4NYJQ

Approach for targeting ras with small molecules that activate sos-mediated nucleotide exchange
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEASAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Approach for targeting Ras with small molecules that activate SOS-mediated nucleotide exchange.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nyjQ00
1A82A 3C8UA 5EE1A 3SFZA 3OFND 3IUYA 3K8YA 3LA6A 1RYHA 2CE7A 2JJ2A 1AS2A 1N0UA 1VG1A 2XJ9A 3ASYA 3BOSA 3IO3A 3OIYA 3R20A 3RANA 4FMDB 2ZRHA 1GILA 3EZ9A 4PC3A 1DAFA 2C9OA 2ZVQX 1AK2A 2R6CA 4XWKA 3LBHA 1II8B 2ZI3A 1CJMA 1Q1QA 4HEJA 4PO8A 2BKEA 2GILA 1HUQA 1G3RA 2XITA 2O8EB 5JEDA 1Z6YA 1Z2AA 4OJQA 4BFZA 4JLOA 4PR0A 3I73A 4IJMA 5TY0A 3ADDA 4JL8A 1JAIA 4A92A 1QVAA 4TYQA 1Q20A 1U8AA 2FSIA 4LYFA 1XXHE 1PZNA 5JZVA 1E3MA 1EFRD 1VHTA 421PA 5JEEA 1YZKA 1S3GA 1WDTA 2WJVA 3KUDA 1J2JA 4JBXA 4Q7KA 2IYQA 2AXNA 1XNJA 3GMTA 4OBEA 4W5WA 4ERNA 2QI9C 1II9A 4QGHA 2QSYA 1SQ5A 2VP9A 3L43A 2R62A 4Q4JB 2BMEA 4HZUA 4FWIB 1XCPA 2XZPA 4PC6A 4YLGA 4O25A 4N3NA 5BN3A 3CBQA 2ZM5A 5CIWA 3GP8A 3KQLA 2HXSA 1KMHA 4F7WA 3S1AB 1IY0A 3MSXA 2A5DA 2XTZA 2QORA 4TQ9A 3U7EB 2PJZA 2REOA 2NG1A 4BPBA 3ZS8A 4D82A 3PUXA 1S9HA 3X1XA 2HJVA 4DSUA 2ZR7A 4G5OA 2BC9A 4GBMA 2QMUA 3EXAA 4ZIRA 2ZQ5A 2ANBA 5B2ZA 4BE7B 2OUKA 1QRAA 1TMKA 1LF5A 1RJ9A 1Q3HA 4QFMA 3CUEF 5L8VA 4K46A 5JMTA 2TMKA 3DM9B 4RSGA 5DSZA 2JGNA 3A6PC 4IVQA 2Q3HA 4UNPA 2BCJQ 4PTLA 2R6GA 2REXB 2PH1A 4JZKA 2J41A 5E7IA 5G41A 5BXQC 1PUJA 3IQXA 3CPEA 3O8RA 5IRCD 2N1BA 2IX3A 4W5HA 1AQUA 2KSQA 3GJXC 3REGA 1XB2A 2C99A 2O8CB 3VR3A 5G40A 2CL6X 3EPLA 4UNSA 2ZRPA 5BQ5A 2GCNA 1OXSC 3QEJA 1UPTA 3RS2A 1CEEA 1VCNA 3AP1A 4C30A 2IYXA 2VF8A 2ZYUX 4JLVA 2AX4A 1XTQA 3BWDD 3PUVA 3GLHB 4B3DA 2OXRA 3AVQA 5KUTA 3QF7A 2GDJA 3GLIB 3W5IA 1TU4A 2IHYA 4J0QA 4X8HA 4XWOA 3SQWA 5AJXA 3I72A 2D3WA 3B1YA 5CDFA 4HATA 2QAGA 4LJ7A 3LO5A 1UAAA 1ZP6A 3HYTA 4P3YA 4NTZA 4TL8A 3OAAD 4A4DA 1BH2A 2BWJA 2DWPA 4M1OA 5LB2A 1I4DD 3QOFA 4DLWA 1Q0UA 4DLUA 4PAQA 1G41A 2QTHA 4TMTA 1YR6A 4QG7A 4LJ5A 4ZKDA 4Y0VA 5KO2A 2HCBA 4Q9HA 4BZXA 3FMPB 4B2PA 1GKUB 2QE7D 5EP4A 3UATA 4HAYA 3BIFA 2BEKA 2QTFA 2B7CA 1Z6GA 1IXZA 1KDPA 3C7KA 3GJ4A 4XSGA 2W83A 1YR8A 2MSCB 2VEDA 2WVJA 3VNUA 2D7DA 1H8ED 1MO3A 4EUNA 5E95A 2YOHA 3MRSA 4LOAA 2JLXA 2FWRA 2A30A 2OBLA 2XB4A 4JSTA 3EZ7A 3QI2A 4IFBA 4PC1A 3LQQA 4F4CA 1Z28A 3HPQA 4TMWA 1RC8A 5TV2A 1CBUA 4CVNA 3A1UA 1OFIA 2CMKA 3KXLA 4P4SB 3VKWA 5JFGA 1P6XA 1W0JA 5FBRB 4A0RA 2BMFA 4QBFA 2ZS9A 1XMVA 1K6MA 2P3SA 4OL0A 4TLDA 5EP2A 3NXSA 3CH4B 3TJZA 1E94E 4YMWA 2HLDD 4I99A 3CRMA 4X8MA 1JR3E 2CJWB 2ODBA 1LS6A 4YXWA 1SXJA 2ZANA 1SVIA 3I8SA 3EPHA 4QGAA 3IBYA 2B7BA 1DOAA 1GAJA 3B8HA 3M0EA 3SJAA 221PA 2J0UA 1XXHA 5J5CA 5HZKA 4A2PA 4WVFA 1E32A 2IS6A 3A1TA 1F2TA 1U0LA 1NN0A 3R9XA 1R2QA 3AM1A 1W46A 3CH5A 4TMZA 4GMDA 1OYYA 3QXSA 4GI7A 3R7WA 4BLQA 5FOWA 1GITA 1LB1B 2QA5A 3GEEA 3OESA 4HB3A 3FMIA 4JS0A 3TUJC 5K8IA 2VHQA 2ZR0A 4KI0A 4P31A 4PO1A 1OHHD 4LC0A 2QQ0A 1H65A 2FSFA 4YMUA 1KO4A 2MMCA 4CIDA 2FNAA 3AKDA 1G16A 3F8TA 4AC9A 3W5JA 3GFPA 4PZYA 3WHLA 4IXMA 4V0LA 2X2EA 2FZ4A 1J8YF 2VP5A 4OYHA 4F92B 1U98A 2W6JD 2PZEA 1FOEB 3W34A 1NKTA 4LJAA 4NYIQ 4U5XA 2HDNB 4DT1A 3T1TA 1M7BA 4O0MA 2ZRGA 2OO7A 2ODNA 3D7MA 2GAAA 3EC2A 1KO1A 1ZNXA 4OJKA 2ZS8A 3THXB 2FFQA 2FMXA 2ZE8A 4MYUA 4BRWA 5CLQA 1FMLA 4D4MA 2W0MA 2PT5A 3ETLA 2K5UA 2QMHA 4O2LA 1EFRA 2Q3MA 3I3SR 3O8CA 2YC2C 1F2UB 2YYZA 3SR0A 1N5KA 4OK5A 3KZ1E 4NCKA 3J81k 3MJHA 3PXGA 1W36C 4IDOA 3SYLA 3UKDA 3IIKA 1X6VA 1US8A 1DAGA 5EE3A 5EE9A 3GLGE 5EE5B 2RGGA 4PPQA 1GIAA 2GETA 4EPXA 5JBQA 4M9QA 1N6RA 1S8FA 4B48A 1Z63A 2ZE6A 3QVVA 1XZQA 3GFOA 3UMSA 1C1YA 4M9XA 2EFDB 4URUR 1OV4A 1R5NA 3SU8A 4EJSB 3PUZA 1E2KA 3FFAA 4HDCA 4XTRA 1DO2A 1NVVQ 1MO5A 2ZRBA 2JEOA 2XNDA 1G20E 2EFGA 4B3BA 1YE8A 2ANCA 1XEXA 1UDWA 4OHWA 3VFDA 1ZJ6A 5L3QB 2LCFA 3L2OB 4HAVA 3EARA 4HAXA 4K81B 4JKIA 4Q1FA 2D2EA 1TF5A 2VSOA 2ORVA 4QBHA 2LKCA 3DVLA 3ONWA 4IW3B 4WZ6A 5KNDA 4XSHA 2OAQ1 2OCYC 3SYNA 1XTSA 4QGFA 2DY1A 3QPVA 4OHYA 4BFWA 1KI8A 4QNMA 3B78A 4URWR 5FI1B 4DDTA 1NNEA 3R9WA 4LPKA 1MR3F 3OE7A 3X1WA 1Y63A 3WMEA 4DZZA 1P2SA 2JLRA 2RMKA 3SOPA 4B6EA 1W44A 1NJGA 4TMXA 5FOSA 1U0JA 4C4PA 1RVDA 1XTJA 5AWFC 2WICA 3QBVA 4FINA 3UK6A 1HQCA 4Q00A 2O8DA 1U9IA 2I3BA 2QZ4A 1L4UA 3TK1A 3LVQE 2GJ8A 3G82C 3WNDA 2IYSA 3BS4A 1Q3TA 3UG7A 1R5BA 3V9PA 2AL7A 1GL6A 1NSTA 3EA5A 2QAJA 1T8TA 1CS4C 1CJVC 1YQTA 1Z5ZA 1UDXA 2VL7A 3AVOA 3CIOA 4XVRA 1UM8A 4DWJA 3ZJYA 4NMMA 5KHOC 4TTQA 2ZRFA 3ND8A 1K5GA 1KYIA 3TSZA 1JR3A 2ZRCA 3U7FB 4Z54A 1KJYA 2WOJA 2GBLA 5SZIA 1KZGB 2GESA 4FWTA 2GNOA 2OFOA 3WYGA 1JQLB 5KPJA 4BEBA 3B82A 1EX6A 5FL3A 1EFHA 2QSZA 3AVUA 2OESA 1KAOA 4MKFA 1FX0A 1GRNA 1TX4B 2ZROA 5G3ZA 2ZYVX 3GD7A 1TNDA 1DAKA 1KMQA 4OQFA 2C9CA 2WJYA 3IKJA 1VDZA 3DZDA 1Z0JA 2EYQA 3QF4B 4XH9B 4V0ME 2WIAA 1HV8A 4ITRC 4JYBA 1G5PA 4PHHA 1KI6A 4C2TA 3TNFA 2J0VA 1W49A 4B74A 4D4JA 2DFLA 4Q9KA 4B2LA 4U7DA 4LHWA 1TEXA 3H4MA 3Q8XB 2WPDA 2MSEB 2XX3A 4EQ6A 5LPNA 5GJCA 4NH0A 1ESNA 3UPUA 5CM8B 4LHVA 2JJ2D 4LC1A 1SHZA 2WWYA 1J70A 2CDNA 4LHXA 5AUPB 