4NYJQ

Approach for targeting ras with small molecules that activate sos-mediated nucleotide exchange
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEASAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Approach for targeting Ras with small molecules that activate SOS-mediated nucleotide exchange.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nyjQ00
3B60A 3RWOA 1JR3A 1A1VA 3WY9A 4ON9A 1R2QA 2ORVA 4Q4HA 3EAQA 4OHYA 2C9CA 3UMSA 3I8XA 4E07A 1P6XA 3M4YA 1GM5A 4K81B 1F5NA 4FCWA 1KI1A 4NL4H 4FXPA 5SZIA 2QL6A 1UBGA 3SHFA 1F48A 1OJLA 3X1WA 4B3BA 2CBZA 4TTPA 1P5ZB 3VR1A 3PEVA 3EZ9A 1RW4A 2ZI7A 1ZC4A 5GVRA 1FUUA 1CR0A 1NKSA 1XMIA 4IFBA 3VU9B 4Q1FA 1NF3A 4KODA 1R0XA 1W5TA 2J9RA 1R8SA 2JASA 3LX5A 4C30A 1A5TA 2XSZA 1WB9A 1NVXQ 3QI2A 2GNOA 1G291 2QA5A 4QGHA 4ZIRB 1TF7A 3MLEA 4FWIB 1W36B 4RZ2A 4YMUA 3AP3A 1E2FA 1XRJA 2RGNA 2W6IA 2IUSA 1FZQA 2XEXA 4C2TA 1OFHA 2CJWB 3SJAA 1E2MA 2DPXA 3OEHA 4KFUA 1YQTA 4Q7LA 4QGGA 4AKIA 1AN0A 2BBOA 2QMUA 2NO7A 2ZI6A 1XEXA 4QHYA 4TQ9A 1U8ZA 4DLXA 4CEJB 3T15A 5L3RA 2Z5FA 4NYIR 1R0YA 1E6CA 2NGRA 2W6JD 1E9DA 3N2IA 1KJYA 4WA7A 4OQNA 3UMFA 5K8TA 4NYIQ 2C99A 4R98A 4EJSB 4AI6A 2IHYA 2ZRHA 2W6JA 2IS4A 2I3BA 3IQWA 4M9ZA 4QG7A 4OQMA 1COWD 1U94A 1CBUA 2QQEA 1PZNA 4DC9A 1UDXA 3K9NA 4PPGA 1ZD9A 2C95A 1N6KA 4WAUA 4EUNA 2P5TB 2IT1A 4GP6A 1TNDA 4TQUS 2FU5C 3OZXA 3OEED 4M21A 4DSNA 4LSGA 3VKHA 4NCIA 1ZM9A 4L9SA 1ZRHA 3BH6A 3K1JA 1CXZA 4IVPA 2HT1A 1IQPA 1E9AA 2YVUA 1TU3A 1LY1A 3WRXC 1H8ED 4QM7A 3NG1A 2DFTA 1OLOA 2WPDD 3AVYA 1KZGB 2A5FA 4PHGA 2R62A 4KITB 1HUQA 2XNDA 3MFYA 1KI2A 4A8JB 4XJXA 4UXJA 1YZTA 2LCFA 3H1TA 4LHVA 4TWZA 1M74A 2G3YA 3A1TA 1W5SA 1YZQA 2NIPA 1E2JA 4KI0A 3TUIC 3WBJA 4ZDKA 4C0QC 3QNUA 2ZRNA 2IYZA 4U00A 1RYFA 