4NYJQ

Approach for targeting ras with small molecules that activate sos-mediated nucleotide exchange
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEASAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Approach for targeting Ras with small molecules that activate SOS-mediated nucleotide exchange.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nyjQ00
2V55B 2AX4A 1Z22A 3DHWC 4RD3A 2WOJA 2MMGA 2AHOA 2QP3A 1L4UA 4LJYA 3VHLB 1HT1E 2JIZD 5DI3B 1M1YE 3G82C 4V0MA 2D62A 3WRXC 2QZ4A 3ZIAA 1JECA 1XBTA 2QMOA 5AUNB 4Q48A 1CJMA 5JSZB 3Q5DA 4CEJB 2QG6A 3B8HA 3SE0A 1RRPA 1S1CA 4TMVA 1XD9A 1Z29A 4DLWA 3IIJA 4C0LA 5ELXA 1S9HA 3Q72A 1XEWX 4QGHA 1YZUA 2PCJA 4HAWA 4TLAA 1ZUIA 2Q3HA 4TMWA 1W5TA 4UNRA 1CS4C 2ERXA 1W4BA 1JPNA 3AF1A 1XNJA 4ZV4A 2C9YA 4N3NA 1PUJA 1UDXA 5L3SB 1XMVA 1PUIA 2QAGB 2CBZA 1N5IA 3B85A 3NC0C 1J8MF 5EZ5A 4P33A 5SZKB 4YQFA 4RSGA 2Q9CA 4TL6A 1GUAA 2XXAA 1E9RA 4DT1A 2R8RA 3RS2A 2XZLA 4KLZA 4XVUA 3U3KA 2AXPA 2HLDA 3TNFA 1CJKC 5J40A 5A0FA 3X1ZA 4NTZA 1HURA 4LPKA 4I99A 4PPFA 4R9UC 1SXJA 3TKLA 4E03A 4R7ZA 4EPYA 3ICEA 4K46A 1OH5A 1YVDA 1G3IA 1Q1BA 3PUXA 3LV8A 2RGEA 1S9DA 1CRQA 4M1YA 1DAEA 4LK2A 1YZGA 1XB2A 4NL4H 5TVKA 2BJWA 1E79A 1GWNA 5K8IA 4E22A 2B8WA 3K1JA 4BLQA 4WZBE 4X8OA 2BBOA 1OE0A 3U5ZB 2JLYA 1DAMA 3WYFA 2WTUA 5EE1A 1XTSA 3DVLA 4JBWA 1EESA 2JLZA 4TLDA 3DMDA 1KDOA 4MH0R 4NH0A 1P9WA 3UIEA 1T8TA 1BKDR 2A78A 2EW1A 1ODFA 5CK4A 5DN6D 4UNNA 3BRWD 3MGCA 5KSPA 2VSFA 1WMSA 1GL6A 2HYIC 4OK5A 2HCBA 2FA9A 2Z83A 4TZ6A 2FZ4A 3VR6A 2F9LA 2GILA 5JJIA 1G3MA 4JL5A 1X8LA 3PEUA 3KJEA 2LWIA 4A15A 1FNMA 1M7HA 2XGJA 4RFVA 3DO6A 3QPWA 4OI0A 1MRSA 2H1LA 1E1QD 1ZINA 4JLMA 4URZR 4BQSA 1W48A 1G4UR 3P20A 4ILEA 4LV6A 4C0KA 4NYJQ 5JI2E 4JLAA 4EJSB 1GTVA 3WNCA 5KTYA 3AVQA 2CDNA 2QGZA 3I61A 5EP3A 2CK3A 2A9KA 5AJYA 1KOFA 2FPMA 2VP4A 5L8VA 4WAUA 1TU3A 3IHWA 3RS0A 1M74A 3TSZA 4ITRC 4Q47A 2IL1A 3PG5A 2JEOA 1E9CA 3ZJYA 4Q21A 1OXXK 4Z8XA 4CF7A 4G5GA 3MD0A 3C16C 1G16A 3U7EB 1S4QA 3W8RA 2C95A 1I2DA 2XZOA 3MMPA 1SXJB 3KQLA 2P0EA 3VKWA 3GQBA 2BKEA 2P6NA 4LZZA 3THXB 3SDZA 3PEWA 3Q3JB 3UMRA 5C1BA 4QBGB 1FX0B 4R98A 3PUZA 1YU9A 2GA8A 1G7RA 4TMKA 2HCJB 2NZJA 5FI0B 4AK9A 4DLYA 5KO2A 2CHGA 3P1JA 1S2MA 2QP4A 4DCUA 4M22A 4CW7A 4K81B 2MSDB 3WY9A 4BFYA 5KNDA 1G3RA 1KSJA 1NI3A 4D0NA 1IXRC 4X8HA 2CHQA 3BFKA 4RD1A 3LQRA 4DSTA 2GF9A 4OI4A 4Z54A 4BLRA 1TQ6A 2JJ2D 3QXJA 5FPKA 1YZTA 3MFYA 1ZNZA 2OFOA 2ZRBA 1JEEA 3C5HA 1J99A 4HAVA 1DVRA 4Q1AA 1VHLA 4QM6A 1NJFA 3EC2A 4LBWA 4D82A 1P9NA 1F2UB 1G17A 2GCOA 2HF9A 2NQ2C 1AZTA 3GJ8A 2ZI7A 3UWKA 4L15A 1DARA 3NEYA 4M4SA 5CB6A 4RD2A 2ZVPX 1LTQA 1XRJA 3GFPA 3QPUA 3A36A 2XEXA 4X8LA 3EZ6A 1NMYA 2ODNA 1KY3A 1DBSA 2Z43A 4PO1A 1SULA 4JJZA 2QPTA 3U2QA 2Q6TA 5EXXA 3SJZA 3LLUA 1SVLA 3QF4B 5EP1A 3SHFA 3UG7A 2DFNA 4E5UA 1KYIA 1CKEA 3CZPA 4NPHA 3PUVA 4JMPA 2BBWA 4KFTA 5G3ZA 5FTMA 2ZQ5A 5DNYB 3KKOA 3UATA 3G0HA 4LJ9A 3KKMA 4BLTA 4M0LA 3LA6A 1CR2A 4XTCS 1ZIPA 1OHHA 1KI9A 5K8UA 1UKZA 3B1ZA 3DPUA 4HB4A 2GZAA 1GKYA 4IOKA 3TQFA 3T61A 3CB4A 2ZI5A 4Q4JB 4MRSA 3JZAA 2J0VA 2CNWD 2GKSA 1P73A 1XP8A 5LB4A 4BPBA 2ZS9A 3CRVA 1G19A 3UPUA 2UZIR 2ZTSA 3R9WA 5FL7D 4A8JC 1Q1ZA 2I1QA 1N6KA 2FV8A 2WJJA 4DSNA 5HE9A 2GJ9A 3NHAA 1E2GA 2P3SA 1S1MA 1SGWA 1P9RA 1W0JA 3B1VA 2JDIA 3NH6A 4LYHA 2IW3A 4LV5B 4TT3D 5DI3A 1JAIA 4H1VA 2GWHA 2NIPA 3JVUA 4M1SA 4MDFA 4Z51A 2H8KA 1KO4A 1BO6A 5DYIA 1RRFA 4YC7A 2QMUA 2FX3A 5CJPA 1V5WA 2R6DA 3UMSA 1ETUA 3GLIB 2V4ZA 4MKFA 1COWD 4Z8YA 2QROA 1E6CA 1OXUA 2GXQA 1R5BA 4LX0A 5FH9A 5EE3A 4KITB 4DDWA 1IXZA 3A6PC 4BEJA 3UWOA 3HU1A 3TBKA 5AWFC 4RCYA 3TAUA 4N1AA 2PMDA 3MLEA 3T1VA 4GRAA 3X1DA 4MRPA 4F4CA 4FXPA 2P67A 4LYFA 5GVRA 2DFKB 1RYHA 2W6JD 4OK3A 2AFIE 4JS0A 5JZVA 2J1LA 3IKJA 3SC3A 4MYTA 1T9HA 3PIRA 3CNLA 2B8TA 5FOWA 1FUUA 2B92A 4DIEA 1ZD1A 4QC2A 4AI6A 1SKQA 2ODBA 1NKSA 3QPVA 2AWNA 5HPYB 2GZHA 4DB2A 4ASUA 4DCNA 3MSXA 3EZFA 1CP2A 3BK7A 4EJSA 3ZQ6A 2VO1A 5CM8B 2VF7A 1YR6A 3GP8A 4CEHB 4B3CA 4YMUA 1TL7C 3AGPA 1U8AA 3T06B 1FMLA 3QUSA 1QHXA 3KFXA 2PH1A 2CCGA 1G3UA 5SZJA 1G9XA 4EUNA 3M6AA 4JKIA 1GL9B 3BB1A 4IXMA 3VNUA 2IS2A 2G83A 4HB2A 2D7DA 5DGXA 1Z0FA 4UNPA 3OIUA 3VR4A 4BFWA 4IVQA 4TSFD 5BW8A 1OIXA 1EWRA 4QRHA 1HH4A 2EYUA 4TWZA 2IS6A 4JJKA 1D5CA 1DAIA 3DM9B 3RSOA 1KK2A 1DAHA 3TIFA 1XU4A 3PXGA 4LHXA 1DPFA 2UKDA 5KPJA 5LD2C 3THWB 1BH2A 3M1IA 4FCTA 1R5OA 4B76A 1TF5A 4PQFA 3KTAA 3U3OA 2CLCX 2G3YA 2JLQA 5DSZA 4XWOA 1W4AA 1D8TA 1K5DA 1VKJA 3L0SA 3AF4A 4LHWA 5F9HA 1P7CA 2V1XA 4U02A 1OH8A 2DR3A 2G0NA 3IEUA 2W0MA 1UBFA 4HAXA 3U6KA 3DZDA 3LAWA 3LXRA 3X1WA 5HKKA 1BIFA 4Z1MD 5M04A 1U9IC 2GAAA 2ZRDA 5CLLA 2ZJOA 2P5SA 4RJLA 1E1QA 3SBEA 3DZ8A 1W36D 2VSXA 2WWWA 4PAOA 1XWIA 2GCOB 1EGAA 2J41A 4TQUS 2CL7X 1TUIA 1KI4A 5E7IA 3A1UA 1N0UA 1NG9A 3K0AA 2YKGA 1CLUA 1KDTA 4HI0E 2F43A 2V6IA 4OHVA 4OQLA 2XTZA 1G3QA 1XMJA 3CF6R 2XNSA 1A2BA 1W49A 4RZXA 1QG4A 1GAJA 4HAUA 2ZE8A 4A4DA 5FUVA 3FPAA 3A8TA 4HEJA 2OCBA 4HYYA 1KO1A 2WV9A 1TADA 5P21A 1KSGA 3K0FA 5LDDC 4MRVA 1E2LA 3T5DA 4L8GA 3LW7A 2ZVQX 3ECCA 2NG1A 3BAFA 4ZIRB 1Z06A 1D2EA 2ONKA 4XD7A 3NIBA 4XVRA 2GDJA 1US8A 