2AWOA 1D8TA 1G4UR 2QTVB 3RS4A 1P4SA 3SJZA 4PZLA 4W9MC 5KNBA 2CVFA 3U3KA 1WXQA 4B3FX 2ZJBA 3W6PA 3VU9A 4CDGA 4Q4LA 5KYKA 1T6NA 3TUIC 2FFBA 2P5SA 3NC1C 3SFVA 4QM6A 1G8GA 2O0KA 1KJZA 4MRSA 1KY3A 3QNUA 2YNMA 3BD9A 3DO6A 4JL5A 3VHXA 3ZVNA 3GLGA 3A4LA 3JZMA 4HZUB 3B13B 4ZKEA 4YMTA 1T9HA 2KB0A 2WWIA 4JVSB 5ELXA 1TU3A 1E0SA 4D80A 2ATXA 1SKYB 5JWHA 4BGDA 2DFNA 1IXRC 1Z6AA 1R0ZA 3D6TB 3P26A 5F9FA 2W0SA 1FNNA 3DMDA 3R8FA 1EWRA 4C0AC 4BFYA 2ZPTX 2XAUA 1NIPA 1TUEA 1FP6A 3EW9A 4BEJA 5P21A 4ZIRB 4BLOA 3DOEA 1OPXA 5FTJA 2CBZA 2IYZA 3LLMA 3WMFA 1D9ZA 4JYCA 2AK2A 3EZ2A 1G7TA 1RJ9B 4PSVA 4PXAA 1VPLA 1QG4A 4GFDA 1N6HA 1G8HA 4GL2A 4M1MA 3TAUA 4OQMA 3BERA 1XJCA 2YVUA 5FTLA 3HWSA 5J47A 5C4MA 1CIPA 3K70D 4C0QC 3UXMA 1FQKA 2EFCB 2O0JA 4AYTA 1EG7A 3B2EA 5FOTA 3RYTC 3AVVA 2FEOA 3CX7A 2H8KA 4Q19A 2VP4A 3BH6A 3LY5A 1R0YA 3DKVA 4U02A 3LX8A 1KI9A 4AWXA 2XZLA 1F6BA 3CONA 4HB2A 3A1WA 2XTMA 4KXFB 2F1JA 2ZE7A 1E9RA 3K09C 2GEVA 5DHAA 4TMKA 2HV8A 4YDSA 2QM8A 3I1FA 2IXEA 2IYLD 1ZYUA 2IEZA 4MUAA 2OT3B 3EZ6A 4TL6A 3TUZC 2QPAA 2FJUA 4OK3A 5JI3E 3GJ3A 3AF1A 2H7VA 5EXXA 2B8WA 4AKIA 1OT3A 4YDHB 2W58A 2IS4A 1S1CA 1AM4D 2J87A 3VQTA 1P7CA 2DYKA 3CNNA 3PIRA 4JJZA 3QXHA 4JLNA 1L2TA 3CRRA 4M0LA 4MRPA 1EX7A 4QGGA 1OFUX 1OFTA 2QAGB 1VYVA 4W5JA 2B21A 1G19A 1NL3A 1E0JA 5BN4A 3LVRE 1IJFA 1TQDA 1AN0A 4JLKA 3GJ7A 3OEHA 4RZ3A 4TZ6A 2WJGA 4A8JA 2GXAA 3QUSA 1GRQA 3FGNA 3T1OA 1ZCAA 4YQFA 1XBTA 3QG1A 3LWNA 3U44A 3IO5A 4A0HA 2VPPA 3UIEA 2G83A 1NMXA 1NBME 1E9BA 2A9KA 2JA1A 2P6RA 2G3YA 4V03A 1T0HB 4PQYA 2A78A 2V55B 3CWZA 1UKEA 4M8NE 2E9SA 3B7GA 3SJCA 1G7CA 3GEHA 3Q5EA 3ICQB 3SQXA 3H2YA 3HJNA 3WBJA 2F55A 1BYIA 1Z3IX 1NN3A 3EAQA 3THYB 1XTRA 1YRAA 3MUFA 6Q21A 1R7RA 1IOZA 4GOXA 5FUVA 4L9WA 4V0MA 4DIDA 1RPZA 3WY9A 4Q7JB 1KSGA 2BMJA 4LV5B 4Y0AA 3REFA 1G3QA 1G6OA 1ZNYA 4LV6A 3SEAA 4ESVA 3UMRA 1OIVA 5CB6A 4R9UC 2ATVA 4URYR 1L8QA 4Q4AA 3L0IB 2IBMA 2IW3A 5BN5A 2HT1A 4A1FA 3TR5A 4NKRA 4WA7A 2C5LA 3BJIC 5JWRA 4POAA 4HUTA 3RLFA 2QP4A 2Z4RA 3LW8A 2GA8A 3CX8A 3O47A 5GJBA 2JJ8A 1JQJC 2ZIAA 2F7SA 2J0UB 1P60A 1XXHB 2R6FA 1W0JD 1F2TB 4DSOA 4URZR 3M4YA 2AN9A 3AUXA 3Q72A 2WTUA 1G3IA 1RE0A 2ZAOA 2Z4SA 5E4FA 1Z83A 2DFKB 3R7WB 2JLYA 1X86B 3IEUA 1AIPA 1Z0AA 5ANRB 1SULA 3A36A 1DG3A 3LBIA 1KSHA 2A5FA 4D0NA 5JJIA 2FGJA 5KSPA 2BV3A 1OKKA 1SXJD 1OE0A 2VA8A 2ZAMA 3V00A 4YXWD 3BH7A 2BJWA 4PHTA 4B35A 2ZETA 1SVOA 1GNPA 1GWNA 4B2IA 5M04A 3KTAB 1L4YA 4MYHA 2VLIA 5FPHA 2IYUA 3KKQA 2EW1A 4ZI3A 1A1VA 1G5RA 3W6OA 1P72A 4ON9A 3T1QA 4EAQA 4CZ2A 1OSNA 3KJGA 5F98A 4DT1B 2W6IA 3PVSA 4IKEA 4YMVA 3C14C 2RGNC 4B76A 2P6UA 1GFIA 1ANKA 1NLZA 2UKDA 3K0CC 4JBYA 5EUMA 1AA9A 1U8YA 3K9HA 4QC2A 3UWKA 1N0VC 4NU0A 1Z2CA 2GJSA 2QPOA 2QP3A 5EJEA 2BCGY 2C78A 4AIIA 5JS7A 2Q3FA 5KU1A 3RRZA 4BWYA 4FW9A 4DSTA 1S2MA 1T5LA 2ERXA 1US8B 2OZEA 3KJIA 4LBYA 4PAOA 4DEXA 1T3HA 4RFSB 3AVXA 3FB4A 2PCJA 4M1YA 2ZEJA 5AJWA 1SXJE 2JATA 2VO1A 1KI4A 2VHTA 1SZPA 2RGXA 4UXIA 4XD7D 4D6PA 1KNXA 2YHSA 1JALA 1MT0A 5IDVA 3AGPA 3RSLA 4MKHA 1HH4A 1E96A 4JLAA 1XDBA 4EIWA 3WP0A 1JPJA 4Q7LA 2WV9A 3WRXC 2OG2A 2V7QA 4MDEA 3NHBA 4LHYA 1XWIA 4KAXA 3AVWA 2ZREA 4JVMA 4XWAA 4BASA 4OI4A 4G5QA 2REBA 2ZUDA 5IHPA 3BB4A 5LBIA 2OFWA 1W4CA 3SI7A 2DCUA 4HLDA 2O5VA 3VR1A 1FUKA 1ZBDA 4ZPXA 3THWA 1DADA 4L8GA 3SE0A 4NCIA 4Q7MB 5JHGB 1HT1E 2QENA 2ZSFA 2KBFA 5FPTA 1S0UA 1N0WA 5EXTA 3B1ZA 4LJ6A 4MRNA 3FOZA 2NOAA 2V6IA 3KJEA 3LBNA 1NBMA 1DELA 1KOFA 3ZZ0A 3TW8B 2XNDD 5KDOA 4CEHA 4JLBA 4KVAA 2BHRA 3RS5A 5JSZA 4HLQB 1EGAA 5FUYA 1CULC 1TF7A 1YJ5A 1ZM2A 5DI9A 5A0FA 2GKSA 3KXIA 5F3WB 2O8DB 4HLUC 2C98A 1GSIA 4JT2A 4B32A 4QKQA 3PFIA 4HB0A 1N6IA 1AS0A 3AGQA 2ZYTX 1Z06A 1ZUNB 3BFXA 2ZVPX 1OXVA 3BFKA 2WJHA 5KSOA 4Q4HA 1U2RA 4EFNA 4DLZA 2NO1A 2NPFA 5TMPA 3OE7D 4F4IA 1JXMA 3T34A 1Q1EA 1QHHA 1QHXA 2G0TA 4GT1A 1KO7A 5K8UA 5B64A 4DLVA 2VIIA 2NO9A 4AKEA 4I1VA 1G64A 1U0HC 2F9LA 2VH5R 4UJ3A 2XXAA 1UKZA 5BYJA 2DR3A 5G3YA 1C9KA 1OXXK 4DLXA 3FMFA 1UBGA 1G5TA 2J59A 3ND9A 2RGDA 1FZQA 3ZD7A 1ZMXA 1V5WA 3BFVA 4MQBA 1T8UA 4TYPA 3KKOA 3VR5A 4DLYA 3U2QA 3AF2A 4ZCIA 2ZI4A 1KI3A 5J4HA 1XD9A 4DCVA 1JR3D 4D2IA 2IYRA 3KFXA 2OILA 2ERYA 3EA0A 5EXSA 4HLCA 3U3OA 5CK5A 3ZDQA 1NJFA 3LXRA 3VHLB 1R6BX 2RB4A 2JLSA 1FW6A 1J99A 4P32A 2WBLC 3PQCA 5FTKA 3BK7A 1PUIA 4Q1CA 4FMDF 1T5IA 4C7OB 4A6PA 1LY1A 2W2TA 2VYFA 4G01B 3FHTA 4C0HA 5FR2A 4F91B 3PUWA 4IEEA 3UG6A 1NIJA 4CRWB 4EKDA 1E99A 2LKDA 1G21E 2X2FA 4Q5IA 4V02A 4Z8XA 1XPRA 4KV9A 2EFEB 3QKRA 3C41J 2RHDA 3AH8A 5CM9C 1KDRA 3HP1A 5H1YA 4A9AA 1UBCA 3K0AA 2IS1A 4Q47A 1K5DA 3UWOA 1JAHA 4LJYA 1FPMA 1XJQA 4CEIB 2IS2A 3R8CA 4IDQA 2JASA 3VU9B 2CNWD 4UXHA 1XRJA 3GQBA 2WPDD 1XF9A 4MUBA 3AB3A 3NDPA 4AKHA 4B73A 3ZZUA 1U9IC 3FPAA 3SS8A 4M9ZA 4RCZA 3BRWD 1CR1A 2ZU0C 3GLGB 5FBVB 4CEJA 1FNMA 2BM0A 1CU1A 3O8BA 4OHXA 4AKGA 1ZUHA 2YWFA 2WWGA 4OKSA 1DS6A 4Q03A 4F93B 4JMPA 2FPKA 4A2WA 1Q44A 3CB4A 4MKIA 1HT2E 1RFLA 1UADA 4L4UA 1XEWY 4OHVA 2BDTA 3DOFA 4PSAA 1ZIOA 2FEMA 3Q85A 1UBEA 2PMDA 3TSWA 1GUAA 1D2EA 4OQXA 3N70A 2Z5FA 1ODFA 4JLDA 4LYJA 5FOVA 1YR9A 2B92A 2GXUA 1NY6A 4TLAA 3RS0A 4PHFA 3BB1A 2QG6A 1YR7A 4TYWA 