3DKPA 5FBRB 2ZJ2A 3CONA 2ZQ5A 2J59A 2P6UA 3TQCA 3BFVA 3U3OA 4M22A 1VYUA 5FUYA 3THYA 2OFOA 3AF3A 3EZ7A 3CKLA 2A5GA 3VKWA 1A7JA 4R7ZA 2WAXA 1XCMA 3NH9A 2A78A 1KO5A 2VF7A 1CEEA 1W36D 1QDEA 3O8RA 2QBYA 4H1VA 4V0MA 4UNRA 4DLTA 1KO7A 1XNJA 4TMXA 2IX3A 2ZVPX 2WV9A 4RFVA 4GZLA 3KDSE 4C9BA 4NONA 2OBMA 1CR1A 3DL0A 3RNLA 4E5UA 4LOAA 1NN0A 3QF4B 4JSYA 1ZC3A 2DR3A 4A0GA 2OZEA 3DM5A 1Q44A 1US8A 2QEQA 1VCMA 2BJVA 1FP6A 1WA5A 2FSHA 2KI5A 2ODWA 2PBRA 2HXYA 3C14C 5FTKA 1DS6A 3GEHA 2VSFA 4CIDA 2ZRIA 3C16C 2EWWA 4E09A 1KMHA 5KNBA 3CRQA 3ZVNA 4ZDWA 2AXNA 1OE0A 1VG0B 2XTNA 4U5XA 3KJGA 2P6RA 2GXQA 2BVNA 3CR8A 2EYQA 3FFAA 2RHMA 2HF8A 1R5OA 1CULC 1CJUC 4KAXA 5TMPA 4C0KA 3CPEA 2IS2A 1P60A 2GWHA 5JRZA 3OFND 4XVQA 2GZDA 2IYQA 1NMYA 2PT5A 4Q4AA 4TMKA 4BRUA 2BV3A 3VR2A 3LBIA 3FOZA 2OILA 4V03A 1GNPA 2IYSA 3QVUA 2QP9X 2EFCB 1E32A 1IXSB 3G0HA 3UWOA 2Z6VA 5H70A 1C1YA 2ZSDA 3B1WA 1KKMA 2JATA 2YWGA 5JCPA 1ZNXA 1ESNA 1XD9A 4B3GA 4A36A 4DKXA 2G1JA 5P21A 3L43A 2F9LA 2J7PD 2ORIA 5JWHA 5HKKD 4IDOA 5KSYA 2XTZA 3EC2A 4M1MA 3SS8A 3AP2A 3M1IA 4BQSA 2H1LA 1RJ9B 3MJRA 3QUSA 2D4HA 3QKSA 3SHWA 1EGAA 4FINA 3W8RA 1VMAA 2IXGA 2JAQA 3HYTA 2H16A 5FUVA 5GVSA 1BKDR 3IILA 2CL0X 4HUQA 2DFLA 2RMKA 4HAUA 2XOKA 1UBEA 5DH9A 3VFDA 3K8YA 5FOSA 5FBVB 5C18A 2A9KA 3TR5A 4OI2A 2B6HA 2WWHA 2X2EA 3B5JA 1KSGA 1ZBDA 2NZJA 3K9GA 4P3YA 2IYWA 3GJ4A 1QF9A 1I4DD 4W5HA 1BS1A 4US2R 3KJIA 1BH2A 2CCGA 3DZDA 3NH6A 2MSEB 4LI0A 4G3XA 2IYTA 4DJTA 1MKYA 2BMEA 1H8EA 2V4ZA 5EJEA 4TZ6A 4TL8A 4Q19A 4EQ6A 3KKPA 2QT0A 3Q3JB 4V0ME 4QBFA 3U44A 1D9ZA 1H8HA 1GDDA 1XD8A 4JYBA 5KPDA 3I5XA 4B2LA 1Z47A 2EFGA 3BORA 4DRZA 3V00A 3KQUA 1NIJA 1ZYUA 3IEVA 5LB4A 4DZZA 1SULA 1T0JB 4TYPA 5JJKA 1Z6AA 4HAZA 3SQWA 4YXWA 2V3CC 3EWSA 3SQXA 