3UUFA

Crystal structure of mono- and diacylglycerol lipase from malassezia globosa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
RGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNFDDHQGIYFHTQIGAVMGECPAQVGAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LIP1, secretory lipase (Family 3)
publication title Crystal structure of a mono- and diacylglycerol lipase from Malassezia globosa reveals a novel lid conformation and insights into the substrate specificity.
pubmed doi rcsb
source organism Malassezia globosa
total genus 101
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uufA00
1GPLA 2QUAA 4ARBA 1Q84A 5E2IA 3WYNA 4B6GA 1R3DA 4DGQA 5AM2A 1JKMA 4Y2VA 4KE6A 4FBLA 1HQDA 3HSSA 3I2GA 3D4LA 3S8YA 4OB6A 4GHWA 4PSDA 3DKKA 1YASA 1CUAA 1GKLA 4IH9A 5LZ9A 5IVDA 5C8VA 3C70A 1K6EA 1JI3A 4HVTA 1H2WA 1UOPA 3EQ9A 4UHCA 5HFNA 4EA6A 1ZJ5A 5DTIA 1YB6A 4IO0A 3DKRA 4AO6A 5DWDA 2Y2UA 5FRDA 4TVKA 5HK8A 2WIFA 3VXKA 2AJCA 3QMMA 2AJLI 4DSAA 2ZYIA 1ZD4A 3GBSA 3M3DA 5A7HA 2OPHA 4DMHA 1XZFA 1XZMA 2XUJA 3MVEA 1JMYA 1YCDA 2J3QA 2VF2A 3I2KA 3BDIA 4ZWNA 2VJCA 4NVRA 2C5FA 1ZJ4A 1GPKA 4XVCA 3C8DA 2V96A 2XMDA 4W1QA 2YYSA 2XQIA 1EK1A 5CMLA 1SCIA 5AK5A 3A70A 5ALPA 1C7JA 2HRQA 3SK0A 4Z49A 1X2EA 1R88A 5H3HA 3KOOA 3RARA 5AI6A 2XMQA 1MX5A 5EI5A 3G02A 4W1PA 1U65A 1K8QA 3H0CA 3WKAA 1DT5A 2QOEA 4G9GA 5AIBA 4E46A 2HFKA 2H7XA 3D5EA 2BGNA 3MUNA 4QDTA 4S0XA 3ZLVA 3FYUA 4J0JA 3OC0A 1NU8A 1LBTA 2ZYRA 3G8YA 1ZD2P 4CI9A 3E3AA 2ZSIA 4IHAA 4N8EA 1DWOA 4HXEB 1UK9A 3C6XA 1THGA 1VLQA 4I3FA 5AOBA 1W6RA 1KU6A 5DNVA 1E89A 3M81A 4QDXA 3FSGA 4PV7A 4U2CA 3FVRA 4Y2TA 4OYLA 1CUWA 1EINA 3H17A 1RYYA 2JGIA 3ZI7A 3G9ZA 3UUFA 2Z3ZA 4YPVA 2D5LA 4WY8A 1Z68A 1X2BA 4GDMA 3U1TA 1JU4A 1CUGA 4LYEA 4WJLA 1CUZA 4YX9A 4PF1A 4LKOA 3KWFA 4MQMA 4QE3A 1GGVA 5ALIA 1BRTA 5K3FA 2OQVA 1QIJA 1QGED 5DJ5A 4B9AA 2C0QA 1LPAB 3DOHA 3LIPA 3RLIA 2JF0A 4AMYA 1XRLA 3IURA 5AM3A 5JYCA 4KE7A 1L7QA 1N1MA 5HK9A 2OXEA 1L7AA 1EA5A 2VT6A 4LHEA 4J3JA 4C01A 4F0JA 1TQHA 2O2IA 5J3JA 3QM1A 4TPKA 3U0VA 3H2KA 3R3YA 1LPOA 2WHPA 1JU3A 4DSZA 5AJHA 4E14A 5K3BA 3H19A 3WWOA 1TRHA 2CEKA 2JIDA 2PSFA 1BN6A 4OD0A 3C6ZA 4BE9A 1TCCA 4OUKX 3AIMA 1XKLA 1WPXA 5C8ZA 2I3DA 1JJIA 1SCKA 5DLPA 1CEXA 1DX4A 4X91A 5JALA 4HAIA 4KE8A 2OCIA 1CUSA 1CFJA 3Q8WA 4QDZA 4ZI5A 4FTWA 1GPNA 3O4HA 1WCYA 3F97A 2ZYSA 3BL8A 3G0IA 4C4ZA 2YASA 4BB0A 2HDWA 1EDDA 5JARA 3WK9A 1EXWA 5DTJA 4AMZA 1R9NA 4H7HA 3DCNA 1VA5A 2QT9A 4HXGA 5FP0A 3KXPA 2K2QB 2FJPA 2WUGA 2QVBA 5E4JA 5AOAA 3V1NA 1JJFA 3HC7A 5C7YA 3KD2A 4EY8A 3HLKA 4BAZA 4N5IX 2AJDA 4B0OA 2I78A 3ESCA 4B80A 2HA3A 1GQRA 4BDSA 4BTLA 4W1SA 4XWGA 2HM7A 1W75A 1E66A 4J0KA 5ALGA 1CUXA 3BDVA 1CUVA 4AQDA 1HPLA 2DQYA 4RGYA 3F96A 4MXDA 2QUBA 5YASA 4H7DA 4MYSA 3STTA 3ZLTA 2HA4A 5HKBA 3EQ7A 1XZEA 1QO7A 4M0EA 2PSDA 2ZVDA 3BF8A 4AB1A 1YA4A 2PPLA 1CR6A 3AZOA 2BKLA 3N0TA 1UKBA 3WYDA 1DWQA 1J1IA 5ALJA 2XUKA 5SYMA 3G9UA 2XUFA 3HZOA 2DFPA 3FVTA 5AIAA 2JGMA 2W22A 5AKEA 3R3WA 2VQ6A 3SX4A 3GROA 4F5ZA 3MUOA 5K3AA 3RK4A 3ILSA 3WZMA 2ECFA 3QITA 4EHBA 3L1IA 4B84A 1CVLA 4X92A 1XFDA 3WMRA 5CH8A 2XLBA 1YAJA 3FCXA 3WIOA 3G7NA 1A88A 5JD6A 1P0IA 2XT0A 1GKKA 1MU0A 3NWOA 2HA7A 5LP1A 5AKGA 3EBLA 2QM0A 3T52A 3B12A 2XUOA 1XZIA 3FYTA 2O7RA 1O6GA 1XRMA 5AKZA 1QJ4A 3DQZA 4OCZA 1CUBA 1TCBA 2JGKA 4DMCA 5AHXA 3DS8A 2WILA 2VSQA 4LIPD 2WJ3A 4MYDA 4H77A 5AI0A 2RIPA 3AIOA 1LPPA 1EI9A 4MQLA 1KEZA 4P08A 4FBMA 1VZ3A 1X70A 2WJ4A 3VJMA 4UFNA 4C4XA 1D07A 1U8EA 2OQIA 1XQWA 4EY4A 5ESRA 5ALTA 2ES4A 1FFCA 5FPQA 1VXOA 1J06A 1QIMA 4QEKA 3D59A 4UBKA 5AM1A 2HA5A 3QPCA 4FFWA 4BDTA 3TGLA 1QO9A 4ZV9A 2BAGA 5IVIA 2DCMA 3N2ZB 1ZI6A 4HRYA 3IBTA 2I3ZA 2ORYA 2GYVA 3I6YA 5ISMA 1QZ3A 2WU3A 1JJBA 1AC5A 5BWCA 3WWEA 4J0DA 3C6YA 4CG1A 3WK6A 4EUSA 1LPNA 4BC0A 3H2IA 2CZQA 4DM7A 2NW6A 4GXNA 5LZ5A 1DT3A 2QRUA 1FFDA 1MO2A 5CT4A 2IX9A 1QIDA 1GT6A 3E4DA 1BCSA 4N8DA 4PNZA 1A8QA 3IB3A 4CFSA 2PSEA 2XUAA 5EIHA 4DNQA 2VJDA 3ICWA 2WIJA 1J07A 1MN6A 7YASA 2QJWA 4B0PA 1ZD5A 1DTEA 4BVKA 4G8CA 1HDEA 2C4HA 2VJBA 2QS9A 5ALSA 1Q83A 3IULA 4Q1VA 3BJMA 3WQHA 2C5GA 4CCWA 3EF3A 4BAUA 2WJ6A 4DMFA 3STXA 3PICA 5AM5A 4EY5A 2CKMA 5ALZA 1HKHA 4KJXA 4B82A 3K6KA 5LZ7A 4WDRA 2ZJ7A 4U2EA 3M82A 3WKCA 3G0BA 3HYSA 1AUOA 3V1LA 1BE0A 4RE6A 1SFRA 2GYWA 3ICVA 4XJVA 1WHTA 2Z8XA 4MWSA 5IH7A 4QDOA 2DHEA 4FMPA 2WUFA 2PUHA 1BU8A 3WLAA 3KSRA 3I28A 2GZSA 4B7ZA 3ZWQA 3STWA 4EY6A 1LPMA 2B9VA 2HFJA 3FLBA 4X97A 3W2TA 1AGYA 5AI9A 1FJ2A 2XUDA 1YB7A 4IH4A 5JAUA 2ACKA 4P93A 4H0CA 1K4YA 4DNOA 2XB6A 5AICA 4K6KA 5A71A 1OILA 4X90A 1PV1A 1QONA 4WFIA 2O7VA 5E4TA 2QKYA 3H2HA 3X3HA 3V9AA 3WK4A 3WKEA 1TKRA 4XX1A 1DQYA 4JNCA 5A7FA 5AM4A 1N5MA 3PFBA 1Y7IA 3H2GA 2C7BA 1MX1A 2B4KA 4W63A 4Y2PA 3O9MA 4Y2XA 5FLKA 4X6XA 4Y2UA 4H7EA 5HF5A 3WI7A 3PF9A 2BCEA 4UBMA 5BV7A 1XZLA 3H04A 1HBJA 3OTQA 3TEJA 3SWWA 1RWQA 5EHXA 4YASA 2BJHA 5T4BA 1DX6A 2JGJA 3OG9A 5LZ8A 4FWBA 5AI5A 1LGYA 4B81A 3LIIA 1UXOA 2X5XA 1M33A 2OLEA 2WUEA 2WU4A 3STVA 4CIAA 4K5QA 1YR2A 3VISA 1ETHA 1UKAA 5AK3A 5ALDA 1A7UA 1DINA 4Y2RA 5F4ZA 5HQ3A 5CT8A 3W04A 4KAAA 3QMWA 5CXUA 3R3VA 4ETWA 4JEIA 3DYVA 4MEAA 2JEYA 