3UUFA

Crystal structure of mono- and diacylglycerol lipase from malassezia globosa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
RGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNFDDHQGIYFHTQIGAVMGECPAQVGAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIP1, secretory lipase (Family 3)
publication title Crystal structure of a mono- and diacylglycerol lipase from Malassezia globosa reveals a novel lid conformation and insights into the substrate specificity.
pubmed doi rcsb
source organism Malassezia globosa
molecule tags Hydrolase
total genus 101
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uufA00
4UBJA 5KWIA 1VE7A 4BE9A 5AP9A 3AINA 4LXIA 3Q8WA 4FLMA 2JGFA 4KAJA 5IVKA 4GBGA 2R8BA 4PO3X 5AOCA 1MPXA 3H2HA 1UOOA 5DLPA 5EIHA 3IULA 4QDTA 1ZJ5A 1JJBA 1G5FA 4C4XA 1YA4A 4KE9A 3VVLA 1U65A 1CUGA 3BDIA 2B4KA 2WHPA 1LPBB 4I4CA 2P8SA 4H7JA 4BE4A 5JAOA 3FYTA 1QFSA 5KBYA 2HM7A 2XUJA 2XMGA 4KE7A 5DYYA 1BRTA 5CTAA 4PSCA 5IH7A 2C7BA 1LBSA 1R1DA 4K6KA 3O95A 4TVKA 3VDXA 1XQYA 4DNPA 5EI5A 1UK6A 4HRXA 2BKLA 2RGUA 4GEGA 5HF8A 5HF6A 5DTIA 3V9AA 2ECFA 2PUJA 1MNAA 3PF8A 4DGQA 1QO9A 2XUHA 4WFKA 5CH3A 3CN9A 3BIWA 4G4IA 1IVYA 5JYCA 4Q82A 3FCXA 1XROA 3C5VA 3M83A 3AUKA 5C8XA 2WUGA 3C8DA 4WDQA 3JW8A 3G9TA 2XQGA 1SC9A 2C5GA 1JMYA 1XQVA 4JYMA 4RE5A 2XMQA 4N5HX 4EY8A 1GKKA 1YAHA 4BZWA 3D0KA 3IURA 2WTNA 1CUSA 2OG1A 1EXWA 4P92A 2PM8A 2VQ6A 1XRNA 3RARA 4DM7A 1QE3A 5ALYA 2JEYA 4J0KA 2WU3A 4K5QA 1CUZA 4M0EA 2WFMA 3VJKA 4G4JA 2BCEA 4FBMA 1B6GA 1BROA 2VT7A 3FLEA 1K5PA 3AZQA 2I3DA 4NZZA 5LYYA 1X2BA 5ALZA 1VXOA 4AX4A 1H2YA 2PSDA 4ARBA 5AKGA 1VJ5A 2C58A 2QUAA 3WWCA 4J03A 5LZ4A 3F97A 4X6UA 5D6OA 4J3JA 3YASA 4Y7DA 2WUFA 1DQYA 2RONA 3I2GA 5JZSA 2WIFA 4J7AA 3O9VA 4B9AA 4N8EA 3G9XA 1HPLA 2H9YA 3N0TA 2RHTA 1CFJA 4J0DA 4X71A 4QLOA 4DSZA 1QZ3A 2JGMA 3H19A 3IVMA 3KSRA 3QVMA 4H7EA 1Y37A 1ZI9A 5EHZA 4Y9SA 2XUKA 1XZCA 2PPLA 3BWXA 4H77A 1UT6A 4QNNA 3C6YA 4X85A 1JJIA 2PU7A 3C8HA 3DD5A 3OURA 3WIOA 3WKCA 1MAHA 4X90A 3H1AA 5CXUA 2ZJ6A 5CXXA 1WHTA 1SCKA 5LZ5A 4X93A 4UBLA 1OCEA 3C45A 1A8QA 3STTA 4NVRA 1CUYA 1VZ3A 2O7VA 2BGNA 1CUJA 5FLKA 4FDMA 1FFAA 3WKBA 4ARAA 3AFIA 5D3KA 1GXSA 1ZIXA 1TAHA 3DL4A 5K5EA 2OCGA 1SFRA 5DNWA 2GYWA 5FPPA 3KD2A 4NS4A 2AXEA 3GFFA 4B9EA 5C8VA 1LPMA 5AIAA 5ALEA 3X3HA 4E14A 3G7NA 5C81A 3HJUA 1GPKA 2B20A 3SX4A 1YSCA 3OG9A 1W76A 1C4XA 3R0VA 2QZPA 1XFDA 5AI0A 4DIUA 1I6WA 1UXOA 1XZGA 3WL7A 3UUFA 4KE8A 3IA2A 3ZLTA 5F4ZA 2DR0A 2WHRA 4UBOA 3STUA 4HXGA 5I7UA 3DDUA 3V1MA 1IZ7A 3G8YA 2XUOA 3WYNA 2ZSIA 4MWSA 3I28A 2B9VA 4ZV7A 4JNCA 4EY6A 4X95A 1LPAB 2ZYSA 3STVA 2G5PA 5T4HA 1MX9A 1VA5A 3QMMA 1BU8A 3STWA 2ZYIA 1RP1A 2CUTA 1EVQA 2XUIA 5HZGA 3N2ZB 1BCRA 1IUPA 1SCIA 5SYMA 2VATA 4G8DA 4KRXA 2JEZA 3BF8A 5K3BA 1NX9A 1WB4A 2HA4A 1SOMA 3KXPA 1TQHA 1VA4A 4J0HA 4KR0A 1DINA 2CZQA 3L1JA 5AM2A 1H23A 3G02A 5ESRA 3O4GA 3WK7A 3MVEA 2XMRA 3HACA 2BUBA 4GXNA 1XZLA 2HRRA 3D7RA 2G4LA 2HIHA 1YAJA 3WKAA 3QBJA 5AK5A 2ZJ7A 2QM0A 1QIKA 3BIXA 5HQ3B 1AURA 1H2XA 5HFAA 4GI1A 4C4ZA 4LXGA 4WCVA 1IMJA 1HLGA 1U2EA 4MJ3A 4OSEA 2D5LA 3QPDA 3KWJA 3FVRA 1QLWA 3ESAA 5CT4A 2I78A 2VJAA 1EINA 2Y6VA 4ZRDA 1ETHA 3C43A 1YASA 2WJ4A 2B61A 4QWMA 4LYEA 3PDCA 4GECA 4UPDA 1RWQA 5CT9A 1USWA 5DJ5A 1CV2A 4OD0A 2E3JA 3WMRA 4MYSA 3FYUA 5JD5A 5J3JA 3C6BA 1LBTA 3BXPA 3L1IA 3LS2A 2XMBA 3CCCA 5LZ8A 4Q05A 4FNGA 3NOXA 1FFDA 1DWOA 3WWDA 3G0BA 3W05A 1BN6A 5ALHA 1EX9A 3R40A 5ALJA 4IH1A 1LPOA 3WK9A 2QJRA 4HAIA 5AIBA 4L3WA 4DYHA 1WB6A 3D5EA 2VF2A 5ALUA 4BCBA 3IUQA 2BFNA 2XDWA 4FBLA 3I1YA 4L72A 2WUDA 2CEKA 5IKXA 4HS9A 1QIMA 3LCRA 3DCNA 3AZPA 2EDCA 3D2CA 2WIDA 1QTRA 3QMVA 1UZAA 4AO7A 3R3UA 4Y2YA 4BRSA 3HYSA 2OLEA 2X8BA 5AKKA 1L7RA 3ZPXA 1N5MA 1LPSA 2CKMA 3W04A 1O6FA 2JGKA 2VEOA 1A88A 3ICVA 5HFNA 2W6CX 3M82A 1N1MA 5AKZA 4JEIA 4CG3A 3BL8A 4UHBA 3BDVA 2CBGA 4RNCA 1QOZA 3AILA 4HXEB 4BDSA 5ALGA 1CUCA 3O0DA 3HC7A 1DT3A 4AB1A 3EIOA 1XZFA 5C8ZA 1Y7IA 4G9EA 2W22A 4DMHA 4UUQA 1AKNA 4WY8A 4P08A 3WJ2A 4B82A 4UBIA 1BCSA 2K2QB 1ZOIA 3EQ9A 4A5SA 5ALLA 3ZLUA 4UFPA 3BE8A 4BC1A 5A7HA 4OB7A 4GLBA 1EA5A 2QS9A 4LHEA 5AK3A 4W1SA 1QIGA 4Q3OA 2Y2VA 4AO6A 2EDAA 5JAUA 2YYSA 4ZV9A 2UZ0A 1BS9A 3FLBA 5A7GA 1EDEA 5LZ2A 2OGSA 1HBJA 5EIAA 3LLCA 2X5XA 5CBKA 3LIIA 5H3HA 5JZBA 1JT2A 1ZI6A 5CRIA 2OAEA 1GPNA 4Y2VA 2Z8XA 1FFBA 1E5TA 1X2EA 3AZOA 4W9RA 1K4YA 2XLBA 1DX6A 5AI4A 1DWPA 5FPQA 4IH4A 1THGA 1UKBA 3F98A 4Y2JA 3F96A 3A2LA 1A8UA 2VTVA 3I6ZA 2OCKA 3A70A 2FJPA 2H7CA 1QO7A 2WILA 2XUDA 4H7DA 4UBKA 4YPVA 5DNUA 1ODCA 1QTIA 5JADA 5CH5A 5D3ZA 4S0XA 2HU8A 4UHDA 1E3QA 3A6ZA 3QYJA 3WIBA 2JBWA 1TRHA 2QXUA 3AJAA 3DL7A 1XRPA 4YASA 3DKKA 1XZMA 1W1IA 4W63A 2Y1KA 4KE6A 4N8SA 3D4LA 4UFOA 4QE3A 3W06A 3DYIA 3I6MA 5ALNA 4KYVA 1N5RA 1VZ2A 3WWEA 2ES4A 5K3FB 4B6GA 5A62A 2R11A 1J06A 3IDAA 4G8CA 1A8SA 5CH8A 3SK0A 2XLCA 4B7ZA 2HADA 3A2NA 2WJ6A 4ITVA 5LKAA 4OB8A 5FV4A 5CT6A 4BVKA 1PV1A 5DNVA 3FYUC 2WFLB 1C7JA 1P0PA 3HI4A 3QMWA 5AH0A 1CR6A 1PJAA 5K3AA 2DQZA 3O4HA 4CFSA 2ZVDA 4G9GA 4BTLA 2FUKA 3W9UA 4ROTA 1GT6A 2PBLA 2BUCA 2FJ0A 2OAGA 2OCLA 1XKLA 2H7YA 4WFJA 4MYDA 1CUEA 4DMFA 4MWTA 3GA7A 4UHCA 1L7AA 