4NYJQ

Approach for targeting ras with small molecules that activate sos-mediated nucleotide exchange
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEASAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Approach for targeting Ras with small molecules that activate SOS-mediated nucleotide exchange.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nyjQ00
2GEDA 4LGMA 1N6NA 3WHLA 2C9YA 3TSWA 3ONWA 4EJSB 2GBLC 3IPYA 3LXRA 1E0JA 2ZRDA 2YC2C 3ASYA 2DFKB 4YMWA 1RJ9B 4CZ2A 4TL7A 3IIKA 4C2TA 5L3VA 5J40A 1KYIA 1R8SA 4WVFA 2ZI6A 1AGPA 2ZRNA 5BN5A 3EA5A 4G01B 5JHGB 1L2TA 2Z83A 1GNRA 1X8LA 1CXZA 2KSQA 2ZI3A 5JS8A 1DS6A 1CEEA 1KOFA 1TUEA 1Z28A 3BORA 3EZ6A 4DLRA 5DE3A 4IW3B 3F5FA 1W36D 1F2TB 4XD7A 1UBGA 2NZJA 3DO6A 1OH7A 2IS4A 3LBNA 5FOUA 5AWFC 4DRZA 3TKLA 2PMDA 2XSZA 3FWYA 1FPMA 4MKIA 1Z47A 3SFVA 4US0R 2CVFA 4LHYA 3U44A 2N46A 1E1QA 2C04A 1V43A 3FHCB 2J7KA 4F92B 4Q4HA 5DHAA 2BBTA 3TQCA 3QXJA 1A2KC 3G5UA 2QAGB 2XOKA 3B1YA 2IXFA 5JCZA 3VR6A 1DVRA 4WIAA 3WYAA 1P2UA 3RS2A 1JB1A 1UKZA 5JWRA 2LCFA 1KGDA 4Q9HA 1GSIA 4MITA 4DZZA 2Z5FA 3L0SA 1ZCAA 2CHGA 3NH9A 4LPKA 4KFTA 1IJEA 3TLXA 1FQKA 5CJPA 3D7MA 2QA5A 1KDTA 2BJWA 4WOPA 1R5BA 2GJSA 4DT1B 1DOAA 4YLGA 4PX9A 3VR5A 1E1RA 1VG8A 4CIDA 4MGZR 4TSFA 4NMMA 3A4LA 2ZSBA 3EASA 4OK3A 5BWMA 1KMHB 4F38A 1X6VA 2HXSA 3C5HA 1CJVC 3QPWA 4HAZA 2FGKA 2NO7A 4OQFA 2O8DB 1BMFD 4QHTA 2GF0A 2QSZA 1T0HB 4E07A 3QIAA 2VHTA 2FSGA 3T5GA 2QBYA 4XH9B 2RGGA 3L0PA 1G8FA 1SVLA 1G3MA 3EPHA 4QL3A 4JLKA 1XCGB 1SQ5A 1VKJA 4C4PA 1HQCA 2Z43A 4TMWA 4H1UA 4LSGA 421PA 3K0SA 3K70C 4LV8B 2RMKA 1GWNA 3OIVA 4PTLA 1HT2E 2BWJA 3SDZA 3THYB 4GP7A 1WQ1R 1YR7A 1U2RA 5JWHA 2P5TB 2ZRFA 4EFNA 3SJBA 5FPSA 4LRWA 4RZXA 2QGNA 5L3QA 1OXTA 4TZ6A 1E9CA 1WA5A 4MKFA 3ADBA 4MA4A 1WCV1 2NGRA 2ZS7A 3O8BA 2EWWA 1Q12A 3KQHA 3P27A 3X1ZA 4GT1A 4JLJA 5DISB 4HZIA 1P62B 4TZ0A 2BC9A 4BGDA 1UPTA 4JLMA 2HLDA 2J7PA 2EU8A 1KKLA 2XTMA 3H84A 1S3SA 2B8WA 2FF7A 2FSFA 4HAYA 4R98A 1P9WA 2QM7A 4FCWA 4L15A 3W8RA 3BERA 3U4QA 4B48A 3CZPA 1B23P 1FTNA 5F9FA 1OIXA 4LPSA 3SYKA 4A0GA 4US2R 3L8YA 3I5XA 1N2CE 1XP8A 1EXMA 5GJCA 3A6PC 3K0CC 2R6DA 3R7WA 3NBZC 1T91A 1SKYB 3RVBA 1TF7A 5JJIA 1DEKA 4L8GA 3KB1A 4LYFA 3K0AB 2C99A 2VP4A 2GRJA 4Q1DA 5B58C 1DTSA 1RZ3A 1VPLA 3EC1A 3B1XA 3GMTA 4QNMA 2VEDA 1XJCA 3Q72A 4N0EA 2JLYA 1XXHE 4QBHA 2C77A 1W7AA 2AN9A 2WSSD 2ZIAA 1M7HA 3OHMA 3RRYA 1XXHA 2ZXUA 3QXCA 4Q7KA 1YRBA 2B7BA 1RRPA 4NPHA 4V02A 2CE2X 3GJ7A 1YR9A 5HE9A 1U9IC 2F3RA 1F5NA 1D2EA 5FBLB 1Z6XA 3JZAA 3V9PA 1JPNA 3RS4A 1GZSA 1OF1A 1FUUA 2ZJOA 3RWMB 4PQRA 3THOA 4ARZA 4GBMA 4CEJB 3PEVA 3WMEA 1G3RA 1P6XA 4MYHA 4JZKA 1C4OA 2GEVA 4NL4H 3AF4A 4YONB 5HCIA 4D0GA 2PJRA 4LHZA 4POAA 5DH9A 4JLAA 3W34A 1JALA 4B73A 3FFAA 4LJAA 2RGXA 3ZVLA 2KI5A 1VCIA 4NYMR 3DMNA 4JLOA 1ZNWA 1G7CA 3NH6A 4MGIR 5A4JA 3BH0A 4JLDA 4P4TA 1HY3A 4PSVA 4XIGS 5AUQA 1GDDA 2JIZD 2IUTA 4NYIR 2W6JD 2OBLA 1NVXQ 1MABB 2NQ2C 2YVUA 3H1TA 3L43A 5CYOA 1OH6A 3CRQA 1R7RA 3SYNA 5KDDA 4MYTA 4Q1BA 4IRUB 4PHTA 1ZU5A 4DDUA 4QJ4A 1WRBA 3U6BA 4RCZA 2AR7A 4UXJA 2BMJA 1RC8A 1KSHA 3QKSB 1W36B 3LVRE 2IYZA 2D06A 4PQFA 2QUZA 2WAXA 2ZRJA 2GCOB 5LDDC 1Q3HA 2CE7A 3MFYA 1RYHA 2XB2A 3RANA 2JLQA 1NKTA 4ACBA 1XPRA 3TR0A 5M04A 5DN6A 1GL9B 3IEUA 1GVNB 3IGFA 4RD6A 1MV5A 3BFVA 3NWJA 1U98A 2HXYA 4QKQA 1SXJA 4LBWA 1GTVA 4KLNA 4F4CA 4EQ6A 3E2IA 1OV4A 5AR1A 1XMVA 3WP1B 1D2MA 1FX0B 2LWIA 4TMKA 1MKYA 5CJ2A 3U7HB 2W6ID 2YNMA 3RHFA 4HZUB 2VHJA 3H0KA 1DE0A 4BPBA 1H8EA 4DCSA 3ZJYA 5A0FA 4PHGA 2GEUA 4P31A 4WZ6A 3KJHA 2IF2A 1N0VC 1G291 2P0EA 4HDOB 2O0JA 1FP6A 4FXPA 1LV7A 1TMKA 4L5BA 2GXUA 4L16A 4N3NA 1ZC3A 2HJGA 4Y0AA 1KTVA 1OFUX 2G83A 3PITA 3I1FA 3GP8A 4IFBA 2GZDA 4A82A 3H86A 2FG5A 3KX2A 4YMUA 1SVWA 3RNLA 2G88A 1ANKA 3BBPA 2CXXA 5CB8A 5EP3A 2ZJZA 5TDHA 4URXR 2JLZA 3C15C 1Z07A 1ZVQA 4ZCLA 1BH2A 4FN5A 1G3UA 3AVQA 1G8YA 1SVOA 3DEFA 5EXPA 1R0XA 4DHEA 5C46F 3PIRA 1WMSA 3VKGA 3WP0A 1O3YA 4RD2A 2ZANA 1E4YA 3AP3A 1KI6A 4Q03A 1NNEA 1J70A 5JBQA 5CDFE 2ZRIA 2WKQA 4K8OA 4KCGA 3FYHA 1GL7A 1OHHA 5CDFA 3U3RA 3WMGA 2YKGA 4TQUS 2ERXA 2J3EA 2BBSA 1G7SA 2XGJA 4X8MA 5IF9A 2F1HA 2OILA 1XMIA 2V7QA 1Z8FA 4EJSA 3VFDA 4LBZA 1E79A 1IY1A 4URZR 4TTPA 2AK2A 1S9HA 3CRVA 3AF0A 3OEHD 1E2KA 4MDFA 2QL6A 4D25A 1A7JA 4M2LA 3UMRA 3GJ6A 2QP4A 4LJ5A 1AM4D 3BRWD 3DL0A 1SVKA 2JJ8A 3BB4A 4QBGB 3TUJC 1KAGA 1UDWA 1YU9A 4A0HA 3PUVA 2V8OA 5FR1A 1QZXA 1Z6AA 1FMJA 1G16A 2ZRCA 4NYMQ 5ANRB 2LKDA 3CZQA 2J9RA 3MAAC 4Y0VA 3GLIE 4P33A 1G7TA 2C2HA 3NHBA 3GLIA 4M22A 2VL7A 2Z4RA 1E2NA 4HAXA 1E69A 4Q47A 1RPZA 3N70A 4Q7JB 2REBA 4NYIQ 4KVAA 4TQAA 5B64A 4BLTA 2VLIA 5IK2A 1D9XA 2X1VA 1IHUA 1SHKA 5K8UA 4Q19A 2ZVQX 2IHYA 2CNWA 3BH7A 1QRAA 2AD1A 4MKGA 1VHLA 1Z0JA 3FOZA 4CEHA 1R2QA 2ZJ2A 4M21A 4RKEA 2FV8A 3ZYCA 1GOTA 2GVDC 3T34A 3CF0A 2IS1A 1B0UA 4YC7A 4TT3A 4M1KA 2ORVA 1YJ5A 1Y63A 4PFSA 4WW0A 3W5JA 2XITA 3QKRB 2JDID 1EG7A 5LD2B 1NN1A 3QSYA 1FNMA 1GNQA 3B9PA 1KI4A 2PZEA 2C5LA 4ASUD 4UKDA 1PUIA 4XVRA 2W2XA 5JI3E 2VO1A 1M2OB 4DT1A 5HZHA 2IYQA 2REOA 1NVVR 4I1OA 4MUAA 3W6OA 2B7CA 2ZJBA 1EGAA 1BIFA 3ND8A 1IOZA 2O0KA 2EW1A 4R7ZA 