3UUFA

Crystal structure of mono- and diacylglycerol lipase from malassezia globosa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
RGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNFDDHQGIYFHTQIGAVMGECPAQVGAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIP1, secretory lipase (Family 3)
publication title Crystal structure of a mono- and diacylglycerol lipase from Malassezia globosa reveals a novel lid conformation and insights into the substrate specificity.
pubmed doi rcsb
source organism Malassezia globosa
molecule tags Hydrolase
total genus 101
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uufA00
1FFCA 5AKXA 5JZ9A 5ALKA 5ISMA 2CJPA 3IULA 5HF5A 4BCDA 4PNZA 2BFNA 1LPOA 5LZ9A 2XMDA 2VF2A 1GXSA 1QIMA 1K63A 2C4HA 4B85A 3HC7A 4W63A 5LKAA 4N5HX 3EQ7A 1GPNA 5ALYA 5T4BA 4A5SA 1CUUA 1CQWA 4RE6A 3KXPA 3WL6A 2ES4A 4MXDA 1LBTA 1UWCA 2PUHA 3OM8A 5A71A 1UK7A 3WKEA 3S8YA 4X91A 3AUKA 1JJIA 5ALSA 2AXEA 5FOQA 2VJAA 2YASA 1MX9A 4OB6A 1CUVA 1JFRA 3Q8WA 4X3CA 1P0QA 4B9AA 4AX4A 1E89A 4JYMA 3KWJA 5SYNA 1EB9A 3CXUA 4ARBA 2ZSHA 1JKMA 4E46A 3D7RA 4E15A 3I2HA 1YAHA 4X00A 1A7UA 3G9TA 1W1IA 2WM2A 3L1HA 5AK4A 4U2EA 1I6WA 3D2BA 1QIFA 1GQRA 3H2HA 3WK6A 1WM1A 2QJWA 3HYSA 4U2GA 1K6EA 3BF8A 1EVEA 4AMYA 2C0QA 4ARAA 3ZLTA 2DQZA 2GYVA 3AZQA 1LZLA 4PO3X 5CH3A 1N1MA 4DNQA 4NS4A 4D9JA 1PV1A 2JGEA 1J2EA 2WSLA 3FNBA 1ZIYA 3FCXA 3N0TA 5IVDA 3M83A 3LIIA 2BUAA 2DHEA 1HLGA 2PKYX 4OUKX 1KU0A 1CUWA 3SX4A 2XT0A 3HJUA 3QH4A 3G0DA 4EY6A 1R50A 4CG1A 1CIJA 2V98A 3P2MA 4O08A 2O7RA 4EZIA 5ALXA 4KR0A 2VAXA 5AK3A 5DWDA 4C01A 4EB0A 1BE0A 1QTRA 1W6RA 3WJ2A 1IUNA 4UFOA 4KE7A 1J06A 1TQHA 4OSEA 1VE6A 3DYIA 2XMGA 4J0KA 1ODSA 4QE3A 2XI4A 1HL7A 1XLUA 2ECFA 1QO7A 5BOVA 5JAOA 1XKLA 2H7YA 2BUBA 3IUNA 1MX5A 1AZWA 3QPDA 2PU7A 4HZGA 2D5LA 4NZZA 4BAZA 5K5EA 1L7QA 3K2IA 3X3HA 1DU4A 3TJMA 2QUAA 4K6GA 1P0IA 3G0IA 3H19A 4AB1A 2UZ0A 4LYDA 4U2CA 5HFNA 1VA4A 5HZGA 2PUJA 1MT3A 4YPVA 1TAHA 3C6BA 4Y2TA 4FLEA 1XZEA 4FOLA 5ALOA 1ZD4A 2AJBA 3HLKA 1UK6A 4UBMA 1OILA 2HA7A 5CXXA 3FBWA 1OXMA 2JGKA 5EGNA 4G4IA 2QVBA 3SK0A 2G5PA 5AIAA 1MO2A 5HF6A 3QYJA 2LIPA 3G02A 3UUFA 3DLTA 3ZV7A 2QS9A 4OYYA 3C43A 4BCBA 4CIBA 1USWA 3D2CA 4Y7DA 3C6XA 1QIEA 2V96A 1RP1A 5DNUA 2XQJA 3FOBA 1LNSA 5KREA 4UHCA 1VXRA 3QPCA 2PSEA 1XZFA 1XRLA 1F0PA 3ESBA 1XZMA 4XX1A 3WWCA 3FSGD 5F4ZA 3WK5A 5T4EA 4GECA 4WDQA 2Z8XA 3G0BA 3BL8A 2EDCA 1XQXA 3N2ZB 4QZVA 2XUHA 4MJ3A 3V1NA 5HQ3B 1ODTC 2JEYA 2Y2VA 3QPAA 4BVKA 3O4IA 4UFPA 4DMCA 3BF7A 3PF9A 5FPQA 4EHBA 1NU6A 4BP8A 4X90A 2O2HA 3BIXA 2IIVA 4X71A 1DQZA 2VT7A 4FBLA 1OCEA 1CUAA 3FYUA 4HAIA 4IQ4A 2FJ0A 4CIAA 2WHPB 5EI5A 4HRXA 2VSQA 3QM1A 2WFLB 2PM8A 1U2EA 2DCMA 2WTMA 2GBCA 3HACA 1WB4A 3G8YA 4EY8A 5AI0A 3NGMA 1B41A 3STYA 4FKBA 2QUBA 2H9YA 3KD2A 5AOCA 1MNQA 2JF0A 2XB6A 1SOMA 2XUDA 4BE4A 4WY5A 1VOTA 4Y2UA 2PBLA 3G0CA 5AI8A 5EIAA 2V97A 4B80A 1Y7IA 3I1YA 1RYYA 4Y2XA 3VJKA 4ZV9A 3WKBA 1HDEA 1JI3A 4ZRDA 3WK7A 2YXPX 2RGUA 3FSGA 1WPXA 1DQYA 2HL6A 1QJ4A 3V1KA 5DLPA 4DNFA 1CUGA 2DQYA 4HTAA 2OLEA 3FLEA 4K6KA 2HA3A 4C6HA 4C4XA 3IBTA 3JYHA 1BN6A 5A7HA 2CB9A 1P0MA 1Q83A 4LYEA 4UUQA 1A8SA 2XUKA 3A6ZA 1CUEA 2XMSA 3H1AA 4IH4A 4FNGA 4Y2QA 3VVMA 1CUSA 1BEZA 4I3FA 3FVRA 2AJCA 1HKHA 1EINA 4K5QA 4Y2JA 1XRMA 2DHDA 3H0CA 1CUCA 2HU7A 1TRHA 1ZD2P 4JH0A 2I3DA 3R0VA 2WUFA 3BJMA 1DT3A 1CUJA 1XLVA 2HIHA 1QIHA 1W4LA 3H17A 4S0XA 5JANA 4P08A 4ITVA 4MYSA 4B83A 2WFMA 3MGAA 3STXA 2Y6VA 3I6YA 5IVIA 4J7AA 1WB5A 2Z3WA 2RIPA 4X94A 3OTQA 3B3QA 3IUQA 3JW8A 4YX9A 3PUIA 1CV2A 2OAEA 2VQ6A 4H0CA 4PSCA 2I3ZA 4ZXFA 4B84A 1JJBA 3I2GA 2XUPA 4KAAA 1WCYA 2PU5A 4WCVA 1CUYA 1XZGA 2QKYA 4AO7A 1FFDA 5JD6A 2VA9A 4KRYA 3ESAA 1XZIA 2QT9A 1DX4A 2ACEA 4FMPA 4LXIA 5JD4A 2J4CA 4Q05A 3WWDA 2OCIA 2B4KA 3PE6A 4E14A 1S8OA 1AKNA 3IB3A 2HA5A 4DNOA 5AKEA 2JIDA 2XUOA 4H7HA 2XMRA 4Y2PA 1D07A 3W9BA 5EFZA 2WIJA 1QZ3A 5DYWA 1BRTA 2PL5A 3M82A 2QTBA 2GBFA 1UOPA 5ALIA 4HXEB 5AKGA 4N8EA 5LIPA 4AMZA 4QNNA 5HK9A 4Q1VA 4QDOA 4Y2VA 1LZKA 1QIIA 3BXPA 3LCRA 1ODCA 4BTVA 1BS9A 3ZLUA 4MEAA 3C87A 3O95A 5K3CA 1AUOA 4Q82A 5I9IA 3WIBA 1HBJA 1YA8A 1WHSA 4I19A 5JASA 4ZI5A 2GZRA 3F67A 5FPPA 3WZMA 2OGZA 4J0JA 3PFBA 4BE9A 1CR6A 1UOQA 1EH5A 2WIKA 4L3WA 3WWOA 3FYUB 1XQWA 4ZGBA 1XFDA 5K3FB 2BGNA 4QEKA 4CG3A 1QO9A 3QITA 1UZAA 2PPLA 2ZYSA 2O2IA 5AI6A 5JATA 1K5PA 1IZ7A 2C5GA 4W1SA 2VAVA 1LPBB 1YB7A 5JARA 4F5ZA 3E4DA 5HQ3A 3WL5A 2G63A 1BEEA 2HRQA 3CCCA 1THTA 1DWPA 4B0OA 1EXWA 1VXOA 3HEAA 1MN6A 4U2FA 3UUEA 1ORVA 2HDWA 3IDAA 2HADA 1QIJA 5A7GA 3BJRA 3AIMA 4X85A 3VDXA 4DNPA 4UPDA 5ALWA 5HCUA 5CT4A 5ALDA 4GXNA 1ZGCA 2WHPA 2QRUA 1MJ5A 1BU8A 2WFLA 3W05A 3MUNA 2WIGA 3KOOA 3ESCA 4QDUA 5AOAA 4GI1A 4OD0A 1F8UA 2EDAA 1WHTA 3DOIA 5AP9A 5ALVA 3VXKA 1X70A 4GHWA 1IUOA 4X95A 3FYUC 2I78A 3U0VA 3V1LA 1VA5A 2ZSIA 1X2EA 4WDRA 1EA5A 1K4YA 4UBOA 3QZUA 2OG1A 3WKAA 1YR2A 4AO8A 4LIPD 5AM1A 5JD5A 2RHTA 3DL7A 4JNCA 2DR0A 5LZ4A 3BIWA 2XUAA 3D3NA 4J0IA 4DYHA 2DFPA 2RAUA 3DEAA 3I2JA 4J0HA 4DSAA 4UHEA 4F21A 3I2FA 1IUPA 3R3YA 1MX1A 2Z3ZA 3C6ZA 3KSRA 4K6HA 3K9BA 1BCRA 2DSNA 4ROTA 3PICA 1FJ2A 1ZOIA 3EIOA 5IH7A 3AZOA 1CVLA 4QLOA 3RK4A 