1LNSA 2X76A 2Y2VA 1QIEA 1RP1A 4U2BA 5D7BA 3BE8A 1IZ8A 1QIHA 2RI6A 4BC1A 4FLEA 2WTNA 5CT5A 4Q3OA 5ALKA 3I6ZA 5ALWA 1CUEA 5EFZA 2GZRA 1Y7HA 4FLMA 2JGFA 4C88A 1UK6A 4KACA 3DOIA 4BTVA 1F8UA 1FFBA 1TK3A 1XZAA 3C5WP 3ZLUA 2LIPA 1LBSA 3WJ2A 4NZZA 1VE6A 3PI6A 4BE4A 5DYTA 2ZJ6A 1EX9A 4FFVA 2ROQA 4DYHA 3AZPA 2XQKA 3DD5A 5JAHA 3AILA 2G63A 4LYDA 2J3DA 2FUKA 3ANTA 2DSNA 5CXXA 5LKAA 5CW2A 4C6HA 4BP8A 4GLBA 3VJKA 3HABA 2WG0A 1ACJA 5ALFA 1W4LA 3BJRA 5CH3A 4ARAA 1UWCA 1EB8A 2FX5A 3CCBA 3UUEA 2WM2A 4Y2SA 5K3DA 2XMBA 3RKSA 4FNMA 1ACLA 3EQ8A 4HXFB 5IVKA 2E3JA 3R3UA 3WWPA 5HZGA 2X8BA 3WIBA 1JT2A 3R0VA 3DL4A 3E0XA 3JW8A 1A8UA 4QZVA 3DJYA 1G42A 5E4YA 2I03A 3FCYA 4M0FA 1IUPA 2XUQA 5HFAA 2ZSHA 1QTIA 4AX4A 3IUJA 4H7FA 4Y2QA 4D9JA 1USWA 2Z3WA 1BROA 2HU7A 4X00A 1PFQA 2WFMA 2YH2A 1TIBA 4H18A 4QWWA 2QZPA 5D3KA 5LIPA 3WK8A 2G4LA 4G4IA 2BFNA 5A62A 1UT6A 5DNWA 2J4FA 1E8MA 3DLTA 4K2AA 1N5RA 3VVMA 3C5VA 3CXUA 1HL7A 3C6BA 3WL5A 2VEOA 3WJ1A 4E11A 4J0GA 5LYYA 4IH1A 5JD4A 1R9MA 5T4EA 3R41A 5C8XA 4HRXA 2V98A 3AUKA 4AO8A 1Y37A 2WQZA 3STYA 5AKHA 2PU7A 2Z5GA 2P8SA 2WFLA 2Y6UA 1AURA 4G8DA 5JZBA 1OCEA 2JEZA 4N5HX 1Q0ZA 2JGLA 5K3CA 1QIIA 1QOZA 1CPYA 5HKAA 2H7CA 1XZCA 1LPSA 4AN0A 2BUCA 1UK8A 4WCVA 1XLVA 5KWIA 1EVEA 5KBYA 5EIAA 2RHWA 1IUNA 1ZIYA 2J4CA 1ODTC 3ED1A 2IITA 3I2JA 5CURA 2C58A 4PQEA 2HU5A 4BCDA 5ALNA 1UZAA 4U2FA 4UPDA 4ZGBA 1SOMA 3FNBA 3WZLA 4GEGA 4DMKA 2V9ZA 5JANA 4FHZA 3F8SA 1IZ7A 2H7YA 3FLAA 3GA7A 3A6ZA 3Q0TA 1YS1X 5CTAA 3OOSA 4DTCA 2XDWA 3DEAA 2HIHA 1BS9A 3V1KA 3VVLA 4U2DA 1MPXA 1ZIXA 1EHYA 5AK4A 1QFSA 1S8OA 5EHZA 4DNFA 3D0KA 2R11A 3R40A 5AKJA 4X85A 4WFKA 3BF7A 4RNCA 3G0CA 2PVSA 4UHEA 4WY5A 2QTBA 2OAGA 3S2ZA 1UOQA 2AJ8A 2RONA 1CUUA 4BAGA 2XLCA 4DLNA 5AM0A 2CJPA 1VA4A 5EIEA 4M0MA 2HADA 3FWHA 1B6GA 1THTA 4OYYA 1CUHA 3W9BA 2Q0XA 1H2XA 4WDQA 5IKXA 3FAKA 2BGRA 1LZKA 4X93A 4GWLA 5ALLA 2PX6A 3HACA 1QIKA 3LCRA 3EIOA 2WG1A 4P92A 5ALEA 5SYNA 3D2CA 2WKWA 4FKBA 4Q05A 3STUA 4NMWA 1XZBA 4KRYA 2G5PA 5D3ZA 1CUJA 1DQZA 3V48A 4UBNA 1CQZA 3IUNA 4CCYB 1GZ7A 4CG2A 1WB5A 3IIIA 4KR0A 1ZD3A 2ACEA 4X7BA 4Q34A 3UMJA 4BVJA 3A2LA 3D3NA 1EVQA 1XKTA 5AKKA 2WFZA 1ODSA 1U4NA 1CIJA 4UFOA 2WLSA 3KDAA 4ZREA 4G4JA 1UOOA 1WOMA 2HHAA 5FOQA 3D7RA 1XRNA 1TAHA 1YS2X 3VDXA 2XUPA 1ORVA 1F0NA 4QDUA 1XZGA 1YSCA 4JUIA 4UBOA 3FYUC 4BRZA 1W76A 4EB0A 1GXSA 2O2GA 1MJ5A 3WWDA 4AXBA 2OGZA 4B9EA 5CT6A 4KE9A 1W52X 3WL7A 4BP9A 3W05A 5LKRA 2VA9A 1ZICA 5CBKA 1R50A 2JGEA 3TJMA 2BUAA 2XMSA 2GBFA 1CV2A 5CH5A 3IDAA 3CCCA 4YK7A 2WSLA 2HL6A 3O0DA 5A7GA 2DHDA 1ZI9A 5AH0A 4K6GA 5AOCA 2QMQA 1CQWA 4C87A 3ZPXA 4NS4A 1N8SA 2OCGA 1CUFA 2CUTA 2HRRA 4UBLA 4CG3A 5T4HA 2DR0A 2PL5A 2Y6VA 5HF8A 1G4HA 3YASA 2XQFA 4Q82A 5I8PA 4B85A 5AP9A 4UHFA 2CBGA 1FFAA 4C4YA 1MNAA 3HRHA 2D0DA 4CIBA 4G9EA 3C43A 1C7IA 3E1GA 5BOVA 3AIKA 4Y2JA 4U2GA 2ZYHA 1VZ2A 5FV4A 2B20A 4G8BA 1PJAA 3WL6A 5FUMA 4ZXFA 3BIXA 1EDBA 2QXUA 4KAFA 2PBLA 2HA6A 1OXMA 3QMVA 3NGMA 1E8DA 1JMKC 2QJRA 3NOXA 3B3QA 2H9YA 2XQGA 1AZWA 3QZUA 4J7AA 3B5EA 4UBIA 4IQ4A 1E8NA 1ZGBA 4LXHA 3FSGD 3HEAA 4JYPA 4P9NA 1P0MA 3D2AA 3O4IA 3DDUA 4UHDA 5JAPA 1ISPA 3QYJA 1YAHA 1GQSA 1QIGA 3AFIA 4X94A 5ALQA 3WL8A 4J03A 5AI4A 1H23A 4EBBA 1DU4A 2PSJA 3FBWA 1MT3A 2VTVA 4X6UA 1F6WA 6YASA 2W6CX 4OU5A 3JYHA 1HLGA 1CRLA 1W1IA 3JWEA 5I7UA 3F9CA 4MEBA 1MAHA 3AZQA 2WTMA 2PKYX 4UHHA 1JFRA 2FJ0A 4B83A 5JASA 2RGUA 2JBWA 4OB7A 3R3ZA 1IVYA 1WM1A 4ZV7A 4A5SA 4BATA 5KREA 4AZ3A 1E3QA 2XUIA 4KYVA 3C87A 4OPMA 3FLEA 4Q3LA 2DHCA 3IUMA 4FDMA 4UBJA 4QA9A 1H2ZA 3OM8A 3ANSA 1T2NA 3C45A 1H2YA 4H7JA 2IIVA 4L0CA 4W9RA 1XZDA 2XMZA 4GW3A 2G5TA 3SC2A 5FPPA 4K6HA 3AINA 4A16A 1J2EA 2GYUA 5HF6A 5JADA 2AJBA 5AKYA 3D2BA 3R3XA 3K9BA 4BVLA 5EHNA 4L72A 2EDAA 3I2HA 1CLEA 1F0PA 5A2GA 2VJAA 3QH4A 4AZ0A 4ROTA 4L3WA 4UFPA 4QWMA 5LZ2A 3L1JA 3P2MA 1H22A 4W1RA 4J0HA 1Q0RA 4I4CA 3F98A 3IUQA 2UZ0A 3I1IA 3G9TA 1LLFA 5AKIA 3ESBA 2HA2A 1QE3A 4DIUA 5K5EA 1ZI8A 5CRIA 1NU6A 2ZJFA 4OSEA 4JYMA 3WA6A 3A2MA 1WHSA 1VJ5A 2EEPA 1K63A 4EY7A 3I6MA 5ALOA 3IVMA 4F21A 1IUOA 4G4GA 3V1MA 4LXIA 4QLAA 4J0IA 5FKJA 1XZKA 4PSUA 5ALVA 3WA7A 3PFCA 2AXEA 5JZSA 4BZZA 4Y7DA 5DYYA 3QVMA 2OGTA 1VXRA 4OU4A 3A2NA 4X6YA 1CUCA 5EHQA 3PUIA 3WK7A 3LLCA 1FSSA 3G0GA 5ALHA 1R1DA 4WFJA 1T4MA 3F67A 3W9UA 1CUIA 2XUHA 5I9IA 1EK2A 2HU8A 3FYUB 3ZV7A 3DYIA 4GBGA 1XLUA 1ZOIA 5ALMA 1UK7A 3GZJA 4HZGA 2VT7A 5A6VA 3PE6A 4GECA 4QNNA 4A23A 4O08A 4X71A 4F60A 3CN7A 3ESDA 2PSHA 1BCRA 4V2IA 4DNPA 2VAVA 3K2IA 5BWBA 3GFFA 5FXMA 3GELA 5HQ3B 4BBZA 1FFEA 1G5FA 1MNQA 2OGSA 4Q3KA 4BYMA 3WWCA 1VKHA 2OAEA 3ESAA 5C81A 2WIDA 1ZGCA 2DQZA 2WHQA 5D6OA 4FNGA 3PUHA 4FOLA 1G66A 5T4FA 4BCCA 4H7KA 3NUZA 5AK6A 1P0QA 5DYWA 1E5TA 5DNUA 5ALYA 4QLOA 4EZIA 1LZLA 2XQJA 3WKDA 2WG2A 4CCYA 1O6FA 3TRDA 4HTAA 1U2EA 2WUDA 1CUYA 1XQYA 3HJUA 5CT9A 5K3FB 1B41A 1P0PA 2O2HA 3OURA 4ZRDA 4BZWA 3H1BA 2GBCA 2CB9A 2OCKA 2VAXA 5HCUA 1XRQA 5AKXA 4TGLA 4BRSA 1VE7A 2WIGA 2H1IA 3L1HA 4MJ3A 4G5XA 4ITVA 4PO3X 5LZ4A 1XZJA 4KEAA 4KAJA 1XQVA 1UKCA 1QFMA 4UUQA 3QPDA 1K5PA 3GUUA 3PDCA 1L7RA 3I2FA 3C8HA 1EDEA 2QR5A 2WHPB 4XIIA 3LS2A 2XMGA 3VJLA 3M83A 4BCBA 1XRRA 5LLSA 3T4UA 2WHRA 