1KMHA 3A37A 3HWSA 3IUYA 4XOIA 2O8DA 2AL7A 4WZBE 1CRPA 1FMLA 1EK0A 5EUQB 4IVPA 1PUJA 1W4AA 1H8HA 4P3YA 2R6GA 4QBFA 2O8EB 2GBLA 2IT1A 1LS1A 1SVSA 3VMFA 1UDXA 3QXSA 4HUTA 4UNSA 5FBRB 4EDHA 2OO7A 2QRNA 2GDJA 3IO3A 4A4DA 2V1XA 3DVLA 1OXSC 4BRUA 4ZDJA 4RSGA 1ZP6A 4CGZA 3WHKA 4KSCA 3THYA 2MSEB 4HDCA 4QFMA 4JL5A 3VU9B 3HR7A 5DI9A 4KJZA 3MUFA 1OFIA 1ZBDA 4A0FA 2F55A 2B8TA 1KO7A 1T6NA 4H9GA 4KBFA 1AGRA 1GM5A 3E1SA 1ZNXA 3EZFA 4XSHA 1E2LA 3AVVA 2PCJA 3GFPA 2ZSDA 3K0EA 1CR1A 1YQTA 4NTZA 1KJWA 2VQSA 2FFQA 3B1ZA 3M1IA 5JZVA 4D26A 3W9YA 3KJGA 5E7IA 3REGA 1ZC4A 5EXXA 2WSMA 3OF5A 1VG0B 2ZI9A 4PC6A 1E0AA 1E2GA 2K5UA 2Q9AA 3EPJA 4B3DA 3SBEA 3VAAA 3WNCA 4BASA 5A5GA 121PA 1VCMA 2JASA 2QM8A 3EWAA 1I4LD 3EIHA 3F3YA 1SKYE 2R2AA 4GPTA 4BRWA 2ZE6A 1IONA 1XMSA 2OFOA 5EE0A 5KOYA 1TEXA 1CKEA 3CR7A 1KSGA 1R8QA 3O8DA 1QHSA 2JAQA 5KU1A 1JEEA 1NMZA 3K0AA 5FBVB 3UXMA 1ZIOA 4KHZA 2VH5R 4NYJR 1RKBA 4I1UA 1F2UB 4B3CA 1GILA 1KK0A 1DG3A 2PEYA 5DI3A 1NSTA 3TSOA 1K8RA 1NLFA 1Z2AA 1JXMA 2BBOA 3D31A 3BGWA 4GOKA 4QHSA 4Z8YA 4CRWB 2EWVA 4IHQA 1J7KA 1XTQA 3EW9A 1BS1A 4Q1EA 3SN6A 3W3AA 2VP9A 3CB4A 4B35A 1ZAKA 3TSZA 4AKGA 1KI2A 4D4JA 2J0VA 2SHKA 1SKQA 3M6AA 4CEJA 1M6NA 3GJ3A 3W5IA 3LNCA 2QEQA 3T15A 2EFHB 2G0TA 4FCVA 4G5SA 4CDGA 3GLGB 1UADA 4FMBB 4JVLA 5J4YA 2JJ1A 2QPOA 1TU3A 4PSAA 2F6RA 1ZW6A 1XEWX 5J4HA 1Z0IA 2B6HA 4FMDB 1HA3A 1R5OA 2WWWA 3PQCA 3MWLA 3AVUA 2ZAOA 4M53A 2YHSA 4OI0A 4JLNA 4M1SA 3P26A 1D9ZA 2PH1A 3QF7A 3IILA 1JPJA 2FWRA 1KI3A 1VG9B 3GJXC 4DLSA 3NDBB 1GG2A 4BLQA 4B2LA 4NONA 5KHOC 1L4YA 2HUPA 2WICA 4A6PA 4GZLA 2ECKA 1ZYUA 1KJZA 4NCKA 4MQBA 3E70C 5D3MA 1A4RA 3NTUA 3R9WA 3BB1A 3U3MA 2BEKA 3QKSA 2Q3MA 2WAYA 3OE7D 4MRRA 4BFUA 3RYTC 3K0CA 4OL0A 3CW2A 4HYYA 3I8SA 2WJHA 3UIEA 2YZ2A 3W6NA 2WKRA 3GEHA 2I1QA 2H7VA 2ZYUX 2PLRA 4RY2A 2IS2A 3VQTA 2YJTD 4IDQA 1YVDA 3B85A 4URYR 5FTJA 1QVRA 2OXRA 2BM1A 1XF9A 4OQXA 1KI1A 2VTKA 4NCNA 2ZJAA 1ZIPA 1NLZA 2VBCA 1KAOA 2XTZA 3Q5EA 4E03A 5IRCD 4YDHB 1KK1A 4FMDF 3Q85A 1KI8A 1VYTA 1DO2A 2BJVA 3CX8A 3Q5DA 1FX0A 1U9IA 1ZUNB 2VHUA 3AF3A 2VHQA 4DEXA 5F98A 1A2BA 4OK6A 4ZO4A 1S1MA 4HZUA 3GLFB 1OPXA 3LAWA 4KLZA 2AFIE 3AKEA 3C7KA 1MO3A 4S2EA 2BKUA 2QQ0A 3KL4A 4DSUA 2WWFA 4S35A 1ZNYA 2WMNB 3A1UA 1CR4A 3QXHA 1CULC 1DELA 1N6LA 1N6RA 2C98A 1T8TA 1X3SA 1YZLA 2HJVA 3VTKA 4F91B 1BMFA 5J5CA 2R9VA 2QAGC 2Y8EA 3LW8A 5JLJA 2F1IA 1M74A 3ZZUA 5FTLA 3AP1A 4IDPA 4HB2A 2GK7A 2H57A 1HE8B 1Z08A 4P4SB 1DAHA 1UBCA 1XEWY 2BMDA 4QBIA 1GITA 4QRHA 4OQNA 2PLFA 1XZQA 4KO8A 1Z2CA 3B9QA 2XEXA 3QXXA 4KI0A 3ADDA 1EFHA 2JATA 2WM9B 2QAJA 4TLEA 5L3SB 1CLUA 4XVUA 4W5HA 1UKVY 4PO8A 2AX4A 1XD8A 3CNOA 1Z3IX 3U3JA 1W44A 3C41J 4PPNA 2AFHE 2GJAA 5EJEA 3UPUA 3V00A 4JMPA 3ZDQA 5JHHB 3QPUA 2P6RA 1IN8A 2Z0MA 4N1AA 3KZ1E 2GZAA 5B57C 1GL6A 3R9IA 4PHFA 2BKEA 4B44A 3TVTA 2ATVA 2FPMA 5IHPA 1CJKC 1S0UA 1DAMA 2BCGY 4RZ3A 4GOJA 2JLSA 5SZJA 2QZ4A 3LDAA 2I3BA 2OAQ1 4JLVA 5TXGA 2HYDA 4AG6A 1HQYE 1PV4A 2XJ4A 2CK3D 3RS5A 1AQYA 4DCUA 1S1CA 4LV6A 2YWHA 1KSFX 3GJ4A 1E9DA 2BMFA 3TK1A 2AK3A 3UWKA 4BZPA 3AM1A 2A9KA 1I4TD 4LOAA 3QEJA 4U00A 3CRMA 4WAUA 3KUCA 3C8UA 2JJ2A 5DNYB 3IEVA 2WWGA 2JGNA 4UJ5A 1P3JA 5HPYB 4OYHA 1UKEA 4DUGA 5L8VA 3PEYA 1G17A 2V1UA 3BH6A 3CO5A 2O52A 1N6PA 1UBEA 4IDHA 3VKHA 3K9NA 3KKNA 5CLQA 2WWHA 2VP6A 2DWPA 2PZGA 3DPUA 1R5NA 3PEWA 1G6OA 2QI9C 1GP2A 2NPIA 1VCNA 2ZI7A 1XZPA 1TF5A 3AKDA 4MH0R 2G9NA 3TVDA 4DDWA 4W5JA 3AVTA 3HJNA 1P72A 1Q44A 1LF5A 2FSHA 3B7GA 3DZ8A 1WDTA 3G82C 2E1RA 2HT6A 1YRAA 3K0FB 4O25A 5SZKB 4RFVA 1BYUA 2NPFA 1P75A 2AWOA 2QP3A 4O2LA 4BFYA 4R2IA 2YWFA 3KJIA 3OEED 2JA1A 2V6JA 1XD2A 5HR5A 1JEDA 5KDLA 3ZIAD 2O8FB 4C0SA 2OFXA 2ZSAA 3OFND 4Q66C 4V0ME 2F9LA 2QMOA 1XTJA 4HLQB 3TW4A 3MWJA 2IEZA 4V0MA 4Q4AA 1QG4A 3CWZA 3KTAA 3GPLA 2FFAA 1E98A 2R8RA 4RVCA 4BEJA 3K9GA 1XCPA 3Q3JB 3L82B 3EWSA 4GFDA 3EAQA 2QRZA 4JT4A 1OFHA 1ZUHA 2QPTA 5KYKA 1GRQA 2JIZA 1E9FA 4DXAA 2W6JA 4A0RA 4BLSA 4Q9JA 1HE1C 2ORWA 5AJWA 3U61B 5AJVB 1JAHA 1J99A 3CR8A 2H1LA 5DYGA 5E7JA 4FWTA 3CIOA 5TV2A 1C1YA 1KK3A 2OG2A 3QI2A 1XPUA 4KBGA 2FFHA 2OSBA 4BFSA 4D81A 3RSLA 5FOTA 2PJZA 2NOAA 2GJ8A 1XEXA 3VU9A 2GK6A 1YZTA 3PV0A 3B1VA 1JQLB 2X2EA 1G4UR 2F9MA 5AUNB 3EIQA 1W0JD 3LV8A 5EZ5A 4HEJA 2HYIC 1E2MA 1DAEA 1TQ4A 2A5YB 2OLKA 4B2PA 1HT1E 4DJTA 1KJYA 3LX8A 4GSYA 1XCMA 4A36A 4W9MC 1IN4A 5HCNA 1SZPA 1W4CA 1VTKA 1ZM3A 4MGKR 2QE7D 2CJWB 1E2IA 4GL2A 2ZRLA 4RFSB 5J47A 2J1LA 2RH5A 3L8ZA 1I4DD 2ZI4A 1XBTA 1W36C 1GKUB 2W6IA 4N0DA 1E96A 4RZUA 2FEOA 2BIFA 4C0LA 4KFRA 3I92A 1NY5A 4M4SA 2X2FA 1T4GA 1NMYA 1NP6A 1C9KA 3VNVA 4JKYA 2IYXA 1II8A 2P6NA 1FTSA 5FTNA 4NCJA 3IDQA 3G0HA 4LCBA 5C1BA 1BO6A 2GCNA 2WBLC 2D7CA 4GOXA 1F2UA 4AC9A 3A4MA 4CEIB 1F60A 2OV2A 3U5ZB 2GKSA 2QY9A 4P4UA 4A15A 2OEPA 3N2IA 1WBBA 1PZNA 1LTQA 2JLUA 1E2HA 3EPKA 2F7SA 2XSZD 2V6IA 2WOOA 1F48A 3FHTA 2DWQA 5H1YA 2PX0A 1VG1A 4M1OA 4XWOA 5FOSA 2KB0A 1MRNA 2OT3B 2ZRBA 4MRVA 1FNNA 3VX3A 5HKKA 2VHCA 1US8B 1LY1A 1AQUA 3EIEA 3WRXC 1ZRHA 4Z54A 2FE4A 2NG1A 1UEIA 3A1VA 1MRSA 4TLAA 3AVYA 4ILEA 3KQNA 1TTTA 2G0NA 1U81A 1D8TA 2DFTA 3TBKA 3KQLA 2JLWA 5FPHA 4E09A 2DB3A 3REFA 