1LBSA 5LYYA 5C8VA 2OCLA 2WUDA 1JT2A 4H35A 5ALMA 1XRRA 5AM4A 2OPHA 2C7BA 2C58A 2Z8ZA 1DT5A 4EY5A 1J07A 3SC2A 5H3HA 2VJCA 5ALPA 3C5WP 3E0XA 3I2IA 4LKOA 2WG1A 3GFFA 4OB8A 2NW6A 3PUHA 2O7VA 3QVMA 1QFSA 1EHYA 4Q3LA 4MWTA 1ZI9A 4AZ3A 1EDEA 5A62A 2PVSA 1MAAA 2YYSA 5CH5A 3GUUA 5D6OA 3AIOA 1VE7A 3WL7A 2WUGA 3DS8A 4KEAA 3L1JA 4RGYA 3WK4A 2XQFA 3TEJA 1DWOA 1QIGA 1VZ3A 2BJHA 4KE6A 4HXFB 2HA4A 2OGTA 5AKIA 1L7RA 3R3UA 4W1RA 4G4GA 5ALNA 2C0PA 4BVJA 4BYMA 1B6GA 1UK8A 4J03A 4IHAA 1YASA 4PW0A 4KE8A 5DJ5A 3CN7A 4C89A 4M0MA 5BWBA 4FHZA 2HA0A 2K2QB 4ZWNA 3BWXA 3C8DA 1DTEA 2VEOA 3V9AA 4DM7A 3CCBA 2J3QA 1XKTA 4LXGA 4WY8A 4ZREA 4BCCA 3AJAA 2CEKA 3FYTA 1HQDA 3V48A 4IH1A 2BAGA 4OCZA 1CPYA 3VISA 6YASA 2XMBA 4B0PA 4BZZA 5K3BA 4L9AA 2HA2A 4A23A 4BRZA 4BZWA 5AJHA 4MWSA 2HU5A 1A88A 4ZV7A 3DKRA 3AZPA 4W1QA 1H2XA 1EI9A 4FNMA 2QM0A 2CKMA 5LKRA 4MEBA 2WJ6A 1H2WA 2H7XA 1CUBA 2ZYHA 5AKHA 3G9XA 1R9MA 3W2TA 3DL4A 4UBNA 5AI5A 3F9CA 3D0KA 1T2NA 2C5FA 4Y9SA 1EDBA 1UOOA 5CTAA 4CCYB 3RKSA 1YS1X 2XUFA 4FLMA 1SCQA 4QDZA 1TCCA 1O6FA 3O4HA 1QONA 5K3FA 5AI4A 4CCWA 1N5RA 3VKFA 5FXMA 4Q3KA 3TRDA 5DTJA 1AURA 1R4ZA 1QIKA 5CT9A 4GLBA 4Y2RA 3O9VA 3GELA 5HKAA 3RARA 2QZPA 3HI4A 1ORWA 1LPSA 5IKXA 2XUJA 1ISPA 5I7UA 3ZI7A 2XQGA 1ZI8A 4M0FA 1W76A 3H1BA 4BRSA 1ACJA 2QXUA 5E4JA 1QLWA 3LIPA 3DDUA 1BN7A 4UBKA 4I4CA 3DKKA 3ZLVA 3D2AA 4J3JA 4Y2YA 5AIBA 1IZ8A 1J1IA 2WIFA 1F0NA 3WA7A 3DD5A 5ALRA 4Z49A 3A2LA 1CUXA 1VKHA 2XQKA 1NX9A 5IVKA 3ED1A 5EHZA 3DCNA 4G8CA 3G9ZA 3QMVA 3WL8A 2CBGA 2RHWA 1LPPA 4WFKA 1IMJA 5DYTA 2HFJA 5A2GA 4KYVA 2X8BA 3WWEA 2WHRA 1C7IA 3E3AA 1JU3A 1XRPA 4L72A 4AXBA 1P0PA 1H2YA 1HPLA 3NWOA 4QDXA 4G1FA 5FV4A 1QIDA 2B9VA 5CXUA 2OCKA 1G66A 4G4JA 3R40A 3QMWA 4DSZA 3I6MA 1ZD5A 1GPKA 2WIDA 4BC1A 2EEPA 2ROQA 3D5EA 4Y2SA 4HXGA 4OU5A 4GDMA 4H18A 1SCKA 1H22A 1G4HA 5JAHA 3TGLA 1MTZA 4AQDA 3F98A 5KWIA 1QTIA 3IVMA 4AZ0A 4OYLA 4G9EA 4KE9A 4BBZA 5DNWA 3WI7A 2HA6A 1YAJA 3K6KA 3WIOA 3ZPXA 1FSSA 1Y7HA 5LP1A 2I03A 1MU0A 1VJ5A 2FJPA 3OG9A 1DWQA 3WMRA 2GYUA 2PSFA 3ILSA 1EX9A 3UMJA 1SC9A 5K3AA 1XZLA 1A8UA 2XDWA 1XRQA 2WTNA 3MUOA 3IURA 5ESRA 5K3DA 2WILA 3CN9A 7YASA 1E8NA 2QXTA 5BWCA 3OURA 2OAGA 4FWBA 1LGYA 2XQIA 4FLFA 4MQLA 5CBKA 1CLEA 5DTIA 5D7BA 3H04A 4EA6A 2JGMA 1F6WA 1Y37A 3BDVA 3BDIA 4X93A 3ANTA 1DX6A 4H7JA 2VJDA 4H7KA 5K3EA 3W06A 4LXHA 4G9GA 1UFOA 5JALA 1Z68A 2J4FA 3AIKA 1CUHA 5FP0A 2ZJ7A 1T4MA 2Y6UA 4UHBA 3I2KA 2ONCA 1ZGBA 5D3ZA 3H18A 2DHCA 2GBIA 4Q3OA 3F97A 3HZOA 1LPAB 1AX9A 1UXOA 4W1PA 3O4GA 3STVA 3ZWQA 5JYCA 1G5FA 2HU8A 3SWWA 1NU8A 5KBYA 4TPKA 3STUA 1ZICA 3C8HA 1AGYA 4X92A 3G9UA 4X6YA 4WFJA 1GKLA 5AKZA 4BDSA 4KAJA 3C45A 1TCAA 4UBLA 4UHDA 5AM2A 3IA2A 5AKLA 4JYPA 1E3QA 1FFBA 2ZJFA 4BVLA 1E8DA 5ALFA 1UK9A 2WKWA 4KACA 1UKAA 2WFZA 1PJAA 2QOEA 1XQYA 3AILA 3FLAA 3O9MA 4BATA 5E4TA 1O6GA 1GKKA 3L1IA 2OQIA 5HFAA 5CURA 5JIBA 4X97A 1ZIXA 3V1MA 4YK7A 4RNCA 4CI9A 4CCYA 5AKKA 4N8DA 2WU4A 5EHQA 2XMCA 3D59A 1EVQA 2JBWA 3EF3A 4DLNA 1H2ZA 4PQEA 3W04A 3DNMA 4QLAA 4OU4A 1X2BA 2PSDA 4OB7A 2B20A 2ZYRA 1ETHA 5HF8A 1RWQA 4UBJA 1AC5A 3IUMA 1MPXA 2JGFA 4XIIA 5EHNA 2VT6A 2CMFA 3VJLA 1G42A 5ALEA 5A6VA 5D3KA 1XZHA 2HM7A 1XZCA 3PI6A 3RLIA 4H77A 3H2IA 1U4NA 3O0DA 4QWMA 4H7EA 1JU4A 1THGA 2Y2UA 1QE3A 3R3ZA 5C7YA 1M33A 2PX6A 4C4ZA 2JGJA 3DJYA 1CUIA 1ACLA 4XJVA 1CFJA 1XQVA 1UKCA 5AKYA 1JMKC 3WLAA 3DOHA 5CT5A 1A8QA 3WZLA 4J0GA 1XROA 3U1TA 1YA4A 3DYVA 4BTLA 2AJ8A 3WYDA 2XMQA 4JUIA 1R88A 5I8PA 2FUKA 5AKJA 4C88A 1TIBA 3O4JA 5EIEA 2XUGA 5CH8A 1XZKA 2R8BA 1EB8A 4KRXA 2XUIA 4HS9A 1LPNA 5EIHA 5SYMA 5J3JA 4L0CA 1KEZA 4B82A 4V2IA 5JZSA 2JGLA 1JJFA 5FRDA 5C8ZA 4M0EA 1SFRA 4OPMA 2VATA 3STWA 1LPMA 4C4YA 4GWLA 3PDCA 5FLKA 4P9NA 5LZ2A 3FLBA 3A2NA 5E2IA 3IIIA 3A2MA 3AINA 3G0GA 3NOXA 1ZJ4A 5C8XA 3DQZA 2PSJA 1XZAA 4QWWA 2XMZA 5AH0A 1XRNA 2PSHA 2ORYA 3EQ9A 2J3DA 1YSCA 3F96A 4CFSA 2QJRA 1E5TA 2HRRA 2GBGA 2OCGA 5C81A 2CZQA 4H7IA 4JEIA 4HRYA 3B5EA 4FFWA 1GT6A 3HABA 2GYWA 5AOBA 1UT6A 3I28A 3VVLA 2P8SA 3C6YA 3NUZA 4DMFA 1H23A 1UKBA 2ZVDA 2BKLA 2D0DA 4B7ZA 5CT8A 4EY4A 5AI9A 3EQ8A 2XE4A 4C87A 3WK9A 3B12A 1AMNA 4UBIA 3M3DA 4IH9A 4EUSA 2RI6A 4NVRA 4J0DA 1QFMA 1QGED 4EBBA 5ALZA 1E8MA 4FTWA 5T4HA 3QBJA 5AM5A 4NMWA 5LZ8A 4H7DA 2YH2A 5AHXA 4RPCA 2VTVA 2H7CA 4DMHA 3JWEA 4XWGA 1FFAA 2H1IA 4G8BA 1W52X 2ZJ6A 4TVKA 1BCSA 1L7AA 3FCYA 4EY7A 1VZ2A 4B6GA 5ALUA 3VJMA 5JADA 1C4XA 4QDTA 2WG2A 3HSSA 1EDDA 1XLWA 4LHEA 4X6UA 5AM3A 4H7FA 4F60A 4PSUA 3MVEA 1EK2A 2JEZA 4F0JA 4INZA 4PF1A 4U2BA 3WYNA 1R1DA 5KWJA 5CMLA 1SCIA 3H2GA 3WK8A 4W9RA 1E66A 2ZYIA 4DGQA 3PF8A 3I6ZA 4GW3A 1W75A 5EHXA 2O2GA 1ZJ5A 3HXKA 1WOMA 3H2KA 2OGSA 4N8SA 3S2ZA 4AO6A 3GA7A 1R9NA 4AN1A 3AFIA 5ALHA 3WWPA 4KAFA 1CEXA 5JAPA 4A16A 5JAUA 5CT6A 1N8SA 5ALJA 3OOSA 2GZSA 5DNVA 1K8QA 4FFVA 3KDAA 1U65A 2WJ4A 3RM3A 3I1IA 3R41A 1GPLA 3KWFA 2WHQA 5HF9A 3ICWA 5FKJA 1U8EA 4KJXA 4U2DA 1Q0RA 1Q0ZA 1GGVA 3FAKA 4B81A 4WJLA 4Q34A 3IUJA 2XUQA 5CW2A 2QMQA 3ANSA 1BROA 2XLCA 2VJBA 5T4FA 4ETWA 4FBMA 1XZDA 3FVTA 1TCBA 3GBSA 4WFIA 1CUFA 4CG2A 2Y1KA 1CQZA 4MYDA 4YASA 2WLSA 4X6XA 1MNAA 4HVTA 5AO9A 1R3DA 3WJ1A 5FUMA 1N5MA 5LZ7A 1WPRA 2Z5GA 1CRLA 