1WCV1 621PA 1R10A 1AGPA 2ZITA 3I32A 4TTPA 5AUNB 2PMKA 1D2NA 3A37A 1D6JA 1GKIA 4QJ3A 2EWVA 2JLUA 1OW3B 3VTKA 3QJYA 3D31A 3GLHE 3HDTA 4LYAA 1GZSA 4TL7A 4M53A 1AKYA 4TSFA 2X1VA 3PV0A 4IRUB 2D06A 2CK3D 4ARZA 2GZAA 2X77A 1MABB 4ZDIA 4Z51A 4TWZA 1FUUA 4Q1DA 1E2GA 4KFTA 2UZIR 2WKQA 3I8XA 4R2IA 1IY1A 3CRQA 5DGXA 5FBLB 3KXKA 1M7GA 1KK2A 1YZNA 4DB4A 4XD7A 3CM0A 1PLJA 2L0XA 3ASZA 3FMOB 2D7CA 3RRMA 1R5OA 2YWGA 2JJ1D 1P2TA 1W48A 5CB8A 4TYNA 3DPUA 3VR2A 3U5ZB 3GJ6A 4WBSA 3Q9LA 5G53C 3AUYA 2CHGA 5F9HA 3PUYA 1E0KA 2ASEA 2J5XA 3GPLA 1ETUA 5FUXA 1X1RA 5DHFA 8OHMA 3I61A 4TT3A 2CHVA 4KFRA 4OI0A 2VP6A 4LJ8A 1J8MF 4PSKA 1VECA 1HYQA 4W7SA 3IEVA 4YC7A 4FCWA 2FOLA 4RD2A 1SGWA 1O3YA 1CF4A 1VYUA 2FSHA 3E1SA 4IOJA 5HZHA 4ZCLA 2ODWA 3U44B 4MGKR 2HF8A 4C0LA 4DSNA 5JJLA 4D81A 3CZPA 4GRAA 1P2VA 1TF2A 2RAPA 2ZTSA 3AF0A 3LNCA 1GP2A 3FWYA 4LDJA 1P73A 2G0NA 4LCBA 1JJVA 1E2EA 4PFSA 4KJZA 3QE0A 4S2EA 4TN1A 2O8EA 1Q21A 2ZJOA 4GMXA 1NI3A 4D26A 1R0WA 1UKVY 2AHOA 3QY0A 3OEHD 5CK4A 3T12A 5CITA 3CRW1 4RFVA 1AQYA 4UQOA 3ZQJA 1XTIA 4A2QA 3MAAC 1JEEA 3KKPA 3IHWA 1OH8A 5JJKA 1X8LA 3RRYA 3KFVA 3W90A 3PEUA 4IFEA 3MWYW 1QDEA 1D5CA 2QP9X 4M21A 4Q4AB 2C96A 2V8OA 5UKDA 1E9DA 2GWHA 2PLRA 3VAAA 2XEXA 1P61B 4Q4JA 5LB4A 4LBVA 2FG5A 1Z0IA 1E9FA 5E7MA 1M6NA 3CKLA 4OHZA 2RKOA 2ZSAA 2MMGA 4GZLA 3QG5A 3G0HA 2X8AA 1P9NA 1ZM9A 3VR4A 1QHIA 3HPRA 4NL4H 4B3GA 5K8LA 4B33A 2AWNA 1WBDA 1G17A 3RVBA 1NG9A 2F6RA 1OB2A 4NCHA 5FPSA 1EXMA 1CKEA 3NBFA 3Q7QA 2ZRMA 1XP8A 4JVNA 1IXSB 3QSYA 2QUZA 2IYYA 2QEQA 3FKSA 1DAEA 1YKSA 4II7A 4H1VA 4HI0E 2Q9CA 1X3SA 1W2HA 3Q7PA 3R9IA 2BJVA 1IHUA 2H18A 2N46A 2FPMA 1IY2A 5K8TA 4X8LA 1S1MA 2ZUBA 4OK6A 4QM7A 3CR7A 3PJRA 4M1TA 3DL0A 1E69A 2PZFA 3MWJA 1VIAA 5JECA 5GJWC 5B30A 3PEWA 1X1SA 4C0JA 1GDDA 2XZOA 2FA9A 2BBTA 4XTCS 5EE0A 2VHCA 4BLTA 4LV8B 1OKKD 2VHJA 2Z83A 1M34E 3HR8A 3AP2A 3K0FA 3QKSA 5JI2E 2O8BA 1K8RA 1NF3A 3QXJA 5DN6A 1D9XA 3EASA 1ESMA 1AKEA 4EJSC 2JIZA 3WNCA 1DAHA 1W4AA 1NN5A 3BBPA 4ZDWA 3IDQA 4DBLC 5C46F 3EPJA 2DB3A 1HE8B 3GLHA 1NRJB 3LX5A 2H1LA 3ZZTA 1OH6A 2D74A 1E1RD 2G6BA 4KBFA 2OBMA 3TSOA 2CCGA 2CNWA 5AR1A 3TGPA 5H68A 1A7JA 3X2SA 4B47A 5FR1A 1A2BA 3U60B 1E6CA 5SZKB 4ZCMA 2IYVA 2W6ID 3AV0B 3GCGA 1NLFA 3VKGA 4NBSA 3DKPA 1DG1G 3ZYCA 4EFMA 2ZXUA 1WQ1R 3LRPA 4OQLA 5J4KA 2QMOA 1BS1A 4R2HA 4AI6A 1MRNA 2IXGA 1PLLA 2OSBA 4MYTA 1T3SA 2IUUA 2IA5A 4AYWA 2VSFA 1SVWA 5FTMA 2O52A 3BB3A 2WOOA 2V3CC 4A15A 2EU8A 4MRVA 1GVNB 3V4FA 2IYWA 1BYUA 4EPWA 1Z07A 2JDID 3RC8A 4LJ4A 3P1JA 2ZUCA 3EIQA 1LFDB 5J40A 4G1UC 5KOYA 1XFAA 1JEDA 1S4QA 3T5DA 2V6JA 2Z43A 3VMFA 4CT5A 2A5GA 4FMCB 3X1DA 3E70C 1DAIA 3QKUA 3TAHA 2NIPA 3THWB 2ZRDA 3K1JA 4KFSA 1KMHB 2GZHA 5J4LA 1G7RA 3PG5A 721PA 5KNCA 4P4SA 3CW2A 3K70B 2BIFA 1WF3A 4GDFA 2YV5A 2JLZA 4ACAA 2QRZA 1GL9B 2V7QD 2J7PA 3W8NA 2DHRA 2FF7A 4C2UA 3CX6A 4B71A 2CK3A 4DLTA 5GVSA 1KGDA 1PJRA 2CLCX 1SVLA 1SVSA 5J4VA 4DUGD 2J46A 4C9BA 4NYJR 2B6HA 4IDPA 2CXXA 3BORA 1E4VA 3TKLA 3WYAA 4B34A 4UNRA 3NDBB 4KODA 3X1ZA 4GPTA 3EG5A 2DFTA 4D4LA 3TR0A 2KE5A 5EZ5A 4G3XA 4RKFA 4EDHA 1BKDR 3L0OA 3LQRA 4GSYA 2GVDC 2JJ1A 1FMJA 3C4JA 1HE1C 4DEYA 3F5FA 1L7VC 1KZ7B 3THOA 4HUQA 2NMVA 4Q4HB 4JSYA 2GJAA 4MKGA 1IJEA 1N3BA 1NBMD 2CEAA 4N1AA 3H1TA 4V0NA 1MKYA 4TTRA 2C8VA 1ZVQA 3ZVMA 5TB5A 1U99A 1TPZA 2LWIA 1YZTA 4A0FA 3H84A 4AY2A 1ZINA 5AJYA 2XXAB 4NZYA 4WZBE 4LYHA 2C04A 4I4LA 1S3SA 3T15A 1DBSA 1FTSA 3ZS9A 3DDCA 1KO5A 1AZSC 4JLPA 5FPKA 4KO8A 5D3QA 3A4NA 2RGCA 2YKGA 4GOKA 3AF3A 2GCPA 3BH0A 4KFUA 4US1R 4Z8YA 2PL3A 1P9WA 5DH9A 1JR6A 1S96A 1GL7A 2BVNA 2HYDA 4NP6A 4URVR 1E2NA 4D25A 1ZM7A 3BGWA 5GVRA 4IOKA 5JHHB 1QHYA 5AJZA 1GRRA 2BEJA 2ZJYA 2ZJZA 3IHLA 4KBGA 3RABA 4DLRA 1FFHA 4TYYA 4EPRA 4PQRA 3SN6A 1D2MA 1F3OA 1EK0A 3SYKA 5IF9A 2O8FA 1EESA 3IPYA 3TVTA 1HTWA 2PJRA 3DEFA 1QHNA 2FE4A 4ILEA 1YZGA 3K70C 1W7AA 1Z22A 4LJ9A 1TQ6A 4FIDA 4C3ZA 1NVWQ 1LS1A 1UEIA 4QHYA 1DVRA 2H16A 3EZFA 4Z1MA 2IWRA 3QKRB 1G3UA 2YJTD 4JLMA 1QVRA 1YZQA 3MMPA 5CYPA 5A4JA 1NG1A 1N2CE 1XTKA 1IONA 4UJ5A 1WMSA 3KX2A 1LF0A 2J1LA 3HU2A 4RCYA 1OLOA 4B43A 2KI5A 1G291 3PCRB 1ZC3A 3B9PA 1Z47A 4LGMA 1KSJA 3ZH9B 1E9SA 2RCNA 2FX3A 3MG9A 3I5YA 3KUCA 4RD0A 2IWHA 1CRQA 3IIJA 2P6NA 2SHKA 1VIYA 4CEJB 3B1VA 1Q22A 2W00A 2ZI9A 4I1UA 4IVPA 1E2DA 5L3QA 1SXJB 3HYRA 4RD4A 1R8QA 4BLRA 4DDUA 4ZI2A 2R44A 2XSZA 4DXAA 4F4JA 1ZIPA 3LAWA 1Q12A 4D4KA 4TZ0A 1BOFA 3ICEA 2GK6A 5KSZA 1TAGA 4JJKA 2NO0A 2R2AA 2JAQA 2VRWA 2GZDA 1N6PA 2WWXA 2GK7A 2C03A 1Z08A 2R65A 4BZQA 1E1QD 2ZRIA 3P27A 4EPTA 4ZV4A 4IDHA 4PX9A 1ZUIA 2WSMA 1DPFA 2IK8A 2E1RA 3DHWC 1OIWA 4G5SA 4BQSA 5DIFA 4KHZA 1VMAA 2QROA 2PEZA 3BC1A 2WAYA 2BBOA 4JT4A 2ZI6A 5FH9A 1XCGB 1C4OA 1M2OB 2FU5C 2IYTA 4QJ5A 3FE2A 4JIMA 5TDHA 4CYMA 2QAGC 4P33A 4L5BA 1BMFA 3GJ5A 2HT6A 2RGBA 1PLKA 1IN8A 1W0KA 4JBWA 3ADCA 1E1RA 4N0DA 3U3JA 1YHNA 2NGRA 4G0NA 4ARZB 4BLPA 4BFUA 4RD6A 4XVQA 2IC5A 3VX3A 5FTNA 4QHTA 4WAUA 1G3MA 2QGZA 1OYWA 2IF2A 1XMIA 4G5RA 4NYMR 1I4TD 1I2MA 2Q9AA 3PEVA 4ZDKA 2XNSA 2JLQA 2KBEA 5CJPA 5J4YA 1XMJA 3TMKA 5HPYB 4LHZA 4PC2A 1U8ZA 3OIUA 4QOSA 2ZRLA 1DE0A 2WWHA 2BBSA 3U4QA 3A1SA 1H8HA 