1AMNA 3W06A 3DNMA 3IA2A 5K3EA 2VATA 2PU5A 1MAAA 3G9XA 3H2JA 3QPAA 2GBGA 4FLFA 1AX9A 1XLWA 3H18A 4G1FA 5FDFA 1KU0A 5AI8A 1I6WA 1MX9A 1WB6A 4UHBA 5JIBA 1IMJA 2PM8A 1QLWA 2WIKA 5ALXA 2PUJA 4HS9A 4PSCA 1QIFA 1C4XA 1UFOA 1MTZA 1ORWA 2CMFA 2R8BA 3WKBA 3I1YA 2RHTA 2XMRA 2BUBA 2V97A 1TCAA 4KRXA 5JD5A 3CN9A 1ODCA 2WFLB 4X3CA 3G0DA 2XMCA 2OCLA 3FOBA 4AO7A 3O4GA 5JAOA 5ALUA 5IVHA 3HI4A 4RE5A 1EH5A 4MWTA 4L9AA 2GBIA 1XQXA 3AJAA 3MGAA 2EDCA 2B61A 4N8SA 3RM3A 2XUGA 1XRPA 4AN1A 4GI1A 3KWJA 1WB4A 4Y9SA 2ONCA 4H35A 1A8SA 3HXKA 3PF8A 4X95A 3O9VA 2RAUA 3BXPA 2HA0A 5AO9A 1YA8A 4PW0A 1VOTA 3WK5A 2YXPX 2QXTA 1R4ZA 1XZHA 2XI4A 3H1AA 3BWXA 3QBJA 2Y1KA 2C0PA 4J0CA 4H7IA 3OPMA 3O95A 4LXGA 5KWJA 1WPRA 5AKLA 1BN7A 5JATA 5ALRA 4I19A 1BEEA 3BIWA 3VKFA 1SCQA 1NX9A 2XE4A 4JH0A 1EB9A 5HF9A 2OG1A 5EGNA 1SC9A 4RPCA 1DWPA 1XROA 3I2IA 1BEZA 3DL7A 1CUDA 4E15A 4OB8A 3LP5A 1QTRA 4INZA 3O4JA 4C89A 1LPBB 1AKNA 2Z8ZA 5JZ9A 4Y2YA 1AQLA
chains in the Genus database with same CATH superfamily
1XJWA 4ECEA 1GPLA 2C7VA 3QJGA 3PQ2A 4YIKA 3G68A 1Q1BA 2JIPA 4G36A 2P2SA 4JB0A 2PX3A 1FBTA 1KMNA 1R3DA 1Z7BA 3D6FA 4DGQA 5EPOA 4F7DA 1TD1A 1JG7A 3GWZA 1M0EA 4AG3A 1O97D 4QQ8A 1R5JA 1NNUA 3I2GA 4CLDA 3R77A 3S8YA 1P4AA 3KB1A 5EPUA 2NU9B 3WXBA 3DKKA 2FN8A 1O94D 3TGPA 4CMCA 2V7BA 5LZ9A 1AQ6A 1COWD 2VNJA 4AJ4A 1U28C 2BPOA 3LHDA 3VNRA 4LTDA 2FWNA 1KQOA 2NU7A 3ZGVA 5LJLA 3VYWA 5C8VA 3DPUA 1U0TA 3KJQA 2JVIA 5EQFA 3WHLA 3EVEA 1N0VC 3A06A 3RFUA 1JI3A 3C5EA 3WLPA 2XOKD 1FU8A 2LV8A 4UHCA 4EA6A 3E9YA 1KC3A 1RJWA 3OQVA 3O92A 4XEHA 3AVTA 4I5EA 1EKXA 2HRZA 3KCQA 1NVVQ 1T8TA 1JHYA 3PPIA 4GOMD 4PSAA 3RPEA 1NURA 3K0KA 1Z7WA 2PNFA 1VGVA 2Q1SA 3RYHB 3ZUPA 2IKSA 1UPBA 5J1SB 4A8JA 3UAYA 1MQ9A 2VR1A 2AJCA 1B2RA 2BMWA 2RGDA 3GV0A 3PFKA 3QMMA 2ZYIA 1SPBS 3V7FA 3HYNA 4L8WB 4RY9A 4BNTA 5K4GA 4MITA 1M2WA 1X39A 2YHSA 1EK0A 2GK4A 1L5SA 2VAPA 4WX2B 3IELA 2W90A 5JUWA 2BEVA 4B2LA 3ELYA 1VJ0A 2FFRA 3GBSA 2V59A 4MRRA 1A8PA 1OLUA 1XVLA 2R7KA 2WRZA 4YV1A 2OPHA 1A2KC 1J23A 1D04A 1FUEA 4N6GA 2CV2A 3IS3A 4FCCA 2ODEA 2DPYA 4HFRA 3VKHA 3CTMA 5J5CA 1JALA 4QYWA 3RVBA 1G8MA 2VDUE 3BXXA 4M7WA 1GQYA 3V6MA 1YK1A 4DVGA 3LZ6A 1MF7A 2XUJA 3LCVB 4P22A 1SCUA 3OZAA 1SD2A 3W3ZB 3QV2A 3RC3A 1A69A 1TXGA 3I2KA 1FXSA 1ST3A 3A31A 1D0SA 4H2DA 2KQUA 2R44A 4TXJA 2C59A 5FTKA 4NVRA 2OOKA 4QQKA 1ONSA 3KYJB 4V3CA 4ID9A 4KP7A 2H3EA 3ILXA 2OZVA 3W8RA 4FFPA 3TZBA 1GPKA 2X3UA 2JFHA 3V1TC 1I0LA 1H8ED 2VXCA 3TCNA 1YCHA 2JJ1D 1HOTA 3OEYA 2C07A 1UAGA 3MSCA 4W1QA 4GZ6A 3ZWAA 4RENA 1T0PA 1Y5IA 4CMHA 4F3KA 2HPVA 3KWLA 5M04A 3FTQA 1Q20A 2XRMA 2XQIA 3V55A 3ENZA 4G2NA 5CDHA 5EJ5A 2AQIA 4MKGA 1TEXA 1B16A 2HSEA 5IP5A 2IHUA 5DU2A 1SQGA 2DRIA 4JB2A 3H11B 4QEZA 1KETA 3AFNA 1R88A 1PR5A 5DN6A 1AUVA 3RARA 4PYKA 3QX3A 1XEAA 3I1FA 4LQ4A 4KXVA 3EFHA 3NJRA 1Y8RB 4PLTA 4DXAA 4FN4A 5T7BA 4TKLA 2XCIA 2Z9DA 1U65A 3CLTC 1EX1A 2IZ5A 4IBOA 5EWJB 2QOEA 2GHTA 3GC6A 3ZV3A 3A6PC 1BCSB 5I9NA 4O4IA 3FDZB 1P29A 2A78A 4E46A 2W2LA 5FBKA 2ERCA 4XFDA 2HAEA 3PQ3A 3FGNA 3EGCA 1EQAA 2PWPA 4Q01A 4E6EA 3MWEB 1ND6A 1OREA 4WH0A 4PRKA 2NADA 3Q72A 3LDUA 1GKIA 4WVLA 3QU7A 3IHLA 4J0JA 2BN4A 3MC1A 4L4XA 5BQ5A 5KJEA 5CDFE 1R15A 3OC0A 1PJSA 1NU8A 2Q27A 3N53A 1G21E 1JIUA 1XMPA 4S1OA 1XP8A 2G25A 3CURA 4CMAA 4F4DA 5A5VA 2YV1A 1QGAA 2J48A 1B8NA 1CBUA 4U0JA 4QT4A 1CLUA 1NC3A 2EFDB 3E3AA 5D8DA 4PQGA 1VLLA 4IHAA 1XCLA 3AKCA 2ZYWX 4GX5A 2GTHA 1OPXA 1DWOA 4HXEB 3LDGA 1E1CB 1I4OA 3C4QA 2ZI5A 2YZKA 1V5GA 2J30A 4K9RA 2QGNA 1Y9AA 3SSAA 2BRUA 2VJOA 4ZCTA 5LWQA 1AXRA 4DLUA 3QIVA 4M1TA 1DJMA 1M5UA 5IK2D 1KOGA 4GOND 1RYFA 1LWOA 2W2TA 2VF7A 1NG1A 1YUBA 4GMKA 4UNNA 5K4AA 3QLEA 3T1QA 4MPPA 521PA 4AG5A 1KU6A 2I4MA 2QUIA 4LCEA 3KZNA 3JQDA 4HWKA 5AUQA 3UOAB 3IJRA 1ZRSA 4A73A 1TVKB 3VKVA 1UC8A 4U2CA 1PR6A 2PV0A 5CAEB 1A2OA 1HT0A 1PS9A 1RXYA 1XTRA 4QQRA 2QRLA 2E7ZA 3DWEX 1RMYA 3F47A 4UEOA 5FBWB 3VGJA 1ISIA 5IDVA 3QVSA 2DFKB 2KBFA 2MSDB 4TWRA 5KB3A 2JGIA 3WLHA 4LZNA 5B1DA 3HQ4O 4CM8B 3DHNA 4M0CA 1O5OA 1RXUA 2H51A 2Z2IA 3OEWA 3Q9SA 1Q0QA 5JYCA 1E9FA 1EPUA 1V95A 2FRVA 2YOGA 2ZUSA 4NSNA 1ZMOA 5AVZA 5HKKA 1HLPA 3T3GA 3RRYA 2D0IA 5HJ5A 1OBVA 1QE5A 2NGRA 1S5PA 1MEOA 3GP3A 4I3GA 2FG6C 3KKQA 5JRZA 2C83A 3V46A 1FTQA 1Y8QB 5AUNB 5JNTA 4OXRA 1IL0A 1CUZA 1IB0A 5T64A 2WZBA 1M1NB 3FGPA 3OOYA 1BFKA 4GYKA 3ZI4A 4DSNA 3CE6A 1J5PA 3B78A 4LKOA 4FONA 4HAOA 1GO2A 4NOLA 1KDZA 4MQMA 5AMXA 5IT5A 1ZQ9A 4QE3A 5F7ZA 1GGVA 4MTCA 4ATNA 4YB8A 4CN8A 3K20A 5HOQA 2JEOA 3PVSA 2PUCA 3LPAA 2I7CA 2ODPA 5JLJA 2GD0A 5JPDA 4MGEA 5ALIA 1MR3F 3PRJA 5DI3B 1H1LA 1MA0A 1YKSA 1M2JA 3R6GA 1GUDA 4OFBA 4FE3A 3AGQA 1QIJA 1EK5A 4WW0A 3TEFA 2HRDA 4FDTA 3CLTD 3R8XA 3SF0A 4G5FA 1XMIA 2HNAA 4DBLC 3ABIA 1LPAB 2UXBB 2AK2A 2JC3A 3T9BA 2BBSA 4ZI7A 5LN1A 3MJEA 2I4IA 5AOVA 2H7VA 2C04A 2JF0A 1RZUA 1JZQA 3KIPA 3BXHA 2HSGA 2P8JA 2VSXA 4ONEA 3RYTC 1T4GA 3HNOA 3F49S 4R01A 1QSGA 4GLOA 1RWVA 1UJ5A 4RFLA 2Q2NA 3FTPA 1KF0A 4GWGA 1U5CA 2W5UA 1O3YA 3BD6A 4M1QA 2ZULA 3HKBB 3O5AA 1KK0A 3R2JA 2X0DA 1XG5A 2JGNA 3DHYA 4BIIA 1SUDA 3E6AA 2JAUA 4TQAA 4LHEA 2ZCVA 2ZT6A 5KZMB 4NR0A 4J3JA 4OXQA 2I7XA 3D1LA 4F0JA 3JQPA 1TW2A 