5JEEA 2HV8A 1RYFA 2BOVA 1XTKA 3PCRB 4OJKA 4PANA 3CRRA 5EZ6B 3SNHA 2VP5A 3IHLA 5F2EA 4B2IA 1E1RD 3A58B 2B21A 1ELOA 1Z22A 4UNRA 3RWOA 1QG2A 4DLWA 2KBFA 4LV5B 1EX6A 2QNRA 5KSPA 4OI2A 1NJGA 4G5QA 1DAIA 4PC3A 1XPOA 2GA8A 5CIQA 4LJYA 3UK6A 1MO5A 5BW8A 2O5VA 1Q57A 2IYUA 2HF8A 4DLZA 1BYIA 3CX7A 2J0QA 1ZCBA 5FPYA 5B30A 3LY5A 3LQQA 1NG1A 1NVUQ 2ZRMA 3M4YA 1T9HA 4P0TA 2VRWA 3AP2A 1LF0A 5HZKA 1FFHA 2C9CA 2DY1A 4DSOA 2Q9BA 1A5TA 1TPZA 2ODWA 4TYQA 2AKYA 1RRCA 3DKVA 4QGFA 2I1VB 1JECA 4LC0A 4AD8A 1XRJA 4LHWA 2JDIA 2X8AA 5FI1B 4TYNA 3DMDA 1G21E 2Q21A 3KQUA 4QOSA 1G6HA 2WIAA 2J87A 4DLYA 5KSOA 2ZJ5A 3THWA 3U6KA 1JAIA 2GJ9A 1L7VC 2F1RA 2GCPA 2ZE7A 1IY0A 1SHZA 3Q9LA 4GI7A 4IDOA 2CHVA 4PQYA 1Q3TA 3UMFA 4AK9A 1JXOA 4PPFA 2V3CC 2HLDD 2FZLA 2IHBA 3AVOA 1MO6A 1Q1QA 4OHZA 4BEBA 2JLVA 5FBQB 1U8AA 2GESA 4V0LA 3K09C 4B33A 1IJFA 2WWXA 3OZXA 4DCNA 2XAUA 5EUMA 2A30A 1MOZA 1FL9A 4B3BA 4Q1FA 5LD2C 4G0NA 3FVQA 1YHNA 4TN1A 5HTKA 1G9XA 2HF9A 1D2NA 1XD9A 1WXQA 3QG1A 5CK5A 3LWNA 3PXGA 1D6JA 3NIBA 2ZYTX 2BBWA 5K8LA 4AYTA 3EXAA 5TARA 4A2PA 5K8TA 4TYPA 1TUIA 4A92A 4A1FA 2H5EA 3EG5A 3FFBA 4HLCA 4U7DA 2F1JA 1WBDA 1ETUA 1Z5ZA 721PA 1DG1G 2YWGA 2JLRA 3AKYA 5FL7A 1ZINA 1E9BA 3LBHA 4DWJA 2ONKA 4BWYA 1G3QA 2GXAA 1NG9A 5C4MA 5FUWA 1W2HA 4ZDIA 1RJ9A 2BVNA 2AD5A 3SOPA 4KFUA 1Q21A 2FX3A 1RFLA 3CM0A 5CB6A 1T5IA 4M9XA 2UZ3A 2IC5A 5FBWB 1XJQA 5GJVC 2IUSA 2OM2A 3SS8A 4B6FA 1CF4A 3GEEA 4ZDWA 2O8BB 2IWRA 3U60B 4R2HA 3QVVA 1RE0A 4MRSA 4MYUA 3ICQB 2IYRA 2EYQA 1UF9A 4KYUA 2IL1A 5FPKA 4B43A 3O47A 221PA 2B92A 2FOLA 4AKHA 1G5RA 2QG6A 3UANA 4QXAA 3B60A 4Q00A 1T0JB 1F2TA 5JRJA 4FMCB 2Q0HA 2ZJYA 2QMUA 2FNAA 2BEJA 3GFTA 3NBXX 2W2TA 3FKQA 2W58A 1TF2A 4L4UA 3WBKA 4RD3A 2BDTA 3ECCA 1ZM7A 4LZZA 2QMHA 3RS7A 4FWIB 1NSFA 2NO9A 4AKEA 1TAGA 3PJRA 1Q0UA 1Q1ZA 2QAGA 1AIPA 3OAAA 3ZQ6A 1COWD 3R20A 4I1SA 4IXNA 2OCBA 1E9SA 2BMEA 4DSTA 2RGCA 2WIBA 2XNSA 4C0KA 1NN0A 1QHIA 2IYLD 3K0FA 1IN5A 1Y3AA 2P3SA 3AB3A 4TTRA 4Q1AA 1W4BA 3DDCA 3P20A 5AJZA 5EE9A 4Z51A 4IFEA 2YOGA 5FOXA 4HAWA 2O8FA 1OYYA 5JMTA 2XNDD 1VECA 4EPXA 3LO5A 2WKPA 2IYWA 3JVVA 5DO9A 1SXJD 4JSYA 3EA0A 1T3SA 4QGGA 1OXVA 4WZAE 2QU8A 4MDEA 1Z06A 2P67A 2IYSA 3QF4B 3VX4A 1KI7A 1N6KA 2ZETA 4YMSA 4A2QA 4FMCF 4D4LA 1GRRA 1OH5A 2ANBA 4YMVA 2NIPA 2HT1A 3GJ5A 1L4UA 4MUBA 4U02A 2Q6TA 3IQXA 2PEZA 4EKDA 5LPNA 4ABYA 1M1YE 4Q1CA 4EPYA 5H8WA 3B2EA 2ZU0C 2ZREA 1G8PA 3CH5A 4KITB 1YZGA 2FZ4A 2X19A 3QE0A 4DB2A 2GVZC 3ZZ0A 4M1MA 4EUNA 5TMPA 1XJ0A 3TQFA 2QBYB 4C0QC 1DADA 1OSNA 1NBME 4DKXA 3ND9A 3BC1A 1WE2A 1KKMA 4B34A 3ZZTA 1OKKD 1U0HC 1KDOA 1NBMA 1NY6A 1S3GA 2YINC 621PA 1E2FA 3MJHA 5TVKA 3IO5A 4BFZA 4GZMA 1MO4A 2ZE8A 3X1XA 2F43B 2UZIR 2DFLA 2CMKA 3X1DA 1EFCA 2OFWA 2KBEA 2GAOA 2X77A 3T1TA 3X1WA 3EC2A 1CIPA 1OHHD 2GZHA 4I1VA 4XWKA 1KI9A 4ZI3A 2VSXA 1NLYA 5BYJA 2VA8A 3IBYA 1OE0A 2OCPA 5BQ5A 2YOFA 3V4RA 2YV5A 1IAQA 1Z0KA 2CJWA 2CL0X 1E2DA 2QORA 4RZ2A 3QY0A 2CHQA 4URUR 4RFSA 2V7QD 5L3RA 5C18A 1TEVA 3HP1A 5FTKA 4G1UC 3KB2A 4JSTA 3CUEF 3SBDA 1PLKA 1K5GA 3E5HA 2AXPA 4BFVA 3SJZA 2ZSEA 4FINA 4PAOA 2WPDD 2OHFA 2V55B 2OZEA 4DVGA 4GMXA 1HH4A 2ZITA 1DAKA 2TMKA 821PA 3CH4B 3PG5A 5DSZA 3MSXA 4JVMA 4XVQA 4XTRA 5J4LA 1CJMA 1IBRA 5G3ZA 4LJ6A 1P9RA 4NHOA 1G18A 2R6FA 1YE8A 4Q21A 1YZKA 2ZYWX 1L8QA 1M7GA 3BD9A 3CBQA 2BHRA 1SVMA 3M0EA 4NKRA 3I61A 3T1QA 4LYHA 3KKQA 3TJZA 4X8HA 1V5WA 2D3WA 3I72A 4JT2A 1OB2A 3TIFA 1RRGA 2ZAMA 4ZIRB 1II0A 4TT3D 1X86B 4GP6A 3PFIA 5FH9A 3ADKA 1US8A 4PC1A 5FL3A 1DO0A 1E32A 2P5SA 1VYVA 1FUKA 2A5DA 3PVSA 1GUAA 1I2MA 1J2JA 4MGYR 2KWIA 3GJ0A 2C9OA 4MRNA 4B75A 2VSOA 2MSCB 1H65A 3HPQA 4FI3C 1OB5A 1D5CA 2RGBA 3BS4A 3B5JA 2NO6A 4TQ9A 5DHFA 1ZD1A 2C8VA 4ZPXA 1NVVQ 3T06B 4C2UA 3UG6A 3VR3A 1MABA 2IBMA 4WXPA 1Z6TA 1GNPA 2EFGA 3MLEA 3SJAA 3ZS9A 5DLQC 2ZJ8A 2H18A 1QBKC 2EYUA 5EP4A 2O8CB 2BCJQ 4ZKEA 1H8HD 2V54A 5BYKA 2ODBA 3TRFA 4JJKA 4DLXA 2ZR0A 5FOVA 3KXIA 1UAAA 1N25A 4UXHA 4US1R 3EPLA 1G19A 1ZMXA 2EFDB 3THXB 2L0XA 3GCGA 4EFLA 4PXAA 5P21A 2GCOA 4OHXA 3WYFA 4HAVA 4DCVA 2QTVB 3QNUA 3ZD6A 2FPLA 2ZS9A 2C78A 4TL9A 1LNZA 4AWXA 1ONBA 3NBYC 1X8KA 3QUSA 3R8CA 3KDSE 3K9LA 1PLJA 3AV0B 3CONA 3GD7A 1XEFA 4JKIA 4BLRA 1JR6A 4PAMA 2LKCA 3D3QA 2FDCA 2ZQ5A 3L2OB 3PR1A 4QJ5A 4PZLA 2GILA 3B8HA 4CT5A 3BWDD 4IXMA 1W4RA 4CF7A 4D82A 3DM9B 1N5KA 1JR3D 4IVRA 1NIPA 4UNNA 1Z0DA 5E7MA 4IKEA 5EXSA 4D80A 1E4VA 3T12A 1NKSA 2R6CA 3ZIAA 8OHMA 3LBIA 1VCOA 1TX4B 2V9PA 2GXSA 1SXJB 1CP2A 1N3BA 4H1VA 3SC3A 2D2FA 2W2VA 3I73A 3WNDA 3BJIC 3TUZC 2OE2A 1G7RA 5EE3A 1KMQA 3S1AB 1P73A 2G1KA 4TLDA 3UMSA 3MWKA 2IEYA 4OBEA 1CR0A 1XTIA 3AF2A 3TNFA 1W47A 4A6XA 3B1WA 4W7SA 4PO1A 1NVWQ 2FFBA 2ZYVX 5GJWC 1DARA 1N6HA 3WXMA 1E0KA 3QEOA 1I2DA 3RDPA 4KVGA 1IN6A 3NHAA 1OYWA 3LA6A 1RVDA 3PENA 3PUYA 3FB4A 1QHHB 4UXIA 1AKYA 3GLHB 1TQ6A 3BAFA 4NYJQ 4AY2A 1Z0AA 4PPGA 3CPHA 5AJYA 4M1YA 2DYKA 2QT0A 1Q20A 3VNUA 4JL8A 1U8YA 2IXGA 2DWOA 4LBYA 4B3FX 1EFTA 4QHYA 1CS4C 2A78A 4F7WA 4F4IA 1OH8A 1YZUA 2G1JA 1M8PA 5JWOA 3HU3A 3IQWA 3PUXA 1N0WA 1T3LA 1W0JA 3CF6R 1KO1A 3H4MA 4QGHA 4UQOA 3K70D 1YR8A 2KJQA 2GF9A 3KJEA 2BV3A 4LX0A 4TL6A 2ZS8A 1ZM2A 