1KMHB 421PA 721PA 2WAXA 4M1OA 2AK3A 2BCJQ 4ZKEA 2WAYA 2FSHA 4M9XA 3SJBA 1GILA 3U4QA 3K9HA 4NHOA 3RRYA 1L4YA 2NTYC 3DM5A 1FW6A 2BDTA 4A92A 1HTWA 1XD8A 2D7CA 2IF2A 2ZE6A 2QRZA 4OYHA 5HCIA 1NLYA 3OIVA 4Z1MA 1YHNA 2QE7A 4Q9IA 4HSEA 2VIIA 4URXR 1E79D 2VP2A 3T1QA 1E96A 1ZM2A 4HLUC 4CT4B 2N1BA 1IY2A 3U44B 2ZRCA 1GKUB 1KI7A 3MCAA 3SJAA 2PCLA 4BWYA 1WRBA 5FPYA 1H65A 2ZREA 3G5UA 1EFRA 1E2NA 2C99A 4V03A 1LY1A 3R20A 4HLCA 4PC1A 3X2SA 3O8DA 3I5XA 4PQYA 3I4LA 2YWGA 2QUZA 2Z0MA 2UVQA 4Q7MB 5FOVA 1WDTA 1Q57A 4GMXA 3FMPB 3PFIA 4EQ6B 5H8WA 4GDFA 1NL3A 2IC5A 4TYYA 4FINA 2QQEA 4TL7A 3A1VA 4C3ZA 4F93B 1U8ZA 4B3BA 5A5GA 4Q1EA 3BC1A 1NN3A 2A5DA 1AS0A 4KV9A 1IN7A 1CTQA 2BWJA 1OSNA 3DOFA 3LWNA 4KFRA 2FPKA 4DSOA 1KI3A 1OH6A 2GRJA 1XEXA 1JQLB 1QDEA 3ZVNA 1KDRA 4PSAA 4IOMA 1LFDB 1SXJD 1ZM3A 3U3MA 4CT5A 3CZQA 2P6UA 3BORA 3CIOA 4ABYA 2WKPA 2R6FA 1KGDA 1II8A 2BM0A 2IUTA 4DDUA 2HUPA 2R6CA 3CH4B 4IOLA 2CVFA 4TMXA 5B30A 3Q5EA 3E70C 1R2QA 4XIGS 4A36A 4GP7A 4NONA 5TXGA 2IUSA 4OL0A 1XD2A 1E94E 4IFBA 4DLZA 2XAUA 4TLBA 1T3LA 2FFQA 2PZGA 5GVSA 3QF7A 2NO6A 3AQ4A 4AY2A 1OB2A 2D2EA 4BEBA 2PZEA 3A1TA 3MJRA 3N70A 3MWLA 1D9XA 2DYKA 2VYFA 3NKVA 2XJ9A 3EG5A 1IN5A 4LJ4A 4RZ3A 2YOHA 3KQHA 4AG6A 1QHIA 2GHIA 3LRPA 4L5BA 3RLFA 4AIIA 2WM9B 4EPXA 1PLKA 3EA0A 2G88A 3FOZA 1M2OB 2X2FA 3W3ZB 1II9A 5F9FA 1U81A 1WCV1 2ZAOA 3P27A 1DELA 5FL3A 2XSZD 2NPIA 4LGMA 4ZDIA 1N6IA 4CEIA 2ZE7A 4HLQB 4U5XA 2K5UA 2BC9A 4MA4A 3GMTA 1UBCA 2XITA 2ZRHA 4MRNA 4R2IA 5JMTA 2O8EB 5SZHB 3QXHA 3T35A 4Q03A 2QTFA 3THWA 3A4NA 3FKSA 5DIFA 4CZ2A 2OSBA 4EDHA 2ORIA 3B78A 4DDTA 1W7AA 1N25A 3QJYA 1NN0A 2MSEB 2BCGY 2LCFA 2QI9C 5JWHA 3GLIE 1HEIA 2O8CB 5DI9A 4CRWB 2DWQA 1XMIA 3KZ1E 3QKRB 3CBQA 4JLVA 5JFGA 1E2EA 4XWKA 1CIPA 2W00A 4A6PA 2GF0A 1H8HD 2NO7A 3QXSA 5FOSA 3RANA 1Z0IA 1TAGA 5DH9A 3CKLA 2QT1A 2O8BB 4ASUD 1AN0A 1VHTA 1Z07A 2R44A 3SU8A 2GBLA 5SZIA 1M7BA 2FSFA 4FCVA 2PJZA 4UJ5A 5G3YA 5JJKA 2OEPA 3JZMA 1H8EA 2VEDA 3FMIA 4V0LA 1HT2E 2BMEA 3ASYA 4A1FA 3KL4A 1TU4A 2C9OA 5GJBA 2PX0A 2C98A 2QSZA 4MKIA 5AUOB 1OT3A 1V43A 1SHZA 2EWVA 2V3CC 2X2EA 1R4AA 4HDQB 2V7QA 5IRCD 1EXMA 5D3QA 4MITA 1FTNA 4EFMA 1VECA 4ERNA 2AXNA 2OV2A 2QT0A 1VCMA 4HB0A 1ELOA 4XTRA 2DWOA 3AM1A 3BWDD 1I4DD 1MO3A 4MYHA 1P4SA 1UBGA 1P61B 3TUIC 3NBXX 1JR3D 3K9GA 5DLQC 1DADA 621PA 2PJRA 4D6PA 1E9FA 1Q20A 1Q3HA 2O5VA 1KI8A 4G5SA 3KKNA 1ZRHA 3GLHA 2ZANA 5TB5A 2H17A 2O0HA 4M1MA 1Z63A 4PFSA 1D6JA 1TEVA 1YZNA 3DKPA 4G1UC 2YWFA 2N42A 1D2NA 5FR2A 1WF3A 1MT0A 2D4HA 2A2ZA 3HJNA 4B2LA 3TK1A 2VH5R 2ZRPA 4JL6A 3LDAA 1Z6GA 5H1YA 3LX5A 4JVSB 1XCPA 4RKEA 1DOAA 4YONB 4XH9B 4B6FA 5F2EA 3DDCA 3CPHA 4ZCMA 1KMQA 3RRMA 1OFIA 2VHTA 2O52A 4OJQA 2ZI6A 2AD1A 2MSCB 3IBYA 4RFSA 5JWOA 1XXHB 2QM7A 1XTQA 2RGDA 1NIPA 3L2OB 5FTNA 5AJZA 1DAFA 5HTKA 3IQXA 1W1WA 3D6TB 5B57C 2XZPA 3RS7A 2ZSFA 3W6PA 3K0EA 2C2HA 3PUWA 3IPYA 3GLFE 1IY1A 3RS4A 3LBNA 4JSTA 2HXYA 4JKYA 3WMGA 1N5KA 1DAKA 1VG1A 3W6OA 1E2IA 3ZZ0A 3UKDA 1CULC 4PZZA 3K0FB 1JXMA 1U99A 2XOKD 2DPXA 4NKRA 3C14C 2YWHA 3EW9A 3LH5A 4MGZR 2JAQA 3OF5A 3OEHD 4WVFA 4QNRA 1GRRA 3B1WA 2X19A 5EXSA 3PVSA 4LC1A 1KO8A 2QENA 1LB1B 2ZRNA 3HP1A 4FW9A 4ZI3A 3K09A 4IKEA 2EFGA 1SKYE 4GP6A 3A58B 6Q21A 1BS1A 3FTQA 4Q7KA 4V0KA 3OIYA 5GJCA 3K0CC 4Q5IA 2ZUBA 1NBME 4NYIR 3WMEA 4DXAA 4IEIA 1OFTA 2YHSA 3NH9A 3SHWA 4BGDA 5EE5B 5JHGB 2FSGA 1IBRA 5HCNA 2GJAA 4P32A 4B2PA 2JATA 2KB0A 3QKSB 1TPZA 1ZM7A 4DIDA 4G5OA 1TTTA 3T5GA 3U7FB 4C30A 2N46A 5IF9A 1VCIA 2QRNA 1Z0JA 3AVPA 2HXSA 5EXTA 2FG5A 2H5EA 4HLUA 1E3MA 4LV8B 1TQ4A 3VR5A 3SQWA 4G5RA 3QNUA 4KBFA 4C4PA 5FI1B 4U00A 3B13B 2ZPTX 2OG2A 4LJ6A 2GXAA 1T91A 2BM1A 5G40A 2AR7A 4D4LA 4C0JA 4L9WA 4CDGA 1OLOA 1AA9A 5B58C 2RMKA 5DHAA 4UNSA 2WOOA 3HYRA 2ZJ8A 2NO9A 3BXZA 8OHMA 2FGKA 1G8GA 3EZ2A 1P2VA 1SVMA 2CVHA 3AUYA 1X6VA 4OKSA 5IK2D 4LHYA 1KO5A 2X77A 1HYQA 3MWJA 4CEHA 5IDVA 3N2IA 3CUEF 1MABA 1E9EA 1FZQA 4FMDB 2D74A 2GBLC 3VKHA 3K9NA 4V0NA 2F7SA 2NZ8A 3C4JA 4IVPA 2C77A 4II7A 1EX6A 4QJ4A 1XPUA 1N5JA 3QOFA 5BYKA 3W3AA 5L3QA 4ZO4A 1Q1QA 3DKVA 2VHJA 3P26A 2W2VA 1IOZA 2IEZA 2ZRJA 4MGKR 4X8MA 2OLKA 1Z3IX 3C15C 4LC0A 2YYZA 4F4IA 1JR3E 5EE9A 3GEHA 4OI2A 1ZVQA 2OBLA 1CF4A 3K0CA 5CYOA 1MRNA 1S3GA 4QBHA 3CR7A 5FUYA 1N5LA 3Q7QA 1U0HC 2BMDA 2GEVA 3AP1A 4A82A 3U7GA 5G53C 3WRYC 4RD6A 4ZDWA 1GNRA 1FPMA 2FNAA 3VR2A 4XJXA 1IM2A 1VG8A 2ZRAA 2ZYWX 3GCGA 2IS1A 4AYXA 2ZJZA 4HATA 1T8UA 4TYPA 1RC8A 3RYTC 1OKKD 1KDPA 1ZUHA 2F9MA 2FSIA 2HT6A 3WBKA 3R8CA 2R6GA 1ZD8A 3RHFA 4KYUA 3IDQA 1VYVA 2V7QD 4MUAA 1J8YF 2GVZC 2JLRA 2Z4RA 3AVXA 3PV0A 1KO7A 3L0PA 4NCKA 2VRWA 2IEYA 2F43B 3DOEA 5ANRB 3A4MA 2VA8A 3VNVA 3QBVA 1Z5ZA 1N6LA 5FBQB 3GJXC 2FEMA 4L16A 4TZ0A 2CL0X 2WMOB 1QHYA 4Q1CA 4O25A 1HY3A 1KHTA 2C8VA 2BVNA 3MRSA 4QGAA 4Q19A 2WWGA 3W9YA 5J4KA 4A0HA 4A8JB 1E99A 4D4JA 1QHGA 3VKGA 4Y0AA 3K70C 5TDHA 1DAGA 3WXMA 4BFUA 3EIEA 5E4FA 3SYNA 1U98A 1JQJC 1N6OA 1RJ9A 4DLSA 1M6NA 3HWSA 4PAQA 5L3VA 2ATVA 4OJKA 2V1UA 1GIAA 4LRWA 1OXTA 3B1YA 2F1RA 4RD0A 1E9SA 3KKPA 2H92A 2KJQA 2QTHA 4BFVA 2A5JA 1NNEA 2QBYA 1L8QA 3BJIC 3ZZUA 3OE7A 3H0KA 4LSGA 3KXIA 2IYVA 1Z83A 4RFSB 4URUR 