2O2IA 2Q9UA 1OKKA 1YQGA 4IX1A 4KL8S 4KYUA 1Z88A 3W5HA 4YV2A 7REQB 5J3JA 4JQZA 4RMNA 1F3LA 2CDCA 1BXKA 3HUEA 3U0VA 1YC5A 3H2KA 4S35A 5HRAA 2J3KA 2QV7A 3CT4A 1FP4A 5D3MB 3I9V1 2GHQA 3S40A 4DSZA 1Q92A 4J2OA 3PC4A 1RABA 1V3VA 5K3BA 1Y1KE 2QZ9A 2N9UA 2XZPA 3FTDA 3H19A 2H4XA 2JFFA 3WGVA 2CV0A 5B64A 1Z0ZA 4O2AF 2LIVA 4FYJA 2BBWA 4BO6A 3A4IA 1TI7A 4OBEA 1JDNA 4NABA 1SC3A 4BE9A 2A1TR 2ZBEA 1TOAA 3A6KA 3P9SA 2P1DA 1N4AA 1GQFA 4MHSA 4QL3A 3JTEA 1JSXA 4OUKX 1V25A 2SBTA 2EBFX 1XKLA 3BWYA 4FFLA 2Q99A 1GUBA 1PEKE 1R2QA 2FW6A 1WPXA 3KYCB 3G82C 4K7JA 4PWYA 4YJHA 3RO7A 2F1KA 1UBNA 3JAWB 1P1CA 4DFDA 3DE4X 5FIUA 4Z53A 1R4NA 5DLPA 1PQUA 5FJJA 3F9RA 3ODGA 2EP7A 3ZQ6A 3R7NA 4AJIA 4ZCIA 1L5KA 3NWJA 2WM8A 3UK1A 4K9KA 5IULC 2FRXA 1ZP6A 5JALA 2Z1NA 3IOYA 4NE2A 1E1QA 4LF7B 2X8JB 5TJ9A 4KZPA 3SE0A 4EECA 2XYVA 2I2XB 3LYAA 4FTWA 4H1UA 4H7PA 4HMPA 1GPNA 2WB4A 5KHLB 1H2HA 3NALA 3S1AA 2WKRA 3O4HA 4X41A 1IQRA 3GDOA 5JSHA 3TRFA 2HF9A 2ZYSA 4C4ZA 2FPMA 5KCZA 4J94A 1I6KA 1DC7A 1YOVA 2ST1A 3HMQA 4BPRA 5JARA 4UUPA 4WKBA 1EXWA 2XAUA 1KJJA 1TJYA 1VJRA 4HH0A 3OCUA 1V4NA 4AMZA 2CXRA 4ZYVA 4LOIA 3PXDA 1XTVA 4E6PA 1HDOA 4H7HA 3HU2A 2QR3A 1VA5A 2OLJA 2QT9A 5I7OA 1LY1A 5CVDA 4GP9A 4PC1A 5HUJA 4L0MA 2WUGA 4QSHA 1UMKA 1DAMA 2O6LA 3DAFA 5IKMA 1DLIA 3FD8A 4EJFA 4AG6A 2X4GA 5AOAA 4CV2A 1IWOA 1JJFA 3VGPA 1GA4A 4A03A 3BQ9A 4R9NA 3KD2A 2GT1A 3P94A 4K9QA 4MPTA 2XDQA 1RJ9A 3HLKA 4EY8A 5BR1A 1OZGA 4ESVA 4HZUA 1BJKA 1D4AA 1C8BA 3IDFA 1YB1A 4AQYB 4DMRA 2EJTA 2GJ9A 3OLXA 4M1EA 5LB4A 2ECKA 4KK3A 4P3NA 4L6AA 5J2TF 1K27A 3LJKA 4UD6A 1L5YA 1G8YA 1TTHA 1PIWA 2Q3JA 2H92A 3I01M 2OYRA 3AM1A 1EBBA 1SOUA 4P80A 3AVWA 3A1UA 3EDCA 4B73A 3SOPA 2R6AA 3WGGA 1E5VA 3K1JA 4A4DA 4W5WA 2XTMA 2CYAA 1H0HA 4KO4S 4TS9A 1JUDA 2EKBA 4FHCA 4BTLA 5BRAA 2GHRA 1OBFO 3THWA 4F2DA 5CVTA 3AJRA 3AERB 1E66A 4J0KA 3RNLA 1NT2A 3C5CA 2GEJA 3L4EA 3AX6A 3GU3A 2AH5A 4YRQA 1P1FA 3WDLA 1KGSA 5TGTA 3ZWWA 3A1FA 4BXOA 1EBUA 2A0KA 4LX0A 4DG8A 1F2UB 5JNRA 1SAYA 3O7WA 3UWOA 3CPHA 2FB9A 3E9ZA 3HB7A 2J0VA 3F96A 4P0QB 4D8XA 1RXIA 3IR5A 2ZWAA 4LY0A 1E1LA 2QUBA 1Q21A 2GEUA 4QXPA 3T7AA 3PR3A 3W9YA 4EFDA 1V4BA 5CM8B 5KYUA 2WHYA 4IP0A 2B4RO 1PZXA 3STTA 3KDSE 1B15A 1UM9A 3EQ7A 2IHZA 3S2UA 4D3FA 1XZEA 4RULA 1QO7A 4UPEA 3GI1A 3R1IA 3CH7A 4M0EA 5LC1A 1GTG1 1GUFA 1OX5A 3R7FA 1C3JA 2ZVDA 3BF8A 3CW9A 3TXYA 3ZGLA 4TLEA 2QVCA 1N77A 1IYZA 2IHBA 1ZNQO 2HWKA 2PPLA 5J23A 1V1MA 4OQDA 1IUKA 1JA9A 1N5LA 2H1WA 1UKBA 4O8CA 1BMFA 3I09A 2ESRA 2V9PA 1BHQ1 5CX1A 1GG2A 3SS8A 4YQZA 3RRFA 1DWQA 4AECA 3RVOA 1J1IA 5ALJA 2IK8A 2FOIA 4CM4B 2DFPA 2QGFA 3FVTA 2G17A 3GLVA 1SUPA 5AIAA 1X8JA 2X13A 3A6EA 1F5SA 1XHFA 3R3WA 5CJJA 2RFLA 4MULA 1AO3A 3I5YA 3MEQA 1J8VA 1B42A 3EGEA 4J4HA 1M2EA 1Z3IX 2VQ6A 1E2NA 2HLHA 4HNSA 3JZIA 4MKZA 1GZVA 2QIPA 4E5DA 5AJYA 2A9RA 5K3AA 2ZIVB 4YACA 3QYPA 4R9VA 5IJAA 3UK2A 1GU7A 3QIAA 1T9HA 3QITA 4Q24A 1IB6A 2BKUA 2H4HA 4AUNA 3A3OA 1OU0A 5DASA 3DEZA 2AN9A 3NOVA 4G97A 1PW7A 1M2NA 1X15A 2X5NA 3P9IA 2CN1A 5JSYA 3WIOA 4EPWA 3AOEA 1U3UA 3MFYA 3TNDA 4MUHA 3S3TA 2W6JD 3JATB 5HRCA 2LD4A 1MC5A 3KQOA 1IHUA 2G6TA 4CKBB 4GQIA 4D6PA 2OKCA 2AFIB 4JBLA 5F35A 2B5OA 3CUSA 3QUSA 3VUFA 2PH5A 4JOCA 1PSWA 3V4RA 4JGBA 1PJQA 4B3SB 3NNSA 1GDHA 4F56A 3BD7A 3NEYA 2EG9A 2R6FA 1SVMA 2ZJZA 5EIWA 2GCEA 1PGQA 3RK1A 5LMCA 2CWDA 1X9HA 1ZUD1 3UHOA 1CQPA 2XUOA 1OZFA 2ATVA 2C9MA 3SFTA 7ADHA 5IKPA 1RM5A 3QSGA 1XZIA 3PC8C 2W37A 2IE0A 1I3LA 2G1KA 2WT9A 3ICCA 4MVJP 4Y1EA 1O6GA 1YJCA 2SECE 4EG1A 3BK2A 5FEUA 1FXUA 4OCZA 4IM7A 3SI7A 3GFTA 3NASA 2I2BA 4HWGA 1RQGA 3D8NA 3FPAA 5CHEA 1TKCA 3DS8A 5AHXA 2WILA 4DBZA 3FNFA 4PY2A 3L0BA 3ZBUA 2WJ3A 4PBTA 2YXBA 2ZTHA 4KXQA 4LOKA 1NVUQ 1MZVA 2GO7A 3FPCA 1ZIDA 1GNVA 2P7IA 2TECE 3V9PA 1T1GA 5A1TA 1R0SA 3GPLA 1SQ0A 2FN7A 5EG5A 1FW6A 3PG5A 3EFBA 3RDPA 2C78A 2FFBA 3O8LA 1E59A 1LPPA 1IBCA 2ZIXB 1OFIA 2IHYA 3TINA 1H85A 2BW0A 1KK2A 2Q8NA 5C51B 1BDIA 4ZCPA 4BRUA 2G82A 3OO1A 2EW1A 4QKQA 1HX7A 4YJDA 3CLKA 2OP1A 3OQJA 4JIGA 2O4CA 3T5GA 1XC7A 4LTNA 4CM8A 1EFVB 1NJSA 2XY4A 1LQ2A 3G0OA 1D07A 3ONEA 3KTOA 4HY3A 4FIZA 4JZKA 3R7LA 3OF3A 1Z6PA 3UT5B 5JH7F 1H2AS 5ESRA 5K0FA 1KMMA 1MOSA 4HTFA 4PC2A 3NKLA 1N2BA 3NCHA 4G24A 3TIXB 1VXOA 4U9HS 1YCGA 4MLPA 4WA7A 4CF5A 4BWYA 3QUAA 5H59A 4ZYZA 3LHKA 4GSKA 1VJGA 4UBKA 1PO7A 2VNAA 4UZFA 5BYBA 4ALJA 1KMQA 2WHEA 4DADA 3D7MA 1TM7E 3T35A 3VO2A 5H8WA 4XZ3A 5LYJB 1DCKA 4CMEC 2REBA 1UMCA 4C0LA 3QPCA 2GCPA 4GE0A 3RSHA 3EXIB 5LFAA 1I7SB 4DB2A 2BFDA 1FU4A 4U0KA 4F4UA 2OC9A 3O83A 1NULA 1U0FA 2BAGA 3NP7A 2VQEB 2EJBA 1DIOB 1ETUA 3LMKA 3HXPA 3TPZA 1F1JA 3LLVA 1O2DA 1OYYA 4HRYA 3SCZA 3U7JA 1DRVA 2AZ4A 2CB0A 1S89A 1NN3A 1PU2A 3IUSA 1N9GA 4I5DA 4I9NA 3ZU6A 2ORYA 2DUJA 5EOVA 4X66B 2GWRA 2NU8A 4HBGA 2B8WA 3B38A 4CNQA 4F38A 4RF2A 1Z37A 2ZJ0A 3WOVA 5ISMA 4QBHA 3E9QA 5FL7A 3E3OA 3S4YA 2BH2A 3RADC 4F04A 3E9EA 4HAYA 3SMQA 1Z2EA 2R6R1 2R6JA 4CKXA 5BWCA 5K0GA 5J59A 2BZ1A 4PM4A 2A9VA 1YC2A 2K87A 3OQIA 2XNCA 1VI2A 4GPBA 1EIZA 1Q0SA 4HDQB 4L74A 4RKYA 2AWNA 3WK6A 2J6BA 3IPXA 4EW3A 4EUSA 6CHYA 3HVUA 2I4TA 4DUGA 1LPNA 2D2VA 4GLJA 4JLKA 3RS3A 1RJFA 4BC0A 5KPJA 3WS7A 3H2IA 3L77A 4LSWA 