4C3ZA 1XWIA 3QENA 2EQBA 2ORIA 2REXB 1ZD9A 1N0UA 3HU2A 2ZR7A 2IS6A 4EIWA 2O8BA 3LW7A 2YC4C 2QE7A 4Q4JB 4YDSA 1UM8A 2NO0A 2JJ1D 3LQRA 4G3XA 3U3KA 4C0AC 4DDTA 2WV9A 1OW3B 3QOFA 1A1VA 4RKFA 2CBZA 4DSNA 3RABA 1TL7C 4LHXA 4LK2A 1LFDB 1MT0A 1OLOA 4YXWD 3FKSD 4XTCS 1AN0A 5JSZB 2CEAA 1U8ZA 3MGCA 2C96A 3F0TA 1F3OA 3RLFA 4AKIA 3NDPA 4PC7A 2QT1A 1CJTC 1HYQA 2JEOA 3SR0A 2GETA 3C4JA 1AZSC 5TB5A 1LW7A 1NF3A 3K09A 1E2EA 4D4KA 3WBJA 3DM5A 4IEIA 2RKOA 1E3MA 2RAPA 2R65A 1DAFA 3VR1A 3GLIB 2CL7X 1P2VA 2WSSA 3T35A 2NO1A 1IXSB 3QKRA 2IYTA 4ZCMA 5KDOA 4DB4A 4GNKA 4ESVA 1FW6A 4PC2A 5E4FA 4QNRA 1EFRD 4E22A 3CWQA 3ICEA 4NDZA 4Z1MD 1AS0A 4NH0A 3LD9A 4A8JB 2BM0A 4CEHB 2DR3A 3I4LA 1OIWA 1EX7A 2F3TA 4L9SA 4EFMA 1CTQA 4ERNA 2E87A 4V03A 4RD4A 3MG9A 3KKMA 3D6TB 3UKDA 4ZCIA 1P60A 2RHMA 5JJKA 2J45A 4B71A 4DLTA 1Z6GA 1JQJC 3AQ4A 4EPRA 3I5YA 3A4NA 4JYCA 1AS3A 4NZYA 5BXQC 4QC2A 3SI7A 3RS3A 4YMTA 1VMAA 4B76A 3QF4A 2G77B 2O8EA 3SHWA 3KKPA 4I4LA 2OESA 2PBRA 3CLVA 3L0OA 1W5SA 2VPPA 3LXXA 3NC0C 2OCAA 3CPEA 3R9XA 4HI0E 3TUIC 1JJ7A 4B74A 5FI0B 1XX6A 1HEIA 3EZ7A 1CR2A 5KUTA 4BUJA 3HYRA 1VIYA 3NEJA 3FMFA 1U99A 2WJIA 1IY2A 4HB4A 4LBVA 5GVRA 2PX3A 2W0SA 521PA 3U2QA 2IYVA 4JIMA 2J0UB 3AKCA 4JYBA 3DOFA 2ANCA 1HUQA 2W83A 4V0OA 4RD1A 5B2ZA 3T5DA 5KNCA 5KPJA 4LI0A 4C0HA 3QKUA 1MH1A 2F43A 1UBFA 2OAP1 1W0KD 2P65A 1X1RA 3P32A 4KODA 4EAQA 1KK2A 4LJ9A 4LUCA 3DHWC 1Z29A 3PUZA 3QJYA 1G3IA 2DCUA 1KZ7B 5JECA 1R4AA 3C14C 2H92A 4RCYA 1Q22A 5KSYA 4OQMA 2A3RA 1KZGB 3DOEA 4UNPA 2QN6A 5CIWA 1P7CA 2QENA 3CNNA 1S9DA 4OI4A 4M0LA 3D8BA 1R0YA 3BFKA 3P1JA 5DGXA 5BN4A 5UKDA 3I32A 1G5TA 4CVNA 3FMIA 3RS0A 5EE5B 4BE7B 5GVSA 4LHVA 3SZRA 4ON9A 1KNXA 2CCKA 1AA9A 1R6BX 2IK8A 5C2JB 2WWIA 5CM9C 4BLOA 4D0LB 4QM7A 3QPVA 4Q5IA 4G5GA 2WJVA 1NI3A 2JJ2D 4DIDA 2ODNA 4B32A 1P2SA 3CKLA 4XD7D 4K81B 3HPRA 1LS6A 4RD0A 5F9HA 4DUGD 2FMXA 2ZSFA 3ZH9B 2FJUA 3TAUA 1M7BA 3HDTA 3I8XA 5FPTA 2D4HA 1OIVA 2R62A 1E1QD 2HDNB 4PHHA 4ZDKA 2ZEJA 4M9SA 3A8TA 2VIIA 1PVOA 4MKHA 3A1WA 2P2LA 2HEIA 4V0KA 3RRMA 3TGPA 2AHOA 2Q3FA 1P2TA 2CVHA 2WJYA 2XOKD 1PLLA 4JVNA 4ZIRA 3IPXA 3GLGE 3MJRA 3ZVMA 4PPQA 2WOJA 5DI3B 3TE6A 2EFEB 1E6CA 4BZQA 3GLGA 1KDPA 3IKJA 4OHVA 1EWQA 1S8FA 4HATA 2RGDA 2EVWX 4NCIA 5JRZA 2D7DA 3AGPA 3CPJB 1N5IA 1M34E 1ZU4A 2IA5A 1G20E 2MSDB 5LBIA 4F93B 5KNDA 3OEHA 2WHXA 3K70B 4X8OA 2H17A 3F8TA 4TSFD 1YZQA 4Z8XA 4AI6A 3HYTA 2ONJA 4Q9IA 2XXAB 3BOSA 2XZLA 5J4KA 2DBYA 1G5PA 1GFIA 1XMJA 3OIYA 3RSOA 4JJZA 6Q21A 1QDEA 5KPDA 3O8RA 4AYWA 2QPAA 2O8CA 3U3OA 4JLPA 1KO4A 1NL3A 2NTYC 4IVQA 4KAXA 3LLMA 3LFUA 3NVAA 1VDZA 4Q01A 1N6IA 3KKOA 4TMZA 2OXCA 4K46A 4NU0A 5LB4A 1AKEA 2XZPA 3NC1C 2PT5A 4C0JA 1R10A 3THXA 2QTHA 3CF2A 2J5XA 2J46A 3ZLJA 1F6BA 2KE5A 3AVPA 5FUXA 3AUYA 2IW3A 1OJLA 3TAHA 4KV9A 3QVUA 4MRPA 2CDNA 2AXNA 2FA9A 5D3MB 3IIMA 5AUOB 2UVQA 4TMXA 1U0JA 1KO8A 1RIFA 4PZZA 2YWEA 1COWA 1VHTA 4O3MA 2DPXA 3BFXA 2GTPA 2VP0A 3DZDA 4AYXA 1N5LA 4ASUA 2WWYA 4C0BA 4LJ4A 3GLFE 4HUQB 3IIJA 3GLFA 2WMOB 3SHFA 2FEMA 1U90A 2ZROA 2J7PD 1W2GA 3FTQA 5HE8A 2JLXA 2OBMA 1SULA 1BOFA 2MMCA 4UJ3A 2PMKA 4KYIB 2PT7A 4II7A 4DLUA 1SXJE 2XNDA 4M1WA 1U94A 3IHWA 2ZRPA 2GAAA 4OI1A 3JZMA 4W5WA 3PUWA 1OT3A 1TU4A 3P4YA 1AS2A 1Z0FA 1IQPA 2E9SA 2WVJA 5JFGA 3TMKA 4HB0A 3A1TA 3S1AA 5CITA 3OIWA 1GIAA 1UEJA 4D4MA 2QQEA 3UWOA 4C7OB 1DAGA 4P4SA 2IWHA 4BFWA 4JL6A 4BLPA 2GHIA 1JJVA 2G6BA 3ADCA 4DCTA 3EZ9A 4O2RA 3KXLA 1QHYA 4TYYA 4FD2A 3GLHE 4PR0A 1G4AE 2WZQA 4URVR 4CYMA 1QHHA 2OCYC 3GLHA 4HLUA 3RC3A 2FN4A 4M9QA 5L3SA 3J81k 3GJ8A 3SYLA 1NMXA 1SVIA 4Q48A 4QM6A 2ZRAA 3U7GA 4URWR 4AG5A 1KNQA 3FDIA 1TADA 2GXQA 3BXZA 1OKKA 1RW4A 1OXXK 2R44A 1PJRA 3VHXA 2CLSA 1GAJA 1NIJA 3ASZA 4DLVA 1E2QA 3FMPB 3W8NA 1AZTA 1G1MA 1NN3A 1R0ZA 2CLCX 3HU1A 2VF7A 1K5DA 4WBSA 2D74A 4JS0A 2R6AA 1QVAA 3GEIA 4NE2A 3U7EB 5D3QA 1LB1B 1AJEA 3N2EA 3BK7A 1GRNA 4OKSA 3T1VA 4IOKA 5HKKD 2D2EA 4OK5A 2ERYA 2CL6X 1W1WA 4IJMA 4MYCA 4Q9LA 4BFTA 1DBSA 4QJ3A 1ZM4A 5CYPA 5E95A 1E2PA 4Q4JA 2AWNA 1HURA 1II9A 1CBUA 2RGEA 1X1SA 2ZVPX 1TNDA 1IXZA 3KUDA 5H70A 2A5GA 4GDFA 5EE1A 2HCBA 5JSZA 1QF9A 1CU1A 4I81A 3ZD7A 2H16A 2WPDA 3OIUA 3X2SA 4JBWA 4B47A 3O8CA 2YOHA 3SQXA 1GKYA 3FE2A 3QBVA 1EWRA 3ETLA 1G64A 4WA7A 1NJFA 5GJBA 2Q9CA 3FHOA 3K53A 1P5ZB 4IOLA 1U0LA 2Q3HA 4LJ8A 5EP1A 2VP2A 3KFXA 2ZI5A 1QHNA 4JBYA 4DIEA 3ZS8A 4Q7MB 3AH8A 3ZVNA 2IX3A 2XTNA 3ZGXA 1J90A 1Z83A 4RJLA 2W0MA 5DYIA 3I3SR 1KDRA 1KO5A 4JLBA 2QSYA 4NCHA 3KFVA 3QG5A 3U44B 3N5CA 4TTQA 1X8JA 4DDVA 1Q1EA 1VIAA 3CRW1 5BN3A 3FGNA 1FZQA 3C16C 2NZ8A 2IXEA 1JNYA 3P4XA 4OQLA 4Q4HB 1S4QA 1SGWA 4A8JA 3NEYA 4C9BA 5DN6D 5IDVA 5KTYA 4D2IA 4TLBA 2ZRGA 4BQSA 3HR8A 3T61A 2ZUBA 3BB3A 2CCJA 2V4ZA 3GFOA 2RGNA 3UATA 2A2ZA 1KSJA 3CX6A 3AUXA 3FMOB 1NN5A 1JI0A 4BFXA 1H8ED 2N42A 4M9ZA 4OHWA 2RB4A 5H68A 2ODEA 1XD2B 1VYUA 4OHYA 4Q9KA 2Z4SA 4L9WA 1KIMA 1QHGA 1AK2A 3B6EA 4TLCA 5J4VA 4AIIA 1N6OA 1E0SA 4Q4AB 3KTAB 4NBSA 2FPKA 5KNBA 2DFNA 1XB2A 4CW7A 5FFMA 1BKDR 1TQ2A 4IOMA 4EPVA 4X8LA 4TL8A 2G3YA 1XNJA 4KSBA 3OE7A 4O0MA 3MWYW 2J0UA 1A82A 1IN7A 1JBKA 2YYZA 2PZFA 4R9UC 3K1JA 4BECA 2VF8A 1P9NA 1N5JA 