1CLEA 1J1IA 5SYNA 1KEZA 3STYA 3DKRA 4C01A 4FTWA 4AN0A 1XZEA 5JALA 2QT9A 4U2FA 2QRUA 2RAUA 1OXMA 5CURA 4P93A 5DYWA 5JAHA 3RLIA 2ZYRA 3DLTA 2BUAA 5EFZA 1F8UA 6YASA 2WHPB 4FKBA 5E2IA 1Y7HA 5FUMA 1JU3A 4J0CA 1QGED 1EDDA 1QIJA 3WKEA 3PE6A 1JI3A 4ZGBA 1IUNA 4C4YA 4WDRA 2Y2UA 3E1GA 4WY5A 1QIFA 3C6XA 4UHEA 2HA7A 3FWHA 4OYLA 2ACEA 3G9ZA 5ALSA 4EY4A 4A16A 1ZI8A 4Y2QA 1AUOA 1UWCA 3BJRA 1C7IA 3K6KA 1ORWA 5BWBA 5YASA 4CCYA 3MUNA 5IVIA 3R41A 1XRLA 3VJMA 3F9CA 3V48A 5IVDA 2XUAA 4OCZA 4DMCA 3G0DA 2O2IA 4WJLA 4BC0A 3FCYA 3ESCA 5HKAA 1LPPA 4IHAA 3H2IA 1XQXA 4I3FA 2VJBA 2RI6A 2QR5A 1CUVA 4F5ZA 3O4JA 4H7KA 4DNFA 3JYHA 5AK6A 5JZ9A 3IUNA 5AI8A 5JARA 3R3XA 4BBZA 1CUXA 4MEAA 4U2BA 3H0CA 4Y2UA 1CUWA 2DHCA 5T4BA 4B85A 4M0FA 4EY7A 3R3WA 2V9ZA 4OU4A 4QWWA 1WCYA 2HA5A 3HRHA 5HKBA 4BVLA 1R50A 5K3CA 1CIJA 1H22A 5IVHA 2ONCA 1CQWA 4KAFA 4FMPA 3IB3A 3WK4A 1S8OA 4OB6A 4EB0A 4X94A 4QDUA 2HU7A 4A23A 1ACLA 3FVTA 3A2MA 1LGYA 4RE6A 4DMKA 1KU0A 1BEEA 1UK7A 1ZJ4A 2O7RA 5JD6A 3D2AA 2DHEA 2ZSHA 1QFMA 4QDOA 2WIJA 4QDXA 4M0MA 4FFWA 5EIEA 3F8SA 1AQLA 1HKHA 3TRDA 2VT6A 1AX9A 4EA6A 4BATA 1L7QA 3IBTA 3O4IA 1TCAA 4H18A 2HA3A 1DX4A 1O6GA 4J0IA 3VVMA 4ZWNA 2C0PA 4C89A 4JH0A 4O08A 4AO8A 2OQVA 5LZ9A 3WL6A 3ZWQA 4LIPD 3R3ZA 5DTJA 5JANA 4W1QA 3G9UA 4AZ3A 2WG0A 5ALKA 4DNQA 1MU0A 2GZSA 3HEAA 1W4LA 2V97A 4GWLA 4BAGA 3I6YA 4OUKX 1ZGBA 1YS2X 5ALIA 4KEAA 4AMZA 3OC0A 5ALTA 3K9BA 1MTZA 1T2NA 1XRMA 5JIBA 5HK9A 4GHWA 5AM3A 3WI7A 2CMFA 1ODTC 5FOQA 5JATA 2QOEA 4UHHA 3PF9A 3P2MA 1XZJA 4CCWA 5JD4A 4G4GA 3TEJA 3FOBA 2H7XA 2XMZA 5AKEA 2ZJFA 4H7HA 2HFKA 5EHNA 3L1HA 1QIIA 5AM0A 1UFOA 4CG2A 2XQFA 1JFRA 2I3ZA 2Z3ZA 2G5TA 3LIPA 4HRYA 5LZ7A 5AKLA 5HF9A 5JAPA 4Q3KA 4UFNA 4F0JA 1HQDA 1YB6A 1J2EA 5JASA 2VJCA 1UKCA 2GBIA 1EB8A 2D0DA 2DFPA 3AIKA 4I19A 3DEAA 4IH9A 4F21A 4BCDA 5KREA 2RHWA 1UKAA 3R3YA 2XB6A 1LPNA 2AJDA 5DWDA 1MAAA 2RIPA 1LLFA 4U2GA 4XX1A 5ALQA 3W2TA 2DQYA 4C6HA 1VOTA 5HF5A 4X00A 3WA6A 3DOIA 2XUQA 5FXMA 1B41A 3PFCA 1D07A 1U8EA 4W1PA 4B84A 4X6YA 2ACKA 4X91A 3WYDA 2AJCA 3RK4A 4AQDA 3V1LA 3ZI7A 2YASA 1XKTA 4EZIA 5E4TA 3UUEA 1Q0ZA 4PW0A 1MT3A 3IUJA 1VKHA 5ISMA 2GYUA 2JIDA 2CJPA 3ANTA 2WG1A 3GZJA 1UK9A 4PNZA 2Z8ZA 1XZAA 2WG2A 5ALDA 4N5IX 3I2HA 1ISPA 3EBLA 2Q0XA 5AKIA 4EBBA 3U1TA 3WZMA 4Y2XA 1ZICA 3C6ZA 4Y2RA 4AN1A 3S8YA 2C5FA 5T4FA 2AJLI 2G63A 1BN7A 2OPHA 4KAAA 4QZVA 1CUDA 1ACJA 4N8DA 4BAUA 4J0GA 2VAXA 1YS1X 3H04A 2PUHA 1CQZA 3I2KA 3H1BA 1G66A 1KU6A 1GQSA 2ROQA 2VJDA 1TCBA 1CEXA 1CVLA 5EHXA 1VLQA 3STXA 2OXEA 4IO0A 5ALRA 4QEKA 2HFJA 3HZOA 3WA7A 4DSAA 1E8MA 4OU5A 3ED1A 2IIVA 4F60A 1EK2A 2PX6A 4U2EA 5LKRA 3FNBA 1JKMA 2DSNA 3WLAA 5FRDA 4MEBA 4LKOA 4DLNA 2VSQA 1CUFA 3GELA 3KDAA 4BDTA 2ZYHA 1HL7A 4H7FA 3FYUB 1EB9A 4B81A 5AI6A 5ALPA 4X6XA 4UBNA 5ALOA 4H0CA 3H2KA 1FFCA 1T4MA 5AK4A 1U4NA 5CT5A 2XMDA 1GGVA 4Q3LA 3ICWA 1CUIA 1RYYA 1UOPA 1XZKA 2DHDA 4INZA 2WM2A 4HVTA 1Q83A 5ALVA 4BCCA 4X7BA 4PQEA 1GKLA 1GQRA 4BZZA 2XQIA 3W9BA 3G0IA 2VA9A 2PSEA 1E8NA 1MJ5A 4FFVA 3C87A 4RPCA 2HRQA 2WLSA 1ZD3A 3CN7A 5C7YA 1NU6A 1HDEA 3FBWA 2BAGA 2V98A 5DYTA 1DQZA 2PL5A 1X70A 3QPCA 3DS8A 4UHFA 2JGEA 1YR2A 1R4ZA 3WQHA 3D59A 2XI4A 4MQMA 5K3EA 3M3DA 3HXKA 3LP5A 3OPMA 1UK8A 4QLAA 4W1RA 1AZWA 3IUMA 2NW6A 1R9NA 2QVBA 3I1IA 3GROA 4CG1A 3R3VA 1H2ZA 3HLKA 1W52X 2JGJA 3T4UA 4X92A 2J3QA 4FLFA 2J4CA 1E89A 3WWOA 2BGRA 1QIHA 5EHQA 1XZBA 1VXRA 2PVSA 1XZDA 4QA9A 4XWGA 4Y2PA 4FWBA 5ALXA 2GBFA 4XIIA 1LZLA 3F67A 5BOVA 1WHSA 2HL6A 4G5XA 1R9MA 1ZD2P 2JF0A 1Q84A 1BEZA 4PSDA 3E4DA 7YASA 1CPYA 1MX1A 4G8BA 4ZXFA 1QONA 2WKWA 4CIAA 4GDMA 1WM1A 2GYVA 2AJBA 1K63A 5EGNA 4HZGA 1CUAA 1MNQA 5FDFA 1WOMA 4Y2TA 3EQ7A 1DTEA 3WK6A 4AMYA 3D3NA 2XUGA 1R3DA 4ZREA 2CB9A 4H7IA 4AXBA 2H1IA 1E66A 4CI9A 5FP0A 4Z49A 4JYPA 5HK8A 4EUSA 4HTAA 1MN6A 1XZIA 4PV7A 1AMNA 4K2AA 2Z3WA 4C88A 4X97A 1P0IA 2PU5A 5HQ3A 4B80A 4WFIA 3EQ8A 1JMKC 2WQZA 5ALMA 2QXTA 2HDWA 4BYMA 2QUBA 3FSGA 4AZ0A 3ESBA 2GBGA 2QTBA 2WHQA 3IIIA 5CW2A 3G0CA 2XMCA 3H2GA 5E4YA 1K8QA 4E46A 1AGYA 3QH4A 2OGZA 1OILA 1XLUA 4B0PA 1FFEA 5ALFA 4IQ4A 3WWPA 4U2DA 4K6GA 3WKDA 1A7UA 1TCCA 3Q0TA 4YK7A 3WL8A 3ANSA 1XRRA 4P9NA 3H18A 3I2FA 5I8PA 3HSSA 2WUEA 2HU5A 1EK1A 4FHZA 1BE0A 1UOQA 4TPKA 2JGIA 1CUBA 1AC5A 3DNMA 1IZ8A 3RM3A 3VISA 1XQWA 1JU4A 4QDZA 3GUUA 1XZHA 1GPLA 1WPXA 3RKSA 2HA6A 5BWCA 3PI6A 2OQIA 3O9MA 1SCQA 2QMQA 3ILSA 4LXHA 5I9IA 1MX5A 3WZLA 4FNMA 3SC2A 4BB0A 4U2CA 4ETWA 3QZUA 1LNSA 1GZ7A 2X76A 2QJWA 4FOLA 2XE4A 2XT0A 2IX9A 1W6RA 5A71A 4H35A 2XUFA 3V1NA 3GBSA 3AIOA 5ALWA 5LLSA 4Y2SA 4BP9A 2PKYX 1H2WA 3VJLA 3H17A 4C87A 3WJ1A 5AJHA 2PSHA 1DWQA 1QIDA 2C0QA 4OPMA 5A6VA 5AKYA 3NUZA 3HABA 1YCDA 4EY5A 2HA2A 3OM8A 3SWWA 4L0CA 5AM5A 1XRQA 1EVEA 4TGLA 3DOHA 3CCBA 4RGYA 2LIPA 1TK3A 3QPAA 2XMSA 3D2BA 2WIKA 2WFZA 3I2IA 5BV7A 1XLVA 3DYVA 1W75A 2XUPA 5E4JA 3B3QA 4KACA 3OOSA 5AKXA 3EF3A 4HXFB 2GBCA 1FJ2A 5LP1A 3KWFA 4L9AA 3ZV7A 1Q0RA 5LIPA 2WIGA 3DQZA 4V2IA 4ZI5A 2OGTA 2YXPX 1ODSA 3C5WP 4KRYA 2PSFA 5AI9A 5CT8A 2V96A 2JGLA 1NU8A 3U0VA 4CCYB 1QIEA 3BJMA 3FLAA 5HCUA 3PICA 1P0MA 3WK5A 1CUUA 1EI9A 1WB5A 1MO2A 4K6HA 3I2JA 3G0GA 3ESDA 1FSSA 3FAKA 1EHYA 1N8SA 4B83A 