4RCZA 3TR0A 4PC1A 5HR5A 1J90A 3L0IB 1UM8A 2YKGA 1P4SA 4KBFA 4V0NA 1G21E 4LYHA 2QE7A 1ZNZA 4YMSA 4EPTA 2ZAOA 1UFQA 5TV2A 3SFVA 2O0KA 2KWIA 1L7VC 2XNSA 2ZRLA 4KO8A 1CRQA 2QGNA 4DDWA 3D3QA 3HDTA 3MG9A 1E0JA 3EXAA 4NYJR 3WRYC 4X8OA 4BFTA 4Y0VA 3WYGA 2AR7A 1OHHA 2KE5A 3WNDA 3O47A 4PAOA 4YMTA 1ZVQA 5FTMA 4PHFA 1NG9A 5CDFA 2VP5A 3MWLA 5CM9C 4EAQA 1Q3HA 2WKRA 3LAWA 5GJVC 2GK7A 4NMMA 3TSZA 5FH9A 3T1VA 4IDQA 4OQLA 4XWAA 1XDBA 2CL6X 1G3RA 3K0AA 1DAIA 4JYCA 2RAPA 3KXIA 5FL7D 4ZKEA 3RS0A 3CX6A 3GEEA 1KI4A 4WZ6A 4AURA 1E1QD 2EYUA 5JRJA 2G9NA 1JR3E 4JT4A 4OI4A 2ZJOA 3KQHA 2ZU0C 3A1UA 1NVVR 2XJ9A 1OFIA 2FEOA 2YOHA 3QKTA 3A4MA 1YR9A 5JEEA 5L8VA 2HXSA 1KIMA 1MO5A 4BGDA 3HPRA 1W4CA 3OIYA 4IDNA 4IXMA 5AUQA 2LKDA 2YV5A 3O8BA 4KJZA 2Z4RA 5SZKB 3RVBA 2YJTD 4DLWA 4ZCMA 2ZANA 5J5CA 3B82A 1UPTA 3GFPA 1JECA 4Q18A 1OV4A 1ANKA 1XD2B 1AK2A 1XMVA 2VTKA 2W0MA 2GJ8A 1EFHA 2P6NA 1E4YA 1KOFA 1G3MA 2C5LA 4JJKA 1XB2A 2GEVA 1M1YE 3CNOA 4JT2A 2RGCA 1F6BA 1PVOA 1VHTA 3FDIA 3KL4A 1KI9A 2JLSA 1GKUB 1G8HA 1RRCA 1XJ0A 2VH5R 2IYUA 3E2IA 3DDCA 1XZPA 2NO9A 5FBQB 2FFAA 3QQ5A 2A2ZA 3VU9A 3U7HB 3FMIA 2X8AA 2CNWD 1E9CA 2W6ID 4FIDA 1F3OA 4D4MA 5J4HA 4A92A 5JECA 1CJMA 1XCPA 4LWZA 2EQBA 3VAAA 3WMFA 5CB6A 3GLFB 4A15A 1KI3A 1QVAA 1VTKA 2AL7A 5J4YA 5KHOC 1WE2A 1N6LA 1JXMA 3CPJB 4JLJA 3B7GA 2H17A 4UNQA 1DAKA 2PL3A 1NRJB 1GRQA 1XBTA 2J0UB 4PSVA 3I73A 4GDFA 2ZJAA 2GXUA 2P3SA 2WWYA 3ZIAD 2WWWA 3ONWA 3QPVA 3ZD6A 2YZ2A 3KUDA 4OKSA 1T3SA 1HE8B 3QIAA 1JNYA 1UEIA 3GJ5A 2OAQ1 4HEJA 4DUGD 4B32A 2R6AA 4RD4A 3KZ1E 1N6OA 1N6NA 4FCVA 3GPLA 2BM1A 3UPUA 2CLDX 3L82B 2YC4C 3TUJC 5DHAA 1SXJA 1FFHA 1ZIPA 4KYUA 4Q9IA 3U3RA 4M1OA 4HATA 2GZAA 2YINC 2N1BA 4M1TA 4PZYA 2EFEB 3ZDQA 1OYWA 1XWIA 3P32A 1FP7A 2A5JA 2FWRA 