4DMKA 5FDFA 3STTA 1Q84A 3OC0A 2IX9A 3FWHA 1DINA 2G5TA 5ALLA 5LLSA 2WG0A 1LLFA 5AICA 3YASA 1GZ7A 5HK8A 3WQHA 1KU6A 4UHHA 4DTCA 3WKCA 5JZBA 4BC0A 3T52A 2R11A 5A7FA 2G4LA 1AQLA 2E3JA 4B9EA 3R3VA 1CUZA 1IVYA 2AJLI 2AJDA 3ESDA 2W6CX 4GEGA 2X76A 3WKDA 4PSDA 1XZBA 1VLQA 1TKRA 2HFKA 4TGLA 2BCEA 3E1GA 3LLCA 3T4UA 4UFNA 3HRHA 1JMYA 1C7JA 3ICVA 2ACKA 4K2AA 5BV7A 4P93A 4BDTA 4J0CA 2Q0XA 2X5XA 3Q0TA 3F8SA 3OPMA 1PFQA 1YS2X 3R3XA 4N5IX 4BB0A 1TK3A 4BAGA 3EBLA 2OXEA 5AK6A 5ALQA 1ZI6A 2IITA 5ALTA 1YB6A 5E4YA 4UHFA 5HKBA 3D4LA 3LS2A 3M81A 3C5VA 2WQZA 3BE8A 4P92A 4G8DA 2RONA 2WJ3A 2XLBA 4XVCA 4BP9A 3GZJA 3GROA 5ALGA 1WB6A 3R3WA 3LP5A 1EK1A 2WUEA 1CUDA 3A70A 3PFCA 3QMMA 3W9UA 2HHAA 5AM0A 1MAHA 4G5XA 3C70A 4QA9A 3G7NA 2B61A 1YCDA 4FDMA 5YASA 2CUTA 4BAUA 4PV7A 1XZJA 1FFEA 2V9ZA 2BGRA 2QR5A 2JGIA 4X7BA 2OQVA 4AN0A 4MQMA 3H2JA 5DYYA 2WU3A 1ZD3A 5AK5A 2FX5A 4DIUA 4IO0A 4GBGA 1GQSA 1QOZA 5CRIA 5IVHA 4RE5A 5LZ5A 4E11A 2BUCA 3WA6A 2W22A
chains in the Genus database with same CATH superfamily
3KT8A 2CHFA 4P2BA 1O3YA 1RADA 2O0HA 4IVNA 5BVHA 2MSEB 1ZONA 2DPXA 2A9RA 1VSBA 3Q7QA 3HWRA 1E1RD 3BHMA 1L9KA 2Q0QA 3ELBA 3OKAA 4YIHA 1T0PA 1EHCA 4B7AA 4A82A 4BCDA 3MERA 4TSFD 2I4IA 5BN3B 1RC1A 4IS3A 1B43A 1GCAA 1R4MB 2X15A 1XP5A 2XCOA 1L1RA 2OO7A 3GFRA 1LPOA 2YMQA 4BS9A 5E6UA 2DEUA 4R71A 4P4UA 1YE3A 3OKCA 1TLTA 4D3DA 2Z6QA 4EHJA 1J2RA 3LC1O 4QGFA 2OV6A 3HSKA 1GP2A 2HCFA 4N1AA 1HMYA 4MQ5A 4HV4A 3FNGA 3TLGA 1IHOA 2J0SA 3FF1A 4ESOA 3G2NA 4OATA 1H5QA 2I7VA 4RF2A 5DSXA 3K2QA 4C3OB 2B5OA 3PTLA 1YQTA 3DEJA 2VJLA 3C97A 4BX3A 4OBWA 2FZCA 1TM5E 1U8XX 1IM2A 4EGQA 5KNDH 1B2RA 5E6RA 2ZU6A 1VPDA 5BV0A 3COSA 1GNSA 3M5PA 4Q7LA 2HGZA 3E53A 2Q3HA 4Q66C 3SC3A 4F1KA 3CKYA 5GJBA 5BRAA 1FYXA 3HC7A 3IIKA 1TJYA 4HSGA 3OQMA 1CZKA 3ER9A 2JAPA 4YT5A 2QVGA 3QFRA 3AEKA 1G63A 2E4VA 4J4BA 4UDOA 1HNWB 3RIXA 5BN5B 4B09A 5LKAA 4PONA 3Q8XB 2BI7A 1ESEA 3EFOA 3K31A 3ZDQA 1P19A 1C1YA 2XYVA 3VUFA 3ITKA 3AUXA 3EZNA 1YR9A 3AHFA 1CQWA 3EFBA 1FP4A 3H11B 1P4GA 4OI2A 3BCUA 1I7LA 4RE6A 2EQ5A 4C7KA 2WB2A 4MXDA 3BXOA 1K6JA 1LBTA 1YJAA 3E9DA 3ET4A 4JWKA 1C3JA 2PUHA 3ABSB 3W5IA 1OYYA 3CLKA 3DH0A 5IT5A 3LFHA 3FNEA 2CFSA 5KNCA 3AUUA 2OCPA 4TN5A 2WJZB 2GM5A 1ZK3A 2BR5A 4DCPA 3S8YA 1VJCA 2EL7A 2EZ8A 1L7EA 1P62B 3ANLA 4TWIA 5B4UA 1LY1A 3K73O 3LO5A 2AXEA 1SQ0A 5FOQA 1Y34E 3MB5A 4UAGA 1H0KA 5EUCA 2FGJA 2YASA 1BH2A 4B79A 2PJUA 5ADHA 3Q8WA 4WXHA 5GWXA 4LS3A 4MDHA 3QVGA 3F3YA 2VP3A 1NYQA 3Q9UA 4PAMA 1CS0B 5NLLA 1IBMB 2Q1XA 3DHYA 4ABYA 4ARBA 2ZSHA 5E6SB 3T35A 4QQ8A 3OCCA 3A36A 3D7RA 4E15A 2VDNB 4ER0A 4BLPA 3Q8KA 4NULA 3NVKI 1B6SA 3U56A 3VYSB 2O3TA 1ND5A 4GYKA 3G9TA 3M4XA 1W1IA 2O6LA 2WM2A 1FZQA 3SR4A 1DFHA 1ULZA 3V8VA 4D5EA 1KKMA 5AK4A 4U2EA 3SX2A 4X60A 2PV7A 4GYWA 2R8OA 2ZRLA 4HDOB 4QDKA 1DL5A 3D2BA 3K70D 2H1SA 4ETIA 1RRVA 2RH9B 4PYLA 4YP0A 3L7MA 3W3ZB 1XC7A 3O4FA 3HYSA 3HA2A 2VDKB 3HKEB 1ZVQA 3JARB 4X7RA 4RKQA 2VR1A 1K6EA 3BF8A 1X77A 1UAGA 1IXZA 1DJOA 3ITNA 1EVKA 3L7YA 4GI5A 2A1TR 5FI3A 3ZBQA 2CK3D 3FW1A 3PC8A 4XH9B 3MJDA 5HZMA 2RGRA 3J80A 1B74A 2W4MA 3ZLTA 4EGFA 3E7XA 5G2OA 1UKYA 4JLKA 2FE1A 3O26A 3OEWA 2GAIA 3AR3A 4AIRA 1IB6A 5K8TA 3B3JA 2XVXA 1YACA 2ZUCA 3FCCA 1R4NB 1NNSA 4HFRA 4U8HA 2JFYA 3B2NA 4Z0HO 1QFJA 4AS2A 3GCDA 1OZAA 1KY3A 5E2BA 4Q9JA 3N0TA 2XOKD 2W2VA 2ALJA 3CWZA 4QJ4A 2B2NA 3HEMA 4GOLD 3FWPA 3SF8A 3OCUA 2MSDB 3D5TA 3RYTC 3IAS6 1NYRA 4ND8A 4FQ8A 4IIHA 3ETLA 3T3PB 4B3CA 5KJFA 1HLGA 3NI2A 2PKYX 1GZSA 3P2YA 3NOOA 4TTAA 3UWOA 3IDZA 1KU0A 4HN9A 4C2BA 1LTKA 1OH7A 4QODA 2QY6A 2O2YA 1E2KA 2DKOA 4AG6A 2Y1XA 1G20A 3RH0A 3SBDA 1NE2A 1C9KA 1I2CA 4R1SA 2PUVA 3DOOA 3QNWA 4KSBA 1YRYE 2VUTA 1I6KA 1L5VA 1T3TA 1X8JA 1RQNA 2M6SA 5CIWA 4EY6A 2B36A 4RUKA 1K7FB 3S2FA 1CIJA 3P2MA 1V6SA 2O7RA 4I9NA 1ZU4A 1WMDA 4JDUA 4OKSA 4Q3EA 5FUWA 4BQIA 5TGZA 5KVVA 2DPMA 2IS2A 5I01A 1E2FA 3RBXA 3SYNA 3HMQA 5CW1A 5T6MA 2VAXA 1R5BA 2X6QA 2Z30A 2O1WA 1NWHA 5DWDA 3SEZA 2JJQA 4F5EA 5AUNB 2FFHA 4U6NA 1EFPB 1ECGA 1KYQA 3I01A 4GWKA 2MSKA 4CQMB 3TD2A 2GXQA 3VNRA 4UFOA 3ZWOA 4BNUA 2FPIA 1NV8A 5JVDF 1VSTA 1RAIA 2PLWA 3WGOA 1EWQA 1LX6A 4MO9A 1LC0A 4W7HA 2CE2X 2DSTA 3KPVA 3UTDA 4J94A 4MHOA 1VTKA 3GJZA 5BMVF 2AMLA 2AN4A 3RFVA 2EP8A 3GFPA 1MA3A 4IJWA 2YZKA 2WVJA 3CONA 4RK6A 3BMCB 1JT9A 3EC7A 4X1YA 3OZXA 3TKAA 4JCCA 2WZDA 2HK7A 2I1QA 3SM9A 2QU8A 4UTXA 3KWMA 3VZCA 2IHBA 1A7KA 2F6RA 3DC7A 3IOCA 3NWEA 4ZOLF 1RZUA 2PZBA 1A95A 3KYDB 4FT4A 4DR2B 2X19A 3GLKA 2WJWA 3PVCA 1SHKA 4G56A 3K8YA 2JDID 4P82A 5ILGA 4Z49A 2F17A 1ML3A 3C3DA 1JHVA 1SWVA 2O8NA 3LRXA 4HLUC 2XNJA 3NHLA 4MUAA 4KR7A 1E60A 3FGOA 3RAEC 3SG0A 1KK2A 5FOTA 3FDIA 3I39X 3N1UA 3X3HA 3IEKA 3AM5A 2BM0A 4ZDKA 2ZUEA 4WBNA 4YDQA 1FNMA 2QZ9A 2IWRA 1HNXB 1T24A 3TJMA 2O8FB 1Z2NX 2LR0A 1Z6AA 4L0QA 3I73A 4BBPA 4IOJA 2QPTA 3E0QA 4FFLA 2UZ0A 2ZWOA 2WJAA 2A30A 1DFIA 4YROA 1TC2A 3AHHA 4EX7A 4F3CA 3VKGA 4HAWA 3VH4A 1ISSA 3VHLB 5DMXA 5BR1A 2IUUA 2PUJA 2GM9A 2QHXA 3PDIB 3WAKA 2D4AA 3K35A 3IUYA 4JI0B 4EO7A 1EUQA 1RKQA 1VSUA 3ICEA 3GP5A 5IT4A 1NBWB 4FOOA 4Y2TA 1RKBA 2G1KA 4TLBA 4DLXA 4UASA 2CVHA 3ND7A 4G0VA 3K0BA 2O8DB 1MIHA 1QVWA 1XZEA 2GZ1A 4FOLA 