4NYJQ

Approach for targeting ras with small molecules that activate sos-mediated nucleotide exchange
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEASAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase HRas
publication title Approach for targeting Ras with small molecules that activate SOS-mediated nucleotide exchange.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nyjQ00
4X8MA 1KO1A 4Q7JB 4XTRA 3ZVNA 2FGJA 5L3SA 2YOGA 3DVLA 3B9QA 2WTUA 4G5GA 2WWHA 3R7WA 3SJCA 2IT1A 3NKVA 1XB2A 3RHFA 4WBSA 1Z22A 1NLFA 4BFSA 2EVWX 2QY9A 2DHRA 1TEVA 2BMJA 3E5HA 4Q1FA 1Y63A 3U3JA 3W5IA 2C04A 2FFAA 2H57A 1RRGA 4B2PA 4DLRA 3RABA 1WRBA 3SFVA 1YR7A 2J0UA 2MMCA 4MRVA 3ND8A 2RH5A 5SZIA 3X1DA 5AJXA 3I32A 4W9MC 3D3QA 4TL6A 4CW7A 4B3GA 3G5UA 2CL0X 3KJIA 1N6LA 2WOJA 3WMFA 3A1VA 4OQNA 3UG7A 1UM8A 2ZRLA 4PR0A 3SDZA 1U99A 1KGDA 2SHKA 1Q3TA 4KCGA 3ZVLA 4WOPA 3U4QA 1OW3B 3W5JA 1H8ED 5C18A 4GPTA 5GVRA 4AURA 1U81A 1FNMA 1W4BA 4XH9B 3RANA 2QTVB 3MGCA 2P67A 3RS2A 3CZQA 2CNWD 2C5LA 5FI0B 4UNNA 2E9SA 2C98A 1E6CA 4TQUS 1DEKA 2J5XA 1G64A 1VTKA 3KKPA 5KSYA 2JAQA 2OCPA 5CLLA 1F60A 5JI3E 4KXFB 2JLXA 4JVNA 2BM0A 4X8HA 4OI1A 3UMSA 4D4JA 4A8JB 4ON9A 3RRNA 2JJ2D 4F92B 1AQUA 3MLEA 2WKQA 3AEZA 2ZJ8A 2IYTA 2XXAA 2PJZA 2N1BA 1QG2A 2P5SA 4V0MA 3CX7A 2VYFA 5G3YA 3TW8B 1G8YA 1JAIA 3BC1A 3GJ0A 4V0LA 1M6NA 1J99A 2DBYA 4GRAA 2IXFA 1N6HA 4B43A 4TQAA 4Q19A 4Q5IA 3MJRA 1SVKA 2AXPA 3PITA 4KYUA 4HATA 1M8PA 1WE2A 1Z47A 3T1TA 3QKTA 3K0CC 4MUBA 2Z0MA 3WP0A 5C1BA 2R9VA 1E98A 1H65A 3C4JA 2B21A 2W2TA 721PA 1A2KC 1FOEB 4KFUA 1IQPA 2ASEA 4PAMA 3BGWA 621PA 2RGNC 3WRXC 1CRQA 1IN7A 1D2MA 3Q5EA 3I1FA 1UPTA 2H18A 3M6AA 2FSGA 4ZCIA 3KQKA 4KJZA 1W48A 2PJRA 1UBCA 3EIEA 3N5CA 4MITA 4MA4A 4ARZA 2E87A 3L0IB 2RGAA 3X1ZA 1F48A 2XX3A 1O3YA 1YZGA 2J59A 4FW9A 4OHYA 1VG1A 2FEOA 1MO6A 3KQLA 3CRRA 4ZDIA 2W00A 2XNDA 1SVMA 3SQWA 1SVLA 1SXJC 4FMCB 1AK2A 2GXSA 4V0NA 4CF7A 5J4HA 3I62A 4OK3A 2QT1A 3K0CA 1R4AA 4NZYA 1TQDA 1W0JA 3PIRA 5AUNB 3B82A 1XWIA 2BOVA 4AI6A 4A0GA 5FTKA 2WICA 2IYVA 1W36B 2HV8A 4PX9A 1CR0A 3AF1A 1VHLA 1EG7A 3UG6A 3A6PC 1KYIA 2QGNA 2CHGA 4JLJA 4HZUB 4LI0A 5JFGA 2VLIA 4LPKA 2WZQA 3TR5A 2QP9X 3KKOA 4NTZA 3T12A 5EXTA 1ZD8A 1G6HA 1NNEA 5FBQB 2DWQA 4PFSA 1II8B 5C4MA 4B32A 4P33A 1AKYA 3QENA 4LOAA 5AJWA 1E2HA 3T15A 1C4OA 2FA9A 3W3AA 1MT0A 2ZI4A 1E9RA 3OIUA 1B23P 4EKDA 2JLWA 1Z6AA 1R6BX 3TUZC 1CS4C 3U60B 5EQTA 3ONWA 1YZTA 2Q9CA 3GJ5A 1YZUA 4TYQA 1N2CE 1EXMA 3MAAC 3C15C 3ZQJA 4URUR 5TARA 2RGBA 4Q9HA 4GP6A 5E95A 4DHEA 4FINA 1COWD 2BBOA 3AP3A 1RIFA 2GDJA 2QMHA 3SEAA 3U7FB 2GXAA 1ZC3A 2EWVA 3SE0A 3VR3A 2ONJA 1XRJA 4P4SB 3QY0A 1IN8A 3V9PA 2FV8A 3OEHA 3TSWA 5J5CA 3SFZA 3W3ZB 4RCZA 4DSOA 5JJIA 4O2RA 1X1SA 3VU9A 1ZVQA 2VEDA 4P31A 1W0KA 2BEJA 2ZE5A 3VKWA 4AD8A 5JI2E 1KIMA 4BFVA 4MKHA 2QPAA 2Y8EA 1NVUQ 4IHQA 4RFVA 1XD2B 1YJ5A 2O8CB 1MO5A 1PUIA 3TIFA 4TL8A 5DN6A 2Z4SA 2FX3A 5TY0A 1ZINA 2CLDX 2HXYA 4Q9LA 4LRWA 3T61A 4MDEA 5EE3A 2HYIC 1XXHE 1OFUX 2W2VA 3GLHB 1A4RA 3MSXA 4JKIA 4Q7KA 3LW7A 5DISB 1A5TA 3VNVA 4TLBA 5BN4A 4B71A 1KKLA 2HYDA 3KB2A 3K0FB 3LX8A 4XD7D 2PX0A 1DAFA 4C0KA 4LV5B 1E2GA 1LW7A 2IYRA 5F98A 1S4QA 3H0KA 1PLLA 2L0XA 4M4SA 4Z8YA 2Q21A 3C16C 2P2LA 1OXVA 4LX0A 3GLIB 1E2NA 4GDFA 3K09C 3OHMA 1N3BA 2OILA 3KJEA 2HUPA 2HLDA 3BWDD 3O8DA 5CJ2A 4JLKA 2FU5C 2BCGY 4RD6A 1MABB 1X8KA 3P27A 1QVAA 2JJ1D 1IJFA 2PLRA 1WP9A 2ZRDA 2GCPA 5FOSA 1ZP6A 4US0R 3DZ8A 1BS1A 3DEFA 2H17A 2RKOA 1FQJA 1E4VA 5EXSA 4XVUA 3AF2A 4V0KA 3IPYA 4HLUA 2FDCA 1E99A 1Q1EA 2FF7A 2VHUA 3QKSB 4JIMA 4NYJR 5FR1A 4DDVA 3E70C 2W2XA 3KJHA 4DSNA 1IN5A 4I1SA 1T3LA 2ZUCA 5FBVB 3KKMA 4DCVA 3FMPB 4G01B 4IW3B 2R6GA 3B1VA 1N25A 1NSTA 1QHGA 3VR6A 4BWYA 4QFMA 5FBRB 1P9RA 1G3IA 4IEEA 4LJ9A 1P9NA 1RVDA 3X1YA 2B7BA 2GVDC 1XXHB 2PMKA 5BN3A 3D7MA 4GOJA 2E1RA 2VP2A 2J41A 4C0SA 4UXHA 5DH9A 2V6IA 1DOAA 3HPRA 2CJWB 2ONKA 2NPFA 3QEJA 2O8FB 1E2IA 1GZSA 1X8LA 1OFIA 4LBVA 5IK2A 1LV7A 4C2TA 2GBLC 2IL1A 3BBPA 5L8VA 2GCNA 2Q9BA 3IQXA 2VQSA 4B6FA 3ADCA 2ZSFA 2VP4A 3AF4A 1OKKA 5EE9A 3WNCA 3LVQE 4B3CA 2FPKA 3PCRB 2WWWA 3OF5A 5FPTA 4PSKA 4ZDJA 1ZM9A 2PZEA 2QPTA 1P2TA 2ZJZA 5M04A 3SBEA 4HUTA 4DLSA 1NVXQ 4HAVA 5JECA 1GOTA 2OEPA 4FCTA 2PBRA 3IUYA 2EQBA 2OBLA 1P2SA 4B75A 1J8YF 3Q7QA 2BMEA 2ZRMA 3FGNA 5DHAA 4A0FA 3QVVA 5KPJA 2AKYA 3VR2A 5JEEA 3NVAA 2NIPA 3THYB 3AVWA 1XD8A 2ZRBA 4Q4HB 5G53C 5JWRA 2F9MA 3KTAB 5BQ5A 2P3SA 1UBEA 3GEIA 2FE4A 3WHLA 4DC9A 1JR6A 1NG9A 5AUPB 3DKPA 1XBTA 2LKCA 3AVVA 1RYFA 1G8HA 4HYYA 2OLKA 3W6OA 1WB9A 4ZCMA 2WIAA 3BERA 4QOSA 1D9XA 1E79D 3GQBA 4ZPXA 1KAGA 4TTPA 3ZDQA 4C30A 1KSJA 1YKSA 4LHWA 1Q3HA 2QP3A 2IS2A 1IY0A 2KJQA 1ZAKA 4R2IA 4WZBE 3EPJA 1R5NA 1RYHA 1MO4A 1R0XA 3ND9A 5J4VA 4BASA 2FFBA 1CBUA 2H92A 3T1VA 3RS7A 1JJVA 2Z43A 2ZROA 1JEDA 3GLGE 5IRCD 2OCAA 2ZREA 2ANBA 3AUYA 4BLPA 2ZI3A 3CRQA 3P1JA 3T1QA 5LDDC 4FXPA 4M1YA 4TLAA 3AP1A 1HV8A 4TMVA 5DI3A 3QF4B 4ESVA 4LYHA 4GMXA 4BLQA 4HLQB 3IBGA 2JLUA 3VR5A 1G19A 1TL7C 1R0YA 2D7CA 2F6RA 1KK2A 4JLMA 3CH4B 4KLNA 4RCYA 1GILA 3IEUA 1W4AA 2A78A 1N5IA 1Q0UA 1U8YA 4B35A 4BFZA 2WHXA 1BMFA 4PPNA 3GJ3A 2OZEA 