3UUFA

Crystal structure of mono- and diacylglycerol lipase from malassezia globosa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
RGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNFDDHQGIYFHTQIGAVMGECPAQVGAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a mono- and diacylglycerol lipase from Malassezia globosa reveals a novel lid conformation and insights into the substrate specificity.
pubmed doi rcsb
source organism Malassezia globosa
molecule tags Hydrolase
molecule keywords LIP1, secretory lipase (Family 3)
total genus 101
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uufA00
1TCCA 3TJMA 4ZV9A 4BTLA 1CRLA 1IMJA 2XUHA 5K3CA 3H04A 1GXSA 2PU5A 3V1NA 5JD4A 4J0CA 1TKRA 4W1PA 5EFZA 1ZICA 4WY5A 4CIBA 3C6XA 5CURA 1YS2X 4ZREA 4EY5A 2PX6A 2OGSA 1ZJ4A 3WK9A 1YA4A 3O9MA 4AN1A 3HC7A 4RNCA 2C4HA 4PSCA 2BCEA 3CXUA 2Y1KA 1E8DA 3G9TA 3O4HA 5LLSA 3G9UA 2XMZA 4U2BA 1WCYA 1XQVA 4KRYA 3DS8A 3OPMA 3ZLVA 5K3EA 1THTA 4Y9SA 3HSSA 2OAGA 4KAAA 3WIOA 4KYVA 3LIPA 1L7AA 3BF7A 4QNNA 4YK7A 2B4KA 2RAUA 4X00A 2ZYSA 5FXMA 3QMMA 4PO3X 1QOZA 3DKRA 5AKLA 1WB5A 3F67A 3ILSA 1XRRA 4BC1A 4QE3A 4PNZA 3V48A 3F9CA 3BF8A 5HCUA 3PFBA 3KWJA 3O4IA 5AM5A 2FUKA 4MYSA 3RM3A 2WHPB 1QIMA 2BUBA 5HF6A 5JZSA 4UBKA 5DLPA 3G7NA 1YB6A 4B85A 1SC9A 3STUA 5JIBA 1MAHA 3WK8A 5CH8A 1YS1X 2Z5GA 4Y2JA 3BJRA 5HZGA 5AOBA 1A7UA 1XZIA 5IH7A 3WQHA 5I8PA 5J3JA 5AK6A 3IIIA 4IH4A 2RHWA 5LKRA 1W6RA 3QPAA 2XUQA 1HPLA 3VJKA 1EI9A 2YYSA 1VA4A 1CLEA 2HA0A 4V2IA 2Y2VA 1LPBB 3KSRA 1CV2A 2XMDA 1FFDA 2ROQA 1TRHA 2EDAA 4LYDA 2XB6A 4NVRA 5JARA 5CT4A 4KAFA 1P0MA 1KU0A 2JGEA 1MNQA 2O2IA 4JEIA 4MJ3A 1P0PA 1XRPA 4X91A 2HFKA 2XI4A 5CT8A 4EHBA 1IUPA 4B81A 2DR0A 3W9BA 1XQYA 4FNGA 1VOTA 2OG1A 4GWLA 4P9NA 2Z3ZA 4GEGA 3O4GA 3F8SA 4GBGA 3QMWA 1OXMA 4ZXFA 1C7JA 4C87A 5ALFA 3DYIA 3K2IA 2QXUA 5ALTA 1E66A 5T4FA 3HJUA 1EK1A 1DT3A 2C7BA 2XQIA 4UHCA 3QZUA 2XUDA 2OAEA 1K63A 5A62A 3L1IA 4UHHA 3ZV7A 3PFCA 1BCSA 1YASA 4J7AA 4E46A 2BFNA 4GDMA 5E4JA 3CN7A 4XX1A 4X90A 3R3WA 4BDSA 3WLAA 1JI3A 4Y2QA 2JGIA 4NS4A 4G8BA 2G5TA 5AK3A 4OSEA 3ANTA 3FVRA 5AI9A 4B0PA 4AMZA 4AQDA 7YASA 2J4CA 1ZI6A 2WFMA 4TGLA 4Y2XA 3VXKA 1UXOA 2GBCA 5DNWA 4YPVA 5ALLA 3QPDA 3IVMA 2C0QA 3M83A 3BDVA 4OB6A 2JEZA 1QIJA 4O08A 3V1KA 4PSDA 5LZ4A 3R3XA 4N5HX 5JAPA 4F21A 1Q0ZA 3FVTA 4Q82A 1WHTA 2V9ZA 4Q05A 1MT3A 4E15A 3H2GA 4KAJA 1XZEA 1XKLA 1LLFA 2PM8A 4JYMA 2XQKA 2HA5A 2IITA 1ZD2P 3GFFA 1ZIYA 1XZFA 3OURA 3GA7A 4MEAA 2WIDA 3G0BA 4NMWA 3WKCA 2XMGA 3WKEA 2JGFA 5DJ5A 4FFVA 2ZJ6A 1CUUA 4C4YA 1ZGCA 2GBIA 5ALUA 1KU6A 5EGNA 1ZD5A 2VATA 4QLAA 4U2CA 3V1LA 1W4LA 4A5SA 4K6KA 2XE4A 4I4CA 1GQRA 4J0KA 1BEZA 1J07A 4OCZA 3I6ZA 5K3DA 2BAGA 2JEYA 3STWA 1TCAA 3F98A 3JW8A 4Y2YA 5HQ3B 1KEZA 4BC0A 5DTJA 1R3DA 5FPPA 3WYNA 5HKBA 1N5MA 2XMSA 3WI7A 5AI4A 4AN0A 1YAJA 4KE7A 2WIJA 4HXGA 2QUBA 1PV1A 2HU8A 5ALQA 5IVDA 2C5FA 3QVMA 3HXKA 5A7HA 4BE9A 1GPLA 2RHTA 1CUEA 1MU0A 4BE4A 2VAXA 1TQHA 5EIEA 1ZI9A 2QMQA 4WFIA 5ALIA 5AKYA 4MQLA 4ZGBA 3VJMA 5KWJA 1LPOA 1QIGA 5DNUA 2XQJA 1XQXA 1DTEA 3O9VA 2HM7A 3BE8A 3AIKA 1EVQA 4CIAA 4S0XA 4CCWA 4HZGA 3WZLA 4QEKA 4G4GA 5AHXA 1MTZA 1WB6A 4DSZA 2ACEA 2QKYA 4G8CA 4J0DA 3IB3A 2VJBA 1P0QA 3ZI7A 1LPAB 4J0JA 4C89A 1ORWA 4ETWA 4G1FA 3F96A 4E11A 4WJLA 1UOOA 3V9AA 5EIAA 1QZ3A 4WCVA 1CUJA 3D4LA 4JYPA 1CUFA 3BIXA 1XRMA 4G9GA 5AI5A 3PE6A 2VF2A 4LYEA 3HI4A 4LKOA 2VQ6A 3LP5A 2PU7A 5AKEA 2WU4A 1XZBA 4AZ3A 1R50A 5LP1A 4FKBA 1UFOA 4IHAA 2PVSA 3R3YA 2QJWA 4G8DA 3C87A 2WUFA 4FLFA 1CPYA 3QYJA 2WHRA 4DNOA 3SWWA 4OU4A 1XZKA 3ESAA 4UBOA 1YCDA 3M81A 5AK5A 4FTWA 3QMVA 2Y6UA 5ALZA 1CR6A 3DQZA 1AUOA 4MWTA 3H1BA 1ACLA 5EHNA 4NZZA 4B84A 4KE6A 1VE6A 3SX4A 1GKLA 2O7RA 1AX9A 5DYWA 5EHXA 4OYLA 4LXIA 5FKJA 3WK5A 1BU8A 3G0CA 3G02A 2GZRA 3WWCA 3KDAA 5ALHA 3K9BA 4ZV7A 1CFJA 1F8UA 1XZHA 1XRQA 1CUDA 1VZ2A 2XMRA 5FV4A 5I7UA 2XUOA 3HYSA 5HF8A 4OYYA 3B12A 1F0NA 1GZ7A 3OOSA 5AJHA 4F60A 3FSGD 4H35A 1DWOA 1VA5A 4QWMA 4L72A 1WOMA 1W75A 3FYUB 1QONA 4IO0A 3AZQA 1LPNA 4K5QA 5HK9A 3BIWA 5D3ZA 3LS2A 4JH0A 2QRUA 1DQYA 2WUEA 3PF8A 2WIGA 5K5EA 3AUKA 1E8MA 1QIFA 2JGMA 1QFSA 1UWCA 2Z8XA 1U65A 5C81A 3E3AA 5CTAA 4EY8A 3ICWA 1PFQA 4BCDA 1SFRA 3I2GA 2I3DA 2PSHA 4AX4A 2GYUA 3I6YA 1FFAA 4X6XA 3DOIA 4M0FA 4B9AA 3I2KA 2YASA 1LBSA 3I6MA 3WL6A 5AK4A 1EK2A 4W1SA 4QWWA 4I19A 4HVTA 4DTCA 4KE9A 5K3AA 3O95A 1I6WA 4TVKA 3HEAA 5SYMA 3BL8A 4QDTA 2LIPA 4UBMA 5AOCA 1CUSA 4X3CA 3LLCA 3D2AA 2HHAA 2AJBA 4MYDA 3FLBA 3MUOA 3ANSA 1T4MA 4UBIA 3AILA 3DOHA 5A6VA 2ZVDA 4H7HA 2VTVA 2XQFA 3KWFA 5YASA 2HA3A 4N8DA 4UBLA 3DL4A 2IIVA 5JAHA 3IDAA 1CUZA 2WFLB 2BGRA 1ORVA 2D5LA 1CUXA 2WSLA 5AICA 5JADA 4FLMA 3LIIA 5AKKA 2W22A 1LZKA 2CUTA 3D0KA 3R0VA 1BN7A 4A16A 1UT6A 5LZ9A 4W63A 5HFAA 2J3QA 3EQ7A 2YH2A 2PSJA 2BUAA 5AH0A 3KD2A 2ACKA 1OILA 4C88A 1UKCA 3R40A 5CT9A 4ROTA 2BJHA 1VKHA 1AKNA 1EB9A 2R11A 1CUBA 5JASA 4K6GA 2ES4A 2X5XA 1Q83A 2AJCA 5DYYA 1FSSA 2HDWA 1AURA 4Q3OA 4BTVA 4GHWA 1R88A 5ALSA 1CVLA 4WFKA 4EY4A 1ODTC 3WYDA 2QUAA 1OCEA 3G9ZA 2RGUA 2OQVA 5ALDA 3R3UA 3FCXA 1XLUA 2H1IA 1HDEA 2C0PA 3JWEA 1S8OA 4UHFA 4J0GA 3IUQA 3ICVA 3BDIA 5AIAA 1JMKC 4ZRDA 