3NC1C 4CW7A 1Q1QA 5KSZA 4ZCLA 2FPLA 2CCKA 4B47A 3QPWA 2CVFA 3JZAA 4PXAA 4M9QA 1G7SA 1ZUIA 2ZS9A 4II7A 4PO9A 2YOGA 1F60A 3LBNA 2MSCB 4TLEA 4PZZA 2RHDA 3KTAB 5IK2A 5BN5A 3C7KA 1AS2A 1XTIA 4RZXA 1WDTA 5F98A 2RGDA 1R6BX 2QSZA 3MWJA 3P4XA 5CITA 3B1ZA 4YLGA 3W6NA 3BJIC 3CM0A 4OHZA 5B58C 2IYRA 3BAFA 3HJNA 5UKDA 3WNCA 5G3YA 5L3SA 4BPBA 2G1KA 1DO0A 1Z08A 2B21A 4HLCA 3U60B 4OHVA 5A5GA 1UDWA 1E79A 3I62A 1F2UB 3FHTA 2PJZA 3GLFE 1NLFA 1NSTA 1OKKD 1SHZA 3LVRE 1CJKC 3OEEA 2GETA 4QC2A 4AC9A 1G3UA 3W6OA 3ZZTA 5L3VA 3FKQA 4Q4JA 4F92B 3FMOB 1JR6A 2B92A 1ZNYA 5FR1A 3U4QA 1QHHB 1VECA 4ZKDA 4C0HA 3EIQA 2Z43A 3P1JA 3KB1A 4URVR 1BOFA 4N0DA 3CH5A 4WXRA 2J46A 4Q48A 2ERYA 2A5DA 2GVDC 2HUPA 3AVVA 5L3QB 4JLPA 2MMGA 4HUTA 4DVGA 3LQQA 4A6XA 1T4GA 5CM8B 1JPJA 2I4IA 4HSEA 5JFGA 2HLDA 3NBXX 2OXRA 4ACBA 4B3FX 2X77A 1GOTA 1Z5ZA 4DCUA 1OXTA 2CHQA 1QHYA 4OQXA 1KI7A 4PPNA 2BBSA 3X1YA 1XMSA 3E70C 1E2QA 1G4AE 821PA 3KQLA 4JL8A 4O0MA 1GTVA 4ZDIA 1AGPA 3U7FB 3GJ6A 1E1QA 1W4AA 1N6RA 5FPKA 1LW7A 3T12A 1W4BA 2FJUA 2QI9C 2WWIA 1DELA 4GRAA 5M04A 4QFMA 3SZRA 4ESVA 3MSXA 4D0NA 4P4SB 3RYTC 1YJ5A 1S9HA 1T6NA 3FPAA 1TF2A 2WJHA 2GZHA 4IRUB 1IN5A 5EUQB 2ERXA 1Q1ZA 2OLJA 4BUJA 5EXXA 1DVRA 4XVRA 5EE9A 3P4YA 5IDVA 1JALA 3PENA 5K8IA 3PG5A 1FX0A 2DBYA 1PUJA 2IXFA 1Z6XA 3SDZA 4CVNA 1CJTC 3IPYA 1SZPA 1KK1A 2GCPA 2XAUA 2IW3A 2ZSBA 5D3MA 4DXAA 3JVUA 4JZKA 4JMPA 3THXB 2G6BA 4LDJA 3TMKA 1KAOA 2FSGA 4QJ4A 3VR6A 4M1WA 2OG2A 1VIAA 2VEDA 4PO8A 4QOSA 4HAWA 4Q03A 4F4CA 4CEHB 5J4VA 3CNNA 1CP2A 5A0FA 4D25A 2JLRA 2QPAA 4GOXA 1D5CA 4TQAA 5EP2A 4DDTA 3PEYA 2BBTA 3LY5A 3LWNA 3K0EA 4NH0A 5F3WB 4TZ0A 1G6HA 4LYAA 3U61B 2OBNA 1ZP6A 2FDCA 1JEDA 1OXXK 2OFWA 2PT7A 1L4YA 2VQSA 4Y0AA 1E2IA 2JIZD 1SHKA 1J8MF 4YMVA 1NLYA 