1L2TA 1ELOA 1N5LA 2IA5A 4KBFA 5EXXA 4DLXA 2UVQA 1T8UA 1HUQA 2A5YB 2LWIA 5FFMA 3K70C 3EIQA 1PJRA 1I4DD 2DFNA 5F9HA 1X3SA 3AB3A 3CLVA 4PZYA 4PZLA 3H4MA 4FCWA 1Q1ZA 4IEIA 3V00A 4IVQA 4ZI2A 5GJVC 2FJUA 4CEIA 1Q20A 3EZFA 1EFRA 2YVUA 4FMDB 2VF7A 3PV0A 3GLFA 4NL4H 1R8QA 5B58C 2ZI7A 2ZI6A 3K1JA 5D3QA 3FYHA 4K46A 4UNQA 1E2KA 5FBLB 3IBYA 3CM0A 4AKHA 1DAEA 4C7OB 1DARA 3QUSA 4KVAA 4YMTA 3THOA 1G4AE 3I5YA 2O0HA 3NEYA 1YQTA 4KU4A 4NHOA 3GLGB 5FUWA 1E2FA 3UATA 2EWWA 3ZS9A 1U9IC 2XNSA 2YINC 1GDDA 5CYPA 1G6OA 4LJ4A 4RZXA 4B73A 3O8RA 3ZH9B 3N2EA 3GJXC 3OFNA 3CWQA 4GP7A 4GOKA 4E03A 4NCIA 1DG1G 1NIPA 3C5HA 2Z83A 2GTPA 2KSQA 4QM7A 3X1XA 4DLYA 4LJYA 3P4XA 2C99A 2F9LA 2QL6A 5A4JA 2XZLA 2NOAA 2OHFA 3ZYCA 4F4IA 1BO6A 1US8A 2J7KA 4H1UA 3L0OA 4IOJA 3EX7C 1LTQA 1ZJ6A 2ZYWX 3CO5A 2IW3A 2J7PA 3H84A 5KHOC 1JNYA 4FMBB 3KXLA 1KKMA 5CDFE 2YWGA 4X8LA 2C77A 5L3VA 2X2EA 4TL7A 1R8SA 1TNDA 2OFOA 4F4CA 2BWJA 5EZ6B 3WYAA 3K0AB 3LBNA 2WWYA 1OH5A 1NN3A 3C5CA 3I3SR 2WAXA 2BCJQ 1TF7A 3F3YA 4OHXA 5DI9A 5FI1B 1G21E 4B47A 4A82A 5C46F 2O8DB 2FEMA 3JVUA 3K53A 1EX7A 4PSVA 5B30A 4NYMQ 3PEVA 4LJ6A 1H8HA 3HPQA 5KO2A 2QORA 2A2ZA 2R44A 1CKEA 3ADKA 1E2JA 1XTSA 3KJGA 5E3HA 1IAQA 3OIWA 1N6OA 2R62A 4U7DA 1P61B 1JALA 2HT6A 4OI2A 1E94E 3BORA 2V7QA 2F1HA 1HURA 3R9XA 4JT2A 1XPUA 5H68A 1L7VC 5KYKA 4A8JA 4WZ6A 2BBSA 2DFLA 4WXRA 2XNDD 3T1OA 2FGKA 2GILA 3FB4A 2ZS7A 3RS5A 1AJEA 2ZI5A 4NDZA 2P0EA 2ZRHA 5KNDA 4PXAA 2QROA 2N46A 3IO5A 5A0FA 2A30A 1FUUA 1X1RA 1CRPA 4M21A 1W0JD 4TN1A 1ESNA 3SYKA 2PCJA 2J1LA 3Q8XB 5JHGB 4JJKA 4XWOA 2A9KA 2R6FA 4HB2A 2ZRAA 4P4TA 2F1JA 1JAHA 3CX8A 3IIMA 1NP6A 2D62A 1N0UA 2F43B 5GVSA 4NU0A 4JT4A 4YMSA 4OQFA 3T06B 3J81k 4JSTA 1F5NA 1ZBDA 1DAIA 2K5UA 3TNFA 3T34A 1X8JA 4HLDA 1CJKC 4N0DA 4MRNA 3B2EA 3QXSA 4KBGA 4JJZA 3WMEA 2ZI9A 1KDPA 2W58A 3HYTA 3QKRB 3DMNA 4D6PA 4N1AA 1KHTA 2ZSAA 3QSYA 1KO7A 2KI5A 5A5GA 2JA1A 1ZCAA 4KHZA 1NJGA 4ZDWA 3K9GA 4HAWA 5F2EA 2QAGB 3TLXA 1R5OA 1MO3A 1OB2A 3U44A 4AG5A 1DO2A 3U3KA 2WM9B 1HYQA 3MRSA 1K5DA 4JS0A 4M1MA 1QG4A 4QNRA 3LA6A 4W5HA 3VAAA 1BYUA 4RKFA 2CHVA 1KNQA 2DFKB 1F2TB 4HDCA 4XSHA 3SJZA 1S9DA 2ORVA 4Z8XA 4X8OA 2ODBA 4AK9A 1D5CA 3OEHD 4EJSB 5HZHA 1KMHB 1R2QA 2GJ8A 4BLTA 1KNXA 3U7GA 5JRZA 1TTTA 3WNDA 2VIIA 1W0KD 4Q9KA 1E9BA 2GRJA 4JLDA 2VSFA 4DCSA 1DE0A 1XMSA 5F9FA 2VSOA 1G20E 4QGAA 1Q21A 1YE8A 4LWZA 5DN6D 1GUAA 2KWIA 3CF2A 4O25A 3QBTA 2ODEA 1N0WA 4RD1A 1Z29A 2NG1A 5JSZB 1EFCA 4GNKA 2YWFA 4FN5A 4JL6A 5IDVA 3ADDA 1DPFA 4DCUA 3QKUA 4K8OA 4RFSB 1AA9A 1CLUA 1Z0IA 3QF7A 4NCHA 3THWB 5KSPA 4GBMA 3FFBA 1E2LA 4MGZR 4Z1MA 4DT1B 2OAP1 2FSFA 4M1OA 4LHVA 3TK1A 1RRPA 2Q3FA 2P65A 4MUAA 2CK3A 2HLDD 1L8QA 1VMAA 4AYTA 1ZW6A 3S1AA 1UFQA 4A2PA 4US2R 2HT1A 1TF5A 1FX0A 4UKDA 4I4LA 1WQ1R 2P6NA 2IEYA 5TDHA 4P3YA 5FOVA 4KITB 4Q21A 2ZAOA 2JLYA 1FMLA 3A4NA 4XJXA 3A58B 5HCNA 2CMKA 2WMNB 2IBMA 1F2UB 2WJGA 3KUCA 1ONBA 1AM4D 1GNRA 1KSHA 1YR9A 1W5SA 1ZUHA 1ZNYA 221PA 4RSGA 2IF2A 3E2IA 3AVXA 4D2IA 2GJKA 5FL3A 5FUYA 4M53A 2O8CA 1CTQA 1AS3A 1UEIA 4ILEA 4AKEA 4IFBA 1W2HA 4PC2A 2IYSA 1XPOA 5B64A 5JS8A 1N0VC 1GWNA 4M22A 1T5IA 5CLQA 1LFDB 3R20A 2NQ2C 3TSOA 1U98A 4WXPA 3EG5A 3K0FA 4MYHA 4PO9A 5LB4A 1BOFA 2GNOA 2AK3A 1NN5A 1NKSA 4TLDA 3Q85A 3RNLA 4OK5A 4V0OA 2JLSA 4EPYA 1EK0A 2X19A 5TMPA 1G7TA 2ZEJA 1WBBA 1VG0B 4IVPA 5HKKA 3WYGA 5IK2D 2RHDA 2A7QA 4L9WA 4YC7A 2OM2A 2DWPA 2WJYA 4LPSA 2GKSA 1E9DA 3K0SA 4B74A 1OKKD 3EA0A 3QNUA 4DLTA 3QXHA 1RRFA 4B33A 1D6JA 4JLBA 4A2QA 4D80A 2J0SA 1Q1QA 3ZZ0A 3GJ8A 3CRMA 1B0UA 3M1IA 3U61B 4Q9IA 1ZYUA 2PCLA 1P2UA 2QQ0A 1ZM7A 3N2IA 4WA7A 4RJLA 2CBZA 3BOSA 1OXXK 3QEOA 2R6DA 6Q21A 2XTNA 2ECKA 1F3OA 1VKJA 2H8KA 4M1WA 2IXGA 1RW4A 3EZ6A 4LBZA 3M0EA 1G3QA 5JZVA 2AD1A 1VPLA 4LJ8A 3WRYC 4HEJA 3BFXA 4OHZA 3B5JA 3MG9A 2BC9A 3PUXA 3THXA 5L3RA 3CNOA 4BZQA 2DB3A 3KXKA 2WSSA 4CYMA 4PC6A 3RWMB 1VYUA 3FKQA 4P32A 1XXHA 4KSCA 3PEWA 4YMVA 5BN5A 2HCBA 4TLEA 5JS7A 2WKRA 2CJWA 3BB3A 1P6XA 2JLRA 2O8FA 5JLJA 3FHTA 1OIVA 1Z0FA 1JI0A 3UWOA 3EIHA 5E4FA 3LQQA 4EQ6A 1IM2A 3UIEA 1Q12A 3UK6A 3B7GA 2NZ8A 4XOIA 3REGA 1U0LA 1DS6A 4JMPA 1YZLA 1P9WA 4U00A 3AQ4A 3CH5A 1T9HA 4KO8A 2J9RA 1VCNA 2GWHA 3CW2A 2ZJOA 4I99A 4JL8A 1Z6GA 2WJHA 4Q4AB 1TX4B 4S2EA 4URVR 5DYIA 4B3DA 3FFAA 2RCNA 5HE9A 5JRJA 4EPTA 3PFIA 1PV4A 2JIZA 2QMUA 4HAZA 1KSGA 1YR8A 2GZDA 2VP9A 1DADA 5CK5A 2IX3A 4C0LA 3FTQA 4NYIR 4Q03A 4DZZA 5L3QA 3O47A 3I72A 2RGEA 4XVRA 3PEUA 3THYA 4NBSA 1JR3E 5CM9C 4Q4HA 2EFDB 1P4SA 2W0MA 4GFDA 4Q4JB 3W6NA 3U3RA 1BMFD 4KODA 3KTAA 1HQCA 1K5GA 3DL0A 1PLKA 2XJ9A 5IT5A 3GLHE 1NKTA 1PZNA 1XEXB 5EE0A 4ZDKA 3IPXA 3KDSE 4TLCA 4XWKA 3MWYW 4HUQB 2OBNA 3GD7A 2N42A 2BM1A 1OH8A 3WHKA 1FP6A 1MH1A 2FNAA 5E7JA 5JCZA 2YNMA 4TMXA 4U5XA 5LD2C 4CEHA 2IC5A 3B1XA 2O0KA 4AWXA 2FN4A 1P62B 2P5TB 3GLIE 3AUXA 1QF9A 1EFRD 1T91A 4TTRA 2XGJA 4E5UA 4HB0A 4OQLA 3LY5A 1MKYA 4MYTA 4QXAA 2GETA 1OXTA 2WVJA 4G5RA 3TVDA 4Q7LA 1G18A 2OCYC 3SU8A 2ODNA 2PT5A 5KSZA 5HPYB 1D2NA 4KYIB 2Q0HA 3QF4A 3LQRA 5AK0A 2QZ4A 3FKSA 2QEQA 5GADl 4UJ3A 3VHLB 2AX4A 2QE7D 2ZE8A 1Q1BA 3OFND 3K70D 2ZRGA 4CZ2A 2ZR7A 5JWHA 4BPBA 1NN1A 2VP0A 3KKNA 