2CJPA 4HRYA 5A2GA 6YASA 3UUEA 4Z49A 4RE6A 1ZIXA 4RGYA 5ALNA 5LZ2A 5AOAA 2WM2A 3C70A 1DWPA 1AZWA 5C8XA 4INZA 4FDMA 2JIDA 4Q1VA 4IH1A 5LZ8A 1UK9A 2JGJA 5AM3A 3EBLA 1XZLA 3IA2A 4FOLA 2WILA 2D0DA 3EQ8A 4BBZA 2WG0A 4WDQA 3QITA 3D3NA 4AZ0A 2DSNA 4H7IA 1UZAA 2O7VA 4BRZA 4BVKA 2O2HA 3DLTA 3U1TA 4CCYB 3KOOA 5FOQA 3A70A 5JD6A 4OU5A 5HFNA 4B9EA 1DU4A 1K8QA 3H2JA 3ESCA 1XRNA 1W1IA 3VKFA 4AO6A 3VDXA 1XZMA 4DGQA 3RKSA 5JZBA 3AINA 2WFLA 2HRQA 3WK7A 4XVCA 4EY6A 2GYWA 3WKDA 3D59A 5HQ3A 1UK8A 1ZJ5A 2Y2UA 4K6HA 3L1HA 2CEKA 2OQIA 3AIMA 4KJXA 3X3HA 4FLEA 3H17A 2WHPA 5T4HA 1Z68A 1G5FA 4U2DA 3PUIA 2H9YA 1MX1A 1WHSA 4J3JA 3F97A 2PL5A 3OTQA 1QJ4A 1C7IA 2PBLA 3VJLA 1MJ5A 4UHBA 3W9UA 5ALVA 2OCIA 2BGNA 4BAUA 5HF9A 2Z3WA 2NW6A 1BROA 4X6UA 1F0PA 4Y2TA 5LKAA 1CUHA 1X2BA 5ALGA 4MWSA 3AIOA 1HQDA 5AI8A 3W04A 5C7YA 3FCYA 3QPCA 5AO9A 1GKKA 1MN6A 3FWHA 3BJMA 5CH5A 2WG2A 4X7BA 3CCCA 3HABA 3STTA 1XZGA 3C5WP 5ALRA 5A7FA 1QIEA 5ALPA 4ITVA 3FBWA 4JNCA 5DNVA 2WJ6A 3EF3A 1USWA 1ZD3A 2ZJFA 3OM8A 3UMJA 2PKYX 5FDFA 3Q0TA 3S2ZA 4B83A 1P0IA 1DT5A 3PI6A 5T4EA 1E3QA 4KR0A 2QOEA 1R1DA 4FMPA 2QM0A 3G0GA 3WWDA 5ALOA 3C8DA 2V98A 3E0XA 2Y6VA 4DSAA 1E5TA 1EH5A 4WFJA 2E3JA 4WDRA 1VXRA 2DHEA 3TRDA 1JU4A 1R4ZA 1CUCA 3O4JA 1AGYA 3W06A 1FFCA 1MNAA 4CFSA 5JAUA 1CUWA 2DHCA 2Z8ZA 4EA6A 4KEAA 4DMCA 1UK6A 4C01A 2ZJ7A 3R41A 3W05A 3P2MA 4QLOA 4IH9A 5A71A 2O2GA 1EDEA 1GQSA 1J06A 3BWXA 4DMHA 2OXEA 4J0HA 4AO8A 5KREA 2XDWA 1BRTA 4G4IA 1ZGBA 5FPQA 3BXPA 2V97A 4PSUA 4OB7A 3HACA 1E8NA 4G4JA 2YXPX 5KWIA 2GBGA 4ZWNA 4H0CA 1ODSA 1U2EA 1QIHA 1W52X 4HRXA 3TGLA 1GT6A 3FNBA 4GLBA 4B80A 5C8ZA 1D07A 5ALWA 3DYVA 3R3VA 2WTNA 4H7EA 1Q84A 2HL6A 2OPHA 2B61A 4AXBA 1G42A 3AJAA 4Q3LA 2QT9A 4TPKA 4HXFB 4Y2VA 3HRHA 3FOBA 5ALXA 2ZYIA 4YASA 2RONA 2J3DA 3FLAA 1H23A 4Q34A 1XRLA 4Q3KA 5IVHA 3AZPA 4UBNA 4H7FA 4X6YA 1QTRA 2QTBA 2JF0A 1PJAA 2WKWA 1Y7HA 1QTIA 4HS9A 5CBKA 5K3BA 3A6ZA 3N2ZB 1VXOA 3SK0A 4M0MA 3GELA 4UHDA 4Y7DA 1ZOIA 3SC2A 2QXTA 5CT6A 3M3DA 1NU6A 3A2MA 1Y7IA 1TIBA 5JYCA 4HTAA 3WA6A 2ZYRA 4Y2UA 5JANA 2WQZA 2G63A 1ZD4A 2VJCA 2CBGA 3STXA 2XMCA 4B82A 1CUVA 1LZLA 4PV7A 4H7DA 2GYVA 3QH4A 4L3WA 2ONCA 4X92A 2QZPA 3MGAA 2XUKA 5HKAA 3WWPA 4DYHA 1IVYA 2XUAA 3DKKA 3DD5A 4BDTA 2WUDA 4KRXA 1BS9A 4DNFA 4LIPD 5LIPA 5E4YA 3I1IA 2PSEA 1ACJA 2HA2A 2QJRA 3PF9A 1MAAA 5K3FA 4G5XA 1NX9A 1QFMA 3G9XA 1SOMA 4KACA 1A8UA 1M33A 4X95A 3OG9A 4OD0A 1T2NA 4GXNA 5E4TA 1L7QA 2WLSA 3C6BA 5D7BA 4BB0A 4X94A 4KE8A 4UPDA 1JJIA 4WY8A 3S8YA 2XLCA 1EX9A 2C58A 3VVMA 1BEEA 3WKBA 3NOXA 3DNMA 4UFOA 1EINA 1FFEA 1RP1A 1GPNA 5EI5A 1N8SA 2VSQA 1CEXA 1LPMA 2UZ0A 1VJ5A 3LCRA 5D6OA 5SYNA 1ISPA 3VISA 5C8VA 3H18A 2ZSHA 3TEJA 5AI0A 1DWQA 4IQ4A 1GGVA 2H7XA 4DNQA 1JFRA 4BAGA 3QBJA 4B6GA 4W9RA 5AKJA 4PW0A 4BCBA 2HFJA 3I1YA 1LPPA 5FP0A 2ORYA 4FBLA 4BVJA 1IZ7A 1THGA 3E4DA 1H2XA 3A2LA 1G4HA 3GUUA 3OC0A 4I3FA 3H2HA 1DX4A 1TK3A 3B3QA 4EBBA 1QO7A 2K2QB 4AMYA 2B20A 5T4BA 3MUNA 1XKTA 2RI6A 3NWOA 3C43A 3AFIA 2OLEA 1K4YA 4GECA 2X8BA 2DCMA 4G9EA 3H19A 4N8EA 2OCGA 3ED1A 5AKIA 4H77A 2HADA 5BWBA 3ESBA 4RE5A 1XZJA 4FFWA 4ARAA 2HA6A 3D2BA 2P8SA 1WB4A 2H7CA 2ZSIA 5FRDA 4UBJA 3EIOA 4CG1A 1BE0A 3I2JA 3O0DA 3DDUA 1EHYA 4F0JA 2OCKA 5LZ7A 4QDUA 1EXWA 1VZ3A 4EB0A 3G8YA 1YR2A 2G5PA 3D2CA 3QM1A 4CG2A 3U0VA 3EQ9A 4X93A 3C8HA 3I2FA 1EVEA 3IUMA 3DEAA 1ZI8A 3NUZA 2HIHA 3I2HA 5AKGA 4HXEB 2RIPA 3FYTA 4N5IX 4RPCA 5IVIA 1UOQA 1QE3A 4P08A 3H0CA 1X70A 3WWOA 2X76A 2JGLA 2I3ZA 2XUJA 1YA8A 3NGMA 4OPMA 2OCLA 4AO7A 5AKZA 4X71A 1Y37A 2XUFA 5D3KA 2PUHA 3IUJA 1L7RA 4UHEA 5BV7A 4MEBA 3WJ2A 5IKXA 5E2IA 4OB8A 2CZQA 1DINA 5EHQA 3ZLUA 4Y2SA 2VT7A 5AM4A 1CUGA 4P93A 5JATA 4D9JA 5ALKA 4BZZA 1R9NA 2R8BA 4DIUA 3WL7A 5CH3A 4L9AA 4AB1A 3B5EA 1SCQA 5ALEA 1H22A 4QDXA 1W76A 4H7KA 1H2YA 4XWGA 5ALMA 5ISMA 5AP9A 4FWBA 3ZPXA 5I9IA 1FJ2A 5CXUA 2CKMA 4YX9A 1X2EA 3I2IA 1VLQA 4MXDA 1RYYA 3WMRA 1BN6A 3Q8WA 3MVEA 4M0EA 3ZWQA 1HBJA 2OGTA 2WIKA 3C5VA 3G0DA 5BWCA 3ZLTA 3YASA 3FYUA 5FUMA 4W1RA 2FX5A 4BP9A 1QIKA 4DMKA 4X85A 3HZOA 3UUFA 2VT6A 1B41A 1QIDA 2OGZA 2WJ4A 1AMNA 3FAKA 1Q0RA 2V96A 1YSCA 1LPSA 1CQWA 4GW3A 3WL5A 3WK6A 4ZI5A 4BZWA 4DM7A 1MO2A 3I28A 4CI9A 5A7GA 4H7JA 4C6HA 2DFPA 4U2EA 4BAZA 5BOVA 3CCBA 1N5RA 1UKBA 4F5ZA 5KBYA 2HA7A 2VJDA 3RLIA 1RWQA 1O6GA 2WJ3A 1JKMA 4PF1A 2FJPA 1HLGA 2XLBA 5F4ZA 5ALYA 3WL8A 5LYYA 2JGKA 5DYTA 5AM0A 2EEPA 3M82A 5AI6A 4BYMA 2BUCA 2DQYA 5H3HA 4QDOA 2FJ0A 2IX9A 2I03A 2JBWA 4EY7A 3H2IA 3ESDA 5JZ9A 1ETHA 3H2KA 3STYA 5JAOA 5K3FB 2GBFA 4GI1A 2WU3A 1SCKA 1B6GA 3D7RA 1CUYA 3G0IA 1QGED 4MQMA 2ECFA 2WIFA 4HAIA 1DX6A 1A8SA 1DQZA 1U4NA 1IZ8A 2CB9A 3STVA 2VJAA 4K2AA 1IUOA 1O6FA 3V1MA 1VE7A 3AZOA 1CIJA 1MX5A 1XFDA 2AJDA 3WWEA 1GPKA 2PPLA 2WFZA 1J1IA 3IUNA 1J2EA 1H2ZA 1HKHA 2XUPA 4CG3A 1JU3A 2WUGA 1N1MA 2BKLA 1H2WA 1YB7A 1SCIA 1CUAA 5DTIA 1QLWA 1LNSA 2G4LA 2DHDA 3HLKA 4Y2PA 1BCRA 3RARA 4EZIA 3KXPA 1XLVA 1AC5A 3WJ1A 4PQEA 1WM1A 2I78A 3DCNA 2PSFA 3GROA 2WG1A 1E89A 4FBMA 4J0IA 2QS9A 1XZAA 1C4XA 2EDCA 1MPXA 2XMQA 3IULA 1HL7A 1CQZA 3FYUC 3N0TA 2PSDA 2XUIA 3C6YA 3D5EA 1ODCA 4UFPA 2VEOA 1AQLA 4FHZA 4W1QA 4B7ZA 4EUSA 4B0OA 3RK4A 4QZVA 2H7YA 