3UUFA

Crystal structure of mono- and diacylglycerol lipase from malassezia globosa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
b'RGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNFDDHQGIYFHTQIGAVMGECPAQVGAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIP1, secretory lipase (Family 3)
publication title Crystal structure of a mono- and diacylglycerol lipase from Malassezia globosa reveals a novel lid conformation and insights into the substrate specificity.
pubmed doi rcsb
source organism Malassezia globosa
molecule tags Hydrolase
total genus 101
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uufA00
1N1MA 1TAHA 2P8SA 3RK4A 4B84A 4TVKA 4G8BA 1EA5A 1R9NA 2WQZA 4C4YA 1CUAA 4Y2XA 3NGMA 1QTIA 2VAVA 2X5XA 5JZ9A 2X76A 4BC0A 4H7KA 3FYTA 4NS4A 5JATA 2XMGA 3VVLA 4ARAA 4QLOA 4UFOA 4PO3X 4BYMA 2C5FA 4GBGA 1XZEA 2XUHA 1ZICA 4PSCA 4IQ4A 4WDRA 4W1RA 2B4KA 3KDAA 3O4JA 3R41A 2Z3WA 1DT3A 2QOEA 5AKEA 3H18A 4GXNA 4BTLA 4UBLA 5CMLA 1AQLA 3AJAA 2RONA 3JW8A 1WM1A 4KAFA 1Q0RA 5JAOA 2H7CA 5FPPA 2JGKA 3C6BA 3D3NA 2ZSHA 1BU8A 4ETWA 4YX9A 4X85A 1UOPA 2WUFA 3FAKA 2D0DA 1MT3A 4Y2UA 4J0GA 1EI9A 1AMNA 1AX9A 1WHTA 2XI4A 5K3DA 2GZSA 5ALSA 2QXUA 3WYDA 1XKTA 4QLAA 1VE7A 3FCXA 1B41A 2XMDA 5DJ5A 2RHWA 5LZ2A 3VVMA 2PBLA 3QMMA 5JZBA 1LBTA 2WIFA 5FKJA 5C8XA 1HQDA 3BE8A 3WL7A 2BGRA 5HQ3B 2PPLA 2QT9A 1DWPA 1QIGA 2DQZA 5AIAA 1JMYA 2QXTA 4K6KA 2XT0A 4MWTA 3A6ZA 1FJ2A 1Q0ZA 1LPAB 4Q3LA 5H3HA 3VXKA 4OB7A 3I1YA 4A23A 3IUNA 2CEKA 4BZZA 5JALA 2WILA 3ZLTA 3FLBA 4FBLA 1X2BA 4FLFA 1K63A 3I2GA 4W1QA 2IX9A 5EFZA 3C6ZA 1MTZA 1Q84A 4WFKA 5CURA 1IMJA 5CXXA 1EINA 2OCGA 5AOBA 5AM2A 2OGZA 2ZVDA 2PL5A 2DHDA 1GXSA 1RWQA 2I03A 4YPVA 4RNCA 3D2BA 2J4FA 4DMFA 3QBJA 3O0DA 5HCUA 4CIAA 5E2IA 3E4DA 1ODCA 2VSQA 5CT4A 4BAZA 1HKHA 1HLGA 4Y7DA 4UBMA 3AZPA 4J0KA 3HABA 5AJHA 2ROQA 3G02A 3S2ZA 4ZRDA 2OAEA 5IVKA 1FSSA 4XIIA 5IH7A 1UXOA 2UZ0A 3ZLVA 1XRPA 2HL6A 2OQIA 1CUCA 3WA6A 2BFNA 3C6XA 4S0XA 3QMWA 1L7AA 3STUA 4QDUA 5AO9A 4KE6A 1QIMA 4PSUA 4H7HA 5ALIA 3ICVA 4UBNA 2OXEA 4PF1A 4NZZA 2ACEA 4FKBA 4Y2VA 5DWDA 2ACKA 4GI1A 1E89A 5DYWA 1UKBA 1ODSA 4HZGA 3ESBA 4MYDA 3VDXA 2B61A 3FWHA 4NMWA 1WB4A 1FFCA 1XROA 3E0XA 2Y6UA 4FNGA 4TPKA 4WY5A 5ALPA 2XMSA 4Y2SA 4JEIA 2FUKA 1YS1X 2PU5A 5EIAA 2VJCA 5ALEA 1CUJA 4DM7A 7YASA 4KACA 1BEZA 1SCQA 1O6FA 3EQ8A 3NWOA 1X70A 4OB6A 4MEAA 4KAJA 2PM8A 4FLEA 2WSLA 3KXPA 1CV2A 1XZHA 2G5PA 2D5LA 1QTRA 4XX1A 2O7VA 2WUDA 3WK8A 1XZFA 2HA0A 4EY7A 2XUGA 1CUFA 4KE8A 4M0FA 4X94A 4C88A 3IUJA 2QZPA 5ALGA 1EX9A 3PICA 4PNZA 1E66A 4IH4A 2XQKA 5FUMA 3F97A 2XE4A 1YAHA 3UUEA 2H1IA 2HA4A 1CUEA 3HEAA 4B83A 2OLEA 1AZWA 1CUVA 5E4YA 4UBOA 3WKEA 5EHZA 2AXEA 3V1MA 2C4HA 4INZA 4EHBA 2CUTA 4F60A 4JNCA 2OGSA 4WDQA 5ALZA 4H7IA 3FYUB 3JWEA 3WZLA 4EY5A 5A7FA 3A2NA 5JD4A 2QVBA 3BDVA 2GBCA 3EIOA 1QO7A 1UZAA 4BBZA 3DD5A 1CUZA 4KAAA 2HFKA 3HSSA 2Z3ZA 4FDMA 1AURA 2PUJA 2JGEA 4AO6A 4OPMA 3HZOA 3IVMA 4BC1A 3KD2A 2WIDA 1N5RA 1XFDA 1ZD4A 4IHAA 3EQ9A 2HHAA 1VLQA 3G7NA 4X91A 4JUIA 3RARA 4N8EA 1EDEA 4B7ZA 1IUPA 3GUUA 3H17A 4ZV7A 1H23A 4HXFB 2WHPA 1CUSA 3NOXA 2QUBA 4M0EA 4X97A 5ALFA 4LIPD 3DQZA 5ALUA 1BCRA 3WYNA 2WU4A 1R9MA 3PE6A 4LYEA 1KU0A 1A8SA 1EK2A 1TQHA 2VEOA 1THGA 1MAAA 1MO2A 4L3WA 1LZLA 1SCKA 1CUGA 3FCYA 5I8PA 5ALDA 3F98A 1YA4A 2YASA 4M0MA 5DNWA 2GYWA 2WKWA 3G8YA 2V98A 1Y7HA 5DTJA 2AJBA 5AM0A 4UUQA 3WKCA 1SOMA 3CN9A 4MEBA 3W05A 2R8BA 3WK4A 1UK8A 2Y1KA 4G8DA 4KJXA 1G66A 4I3FA 3TRDA 3O95A 5AOCA 5EIHA 5DNUA 3E3AA 2RGUA 1K4YA 3IUMA 1ACJA 3B5EA 3QVMA 4J0IA 2LIPA 3QPDA 4BATA 1XQYA 5D6OA 1RP1A 1U4NA 5AKZA 3I1IA 5JARA 2HA2A 5K3EA 4DNPA 1MU0A 2CB9A 4BDSA 2NW6A 4QDOA 3VJMA 1W52X 1WHSA 3SWWA 3BL8A 3H04A 5ALVA 4BRSA 5ALKA 3E1GA 2JGLA 5HKBA 1VOTA 1IUNA 2GYUA 4J03A 2QKYA 2AJLI 4RGYA 3QYJA 2XLCA 3FSGD 2XUQA 1U65A 4C4ZA 5CBKA 4X3CA 5ALJA 3W9UA 2YH2A 4AX4A 4AB1A 2H7XA 4DMKA 2ECFA 4ZREA 4K5QA 1F0NA 4DNFA 1MX5A 4HS9A 3GA7A 5FV4A 3M82A 3ILSA 3WWCA 4FOLA 2XMRA 2XUDA 1P0PA 1FFEA 3PFBA 3R3XA 4EY4A 3H2GA 5BOVA 4X90A 3DCNA 1VA4A 5K5EA 2Q0XA 1LGYA 2HU8A 4K2AA 5AM4A 1K5PA 3V48A 4B9EA 2BUBA 2HU5A 3MVEA 3BIWA 4FFWA 3C45A 4DYHA 3VISA 4G5XA 2WFMA 2WJ6A 4W63A 5HF8A 2WG2A 2RHTA 2QR5A 3W06A 4KE7A 1XZDA 4MJ3A 1MNQA 1KU6A 5AICA 5AH0A 3WA7A 1CLEA 4MXDA 4UHHA 1BN6A 5HFNA 3AZQA 4EY8A 4Q05A 4PV7A 5ALOA 4FNMA 3RKSA 2VQ6A 3HRHA 1XZKA 3BDIA 3DL7A 5LP1A 2OGTA 3WLAA 5JAPA 4ITVA 5HF9A 3IIIA 5KBYA 3ANTA 4G4JA 4K6HA 1QOZA 2WIGA 5FLKA 2JEZA 5J3JA 4I4CA 4B6GA 3OM8A 1XRLA 3DDUA 2WU3A 2J3DA 1J1IA 4X6YA 3EQ7A 5ALMA 4KRXA 2GYVA 1TKRA 4IO0A 3CCCA 1EVQA 4BVLA 5CT9A 2HM7A 3C6YA 1W75A 3V1KA 5ALWA 4G1FA 1NX9A 3G9ZA 2DFPA 2PSJA 3SX4A 5I7UA 4GW3A 2OCKA 5AI8A 4GDMA 5AKXA 4H18A 5EIEA 4Y2TA 4AMZA 3O9MA 3C5WP 3WIOA 2C0PA 1UKCA 2PSFA 5AM5A 1TCCA 4IH9A 1VKHA 4UFNA 4Q82A 4EUSA 5T4FA 1QIFA 3R3YA 3D59A 4UHBA 1GKLA 1S8OA 4X92A 4N5HX 1E3QA 1XZIA 2FX5A 3PF8A 5HQ3A 4GWLA 2XMBA 3QH4A 4OB8A 1H2YA 2VTVA 4HAIA 1ZGBA 4CCWA 5BWCA 3H2HA 5HK9A 3HI4A 1XLUA 4FWBA 1BCSA 4K6GA 1CFJA 1K8QA 4P08A 1QLWA 2WUGA 5IVHA 2GBIA 3I2IA 1A7UA 3BWXA 5ALXA 2HA3A 2HADA 4Q1VA 4GEGA 1G4HA 4B85A 5A62A 3TEJA 1H2XA 