3HR7A 4HZIA 3TLXA 2QBYA 4PHGA 5DNYB 121PA 2ZRAA 5SZHB 4TSFD 2BMDA 3MGCA 1T3LA 1KI1A 1XEWX 1UFQA 4L15A 2F1HA 2OCPA 2JDIA 3EIEA 3N2EA 2IT1A 1E2QA 5LDDC 5DISB 2IUTA 3UMFA 3CO5A 4HSEA 3K9NA 1VG9B 1XJ0A 2ZYWX 3QF4A 5TARA 2ZRKA 2NO6A 3AKCA 4WXPA 4TL9A 4KVGA 3C15C 1BO6A 4Q48A 1E2PA 4CW7A 2WSSA 3LDAA 3ECCA 3K09A 3ZIAA 4M4SA 3U7GA 3NH9A 1QBKC 1KJWA 2WJIA 1SXJC 2QMEA 3IIMA 4QBIA 2W2VA 4X8OA 4H1UA 3T5GA 1CXZA 1W4BA 2PZGA 4TT3D 2YZ2A 1DARA 3A8TA 3QVUA 4DRZA 4DUGA 1KI7A 4LZZA 4OI1A 1QF9A 1R4AA 1XEXB 2C95A 3GJ8A 3N5CA 4L9SA 4V0OA 1XD8A 2AKYA 5AUQA 3EWAA 1KKLA 4M1WA 3FVQA 3W6NA 3MWLA 4B44A 5BYKA 3C5HA 2VP2A 3GLFE 1YU9A 5KPDA 2PX0A 3OHMA 2NPIA 5C2JB 3I5XA 4KLZA 1T0JB 2F9MA 3RS7A 2GVZC 1RKBA 4DDVA 2GF0A 3F0TA 2ZI7A 1Z6TA 2BM1A 1N6NA 5HKKD 3SJBA 1FTNA 1XCMA 3G5UA 5D3MA 1TQ4A 1TUIA 4ACBA 4PANA 1ZD8A 3K9LA 1VG0B 1W5SA 1M7HA 5GADl 1XPOA 2IHBA 3MCAA 1WA5A 3U7HB 1FP7A 3T06B 3AVPA 5EP1A 4MRRA 5TVKA 1KY2A 3JVVA 2D62A 2RGEA 5IK2A 5FFMA 1NKSA 3RHFA 2H57A 3LFUA 1QZXA 2Z6VA 5FBQB 4E07A 2WWFA 3LH5A 4E22A 1NN1A 2EYUA 5FL7D 2CE2X 4MITA 1CR4A 4LUCA 4Q18A 3LD9A 1E4YA 1UBFA 3L0PA 4EPYA 1N5LA 4R71A 1Z0KA 5B58C 1COWA 1NVXQ 1CR0A 2ZJAA 2GXQA 5EUQB 1N5JA 3CF6R 3FDIA 3OEEA 3B9QA 4WW0A 3KDSE 2E87A 2EWWA 4HAZA 5AJVB 1PVOA 4QJ4A 1G8PA 4I1SA 1II0A 2F1IA 2WKRA 5B57C 1NMZA 3NHAA 1GNQA 2C9YA 1TEVA 2GTPA 1RRGA 3SBDA 1GKYA 1FX0B 2DWOA 2FN4A 2HEIA 4IEIA 5L3SA 1ZU5A 4Q1EA 2J7KA 1Y3AA 1CLUA 2JLWA 3K0FB 1F48A 2G1JA 3QKSB 3QXCA 3UANA 2O8BB 3FKSD 2YWHA 3W9YA 4KITB 1GM5A 1TADA 3L0SA 3OF5A 1KI6B 2ZR9A 3A58B 2P2LA 4PPGA 2R8RA 4QBGB 3QENA 4EPVA 2V54A 2BOVA 1WP9A 3DM5A 2OLKA 1Z0FA 4MYCA 1KK1A 4EQ6B 4RZXA 5C4GB 4M1SA 2OE2A 3RS3A 1J90A 5DI3A 4M9SA 4UNNA 5FI0B 5JCPA 3SZRA 2OAP1 4US2R 3RAPR 4PC7A 1E0AA 3MD0A 5DN6D 4O2RA 2NZJA 1QHSA 1GOTA 1G1MA 4MDFA 2JIZD 4O3MA 4FN5A 3AKEA 1JJ7A 1RRFA 2P65A 4PZZA 3OIWA 1EFUA 3CLVA 4RJLA 5E7JA 2I1QA 2RGNA 2Y8EA 2PLFA 3NG1A 1N6OA 1Q57A 3K0CA 4B6FA 2RGAA 2A5YB 1ZC4A 3X1YA 3PEYA 3K9GA 3SHWA 2AFHE 3D8BA 2WZQA 2ZRJA 1P62B 3A1VA 821PA 1E1QA 1NP6A 2IXFA 5DLQC 4EFLA 2AD1A 3THYA 1T91A 1W36B 2NZ8A 1MRSA 3KJHA 2HJGA 3SDZA 3B6EA 1E79D 1LW7A 2QGNA 1A2KC 4LX0A 2J9RA 2RHMA 4BRUA 2DPXA 2YINC 3KKNA 5KDLA 3KKMA 2F43A 4P0TA 1LNZA 3DMNA 3RWMB 1KDTA 2WJJA 2ORWA 4BUJA 1WB9A 4U00A 2GBLC 4NHOA 3FYHA 2B8TA 3K0EA 3PR1A 1CRPA 2ZRNA 3MFYA 3CF2A 4HDQB 4IDNA 4US0R 5HE9A 4DHEA 3IBGA 4H9GA 4LRWA 4MGZR 2CHQA 3A4MA 1W36D 1WRBA 5HCIA 3WNBA 3U3RA 3EPKA 1OFHA 1OH7A 1A5TA 1SVMA 4CT4B 4BFXA 2ZJ2A 2HXYA 3TH5A 1RRPA 3W3AA 4Q9JA 2MSDB 3KL4A 3T61A 1W1WA 1W2GA 2AR7A 3GLFA 4DC9A 3HU3A 1CTQA 2GCOA 3ZVRA 3GLIE 1IN4A 2HCJB 2VP0A 2FSGA 4HUQB 4Q66C 4DKXA 1UKYA 2J7PD 2V4ZA 2YOGA 3Q3JB 4RVCA 3QIAA 3I62A 1KAGA 4JLJA 4NONA 4G5GA 3U6BA 1U94A 3ADBA 4RD3A 4Q21A 5JRZA 1A4RA 1VKJA 1F60A 3W3ZB 2GHIA 2RH5A 1E2MA 3NBXX 3TIFA 3WMGA 4RZUA 3OFNA 1XD2A 4QRHA 3PENA 3CWQA 3VNVA 2GJKA 5DE3A 5BW8A 4XIGS 1IQPA 3QQ5A 3M6AA 3OIVA 1RYFA 2QM7A 1BIFA 2H17A 3NBYC 2CVHA 3KTAA 5F2EA 5A5GA 1PV4A 5SZJA 4ASUD 4DIEA 4XVUA 5JS8A 2EVWX 2P5TB 2Z0MA 3I92A 4NPHA 4TMVA 2C77A 4GOJA 3ZQ6A 1ONBA 4HLUA 2YC4C 1N6KA 4AG6A 3HU1A 2OCAA 3IGFA 2EFHB 3D3QA 4P4UA 2P0EA 4HB4A 4DCSA 2UZ3A 1MV5A 2ZJ8A 4LWZA 3SNHA 3L8ZA 1G7SA 4RY2A 5JCZA 1FQJA 1MO4A 4FCVA 4A8JB 1U90A 1ZM3A 4DLSA 4NYJQ 1P75A 1RIFA 1XZPA 1Z6XA 1AS3A 3LV8A 3RDPA 4BZPA 2O8FB 2OV2A 1II8A 2AKAB 3B60A 5HE8A 521PA 3LLUA 2CL0X 1QHGA 3L82B 1E2FA 4RFSA 2OHFA 5DYIA 5C18A 3NC0C 3O8DA 5HKKA 5IT5A 5KSYA 1VCIA 3V4RA 1N6LA 4PQFA 4DCUA 1N5IA 3JVUA 3M1IA 1CJTC 4TLEA 4M1KA 2CLDX 1VCOA 5CLLA 1YZLA 4TQUS 5HCNA 2CCJA 4C0KA 4AK9A 1W47A 5LD2B 1R0XA 2PCLA 1F5NA 3IILA 3P32A 2V1UA 1KI2A 3TQFA 4NE2A 2WIBA 4FCTA 5JRJA 2H92A 4Q1AA 3EX7C 4FD2A 3EIHA 5FOUA 3H0KA 2ZSDA 3LXXA 1UF9A 1VHLA 3FFBA 1HA3A 3SC3A 1NMYA 1I2DA 3FHCB 1KIMA 4KSCA 5FL7A 1Z29A 1E98A 1IN5A 1HY3A 2ECKA 3MWKA 4Z1MD 1G18A 1YRBA 3PITA 3ZLJA 1JXOA 3WYFA 1JB1A 1KDOA 1SKQA 2YWEA 5DYGA 3SBEA 4BLSA 3S1AA 2WMOB 4LPSA 4QNRA 3TBKA 3RC3A 4R98A 2AD5A 2GRJA 3T1VA 4E09A 2OBNA 2QT0A 5H8WA 4TLCA 1KK0A 1VCMA 4L16A 4B3CA 3P20A 4DCNA 4Q01A 3LW7A 4LBZA 3L8YA 4KLNA 2CL7X 1IN6A 3U3MA 1P5ZB 2QL6A 1EFCA 2XSZD 5EQTA 4B3XA 2A3RA 2GJ9A 4GP6A 2F3TA 1JBKA 1AGRA 3QEOA 3FKQA 4WOPA 5EXPA 5FOXA 4DCTA 2VF7A 2A7QA 3NKVA 3NIBA 3QPUA 4JL6A 4WIAA 2ZJ5A 3E5HA 4A8JC 1LVGA 4FMBB 3C5CA 2A2ZA 4WZAE 4BFSA 1G9XA 4UNQA 2NO7A 3TRFA 3ZD6A 2R6DA 2FZLA 4IHQA 2W2XA 2O8CA 4TQAA 3OAAA 1J7KA 3EC1A 1JPNA 3TQCA 4DB2A 2OCBA 3NBZC 4CF7A 4MGYR 4DJTA 2CLSA 3KB1A 3U4QB 2IEYA 2V9PA 3CRVA 2VBCA 3CPHA 4RD1A 5BWMA 2QBYB 1BMFD 2DWQA 4Q9LA 1W0KD 2QE7A 2QY9A 2IL1A 4B75A 2WMNB 3FTQA 3GLIA 4K8OA 3MJRA 2FFHA 3RRNA 4LY6A 4XJXA 1H8EA 3B1XA 3JZAA 1AJEA 3KQNA 4BFVA 2PT7A 5LD2C 1KO8A 2JCSA 2KJQA 2PX3A 2ZI5A 3U61B 2ONKA 2VTKA 2YOFA 4Q9IA 1LTQA 2OFXA 3WXMA 4DDWA 1G8FA 2WAXA 3B85A 3GFTA 1IN7A 1H8HD 4S35A 3ZVLA 4RZ2A 3WBKA 4A82A 1E79A 2XOKD 4NDZA 1M74A 1B0UA 4PO9A 3NWJA 2OLJA 3RSOA 2J45A 4GNKA 4WXRA 4D0GA 5AUOB 4C7OA 1U81A 4ZDJA 3B5JA 3CPJB 3I4LA 1N25A 5HTKA 1O87A 4PAMA 3DZ8A 1XEFA 2QN6A 1ZM4A 2HLDA 1OF1A 1CJKC 1P2UA 