4IOLA 3HR7A 2AN9A 3SJAA 4KFTA 1XZQA 4G1UC 1WF3A 1KI6B 1GM5A 2B92A 4HLUC 4BLRA 3V4RA 3CIOA 5K8TA 3TQFA 3LX5A 3CBQA 1V43A 4JLPA 1Z3IX 2QNRA 4Q7MB 4TWZA 2J7PD 4UNPA 2J0UB 3EXAA 1UKYA 2PH1A 1DAMA 1GAJA 4ZO4A 4HLCA 1FL9A 1JXOA 1DAHA 3LXXA 2QSYA 1Z07A 2YC4C 2ATVA 5CJPA 2ZYTX 4AKGA 2AXNA 1G5PA 1XEWY 4P0TA 2O8BA 1VCOA 3TW4A 4NCKA 5DO9A 3FVQA 3GFTA 3UANA 1OJLA 1XTRA 4PHGA 3RSOA 3FHCB 4EFMA 5FTNA 2ZITA 1NBME 2CHQA 3IIJA 3U4QB 1DELA 1GNQA 3GLGA 1RRCA 4RZ2A 4BECA 5J4LA 3HU1A 3ZVRA 1H8HD 1E9FA 3N70A 1Q57A 4G0NA 3TE6A 1G8FA 1HQYE 3KUDA 1G7CA 1NY6A 1IONA 3SQXA 4QGGA 3NTUA 1TUEA 2QMEA 2VA8A 5BXQC 4D0LB 4CT4B 4GSYA 1AIPA 4YMWA 3R8FA 2YC2C 3P26A 3EPKA 5KNCA 2V7QD 3WBKA 2VHTA 3CNLA 1YU9A 5FPYA 1WBDA 1WA5A 1FFHA 5LBIA 3TR0A 5FOXA 1TAGA 4DLUA 4M1KA 1W2GA 3WXMA 3DOEA 4D4LA 1NY5A 2REBA 3A37A 1S96A 2ZETA 3I92A 2XXAB 1IN4A 1KSFX 2R6AA 3HU3A 3RAPR 4A1FA 2V55B 1FZQA 4MGYR 3ADBA 4QGHA 1G5TA 1ZUNB 4J0QA 3VMFA 1VCMA 2BIFA 1S8FA 3VHXA 3QIAA 1IY2A 1E1RA 4NYIQ 1Z06A 3V4FA 3AVQA 1G7RA 1LF5A 4B48A 3Q9LA 2QBYB 4KSBA 1S1MA 3D8BA 1TQ2A 5FTLA 1E9CA 2O8DA 1OSNA 1UKEA 4M8NE 521PA 3SI7A 2VO1A 4PAQA 3RDPA 4TMZA 5GJCA 4Q9JA 1P75A 3U3OA 3BRWD 3VX3A 3FOZA 2IHBA 1GL7A 2B8TA 4ABYA 3OZXA 3WY9A 3KX2A 3TJZA 1SXJE 4IVRA 4EIWA 1OHHA 3O8CA 2DY1A 2J0QA 1V5WA 2OAQ1 4LJAA 1W44A 5FPSA 1CJUC 4TT3A 4CEJA 1NL3A 3EW9A 5KSOA 4AY2A 1XJCA 4ARZB 1KAOA 1GL9B 1NMXA 3ZIAA 2GJAA 4TL9A 1IJEA 1T0HB 2IYXA 1OH6A 3T5GA 4ZI3A 4KFRA 1EWQA 3RRYA 1ZNZA 4JLNA 5AJYA 5FH9A 4TTQA 4NPHA 3HWSA 5EE5B 3SZRA 1JEEA 4ZKEA 1U0HC 2QENA 2J87A 1Z08A 4A2WA 2ZSBA 4CRWB 1KJWA 1CJMA 4GMDA 2VP6A 1HA3A 1KK3A 1SULA 2A5JA 1R10A 3MMPA 3MWKA 1XF9A 3G82C 8OHMA 1W36D 5DHFA 1E9SA 1T3SA 4BFYA 3EC2A 1JPJA 2F43A 5CDFA 2C9YA 2BHRA 1NLYA 3TBKA 1A7JA 4G5OA 4FWTA 4BLOA 1FP7A 4TZ6A 1NMZA 1XTJA 1Z0KA 2EFEB 1LB1B 2ANCA 2WJJA 3LVRE 2ZRIA 1KI3A 1N5KA 4MRRA 1T4GA 4Z51A 2GCOB 3KFVA 5FL7A 2IYUA 2AL7A 3RS4A 4QHTA 4HSEA 1JBKA 4DIEA 2Q6TA 3OIVA 3X2SA 2EFGA 1P7CA 1SHKA 4C3ZA 2WPDA 1XFAA 1RKBA 4RVCA 4RZ3A 1VG8A 4EFNA 1IY1A 4TMWA 1G3MA 3NBFA 1GKIA 5AUOB 3O8BA 2YWEA 3KXIA 2DWOA 1W5TA 2REXB 5AR1A 3CKLA 1CJTC 1SXJB 2ZUDA 5DLQC 1AGPA 3EPHA 2D74A 4Z1MD 2WBLC 2IWRA 3BXZA 4ERNA 2JCSA 2WJVA 4OHWA 2CK3D 3NIBA 2HEIA 3I73A 2AWOA 4PQYA 4BLSA 3NEJA 5ELXA 2B6HA 3A4LA 4OJKA 1KMQA 2EYQA 2H1LA 4GOXA 1CJVC 2GXQA 2KE5A 3A1WA 3GMTA 1LS1A 4A36A 2IHYA 3VX4A 4EJSA 2ZSDA 1J2JA 4RD2A 1N6KA 1NSFA 2BVNA 1UKZA 4Q01A 5AJVB 3SJBA 1KMHA 5BWMA 5JBQA 4GZMA 1W47A 1TEXA 3OEEA 4NYJQ 3VNUA 3HDTA 4MYUA 4CDGA 1G1MA 4UNSA 2HJVA 3AGPA 1MV5A 3AKEA 4V02A 5CIQA 3RRMA 3ZZTA 3EPLA 2P6RA 3IIKA 1QVRA 4EUNA 2YOHA 4PAOA 1AQYA 2HF8A 3AKDA 5JSZA 3MFYA 2AHOA 1MRSA 1U94A 2OV2A 3BE4A 3IQWA 4HAXA 5D3MA 1EESA 1E1QA 2FZ4A 1OT3A 3IKJA 2AK2A 3VR1A 1E2MA 3LXRA 3DDCA 5H1YA 1U8ZA 4F91B 2BBTA 2ZR9A 2BEKA 3B78A 4B2LA 1NRJB 2IF0A 3BB4A 2FSIA 4D82A 4RZUA 2QG6A 4D25A 1S9HA 2FSHA 4E09A 4DT1A 5HKKD 1P2VA 2QE7A 1UADA 3IDQA 2O5VA 3L8YA 3LBHA 3TUIC 3NHBA 1MR3F 2CE7A 2GF0A 3OESA 3W9YA 2G6BA 1Z5ZA 4PO1A 1DG3A 2VP5A 3PQCA 4Q1CA 1K8RA 1RJ9B 4BRWA 2QI9C 3GFOA 2QM8A 3CPHA 2X2FA 2WWFA 3RC3A 2OXCA 1F2UA 1TUIA 4QBIA 1T3HA 3B60A 2ZM5A 3U7HB 5E7MA 1XCPA 1HTWA 2QMOA 4A8JC 2WWXA 4TYNA 2AD5A 2G83A 3CF0A 2XJ4A 1C1YA 1G7SA 3K0EA 1KTVA 3P32A 2EYUA 4II7A 1S1CA 2QSZA 2W6IA 5HZKA 2ZJ2A 3LW8A 4IDQA 1NLZA 2WSSD 4KLZA 1NMYA 3B1WA 3RS3A 1Z0AA 4QNMA 5EP3A 3FDIA 4UQOA 3SOPA 4OBEA 2CLCX 2MSDB 1D9ZA 3LH5A 4WW0A 2GEDA 4FWIB 5EJEA 4I1VA 2IXEA 3EWSA 2C78A 4C4PA 3I8SA 4CGZA 2IEZA 4DXAA 4HI0E 3CX6A 1FPMA 2HXSA 2ZE6A 1JB1A 3BH6A 4L15A 1DBSA 1CXZA 4O2LA 2QU8A 4YDSA 4TQ9A 5DGXA 1RE0A 2XSZA 1IOZA 5HTKA 2G77B 4UNRA 5FOWA 5J47A 2ZS8A 1NI3A 3LDAA 1OXSC 3FHOA 5H70A 4FI3C 3BIFA 2JDIA 2ZRJA 2HJGA 2A5GA 4C0HA 2IS6A 1RFLA 1J70A 3SR0A 1OH7A 3TAUA 1XMJA 2FPMA 1OV4A 4HB3A 2VH5R 2D3WA 4MKFA 4ITRC 2ZJ5A 2BJWA 1XJ0A 4NCJA 2JIZD 2ZRCA 1UBGA 2CCKA 4DB2A 4M9QA 2PEYA 3H86A 3X1WA 4L5BA 4W5WA 2X77A 1KOFA 5KDLA 3R9IA 4C0BA 4EPVA 5DSZA 2OT3B 4GI7A 4M1TA 2PEZA 4MKIA 3NWJA 3IHLA 3R8CA 1XPRA 3EZ9A 1I2MA 1ZU5A 5G41A 3VQTA 4L8GA 2VSXA 4ZIRB 1BYIA 3ICQB 1KO4A 3AKYA 2ERXA 3TKLA 1ZM4A 4PHHA 4LV8B 4C0QC 5JWOA 3KQHA 3B13B 3CUEF 3W8RA 1W36C 4IDNA 1A82A 4A6PA 4OJQA 1E0AA 4Y0AA 2CLSA 2LKDA 3AVPA 5EUMA 3RC8A 5J4KA 2CXXA 1CP2A 2G88A 4DDWA 3UPUA 4G3XA 5IHPA 4BQSA 3DPUA 3PUVA 4FIDA 3ZZUA 1SHZA 1N6PA 3DKVA 4BFWA 4EPWA 1EWRA 5JCPA 2O52A 3CB4A 4F7WA 1E4YA 2ZSEA 1AS2A 2QUZA 2XEXA 4JSYA 2QRZA 2QN6A 2QAJA 5KNBA 1WXQA 2OUKA 2FH5B 1OXUA 3EZ7A 1J90A 2WAYA 4JZKA 3TH5A 3BK7A 4YDHB 4D4MA 1KZ7B 3EC1A 4NH0A 4UXIA 3CPJB 4E22A 5FTMA 3ZJYA 5GJBA 1YRBA 3FKSD 1KDOA 4DKXA 2KB0A 1ANKA 1DAKA 2Z5FA 2W83A 4JVLA 1BIFA 5TVKA 3DO6A 5JEDA 1XJQA 2ZJYA 3I8XA 4HZUA 3CZPA 2C9CA 2PL3A 1R7RA 4S35A 4MDFA 4Q4JA 1Z6YA 1CIPA 4UJ5A 2FFHA 4CIDA 2NZJA 1X86B 4M9ZA 2ZIAA 3QE0A 1XDBA 1XEXA 4LHZA 1ODFA 1II8A 4Q66C 5LPNA 3VR4A 1D2EA 1U2RA 3HP1A 4PHTA 1Z2AA 1G9XA 3BB1A 4UXJA 1R0ZA 2CCGA 2H5EA 2YYZA 5EZ5A 4DUGA 4LYAA 4MRSA 1XU4A 4BEBA 1P72A 4IDOA 2I4IA 1DO0A 5EP2A 3BD9A 1OB5A 4HAUA 4DEXA 1WDTA 1S3GA 3L8ZA 3KFXA 4F93B 4B44A 4DCTA 