4JIMA 1L1FA 3ZIAD 5UKDA 4FOPA 4ODIA 3O38A 4KK4A 1TTQB 4J0QA 1MGPA 1ZD4A 1K97A 1LDBA 2G9RA 2VCHA 2ZRAA 3HLKA 4OHFA 5DGCA 3WLLA 2VNIA 3VSEA 2JLRA 4JC4A 4UBMA 3QVLA 3SF8B 1MDBA 2B99A 2Q7DA 2JGKA 3KZOA 5AW9A 4DW8A 3J81k 1RPAA 1B73A 5EGNA 4EJ0A 3AXTA 1XBTA 2FN9A 4G4IA 1W0KD 4G0QA 2EEZA 4LYFA 3WGIA 5I4IA 2GASA 3FTQA 4XX0A 4BGIA 2VL7A 4LCEA 2DT5A 1PJSA 3AB8A 1ZLXA 3G79A 4RHXA 3ZCVA 4YRPA 3QYJA 3GMDA 4QXOA 1RWVA 2LIPA 1XNJA 4BASA 2BH9A 2DULA 2YXBA 3DLTA 4YMLA 3ZV7A 2QRVB 2V6BA 3U13A 3ZCPA 1N6NA 1SOUA 4MRRA 1U04A 3H99A 4OYYA 3DV0A 5FNVF 2VVTA 3KLBA 4WLVA 4X1KA 1WSBA 2J5RA 1WHSB 4F04A 2QX7A 4Y7DA 2CVZA 3O8CA 3EY4A 5I9BA 1CNMA 5DHTA 2V96A 2WKPA 4E1BA 3ZI4A 1JQEA 1TQ8A 1U5CA 4JJ6A 1MFPA 4L6IA 3X1MA 1OZHA 5DNUA 1CP3A 1DEXA 3DFUA 1NAIA 1NF8A 1O5IA 2BD0A 2QE6A 3A3YA 3R4VA 4KX5A 1XNQB 3G8AA 3FOBA 1LNSA 2PTGA 3LZ6A 2TMKA 3LCJA 4UHCA 5KYTA 2BFWA 1A97A 1TPYA 1N78A 2AB0A 1Z5PA 4GLJA 4L2IA 1T0BA 2QV7A 4V39A 1U0NA 5CCXA 1E2IA 2A5GA 2FEMA 1WKCA 4L4XA 2P41A 3LUFA 5LP6F 1BX1A 1F0PA 2A6PA 3ESBA 3D7MA 4NEGA 1TA0A 2B4TO 5LQKA 3BT7A 1FMCA 3QG5A 3BHNA 2AN1A 4ZQGA 4X9XA 2CL5A 2D2EA 4F93B 1Q22A 3U48A 1TJ3A 3UT5A 4AP5A 2Z8XA 1BMQA 1XNRB 3G0BA 4MDFA 3OECA 2IQ5A 3FCEA 2YWRA 3CNLA 3DZIA 3TLMA 5JMPA 3WIUA 3SS7X 3KTFA 3A9TA 1YZQA 2B4RO 1E32A 2H29A 2JCBA 3QLUA 1E1QA 2DF8A 1YR7A 2ODAA 2Y2VA 3RAPR 1ZK2A 3N3AC 4DV4B 2JIZA 4BNIA 3O4IA 5DN9A 1QLJA 3VPSA 1PJ8A 4OQDA 4ZRMA 1YJXA 2P3OA 1ZC3A 5IZCC 2RGXA 5EVCA 4LK3A 4PRYA 3SOZA 1GWNA 3BF7A 5ERXA 3R7WB 3LUKA 4GDFA 3M6MD 1GUZA 1NBEA 3MM4A 4MH0R 3SDSA 4WZAA 3IO3A 3AUAA 4RELA 2IXTA 2HRDA 3B7WA 2HWUA 1F8GA 3MJ4A 4X90A 3W77A 4BP8A 2HHLA 2O2HA 1WBDA 2IS6A 4ZU3A 3M6XA 1QO0D 3A1VA 1OCEA 1BW9A 2WJVA 3FYUA 3H42B 4I9GA 1ZIDA 1U6JA 2OZEA 4HDRB 3KOYA 4L8VA 4NZOA 4TM8A 4ZV4A 1YUMA 1WG8A 1V3VA 1URPA 1RHRA 1SBNE 1US8A 2OC9A 4E2FA 1GHTA 2ZR8A 2P30A 5TMPA 3F47A 4QKQA 1FDWA 4AJ2A 4HRXA 1QUEA 5DK4A 2OILA 2VSQA 2H4FA 3DOUA 4CKZA 5JJ5A 1U7XA 2WFLB 3ABOB 5C9ZA 3Q7PA 2YS7A 1FUIA 2PM8A 3UA3A 3AGQA 2WICA 4U1RA 1WDKA 2RB4A 1RXUA 3EZ2A 3S5JA 2GBCA 3AY6A 5DI9A 3HACA 3QF4A 3DE0X 1Z6GA 3EIWA 4DCGA 4A6XA 3OIVA 1CC1S 4PHCA 3CLTD 5CA1F 3ZU5A 4WNCA 2W6ZA 5AI0A 2WPDA 3NGMA 2DBYA 2HWWA 3FUUA 1AUPA 2W6JA 1EVYA 2PZAA 4L73A 3RSFA 2RGNA 4S1OA 1J0EA 4FKBA 3FMVA 3ZGNA 2VRCA 1R0SA 4EJMA 4Y1EA 3NAGA 5F1KA 2YHIB 3MJFA 1RRMA 4C0JA 5C51B 1RD4A 1DO8A 1DELA 2FFQA 2QWXA 1JECA 3LPLA 1OE0A 4FE7A 5AOCA 4YN3A 3T1QA 4J90A 4BFZA 2BDEA 3FIJA 1SOMA 1OX4A 1VLZA 1ZHHA 3IT1A 4MDYA 3DZJA 1U8YA 2FZKA 3D64A 3QTTA 5HZHA 5CB4F 1WVGA 2ABWA 4L08A 5EIAA 3WIEA 3WBKA 3A58B 3ONFA 5EKXA 3E3LA 3HO6A 3GCWA 1Y7IA 4RHFA 2EZ9A 3OZSA 3VR1A 4TXMA 4IIGA 1HDEA 4DQ0A 4LTNA 1SVIA 2I6UA 3F78A 3NCTA 4KPUA 1IN7A 3AR5A 3KZCA 1R37A 3MWEA 5E3HA 1C2TA 2MYPA 2YXPX 1J8MF 3FSGA 4NKRA 2IXGA 1WPXA 4Q7QA 4D02A 1DQYA 2HL6A 1Y3AA 1W44A 3HUEA 1XZQA 4MLDA 2D2FA 4URHA 4CKWA 1K0UA 1CUGA 4QGSA 2DQYA 2Q6LA 3NTQA 4QFCA 4QUGA 5IU6A 2D7DA 4TS1A 4B3JA 1TF5A 4IDGA 4HTAA 4O4JF 5DN6D 4QSHA 3AHGA 3FLEA 4K6KA 4KB5A 3TIVA 4LXQA 5FTKA 3VH1A 4ZAWA 3VSDA 3FPCA 3L7BA 1OD6A 2VP4A 1XTZA 3TVDA 3JYHA 4V1CA 1BN6A 1R2QA 5A7HA 4GQBA 3VNVA 3VR6D 3U4IA 4AKHA 2JL1A 3BH6A 1DBRA 1YJQA 3GGDA 5F64A 3TQRA 3R9XA 1SCDA 5DBGA 2EARA 3T7EA 5U4XA 1HDIA 3F6BX 3QLVA 2P62A 3AV3A 4IH4A 5FFFA 4ZVUA 1B3RA 5FBKA 3ROTA 4DCCA 2ZJ1A 4BKPA 3BA1A 2RC6A 3T7AA 1HV8A 1VL5A 4MVJA 4OK5A 4PPNA 5KX5F 2HJGA 1CUSA 3W6UA 4BO6A 5GIOE 4MWCA 3TW4A 1O96B 5K4HA 1OU0A 1T1EA 4OP1A 5GY7A 3BEOA 2O9JA 3N2IA 1RIIA 4K5QA 1TZKA 5EIBD 4A7PA 2H4JA 5IFLA 4JXZA 1FLNA 4U39A 3G1WA 2XVYA 4HADA 1WO8A 2HU7A 1E79D 1X1TA 4I4TB 4KFUA 3ISVA 1O08A 3WBJA 4IKOA 4JH0A 5K45A 1CEYA 2YKGA 4MHSA 4FVTA 2E5FA 1IUKA 4E6EA 1PGPA 2X0RA 1QYCA 1SCUB 2I6FA 3BJMA 1OWPA 3MWGA 1AV7A 1XCMA 5K0GA 1U0TA 2GPYA 4KLZA 4OEHA 3VVBA 3ZZUA 4ZCSA 3ZQJA 2CDBA 3PC8C 3FFAA 1SUFA 4HLNA 4YJFA 3Q0EA 1CUJA 4QQKA 1YS6A 4WZZA 2HIHA 2GCGA 1IJKA 3GGSA 3MMSA 1FP1D 3SFTA 3FDZB 3WHKA 4BN0A 1T1SA 3L0OA 3PC2A 2ZJ2A 5TE9A 4UCFA 4ITVA 2QYSA 3S70A 4PRZA 1VI6A 3DDWA 2WFMA 5EESA 2MINA 3OEYA 3STXA 2PEZA 3I3SR 1RBZA 4C2AA 4F2DA 2BN4A 1K8XB 2G67A 3OM0A 4MUKA 4HWPA 4OXXA 2IDMA 3BBLA 3QVUA 4UE2A 5GJCA 4MZXA 5HE9A 2Q1WA 3TQTA 2Z3WA 4WZ6A 4I08A 3M2PA 2NTYC 2HCTA 4RJ2A 2UUCB 4H31A 3W34A 1AF4A 4DIBA 3IUQA 4JR0A 4ZKDA 1CR2A 1ELOA 4G63A 4YRJA 4O2RA 3T5DA 4BP3A 3MTGA 4RMNA 4HBGA 2ZK7A 1L5KA 3RHTA 4DGSA 4YI3A 3P0JA 1Z83A 4H0CA 4DV1B 3HCBA 4PSCA 4GOMD 2IP1A 4RD1A 5HRCA 3MTQA 3T1OA 1D6SA 1ADYA 4TYMA 2GWRA 2YZGA 2H52A 5LD2C 1B00A 2KE5A 3FZEA 4ZT2A 3SVZA 4L16A 3TD9A 2W7TA 2BEUA 1WCYA 2X22A 4EG6A 5HILA 4WE3A 1YE8A 4Q19A 4B3FX 3H1TA 3DZFA 3PD1A 4WCVA 2YW2A 4I5EA 1CUYA 3Q9NA 4QYSA 4UUAA 2YNMC 4XWAA 5DLEA 3C24A 3H8WA 2ZI6A 2ZS8A 3UJAA 1U98A 3DWIA 2I67A 2VA9A 3BMOA 2FSHA 5HTKA 2QR3A 3DMYA 4OXIA 3QLTA 2NU6B 2YHAA 2PWAA 4GWGA 2DY1A 5AW2A 4JL5A 2HMVA 3I6IA 5JPCA 3EVTA 3T7JA 2KSQA 2ACEA 1Q44A 4W5HA 1M2NA 1Q2XA 1R64A 4GT1A 4TKMA 3V4ZA 5IS2A 3KPJA 3OQ1A 5JD4A 2J4CA 4EGAA 5JS1A 1HOTA 2O8EB 2UYHA 1SUWA 2OCIA 4OM7A 2D7JA 1TRKA 1H1TA 1YR8A 2F8MA 4PYKA 3G3EA 1S8OA 4DZZA 4RIHA 3WADA 3ZU3A 4JBGA 4ZZIA 4B6JA 