3U6KA 3WHKA 5KTYA 3F3YA 2JLVA 2WM9B 5L3VA 3P4XA 1E2LA 1JI0A 1UEJA 2ZSBA 3ZGXA 3AVTA 5C1BA 4NYIR 1ZW6A 1ELOA 2WSSD 1TQ2A 4Q02A 4C0SA 4NYMQ 5DO9A 2G88A 3CNLA 3K53A 5FBWB 4F38A 4CEIA 3ZIAD 4YMSA 2AFIE 2EQBA 2XGJA 2XB2A 1NVUQ 4BECA 1CP2A 2FDCA 1KKMA 2FV8A 3QBTA 1ZD9A 4CEHB 4UXJA 5D3MB 1FL9A 2OEPA 1KNQA 1OHHA 1XX6A 2GEUA 2CJWA 2ORIA 2QNRA 2QRNA 2G77B 3H86A 4KYUA 5EZ6B 5JSZB 1X8KA 4KYIB 1W5TA 5JWOA 1RRCA 2J3EA 2P67A 1MO6A 4FI3C 4M2LA 4XOIA 3MLEA 3CNOA 2GXSA 5CIQA 3VKHA 2ODEA 1EFTA 4ASUA 5CYOA 1IM2A 4RKEA 2VHUA 2FH5B 3EWSA 2VQSA 1R8SA 4V0KA 4IVRA 3E2IA 4LI0A 1XMSA 4TLBA 2C2HA 4I1OA 2W6JA 3CR8A 2IUSA 4IOLA 2WKPA 1XPUA 1QHHB 3K0SA 2F3RA 1OIXA 2BKUA 1JECA 1LV7A 5FUWA 3BAFA 5CJ2A 3QPWA 4UKDA 4MA4A 1TTTA 2BBWA 1P9RA 1ZNZA 3AF4A 1P3JA 1VG8A 2PEYA 4I81A 2QU8A 3B1WA 4PPNA 1Q1BA 4KU4A 4ESHA 1NVVR 2J0SA 4KCGA 5IK2D 2CCKA 3AP3A 1TL7C 4OI2A 1UJ2A 3GEIA 1ZRHA 2WWWA 3QXXA 4QL3A 3WRYC 3KQHA 1I4LD 1KSFX 2QPTA 1MABA 1HURA 5L3SB 3VX4A 5AK0A 2ZS7A 2UVQA 1Z8FA 2QT1A 3IPXA 1COWD 1E9EA 1DEKA 2A5JA 2I1VB 3OEED 4NCJA 2N42A 3THXA 1ZAKA 3CF0A 3BXZA 2FGKA 1IAQA 4BFTA 4DVGA 3W8RA 3AKYA 4AG5A 4LSGA 1F2UA 1OXTA 2F1RA 3AQ4A 4ZO4A 5JLJA 4HDOB 1HEIA 1E2HA 2HF9A 1MOZA 1XU4A 4E03A 2ZU6A 1NLYA 3TW4A 1HQYE 5DI3B 3NEYA 4C0BA 3N2IA 3RNLA 3TVDA 3OZXA 1G6HA 1ZD1A 3NH6A 4JKYA 1OJLA 1NY5A 2FFAA 2NTYC 4AURA 4GZMA 3KB2A 2X19A 1SKYE 3P4YA 4GP7A 1DO0A 1IBRA 1KTVA 2IF0A 3K0AB 4MGIR 4MH0R 2R6AA 3NTUA 4KSBA 1VYTA 3SHFA 2GF9A 1JNYA 1QG2A 3NEJA 1MH1A 1WBBA 4N0EA 2OM2A 4HAUA 1E2JA 4JVLA 2I4IA 4EJSA 2QQEA 4URXR 3AVYA 1RW4A 4LBWA 4R7ZA 4P4TA 5E3HA 4E5UA 2Q0HA 2FPLA 4Q1BA 1RZ3A 1OXUA 4AYXA 4OQNA 4FXPA 5EP3A 2Q9BA 1B23P 4AD8A 5KDDA 4HYYA 4HAWA 2HYIC 1DAMA 1E9AA 4FMCF 3FHOA 2XTNA 2G9NA 1ZCBA 2D2FA 2DBYA 2VSXA 2ZE5A 3GJ0A 3RWOA 2F43B 1SHKA 2GAOA 1KHTA 5FPYA 4QXAA 1DTSA 1G8YA 3QKTA 3KQKA 2ONJA 3IQWA 5L3RA 5TXGA 4NCNA 2J0QA 2R9VA 2O0HA 1S9DA 2G1KA 2HUPA 2GEDA 1V43A 2XJ4A 2H5EA 3AEZA 3ADKA 1VTKA 5HR5A 1NSFA 1SVKA 1Z0DA 1T4GA 4D0LB 1ZU4A 3GLFB 2ZSEA 1GG2A 2GCOB 1OB5A 1AZTA 4CGZA 1CR2A 3TE6A 1YVDA 5CDFE 4M22A 1YZUA 4LK2A 4QHSA 4A36A 3T35A 1G4AE 4PPFA 1EWQA 3Q5DA 1E9CA 2Q6TA 1W4RA 1XD2B 2AK3A 5H70A 4A0GA 1GTVA 2KWIA 5GJVC 4A6XA 1ZNWA 2NQ2C 1E2IA 1CJUC 1OH5A 1Q1ZA 3CZQA 1M8PA 3NVAA 2OXCA 2AXPA 2XOKA 2V1XA 1X8JA 2PBRA 4IOMA 3KQUA 4ABYA 3VR6A 3WP1B 3BE4A 1KK3A 2Q21A 3C16C 2WHXA 4YONB 1M1YE 1WE2A 1GNRA 2D4HA 4IXNA
chains in the Genus database with same CATH superfamily
4CM1A 1L5RA 1A82A 4YT5A 4W8OA 4IV8A 3JU3A 3T9DA 4AIRA 3IUYA 4BP9A 2CE7A 1JIIA 2NYRA 3AEXA 1VG1A 3OIYA 1CUDA 1KBQA 3R20A 2IHTA 1C0IA 1X3LA 1AUXA 4O63O 4RKRA 2B78A 4BQRA 2ZRHA 3FRIA 4UDNA 1GILA 3KB6A 4ZAXA 3SXUB 1E7RA 1Q74A 1WCIA 3EQ6A 3V34A 4BWVA 3HDHA 3LL4A 4FJ0A 4HTFA 2VDJA 3KEGA 4O1HA 4PWZA 3IAAA 4YACA 2NACA 1QU3A 5IT4A 3C7AA 2X5KO 5AK5A 5JXHA 1TZMA 1TCCA 4PO8A 4MP3A 5EZYA 3RSZA 5J2UB 3NYWA 1Y8CA 4G1FA 4JLOA 5D5HA 4V0RA 2UZ4A 2BI7A 3UCXA 4RTQA 2YIJA 4FQ5A 1F9AA 1DTWA 3I6ZA 9LDTA 1YF3A 2BMAA 3LCCA 3T7KA 1JZSA 2UVDA 1Y4SA 2Q7OE 3VTFA 1UZAA 1PZNA 3MJEA 1VHTA 1G60A 1HE3A 1YZKA 4CCSA 1SY7A 4E5KA 5A9RA 2WJVA 3KUDA 3R5FA 4CCYB 3LA8A 1LK5A 2PFKA 1C8VB 1VIVA 2GBIA 4H1HA 4H4CA 5K6AA 1A04A 4N7RA 2IYQA 1NXSA 3JQ8B 3THXA 1UODA 1H85A 2HRQA 3GMTA 4EI9A 4O2BF 1NUSA 4G1MB 3DXYA 4XLZA 1WUKS 4DZTA 5K5EA 5D3KA 1NRIA 2PUFA 2YHUA 4DJDC 6LDHA 5HJ5A 1T4DA 3TPCA 4AU1A 4NOKA 1U2TA 5ALPA 3RGGA 4DE5A 4Q4CA 1ZO8A 5GQSA 2LZ0A 4F5DA 1CQIB 5EQJB 4JI6B 1Z5WA 2YV2A 1Y8AA 3F78A 3NM4A 3MSXA 5DXJA 5JXGA 5LYJB 4BNUA 4TQ9A 3U7EB 1A9XB 1P1FA 4QU0A 3LWBA 3MS4A 4X6YA 5I9IA 1S9HA 3UNXA 3QX7A 4N6GA 4WK0B 2I6SA 2PD6A 3QV1A 2JIMA 2BC9A 2MTBA 3CG4A 2QMUA 2XWQA 1T3TA 2CKMA 3CX3A 2AFHB 3C8ZA 5IT9A 2G40A 3M6IA 5T4BA 3WYDA 3U09A 1X39A 3KZVA 4D8UA 4UARA 2NU6B 2OGTA 3C3WA 4OGLA 5I47A 4QOEA 3GLRA 2VQ3A 3MWDB 1VL0A 4FDTA 3CUEF 3U0BA 4D8TA 1GPBA 1TJPB 5JMTA 1GQOA 1YXMA 4RSGA 4BKOA 3DHYA 5DSZA 4ZCTA 2JI7A 4EZIA 2Y0CA 5A62A 3DV2A 2HA6A 5LJIA 4YCJA 1L7RA 1LDGA 1LKZA 1E2UA 1NVTA 2BFDA 2E4UA 4DR5B 1Y7PA 3LPMA 3N7TA 2QX6A 4PTLA 1HEUA 2B82A 3KNZA 3N8NA 1AUQA 5KNDD 2PH1A 1VP3A 1SD5A 1Y7IA 2J41A 2QTAA 4RESA 4XOUA 5G41A 5M3BA 5CDTA 3CPEA 1JZQA 3MJVA 1N2BA 3OEYA 1HZZA 4W6QA 3GROA 4ND8B 5F78A 5EIFA 4U0KA 2RB5A 4BMPB 4P0QB 1Q95A 2PMWB 4JCCA 5DGDA 1OXBB 5HF8A 4AY4A 1V16B 3REGA 3MELA 1XB2A 1PWHA 1BXRA 1TYEB 2QX9A 3OZDA 4YB8A 2O8CB 3B6KA 2PWPA 3IQZA 2ZRPA 5HJ2A 3INRA 1N2ZA 2ZIWB 2AMVA 1UPTA 4LRUA 2YWCA 3RS2A 4C30A 3DHNA 3UWSA 1AZLA 2VF8A 2ZYUX 4JBHA 5IW8A 1NTOA 1IE3A 3BWDD 3GLHB 4B3DA 2OXRA 4TTJA 3H18A 3TOCA 4D7AA 2BKAA 3JWHA 3PDJA 5TQVA 2C5AA 4IIJF 4BE9A 3K9BA 2RHGB 4FFMA 1T4MA 2PMFA 3SQWA 2G8LA 5AJXA 3I72A 3AERA 5HIIA 4CKBB 1JDUA 4A5SA 3UICA 3EVBA 4PNHA 5DDIP 2XY4A 4NTZA 5JIBA 2BHTA 4ZTBA 1PEAA 3QVLA 3SIPA 1BH2A 2VT7A 5LB2A 3ZTWA 4DLWA 1I4DD 2RHLA 1ZVKA 3PQ5A 3RE1A 3GDWA 5IULC 1SQFA 1G41A 3QU4A 3IDZA 4MJLA 5JPIA 2QTHA 4TMTA 4BMXA 4LJ5A 1YDFA 2VCEA 1CUAA 2BHNA 3HVKA 3R5KA 4OD0A 4L7VA 4KYVA 2HD4A 1DI0A 3FMPB 3P2IA 4BZXA 4PG8A 1P91A 4FM9A 2BGTA 1EUDA 3BIFA 2EL9A 5I9SA 2QJOA 1KARA 2B7CA 1Z6GA 