4DMFA 5EHZA 5EIHA 3WZMA 2XMBA 1K5PA 4ARBA 1JJBA 2GZSA 4JUIA 3DL7A 2HA4A 3K6KA 2HRRA 4XJVA 1UKAA 3C45A 4LXHA 1A8QA 4N8SA 4BATA 3E1GA 2WTMA 2W6CX 4BP8A 4A23A 5CT5A 1JT2A 3VVLA 1JMYA 3JYHA 4C4XA 1A88A 3IURA 2XUGA 2XT0A 4E14A 1UOPA 4BRSA 1WPRA 5AKHA 4C4ZA 5AIBA 3T4UA 4BVLA 5ESRA 5HF5A 5AM2A 1QIIA 4BCCA 3IBTA 3PUHA 2ZYHA 4LHEA 2PUJA 2QVBA 3WK4A 2J4FA 2WHQA 5IVKA 3PDCA 3CN9A 1G66A 2CMFA 1QO9A 5ALJA 2QR5A 4CCYA 2DQZA 3H1AA 1MX9A 2AJLI 2VAVA 5DWDA 1LGYA 2XQGA 1XZDA 4X97A 1U8EA 3A2NA 1WPXA 1YAHA 5CRIA 5AKXA 4U2FA 1JJFA 5JD5A 1LBTA 5CXXA 3GZJA 1F6WA 1K6EA 4DNPA 1TCBA 2C5GA 2B9VA 1EDDA 1EA5A 4L0CA 5CW2A 1R9MA 4P92A 3FLEA 3R3ZA 1FFBA 5LZ5A 1XLWA 4FNMA 3T52A 4DLNA 1EDBA 4Y2RA 1UK7A 3W2TA 3WA7A 4OUKX 4U2GA 5JALA 3DJYA 1XROA 5CMLA 4J03A 2AXEA 4QDZA 5FLKA 1XQWA 2VA9A 2AJ8A 4QA9A 2HU7A 1EB8A 3GBSA 2HU5A 5AM1A 3FSGA 5HK8A 1TAHA 1IUNA 4LXGA 3WIBA 1NU8A 4XIIA 3WKAA 1XZCA 3C6ZA 4UUQA 4H18A 1CUIA 4UFNA 3L1JA 2Q0XA 3PICA
chains in the Genus database with same CATH superfamily
1AUQA 4KGVA 3FPCA 4OQYA 4YRDA 4IR7A 5FX2A 3EZYA 3LZ6A 5EP2A 3W8EA 4O3MA 4REMA 3IV9A 2VDUE 1FXSA 2OV8A 2WOOA 3GLVA 3IH5A 4MINA 4RMJA 3SM3A 5KYUB 2BMVA 5K3CA 2R4QA 4D8UA 5K7SA 2KYRA 3Q5EA 4B4OA 3QWHA 1YZ3A 2Q1SA 1VKNA 4A8HA 4RHCA 1FU8A 2ZAIA 1NY6A 3E81A 4CT4B 1BYIA 3W4JA 1TM3E 3QV1A 3GNSA 1QP4A 4OBWA 4N7RA 4TVBA 1DBVO 1TVMA 3EVAA 4U9IS 2QN8A 4AP5A 1CYEA 3IA7A 3G5UA 4KJZA 4WY5A 3HVJA 1JNXX 4ZJYA 1W25A 3LMKA 1EJBA 3OTHA 3VMFA 1YS2X 3GWZA 3BORA 3BXHA 1AQ6A 1RQ7A 4BZQA 5B3LA 4D79A 2CLDX 3THXA 2ZJ8A 1P80A 5CIYA 1ZH6A 1PD1A 2C07A 4IJ5A 5IW8A 2IUSA 1HE3A 2GASA 2G9QA 5EYPA 4U9HS 4NNOA 2PWPA 1WD7A 3N8DA 1RAIA 2P67A 2YTZA 3OZ7A 3KTAB 3EDMA 5E8JA 1FVXA 2A9KA 4CU2A 2AKYA 4YAOA 1SM4A 2BCEA 3JQEA 3CXUA 1C2YA 2GF0A 4B87A 3B1KA 1NVMB 1K06A 5CYOA 1E8DA 2YXNA 2DFKB 3DW3X 3H87A 1KO4A 2ZOSA 4OLJA 3LCCA 5TQ2A 4J29A 2JGDA 1RCTE 4KWTA 5DTEA 3PHGA 3S29A 1UDWA 4HAYA 1L5WA 3G9UA 2PZGA 3NXKA 3I53A 3T7KA 4I3HA 4LOKA 5IS2A 4YUZA 1ZH4A 1E3EA 1U3UA 1XK6A 4ODIA 4FYYA 1XQVA 1L5LA 1O77A 1CQIB 5LQAA 5BSVA 4KRYA 2VA8A 3SXPA 3A0UA 3S7TA 2NN3C 3FNFA 3LC0A 5KAPA 5EQJB 5K3EA 3ZI4A 3ZWDA 4YROA 3EW7A 4D4HA 1T43A 3HSSA 2OAGA 2J6BA 4KODA 1U5BA 3DXYA 5IK2A 2PLRA 2VP9A 3SNKA 3WIOA 4LOHA 4E7OA 3UATA 2FPGB 2R9VA 4DN6A 4NV0A 1LUAA 3FR8A 2FKNA 3UHJA 3TPZA 1GVHA 2GOYA 1L7AA 2I1QA 2QVCA 5JSZB 5FLXA 3GJYA 4MUXA 3WLTA 4YRGA 1FSZA 3CT4A 2JAQA 5FEUA 2H6EA 3CPSA 5K20A 1YACA 4OK5A 2UXDB 4R8KA 3CNEA 2DBZA 2UXBB 5FXMA 2AYZA 1PR3A 1YDFA 3CLRD 5CIQA 3IQFA 2YJZA 4IX1A 4M9XA 4PO3X 4YJHA 1ZONA 4EKDA 3Q40A 1QYIA 1XTTA 4J8PA 4YMSA 3EC1A 3DAYA 4HEHA 2X1MA 3RSZA 4HWGA 2JD1A 3BEDA 3C8MA 3VC7A 4NWIA 1XBTA 5A4FS 1DKQA 3IRUA 3KE8A 4NG4A 1KERA 1XRRA 2J9ZB 2OCYC 4YBZA 1CJKC 1ELOA 2G9VA 2JCYA 4J94A 5EZYB 2YC2C 1X0VA 1NI5A 2I7VA 3OCCA 4W9NA 3ZDCA 4Q9IA 4QE3A 3F9CA 3EIEA 3U7JA 2PEZA 3R75A 2HPVA 1RWNA 2G83A 2TMDA 1Q11A 4R40A 5AM5A 1M74A 1U0TA 2GLUA 4GM4A 3RM3A 4DBLE 4ZOLF 3U2QA 5CEJA 1XAGA 2XCQA 1TVEA 1Z5GA 1ZY2A 5I5GA 4OMUA 3KZMA 1H8ED 1PJQA 2CYBA 2ZWMA 3B52X 4AL4A 2Z43A 4XM0A 4BFSA 5C5CA 4PN3A 1KQFA 2A3NA 3N6XA 1KJ9A 1IG0A 2V59A 3GBVA 4JI3B 1X7WA 3KHTA 1NBWB 2IXDA 1STOA 3M70A 5JIBA 1MAHA 3W5DA 2W6ZA 2Z4SA 1L3BA 1I4WA 2OV1A 1GR1A 4GPTA 5FQOA 1LNQA 2H9IA 1C9NA 2O8FA 5ILGA 4YRLA 3HI6A 3QNWA 3BJRA 1PIWA 1XZPA 2RI1A 1Q1NA 2OORC 4FC7A 5EKXA 5G1PA 4WOJA 3WIDA 2F8LA 4ZCTA 4XDYA 4XQGA 5IH7A 2VHJA 1YNSA 2BGWA 2P3LA 2G1KA 5AK6A 4IH4A 4L8LA 3IOCA 3P26A 1Z63A 1W6RA 1QMPA 1Y6JA 3LRTA 5ILQA 1PUXA 3R5SA 5BY2A 2DPHA 3C5HA 1D0VA 3LDAA 4A4DA 2YYSA 3HJCA 1VA4A 3MGGA 4IRMA 4E1VA 1CLEA 5FL7A 3Q7QA 1TZCA 4EELA 2QTAA 1CY1A 3AH8A 3OJFA 4GPIB 4ZFNA 4HDMB 3AONB 3KL4A 3FYCA 1M67A 3FYSA 3UB2A 2CFIA 1IY0A 1S7CA 4KIFA 4KVFA 3IFSA 2QUKA 1JPJA 4I55B 2OBXA 3S5JA 4O2BB 1A8HA 1A1VA 2Z9DA 1K6XA 4OH7A 1N2BA 4KK4A 3WGMA 3AV3A 3FUCA 2VBGA 3AUXA 4FMDB 4UASA 4NVRA 4E32A 5L3SB 2ZDHA 2GN9A 3HSYA 3BRQA 4KAFA 1CP3A 2F1HA 1KZGB 4RVUA 2L0XA 2VP0A 1S2NA 1X80A 1KU0A 2J6IA 2PIAA 3HR7A 4S1WA 4QICA 2K7FA 3RSCA 2D3WA 3N3BC 1GV0A 3KKMA 4DA9A 1W5EA 4D41A 3NVMB 1SB8A 3KELA 3S55A 3K9CA 1Z29A 2O2IA 2ZT7A 5JDIC 3FGOA 1SOWA 1J1ZA 3UJ8A 1TI7A 1SBNE 2GFQA 4X91A 1T1JA 2XI4A 5FUBA 1LI5A 1IUPA 1GDHA 1ONPA 1DX9A 3C6MA 2E89A 3FJ1A 1JJAA 2B5OA 3HU1A 3IT0A 4JLVA 4OQQA 3UWSA 1F4PA 3EQZA 1V6AA 2Q49A 4MAMA 3RV3A 3VZQA 1SVUA 2FWJA 4Q1DA 4DCTA 3KJGA 4KL8S 2CFCA 2IYFA 4MVJG 1GNVA 1I7LA 2GXQA 3TRIA 2Z3ZA 4EO4A 2HREA 5JMWA 2JFFA 3LDGA 4IRUB 4ZVVA 2Z95A 4B44A 5C80A 1NG9A 2AG1A 4HDNA 4WA7A 1A4IA 3RNLA 2WWFA 1C29B 4ZD6A 4DLLA 4D0GA 3IAEA 4B48A 2G1AA 4M0UA 5EA2A 3K2IA 4LK3A 2QXUA 2RBEA 5FADA 1KIAA 4DIMA 1AV7A 1E66A 2H5IA 1I7PA 1W9HA 2IPNA 3H5AA 1ONOA 3HJUA 1II8B 3FAZA 3ET5A 4JUDX 5EJ5A 3A6LA 3OESA 5EZ6B 2XUZA 5K3OA 1N7JA 2A9VA 1U2SA 2GEFA 2MYPA 2XQIA 3B13B 4EMUA 3OA0A 5BW5A 1JAYA 2H5LA 3QZUA 3F2VA 3OAAA 3CJTA 4M7RA 1Z22A 1ZAKA 3WICA 2JK0A 3C4VA 1KAOA 3URKA 2N42A 1U94A 3FE2A 3BJZA 4BGEA 1ILWA 4G97A 2DQKA 3KOYA 4MUNA 4F3CA 4QOSA 4RF5A 5EY5B 1F14A 3ZE0B 1F6DA 2A9QA 3HA3A 5AJZA 2AMJA 5AW1A 3I6QA 4YT4A 1KY4A 1YASA 4LGVA 1OXVA 2NSYA 3DZJA 4RZUA 3WYCA 1TF2A 