5HCIA 4R2HA 1FQKA 1EESA 5HCNA 2GESA 1S2MA 2IC5A 1KDTA 3CF0A 4AWXA 5CB8A 1NY5A 1WXQA 4KXFB 4O25A 1MRSA 1MABB 2AK3A 1P9RA 1K5GA 3SU8A 3T5GA 2QTFA 4ACAA 2OCAA 4NHOA 1NVWQ 4IOJA 1MO4A 1N0UA 3PV0A 1SVMA 2GBLA 3AF1A 1GL7A 1G5PA 3L0PA 4TLBA 2VHTA 1DTSA 3AP1A 3QBTA 3TAUA 4DT1A 2JIZA 4ABYA 2V6IA 4HUQB 5G41A 2ZUCA 3IDQA 1VHLA 3AF0A 1G18A 4B75A 2WTUA 2WJVA 5E4FA 1JAIA 2E9SA 1UF9A 2D3WA 1U98A 4TYQA 1R10A 1Z0FA 2NO6A 4LJAA 3GFOA 4KFRA 1IN7A 1QRAA 3PUVA 4TT3D 1CF4A 2NZ8A 4MRSA 1OB2A 4C0BA 2RGBA 5KO2A 3A6PC 1OF1A 1N2CE 4JBWA 4ZI3A 1DO2A 2B7CA 2ZYTX 4AY2A 3M0EA 5C46F 1NNEA 3KKOA 1Z07A 1Z0DA 1BO6A 1KAGA 4JVNA 4UXIA 4KLNA 1TL7C 5L3SB 2ECKA 1N6HA 3PUYA 2Q3FA 4HDCA 1XJCA 2MMCA 4AIIA 4DEYA 5BYJA 4PAMA 4LJ4A 5FOWA 4XTCS 5F2EA 4HZUB 2O8BB 1D9XA 1M7BA 1IAQA 2DWOA 2IXEA 3KJEA 3AEZA 4WZAE 4FN5A 4MITA 2F55A 2O8EB 3QXSA 2ZRDA 2OCPA 1NIPA 5DISB 2FE4A 2RGGA 4LBWA 1GL6A 1TQ4A 1FOEB 4Z1MD 1RIFA 2GAAA 2WJIA 4EJSC 3AKDA 3C15C 1BYIA 3B1VA 2PMKA 5FBLB 1DOAA 4ARZA 4PFSA 3U3JA 2A30A 3K9LA 1O87A 1Q0UA 2O8DB 2QMHA 1QZXA 4EFLA 2QP3A 2QU8A 3QKRB 1TX4B 3K0AB 1LS1A 4PO1A 3QY0A 3RRNA 4QJ5A 4LK2A 2OT3B 1NN3A 4TLAA 2WIBA 2IWRA 5F9HA 1E9EA 2W0SA 1Z63A 1QHSA 5FPTA 1DADA 3GLHB 2OUKA 3GFTA 4B6FA 1D2EA 4BFWA 2PZEA 3OAAD 4PHHA 1RRPA 1YU9A 3K0CA 3OE7A 4CF7A 4G5RA 2ZRFA 1CLUA 2OSBA 5LPNA 3HPQA 2JCSA 2P2LA 4OI0A 1S3GA 4A8JC 1TPZA 2VP4A 4EJSA 2FX3A 3AUXA 2WWFA 4C0JA 4Q21A 5JS8A 4DHEA 5EE1A 3JVVA 4GFDA 4PC6A 1ZMXA 3ZVRA 1VCIA 1S1MA 2FMXA 2ANBA 5DO9A 1LV7A 1CTQA 4UQOA 1NKTA 1LFDB 4OK5A 2ODEA 4YQFA 1A4RA 1OIXA 1SXJC 3I72A 4MGYR 3IBYA 4JLOA 4BZXA 5FPSA 4F7WA 2R9VA 3GJ3A 1K8RA 4XSHA 2JLYA 3F8TA 2FSFA 5CYOA 3Q5EA 1FNNA 4YDSA 3BC1A 1E2PA 4MYCA 1QHGA 1PUIA 1YRAA 2QSYA 4CGZA 3AVQA 4HDOB 3RS2A 2IYVA 