2WV9A 4YXWA 2PLFA 4B76A 2XITA 1SVSA 1WMSA 1SVOA 2PMDA 2ZYUX 4CEIB 1M7HA 5E7IA 4IJMA 2G9NA 5K8LA 1VIAA 3AVUA 4G5SA 3SS8A 3MD0A 4ASUA 5FBWB 2GZAA 1XTQA 4QHYA 5KTYA 2G3YA 4M2LA 2VHJA 1TQ6A 3IHWA 2GJSA 4ZKDA 5BW8A 4PQFA 4P4SA 1FUKA 4A6XA 1GFIA 2NO0A 3ZD7A 4LK2A 2GK7A 4IDPA 2G0TA 4LJ7A 3GFPA 3FMOB 1HY3A 1QBKC 4NKRA 5HR5A 2B8WA 3LRPA 4CVNA 2IS1A 1GRQA 1LY1A 2QA5A 2GESA 1IXSB 1XD2A 4TSFD 2OSBA 1JR3A 1Y3AA 1SKYE 1EFTA 4L16A 4DJTA 3K70B 4ZV4A 1KI6A 5JMTA 3B1YA 5EUQB 1NN0A 2C95A 2QP4A 2ZU6A 4D0NA 3GLHA 4JVSB 4IOKA 2MMGA 4PC3A 1VCIA 2EU8A 4LHYA 1UKVY 1EFHA 2OLJA 2ZJBA 3TRFA 5FOTA 1US8B 3NG1A 3NBZC 1GP2A 3A4MA 2ZXUA 1Z8FA 1G4UR 1E1RD 5CITA 1YZKA 2I1VB 4P4UA 1NJFA 3L0PA 2Q3MA 1CR2A 5DYGA 5J4YA 4LHXA 2QRNA 1GIAA 2V9PA 2ZUBA 821PA 3GLIA 2GEVA 2QTFA 4WIAA 4FCVA 3F0TA 4M9SA 4KVGA 1G8PA 2OESA 1LF0A 3HU2A 1MABA 1ZD9A 4C9BA 1QHHB 4IOMA 3U6BA 4LYJA 3VFDA 3P20A 2JJ8A 5CB8A 4POAA 3CR7A 3U6KA 4CT5A 4RD0A 5CYOA 3QBVA 1W46A 2GK6A 2Z6VA 4HDQB 3QPWA 4PZZA 1XCMA 2KBEA 1G291 3ZGXA 1OHHD 2BBWA 3QKSA 1G3RA 4DDTA 3VKHA 5DNYB 4B34A 4TT3D 5BYJA 2ZRKA 4DVGA 5KOYA 4DLWA 1QHSA 3LV8A 1TU4A 1OF1A 1PLJA 3W90A 2IYQA 4NP6A 2V8OA 3ZIAD 1K6MA 3WMGA 2WWGA 5KDDA 3K8YA 2P6UA 1WCV1 1U8AA 2BKUA 3A36A 1SKYB 2ZVQX 2O0JA 4LC1A 1U0JA 3RYTC 4OI0A 3T5DA 2J0VA 3DOFA 4O3MA 3HJNA 4PSAA 2W6JA 5CK4A 2O8EB 3UMRA 3VTKA 3OE7A 5FPHA 2WIBA 1AGRA 1OYYA 3A1TA 1G8GA 1ZCBA 4Q02A 1AZTA 4QG7A 1PUJA 1YZNA 2JGNA 1P60A 2V1UA 4LZZA 4B3FX 2GXUA 4DDUA 4OHVA 4A0HA 3AGQA 3REFA 2F55A 4PPGA 2QBYA 1N6RA 2RGCA 3B9PA 4R71A 4XSGA 5FL7D 2ZJAA 1ZUIA 3KQNA 3W8NA 3KB1A 2CE2X 3KZ1E 4C0AC 2BKEA 2G0NA 4F38A 1NBMA 4C0JA 3U3MA 4L4UA 3C8UA 1UDXA 4KV9A 4B3XA 3AV0B 4JL5A 2WPDD 5FUXA 4BGDA 4EPXA 1KJYA 5TV2A 1W1WA 2YHSA 2DFTA 5FUVA 4DIDA 4URXR 4DLZA 2CL7X 2H7VA 4TMKA 4GT1A 1TMKA 1N6IA 5BYKA 3NDBB 2ZRFA 2F7SA 1E32A 4K81B 1AKEA 3M4YA 5G3ZA 4LY6A 2YWHA 4QJ3A 4W7SA 1J7KA 1XEFA 121PA 1OIWA 1VECA 4YONB 1T8TA 2FFQA 2ATXA 3U44B 2XB2A 1D8TA 1T0JB 4G5QA 1FW6A 1KI2A 3HR8A 3JVVA 4A15A 1KY3A 4NE2A 2IYWA 1P5ZB 4BEJA 3CWZA 2FG5A 2XOKA 1SZPA 3ZD6A 3RSLA 2QT0A 2R65A 3GJ6A 3SN6A 3UWKA 1M7GA 3EAQA 1Z63A 1DVRA 1XD9A 4B3BA 3ETLA 4FMCF 4IXNA 1JJ7A 4NMMA 3OEED 2RGNA 4HZIA 2UZ3A 2OE2A 3QXCA 2OBMA 3GJ4A 5B57C 1SQ5A 2GCOA 2ZS9A 3PG5A 4GZLA 1ZU4A 5EE1A 3A1SA 4JLAA 1N6NA 3U2QA 1XTIA 1XZPA 2HF9A 4YLGA 4BRUA 2XTMA 1E1QD 4A4DA 3DM9B 4QL3A 4Q00A 4MH0R 2OXRA 3C41J 4LBYA 1SXJA 1E96A 2YJTD 4BE7B 4LSGA 1TPZA 2RMKA 1XX6A 1P73A 5B2ZA 3QJYA 2AR7A 3BFKA 3IEVA 2FOLA 1QHIA 2VRWA 3TVTA 3NHAA 1F6BA 5L3SB 1CR4A 4AG6A 2JEOA 3CR8A 4B2IA 3BS4A 4JLOA 2NO7A 3R7WB 3KQUA 2YV5A 3S1AB 3IGFA 2BJVA 1FX0B 4MQBA 4WVFA 4V0ME 1KDRA 1KZGB 1VYVA 3WYFA 3BH0A 1M7BA 1GVNB 1MRNA 5HE8A 3FWYA 4QJ5A 2BV3A 3LLUA 4L9SA 2VPPA 5HCIA 1YR6A 1NF3A 1ZM3A 2W6ID 4DB4A 2EFHB 4PTLA 4ACBA 1C9KA 2AFIE 3QXJA 4Q1AA 1E2EA 3RRZA 2FMXA 3LNCA 1NIJA 5GJWC 3OAAA 3GP8A 3EA5A 3A1UA 2CL6X 2ZRPA 4TYPA 3PVSA 4C7OA 1KO8A 2TMKA 2QM7A 3CONA 1TADA 3B8HA 5KU1A 1HE1C 2JLVA 4F4JA 2F1IA 3NH9A 1W7AA 3MCAA 4QBGB 2DPXA 4RD3A 4Q47A 2C03A 1VIYA 1HEIA 3LLMA 3PJRA 3DZDA 4IRUB 2RHMA 1OYWA 4LGMA 4US1R 3EASA 2XSZD 4E07A 3K9HA 3CF6R 2IUTA 2IWHA 4KI0A 4HAYA 4HB4A 4QRHA 4TSFA 5FPKA 3WP1B 1Z2CA 2CEAA 1OFTA 2JDID 2EFCB 1G5RA 1RJ9A 2XB4A 1ZIOA 4JYBA 4QBHA 1L4YA 1MOZA 421PA 2V54A 2ZQ5A 1KI4A 1ETUA 1E0KA 4LUCA 2HDNB 2IUSA 4OI4A 2C2HA 2GF9A 3AVTA 1ZC4A 3SNHA 3DHWC 2OFWA 1Z0JA 1AN0A 3QG5A 3B85A 2F3TA 3KKQA 3ICEA 1II9A 3LD9A 3PUWA 1KJZA 3K0AA 1OPXA 1Z6XA 1ZD1A 4IDHA 1Q22A 1O87A 4URYR 3VKGA 3THXB 4AIIA 1GITA 2R2AA 3GEHA 2MSCB 2WWIA 3ZS8A 2EW1A 1H8EA 4WZAE 4Z54A 1KY2A 3K09A 3NBXX 4EFLA 2REOA 2IYYA 2C96A 5SZKB 3Q5DA 2VL7A 2AWNA 3IO3A 2CNWA 1ZM2A 4A9AA 1JQJC 1OLOA 2NPIA 2R8RA 3ZQ6A 1A2BA 2YOFA 4R2HA 2KBFA 3EARA 1ESMA 1OIXA 3JZAA 2VF8A 3GJ7A 5EP4A 4A0RA 4EQ6B 2XAUA 2QQEA 1E0SA 1Z6TA 1VG9B 2JJ2A 3PEYA 1SKQA 2IS4A 3AF3A 2D06A 3U5ZB 1KK0A 4B6EA 4PPQA 5SZHB 3BAFA 3PENA 2QAGC 1TU3A 4LCBA 1M74A 3W34A 1SVIA 3LWNA 2CDNA 4MYCA 2Z4RA 4OQXA 4LDJA 1PVOA 2LCFA 1IXRC 4YQFA 1HH4A 1G41A 1GKUB 3QXXA 4LV6A 2AKAB 2ZRNA 5DIFA 1XNJA 4Q1DA 4Q4LA 3SHFA 2UZIR 4ZIRA 2ZTSA 3ZVMA 5H8WA 2G1JA 4D26A 2BMFA 5L3QB 1FMJA 2NO9A 3JZMA 3MWJA 1NVVR 4EJSC 4ESHA 3F8TA 4XWAA 2GBLA 3QKRA 1S3SA 1E69A 4NYMR 1GRNA 4DUGD 1N5JA 4PHFA 5FOUA 4MKGA 4BFTA 4I1OA 3T35A 5CM8B 2ORWA 4Q18A 1HE8B 4M9XA 2QAGA 5K8UA 4RD4A 3UXMA 5LB2A 4CEHB 4R7ZA 4OYHA 4XTCS 1VDZA 4YXWD 2CVHA 3I4LA 3SC3A 3PUYA 1TQ4A 1CF4A 3LFUA 5AUQA 2GZHA 4OK6A 3HYRA 1XCGB 5JHHB 2ZU0C 4W5JA 3F5FA 4ASUD 2GA8A 2RGDA 4LJ5A 1F2TA 1UF9A 4JYCA 2VBCA 1J8MF 3P4YA 4TYYA 4JBWA 1VYTA 2D2FA 2GAAA 2PX3A 3L0SA 3D31A 3Q7PA 4Q48A 1W49A 2ZVPX 4GL2A 2V1XA 4URWR 4OQMA 1JXMA 4D81A 2UKDA 1HT1E 1XMVA 4N3NA 4LYFA 1U90A 1QHNA 1M34E 1M2OB 2ZYVX 3H2YA 3I5XA 2FZLA 3B1ZA 2V6JA 2PZGA 2X8AA 4JVMA 4ZCLA 1CU1A 3NC1C 2BDTA 3CRW1 4IXMA 5FTJA 1HT2E 3LAWA 1JR3D 2C9OA 3VU9B 1R5BA 4PO8A 2D2EA 1LS6A 4EPRA 1T5LA 4I1UA 4OL0A 4Y0VA 4QHSA 5LD2B 1VHTA 1I4LD 1Z83A 1E9AA 4M0LA 2V3CC 3BFVA 1KI9A 1XMIA 1SGWA 2PT7A 2AFHE 4QJ4A 5EXPA 4PC1A 2WKPA 5AWFC 1X6VA 2IK8A 2IYZA 4RFSA 