4GPTA 4MKGA 2PBRA 3IUYA 4KAXA 1T0HB 2ZRFA 1SXJE 2B6HA 2QORA 2OBNA 4KJZA 4HDCA 3GLHE 2FH5B 3NBZC 2LKCA 4FCWA 4M9SA 2IXGA 3RABA 3PJRA 4OHYA 2I4IA 1T5IA 4YXWA 1NKTA 3VFDA 4H1UA 3GLFB 2IYLD 1KJYA 1AQUA 3LBHA 1YRAA 1RZ3A 3QVUA 5D3MB 2JLVA 1BYUA 2IYWA 3KKQA 3AP2A 4BRUA 1NN5A 3AVYA 4JLKA 2Z5FA 3VR1A 4Q4AB 4B73A 2WSSA 3ZS9A 3IPXA 1YJ5A 4XSGA 1VCOA 3SR0A 1BOFA 3OZXA 2H57A 1CJVC 4F38A 1KZGB 4WXPA 1AIPA 4TQAA 1GOTA 4PR0A 1FMJA 1E32A 2ZIAA 2RB4A 4P31A 3FMFA 1XTRA 3L0IB 3EPHA 3BIFA 1XJ0A 4KBGA 4ARZB 1UF9A 2F3TA 5FUWA 5H70A 5BN5A 3T1TA 3E5HA 1OV4A 2EFCB 1YQTA 2GXSA 4D2IA 5DISB 3ADBA 3ZH9B 2WJHA 3P4YA 2HV8A 1NRJB 2YOGA 3Q7PA 2OXCA 4LPSA 4LWZA 4HDOB 3WNBA 4JLDA 1QHHB 2ZROA 1Y3AA 3TJZA 1AKEA 4Q4AA 4DUGD 5KDDA 3LD9A 3SN6A 4C7OA 1NY6A 3SEAA 1ZC4A 4JLJA 3B60A 5IK2A 4EKDA 1ZCAA 4OQMA 3NTUA 3QSYA 4TMZA 2IWRA 4DLRA 3BGWA 4KU4A 2ZSAA 1WBBA 1ZP6A 1OXSC 2FFAA 3WHLA 4B3DA 3CRMA 2IX3A 4L4UA 4UXHA 1E0KA 1W5SA 5FBLB 2HJGA 2HT1A 1NLFA 1W44A 4Q9HA 2PMKA 2X1VA 4TN1A 1I2MA 1JR6A 4D4KA 4PQRA 1YR9A 4BLPA 1E4VA 2XNDD 5FTKA 2Q9BA 4WW0A 5BQ5A 2O8BA 2RH5A 3QKSA 1UEIA 1GRNA 4HLDA 4PPQA 3I32A 2J7PA 3PEVA 4LJAA 4KI0A 4IJMA 4W9MC 1AM4D 2ZJ5A 2RGCA 4DBLC 3NEJA 1ESMA 4R71A 2IHYA 1NVWQ 4UXIA 5C2JB 3QKTA 1LF5A 1XF9A 1R10A 1HUQA 2R2AA 3H86A 2V6JA 4H9GA 3TAHA 3GLFA 1OYWA 2FMXA 2ZSDA 4JVNA 4AKIA 1TUEA 4P4TA 4HUTA 2REBA 2NPFA 1GSIA 2OUKA 1CRPA 4KVAA 1VYTA 1UEJA 4MQBA 3R8FA 1GL7A 2Z6VA 1NSTA 1ZU4A 4AC9A 1GRQA 2O8FA 5EJEA 3CWQA 1G5TA 1IAQA 1XEWY 2QEQA 3B5JA 3EWSA 3EARA 1GFIA 4IDOA 5CIWA 4A2PA 4B43A 3OAAD 4NYMQ 1ZJ6A 5KNBA 4B3FX 1FQKA 4W5JA 4OHZA 2QE7D 2BMFA 2QAGA 2YZ2A 3S1AB 2WIAA 1G7TA 3EAQA 4GT1A 4GZMA 3I3SR 3ND8A 4M1WA 1IJFA 2OAQ1 3ZZTA 1P2SA 3L43A 3QF4A 2Y8EA 3AVVA 3SQXA 3FYHA 2ORVA 3TQCA 1EFRD 1BMFD 1LF0A 1PVOA 2XJ4A 1T3HA 3CR8A 1Z47A 4Q4HA 2ZS8A 5GADl 3UXMA 3AVTA 1O3YA 3W8NA 4G0NA 3WP0A 2WPDD 4ACBA 2EQBA 2FZLA 2JIZA 3FMOB 5L3SA 2ZU0C 1EX7A 3MG9A 2GESA 2VP0A 3VX4A 3VU9A 4NCIA 3NDBB 2OE2A 2RGNC 2FF7A 1WE2A 2QAGC 1CEEA 3HR7A 4PC6A 5EUMA 3QQ5A 1KI6A 1A5TA 1IHUA 4Q1BA 1ZNWA 4MGYR 3GLGA 3LW8A 1VDZA 1E1RD 3OFND 5EUQB 2J87A 1GVNB 2ZYVX 3ZQJA 2ANBA 2R62A 3PCRB 1PJRA 2GJSA 4JT4A 1E2HA 4IFEA 4DLUA 4EIWA 1Z2CA 1ZYUA 3CRQA 5DE3A 1QHHA 1DG1G 4QJ3A 2ODEA 3AKYA 1UAAA 5EQTA 4ZPXA 1Q44A 3PUYA 4RZ2A 3VU9B 4ACAA 2FWRA 3LX8A 1YZKA 2ZSEA 3KJIA 2GVDC 5BYJA 1N3BA 2BEJA 2IUUA 4B6EA 4YMTA 5C4GB 2H16A 4UJ3A 3GFOA 1KJZA 2E1RA 4JBYA 3RSLA 3KB2A 1KKMA 1OHHD 1QVAA 3ETLA 2FFBA 1NLZA 2QQ0A 2RHMA 3PQCA 4LJ8A 1I4TD 2A5YB 2J5XA 5CK5A 1KSHA 5TARA 1XJQA 4C0SA 2AKYA 3I62A 1KI1A 1Q12A 1R0WA 2D06A 4O2RA 4NBSA 3QXCA 2VPPA 2HYDA 1TMKA 3LQQA 2G77B 2VHCA 1A1VA 4MDEA 2HF8A 4TTRA 3ADCA 3BB3A 2WHXA 4DDVA 1P5ZB 4JVLA 4L9SA 4ARZA 1IJEA 4W5WA 1TX4B 3OE7D 5EE0A 3ND9A 1AGPA 1QZXA 1SVSA 2XB4A 4M21A 1W4CA 3R7WA 1JAHA 3HU3A 3K0AB 2PZFA 3IHLA 3J81k 2WWIA 1F6BA 2IYTA 2J0SA 2DBYA 3I92A 1TQDA 1CXZA 4FIDA 3GLIA 4JLBA 4WOPA 4YMWA 1PV4A 2YC4C 1UKYA 1J70A 2CHVA 1COWA 1ZNYA 3SFZA 2RKOA 5HZHA 4MYCA 4DRZA 4KYIB 4Q18A 2D2FA 5E7JA 3W5JA 5FPHA 4M2LA 1MV5A 4BECA 5C18A 2IK8A 3FVQA 2J0UA 2F1JA 1RW4A 3CX6A 4N0DA 4OHWA 2QA5A 3WHKA 5TY0A 1EFUA 4G01B 2AL7A 4Q4LA 3FFAA 4D81A 5KSYA 4M53A 1E98A 1B23P 1ZM4A 1XMSA 2NO1A 3AV0B 1G4AE 4TYNA 1IN6A 1Z28A 3ADDA 5CDFA 5FOUA 1R5NA 2W83A 3IIKA 4PC7A 2PL3A 4AG5A 4Q4JA 4LJ5A 1Z08A 2OLJA 2OT3B 4GOJA 1NN1A 2EU8A 1F5NA 2V54A 4B32A 3EXAA 3RNLA 3I72A 2ZR7A 2QY9A 5J4VA 3B9PA 2ZYUX 2O0KA 2HJVA 2AN9A 4A2QA 1UPTA 1KK0A 3MWKA 1E9DA 3TGPA 1GDDA 2KWIA 2FN4A 1A7JA 1JNYA 1Q21A 4PXAA 5FTLA 1NIJA 5JWRA 2A30A 4TYWA 4JYBA 2OCPA 2A5FA 1KK1A 4JSYA 4I81A 5KSOA 1QHNA 5G41A 1MO4A 1A82A 4P4SA 3BBPA 3ZIAD 1ANKA 4JIMA 2OESA 4KSBA 4W5HA 3ICQB 2IA5A 1OIWA 1U9IA 4JLPA 3LLMA 4M9QA 3TW4A 5KOYA 4P4UA 2J0UB 4PANA 3ZGXA 4PO8A 2NO0A 3B6EA 3Q9LA 3VX3A 1TQ2A 2C5LA 5UKDA 1LS6A 4OBEA 1OKKA 1KSFX 3V4FA 3BOSA 2HLDD 1VG9B 5CITA 1XXHA 1R6BX 2ATXA 3IILA 3QBTA 1RFLA 4IRUB 1G20E 2J7KA 4PC2A 3CWZA 3TE6A 5KYKA 3KQKA 4BLSA 2AWOA 1KNQA 2G6BA 2YINC 2XSZA 3HPRA 1OJLA 2QTVB 2F3RA 4IXNA 5FTJA 5JHHB 2G0TA 3RRZA 1OIVA 1W0KA 2P65A 4MYUA 2WPDA 2DHRA 4LBVA 4O2LA 4PZYA 3I1FA 4AYTA 1XJCA 1ZC3A 1AS3A 2A3RA 4CGZA 1VPLA 2GEDA 5K8LA 1Q0UA 3K09C 1FP7A 1ZU5A 4W7SA 5FR1A 3THYB 3QEOA 4GZLA 5EXPA 1N6PA 2WIBA 1ESNA 4IDQA 3TR0A 1MO6A 1NG1A 2ZI3A 1R8QA 3C7KA 2CCKA 5GJWC 1JALA 3LNCA 1UDWA 4B2IA 2ZUDA 5J4HA 2ASEA 1RJ9B 3GEIA 4PO9A 4IW3B 4EJSC 1KI6B 3U4QB 2ZSBA 3NHBA 3K70B 4Q7JB 4JT2A 4OK6A 4ZCIA 1KK3A 3VAAA 5FOXA 4EQ6A 4BRWA 1KJWA 3SOPA 2VL7A 3OHMA 3Q8XB 4NP6A 4F91B 4LYJA 4M1TA 1L2TA 3RC8A 1E0SA 4NZYA 2DY1A 2B7BA 2ZS7A 3N5CA 2EWWA 4ZI2A 4FN5A 4GNKA 5LPNA 5JS7A 4Q4HB 2W0SA 4RVCA 3RDPA 1CJUC 4RZUA 2E87A 3EZ7A 2ZRLA 2PX3A 1N2CE 2DFLA 3B9QA 3AEZA 1KAGA 4C9BA 1YR7A 5KU1A 1C9KA 2CLSA 4PPGA 2HEIA 4MUBA 4QFMA 4KSCA 3TW8B 2JGNA 1VTKA 3OEEA 4FMDF 3FGNA 4KFSA 1QHSA 2ZRIA 4HZUB 4DB4A 5F3WB 5IHPA 4EPTA 2VP5A 1QRAA 1SVIA 4JZKA 3LVRE 3TRFA 2O8EA 4TQ9A 1NVVR 1JR3A 1ZUNB 2J59A 2WJIA 3K53A 3QY0A 4ZDKA 5IT5A 5E95A 1DG3A 1W47A 2Q3FA 2OZEA 1VMAA 4Q7LA 2Q0HA 3R7WB 1FX0A 2P5TB 3RS3A 3M0EA 3GJ5A 