5AICA 4BAZA 3TGLA 5T4EA 1K6EA 4Q34A 4Q1VA 1G42A 3H2JA 3UMJA 4GW3A 2HHAA 2FX5A 5AM4A 2Z5GA 3ZLVA 5AHXA 3TJMA 1IUOA 1DT5A 2J3DA 4G1FA 1M33A 3PUIA 4UBMA 3AIMA 5AOAA 4YX9A 1TKRA 1YB7A 5A7FA 5CMLA 2O2GA 2HA0A 5D7BA 3PFBA 4CIBA 2YH2A 2Y6UA 3PUHA 2J4FA 4MXDA 4XVCA 3S2ZA 2XQJA 3QM1A 4KJXA 2ORYA 3K2IA 2DCMA 1ORVA 4OYYA 1TIBA 1THTA 3E0XA 1EDBA 1J07A 1VE6A 5K3FA 2WJ3A 3WK8A 2IITA 3VXKA 1DU4A 1R88A 2PSJA 3NWOA 1LZKA 1E8DA 1ZD5A 1CRLA 2VAVA 4DTCA 1EH5A 5K3DA 1WPRA 1ZGCA 1G4HA 5AOBA 3OTQA 4EHBA 4BVJA 3FSGD 4MQLA 4E15A 1ZIYA 2XQKA 3B5EA 3V1KA 3B12A 5AI5A 4LYDA 4NMWA 2I03A 2QKYA 4BRZA 4PSUA 1QJ4A 2WSLA 2WFLA 3VKFA 1P0QA 3JWEA 5AKHA 2EEPA 3NGMA 4J0JA 5KWJA 3M81A 2WU4A 2GZRA 4B0OA 3BF7A 4XJVA 3C70A 5FKJA 4D9JA 4BP8A 1CUHA 3DJYA 3MUOA 2BJHA 4BTVA 1F0NA 4X3CA 5A2GA 3T52A 5AO9A 2WTMA 4E11A 2C4HA 2OCIA 2AJ8A 2O2HA 3E3AA 1XLWA 4JUIA 1ZD4A 3MGAA 4PF1A 3WL5A 3KOOA 5AKJA 1F0PA 1Z68A 1JJFA 1YA8A 4FLEA 3QITA 1F6WA 5AM1A 3CXUA 1PFQA 4DNOA
chains in the Genus database with same CATH superfamily
3PYMA 2J59A 2FSGA 4UBJA 5EYPA 3F9IA 3FTNA 4LOHA 4IHQA 4XI9A 1IK4A 2FW7A 2ORIA 1VDZA 2MYPA 3CRZA 1XE3A 1QCZA 3NVAA 4KLZA 5AP9A 4LXIA 2X8JA 3V7FA 1B14A 3Q2KA 3Q8WA 2PLRA 3NBXX 1H0HA 4UTXA 3W5DA 1YRHA 2AOXA 2CF5A 3ZW7A 1FYXA 4GBGA 5IYZF 3U7QA 3HMQA 3A0RB 1I7QB 1Q0TA 1J09A 4PO3X 1XVLA 2AG0A 3N58A 1AD2A 3H2HA 3JPWA 5LMCA 4RXTA 5A4DA 1ZESA 4BO3A 4MVJM 5CVTA 1Q0QA 3ZU5A 3DKPA 3GLGE 4ZO8A 3HDVA 5EJ8A 4C76A 2H29A 4PYIA 3VVLA 3MC1A 3DMTA 1CUGA 3BDIA 3LBAA 3D6HA 3PT9A 3M4XA 2H0RA 4LJ7A 4W99A 4ZHQF 1SOVA 2XSZA 2P9ZA 4RF4A 3W2HA 1ODIA 1TM7E 4CMCA 3PU6A 2COEA 4HK4A 1REQB 4MHTA 4RMJA 1QM5A 5B2FA 2P8SA 3WOVA 2E37A 4I3GA 1NASA 2G76A 3ZXIA 1C3EA 4H7JA 3TLGB 1VCOA 4ZP1A 1D6MA 1V7CA 2W7TA 4KB5A 1GTSA 3KPVA 1ZEMA 1W36C 4GKKB 2WRZA 1D8TA 2YOHA 3D81A 2XUJA 3HJGA 3OCVA 4TSKA 5JVDF 1B00A 1TMGE 2RGYA 3BICA 4JJ7A 4E5SA 5HSGA 3N2GB 3H8SA 1KVTA 2JFXA 4NSNA 1WX1A 1P62B 4ENPA 2C2YA 3DWFA 1JKFA 3W1VA 3BMQB 5A5FA 1FFWA 1QWSA 1D4OA 1R1DA 3ITNA 4WPGA 3ZGYA 1IWPB 5F35A 4K6KA 1WP4A 2GCEA 1IVNA 2MU1A 3O95A 4BLTA 2UUBB 4KNWA 4PHFA 4TVKA 4QGAA 4ITUA 2FNAA 1UK6A 5JS8A 4Y7CA 4Z8XA 3UHOA 5IUNC 1I4WA 1OUMA 1ID1A 2AS0A 2VPWA 3FTDA 1ZH0A 4GMGA 3OM1A 4FYVA 1R6XA 3WMFA 3KJHA 3V9AA 2IYYA 2ZRQA 2B9EA 5CPBA 4C4PA 1AF4A 4ZDKA 2VJLA 4ZU6X 3FHJA 2GYYA 5BR4A 1VBMA 1VL5A 2GEDA 2VNJA 1EDZA 4HB2A 4X8OA 4E5YA 3UJ7A 3LCVB 1IVYA 2D7CA 2NTYC 4JR2A 4NH0A 1U1GA 4HWRA 1XQ1A 3AFMA 5EXXA 4Q82A 1POWA 2FHPA 1PNVA 1EFDN 4AY3A 3V8QA 3D8RA 1V43A 2XT9A 2PD6A 1JIVA 1FQOA 2WUGA 1NOJA 2VPIA 4FT4A 4DJDC 4EG3A 3ZY3A 3G9TA 4OBWA 3V4LA 3UV6A 3PB3A 3PCRB 5EP2A 1SC9A 5EESA 3NHKA 3JS5A 4JJIA 3BUSA 4MV5A 3WGNA 1UBTS 4AMUA 3B20A 3IOMA 3RVNA 4WNCA 4M53A 1QZUA 1B74A 4GI3A 5IJ9B 1UMCB 1U0FA 5BW8A 3I39X 1N75A 3F5DA 5CK4A 4N65A 2VDWB 3OY7A 5BURA 1L4MA 1JLRA 1U90A 2RBKA 3W5SA 4A3SA 4BZWA 1RFGE 1MG0A 1C0KA 3EW9A 3H5TA 4B7CA 3TOSA 1WRBA 3GR6A 1WR8A 2BM8A 3OBIA 4KQWA 4CQJA 4MI3A 3P9NA 4ESHA 4V3BA 4ZFNA 1CF4A 1YONA 1K27A 2PM8A 4X1KA 4JP5A 5T6MA 4P7GA 1XRNA 1B43A 5EKXA 3AJRA 3Q87B 5EZ6B 3K9CA 2MSDB 3RARA 4DM7A 4QGSA 1ZM7A 2JLWA 3K1JA 1NMXA 4P53A 2PS3A 3ZHYA 4BVFA 2YFHA 3U7EB 1Z5OA 4JLDA 3H4MA 2R8ZA 4DLYA 4TWAA 2P3QA 4EPWA 3K6RA 2HJ9A 1PD0A 1OT3A 1SBQA 3FZQA 4URZR 2DBVO 1W19A 2VR1A 3UOWA 4M0EA 4CLOB 3UY4A 3EDRA 3VJKA 1LBQA 2EFDB 5FUQA 2BHLA 4HYQA 5CW1A 2F9FA 1DC8A 1P17A 2BCEA 4BV9A 2IUUA 1X8JA 1AVTA 3CZ9A 2H7VA 4MRNA 5CVEA 3JQBC 1LI5A 1QYCA 4AN4A 1RJWA 4BN5A 1WBDA 5KOHB 4GZ6A 4UNIA 1BX1A 3I53A 2QI9C 1KO4A 1VXOA 2C4MA 5IXYA 1MP0A 4AX4A 2AOWA 2ZKIA 3F6BX 2ZKLA 2OV8A 5H81A 4A2WA 1Q11A 3AXTA 3KB6A 2PSDA 3DZDA 2FSFA 4ARBA 1EIZA 1G0OA 2P9FA 3VNSA 1CE8B 3AVXA 1G3UA 5IEBA 3WWCA 5EIXA 1ZVVA 4I8XA 1GRVA 5H83A 3CF6R 1OI4A 4JT9A 2NZUG 1G59A 4K88A 1ZRSA 1PQ4A 2OFPA 2QN7A 5KNBH 4RD2A 1DAHA 2ATVA 4ZN6A 3IEMA 3YASA 3QRWA 1TQ8A 3HGMA 3OZUA 1ZU5A 1ONPA 1GL6A 4G5GA 4LF6B 2YUTA 2ZREA 5CD1A 1DOZA 1J99A 1PUXA 3GVXA 4Z0TA 4HNAA 3I2GA 5EUBA 5F9MA 5BVHA 3MT0A 3C3CA 3QEMA 1IZYA 3LI2A 3W3AA 4MUEA 5AJVB 3TECE 2X2FA 3WQRA 1MC5A 3CVOA 1QR2A 3IHWA 4E2XA 1HPLA 3LK7A 3TQTA 4GIBA 2H9YA 3N0TA 3VKVA 3WNZA 3V4OA 1JS1X 2NMVA 3B9BA 2QROA 2WB2A 2OAQ1 2RHTA 4P7FA 4U1RA 1GTJ1 1VHDA 1Y4DE 2FMKA 2H4FA 4A0FA 2IE8A 4RQUA 3IAM1 5EWMB 4DLTA 1R0WA 1Z83A 1WU7A 1EUDA 2AEMA 2OESA 2P5UA 2VHJA 3BZUA 4LRQA 2AW3A 3T5CA 4KITB 1Q7TA 3EFBA 2EW8A 3IVMA 3KSRA 3W34A 4LE0A 3ZHCA 4H7EA 4D4JA 1AA6A 3CCFA 4D8UA 1ZI9A 1HV8A 4YQEA 3Q2IA 3QGMA 3P20A 1SB8A 4NDAA 4WNAB 3CR8A 4ZZ1A 3D6AA 3QEBZ 2Z6UA 1C1DA 2PPLA 2XZPA 4WA7A 4ZQHA 5DSTA 4OHYA 3EASA 3OA2A 2ZSDA 5F3WB 4H77A 1UT6A 4W7IA 1TF5A 1SVOA 5THXA 3LAWA 2NVUA 3KVYA 4XW2A 5JE8A 1ATZA 4TTAA 4KPFC 3SX0A 1DIGA 3Q3EA 1MABB 3WY9A 4RTLA 5HA5A 1D2NA 1FS5A 3DD5A 4FFSA 4OHBA 1OLOA 1N78A 4GZLA 1SEVA 3U1BA 1Z4NA 2V6BA 3H1AA 1RI5A 1NF3A 2LWIA 2SBTA 3LVFO 5GZ6A 1YVPA 4UZSA 1IJEA 5DBEX 4BKOA 3P9QA 2PN1A 2VPZA 4HGZA 1J8FA 2BIFA 1WHTA 1BW9B 1IRXA 1F1JA 1T5SA 2NU7B 3H99A 3L8EA 3NIWA 4J07A 1KYZA 1ORTA 3FFBA 3JY6A 4RHTA 3SX2A 1ADFA 3FTFA 4W8HA 4YCSA 1FNMA 4IIBA 1UOEA 2LCFA 4IJVA 5COBA 1A8QA 1D2AA 3RB8A 4YFVA 3QV2A 