4PSKA 4G5RA 1W48A 2AKAB 1G41A 3VHLB 1S2MA 3L0IB 1WB9A 3ZQJA 2GJKA 1KY2A 3B13B 4V0NA 1E94E 3NKVA 4XJXA 5JJLA 2FH5B 3SU8A 1Q1BA 2ZUDA 2O0HA 2ZRHA 1HTWA 5L3QB 1XEXB 4LYJA 1ZD8A 3UG7A 3R8FA 4DEYA 2A5JA 4TWZA 5FL7D 4F4JA 1J8MF 1UKYA 4EPTA 1E79D 4LWZA 3WYGA 4HLDA 4FCTA 3WRYC 4D0NA 5KO2A 1E9AA 5JEDA 2Z6VA 3QBTA 1JR3E 2A7QA 2XB4A 1XDBA 3SQWA 5GADl 4A2WA 1WF3A 1XU4A 1JR3A 4I99A 1WP9A 2XX3A 1FQJA 4KU4A 3MMPA 3QKTA 2OUKA 3QQ5A 3V4FA 4FIDA 3LRPA 1G8GA 1ZJ6A 4JVSB 2N1BA 3AVXA 3U4QB 4PAQA 5F3WB 2XZOA 3K9HA 1T5LA 1E9EA 2ZU6A 4P32A 3Q8XB 4KFSA 3W90A 4ZI2A 3SEAA 4CEIA 5FOWA 4D6PA 1MR3F 3EZ2A 3VR2A 4QGAA 3R7WB 1RRFA 1Z6YA 3W6PA 5IK2D 1ESMA 5AJXA 2QMEA 4LYAA 1O87A 5JCPA 1ESNA 2CNWD 4TMVA 2ZPTX 3NBFA 1QHXA 4ESHA 1II8B 2EFCB 3DKPA 2QTFA 1ZUIA 1Z63A 3GQBA 4HB3A 3TH5A 1DPFA 2VYFA 1FOEB 5EXTA 2ZR9A 1XXHB 3OAAD 1SXJC 2HCJB 5SZIA 1W46A 1ZM9A 2GNOA 2P6UA 2PL3A 3W3ZB 1S96A 1W49A 2J59A 2PCLA 3FPAA 4LY6A 1ODFA 4IEEA 4FW9A 5K8IA 3B78A 3SJCA 4ARZB 1YR6A 3Q7PA 3KXKA 4IDNA 2W00A 4JBXA 3A1SA 3LVQE 1XTSA 5EP2A 3LX5A 4KXFB 3LLUA 2JCSA 4NP6A 2RHDA 2VSFA 5CLLA 3AVWA 4M1TA 4HAUA 2CK3A 4UNQA 5KSZA 4YQFA 4Q18A 2ZUCA 3SFZA 3KQKA 2XXAA 3PEUA 3U7FB 1XTRA 3JVUA 4HLUC 4HSEA 4QG7A 3BIFA 5SZHB 5FR2A 2ZM5A 1E2JA 4GMDA 4LC1A 1K6MA 3WMFA 3BE4A 5LB2A 4YXWA 4ZV4A 3FKSA 4OJQA 4AURA 4PZYA 2ZE5A 4DC9A 3VKWA 5G41A 2WJGA 2ZTSA 3OESA 2ZRKA 4G5OA 3WY9A 2C03A 4HDQB 5G40A 1T8UA 2UKDA 2IYYA 3Q7QA 2QGZA 1T3HA 2QP9X 1E9RA 3RAPR 3TW8B 1P61B 4IOJA 1UFQA 2XJ9A 4Q7LA 3NG1A 4TMTA 5IT5A 5TY0A 2MMGA 3RC8A 4M8NE 1ZNZA 4R71A 2RCNA 4A9AA 4EJSC 2OBNA 1YZNA 1NBMD 4Q02A 5G53C 5CM8B 1HV8A 3LH5A 4GRAA 2FSIA 3CNLA 4J0QA 4U5XA 4DBLC 4B3GA 1EFRA 4EPWA 3MRSA 4E5UA 4Z1MA 2RGAA 3EARA 4HUQA 5FTMA 1IM2A 2A5FA 3OEEA 5DIFA 3X1YA 4LJ7A 3OFNA 4PO9A 1XFAA 4BZXA 5EQTA 4EQ6B 1OXUA 2FU5C 5C4GB 3VR4A 1KHTA 3C5CA 3H2YA 2J0SA 4WXRA 2IUUA 3THWB 1IXRC 4ZKDA 3EX7C 3RRZA 2I4IA 5E3HA 5G3YA 2J41A 1YKSA 3WNBA 2D62A 3K8YA 3MCAA 3B82A 1J8YF 1E99A 2GWHA 4C7OA 1CRQA 2WJJA 1KY3A 2C95A 4B6EA 2ATXA 4ITRC 4A8JC 4TYWA 3T1OA 3AGQA 3IBGA 1EESA 1R0WA 2H8KA 4XSGA 5AK0A 2NMVA 5FUYA 3A36A 1NRJB 4CT4B 3TR5A 1UJ2A 5CK4A 2OLJA 2RGNC 3NXSA 2ASEA 1GKIA 1LVGA 2DHRA 2FGJA 3MD0A 2CCGA 1EFUA 3ZVRA 1P4SA 5JS7A 3AEZA 1CJUC 4B3XA 5FUVA 2WTUA 5JI2E 4XWAA 3RRNA 1KI6B 2CLDX 3AF1A 5ELXA 1W0KA 1TQDA 3I62A 1FP7A 4LDJA 3SE0A 2QROA 4ACAA 1W5TA 2IF0A 4C30A 1G8HA 5AUPB 4Q4LA 1OFTA
chains in the Genus database with same CATH superfamily
3AL3A 2BFBB 1KP3A 4JJ8A 4LGMA 5IJ0A 3EZLA 5DTRA 1N6NA 5DW0A 1FXWA 1L7PA 2C9YA 4RNDB 1IEVA 1SXQA 1CPYA 4D79A 1PEAA 2FRDC 2GBLC 4KMSA 1RD4A 3KSAC 2DFKB 3RC2A 5DULA 3IIKA 2CJPA 2HAEA 2BFMA 3VO2A 8ADHA 4J3FA 4ER3A 4XW2A 2R96A 4PWYA 1LI7A 3LIIA 4LTDA 5J40A 3E9DA 3NNSA 2VCYA 1V3QE 2BHLA 1O5OA 3EW7A 3L8CA 2WE7A 2ZRNA 4LDZA 3HM9A 4KUEA 4DXHA 1ODTC 1UFVA 3AESA 3DBHB 1S7CA 1P18A 3STVA 2KSQA 3SG0A 4HEA1 4YAJA 1UQTA 5JS8A 1DS6A 3FYCA 4AY4A 1KOFA 4QU0A 5DRTA 2VLBA 2OOSA 5DNEA 3EFEA 5I7FA 3A1DA 1JRLA 3OEWA 4NFHA 2AOUB 2H4YA 3IPAA 5AVSA 4FFVA 3ROEA 2NZJA 3I6ZA 2PKQP 2PKCA 5AWFC 3TKLA 2P7HA 1RCUA 1SZDA 2XSZA 2AV6A 3FF4A 1TZ2A 1Z47A 1MDFA 4L73A 3O2SB 1V6AA 4REQB 1FRNA 1LSJA 1Z62A 2C04A 3FHCB 2J7KA 1NJ2A 2O1XA 2NPOA 3TQCA 3IAUA 2IXFA 4ZI5A 3UOAB 2RAUA 1IZ8A 2X8BA 3F5SA 4WIAA 1EVKA 2Q3BA 2NVUB 1YOBA 2WHYA 1P2UA 1JB1A 2LCFA 1GSIA 2Z5FA 1BGVA 2D13A 4GPBA 2CHGA 2J4CA 4CFZA 4KWTA 1PT9A 2ODTX 2WT8A 3R40A 4M7RA 5CJPA 3D7MA 1JA9A 4C5CA 3B3GA 4PGMA 3PHCA 2GJSA 1KU0A 2IZ5A 5JNSA 2FB9A 1E1RA 4ENRA 4CIDA 4MGZR 1JQBA 3K0BA 4JEUA 2YS7A 4FR2A 1C9MA 3K2EA 2ZSBA 2I99A 2JAUA 5F4BA 4DQVA 3WL6A 4BTLA 1KMHB 4D44A 1X6VA 3C5HA 1Z9BA 1CY4A 2FGKA 2J0EA 2NO7A 4ZOBA 3EDMA 5KWSA 1ZHHA 1WV0A 1Q7CA 1JKMA 3UHAA 1GNTA 2GF0A 3ANNA 4S1TA 2AR0A 3KIPA 4UU7A 5L4SA 2D5IA 2FSGA 3T5GA 4YBZA 2FPPA 1CUHA 3IVRA 1GHTA 4MWZA 5DCWA 1PG5A 1WPRA 1WIWA 3HP7A 1MX5A 1SQ5A 2AMVA 3OQIA 1JQ5A 2X1MA 3H5OA 5ALOA 5HDBB 4X65B 1M66A 4IIJA 421PA 3JV7A 4TXLA 3K0SA 2JCVA 2JIDA 4QU9A 2IH4A 3FBGA 4UBLA 3W5DA 3EOBI 1U0BB 3OIVA 3U31A 1YK1A 2CXUA 3GUHA 2BWJA 3W6UA 2CXRA 2WFLB 1Z2PX 1YR7A 1CB0A 1Y3FE 3G17A 3RO7A 4EFNA 5A6VA 5F7OA 1U7DA 4RZXA 4WN3A 5L3QA 1OI3A 5J2UB 1WA5A 4V3CA 3UAXA 2P1DA 3T9BA 4Z86A 3COSA 2I2AA 5TJ9A 3PEEA 1ZUWA 1KXZA 3QBDA 3IP9A 3P27A 3HGQA 1A2QA 5DISB 4ZAXA 4RJIA 4C29A 1U2SA 2BC9A 1Z6ZA 2H59A 4Q3OA 4N5DA 4R9NA 4WUVA 5ARBA 4RF3A 3KTOA 3LWBA 2M9MA 5AIBA 3GRAA 2FW8A 3EBOA 4BATA 4HAYA 2B8WA 2FSFA 3UPDA 1E1DA 1I3NA 2G08A 1GUDA 1SZJG 3TDNA 3QUCA 3ZBPA 1NYQA 1YMQA 1WNTA 4I3FA 5AKZA 1ZVMA 2PSSA 3T95A 3MELA 2QS9A 1DXOA 1FTNA 2DPGA 2R97A 1AK9A 1BHO1 1OIXA 3HMQA 3MMZA 5F9FA 4J1SA 1EB8A 3KO8A 1JQEA 3I0NA 3L8YA 4BO9A 1EPUA 1TMGE 2HZBA 2IDKA 4LY0A 3A6PC 4JBNA 2R6DA 1FYDA 1RM3A 4D9JA 1JEYA 1J42A 4MVJF 3NBZC 2HRCA 1RQNA 3F78A 4CNBA 4TOIA 3DBLA 4D9NA 5B12A 4LFBB 1AQLA 2X1LA 3K1AA 4O29A 2Q3LA 1LH0A 3NHSA 1EHYA 4M86A 2QAIA 4Z3KA 2GRJA 4JWTA 1DTSA 3B5EA 1RZ3A 3B1XA 5ILGA 2ZBDA 1ZGZA 3DBIA 4MLDA 4O33A 4N0EA 2XYPA 2JLYA 5IAAA 5IYZB 3C1TA 3FSGA 4QBHA 2V6GA 1QGZA 3DMHA 2ZIAA 1NVDA 3AY7A 3OHMA 4YDQA 1SBZA 4Q7KA 