4YRIA 5KVSA 2EX4A 4O2AA 2FSVC 4S1WA 1YVUA 4JJAA 2KW5A 3LLUA 3R6WA 1OFUA 3H7IA 1EUCB 2FYTA 4WA8A 5MHTA 3KP1A 3H1EA 5K9ZA 3JTMA 1U2DA 1D1SA 2QGZA 1G7TA 4L5YA 4EMTA 1E1KA 1QIDA 3E4DA 4ZO7A 4DG9A 4Z49A 4MKIA 5JRJA 1E0KA 3LGAA 4N8DA 1PD1A 3A9UA 1A8QA 1KY4A 3V4VB 2QHXA 3IB3A 1FVXA 4CFSA 5BVGB 1DC4A 3U5ZB 5KO2A 2XUAA 2IUYA 3V8PA 1RPNA 3INNA 2QORA 1G98A 3ZXXA 5JU6A 4C6RA 1DBWA 2G70A 3PQCA 5G3YA 3RASA 2EKDA 2AMVA 4GMHA 2W11A 3LVBA 4LZJA 4EYOA 2QJWA 1U8ZA 4P3KA 1ZGGA 1IXKA 4S1TA 1XKQA 2KHZA 1QFJA 3IMKA 4IHJF 3CX3A 4JR2A 2VT2A 4G8CA 2JHAA 4RV4A 2C4HA 1EESA 1RPAA 4LRTB 3SC6A 4F3TA 1QAMA 4XGKA 5IEBA 4RZ3A 2VJBA 2QS9A 5ALSA 3MT8A 4HLDA 2EFCB 4RVSA 2PFSA 4DT1A 2QROA 1E0AA 2XTJA 3CIFA 4IJVA 1IXZA 1O57A 1DCFA 2OSBA 3B53X 4ERXA 3BX1A 3RG2A 1HE3A 2JVKA 3HN6A 4EABA 3WQHA 2D8AA 1J0DA 4AURA 2LKDA 2I99A 4CCWA 2VBIA 5BMVF 5DE3A 3GYBA 5HCIA 4OH1A 221PA 5BN4B 5AJVB 3AJDA 2J8ZA 2ZI9A 4URUR 3THXA 1DL5A 1GR0A 1V45E 3L1UA 1KY5A 4KBFA 2VNKA 4TZTA 4B6OA 1EVKA 3STXA 1RWNA 3T15A 5H9WA 1G20A 3NTOA 4W5RA 1Y6JA 3IDOA 2CKMA 5ALZA 4EHAA 3GH1A 3DE5X 3ITDA 1STOA 1HKHA 3KOUA 3HA3A 3ROMA 2ZBDA 2HK9A 3SHVA 2UXDB 2A33A 1T2AA 1NW3A 3IVCA 3FOAA 1AHPA 5J2TA 5KKAA 3K6KA 1N2HA 5D01A 2ZRQA 4G1UC 3SZGA 3WRWA 5CXQA 2ZJ7A 1PGOA 2QZ4A 2ZWIA 4U2EA 4Y3UA 3G0BA 1PF7E 3CFYA 5FBHA 4ZKEA 1I30A 1RWXA 3KL2A 4KQXA 5DT2A 3CY6A 1HM5A 3GRRA 4ALMA 4RMHA 3ORQA 3BH6A 4MUAA 1NHWA 1BXRA 2MYNA 3ICVA 3AF5A 4OXNA 1F9EA 3F3KA 1JZTA 3OZDA 3ONWA 3GBPA 4DQKA 2AFHB 1SXGA 1P1IA 1KI4A 4MWSA 1ORIA 1QHXA 4Q4HB 1KKMA 5DBEX 3VR1A 3BVPA 3H2YA 1YJAA 4JJFA 1K5DA 3EY9A 3N2LA 4N41A 3AEQB 1QGYA 3ONFA 3ZHCA 1ML4A 4ZCMA 4N7BA 5BSVA 1U0SY 1IN7A 3L7LA 2W7TA 3KR0A 4M22A 2UYGA 2G80A 4EHLA 2PGXA 1O03A 2X19A 4NYIR 4R0VA 3PCRB 2GZSA 5ULLA 4DM4A 2PLNA 1MV8A 4JBXA 4R2IA 1VLZA 2ZR8A 1OZAA 3FLBA 3KUKA 4X97A 1AGYA 3W2TA 2GVZC 1FJ2A 3A27A 3ENKA 3HS3A 1DG1G 3OIGA 3PT9A 2D6FA 3PDUA 4C30A 1ZCJA 2BEUB 1Y5LA 4HFJA 5EJIA 3W5JA 1TYCA 4A92A 1CEEA 2J3EA 3NH6A 1HEIA 3QPVA 4D9FA 3MK31 1IN1A 3K15A 3U60B 1WU7A 4C0QC 2FFJA 3AEUB 4H0CA 4HLUC 1K4YA 2J3HA 3FWZA 2XB6A 3BIOA 3N87A 5THKA 5C7OO 5AICA 2H85A 4WN3A 3LKZA 1NF8A 1P60A 2LKCA 1VMAA 3TI9A 1J09A 5LQCA 1ABEA 1W5SA 1DPGA 3PENA 2D1FA 5EWMA 5KOYA 4O63O 2UKDA 1Y6QA 4UDYX 1CJMA 1KI6A 4RZIA 4V0RA 4S12A 3VU9B 1XTTA 1Y1QA 3WKEA 3EF1A 4QRIA 1SD5A 2QLLA 1WKVA 1UDBA 4PEVA 5T4BA 2DFDA 4I0WB 4YHBA 4ZHQB 2GZDA 2NPOA 3WLQA 3F9IA 3KK0A 4G4SO 2AR0A 2UAGA 1O9BA 1POXA 3IILA 5AM4A 4UASA 1N5MA 3AR9A 4E5VA 5F7OA 1ATIA 1LLQA 3O03A 4ZDIA 4KWTA 5TLSA 4D02A 5KHAA 1KMCA 5IC6A 3URMA 4RY8A 1QYVA 3EEQA 3O9MA 4Y2XA 1H9AA 5BW4A 3GN2A 3FOWA 4PSVA 5FLKA 5ECWA 4CQJA 4H7EA 5HF5A 3RT9A 2C88A 4G0NA 4JB3A 2OP0A 2ZIFA 1X7YA 2IOQA 4XIYA 2HY7A 4C76A 2NZVG 4EEZA 4EJSC 4DL9A 1CR4A 3LK6A 3L7IA 4BNMA 2BCEA 4WXRA 1U9JA 1OI4A 1PTJA 1MHTA 4DQUA 3G5UA 4YDSA 3OTQA 3TEJA 3LY8A 3QTBA 1I3CA 1WNFA 1QGZA 3LVQE 4U7PB 3VPAA 1P7PA 1AO0A 1U8AA 1YL6A 1N57A 1U7TA 2A1UB 5E3IA 3OG9A 4IZ6A 1NLFA 3E22A 4QBKA 4R9RA 1IU9A 3HDTA 5LZ8A 4K9SA 2O5CA 5AI5A 2JRLA 4YRTA 4J6EA 3F7TA 5IKOA 3M5WA 3LIIA 3FI9A 4OUDB 1Y4AE 2F1OA 4WCFC 5AW6A 1KYWA 3C98A 1VYTA 4ZVTA 4YCLA 4DUZB 4KH0A 4H0FA 3TJZA 2OLEA 4KXUA 3OPXA 3TW0A 1NM5C 3LQYA 2FMIA 1W25A 4CIAA 4K5QA 4WLNA 1YR2A 3H9GA 3EG9B 3TCKA 721PA 3A26A 3MLAA 4MS1B 1UKAA 4OLAA 5ALDA 3OZWA 1AK1A 1KWKA 1Y9ZA 3USCS 2OHJA 2WD7A 4BVFA 1BH2A 3REQA 2ZPAA 5CT8A 4OI1A 3W04A 4BNKA 5B7PA 4BJ6A 1Y9JA 5JS6A 4FJ1A 1W581 1G8JA 1E2IA 2YHAA 1FUKA 3EDRA 3SXJA 3TR0A 4BX8A 3LE8A 4E7OA 5AUPB 2ZZNA 5JXIA 1OXUA 2JCGA 4ZJYA 1N32B 3ICEA 3KAQA 1TE2A 3VVCA 4IGIA 2ZBRA 3GFVA 1YE3A 2PWAA 3DZKA 3C1AA 5C5DA 2HQ1A 2IOYA 2X76A 4R1QA 4X8MA 5C34B 5L6MB 2GHIA 4DLRA 5I7SA 1ZWLA 4L9RA 4OBXA 3OIFA 2BHLA 5D7BA 1FQOA 1BDJA 3NGXA 5F3RA 5LDHA 1OFVA 2Y0CA 5HFJA 3GQVA 3CZQA 4ALNA 5JH7A 3O8OB 4U9UA 3Q6NA 5A0FA 2WAAA 1U2GC 2C2ZA 4L51A 4YREA 2EFHB 3ZNNA 4Q3OA 4N76A 4INOA 1PT8A 3TSWA 1Z5NA 3V4SA 4G0MA 5K8IA 1M2HA 1YZUA 2FWRA 1LJUA 3G2MA 2FW9A 4XCVA 4Z7JA 4O25A 3IKVA 2GZRA 4XRGA 1Y7HA 3OJWA 3VHXB 1K7FB 4EFMA 3BL5A 1RXEA 2JGFA 3PYXA 4C88A 4EHIA 1MABB 4QFMA 4ZPXA 4BTVA 2CNWA 4JP5A 4L8GA 1U3GA 3ANMA 4NZYA 4MUEA 2HBZA 1KZ9A 4K0RA 3CF0A 2EIHA 4D4JA 4WBNF 2VHYA 3UMYA 1ZOLA 3ZLUA 1J0CA 4F4HA 1VMIA 3CGGA 3E9CA 3KQYA 1YI1A 4NJEA 4NZZA 5DP1A 3PI6A 5EPEA 1EUDB 2H5LA 4OV6B 4LY6A 2Y67A 4IICA 1UBTS 1U7PA 1W1WA 1DS6A 1UPCA 1Z2CA 2ZJ6A 3JQRA 3RAGA 4A0RA 2X8AA 5LP6B 2FCAA 2O05A 2QVZX 3I9V6 3QW2A 4PLZA 3ESXA 5U9CA 2WPDD 1XNHA 3Q3CA 2DPLA 2YV5A 3N8IA 3KNZA 4UXHA 2QYTA 5HKOA 3AILA 4LYDA 2IIBA 2J3DA 2M6RA 2IS4A 3ER8A 3BB3A 3PVCA 3G0HA 5EE9A 3ZIAD 1LDNA 3FX2A 3SX0A 5CXXA 3IHWA 3L9WA 1E3IA 3TRHA 2R62A 3LXXA 1UFVA 1Z5VA 4MMXB 4C6HA 3G2PA 3M3HA 3OZ7A 2HXYA 4RPLA 4YLGA 3KQNA 2ZGVA 3SR4A 3HDJA 1KORA 1JQLB 3TNLA 1SELA 2V7UA 1JE0A 5ALFA 3VR3A 1GTRA 3JAKA 4FMDF 1YZVA 3BJRA 1XTJA 5KJCA 1UWCA 3FVWA 4UXJA 3MCAA 1E2BA 4LCJA 5EE0A 1KDTA 2WM2A 3K0CC 5J2UB 4IRMA 5K3DA 1CS0B 2HJVA 2HWWA 4XB1A 1HTWA 5M29A 2PAAA 4Z1MD 1W47A 4FNMA 1AMOA 5DGIA 1X1EA 1OAOC 2FWJA 1ACLA 1K9SA 3B6MA 3EQ8A 4HXFB 4W7HA 4JWTA 2GK3A 2JJYA 2J33A 1R6DA 1KJIA 