3DEFA 5CYPA 1WB9A 1XZQA 4NYMR 1YR8A 3REFA 3NVAA 2GJKA 1G7CA 2UZ3A 2H18A 2CMKA 4UQOA 2W6JA 2H7VA 1MO5A 3X1YA 1CR4A 1QBKC 2WWHA 1ZM9A 2QPAA 2QL6A 4DWJA 3A37A 1N6NA 1U2RA 2YWEA 1SHKA 2JCSA 1NVXQ 2QAJA 3GJ4A 4YMVA 4PAMA 3TR5A 1DO2A 3V4RA 2QPOA 4DUGA 3GJ0A 2WKRA 4E07A 3KDSE 4NE2A 4C0AC 4IDNA 4QBIA 3W6NA 4DLXA 2G1JA 3BERA 5TV2A 2Q3MA 1P60A 1P6XA 2OHFA 1E2JA 3CONA 5LD2B 3EPKA 2QM8A 1Z8FA 1F2TA 3ZVMA 1F3OA 3HU2A 2XNDA 5CDFE 5JI3E 1DO0A 1E2PA 4FMCF 3RRNA 1IN8A 3CX8A 1EFTA 5J4YA 3O8CA 3B7GA 1RE0A 3OEED 4EFNA 3VR3A 1M7GA 1R0YA 3RC3A 3KQUA 4QXAA 1IQPA 4PSVA 2YNMA 1A2KC 4RKFA 3KB1A 4EAQA 4RY2A 1YE8A 1RRGA 2OILA 3THXA 3QEJA 5AJXA 5BXQC 2RGAA 2O8DA 2YV5A 3AKEA 3AF0A 3U3JA 5K8TA 4BFZA 2RCNA 5KUTA 3BH0A 5JLJA 3IO3A 4ZCLA 3WYGA 5B2ZA 1A4RA 4KO8A 3VHXA 3L82B 5JSZA 1G1MA 1DS6A 3WMFA 1XDBA 3O8RA 3ZD7A 4F4JA 1WBDA 1G6OA 1N6RA 1EG7A 2J45A 3EX7C 1UKEA 1G8HA 4EFLA 1W4RA 3CM0A 3AGQA 4UKDA 1X1SA 3SYKA 1B0UA 1SXJC 2FEOA 4NYIQ 4RCZA 1EWQA 1SKYB 5BN3A 3KXKA 1H8HA 4LI0A 2GZDA 4I1VA 3BS4A 1N6HA 4KLNA 3WYAA 4LDJA 4LY6A 2QN6A 1XEXB 2IT1A 5JCPA 5JBQA 3U7HB 5L3RA 3NXSA 4B71A 1NF3A 2Z4SA 4Q02A 5HZKA 2JDID 4TT3A 5JRZA 1JPJA 3EA5A 4KXFB 5JJLA 2IYXA 1LVGA 2O0JA 1P62B 3K70D 1G5PA 1TNDA 2WJGA 2BEKA 3KX2A 4NDZA 4B74A 1NBMD 5KDOA 2EFDB 2ZI4A 2W6ID 1ZIOA 3AKDA 3LO5A 5D3MA 1W0KD 2YJTD 3MJHA 4KVGA 1E1RA 3ZLJA 1XXHE 2OFXA 1TF2A 3LFUA 3I73A 3WP1B 1RPZA 2ZITA 3CF2A 3EPLA 3H84A 3ZDQA 3C5CA 2TMKA 4Q1FA 3S1AA 5AK0A 1D2MA 1WA5A 4WBSA 3FHTA 4S2EA 4P4SB 5FPSA 2QBYB 2Q21A 1ONBA 3I5YA 2ZI9A 2JLSA 3TUJC 1ZBDA 3IEVA 2KBFA 3X1XA 1RRCA 1RVDA 2FDCA 1JBKA 1OF1A 1MOZA 2O8FB 1Z0KA 2F1IA 3TVTA 3P4XA 4B48A 4IDPA 1R0XA 4HZIA 4DJTA 1HV8A 1WXQA 4WZAE 3RVBA 5TMPA 5LBIA 3T15A 1YRBA 1WQ1R 2B7CA 3NC1C 3EPJA 1VG0B 521PA 4JLOA 4OI1A 3W5IA 1GM5A 3QKUA 2AK2A 4NCHA 1E0AA 1E69A 4HUQA 2QNRA 2GJ8A 4B75A 4NU0A 4DCTA 1UADA 3FHOA 1W36C 4BZPA 1E2MA 1R0ZA 1HE1C 5HE8A 1FTSA 1KZ7B 3KTAB 1GG2A 1C4OA 2J3EA 4A0FA 5J47A 3K0SA 1R7RA 3OEHA 4B34A 3BB4A 4DCVA 1RYFA 4TL8A 1OB5A 5B64A 2VBCA 1SVKA 1YZQA 5AUPB 2JLUA 4P3YA 1Z6AA 1Z6TA 2NGRA 4GBMA 2OM2A 3V00A 1OFUX 4J0QA 4D80A 2RGGA 2W2XA 3L8YA 3NBYC 2J7PD 2IYSA 3AB3A 4A2WA 3IBGA 3TLXA 2ERYA 3RS5A 2CEAA 1IN4A 4BFSA 4HAZA 5HKKD 1EK0A 1F2UA 1M34E 3B82A 4D0LB 1RKBA 2R65A 2FJUA 3O47A 1G7SA 2OBMA 2O8DB 1JJ7A 3GD7A 4US0R 3GLGE 4C0BA 1KIMA 1OFHA 1M8PA 1TF7A 1R8SA 4PHHA 2P2LA 2REXB 4B33A 3AVWA 2AKAB 3THOA 2BBSA 4C2TA 3FDIA 1BYIA 4D26A 4V0ME 1G21E 4C2UA 4Q01A 3M4YA 5AJVB 3CRRA 4HB3A 3UG6A 2BJVA 2CJWA 2XB2A 2C03A 1FNNA 3OESA 2RGXA 3R9IA 5JECA 4D25A 3T1OA 2KE5A 4DVGA 2ZEJA 1KMHA 4GOKA 1PLLA 4WIAA 1E0JA 1JEDA 1II0A 4B35A 5CB8A 1MABB 2EVWX 4I4LA 2CE7A 3D3QA 3ZD6A 1Y63A 2KBEA 1Z2AA 2ZR0A 3ADKA 3CX7A 5DHFA 1G41A 5AR1A 5JEDA 4CEIB 5BN4A 5FBVB 2GNOA 4A6XA 4YDSA 2CNWA 3FWYA 1NVUQ 4M8NE 4P0TA 2EFEB 4UNQA 5JEEA 1U0LA 3QENA 4LUCA 1IXSB 2P6RA 1XPOA 1J2JA 2VTKA 2C04A 4S35A 5E7MA 4BZXA 3AKCA 1QG2A 2GAOA 3MUFA 1AS2A 3OFNA 5JS8A 3N2EA 3VTKA 2I3BA 3W34A 5HR5A 4K8OA 2GK7A 3ONWA 3KUCA 5FUXA 2WICA 1GP2A 3CNOA 1NVVQ 2ZJYA 1G291 2ZRKA 4KHZA 4DEXA 2C9CA 4Q9JA 4RD4A 2CK3D 2BBTA 4F92B 3R9XA 2JA1A 1CBUA 3KXLA 3BE4A 1X1RA 3TVDA 1GZSA 1KTVA 2ECKA 5AUQA 4AWXA 4JVMA 1X86B 4XD7D 2WJYA 2DB3A 1P2TA 4QHTA 2A5GA 1AQYA 4GMDA 4U7DA 3TSWA 3GJ3A 1ZMXA 5J5CA 3RWMB 4URVR 5CIQA 1F48A 2ZJ2A 2GXUA 1NY5A 1E9AA 2JJ2A 3TSOA 1S8FA 4XVQA 4Q66C 1GNPA 1N0VC 2ZJAA 3AF2A 4V0OA 3CNNA 1TEXA 2CE2X 2HDNB 5AJWA 4QGFA 3GPLA 2A7QA 4B47A 3FB4A 1G18A 5CLQA 4NCJA 5EP2A 3RWOA 2JASA 3B2EA 4LCBA 4UXJA 2KSQA 4YDHB 1SVOA 3SBDA 1FL9A 4FMCB 1VIYA 4PHGA 3PITA 4US2R 3CPEA 4JBXA 1OYYA 3DMNA 3GLHB 3WNDA 3W90A 2IYZA 3A4LA 4D0GA 1T4GA 4AURA 1XCMA 3F8TA 5FBRB 2VSOA 2BIFA 3QG1A 4HZUA 3AP3A 1JB1A 2JJ1D 3LBIA 1EFHA 1KI2A 1U8YA 4GI7A 4GOXA 2QU8A 1U0JA 3QIAA 1E4YA 1W46A 1ZCBA 4TSFA 2CCJA 1J90A 3LVQE 2XOKA 1YKSA 3AF3A 3RAPR 2ZAMA 2WSMA 3AVUA 3U60B 1QF9A 3HDTA 2OCAA 4DCSA 2D3WA 3E2IA 1Q1EA 4WXRA 4LHVA 2OAP1 5FBWB 2DFTA 1KNXA 2B21A 3T34A 4TTQA 1AZSC 3I8XA 3EIHA 4OQXA 2ZRGA 4YLGA 1X8KA 4OQFA 4ON9A 2IYYA 2F55A 4HAYA 1UKVY 2YOFA 1W36B 1MKYA 4DC9A 1D9ZA 3GJ7A 4ESVA 2BOVA 4WZ6A 2MMCA 4A0RA 2GTPA 5EP4A 1W2HA 1OPXA 1WP9A 1IONA 3C41J 1P3JA 2ZUCA 1LW7A 2VHQA 4QHYA 1ZW6A 5GJVC 3SS8A 1C1YA 4CVNA 4FI3C 4JLNA 3SI7A 2BV3A 3K9LA 4PX9A 5FL7A 1F60A 2XTNA 3CPJB 3SNHA 2WSSD 3BH6A 3ASZA 2ODWA 3CRW1 4LHZA 2VF8A 4YXWD 5FPTA 1DE0A 1NMZA 4C7OB 4C0HA 4XWAA 2CL6X 4OQNA 1OH7A 2FGJA 3EC1A 4GFDA 2WZQA 2XXAB 4DHEA 1HQCA 2FPLA 5FFMA 2JJ1A 3ZVRA 1G5RA 3KJGA 2ONJA 4FD2A 1T0JB 1XFAA 4QBFA 1KY2A 1W2GA 4BASA 4PTLA 3ZYCA 1GNQA 4FWTA 3BFVA 1Q22A 3HYTA 1NJGA 1CU1A 3H4MA 3KFVA 3EASA 4URYR 4TL9A 1XPRA 2O8CA 2FU5C 2WWYA 3QI2A 3DL0A 3NBFA 3E1SA 1L7VC 1JJVA 1AKYA 3L0OA 3D8BA 5C4MA 3AH8A 1K8RA 1PLJA 2QGNA 2RHDA 3HR8A 1CJTC 4V02A 1ZAKA 5BWMA 3U61B 1UBEA 3Q85A 2WBLC 5KSZA 2ZRMA 2RGBA 5EZ6B 1HE8B 1ZD9A 1G6HA 5KDLA 4C0QC 1XD2B 2E9SA 5JCZA 4HUQB 4A8JA 5CJ2A 1MR3F 3U3RA 3KUDA 3SFVA 2ZR9A 2CLDX 2PEZA 1XTKA 1G8PA 4POAA 4ZKDA 1G64A 4DEYA 2OFWA 2KI5A 4M9ZA 4XSHA 1P2UA 2I1VB 2WVJA 2PLRA 3IIMA 4A9AA 1E2QA 