1IBRA 1ZMXA 3THWA 4I81A 3GEEA 5TXGA 4LC0A 3AM1A 2WMOB 4YMUA 1JECA 2Q9AA 2BMDA 2OFXA 1AS0A 3Q72A 5J40A 2WSMA 1KI1A 1RC8A 2O8BB 2DR3A 1G16A 4TZ0A 4M1SA 4AC9A 1QRAA 4TMTA 2XTZA 3U7EB 2ZANA 1KO5A 1QDEA 3AVOA 1UDWA 1ZRHA 1COWA 5EP1A 4FMDF 1FTSA 3ZLJA 1CR1A 2WJIA 4IFEA 3WNBA 4JBXA 1XP8A 1II0A 2NGRA 1E2DA 1BH2A 1NVWQ 5DE3A 4NONA 3TSZA 3SBDA 1RPZA 3C7KA 3MWLA 3RVBA 3TUJC 5CB6A 1GG2A 1L4UA 2NTYC 1ZNWA 2GVZC 4D0GA 2G1KA 3PR1A 5K8IA 4R9UC 4U02A 3DM5A 4TYWA 1UAAA 4N0EA 2F1RA 2NO1A 3GCGA 4H9GA 4IKEA 3Q3JB 2IUUA 2W6JD 3FMFA 1Z28A 2J3EA 2V4ZA 3E1SA 3WBJA 1XEWX 1FQKA 4BFXA 3MJHA 3OE7D 4QKQA 1BKDR 2WOOA 1EGAA 4XD7A 2ZE7A 1GSIA 2RGGA 4PPFA 4BFUA 2FWRA 3IILA 4LBWA 5JJKA 5ANRB 1JQLB 2XZOA 5CIWA 3L2OB 1P3JA 3QI2A 1IN6A 5UKDA 1Q44A 1GKYA 2ZPTX 2ORIA 1QHHA 1U9IA 4MGIR 3AF0A 1RZ3A 2DCUA 1NVVQ 5SZJA 1M1YE 4KFSA 1NBMD 4Q1BA 2JJ1A 3SHWA 3AVYA 1QHXA 1I2DA 2MSEB 2JLZA 3UKDA 4BZPA 4AYXA 4DCNA 1JPNA 4JLVA 2Q3HA 4Q1EA 1ZNXA 2RAPA 3MUFA 2OCBA 4MRPA 2NMVA 4RY2A 1IXZA 4JBYA 2PZFA 2D7DA 3RWOA 1E2PA 1YRAA 2GJ9A 3AH8A 4QM6A 2VHCA 3CRVA 3BJIC 1E3MA 1T6NA 4CEJB 3RLFA 1YVDA 2YZ2A 2GHIA 2QGZA 1A1VA 1OE0A 2R6CA 3R9WA 2D4HA 4ACAA 1Z0DA 2I3BA 2J46A 3QOFA 4AKIA 5JJLA 1FTNA 2JLQA 5TB5A 4R98A 2ZR0A 2XOKD 4RKEA 2O8EA 3AP2A 3L43A 3BH7A 3D6TB 1LVGA 3SYNA 1GTVA 2GEUA 1I4TD 2J45A 3H1TA 1QHYA 1KK1A 3ECCA 3LBIA 1GRRA 2VTKA 3RS0A 4AYWA 4KAXA 3ASZA 4O0MA 2FPLA 3TMKA 4DRZA 2A3RA 1KDTA 1TF2A 3NC0C 2JATA 1W4CA 3QPUA 5G40A 1DAGA 3ASYA 1UEJA 4C2UA 3GLFE 1UBFA 4A92A 1AZSC 1GNPA 1G3UA 3TAHA 4DWJA 2RGXA 2I1QA 3C14C 1YZQA 4QGFA 4H1VA 2XZPA 3QQ5A 4Q4AA 4DLVA 2HCJB 1S0UA 4QC2A 3DMDA 3CPEA 5KPDA 1UJ2A 1CEEA 3FPAA 4PC7A 5P21A 1SXJD 2X1VA 2VHQA 1CULC 1XTKA 3EWAA 2F3RA 1EX6A 1LNZA 1G17A 4NCNA 5DI3B 4DBLC 3I61A 4XIGS 3NBYC 3QG1A 2JASA 1FNNA 4PQRA 3A8TA 5AJZA 4BUJA 2A5DA 2OO7A 1IHUA 3L82B 2RB4A 2IYLD 1E9EA 5KDOA 3PXGA 2ERYA 3NXSA 1EFUA 3NH6A 4V03A 2GAOA 3FMIA 3LO5A 3K9LA 4EAQA 1ZIPA 5C2JB 3SYLA 3TGPA 4HUQA 2DYKA 4DEYA 3GPLA 1NG1A 2CVFA 1QZXA 1OFHA 4WAUA 3TQCA 5F3WB 3OIYA 4URZR 1KI7A 1E2QA 2ODWA 3UMFA 1R0WA 2B7CA 2QPOA 4QBFA 1E79A 4PANA 3PUZA 3NDPA 3AKCA 4DSTA 1KI8A 4D4KA 4JKYA 3FE2A 2QTHA 2A5FA 3KL4A 3QVUA 1SVWA 2C8VA 1DTSA 2YKGA 3OAAD 3B6EA 2OG2A 2NO6A 3QPVA 4DSUA 3K9NA 3GLFB 4XVQA 4EDHA 5IF9A 3G0HA 2W0SA 2H16A 3W6PA 1GL6A 2ZAMA 4MGKR 5D3MB 1W4RA 4HDOB 4FD2A 1S2MA 1YHNA 3CNNA 3EZ2A 4OKSA 4BZXA 5KUTA 5C4GB 2CCJA 5FR2A 1E0JA
chains in the Genus database with same CATH superfamily
2O3TA 3F5SA 3HDVA 3KDAA 3P52A 3MRXA 3UK2A 4B6RA 5L3SA 3FNRA 2I91A 3P9NA 1L8LA 3TVYA 4YT8A 1VKOA 2L17A 2WWHA 4G5GA 4MUFA 1XB2A 1C1DA 4WBSA 5KS2A 5A4AA 2CFCA 4GR4A 1H85A 4A03A 3L1VA 2EVWX 4KQ2A 1Z7EA 3F6YA 3HYCA 3T1YB 3E5HA 3L02A 4P93A 4E2WA 3HGMA 4DQVA 5DNDA 4HGNA 2C04A 4XB2A 4B2PA 1XRRA 4JGIA 2C3YA 3MEQA 2QVYX 1WRBA 4V38A 2O8VA 2IBSA 2CD9A 1VPDA 2MMCA 2DUUA 4W9RA 1Z4OA 1FQWA 2A1UB 3ND8A 1FTWA 3PXAA 4ERXA 3HJRA 3X1DA 3I32A 4Z0TA 1E5DA 3J7AC 2Z4TA 4JAVC 4B3GA 1NUPA 3G5UA 2VNHA 3KJIA 4J3JA 1N6LA 5EMNA 5F21A 1U0NA 3PR3A 3FAKA 3KTOA 4RPJA 4BV8A 4JB2A 1UM8A 2ZRLA 5AM4A 1KC1A 3CXUA 1YWGO 3EXFB 3LBAA 2XGMA 3PGXA 4EB0A 4M0EA 4XDHA 8ADHA 1KGDA 4JIGA 1QQAA 1M66A 1G20B 1HFJA 5IZCA 5JXHA 1YVPA 3ZWNA 2RIRA 4YRRA 3PHHA 3U4QA 2R8XA 4PZPA 3IAUA 3HUTA 4CUKA 2E49A 4PLHA 1HKUA 2FPSA 4UM5A 4YXFA 1SOUA 2FUEA 3G79A 2ICAA 4QPNA 2QTVB 1DG9A 5DNUA 1K7YA 3B7PA 1MDFA 1CUAA 2I76A 3EUFA 3O21A 4LF5B 4Z53A 1F6DA 2C98A 5B7NA 1DEKA 1DQZA 5JDCC 1UQUA 1G64A 1BHSA 1VTKA 3KKPA 1Z5UA 3H2ZA 2OCPA 2Q7OE 1QHEA 4O4HB 2V7WA 4QDOA 1IM8A 2PLAA 2WG1A 4AO7A 3L4JA 4KXFB 2DJ5A 1CVLA 1PT7A 3R9XB 5CH5A 4OI1A 4D4JA 5KYYB 1OZHA 3PE4A 3RRNA 1QPGA 1PGOA 2W2LA 2WKSA 5LZ5A 3QVSA 1LSSA 2IYTA 1YBHA 4ZYWA 3DDNA 3QWFA 1DEXA 1HE5A 3EZGA 4FW8A 2Y6VA 5BNWA 1NVEA 2N1BA 3OCXA 1LNQA 2B61A 1XR3A 3CX7A 2VYFA 2NSYA 3DFIA 1O9BA 3GVHA 2ZJ4A 4FDAA 1J99A 4ER7A 1G8SA 3BICA 2AW3A 4GRAA 1N6HA 2MINB 3SEQA 3ZBUA 1HE4A 1Z4JA 1Z74A 1JHUA 2FMFA 3PITA 1Y80A 2WJAA 3O1IC 3KTDA 1IL0A 1PSDA 4JVOA 3RUPA 1GNSA 1QCCA 4JUAA 3HI4A 2J6IA 1A96A 1VSUA 5C1BA 1R0SA 1RQPA 1KWKA 1XUOA 3ELWA 2B21A 3QJ5A 2Z9DA 4JUBA 2C42A 4BNXA 3QVGB 4PAMA 3BGWA 5LCXA 2RGNC 2B5WA 3WRXC 4KWHA 4C05A 1IN7A 4YYEA 2XMBA 3LGAA 3M6AA 1KVRA 4TZKA 1DEHA 1TCVA 3NDIA 3VXKA 3KQSA 3KQKA 3G2HA 3CU5A 1VE5A 1W48A 3QQPA 2ETXA 1UBCA 4EEKA 2GYWA 1SCKA 4LW8A 1G63A 3A9VA 1XQWA 3OEWA 1DXOA 2RHGB 2RGAA 3R23A 4DANA 2FW9A 2XX3A 1MD9A 1YZGA 4HYQA 5H82A 4G2NA 4OHYA 5EZSA 2X14A 4FI3F 2NW6A 4BFCA 3EZLA 4JA2A 3CRRA 4JI7B 2W00A 3IUPA 5CT8A 2ZUVA 4MI3A 3UJ8A 5CA0B 3GLGA 3UHOA 3SQWA 1YNOA 5CH3A 2JARA 1AK2A 3DJFA 4YI5A 5P8WA 3EF1A 3ETHA 1M76A 3HRHA 4OK3A 5A05A 3K0CA 1CE8A 1RMQA 2X42A 3Q3HA 4R8VA 3TECE 3B5EA 4GD3Q 1KQGA 1JBEA 1R4MA 5FV4A 1DOZA 3T5PA 3NATA 2WICA 5FTKA 5JYBA 3HI6A 1RS0A 4BKRA 2P75A 2XCSB 4PX9A 3KPWA 3H97A 1Q7BA 3LP8A 2G63A 2QGNA 2PMCA 2XBLA 1JDTA 5KMGB 3C39A 7ADHA 1OA1A 4IF6A 2QP9X 2W43A 3L1IA 4N5IX 3C87A 3T12A 1MB3A 4R3UC 1O57A 2GM5A 5EXTA 2PSHA 3RTGA 2OZLA 3HJTA 3TN7A 4C1NA 4MPDA 4RJKA 5C4MA 4B32A 1Q0SA 4P33A 2A9RA 1Z88A 5FTWA 2X3YA 4KXWA 1N5OX 