1QPBA 2F1IA 4YLEA 1RVV1 1MJGM 2J6BA 2P77A 1RM4A 2PX2A 4CT4B 4CLRB 4E7PA 3IV9A 5BNFA 3OOEA 2XUOA 2JLBA 3IP5A 2XMRA 2BCJQ 1PGNA 4TZTA 4O8CA 5CK5A 5L6LB 1GO2A 2J67A 4WESB 1ZNQO 4DLTA 1BRTA 4C7OA 2PL5A 1U28A 3AYZB 2H1LA 2REQB 2ZRNA 3FGZA 3GD5A 1W35A 3IPYA 4PQRA 5T6BA 5TXGA 1CY2A 5LVAA 4N8EA 3D4NA 1Y8QB 3L0PA 4JASB 1PQPA 4BVHA 4YLYA 1P6UA 1BDJA 4D25A 4Q1VA 2WV9A 3R44A 4H60A 4KP7A 3JD2A 4DVGA 4EHNA 4WBNF 3ZTWA 4E30A 5G4KB 3DZBA 3EZ7A 4Y2VA 1C0KA 3L7AA 4AF8A 3IMGA 4PCUA 5BSTA 3X1JA 4O4LF 4MO2A 4KMSA 3ICQB 3LCRA 3NKLA 1DO0A 1ODCA 2JA2A 3AG6A 3VZPA 2EFYA 5H8WA 2HNBA 3A4VA 4BMDA 721PA 2SECE 1TD9A 2GKGA 4KLAA 1ES9A 3NT2A 5K3CA 5ITWA 3AOEA 4BU0A 4JI5B 4Q82A 1P2TA 4RWZA 4COKA 3DE1X 1DDOA 4FYPA 4O33A 3ECCA 4YXWA 2CMHA 3K0SA 1YA8A 2FSSA 4UM9D 3GFGA 4RVFA 4N6GA 3QXXA 1Y48E 1DJQA 3F6SA 2ZYWX 3CMCO 2WWFA 4IOLA 4TL7A 4TROA 4ZI5A 1KAMA 1Z6TA 4AROA 3ED5A 4CKXA 2LKDA 3BC1A 3EYWA 3F67A 1YRHA 1J8DA 4DKJA 4FQ7A 4O2AA 1NE7A 3PYMA 1KJZA 4BE9A 4TSRA 5SZJA 4NECA 4FJ1A 4ZAFA 4L3WA 3RK1A 1DADA 2QSUA 3ES9A 3IMKA 4NK4A 3WWOA 2G6TA 2Q2QA 2C9BA 1CY7A 1UBRS 1NMEA 1SIOA 3EZ6A 4ZGBA 1NUHA 5EHGA 2I3GA 5E4FA 1XFDA 5BP7A 2WSIA 3AESA 3KEMA 2JK1A 3VOAA 2Q8NA 5FUVA 3N6RA 4PICA 3EGOA 4FFBA 4EOGA 4KXXA 4CG3A 5AVTA 1VIVA 1SBQA 1ZBDA 2BGLA 1HY3A 4OG2A 5E95A 4KITB 1RIFA 4ICIA 1AGNA 4CKBA 4FSHA 2DY0A 1QO9A 3QITA 3MRSA 4PFQA 4MMZB 1DXOA 2PPLA 3UV3A 2NNLD 2O2IA 1A0OA 3JV7A 1XJ5A 5AI6A 5JATA 3AM4A 2FMTA 2P0AA 1K5PA 2R9VA 1V35A 2C5GA 3OZEA 2RI1A 2VAVA 2IHVA 3NDBB 1GU0A 1B8OA 1AB5A 1E2DA 4M1KA 2EKLA 3E4DA 4DN6A 4EM6A 1MP0A 5HQ3A 2D5BA 2B2CA 2OTCA 1UQTA 2QLBA 2G63A 5F1PA 3WL5A 1BEEA 3D6TB 5LU8A 2HRQA 3QEJA 2IYWA 5DGIA 2C94A 4YFYA 3LUGA 4BV8A 1IDOA 3V1TC 4B0OA 2WVGA 3VYTB 1D3AA 1VXOA 4GP9A 3WBBA 1GVNB 3E1SA 3UGTA 5AVUA 2WQ7A 3DB1A 4ZHQF 3GPLA 2HDWA 1MG5A 3OX2A 2AG1A 4HOYA 1OZ0A 3ZWWA 2Q9AA 1UXKA 2YNMD 4YCCA 3LFUA 2ZSDA 5TMDA 2ZRFA 2R6AA 3RADC 3AIMA 1H1LA 1SVSA 1ILEA 2R97A 2G36A 5F5NA 5ALWA 1DV2A 4LISA 4O25A 2FPMA 5L3SA 2QYTA 1N6LA 4GXNA 3QLUC 3KXLA 3S2IA 1M75A 2GTIA 2WHPA 2E48A 3OIUA 2WWGA 1M8GA 4EG8A 1L8QA 1YUBA 1PT6A 3ZX4A 3R6LA 4JP2A 4L0MA 3CCFA 2AFHB 3R6DA 1ZH8A 4HWSA 3CSUA 3I37X 5DYIA 4X64B 1KJJA 1CF4A 2JD0A 5AOAA 5FBZA 2PNFA 4QAJA 3C1AA 2XBMA 3UXHA 5JMWA 1G59A 3OIGA 3AF4A 3H2YA 4AD8A 1KMHA 2RDMA 4GX1A 3AM1A 1JQLB 2QAGA 3K9GA 5C3UA 2GPTA 1R0RE 2ZUUA 3FYUC 3C4QA 3U0VA 3ZCQA 1KZ6A 2Q46A 3V1LA 4DT1B 2SKEA 3J7TA 2OP0A 2H9IA 4FYMA 2QW1A 4YWHA 3EXHB 3FZQA 4ZOEA 3U9SA 3P5SA 3I9V1 3ML1A 4XYEA 1M2VB 2AOUB 2AFHE 5HEKA 3MG9A 3GA0A 2QORA 4M87A 2XD4A 4XFDA 1ZUD1 3LX4A 5ERGB 2GZMA 3I2YX 4AO8A 1D0SA 2G40A 3H87A 4ZCRA 2FRDA 2FUEA 3HJBA 1JFSA 3RRFA 1DG1G 4LIPD 5CNIA 1KMCA 1CB7A 5JD5A 1CZOA 1E4VA 4ZI3A 2WPNA 1I0LA 4IHJB 3LBNA 1L4NA 4DDHA 2G9QA 2QNBA 3BIWA 3HP4A 1XEXB 1C29B 2XUAA 3GYGA 4J7CA 1T1GA 1Q77A 2J45A 2RGNC 5DHPA 4LAFA 5H4HA 3UT6A 4OGGA 3ZDZB 4RFLA 3TNDA 2IK8A 4YR9A 4J0IA 9LDBA 3C3JA 3JYNA 4DYHA 1T36A 3LXUX 3CF4A 4ER6A 5CB6A 3ZE9A 1T2AA 1VI2A 3JQAB 4PZCA 1EEXB 1I4OA 2BFFA 3PFFA 3RVBA 2ZWAA 3PUZA 2JLZA 3H6KA 1F8FA 4V0KA 3T3HA 3AVPA 4Z86A 4ZO9A 4BNGA 4DCUA 3R3YA 3LY9A 3HJFA 3GQVA 3C6QA 3ILHA 4MCIA 3KSRA 1GLGA 3R5FA 1Z82A 4JENA 2X0FA 2M2IA 3K9BA 4MPRA 2V7UA 3GPIA 1BCRA 1JHXA 2PWYA 1F12A 3EIEA 1M34A 4ROTA 1ZOIA 1OFUX 4E31A 1BXRB 2P65A 1IWOA 1L5FA 3EIOA 3FNHA 1HQYE 1JPUA 7AT1A 1N33B 3I5AA 4XSVA 1Z2EA 1VJRA 2NNWB 2YV3A 3G5TA 3HKDA 3OJ0A 5HNKA 4IQ8A 2R84A 2YYZA 1GGJA 4MYUA 4DWJA 2WUDA 1Z47A 2GTPA 2H92A 4UM8B 5JW6A 3ZNOA 1OIXA 2UYYA 3DTVD 2BKEA 5CLQA 1BC5A 1OBHA 5FWDA 1XVTA 5AM4A 4MW5A 4HY3A 4V1CI 1HFKA 1JEYB 3OZAA 1CY6A 1MOQA 3KLPX 4JELA 4BE7B 3JR7A 4II2A 3TRFA 1YONA 2QX8A 4EY5A 5BR4A 1XGKA 3SC2A 3K6SB 4OUDB 4DDUA 4A10A 2WU1A 2GF0A 3H4IA 3ANYB 3PLAE 2H6EA 3UHAA 3I9V6 2OSBA 1P45A 4HGNA 4YRQA 1M1ZA 3G1TA 3H9UA 3QE3A 1DV1A 1S7CA 4F11A 4IL5A 4JB2A 4DB4A 4BIMA 1YFZA 3D8UA 5CFPA 3PUHA 3COVA 4W7SA 2O7VA 2J9FB 2Z2XA 5GADl 1SHUX 1L4KA 5J2TB 2PNJA 2VHUA 3EEIA 4OQLA 3QLVC 4UW9A 4A9AA 1FW6A 4NARA 1FNBA 1TC1A 3BMNB 2YTZA 3IHWA 3SICE 2D00A 2HMAA 2J5XA 4AZ3A 2PVSA 4EW6A 2RH8A 3F6YA 5DO9A 1PQ4A 2RK3A 2YYSA 3KZNA 1DZIA 3PB3A 5IK2A 4E5VA 4Z51A 1KJNA 2FR8A 5HGJA 5LLTA 1VE7A 5AUPB 2GZ2A 2ZUBA 4AICA 3WL7A 2JJ8A 2WUGA 5KQSA 4CMCA 4R7ZA 1PZXA 1SD1A 1DBVO 4C7MA 3HB7A 1PEKE 1XV5A 5E8JA 1SOWA 2R8XA 4KI7A 5GV8A 1AK1A 1QX3A 2ZIFA 1S89A 2ZSAA 2XKJE 4KODA 1JDBC 2HRCA 5EKTA 1KA9H 4KREA 2ARKA 1XWFA 2NWQA 2DHQA 4H6VA 4IGAA 4OAPA 3UFXA 3VOBA 4URFA 4PQFA 3VAYA 2G3YA 1NFQA 2GCEA 2EGUA 3OE4A 3WMWA 4YQYA 4KE6A 4TTPA 3T9CA 4HXFB 4DJAA 2OGTA 2CHEA 3OTGA 2ZIAA 2H07A 1SC1A 3LQ4A 4I2NA 1YIDA 4FDLA 1KEVA 5FH9A 3FPKA 2KJQA 3R3UA 5F77A 2FHSA 3OD1A 5AVOA 3FNRA 4MP8A 5DX8A 2ZXUA 4FGZA 3KC2A 4HMOA 2C2XA 1AJEA 3IQDB 2CNBA 4NMLA 1RZRD 1P31A 2HLDA 3KJNA 3Q2OA 4IDFA 1CZHA 4AJHA 1UK8A 4J03A 1H9AA 3H8VA 5IAKA 4ARSA 5AW1A 4DMMA 1E3MA 4CKCA 4PW0A 4EI9A 2AX4A 2H2DA 5DJ5A 1JWLA 2LW7A 1HLDA 1JLHA 2IYXA 1SXIA 1CDOA 3C3YA 4R6XA 1ZH4A 4Q4JB 4JLNA 3ZTYA 5KWVA 121PA 2UYQA 4HNQA 4O5OA 3RW9A 1U94A 4FHZA 5FHQA 4HFJA 3L6CA 5ILQA 1RYFA 3IXLA 4WX2B 2FZGA 5TSDA 2DLNA 4TXLA 3PPXA 