5DYIA 4ZCIA 1U2RA 1EK0A 3O8DA 1XPRA 2DB3A 3IKJA 2ZUDA 4D0LB 1AS3A 2GCNA 2WOJA 5DGXA 1XXHE 2QQ0A 1X8KA 4GZMA 4KFSA 2OHFA 1BIFA 1XJQA 1R7RA 1C4OA 2CHGA 2K5UA 4LJYA 4E03A 4PZLA 1AQYA 3EZFA 1FTSA 1E0SA 1S3SA 1KJZA 2GBLC 4GI7A 4LGMA 4A2WA 3CZPA 1Z06A 2FN4A 3OF5A 4DEXA 2HJVA 5G40A 2DHRA 4RKEA 5JZVA 2WICA 3A58B 4B34A 1X8LA 3RABA 3SJBA 1G64A 1P9WA 4I99A 4NPHA 1OT3A 2RB4A 4RD3A 2CCJA 3BH0A 2XXAA 4AYWA 2BCJQ 4UJ3A 3NDBB 2QG6A 1P2TA 4DCVA 4TL7A 1LS6A 4AD8A 2OM2A 3A1SA 3B13B 4M4SA 1YRBA 1ZM4A 1MOZA 2H8KA 5FR2A 2EWVA 2XNDD 1RPZA 5D3QA 1VG9B 5JWOA 3K0CC 1Q20A 3QG1A 4W7SA 3GLGB 1N5JA 2KSQA 4D80A 3D8BA 3SJZA 4MKHA 2V6JA 3BBPA 3EZ6A 4KU4A 3IIKA 3THWA 3DHWC 1CU1A 3Q72A 4PQRA 5G3ZA 1HTWA 3SYLA 4XSGA 1WF3A 4I1OA 2XGJA 2ONKA 2QGZA 1FQJA 1SVKA 3OEHD 4G0NA 1XU4A 1XD2A 4B33A 4FMBB 2QY9A 1ETUA 4JSTA 4I1UA 2D62A 1G5RA 2YWFA 1XX6A 3JZMA 1RRFA 2PX3A 3ZQJA 4JKIA 1XTRA 4G5GA 4Q4AB 3SR0A 3N70A 3RS5A 2BMFA 1KDOA 3UG6A 4A6PA 4BLQA 2F1RA 1NVUQ 1HY3A 4XTRA 2O5VA 3QEOA 6Q21A 1KSHA 3I8SA 3GLFA 2Q9AA 4QGFA 1E9BA 3FHOA 1UKZA 4DSOA 2F1IA 4JLKA 2FOLA 1RE0A 2NG1A 3B6EA 4BFUA 3A4NA 2ASEA 4XD7D 1MRNA 1T91A 1W2HA 2PCLA 1GVNB 2W83A 3ZGXA 3KKNA 3C8UA 4Q7MB 1DPFA 1X86B 4B3CA 1E2HA 1R0ZA 1OIWA 4OK6A 3PUXA 4QL3A 3SOPA 2PCJA 3TSWA 4D4KA 4WIAA 4DB2A 2R6CA 3CUEF 1E0AA 5BW8A 1C9KA 2VRWA 3QKSB 2XSZD 2VHQA 4B73A 2ZEJA 2ZRCA 4Q4HB 3GP8A 1VCNA 1W44A 4KHZA 1QHIA 5D3MB 3GLGE 4B44A 1JAHA 2VLIA 1EX7A 4G5SA 4RD2A 1S9DA 4XOIA 4A9AA 1ZNWA 1HQCA 2ZXUA 2QBYB 3ZD7A 2FGKA 1WBBA 3NHBA 4H1UA 3REFA 5C4GB 5DNYB 4QKQA 1Y3AA 4UNPA 3AV0B 1WBDA 3B8HA 3WBKA 3QJYA 1E2GA 2GKSA 2A7QA 3R20A 3BERA 4EPRA 2GTPA 1D2MA 1E9FA 2ZE6A 3OIVA 4G1UC 3B85A 1KY3A 3CPHA 4JBYA 4LC1A 4RD0A 3CNLA 1W0JA 1GRRA 2GILA 2WPDA 2X19A 