5AKEA 2QG9A 4RKYA 5A6SA 1EX9A 2DUWA 1DBRA 3P0IA 4HRAA 1H93A 1Y42X 1CZKA 3TTWA 1E9RA 1QONA 2BEWA 3GJRA 4B4DA 4ZVUA 4EKDA 5FJIA 3OH8A 1CS4C 2HIMA 4HS9A 3ZWQA 2Y9PB 4G5YA 4ZOLB 1JDBB 1R4ZA 1ZG3A 3ESCA 3TLKA 1XZFA 1IMOA 4HVAA 5L7YA 4CCAA 2R8BA 3MAAC 2GM4A 1J0AA 1Q7EA 4EHBA 3T5MA 2RGBA 4L0MA 4Q9HA 4FGKA 5IBPA 3T7TA 3VPDA 1C0PA 1YS7A 3F73A 1QAMA 1NU6A 5ALNA 4FINA 3TZCA 3VZRA 1E3WA 1TVEA 5CVDA 2GDJA 3SEAA 3ESBA 1GKKA 4IQFA 1ZC3A 3H65A 5BV8A 5T8KA 1QYIA 3JY6A 3PKJA 3WL3A 4L4YA 2PV7A 1IN8A 3EGEA 3V9PA 2DU8A 3TSWA 4DLKA 3W3ZB 5HQJA 1XZNA 1PJ3A 3L05A 3ZWXA 4LF4B 3HCFA 4O2RA 1QU2A 1O2DA 3H2GA 2Q07A 1KBOA 2MIIA 1DDOA 1WMDA 1ZVQA 2O4UX 1W0KA 2BEJA 4UHJA 4PEVA 1ENOA 5JO0A 2Y8EA 2Z30A 1GQSA 3GF4A 3I9OA 1KAEA 1XD2B 3F47A 4RFVA 4HR7A 4V0QA 3DFFA 4TL8A 3H04A 2R00C 2Z4SA 5CVCA 1ZINA 1UDBA 4EK9A 4JMLA 3DE5X 3Q7EA 2QIPA 2W6CX 5EE3A 2BEUB 4AX4A 1LK7A 1E1KA 1XXHE 2HZBA 3KUUA 4F5WA 2HYIC 4BIIA 2HQ1A 2HU2A 4KXYA 1XA0A 4TLBA 4Y9RA 4RTQA 3QPAA 4B71A 1YOBA 3BHNA 4XD7D 3BPSA 3DC2A 3PHCA 2NXNA 1DAFA 1FDIA 1MF7A 4F1WA 5EHZA 1FX1A 3V8QA 1S4QA 5JBNA 1ISFA 1NJ2A 3DR5A 4LTNA 1HRKA 2P1ZA 3OZGA 4OXXA 5JDIA 3DV9A 1IK6A 3DTVA 4EBFA 1EGQA 1QFYA 1TA9A 3OMXA 1PEDA 2VH2A 3L5KA 4GVXA 3V7NA 4RMJA 4ZK2A 1E2NA 1Q77A 1UOQA 1LDEA 2XZDA 1N3BA 2D1SA 1TAHA 4P8RA 3RAGA 2HLDA 3RI3A 4DXDA 3OQOA 4Y2SA 1WSAA 2GN2A 2G67A 2ODTX 2TMGA 3T3EA 2V98A 1X8KA 5LBTA 4PWZA 3VNRA 4Y2RA 1PHPA 2G5CA 5JQGF 2C2GA 3N2GB 4MMZB 2EBFX 3LYLA 3N0WA 1WP9A 2ZRDA 2EKDA 3DOHA 1CDEA 4EATA 3DZ8A 2PVCA 2J5BA 2WW8A 1FQJA 4E3WA 3AF2A 1I5OA 1T25A 4HLUA 1Q1EA 2HEGA 3BQ9A 4DDVA 2OYSA 3G0CA 4DSNA 5JCJD 1IN5A 4EABA 3COSA 4HS4A 1RAHA 4B84A 1T3LA 3U4IA 3L7LA 1R66A 1AF4A 2BI7A 3OOWA 1KA9H 3V6MA 4DCVA 1H2HA 4DWOA 4K9SA 2CJFA 2P9HA 3FMPB 4ID9A 4UPVA 3OT4A 3BXFA 4BNKA 1QHGA 1BEUB 3NZEA 3ODPA 1OXKB 1T5SA 4PZUA 3QU7A 5CVJA 4BWYA 1R6VA 3I6BA 5AK6A 2R84A 3CBGA 4ZT2A 1NQOA 1OOEA 1TKCA 2GBGA 3X1YA 4EHHA 4ZYTA 1GO2A 1XXHB 2GVDC 1ECPA 1EP2B 3LYHA 4FLEA 4IHJA 2H9IA 3T3HA 1WZ2A 5LYJF 4WY2A 1NW8A 2E1RA 3H05A 3RSQA 4C0SA 2E6KA 4HWPA 4XYEA 2NPFA 2O14A 3QEJA 2O8FB 2F8MA 3BGSA 4LBVA 2NUTA 1OFIA 5IKEA 1HYEA 1JU4A 4G0WA 3MTJA 4C2TA 4LNAA 1OBVA 3LLCA 4RHXA 2OO3A 2X23A 4ND8B 4RK6A 3JWHA 4F2PA 3PLAE 3C1UA 2BFCB 1ETHA 1QGED 2UXBB 5EE9A 3IT2A 1RXSA 3ZHVA 4Q7QA 2FPKA 3PCRB 4LQCA 1N2JA 4UHCA 4LWQA 1QIFA 4BMOB 2EHJA 2C82A 3CKYA 2DBVO 2P27A 1S7GA 3RLIA 1ZM9A 1U2PA 1YB7A 2PZEA 4CFYA 3OOEA 2FOXA 5K05A 2ZJZA 1L7QA 2Q1YA 5LQDA 3TNLA 1Y7IA 3DC7A 3SBEA 1E20A 1MX1A 4YHHB 2XXBA 4PIPA 4R05A 3V4VB 1JX6A 2PBRA 1POWA 3BTVA 3D43A 2EQBA 3AHFA 4D4IA 1J8YF 4W7IA 4A73A 5AO9A 2Z6UA 3D4PA 5EJ9A 1E7QA 1ZR2A 3M82A 3FGNA 4YQEA 4A0FA 4NVRA 3UJHA 2XB6A 3WQBA 3QVVA 1J8FA 3HFJA 1NKVA 5KPJA 3SM9A 2WF8A 1WSWA 2OHGA 3CH6A 3VUEA 2DHDA 2NIPA 3F6RA 4CPDA 3THYB 1SBNE 3IAM6 3HFSA 4CNQA 1IATA 3LUHA 1F0YA 1YI0A 3U49A 3WIDA 3JU3A 1GNTA 2O2IA 2FPUA 3FFWA 2LKCA 4MKXA 4NJMB 5KWEA 1VLMA 3AVVA 1RYFA 3UKOA 2OLKA 1NBEA 3ASUA 2AQHA 4G0UA 4TN5A 1Y9JA 2G8LA 2KS6A 4M83A 1D6MA 1LKZA 4ZPXA 1WOMA 2CNLA 3ZDQA 1BHQ1 2AJ8A 5CXXA 3OPNA 4DDHA 4JYAB 1JQBA 3C3DA 2A9QA 3Q15C 2XBMA 3FYUA 4WZBE 3DMFA 1R5NA 5A7HA 2D5LA 5EQJB 5A5DA 3BBLA 1ORRA 4D7AA 1JPUA 3N7AA 1EZ4A 3ZGNA 2OAEA 2JIOA 3RS7A 1R6TA 2P9QA 3H9UA 1JEDA 4K5QA 2ID9A 3GNLA 1LJUA 5LQRA 1O94C 3WOVA 4K03A 1TMOA 5AW2A 1UJ6A 1OBHA 2ACEA 2ZI3A 1L5VA 3CRQA 2GBPA 3B48A 4Z9YA 2EP8A 3T1QA 2NU9B 4B83A 5LDDC 2JIDA 5DMXA 1HV8A 5DI3A 3IEPA 3NHKA 3EJ6A 1KH2A 1DHTA 1PZEA 4GI1A 4BLQA 1Y6GA 4FYJA 2BM9A 4C0WA 3KR9A 3FNIA 1TL7C 1R0YA 1HQKA 4KGDA 2B3TA 5ISMA 4JXZA 1ADYA 4RCYA 5KYXA 2JFVA 2X0JA 1U8YA 2R8OA 3ELDA 3QX7A 4IKOA 2JD0A 3BZUA 3E1GA 3RWBA 5KCZA 1BRTA 2WP8J 2O5RA 1BMFA 2H2WA 1G5FA 2IQIA 2OZEA 3GJ3A 4PPNA 2PAAA 3K31A 4GE3A 3U31A 5ALGA 4EW2A 3TRKA 2C4MA 4KBFA 4N7RA 4CM9A 2EL7A 5D84A 5TLSA 3WDKA 5C8DA 1ISIA 3HCCA 1RD4A 1S4MA 4YAKA 3ULKA 4TV8B 2Y4OA 1NATA 1GA6A 1P8JA 3MTGA 3OCYA 1SHTX 3GXBA 3KC2A 1THTA 4MQFB 4MW6A 1TVKB 1PHRA 4UE2A 4HMPA 1CUSA 1E5XA 4WVLA 3GBVA 4PNZA 3TTTA 1U3FA 2O2EA 5E4YA 2RHOA 4EA8A 1TYCA 2QGFA 3EZFA 1N7GA 2VF7A 4L9RA 4TV8F 3DEHA 5LP6F 2GN1A 3WLFA 1FXSA 4IJKA 5J1TB 1RZRA 2ZI7A 2WMDA 2ZI6A 3EFOB 2PZAA 3EY9A 1R50A 1NTOA 4WZBB 5D3QA 2FX5A 3WDMA 3FYHA 3LSYA 5FBLB 1O54A 3FYDA 1O0BA 3CM0A 3IODA 2WJPA 4J0IA 1T29A 1W6RA 4KR9A 4C7OB 3QUSA 3I5YA 5KCMA 3THOA 3HDGA 2O0HA 3G9XA 1YQTA 2QUHA 3NEYA 3TL2A 1PT8A 1IUOA 4PCLA 1QRSA 2A35A 2G1PA 3ETJA 3NUGA 3MCZA 1QWOA 5F64A 1P3DA 3CW9A 1PL8A 1U9IC 2PMWB 1GDDA 1NUSA 1G6OA 2EC5A 3IP1A 3TIXB 4RETA 3ZJ5A 4JXXA 3ZH9B 4RQAA 2Z3WA 3QH4A 1RJWA 3FMVA 1TJ4A 1EM8B 1BS9A 1ICEA 2QVXX 1YDMA 1UWKA 2Z98A 1V0JA 4JP2A 1XP5A 4NZNA 5FEMA 2XRZA 1W9MA 3HCOA 3G68A 4NCIA 4E03A 5C8XA 2HA4A 4OOFA 3HN6A 3K94A 1LQ2A 2VF2A 2KSQA 3C6KA 4LECA 2W6OA 1E1MA 1WXXA 5DM60 1M9NA 4LJYA 3P4XA 4LQDA 1MAAA 1ZH6A 2C99A 3IAS1 3ZHBA 5F35A 4WE3A 2XZLA 2RE8A 2NOAA 4QXPA 4DLPA 3ZYCA 4EBBA 3JASA 3IUEA 2ZYWX 4IOJA 4UASA 3ROEA 2HIHA 3W5BA 4XGQA 4QXRA 3EEQA 2VPTA 4FGLA 3ETGA 5KHOC 4M49A 1ZPDA 4LY9A 3EGDB 4PG6A 5H3LA 4A5OA 5DT9A 1I3LA 1U6IA 1FBNA 4TL7A 1U6KA 