3AO0B 3D1JA 2XTZA 4NVRA 1DEOA 1KI3A 4XD2A 3O8CA 1J8QA 1MFZA 2FA9A 1KXJA 1Q15A 5FLKA 5EIBD 1OOEA 2P2ZA 1HC7A 1M6VA 2P1RA 3HB9A 3TTVA 4GOOD 3D3QA 1R8XA 4KDRA 3WKBA 4DF3A 2DHQA 4M88A 5D00A 2D5CA 3PC2A 4KUHA 4K0RA 1NN0A 1UP6A 2JBAB 4MYHA 3TFQA 1ZKDA 2V59A 2YJTD 1GXSA 4UM5A 3RHSA 3D6MA 1N7HA 3FFTA 3HE3A 2B3TA 3IEPA 2GJAA 1EGMB 4A6EA 4KRFA 3DL4A 2C2XA 5B5SA 4AWBA 1VIAA 3Q8XB 1PJ4A 5KUTA 1US8A 1JG7A 4EGJA 1LWNA 4HQ0A 3EZYA 5HGXA 1PJCA 2JW5A 5BV8A 3V5NA 1SFRA 1XTQA 2AOTA 2QMHA 3OCWA 3WDLA 1JZQA 2GYWA 4KH0A 4F2PA 3BMNB 3AEKB 3PIDA 5IRCD 2NXJA 2RGCA 3GFFA 3HHEA 4O1HA 4UJ5A 3PR3A 4P7KA 2ARKA 5ERXA 4CDMA 1VP3A 1RACA 3PBKA 4HBZA 5C8VA 2F43A 4OLAA 5ALEA 2QN9A 1Z2CA 3PLAE 4E14A 1MF7A 3ZE2B 2BEWB 2X8LA 1H5UA 3ZH2A 4HLDA 2YX1A 4OQMA 2CJWB 4M1MA 1H05A 4TLAA 1GARA 4AXXA 4N01A 4NBVA 2VUSA 1DRJA 4OMFG 1YSCA 5G02A 1P1CA 3ODGA 3OKCA 3T9AA 4BO2A 1Q5PA 4MQUA 4X44A 3K30A 3KR0A 4FZ3A 2J0EA 3OG9A 2B7CA 4IG9A 1C4XA 2QW1A 4R1NA 1A5ZA 4CL3A 1YMVA 2EX4A 3OJEA 4BFCA 2WU8A 8ABPA 4R1UA 1I6WA 3EFEA 1RYBA 1FXUA 1H1TA 3WLHA 1CJMA 1PV4A 1KOGA 4DPMA 5CCBA 1FFGA 1JXAA 1NNLA 1FRNA 1QH1B 1S01A 2I76A 2VNIA 2YL2A 3PHGA 4EVSA 3ZU6A 3BGDA 1YDMA 3VGJA 4EA8A 2VJPA 4DR5B 3ISJA 4ONEA 3DBRA 1UAAA 4QFBA 4B8ZA 3K9WA 1LTHR 3IAM6 3L7JA 3NIBA 1HE1C 4JJFA 2WHRA 1R5JA 2NG1A 5A9SA 3FPKA 4R8MA 1KS9A 1I2CA 1U28A 3FPCA 1LLQA 3M34A 4L73A 4E5DA 5EUMA 5L3QB 1AUQA 1LX7A 2R47A 1N7JA 3GOQA 1A9RA 3FUWA 2IJGX 4IINA 1N4AA 2V6IA 4FMDF 2WZBA 4RGQA 4YYEA 2A3NA 3S4YA 2CB0A 3S3TA 1IZ7A 3C5HA 4NU6A 4JI1B 2QZJA 3WYNA 1TF7A 1HY3A 1JDBB 3GK3A 4MWSA 5I01A 3GMSA 1USGA 4C0KA 4DCCA 2J3HA 3LUCA 2QEQA 3L01A 4YDRA 5JMWA 2A14A 1PG5A 2PA0A 2WJZB 4TMFA 1P9NA 2TMGA 4JNCA 1KK2A 1X8LA 4QXMA 3T5TA 1R6BX 2G82A 3F74A 1PZHA 2ZYSA 3OAAD 4FGWA 3STVA 4G2TA 3H2YA 5BORA 2FE4A 3VA7A 1RZRD 1QS0B 4G23A 2G5PA 4GMDA 4G5HA 4QRHA 3MHPA 4L2IB 3BXGA 5K05A 1MX9A 2BM9A 4WEQA 3LT0A 1E6LA 1E6EA 3LRTA 1RYZA 721PA 4FGJA 2QQGA 3DPSA 4F3KA 4MLPA 1HNXB 2PNFA 1AKUA 1BU8A 1V25A 5IBQA 3PCXA 2Y1OA 2IW3A 3MIIA 3HLYA 4YRRA 4JJ4A 4YMLA 1KRXA 4IKOA 6PFKA 1JRLA 4ZMBA 3TVYA 3DNFA 3AEQA 3MGCA 2GHIA 2F59A 2JLYA 2FR1A 1N3IA 2P9YA 2AKEA 1JBEA 2JCVA 1KAGA 2NVOA 5BUZA 3G8AA 1WKBA 3M33A 4M86A 5AWFC 4BUZA 4CEIB 4QQNA 1FFYA 1UC9A 1AIPA 2WTUA 4G8DA 1JB1A 1P9RA 3BF8A 1PK7A 1D2RA 3SEAA 5A2QA 4JP1A 4BQIA 1QGDA 5JSZB 1JALA 1NLFA 3KXPA 1HDCA 4L4YA 1IBRA 1VHQA 1GKIA 3A6JA 1DEKA 1VA4A 4Q4JA 3SOZA 4IIVA 1KFEB 2J5QA 3L1JA 4CF3A 4FPXA 5C1OA 2XE7A 3K53A 3ECSA 3WYCA 2UZ1B 3Q3VA 3DDZX 4D99A 5EJMA 2J41A 1OXVA 2QZ9A 2W2XA 2Z2JA 3TRHA 4B79A 4EG5A 1S6YA 4IIJA 4W6ZA 4MKIA 3R7FA 1VI2A 1F0KA 2L17A 3LU1A 4X0EA 4MI1A 1O6BA 4AT1A 4OVKA 1EE2A 3CKYA 2ECKA 1XZLA 1EZ1A 3FWPA 3D7RA 1KQFA 3TTUA 2IBTA 2P68A 5DFAA 5CDFE 1GAWA 2RAVA 3S2GA 3KSAC 3MAGA 2DT5A 3ANYB 4PX2A 2ZZNA 2I7XA 4TMXA 3QBJA 1GG5A 4YJ3F 2HCBA 2W6JD 3GAAA 3KL4A 4OL9A 1VECA 1DFIA 2IZ5A 5FR1A 1IWBB 2ZJ7A 5T3UA 3UHJA 3WMEA 1T4CA 3BYZA 1QIKA 1EHCA 4YECA 2R8YA 3H11A 5HQ3B 2VRNA 4BZXA 3C3WA 2PRYA 3E0QA 3NV7A 2V4ZA 4FJ2A 2ZI3A 1A5TA 2PZ8A 2Q50A 1ZU4A 1W49A 2VDNB 4HQNA 2EZ9A 5C37A 2D06A 7AT1A 3R6LA 3DLBA 3IKVA 5HFAA 1EU1A 4C4ZA 2NV6A 3KQTA 3OX3A 4G09A 2HO4A 2PNJA 2BFCB 4CUKA 1DS6A 5B1YA 2QR3A 2ZJYA 1FDRA 4RS3A 4OGGA 3ZDRA 3DEJA 2WNSA 4P54A 5AXCA 2B5OA 4Z9YA 1HLGA 2WV7A 1U2EA 3BDAA 3M0EA 1G5HA 1PLJA 3OPYI 4LKRA 1FXSA 4O2AB 2ORED 4OSEA 4TTPA 4EQ6B 1E9RA 3C3DA 4GX1A 2PS9A 2UUCB 2ZRBA 3KWJA 1QLWA 1FFXB 2H0AA 2INGX 4IIDA 5CT4A 4YP6A 1EQUA 1VLZA 2RHLA 2VJAA 4B76A 3THYB 1EINA 1NNUA 3QSGA 4N5LA 1A9XB 1PT9A 4WA8A 5AUPB 3W4IA 4EF4A 3O2JA 1IY0A 1U8AA 3AC0A 3GRCA 4G1UC 4XWOA 2J7PA 1ETHA 1U4SA 3ENVA 4EABA 1M75A 1LLCA 2QRKA 2K87A 3LOQA 4QU9A 4ZQCB 3RAFC 5A0VA 4DC0A 3PDCA 3Q12A 4UPDA 2RBEA 1ECGA 5JPIA 2OCAA 1T9GS 3RKRA 3E81A 1CY8A 3G0OA 2X14A 2X19A 2ZRLA 4KXXA 3PFNA 4H4DA 4FSHA 4DLPA 3D7KA 2PPVA 4MYSA 3IB6A 3IRVA 4CG0A 7GPBA 4US2R 3FYUA 1BA2A 4B4DA 5ICSA 3E27A 3KG2A 3O73A 4TLDA 1VPVA 3H05A 5B4UA 2EG9A 2O23A 3CSUA 3FB1A 1RQGA 3K96A 4KR7A 1CF2O 3RS5A 3L1IA 3T8YA 1QGOA 4EG0A 1SUFA 2FP3A 3L7IA 3FYHA 3PV0A 1W94A 1HZZC 2CWWA 2BLLA 2EJUA 5LZ8A 4B2IA 1E9VA 4Q05A 4PHHA 2QVXX 3CUWA 4A0GA 1EUZA 2YYZA 3WGVA 1R66A 4JUCA 5EHIA 3SJUA 4KPUA 1Z28A 5HEKA 1BFDA 3K09A 2DF8A 4CM3A 1BHQ1 1OYOA 1AS3A 3M6LA 3PQFA 4LF4B 1HYQA 4PPQA 3V2IA 1M0EA 1BN6A 4D4KA 2Q2QA 1V8FA 3CLSD 3GLIB 1G9XA 3QIAA 1M83A 1EX9A 1YZYA 5LOVB 4IH1A 5JQGB 1F5NA 1M6EX 1UBMS 4XGRA 3D5QA 2BH9A 2QJRA 4OHWA 3HDHA 1U3UA 2QTVB 3KO8A 4HAIA 1TK9A 4HMQA 4UVHA 3VC1A 2H51A 5DGHA 2ESRA 3A9CA 3C8MA 2WD9A 4CM1A 1Y1KE 2IZ0A 3D5EA 4QOGA 5SYAA 1MX3A 3WYEA 5IX8A 4TXMA 3IELA 4TXNA 4CM9A 2BSXA 1B23P 3H6KA 3Q88A 4WECA 3GHHA 4LVNA 5ILQA 2I99A 4B3BA 4H60A 2AMJA 2J85A 2JIMA 3QKSA 3KQPA 4JYBA 1ZONA 2CEKA 5IKXA 2YKGA 2FFQA 4ME6A 1JPUA 3KHTA 4HS9A 4K8OA 2E4YA 5ADVA 1D04A 1Z15A 4J7CA 3VSDA 3BB1A 3FTEA 1NQWA 1BA3A 1S96A 3RYTC 1DKUA 3VR5D 1SXHA 2XCIA 5KNCA 1ZSYA 1H6CA 1OAKA 3LCRA 5IS2A 1DJPA 2RHOA 3B5IA 1V3QE 5AQEA 5EZYA 3R7NA 4FDLA 3MM4A 3OETA 1OAOA 3SSAA 3BXOA 2YDYA 2WIDA 3O84A 1U3VA 1PJ3A 1BH2A 1LDEA 1QTRA 3QMVA 4PLTA 5KU7A 2BMEA 1MORA 4HKTA 1KJNA 