3A2NA 1I13A 2GGSA 2B7BA 2SCUA 4JJEA 3N2YA 4XFDA 1WF6A 1KERA 4Z4IA 1IUOA 2JCBA 2ZTVA 3HWX1 1AQNA 1U9IC 4E3ZA 1DQYA 1D2EA 2XDQB 4QARA 1ND6A 5FBLB 2IU6A 3IQGX 2I80A 4JGIA 3H99A 1GZSA 4UE2A 4YK7A 3THOA 4PQRA 4GBMA 1N7GA 3PEVA 2B3TA 2NU9A 2X8WA 4ZHQF 2OMEA 1Q50A 3LI2A 1C4OA 2X42A 4JZKA 2DU8A 4LZOA 1DZ3A 2KW5A 1SKAA 1U0FA 3HZRA 3RIXA 3O8QB 3ZW7A 3OFJA 1PJ8A 4PE5B 3PT5A 4KJXA 1GEGA 2QVYX 1BE6A 4QPPA 1NUAA 2DWUA 2UDPA 3JQFA 1B0ZA 4YCJA 2KI5A 2G9ZA 1NOJA 3SM3A 3DMNA 5B7QA 4YAUA 2I3ZA 3A4VA 1UBMS 1G7CA 3AUAA 3NH6A 1BN6A 4MGIR 5AI0A 5A4JA 1GAXA 1C7EA 2HX1A 1HDGO 2NV0A 1YZ3A 1KTIA 2VPWA 3HB0A 1GDDA 4KO2S 2IUTA 3BXGA 3WIVA 1M1UA 1ULUA 1MGOA 2W6JD 2OL4A 1CZOA 4HDAA 3UKJA 2BFWA 3NKFA 1XQ9A 2XZDA 3KKEA 3SYNA 5AVYA 3UWDA 4IRUB 5BUSA 4QJ4A 1JEQA 1Y9JA 5EFOA 1UH5A 5FO0A 3SBOA 3OOEA 4RCZA 5ALVA 1SKBA 3HA7A 3O31A 2DGDA 1PHPA 2O3SA 4Y2UA 2X4LA 5IFKA 4QA9A 2Q46A 3LVRE 4PQFA 1STOA 4PG5A 1UIMA 4OJNA 5IH3A 4I1IA 4BP9A 4QULA 5FX2A 1DV1A 3FCYA 3RR2A 1SIOA 1QLJA 4LX8A 3ZDBA 1S01A 3QBJA 1FDSA 2Z1MA 3NM6B 3ZCUA 3H13A 1P0CA 2EC5A 2JLQA 5TPWA 2QLTA 4KGZA 1NKTA 4IS3A 4EO9A 3SVTA 1KS2A 2QQGA 3O3NB 3O73A 5EZYA 4W5RA 4ACBA 3PI6A 1H1TA 1A8IA 5DN6A 1GL9B 3GFVA 3PKIA 1W9MA 1WMBA 5CU7A 3ZWOA 3PWTA 4MVCA 5B3AA 4I8DA 1PK9A 3V4VB 1NW7A 2AT1A 2PL1A 3NWBA 3EAGA 4KLNA 4MLCA 4EQ6A 2YS6A 4M1ZA 4MVJI 1QGDA 1D2MA 3V7UA 1FX0B 2R7AA 5BNZA 3RAFC 3LHSA 3U7HB 2GJ4A 2W6ID 1JNXX 2YNMA 1NAHA 2JAHA 3ZD9A 4JC5A 1YTUA 5I3CA 4A7PA 1RBZA 3KWLA 2I87A 5EIOA 5BMVF 2GEUA 1JJBA 3KJHA 3USES 2P0EA 4BBPA 4FFMA 1BE8A 1T8YA 1CETA 2FLVA 3UMGA 3B3JA 1HFEL 1TMKA 4L5BA 2GXUA 2ZGVA 3H2BA 1YQGA 2HJGA 4PV7A 4Y0AA 1ZRNA 1OFUX 2O3UA 5CLGA 5ILQA 4IFBA 2GZDA 2VUSA 4ZALA 3EMBA 4MX8A 4RSRA 4BVKA 2AVNA 1V37A 3I28A 3VU3A 2PFGA 1U8CB 2CXXA 3DMGA 3IC5A 1CUDA 1ZWLA 3I58A 5TDHA 3WZMA 2XYQA 1H2ZA 4DE5A 1Z07A 3T7RA 1ZVQA 4BV8A 4URXR 2JLZA 3OFVA 2R6JA 4MUYA 3LRXA 4OQQA 3JQ7B 4BCDA 4WOJA 3TVYA 5C46F 4LZPA 1U1IA 1RI4A 1DHTA 2I66A 5EZQA 3WWZA 2VPQA 2ZANA 2PJRA 1TYCA 4TV8A 3ZLBA 1KI6A 3ZG6A 4Q03A 1VGQA 3F9RA 3ZV4A 4JODA 4HQ6A 2VHEA 1OHHA 3IQEA 1IUNA 3U3RA 5C52B 1GSOA 4C4AA 3HKBA 1YE5A 4UM9D 1X1QA 3CLRD 2H9IA 3UCXA 2BBSA 2PFKA 2QUAA 2AQ8A 2QTBA 4R9SA 3ENKA 3IESA 2RIPA 1L5LA 2F3UA 3LF2A 4O8CA 3TS1A 5IF9A 1EYZA 2AR9A 2F1HA 1XMIA 2OILA 3M6VA 3QVLA 2WAOA 1UWLA 2CFRA 3ILXA 3ADOA 1YQDA 1EVZA 4FC7A 4LBZA 4PLTA 4RDHA 3NP9A 4ES6A 5KB3A 3V2IA 1LBSA 3IKMB 4BNVA 1S9HA 1TT5A 3OEHD 4F4HA 2DQYA 1E2KA 3PJGA 4W82A 1VOTA 4J0GA 4GI3A 3ES9A 1CY1A 1T34A 4NNJA 4X00A 3UMRA 4FDAA 3W4JA 4U6SA 3W8EA 1UFOA 2IOQA 5DXAA 6YASA 2OY0A 5TQ0A 2H48A 4WLNA 1YU9A 3PUVA 5EUBA 2HJHA 3OI7A 1QZXA 4XDZA 4K9PA 1VJ0A 3UYKA 4TLLB 5JT1A 2F1KA 3F97A 4M0DA 4LRUA 3CYFA 4OUKX 1JSZA 4XUCA 1SA0A 4N5IX 3NHBA 2CSXA 4M22A 1E2NA 3COJA 1P2DA 2A94A 4JAVC 2ZAGA 4X1OA 5I48A 4KFCA 2CLOB 3KOMA 2HV9A 2YBEA 5IK2A 2X1VA 4Z9AA 1IHUA 5KNLA 2GF2A 1CEXA 1PFYA 1SHKA 1PJLA 4LE2A 2JFHA 1N92A 3LPNA 2YDXA 1LPPA 3G02A 5TQ2A 3T3DA 3BH7A 2JKYA 4I6EA 2V9CA 3KAJA 2C0PA 3JWGA 4P4NA 2EBUA 3QY9A 4M21A 3T5AA 3BRQA 5CVDA 5EFZA 1GOTA 1SOUA 2GVDC 2AI3A 3DHVA 3VC7A 2WQZA 2RH9B 5LKRA 4WJLA 3KYDA 3EQ2A 4PFSA 4QU8A 3HXPA 3MJ4A 3W5JA 3QKRB 9GPBA 1EG7A 3DSRA 5CCDA 5LD2B 3QSYA 2I6GA 2XUPA 4LQLA 3OX1A 4MYSA 1ZMTA 2CWWA 3ZKWB 2PZEA 1PS9A 4DS3A 1Q7TA 2GZMA 5D5HA 3BILA 1UP7A 4F6RA 3ZNOA 4WNIA 1E3LA 3TD2A 3LCUA 5HOQA 4Y3UA 4XE5A 5JI3E 2VO1A 2JFGA 5CVEA 5AOAA 2BY4A 3QMVA 1JHXA 1NVVR 1Z4MA 2P4UA 1L5NA 3TB6A 2ID9A 4QYXA 4ENQA 1KETA 2WKSA 1IOZA 5TR9A 5DM60 1NJ5A 3M4NA 4S04A 3CEJA 4H3HB 7ABPA 1YB4A 2R6HA 2VNAA 3JWPA 1NRXA 3A37A 2J4FA 4XOIA 2ADOA 3WL8A 3HFGA 1CRPA 2XCQA 1FMLA 3MGAA 1PR9A 1T0PA 4D9GA 2O2GA 1O97C 3FLEA 2D5BA 4QBFA 4D0RA 2O8EB 1VP3A 2IT1A 3V2HA 3L6DA 1B14A 1U0OC 1VXOA 1KR2A 2ASVA 3JYNA 4N6GA 4ZT4A 4HN4B 3ZLTA 4M0PA 3NT4A 4R69A 2EX4A 4QPZA 1E77A 3F96A 1FK8A 5THXA 3CVUA 3FN4A 4X41A 4BRSA 5DBHX 5TNXA 2WV7A 3TOXA 4HNAA 4RSGA 2FE1A 3CGWA 1P1CA 4E1VA 4WCFA 4CGZA 3WHKA 4KSCA 1BGXT 5B53A 4QFMA 3DPIA 1T6BY 3SLGA 3VU9B 2YXBA 2B82A 1R00A 2PX6A 3LKZA 1JLLB 1GZ3A 1L4FA 3E3OA 3I6IA 4KJZA 5IM5A 1ZBDA 4MRMB 1KZYC 2B8TA 4A0FA 3GZNA 1ULSA 4K9KA 2F55A 4QTTB 1ESZA 4ZVKA 3IPLA 3WDKA 3UAGA 3EUWA 4XEUA 1V35A 5IMBA 3ZNPA 3IAS1 1ZVKA 3AVVA 1C3OB 3GLKA 5CFMA 1LX7A 2ZWAA 1JA0A 1CR1A 4Q3LA 4NTZA 3M3PA 2VQSA 2VTBB 1L4EA 2SBTA 1XZIA 3LM8A 2C7OA 6PFKA 1YCHA 2WMYA 1E3JA 4IR7A 1ZC4A 3GZJA 3REGA 1U2PA 4KLCA 4IJQA 3RSFA 1P7PA 1E0AA 1E2GA 4IY1A 2Q9AA 3EXFA 2UYGA 4QDUA 3ST7A 3WGHA 4TXHA 4JI6B 1WWKA 2OVFA 4RPGA 2UZAA 3PCTA 121PA 1M5TA 1VCMA 2B4QA 4F3CA 3BE8A 3EWAA 4EY4A 2WIFA 3G2IA 4JDPA 2JHCA 5DX0A 2R2AA 5F5LA 1GPYA 4IDAA 1G38A 4CMCA 1CKEA 1FFSA 4F5DA 1B3RA 3ILVA 1NW4A 2Q4OA 4M1EA 4TUYF 3A6ZA 4GOLD 1V9LA 3PWZA 1R8QA 3V4PB 4ZREA 4YTEA 1JEEA 2EBWA 1NMZA 1BXGA 5FT9A 1PZGA 3DP9A 3UXMA 2FPIA 3SZ3A 3OCXA 3HCAA 1FSSA 4ZQIA 4D4HA 3QU4A 2Z6UA 2G5PA 1KK0A 1DUVG 4XIJA 3OX2A 1DQSA 3OTHA 1JXMA 1OFUA 4GOKA 2B1RA 4CRWB 4Z8YA 3OC0A 2COUA 4K6FA 4PCLA 2EWVA 4TM7A 4IHQA 4TLMB 1VDMA 1DCKA 2RGRA 1UUFA 1XTQA 1RJEA 1BS1A 3EW9A 1T2NA 2YN4A 4MPTA 4ZI7F 