1R37A 2I2AA 3MXOA 3R3UA 1Z8FA 3C6KA 2SKCA 4AY4A 2E37A 5JVDF 2X8BA 5DNCA 1NMXA 3WIBA 3L07A 1BDMA 1NF2A 1S4QA 4MROA 1JT2A 3UGKA 1NVTA 3NB0A 1B0PA 1LD3A 1L0BA 1ZBQA 1X9IA 2MOKA 4XD7D 4AIRA 2BKVA 1IBLB 4OQNA 4GM4A 3DL4A 1BDBA 3HO8A 1MJHA 2WZCA 1G42A 3FRHA 2I03A 4M0FA 2FR8A 1Z8NA 3D0QA 2ZSHA 4EA9A 1JA0A 1LDGA 1MOPA 1QTIA 1NUQA 4IHJA 3MJTA 4RTJA 4QJ4A 1QQTA 4BECA 1AZSC 2FPUA 2C4TA 2G4CA 5A3QA 4INPA 1YIAA 4FHFA 3V8QA 4DTIA 1BROA 1T3GA 2IOHA 4DY6A 5AVXA 4YP7A 4NYMR 4I2NA 1PNTA 4GBJA 4MKXA 5U4XA 1KPGA 2PDAA 1PFQA 3KJXA 4LE2A 4PR3A 3ZWDA 4ER0A 1QGUB 1TIBA 4N5NA 3QLTA 5BMVA 5TJHA 3EA5A 5DXFA 4B32A 1CZKA 2XNDD 3AL2A 4MMZB 2FPWA 1RWKA 1NP7A 1U2RA 5E6UA 1WBDA 3VI4B 4RSHA 1N7HA 1D1TA 2BHRA 4HH4A 2FLKA 2BJWA 2BTOA 3DGFC 1XZNA 4LMPA 5FOUA 3G1TA 5DCUA 2AG0A 2P78A 4DMMA 1OXTA 5IS2A 3M5CA 2V1UA 5DNWA 3AR6A 2QTVA 2FMHA 1KQPA 4QUIA 5BWOA 2BSQA 3T7DA 1MP0A 1Z74A 3HCDA 3M4ZA 3VPXA 1Z28A 3E5HA 4IX9A 4J3NA 4BNJA 3IAHA 5JMOA 3C5VA 2YRFA 3HDHA 1PJZA 2B4TO 1KFBB 2A2ZA 3R9KA 1BQ4A 3ITNA 3CT6A 3RKRA 3EIHA 3R20A 5KINB 1AQUA 1Z0SA 2WWRA 3WJ1A 5JDIC 3MTQA 1TVMA 2ZRLA 1N5KA 2IZ7A 3C1TA 3KU1A 2XWJI 5CA1F 2KPOA 3BGSA 4FC6A 5LYYA 3SM9A 5JD4A 1EWTA 5FTJA 2PJUA 3A6DA 4AXXA 1EWYA 2PQMA 3DWGA 4HRXA 5IBQA 4NZPA 1I5RA 3BA6A 4JD5A 1I33A 2CVQA 4KPUA 2C5AA 3OU7A 2EIXA 1QX3A 3GT0A 3KKEA 3K9NA 3BT7A 4YLEA 1E3TA 4M9RA 2PU7A 3OKCA 4QECA 1OGIA 4OHZA 2Z5GA 3TLXA 3FCOA 5CNMA 2P8SA 1DKPA 1FFSA 2QR2A 2PZEA 2XH8A 4FKZA 5JCJD 5P21A 3BILA 5TQJA 1JZSA 4XSHA 3SVZA 3NV7A 4G8DA 1T9DA 1Y7PA 2Q5OA 2R47A 4OJYA 4Q7LA 4N5HX 4M9QA 2RG7A 1ESEA 1Z0DA 4J16A 4TM7A 3FROA 4QYIB 2PRSA 1IE3A 1I1OA 2CE2X 2OYCA 2JLCA 1X0VA 4GM0A 1YE8A 1CPYA 4MJ7A 4D46A 2HMYB 1TIPA 1IAQA 4I6JA 1NQXA 4L50A 4V24A 4GR5A 4XFKA 2XT9A 4MWEA 2NQ2C 3R5XA 2BKEA 3EZYA 4PR0A 2EHJA 4OP2A 4WE3A 2G08A 3A3NA 1UK8A 3BGIA 4TRNA 4KPFC 3ZEIA 2B69A 2Z2JA 3TDKA 5KX5F 4IXNA 2D54A 3H6HA 4I5GA 4EPXA 1XLVA 3R5HA 1Y89A 1XT6A 4NNPA 2NUAB 3CLVA 3DBOB 3NIDB 3IR7A 5KWIA 1GZ6A 3RKUA 5JCXA 3DT6A 5EIAA 2Q3HA 2WF8A 2C3UA 3E7XA 1IUNA 4F1WA 1ZIYA 5KTNA 5GZ3A 2HN9A 3N2YA 2J4CA 1GRVA 1KZ4A 3QYFA 1VI6A 4XDGA 1ADFA 1UMDB 3RQIA 2I4LA 1KSFX 3GLIB 3NDPA 2XSZA 3ED1A 3T3OA 2IITA 3UV7A 1WZUA 2C58A 2VDNB 1BMTA 3COWA 3JQFA 4H0NA 4MJLA 1WHSB 5ALNA 3WFIA 4UOZA 4IR7A 2IVZA 4JA2A 4Q7EA 4C4TA 1UBMS 1SUBA 1P4HA 4GEGA 5BQ3A 5KNDD 3IQWA 5E2AA 3ZWCA 1X38A 3SU8A 3PQ8A 1DJQA 5A9RA 1N2CA 3FHOA 5ECDA 1VECA 1L7BA 4AP5A 2HMUA 1DADA 1WA5A 2AW3A 1QRDA 2GMWA 3LUBA 3N7AA 4Q3BA 4YI5A 4HNVA 3F8WA 2HLPA 2G72A 4JEHA 5EP3A 1YS1X 3ICPA 5CTAA 2IEGA 2HJRA 1CR1A 1D2MA 4MW1A 3UMVA 4UVEA 2QSJA 3IOBA 2XGSA 1NNI1 3ED5A 2ZIWB 3WTCA 3F73A 5IDYA 2ZDHA 3OX3A 3SAJA 3UJCA 4F46A 4CETA 2FOLA 4FPXA 3X1KA 4HVLA 1Y8ZA 3BMQB 2CUZA 4I1PA 3H5VA 1PSZA 2C1EA 1ZYUA 4FR2A 4NJMB 4DLBA 2YMMA 5KQLA 4HUQA 1NG9A 4NHOA 3NH9A 4G0QA 1XZQA 1V6SA 2IIPA 2J7PD 5AK4A 1ESCA 2C7PA 3DTTA 2G71A 2ADFA 2IS2A 3SE7A 2FSHA 1TLTA 4FM9A 2R11A 5KYNA 3MD0A 4X85A 1CQJA 4BQNA 2RD2A 2XB8A 3CSSA 5B5SA 4LHVA 3Q8LA 4V2UA 2Y1CA 3HWX1 2N75A 3NWEA 2QTBA 1SZPA 3DOUA 2A9FA 3CEPB 4IJMA 4Q4AB 1HXHA 5L40A 5EUCA 1L5OA 4MVWA 2HWUA 3ZCXA 5CFNA 3K71B 3Q11A 2GM4A 2Y9PB 2RONA 1Z25A 1SQ6A 1P75A 3KQWA 5EYPB 1G20E 2J87A 3T7SA 4E33A 2N47A 3FDXA 1NHGA 1CHDA 4DLNA 1Q7CA 2C8JA 1VA4A 3I4CA 1BMQA 4KDEA 1OLSA 3SR3A 2CHUA 5HTOA 3CPEA 1BCRB 4NECA 3N5CA 2EW8A 3HJRA 3QEMA 3EA0A 5JYDA 6ADHA 1A1VA 1VE9A 1C0PA 2R9VA 2Q3CA 2ZRFA 3FWHA 5HMLA 5HHTA 1THTA 2PUVA 1WJGA 4HFNA 4LRUA 4UM9D 5BNFA 1Z07A 2GPBA 4ENRA 3P9RA 4FCVA 4RHTA 4ESOA 2PWYA 1G7SA 1RYNA 4XWTA 5KNDH 1L1EA 5K8JB 1JDUA 1H6AA 4TSRA 1UIRA 3FDJA 4M37A 5LOVF 2PTGA 1BQEA 3F2VA 3WMEA 1TLLA 3FFXA 4WDQA 4IDHA 4D9GA 5IKXA 1DB3A 2JGDB 2GCOB 4D4KA 2QAGC 3E5MA 3FAKA 1DEOA 4PYOA 1LZKA 3QX9A 2BBOA 4PO9A 2OAQ1 1G6Q1 2ID7A 5B12A 3CE9A 3L7MA 2O54A 1FMFA 3ND5A 4CM9A 2PMKA 5BWNA 5JY1A 3WAJA 5ALLA 1PN3A 5FR2A 5LQKA 2EKPA 2VEDA 1QORA 4D8WA 4UVIA 1K0UA 2V55B 1QIKA 4YA6A 1P19A 5D5HA 5F73A 3LCRA 3EIOA 2WG1A 1Y82A 2VJNA 3I2YX 1KQNA 2R68A 4G5OA 3ZHQA 1F8YA 1FMCA 3SQOA 3D2CA 4AD8A 1H6BA 4Q05A 3SJ7A 4YAKA 4D25A 4WT7A 5BSTA 4EGCB 4RVCA 4KRYA 1FS6A 4INAA 3I6QA 1ODJA 5HWSA 2BGTA 1LVGA 1DQSA 3Q41A 4Y1RB 2W42A 5F3WB 3CLRD 5JD5A 3EZ6A 3NRJA 3GL9A 4BL5A 4UBNA 2YIMA 2MWMA 3QU4A 4B6QA 4YCCA 3LT1A 1DO8A 1CQZA 5DKFA 5BSRA 2G1UA 3G49A 4LJ8A 5FPYA 4FYKA 4CG2A 2AUTA 1A97A 2E49A 2CHGA 1MC1A 3OZFA 4HD8A 3QVXA 3AVOA 2YN2A 2QAIA 3MTGA 4DR3B 3OT1B 1FUIA 1UXJA 2FZWA 4FR0A 3EGOA 1C7FA 3T3HA 3PCXA 4JAVC 5FNVF 2VHTA 3OJXA 4MPJA 1NBMA 2R5FA 1TF7A 2AI3A 3AM4A 3ZH9B 4BFUA 1EVQA 2EL9A 3JQAA 4YRZA 4QOSA 5AKKA 2ZG6A 1M2OB 1U4NA 4Q6BA 4X20B 2GFIA 3N74A 3Q98A 3MAGA 4BLWA 3S2FA 2BP7A 3O8BA 2JK0A 1KEWA 3EZLA 3VVBA 1JL3A 4F9TA 1E6LA 2WABA 4JVSB 3LP6A 3RHSA 3MTEA 1WMBA 1Z4PX 1WOMA 4JR1A 4Y9TA 3D7RA 4AKTA 4WRRA 3VDXA 2FSSA 1WMAA 3TD2A 5JW6A 2Q2OA 4KNYA 2PD6A 2F1JA 2AG5A 2PS9A 3GJYA 1ZKDA 5GPBA 4DMUB 4RFSA 3X44A 3RAFC 2CJWA 3HB9A 5EINA 2FX2A 2XBUA 5JVDA 2ZSJA 3ZWNA 5BQFA 2JW5A 2W2PA 4IOLA 2JJ2D 5IUJC 1JHAA 4EKYA 2OHIA 3AG6A 3AB7A 3D4NA 4HQ6A 1QP0A 1N1DA 2ZB7A 5AWFC 4C0HA 4S1NA 2W8BB 4KRGA 1MJ5A 3THYA 