1EH5A 1DWOA 4F5ZA 1AUOA 4BB0A 3WZMA 5CT8A 1CIJA 4I19A 3HYSA 3QITA 4AZ3A 1CR6A 2VJAA 4Q3OA 3T4UA 1FFDA 4KYVA 1CEXA 3T52A 5HFAA 1PFQA 1ACLA 3QMVA 2QJRA 4AMYA 2W6CX 5BWBA 2EDCA 4UHEA 3WK5A 1R3DA 1C7IA 1DINA 3G0BA 1EB9A 4OCZA 2Y2VA 3DYVA 5LLSA 5DLPA 3HJUA 2C58A 1T2NA 4CIBA 4CG2A 2QUAA 3DOIA 3DKRA 3HLKA 3EBLA 4C87A 2HRRA 5JIBA 3STWA 2G4LA 2WTNA 4H0CA 5T4HA 1J2EA 1XQVA 5C8ZA 1SCIA 3HACA 4UHCA 3LIIA 4X00A 1U2EA 1CUUA 3U1TA 1MX1A 3GFFA 1I6WA 2V96A 1CPYA 1TK3A 1IZ8A 3V1LA 1EXWA 2JGFA 3STXA 2CBGA 2ZJ6A 5DYYA 3U0VA 4GLBA 2QM0A 4G9EA 1QE3A 2Z8ZA 1O6GA 3R3VA 3SK0A 1F0PA 3GELA 4B82A 4BZWA 3MUNA 1UK6A 2XMQA 4X6UA 4EZIA 1NU8A 1D07A 4BAUA 3C70A 1P0MA 5CT6A 1NU6A 4FTWA 4EA6A 3I2FA 1T4MA 3FLEA 4H77A 3IURA 1UOQA 1ZIYA 2Y6VA 1VA5A 4X7BA 2AJ8A 3STVA 2OG1A 4J3JA 3WK6A 4QDZA 4CG1A 5CXUA 2QRUA 4WY8A 4WFJA 4DSZA 5FDFA 4ZGBA 2H7YA 5AI0A 1YASA 4BVKA 1QIIA 3NUZA 1TRHA 3CN7A 1K6EA 3IBTA 5F4ZA 2EDAA 1VJ5A 4D9JA 5C7YA 3FBWA 1WB6A 2WFZA 3STTA 1XKLA 1JFRA 3H2IA 1MPXA 1XLWA 2CKMA 5AM3A 3DEAA 4BE4A 3GZJA 3N0TA 5AI6A 1BROA 2C7BA 1QIEA 4LKOA 1Y7IA 4J0HA 5AI4A 1ODTC 2IIVA 4ZWNA 5FXMA 3WL6A 4AO7A 4PSDA 2AJDA 1AGYA 5K3BA 3KSRA 3FYUA 3DKKA 1ETHA 1W6RA 3R3UA 1DWQA 1XZBA 3FSGA 2RIPA 4Y2RA 5KWIA 3KWFA 5AKLA 1GPNA 2BUCA 5LZ7A 1JJBA 4YK7A 2GBGA 1R88A 1DTEA 3C8HA 5AI9A 4JYPA 4L0CA 1DX6A 4U2EA 2DHEA 4G8CA 5C8VA 3H2JA 1ORWA 4BCBA 1A88A 2XUFA 4DNOA 4OYLA 3AINA 3AIOA 1FFAA 5JAUA 1PV1A 5K3CA 2WIJA 3I6MA 2ZYIA 1L7RA 4FHZA 1GQRA 5CH8A 1EB8A 2Z5GA 5LKAA 4P92A 2RAUA 1LZKA 4X71A 4Y2PA 2XMZA 3OG9A 5LZ5A 5A7HA 5LIPA 2C5GA 3ANSA 1JMKC 1YB7A 4DIUA 4OU5A 3ESCA 3W2TA 4QA9A 3VJLA 2ES4A 4DLNA 1OILA 1CUBA 2VF2A 3PUIA 5JYCA 3DJYA 3BF8A 5HF5A 4H7DA 3I2HA 1QIHA 1GPLA 2CZQA 2HU7A 1MNAA 3FLAA 3M81A 1QFMA 5I9IA 1CQWA 5HZGA 3ZPXA 5AKHA 1UKAA 5HKAA 1QO9A 1EK1A 1ZIXA 3DLTA 3PFCA 5K3AA 3A2LA 3I2KA 1QZ3A 2K2QB 1L7QA 4CG3A 5ALRA 5JAHA 3AFIA 1BRTA 3MUOA 1XZMA 4KE9A 1HBJA 4DMCA 3JYHA 1XZLA 4LYDA 2BAGA 4MQMA 3Q8WA 1LPMA 1H2WA 2BKLA 1AC5A 2VAXA 1IUOA 5IVDA 2HA5A 5ALTA 2OAGA 3FVRA 1LPPA 1R4ZA 1DU4A 2J3QA 2ZJFA 1HL7A 3DOHA 4N8SA 3L1IA 4FFVA 1DT5A 2V9ZA 3WKDA 4QWWA 1ZI9A 1XZCA 4MYSA 3TJMA 3W9BA 3R3WA 2VATA 3BJRA 3OTQA 3B12A 5IKXA 1BE0A 3ZI7A 1XZJA 4O08A 4DMHA 4OSEA 4B9AA 4W1SA 1YCDA 3UMJA 3WWPA 5FPQA 4ARBA 2V97A 3B3QA 5AKYA 1XLVA 4FLMA 3H19A 3L1JA 4EBBA 3I2JA 1J07A 4NVRA 2I3ZA 4QDXA 5HK8A 1QONA 1GPKA 3M83A 4YASA 5ALNA 4UBIA 1XRQA 3ESDA 1QGED 4BP9A 3DS8A 1CUXA 1LPBB 4L72A 2VA9A 1CQZA 3N2ZB 5EI5A 2WLSA 3D0KA 2GBFA 2OPHA 1W76A 2BGNA 3G0IA 4UHDA 1XQXA 2ZSIA 1ZJ5A 4RE6A 3WI7A 1UK7A 1VE6A 4B0OA 5DNVA 3RLIA 2PSDA 1XRNA 1VZ3A 5YASA 4F21A 2DSNA 4UBJA 2YXPX 4BTVA 2I3DA 3WMRA 5D3ZA 2AJCA 3FVTA 1EDBA 4DGQA 3KWJA 4AXBA 3PF9A 1VXRA 5JADA 2O7RA 2XQFA 2DHCA 2WJ3A 1E8NA 4LXGA 2ZYSA 3R0VA 4G9GA 5T4EA 1GT6A 2B9VA 2ZYHA 2JIDA 3BJMA 4B80A 1JT2A 4BCDA 5JZSA 3ZV7A 1YSCA 5AOAA 1JU3A 1YAJA 2WM2A 3G0GA 3G9TA 4H7JA 1YR2A 1A8UA 1AKNA 2IITA 3WJ2A 1USWA 1GGVA 4P9NA 1R50A 1RYYA 2WHRA 1E8DA 4ROTA 2XLBA 2YYSA 2I78A 4FMPA 3LS2A 5LZ8A 3G9UA 1ZI6A 1OXMA 2PSEA 3O4GA 2GZRA 3PDCA 4H35A 3S8YA 3F8SA 3O4IA 1BEEA 4C4XA 1MN6A 5AKKA 3G0DA 2XUJA 3LCRA 4G4IA 4C01A 4HVTA 4Y9SA 5LYYA 3W04A 2WIKA 4UHFA 3LIPA 4V2IA 6YASA 5AK6A 1QIDA 1HDEA 1ZD5A 2WJ4A 5EHNA 5ALHA 4C89A 1YS2X 2FJPA 4QEKA 4W1PA 3ED1A 2VJBA 4N5IX 4N8DA 5JANA 2OQVA 1CUIA 1LPNA 3V1NA 3QM1A 5KWJA 4Q3KA 3BIXA 3AUKA 3H0CA 4J0CA 2DR0A 3ZLUA 5A7GA 5D7BA 3GROA 2ONCA 1P0QA 1R1DA 2JEYA 5E4TA 4XVCA 1QJ4A 5ISMA 3C5VA 4DTCA 1LPOA 1WPXA 3L1HA 2XB6A 3D5EA 1QIJA 3HXKA 4UPDA 1HPLA 4OD0A 4PQEA 3STYA 1VXOA 1GKKA 2WTMA 4U2GA 3C43A 3FOBA 2VJDA 4HXGA 5T4BA 1YB6A 3OPMA 5AK4A 4E46A 4ZXFA 3R3ZA 3BXPA 4WFIA 4ZV9A 2HA6A 3H2KA 3IUQA 1TCBA 2QS9A 1Y37A 2EEPA 2Y2UA 1X2EA 2WHQA 4BVJA 1H22A 2DQYA 3WWDA 3P2MA 2XUOA 3WWOA 1CUWA 3I6YA 1JJFA 2Z8XA 3D2CA 5CH3A 2X8BA 1UWCA 1P0IA 4LXIA 2HIHA 3K6KA 3WJ1A 4QE3A 3WWEA 1N5MA 1UFOA 3WKBA 1EDDA 3WQHA 5DTIA 5AK3A 4E15A 1OCEA 5D3KA 4GHWA 4UBKA 2HA7A 1MX9A 1ZD3A 3AIMA 1N8SA 3F96A 3OC0A 4OYYA 4J0JA 3WL5A 3GBSA 3HC7A 4X95A 2B20A 1ISPA 4U2DA 4BCCA 1PJAA 4XJVA 3UUFA 1ZOIA 2ZJ7A 4EB0A 4AQDA 5AIBA 3DYIA 3K2IA 4KRYA 2XUKA 2WG0A 4Q34A 5IVIA 4AN0A 3LLCA 2PUHA 5CH5A 4U2CA 4FBMA 5AM1A 1IVYA 5C81A 4CFSA 3G0CA 1JI3A 3F67A 1WOMA 4KEAA 1G42A 3CCBA 3M3DA 1VZ2A 2PKYX 4HRXA 4H7FA 1EVEA 2VT6A 4G4GA 5JD6A 3PUHA 3AILA 1C7JA 2W22A 1C4XA 3ICWA 3AZOA 4JH0A 4C6HA 3IDAA 2BCEA 5LKRA 4X93A 3YASA 1DX4A 2XUIA 1TIBA 1THTA 4MQLA 3FYUC 3VJKA 5A6VA 2HFJA 5EGNA 2XQJA 2PSHA 5JASA 3TGLA 2O2IA 4Y2JA 4X6XA 4LHEA 3WIBA 4RE5A 3WL8A 1ZJ4A 2O2HA 1QFSA 1CUDA 4AN1A 2FJ0A 2R11A 2RI6A 1XZAA 1XRRA 4Y2QA 5A2GA 2G5TA 2G63A 2JF0A 1ORVA 4GECA 4QWMA 4QNNA 4HTAA 5SYNA 4A5SA 5EHXA 5JD5A 2WFLB 5A71A 4E14A 3BF7A 2JGMA 1LNSA 5CW2A 2QMQA 5SYMA 2WFLA 5AP9A 1TCAA 1DQZA 3IA2A 1SC9A 1XQWA 2XUPA 5K3FB 3C87A 1G5FA 4QDTA 2XMCA 5K3FA 5HF6A 1E5TA 3EF3A 1CUHA 3G9XA 4BAGA 3X3HA 5FP0A 4BP8A 2E3JA 1A8QA 3RM3A 4QZVA 4Z49A 1GQSA 1J06A 1EHYA 4HXEB 2VT7A 1MJ5A 3F9CA 1CVLA 1MAHA 1XRMA 3QPCA 2WHPB 5ESRA 2PU7A 3WK7A 2XQGA 1UK9A 3KOOA 3D2AA 2CMFA 1JU4A 3O9VA 2OCLA 1BS9A 4WCVA 4ZI5A 4H7EA 