3U4HA 4FR0A 4DBLC 5I7WA 2G7ZA 4RJTA 1DTEA 2LDXA 3V9AA 4Y9RA 1LD3A 2P9ZA 3GJ6A 4OQEA 5B1IA 4B6PA 4KWEA 4DYVA 1A2OA 3IAUA 3IP8A 4MR9A 4PLZA 4DM7A 4PZDA 1OLSB 2J3QA 3CCBA 4CL0A 4YJ2A 4BCCA 2AXNA 4JC8A 4UOQA 3I1JA 3Q7EA 1WP9A 3LKBA 2CEKA 3SKXA 1LEHA 2I4MA 1JKFA 4FR5A 2BV3A 1HQDA 2DAPA 4CGZA 4W6ZA 4OCZA 1WUHS 3PQ8A 1KRXA 1YO6A 4MP3A 4BB6A 4DLBA 2IY7A 4D3YA 1ECLA 1I33A 2ZB3A 4IMPA 5CM2Z 5K3BA 4N3AA 3MLAA 3KIPA 4BGUA 2HA2A 2AXQA 3EC1A 3NQ41 5IVIA 3W8NA 4MR8A 2PBRA 1PSDA 4O29A 1Q1NA 4AK9A 2GCPA 3HCPA 3KQOA 3U4DA 2K5UA 1WMAA 1A88A 3ADKA 3AX6A 5G1OA 2IJGX 1CEEA 1DKNA 1OTYA 5KHAA 4DHEA 1V4BA 4QJ5A 3DKRA 4U7FA 2Q3CA 3AZPA 2ZTUA 1JB9A 2RK4A 3OLZA 1WMBA 2PRZA 1GD1O 3L1KA 3W2EA 1RYBA 4POOA 1CB0A 1NRJB 3JXEA 3VPGA 4PNEA 2M32A 4MW9A 1H2XA 1MBZA 5EJ5A 1EI9A 4MB2A 2A0WA 3KP1A 4RV9A 3UF0A 5HOEA 3SR0A 3RGGA 1UBSB 2YIMA 4FNMA 1NVEA 1EFVB 2CKMA 3ITEA 4E2XA 2PFGA 4WVFA 1C7FA 2WJ6A 4BLWA 5JAMA 2QW8A 3IOMA 4FYIA 2WAYA 5DBHX 1BHSA 1JWBB 2H7XA 3VMMA 1CUBA 2ZYHA 4JI3B 2OUIA 3W2TA 3GL9A 2QZSA 4OK3A 5DLDA 1ESCA 4HDMB 4P3PA 1UH5A 1QPGA 3QVKA 1FTQA 2VQSA 2XBUA 4RMHA 3AL3A 4FS3A 5JPDA 2OFWA 3D0KA 1EE2A 5AJTA 2FW9A 5KJCA 2EFEB 5BQ5A 3WGVA 5CM9C 1E2PA 4I55B 1GRNA 5AVVA 5KNDD 5MN5A 4DR1B 3TQHA 4TVOA 5A4KA 3EBPA 3V4FA 3Q85A 3VR4A 3UK6A 3ZGXA 1Y4SA 5BN1A 4IZOA 5JXIA 4DV0B 2PUEA 3UMFA 4BJHB 1E62A 1UBCA 4IHKA 4IIJF 3EMVA 4Q3BA 4EYGA 2YXLA 1N57A 1YS1X 2WW8A 3NM4A 2Q5QA 1AQ6A 3MT7A 5LIRA 3O4HA 3TOCA 3I9KA 4HMPA 1QONA 1UR5A 2V7QD 1HG0A 1WKBA 5EERA 3WG9A 5K3FA 1SVKA 5P21A 1J25A 1GILA 1H6BA 1TZJA 2PO7A 3ZU2A 4BQNA 2X86A 3AOEC 1Z25A 3LBYA 1QQAA 2DTXA 4PC6A 4A0RA 3AVQA 2QD4A 4GMHA 3NMUF 2X4GA 1S6YA 3ENWA 5FXMA 4CNQA 3JD3A 4CKEB 4Q3KA 4AF6A 4G41A 4PBTA 2HXGA 4W5OA 5DHAA 3PWTA 5DTJA 4AN4A 4OQQA 4GLBA 5ARDA 4ZODA 3TXXA 1JGTA 5I8ZA 6ADHA 1X7WA 3IPCA 1Z6XA 4DUGD 4F4DA 3O9VA 1V5WA 3DLAA 1JSXA 1WZNA 2FJUA 4WOBA 1ORWA 4GG1A 1D9XA 4EW1A 1A5AB 2DQSA 3QKSA 1IJFA 2BGUA 2XUJA 1NF9A 4GOKA 4GO1A 5DYNA 2Q4EA 4G25A 3W6OA 4F2PA 1YK0A 1ZI8A 3OO1A 5KI6A 2GTHA 1QCCA 2HD4A 1HDOA 2XR1A 1WJGA 1LX7A 1LBHA 1NXWA 1W76A 1ZCAA 5FL7A 3RS3A 5CD1A 4K0KB 2WF7A 5JNTA 2ORED 2QXUA 4M37A 5E4JA 3A25A 3OJFA 4GZ5A 5J40A 1QLWA 1NOIA 1TB4A 3DDCA 4J29A 1TU0A 4MCHA 4QD3A 4ESHA 3LI2A 1WW3A 2G77B 3N9IA 4DJTA 1NMSA 1KAQA 5TIIA 2AI3A 2FQQA 2PH1A 2QL9A 3DKKA 1OT5A 1X87A 1PT9A 3K92A 3FKSD 4FHDA 4TT3D 2D59A 3ZLVA 4IYJA 5E9JA 5C37A 1V96A 1L1EA 1N9ZA 3EYAA 3PZBA 3MC1A 2EXXA 4PPGA 3UCEA 3VV2A 4B3DA 4D3XA 2C4MA 2UZ1A 3ZS9A 4B47A 4ZI7B 3AFNA 3D0QA 1ZM4A 1IZ8A 1PG5A 1OOEA 3P9YA 3SXUA 3CB2A 5C18A 1DUSA 4B43A 1AQNA 4XWYA 1BAPA 1ZVMA 5TGTA 4EI2A 2ZREA 5DFAA 1BA3A 1OXXK 4LF5B 1ESMA 3T1HB 4PN7A 2GOYA 4IJVA 3N75A 2G4CA 1KQOA 3BWMA 4Q00A 2X2FA 2CJWB 2YJ4A 2VO1A 1QG6A 1R8QA 3W6ZA 3ZD9A 2GK7A 3KQNA 2CJFA 1OXBB 3WNQA 4OQMA 4Q3NA 1OJ7A 2N46A 5IVKA 5EHZA 1RM5A 2JGRA 3DCNA 4G8CA 4KZKA 1B15A 4JT9A 1UC8A 5EZ6B 3RFTA 2JATA 4H1UA 4M86A 1HDZA 1TF7A 3QEOA 4DPKA 3WLOA 3WL8A 4P4TA 2IXBA 1W0JA 5EINA 4ZQCB 4NZYA 5KC8A 3CXRA 3IDFA 3OIYA 4KN5A 2P4HX 2ZLBA 4WI1A 3VH2A 1KVQA 3OHMA 5A3RA 1TAGA 1T4CA 1IE3A 1U4OA 1TM1E 3MF4A 4WFKA 4NV3A 1BDMA 3P94A 2HFJA 1Y8RB 2J07A 4PX5A 2UXDB 4G1UC 5DTEA 4B3GA 1GNVA 3CUTA 4NFHA 4TRJA 1L7OA 2QM3A 2QD2A 2X8BA 4EA8A 3L4SO 2HBQA 2I9KA 4RD6A 5JH7B 3LY8A 2LP4Y 1K6XA 2LRHA 4EKNB 5ETJA 1UXGA 3N76A 2X8AA 2AIRA 2ZBQA 3ACBA 3QQPA 4HUQA 4KQ2A 4L72A 13PKA 2V7BA 4LMAA 2CHQA 2QAGC 3BMQA 5HDBB 5FFNA 2G76A 2GR9A 4FOSA 4H7PA 4BOYA 2A9JA 4D97A 3G5AA 1U5BA 5KYXA 4M4SA 4B4OA 3JAMA 1NI5A 3MS2A 3LLUA 4YMVA 1ZQ1A 2PL1A 3UV7A 4J1TA 1EJBA 1QIDA 3AK4A 4H1TA 1AKRA 2RJNA 4ADSG 2FDXA 4HN4B 3LQYA 2R2AA 2VAMA 2HCRA 4N47A 2CLEB 4LPSA 4Q93A 2FRDC 4XD7A 1BOFA 1NZFA 3M9XA 5IAJA 4JOBA 1OB2A 4I81A 4ZVKA 3C8UA 4DSZA 5A4DA 3BCSA 2GRAA 3L0CA 4PX9A 5GIPE 4RTNA 2QVXX 4GX5A 2WIDA 3OPYI 5AW3A 2JAWA 1Z26A 4B8WA 4W9MC 4FPXA 2B5VA 4Y2SA 5HJEA 5LOVF 3CE9A 1DIRA 1LW7A 3QVJA 2AKAB 1SCKA 1H22A 2BM8A 3FCOA 1JR2A 4RD4A 4AP6A 3ORSA 1JLRA 4YQFA 3TGLA 4GMKA 1I4TD 1MTZA 2Q7OE 2PCLA 4R0MA 2F9FA 2FUCA 1JEEA 1HSOA 4ER7A 1NI3A 4RY8A 3SZRA 5JV5A 1R0WA 4X20B 4BBJA 3NYWA 2XCIA 4Q47A 3TI7A 1EP1B 1M0EA 1ND6A 1QTIA 2VDVE 3FETA 3IXMA 4M1ZA 2X41A 4M0PA 4AZ0A 4KE9A 4BBZA 5LYJF 5FPKA 4PCVA 2P40A 3OPVA 5BVGA 4F46A 1NW3A 2W00A 4N3BA 1I9GA 4K46A 2QGFA 2JJ2A 3IHTA 3LPDA 4NC9A 4GL2A 1YQ9A 5K0JA 2PZLA 2RHMA 2ZCVA 3WIOA 1F2TA 3DWEX 4G0OA 5JCJD 4KXYA 4WGFA 1U02A 5MN6A 4JJIA 3O2QB 4TZ6A 4O2BB 2F2TA 2E37A 4RK5A 1Y4UA 5DTQA 4D8TA 2ID4A 2WTBA 3W0LB 1W93A 2FJPA 1E20A 1T8YA 4R05A 1DMSA 2GAFA 3RAGA 4Z4HA 1TPZA 4U5QA 1Z74A 5GVRA 2HHHB 1J8FA 1WW2A 4Q1BA 1DCTA 5KTRA 3H4MA 4RHCA 1BKYA 2RAVA 1V1JA 3STUA 2P8JA 1QV9A 4EUHA 4HDQB 4HTFA 1RJFA 3UMJA 4EDHA 5DW0A 4EHKA 1GL9B 2IVZA 1PR0A 1PNVA 2IEBA 3FG9A 3O1LA 3DV2A 1SHJA 4YRBA 1KFCB 1REQB 5I9SA 3AETB 4P5DA 1XRQA 3L1UA 3LOQA 1UBHS 4JITA 1ZWKA 1NTRA 4L3VA 3L0BA 3NNNA 1EK0A 2NUTB 4UVGA 2QTGA 3QI7A 2G4VA 2PX5A 7YASA 1E8NA 5HQTA 3JQ9A 5BWCA 1Q1ZA 3OX3A 4IV8A 1OLXB 3EA5A 4EVSA 5NULA 4ERNA 2ZS7A 3OFVA 2QT1A 2QN1A 3U2QA 4BO2A 1QAQA 1W0CA 4ML3A 1OYVA 4FLFA 3ZS8A 2YDYA 2GESA 5CBKA 2Z5LA 5D7BA 