2HCFA 2HK7A 4RLQA 4XSGA 5LVAA 2JJMA 1YR8A 4HH3C 2VEDA 5L6MB 1RXVA 2AR0A 1MO3A 2I5PO 1M2FA 3FTEA 1M1YA 1VL8A 4ZOLA 4PYIA 4C6TA 2X7HA 4LOAA 2FWRA 2GK4A 2ZWVA 4G23A 2OBLA 4Q34A 4IFBA 5DNCA 5CTAA 1QVVA 3OKPA 4YXFA 3ONEA 3STTA 1RC8A 2Q1WA 4AUNA 2I62A 1QR6A 2E4ZA 1CBUA 2XKBA 4OVKA 1W76A 2DE0X 2BZSA 2IVZA 2ZW9A 3N8GA 3FHLA 2MSLA 2HV9A 4K9NA 4X44A 5C3MA 1RXIA 2YFQA 3C3JA 2DT8A 1VC2A 2Z04A 5IAOA 4FP9A 4TLDA 4WOJA 3CO0S 4UD2A 5AM3A 3PI6A 3PK0A 3S6JA 3L6CA 1J4AA 1E7YA 2V45A 4EB6A 2HLDD 3OJ0A 4J3NA 1A98A 1DX9A 3UBTA 1MIOB 3DOHA 3MRTA 3GO4A 3ZGNA 3HSSA 3RU9A 2FEXA 1ZX1A 3I8SA 3RRXA 3A9VA 3MQ2A 1C41A 3IBYA 4KXQA 3FF4A 2QZSA 1LBQA 2NYVA 3M0EA 1LTKA 4K9SA 3D43A 1XXHA 5J5CA 3SJAA 4BTLA 4WVFA 2IS6A 2WVHA 3A1TA 5C1IA 3IC5A 3SQOA 5HNKA 2C4NA 3O1IC 1J97A 2EHDA 3OPMA 4YRKA 3URMA 4FIZA 1WMAA 3BXPA 3CH5A 3UT6A 2PJUA 2FSPA 2BDUA 4GI7A 3ESXA 1IHPA 1BD4A 3SEFA 1D03A 2AUNA 5E9JA 1JWBB 4W7IA 1I2CA 1PK9A 1T15A 4JS0A 4ZARA 3CLKA 3AJDA 2F9FA 1OHHD 3TLJA 4TKZA 4DAEA 2FSFA 4YMUA 1GADO 2PBZA 4AC9A 1E5XA 3NO4A 3ZWMA 5ALXA 1ISFA 3ZJTA 1X7WB 3WMWA 3JR7A 4IXMA 2OBBA 4V0LA 4F04A 2P2ZA 2VG8A 2CGEA 4YJ3B 4FDUA 1C81A 1EFKA 2X2EA 3SKVA 3DF9A 1J8YF 1WVGA 5HRCA 3RC1A 3DAOA 4OYHA 4F92B 1D2RA 4LKRA 1NKTA 3CZ5A 3QW4B 5I7FA 3DEZA 2FEWB 2ZUVA 2JH3A 4HMOA 4RVFA 3ZI0A 1L7DA 5A7GA 1LLQA 4O0MA 3S3TA 1RHQA 3WKAA 3WSTA 1EXVA 4LF7B 2IP1A 1Z4KA 2Q6LA 2ZS8A 4OJKA 4Q3LA 3GI1A 5ALDA 3S1LA 5BWBA 5L4SA 3AR2A 2OHOA 4BTVA 4MYUA 1GARA 2OCDA 4HXFB 3U7JA 4BRWA 4PCVA 3H75A 4D4MA 2Y1XA 3OEWA 4I5FA 2K5UA 2V65A 3NAZA 2PUEA 2ECPA 1UDCA 2Q3MA 2YC2C 4U2GA 1EA5A 1UFRA 2PRZA 5FORA 1N5KA 4OK5A 1AHPA 2FZVA 5GZ3A 1U2PA 5U4QA 3JD0A 3MJHA 4NNPA 5TPWA 5CH5A 5BW5A 3Q7RA 4OQPA 3C98A 4HX5A 2X58A 5EPEA 4WY5A 4UQLA 3MAGA 1M2NA 1US8A 1FP2A 3I23A 1Z34A 4Y3UA 2VF5X 5EE3A 3TG8A 1CVRA 3N86A 5EVJA 1V8ZA 5T3UA 3D0OA 3WZLA 3RJTA 3ED1A 3ZUGA 4WZAB 3AC0A 2RGGA 1N0IA 1W19A 4OG2A 1ZAYA 4W5OA 2ZYDA 3ROKA 2PPLA 2GETA 1SUCA 2XD9A 3JQGA 2WHPA 4HQFA 5DJ5A 4M9QA 3NHRA 2W11A 4IGAA 1EM8B 4Q3DA 1GZ4A 3BMCB 2NXNA 1W35A 2FJPA 2PSEA 3ONDA 1FRZA 3DVAB 3TRDA 1LW6E 1OOEA 2Y1WA 3GX1A 1IDN1 1P0FA 4QU8A 4RACA 5AI4A 5F7ZA 4BPRA 4ECEA 1R5NA 4P3NA 2UZ0A 3MBOA 4MS1B 3FDXA 4XTRA 4A26A 2OZVA 4CL2A 5HKAA 1DO2A 1NVVQ 1RHKA 4YRTA 5ES3A 3NJRA 4YLEA 1C1DB 2JEOA 2XNDA 3N2YA 2ANCA 4GEKA 2YUTA 5IBCA 1Y6QA 5F12A 4CLRB 3O95A 4EW3A 3P0RA 4DR7B 2A59A 2GD0A 4YWHA 3MEQA 1UDWA 3WLIA 4HGRA 2C5SA 2GARA 1Q50A 4EHKA 5L3QB 3ZWKA 4JD5A 4D46A 4HAVA 2PLNA 5JZ9A 3RHSA 3O7MA 2ZWOA 1ODIA 2HKIA 3BRQA 3DA8A 3DBHA 4K81B 3FUUA 4ODIA 4TPKA 3GN1A 1XDUA 3IE2A 1BE1A 4PWYA 5DCUA 1V7CA 2Q4BA 4QBHA 3HMQA 5BR7A 1HQDA 4IW3B 5LYYA 1SOUA 3GXOA 3SYNA 2ZZMA 4AJ1A 2V58A 3TSAA 4WKOA 3EZLA 3ICVA 1KI8A 1QIIA 3B78A 4QNMA 4RF3A 5FI1B 4DDTA 4LPKA 1HQKA 2PQ2A 3X1WA 2JVJA 3HKEA 1FLDA 1UBJS 3AEUA 3MRXA 4NE9A 5BQFA 2JLRA 3SOPA 1VPDA 1W44A 4TMXA 3A1EA 1XNQB 1QYRA 4MLPA 1U0JA 3A6HA 2ZBDA 3ICOA 4XYEA 1LPSA 1WR8A 5FOSA 3TE7A 1XTJA 3MTAA 3UK6A 3E53A 5NLLA 3OKAA 2W71A 3C24A 4PS0A 3TK1A 1L4UA 2AJLI 3DMGA 2JHPA 2GJ8A 4LQLA 3PS9A 4ALIA 3WLAA 3BS4A 1Q3TA 3USCS 1TXGA 3DDZX 5JJ5A 4J94A 4F72A 1GL6A 2W42A 2XECA 1T2AA 4KQJA 3BWEA 3ZKWA 3JAMA 1RFGE 1CJVC 3CIOA 4Z49A 1UDXA 3AVOA 4MQUA 3HI4A 4RTSA 4DPLA 4O33A 2ASVA 1QGED 2EBFX 4DWJA 5CVTA 3H4TA 4OLFA 2QQ5A 2C8KA 3CVXA 1TZJA 2ZRFA 2IW1A 1NJ1A 2ZUWA 1FW8A 1ZQ9A 1L6IA 3JQDA 2AEEA 1YJXA 4EMTA 1F1JA 3IAEA 4G86A 3H2ZA 4FLFA 1X14A 4TLMB 4AZ3A 4Z54A 4CG1A 1XVVA 3Q10A 4C76A 2OFOA 2XQIA 4RY8A 3WYGA 1EK2A 3AUKA 4N76A 3QVMA 2OESA 3GAAA 2BI4A 2WUFA 1KAOA 4WY8A 4MKFA 3FPSA 2P30A 4HDRA 2A8YA 1TX4B 4IVNA 4RSHA 1NM5A 4X1IB 3UPTA 2G9VA 2YRFA 3V8RA 3HKBB 4CHTA 4PLZA 3I8OA 1G0NA 1Z25A 5FWAA 3UJCA 3BWVA 3QF4B 4XH9B 3QM1A 2O9JA 1H23A 3KYCA 4QYWA 4ITRC 1GQSA 1G5PA 3K1AB 2QD1A 1V9SA 2YZGA 2FP4B 1W49A 2J08A 4LDAA 3WI7A 4HRVA 1W9HA 4LHWA 1TEXA 4V24A 1GQQA 5BOVA 1CE8B 3COSA 1JKFA 5IC5A 3OZAA 4PBRA 2R751 2XX3A 4K3UA 4EQ6A 2Q0SA 1DLJA 3GGPA 3MGGA 1SXIA 2FZGA 4WX2B 1XV5A 4L5YA 3CG0A 4XQ0A 1YVRA 3FPEA 3C6YA 5CM8B 2PG3A 5KWIA 1S02A 1OTHA 1ZD4A 1AB5A 2HU8A 1SHZA 1X7ZA 4ZO6A 1HYBA 3GZNB 2B37A 2CWWA 3SD7A 2J4DA 4CF3A 3RS4A 3SJZA 3FOWA 3M5DA 1E6WA 4PZLA 4QPDA 4Y6RA 4W9MC 5A4DA 5KNBA 1XKXA 2IXBA 4UM7A 2ZJBA 5JH7F 2NZVG 2RK4A 1MW8X 5HMMA 3TUIC 2FFBA 2G04A 4OHRA 4MVJF 2YRXA 1I3KA 1KJZA 4MI1A 3KOZA 1KY3A 4X71A 5AOCA 1N33B 4ZPJA 4UCQA 3DO6A 4X3OA 1ECBA 4JL5A 2HADA 2HX1A 3D6FA 3M83A 5JMWA 3GLGA 4UMEA 3G2IA 2J6HA 3JZMA 4NBNA 3OFSA 2WWTA 1PFKA 1VE7A 5AJUA 2GM4A 4OLBA 4N48A 2WWRA 1ZESA 4JVSB 2K2WA 5ELXA 1QP4A 2HAEA 3ILSA 4YQYA 2ATXA 5JWHA 1EXWA 1X2EA 5CJJA 4GQBA 3FUVA 1IXRC 2MCFA 1Z6AA 4H15A 1R0ZA 3WSVA 3L0BA 4MW9A 2OCLA 4PXSA 4LMPA 2QDXA 4H17A 1FJ2A 1MC5A 4BFYA 1HOXA 2HWYA 5IABA 1NIPA 2QW8A 2YXLA 2EKPA 2H9YA 3EW9A 2NXCA 4XPIA 2AI1A 5P21A 3U9SA 2NSJA 1IHDA 2V7BA 3DZCA 3DOEA 1OPXA 3KQYA 3C2QA 3OPVA 3TXXA 2CBZA 3LS2A 4RGQA 4HNVA 1QQ6A 2ILTA 3IMFA 1LI7A 1U7PA 3AJ9A 4L57A 1EQAA 2AK2A 3RVKA 1E1LA 2ZPUA 3GDOA 1MQ9A 2VYQA 4QBTA 4M1MA 2BLLA 5AW0A 2Y9MB 1F8GA 3BERA 1XJCA 3Q87B 3C3KA 3ENVA 5M5BA 1KQGA 