2DCMA 3IB3A 4PW0A 4JYMA 2XDWA 2JBWA 4DSAA 5KREA 4P93A 1Q83A 3CXUA 2XQIA 5BV7A 4B0PA 1ZI8A 4IH1A 3D4LA 1WCYA 3WKAA 4F0JA 1W4LA 3VKFA 3QZUA 2JGJA 1CUYA 3AIKA 3H1BA 4J0DA 3WK9A 1ZD2P 4KR0A 3Q0TA 4A16A 1ZGCA 5AHXA 4BRZA 1IZ7A 3A70A 4OUKX 5LZ9A 2HRQA 4U2BA 3ZWQA 1LBSA 4WJLA 3R40A 1W1IA 1CRLA 3DL4A 2H9YA 5FRDA 2QJWA 3QPAA 4XWGA 4TGLA 3A2MA 4BDTA 1GZ7A 1U8EA 3PI6A 2ZYRA 2XUAA 1FFBA 3SC2A 2CJPA 4HRYA 2ORYA 1Z68A 3H1AA 5AI5A 1F6WA 3OOSA 4DNQA 3V9AA 3D7RA 1WPRA 2J4CA 1XZGA 2C0QA 5AKIA 5EHQA 1QIKA 5AKJA 3MGAA 4RPCA 1LLFA 5ALQA 5ALLA 2HDWA 3C8DA 2QTBA 1F8UA 1H2ZA 3FNBA 1JKMA 3I6ZA 1B6GA 3DNMA 1UOOA 4J7AA 2PVSA 1UT6A 5AKGA 5E4JA 1BN7A 3K9BA 1JJIA 3O4HA 2WUEA 4EY6A 2OCIA 5AK5A 2WG1A 1DQYA 4AZ0A 2PX6A 3ESAA 1SFRA 1KEZA 4CI9A 4B81A 4MWSA 1LPSA 4UFPA 5ALYA 4AO8A 3OURA 1YA8A 1E8MA 4E11A 2O2GA 5DYTA 3IULA 1M33A 4U2FA 5CRIA 4OU4A 5FOQA 4CCYB 4W9RA 3LP5A 5LZ4A 5CT5A 4CCYA 4L9AA 4LXHA 2JGIA 2BUAA 3I28A 4BE9A 2BJHA 1WB5A 4Y2YA 5CTAA
chains in the Genus database with same CATH superfamily
4B84A 1FMFA 1C7RA 3VDNB 2I7TA 3GLGA 2WB4A 5I9MA 4QFMA 1O94D 3UOWA 3SXUA 2G71A 4DKJA 2OB2A 1ZVMA 3F3SA 2PRKA 1R9NA 2QLTA 3AY6A 2DWPA 4C4YA 4YRNA 1G9XA 5ELLA 4F85A 2YL2A 1T25A 2O4CA 2ZBQA 2PJDA 3IE0A 4IWXA 1P6QA 3AFMA 3V1UA 4H9GA 2JZCA 4NOKA 1YL7A 2X76A 2BI4A 2RGGA 4DXHA 5DXFA 2HPHA 1ZK2A 3QWHA 1N0WA 4BP1A 4MWEA 1WG8A 1CG6A 4D96A 2AA3A 2W48A 4KFUA 4LJ6A 5CW1A 2QJFA 2RG7A 4QLOA 4R3NA 3ISVA 3R7BA 1A4RA 4FR0A 4NSNA 4ZQEA 3R09A 1WXWA 1W0JD 4NE7A 4LBZA 4YMHA 2C5FA 2C03A 1AB5A 3ZHCA 5JSZA 1XZEA 3C4JA 5JJ5A 4OK6A 2X40A 1UBKS 2WSMA 2YMQA 4I3HA 3MMXA 3WO1A 4NZYA 1AXEA 1ESMA 3DA8A 3I0MA 4ESOA 1G59A 1XHFA 1OMOA 4DC9A 1DAPA 1GM5A 1T4DA 3NYRA 5EZYB 2ZM6B 2DUUA 3IQDB 4QYTA 5KTNA 4MA4A 2G7ZA 3IC5A 3S7TA 3JWHA 1I6LA 4QRDA 4KFCA 4YH1A 3LTNC 1TYEB 2P0AA 3QNWA 5F2NA 3I52A 1RXVA 4HVLA 5BMVB 3NMUF 2C00A 2W6JA 1FUYB 4WKNA 1KR5A 2JKVA 2O06A 1N2ZA 2A92A 3T7IA 1PP4A 4IIEA 3UMRA 3UXEA 1ORIA 4TS3A 1UF9A 3MW8A 2EF1A 1DO2A 3GMDA 4NE9A 4QHSA 1F20A 3AF4A 3GG2A 3HR8A 4IFIA 4BFLA 4F9FA 5IS2A 3KAJA 4CQLB 5CMLA 2W4QA 2NU7B 1N8TA 1JU9A 5AW5A 3BT7A 4XPIB 2P6UA 1JLKA 2G5CA 5JCZA 2A1IA 3OWOA 1E2DA 2ID9A 3MCZA 1W2HA 2XDQA 3AKEA 2H5JA 1Q0RA 3NHFA 5I6DA 2VHEA 1CY6A 2ZBDA 2H7CA 3GA0A 1TO2E 2WVHA 3A7DA 5CGZA 1B6SA 4OLHA 4P83A 2JGKA 3ELBA 4KCGA 2IZ6A 4OLFA 5LMNB 4ESVA 3OT1A 2D0PB 4MK4A 3CX4A 3AESA 3D3NA 1MKYA 2QP9X 4E33A 2ZSHA 1ZC3A 4JJ8A 4PWZA 2CHEA 2RHGB 3GGGA 3OQBA 1U94A 1BU8A 4M89A 1VCNA 3AXSA 5E3JA 3K9GA 3D8RA 3V42A 1I32A 3ZHZA 4YX9A 4ZCIA 3HI6A 4HQ0A 4C0WA 3QBTA 1JDTA 3O73A 5TIIA 3FAKA 4ENVA 4G2TA 2PEZA 3FHCB 2VN8A 2BFBB 1GRQA 3JALB 4J0GA 4JDUA 4JI6B 3ZGNA 1C9JA 1YRLA 2DH5A 2YZ7A 5BWMA 3KTAB 1SVUA 3H1EA 1EI9A 4DZTA 3WLNA 5FL3A 1E7RA 5LIRA 1AMNA 4WVFA 4B6RA 2FYTA 4M49A 2Z5VA 2PGXA 3LBIA 2XI4A 5JW6A 3HADA 4D9BA 4EJFA 1MEOA 2EFYA 1L7OA 1T5LA 2XVZA 3NUGA 1GTSA 1A9OA 2DFDA 4E5VA 4XB1A 2XVAA 4J2HA 3URMA 1EP9A 1RLUA 1N9GB 2A9QA 1VE7A 2M6RA 2CXTA 2NXCA 1TE2A 2OK8A 2Y0PA 3NH9A 2PCJA 3RU9A 3WGGA 5B55A 2CE7A 3WV4A 4HQFA 2XTMA 2WZBA 3A6DA 2A5LA 4QODA 4YUVA 1PJRA 4ZAGA 4M1SA 2MMGA 5HMLA 2VWQA 2PNJA 1IBLB 3NCTA 2WTAA 4FCCA 1KC3A 2CNKA 2JKYA 5DU2A 3VVMA 3ZWYA 1WBBA 3WTBA 3F47A 4YDHB 2PUEA 5FKJA 3WLJA 4RV4A 1NQOA 3L6CA 4LX8A 1O0SA 1YNSA 1ZU5A 4G89A 1H9AA 1E4EB 3GEDA 2PUVA 3ZUPA 4B44A 3OHMA 3THRA 1SBCA 3AP1A 3DOUA 3H4MA 1QIGA 1Y6GA 3OZCA 3JSAA 3CEPB 2SICE 4Q3EA 2QXTA 4MWTA 5C5CA 3A6ZA 1FJ2A 4OI1A 2VP2A 1X8JA 1L7EA 2JAWA 1E1QA 4Q3LA 5IHPA 1X87A 5TC4A 1WVIA 3A9WA 2CKDA 2XTJA 4YJ3F 3W5VA 1W0CA 1A2KC 2NO6A 4A23A 4DSNA 4MQEB 3K1YA 3PDIB 4QT0A 3O74A 2FP3A 4EPXA 4BB5A 5CDUA 2GXQA 9GPBA 2D59A 2EWWA 2NO1A 3USZA 2OORC 4BRUA 2EFJA 4HNHA 1F8XA 4UDXX 4FBLA 1SKUA 1W4CA 5EERA 1O54A 1ORHA 1V5GA 4HMPA 3RLFA 4EYQA 1X2BA 3FR8A 3GH3A 4D9GA 2QRKA 3I2GA 4AF7A 3BMXA 3U7GA 2IDZA 3JYNA 5DDIP 3LJKA 4M88A 3L7MA 1KSGA 4CKEA 2A9RA 2B8WA 2DUMA 1IMJA 1C3VA 1VSTA 4B6FA 5CYGA 1UODA 2ERXA 3H8JA 5DYIA 2GM9A 4KUHA 3U61B 3KEFA 1KI7A 1OYYA 2IKQA 2EJBA 3GV0A 1WD5A 4QXAA 4GI7A 1E6WA 2DF8A 1OT5A 2F17A 1T8SA 2A9FA 2DHDA 3IKJA 3N05A 1ZITA 4KRGA 2GBLC 2QF7A 5KYTA 3RYCB 2I2CA 1T5DX 3DZDA 3QVLA 3QYAA 1KSFX 1T3LA 1YHNA 3B1VA 4MGYR 5SICE 3SEFA 1JXOA 3W2FA 1UXJA 2I03A 3G2NA 4RNCA 4IOLA 13PKA 1ODLA 2QTFA 1C3OA 3QXSA 5CK5A 4PBSA 1M8KA 3PVCA 4TLCA 3U9LA 3QBJA 4JB0A 1AQUA 5HCUA 3LL7A 1NF3A 3K0EA 5CHYA 4CIAA 4FILA 4FJ2A 4JUAA 4KQMA 2V8BA 2W4MA 3E4DA 1TL7C 4GLLA 4RYDA 3W2HA 4H3SA 4J7UA 1FTSA 2PGJA 3I53A 3ONEA 4LWOA 5AHOA 3ZW9A 5AFSA 2XGJA 3CW9A 1HKHA 4MW2A 1P9LA 1XXLA 1T0HB 4YJKA 2NTJA 3KOWA 3P2JA 1MABA 5IAOA 1GPYA 4ZT2A 4J0KA 4C4OA 4YGXB 1N6HA 1KRWA 2DQ4A 1JBQA 2FTKE 1PW5A 1JHYA 1G18A 4A1FA 5C80A 1L1QA 2VYCA 1P31A 3KT3A 4FFSA 4C6RA 3T7JA 1T0BA 4QU0A 2BGWA 2DETA 2ORWA 1EM6A 2XOEA 3R2JA 3S2ZA 4W5OA 2B30A 3SMVA 1E3DA 2DFKB 3RTGA 4ZRDA 4FFPA 4AJKA 3KUDA 1E1KA 5E6UB 4DIOA 1JIJA 2OAEA 4C7VA 1T2FA 2C9MA 3ZJVA 3HHPA 1KSJA 3DWIA 3H2BA 3ONNA 3S8MA 3C48A 1DJNA 1SH7A 2Q6IA 4WZZA 5FI0B 3ME5A 4O4HF 2PMWB 4X66B 3EQ6A 1UXOA 2QLFA 1N2CE 4JXZA 4I6EA 3IJ5A 3DCJA 5CD1A 5JNUA 4TYYA 1SC1A 1VYVA 1X7XB 5DGXA 