4L3VA 1FNSA 3KSAC 1VPDA 3NBFA 1WIWA 3WWDA 1SO8A 2A58A 2FUCA 4WN9A 1SVIA 4BNYA 4KE9A 1PDOA 1W52X 4GI3A 5ED4A 3DFKA 1G6KA 4U6SA 3S55A 3RS7A 2IF0A 1N6LA 2Z09A 3PU6A 4L2IA 1NUHA 2H4ZA 4UMVA 1ZICA 5ANRB 1ZHOA 2Q3EA 5I7HA 1VE1A 1QWOA 3V4PB 3R75A 1A2QA 3WBBA 2JFGA 1BVRA 1IJBA 4RF4A 5K0SA 1PEYA 1X1RA 2Y05A 5FFNA 4TLAA 3JQGA 5E1MA 2J7KA 3RJZA 4ARZB 3KHTA 1EM6A 1FNMA 3H8SA 1V7ZA 4XQ9A 1QAQA 3NP9A 3HYTA 5GJVC 3TTXA 3PWKA 4A1FA 4LDJA 4DXHA 3QBTA 2X0NA 4V39A 2WW8A 3THRA 3LX5A 4AI6A 3D0RA 1H4QA 3LX4A 3W34A 3KUDA 4Q47A 4YK7A 2WSLA 3NW9A 3EWNA 3V1YA 3MWKA 4C07A 2KLHA 5AH0A 4NXMB 1NMQA 4KPYA 1JAZA 4TT8A 2H1FA 4XPIA 1W88B 4RC9A 2VRNA 2Q7DA 1KP9A 2JARA 1Z8DA 1TFRA 1N2OA 3QEKA 2ZRKA 3HLTA 1P7WA 1N8SA 4NS4A 3PNMA 4ZVNA 2IXDA 1I6MA 4N3CA 3WRYC 2ZDQA 4JI8B 5TPZD 1JEYB 3F3SA 3T95A 3B7PA 3U9TA 4JP3A 1DAIA 4YAUA 4F97A 2AI1A 3QXJA 2AT1A 3KZCA 4KDCA 3T5PA 2V65A 4LOAA 1NJGA 2ZWVA 4U6NA 4ZQHA 3VTAA 2DR0A 2BMFA 4BFTA 5CA1A 2Z4RA 2Y6VA 1LC3A 5FWNA 2F90A 3E3LA 1G4HA 4LV8B 2Q45A 4OMCA 1U3TA 3KC2A 3MM4A 1P74A 4LYJA 5COBA 3RSCA 4B85A 2DR3A 4X7RA 5JDCC 3T6KA 5AP9A 2O8EB 1RHJA 1EWKA 3RWMB 3S2GA 3DCJA 3R7BA 2O20A 3TRJA 1ZZEA 4N1AA 2GNAA 4RABA 3TWOA 1TJ5A 2L0XA 4YJ2F 5J63A 4A8HA 4C4YA 5JXWA 3FDIA 2CNOA 3HRHA 2RC6A 2ZVJA 3HY3A 3B3FA 4YFVA 4FWTA 1BOOA 4HOYA 4W9NA 4C1BA 4OJTA 4KK4A 4NPHA 4YGYA 4RDCA 1M8GA 1TRKA 2QEQA 5IVPA 3P5SA 1E6UA 3SC4A 2E85A 3S0JA 1SHKA 5I3CA 2HMVA 1WTAA 1Z0JA 1A9OA 3N6RA 1GPWB 1WCIB 1I4TD 2G9NA 3U17A 2Q1WA 4D42A 1JAIA 5F9MA 4ILKA 2I7DA 4Y2JA 5JD3A 4P7KA 4M98A 3IT0A 4U2GA 4W8HA 2H63A 5EKDA 3ILYA 1RYBA 5FV4A 3NRCA 4G8BA 1GHTA 4JSTA 5LQUA 1WY5A 4XXHA 5EZQA 4LZWA 5DHRA 3DEIA 2NP6A 5FUMA 4D4MA 3EDYA 1JKJB 2P9CA 2QMEA 3BFVA 2XCQA 3PTZA 3QTLA 4JYCA 4PQFA 1PWZA 1J9EA 5BSUA 3QF4B 4Z7QB 4CKZA 1MKYA 3FSEA 3SY8A 2FVYA 4MTLA 4KAFA 4CV1A 2BC9A 1I0IA 1FE8A 4AY3A 3PFNA 3WICA 4AJEA 1DRWA 5INTA 4OX9Y 1IRXA 3NGMA 2ODBA 1HQCA 4RTMA 1XEXA 3B3QA 3LCJA 5C5IA 1V7PC 2O7SA 2XQGA 3K92A 3EXHC 1SZCA 3KOZA 1T9BA 4FP9A 4G6ZA 2JJMA 2YN0A 4I66A 1PFKA 2B30A 4M88A 1F12A 3B5EA 1Z4QA 2AX4A 4YJ3B 1DBSA 5CYFA 2CLOB 1V3UA 2QV0A 4IQ4A 1ECJA 2EQAA 4M1WA 1JG6A 4RA6B 2HK6A 1ZGBA 3PGJA 5A3SA 1UKYA 4L5CA 5DNAA 3EDMA 4LXHA 2IEYA 4P4SB 1PZGA 3WZ2A 4D9HA 4DCMA 1XMVA 3HEAA 4GQBA 4N5MA 3EVGA 5TVGA 1QQ6A 4P9NA 2JLYA 1GD1O 2CK3D 3DR5A 3O4IA 2YWJA 1LW7A 2ACWA 4RL4A 3LQQA 3DMHA 1VBKA 2PN1A 4JX8A 3GJZA 1V8ZA 1Q57A 3DE3X 2O57A 2OUIA 4JODA 1CZOA 1F8GA 4ZODA 5JAQA 5C53B 2QRPA 3CVYA 1LJ8A 3QOWA 2GVNA 1X13A 1ONPA 4KXNA 4BJHB 1W44A 3K70B 3NYIA 3AFIA 1K98A 1LBIA 1RM0A 3MZ0A 5AI4A 3WL8A 1GA6A 2RIRA 3GWGA 5DNEA 4B4VA 4EG3A 3BREA 4QTYA 3OESA 1BVUA 1VIVA 4C3ZA 1MT3A 3IPCA 3L7BA 1W85B 2R00A 5DHUA 3ROZA 2ZT7A 1TTTA 1UZMA 2RBKA 5KYTA 2H5JA 3FOEC 1G4UR 2W71A 1C50A 1K5HA 3O9ZA 2H2IA 1VL0A 3QLJA 3N5KA 2APJA 5L3SB 2O8BA 1B1CA 4YXWA 3ZCRA 5HW0A 1ZJWA 1TZ2A 1CRLA 2AK3A 1XCBA 4AWXA 5I7UA 2B4QA 4AZTA 4UTXA 1HNNA 2VZLA 2WTMA 3TPFA 1XKXA 4TYNA 2WMNB 2GXSA 2CVFA 2O2CA 4UHHA 4XVHA 2Z98A 1GDDA 3JAWA 4G56A 1YMQA 3N8GA 3EPLA 2GJ8A 4KQFA 1MDFA 1PYGA 2UZ4A 3ORRA 4D74A 4V0SA 2JLSA 3GEBA 4I9HA 1RDFA 3JZAA 2FZCA 1XDWA 1DAFA 1U94A 5CCEA 1D5CA 1TU0A 2EGUA 4PCLA 2P0AA 4AWBA 3T3MB 5KREA 2P1ZA 4CVNA 1E3QA 4K2HA 3ZOKA 1IQUA 1KVTA 1QPBA 2XUIA 3MPOA 2FF7A 3ODPA 3MHTA 2V6MA 2NP7A 2PYIA 1RD4A 5IBCA 3HL4A 1LJLA 3C87A 3Q87B 3FLEA 3PYMA 1N34B 1QC5B 3IRUA 4RESA 4CQLA 2IUUA 1V8DA 3CEAA 1J99A 5FPHA 3F7NA 3OZSA 1AQJA 4MCHA 1M2FA 4FDMA 2P5UA 4KIGA 3EC2A 5DIZA 4LWQA 3JQ9A 3UEOA 5TMPA 4EA8A 3K16A 3QFTA 3TBKA 4FDVA 2PS0A 2I7TA 1KO1A 5DO9A 4G1BA 4ZAZA 1ULZA 3QA3E 1WPQA 5JXHA 4YPFA 3IUEA 1S8AA 1T2NA 1ZLXA 3C45A 3TTTA 1G59A 2IIVA 3A1NA 5CNIA 4R9UC 3QHAA 2EF0A 4LXYA 1XZDA 1TLFA 1NMEA 3U13A 2RK4A 2Y66A 4A26A 2E87A 3SKVA 3SC2A 1Z5OA 4ZAGA 1PV2A 5EMMA 3VQTA 4YCDA 3BEOA 4K6HA 4DR6B 2V58A 1T5SA 3ONDA 2IQIA 2WDPA 3AINA 4JK3A 2AR7A 1C9KA 3ZHSA 2C92A 1KAGA 3Q7PA 1I6LA 5E9QA 3K4QA 4OHRA 5KU7A 2E4ZA 2PFKA 2O52A 3CX8A 2W8ZA 5I51A 3KS9A 3OT4A 4WBSA 5DGCA 4D6YA 2NWQA 4BVLA 2ATIA 5EHNA 4L4UA 4V1CB 2DWOA 2YW2A 4QPPA 3RF6A 1K88A 1Q74A 4HLQB 1S2LA 4HRAA 1UJMA 4LYHA 4HB0A 4LMRA 4BFXA 3FTEA 1T1EA 2HQSA 5FNVA 2ZRGA 3HMKA 5TB5A 2JL1A 1A1SA 3RS2A 1SQFA 1Z36A 3UB4A 2EW2A 4UFPA 4V0MA 5DH9A 4M6WA 3NHWA 3P9XA 4QWMA 1ZM2A 2GPTA 3TAHA 5LZ2A 3ADBA 3L1JA 3DV0B 3AU9A 1OXXK 3GZTB 1JFTA 1IEXA 3U4QB 3QWIA 5T67A 4G1VA 1LBQA 2CNKA 1ZXLA 4YMUA 5IF3A 4MAFA 2WSSD 4UDOA 3TLCA 1WAMA 2X0EA 1PFWA 2IS6A 2ZSFA 2UZ0A 3OECA 4ZGWA 2AF3C 3G9TA 3QI2A 2VYVD 3AR2A 1N2CE 4LYAA 4M0KA 4DS3A 4L9WA 3VDNB 3TX2A 1UZUA 3TM5A 2ZJFA 3FMPB 3VU0A 4F9GA 3ESYA 4FYXA 1SKBA 3NTQA 1HZZC 2LCFA 4LVNA 1VJ5A 4IDFA 5AUOB 3T9EA 1K63A 1ZUIA 1YZKA 4EY7A 1WL8A 3PRHA 1C80A 3SIPA 1X7XB 4TL8A 5D5QA 4YUZA 2PRZA 4XOIA 4NFSA 3DMRA 4NH0A 1C7ZA 1H69A 1JDJA 2C1ZA 2P3LA 1DV2A 3GR6A 4WHMA 4MIOA 4ZVKA 3EGDB 4KR6A 5KNBA 1V9LA 1C2TA 2PAFA 3D64A 2ZJAA 2BFCB 4AY2A 2R65A 2XTNA 4LXIA 2FRDC 1JHMA 2P69A 4DRYA 4J0IA 4D26A 5FKJA 4PSUA 3I45A 2X86A 3P4YA 3KQLA 4OX9B 1KR2A 3ESZA 3EB9A 4AS2A 1X6VA 2NZXA 1SVWA 1U0OC 3OE4A 3VR6A 4KI0A 1CWUA 5JZSA 1GPH1 1Y6ZA 4H6PA 5DYYA 