4F3RA 2BWJA 3VI4B 2MYNA 5TPZD 3JATB 1XZDA 3LBNA 2BY4A 2GYVA 4KGZA 4RMHA 3C5CA 1L1QA 5BVHB 2Y99A 3AL0C 1CUYA 1MRZA 4D9JA 5FI1B 1G21E 3H1PA 5D7NA 4CIYA 5C46F 4N8EA 3JVUA 5B30A 4XD2A 3ET5A 3A2NA 1L4GA 1TDJA 2DT5A 1H8HA 1A98A 2KQUA 3CEJA 5KO2A 5BUZA 2R44A 2IDMA 1ZA2A 3DT6A 10MHA 1FIUA 1XTSA 1TO6A 3KJGA 5E3HA 3ZI7A 1A9XA 4CETA 2JGEA 4TTAA 1RHQA 3IUJA 3ZD8A 3ZGVA 5DHSA 1W5FA 2HT6A 4GECA 3WV4A 1HZJA 5G1NA 2F1HA 3A32A 5AJTA 4JT2A 4F2HA 2ONCA 1L7VC 1XPUA 2B78A 2PD3A 1TM7E 2QTBA 3EOBI 4HDRA 1ULZA 4WZ6A 4ZCPA 3HU5A 1IWOA 1SA0A 2BBSA 3PNSA 4WXRA 3T1OA 3IURA 3EEYA 2BFAA 1AJEA 1TUBB 2FR8C 4LVUA 3D54D 4KZKA 4M7PA 5BQ3A 1LDBA 2QROA 3IO5A 4K6HA 1U7DA 1FUUA 3OIGA 1W59A 2WABA 5AM1A 1A9PA 4M21A 3NPAA 2GPNA 1W0JD 5JPCA 4LWPA 3IEKA 5GP1A 3U37A 5TGDA 4EKIA 2BPOA 4JJKA 3F6PA 3SJ7A 2NUBA 2R6FA 2VXOA 3MINA 4HB2A 2MYTA 5EKUA 4GBGA 1WZNA 2ZRAA 4MWBA 4LXQA 1TYBE 2PSDA 1QQ7A 1JAHA 13PKA 3QFHA 5BSTA 2F43B 4YMSA 3ZZ1A 4KYVA 3NTRA 4JSTA 5J58A 4WCFA 2K5UA 2RGWA 6REQB 3H13A 3T34A 2B1QA 1CJKC 3PP8A 4GOLD 4N0DA 1RXYA 4UM7A 4UUNA 2WTEA 2WVHA 2RAUA 3UHAA 3CB2A 2G5GX 4QTUB 2QIOA 1YK0A 3MS4A 2HSGA 4ALNA 3DLAA 2W58A 3PPVA 2ZZNA 2WB4A 3QKRB 4M0FA 3DMNA 3RSZA 4D6PA 1JFVA 1SU6A 4N1AA 5HXAA 5AHWA 4UAGA 5EVJA 1GAXA 2XYRA 1YDGA 4H18A 2Y1EA 3WWYA 3KG2A 1QB8A 2BKVA 2YZGA 3KV1A 3TZQA 5AW8A 1E6EA 1U2GA 2CY0A 4I2VA 1QDUA 2RONA 3U62A 1H0HA 1AQJA 1EXVA 1QBGA 3ZHTA 3HEAA 2ZBFA 1EK1A 3RT9A 1R5OA 2CFTA 3BG5A 4AG5A 3INYA 2AMFA 3TG8A 1S6YA 1SQ6A 3MT7A 1E18A 2VHXA 3AG5A 4U7GA 4M1MA 1RLTA 3Q87B 4QNRA 3VAAA 2AI1A 3F7TA 1VBKA 4GH5A 4PLYA 4BC1A 1WY5A 5IKXA 4X66B 3H1FA 4CG3A 1QE0A 1QOQB 2YBDA 4BDTA 1SM4A 4Z8XA 2X4IA 4RUKA 4BWGA 1I32A 5BOSA 4RDXA 4QIHA 2GN4A 3PQ4A 4G24A 1R2QA 2GJ8A 4Z86A 4DM4A 4K05A 1VSTA 4G9EA 3ZHZA 3U7GA 1X15A 3FSGD 1CEXA 1E9BA 1DIOB 4XCXA 2VSFA 4HCJA 4L57A 3NORA 2VSOA 1L4LA 2C7PA 4UVIA 5K0BA 2ISQA 4LWZA 2PO7A 5DTIA 1GUAA 3OF3A 3CF2A 1WULS 4O25A 3VZBA 2NVOA 4FNAA 3VTAA 2ODEA 1ATZA 1VJDA 3RGWS 1BH6A 4YCSA 1X7WA 2VJBA 1GADO 2JKVA 3NETA 4X3OA 3ICWA 3FWNA 5IDVA 1T4BA 2OGZA 3Q41A 3KHUA 1MNAA 2A33A 1XI2A 3L04A 1MTOA 1FP1D 1PNVA 2XYGA 5I7RA 1Z0IA 1CLUA 3QF7A 5IZCC 1H5NA 3THWB 3QIVA 3A6KA 1OTHA 3V34A 1HE3A 2OAP1 1XAIA 2FSFA 5ICMA 1H2EA 1J9GA 1JHMA 2Q3FA 5LXTA 4FGSA 2FQ1A 2PZKA 3R9KA 2WWTA 1P9OA 4Q3NA 3HDJA 1GGJA 4IPTA 4W82A 1AH2A 3S1AA 2G72A 3R74A 4DMRA 4JHXA 3OZIA 1Z0ZA 2QLBA 4I4LA 5T6MA 1NQWA 5TDHA 5CU7A 2A92A 1FU7A 4BNVA 4Q21A 2ZAOA 1NLMA 2JLYA 1NMEA 5BQOA 2PUEA 1QQ6A 2FWAA 4Q9NA 2WJGA 1L9XA 3RF6A 1YR9A 1AM4D 2JAHA 4DDKA 2QRJA 1RJFA 4G41A 3LGXA 1DPGA 1I9GA 4RSGA 1QGUB 3AVXA 2A58A 3F5QA 4ZYUA 1DHRA 1Q50A 2B69A 1XYVA 2GJKA 5FL3A 5FUYA 4QU9A 2QTZA 1L5KA 2P9EA 3FZEA 3P0HA 5EY5B 4BQRA 3SHTA 4NCXA 1UEIA 1GCAA 1P33A 3FUXA 4X92A 4PY2A 4KR0A 1O5IA 5CURA 4AKEA 3BJMA 4ZYVA 1V95A 3E27A 1L6RA 1NAHA 1O6GA 3CLRD 3H83A 4PC2A 3MOIA 2I33A 3VR6D 2HADA 3A06A 1LFDB 3PX2A 4CKWB 3GT0A 1HYGA 1TMYA 4GC9A 2NQ2C 4O4JB 4RMGA 3TSOA 3EG5A 3UT6A 4BGIA 2AK3A 4EHIA 2X5XA 5IULC 3Q85A 3LY7A 1ABEA 4GP9A 5CTJA 4YIKA 2PA0A 4ZT5A 2FY8A 3SS7X 1ARZA 4EPYA 2X19A 3ZHUA 5TMPA 1G7TA 4I19A 1JW9B 4RHEA 5I51A 2ZIWB 2O2XA 4IMJB 1O6ZA 5H83A 1AQNA 1J4AA 1VG0B 5AJUA 5DTRA 3TW0A 4FVTA 3VVMA 5HKKA 2X0DA 5LQKA 4YC7A 1L7OA 4IICA 1GCIA 4WWHA 3DHNA 1X87A 3P9ZA 4C3VA 1ZMOA 3K0SA 2C3PA 2BFBA 2LZ0A 1D4OA 1Z45A 1KYTA 2BSAA 1CQJA 5U1PA 3G1WA 3UWMA 2IHUA 3WLAA 3G3EA 1D6JA 1T24A 2J0SA 4OM8A 1SC3A 1KOLA 3HCWA 3ZCPA 1QNFA 2EERA 2IXAA 3MWEB 2VWHA 3OQIB 5HG0A 5IH3A 1JA1A 4RJLA 1I7LA 1UBOS 3UGQA 4CKCB 1OXXK 1Z17A 3O3OB 3QEOA 1JZSA 2XTNA 4YP0A 6Q21A 1VKJA 1FFEA 1GZ3A 4I46A 5H5JA 1QVZA 4NFHA 2Z1NA 4L6IA 3OTOB 1QGOA 1RW4A 1DTEA 1F06A 4IFTA 1P81A 2V7UA 3LFTA 4A91A 1IHOA 4FBGA 1PNTA 2HOQA 4OXRA 4ZEOA 3WRYC 1B4DA 2OQ2A 2Y1LA 4FU0A 4HSGA 5ENVA 3FRIA 2YVAA 3BMCA 4NAUA 1MIOA 4GLOA 1E2UA 3CNOA 3Q8WA 5IKOA 2BHTA 2WSSA 5IEBA 3UAWA 4PC6A 1XPJA 1YVEI 3G2NA 3RWMB 3VM6A 4ER0A 3I6QA 1ZEMA 3EZYA 4YP5A 3KSAC 3UUEA 1JMVA 3PEWA 3PKZA 3VO2A 2HCBA 2GO7A 4P98A 3CVJA 2CJWA 1P7ZA 3BB3A 1NONA 1BU8A 5JLJA 3WL8A 3FHTA 1AUVA 4XFDA 1VJTA 2CEKA 3DUFA 2WSLA 3R3WA 2XCIA 3AYZB 3EIHA 5IFKA 5E4FA 1NT4A 1IM2A 1NNSA 4YAGA 3UIEA 2VNAA 1SZJG 2FWPA 2R11A 3MS7A 3B7GA 3OX2A 2IY7A 2NZ8A 2XHEA 1U0LA 2PVSA 3G8YA 4JMPA 1K3FA 2FPIB 4N5LA 1YZLA 4DW8A 1HDOA 1P9WA 4U00A 1JQ3A 5C5DA 1Y8CA 2VRBA 1VCNA 3PS9A 3GUHA 4I99A 4JL8A 1LLFA 3HQ4O 3HWRA 1H94A 1KL7A 4Q4AB 3M3HA 3V1NA 4URVR 1VKHA 1Z7GA 3FFAA 2J9GA 2RCNA 3NHLA 4NZOA 5D5HA 4CM8A 4EG5A 3CUYA 4Z5XA 1YR8A 2VP9A 1Y4UA 2JW5A 2ZTMA 4Y2VA 3BXXA 1FXUA 3FOAA 4YAWA 3VR5D 3AR7A 2VCEA 3LDHA 4L4XA 1M8GA 4S12A 3D6HA 3USES 4ARSA 5L3QA 4CQMB 3I72A 2R7KA 2RGEA 4XVRA 3I2YX 3PEUA 3NBUA 4ZHQA 2QTGA 4Q4HA 2EFDB 3MGKA 2W0MA 4GFDA 5LM3A 1PGQA 2PUWA 3BZWA 3MRVA 1XVVA 2VPQA 3C6XA 3KTAA 4KEAA 3DZKA 1K5GA 3DOIA 4KODA 4TS4A 3AESA 4WA8A 3O94A 5E38A 3GLHE 3WJAA 4WKOA 1PZNA 4ZVOA 4LTMA 1QP0A 1FNBA 2JRLA 3AFMA 4ZDKA 3JAKB 4HUQB 1BFUA 1LPMA 1T6BY 2OBNA 4FYHA 2JGRA 1PGPA 2BM1A 4JLWA 3R0ZA 2O7VA 4ZT6A 3SZLA 5JARA 3NB0A 5DYNA 1FP6A 3RH0A 2I67A 3KWMA 3R3SA 5E7JA 4TMXA 3NGLA 