4I4IA 3KT0A 3PQDA 3JQAB 1Z2NX 3G9TA 1FQKA 4GGPA 4CLHA 3N2KB 1H4SA 1N32B 1V8BA 5DBEX 3B2EA 5FOTA 3RYTC 4H77A 2NUAB 3H5IA 1GQRA 2FEOA 2ZKLA 3CX7A 5F4BA 1L3CA 2GTIA 5NULA 1FUYB 3TOVA 2BSQA 4U7TB 4RZQA 3T5BA 3FOCA 4J0IA 2W4IA 2PKRA 4JJIA 1KI9A 3LBFA 3GUVA 3CONA 1Z56C 4ZI7A 4RV4A 4U7JA 3ROQA 2F1JA 2ZE7A 3ACDA 4Z8XA 2D5IA 3DOUA 3NUZA 4MV7A 3QFTA 2G82A 3DE4X 4WWHA 5LWQA 4TMKA 3L7NA 2NU9A 4WTOA 5T6MA 3TS1A 5HM6A 2SKEA 3VPAA 4WCFA 5ADUS 2X9QA 1SA0A 4N3AA 3TUZC 1QFZA 4QYIA 4X3CA 2G4VA 3GJ3A 5I51A 4JGBA 4J1QA 1S1CA 4UEOA 2J87A 2QW1A 3TXAA 3VQTA 4UZFA 1P7CA 1E7MA 1RLMA 4XIYA 4NC9A 5G02A 3NDRA 4WECA 4JLNA 1Y9JA 4MRPA 1X19A 2OCIA 4QGGA 1C50A 5GTDA 5DN9A 3V8NA 2W43A 2FRDC 4BN0A 5LJLA 1D7AA 1AN0A 4JLKA 4RGVA 3GJ7A 2C4WA 3OEHA 2E1PA 3LQ2A 4XYMA 4FB5A 3TIGA 4KZKA 1S7GA 3QRWA 4PGFA 3PGVA 4RPLA 3K20A 2VZEA 3QUSA 1GRQA 3KAQA 3VOSA 2I76A 4EITA 2WF7A 1NNLA 4GO1A 5JUWA 1QG6A 1BRMA 1QIDA 1U0EA 2YV4A 1RR6A 5KWJA 3FCSB 3EF1A 5EYPA 4L5IA 3MTJA 1NBME 3HADA 4Z3OA 2P6RA 1HYHA 2G3YA 2JD1A 4U8GA 2WT8A 2O5CA 4O8CA 4TUYF 1PV1A 3HV0A 4PQYA 4KAJA 5DASA 2PT6A 4JXZA 3N87A 4HDNA 2Q1UA 1XCOA 1UKEA 4M8NE 3SJCA 3N0TA 1UAGA 3SQXA 2DEUA 3G2NA 1X1EA 4CL8A 1RZVA 3TFWA 3KHSA 3KZOA 1VL2A 2AZXA 3EAQA 1WP4A 1J9GA 2PGXA 2XMSA 2AIRA 3MUFA 1GQYA 4D3XA 1ZICA 2GKOA 2A0UA 4P0PB 2GI4A 4JOQA 3OCWA 5DHPA 2VCYA 3DDOA 1F5SA 4HNQA 4DIDA 1YDMA 2K7FA 1ADBA 4FK8A 4JNCA 4Q7JB 2V7EA 3NTRA 5DEOA 6AT1A 1KSGA 3ROPA 4Y0AA 5BV0A 5I7EA 5GP1A 1G3QA 2LTAA 1PT7A 1H69A 3GPBA 3GV0A 5DGCA 5IYZF 1OIVA 5CB6A 4URYR 1R6AA 1C0KA 3FTNA 5ALGA 2HSJA 3SICE 1GT6A 2BFMA 2DX7A 5C3UA 1YFLA 2IX9A 3TR5A 2A1UB 4IG4A 3BJIC 1F2VA 1O6ZA 4HUTA 3DYIA 1TKAA 4UU7A 1Q92A 1CW2B 2GA8A 1QKIA 2HJSA 3VTAA 1DXYA 3PQ2A 3UZUA 1E7QA 1M8FA 5MGNA 1VPWA 2VK8A 3AR5A 2ACKA 2F7SA 4KTVE 4F6CA 1GYPA 5J1TB 3TZBA 5IC4A 1PQWA 5KCMA 1X74A 5BSGA 1F2TB 5EHZA 2ZJ0A 4URZR 3M4YA 1XN1A 1C8KA 3LHIA 3Q72A 2WTUA 4JOBA 2ZAOA 2Y76A 3E82A 5EPUA 1PD0A 4HNGA 2J9GA 4HFRA 3W2HA 5FQNA 4P80A 3V1YA 4YUAA 1A3CA 2FR8C 2ADMA 2C20A 1DG3A 1AQJA 1EDEA 1X1AA 1U9JA 1IG3A 4FDVA 4G0XA 2RAFA 4WK6A 4TYNA 4D0NA 5EIEA 5KSPA 4KO1S 5SY6A 3FWKA 1B26A 1NJ6A 1OE0A 1MU0A 1PSDA 4YBZA 4BP3A 2MT9A 3R7AA 2VH2A 2X41A 2PMCA 4PHTA 5A06A 5KWVA 3UFXA 2JFUA 4S1VA 3OZGA 3PX3A 4W82A 4B2IA 4JR2A 2FDRA 1L4YA 4BY9E 1RS0A 2Q07A 2VLIA 1VZ2A 4RW0A 4A6DA 1S2GA 4KX3A 4BKQA 4BX9A 3BG5A 3QWHA 1P72A 2Y3IA 3IUNA 1E3IA 4X41A 1G2OA 4TZTA 1CQZA 4LJKA 2R0QC 4EAQA 3M5CA 1JDNA 1OSNA 2PKEA 2ZBEA 3MWFA 1PGJA 4CMHA 4DT1B 5A3JA 2P2DA 2W6IA 5TQJA 2DHQA 3NGMA 1CWUA 1BKYA 2AG0A 2J3KA 3IBCA 2P6UA 4JJ6A 4BX2A 2PSSA 1AV7A 3WX0A 3D7KA 4PY2A 2PL5A 1JS1X 2R5NA 1BZYA 2EGGA 4ER3A 4PW0A 4H59A 3UWKA 1XELA 1N0VC 1ADCA 5EIBC 2QX4A 1FFGA 2Y27A 2QP3A 4K88A 4RPKA 2C78A 4CM8B 1ZMRA 2GJ4A 1RP7A 1I4OA 1AMNA 2QNBA 1DBIA 4BWYA 4DSTA 3KJIA 3WQQA 2JRLA 4PAOA 1QG0A 4IEFB 1EGHA 4RFSB 4Z86A 1T6BY 4CR7A 1QX3A 3AW8A 1QIFA 3MZ0A 4QICA 2JATA 4EL0A 2VJDA 2VHTA 2PL1A 2RGXA 3EDRA 3DBLB 3EVZA 2CHUA 4U3JA 3OQ1A 1NQTA 2EBHX 1OLXA 2YHSA 1JALA 2FUEA 3ZG6A 3OE4A 3QPDA 3R0ZA 3QEMA 4AJHA 2RHCA 3HRIA 3M3HA 4CKEA 1GAWA 2IHKA 1A8UA 1O58A 1UXJA 4OO3A 1ABEA 5FLYA 2CVZA 5KX5B 1HE5A 3O26A 3WICA 3BHMA 3ZPXA 3HM9A 3ICWA 4C1BA 3BWMA 4I0WB 4IUDS 1XOIA 2H3EA 4RA9B 1XWIA 1EDZA 4KAXA 2EATA 4A10A 3AVWA 4X6XA 1ZUWA 2V97A 1DRKA 3X1KA 4JVMA 4YRJA 5M7EA 2GSDA 2REBA 4KWEA 1U8CB 5FLXA 1L9KA 3D2CA 2H31A 1W4CA 2PUVA 3SI7A 4BNGA 2A9QA 3E9YA 4B8ZA 2OCKA 4ETWA 4EX7A 1JFSA 3THWA 4MUHA 1IEVA 4KPUA 5JHGB 1TM5E 2XXJA 2EXXA 2EKLA 1Y42X 4O4IA 2G1AA 4ALKA 5HTOA 3NP7A 5HKLA 1H6AA 3A3NA 1OA1A 2V6IA 1BDIA 3G2KA 4RELA 3TINA 1QGYA 4ID9A 5D6NA 5HDBB 3ZDBA 1JAXA 3NONA 2ZFUA 5IBRA 1KOFA 2RH9B 4LSMA 1Q83A 2TMYA 1N9GA 2D00A 2XNDD 4PYNA 4DV6B 3EGWA 5KDOA 4CEHA 1SUDA 4KVAA 4W8HA 4N49A 4TM8A 4NY1A 2BHRA 4UM5A 3QYAA 2QRHA 4HLQB 1EGAA 3D4LA 1QSGA 2EP8A 1YBFA 5DI9A 2CXQA 2A9RA 3AFHA 1L4GA 1TECE 3GWZA 3MOIA 3MTDA 3HCNA 4GBGA 2COUA 4PO3X 2C98A 5LP6F 3LWDA 1RRKA 2FMIA 1J07A 1QGZA 1AXGA 3NOVA 1IN1A 1DC8A 2ZYTX 1Z06A 3BZUA 1V41E 4GMHA 4E1VA 2K7ZA 2ZVPX 3AU8A 3R23A 3CB2A 2WJHA 3K2BA 5J23A 1WWKA 4OXIA 3KELA 4RDIA 2NPFA 1TO6A 4XXHA 4MUNA 4F4IA 3BICA 1DFGA 2X3FA 1XAIA 4PX2A 1ZH8A 4GT1A 3UMBA 1KO7A 1GUDA 3BHJA 5KYUA 4BEWA 1G66A 2QZJA 2QL9A 4UU1A 2UDPA 3A2MA 4FYKA 3A04A 2NO9A 5I9LA 4AKEA 2Y05A 2O7VA 1UBHS 3L6EA 2XUZA 2F9LA 2XXAA 2FWMX 3EXHB 4FOPA 2H1HA 5AVOA 1C9KA 3R7SA 2OBXA 1GZ3A 4X60A 4C4SA 4DLXA 2H4WA 4EVRA 1P1CA 3RYCA 1G5TA 2Y6UA 3M4XA 3ND9A 4OXXA 2PGAA 3HWRA 5CNMA 1FZQA 3VUFA 3U80A 4M1ZA 1NUTA 2COKA 2M1ZA 3E03A 3EQZA 3B70A 3S7TA 5IDYA 3IAM6 4JJ7A 2NP6A 4AY5A 2V3WA 5CUQA 3K9QO 1ONOA 1XYGA 4IINA 1K3TA 4DR3B 1NDQA 4DV1B 1D5WA 3JARA 3L8MA 5ULLA 3VNQA 1SCKA 1DDIA 2OILA 5BMOA 5JOQA 1U3CA 5EXSA 4JQSA 4MV1A 3P2JA 2FSUA 3LXRA 5B6IA 1PR0A 3VHLB 1R6BX 1MH9A 5TMDA 3PXAA 4P32A 2GEJA 4LX8A 3LUJA 3BK7A 2FQYA 3DJYA 2J3DA 4N9QA 3DYBA 2P0AA 2NVOA 3I37X 4FMDF 3TZQA 3CJQA 1ECCA 5JJCA 4A6PA 3FUTA 3KE9A 2W2TA 1GD1O 3IVGA 3FHTA 2VTBB 1H9CA 2N1MA 3O9MA 1JQDA 1MF7A 2Q2WA 2XIJA 3EXG1 1WKVA 4IEEA 4CM9A 2QV0A 5B1YA 5DULA 1ZD5A 