3OZEA 5A9SA 1THMA 2YNMA 3G5LA 3HHPA 2AL7A 2OGTA 3MCWA 3QVMA 3JYPA 3QWBA 4I1SA 1Y98A 3TBFA 1H8HD 1KPIA 4MHOA 4B45A 3KKMA 1S2IA 1ZM4A 4UHKA 3TSAA 4R1MA 1QRUA 2FQ1A 3LA8A 1RQLA 4X6YA 4YEDA 2JBHA 5ENZA 3BFJA 1GPJA 3FIJA 3LQFA 1N2IA 3AI2A 1FSSA 4JLWA 1QKIA 3G0GA 5ALHA 1X77A 3UJ8A 1ODFA 2W6QA 2GBPA 3PKZA 4GZ5A 4Q02A 3F67A 2YHUA 8GPBA 1CUIA 2EG5A 2XUHA 5MFZA 4LNUB 3KALA 1E5XA 1PX2A 1C3XA 1EK2A 3FYUB 1QG4A 3HXLA 3A3YA 3I9MA 5TF0A 3T7EA 4LWZA 4ZC1A 4RK4A 1L2TA 1YRBA 4EENA 3GNQA 4ZQBA 5IAEA 3FAZA 3GZJA 3D43A 3GPBA 3IC5A 1FA9A 3DD1A 1S2OA 1BQ3A 3U09A 5FT9A 3ZDDA 1OD6A 2V9CA 1HG0A 1PR1A 1TTQB 2DWUA 4GECA 2O23A 2XUZA 3DFIA 1N5OX 1K7YA 2XVYA 3ESDA 2D5BA 4GKJB 2R1TB 4V2IA 4LBVA 4BNWA 4MIKA 2G09A 5BN3B 5LD2B 3JQ7B 2X9NA 1X7ZB 5J5VA 4YJ2A 1APBA 2OFFA 4YRBA 5FPTA 4BMNA 5IN4A 4AF7A 3LOQA 3EULA 4OFZA 4LHXA 4OKNA 2B83A 1VKNA 2B3DA 3BZUA 3GLKA 4IVQA 1G5FA 2QW0X 3NZEA 3HGTA 1CE8A 1X74A 4ND8B 1FY2A 2YYZA 5BSEA 1VKHA 1BGVA 1OZ0A 1E1NA 4R41A 5C81A 1L7MA 2M2IA 3L8CA 4R5HA 2WHQA 1ZX1A 5LWHA 4CU2A 2VZ0A 4NAUA 2PT5A 1YFKA 4RKRA 2ENWA 5DEOA 5F1PA 4B6RA 1K3FA 4JCCA 2CLCX 2CMKA 3PEWA 2FFAA 4RYDA 3ELUA 4E07A 1ZH0A 5GONB 1JH9A 1G66A 4H27A 3QOXA 1KPHA 2Q41A 4JJIA 5JWRA 1IEVA 3FJYA 1BA3A 2HK8A 3NUZA 5CDSA 1P0QA 4HDKB 1MVOA 2OO3A 3R9XB 1C9JA 1E5TA 3CRMA 3TGWA 3NBYC 4FGZA 1DE0A 4PGMA 3T0GA 2GESA 4JHLA 3D9QX 1NBME 3BCHA 4NBUA 3WR5A 3TECE 2RKBA 1LZLA 1PNVA 2A30A 2YWBA 1Q1QA 2XQJA 1U0EA 3F6PA 4E1BA 5K0JA 3BBLA 2F8SA 1UDCA 2R8RA 5BQOA 4DILA 4EKIA 2JAHA 2QQFA 2WUDA 1M1UA 4QXQA 5BNTA 3ILVA 2J0QA 1CUYA 3DZ8A 1XQYA 5H83A 1NBHA 3B9PA 3UAGA 2BFOA 3BH7A 2ZE7A 4P54A 1MB3A 1OIVA 1G5IA 1G60A 1HRDA 5CVJA 4LGMA 4UAJA 4ZT2A 3SGLA 1Y3FE 1NUUA 1PZFA 3VNAA 1I2MA 4MVJI 2L17A 3OHPA 3N6XA 4MR9B 2ILTA 2IUTA 4NBRA 4WQMA 1Z62A 2GZMA 2VP3A 1QBGA 3MCVA 4ZRDA 4BZWA 1Z38A 1U9CA 3H1BA 1C9DB 5L3QA 3AFGA 1P4JA 4KODA 1OJLA 3BSYA 3HWWA 3H5AA 4JQYA 3OFSA 2NO1A 3SYNA 1LF0A 3H6GA 1RSZA 1ELOA 3L6RA 3P45A 1E62A 5HCUA 5AKXA 1YVEI 1A04A 4DDHA 4C7OB 1E7RA 4TGLA 3OX2A 4ARSA 2ZUVA 1O6BA 3I5XA 3MTIA 1Z17A 2JATA 4G67A 5EJFA 4WJKB 4FSDA 2NYAA 3L1HA 1WXQA 4MJ3A 4BZQA 2QY6A 4G5XA 4MARA 4W4TA 4BDTA 4QNRA 5LZ4A 3BHNA 3AI1A 4KEAA 3ULKA 3K1AB 2DBQA 2COKA 2A0FA 4TKVA 1KDYA 1SB9A 3BQMB 3D4IA 1G2OA 2CJFA 1K7XB 3CHYA 3SDBA 1NW6A 1UWKA 1W9HA 2IPLA 3BH0A 1UKCA 4M83A 5CLQA 1ZM7A 3LHFA 1Q1ZA 5EL0A 3SFZA 5ABPA 1EGVB 1G9TA 2P9TA 1W0JD 2MSWA 1ZM9A 3HRKA 4Z2YA 4EK9A 4TMTA 5ITSA 1C41A 3FWYA 3H2ZA 1K5PA 2FXVA 2IXGA 2O2YA 1ECFA 3SQMA 3B6KA 1HURA 3WGMA 5D51S 1VRCA 3PQEA 3PDCA 2A9QA 4BASA 4NAHA 1E79A 3WNBA 1L7RA 4HLNA 4A0FA 1Y6GA 4CEHA 3D8HA 2QR5A 1AIPA 2FPOA 1GITA 3G79A 5BMOA 5CBPB 1UMBB 5GVSA 2QLJA 5LQNA 3J81k 3LS2A 3H2BA 4E5SA 3FZNA 4CQMD 3OY2A 2LCQA 3ZHYA 4CEJA 4M7PA 3JVVA 2SNIE 3OJEA 3EX7C 5AW1A 3OU2A 3M83A 1XEFA 4I46A 4F1KA 4N12A 5DTEA 2ISSD 4L7QA 1K3TA 1RZ3A 2FMFA 1NZJA 3WVNA 3IP5A 4DR1B 1KJNA 3IDQA 1BWQA 2WUWE 3MRXA 3Q9NA 1YDMA 3GAZA 3MTAA 4YUXA 4UUNA 1RI1A 3K6RA 5T6MA 1O4WA 2WT4A 3CMMA 3K8ZA 3SBXA 2H11A 2I2WA 3F6EX 3TFQA 2NO6A 1G0OA 3ABRB 9LDTA 3A6LA 3LY5A 1ONNA 1XDBA 1WW2A 1O95A 1U90A 3M0EA 5DV9A 2VATA 5D2CA 4NY1A 3HFSA 4KG7A 3GJ5A 1A4XA 1LVUA 2ZSDA 2XNJA 1YTUA 4FCTA 1U3WA 3GJ4A 4G89A 2LW7A 3EWAA 1VLHA 2QUJA 1A4UA 2Q5CA 3K6SB 1F2TB 5DCYA 2ORVA 5CCDA 3T4EA 1CJTC 2F3SA 1HE5A 4US1R 2OXRA 1KU0A 5F2OA 1PNOA 1Y1RA 1OV4A 2FLWA 4HGRA 5IW8A 3DYBA 2XCTB 2C8VA 3H9QA 1FPMA 3WGKA 1IPFA 2VL7A 4P4NA 4DHWA 2REQB 3QKRA 3BS4A 4PBRA 3ZWMA 2RKOA 2QL6A 3PC7A 5BORA 3RTGA 2CSUA 3BJEA 4OA5A 4WWHA 4O4JB 2IBTA 5ILQA 2WIKA 5KQRA 1JHUA 2D5IA 3CIOA 1JWLA 7AT1A 1NW4A 2PX0A 1AV7A 4M54A 2D0OB 1EZ4A 1SEVA 2H2WA 4Q4HA 2B34A 3VJRA 2RBEA 4PZLA 4J1NA 3C85A 3NVMB 4W6QA 4ZA2A 2XD9A 1B2LA 2FG7C 4FZJA 4IDAA 5HILA 3C97A 3H84A 2P5YA 3MS7A 2IYUA 1X7DA 4CDRA 5BN5A 2VPIA 2YJGA 4DRXA 5HVNA 1IZYA 1TCAA 1RKQA 1TECE 3DAGA 3OJLA 4AJNA 2BYTA 2V3CC 2ZQ5A 5I9BA 5LU9A 2XECA 3PDIA 1JBEA 3QVWA 1M8PA 4HX2A 4I50F 1KE1A 4E4RA 4P58A 3T9AA 4WK6A 1EGHA 4EX7A 5C35A 1JAXA 3W3AD 4EP1A 2WFLB 1KZ6A 2BEUA 1JPJA 4X3CA 5EE5B 3TTWA 3G0DA 3C8ZA 1DV1A 2H2DA 2PTHA 3JRWA 1QG0A 1RKUA 1ONBA 1EBFA 1FPQA 1OSNA 4FGKA 3THOA 3UZUA 2QYSA 1BE8A 4GO1A 5DHQA 4ZVMA 4C06A 4B3JA 2ZUCA 2Q6IA 4QOJA 5CHYA 4P3OA 4BN4A 1AK2A 5GWXA 2QP9X 2VBCA 5G0UA 1JEEA 3B36A 4ME6A 2GBIA 3LBFA 4RF3A 2EDCA 1XD8A 2H5IA 3TRKA 2RC5A 1T2EA 5DM4A 1N0HA 1N9ZA 2IEDA 2PT9A 3DE1X 3RM3A 4GYWA 4FJ2A 2IYAA 1HK7A 4GI1A 1YR9A 3BTUA 3KWJA 2DH5A 3BK7A 1YU9A 4H35A 1FUYB 2PD4A 1ZO8A 1CSEE 1A8SA 1E3WB 3LCCA 2AHOA 3HXKA 2FETA 3MIIA 2NUPB 4N82A 5IRCD 3MILA 2DECA 1CZUA 3TLZA 1ZL2A 4HH1A 2WOJA 3TMKA 1P1KA 3GY0A 3V3KA 6Q21A 2OO7A 2RAUA 3L9XA 3G85A 4C3UA 4KMSA 1UJ2A 1RFGE 2O8DA 1PVVA 3N2KA 3K32A 2YXPX 3CNNA 3LDHA 1LRKA 1JLLB 2HV9A 3VMFA 2NQ8A 2Z57A 1FYVA 2QXTA 4M1KA 4R0MA 1AB6A 4U8HA 4II7A 1B0ZA 1URPA 3HXOA 1JAYA 1EWRA 3KTFA 1R4ZA 1RPTA 2ECQA 4N40A 4R8LA 3VFDA 4B4DA 1W96A 1Q5PA 2R2GA 5HSGA 1Y1LA 5FV7A 2ICAA 1IBSA 2ZCUA 5FOXA 4OI0A 4WEQA 4CHTA 3ZYZA 1RRMA 5JG7A 1OFGA 1FDVA 3RS4A 3SF8A 2NMVA 2JDID 1OV6A 2A92A 1VJCA 3JRXA 4J0CA 4HDOB 3UUWA 1I32A 2O2SA 3JCZA 3KR1A 1ZN8A 1ACMA