4FDVA 3HYSA 4Y2YA 3OZRA 4KSYA 1BFKA 5AKKA 4MB6A 4F7DA 3T1QA 3ZJVA 3I45A 3W04A 1COWA 1I0LA 2FK7A 4YGYA 4WXMA 2JGKA 3USCS 3GDOA 3J7AC 2VZ9A 3OJWA 5B3LA 1YS4A 2SKCA 1FMFA 4F3RA 2FFHA 2QPLA 4BQSA 3GVHA 3T38A 4DG5A 4FB5A 1SUSA 3CUVA 1G38A 1EUQA 2PR2A 1N1MA 2B1GA 4JEIA 4QAQA 1WZNA 2X4GA 1X7GA 3AFNA 2UXCB 1RTTA 2PUTA 3W78A 4DUGA 2ZUUA 2IELA 3INRA 2C59A 5J2UA 1VKJA 4UEOA 5HGJA 1GCIA 3B8HA 3TW4A 1OXBB 2PLAA 4GWGA 4OOFA 5EFOA 4LE2A 4RY9A 4LJ4A 4QU0A 2X5KO 3OIGA 4O8ZA 5EEGA 4BDSA 4E21A 2CLDX 3A3PA 3TVDA 3V8RA 1U94A 4JGIA 1PIWA 4C21A 4ZVTA 4XWWA 2EKQA 3ZY2A 1WZIA 2AUNA 2XNJA 3H4IA 2JLUA 3EIOA 2ZRGA 4BVGA 5GVRA 4NBNA 4AUEA 4DUPA 5IT5A 1N36B 2WUVA 2Z2YA 5DM60 5C8ZA 4I55A 2W22A 4LDZA 1QSGA 1O03A 4EKGA 2C3MA 5AVOA 3H65A 4CQLB 4DMHA 4YP0A 1P19A 4R1QA 2BI8A 1M54A 1R6AA 3WJ2A 1GTZA 3MIZA 3WHIA 1Y8QB 4YREA 2DXIA 3ENZA 1J49A 3HBFA 1Z7BA 1H8EA 2YZKA 3PGKA 5JFGA 2FEKA 4ZK2A 2H1SA 1Q0UA 1M8JA 1GUAA 3FZGA 4KG7A 3UH1A 3LTNC 4B4UA 1E3TA 4S0ZA 2E4AA 4OP1A 1UQUA 3CNLA 2HAEA 2E9SA 4BNDB 3JQ7B 1QLHA 3OSUA 1NG1A 2BMDA 3G6KA 2IPAB 3LGXA 4IXMA 4W1SA 1QIGA 4Q3OA 3WGYA 2OZEA 2Y2VA 2ZRPA 3CB4A 1W0KA 2FF7A 1M9NA 4BEVA 4R2MA 5HP4A 2EDAA 5C1IA 1TEVA 2QN6A 3NFYA 2YYSA 2J87A 2WINI 2IH4A 2RARA 2ZR8A 4WTOA 3LLUA 3TYXA 3UWOA 4DV2B 1GNVA 2UZ0A 5CDSA 2OXRA 4UAUA 2F1KA 2Y68A 3IHLA 1UDAA 2QG6A 1TQ6A 1B26A 3OD1A 4P31A 5A7GA 4A8PA 4MHSA 2J0UB 4XYBA 3KT3A 4QPJC 3KALA 3CH5A 3DVAA 2VF7A 4RMHA 3S2IA 1GZVA 2F9MA 3OHPA 1U1CA 4FMBB 4HGOA 4D6YA 1FNSA 5IK2D 3DVLA 3FRJA 3OEHD 3QUBA 1RAIA 2GSDA 1E0AA 1AZSC 3R7AA 1H8HA 2XE6A 2ZB7A 3JQCA 2FK8A 3W5JA 1X9IA 3DT9A 3AM4A 1U8CB 4E5VA 2BFDA 2HHCA 1A95A 1QHYA 2G77B 4L85A 4W7SA 2BGLA 3VC2A 4ARZA 5C3MA 4MOWA 5BR7A 3SJZA 2BZ0A 3GNQA 4LZLA 4PYMA 4CQMD 1RXWA 1X2EA 3WX0A 3ND5A 4E4YA 2GH1A 1UJCA 3JQGB 3IMGA 3OLYA 1YFJA 3K92A 1L4HA 3VSEA 3EF0A 5KSYA 1DX6A 5AI4A 4C7BA 1LB1B 1RAEA 2GSWA 2NSDA 5EP1A 4EB6B 3KB8A 2PG3A 1E7RA 1QHHA 1T91A 4Q47A 3TD2A 3NHPA 2RE8A 1U2GC 3TLBA 2X4LA 1THGA 4DBVO 1GV0A 3UOAB 1RAFA 2G0NA 1IB0A 1V35A 2OBMA 5DBOA 2E4XA 4M3NA 1T9DA 1Y8CA 2X0IA 4FCTA 1A8UA 1AKTA 4B4VA 4KPEC 4Q4LA 4U0JA 2F4NA 1GZ6A 1HQKA 2BD0A 3DEZA 1GHTA 1UBJS 3ETHA 1XCOA 2ZUFA 3TZBA 1TA4A 1OE0A 2Q9BA 1T5LA 3OQ6A 4L75A 1OR8A 2JIRA 1G21B 3A70A 2FJPA 3DFIA 4XUCA 2VSOA 1JB9A 3EVNA 4M0UA 1EPUA 2P5YA 1Q19A 1E58A 1KEUA 3QBEA 4HAZA 4YMIA 1GADO 4BX9A 5IBPA 4WZBE 1H5NA 1W0JD 1MJGM 2XD4A 3DYBA 5A3VA 3MOGA 3W8RA 5LXTF 2GDJA 3MJFA 2W2LD 4DC1A 2D2XA 3DBVO 5DP1A 3F2IA 3GL9A 2HU8A 2FXIA 2I6QA 4HJXA 4BNVA 4LDNA 2PJZA 4MYCA 4AMGA 1K4MA 1VPWA 2RG7A 4O4IF 3FX2A 1TRHA 4P0TA 5JJIA 4NE7A 3PHBE 4PGGA 2RGAA 1D0VA 2F17A 2JGRA 2B4QA 4QYXA 5LBTA 4YASA 3DKKA 4YRIA 1C0PA 1XZMA 2LIVA 5JU6A 1R9JA 2Y1KA 4IDEA 4KE6A 5GONF 3L8ZA 1GNLA 2WB4A 1HTBA 1LV7A 4CU2A 5JC1A 1N9GA 4EI7A 2OZKA 1T2CA 1G63A 3DYIA 3I6MA 3T9EA 2ODTX 4FKZA 3QEJA 4MUGA 4QUAA 3HCWA 2ZJAA 4PVDA 2F62A 4LDPA 3SZOA 4DE5A 1DG1G 1ZGGA 3H86A 2JLAA 2VDKB 2C9DA 2FSVC 3K4PA 1M72A 3U5ZB 1H6AA 3UOGA 2C54A 4N3CA 5I7VA 3WWEA 3VAYA 4YUWA 2EATA 4JC4A 4GQIA 1VKNA 5T64A 2IT1A 2PZGA 3ABIA 3MXOA 1FP4B 1DL5A 4Z0PA 1O96B 5AJUA 3JASB 3IDAA 3P97A 2NT4A 4H3HB 3TI9A 1HQYE 1PFKA 4HPJB 3U40A 3SK0A 2I8AA 3V8MA 4IIGA 1JBKA 2XLCA 3FTQA 1CLUA 1X1EA 2B37A 1FA9A 1Z6ZA 3E9QA 4GM0A 4B7ZA 4EHKA 1TT5A 4B2PA 1PW7A 4TTRA 4PXAA 3G2OA 3GMTA 2WJ6A 3SOPA 4CMJA 2AW5A 1CF9A 2O2XA 3LPMA 4YXWD 1PQUA 2L82A 5IN5A 3EWAA 1FRFS 1FX1A 1SHJA 2G80A 2GFHA 2GN4A 2QNBA 3AY0A 3TXXA 3KX2A 3JAWA 3G7UA 3ICOA 1QKIA 5CT6A 4EAAA 2I29A 1P7PA 4HH4A 4R1LA 1XTJA 3AFGA 3WLTA 4EMUA 4FSXA 1AN9A 4IEFB 1PV1A 3AEYA 4H1TA 3K1YA 3BAFA 5FBLB 1WKCA 4NOMA 4J2HA 4KREA 2GD0A 1P1BA 2E85A 4PYKA 4KSBA 4AJOA 4GVLA 1G1AA 1X1DA 3IKLA 4U5XA 4G37A 1DO0A 1GGJA 2BL4A 1KC3A 2DUMA 1EWQA 3AKEA 4EWLA 1XHEA 4Y1RB 1ENYA 3GC6A 4KWHA 4TV8B 1ISHA 3WWYA 4LX0A 1IONA 1NUPA 3D8TA 3PFIA 5FLYA 4P4TA 3NHSA 1TM2A 3D64A 4DDTA 3I6BA 1I6MA 2BN4A 2FUKA 2ZBDA 4ROTA 4FWTA 1H2AS 3S70A 9GPBA 5HJ5A 1DAFA 4DDHA 4TKVB 3L8FA 4TTTS 4XIFA 5HIIA 4DLKA 2EAUA 3PUJA 3ZVKA 3RC7A 2DR3A 1PDOA 2WSBA 1NNEA 1XKLA 1JJAA 1RYHA 3LNCA 1GVNB 1V95A 4JX8A 3HDGA 2YVLA 3IAAA 4KVFA 4MYDA 4AKTA 2NPFA 4X66B 2XJ9A 3FN4A 1DAPA 5KYUA 3F7NA 3ECAA 2ZIUB 1HRDA 5K7SA 4HMPA 2IHUA 4WJKB 2RKBA 3NCTA 2QB5A 4TLEA 4Z7JA 3DHVA 1I32A 3RT7A 5DM2A 3STYA 2IPMA 3DKRA 3EVTA 3FKQA 4XQEA 1JEQB 2O8VA 4R2XA 3IXQA 4YRKA 3QVXA 3TPFA 4HC4A 3N8IA 5KCMA 2ZZMA 3K8OE 3CYFA 4FN4A 5E7JA 4CT0A 1JEJA 1FLVA 2X6TA 1R0BA 3A4TA 2J09A 3CKKA 4B4WA 4DSNA 5JPCA 2PUWA 2ZCJA 2QRUA 2GX6A 4MDHA 2WYHA 4DADA 1DRVA 4PIMA 1F2UA 4Q9KA 3K72B 5CURA 5E6SB 5BSRA 3IEIA 3TINA 3UJPA 2P3OA 2KBEA 4LMAA 3IA7A 1KK3A 4ALNA 1WETA 2COKA 3CLUC 3G8DA 1BMFD 1G8HA 2Z5LA 2GK6A 2RC6A 4RGVA 5HWSA 3DLTA 1YA6A 2FSHA 1O95A 2CDNA 4IZIA 5FWNA 1DAOA 2PMEA 4YMHA 1P2UA 1TU0A 3BWYA 1NBEA 2HJGA 3KZKA 4TYWA 4OQZA 3CJQA 3HU2A 1QGUA 1O57A 1YB1A 2P0AA 3BG5A 4AF8A 4RTKA 1R5NA 2V0GA 1PFWA 3KFLA 4FE3A 1P5FA 2J67A 1CZNA 1YT5A 1N32B 1C8VB 1CZOA 1JU3A 3GAMA 1R9GA 4GR4A 3HVJA 4EFKA 4GSKA 2FRDC 4B5LA 4JI8B 3NEYA 1K3UB 4OQFA 4X3PA 5EN4A 1CJCA 2ZPUA 2KJQA 1NMQA 3GDWA 3NIFB 1KMCA 3BA1A 2ZYWX 