4PHTA 2AFHE 1AJEA 3CO5A 4LOAA 3H1TA 3IO5A 2EFHB 1QVRA 1E2DA 4MRRA 2Q9AA 4TMTA 2LKDA 3QVVA 1VCNA 3GEEA 2EYQA 2ZXUA 1OW3B 4BFTA 4WA7A 4CEJA 4JYCA 4EPVA 4AKHA 1LV7A 1SQ5A 1Z6YA 4IVRA 4PSKA 1ZNXA 2XX3A 2RGNA 2CJWB 4BZQA 3O8BA 5KHOC 1PZNA 2PLFA 2AD5A 4AYWA 1T5LA 2BMJA 4CYMA 3PEYA 3HPQA 2W6IA 3SJCA 3UK6A 4O3MA 2IYRA 2F1HA 2WMNB 821PA 2ORWA 3H2YA 1P75A 2W58A 3UMFA 2G1KA 4KODA 4PPNA 2NOAA 2YVUA 3C8UA 2VLIA 1FP6A 2QP9X 4OHXA 2C78A 4LYAA 2IF0A 4PZLA 4NCNA 4DLTA 1NP6A 2GEUA 3EIQA 1K6MA 3IQWA 1DTSA 3WBJA 1VIAA 3GLGB 1NSFA 1E2KA 2PT7A 1BMFA 1SVWA 2XTMA 5FOTA 4EPWA 3NDPA 3I8SA 4XOIA 4B3XA 2RAPA 5KPDA 1II8B 2GK6A 3P32A 1T3SA 4QM7A 1XTIA 1O87A 1YZLA 4NMMA 2IBMA 4B44A 2QMHA 1U94A 2C96A 4F7WA 4QL3A 1AGRA 2GETA 4IEEA 3PENA 4QG7A 1S3SA 4DZZA 3MWYW 2ZJBA 4EPRA 2REOA 3NG1A 4BLOA 2J9RA 1HQYE 1XEFA 1W0JD 4Q9KA 2WWFA 3CLVA 1XZPA 3FHCB 3B1XA 3JVVA 4IOJA 1G8FA 4ZIRA 2JLXA 3TUZC 3GFTA 3D7MA 3FKQA 3REGA 3SYLA 1US8B 2CXXA 4ESHA 4AKEA 1GITA 1CR1A 3KQNA 4GL2A 4LBYA 5CM9C 4M1KA 3FE2A 2VQSA 4G3XA 4D4MA 2J0QA 2JJ8A 1DEKA 1MH1A 5F98A 4DKXA 3BH7A 3IGFA 4QOSA 3TMKA 1S0UA 4I1SA 5DN6A 2ZE5A 3K8YA 1E2FA 2VP6A 1UFQA 1I4LD 3EWAA 3T12A 1EFCA 1GKIA 2IWHA 1Q3TA 3FFBA 4FWIB 2FE4A 4NYJR 1X3SA 2ZM5A 4TYQA 1NMXA 1KKLA 3QKRA 3D31A 4KFUA 3NWJA 1XCGB 3CW2A 2R9VA 2BKUA 3A1SA 3QE0A 2W2TA 1H8ED 3L8ZA 4I1UA 2IXEA 2NMVA 3ZS8A 3VQTA 3A1WA 1U90A 2JLWA 1FOEB 1FFHA 1S96A 3QXXA 4QNMA 4AD8A 2DCUA 4ZDJA 4QGGA 4JL8A 2FOLA 2GCPA 1P72A 2DWPA 4BUJA 4QJ5A 4PC3A 2VP9A 2F6RA 4N0EA 121PA 1T6NA 4R2HA 3LXXA 1UM8A 2ZYTX 4Y0VA 4IHQA 4DLVA 2X8AA 3CF0A 1HA3A 5KNCA 3SZRA 4QKQA 1E9BA 4YMSA 2PT5A 4IDHA 3PR1A 3MAAC 1KAOA 2WKQA 2ANCA 3ZVLA 3U6BA 2SHKA 4I1OA 4DT1B 2OXRA 4Q00A 1Z0AA 3F0TA 2G9NA 4MKHA 1Z6XA 2IXFA 2ZU6A 2IS4A 5H68A 2IYUA 2OO7A 4LBZA 3QG5A 4FMBB 4TLEA 3OIWA 3LY5A 3OAAA 4LJ7A 4QHSA 1FUKA 2IYQA 5L3QB 2WWXA 4US1R 3V9PA 1LNZA 1X8JA 4KCGA 4A0GA 3THYA 4PHFA 5E3HA 2R6AA 1FQJA 2YC2C 5JRJA 4BFXA 4TLCA 5C46F 4CIDA 3BD9A 2FFHA 2PEYA 3CH5A 1OXVA 2OCYC 1NBMA 3UANA 4TTPA 5DO9A 2V8OA 2WJVA 2QSYA 3AVOA 4DSUA 1Z0DA 3EZ9A 4Q1DA 4Q9LA 5A4JA 1J7KA 1JXOA 1LS1A 3F5FA 1RIFA 1IY0A 1F2TB 5LB2A 3F3YA 5J4LA 4MGIR 3FKSD 4URWR 4BE7B 3VMFA 2BHRA 1CR0A 221PA 1AK2A 1N0WA 1JI0A 1K5GA 2IHBA 2QMEA 2V9PA 4E09A 1G8YA 1VYUA 2GCNA 1SZPA 2J46A 4AKGA 4GSYA 5DYGA 4B3GA 3KJHA 2L0XA 1XTJA 3AUXA 1XX6A 2ZETA 3BFXA 3TH5A 2VHUA 4O0MA 3U44A 4G5QA 3GJ6A 1UJ2A
chains in the Genus database with same CATH superfamily
2B2CA 4P54A 1FCJA 3VH3A 2WOJA 4JYZA 3GT7A 4OXIA 2QP3A 2VCHA 4MUFA 4S1NA 2GD6A 1TVKA 1L4HA 3I39X 3G82C 1HNXB 1PIWA 3WRXC 4QDUA 2GTIA 2PIAA 2PRYA 5AUNB 4BMDA 2VXYA 1CJMA 2OV6A 5AW2A 2FEPA 3QPCA 4IJUA 4KXVA 2QG6A 3SE0A 5JSZB 1Q83A 5A5EA 1V2GA 2AUMA 3D3NA 4HAWA 1MQAA 4KQ9A 1DCMA 2I8LA 4TMVA 4OLAA 2HK8A 1XD9A 3ADOA 4IF6A 3PC2A 4IP0A 2UUAB 3DYBA 5BWOA 1JP7A 2XV1A 4NICA 3U26A 1ZUNA 3QU2A 4TLAA 3DT8A 4XJSA 4CV2A 4TMWA 4MI6A 1W5TA 3BM5A 3ZHTA 2ERXA 2OXFA 1YO6A 1G4HA 3OCUA 2XCIA 4L6AA 4LMBA 3ZBQA 3A1NA 2HWWA 2C9YA 1YONA 1G5IA 2VRCA 3NOVA 5G2OA 1L7XA 1UDXA 4NBUA 1T1EA 2PX6A 3BMXA 3KU4A 4RPHA 4EL5A 5L3SB 1RKVA 2JK0A 2QAGB 3D6JA 1CY7A 2A9RA 1DCKA 2B4YA 4QASA 5CA0B 3OZAA 4AY4A 1GZDA 2IZ1A 4MCIA 3M4JA 4FR0A 3OLZA 2Q9CA 2ZSJA 4RSGA 1BX0A 4XM2A 5LKAA 2XXAA 1PJTA 5GIPE 5HS4A 3S27A 1JYSA 2O57A 4KLZA 3CB2A 3DH0A 4BN0A 5HIIA 5IJ9B 2W2NA 4J0EA 3TNFA 1UXOA 2OPBA 3X1ZA 4DMFA 5LQAA 2QRVB 1JILA 1HURA 2PWBA 1LRLA 4R9UC 4E03A 4V0SA 3HDQA 2GPNA 1YVDA 1G3IA 1Q1BA 2FHSA 3HVJA 3LV8A 2PX4A 3G68A 3PUXA 3V4PB 3WJAA 4M1YA 4Y2JA 3T9CA 2Z98A 2BUBA 3A6DA 1DAEA 3V8BA 1TVKB 4OXXA 2RGYA 1XB2A 3RPEA 3WL8A 2EWMA 1GWNA 2ZYIA 4LK3A 1BVRA 5T3UA 3WRYA 1YS6A 3I6BA 1Y9DA 1KEVA 4G0QA 5KJ1A 4FN4A 3DMPA 4BLQA 4PAWA 3PKJA 2E55A 4R3UC 1E20A 5FEMA 3U5ZB 3WYFA 1IJBA 2WTUA 1GZ5A 2CT8A 1QDLB 1T13A 1QHFA 2WWVD 2NV0A 2W5UA 4B6PA 5M2QA 4MH0R 1IBKB 2A78A 1OROA 3OE1A 3BRWD 1JDBB 1FW8A 2GN0A 1UFKA 1W5EA 4Q37A 2RK3A 3T4XA 2XB8A 1FFBA 5U4XA 4PG7A 5JR3A 3L07A 2B5VA 4WL0A 3I9JA 3GZ4A 4ZOQI 3IP8A 2O06A 3UK1A 1YB1A 3PA8A 1X8LA 3KJEA 3KR1A 4CG2A 3B38A 2KHZA 1Z2PX 1CX9B 2CEKA 1B0ZA 1JE1A 3MUOA 2RGRA 1QQ6A 3SYMA 1PUXA 4CIVA 2H1LA 3P4UA 2H8GA 4HP8A 1GQYA 3VC2A 2CFRA 5MDHA 2HA6A 2V7GA 1YCDA 3D2BA 4LV6A 2V6GA 1IK4A 8ABPA 4K3UA 2EDCA 3I0ZA 4ER3A 4GGOA 2CDNA 2PYIA 1P0CA 2Y66A 1VMIA 4ZYTA 4CKYA 2A9KA 3BFJA 5AJYA 4B3RB 1W88A 5L8VA 3EDRA 4WAUA 3RS0A 3TTYA 3OPNA 2IZZA 4GIBA 2BFFA 4ITRC 1KEWA 5LJIA 2DFVA 1PD0A 1I24A 4CF7A 3N75A 4FZVA 5IFLA 3E8MA 1P6UA 2V7BA 2HREA 3HKEB 3I58A 4XI9A 1WNTA 1ZHHA 3A2NA 1WW8A 2VDUE 2H7CA 4HRAA 1X7YB 3MTEA 3MMPA 4XGRA 3TI7A 1VLJA 3UMCA 4D41A 5ALFA 1IHDA 2L82A 5DGIA 4W5RA 4QBGB 1PD1A 5BMOA 5JCXA 1MQ9A 4G1VA 4TM8A 4CG3A 1O95C 1ZG3A 1EWKA 1T5TA 3SF8B 4TMKA 4B2YA 2HCJB 3ND5A 3RNOA 5KNBD 5CH3A 5KO2A 5EJAA 4QXMA 1QRUA 1S2MA 4DCUA 2HRDA 2VZLA 3B1FA 1G20B 3KRTA 4HFNA 2IIQA 1ZI8A 4K81B 4M22A 3RGWS 4Q3LA 3WY9A 1NI3A 4D9FA 1YB2A 1Q77A 2CHQA 4RD1A 2GNPA 4ZAXA 4DSTA 1JWLA 3Q2IA 4OI4A 1FRFS 2VDOB 3GDFA 1TQ6A 1PL8A 1U04A 1KE1A 3RFUA 4XASA 4PYMA 1GQOA 3WNZA 1AX9A 2XVXA 3WG9A 4G0YA 4HAVA 4Q1AA 