3R6GA 4IDFA 3CB4A 1QPGA 3N76A 3UICA 4INZA 2IXAA 4UTNA 3QYPA 1ZSNA 2GI4A 4AFNA 3OHPA 4A1OA 3V7FA 1HFKA 1B2RA 3AIMA 5AJTA 2ST1A 4AQYB 2JFVA 1P8AA 4FMBB 1GRCA 3WNVA 3T3OA 4HBGA 2PHZA 3PXXA 1GTG1 4I4TA 4JVLA 4MULA 4A03A 2JJ1A 1TU3A 2XHEA 5CH8A 4EG1A 2OENG 1TVMA 4NJEA 2GK4A 2A9RA 1IPEA 1ZESA 3DR5A 2IGBA 5ALRA 1HA3A 1R5OA 3I8OA 3PQCA 3MWLA 2ZAOA 3GPDG 4M53A 4CTMA 1N3YA 3L92A 1WHSA 5D7BA 2Z2ZA 3RIEA 4ENVA 2ZVDA 3K8QA 4L5CA 4B7AA 1W1UA 2XOXA 2EL9A 3P26A 1FRVA 1E64A 1THMA 4O59O 3W0LB 2PH1A 2ZBGA 3QF7A 3GI1A 1BCSA 1JPJA 3E48A 4E7PA 4DLSA 1GG2A 4L0QA 3G5TA 4B2LA 4BLQA 1T8SA 4YQYA 4GI1A 5H3LA 4CM8A 1UZAA 2ECKA 5CVCA 5KNBD 2I33A 3LC0A 1L5KA 1L9KA 4UBKA 1R74A 2ZCVA 3AEUB 4MQBA 3D9QX 3GCWA 3OZCA 4V0QA 3ZHOA 4PYJA 2FOXA 2OMKA 3R9WA 5LOVB 4W5OA 3T7TA 3U3MA 1YGYA 3QKSA 2Q3MA 2WAYA 1TO2E 2LIVA 1UOPA 5FJJA 4BLUA 4DC1A 1ND5A 3K0CA 3L0BA 1QWSA 4OL0A 1QFMA 3IRVA 5AKIA 3W6NA 3GEHA 2PLRA 1OFVA 2YJTD 4IDQA 1LGYA 3P94A 4URYR 2UAGA 5FTJA 1Q77A 1HR0B 2FQYA 1RQLA 1VMIA 2VK1A 5EHNA 1TGYA 2VTKA 2J5QA 3RUDA 4UAUA 2VBCA 4MQ5A 4UU0A 2HADA 2IP4A 1KAOA 3VPCA 1GSHA 2IY9A 2YMQA 4YJHB 4MQEA 3YASA 3SWWA 3NBAA 4NU6A 1BHQ1 3WL5A 4FMDF 2JI4A 2Q50A 1KI8A 1VYTA 2BJVA 2FPGB 3Q85A 3OZDA 4K9MA 1SUIA 4MTCA 4DEXA 1XE3A 2PNFA 4HNVA 4B8WA 3KPYA 3B89A 5CB0A 1OC4A 3L04A 4X6YA 3AKEA 4MUNA 1MO3A 4M0EA 2PMEA 4A5OA 2BKUA 2QQ0A 3ZUGA 1IWPB 2AFIA 4QDJA 1K08A 3P9IA 1UBTS 1ZNYA 3DZJA 9LDTA 3FFWA 4G1FA 4L1KA 3SE7A 3VOAA 1CULC 1DELA 1N6LA 2X0RA 3DEZA 3EWIA 4MKXA 3G2MA 5AIAA 1EA5A 4F91B 1GZHB 1J1UA 5J5CA 2GS9A 2QAGC 2Y8EA 3L1VA 1QV9A 2G80A 3LW8A 3QUBA 2AG5A 3H8SA 3UWSA 4U2CA 5JLJA 1Q0PA 1Q1GA 3AP1A 1GYRA 1CVLA 4HNGA 4LF5B 1GFZA 2GK7A 1P0IA 3JY6A 1DBWA 2P9TA 3TFWA 2YZNA 2PM8A 2OAEA 1VC2A 3F3MA 4MAAA 2BMDA 1NVAA 3H6HA 4KIFA 4AJJA 5AW9A 2Y1EA 2ZJFA 4PNZA 4BB0A 4OQNA 1UPBA 3EULA 1XRLA 2CJXA 3HUFA 1V8ZA 4QATA 4WNCA 1R8YA 3B9QA 2C4UA 3PTZA 4MA5A 3V9AA 3D3KA 3HHEA 3ZGYA 3D7SA 4BNTA 2WJZB 2QAJA 5L3SB 1CLUA 1MIOA 2O4UX 5CCBA 3HCEA 2AX4A 3CNOA 3U3JA 4YR9A 1F9AA 1W44A 2GJAA 3P45A 4OYLA 4UTZA 3ZDQA 5BP7A 4ZARA 3TLEA 3UJAA 2W2QA 2R0QC 1A72A 2GZAA 4R1OA 4OX9Y 1GL6A 4RY8A 3VHXB 3NIFB 5JAIA 3MHPA 1VLHA 5DM1A 1YB1A 3BTUA 3JARB 2C94A 4IIVA 1DAMA 1VPDA 1EQUA 4E32A 4OGWA 2HLHA 4XYLA 2JLSA 1Y1QA 3BXHA 4B9AA 3LDAA 3VR3D 4AG6A 1ZA2A 5CA1F 3KQPA 1NPTO 4BCCA 4U8HA 1AQYA 4TPKA 1EIWA 5F2KA 1UDBA 4RLSA 3S27A 5FHRA 3WBBA 3H11A 3EMVA 1NI4B 3GJ4A 4WCFC 2Y2UA 1E9DA 2BMFA 3TK1A 3JWIA 3I2IA 2XXJA 1A7UA 1PCXA 3LUBA 4XX0B 4YMIA 3UWKA 5FUQA 4XGKA 2O4CA 4WK4B 2B94A 1I4TD 2R85A 3QEJA 3JW8A 3CRMA 3I04M 3DPSA 5IBPA 3WYNA 3ZV7A 5MN5A 3WLJA 2HCTA 2JJ2A 3HDJA 1ISIA 4PAWA 2JGNA 2AE1A 1PFUA 1ZIDA 1MJNA 2EG5A 2J6BA 1UKEA 1YJQA 4OYHA 4PIPA 3GX1A 1CJCA 3CLUC 5B4VA 3C7AA 1XNHA 3B3AA 1KEWA 3L7YA 2CVPA 4IDHA 3VKHA 1XNGA 4RQUA 3DTVD 2VP6A 1CUIA 5CR9A 2DKOA 1R5NA 4KDRA 3VJRA 7REQA 4KR6A 3GP5A 1R15A 2ZQZA 1I7PA 1VCNA 3OZGA 3V4ZA 1XZPA 4H59A 1MC5A 2I55A 4MNTA 5LU9A 4DDWA 1O96A 4W5JA 2P2CA 3ESXA 3JALA 3JQAB 3Q1KA 2C7VA 4L07A 4L72A 4QT0A 5EJIA 5JSKA 3AVTA 2FTKE 3C6KA 3B7GA 2BRUA 3PKZA 3KLMX 1QGUA 4WKGA 3G82C 2RD2A 2HT6A 3K0FB 3IUQA 4O25A 5SZKB 4HYTA 3WE7A 4ZANA 3KJXA 5JXGA 2EBHX 3NONA 3EVNA 4O2BB 3NT5A 3LDHA 4O2LA 4BFYA 1ZXLA 3OEED 1BCRA 2OOKA 4R2WA 2WNSA 2FZWA 4AJNA 2ZCUA 2XRZA 1ACMA 1P1FA 4V0ME 4OP2A 2EJTA 2QMOA 1ZVVA 4B84A 2GEJA 2BE7A 2MYPA 2G28A 4YLEA 3A9VA 2ZSKA 1Q6ZA 4KB5A 4LNUA 3UMJA 1WDLA 4RIHA 3FDFA 5ALLA 2HPZA 1SEPA 1SOWA 3K9GA 5KX5F 3EWSA 3EEOA 1Y6RA 3EAQA 4RDIA 3S28A 4HDRA 1OFHA 2AW3A 2VKQA 4I8IA 4JT4A 3R7DA 5F76A 1QM5A 3R6WA 3L1IA 5B1SA 4BLSA 4DXAA 4M89A 5AJWA 5HW0A 3U61B 1P0MA 1YDGA 1XQ6A 4CL8A 2HA0A 3KHUA 3QPAA 3VC1A 2BN4A 3UO8B 1S8NA 3CIOA 2P4QA 1K63A 4MV3A 5B7NA 2HQSA 2GN9A 3ZQUA 1GG9A 2F3PA 5EESA 2FR8A 1OOEA 5IH7A 3C8MA 5FOTA 4N12A 4AUEA 2EP8A 2VWQA 2GJ8A 2YN0A 3AJDA 1XEXA 1KIAA 4PG8A 3HY3A 4XDYA 1YRYE 4ETNA 5B3JC 5KKAA 3Q8LA 2EQ5A 3PV0A 2PA3A 4RE5A 3UB2A 4D3XA 2QDKA 4XJVA 2I1WA 4UM7A 3L7NA 4PZEA 1DAEA 2E55A 2OLKA 2F1OA 4RVNA 3SQMA 3U7QA 4B2PA 3LX8A 5KSWB 5LMNB 1XCMA 4YVFA 1M2JA 1FNCA 3WGQA 4A36A 2CL5A 5E7QA 3EGXB 5HCNA 4CV2A 13PKA 2IHUA 1SZPA 1W4CA 2QLMA 5LZ4A 3GVHA 4AMUA 1M75A 4K6HA 4IGIA 1Q15A 4LRXA 4CF4A 2O5CA 3DVAA 4XOUA 1ZM3A 4MGKR 3KUXA 2EHJA 2H7YA 2D8AA 2PVSA 2QE7D 2Q4TA 1E2IA 1JIIA 2RKBA 2JGEA 1I80A 3QNMA 5K2OA 2RHCA 2RH5A 3I2YX 3T5CA 2J85A 2ZI4A 3HN6A 5EJ7A 1W36C 2J3QA 4KREA 1CJBA 3H9CA 3CJTA 1H2RS 4CR8A 1D1QA 1JH8A 1Q1NA 1HPLA 4KFRA 4ZVPA 4CMBA 4LJRA 1XR3A 1JT2A 2WABA 1T4GA 1EFLA 1GL3A 1NMYA 1Y81A 1EZ4A 2I71A 4AJIA 3CURA 4TMFA 4CLOB 2BH2A 1FBNA 3FAKA 3TZBA 5I4IA 5FTNA 4WFQA 4NCJA 3WDMA 2BP7B 3IDQA 1GT91 4XXHA 3COZA 3CUVA 5C1BA 1XHEA 4KWEA 1ISFA 2L82A 3D4PA 3NC4A 4B3IA 1ID1A 3D02A 4N54A 5DM0A 4XR9A 2GKSA 4P4UA 1WBBA 2OEPA 2VHVA 3H9UA 1PZNA 5G0WA 1A9XB 1P77A 3HBLA 4AO6A 1BS9A 3WLHA 2C4WA 2XSZD 2Y27A 3EXG1 4QXMA 2WOOA 3ODPA 3ZE2B 5K01A 1UK6A 2GZ3A 1N2EA 2QZSA 2GFQA 3IV9A 3FHTA 4DV6B 4XWOA 1MA3A 1U2ZA 3GQBB 4LK3A 1YFJA 4LWQA 5FOSA 1Y4DE 1MRNA 1VE7A 1W52X 2MOKA 4MRVA 3EVAA 2YL2A 3UYLA 5COQA 4DR3B 2C3YA 3LPMA 