1G64A 4MLDA 5H82A 2BSQA 4RVGA 4YY3B 4C4YA 1FX0A 4P4GA 1BZYA 4LCJA 4V0ME 2NYAA 4HX5A 4WY5A 3C6XA 4UHEA 3H1EA 3GRUA 5DI3B 1WD5A 3I3OA 4JCCA 3JQPA 3ZWPA 1MC4A 3BXHA 4IWXA 4AY2A 1OVMA 4LV5B 4OBXA 3KKLA 1N2XA 3CE9A 1NXTA 4F6LA 3FDZB 1Q0LA 5IM4A 4A16A 2P35A 3DE1X 4YRZA 4EP1A 3FLMA 2BKAA 4MGIR 2OT3B 4RSHA 3OT4A 2HQOA 3VR6D 2ZRNA 3DTTA 2KWIA 1C7IA 4M1EA 1ZVMA 4AKSA 2WU1A 3DV0A 3OPYB 4NRDA 3OCCA 3P4YA 3JYPA 3HWX1 3KKMA 3VJMA 3DZBA 3BFJA 2I3AA 1TKBA 4HR7A 5EMMA 3ZWNA 3LC7O 5FULA 3V8EA 3ND7A 3OF2A 4K9RA 5GJVC 5B55A 4YP7A 4DR6B 5IEJA 2PUAA 1N6OA 5K6AA 1DC3A 2IYXA 1GYRA 1CY6A 2XYHA 3IO5A 4I2VA 4JJZA 4XD7A 3BXXA 2O2DA 3ROTA 4WJLA 1QQ6A 1ODKA 3BH7A 5CVCA 1U98A 2BCGY 2NO0A 1R4MB 3KIPA 4GNRA 1L6IA 2Z2KA 3JPYA 1UBHS 2FU5C 2HDHA 4TQAA 5GP1A 2J0QA 4EY3A 2CXOA 1BGWA 5DHTA 4HX9A 5DLQC 4C3ZA 4DNXA 4I3FA 2VJBA 3R6WA 2QR5A 2X41A 3Q1KA 1I6KA 1KJ9A 5DRTA 1XTTA 4H7KA 2C7PA 2PMFA 2JI8A 3GRZA 5KKAA 1LLDA 2GZ2A 2VHWA 1KI9A 3KCQA 2W11A 3R3XA 1QJCA 5ES3A 4MPJA 2UZIR 4Q4DA 2XEXA 4MAMA 2WBLC 2MTBA 4YLEA 3BFPA 3COVA 3T5DA 3H5LA 3R3HA 3T3IA 4BNKA 4JQOA 5EA2A 3E22A 4JZYA 2YJ5A 3L49A 1TJNA 5E9JA 4QPCA 1Q74A 3CRQA 2VDOB 3G2LA 3ZXSA 1RI1A 2XXAB 2R5NA 4WKGA 1RSZA 1F7UA 3SQXA 3JR7A 1PNTA 4RETA 1GEGA 1CUWA 2OWDA 4NE9A 4NFLA 4AROA 4RLHA 5JQWA 3ADCA 4CTMA 3O3OB 4I7EA 2AMFA 3JQ9A 3LL4A 4EY7A 3FF4A 1RRFA 3LRPA 2XCSB 4QYTA 3B1WA 5J5CA 2WR8A 3O3NB 2HA5A 3WB1A 5BRAA 2D0PB 4JQYA 4KQGA 3JZAA 3RFCA 4DG9A 3MUFA 1PT6A 4BVLA 5HKBA 4HOYA 3UT5A 1H22A 4M46A 1PEYA 2ZPTX 3FPLA 5JISA 3DO5A 1WG8A 3PEEA 1CQWA 2IE0A 4NBRA 1ORHA 1JDTA 4MA5A 3LUAA 3UK2A 3ZWMA 4ZHQB 5FJIA 1U7PA 2A67A 2X5JO 4NECA 1S8OA 3A4VA 4J75A 1JIIA 4EB0A 2HPZA 1HMYA 1SHKA 3FPGA 4X94A 4HNRA 4CV3A 3HY4A 2R87A 2HU7A 3GGSA 3OZ7A 5K0NA 3ENQA 1LNQA 3IE0A 3QE2A 5BV2P 3A2MA 3E7WA 1Y5RA 4M9QA 4RE6A 4YC7A 4BJ1A 3U3KA 2CV2A 1S3FA 1FPQA 1EX7A 2MSKA 1ZJ4A 4TQGA 5FTWA 3TTTA 5JD6A 5KEIA 3QEAZ 3ASYA 4XCVA 1L7PA 2NQ2C 3CLTC 5JVDB 3UV7A 1DIRA 4BP1A 3B1XA 4IRUB 4BMNA 2AMVA 4R2WA 5JZOA 5T8KC 1Q3HA 4P35A 1T25A 3LVBA 4HDAA 3RLFA 3QKWA 1HKHA 1PBTA 1JHRA 3TRDA 5JTTA 4WLVA 4BATA 3AVWA 1U11A 3EF1A 4IGKA 3O4IA 4NV1A 3NATA 1Z08A 5KSWB 1E4EB 4GUAA 1IN5A 2JGNA 3B3AA 1NNSA 2HA3A 1M6HA 3BRSA 3IT0A 2R1VB 1ECJA 4RHEA 2CK3D 3VYSB 4J0FA 2PYDA 3CUEF 4WIAA 2A8YA 3QV1A 5E2BA 1XDGA 4ZWNA 3V33A 4C89A 2FQYA 5JDCA 4JH0A 4A15A 10MHA 3F3MA 2IS2A 2Y9MB 2Y67A 4OA8A 3LYAA 3O8OA 2XNSA 2OQVA 4L3OA 1YRLA 3USZA 4KLNA 3VDQA 5JDIA 3WL6A 1QP4A 5CVJA 2P9QA 6REQB 1UBSB 4DMLA 2DZDA 3D8BA 5BV1A 5JANA 1GFWA 4YA6A 1WW2A 3G9UA 5EJ6A 5ARDA 1GG8A 5IZCC 3FNEA 2WG0A 4E1BA 3T5AA 4GRIA 4DV4B 3UB3A 2GZSA 3R5JA 4OHPA 3Q98A 3QUAA 3HEAA 2WOOA 1SHUX 5I47A 3A6KA 4Z99A 2QX9A 3HBAA 5AVRA 4BAGA 4KLAA 2AZTA 4R05A 4XX0A 3M5DA 4IDNA 4IWYA 2HT6A 4XJXA 3SVLA 3VNQA 1UKEA 1ZGBA 4NBWA 3EVEA 1CR2A 5ALIA 4DSOA 2V0NA 2OOKA 4JL8A 5WRFA 4BMVA 4Y18A 5I7SA 4TZKA 1Y6JA 3EN0A 3OC0A 3EY9A 5L40A 2RIRA 1MTZA 2BEVB 1VPEA 1WL8A 3P0FA 4RPIA 2V7BA 1KK1A 1X7WB 3QWHA 4M9ZA 5JIBA 4X1YA 4MA0A 4L78A 5AM3A 2CNBA 3CGWA 4O1IA 1DX9A 3VR4A 4TL9A 1PTJC 2ZE6A 1VHJA 1U9CA 1XCMA 4KSCA 3TH5A 1FNBA 3K0HA 3X44A 3KQLA 2PA3A 5SZJA 1HI9A 1OLUB 2APJA 2E5WA 2JD2A 3PF9A 2X9GA 1U2DC 3GN2A 3AKZA 3EGCA 5JD4A 3ONDA 1KKMA 2GO7A 2LCIA 3LGAA 2X4IA 3ZDEA 5HJ2A 3OZDA 1LRJA 1P44A 2H5EA 4FGUA 4D9NA 2PSSA 4Z4IA 4KN5A 2AUMA 2ZJFA 1CIPA 1JDBC 4H7HA 2QV7A 2LKCA 3SQDA 2IYTA 1IHYA 2AKYA 2B82A 2GR9A 4ETMA 4LYHA 4M55A 4UM9B 1W96A 1JFRA 1FYWA 2BF4A 2HCRA 2I3ZA 1PTKA 2UYQA 2XITA 4NZPA 5FQNA 1QB8A 3DTVD 3K0CA 4DXDA 4KUEA 2FRXA 2JH3A 5FTMA 4Z53A 4N7JA 3QVJA 2DPGA 3OZFA 2FPXA 1Z25A 2CDAA 4FXOA 4OK3A 3SYRA 4F0JA 3BSSA 5IBRA 1REQA 5B6PA 3IMCA 1U0NA 3LNTA 2V55B 1M1YE 1KTIA 1J2EA 4ND7A 1BQ4A 1RXEA 3U9LA 1K0FA 4DY4A 1L4FA 4MICA 5JASA 3A1UA 4RK1A 3ND6A 4N49A 1H3EA 4OFXA 2W2PA 2ZROA 2GBIA 2WVAA 4YDQA 5FBZA 3TQHA 4BO1A 2G07A 1IN7A 3CLRD 4UAJA 4EHNA 1SCUB 1Z2NX 1NONA 1Q1BA 1B2RA 2CLLB 2G40A 2GDZA 2FUG1 2IEBA 2ZE7A 3EVZA 3Q3JB 1PJQA 3DNPA 4HAYA 2GF0A 4HV4A 4P0PB 2OBBA 4BCDA 3JAMA 5JXIA 3T3HA 2ZS8A 1Q44A 1VG1A 2J6HA 2NGRA 4H15A 4H7PA 2Y8EA 1THMA 2PUDA 4RWEA 3X2FA 4ZVQA 2XJ4A 1KDVA 1A4RA 4US0R 1H5QA 4TKLA 1UKAA 3R3YA 1MEOA 1LPNA 1W4ZA 2O07A 2Q3LA 3MWFA 2NSHA 5B58T 2PL1A 1JZSA 3VYRB 3IJEB 5CDUA 1UINA 4PC3A 3W2TA 4FYJA 4PRLA 4FWIB 3C4VA 4WLNA 4C3OB 4OGKA 1GDTA 4TWRA 1VE9A 4IDCA 2VL7A 5HNKA 5DHSA 3ZX5A 1Y34E 4BKRA 3CKMA 3BJZA 4D3DA 3H9GA 4HN4B 3GLKA 4ON9A 2GEBA 3UFXB 1FYDA 2JK0A 3OUUA 1JP7A 2WSMA 8LDHA 3QXGA 2H1HA 4N0QA 4RTOA 1D07A 1U8EA 2M6LA 4WZAA 5LWHA 1YR1A 3HSKA 4HX2A 2Q4DA 2OZLB 3HWSA 3ER9A 4Q00A 4W1PA 4B84A 1UPXA 3JQDA 4FZ5A 4NJEB 1KI6A 4C04A 1NTRA 1NYQA 3WYDA 1EZ4A 1SXJE 4YWHA 3KDSE 4LPKA 3VBEA 4BQRA 4CTNA 1ZINA 1LQTA 4ZYTA 1RXVA 2QX7A 1HOTA 3LYLA 5AVJA 2FLKA 4EZIA 2CSUA 5E6UB 5EL0A 3UTCA 4BXOA 2ZFUA 1C9EA 3UUEA 3BGOS 4R0VA 5HYVA 1C0IA 2QX6A 2ZSBA 3SHVA 4DWOA 4YRMA 1WEHA 2P11A 2PO5A 4IFEA 4U63A 2DQ4A 5EMHA 4MR7B 2DWUA 3LFHA 2WG1A 1YZNA 3UXHA 4RY8A 1XMJA 3O26A 1TKAA 1UK9A 4G67A 1UDXA 3MWDA 4AURA 5C5IA 3ZOKA 3D1LA 4FNOA 2H52A 1PWXA 1E0KA 1O94C 2DULA 2Q9UA 4JLWA 4PNZA 3RWOA 4R71A 3ZZTA 3N3AC 