4D99A 1K27A 1VHLA 3FETA 3C3WA 1YRLA 4XAQA 3RB8A 5LUAA 5DHRA 2D00A 3GJ8A 4CMJA 4ER5A 3V4LA 2RH8A 4AULA 3KZKA 2Y77A 5EPOA 1XOIA 2WTAA 2ZWMA 1FZTA 1CCWA 2OCXA 3IUQA 4U7HA 2VTBB 2DH6A 3NYQA 3QU4A 3K71B 1Z5GA 4CQJA 2DHDA 3SLKA 1VKHA 2CDCA 1SULA 1TM5E 2O3JA 1K5PA 3NHUA 4RGVA 1P2BA 1XZHA 3EJWA 3ABOB 5SY9A 1BFUA 4AP6A 4FZJA 4CLOA 2I2CA 2C3MA 3LLUA 5BOSB 1TYAE 1Q7GA 5EP1A 4KN6A 3SHFA 1BE1A 2DFNA 3G2LA 4AT1A 4BO4A 1M83A 4UUBA 2GN6A 1ZK0A 4D3YA 2VDLB 1LU9A 4Q3KA 3CZPA 3O4HA 4R8MA 4FPXA 3L1JA 3ZDZB 4CF4A 1BKYA 1MB4A 5FTMA 3EZNA 3KKOA 1WV0A 4FYHA 1OXBB 1C41A 3JX9A 4JYMA 4R1UA 3G0BA 5SYAA 3KKMA 5AJTA 5TGDA 2QD2A 3II6X 1CR2A 4MQ6A 1TB4A 4BLTA 1ULBA 3LUBA 4IV5A 3WBBA 4IZOA 5FB3A 3JD1A 4MVJP 4RQAA 1P39A 2GZAA 1GKYA 1H0SA 3HCCA 1ECFA 4MRSA 4PYLA 1K6XA 3QTTA 4B3MB 4F4FA 1I80A 2WHPA 4J1SA 4BX0A 3TXYA 2IJGX 1P73A 4W99A 4EZIA 5KHLB 2QMYA 1C2TA 1UQRA 1G63A 4GL4A 4GXRA 1GGNA 4X20B 4XWGA 4BPBA 2ZCUA 2Z30A 3X2EA 1G19A 2OOSA 3R40A 2JHGA 5A62A 3CTPA 1WHTA 2JI6A 2W9XA 4LS3A 3Q6IA 1AV7A 1DIGA 3TKAA 2FHPA 1UINA 1GR0A 1E2GA 3KAPA 5KCMA 1SGWA 4F97A 1EVYA 2C5EA 1V47A 1H5NA 2P2SA 1ZD3A 4MDFA 2PKXA 4Z51A 1CUHA 2H8KA 1WXGA 4JJIA 3FNHA 2GO7A 4YQYA 1FDIA 4QREA 5DYIA 1RRFA 4ZICA 3W2HA 2QMUA 2G8NA 2FX3A 1DRVA 2VZ0A 3SQDA 1V5WA 3UMSA 3UQYS 5JNRA 4DCGA 1PTJA 3GRPA 1EJ6A 1JYEA 1E6CA 1RWQA 1SZDA 4YGYA 1Y8AA 1EINA 3FOWA 4LX0A 5J2TF 4I1IA 5FH9A 4KITB 2AC2A 1IRIA 2HFJA 4LRTB 4DQKA 4DDWA 1H3NA 3PGLA 3A6PC 4GM4A 3PUKA 3TBKA 1OLUA 4FGJA 1E62A 4HN9A 4LZOA 1RZUA 3RM3A 3FBTA 2OYRA 1XU7A 2IXDA 5EG5A 3REQB 3TAUA 3IEXA 3OZGA 4E13A 4F4CA 4Z0NA 3E9QA 3GZJA 4AJ9A 1EM8B 5MGBA 2DFKB 3USES 1RQ2A 3PNQA 3KKEA 5BY2A 3NPMA 4GYYA 2AFIE 1AH2A 4W9NA 3OD5A 5HIAA 2QZZA 4X95A 2WEKA 1N1EA 1RABA 2O1SA 4REMA 4AB1A 3PIRA 1UDCA 2B8TA 3CNLA 3KYIB 3L4EA 1QMGA 3MT9A 5G02A 3W2FA 1EGHA 1PBNA 1T9ZA 4N18A 5CXQA 1NKSA 1UT6A 3MZ0A 1X3LA 5HPYB 3HR4A 5IKOA 4QTYA 3JD3A 2CSXA 2GZHA 4NPAA 2AJCA 1CP2A 1JKFA 2XCSB 4FT2A 2O5EA 2CFSA 1YMVA 2QTMA 1I30A 2EZTA 3M6XA 3T06B 1FP4A 5J5VA 2ZAGA 4B40A 1OGJA 1B14A 2X76A 3HU5A 3RUPA 1X80A 1NNSA 1Q0SA 3PRHA 4YWHA 1ZGJA 4F4DA 1X7HA 4IDCA 2ST1A 4JKIA 4OVKA 5FWAA 2FW0A 1J8VA 4HS4A 1Y1QA 3HLKA 4IJ6A 3ST7A 1Z0FA 4UNPA 3OIUA 2LTAA 2AQ8A 3IAUA 4IVQA 4BFWA 1RJGA 3BE5A 3FPKA 5JCOA 1EWRA 4AJKA 4S05A 1A5SB 1ECCA 1Y6GA 3LF2A 2BFPA 3BA1A 2FR0A 4H7HA 2AZDA 2RJNA 3JQ8A 2Q5FA 3QYFA 4QODA 3S2EA 4Z4IA 1DWOA 1NNI1 4Z0HO 4L74A 2X5NA 4FCTA 1Z88A 2GWRA 4B76A 3AOEC 1UKCA 4DMKA 3Q41A 2G3YA 3U3OA 3WZLA 1W4AA 2C2YA 4GHWA 2CJPA 4WESB 1VKJA 3NBMA 3AF4A 1WXIA 1CQWA 4U02A 5JAOA 2FR8A 1OH8A 1T6XA 2DR3A 3HSYA 3IEUA 1UBFA 2G72A 5I47A 3DZDA 3X1WA 2P9FA 2ZJ3A 1F2VA 2G7ZA 3BMNB 1U9IC 1WZIA 1ORTA 2GAAA 2ZJOA 3H5RA 3IE2A 5JYEA 4KZPA 1KP9A 1XRSB 5EJ7A 3SBEA 5T67A 1A9YA 2IPAB 3DZ8A 2C1EA 2OR3A 4I1YA 4CM8A 5INTA 4W5QA 1ZRNA 4PAOA 1W36D 1Y3IA 2GCOB 3I23A 3RFCA 2DTEA 4OA8A 3ZJVA 2ZYSA 3FSEA 5ALOA 1ZD2P 1LBSA 1JGTA 4PM4A 2TMYA 3ROFA 1XU9A 2QD4A 5KAMA 2V6IA 4U39A 1SB8A 1G3QA 2XTZA 3FTDA 2CNBA 4YUXA 5EHQA 3RJZA 5E6SB 2V7TA 1U28C 4RZXA 2JHPA 2B20A 2I1WA 5FUVA 5I3ZA 3DOJA 3FPAA 4C88A 1ORDA 2OCBA 4D43A 1RQXA 1Q19A 1T36B 1ABBA 1TIBA 1JJFA 1Z5WA 2X23A 2PHZA 2YVLA 4F2DA 5LDDC 4EHAA 4QU5A 4BNGA 4R54A 2NG1A 3RSQA 2JAXA 1Y7LA 3BAFA 4ZIRB 1Z06A 2PUVA 1CETA 1D2EA 1KEEB 3LQKA 5AXDA 3TS1A 3ZLUA 2PR7A 1XNHA 1J0CA 1VGQA 1L1FA 2IXBA 1XZCA 1US8A 3ZN2A 3G9TA 1KMHB 1H6DA 4KUEA 3OQ1A 4M1OA 2GEKA 3Q0IA 2D2XA 4KGXA 4DAOA 2QD3A 3BE8A 4ETNA 1QPBA 2EJBA 3RRYA 2XDWA 3AIIA 3M82A 3OPXA 1TT5B 3AF6A 3DM5A 2KQUA 1MNAA 2E5FA 4Y0NA 3UMGA 3NV9A 1NJSA 5TLSA 2PA3A 1XD8A 2D7CA 3PB3A 2XZDA 4Z1MA 5HFNA 1WHSA 1EFDN 1YHNA 1Z0SA 4FFDA 4QYWA 1BCSA 3FPEA 4HLNA 1VSVA 4GPEA 1FFWA 4BN5A 4JN6B 5T4FA 4HLUC 4NHEA 4HMQA 1L4BA 4E94A 1IN1A 2DVMA 1A8UA 4R1SA 1DC3A 3MCAA 1J9GA 2OVFA 4WCDA 4BWYA 1CYDA 4JYPA 5FPYA 2NYUA 2M6LA 3W5VA 4AQDA 2ZREA 2RHBA 1EFRA 3G5UA 4L8FA 4OMDA 1MW9X 4LXYA 2WAOA 3I4LA 4KN8A 4Q7MB 2W71A 3D3WA 3NOOA 5FOVA 4CQLA 3FMPB 3OU2A 4EQ6B 1P45A 2Y92A 4TYYA 3EGWA 3GGDA 4TL7A 4B4DA 4FQ8A 4RLQA 4AMGA 4N3GA 4B3BA 1UZLA 3ITEA 5CT5A 4CF6A 5A5GA 3HBMA 2A5DA 4YCMA 4KV9A 1CTQA 3OTHA 3NIGB 5KYXB 1OSNA 2DX7A 3LWNA 1NQOA 2FPKA 3VSBA 4LF5B 2A9FA 3IV9A 1KY4A 3GIWA 1KI3A 1RYMA 5KKCA 1KQFA 1OH6A 1XEXA 1QDEA 3I52A 2OWDA 1BQEA 1GEGA 4KXUA 4HWRA 3VR5D 3SF0A 4CT5A 2CDAA 2YJNA 1OUMA 2C4WA 1TM1E 2WKPA 3A6HA 5BUCA 1WMDA 3AETA 1KGDA 1YFJA 2JGFA 3DP9A 3EGXA 1A3CA 1XVUA 4PAGA 3KZMA 3RYIB 3BRWA 1FB5A 2CVFA 1Z4MA 2X14A 2ON6A 3AHEA 2YWJA 3Q5EA 4P4LA 1DLJA 3LTEA 2PGDA 1G5HA 4XIGS 5REQB 1NPDA 1EXVA 1L4GA 1Z7GA 5AW0A 4BBZA 1SC1A 5CT6A 3O0DA 4NWIA 4Z4CA 3QFTA 4YCNA 4IFBA 4FX2A 1T2FA 2P30A 4GI3A 1YR3A 2F3PA 5HFAA 2YNMC 2NO6A 3DDSA 4R0NA 4QXRA 4TV8B 5A3RA 4P8RA 5H81A 1EPUA 4C4XA 3OOHA 4D79A 1JDVA 1I4WA 3KQOA 4FM9A 1OI4A 2H07A 2DYKA 1TCUA 2VYFA 3S6JA 2PYDA 2XJ9A 1IN5A 1R6VA 1OJ7A 1WMAA 2YOHA 3CQ9A 3CMMA 3JWEA 1D0SA 3Q3EA 5B1YA 2C8KA 4IDAA 1S8NA 4JJEA 4EO4A 2QX6A 1UBTS 3O21A 1H22A 2G88A 4HYTA 4MIYA 3GEGA 2R47A 1U81A 2ZAOA 3M6VA 5ADHA 4ND3A 2JGMA 4BKOA 2EJUA 5AFSA 5KYWB 3PU6A 1Y8CA 