3H2SA 5JBIA 4MW5A 1TA4A 2B4QA 5JQGA 2BEWB 4KXLA 1L7AA 4MRNA 1VRWA 1ULBA 1IY9A 2ZANA 5AO9A 1QIMA 3T1QA 4A03A 1J8DA 3THYB 4RM3A 4H7HA 1DOHA 2YFQA 3K2BA 4AUEA 3ABZA 4OFZA 1A04A 2R66A 2E21A 2QTZA 3H86A 2HUPA 5G1OA 3V3TA 4DA4A 4PF1A 4MROA 5LUAA 3OQ1A 1EVJA 3CWZA 3LA8A 3ND7A 4PWYA 2ZR0A 3BTOA 3OCJA 2LGJA 2A0UA 1YCFA 3FJ1A 1ONNA 2ACEA 2CMGA 3FE2A 4I55B 4NZZA 1VBMA 5EL0A 1N0HA 1SZDA 4Y2VA 4R8MA 1KKUA 1GCIA 1TVKB 2IDKA 5K2OA 3I5YA 4GI1A 4G4SP 3GA5A 3EBOA 1PG0A 2E4UA 4A0QA 4Y98A 1IB0A 1QZUA 3W4KA 2FAXA 2JLRA 1MAVA 1ODSA 1I1QB 4HZGA 1GNRA 3ESBA 5EPOA 3VDXA 2QL7A 3L6OO 4NMWA 3VNVA 3EXHC 4PR0A 3CT4A 4Q1DA 4S04A 3QVTA 5C31A 2LIVA 5GVRA 3D8BA 3TRJA 2IZ5A 4QJBA 1I14A 1S2DA 4G67A 3TQSA 2JAUA 2WPNA 3IGFA 1AU9A 3KB1A 4Z0TA 1EFPA 5LYJA 4D3YA 4FNGA 1V7CA 4LVOA 2H63A 4CUKA 2XZTA 2PQ6A 5CCXA 4HNVA 1GSOA 3D0RA 1W29A 2ZRCA 3CUEF 2OSVA 1SUIA 3FPSA 3OCXA 1MOSA 4R0NA 4B3IA 4JHXA 3KPWA 4Y2SA 5FTJA 1XGKA 2C1EA 3L0YA 2XA1A 3ZE9A 4EQ6B 3E9CA 2FUKA 3TTYA 1DARA 2P69A 3DZ8A 1RRCA 1QTQA 4LFAB 4I1UA 5EIAA 4WSOA 4MWGA 3KKPA 5DRTA 4JVOA 3RTEA 5ALEA 1WNFA 4R6XA 4DM7A 1PSDA 4ZPXA 3G82C 3KO8A 2R6HA 3WJAA 2R1VB 4LISA 2FZKA 2MDTA 5KU1A 1TJ5A 2O8DB 3A1FA 2WSSD 3EQ8A 1Z36A 4ZEVA 1X70A 4C7MA 3Q10A 4R98A 4MQFB 2Z2JA 4DVGA 1WO8A 1ARZA 4KAJA 2EBFX 2HQSA 2E6UX 2VSNA 2WYHA 3CVOA 4QTTB 4K88A 2JI7A 5F1PA 5CLFA 2PV7A 3AQIA 3LT2A 3D6MA 3KXPA 3QBVA 4PFKA 3DE2X 3TL2A 4C9BA 1Z16A 2D5LA 4XGRA 1QTRA 5DBFA 1HTWA 1PR5A 3BMCA 3VDRA 1EUZA 2G80A 3REGA 1AUXA 4EVQA 1KOGA 2GKGA 1G8GA 3H5OA 1QGAA 3TIVA 5TQ2A 4D43A 1XZFA 1NA5A 1ST3A 1I4DD 1WW3A 4G85A 4UXJA 4ZDWA 3U62A 2FZ4A 2MINB 1ECBA 4M0FA 1C4OA 3E9MA 2VO1A 2H1OA 3PUZA 2F1HA 4NLLA 4WXPA 1XD2B 4BKUA 4WK2B 1Y5NA 3IUJA 1QV6A 3LVQE 2JZOA 2D62A 2HMVA 2Q3HA 4ER3A 3M4YA 1YFKA 1E66A 3MJHA 2GT1A 4IH4A 3T9FA 1Q5PA 3PL5A 1F2UB 3UGKA 5FUMA 4HCJA 2XE4A 2OVBA 1YHZA 1MC8A 4YLEA 5FO0A 4CEHB 2H1IA 2I80A 2AXPA 2OVFA 3K9HA 2HA4A 1XX6A 1BG6A 2EXXA 2E6KA 1UAGA 4B83A 1VHQA 2I3GA 4P3NA 4EG3A 5BW8A 1IRXA 4MVJA 5K01A 5F7XA 1P6UA 3RSLA 1QLHA 2FZGA 3E58A 4GPIB 5A9TA 1LF5A 4TLLB 3DW3X 2R8ZA 4C22A 2VDKB 1C9YA 1R6DA 4J1QA 3VUEA 1WS6A 5KYUB 3JQ8A 2ZS8A 3BL5A 3QPBA 4LEIA 1OX4B 1Z13A 2YJ5A 4INZA 3GZTB 5P8WA 5C4MA 4A8TA 3L6BA 4JNCA 1TQ8A 2BSAA 5FORA 1NW8A 4AUNA 1XZPA 4JMLA 5GZ1A 4JB3A 1LJUA 2F9MA 5JTTA 4AJ9A 2I4RA 2OFWA 5F64A 4H7IA 3FYUB 3VO2A 4P1ZA 3ZY3A 4DDTA 4QC2A 4EY5A 4RGVA 1T0JB 1AG9A 3EQZA 4IKPA 3SNHA 4DN6A 3U4CA 1YB4A 3A2KA 1FNNA 5LP6A 1U04A 5JD4A 2GZ3A 2QPTA 4FMBB 4JL5A 2I62A 3LPCA 1GFIA 1UZAA 4MAFA 4B33A 1OZFA 4BNUA 3RRNA 2HTEA 4DIDA 3I9LA 2JCGA 2BHSA 2IT1A 4BBPA 1VKZA 3BREA 1LDGA 1SCJA 1RQXA 2YYAA 3HJAA 4RHFA 4B3FX 5BNTA 5BV1A 2M6SA 3HJCA 5LFAA 3WFJA 3GLGE 4GP7A 2IPAB 2GHIA 1AURA 3LHDA 2A1TR 2Z3VA 1FBTA 1LQUA 3GGCA 2MIIA 3H65A 5FO1A 3UH1A 5A6SA 2X0RA 4RLSA 2F9FA 3GRYA 3GOHA 2H0AA 5ECDA 3ZZ0A 2H1LA 4U9IS 3IIJA 5SY4A 3ZVLA 1I7LA 2D2FA 3LGXA 1ZO8A 1R10A 3FMFA 2P9GA 3H3XA 4L1KA 2B8JA 1RHJA 3IJRA 4M9QA 4NJEB 4QUBA 4RKFA 4UUBA 5A5GA 1QV7A 4MH0R 3VKVA 3ABQB 3FNFA 3HKEB 1ULUA 1N5RA 1PFKA 4AF8A 4XWAA 3AHHA 1KBOA 2B4TO 2QP3A 1LCIA 1T8YA 1HGXA 1P75A 1YK1A 1NR1A 3CSDA 3QVGB 1L3IA 1SHLA 2REQB 4PXSA 3W6UA 4C20A 1VBNA 2IXEA 3EQ9A 4RIHA 4KITB 1P91A 4DV1B 2HHAA 3DOCA 3ZHBA 1C1XB 1S6YA 3AVOA 3G17A 2PQMA 3REQB 1J0BA 4JUIA 4PPYA 3RARA 1EP2B 1QF7A 2PIDA 3T7SA 3SICE 1BAPA 1VJ1A 1DZIA 1JKFA 2JBAB 3JPWA 4V0LA 4B7ZA 1TC1A 4PY2A 1M1ZA 2G76A 3AM3A 4XDYA 1RYDA 4LZOA 3IBYA 1YUNA 2OBNA 3Q3CA 1Z73A 5JH7A 4HXFB 2VJOA 3F9RA 1G2IA 2Q2QA 2HEGA 3FPHA 3PUJA 3OTWA 3GZNA 1YVUA 3BJZA 3PQ7A 2VYVA 1USKA 4M0EA 1PZXA 4AI6A 3TBKA 4X97A 4LIPD 1RKVA 3DQZA 5ALUA 4D0NA 1BCRA 5JZSA 2JCSA 1SVIA 4DL9A 3HGMA 1YRBA 3L7KA 3ES9A 4G8JA 4LYEA 4UOEA 4K87A 3JQAD 2BGGA 1X80A 1OV6A 1TTQB 3E9QA 5GADl 4URWR 1KI6A 3HPQA 3GLHE 1E9BA 1KAEA 1QKJA 1WCIA 1X39A 2CLHB 1THGA 1JE1A 4ZHSA 4BXOB 5DM70 1PK8A 2IYTA 1KK2A 1GGMA 1SCKA 1LK5A 1TLLA 1MXFA 1PJLA 1SVLA 3PDJA 2W37A 4PYKA 1S01A 4V3BA 1DEHA 2HK8A 3FF4A 3HCEA 4KNVA 2XUZA 3SOPA 2VNSA 4UTNA 5JQWA 1Y9ZA 2WAOA 2PZGA 1TJ4A 4X6LA 3L4BC 3FJOA 2ZVQX 3DLAA 2A94A 2DPXA 2OZLB 3F98A 1YRWA 3RSQA 4DQUA 3C3JA 5HBRA 4YAGA 4NCIA 1KOLA 2QYOA 2C9BA 5IW8A 3H1TA 3A4NA 4JR2A 4UNRA 4GI5A 1NUHA 1RQGA 2N42A 4GT1A 1P0CA 5HJEA 3G8YA 1YC2A 2QLMA 2X6TA 2B92A 1ELOA 2WT9A 3RSZA 3KTDA 3CUVA 4RORA 3U6KA 2AJBA 2FLVA 5AM0A 1Q1EA 1VRCA 2EP7A 3GLIE 1SOMA 3CN9A 5DM60 1CHDA 5JR3A 2W90A 1IL0A 3O84A 4KPUA 2VRBA 4OP2A 1X13A 5EZ5A 4PC2A 1OFTA 4IIJF 5MN5A 3WK4A 2BTQA 4G8DA 3HVIA 1LD3A 3R0QA 1RZRD 4D0SA 2O8FB 4MDEA 3ZNNA 1HOTA 1IONA 1J6UA 2MR6A 4FMCB 1FTWA 2VDVE 5AOCA 4OK5A 5B1HA 3RYFA 4OOFA 3WO0A 5D5PA 1UOEA 3AGPA 1E2FA 5DSXA 5BO5A 2P5SA 3EVCA 3OJWA 5HBGA 3B5EA 4B6PA 4ZQIA 1KFKB 1H0SA 4P4NA 4J0IA 3UMYA 1QRSA 2A5JA 2NG1A 2AYYA 5JVDF 2J45A 1OLSB 3C3WA 1IXSB 1G20B 2C4UA 1ZM4A 3QBDA 1X1EA 2Q9CA 4XCQA 4L4UA 5D6OA 2AYZA 4B7UA 3QK7A 1KY5A 1RP1A 1VPVA 4HTFA 5E7IA 5JAMA 2WU8A 3ADDA 2HJWA 3BXGA 3U3OA 3ZBQA 3I1IA 4MVJD 3TO5A 2FCAA 3RSFA 1TQ6A 4BUZA 3B48A 2QN7A 4NENA 3V4PB 1C2TA 4PHGA 3HUFA 2JIPA 1JI0A 1PE0A 3PTZA 2VDJA 4TTQA 5IJWA 3D31A 4S1NA 3BOSA 5HDQA 