3PKZA 4TYWA 3MLBA 4W8OA 1X3LA 4X90A 3OFVA 1QLHA 1QH9A 3SMVA 4BDSA 4XWWA 3OFKA 2F55A 2XNDD 1OB2A 5L4NA 2QEQA 3K9GA 1JKJA 2YJTD 1RXUA 3UJDA 4OOEA 4NS4A 5IARA 3U4HA 5L4LA 3DTYA 1K27A 3SQOA 5AK3A 1H1LB 4TLAA 1RKVA 3ANTA 3FVRA 3BDAA 3ZU3A 4HFMA 1IXZA 1FJHA 1NI4B 4UVHA 3UV3A 4D4MA 2FGKA 4JQSA 3LDUA 3AJDA 4HNRA 2F3RA 2YHAA 1PWEA 3PIDA 4HSGA 1D0SA 4YJKA 3L8DA 4X1KB 2NACA 3Q2OA 3DEYX 2VKTA 3AFMA 1LC3A 2FSUA 1OYYA 2OHJA 3RD5A 2SNIE 3DAHA 1T91A 3VXKA 4E3WA 3PNYA 1N2OA 4XX0A 4X66B 3P0FA 2VHZA 3HMKA 1ZMXA 4MR9B 1KAQA 5DEIA 3MT7A 4ZANA 3WXMA 4QT4A 4MA0A 2DWUA 1AD2A 1AZSC 1YUNA 2BFWA 5EIBC 1CIPA 1ETUA 3D8HA 1CDEA 1NMXA 3AHHA 2I3BA 1DVRA 3M83A 4B1FA 4K81B 2PIDA 2VF8A 4G65A 4BV8A 5CB4A 3EXHB 5B6PA 1ICEA 2IYZA 1B16A 1J2JA 1PR5A 1QZTA 3H16A 3R5TA 1NI3A 2QT1A 4IQGA 1ZR4A 1MDBA 3IAXA 5DH9A 4BGIA 4BMPB 1J21A 2R6HA 2ZIUB 2C5HA 1X0XA 3CPHA 2ZRKA 3K70B 1RVDA 2Q2NA 3TLCA 3OCUA 1N2GA 3CH4B 3FVTA 4FEAA 2IHKA 2FYTA 4Q82A 1OH8A 4GS5A 3M5WA 3UAZA 1MT3A 1AQYA 2ONKA 2E4AA 4YMTA 4KBGA 2E4VA 5BSMA 3H2GA 1LFAA 1N2CE 1T0HB 2AS0A 3O7MA 4MITA 2FWBA 3TRJA 2O8NA 1V4VA 2BEWA 2IODA 2OLKA 2PM8A 4ME6A 4XM2A 3ZK8A 5J4LA 1PNOA 2Z3VA 3HWRA 5K0SA 4Q16A 1PZMA 3F4KA 1C3JA 4IILA 5D1HA 3ONEA 3GGOA 5EC8A 2VUIB 4DJ5X 1ZIYA 1Z6TA 3I30X 1XVUA 1LK5A 2DFVA 1MVOA 2DFNA 5KKNB 1FNNA 2YFHA 2GFIA 2ZYVX 4YAFA 3KOWA 2RAFA 4OTZA 2QYHA 3O38A 4G5QA 3GFPA 4BX0A 2W42A 2JJQA 4AS1A 3QKWA 1IAQA 1G7CA 3G0BA 1D5CA 4RJJA 3E15A 1HM5A 4E22A 3UMVA 2PZKA 1KO5A 1HG1A 2IZ1A 2JGFA 3QXJA 2VLIA 3MZ0A 5CFLA 1EK0A 2IYTA 5IP5A 1G1MA 2N1MA 3D6MA 3AOEA 4K7JA 4CJXA 4GUAA 3SIRA 4DWOA 1CUUA 2WJZB 2EHDA 3P4YA 4H1UA 3BMQA 2PUGA 1XFAA 1V11A 1XEFA 3CUYA 1VDMA 3DOCA 4JP1A 4NZ9A 5L3RA 5EGNA 4C78A 1SXHA 4G0QA 3RAFC 5AOVA 1CNEA 2VATA 4MKRA 1SU4A 2EP8A 2GNPA 2I3AA 4GFDA 1K08A 2PD6A 5A9TA 1APBA 2ZTMA 5HE9A 4D0RA 1KQNA 4G1EB 5KYUA 4L5CA 3ER6A 4N5NA 1HZZA 4F3KA 3KLMX 4DV5B 4K6KA 1RR6A 2D2VA 1WSDA 3GGCA 5SV2A 3TD6A 1TAQA 3QOWA 4AICA 1GQRA 3A04A 2AVDA 4XFKA 1BEZA 2Q9AA 2UYCA 4JJEA 4MJXA 4ZZ0A 3HV2A 3GPBA 4TV8A 5K3DA 4BNKA 1TK2A 3NIGB 4YUAA 5ITVA 4J1TC 4LAFA 1A7JA 2JEYA 1Y6ZA 1W29A 3A1NA 3F98A 3L8FA 4GYKA 1D09A 3KKPA 1X7YB 3UWKA 1Y9ZA 1EP1B 3CRRA 3TOXA 2R8XA 4RVFA 3EA4A 4IPTA 3N39C 2VP2A 3OE1A 5HIMA 4WJKB 3UXEA 2DY1A 5T64A 5LLDA 3IKTA 3WYNA 2RHOA 3ZW9A 1R0SA 4ZJZA 1QHSA 1W88A 2ZVQX 4TRJA 3WR5A 2H17A 2WIJA 3A4LA 3SDZA 4BV9A 3A1CA 3NKFA 3TIVA 3LK7A 2ZT6A 3A4TA 2QUBA 3Q8XB 1H2RS 1SK9A 2Q1WA 4NCIA 4UQOA 2C5FA 1YZLA 5I7FA 3CWCA 3RHFA 1Y1QA 1QGDA 2ZTUA 2QTZA 4YJ2A 3MRVA 4HN4B 5K99A 3ZTTA 4DPMA 4PFSA 1RZRA 2QQFA 2XAAA 2O2ZA 2RHTA 5F1PA 3RK0A 3S5UA 4BE4A 1SUIA 3CZ5A 2GKOA 5L3QB 1JDNA 3DLCA 3DZDA 5EJAA 3ZZTA 4GMFA 1L4UA 2HCRA 1ZCAA 3UXMA 1XU4A 1TQHA 3LXXA 3VDMA 1CXZA 1P0CA 1B0ZA 4EG4A 5T7BA 3R9XB 1H0HA 1NV9A 2H1VA 4E21A 2QXYA 5HIJA 2V8BA 1UM9A 3LYAA 5BWNA 4TWAA 1G17A 4V0OA 3ZWKA 1BWPA 4NPAA 2JLWA 1RXEA 1GU0A 2W48A 2Z2XA 2I66A 2K7ZA 3ABSB 1QUFA 3GARA 1WZEA 3I8XA 4JROA 1HI9A 1Q74A 2HM7A 3AY0A 3BE8A 3FUUA 4B7XA 5KTOA 1XKQA 1UKYA 2QX7A 3E8SA 3S2IA 2FCRA 1T1SA 3VVCA 4PC6A 1N6KA 4WBNB 3RRFA 4ZYTA 1KK1A 2UVPA 4E5VA 4RH0A 4ZU3A 4P3OA 3WZLA 4CCWA 1JKFA 5DHTA 5BSKA 5J4YA 2Y1EA 5BNIA 3FMIA 1R5NA 1MTZA 4QU5A 1O94A 5BN5A 4Q48A 3H8WA 4JHLA 2ZPAA 2H2FA 2IY8A 2PV0A 2NV6A 5B30A 1FP1D 3SXUA 1P0QA 3M1AA 2W83A 4JT9A 4GZMA 2GPAA 3ZI7A 4LF8B 1IJEA 2I4LA 2PT7A 2PZ8A 2W6MA 1E1MA 1IAVA 2WWIA 3E7XA 4V03A 1CJSA 3SVZA 1S8AA 5IANA 2FQXA 4ARIA 5T3YA 1GQOA 1KEEB 3RVNA 1Z2EA 1PLLA 3CR3C 5I47A 1BDMA 1V1RB 1NI4A 1SVOA 5KNDH 5EIAA 3R6LA 2K6GA 4TKUA 9ATCA 4G3XA 1G59A 2GN2A 1KPGA 2DUUA 5HCIA 4EHFA 3FHJA 3VR6A 4A0HA 1ANKA 1Y7TA 4W6QA 1JIXA 1P77A 2E1RA 4R16A 2W6NA 1HDYA 5AI5A 3MIZA 5JZOA 3CEAA 3ZJUA 1HDZA 3JQGB 3GUHA 2PGIA 4CU5A 4NYIR 3HH8A 3H5RA 1V16B 2ZBRA 3CM0A 3X44A 5K8LA 2HQRA 3OZSA 5KIAA 4LF9B 1BWRA 1NAIA 2Q8PA 1OVMA 5EERA 3II6X 1R50A 2R1VA 4F9EA 2ZLBA 4E5MA 2GD2A 4RTPA 1WNFA 1N1GA 4DIFA 2HV9A 2B1RA 4UVDA 3QNMA 2WIBA 1ILEA 4YJGA 2PVSA 3F7TA 1TEHA 3GW8A 4N49A 4NV3A 4R2XA 4XARA 1QGYA 3U3RA 3MJTA 2QVYX 1O0BA 3F7NA 3PUXA 2SCUA 1SAYA 2OAQ1 4HNUA 3S1SA 4DJDC 1KJYA 1X77A 1KZ7B 5G1OA 4PTYA 5BV2P 4G1BA 3SR0A 4PSAA 2PXXA 1TZBA 1BDJA 4KQ6A 2WHRA 1UEXC 3DLBA 5KWVA 2ONYA 5IZCA 1M2FA 1MAWA 2RMKA 5DBFA 3U7IA 1M7GA 1AQJA 3HB0A 5HS6A 5EZ5A 3NHRA 1J9GA 1C3EA 1DMRA 3ESAA 3EULA 2E37A 3PDHA 4UBOA 4XCVA 1R74A 1YCDA 1Q7GA 2ARKA 4C6TB 5CG2A 1T36A 1XCJA 4F7WA 5AHRA 3E9EA 4DC1A 4L9WA 4TMKA 1A5ZA 3FHOA 5ALZA 1YA6A 3GUCA 4DQDA 3HCFA 3HDQA 3DQZA 3X1KA 1KYVA 3E5MA 1AUOA 4MWTA 2XWJI 3E1SA 1NDHA 1VL1A 4O2BA 4QL3A 2VPTA 1TLFA 3AI3A 3CVJA 4I6EA 4MUAA 4O4LB 4W5WA 3UB3A 5EHNA 2EFJA 3ZNNA 5L3ZA 4EABA 1Z7WA 2PKQP 3ETEA 4IS2A 3NM6B 1Q3HA 2UYYA 4GZ3A 1A04A 1JR3D 1VSQA 4Z5XA 1TTTA 2J41A 5AW0A 2YWDA 3GJZA 2AA3A 2F9FA 1GZUA 3NYWA 2IHYA 3OZIA 2FFAA 5A0FA 3TZCA 1ZHFA 1P7VA 2BMJA 1N32B 2P7IA 5EHXA 1MOSA 3ZYCA 2BF7A 1P5HA 4LXIA 4QSMA 1QTNA 2BC9A 5FKJA 5IDVA 1HFJA 1V3QE 4S12A 1FFYA 4OI1A 5F12A 3G0CA 1GL3A 3IAFA 1LS1A 3F3YA 1XD2A 3KDAA 1CJTC 5PGMA 2Y92A 4ZV7A 1AMUA 1M2OA 1XZHA 4QIHA 1P6QA 4MQFA 4NPCA 1VZ2A 4TWJA 3RHZA 1WULS 4UNSA 