3THSA 3TKLA 2Q3FA 4I7EA 2NO1A 1ZU5A 2JFHA 4EA6A 4I1PA 3OZRA 2PZEA 2CWWA 1F6WA 2V5AA 2BFAA 3HJGA 4UCWA 2G9ZA 4EA9A 1ESDA 3WYAA 2IDKA 3ANTA 5J4LA 5TGDA 4H7JA 3R9KA 3CTPA 2FR8C 3DTTA 4C0HA 4H7KA 4L5IA 5K3EA 2Y0EA 4Q1DA 4UUBA 3WFIA 1XOIA 2XYGA 5JCXA 4YCNA 3O03A 1UFOA 3FWZA 2QJOA 4H3HB 2IE8A 1L8AA 3GBVA 5D86A 4NE2A 2PA0A 4XJTA 3UB4A 3D6VA 4N5NA 3RVNA 4XVHA 1UM9A 2F9MA 3KYBA 1Y7PA 3LE8A 1L4YA 3MS4A 3K0AB 1T4MA 3DFFA 3NBUA 2YUTA 5HM8A 3TRHA 1GQ2A 4MULA 2ONCA 3K8ZA 1PGQA 3FPFA 4KQFA 4S1VA 5BSGA 3TM4A 4V0SA 4DR3B 3TVTA 3EUEA 2HNAA 3BFKA 4D44A 3ZEIA 2C54A 1CQJA 4LPKA 1JSLA 1V3QE 2H11A 3PJEA 5A3SA 2QVLA 3KALA 4N9WA 4OKNA 1UXOA 2SHKA 1WQ4A 1WSDA 2VDWA 4FMCB 4R8VA 5K0TA 3ZV6A 4EYOA 2BF4A 2HU8A 1FUYB 1Q5PA 4PXAA 3SWWA 3WYFA 3EXAA 1EE1A 3GR6A 4PAWA 3BIFA 3K5HA 2RG1A 2W2KB 2WMOB 1R6VA 3D81A 4DCSA 2KYRA 4YRLA 2FF5A 5HXAA 3KQWA 4RGBA 1OXSC 3JCZA 3TYXA 3W8EA 3WXMA 1DIGA 1LSJA 2CWDA 3G9UA 4KAJA 1XWWA 3HUTA 3DOEA 2CNWD 4JU8A 4WV3A 5C8YB 4UM7A 1KKUA 4C1BA 4IFEA 4Y6QA 1T0UA 1TCAA 2EAUA 1UWKA 4KN6A 1DJMA 1IHPA 4GOJA 2Q4TA 5AKLA 4MUNA 1FFBA 3FAZA 1QYIA 3AF1A 3AEQA 1Y6QA 3ZZMA 2FQ1A 5TQ0B 1TU3A 3NJ8A 4FINA 3IBFA 3IS3A 4L8YA 4QOHA 4BVLA 4AAYA 1SXPA 6LDHA 1ZH0A 1U2SA 4CFZA 1DKRA 4IEEA 4NDAA 1X80B 4QRHA 4DMRA 3QX3A 4WOJA 1DRWA 1K27A 2XIQA 1C0PA 3C3CA 1Z45A 3NBQA 4BZXA 1UKAA 2FRVA 2RI0A 4MVXA 2OXCA 4CT0A 3UPUA 3VR3D 4DC1A 1W5FA 2WFZA 4IRUB 1PX0A 1YOVA 2HK8A 2KS6A 3EIHA 3PA6A 5LXTF 5I5EA 2A0XA 2P2ZA 1A9ZA 3NGXA 3E5RA 3OO0A 2QOEA 3PGLA 4NBKA 4MA5A 1VL2A 2CUNA 3I72A 2A8YA 4DUYB 2XTZA 1TKAA 4AJ9A 1AY0A 3O5AA 2G70A 3ZDRA 4KRGA 3AILA 4I5DA 1UDRA 2EX0A 4PAGA 5JPIA 5M29A 1XJ0A 4OLFA 3RSOA 3MYRA 5U9CA 4BV9A 2PGLA 2CL7X 4M6WA 2NZVG 5EUBA 4YRRA 2Q1TA 3EZGA 3UW1A 1M2OA 3T95A 4FD3A 4U7JA 5ITZB 3QHPA 1P1CA 5F51A 5HFAA 3G7SA 3O93A 5KTOA 1C30B 4Z1MA 4ZJZA 3V1MA 3KUXA 1OLOA 3LX6A 2K4MA 4HNAA 3IEVA 5AKKA 3ZW8A 5JVDA 3SYTA 3HO1A 2E7ZA 3WJ7A 4JHXA 3W6NA 3FUWA 1R6AA 2IODA 4U3JB 5IJ0B 3EF3A 3IMCA 4EB3A 2WOJA 2G06A 5BMVA 1H2ZA 3JQCA 1R5NA 5FQOA 1AG9A 1CBUA 3SZGA 4U7GA 3EXEA 1NF2A 5T8KC 3HDHA 1X2BA 3LUHA 5ICGA 2OOSA 2WSSA 3PQ3A 1YZUA 4IJ6A 3T5MA 4NU8X 3M2TA 3PWSA 4HKTA 4LBYA 3ZGOA 1W47A 2O52A 2HIMA 1LB1B 2QUIA 2QVYX 2ZYRA 5FWXB 1CQPA 2P75A 2ZJ3A 3C5EA 3FWNA 4ZOLA 3RRYA 3HNRA 3MCZA 1PKXA 2BMJA 4JU9A 4URVR 3L7CA 1SVWA 2IY8A 3WO1A 4WCFB 5C1BA 1IK4A 3BXZA 1AC5A 3T7KA 3SHOA 2HMWA 5EHNA 1E4YA 4PG6A 1R66A 3K0CC 5A4MS 1K3UB 4EP1A 1N75A 2CMFA 4AY3A 1NXVA 1UJ2A 3I5YA 3QIVA 1B26A 2HSDA 2QTZA 5ALEA 5EJEA 2V3VA 1NSTA 1XZHA 2HM7A 4WN9A 5HGXA 2VZ0A 3VI4B 3OCZA 1XZCA 4LNUB 3M5DA 2JIMA 3RLIA 1W5EA 3D1LA 3GJYA 4CW7A 4DQVA 5CCEA 6Q21A 1V8PA 3CW9A 3LK6A 2DU8A 4Q4CA 1JF8A 2NLOA 3ORRA 4WKGA 4ZT3A 4MJXA 4G0NA 4DA7A 3P7MA 5AVZA 1RLTA 1JU4A 3KAPA 2B4AA 2PX3A 1GTZA 1QE3A 2APJA 1Z2DA 3ABQB 3R3ZA 1YZLA 1M33A 1Q1EA 2FZVA 4M3NA 5HVNA 1Y33E 4EIWA 6CHYA 1RAHA 2PX6A 3ITDA 4ZU1X 1UP7A 1WWKA 3BHIA 1KGDA 2I8CA 3O0TA 4RK1A 3OJXA 4F92B 4V24A 2QDXA 1K92A 2OBFA 3DVQX 4DCJA 1PD0A 4WD3A 3RCBA 5K8JB 1CFJA 1KAEA 4MIKA 2JH3A 1KEEA 1F06A 1FQOA 5B6IA 4Z4EA 4Z2AA 1OH8A 3GT3A 1JMKC 3QQ5A 4MB0A 4AKSA 4LCBA 4M7PA 3ZD8A 5A3JA 2VZEA 1NVDA 2VJMB 3BXHA 4IPTA 3WZLA 4B4VA 4C20A 4PLWA 4TUYF 2GAAA 3KQQA 3DTYA 1IIRA 2V03A 4C6TB 1J90A 1ZRMA 4KL8S 5IAOA 1Y3FE 1T3ZA 2Q5FA 1Z2PX 3Q3HA 4FE3A 4ZZ0A 2FUKA 5AKJA 2N3ZA 5A05A 4L51A 5KYUA 2XCTB 1SPXA 1TUGA 3EOZA 5JCOA 4GKAA 1UZUA 1NKTA 3ND8A 1UDCA 3THRA 1P2FA 1XU9A 5J3JA 4EHDA 1U7TA 3DHWC 2QRMA 2FR1A 1SA0A 4FX5A 4B82A 3U7RA 2Q3LA 2P4QA 2P79A 4F1WA 4EKYA 5EIOA 4TYYA 3HR4A 5JZSA 2G7MC 4PS1A 5A9TA 1FFXB 1JJFA 3IBGA 2PAAA 4PYNA 5FRDA 1T9GS 2KBEA 4QYIA 2AMYA 3A6EA 2YZNA 4LYGA 3H5WA 4A8JA 4M0LA 3L8EA 1T9BA 1ZD9A 3OZUA 2QAIA 4KR2A 5FBRB 4OPMA 1YD7A 2H4XA 4J91A 5ESXA 3JAKA 1W1WA 4BFVA 4EDFA 1Z0SA 4FFNA 3RVPA 5BSMA 3DFZA 1SUBA 1EX6A 2VCEA 4UTZA 3UGKA 3VYRB 3TECE 4I1IA 3W5BA 1NJ2A 1JX6A 1L5NA 2F62A 1N3LA 2OD7A 1XMXA 3I1FA 1JDUA 2GCNA 3COPA 4A0GA 2WFAA 3FLBA 3QX7A 1XSEA 1T34A 2OM6A 3CH5A 2F48A 5LP6A 3PFIA 1VIMA 1YZKA 3A2MA 3AINA 3AONB 5IYZF 2HHJA 2IEDA 1R5JA 4N6OA 5BV2P 4OJNA 4K9LA 4M9UA 4CDNA 3QVXA 1T6NA 1EIWA 4OAQA 1LA2A 1WZEA 2YRXA 1KJYA 1CVRA 2PSJA 1SUIA 2VNJA 4FDVA 3B6EA 3CIOA 1WETA 3OF5A 4WNIA 5DYGA 3UJDA 2O3SA 1XRNA 4HNSA 5A5EA 4PCLA 2XYQA 3TQIA 1HO3A 3PR2B 3F96A 4TV8B 1E6KA 3RANA 5LQRA 2VZLA 1Z37A 4RETA 3IJPA 4RJJA 5U1PA 4BKOA 4BWYA 3I01M 1TKBA 3LT2A 4J9VA 2HRRA 2GBGA 2OCGA 5CFMA 2CZQA 4WSOA 1H0SA 5TMEA 1EBUA 3GH1A 2OK7A 4U5XA 3UNXA 1A9QA 5JJBA 5LMNB 1V7QA 1VP9A 3PHIA 4RAQA 2QZJA 2SBTA 4RGVA 3PNYA 4OJQA 4BNFA 2IOFA 4J1TC 5COQA 3B5EA 3TEMA 4OFZA 3WGNA 4JKYA 4NYJR 2IYSA 2GYWA 2Q9CA 2BMFA 3BE5A 2OL4A 2NT3A 4LYHA 4NHEA 4DSTA 1MQ8B 1R0KA 2P8SA 2RKWA 5E1DA 1G19A 1SBTA 2GJ8A 3NUZA 3PJDA 3KV1A 2LGJA 4XOUA 5JT1A 1Y1RA 4ZOCA 5CEEA 3VHXA 4S04A 4PSAA 1F1BA 2BKLA 1IULA 2FOIA 1YMQA 1MAUA 2JBHA 5BXQC 2PXHA 3KVNA 4JN6B 4D46A 2YDXA 1I94B 1VCIA 2CJYA 2HREA 1N6RA 5CT8A 1KVSA 4AY5A 5KQLA 2C9YA 2YN4A 2JI4A 1GZ6A 5FYQA 3H1PA 3T7RA 3WGGA 4ZFNA 3ZHSA 5IF3A 3QKRA 1F6BA 3TZQA 3CRQA 1RWMA 1TZ2A 2V4ZA 2FSUA 1H4TA 4U7WA 1K3FA 3UHOA 5CA1A 5AR1A 