2I2DA 3AONB 5K3EA 1GOTA 4U5QA 4XUCA 4DPKA 4J43A 2UVDA 2JPDA 4K40A 1R8YA 1B0ZA 4JEUA 3G5UA 3NB0A 2ACVA 5KWEA 2E1PA 2O0MA 5IZ4A 3JQ8B 1PWYE 2QMOA 1FE8A 1TK2A 1NV9A 4F8YA 1EK0A 3RABA 3SWWA 2O8CB 3A4VA 1N6PA 3H04A 4GSYA 4N3BA 3EG9A 2YNMA 5FA6A 2PWAA 3HZHA 5EZ6B 1XVTA 5FUVA 3KQHA 3KJNA 1WCXA 3NNNA 1VOTA 3NC1C 1BHO1 1U6JA 3X1MA 5A5VA 5KPJA 4J03A 3F78A 3IUBA 3GT0A 1PR4A 3M6UA 4BU1A 1VBKA 2Q9AA 4LJLA 4RGYA 3A1NA 1CWUA 4EG8A 1YZTA 3Q5GA 2ZIUB 3HVJA 4B46A 3FSGD 3G6WA 2RAVA 3BB1A 4C4ZA 2CFIA 2QTTA 1FZQA 5CFRA 1KGDA 5LBIA 3UV3A 1MPTA 3PGMA 4TVBA 5GGXA 3Q98A 2YDYA 4QNMA 4HH3C 3EN0A 1VLJA 4MI3A 3FW1A 4AX4A 4FQ8A 3W5UA 2FGKA 3KEQA 2VBIA 1X1QA 3MXTA 1O57A 4ZREA 1ZWLA 1F0NA 2IS6A 1UFQA 1JEEA 1PEDA 5EXXA 3GA7A 4IIXA 5AVQA 3QBEA 3KKOA 4WZBA 2OECA 1WU7A 3ELDA 1C1YA 3FDXA 5FV4A 5KX5B 1AO0A 4YJ2B 2A5FA 4U39A 2C77A 4ALKA 4KQWA 1Y5LA 2XMRA 2XUDA 4CV3A 1Z74A 2VOEA 3CZMA 3HL0A 4CI0B 1RQNA 3KYCB 4XB2A 3PFBA 3H2GA 4HDRA 4CMBA 2CY0A 4DEVA 4R8SA 3EXIB 2FPSA 4X90A 3JQ9A 2ON6A 3OPQA 1V2GA 4XEUA 1E0JA 4TKZA 1PJQA 2IU6A 2OILA 3EWSA 4O4HA 2BFAA 1FW8A 2R85A 3O47A 1L9XA 1PYGA 5FTWA 2O7QA 2Q0XA 3RD5A 5G41A 4ER7A 3UAOA 3AFHA 3GD5A 5HR5A 3KEMA 2CXXA 2GPWA 2HU8A 2IXDA 2NZXA 2RGDA 1KO7A 1R9JA 3NS7A 4D4KA 5EJ8A 3ZVNA 3GEIA 3II6X 3U7QB 3MRXA 4U7WA 5FWDA 2AEMA 3H5RA 1IJFA 4LGCA 4B9EA 4CV0A 5CM8B 3MVEA 1Z5PA 2Q29A 2UKDA 4ZOLF 4FE4A 3QXGA 4C1BA 4H15A 3TH5A 2VBGA 3CIOA 3KC2A 4DYHA 2G17A 4PGHA 3OEHA 4MPDA 3SIPA 2AHRA 5CA1A 1CJTC 4X94A 1UKYA 5D7NA 5AJWA 1EGHA 2DBQA 3RAGA 5HF8A 5FYQA 3NOQA 1KY4A 7MDHA 3E4CA 1NMXA 1EBFA 3EB9A 3GI1A 1FW6A 1H4TA 4ARCA 4KDRA 2NVOA 1IOWA 1YZUA 2UZAA 3UB3A 2Q1SA 3WHKA 1MNQA 5AICA 1RAGA 4MW7A 3W3AA 4HD8A 3CX8A 5TEWA 4B47A 1KI8A 4DFDA 3A32A 1WAMA 2FFRA 5BR7A 3E7PA 4D25A 4MPTA 3BTSA 2RB5A 4LGMA 4FYVA 5KTRA 2R1ZA 2O23A 4FFMA 5HFNA 1MXHA 2XZDA 3PQCA 3JZMA 3C2QA 3F8TA 4JLPA 4PV7A 4FNMA 1PTJA 3SKVA 4JJ4A 4PO1A 1NGSA 1O0BA 1RVDA 5E7QA 4RVSA 1E9EA 5EZYA 4BX9A 5L40A 2FPMA 3DL7A 5LP1A 2PE5A 1FJHA 2ENWA 3W3ZB 2ETVA 2V5UA 4FBGA 3UK2A 1TT5A 2QQEA 3W90A 3L6UA 5JS7A 1EAMA 5KBYA 1MGPA 2FB9A 3EX7C 4WK6A 5BQ5A 4RPLA 1RQRA 1QOZA 4UAGA 1MEJA 2H52A 2DXIA 2J5KA 2WUWE 4JVMA 3PVSA 1C8LA 3IAS6 4O0MA 1UQUA 3H3JA 4RKEA 4H4DA 1Y1QA 2XNKA 4J2TA 1XXHB 3OM8A 5JTUA 5JNWA 4JIGA 3KFVA 2H2WA 3KJIA 1IPEA 1IOVA 5SY9A 2WU3A 1IHPA 3QOFA 1VI5A 2J3DA 1W4AA 1JIUA 2WWGA 3IKVA 5DHPA 1M83A 3H87A 1D2EA 1UBHS 4X6YA 3HUDA 1FFYA 5H4HA 1UXIA 3ORYA 3GFVA 3CCCA 4ER5A 4RENA 3UEOA 2NTNA 4YRIA 4NV0A 4M86A 3ZDCA 1P2GA 1SVSA 3C6YA 1NE2A 2I3AA 4IMPA 4CXMA 2N46A 1GSHA 3BHJA 4ED9A 2AC7A 3QJYA 3QX7A 1E0SA 1T0UA 4AJLA 5LOVF 4M1WA 1U9ZA 2GASA 3P0HA 1NX9A 3G9ZA 4OHOA 4PLZA 1KEEB 1X86B 2OFPA 4D4IA 1SBZA 4B7AA 2GCOB 5T6BA 1R5JA 1PQWA 3UAZA 3W6OA 1NVTA 4JP8A 4LNUB 2L42A 3PWZA 3I23A 2GLTA 4GW3A 3KZOA 1OXVA 2OCKA 1VG0B 4MRMA 3SG0A 3JALA 4UM9B 1NMSA 1T24A 2ZFUA 2XMPA 1QG6A 4DYDA 4F84A 2CW5A 2BF4A 4Y2TA 4RJ2A 1VHJA 2YS6A 1SA0A 4BO9A 2C4VA 1YOBA 3EQ2A 4Q7JB 1CE8A 4LJYA 3QIAA 4V3CA 1JV2B 3NRCA 2JI8A 5AM5A 1GZ6A 1TCCA 4LUCA 4LF5B 4F71A 3MWKA 1S3SA 1N9GA 4JOBA 2V4MA 1VSBA 1AS3A 1Z3IX 2J48A 5DSZA 2FK7A 1KARA 1UT5A 3D59A 4AN4A 4E5DA 1E63A 1RXUA 3DB1A 3QU7A 4FYJA 3V8RA 3T3GA 3UHAA 3RUIA 3HYTA 3WGKA 3EVAA 2AWOA 1GKLA 1RC0A 3BTVA 4MVJE 1SCNE 2DMRA 5FHQA 5C1PA 1F0KA 3DUFB 1S8OA 5J4VA 5MN6A 4QNRA 2A58A 2H57A 4B32A 2BGTA 1GY8A 3HEMA 1P39A 1YVPA 3I9JA 4RKWA 3M34A 2EKLA 4N5HX 1L4LA 2VZLA 1C7QA 3ZE7A 1XZIA 2XE7A 4QX6A 3IMEA 4ZQHA 4DG8A 4X65B 2IK8A 4KJZA 4XJXA 3WGJA 4POOA 1T9GR 4KO4S 4CF7A 1MGOA 1H2YA 2ZXEA 3KRTA 1ZGBA 1JFFB 4CQJA 4KBFA 1KHTA 1TU0A 1H05A 3MJEA 1DMSA 5EVCA 4TT8A 1UEIA 3R6GA 1YRQA 5DIFA 3UJHA 4NARA 3JWJA 4S1PA 3U49A 3GCDA 5DOZA 4K6GA 4D92A 4EHNA 1K8QA 4LMAA 4NNPA 4AKHA 2FMXA 4KSCA 2P90A 2PZBA 1Z4JA 2GBIA 2FPKA 2X0IA 3T5CA 1M9NA 4KLCA 1CSEE 2ZCJA 2HCJB 4G6ZA 1DKUA 4XDHA 1Y4SA 2H3HA 4RH3A 4IOKA 4DLRA 2BMVA 2JFYA 4Q1VA 4REOA 4RPHA 3PXUA 1SBNE 5JCOC 1YBHA 1LBEA 1QHIA 1VLZA 3CV3A 3LAWA 1AGRA 8MHTA 4DV6B 2H29A 2FWPA 4H2DA 3MYRA 3TFQA 5LVAA 3F2VA 4MCAA 3DEKA 3OX2A 3K4QA 4QYWA 4OQQA 2WNHA 3DBVO 1DLJA 3AL3A 1AUOA 1S9DA 1V0JA 1TIPA 5ILQA 3K35A 2ZWAA 1EG2A 4X7RA 2INGX 3HSYA 1CP2A 4EP1A 2PDAA 3DL0A 1OPRA 1D0VA 2Z58A 1E96A 2ZI3A 4YJFB 2JIQA 3AF6A 2IS1A 4DLTA 4Q3OA 1M0WA 3TS1A 3WLTA 1OVGA 5K6AC 1BXRB 4KYVA 4R7GA 3T52A 1JXMA 3NR2A 3PL1A 3E1SA 1PFQA 3N0VA 4UDNA 2BISA 4MVXA 2E37A 3OQHA 3OTHA 5CCEA 3CR8A 3QX9A 2W6CX 4M9UA 1CJUC 3UK6A 4UHEA 4RAQA 3I73A 1DINA 1Q19A 1UCFA 2ZOSA 1ZUNB 3GT4A 3MGGA 3BH7A 4NBVA 4Q9HA 4M1TA 1OHHA 4DA8A 5IAAA 5KB3A 2LDXA 3N0RA 4R8VA 1L5FA 1AVTA 2DKOA 3ZS9A 1SEPA 4G26A 4KQIA 1GPMA 1RSZA 1GGEA 4C76A 1WRBA 2WTXA 3ORQA 4DMMA 1NM5A 3DXFA 1ZESA 2UZ1B 2OP0A 1GG2A 2W7TA 4L5BA 3OTOB 5LQMA 4URFA 2O57A 1T2NA 3GLRA 5E6UA 4CG2A 4HYTA 2QT1A 3RKUA 1LFAA 3HLKA 4ISCA 1HDIA 4JASB 3EBLA 5FJJA 1FDSA 3NDJA 1W5SA 2NO0A 5KJ6A 1Z18A 2HRRA 1S8NA 2WTNA 3ZK8A 1Z2OX 1J2EA 5IVPA 3JWIA 5F5LA 2DHRA 5LMZA 4IHJB 3BORA 4B3DA 2OCPA 1SCIA 2HAEA 1YCHA 1YVRA 2QX7A 4MRAA 1R6BX 3KFXA 3TFWA 3HACA 1EWYA 3ISJA 3T4PA 3QXJA 3V4ZA 1AV6A 2ZS9A 3N28A 1E5LA 4YP6A 3M1YA 3ND9A 3U3MA 