1JPUA 2PDAA 5ICFA 1BAPA 3BMNA 1NC3A 4EPVA 1ZN7A 3S7ZA 3GQBA 4A82A 4JBIA 4TTSA 1GT91 4NBTA 4C76A 5BN3B 2DBQA 4C6RA 5A5GA 3ZU4A 1T6YA 4UU7A 4TV8B 3M6WA 4UTVA 4YHBA 3BL6A 2WU0A 1VA5A 5DGCA 4QWMA 4L72A 1WU7A 4A2CA 5BORA 1G0OA 3KT0A 3MMPA 1P2UA 3UJNA 4F2HA 4NBSA 4CUZA 4QREA 1WKCA 2J45A 3C3JA 3DMGA 3MHPA 1Q21A 3CEPB 2RCYA 4GYJA 5E3JA 1NF9A 2QRUA 1C4OA 1DQYA 2CHQA 4L9RA 3RIEA 1ORHA 1G3MA 3B1WA 4IO1A 3J7AC 4E5PA 4S1OA 2OFPA 4HH1A 4ARZA 1UDAA 3MELA 3N28A 4OXNA 1QWOA 5HIKA 5C4IA 2JGMA 2N46A 4YR9A 1QYXA 1WMFA 1ULZA 2JIPA 4XUDA 3ICQB 5JSKA 1DV2A 4R0NA 5GJWC 1YL5A 1HH4A 3CRNA 2SBTA 5B1YA 1OIXA 5DLYA 2VJQA 4Q7MB 5ULLA 1KAGA 3ER8A 4P6VF 5ICEA 1KDTA 2ZSDA 3NDJA 4MVCA 1WX1A 1NP3A 3TSZA 5CCEA 2DWPA 1YKGA 1TJYA 3ICWA 4MDEA 1SURA 3HJHA 1G4AE 4X5OA 5KNBH 2VTKA 4Z3KA 2MSEB 3B85A 5DNDA 2FPSA 3HFJA 1BKSB 3IQZA 5AYVA 3T1NA 3VSDA 1JEYA 5A0TA 2FPLA 2XVMA 3MJVA 5H5JA 4AKEA 3F2IA 3ITKA 2GK7A 2PSHA 2QL9A 1XZQA 4MH0R 4A92A 2H16A 2ZWVA 2XA1A 4G0VA 2WLTA 2VZEA 3KC2A 4MKZA 1SZPA 2NUTA 4AX4A 2GYUA 2WEKA 3RKRA 4CE6A 5J47A 2XSZD 3F7MA 1FFAA 1O0SA 3K1TA 4X6XA 2C8LA 4O2BF 5LPNA 1ZA1A 2NZ2A 2P6RA 1NVVR 4WKOA 4B9AA 2FP3A 4YAIA 3T9AA 1NVUQ 5BN5B 4HYTA 3ND6A 1NMSA 3ANYB 1LBSA 1PV2A 2WAYA 3AKDA 1CDZA 2HGZA 3I6MA 5J59A 5GMOA 5F21A 3BHNA 3O1IC 2XTZA 1WLYA 5AK4A 1EK2A 1YIOA 4ETIA 1HNNA 4GE3A 4FSHA 4F2PA 5JBQA 2P3SA 4I19A 3VR4A 4Q93A 4ZT5A 1RYEA 2EARA 3SYTA 3H13A 2ZB7A 3I3SR 1IIBA 2JRLA 1KIFA 2JFZA 4G5YA 3O95A 1NL3A 3HEAA 2QTGA 4RA6A 5SYMA 1YOBA 2HPHA 1X7WB 2HWWA 3GAMA 4QUGA 4DV0B 1PAUA 1HURA 3AEZA 5AOCA 3UW3A 3K0FA 4TYQA 1V43A 3LPAA 3MJCA 3OSZA 1KR2A 4B6EA 1Q95A 1QK4A 4H3KB 4E3ZA 4XYMA 1VIAA 2BM8A 4WVLA 3VH2A 2WKPA 3OZEA 2C4VA 1G3RA 4YCBA 3L7IA 4ESOA 3A32A 4NCJA 4E5SA 4KPUB 3ANSA 1QVRA 2WTEA 2A5DA 4V0ME 1TUGA 3ISVA 4UBIA 3TL2A 2WVGA 4NV1A 4P3PA 3TQSA 3BM5A 4PANA 4E94A 3HP4A 1FCJA 2Z4TA 2VHCA 4KLNA 1KBQA 3DXFA 1RWXA 2FPPA 4H7HA 4HGYA 4MGKR 1XJ0A 4P38A 5A05A 5IM4F 3MT9A 3P96A 1GJRA 2N9UA 3S0JA 4RPGA 4KXMA 5JLAA 1CR2A 4KWEA 4YPOA 3I04M 3HBJA 5EUMA 1NXXA 1W9MA 3T7RA 4UE3S 3B5JA 2ILVA 2AZTA 3LKVA 2PYDA 4OREX 4Q9JA 1OFVA 3HUDA 3JWGA 2ZUEA 3AHCA 3GLQA 3JAWA 4AQYB 4GR5A 4NG5A 5CXQA 1IWPB 2FN4A 2MSKA 3FTFA 1ZU4A 1D6NA 4EYKA 2GJ8A 2SKCA 3RWOA 1VCNA 2XTJA 4HZUB 4JBXA 2D5LA 1CUXA 2ZUBA 4DMRA 3CW8X 3WLMA 2ZR9A 3F0TA 4FLMA 4PQGA 2VJLA 2HSEA 4CN9A 3DDZX 1KI1A 1V5GA 4RL4A 2W22A 3LNTA 2VYVA 1PVOA 4XVHA 1RHJA 1HFEL 1LZKA 4MW7A 4Q1EA 4CGYA 4EF4A 3BXZA 4RFVA 3EH1A 5PNTA 3DEJA 4ER5A 1Q6YA 5CDTA 5JH7F 2IS4A 4LBZA 5AVQA 2FSPA 3R0VA 2GCEA 4CDGA 3RQSA 1E4EB 2CHVA 1ESDA 1NW8A 2V6IA 1FUUA 3P2IA 2OGWA 4GWKA 4JDPA 5ECGC 2IW1A 3ST7A 1X74A 2BI8A 2Z5LA 3T9FA 1AMOA 3FJOA 2QN1A 3I04A 5KO2A 3FPFA 2J3QA 4X7MA 4MCIA 3T5CA 3HR4A 2BHNA 3TQQA 1XA0A 5B1EA 2F6RA 3NJ8A 4MRMA 4Q3EA 1SXGA 2BUAA 5JNVA 2GTHA 1U5AA 2ACKA 2C84A 1O3YA 5HCNA 4C88A 5KSZA 1MOZA 1ZJYA 3N07A 5CT9A 3WQSB 5FWYA 4DIDA 1RKBA 3FH0A 4YCSA 3H9UA 1UMCB 4CETA 3A1SA 1E77A 3BE4A 1E0DA 1DJMA 1J9EA 3AFGA 1MJGM 4XEUA 3PT5A 4ZTZB 1YRLA 3TSYA 1EWQA 3G6KA 5ESXA 3V4PB 4WI1A 1KQOA 1CUBA 2FUG1 2GN4A 2XH8A 3BG5A 5AQEA 4DIKA 5B7NA 3ADBA 3ROQA 3GJ3A 3KVRA 1H0RA 3OIGA 3UTDA 1YR6A 2FXVA 1ST2A 3GVIA 3PENA 2IS6A 3LWDA 4QBTA 2ZE8A 1CKEA 1Q77A 4Q47A 4AJEA 3TDMA 3TOVA 1WXIA 4ZCMA 4D4IA 4FFNA 4WOKA 5C32A 1EXNA 3DGEC 5BNFA 3NNNA 5AVJA 4LQCA 5DM0A 3RIGA 4WNAA 1NXTA 1T3LA 5DP1A 3K35A 5I4KA 3U3KA 4GHWA 4JI7B 2WMDA 2FW1A 2X9VA 1A82A 2WF5A 5CVDA 2NVUB 2CLIB 2GPTA 4AS3A 3AESB 3CUKA 2ZITA 5ALSA 4J1QA 1KP2A 2Y9PB 4UM5A 4OUDB 2D74A 3HDJA 2N1BA 2D1RA 4KFCA 1ZG3A 3KYIB 3ZD7A 3GT7A 3QF7A 4CM3A 4YCAA 3WYDA 4OQPA 1Z39A 2H2DA 4NY1A 1VGVA 4INJA 4OJYA 1E64A 1OCEA 4QX6A 4F4UA 2OKGA 1R37A 3NONA 4LDAA 2R7NA 3TW6A 3PXDA 4F4CA 5L45A 2PSSA 1XLUA 4TSFD 5AW8A 4P2GA 1LRLA 2BEVA 3NT4A 3D8UA 3KALA 2HCTA 3JWEA 5K2MA 1JLKA 4J16C 3VKVA 2EAUA 1LDNA 2A1TS 2BFBA 1GDDA 3KU1A 2R751 2GQ0A 5TGZA 1IJKA 5AIAA 4BIMA 4BNHA 3QHAA 3WWZA 2JCGA 3KJIA 1IXRC 3D7KA 2FPXA 7AT1A 3PK0A 1QXSA 4MUBA 4TMZA 4RE6A 2HJ9A 4RJKA 3AR5A 2ZRMA 3G2PA 3M49A 1DI0A 1H5NA 4WBNF 2JGRA 4Y9UA 4EOGA 2BFFB 2GJSA 2WM2A 4Z9BA 5C8YF 3R8FA 2J9FA 5FTKA 4S3MA 2ASEA 4YCDA 3CMMA 3AETA 1VBKA 5JWRA 1T3HA 1H93A 3F1KA 1INLA 2UAGA 2HXYA 2F48A 3EEBA 5I51A 4DCMA 3HB1A 4HRVA 4Q1VA 4RLFA 1NG1A 1QU3A 1JS1X 1YC5A 2W58A 3DWIA 1E0JA 1Q19A 3H8SA 5LZ8A 1TM4E 4ZYLA 2VNSA 3QEAZ 4ZQCB 3GD5A 4E03A 4JC5A 1QH1A 1XZLA 1XDWA 1DOAA 1PNVA 4R69A 1H2FA 3ZVNA 2C2BA 5LDHA 1NKSA 3B9BA 4BWVA 4R83A 2WILA 2Q29A 3NP9A 2G88A 1QGUB 4YY3B 4BBZA 1C1DB 3NRJA 1VPTA 5F1YA 3WNBA 1OFGA 2P68A 4JLSA 5DIZA 3N0WA 1E3WA 3DVSX 1EM8B 3QY0A 3LA8A 4JSYA 3OF3A 4XSGA 3PNSA 4TS9A 5IMBA 4FMDF 2MSDB 1TKCA 1ZCBA 4AZ0A 4DKJA 2D1SA 3B20A 4H7PA 4FD3A 4H7IA 2C2XA 4RFSB 3FKJA 1SHZA 3WBKA 4BRZA 2P9GA 3L6UA 1KK2A 13PKA 3A3PA 3T61A 3UHOA 5JVDF 2CNNA 2VSOA 2CVPA 3D3WA 4Q15A 3W7AA 4CCYB 1F4LA 2FF7A 1P33A 2JATA 2LZ0A 4PBSA 3KZCA 5FOQA 1H4SA 4LNUB 1I5RA 3G2MA 4YONB 1IYZA 1GU1A 1XU7A 2A1IA 2ZR7A 4RHYA 1N34B 4JJGA 2IYYA 3E9RA 5KC8A 3MTAA 4OU5A 5HFNA 4JXXA 2YBEA 4P82A 4CEHB 1UXKA 3HKEA 5M5BA 5D86A 1UAGA 3UWOA 1K8QA 1U8ZA 2TSYB 1KFBB 3RB8A 