4CRWB 4V02A 2P91A 2YYYA 3HBLA 5ESDA 2FWBA 4JI7B 1UMCB 4FYJA 3OQVA 2GD2A 3KTFA 5FYQA 5EMHA 4RTLA 3KJXA 2VRCD 3AETB 4LXXA 4FGUA 1K5DA 1FVFA 4AX4A 1NW3A 4EGQA 4CEIB 4FU0A 2VAXA 2FWIA 4BJ5A 1QKJA 2ZZNA 1XRJA 3CLHA 3TNLA 2AUMA 4EF5A 1XF9A 1EAMA 1YJBA 3AB3A 4MQLA 3C3EA 5CLGA 1MTOA 1U0TA 1BHSA 3D5EA 3ZZUA 3FPAA 3SS8A 3AJRA 5K0TA 1LZKA 2BY4A 1GLGA 4MQMA 1NR5A 1E5QA 1LBTA 4OHXA 3VPXA 2XA9A 5LLTA 3OZSA 2EGHA 2YWFA 2C2BA 4L51A 3R6LA 2A0XA 3S5UA 3T3DA 5A7FA 3GMIA 3HCEA 2RC5A 4OHVA 3EGXB 1AOXA 1O9BA 2BDTA 1C1XA 1OX4B 1WTAA 1JU3A 1OGIA 2ZTLA 5KNBD 2DBVO 4IYJA 4OQXA 2GLXA 2J4FA 2O7RA 5IWAB 1VL5A 3UAOA 3P9CA 4JLDA 4K1LA 2IIVA 2Y1CA 1B3RA 4M7RA 3RRJA 1YR9A 4CMCA 1ZJWA 3FSRA 2VAVA 3EXHC 3IYLW 4WSOA 4FE7A 4RSMA 3MJFA 4CWAA 3FY4A 2BUCA 3QELB 2XVYA 1XFDA 4KN8A 3RTGA 4ED9A 1G20B 5MFZA 1AGPA 1E20A 1JKJA 4FSDA 4TTPA 1B0AA 4RU1A 3G3EA 5AUNB 4RTNA 2PMKA 5SICE 3D5TA 4YMHA 3A37A 1GVHA 3MT7A 1GKIA 1U3FA 3I4CA 1ZQ1A 3N0VA 5KYWB 1CZHA 1OW3B 3PHJA 2IU4A 3D31A 3HDTA 4LYAA 5AJTA 4CR8A 1YVEI 4F5YA 4JP1A 1DC7A 4NATA 2JVIA 1AKYA 2O2CA 4IICA 1RWVA 3BD8A 3P9NA 1GG9A 3PV0A 4EGJA 1E6MA 3EF0A 2GMWA 2D06A 2JD2A 3OMXA 4RBNA 4AO8A 2Z6QA 1GNLA 2G9ZA 4YT8A 4Q12A 1MABB 2QTRA 2M6SA 3FVVA 2ZBUA 5CURA 2D2XA 2C9MA 3TDKA 3SIXA 4B4KA 4EKEA 2WF9A 5B3KA 2WHRA 2ZTVA 1CD5A 1E2GA 1QGDA 3HUFA 3SZOA 3RB8A 3GFRA 3U5TA 3HDVA 1U1IA 2XR1A 3R5SA 4W63A 5AKGA 1U2SA 4Q3CA 4OJTA 3NGXA 1PX0A 2JKYA 4XD7A 3V1LA 4DB4A 1UC4B 3FMOB 1J8DA 1ND6A 5CX4A 2IP4A 2JJ1D 2YWBA 2IY7A 5J1SB 3N8DA 3RKSA 2ID4A 1ZDMA 4U1RA 3DPUA 4HNAA 2R1VB 2R68A 3EOBI 5T41A 4E3ZA 3GJ6A 4WBSA 2A86A 5G53C 3OG9A 4AS2A 1UFOA 4L9AA 2BH9A 1MAUA 3CUSA 4GRDA 3RHZA 3BX1A 5FUXA 1X1RA 3EHDA 5DHFA 5B37A 4ZOQI 1PZHA 5KYTA 3PQFA 3CW8X 2CHVA 4LNUA 1LWNA 4R16A 3T4UA 3WDSA 2VP6A 4LJ8A 1J8MF 4PSKA 3W8FA 4W5TA 2X0RA 2VSQA 3R3SA 2FAXA 4YBRA 1S2OA 4W7SA 2OQRA 1GUZA 3RK0A 1Q2UA 2EERA 1CUWA 3Q1KA 1SGWA 3RVJA 3A1FA 1U1EA 1VYUA 1NMEA 2CFTA 2PV7A 3IKVA 4PVDA 2ID9A 3KZNA 2HF8A 3OU2A 2ZSJA 5BSKA 2Q50A 1JH8A 1P2VA 1NQAO 1P44A 3EFOA 4EABA 1CY4A 2O0MA 2NN3C 3AF0A 1ZKDA 1ZOSA 4GZ6A 1IWOA 2HSEA 4R1QA 5AW4A 1P73A 1IBCA 3DDHA 4PFSA 1E2EA 1J6UA 3LDHA 4BBPA 3ZJ4A 4TN1A 2NZXA 1TLTA 2UXDB 4D26A 3NPMA 3IHTA 1EP9A 5HBRA 4GF5A 2AHOA 2G63A 4M6WB 2LCQA 3OEHD 3UW1A 4YS6A 5FA5A 3RJZA 2Q5FA 2H2WA 5CK4A 4DG9A 3ZE0B 5CITA 1JSCA 1GGNA 3CRW1 1EA7A 1WBJB 2OBYA 2RARA 3ZQJA 1XTIA 3KOOA 4A2QA 4OOFA 1W34A 1OXMA 3DQPA 4EJMA 4OA5A 5G0SA 3VZQA 3CCCA 4Y2QA 5FI3A 1OH8A 4YRRA 3PHBE 5JJKA 1CETA 1TZ2A 5K3OA 1PT9A 4J07A 1KHHA 4LGVA 5BO5A 1D5CA 3RUHA 1TFRA 3UJ7A 4F9TA 1I2AA 2JI9A 3H11A 4W7HA 5EJ4A 4HBGA 2PLRA 3ENKA 4O6VA 5JC8A 1GGMA 3HWWA 5D7NA 1NNSA 4COOA 2Z5VA 1E9FA 4UEJA 1PHPA 2NADA 5I5EA 2AW5A 5TPZA 3SOZA 1GTSA 1R6XA 4D4HA 4Y1RA 2MMGA 2QU7A 5DCLA 1P9NA 1ZM9A 3COYA 3VR4A 1BAPA 4JY7A 1L7MA 1YACA 4PX5A 1E66A 4ND3A 4AP6A 4R3NA 3L4SO 2WY2D 4B3GA 3FRHA 2E6KA 2YY5A 1CUZA 1L1QA 3IUPA 2I03A 3AF5A 4MW0A 4TGLA 4TT8A 4ZZ1A 1WBDA 5BQXA 2F6RA 1TM1E 4PYQA 2VA9A 3PVZA 3TG2A 3HGQA 3B20A 3JCZA 3KUXA 3NBFA 3Q7QA 1M2VB 2NU6A 2ZRMA 3HN2A 1XP8A 4ZO7A 1N2EA 2H4XA 3DPSA 4YRPA 1DQNA 2FG6C 3AFGA 3T99A 3X0DA 1DAEA 4DC1A 2WAMA 4HI0E 1X3SA 1JXQA 1QCZA 2BJVA 5CXXA 1QC5B 4DABA 1V9LA 1IY2A 1SUPA 1S1MA 2JGEA 3B6MA 3L7MA 2ZBQA 4G0YA 4V0QA 2UUAB 4AF6A 5ARBA 2BFCB 4HRAA 2FPXA 2JGRA 1E69A 1SG0A 2PTHA 2QF7A 4IG9A 2I2AA 4EEZA 2WFLA 3MWJA 3U26A 4BUCA 5JECA 1ZW1A 1DUVG 2GNAA 1P4RA 1PJBA 3OQBA 4MTCA 3WKEA 4MLCA 2XZOA 2WD8A 4BO3A 2G1UA 1KEVA 2VDOB 2BBTA 3SX4A 3TIXB 3LQFA 2VHCA 4LE0A 3KVNA 1FFAA 2JCGA 4ZO9A 3UJ3X 4QNNA 1M34E 2HTEA 5J2TF 1Q14A 3ILXA 1GUBA 5JI2E 5AVTA 1NF3A 2DTEA 4X63A 3WDKA 3R0IA 4AN4A 4BO9A 1D9XA 3EASA 3ZBUA 1MJGM 2PGDA 2QS9A 1DAHA 2QJTA 5EJFA 1W4AA 1NN5A 1Y8RB 4DBLC 1FSGA 3NS7A 3EPJA 2JIBA 1VMKA 3GLHA 3LX5A 5WRFA 2H1LA 3T5CA 1KMCA 5BUZA 1E1RD 1UDBA 1RZUA 4FVTA 4RCVA 4Q9AA 2RE8A 1XHFA 5LQCA 2VPWA 3RS8A 3X2SA 5FR1A 3AI2A 4AP5A 4ZCMA 4MIYA 1J0AA 5EJ9A 1IZ0A 2W6ID 5IDXA 1YDEA 3NKLA 5KHLB 4NBSA 5AXAA 2ZXUA 4C05A 3AOEA 3LRPA 1Z74A 3FH0A 4BQIA 4G2TA 1BS1A 3LPAA 3F73A 4AI6A 1MRNA 2EJUA 4G5YA 1NZJA 2O06A 4RY9A 4HHEA 4LTDA 4TXHA 3L7DA 3RW9A 2CFOA 4IHJB 1PGNA 2Q5LA 3E9RA 4C7MA 1X1CA 2YZ7A 3IUBA 4UTRA 1Q0PA 1ZUD1 3ZDRA 2PQ0A 4P08A 2Q7DA 2W48A 4OPMA 1XDSA 4EPWA 2SCUB 3RC8A 2PFGA 3DEIA 2BH2A 2GBFA 3R3JA 3CN7A 3EIQA 1AO3A 3HCRA 1KE2A 4H1WA 3CXUA 1UJMA 1XCJA 2BP7B 3KOUA 4G1UC 3RTCA 2MSNA 1JEDA 2ZIEA 3DZHA 5DRTA 2HCRA 1GUFA 3MINA 4FMCB 3NDJA 3HGMA 1GPYA 2QN8A 3X1DA 3BWCA 4EG7A 2NIPA 1IBKB 2QX8A 3VTZA 3K1JA 5G1PA 3UYLA 4QPNA 3H1BA 1RBQA 4EYSA 1C80A 4OIFA 1OUMA 3E22B 1LBEA 5JR3A 1WF3A 4QXPA 3BJEA 2WR8A 3T3MB 3GY0A 4HEHA 2VJPA 2BZ0A 2OWDA 3F96A 1CY8A 1K6EA 2WJ4A 2J7PA 2YQZA 4QXQA 3W8NA 2FF7A 2FP3A 2WTAA 3CX6A 3FPCA 3ITNA 4Q4DA 4DLTA 4G8CA 5GVSA 1KGDA 2WVAA 3I52A 1SVLA 4XAQA 3CJTA 1SVSA 4MV8A 3PDIA 4XLLA 4DUGD 5IXYA 4NYJR 4L27A 1L7EA 4XEUA 5IAAA 3TKLA 3WYAA 4B34A 1WVMA 1MIOA 1Y1KE 3MBKA 4YALA 4GPTA 3VSAA 3GRKA 2KE5A 3QJGA 3O4RA 1OZGA 2ZAYA 3L0OA 1CDEA 5KAMA 1RQLA 3FYCA 1SC4A 4N01A 5FKJA 3FBGA 3C4JA 1HE1C 2WT4A 4DEYA 1B8UA