4WE3A 3IJPA 1HM5A 2ZUCA 1BCRB 5ALDA 1OLXB 2AOUB 4N5IX 3I2HA 2J0SA 1E2GA 1OBOA 3FE2A 1UFRA 1RKVA 1MLDA 3LHFA 2ZXUA 5AKIA 4M9RA 5CNKA 2CN1A 1YOVB 3CW9A 3GLHB 4AZWA 2RGRA 4Q9NA 4RK7A 4ZKDA 2HQBA 2B8TA 5K8IA 1LSJA 2HJRA 3HJAA 2Z8YA 3OE7D 1P1FA 2R6AA 3R4VA 4N82A 4NOKA 3VC7A 4FEGA 1OV6A 1AGPA 1L3IA 2C5FA 4X1IB 4CLOA 4EGQA 2ZJOA 5ED4A 2HSDA 1BN7A 4MYTA 4Z54A 2BHSA 2G7MC 4OJKA 1DKPA 3TUIC 2VK2A 2DH5A 2DCUA 2QRLA 3S2SA 3WRWA 2FWBA 5ECGC 1RRGA 4WI1A 3B6EA 2WLTA 5C53B 3L7MA 4CJXA 4WLUA 3WS7A 2FW0A 1SELA 1N5DA 4UAVA 1VLHA 2X77A 3B36A 1F38A 1TB4A 4NONA 1EE1A 2CZGA 1SR8A 3GGGA 2BFFA 5HS4A 4QVIA 1T15A 1GPAA 4C4AA 2CV1A 3HCPA 4M7OA 3ONVA 2PUHA 1ZN9A 4PONA 4YJ2B 1N4DA 1WY5A 2Q21A 2Z2IA 1YRWA 2FXVA 1CE8A 4K40A 3ZWYA 1FSFA 2NACA 5EKSA 1TCBA 1CEXA 1Z8NA 2OBFA 1R37A 2Y1WA 2YRWA 3Q5EA 4BMZA 4C43A 1CVLA 4ZMSA 3C85A 1DIBA 2G9QA 1ZD1A 1ZCJA 1OX4B 3NYWA 5B53A 3STXA 1JEDA 1AHNA 4G63A 5IJWA 5LQCA 4KVGA 2DKOA 2CUKA 2Q2WA 1RKBA 2CVZA 3RUAA 3ZJ5A 4IZOA 5EXPA 4QEKA 3HZOA 3OSZA 1U7HA 3H1PA 1VE3A 4D42A 4R6XA 1A8IA 1TEZA 2A5GA 1VGVA 2P0EA 1OPRA 1NUTA 2YWEA 1N8KA 5IJ9A 4I5FA 4L5CA 2I3BA 2GZAA 4RABA 4F60A 4I1YA 1EK2A 5EUQB 1U0RA 2TMDA 3LA8A 5LPNA 5LM3A 1BDIA 2IIQA 4DTIA 3ZY5A 2R4UA 1R10A 2WF9A 3P0JA 5EWMA 2CXXA 4BX8A 2EKPA 1Z6TA 4P34A 1O0SA 3A9UA 4XVHA 4AY6A 5FRDA 1AKEA 1PEDA 2HK8A 3CPHA 4RDCA 2QM8A 4PCAA 1MA0A 4L7QA 1IE3A 4UOQA 4O63O 2IOQA 1KEKA 3OCJA 4WNAA 1D1TA 4FMDB 1C7FA 4V0QA 3BBLA 2HK9A 2XWBF 2P27A 5JRZA 2ZAGA 2BGWA 3GBVA 4PQFA 4NWIA 4PEVA 1NVDA 2GF9A 3KLPX 4B40A 1B8PA 4E2WA 3M9XA 2IZZA 3UHPA 4E31A 4RADA 2OXIA 1DV2A 3NT2A 4L6AA 4XYGA 3K31A 1IM5A 1EB9A 4B81A 1VLLA 4DXAA 5K8TA 4AJ9A 1PZNA 2Q27A 4K03A 4MW4A 4WKPA 1XF1A 5D6NA 4ND8B 5ALOA 3CEAA 2C4KA 1IY9A 3MBKA 1YR8A 3E8XA 4PGHA 4ENQA 1ENZA 3LPCA 4HEHA 4M0LA 1KDPA 1U4NA 3DOOA 1ZK3A 1P3JA 3P5BA 3HQ4O 3G5TA 4JHXA 1BW9A 1V3VA 5CA1A 2XMDA 4UDNA 1E5VA 2EGUA 3CEJA 4R1PA 1JQBA 1XTBA 2AK3A 2WMOB 3ICWA 3KBOA 2B83A 2R7NA 5ES4B 4O3MA 1T9KA 4EZBA 3S27A 5D1HA 1VL0A 2QTLA 2DHDA 1LNZA 1FUYB 3BL5A 4INZA 4XQGA 3LO5A 4L08A 2C95A 5ECWA 3L9XA 1UJNA 3D5TA 3UKDA 2Z4TA 3KYDB 4KX3A 4L5BA 4O0LA 3CNQS 4D98A 1C2YA 2SECE 2EZUA 3GLVA 1U2PA 2EJWA 1RYDA 3E05A 3OLQA 3SEZA 3W9BA 1X7HA 2JLXA 3ADDA 2AD5A 1FDTA 1A96A 1QHSA 1YJXA 2JBAA 4MKXA 3UANA 4F4FA 3QTBA 3TI7A 4ZYUA 1MJ5A 2NO9A 1Z35A 5LMNB 1MHTA 4DT1B 3GN1A 3PHIA 3ROMA 2RK6A 1TRKA 3A4NA 3VFDA 1JE1A 4YO8A 5EJ2A 3MMZA 2Y4NA 3IOEA 2G6TA 5LBIA 1HYEA 1LV8A 5DM0A 3E2PA 2XHZA 1ZD3A 4HY3A 4NULA 2RJ3A 1NU6A 2AYZA 1NBAA 4MYRA 4QX6A 3Q0IA 4S2EA 3BMNA 4WCFB 3AEKA 1JVNA 2NTJA 3FBWA 4IDGA 5MF6A 3H6HA 2R2AA 3LW8A 4ARVA 5KJFA 1CQXA 3WYGA 1UXHA 3OWOA 3B2NA 3QPCA 2R8OA 3FMOB 2GCPA 4AYWA 2C7GA 3D6TB 3UF0A 2Z1NA 4MV8A 4BVBA 4YJ3B 5ICCA 1U7UA 2AG5A 2CJWA 1NW7A 3FNGA 5L3SA 1NRJB 3VOBA 3ZHRA 2W2NA 1E61A 1VMIA 3I30X 3E2IA 3X0DA 2P6PA 1KKUA 3LBIA 4JJKA 3VDNB 4BNXA 4X63A 1NW4A 3M3DA 5JBQA 1Z5GA 2FPIB 2Y71A 3AETB 3LP5A 2QAGA 4G0QA 4D1YA 3FTCA 4MROA 5BT8A 5FF9A 3OPMA 1UK8A 3VMMA 1ZSVA 4W1RA 1AZWA 2GJ4A 1QH1A 4AJLA 1R9NA 1Z6YA 3PJFA 2QVBA 3I1IA 2Z2XA 2HMAA 2WPNA 4KLCA 3UCFA 2YXEA 5C46F 2UXBB 1DMSA 3MHTA 3R3VA 2O5RA 5DNCA 1W52X 3GLRA 3SZLA 4F3NA 3FOCA 1JHQA 4DY6A 1Y4AE 4A0RA 1E2PA 2J3QA 3AVQA 4DARA 1G8YA 3NEJA 2D1FA 4FP9A 5L3QA 4S1PA 4Y6PA 3GNLA 2G1JA 1SXPA 3O7WA 2QNRA 5EHQA 4UQPA 2IHTA 5F3RA 1RW4A 1C9MA 1VXRA 2C1ZA 4CMEC 5C1DA 4FZJA 1UPFA 4QRIA 1S3SA 1QP7A 1RM0A 3DXXA 4XWGA 1TZ2A 5K51A 3RIHA 1Z75A 3W4KA 4X41A 5ALXA 2G9NA 4LDQA 2GBFA 4EYSA 4XIIA 1QH8B 5IHXA 4R4JA 5BOVA 2Z2ZA 2W6QA 5H9VA 2Q3HA 3UTDA 1FS4A 2VBIA 3E9RA 1PNQA 1LI4A 1F2VA 1PL8A 1QS0A 1IRIA 3CT6A 4H1HA 2VFAA 1Q84A 4XXHA 4NBTA 3PTZA 4TN5A 4L2IA 2HYDA 4PSDA 4ZDJA 2E18A 4ZZ3A 2WWGA 4TT3D 1CPYA 1DPFA 3R2JA 2EZTA 2JFZA 3OTGA 1E92A 4FGLA 3AF0A 1E79D 4MVJA 4E5KA 3RVSA 4LBYA 4M9SA 4ZAVA 4CIAA 5LU9A 2BR3A 4Q24A 4RIIA 4WVLA 3P26A 3OEWA 1JFSA 3E9MA 1N8NA 3N53A 4HNGA 3VI3B 4DXHA 5IT4A 1J20A 4RCZA 4DFDA 4A91A 5EGNA 3S44A 5BNWA 1EP3B 5JY1A 2ZTMA 3IAS6 1WVMA 4LHVA 5FDFA 5JSZA 4Y2TA 4MKRA 1NQXA 1NUQA 3AJ9A 4GE3A 4TVSA 4NPHA 2XW6A 3JSXA 4RW0A 1W85A 5EPEA 4FFLA 2FWJA 4LY9A 1VQ1A 2BI4A 2XF2A 4OQXA 4DUYB 3PUWA 1XMOB 4HLUA 2UZ1A 3WK6A 1B8UA 4QYWA 2H92A 2AZ4A 3OCYA 4GI2A 5LIRA 3A05A 4MW0A 3LHKA 2CCKA 2OCDA 3ORFA 5AQ1A 5I7FA 4OXNA 1EAYA 2VHCA 3NWJA 5LQRA 5C8YF 4H7IA 3I0ZA 4QUEA 2FDCA 1B1AA 1Y9DA 2PLWA 4TUYF 3EVFA 3Q72A 4X24A 4MKHA 4ZAXA 4AJPA 3AESB 1KA9H 3FXAA 3TOVA 5FP0A 3I04M 4CI9A 2AN9A 3L1VA 1C81A 3JD3A 5HK8A 1QU3A 5EIWA 2ZR0A 3G5MA 4HTAA 4RCYA 1L8AA 3BGIA 4IYRA 5DTRA 4PV7A 4NG5A 2FWPA 4K2AA 2YVKA 2Z3WA 4C88A 4B2YA 1AQJA 4P3OA 1DADA 1ZRHA 1PSWA 5HZKA 2R25B 5HQ3A 1XP5A 3K9HA 4OATA 1G5QA 5E7IA 2HDNB 4B80A 1ZN8A 1FRZA 3F7MA 4H2DA 1YRYE 4Q37A 3PNBA 1IN4A 3QVUA 5ALMA 3V7WA 5AHRA 4V0NA 3HYCA 3N6XA 3WJAA 5AVVA 1T2UA 2PZBA 4Q4HB 2HDWA 1ES9A 2AG6A 4C2UA 5CFMA 2B98A 3T15A 3KU1A 4AWXA 1JR2A 3DT6A 2HT1A 2BFCA 1RBZA 2QUBA 1Y3CE 1UBCA 4XSVA 3ESBA 2FHSA 3ZHTA 5LU8A 2WHQA 4GLLA 2ZB3A 3E82A 3OKPA 2RGNA 4O2AA 3GLSA 3V6MA 5DLYA 2RKWA 3C3MA 5AHWA 1QZZA 5KPJA 3L8GA 1FFXA 2JCXA 3LRXA 1S0UA 3H2GA 4PAQA 1YFZA 4PC7A 