2ZE7A 3CLTD 4HLQB 3HCEA 3A0RB 3BDVA 3FSGD 4PCAA 2XITA 3MTIA 3V1LA 4HNUA 3OKCA 3NASA 3FFTA 2MYUA 3B7PA 1K1EA 1SQ6A 2NZUG 1VCHA 2QTFA 2NU6A 3D5TA 3FKSA 1HMPA 4MICA 4MXDA 1SXIA 4M0MA 2EKQA 3V5NA 4I2NA 4MV1A 3U81A 3LC1O 4LZNA 2OA0A 1T35A 4BCDA 3WQQA 1AVTA 2QW1A 2O8CB 5EKSA 5AXAA 4MIKA 5CP8A 1BFDA 5F73A 4KGDA 1DIHA 1P3DA 2J5BA 3IQDB 4JLVA 1N32B 3DEJA 4XWKA 1IOLA 1PG0A 3EG9A 5KYWA 3HA7A 1HG0A 2W00A 1UPUA 4A6PA 1V11B 2AXEA 2FSSA 5AKXA 3CRZA 1XJWA 3CKLA 3L4BC 1VQ1A 2ZIFA 3DV0B 3PC3A 2XOEA 3MD9A 1YSCA 5SZIA 4UHKA 5ALLA 1CQPA 2VEDA 1RT9A 2XT0A 1ZD4A 1GGEA 1KZ9A 1A4UA 2BMEA 3R77A 4K6MA 3TM4A 5KTMA 1A4IA 3L1UA 1NZJA 2C98A 2AJBA 1V43A 2BGJA 2IZ5A 5E1DA 1R4AA 1YDGA 1TAHA 3KJZA 4JBHA 5DP2A 3ZXXA 1I32A 1FTNA 1QQ5A 4FDLA 2Q3LA 3CT6A 1EEXB 2OV2A 2Z2YA 1LQ2A 1VCMA 1ELOA 3PP8A 1ODKA 2DWOA 4TLLB 3KEGA 2QZSA 3BWBA 2QW8A 3BWDD 3GWZA 1S5PA 5JC1A 4C7VA 3VC7A 3N8NA 2NSDA 1P7VA 1CF2O 4DFDA 3QTBA 2YFYA 3TUIC 3NBXX 1NR1A 4I0WB 1DADA 1PT7A 5AVYA 2ZUFA 1M1NB 1N2GA 1THTA 1E9FA 1VPEA 2CDRA 1Q3HA 2QXYA 3VNBA 3KPJA 3KKNA 1N7GA 1ZRHA 5A0VA 4D9NA 4MWEA 1QUEA 3W1EA 3UMMA 1LK7A 2C5SA 1IUOA 5FYQA 1TEVA 5IJWA 4G1UC 4KQHA 1KZ6A 4KWHA 1WF3A 1AB5A 4JB3A 2I91A 5A0TA 4L0DA 3QRWA 1E5DA 1Q0RA 3HJNA 1GQSA 4IIHA 4L5YA 2HMWA 4MINA 3TK1A 4JL6A 1V11A 3GLRA 1BCSB 1XZEA 3LDAA 3UENA 3NONA 1XCPA 2DTXA 2ORYA 3CXUA 2CLHB 5C1IA 2H65A 4D97A 3DDCA 3IDSA 3GA0A 4ZCMA 3M1LA 4XLTA 2O52A 2ZI6A 3GJTA 3IBYA 4JQOA 4RFSA 1AMUA 4LFAB 1ZSVA 2J3JA 3PK0A 4NBVA 1NPYA 3L2OB 3C24A 2GHRA 5AJZA 1N2JA 2Q99A 4F6CA 1WX1A 1P4HA 5BV8A 2AYXA 3IQXA 3D6TB 2YTZA 4GR9A 5K8VA 4CV3A 4YJ3A 1GLNA 3IOEA 3BVPA 4EYOA 2ZSFA 3TO5A 3W6PA 4LF9B 3PUWA 2J5RA 2V45A 3IPYA 2FWNA 2PKQO 4OV6B 3GRYA 1O8BA 5KQLA 4MPPA 3ES9A 5F35A 3RREA 4CT0A 1JDTA 1T8YA 1VG1A 1DAKA 3IVCA 3SX2A 3UT5B 5I9SA 1Z6ZA 1JPUA 4L02A 5EWMB 2HADA 1PJ2A 3GPBA 2JNWA 1NJ1A 3NFRA 2OCDA 2QIOA 4LX8A 2G67A 1F06A 1F12A 3N3BC 4ZOBA 2JAQA 2YZNA 4BNKA 3SR3A 2OLEA 4WKOA 4WN9A 2IGTA 2X19A 3QVKA 5EXSA 4DQLA 1U2DA 4IZIA 4LC1A 5CFNA 3HN2A 1LB1B 4ZI3A 3DF9A 3NRCA 4IKEA 4CTOA 2ZPUA 1L7BA 2LGJA 1CDEA 1GNSA 3ANTA 2NAFA 2OSVA 2XCQA 1Z2EA 2OORA 2ZUBA 1L5MA 1PWYE 3HB0A 4IPTA 4QO8A 2YHSA 4BGDA 1UDAA 3GDHA 2ZKIA 3WIEA 3VPGA 2H85A 3H1GA 4LNUB 1PHRA 1DEAA 5BV2P 1QPZA 3MSCA 3UFXA 1CE8B 2AEEA 3T5GA 3MGAA 4C30A 3JRXA 4WEQA 4X7BA 1Z0JA 2MIIA 2HXSA 5J2UA 4BGVA 1UKAA 5A7HA 2P79A 4U0JA 1EM8A 3SQWA 1UK7A 4K9DA 3QNUA 4KBFA 2JEYA 4KQ2A 4C4PA 4KMRA 4LJSA 4U00A 2HH9A 1XZKA 2H9IA 4U2KA 3TTWA 3NS7A 2GXAA 2F8LA 1R6XA 3IOYA 4X6XA 2AFRA 3WK4A 1LK0A 3TXXA 3VVMA 1OLOA 3KR0A 3JCZA 4NDNE 4UNSA 4QQNA 2UXCB 3DV2A 4DG9A 1FP1D 3E7PA 8OHMA 5H5JA 5FRDA 1P2VA 4MDHA 3TGLA 2G9UA 1ONOA 1Z0ZA 4LMPA 1VJRA 2RJ3A 2O1EA 2P90A 4DR1B 3HBAA 3SHTA 4MLCA 4TRNA 3ROEA 1HQKA 4FMDB 3T1YB 2D74A 3VR0A 5A9SA 2NZ8A 3ZU6A 2O2XA 3H3JA 3Q4GA 4DXDA 4L51A 1TAUA 1SUCA 2OKCA 2WYHA 1N5JA 3QOFA 4HNVA 2JFQA 3SX0A 2RSLA 3L18A 1Q1QA 2V0NA 4NEHB 1FVOA 2YWBA 3DKVA 4DLNA 1BGVA 2Y1EA 4R8VA 4B84A 2H2AA 5BSEA 3H2JA 5LFAA 2WC1A 3OZIA 4G0OA 5J58A 4IM7A 2OLKA 4YRIA 3HXKA 2I03A 4F4IA 4X45A 3R7LA 4V3CA 2Z6UA 4FYWA 3IVMA 2OBLA 3EMVA 3HUDA 3MHTA 3EVDA 3P52A 4C14A 5B7NA 1MRNA 5JCOC 1ID8A 1B43A 1S3GA 5LYYA 5CR9A 2XKKA 4I5EA 3QQPA 2QKYA 1LCIA 1Y4SA 3H5VA 2YN2A 2YYYA 3ZE2B 5BSWA 4IIEA 2X1MA 1X77A 1Y3BE 3DBOB 2HB6A 5FIUA 2XMSA 1DCFA 4NNOA 4YEDA 1UAYA 3PTLA 4ZT6A 4XJXA 1XO1A 2NSJA 3TBHA 3ZE6A 1IM2A 1X74A 1J56A 2ZYWX 5COQA 3ZDRA 4F2WA 5FEUA 3NGMA 4HATA 1T8UA 2JCBA 1RM0A 2RIRA 4MPDA 4QPDA 4TYPA 3VDXA 3ZXSA 1AD2A 1KDPA 1CNFA 3WBKA 4ODIA 2OUIA 3R8CA 4A26A 3ZWYA 3RHFA 4I55B 2V7QD 5COAA 3MPOA 1FE8A 4WLEA 1V5FA 4Z7QB 4AO8A 1NW5A 2GVZC 4JUDX 4BQIA 3FPBA 4ENVA 1YC5A 3AVXA 3RIYA 3PV0A 3L0PA 1Y1PA 1VIDA 1ZH8A 1ONPA 3O4FA 3VDMA 3VDNB 3MRTA 5E1OA 3NHSA 2UDPA 4KPUB 2BP7B 2VNJA 1CQZA 2WF6A 1RI1A 2LIVA 3GJXC 3GZNA 5GV8A 3GARA 1EUCB 2J9FB 4B6RA 5KVSA 4HOYA 4X1OA 3KQTA 1O6ZA 3HP4A 3P7MA 3ZZ1A 1Y1SA 2HQSA 2QWXA 4XPZA 2PPLA 4MRMA 3UHFA 2Q4EA 4Y2YA 5JJCA 1A50B 1E99A 4TSRA 2A14A 1QHGA 3VKGA 4U2EA 3UB2A 1EVLA 5IM5A 2FW1A 3K32A 4EGJA 4LXGA 2PWAA 5E4FA 3HL4A 1Z2NX 5EXEA 1T6ZA 4URFA 1N6OA 5G4KA 2CKMA 4DLSA 2FPGA 3LRTA 1UBUS 4PAQA 4RVDA 1UK8A 3FUVA 5C5DA 2P75A 2UU9B 3BDAA 1F4PA 4LRWA 4PU0A 4TXJA 2N9UA 3RYCA 1OXTA 2J32A 3B1YA 3SR4A 5J1SB 3KKPA 4ZYYA 1FMTA 9ATCA 2AGVA 3AHGA 4MS3B 3VZPA 3RVQA 4KOAA 1NNEA 3STWA 4BMVA 1YE3A 4FFVA 4BVEA 3H0KA 1SUBA 2A1TR 2BFBA 2H08A 4RABA 4OEHA 3WIDA 1XZ8A 1EBBA 1W35A 3DFIA 3ACBA 1XRPA 2HNBA 4DQDA 1Q14A 4RFSB 4BU1A 5HQ3A 4NCBA 5BVGB 4II2A 2JZNA 4RLHA 4KAXA 4CR8A 4ZGGA 5CDUA 1IM5A 1ZGGA 4S12A 1R00A 1OZFA 3KTFA 5HF5A 2AI1A 2DH5A 2LRHA 1J39A 4UUQA 2H3EA 3IA2A 3TSYA 1ZESA 5ADUS 1JFSA 1U28A 2XWSA 3GLHE 2IV2X 2LKCA 2AB0A 3OSUA 2IXGA 4UFNA 4GPZA 3CPSA 1QWOA 2FMKA 3F78A 5FAXA 1WSBA 4Q3BA 5DMHA 4BNLA 4MPTA 1T2UA 5CFLA 3DEIA 1H9BA 1KJYA 1P5RA 2CN1A 4JA2A 3T4EA 5F76A 2P9ZA 3HKCB 3P2EA 1EJBA 2IYWA 3PC7A 4U6NA 4UAGA 3VOSA 1NA5A 4Y18A 1EDBA 4U2BA 3AVYA 3ISTA 1LEHA 4JLKA 5EJ2A 1SCQA 3ICCA 5A7GA 1JR2A 3HVRA 3DLPX 4OJTA 5LOVF 1URPA 4PPYA 3BGDA 5JQWA 1FSPA 3DAGA 1HX7A 