5A3QA 5FH9A 1MX1A 5L3QA 1DHRA 2QX8A 2W98A 3HZZA 5IAGA 4EF4A 3FGOA 2OZPA 3L43A 4GM4A 1ULZA 4O3MA 3EXAA 2FEWB 1CPYA 4MMXB 2GFHA 2H11A 2HU2A 1TK3A 3OCCA 1M34A 3IR5A 1X0VA 2PD6A 3KAPA 2EP8A 1EXWA 1Y9AA 1ZZGA 2JGFA 2WD7A 2Z83A 4LXXA 5EUMA 4CMHA 2HHHB 4FFBB 4HPWA 4I55A 3ETHA 4KMOA 3DZIA 4U9HS 4ZALA 3UT5B 4B3TB 1T9AA 4GLBA 1TVKA 2QM0A 3WSTA 1O77A 1RLMA 4FT4A 4XM1A 1WZCA 2J3MA 3G2IA 3JQAB 4DC1A 1MA0A 4FMDF 2YRFA 3JATA 3CUWA 1Z07A 3SK0A 5FQOA 2DT5A 4U8HA 3U81A 4BV3A 1KEUA 2FFJA 4B45A 5G4LA 2EP5A 1HV8A 2P75A 4AF6A 1L4HA 2XMQA 4DEXA 3F3YA 5B2EA 2J4DA 3ZEIA 4EZIA 3H9GA 3CLRC 3V46A 1XEFA 1O95A 3REOA 2K7FA 2BJWA 1D07A 1OAKA 3EVEA 3C70A 1XN1A 3F6RA 2A84A 5CT6A 2G77B 4KR9A 3TDMA 1XLTA 1T3TA 1Z8HA 1BE8A 2FPPB 3H4VA 1PGPA 2IX3A 2B5OA 3UAVA 3NI2A 3FFAA 4ZCMA 3NH6A 1ZSNA 2XR1A 3F1KA 1BNCA 1ZIYA 1V1RA 2EBUA 3V4OA 3WLQA 4CVNA 4AG3A 6Q21A 2WD8A 1PFWA 1LNQA 1NKVA 1K3FA 1O1YA 1POXA 2XCLA 1KIFA 2E5FA 2AJ8A 2CHFA 2NQ8A 3KU4A 4HYYA 3S29A 1C1DB 4E51A 4E4YA 2OG1A 2CVFA 2FKNA 1D04A 1NSYA 2OHXA 2W71A 2R1VA 3M5WA 1GKUB 1X9GA 3IBGA 4N0EA 3OZSA 4TL6A 1SG0A 2G6BA 4NXMB 2ZEJA 3OF3A 4MQFA 3FIJA 1MIOA 1BIFA 1SU4A 4R9VA 4JQZA 5TR9A 1BH2A 1FTQA 6ADHA 1J0AA 4HEQA 4W9NA 1Z7YA 4J0QA 3CH7A 4UMEA 4PZCA 4WY8A 2R60A 1XKQA 2JFQA 2DY0A 1ANKA 3OSZA 2IUEA 1P1RA 4IXNA 4WFJA 2L19A 4ZO9A 3AG6A 5FDFA 2FW7A 5HVNA 2Z1NA 2JH8A 5GM2A 3TECE 1P5ZB 4HGZA 1K7EB 4Z3DA 3VZSA 5DGTA 2QP4A 5I7FA 3WNZA 4PLHA 2WJAA 4DHEA 2Q3LA 1Y6JA 2MINA 4Q39A 3U13A 2I33A 4F3NA 3DFIA 4KNWA 4IIBA 5DYNA 5HQTA 1NG9A 1V9LA 3WX0A 1VLHA 5JFGA 3OQOA 4Z9XA 3D0QA 1VJCA 3CN7A 1K6EA 3FR7A 4IIDA 4PS0A 3RRMA 2FSGA 4X7MA 1N2BA 4YQZA 3TOVA 1HYQA 2D13A 1T5TA 1PWZA 2HOQA 2RHHA 4EO7A 2PA0A 2EDAA 5KDDA 1V11A 3HXQA 5C7YA 3OF2A 3I04M 1CIPA 3Q41A 2PKQP 4G81A 5AXDA 5A5DA 2WPDA 3C74A 5I7OA 1R0SA 1W73A 4MPPA 1L5RA 2L69A 1BVUA 1JFRA 2JHFA 4PLVA 2ZJ2A 2NVWA 3FB1A 2ZR8A 5TS3A 1RI3A 1K68A 1XLWA 4OJTA 1RRVA 4ZHQB 5GVSA 5AM3A 1PEKE 2XAUA 3PKIA 1U9JA 3M5CA 1OLUB 4JBNA 4RADA 2C2BA 3N0TA 4KZKA 5AI6A 3MWJA 1WVMA 2Q99A 1Y6FA 3Q7PA 4X1IB 4TMXA 1Y7IA 3I0ZA 5HQJA 3CNOA 1E62A 1R27A 4WZBE 5SY6A 3RJTA 3RVKA 3X1YA 3UJ8A 3WL6A 4EHDA 2Q4EA 4RLQA 2LPMA 4CLEA 1K1EA 1TPYA 3IEUA 5K3BA 1DBPA 2VSXA 1J7KA 3ZGXA 1KZ4A 1SCAA 3FYUA 3BKWA 3A3KA 4RY0A 1Z45A 1LK0A 4ZVOA 1DWUA 3D3EA 3TNDA 2C2OA 2G6TA 2I99A 3NBZC 4KN6A 1OH8A 1DWQA 3QW4B 3LX6A 4QAJA 3ZWCA 3A0RB 1DTWB 4DLVA 4QBKA 1FCJA 3BFXA 3TKLA 1O94C 2SKDA 4BMXA 4Q7QA 5CFLA 4H7PA 2RKOA 2WM9B 3IEMA 4Y1RA 5LZ7A 3SDBA 4JJIA 1NIJA 2VQSA 3RH0A 5LM3A 3W0LB 1E3JA 3BZBA 3HJFA 3A1SA 2KLHA 3C3AA 1JFSA 2ZRBA 4FUTA 3OEEA 3FTDA 3L6DA 4S0ZA 2BL4A 5E6RA 1DTEA 3WP1B 1NC1A 1QHEA 3LRTA 5KZMB 1MX3A 4TUYB 4ZP1A 4MCIA 5FWYB 2F3PA 1DX6A 2FJUA 3S8EA 4HQNA 4NJEA 4N48A 4G9BA 3KJQA 4HVCA 4GX1A 3MIIA 3HKEA 2ZM5A 1FPQA 4KQCA 4YRTA 1KE1A 4DR5B 1X1RA 1H42A 3IP6A 3KJGA 4CM8A 1TAUA 2WQ6A 3LXMA 4DNOA 2DX7A 1E2PA 4OYLA 5K0BA 4BQPA 1WUTA 4LJRA 1Z75A 2HMAA 3JQCA 4IHKA 1Q1AA 5JT1A 1WSWA 1C1XA 2ZBUA 1JF8A 3REQA 4EKIA 1TYCA 1N5JA 2ZVJA 2VJLA 1JBKA 3M1AA 3AERA 3RYIA 1NSFA 4FHZA 3NEAA 2Q50A 3AI3A 1B7GO 4KYIB 4OAOA 3AO0B 5CH8A 2QVGA 5FX2A 2Z5GA 3FGZA 4YRKA 1A76A 1N92A 4GPAA 2PZ8A 2YN0A 3AG5A 2WWTA 3IQIX 4AKEA 4PRLA 1THMA 5NLLA 3SEAA 2BLLA 5DTRA 3PXCX 3E5HA 2O3UA 4FKMA 4AJJA 4HQ6A 4CMAA 1JSXA 1LZKA 3C1AA 5HW0A 4F3TA 3AFOA 3OE4A 2ZULA 4NPCA 4QREA 4XX0A 4B79A 4L78A 2XX3A 2PRIA 1UIMA 2J9RA 1MO6A 1E69A 1W5TA 4CLRB 2A9OA 1TJPB 4D0GA 1LDYA 2QJTA 4O8CA 5KVCA 5T8KA 2PKRA 4MR8B 3CVVA 1ZNQO 1S9HA 1Z4OA 5F33A 3CWQA 5L3SA 1EFCA 1H8HD 1ID1A 2Z95A 3ESCA 4I5FA 4HB3A 1FC0A 5DBGA 3W2TA 1P5RA 5KAMA 2HPVA 1C9EA 1E9SA 4HDNA 1CUBA 1M1NA 1TC2A 4P4TA 2VF2A 1CR2A 4KO2S 5IKMA 3BF8A 3HBAA 2OBXA 4H7DA 1ES9A 3HBLA 5FPYA 3BSSA 2HU7A 3GVCA 2FMIA 1TZ2A 4MAAA 1TUEA 3DMRA 1NYRA 1XZQA 2C8LA 2GO1A 2G28A 3M81A 5I9IA 3CF2A 2FOXA 5F7OA 4U6SA 5HZGA 2OZLA 3BWCA 4KX3A 5FAKA 2R8RA 1ZUD1 5D00A 4YROA 4IICA 2G25A 1C8KA 1U28A 2IUYA 2YWCA 4P6VF 1N3LA 2DJ5A 2KX7A 2PN1A 3CH6A 3F6YA 5EXEA 4BLVA 3LRXA 4S05A 3TSZA 1NLUA 5K3AA 1TD9A 3CF4A 1Q7CA 1KI1A 4WACA 5KNBH 4QO8A 2X8WA 1C5KA 1XMQB 3A2LA 1QK4A 1VPLA 2CNWA 4HQOA 2B5WA 3EJ6A 1J8YF 4K9OA 1N1DA 3IMFA 4MRRA 4LPKA 2FR8A 3A14A 3AFIA 3FSEA 3H16A 3PENA 4MARA 1UMKA 1BRTA 4M1OA 4LSZA 4R40A 1ZXXA 5FBLB 5FOWA 1XZMA 3GFTA 3WMEA 3HM9A 3N7AA 2ZI7A 3UJPA 1R8JA 3MWDB 4YFVA 3WGMA 2LCFA 4EZBA 1NOKA 4LYDA 2QGNA 4A9AA 2HRBA 4LBYA 2BAGA 4FYXA 2B1QA 2FWAA 1LPMA 3Q8WA 1H2WA 4GP6A 3LOUA 2CLIB 5LQJA 2WP8J 3QY9A 4JWTA 1VQ1A 2H4JA 4Q1EA 4CKYA 2HA5A 3VKHA 2HBRA 4HS4A 1SUCA 2I6GA 4CKWA 4JHLA 2ZUDA 4JLMA 3O6VA 1AKEA 3RS9A 3UW1A 3G0HA 4QECA 1OLSA 1G20A 2R6DA 2C99A 3TM5A 4N8SA 3O0TA 2VHCA 2NACA 1RZUA 4JFRA 4YJHA 1KZGB 1DT5A 3IUPA 4YRZA 5DHSA 3OM0A 1L4MA 4R1LA 2VK4A 4D44A 4DLLA 5BURA 2HSDA 3L79A 1XZCA 1SM4A 3OIFA 4MYSA 4NATA 3TJMA 1Z82A 5AVUA 2J59A 3W9BA 5IUNC 3FKSD 4TXNA 1DAGA 2OMEA 1XEXA 1J2UA 1MC4A 1Z4IA 2Z43A 3OTQA 4YP9A 3GRPA 4YRRA 4FI3F 4KN8A 1F8GA 1F3LA 2FSVC 1IZ9A 1XZJA 1EFKA 4OSEA 3DAPA 1E2QA 3P0RA 3FI0A 5T6MA 3R6LA 1YDGA 3N74A 1TU4A 2CJWB 3OOJA 1NG1A 4L4ZA 3UMJA 4DIEA 1W5BA 4CR7A 1FLDA 3V4VB 3GGOA 