1AKTA 4L4SA 1TGYA 4UJ3A 3GCGA 5F23A 5KJEA 4W8GA 2C7PA 1V5FA 2ZS8A 3VBCA 1IOVA 2Q2WA 4LX8A 3NHYA 2AR9A 2Q3HA 1XZMA 2JFOA 3NATA 1WY5A 1YZFA 1C41A 1MOPA 2C3PA 2V7BA 1H2HA 1NHGA 2JFHA 1THMA 3HADA 3KG2A 5TPWA 3JARB 2HRQA 4J3NA 1I2BA 5EUBA 1U8FO 3FGZA 4EUFA 2RG7A 4E5YA 3T4PA 1Y8RB 1V95A 1SC3A 2B8EA 5HTOA 4PQYA 3OKCA 2W4IA 1ZL2A 2P3OA 4K6HA 2Y1XA 3PJDA 1KH2A 3H0KA 2OQIA 3NOVA 2P69A 3Q7SA 1DDOA 3N7UA 2W43A 3B6IA 1U0OC 5JRJA 2ZDQA 2ZIXA 4JL5A 5HBRA 4WLOA 3H4VA 4W5TA 2GEKA 4KP7A 1KK3A 1TTHA 3BCRA 1QP7A 5HM6A 4QATA 3V6MA 1R5BA 1Z6PA 4J4TA 5CU7A 3IP3A 1XNRB 2GVZC 1DAIA 4H6WA 3PZRA 2GHQA 5F7ZA 2TECE 3PUIA 1OFUA 2XKAA 5LA6F 5GZ1A 5KQSA 3GFVA 1RKQA 3KBBA 5BQXA 2FPMA 2OXRA 2PL5A 5LQDA 3OTQA 1P2FA 3CS3A 4LG1A 1LD3A 2PBLA 2NZXA 1UDCA 5LP6B 2A0FA 3OIUA 4UHBA 3DE2X 4ALNA 4AF6A 4HB3A 3NEAA 2W4MA 4HEA1 4M8KA 5HF9A 2Z3WA 3U7EB 4BAUA 1BROA 1NT2A 4XRGA 3C41J 3EEQA 5A9SA 3RTBA 4RK5A 1U9CA 3MEQA 2O8EB 1OA0A 2J7KA 1UM9B 4HEJA 4DCPA 2X4IA 1H9AA 1VRVA 4MHSA 1NFRA 1UPXA 2P91A 1L7XA 3VPGA 2QPAA 4EPRA 4BPRA 4BQRA 2JFYA 2RKOA 4EL5A 1TAUA 2ZRJA 5FH9A 3PPIA 1SVMA 4FHCA 3PWKA 4I1VA 4DANA 1U6KA 1M9NA 5E7IA 1MN6A 1QKKA 4F1KA 2Z08A 3TX6A 3BJMA 1NBEA 2G04A 3C0KA 4TL6A 3X1XA 5CH5A 1B00A 1F51E 2ZIZA 2P9EA 4X7BA 2D5IA 2O5RA 5B4VA 1DO8A 3AVVA 5SY6A 4D3ZA 2GLXA 2NUTB 4NBLA 1QANA 3E1KA 4U63A 5A7FA 2IE0A 3BGDA 2VTBA 1L9KA 4BLTA 4RSMA 5F9FA 1QHHB 3HO1A 5JV5A 5DNVA 3UJ6A 2WNHA 4QTYA 1U8TA 4H17A 1MH1A 3K4HA 4XWYA 1USWA 1Z0SA 1AV6A 2DLDA 3EIWA 1TF7A 3IQHX 4DILA 5K0EA 4DCUA 2YBDA 2PKYX 5FDFA 2Q3EA 5I4CA 1XQ9A 1C2TA 4OGWA 1HT0A 1EESA 3OZDA 4RDXA 3EXFB 2G6BA 2INGX 2FK8A 2PLFA 2YHSA 2W6ID 3TZQA 2Y0BA 2X0IA 2HK7A 1SHJA 3CLUD 2PKEA 4BPBA 5CPFA 1E63A 4NEQA 2QOEA 2BKUA 2EW8A 3CX3A 1Z36A 2ZTVA 1LTQA 5ES4B 4WZBE 1PUIA 5EQDA 5J2UA 2X5NA 2LD4A 2AHRA 5TB5A 4AMBA 4Z1MD 1JVBA 5DGIA 3VZRA 3UW1A 3KSAC 1D1PA 2AMLA 2J87A 3FETA 4Q9LA 1SIOA 1LBHA 3BA1A 1QPZA 3E0XA 1CY6A 1CQPA 4DSAA 4B3CA 5A3SA 4H27A 1JEAA 2C5LA 4GP7A 1JR3A 4GNRA 4MS1B 4BFCA 1P2VA 1HEYA 1L5HB 4HDRA 2GWHA 4WDRA 1XR3A 5TARA 1WSWA 3VR5H 2NP7A 1RPNA 1JU4A 4IINA 4QYSA 1NUHA 1R4ZA 1XEAA 3GL9A 3U3MA 2GLTA 2VNJA 1DRKA 1PX2A 5AUNB 3N8KA 2FFQA 4RA9B 2F9LA 3IPRA 1J5EB 5LA6B 2HNKA 1Z74A 2PMKA 1OREA 4DY6A 1UMBA 1LY1A 2O59A 2VFAA 1U8CB 2HJGA 3QXSA 4PFQA 2DHCA 4TWZA 3WRWA 4KEAA 1W5BA 2I22A 4C01A 2C9OA 2BI4A 3N6RA 1ZK3A 3B5IA 3QLVA 4RY2A 5TSDA 2IS2A 1T2UA 3GRFA 3QPVA 3OPXA 1KRWA 3T5AA 1CBUA 1TM7E 5IKMA 1U1CA 2XPCA 3AEQB 1Y6QA 1UDXA 3RS5A 3SYLA 1HYEA 1J06A 4TUYB 4ZT4A 3BWXA 4FFDA 1TYEB 2C5EA 4RMIA 3C16C 2CB0A 2DUMA 3IDZA 1LSSA 3DPIA 1M5RA 1O5IA 1V4BA 1M8PA 1FNMA 4R9NA 2GH1A 2YOFA 2Z9CA 4P81A 2XDWA 4RD2A 4RORA 3DZGA 1MB4A 4Y6QA 3VZBA 1D7AA 3UK2A 3RVBA 1NGSA 2ADOA 3A31A 3QENA 3KOUA 4WEQA 4FE3A 3ZOZA 4CL2A 1JHDA 1M76A 3E9YA 1AA6A 4CV1A 1FYWA 3F1LA 1LLCA 3HACA 4DKXA 4GL2A 2OM6A 4V2UA 1QP0A 2I1LA 4QYIA 4X3OA 4QRDA 2P41A 3I72A 2ZS7A 3UKJA 2ORIA 5BV8A 1BFKA 1EZ4A 1YHZA 4MWOA 4U39A 4UAJA 1QIHA 3AMVA 1TFRA 1W52X 1F38A 5F33A 4CDRA 1GT6A 1MX3A 1QYCA 2IEBA 3OZXA 4ABTA 1R6VA 1IK6A 1IDN1 1U1EA 3I9JA 3QLUC 4HK4A 3EHDA 4XVQA 3RFFA 3THYA 1MB0A 1MT0A 5IM4A 4DIBA 2XRMA 1FE8A 1W19A 4Z1MA 2ZRAA 3GEMA 4OHYA 4OHKA 2W6PA 1SXJB 4B6QA 3SEFA 1DJQA 1ZIOA 3B9PA 3F74A 1EMDA 2C7VA 1W0KA 2P11A 3GV0A 3NAQA 2B61A 4WZAB 5CVJA 2C9ZA 4RD6A 5EZSA 2D7CA 2PQ0A 3L0SA 3SBEA 1GL9B 4Q3LA 4CLXA 5JS7A 3HA2A 3KZKA 2QENA 2Q4RA 3SC4A 1R0CA 1O58A 3ZWOA 1SOAA 5BSEA 5C1IA 4HXFB 3H2BA 1HSOA 2JKZA 2P6MA 2XVYA 3K70D 2I6XA 5EWJA 5JJLA 2CYCA 3UGTA 3UPUA 1SC4A 2WKQA 3LKBA 2ZYIA 3DV0B 2O0JA 1VHDA 2JNWA 3O3OB 4YASA 3Q3IA 5DZSA 3ZZUA 5IUNC 5IXSA 1Q17A 4EGAA 3ZK9A 4LI3X 4YMGA 5DYNA 2ANCA 3FOZA 4OFBA 1MH9A 3CLSD 3MJ4A 1U2QA 4MUHA 4R8SA 4IJUA 5JC8A 2HDOA 4Q3KA 2R00C 5FORA 3AZPA 3ILYA 1TQ4A 5JU6A 2QX9A 4KOAA 2J0SA 2WWVD 1KZYC 4IMRA 4P3KA 2QTBA 2JF0A 4GX2A 4RELA 4B7UA 5JPDA 1PJAA 1WUKS 1I51A 3FZNA 2V7UA 3PEYA 5A0VA 4V3CA 2GBLA 1EFLA 1VSBA 1WDKA 1BQEA 1NW5A 1W44A 2XGMA 3FFTA 4QASA 3L5KA 5D3QA 3R7NA 5CBKA 2F7SA 1X7XA 2BEVB 2NT3A 3A6ZA 2P0EA 3H5TA 4HYQA 5COBA 5EE9A 1XTQA 3FB1A 3PHBE 2OL4A 4BQSA 3R6TA 3RASA 2W6OA 2QRVB 4M0MA 3B1XA 2C5AA 1OZ0A 2AR7A 2ATCA 3FPEA 2PLAA 5IDXA 3KRTA 1DAGA 1PR4A 4GMKA 1VRCA 4A8PA 1NU6A 3IC5A 1G8FA 3BT7A 4MULA 4M76B 4MRSA 3ASVA 3PC3A 3LBNA 2GTIA 1KFCB 1I0LA 3CSUA 1LB1B 3WA6A 2QD1A 4Y2UA 5JANA 2ODQA 2E5WA 1H3NA 2IKQA 2B98A 2JJ1D 2OCBA 3LC1O 1MENA 4KN5A 3TBHA 3BX1A 2CBGA 1T5SA 2PGJA 2P2ZA 5K8JB 1T0UA 2IYNA 2PT5A 4OGLA 4P7KA 1HDCA 1LZLA 4Z99A 4CI0B 2D0PB 4DLVA 2CY0A 3OPVA 3KB6A 2WTUA 1U02A 3PC8A 3SMQA 5I3ZA 3V6LA 2ONCA 3EVCA 4KGXA 3WGZA 2RGYA 3KZXA 4J7XA 4BZXA 5BVHA 3W5BA 1FLNA 2PCJA 5HKAA 1Y1RA 3O1JC 1KDZA 2BKXA 1S1CA 2JAUA 2FUG6 4P31A 3DKKA 4DYHA 4EKYA 5CVTA 1BHQ1 3H1GA 1GL7A 4FCCA 4R31A 4DV2B 4KR3A 3LHFA 2FOIA 1OIWA 4GMXA 4DL9A 2NTJA 4Q03A 3JD3A 3E5HA 4WL0A 4IG4A 2J5RA 4E2YA 1Z28A 1IM8A 2X7JA 4D4GA 4FYIA 3MJRA 1T5DX 1TO2E 2WA2A 4J7CA 3S1LA 1BMFD 3GT3A 3PF9A 4Z7NB 3SD7A 3O73A 4I3GA 4UD6A 5GGXA 4HLNA 1X87A 2XDAA 3OQBA 3I6BA 4KI0A 5BXYA 4A0RA 2XB4A 4X95A 2ST1A 4NARA 4WZAE 1T2NA 3BWBA 3OQ1A 4Y9TA 2X9GA 2EGHA 