3D7MA 1UEJA 3IO5A 1ZUNB 1TAGA 4PC2A 4FW9A 1G17A 2GCOA 1KSFX 1XEFA 1IBRA 2QM7A 5JLJA 2CE2X 3TRFA 5L3QA 1NP6A 1R8QA 5ELXA 2JLUA 3RANA 2PEYA 1W47A 2HT6A 1PLJA 2WMOB 1E69A 5HE8A 1E2NA 3GJ7A 2QRZA 4YONB 3LLMA 1FUKA 2V54A 2HV8A 1LTQA 4CRWB 3LXRA 3NXSA 2O8CA 4D4JA 2FV8A 2QPTA 1MO6A 1IOZA 3IGFA 2HF9A 1SVWA 2O8FA 1HT2E 1DAEA 4LCBA 4I81A 1U99A 3C5HA 3LV8A 2ZI5A 1A82A 2ODNA 2GVZC 5E7JA 4TN1A 5DHFA 4RZUA 3P26A 2BM0A 2FF7A 1EFUA 1N0WA 2C9YA 1XPUA 4NP6A 5EP4A 3ASZA 2PZFA 4NYMR 3S1AA 1FMLA 4B2IA 3K70C 4QJ3A 4G5QA 2ZREA 1IY0A 1RJ9A 2C78A 3IIMA 1OH5A 4LJ9A 1VG1A 3U4QB 2AHOA 4QBHA 3X2SA 2FFBA 1WCV1 2XJ4A 2R6FA 4Q9KA 2ZE5A 3WNBA 2FA9A 1KJWA 2GEUA 3QBVA 4US0R 5DN6D 4HB2A 1UJ2A 1YZGA 4X8HA 2NMVA 3MMPA 4HLUC 4BLRA 1MR3F 4PSKA 1MH1A 4LZZA 4Q9JA 3TVTA 3FYHA 1I4LD 2VSOA 1T5LA 3HYRA 4C2UA 1MV5A 4UNNA 5CIQA 4RCYA 1A2BA 5FOXA 2GCOB 5EUMA 4B35A 4X8MA 4FI3C 4V02A 2GDJA 1SVIA 1P73A 5KNCA 2XITA 3BE4A 1HT1E 2C77A 3AM1A 5BQ5A 4F93B 221PA 4OL0A 2FFQA 2J45A 4IEIA 3MGCA 1IJEA 1YZUA 4O2LA 4J0QA 4HAYA 4Q66C 3ZJYA 1ELOA 4Q9LA 1KSJA 2IEYA 3NIBA 4MYUA 2HYDA 1U9IC 2VYFA 2ZR0A 4Q4JB 3AVTA 3QXCA 3NKVA 4S2EA 2IF0A 1E2LA 3KKQA 1II9A 5DSZA 4JIMA 4JS0A 2JLZA 1M7HA 2XX3A 3MD0A 1GKIA 1D6JA 1UKVY 1GP2A 3EC1A 2HLDD 621PA 3QF4A 2QTHA 3DMDA 2R6GA 4BECA 4LV6A 3UIEA 3VNVA 1ZUHA 5KDLA 2ZYVX 2R6DA 2AWNA 4EPWA 4Q9HA 4Q7KA 3GEIA 4OK3A 4V0KA 1KKLA 1NBMA 1IN6A 4URWR 4IJMA 4A0FA 2ZR7A 4ZO4A 4TYYA 1N0VC 1KK0A 4FMDF 4KVAA 4QBIA 3RAPR 3U5ZB 4CEJA 1W0JD 2YNMA 1BMFA 3OE7D 1S8FA 3W34A 1P2VA 1W48A 2YWHA 2FH5B 4W5WA 3A1VA 4QM6A 4DLRA 1XCGB 2V9PA 3IO3A 4LHYA 1AIPA 5JJLA 2REOA 3TE6A 1FMJA 2BJWA 2CJWA 3B78A 4WBSA 3WP0A 1W49A 4DSUA 2BMJA 3REGA 1HEIA 5FOUA 2W2TA 3C41J 1ODFA 3H2YA 3PXGA 1XXHB 4RFSB 3MAAC 1ZM2A 