1B43A 5FPQA 5TMDA 1CZNA 1VC2A 2VUTA 2VYND 3ZHVA 2ISQA 2O3SA 1ISGA 5AKYA 3O21A 2BE7A 3UHJA 3BZUA 1LDMA 5F2EA 4DNXA 5KWVA 2I54A 4E21A 1F14A 1UPAA 2NUPB 1Q1GA 1AKUA 2ZWVA 4CODB 1G21A 1B1CA 1LLCA 4EBBA 3LUFA 5EKDA 1UBUS 2W6NA 1MB3A 3CX7A 2XCTB 3AVXA 1QZTA 4Q1FA 5EJIA 4PFQA 3ACDA 3UV7A 2AKYA 4UAJA 1NV8A 4WT7A 1MH9A 1R15A 3SBDA 1LV7A 1ZLXA 4HLCA 4U2KA 1FYXA 3GP5A 4BMPB 1GPKA 1WWKA 3OM1A 2D2VA 4J4BA 1W46A 5I8ZA 1ZCJA 1WUJS 1E6KA 4GRIA 2GKOA 1F5NA 4GX2A 3BD8A 3LYAA 3D6TB 3K9WA 5ALNA 3NP9A 3K6SB 2RCNA 3NVKI 1EDZA 2IXGA 1G55A 5FYDA 1MOPA 1KYXA 2NV0A 2ZBRA 1SXQA 3FWPA 2R84A 4C7OA 1VFNA 2GEVA 1T8WA 4C3UA 1I6KA 1JJAA 4I81A 4RFLA 5I5GA 4BP9A 3DS8A 1J9GA 4YJ2A 3BMQA 1TM5E 4L72A 2AEJA 4LC9A 4BFYA 6AT1A 5I7EA 2AK2A 1SUSA 5A1TA 2VZ9A 2ENUA 3GT7A 3IUEA 3KYCA 4UJ3A 4LK3A 4C7BA 4EVSA 4F3RA 1H2HA 3VNAA 5BOSB 1W5EA 3CG0A 3WMWA 2GBFA 4IXMA 1RC8A 1HURA 4LW8A 2BGNA 4EL0A 1XD9A 3EXIA 4KXXA 4UHDA 4UHCA 3L5KA 5IF9A 4HGRA 2XT9A 1GQOA 1JG7A 2G1AA 2C9YA 4RK1A 1HRDA 2AW5A 3ASZA 3SF0A 3T7RA 3I62A 1VE6A 1VE1A 4J4HA 4GH5A 4CM9A 4Q9LA 1OI4A 4EG4A 4EK9A 4TRJA 1NJGA 2PSDA 1Q3TA 1MV5A 2KI5A 3S44A 1NNI1 4N5LA 3TX2A 3ZW7A 5IANA 2AFHA 1GKYA 1X14A 4HDCA 3L9WA 5LNK6 1VZ3A 2F1JA 4QIHA 3G2HA 3AP2A 4WX2B 5YASA 3ICPA 5HCIA 3X1WA 4KIGA 5K8CA 3T3HA 2KBFA 2FE4A 2DAPA 3OJCA 3WRXC 1X1CA 1A71A 1KYZA 1BA2A 4EM6A 3NLLA 3DTYA 4MQ6A 4OK3A 1CRPA 1JQBA 5C5IA 4G0WA 1IPFA 4UKDA 2AJCA 4DGQA 3CLTC 1U81A 4ECEA 3QA3E 3CURA 4DLKA 3K53A 1M34E 1OFVA 5JE8A 2XVYA 2E4VA 2O7RA 3PIRA 1CETA 1H4QA 5KTPA 3OKAA 1E8NA 5BUQA 2YXDA 2ZYSA 3R0VA 2DLNA 4BIMA 1DXOA 2B7BA 1P2SA 4D41A 3SMQA 3FCEA 1ZSYA 2VTEA 4Q7EA 5CFMA 1GT6A 5IYZB 2B9VA 3MTDA 2QTGA 3I05A 1GSIA 2ZYHA 5IFLA 3DZHA 3RHSA 3AF0A 4B80A 1AKYA 3UMBA 2W2KB 3NU1A 1O6ZA 1ZM2A 3I4FA 1NVEA 3OZRA 8OHMA 2C2YA 2Y1WA 3NG1A 4IG9A 4YXWA 2FETA 2JW5A 4RSRA 4Z0PA 1F8YA 1S4QA 3KPJA 2QUIA 1U8CB 3L7BA 4UJ5A 5ENDA 5A05A 5E9WA 3LHKA 1JDBB 5K0NA 1U7XA 1YR2A 2X8AA 3LBFA 4DCUA 2CJYA 3HBMA 3MFQA 1E79A 1XBTA 3GEMA 3IPCA 2HCBA 2BFDB 3OJLA 3CS3A 1KFJB 2ZRPA 2R5WA 3PUKA 4L9RA 4PCLA 5ESXA 2GARA 3GUVA 2XGMA 1G17A 2VEDA 3GEPA 3HBNA 4M7PA 4P3KA 3SQMA 1HMPA 2DB3A 2F3QA 4GI2A 1AKNA 2HCRA 6PFKA 3K70D 4AKSA 3BRCA 3WJ2A 4ZKDA 1LSJA 1NT4A 1IXKA 3DEJA 3N6RA 2LV8A 3SS7X 5KNLA 2QPAA 2QDKA 5HQ3A 1GGVA 2VJKA 4WNCA 1UH5A 2O0LA 1R50A 2VNKA 5AUQA 2WSIA 1USGA 3KOMA 4CNBA 1IE3A 2Y67A 3KZVA 4IINA 1YE8A 3B9QA 3GN2A 5FTMA 1VIAA 4IDQA 1J70A 1BMTA 1RWXA 1QZZA 4A26A 1AQNA 1FFSA 1D2RA 5LZ8A 8LDHA 1W8DA 3AI2A 2W6ID 1S2GA 3CMMA 3ROGA 2B25A 2PSEA 3RB8A 5COAA 1ECGA 2AG6A 2GZRA 3LTEA 1OA1A 5GJWC 2VPIA 3L7CA 4LHWA 4DR7B 3AM1A 3R3JA 3VNSA 4G07A 1Z5ZA 2EFGA 2QTWB 2GCOA 2RGEA 3JQEA 1PD0A 1JEQB 3CJTA 1EZZA 2PH7A 2QTRA 3O4IA 4TS4A 5DLEA 5FTKA 3RVSA 1PLJA 1L7MA 1UADA 4D99A 1FNBA 2PWZA 3K6JA 4TKLA 1RTTA 1OYVA 2PD4A 2RI0A 4UD2A 2Y1CA 2Q1TA 4P2BA 4YECA 1ADFA 3COYA 4I5EA 1IRIA 4JJ7A 4HVTA 2C57A 4JJZA 4ND7A 3ZWPA 5B64A 3P2OA 3VR3D 1T3ZA 2GCNA 2IE8A 2KHZA 1JIVA 3NBAA 2AX3A 4MI1A 5LYYA 1JWAB 2HT6A 2QWXA 1AKRA 5E6SB 1RCTE 1XTBA 4IXTA 2GN4A 2WJHA 4O4IF 5EUQB 5GINE 1QIDA 3O26A 4KVAA 1DUIA 3RS0A 1GGNA 4KHZA 1EG7A 3AI7A 1WY5A 1RYFA 2JD1A 5B1DA 4C14A 2H8GA 3ZTWA 3FDIA 4WASA 5EHNA 3MMSA 5M5BA 4LCBA 4S1OA 5C34B 4ZRNA 3MCUA 1M3SA 3QE4A 3O8QA 2QRVB 4FINA 4OBBA 4PM4A 3S7ZA 5IN4A 2HYIC 2Y1XA 4Q02A 2EWVA 5IKOA 4K6FA 1KJQA 4YT8A 4K0KB 1Z29A 3UC9A 4OXNA 1X7HA 1U9IC 3R1IA 2OQVA 5AMXA 5ADWA 2VP3A 4EI7A 3ZCTA 3N53A 3MCVA 4BV2A 4N0DA 2F43B 3B9PA 2ZT7A 5KYWA 4MS3B 3FKJA 1SHJA 2A57A 2ZKIA 3FPBA 4LZWA 5TXGA 1J4AA 5CA0F 3KXDA 3QFCA 4NBLA 3M2PA 5CVTA 5KWJA 4TZ6A 5DVZA 1C7EA 3A28A 3FY4A 1EVZA 2L2QA 3H0CA 4GGOA 2VDWA 4J0CA 3I9NA 2KLBA 1SU6A 3GJ0A 2CHQA 1JFFA 2CLSA 1H2BA 2Z6VA 2I66A 3KS9A 3LE8A 4PAWA 3GROA 3TIGA 2NQ2C 5B30A 3NHMA 4YPFA 5FPHA 3K05A 2HJSA 1P0QA 1J9EA 1R0KA 3RSOA 3RUCA 4LK2A 1YQEA 2QA5A 1B2LA 4XVCA 4CIDA 3SVLA 4E5NA 2QN8A 4IFTA 2WWIA 3U44A 2YBDA 4NFSA 1PS8A 3SX2A 3IDZA 4LF9B 3ZWXA 2EG5A 4L8VA 2I71A 1WPXA 2J9FB 2P9TA 2IFTA 2VTKA 3WC4A 2QE7A 4HKTA 3H84A 4L28A 1EIZA 1PBTA 2QTVB 1Z4MA 4QBTA 3VNRA 5M29A 2DTEA 1T1RA 3N75A 5JNTA 5B1EA 3HJBA 3KOUA 4NL4H 2N1BA 4R9UC 2X2EA 4H6VA 5FJIA 3SDZA 4DY6A 5DNYB 2WTMA 4N3GA 3C43A 1A1SA 3ZXUB 5KDOA 3ABSB 1HYBA 1RHRA 1S2NA 2VH5R 1U8XX 2P9QA 4AP6A 1I3LA 4HXGA 1YB6A 3DC7A 3EIWA 3IOBA 2PLRA 3IT3A 4GOJA 1F2DA 1Z5OA 1DL5A 2X3YA 4A0SA 4ASUA 3TLJA 3A4LA 1HDXA 2AK3A 4ZXFA 2W8BB 1TTHA 1BH6A 5FPKA 3K72B 3R3ZA 4MIOA 3BXPA 4RQUA 2ZITA 3CB4A 5AJTA 1GZDA 3JCZA 3VFDA 5DWVA 3S1SA 2FPGB 4JBYA 1OXUA 2VJMB 4OX9Y 3AEKB 3PQ4A 5HIMA 4B6EA 1PTKA 2DFVA 1T29A 4PG5A 5HDBB 2OCXA 1LH0A 4EAAA 2VHTA 3ZYCA 4BVJA 1CY2A 1E6UA 1OWNA 1PVDA 1IZYA 2NP6A 3L46A 3VX3A 4YV1A 3F2IA 4QAQA 2JFVA 3FTQA 3WWDA 1NJ5A 5I7AA 3TEFA 1E2BA 2QG4A 3BQMB 1G0OA 1CUWA 1M7BA 1TAGA 5TPZD 1JJFA 2UZ1A 2Z8XA 5CH3A 1DKQA 4KIUA 2C42A 4MRPA 1UWCA 4O4LB 4L9WA 5M2QA 3VU1A 3AOEC 1P0IA 2VDQB 4LXIA 4PINA 4IZIA 3ESQA 1UFOA 3S81A 1MR3F 2ASVA 1NPYA 1EDDA 1XTVA 4YMWA 2I87A 5HIJA 5DN6D 2OV8A 2XXAB 3JZIA 2H16A 1EXNA 1FLAA 3BILA 5KYVA 1QCYA 2LBPA 5AK3A 4E15A 2WT8A 3IAFA 5TT0A 4KWIA 1ICIA 1X9IA 2JHPA 