2WSSA 2QI9F 2QZJA 3JQAA 1QJ4A 1VCOA 2NNLD 1RP7A 2J9YB 3CZMA 3E4CA 1WIWA 5HDBB 3N87A 3OEWA 3OJEA 1M1ZA 3D6MA 1GOTA 4IIDA 1XAGA 4HEA1 1IEVA 4JGIA 3FUWA 2QN7A 2RB4A 4K9SA 1DBRA 3QMWA 4P31A 1ODLA 1HE4A 2P2ZA 3IEIA 4G4GA 4QVGA 2WT9A 1HYHA 4ARZB 1UF9A 5K0FA 2F3TA 4K6CA 5KTTA 2QVLA 1VSQA 3NHLA 3QKWA 2NAPA 4HNTA 3A2LA 4HVTA 2BW0A 5IUKC 3SC4A 3IPAA 4JC0A 1K8ZB 1OWLA 2GXSA 3MINA 3O4GA 3PPVA 4G26A 3G5MA 5FP0A 4D2IA 2GLTA 3ADBA 2YIVX 3P4YA 2UYCA 1XZJA 1NRJB 4O2AF 1JAZA 3CNQS 4LWZA 4JLDA 1QHHB 1Z33A 3QU5A 4RMIA 4AMUA 3LD9A 1I9CA 4IO0A 3OKPA 3WGTA 4R83A 2F62A 1B6TA 1KJJA 2MHCA 1I3CA 5IK2A 4D3DA 1X8XA 4EKDA 4LDQA 2O4UX 3OA2A 3PC4A 4ZTBA 1SU6A 2M1XA 4GVLA 4FJ1A 1N5DA 4DLRA 5ENVA 3ZHVA 4Q12A 1P1RA 3WHLA 1NZDA 3RBVA 3WTCA 2IX3A 3KEFA 1AUOA 1TGVA 1P1IA 1E0KA 1W5SA 1R4NB 4L4UA 1OZHA 4TSKA 4TV9F 4CM8B 4FFRA 2EXXA 1MN6A 2B94A 2XA9A 3KHTA 4I14A 2HT1A 3F6CA 4JEMA 1BOOA 2X1VA 3CT4A 4HGYA 5EIHA 1TYEB 2Q9BA 5DHTA 4ECEA 3Q8KA 3QKSA 1KYXA 1UEIA 2VR1A 1GRNA 4HLDA 4PPQA 1JHUA 3UA3A 2EKPA 4FUQA 5KS2A 1BCRA 1Y81A 2DCMA 2EJTA 1PZFA 2ZIGA 1FDOA 1JWAB 2NU9B 1LVHA 2Z9DA 4WESA 2H54A 2W6OA 1T26A 2OQVA 4W9MC 4CLXA 1SU8A 4J1TA 3D5EA 1NVWQ 5C2JB 1QIJA 3U80A 4IH4A 4OQZA 2EKLA 2PRSA 1EGQA 3H86A 1E1CA 2RHRA 4TVOA 4DF3A 5CFMA 1GA6A 3TAHA 1Z4OA 2XIQA 2ZSDA 4RM2A 3FKJA 4G0PA 1TUEA 3I2FA 2NUAA 2REBA 4PRZA 1QVZA 5L6LB 1CRPA 3RW9A 3WK9A 1YE5A 4WRRA 3AJ8A 5CNJA 3SXUB 3KTDA 4BLVA 2LBPA 2NZWA 2WNIA 3I6YA 1GL7A 2Z6VA 1V6CA 2VYND 4NS4A 4PRKA 4X93A 5LYJA 3RS8A 1KEKA 1BHJA 1J5XA 1YFLA 5EJEA 3NQ41 5C31A 1JIVA 1X70A 3JRNA 4B43A 3GHYA 2IPOA 3A9VA 3GAAA 4H6XA 5CIWA 4ZVRA 4ED9A 1K9VF 4NYMQ 4HDMB 4PINA 2OFFA 3O4IA 3RE1A 1QC5A 4XQEA 3D8RA 3G8DA 1R37A 3NGLA 4XIIA 1FS5A 1G7TA 3M4NA 3RJ9A 3CHYA 1BSVA 2OBYA 3ND8A 4QAJA 4C06A 3RU7A 1DUSA 4OU5A 3AVVA 1QB7A 1XUOA 4EVQA 3SQXA 3UH1A 3M3PA 2AOUB 1KEPA 2D5IA 5H9WA 3ELBA 1J2YA 4LRYA 5KTPA 1Z47A 2JL1A 4MW9A 5CD1A 5GADl 3D02A 3AEUB 4V1CA 3DPIA 3MMSA 2BF7A 4G0NA 4MHTA 1R4MB 4RH0A 3FB1A 5CLHA 4ZU1X 4ACBA 4JUCA 5IBRA 1SWVA 4MWDA 2FZLA 4AUMA 3FMOB 1IZ9A 1EX7A 2FQ1A 5KREA 3VX4A 3DZHA 2ZUUA 3A14A 1NXTA 2FF7A 1WUJS 3WQHA 5EUMA 1JAXA 3RIMA 2VJDA 3EQZA 1ZEMA 1GHTA 1X7WB 2FB9A 2HGZA 2XGMA 3CWCA 3F4LA 4OFZA 4MGYR 5AKGA 1JLHA 1JFFB 1RLTA 4AO6A 2NUAB 1Z73A 3R6LA 1I1HA 2ANBA 2O2JA 3ZLTA 2GJSA 1Y5RA 2HQBA 3QE4A 1VBNA 4ZVNA 1E2HA 4IFEA 3IKTA 4RMGA 1ZNQO 1FXSA 3FCAA 2VJYA 3KKKA 1Y42X 3KYCA 4EIWA 1W29A 1Z68A 5EHZA 2PGJA 1QTIA 2ZIVB 3C8ZA 5TMDA 4BDTA 3R0VA 3G7NA 1V48A 3EXEA 1QG6A 1O58A 4JCCA 2GHQA 3DOUA 3KXPA 2ODEA 3NXKA 5J59A 3KE8A 4YRBA 4GPAA 4YI3A 5AW8A 4NRDA 4OMFG 1RYYA 2Q4OA 1Q44A 3AY3A 2OZKA 1M2NA 2WFAA 3PUYA 4H08A 4L7QA 2C00A 3LX8A 4O1IA 4RZ2A 4WJKB 4O2AB 4X7PA 2R4UA 5K0GA 5L7WA 1U63A 2PVPA 2CFOA 4ZVQA 1L5HB 2BEJA 1YKGA 1EVKA 5KYUB 2UUCB 4B6EA 4NZ9A 4RVFA 1UK6A 4A8HA 1ECPA 4I1RA 3ETNA 4UJ3A 3PEEA 4RLFA 4WERA 1I51A 1JIKA 5ALDA 2ID4A 2P9HA 2BTEA 3RSLA 1FYDA 1QP4A 3CLSC 2ZB3A 1U1GA 3JASB 4E4RA 2FW8A 1T9DA 1VE3A 4MEJA 3WTBA 2YBEA 3H8JA 2XMQA 3I1JA 4MWOA 3ETLA 1WLYA 3FFXA 3D8NA 5ULLA 3V1NA 5BNWA 1ICIA 2A5YB 2J5XA 2XYHA 3JWGA 4KAJA 2P9YA 4MAAA 5CK5A 6NULA 1FJXA 1EQ2A 2P78A 3C43A 4LVOA 4EMBA 2NTEA 3Q40A 3QK7A 3ZU4A 4PO3X 4BVFA 1LWNA 2VPPA 3CCBA 4IJWA 4CMCA 5IASA 1TMKA 3LPNA 3LQQA 2P0AA 2G77B 3FLAA 4P5EA 5M29A 1QKJA 1V4NA 2BZ0A 3IHKA 2HF8A 3JAWA 2TMDA 3C6XA 4NMHA 1DFIA 4OIFA 4BEWA 3L6OO 4BP3A 1NZFA 4JVLA 2Z4TA 5AJUA 3VSEA 4ARZA 2WSLA 2C83A 1IJEA 2F1OA 4QU9A 2VLBA 2VYQA 4C6RA 3ND9A 3R0JA 1SVSA 2LCQA 3UW3A 4JB0A 3V8EA 4EZEA 5HJ7A 4BQEA 3FDZA 4RPGA 2X6RA 3EMKA 3K0AB 1Q0QA 3MILA 1QS0A 4MVJF 1R6UA 2IYTA 4IIJF 4P53A 1XQ6A 3CN9A 2FQXA 4FIDA 3LCCA 4C04A 3DZKA 5B4UA 3BXEA 3B12A 2YC4C 5K03A 1UKYA 4B82A 2WUVA 1COWA 2XCLA 1ZNYA 2RKOA 1VC2A 2BHLA 2QQGA 3EQ7A 4WXYB 4Q18A 2NUPB 3G88A 3MT7A 4HYQA 1GJRA 4C87A 5E7JA 1E61A 2SICE 3FLMA 2IP4A 4XPIB 1H0RA 2J67A 2QJFA 1PG2A 4CLHA 2WK1A 3CX6A 4N0DA 4NBRA 4OHWA 2EARA 2ZKLA 2XGOA 1Z4IA 3IAHA 4LSWA 3SS9X 4D81A 2DSNA 2WU1A 2X6TA 1E98A 3HWWA 3NTVA 4M53A 4PGFA 3SIXA 3AV0B 4KPFC 5AM3A 1BD4A 2ZDGA 1GO2A 3TRJA 3N0WA 2MDTA 3IRVA 4UDNA 3KQSA 4ALKA 2ZWVA 2YCBA 3ADDA 1NUAA 3QE2A 4UBKA 4PC7A 3CA8A 2PL3A 4Q4JA 1U8CB 1Z08A 2OLJA 5GAJA 1GZ7A 2CKDA 4TGLA 4D56A 1NN1A 2EU8A 3MN1A 4Q93A 4FD3A 1IE3A 2V54A 2JJQA 1C7ZA 3PJEA 2FRVA 3GP3A 2DTDA 4EJMA 1BXZA 3RNLA 3L1VA 1Y1RA 2QY9A 5J4VA 1BD3A 2X42A 3FYDA 3KJQA 3C8HA 2O0KA 4N65A 4N54A 3SCZA 1J9ZA 3Q7RA 2O2ZA 3UM9A 4BX3A 1HR0B 3O3CA 3WGHA 5JSKA 3MWKA 4IRXA 3TXAA 1YUMA 2Z09A 3DZJA 4RY8A 4E5MA 3U4DA 3QVSA 5BW5A 4EKYA 3IAS1 4FGLA 4EW3A 5FTLA 2X9NA 1NIJA 2I78A 2VBFA 2A30A 4LF8B 4JYBA 4BB9A 1A7UA 3CGGA 4I81A 4CFYA 1QK3A 3ZKWB 4E5PA 3RLIA 4GWLA 3AFHA 2HCFA 3BBPA 3PS9A 3ZIAD 1JG6A 1IWPB 1XDZA 1XZNA 3F6RA 1UBNA 3FRIA 4B4WA 2GHTA 3G2QA 3HVUA 3LLMA 4JLPA 3RBZA 5IZCA 2VQ6A 4Z53A 4P4UA 5JD5A 1FQWA 3EIUA 4F56A 2HJWA 1C29B 4X00A 1JG4A 3Q9LA 1O2DA 4QO7A 3HCAA 5B30A 3AJAA 4I5DA 4OBEA 1KSFX 5KYKA 2HLDD 4AJIA 4F2HA 1AKRA 1VG9B 3KT6A 1JL3A 4N03A 4AIRA 5CITA 3GI1A 3ORFA 4KQ1A 3ZUGA 4IV0A 2JD0A 3B51X 2AWOA 1KNQA 2G6BA 2YINC 2XSZA