3ZJUA 4WADA 3PT5A 3WK9A 3AU8A 1CE8A 4GZLA 1NW7A 3ID6C 5CDFE 3DBHA 3G2QA 3O7WA 4WKPA 4M38A 3HLYA 4Y9TA 5LBUA 3DF9A 1E9VA 1GUBA 1XCOA 3VC1A 2X3FA 1E7MA 1U1IA 1QH0A 1VSQA 3UWSA 2B35A 4FE4A 2J3EA 3U7JA 1SKMA 2VT3A 1VG0B 5FEUA 3E7DA 1FX0B 5J5CA 2QTHA 4X3OA 3RAJA 1SZDA 1ZXBA 1ULSA 5CB4A 1QFMA 1M0SA 5DH9A 1CSEE 2XE7A 3HZRA 3ON5A 5JECA 2XXAB 1NL3A 1X15A 2GVDC 2C7RA 3AVYA 1QUFA 1GAXA 3EH2A 1KMMA 2X13A 5ALZA 1H8ED 5T4HA 3UXMA 2E82A 5EAIA 1J70A 4GLFA 4LJ4A 2PUTA 4ONEA 3VKUA 5AM5A 2J9XB 2P27A 2XT9A 4DA0A 4RZ2A 4H7DA 1MIOA 5KNBA 1E6LA 1CDZA 1XHEA 2PWZA 3DVRX 3NXKA 1K7YA 4RPCA 3NHFA 3TW6A 2VTVA 2XE6A 3BXEA 2H2IA 1A50B 1ZINA 2WINI 5H81A 2H1IA 2Z1MA 5HUQA 2VPPA 3ROEA 3VKVA 3G2LA 3ONEA 4DLYA 3B7PA 4O4JA 1NUSA 3KE8A 2IQIA 3DLIA 3M6IA 5F7ZA 5L7TA 2ZRHA 5E6UB 2NSLA 1ZY2A 2Q9UA 1U6IA 1CKEA 4EY7A 5JBNA 4V0QA 1SXJA 4B6GA 2WB4A 3DZHA 4ZVLA 3LXRA 1NVWQ 1SBIA 1UXJA 5ALUA 3GK3A 2J87A 3TLGB 1J0AA 1JSCA 1NVXQ 4AVYA 3WB0A 5JQGB 4ZO6A 1QNFA 4FYXA 1D0VA 3N3BC 4AYTA 3INGA 3PD0A 3HSSA 4Z0TA 4D74A 2CGEA 3B3FA 4JT8A 1KYXA 3UG6A 4CMBA 1O6BA 1J0XO 2BSAA 2L82A 3LT4A 2NU9A 4DB2A 5KYYA 1J56A 5E6RB 3UMGA 3JALA 2Q62A 2QLNA 4LHEA 4X6UA 3VNQA 5J47A 4F91B 4QU9A 1RSZA 1KZ7B 1SQSA 4ARUA 4MWBA 4F60A 5A5VA 3Q8MA 2XZLA 5TEVA 4W5RA 3NHSA 1YZNA 3BKWA 3LHSA 4M8LA 4D79A 3D4IA 5KTTA 5L4SA 3AEKB 3MVEA 3OPNA 1R15A 2JEZA 3AERA 3CNOA 4X3PA 3C7KA 4ZN6A 4NOMA 5IKPA 1Z16A 1O5OA 3EFOB 4CM5A 2FXIA 3HZHA 5BYKA 5KWJA 4KNYA 4LWOA 4DQUA 5CMLA 4DLKA 4S1WA 1SCIA 1IYZA 1VSVA 1FP4B 1Y1KE 1J1ZA 2CEAA 4KQMA 1SKAA 3IVRA 1SBZA 3FPLA 4QJ3A 5KIAA 3LZDA 1KRWA 1Z33A 3MWFA 4KLNA 1E66A 1RVDA 2VUIB 3DE3X 4KXVA 4B17A 4J2TA 3PF8A 5CCBA 2HJ9A 4XGKA 5IJ9A 3M4JA 2F55A 4D7AA 3QFTA 4JOQA 2B9EA 4HLDA 1W75A 3OP1A 2CDAA 5DU2A 4E5KA 3M89A 4EJSA 1R6TA 4H1WA 2FE4A 1P2GA 1O87A 3HXKA 4IIBA 1T5BA 5BO5A 5IVPA 5KMGB 1ENOA 1W59A 4DR7B 7MHTA 3QYAA 1DCMA 2CHGA 1SIBE 3C3EA 3K9WA 3TAHA 3VH3A 5B4TA 2YOFA 3QVGB 3FUXA 4K40A 3IELA 4UHKA 3TMAA 3ZX5A 2C5BA 1JAZA 2W4QA 3PE4A 1HE8B 3ETJA 1FF9A 4RVNA 4HUTA 5FUQA 1J5PA 2JH8A 2PGXA 4I6GA 5M04A 2PGAA 2XCUA 1A9XA 5JAUA 3O1HB 3IFSA 2DBVO 4EW2A 5B37A 3OLVA 1E92A 2B6NA 5EEGA 1TCVA 5ALJA 3OOSA 3WLTA 2QRQA 3C48A 5F2EA 3TCXB 3V1YA 1K8QA 2WP0A 4FFVA 4KQ1A 1E4OA 3D9QX 3KDAA 1U65A 2ZETA 3A8TA 1N3IA 3KWFA 4FFPA 4KLRA 2PBZA 4RCZA 3OA2A 2PK3A 3TZKA 4AJKA 3RTDA 3CGWA 3BD8A 4FEEA 4MUIA 5JLJA 2WIAA 5FKJA 4EB6B 1U8EA 3ZDAA 2WJIA 5IULC 3NFYA 1GZUA 1IDN1 4CLDA 4GC5A 5BQ3A 2CXTA 2Q4DA 1KSFX 3ZWVA 4BBAA 5JNSA 4XQCA 1X74A 2AZTA 4LMBA 4EATA 1EJ2A 3B52X 5GJVC 3A1WA 3IUJA 1W2GA 2NG1A 2DBRA 3ANSA 4A91A 1QP8A 3KQKA 3OY7A 2VJBA 2ZQ5A 5T4FA 2R2GA 3KPUA 3P0EA 5DKFA 5EA2A 2F1JA 4X41A 2W2XA 1TO2E 3A1DA 3GBSA 4J8PA 4QPNA 3BM5A 3I52A 5HIMA 1II9A 1SG9A 1GY8A 4BL5A 3JD0A 1W88A 1U0HC 1MNAA 3DEKA 3VPDA 3QBDA 1R3DA 4BQEA 1CS0A 1WVIA 4HLQB 4INOA 4MIEA 1J22A 1GPJA 2CNNA 4XM1A 5EGSA 1YS4A 3T5BA 1YTLA 5FUMA 4AJ4A 2CVPA 3AR4A 4ND8B 4IDAA 4HEA6 2I66A 2QVCA 1A1SA 2UZ3A 3TOXA 1CJVC 4FFSA 4M0KA 2H57A 3LD9A 5G53C 3AJ9A 1NJ8A 3B85A 3UAVA 2A1UB 1G20B 4C06A 3K72B 5FTWA 4RHTA 5K0EA 3H6HA 4R5HA 1JIVA 3USES 3ZCUA 3N0XA 4EHHA 5FDFA 1XMOB 3AO0B 1OR8A 1EFLA 2FN4A 3OC0A 2B4YA 2OV1A 5TQ2B 1KVTA 2F3SA 2GPJA 1P5RA 1N2XA 1UMDA 3AXSA 4KC0A 3KR0A 4B48A 1ZMXA 3W1WA 2H1OA 4H2DA 1M6EX 2C88A 3C6KA 1KO7A 1SU8A 4HS4A 5GPBA 3HKEA 3JARA 3A4MA 1GZ7A 2CLHB 1D2CA 5FUYA 4JUBA 1A8HA 2HCJB 3DAGA 3WSTA 5ARBA 4JX8A 4OY3A 2CLLB 3ZXSA 5HZKA 3N8NA 1XDZA 3EWSA 2MR5A 3EQ6A 2QTNA 2WM3A 1GZ4A 3CT4A 3KK0A 3IR5A 3OIDA 1G20E 4UHHA 3WKCA 5JZBA 2GXSA 3IR7A 2FPIB 4A36A 1A5ZA 1QYWA 2R11A 3V8QA 3AUYA 4F38A 1W96A 4O4LA 4TV9B 3TG2A 4DR4B 3MLBA 1RYZA 3OQPA 1ODJA 5IX8A 2VXYA 1YS9A 3UEOA 4Z2YA 4ZC1A 2D0PB 3RNLA 1NC1A 3Q3JB 1T4BA 2AC4A 1D7AA 3AC0A 4X6LA 5ECWA 4B9EA 3KQHA 2OY0A 1K06A 4TXJA 1A1VA 2VHXA 3A3KA 3S68A 1HFJA 4NLLA 4X1YB 3QKIA 3GFOA 3G6WA 4DJDC 4LOHA 2B1GA 3TRIA 5LMCA 1KQGA 2W70A 3G2HA 5H80A 3GLGA 1TLFA 2PSSA 3DMTC 3ESDA 4GYYA 4P4SA 5JZMA 4GEGA 2X76A 4WA7A 4B75A 1LBQA 1Z0DA 3WKDA 1W30A 1YH3A 3AG5A 3GJSA 4N6NA 2O2XA 4AQ7A 4ZTZB 2V45A 2RGCA 3OVMA 3SMQA 1TKRA 3C3MA 1S8AA 4UMFA 5C5IA 4HHEA 4JLSA 1UPBA 1GTVA 3BD6A 4L1KA 4TGLA 3LP6A 2BCEA 4M0DA 3E1GA 4LCJA 3SJBA 4JLOA 5EKDA 1QP7A 2DUJA 3ZD6A 3ICVA 4LFAB 1IPEA 1P3JA 4N7JA 5KOYA 4PZYA 3TE7A 5D7NA 5BV7A 4BDTA 3JYPA 5JCOC 3KD3A 1QBGA 1SU7A 4M1QA 4BQOA 1QH8A 2X5XA 1YBVA 3GRPA 3GOQA 1X1CA 4KKVA 2E85A 3KQLA 1H5UA 1BX3A 1OYOA 1GDTA 3ACCA 4KXQA 4FEGA 1H85A 4I2VA 5AJVB 3RJMA 2IZ7A 4RZXA 3WFJA 4LF4B 2Q6KA 4FFRA 3QBVA 4KTTE 3N6VA 2C2GA 4F85A 2C82A 1AO0A 4A8JC 1NC3A 4WLNA 1VRCA 4JI1B 1QS0A 1WU8A 3PFWO 4P6VF 2P5SA 3G85A 1YQEA 3U39A 4GFDA 2ERXA 2DPGA 3HB5X 4I1RA 2TECE 5KYXB 1GPH1 4YMSA 3ZKAA 2PCJA 1QQBA 1OPXA 2GJKA 3EGWA 1GL7A 5AK6A 2BFEA 5K2MA 3Q9LA 4ON9A 1SBYA 3I05A 1W2WB 2W6ID 2Y71A 3OT5A 4LJ6A 4NCXA 4PFJA 1CNFA 2J6IA 4UQOA 5DCWA 5ALTA 4RVOA 1Z88A 3RBZA 1KYYA 4ZHQA 3PXDA 5IKEA 2ZE6A 1T10A 3PQ5A 3EJWA 4AZVA 5D3MA 3DFIA 1Z15A 2W83A 4BJ3A 5AUOB 2WQZA 4YO7A 4XX0B 4ZDJA 2QJFA 5B4VA 2L69A 1ZR4A 4Z4IA 1EK5A 5D1NA 3WGHA 3ROXA 1G8JA 3K30A 3EWNA 3SHQA 1M72A 1FDIA 3IP9A 1S2NA