3GCWA 2YXEA 4D9BA 2FZCA 2DRIA 3NG1A 5D7BA 4BB0A 5EWMA 4YRZA 3ND7A 1TEZA 4LDPA 4DA4A 1Q1AA 3S6JA 3VBEA 4Q3BA 2H1RA 5EPEA 2N0SA 3ZGVA 3RFXA 3LGAA 2EJCA 4RY8A 3PP8A 2A84A 3GDWA 1RDFA 5J5CA 2C58A 3ZHQA 1BEEA 1Z4QA 2PUTA 3WKBA 3K5HA 1WMEA 4MV7A 4O63O 4UFOA 3AL0C 5AVOA 3KV1A 1EINA 1FFEA 3IP7A 1V8DA 1GPNA 2QRNA 4LJ9A 3SSAA 3HRIA 2HIAA 3CNNA 3T7EA 4BMXA 4CT5A 2RD2A 3GI1A 3L0BA 1BOFA 3OQPA 1VJ5A 3ZCQA 3ZCTA 5CD9A 3LCRA 5D6OA 3L7CA 4KYTA 1SCJA 1ZUNA 2L69A 3AFHA 3T7TA 3W5IA 5IYZA 3BFXA 3H18A 3KUCA 4TT3D 1E4EA 1MC1A 5EXTA 2X9NA 1DWQA 2F1RA 1GPH1 3P2YA 2KBEA 3H1TA 1R4MB 1A9PA 4MV6A 3LC7O 1RQXA 4GOND 4LVOA 2WUVA 2H8KA 4MPRA 4YT5A 1L4BA 2H7XA 3PQ2A 2FWMX 3PA8A 2W9XA 2AUMA 1T6NA 2WAXA 1W0JA 1FP6A 3KT3A 1YCHA 4G5HA 3W2FA 1FYEA 3DDWA 3E7DA 1CEEA 1VFPA 2FEMA 1AH2A 3PQEA 3LD9A 4HYEA 3F90A 1SN7A 2VO1A 5A6SB 1NJ6A 2A9OA 2R47A 3I4LA 4A15A 3ZE9A 1JFSA 3QBDA 4PLYA 1MC8A 2HFJA 2GJ9A 4HGRA 2JVKA 2ORYA 3MUEA 3NKLA 3QP9A 2M9MA 1KMNA 1IZ7A 1T3TA 1S8NA 1E9FA 1TAGA 1THGA 3KQVA 2QZZA 3QE2A 1RM3A 1H2XA 5C2JB 2D62A 4YJGB 3NFRA 4JBNA 1EYZA 3BH7A 4IXDA 1VMAA 4V02A 1TVKB 3SHWA 3WZ2A 2ZWPA 4D8VA 2M1ZA 2PUVA 4WLFA 4IDBA 2F1IA 2ZGVA 3NO4A 3OC0A 3E05A 3EK2A 3UUGA 4JBHA 1KWKA 3RAJA 2C29D 2GD6A 1TCUA 2ZJ3A 1JSRA 3A4YA 1BKYA 4HDSA 4NX2A 2CHUA 2WWRA 2G9RA 5DX8A 1HLDA 1Y8CA 2HF8A 4R9RA 3SHQA 4I4TA 3VNRA 5IBCA 4F84A 4WVFA 3I5YA 1YZTA 4HUJA 4N5LA 4DA8A 1FTGA 2G28A 5K4HA 2PS3A 4F71A 3C43A 1JDJA 3HXMA 4O5OA 5GZ3A 5KDOA 4IDOA 2SHKA 3QE0A 2IV2X 2YNMC 4YDHB 3ELYA 1K4YA 4DUGD 4FS8A 3FOAA 5EJ8A 2CVQA 3T3EA 3U1BA 1E9DA 3OE7A 4J6EA 4RTRA 3H19A 1Z3CA 4PONA 5TEWA 5IAAA 3O8DA 2H1SA 3HSKA 4QUJA 4MVJF 2JIRA 2R7MA 1OAOC 2IXGA 4IJ6A 3SKVA 4G8JA 1G2OA 2QPLA 2NSLA 2CD9A 1B0AA 4G0MA 4JJ6A 2V6GA 4JXJA 1UJ2A 5JO9A 3WSWA 5LYJB 4ARAA 1WZNA 2OC4A 2HA6A 2RK6A 5A02A 4ZEVA 3K0KA 4QYMA 2H2GA 3AVQA 1K1EA 2ZE7A 1LRKA 2ZSIA 4HF7A 1Y9AA 4TT3A 4UBJA 3U7RA 3F9IA 1HDGO 1XJCA 4JJ4A 2BLLA 2EBWA 3O0DA 3PDIB 4KX3A 4LFBB 1C14A 1REQB 2IXAA 3OZAA 4DABA 5ICMA 3R77A 5IT9A 3DA8A 2CWDA 3DXXA 4MR9A 4EW2A 1JIIA 3BH0A 1MABA 1ECGA 3A2KA 5KNCD 1X8KA 2HC9A 2J9FB 3M34A 4HGZA 4IKPA 4OHRA 2IYWA 1R9JA 3TQFA 2GI4A 3UZUA 2QF7A 3K8ZA 2LDXA 3WRYA 4QDUA 1EXWA 3TB4A 2QSYA 4URUR 3SYKA 3ZDYB 1PGQA 4JMPA 4DMLA 4ZYVA 3KQKA 3UBTA 2AOTB 1MZPA 3ROMA 3ZKAA 5EESA 3CUTA 3NHBA 4NZYA 4AZTA 2VJMB 3ONFA 4O2AB 4EJMA 1E62A 4MV3A 4UUNA 1JWAB 3F49S 4IYJA 4YRBA 4R2HA 4L28A 4YMWA 3EZNA 4DT1B 4C3VA 1AHPA 3JYPA 3V2UA 3EQ9A 4BRWA 4BKRA 3ZLJA 1EIWA 2WE8A 1C7ZA 1XL1A 4EQ6A 5GTDA 1QVAA 5CNJA 3IUMA 3D02A 3DEAA 3OAAD 4BVEA 3NUZA 4M9SA 4EMSA 2UUBB 4N3CA 3ECSA 4J2HA 2V3CC 1EHIA 4MQ6A 4QPCA 1DLJA 4N4AA 2BTQA 1ZK1A 1JHXA 1LTHR 2WYUA 3G8CA 1V47A 4CMCA 4TYNA 1R0XA 1YZKA 1UOQA 4RSRA 1G6Q1 3RADC 3H0CA 1T4CA 3R0JA 1C0KA 4LE1A 3T3OA 2ZIEA 2ZG6A 1CE8B 2XCUA 5I4BA 5JOQA 5B3AA 5LR6A 2BKVA 2VWPA 2QWXA 3K2BA 1B8UA 1W46A 1QK5A 3UJHA 3ZV3A 4DDUA 3CO0S 2X76A 2R1UA 3DKPA 3N0RA 1JEDA 3ZJ4A 4CQLB 4ETNA 4R2IA 4F7DA 5HVNA 1XVAA 3AJRA 4YECA 2FWPA 1R9GA 2B82A 2BONA 1JLMA 2VJOA 2I3ZA 4PXYA 5C3UA 2XUJA 3NNSA 1YA8A 1TRKA 3LUAA 3NGMA 2IPXA 4IMJB 4OPMA 2ZREA 5H80A 3ZZMA 5H3LA 1M0TA 1WZUA 3HDGA 4H31A 1DC4A 3VV3A 3M6MD 4OQZA 4QNMA 3JQCA 1F2UB 4UHEA 2CE2X 2GZ1A 1Y9DA 3M5DA 2FQYA 4YEDA 3IB6A 2X6RA 3LLVA 1VYVA 2NP6A 1N4AA 1F1JA 1WUJS 4KXWA 4U5QA 5ITWA 2R1TA 1ZOPA 3LW7A 3PHHA 4OB8A 2UZ1A 3PSAA 1DINA 2BZSA 3WYGA 2DQSA 1WDLA 3L0CA 5MDHA 4EVRA 4FN4A 2I1WA 1U31A 3PFIA 5AM4A 1PJTA 3ZX5A 5J5VA 1E7YA 5BR7A 1JG6A 1JHRA 2B2XA 3RVKA 3D7SA 4V0QA 4Z6KA 1NVTA 5JFOA 1YVPA 4O3FA 1G60A 1E1QA 1OBCA 3IVXA 3EAQA 3PFWO 1UWVA 1IRIA 3OCVA 4IHKA 5FFNA 1PZGA 2BELA 1BOOA 4HQRA 4HWPA 5EEGA 2JVJA 2VNHA 3PNVA 4EHJA 4LWOA 3N2KB 4DQ0A 4LF4B 1M83A 3PNBA 4W99A 2IYSA 3KK0A 2WVAA 4QDXA 4AY3A 1W76A 3L7YA 3A1VA 3BBPA 5KYYB 3KQTA 3UQZA 5I9MA 5ALMA 2CFSA 2PXAA 3OMLA 1OLSA 1UADA 2PEYA 2MSCB 3AGPA 5ISMA 1YFZA 2CV2A 4EUKA 1R5OA 3ZPXA 3FCOA 3SDSA 4MVJH 1FJ2A 1V0JA 2NSJA 4QELA 4G1UC 1R6AA 4GO1A 5L9AA 2P6NA 1C5KA 1F5NA 5FI3A 3SICE 4C7OB 1X2EA 1FDOA 1RYYA 4ZVRA 3IIEA 4A1OA 4KR2A 2MJLA 3LOQA 4J1SA 4LOIA 4KO2S 2QE6A 4X3PA 1WBBA 1CQJB 4HPJB 3R24A 1C7FA 2PZLA 1NXPA 2O8EA 4B2LA 2AYXA 1JYEA 2O1XA 4N7MA 2GKSA 4HV4A 4J76A 2D2XA 4N9WA 5DX1A 1ZP6A 3A1WA 4KDCA 3SDBA 3TLGB 1OI3A 5L3QA 1G41A 5E1DA 3C5VA 3EZFA 2WQ7A 3NBAA 1OTYA 1RXCA 2O6LA 5EMLA 3WDSA 4B6OA 1E1CB 2XKBA 3J81A 2NPOA 2H4ZA 2GAJA 2B2CA 3FYUA 4TXJA 1A8PA 4WACA 2C97A 2FX5A 2ZR0A 1QOQB 1JMVA 1H4TA 1V5EA 3P9RA 4KIUA 4RQBA 5SY4A 4A03A 1QIKA 4KGDA 2QB5A 3O94A 4R9SA 2ISCA 1D6MA 3HN7A 4P5PA 3UUWA 4CM7A 3IS3A 5JS1A 2TRSB 2REQA 1KEPA 3FDJA 1E94E 3OFJA 4X1OA 1B41A 1UAAA 4TTQA 2AQ8A 3TG8A 2YXLA 1JSLA 4P0PB 1GNLA 2WJ4A 4X64B 3I12A 5CLQA 4EG3A 2AMFA 4QOJA 2PT6A 4TQAA 3AEYA 4K6OA 1GPWB 1Q0RA 3LBIA 3ESXA 5JH7A 2P9CA 1X92A 3OVMA 4ER7A 4XW2A 1CQWA 2B1IA 2VK1A 3FY4A 5M04A 4OMFG 1R6UA 1LLQA 3UOAB 5AVKA 5GY7A 5JCJA 3WGHA 5AVUA 1NW6A 1PS8A 2HF9A 1NVDA 3BN3A 5JQGB 3WRYC 1FTSA 1XT6A 5JLJA 3SCZA 2GETA 1KEEA 3QEJA 3ROTA 2MINA 1DV1A 3MILA 1Z2NX 3EEFA 1R4NB 5ELMA 1J97A 2YWFA 3N76A 4JY7A 3TO5A 2J3LA 3QLUA 5BNTA 3SZRA 3OCJA 4GXQA 