5DOZA 3U26A 4AP5A 1PGJA 5JBIA 4D3XA 2R86A 3SP1A 3PRYA 4P38A 3EMBA 3ESRA 1TI7A 2ZRAA 4JFRA 2D7DA 3RAJA 4WINA 2YINC 1CKEA 3J81A 4HGPA 2Q2NA 1CVRA 3QH4A 2JZOA 2OGZA 2IA5A 4L0DA 1PL6A 1ZK4A 4WOBA 3HKCB 3VYTB 1JG1A 3B52X 3PKZA 4B0PA 1IY8A 2O0HA 1T8TA 2Q1SA 4MVJP 3WBKA 4B8WA 5DGTA 2NO6A 2WAXA 1R0ZA 2GAOA 2W2KA 3CRVA 4NP6A 4QT0A 4M1YA 4WJZA 2PUEA 4G56A 4C07A 2C2KA 3QBTA 4LRYA 1I3LA 5EJFA 4ZVVA 3NP7A 4BV2A 2OWEA 1VHLA 3L92A 3Q0TA 5A04A 4G0PA 4K87A 4BMSA 2PHZA 3NT5A 5HPYB 3L4BA 1K88A 4P9NA 1YI1A 1RADA 4LBZA 2WYVA 1SC3A 2XOKD 3EAQA 4AJHA 1NPDA 1U6IA 4ZCQA 4CMAA 3ZCSA 2G9UA 4CMBA 5TR9A 4JYZA 3HSSA 3BD6A 1AK2A 3K0BA 3MEQA 1F06A 1CB0A 1JFFB 4OSPA 2BVNA 1A71A 3EEOA 5E8JA 4QUDA 3C7TA 5A4JA 4RTRA 3G5AA 2QIOA 4MO2A 5IZ4A 2ZTLA 4AJ1A 5EZQA 4YLYA 1VG0B 1N33B 1Q95A 3TLCA 1ZDMA 1DNPA 4FHZA 2DC1A 3CWCA 3FCOA 3GFGA 3GLIA 3JQQA 2R00C 1YQUA 2RHDA 4II3A 4BGUA 4L4XA 2H4WA 2ZI9A 3F78A 5JQGA 3C14C 2C1EA 3KK0A 4X7RA 4MK4A 3VISA 2ZRDA 2P67A 3CUKA 1XQWA 3VHRA 4KP7A 3KTFA 4IUYA 1JU4A 2W4MA 4FYKA 1GCGA 4NNPA 2IXFA 2QU8A 3CZAA 3GUUA 1GIAA 2ALJA 1XTSA 4NK5A 4QDZA 1XZHA 1L3BA 3HI6A 4D9MA 1WPXA 3RKSA 2JIZD 5BWCA 2QZ4A 3AHJA 2QMQA 2CNWA 3M7IA 3ES9A 3VGPA 2O2JA 2JFYA 2XRMA 3FGPA 4N7MA 3WZLA 4DWWA 3T5GA 5HUHA 1AXGA 1C1XB 3UQYS 5CEFA 5K8UA 1E5DA 4KDCA 2BH2A 2AG1A 1LC0A 4ETWA 1ZM3A 4HWKA 2NP7A 2X76A 1GZ7A 4G9BA 3LF2A 5LMUB 4C4SA 3NEAA 2IX9A 2VZ0A 2WTBA 2H8KA 4ER3A 4EFMA 1TYZA 2OSBA 3D1VA 1RJEA 5LD2B 2I2XB 3ANMA 3EOBI 3L84A 4Q15A 5DN9A 1UBFA 1RXYA 2EGHA 4BN0A 1T9AA 1RQ7A 2PKYX 3C4QA 3B89A 4N39A 3BB3A 4BP9A 4G26A 4ND5A 4BVEA 1NE7A 2ICAA 4CV0A 3FMFA 3H17A 4ODIA 1NRIA 4G0ZA 2IV7A 4GM4A 1DWQA 4MHOA 1SZDA 4LOLA 5B37A 4B8YA 4BFTA 5TJ9A 2R6GA 1FK8A 3CUTA 3DUWA 2ZYGA 1LKZA 5AKYA 4JLSA 2H63A 3ISVA 1W48A 3HR8A 3HABA 4Y1GA 3RBZA 5ICGA 2YIJA 3L0YA 4DR7B 2R6FA 4CIDA 5MN6A 3M4ZA 1A7KA 2OBYA 5EKDA 4OI4A 5U4QA 1J7JA 1PI3A 3KV3O 4JAVC 3OM8A 4IDAA 2W6MA 3KQQA 3SYTA 4L0CA 4K8RB 5J2TF 621PA 1KJJA 3OH8A 4EJSB 4TGLA 5J4VA 2ZUWA 3F1KA 5D1NA 1WMBA 5EZ5A 3RAPR 3DOHA 3CCBA 2Z43A 4AJEA 4BFWA 5HE9A 3U3ZA 2E4ZA 3QPAA 4O4IB 2OK8A 3H83A 4RPJA 3ZE6A 4A73A 4XFDA 3KQSA 4CQLA 3Q0EA 3WQQA 4KQXA 4PSKA 4DMMA 1RC8A 2G1PA 5P8WA 4ZQEA 2QVZX 4U7DA 1Y8QA 1Z29A 2OV6A 2ZQYA 2FG5A 1XLVA 2Y1DA 3N2IA 1FDIA 1RQ2A 5GONB 3CWQA 2WF5A 1ZQ9A 3S7ZA 1IG0A 1U9ZA 2O3RA 1KOFA 2YV5A 3SSOA 3PHJA 3R7WB 2QD5A 3FZNA 3WGLA 3EF3A 1P5HA 2IYNA 1TTQB 3MCVA 4BNDA 2CFTA 1FSPA 5CFZA 3TAHA 3HZZA 1EYZA 1HT3A 4RHFA 5BUCA 4R8VA 1W4AA 2B25A 2CHFA 4OF4A 1TL7C 2EOAA 4R40A 4NCHA 2AR7A 4HXFB 1PQWA 3FSJX 2JS7A 3A4LA 5D87A 2JAPA 5JJBA 1LH0A 3KWFA 1YL7A 4L9AA 4OK6A 1X14A 4NR0A 2WJAA 1RI3A 1RLTA 3MTIA 3KU4A 1ZNXA 4BLUA 4D6PA 1YXMA 1F17A 2FDRA 3KTOA 1FJHA 4UVEA 4NJOA 4OKSA 1B8VA 5FOUA 3MCTA 1Z7WA 4XDHA 4C7MA 4ZI5A 5ARCA 1ODSA 2J0UA 1GGHA 4KRYA 4OA5A 1E77A 5CIQA 1TVKB 3HVKA 4QNMA 3KFVA 1GA4A 4UZFA 2EBHX 1M5TA 3EH1A 1NUUA 2MINB 1Z07A 1X87A 5C4MA 4M7RA 1F0YA 1QCCA 4ALJA 3CNBA 2N1MA 4XIYA 1G7TA 4IS3A 2I6GA 4RENA 2FKAA 2V7TA 2QTRA 2IYFA 3L0BA 4S1VA 1OTYA 4Z9FA 5KKNB 1SBNE 1XWFA 5HKLA 2Z0MA 4JBHA 3MJTA 4MCJA 3QUQA 3RRFA 4Q7MB 1UKYA 5DMHA 4K86A 2PX8A 4OJTA 4HLCA 5I9BA 5EC8A 2L42A 3JQGA 1E2LA 3P0HA 4PZ9A 4PAMA 5KOJB 5FNVF 2FETA 3CZCA 4F86A 4K6HA 1AMUA 2JAXA 2JHFA 2CWDA 4QBTA 5CB8A 1RHQA 2EQ5A 3TBHA 3TTYA 5H70A 3V4VB 1NURA 1U8UA 3N86A 4QPDA 5ANRB 3NBUA 1N8SA 4EFNA 1BX0A 5AICA 2P9GA 2LE0A 1KY2A 1LS1A 4GNKA 2EFGA 5DPMA 3CF2A 1D5CA 4Q9IA 2E0IA 4YT2A 3OZCA 3UMJA 3H6GA 1AQUA 1Q17A 4GW3A 5DK4A 3I8SA 5DN6A 2YMMA 4IBOA 4JP8A 5JCXA 1G21A 1P2GA 4HB0A 4F1JA 1BYUA 1T3GA 3VZQA 1WIWA 1BWSA 2PL9A 4L4RA 1C50A 1PUIA 1JFTA 5KB3A 4OQNA 4YRCA 1WXDA 1IUOA 1DT5A 3MQ2A 4BZQA 4TTVA 3FIUA 4J94A 4MX8A 5DYGA 5I5GA 3UBTA 2GCGA 3D02A 2A5FA 4BLWA 1JQEA 4UBMA 5ED0A 1YFLA 3K0KA 4K26A 1W1UA 2AI2A 3O47A 5ERYA 4B4KA 1U31A 1Z5PA 4W5WA 5AUNB 3KOMA 5IC5A 3B6IA 1CX9B 2I0FA 4XB6B 5CMLA 3W3AD 3BAZA 4NZ9A 2AWOA 2DUJA 2XNDA 2JGAA 3L7NA 4HPWA 4RL6A 3PA8A 2NPOA 5D7BA 2I1VB 5CVUA 2A9OA 3PFBA 4QQ8A 1G8FA 5GVSA 1RHKA 1TLLA 2OSVA 4PO9A 5H0IA 4L0QA 1FVOA 3PUHA 1V3UA 3CKLA 3EQ6A 2NZWA 4MXDA 4R8SA 2H1FA 4ZRNA 4KL8S 3L0ZA 3NYQA 1KSFX 3K2IA 1Y4UA 3IQDB 3LYHA 4BO4A 4BQFA 1GN9A 2GPNA 3HBMA 1KAOA 3GJ5A 3HR4A 4I2NA 4HYEA 1W581 4KDFA 4V24A 2RH4A 4N3NA 1P0CA 2GPYA 2A1TR 3E0XA 4ND4A 1K8ZB 5C7IO 5EMLA 5G1PA 1QTNA 2DLNA 2OEPA 3OEYA 2AX4A 4D9GA 3AUTA 2GVNA 4YDSA 1FBNA 2RHBA 2UYOA 4LQ4A 4J4BA 5FV7A 3G5LA 3ZWKA 2G1AA 1O96A 1HK7A 2YJNA 3IT3A 3JASA 3NWOA 1U2ZA 1Y6ZA 2NYVA 5T5QA 2BP7B 3HBLA 3ONEA 4YT4A 5IG2A 3LDFA 4LJKA 2YIVX 2VN8A 4YAGA 3QXXA 2CXNA 1P73A 4DTCA 3SR3A 2H00A 4F71A 1I6LA 1ZGCA 4X8LA 1BU5A 3OZWA 4W8OA 1JR6A 4NCIA 3JZFA 3A9WA 4P84A 4RO0A 4J91A 3QE9Y 1DKRA 3HJHA 5KNBA 2R60A 4N12A 5EVCA 4MQLA 1JWBB 3ZNPA 1F4PA 3BXZA 4JDPA 1ZWKA 4D9HA 1T3HA 4FFOA 3B5EA 4G0NA 4H0NA 1WKVA 3B12A 3V1KA 4NMWA 2DAPA 2P5SA 2EP8A 2YWDA 4JI6B 2YY6A 4JKOA 4BRZA 2YWCA 1PFGA 1QJ4A 1V37A 3FCAA 3JQRA 3V97A 4DEYA 4LF7B 3O2SB 4N5NA 4DS3A 3FOEC 3VKFA 5A3JA 3JWEA 1XZNA 1L4GA 1L5KA 2CDRA 3NGMA 1HEIA 4GYYA 1FMJA 2PWBA 1ZUIA 3F5FA 4YP1A 1ZW1A 4HAVA 1ADBA 1N5KA 4MZXA 3TDNA