2H08A 4AWXA 1DX4A 2V9CA 3C70A 3D1LA 3OUZA 3UGTA 4J75A 2MTBA 2XCOA 3AUXA 5CVTA 1BRMA 4O4IF 1T91A 4UAJA 4WX2B 4TTRA 3ZNOA 1ZBQA 4BNDA 3WVNA 4DTCA 3ODGA 1LK5A 2QZSA 1MKYA 1XQ9A 2V7BA 1P0QA 3DFMA 5ALEA 5ICCA 3OZRA 5CAEB 1CUIA 3TNJA 3JARB 4EYSA 3EQ7A 4L08A 2ODNA 3SU8A 1OV6A 1PG0A 1RTTA 1ABBA 1YV9A 5FYQA 4MPRA 5JDIC 3ZDEA 4Q4DA 3VPAA 5A62A 4PLPA 1OLSB 4LZNA 1GXSB 1X7YB 2HV9A 1UBHS 4IDFA 1CT9A 1DMRA 4WLOA 5IYZA 4QASA 2A9OA 4ZI5A 1ULBA 4QECA 3TI9A 5GADl 3GA7A 2EGHA 1M2OA 3CG0A 1POXA 4D9IA 4PXSA 3VHLB 2QE7D 4WEQA 1WCYA 1JZTA 1Q84A 3OMWA 4YJGA 5JH7A 3HXTA 5JVDF 3OFND 2AZTA 1EFKA 2ZRGA 3EXHA 4FDVA 3LTNC 3UMVA 1NN1A 4YRMA 1NP3A 2BGRA 5L7WA 4IOLA 1VBMA 2PUHA 1LX7A 4F11A 5KX5A 4KQGA 1SCNE 2YW9A 4WFIA 3PC7A 3SJAA 3A7EA 1NVMB 1RCTE 3GH3A 4B8YA 3UVEA 1KI6B 3PJGA 1TCBA 4KLCA 4MW5A 1SWWA 3HSSA 1J24A 2PR2A 4HLUC 4M9CA 2DUNA 3U9LA 4Q3DA 2X4GA 2CLFB 4X91A 3CBQA 3ZCXA 5KYUA 4H2DA 4QTXA 4RW0A 4CL8A 1I3MA 1Z3IX 4Q7MB 1X74A 5CT6A 4JOSA 1VXRA 2XVZA 5F23A 4IX9A 1NBOA 3HN7A 5ENZA 2PH1A 3X43A 3D5TA 1EFVA 3EJWA 4WH0A 2YC4C 2ATVA 2F90A 1H4TA 4YJKA 3A6GA 1WCXA 3S2UA 3TW4A 3C7AA 1EX1A 5HKOA 1FW8A 1JGTA 2I7VA 2ISCA 5DO9A 4IDDA 1NUHA 2GEKA 1ND6A 3VPBA 2YYAA 3FHCB 3P96A 4K6KA 5DTQA 2YXDA 1WY7A 1B41A 2EF1A 5C8VA 4F84A 5JALA 1FK8A 1H69A 3GUUA 3SKVA 4HX2A 4M7OA 1YQEA 3ZGYA 3ZVRA 4BECA 3AFIA 3T9CA 4G0NA 1DQPA 3TE6A 2LGJA 1NU8A 1H6AA 1IFXA 1MB0A 3RW9A 3KUDA 3YASA 1NY6A 1GCUA 5BNZA 1FYEA 3GXOA 1NVBA 3V32A 4CT4B 5CDTA 1WDMA 2NN3C 4K1XA 4YMWA 4FHFA 1O5OA 3IBFA 2PTHA 3VZPA 3D6FA 3R8FA 2V7QD 4K8RB 3WBKA 1PTKA 1JTVA 1V5EA 1K2WA 4G4SP 4B3TB 4C76A 4PCVA 4DCJA 4LIPD 5B1SA 1WBDA 3TR0A 1CETA 2NU7B 4B6PA 4BMNA 1FA9A 2O48X 4YVFA 3S68A 4XDGA 3WXMA 4D4LA 1NY5A 5KNDD 3RSSA 2ZETA 2EDCA 3DZCA 3I92A 1AXRA 1KSFX 2HQRA 2R6AA 3VR6H 3EDYA 3D3NA 3P0RA 4MUKA 4UEKA 2YCBA 3LCVB 3QEKA 4FSHA 3UZUA 3ESYA 3AX6A 3K72B 3QTLA 1UH5A 3RAEC 1S8FA 3GLTA 2XOEA 3MN1A 3PF8A 4RWEA 1T1RA 1IY2A 1NX9A 2WTNA 3V46A 2JGMA 3CHYA 1PW7A 1Y5MA 2P41A 2J3MA 2OPBA 2NYVA 4N5NA 1OUMA 1GZ5A 4NFLA 4HV4A 1OX4B 3ZU6A 3E81A 4FSXA 1F8GA 2AFIB 3BUSA 2FPRA 3JWEA 1KEKA 1ADFA 1S1MA 4YUZA 2O8DA 3FM9A 1HMYA 4GE0A 1A4IA 2QR2A 3EWIA 4CLOB 1U8TA 3GFFA 5KKAA 2WD8A 3BRCA 2VCHA 3RDPA 3QFFA 4TMZA 2VJNA 1P75A 4WGGA 5GJCA 2XF8A 3R5XA 4KPEC 4ARIA 4WCVA 1E0DA 3ORSA 3M2PA 5AIBA 2BSXA 3KX2A 4IHKA 3HGTA 3WY9A 4AQYB 1GT6A 5GIOE 4IVRA 1MAUA 3FYUC 3O8CA 3BGDA 1PE0A 2OAQ1 3IR7A 5FPSA 1CJUC 1HLFA 2BMVA 3DA8A 4TT3A 1NL3A 4KWTA 1Q0PA 5ALUA 3ROFA 1SQSA 1U8CB 3FR8A 1JIXA 1NMXA 5CCEA 5I4BA 3ZIAA 4RO0A 4F3KA 4TL9A 1T1SA 4Z4GA 2GUGA 3SR4A 2BTQB 1YQXA 3F3KA 3D4LA 3GZNA 4KFRA 3T5GA 3T7AA 4ZI3A 3RRYA 1EWQA 4JLNA 3PTAA 1XQYA 1E4EB 2INGX 4MUGA 2NYAA 4HWOA 4OA8A 3COJA 3SZRA 2ZWAA 1JEEA 4ZKEA 4EG0A 1U0HC 2QENA 2J87A 3EGIA 2NUAB 1L0BA 2AHRA 3U0VA 2VN8A 4FFWA 3I04A 5CUQA 4C87A 2DTEA 5C81A 4G5XA 1KK3A 3SLKA 4RVSA 3MWKA 1XF9A 3L46A 1W36D 3IAXA 1GRVA 1IDN1 4M7RA 4MNTA 3WQQA 3EC2A 4U7HA 4DG5A 4BO5A 5CDFA 4RTRA 3EG9A 1NQAO 4PHCA 4AS1A 1CG6A 1CPYA 2VYQA 1FP7A 3PRKE 1NMZA 3QU5A 3I2GA 3S28A 1RDFA 2WM8A 4DHEA 4PX3A 3LVRE 2VQFB 2ZRIA 1KI3A 4P83A 1FZTA 1T4GA 3LHIA 4PVDA 5AVYA 1UPCA 1CY0A 3SEZA 3LWBA 3RS4A 5AHRA 1X3LA 3JALB 2C7VA 4HSEA 5DEOA 3WLMA 1JBKA 2Z9CA 3S1SA 3E5NA 1M8FA 1PP4A 1P7CA 2C5GA 4MJ7A 4WZAB 2AC7A 4IMRA 5BT9A 5DT2A 4RVCA 1ZGCA 3RVKA 3ESDA 5ESWA 1RBQA 1YJXA 3KB6A 1IBMB 1JIQA 2DWOA 4EUSA 1GGFA 1UPFA 1P7YA 1CW2B 3LYUA 1CJTC 1CRZA 2HA7A 3PKIA 4G4SO 4RSRA 3T4EA 3EPHA 5HM8A 5FDFA 3JQ9A 2IWRA 1X38A 2P78A 4ERNA 3PCTA 3AEQB 1QFMA 4IV5A 4OHWA 1NOJA 3KXPA 1MMFB 2H1HA 2HEIA 2O2SA 1ZJWA 3EUAA 3MTBA 2A67A 4IAOA 4PQYA 4UTZA 4ZAYA 2AEEA 4XRRA 3NEJA 4GRDA 2FEXA 3VSDA 2B6HA 3QHAA 3A4LA 3N2KB 3EVAA 1L5SA 1ZS9A 2I6QA 2ZKLA 1LS1A 2NXCA 3QYAA 4WD3A 5CVUA 1EKXA 1NUUA 4MVCA 5H81A 1RXWA 3VX4A 4WLUA 1MEOA 2ETVA 1B8OA 2FRXA 3B6KA 3ZXSA 3KPUA 5AJVB 3CFYA 5T4EA 4YO7A 1KZ6A 1T3ZA 4RESA 4CDGA 4MYUA 2O5EA 4DV3B 3WL6A 1TPYA 1A9OA 1NQTA 1NW9B 1XLUA 2CZCA 1QKJA 3AKEA 1HWYA 2PFKA 3AGPA 3CNEA 3JQ6A 4IJQA 4YJ3B 3ZZTA 4D9NA 1LBEA 2PUDA 5IYZF 2EJTA 4N0QA 2YOHA 4PAOA 1MW8X 4UEWA 2VQ6A 3B6MA 1YB4A 3E03A 2HF8A 4JYMA 4XQ9A 5DIZA 9ABPA 1UBJS 2OV2A 4HAXA 5IT4A 3ZD7A 4M60A 3GEMA 1E1QA 3ZBQA 1OT3A 2FZ4A 2QJWA 2AK2A 2J6HA 3DGEC 3LXRA 3DDCA 5I01A 3NHZA 3SZMA 1GQ2A 2O1SA 2BBTA 4D9BA 2ZR9A 5F5LA 4DMMA 4UMVA 1VHDA 1RNLA 3B78A 3FZQA 3G5AA 1QO0D 4Z9XA 1CF9A 2IF0A 1NE2A 1NHWA 2FSIA 1U2QA 2HMUA 3Q1LA 2IBTA 1S9HA 3FUTA 3SQLA 3JQAD 3MB8A 4R6XA 3TO5A 1CRWG 3K2BA 2BRUA 4II2A 1JIVA 5HDQA 3M70A 1VB5A 2QE7A 1UADA 3IVGA 7YASA 3OP1A 1SELA 3BCHA 3IDQA 3R3ZA 3TBHA 2Q5EA 2EG9A 4BGVA 2CYAA 1MR3F 3NOOA 4OMUA 2B25A 4WDRA 2P2CA 3N0VA 5KYVA 5LA6F 4AF7A 4K6FA 4LMRA 2QD3A 1T35A 1Z5ZA 2AJLI 4PO1A 1JLLB 3E3MA 2HA6A 3JQRA 1N1GA 4CJXA 3DE2X 3PQCA 3Q8LA 3QVLA 2XBUA 1RJ9B 4A23A 3GFOA 3CPHA 4KOAA 2X2FA 1GAEO 3AXTA 1FNCA 4D8XA 1TUIA 2PSFA 2ZM5A 3U4GA 1SCIA 1HTWA 2CGEA 2QMOA 1JKJB 4TYNA 2B4AA 2XJ4A 4JY7A 2HN9A 4X97A 1G7SA 4YWHA 4BNYA 3P32A 5FWNA 2AJCA 4JNCA 4ZHSA 2X8JA 3N0XA 4Q34A 5EIFA 2W6IA 2WD7B 2WG2A 3K9CA 2AQ8A 3VVLA 1V96A 1NLZA