5A7GA 4JI6B 4C20A 3HVUA 3ZZ0A 3R2JA 4R1QA 3UENA 4C6HA 2C03A 3P27A 4RLQA 2R8ZA 2XITA 3CGGA 2C54A 3N2GB 4CKYA 4MYCA 1B7GO 1A69A 1N5RA 1FPMA 1TZ2A 4N41A 3IBYA 3Q3EA 1LQ2A 1MEEA 5K0FA 1FRFS 2I2BA 1WZ2A 4KKXB 4WX2B 1AIPA 4D9NA 3URMA 3CVWA 3OQOA 2Q9BA 3Q0EA 5ARCA 4MS4A 1QQ6A 2WJ3A 1BDBA 1GCOA 1YTLA 3E3NA 1MO6A 1RFGE 2E7ZA 4PF1A 1L5GB 4ZKDA 5BPFA 1KA9H 3E5NA 3U16A 1TF5A 4QECA 1N75A 2J32A 2XLBA 4Q7QA 1WV0A 2PMDA 4HDNB 1KR5A 4GC9A 5ALYA 5DBEX 3WHPA 3JQPA 2LWIA 3INRA 2A88A 1PR6A 3RPEA 3DDCA 2CMHA 2PKRA 2ZB2A 4ROSA 4RX1A 5BUCA 1YZGA 1TYZA 1WOYA 2C7GA 4HBGA 3GAAA 5AM0A 5DMXA 2O54A 5I9SA 4MP8A 4QQ8A 3M82A 4DJEC 1Y6RA 5EHGA 1CZNA 3LECA 2BUCA 5H3HA 2WWXA 4DTIA 4OAPA 1CY7A 2FFHA 1K3FA 1O8CA 1SXJD 1ZX1A 2IX9A 1NUTA 2NXWA 2UZ3A 3BICA 3I5AA 4JL8A 5DSZA 4OATA 2W98A 2JBWA 1SIUA 3IEMA 4DQKA 3TTVA 1U2GA 4B31A 3ON5A 1U0LA 3VUFA 5CFQA 1T1RA 2F1OA 4UDOA 2OUKA 3OHPA 3CF0A 5KPDA 5H3CA 2H06A 1MJFA 3I39X 4WGGA 4Q4CA 5B7QA 4GI1A 5EIXA 4MW5A 1SCKA 3VO8A 1IBSA 1B6GA 4BX8A 3AIIA 1XVVA 1C9EA 1OXUA 4K9SA 2AG6A 4KDRA 3D7RA 3OX1A 1CUYA 1F5SA 3IKMB 5T4FA 2ECFA 1Q6ZA 4QNRA 4PYQA 2QI9C 2YV4A 4YI3A 3FOFC 2BEUB 4ECAA 2QY9A 1BYUA 4J90A 3MWEB 5ENDA 4U02A 4WCFB 1G8HA 1RC1A 1IZ8A 2WVJA 4ZALA 4D43A 4EGSA 3EVTA 2IH5A 1H42A 3ZD6A 4A3SA 2FSHA 3B70A 1UMDA 3L41A 1H1LA 5IASA 4JLOA 2FP4B 2IUTA 3R44A 4K2AA 3PNQA 4MVJA 4NULA 2IPOA 3WRVA 1BJTA 3C39A 1TYBE 1R12A 5LUAA 4Z3OA 1O6FA 1FW6A 4N0EA 3V1MA 3AZOA 2H8GA 3L7OA 3O3MB 3VKHA 2Z6UA 2R6JA 3VGJA 3UICA 1L2TA 5A6SA 3PIRA 1GAXA 4URZR 1MJNA 4V38A 2ONJA 3EY9A 5BV1A 1ZQ1A 2Q2OA 4RJ2A 3MRSA 1U2PA 1G6OA 1U9ZA 2ZJ1A 3WWEA 1FMCA 4DCVA 1RYZA 4OL0A 5ARDA 3GJTA 4NFLA 4JLAA 5FOWA 5K8CA 2ZBUA 4O8ZA 1FDVA 2B8NA 3IUNA 1SQGA 3EIHA 5IULC 4B3MB 2HY7A 1CR1A 3R0QA 3OA2A 1XMIA 4JN6B 4NYIQ 1JU3A 1BIFA 1XSEA 3K7EA 3JALA 1N1MA 3B6JA 1VMKA 3D6JA 1H2WA 5H16A 4QXQA 1SCIA 3RSFA 4B74A 4DLPA 4YP0A 1PO7A 2PZJA 1RZRD 3OJWA 3DEZA 1GTJ1 1QLWA 2WAAA 3TBKA 1AU9A 2DHDA 1F17A 2G7ZA 3TNYA 3IAHA 3OQHA 4IIFA 1P7YA 3NC4A 3L1KA 3V33A 4F85A 4AI6A 1NQ5A 2BMEA 1BCRA 3MK31 4MKIA 1GARA 4EZIA 1HYBA 4Y6SA 3H7AA 3JRXA 5I01A 3AVYA 3KEFA 3U9TA 4GQIA 5I8WA 4C0HA 1MW9X 4FWTA 3ZDQA 4RIGA 3LT1A 4IRXA 4PQEA 1A8IA 5ECWA 3LHIA 1PJ8A 2HYDA 3DCNA 4G89A 3CR7A 1XNHA 3T4XA 4B6JA 5HSGA 3T9EA 5CD1A 2WG1A 1J39A 4EY3A 3B8EA 1S3GA 4J0IA 3TXYA 5JNLA 2OV3A 5HTKA 3BWMA 4PC2A 1QVZA 4QXMA 5JDIA 2HI0A 1W7AA 1M1YB 3GD7A 2C61A 2EDCA 4FMCB 3TOZA 3VYTB 2ZPTX 2QRVA 4B09A 1MPTA 2PWBA 1NXWA 2R6CA 3MTQA 5JPIA 4HP8A 5JROA 3HKEB 4ZI3A 1Y3DE 3FCEA 1JEYB 1QG4A 2BJVA 1ZR2A 1WP4A 4FE7A 1NR1A 4H6XA 1OAKA 1YR8A 3ZHVA 5KTTA 3W8NA 2XHZA 5FNVB 1N4DA 2ZRIA 2LDBA 3PQ6A 4EG8A 1T9GS 3K9HA 2QTTA 2GB4A 3QU5A 4N3GA 2Z56A 4OQXA 2C9CA 3GWGA 5K0LA 4AD8A 1KAHA 5FTLA 3PC8C 1ITZA 3L8MA 3IIKA 4Q7KA 4ITUA 2Q5IA 2AD1A 1W6UA 1Y82A 1CY4A 3JCZA 4CKCA 3H3XA 5JSFA 1TLLA 4W1QA 1P4AA 4AULA 4QM7A 3UKDA 1EX6A 2VK4A 5KVSA 2R97A 3RK4A 4B0OA 3FOWA 3VOTA 2OAP1 3GUVA 4CNQA 4DLAA 5EHZA 5JNTA 2BGKA 4JNKA 1PCXA 4NYJR 5LB2A 2W37A 1G16A 1ZRMA 4R68A 4TL7A 5EXPA 4AWAA 1ZRSA 1QR2A 2GZSA 2RK4A 4KQWA 3WIEA 2O3QA 1QCYA 3A1DA 2QTHA 4ZDWA 2WPDA 3B3FA 1U0JA 2K87A 2XKJE 1KBOA 1Y8QA 2OO5A 1WP9A 3B6ZA 4WN3A 5JXIA 2CLKB 4N8SA 2QMUA 4BATA 2OUIA 4H6PA 4UXJA 3I05A 1IIRA 2ID9A 4MS3B 4I66A 5K0GA 1HRKA 3AG5A 3ZJ5A 2F64A 3I34X 2HSJA 4RZ2A 3PHCA 4RL6A 4UOZA 3DV2A 2IYVA 4MCJA 2NQ2C 2Q6TA 2ZI4A 2ZSEA 3BSWA 3STHA 1IN6A 5CT5A 4ZZ1A 5L7TA 3VVLA 3MBKA 2XZLA 1JMYA 3L6OO 4D81A 2VDLB 3MWYW 1A88A 3IURA 4JKIA 1BCSB 5IK2D 1WCV1 4K88A 4XOIA 2G8LA 1E0SA 5K0TA 3TW4A 1U11A 4PG6A 4TTVA 4E14A 1E2MA 4C4ZA 4DEXA 3KYCB 1KVUA 1ZHOA 3T4UA 1MBZA 3NBQA 1PYGA 3ODPA 4JK3A 4KXFB 3IBFA 1P44A 4KB5A 1K8YB 5ESRA 2QN2A 4LJLA 3TNDA 5BSWA 5AM2A 4HDQB 2NSHA 4M1EA 1SCBA 3RODA 2ZRNA 3U13A 4YAGA 4BNDB 3UY4A 4IL5A 1SU8A 3RV4A 2PUJA 4DHEA 2XGJA 1YQTA 4HUQB 1QZZA 7REQA 4P1ZA 1W0JD 2FJUA 3DKIA 3UGKA 2NLOA 5F52A 4B3RB 4GOOD 3BMCB 1YJQA 4MICA 2J08A 2FR0A 3OZRA 1FX0A 3EDCA 1TXGA 5I7OA 1EP9A 1MRNA 3JATB 1LVGA 1SBZA 1FMFA 2PTHA 4HZUA 4F3YA 5JT1A 1ZC3A 4QUBA 4D45A 2WQ6A 1SD5A 3HY4A 3NHFA 3ROXA 2UYQA 4YO8A 1D2MA 2DPGA 2DWQA 1G3IA 4Y6GB 4BL5A 4HRAA 4EKGA 3CN9A 1S2LA 2WMOB 3HBMA 3ISJA 1Z16A 2PQ6A 4GR4A 2PS0A 1Y1KE 4LBYA 1GYQA 1YHNA 5SICE 1NZFA 4B8ZA 4ZCSA 2Q07A 4U7DA 3H1AA 3GRCA 5T5QA 3ZV6A 3H5OA 1Z6YA 3LQ4A 1VPEA 3M4ZA 5EKUA 1CIVA 4DA0A 5DWDA 3LGXA 4DDHA 1LGYA 1GRVA 1RBQA 2XQGA 5A5VA 3IYLW 5A3JA 2FEAA 2MDTA 1BE6A 1WPXA 1AKEA 3SHOA 5I45A 3SYNA 4YCLA 2WB2A 3DMFA 3RRJA 3OKPA 2NO1A 1QMGA 2LBPA 3M89A 3BGWA 5FUYA 3BB1A 6LDHA 4GU5A 2WAOA 1OU0A 2C4MA 2LGJA 3I76A 1JJFA 2GK6A 2A0UA 4QSHA 4UE2A 4EEXA 5G0VA 2F90A 5HKOA 1N7HA 5CXXA 5CDUA 4KQ1A 3ZXSA 4DNPA 2H0RA 2O8FB 2O2CA 4NDAA 5KZMB 4KPFC 3E7FA 5LQSA 3VAZA 1EA5A 3CX7A 4YP1A 4FGZA 4C5AA 3IV6A 3K20A 2R5FA 4M22A 5A04A 1QRRA 1RQLA 2XJ4A 3KVVA 3R3ZA 1MO5A 2F3TA 3KJXA 4NH4A 4UNPA 1CRPA 1RZ3A 3KYDA 4L8FA 1L8LA 3JPYA 2ZKIA 3FGPA 2AEJA 1EDBA 3PRKE 4DLNA 4DR3B 2ISQA 1DO2A 4I5FA 4E13A 3W2TA 3BJEA 1JTFA 3QLVC 1PR1A 1E1CA 2Q28A 4ZHQB 4U2GA 1RAHA 5JALA 2C9BA 1OYOA 1XROA 3OD1A 3OD5A 1LWOA 2ET6A 1FUEA 1YQUA 3ADOA 1Z6XA 3GJQA