3EXIA 5FEUA 4K9LA 1MD9A 2G7ZA 1M2VB 2VPZA 3T3EA 4J1QA 1NE2A 2ID8A 3OZUA 4WLFA 5FYDA 5CA0B 3F9CA 1MW8X 3KR9A 4UTVA 4BO3A 2V45A 3TBKA 1IDOA 4E09A 3BSYA 4OYYA 4PANA 1RYFA 1WXWA 2CFCA 3LL7A 3OQPA 5AHOA 4AS1A 3IHLA 2NZWA 4R31A 1E1RD 1FXUA 4CG3A 4N48A 4BL5A 1FDWA 3IVGA 1FC0A 3EWNA 4B40A 3BZWA 3PPWA 3ZHXA 3RWOA 1FLDA 4JOQA 4DY4A 3T8YA 4DLWA 3RT1A 1EMDA 5KSPA 1EK1A 1NJGA 1MJHA 4R7GA 3WSTA 2Q5JA 1DQRA 1KRHA 1YNSA 2XVZA 3N53A 1JUDA 4R2KA 1MO5A 5BW8A 1R3DA 2O5VA 1S6YA 4DCMA 2HF8A 2XW6A 4WD3A 2QUJA 2WA1A 2NT3A 3E3NA 4MSUA 4XYMA 3KBOA 2GYVA 3JATB 4H6PA 3WLNA 4RDXA 1EBFA 3GCDA 3HO1A 2NACA 4KQMA 1WW8A 1FU8A 3KP1A 3RVQA 3X3HA 2CHFA 5B2EA 4YIHA 1BFDA 4OEHA 1Z7EA 3C5WP 2XCUA 5AO9A 2V3VA 1LDYA 4OB7A 3V6MA 4DREA 3AP2A 3OEYA 4F96A 5K3OA 5HGXA 1FFHA 2ZT6A 1I32A 4PS0A 1JPUA 2DY1A 4DSOA 1TPZA 4CFYA 2WQ7A 3GW8A 3N8HA 3RC7A 5ECDA 5J63A 2ISQA 5DHUA 2K7ZA 5IF3A 3DL2A 4TYNA 2Q2OA 3DMDA 4IHJF 3UVEA 2CFSA 2Q21A 3KQUA 1RAAA 3LDFA 3ICWA 1TD1A 2J87A 5BSHA 2G4VA 2Z56A 3THWA 2LDBA 4GKAA 2YXLA 1SHZA 2CHVA 1R6VA 1B16A 4KIJA 3LPCA 3NWPA 2NP7A 5JTUA 3UJ6A 3MILA 3PXAA 1C9YA 4JJ7A 3CNHA 4TV9A 1Z2NX 4ROTA 4V0LA 2QTZA 4B33A 1H22A 1PR0A 4M55A 1TMOA 4EBBA 1ORRA 4WVLA 4UEQA 5DBEX 3F49S 2I7XA 4CQLB 5C3MA 1X7GA 1MOZA 3QPCA 3GA0A 3MWFA 4LDQA 3QUAA 5AVWA 4QGBA 4Q1FA 4DIOA 5KOHA 2YN2A 3C3JA 5L40A 2X4GA 1P81A 1A27A 2PD6A 1WXQA 3QG1A 4LF8B 1FE8A 3L5OA 2OHIA 3M3HA 4OUDB 3UJ7A 2AE2A 3RU3A 1D6JA 3NIBA 2JCGA 4KK3A 1GGNA 2XWBF 4ZVTA 3EXAA 5K8TA 1M6YA 1M1NA 1TQ8A 1L1QA 3FNIA 3E03A 1KDVA 5ISMA 2BUBA 3KL2A 4RM3A 3TLMA 3WFJA 3G0CA 2WM8A 3G13A 5EIXA 3HKCB 3KQOA 4DW8A 3TNJA 1W29A 1ZIYA 3VISA 1ZEMA 1N34B 4NMWA 3OQOA 3MGKA 4J91A 4GKJB 5CYGA 2VK2A 4MV1A 1ZINA 1KRXA 1E9BA 2HWWA 4P7KA 4J7UA 5JNUA 4DDHA 1UT8A 2PMBA 4KC0A 3P71T 2VOEA 3AUFA 2AD5A 5KNDD 2WD7B 4HJRA 4QLOA 3R6DA 3HACA 1T5IA 1PJ2A 5FNVA 5JZOA 2UZ3A 1L5QA 1ISHA 2NUPB 1WU7A 2OM2A 5G1PA 2IFTA 4BAZA 4EHHA 1NQAO 1UZUA 5BOVA 4UM8B 2O8BB 3D4OA 4E1BA 2YHIA 4R8SA 4R2HA 3QVVA 1Q14A 4QQFA 1NFRA 4CKEB 1L5HB 3J7TA 3V8VA 1MP0A 3JRWA 1BEUB 1SD5A 1EAMA 5FPKA 2FZKA 4MJ7A 3O47A 4TZKA 221PA 1E7WA 2IOFK 3FCAA 5CW2A 4ZVMA 2J3IA 3NP7A 2GSWA 2RBKA 1YMVA 2QG6A 2Y0CA 2I2DA 3U4IA 1Z7WA 4QXAA 5K0LA 3QELA 1Y9EA 5JROA 1U9YA 2VJPA 4OOEA 5JRJA 3O4RA 4FMCB 1QYDA 2FNAA 1F0YA 4BTEA 2W2MA 3DBRB 2GUWA 2W58A 1TF2A 4KWIA 4ZQHA 1LBHA 2X6TA 5T57A 4MWCA 3MK31 3WBKA 1UPFA 4UTPA 1T1SA 1C7QA 4GVLA 3E82A 3FOAA 3IAFA 3KE9A 1DFIA 1IH8A 3QLUA 4YB8A 4E2ZA 2NO9A 1BTOA 1TAGA 3PJRA 4C21A 1TAQA 2PG3A 3AYZB 5CURA 1Q0UA 1XZAA 2WMDA 4CW7A 3EC7A 5C1OA 5EZSA 3O93A 1OA1A 2D54A 2OCBA 3WLLA 1D2AA 1D1TA 1E9SA 1X3LA 3NTXA 2V7TA 3SVLA 3ZI7A 1L8OA 4YAWA 5CVVA 3HGMA 1OY1A 3K15A 3KZXA 1IZ7A 4M8LA 1DEOA 2IYLD 2ROQA 2CLKB 2YW9A 1E7SA 2WT9A 3VHQA 3WTBA 4BFCA 3AB3A 4Q1VA 1UC8A 4M87A 1VKOA 3TTYA 4Z49A 5AW1A 1MBZA 4R1LA 4L4YA 5EE9A 1C3JA 1J06A 1DEAA 3W5SA 4ZK2A 4KPEC 4G4JA 4ZVQA 1ODJA 1OYYA 2OHJA 4MR9A 2XNDD 1JHZA 1VECA 1PG0A 3M33A 1SY7A 5K20A 1POXA 1HYEA 4JSYA 3D3WB 5DSTA 2GD2A 3BWEA 3G5LA 5JG7A 2AI2A 1R4NA 1T3SA 4QGGA 1Y1KE 2DUNA 3FVRA 3VBEA 5C8YF 5IVKA 3VUFA 3X1MA 5AD1A 2IYSA 4WZAA 1PSWA 2Z2JA 3RU2A 3U9SA 4LC9A 1BH6A 4DSAA 3VO8A 4NC9A 1RQRA 1YE3A 3D1LA 1PGQA 1I6LA 5EZ5A 4D4LA 3Q88A 1XSEA 2ANBA 2VZLA 2WUEA 4FBMA 5G4KA 2OV3A 4CKCA 3GJ5A 1L4UA 4IXTA 2CUZA 5T67A 2Q6TA 3ZEAA 2WHPB 3T1NA 4EKDA 1HNNA 4EMBA 3HK2A 4M0KA 4I14A 3Q87B 7MHTA 3C3KA 2ONYA 2FZ4A 4DB2A 1YVRA 2ZIGA 2DLDA 3QX8A 4FEEA 1XJ0A 1N7IA 2QBYB 3UMCA 3KVYA 5LFAA 4FYYA 3GFSA 1WE2A 1KKMA 3CWCA 4YJ3A 5FBZA 1KDOA 1S3GA 3IMFA 4MCJA 4IBOA 2ECFA 1PL6A 1MO4A 2VDRB 4FPXA 3O4IA 2IE8A 2I7DA 3BGSA 2UZIR 2CLHB 2DFLA 3X1DA 4MIKA 1EFCA 5BVHB 2OFWA 2AJTA 2KBEA 3CKYA 3EQ9A 3KOYA 2GAOA 3SXUB 3X1WA 3D8RA 3EC2A 2FJ0A 2Q49A 3RG8A 1OHHD 4I1VA 3HUUA 2BL4A 3VDXA 3OMLA 2RARA 2DOKA 3IBYA 5FP0A 3NEAA 1KMNA 2YV5A 5C80A 4FFBA 2CJWA 4K86A 1E2DA 2N0SA 3WK8A 1YB6A 3QY0A 4ZVLA 1T8WA 2HDOA 5L3RA 1VBFA 1TCAA 3OU7A 5C18A 1JMYA 1JKIA 4CFSA 4ICIA 1KR5A 2CSUA 1K5GA 2AHRA 4G4SP 2QY6A 1HYGA 4FINA 4Z2AA 1ISSA 2V55B 3MLAA 4DVGA 1GGHA 4QG3A 821PA 1BJTA 1XJWA 1OR8A 5A03A 1PJ3A 4RKRA 2PZMA 1K4KA 3AETA 1P9LA 3HADA 3SXJA 3WLKX 4JVMA 5HUJA 4L7VA 1U2QA 4BJHB 4N8DA 3ZY6A 4MUFA 2GRAA 3WGGA 2A4KA 3LXMA 3SPXA 5A3JA 1P6QA 4LJ6A 4UPDA 1UXJA 1P9RA 4NBTA 5AQEA 5HX7A 1JDZA 1P2BA 1N3LA 4IDCA 2HFJA 4BLWA 3PDCA 2OHXA 1YZKA 2ZYWX 1YS6A 3G23A 4QVGA 2AF4C 4Z7JA 4EKGA 1I24A 5MFZA 3A1CA 4HP8A 4RANA 1PWEA 1DP4A 4NKRA 4FP9A 2B0JA 3BQMB 4YP9A 2HREA 5DHQA 3ZCTA 2D3WA 2Q3DA 1NMSA 4JT2A 1CQJA 3HTXA 4QPNA 2D2XA 3TIFA 5JH7F 5EG5A 4IMPA 1JI3A 1I01A 4IMJB 3DFMA 2XECA 1WCIA 1X86B 4GP6A 5DI3A 3HDGA 3IEPA 1RYNA 2I5PO 5C34B 2QQFA 2YW2A 3ADKA 3UJHA 2P4EA 2Q0SA 2XQFA 1WCYA 3TO5A 3DFZA 5KQMA 1YDMA 1F8XA 2VDMB 1D2GA 5E6SB 4NY1A 5HJ2A 1CUBA 4MGYR 1J2JA 1XDUA 2GM5A 5EJ9A 4C4TA 2EL7A 1Z17A 1H65A 3ESCA 3L6EA 4RKYA 5HDQA 4BGUA 4E5MA 3D0KA 1D5CA 1P1HA 2RGBA 2FK7A 2WYHA 3AUKA 2B99A 3C3CA 3FUUA 4PZ9A 4TQ9A 4ZPXA 4ZQEA 4B80A 1PYGA 4OMCA 4DCOA 5JCOC 1EQ2A 1MABA 1RPJA 1KORA 1Y7IA 2Q0QA 1XC7A 4D43A 2A0XA 1PZEA 4MWDA 3PSAA 3SJAA