2BGJA 1KYIA 4CEJB 1VPDA 1L3BA 2D74A 1C4KA 1G1AA 1P0FA 5JYBA 4ND1A 2B7CA 3QF4A 4GGPA 3Q3EA 4DPLA 5J2TA 1WVGA 2IYQA 3ZCSA 3A7EA 2GVZC 1WZNA 4GYYA 4FDAA 5A04A 4J0JA 1XR3A 2RFLA 2WOJA 3B8HA 5ENVA 2XOXA 3C3KA 4F9GA 1P8JA 1KFBB 5DH9A 1USUA 4IIJB 1U8YA 3RS7A 2B20A 1AOXA 3DE4X 3QP9A 1OX5A 1ISPA 3OJOA 2EL9A 2G09A 2W58A 3OBBA 4J49A 2OMKA 4XGIA 4YI5A 2FXIA 1YS7A 3RSSA 4D5EA 1PJAA 1ONOA 2X1HA 3BXHA 4XJVA 4NS1A 3D7MA 4DGSA 3ZOKA 4HT3B 1BE6A 4UHJA 3X1KA 2I7CA 1IG3A 3DYIA 4PLPA 3T7EA 4L73A 5F1YA 1DDOA 4ISBA 4EX6A 1VTKA 1X8KA 4J6FA 1SKYE 4Q34A 1ZCBA 4ZAVA 2AOVA 2ZJ1A 4JUFA 5JVDB 4YUXA 4NQRA 1CJMA 4LPSA 2A6PA 4FBMA 3CO0S 3DNPA 2MSNA 3PFHA 4OEHA 2C8KA 3TZHA 4PIMA 2R44A 3TVTA 1SCBA 2P6NA 4LECA 1VM6A 3G0CA 4X0EA 1YL6A 3ZDZB 4C3VA 1R66A 5FI5A 1JR6A 4G1UC 4DCSA 1RYBA 1WOMA 2JJ1D 3I6IA 4KEAA 2JJQA 4OKIA 5J2UF 3CCBA 2JFUA 4BJ6A 4Z4QA 1QU2A 1I2DA 4KC0A 4Z86A 5CVCA 2AXQA 4MINA 1XQ1A 4LMPA 1BFKA 3AJ9A 3PNMA 1TEHA 4UQPA 1GO2A 3RVDA 1HDGO 4PN3A 3H42B 2RCYA 2RGYA 4PYMA 5ES3A 3HGQA 4NV1A 4OQEA 2B21A 4AMVA 1NNEA 1T0PA 3PUHA 4Q3DA 2VXBA 2PMDA 4G56A 5L3RA 4CUJA 3ESYA 3ITNA 3EFEA 3VR6A 5L4LA 3ZGOA 4XWWA 2WIBA 1LVGA 4AJHA 2AR0A 2Y8EA 2YWXA 5EWLB 1KK1A 3D4PA 3IO5A 3MQ2A 1II0A 2EFHB 4YBZA 5K8TA 2VQDA 1L5NA 2O8BB 1DKMA 3MAJA 1N1GA 3IDAA 1KVUA 4P58A 4AU1A 4QM6A 2XOKD 5LKRA 1UPFA 2FY8A 1Y8QB 3NEPX 4V0NA 3U9SA 4DJDC 1QR6A 1DX4A 1EVYA 3IKTA 2V6IA 2ZRKA 3MTJA 3IJEB 4G0OA 2YRWA 3VPSA 3KJZA 4B7CA 1E3MA 3HRKA 1IC6A 1VHDA 3X2EA 4M0KA 5EGNA 3DVAB 3GP8A 2YWJA 5TVGA 4NCAA 1G9SA 3O8OA 1KBZA 5JASA 4NU0A 2QRLA 4GX5A 5EMKA 2DPLA 3NJRA 4X61A 3EPPA 4CL3A 1I4WA 5D5HA 3HL4A 3HN7A 5HZKA 4LHEA 4RE5A 2Q1XA 6REQB 1G21E 2PK3A 3LOPA 2OKGA 1KOFA 1W4BA 3THXA 1QFSA 2FJ0A 3SZMA 4PYJA 1M73E 1XRRA 4Y2QA 2VPZA 1EK5A 3HVUA 4ENPA 3I9MA 2G63A 4NDNE 4RTPA 3KB6A 1ORVA 3O4VA 5D87A 3LUJA 3N3BC 5HA5A 4ZHQA 2ZI5A 2CFSA 4WBNB 4HTAA 5KNCA 5C46F 5IX8A 4EQ6A 1LU9A 1IK6A 4QBIA 121PA 3L07A 1ZK3A 4YCCA 1HE3A 3E9EA 2VPYA 4MKRA 2V59A 4A5SA 4F4DA 2QVXX 2XNSA 4X1IA 1D3AA 3PHHA 3QUSA 4P3OA 3AGQA 5DASA 1U2PA 3FNHA 3O1JC 3BRQA 5EE0A 3M33A 2O0HA 4I8XA 5JWRA 1UKEA 1G5HA 3AY0A 2QMQA 4Q4LA 4K9RA 1OH6A 5IEBA 3NOOA 2FPIB 4CRWB 1VMEA 4HGPA 2VH2A 2FUG6 3U19A 2NVBA 2ISSD 1JMVA 3PQFA 4NX2A 5DX1A 1NPDA 1EFRD 5EWMB 3GP3A 4Y0NA 5B1SA 1V7QA 3OY7A 2NZ8A 3TD9A 4K6CA 3TW8B 1DAFA 1F9EA 2YVUA 1DQSA 2TYSB 4J1TA 1DTWA 2HSWA 4DWWA 4BEWA 3QEOA 4IMRA 1E1MA 2E7ZA 4DW8A 4Z99A 1QORA 3N70A 2BDTA 3KB2A 3D7KA 4DDVA 4HN4B 3VR5A 3UJCA 4KQGA 4FGZA 2BCGY 1KPGA 3B20A 3O03A 4RK6A 2AFHE 3KQLA 2W8ZA 1NBOA 5T5QA 2GHTA 1RW4A 4FDUA 5EJEA 1KMCA 3PFFA 1WW2A 4L95C 2W6ZA 5K3FA 4ARUA 4CIXA 3C3EA 1SXGA 3TYXA 3FGPA 3GPBA 3VC3A 3WBKA 4TUYA 1F8FA 5FWYA 1CUHA 3B9RA 4RVDA 3M70A 2JHCA 4BWVA 3NIDB 3HU5A 4G0UA 5FP0A 2YHSA 3M3HA 1BDBA 1FYVA 4MUIA 3KJHA 4EDFA 4BNGA 1KZYC 1QGYA 3L0PA 3MLAA 3ZQJA 1GQSA 3BMNA 4GD3Q 3F3KA 4RNDB 1EHYA 1S1MA 3PHIA 3HRIA 3TKAA 4QOIA 1VGQA 1F1BA 1XTZA 5AYVA 4BNKA 1SUDA 4CM5A 2HCFA 1Q7TA 4MB6A 4WL0A 3ZHOA 1CQJB 3RS5A 4ZEOA 3ER9A 3CA8A 4L4XA 1JDJA 3RWOA 4JXJA 3N6XA 1MJ5A 3CVWA 1FNMA 2OHFA 3JZFA 1D0IA 1KC1A 1KP3A 4GLOA 3OIUA 4IQFA 1GA1A 4IWYA 4C0SA 3IH5A 5JDCC 2ZT5A 4LV6A 1GA4A 1OIVA 4ZO4A 3MSCA 2PRSA 1OXXK 4QOJA 5D6NA 3EW7A 2FLKA 2C5SA 2PXCA 1EE9A 4QOGA 1Z22A 1OFIA 1ACMA 3UENA 5IJ9A 2YHIB 1MP0A 4AS3A 1FRZA 2P68A 3REFA 2E4WA 4CLRA 2BKUA 2HK7A 4JYCA 3WGNA 2EBHX 1P5FA 5HEKA 2TMGA 3V2HA 1E6CA 1CB0A 4CR8A 4CLXA 1EWVA 4F72A 5KQSA 1I10A 1OKKA 4M9XA 4Q4DA 3O83A 2V0GA 3OZUA 1MQ9A 3KZKA 3O1HB 2NM0A 3OZIA 5DLQC 4ZEXA 2NU9B 4GG1A 4ES6A 2F48A 4FPXA 2DCMA 1SN7A 4JYMA 1QHNA 2R86A 4XXHA 2A86A 4ZZ0A 2H07A 2H51A 1I2CA 3MS4A 1W19A 5KYNA 5KNDA 3BULA 4LSGA 1CXZA 2VSYA 4F56A 1SZJG 2VF5X 3LT5A 3U7FB 4AZWA 3Q1KA 4C03A 2B69A 1P1BA 4LRWA 2X9NA 4I8DA 4D8TA 1E4VA 1X8XA 2P0YA 1ZI8A 1DKRA 2PGAA 3K09C 1FIUA 4ZQBA 1KOJA 4EPYA 5EAIA 3NV7A 2AGVA 2CZGA 1Q3HA 1QYCA 4TS1A 1W4LA 3LC0A 3NBMA 5IJXA 2ZE5A 4QU8A 1BJKA 1BMDA 1ESNA 3AVUA 3H1BA 4J0DA 1MEEA 3IQEA 3WK9A 4BMVA 3HDTA 3ABRB 4F6RB 3PFKA 1L7NA 2P91A 4JOSA 3BBPA 1SGWA 4K9KA 1WZ2A 3P9PA 2EAUA 3KJEA 3A70A 3B3FA 2ODWA 2VTBB 4MMZB 2ZJZA 5TGTA 1RJFA 2HRQA 4U2BA 721PA 5LZ9A 2WU1A 4QM7A 2O5CA 1TJ3A 2QTCA 1ZAYA 3S40A 3W6ZA 4YUYA 3GH1A 4BHTA 1CQIB 1CRLA 3RHZA 3HBFA 1S3IA 2H9YA 3FRHA 4BWGA 4EUNA 3T0GA 1C2YA 4MPRA 1U8EA 1JYEA 2P5UA 2GTHA 3F7MA 4YONB 4HZIA 2XUAA 3WWZA 1FFBA 4NV3A 3SE7A 3OLWA 5BNIA 2CJPA 2F4NA 2ORYA 2ZSJA 1Y6RA 4TL9A 1D1TA 5DWQA 1CR4A 2VRCD 4HWSA 1R4AA 1IHOA 1NBAA 2B1RA 2WF9A 1E1CA 3KQSA 3QPWA 3QUBA 2PL1A 1VB3A 3V9AA 2ZYVX 2YCBA 1C1HA 3D7RA 4PX2A 1CLUA 2C0QA 3MJCA 4KYUA 3ZH9B 2AFIB 4LYJA 1QP8A 3MT0A 5ALQA 1F8UA 5IWCA 2R8EA 1D03A 1D2NA 1W9MA 1ZOOA 1YTLA 2ZDHA 4HI0E 2UYHA 5HX7A 4BU0A 1T9DA 1VCOA 1IJKA 1SOUA 3JYPA 1D7OA 1IEWA 3I6ZA 3JQ9C 3PU6A 1BGWA 2ZCUA 3RSCA 3RANA 1JKJA 2IP4A 1XC7A 1K7CA 2AFRA 2CXRA 3CZ9A 1BXZA 3CINA 1H4VB 1UOOA 2JFBA 3DF9A 2RI1A 2PVSA 4J7AA 4CT5A 1UZUA 4B6OA 2QZSA 4YMLA 1Z63A 1C30A 2D1SA 2JATA 3TE7A 1UT6A 5E4JA 4JGBA 4HJRA 4TSKA 5GJCA 3P9ZA 3LECA 3WJ7A 3ZWOA 4GO1A 3K9BA 2ZIZA 2IYUA 2Z2YA 4ZCSA 1TO6A 3PNPA 4BMZA 2A9VA 5GWXA 4QQKA