3EG5A 5F9FA 4QGAA 5TDHA 1Y63A 2JJ2A 3TJZA 2VA8A 3NC0C 3EPHA 3THXA 5DI3A 4LBYA 1KMHB 4BZPA 1U0HC 2V7QD 4RSGA 4AKEA 1B23P 4YMWA 1LF0A 5FTLA 2AXPA 3GJXC 4JL5A 3S1AB 4TSFA 1KGDA 2ZUBA 5CK4A 3ZZUA 2AD1A 3K70B 5LD2C 5FFMA 1UKEA 3TKLA 3RSOA 1RZ3A 4LYFA 3EPLA 1KDPA 1E2KA 3O8CA 2WKPA 1E3MA 3J81k 3MJHA 2H18A 2BIFA 2VPPA 2CK3A 4OBEA 5BXQC 2FNAA 3AQ4A 2FZLA 1RFLA 4DUGA 1G4UR 5BN4A 3GMTA 3RHFA 2QN6A 4M9SA 4P4UA 1EFRD 2YOFA 5JEDA 3SI7A 1NVVQ 1Z83A 1ZU4A 5KUTA 3K9HA 3CH4B 4MGKR 3Q7PA 3A4LA 2JLWA 4C0AC 2QZ4A 1GG2A 4LJ8A 2C2HA 4B6EA 4ARZB 1SKYE 1M2OB 1Z6YA 2IK8A 2P0EA 3IIJA 3OIUA 4KV9A 1P7CA 1T3HA 2CE7A 5B64A 4LBVA 1WRBA 3LDAA 4OHWA 2ZJBA 1LVGA 3H86A 3GLIA 1E98A 4LBZA 4NCHA 3SYNA 2D2FA 2QORA 3T1OA 4BLPA 1XTSA 1YZNA 4Z8YA 3R9WA 1FNMA 1Z28A 2F3RA 3IHWA 3FFBA 4NYMQ 3AF2A 2WVJA 4ZPXA 3ECCA 2X1VA 2QROA 2WJJA 5TARA 1U8YA 2PMDA 3DVLA 4TMWA 3H0KA 3NBFA 1UAAA 4BLTA 2R65A 4BASA 2IL1A 2OE2A 4GP7A 5JHGB 3ADBA 4MYTA 3ZLJA 2OEPA 1AQUA 4ERNA 2L0XA 2RKOA 4PQFA 4BFXA 4FMCB 2GA8A 1KNQA 1W0KA 5EZ6B 3TNFA 4I1SA 1SKQA 2DFNA 2YYZA 4RY2A 4GOKA 2Q3HA 2VSXA 3RLFA 1YHNA 2HCJB 2QE7D 2J1LA 1NJFA 4HAXA 2WKQA 3A1WA 4KBGA 4M9XA 3PFIA 4ITRC 4MYHA 4AG6A 1EWQA 1ZU5A 5EE0A 1HYQA 3LRPA 3BH7A 3EW9A 3LFUA 1DAFA 1GRNA 2GEDA 5FOVA 1XPOA 1DEKA 4D82A 5E7IA 1KYIA 1G16A 2J87A 4OHXA 2G0TA 1IY2A 4DLUA 3KFVA 1GFIA 3ZZ0A 3M6AA 2PH1A 1JQJC 3LH5A 3LLUA 4EFMA 4FWTA 4CYMA 3QXJA 4P0TA 2V8OA 4FMCF 2AN9A 4P4TA 1GIAA 3H4MA 4WVFA 4A0RA 3LVQE 2ZE7A 4LPKA 5IHPA 1X6VA 3IPXA 3OIWA 2XOKD 4IVQA 3MUFA 2XXAB 4LRWA 2IUUA 4LJ7A 1DARA 2ZAMA 1G7TA 1TTTA 1GSIA 2OLKA 4B43A 1TF5A 2IHBA 4TMZA 5JCZA 1Z6GA 4L16A 3EWAA 2AK2A 1NLZA 1YKSA 4OJQA 4W5JA 4A82A 5DYGA 3PEWA 3T35A 4Z8XA 1S0UA 4JVMA 2CNWA 4ILEA 4BFVA 4HI0E 1G1MA 2RGNC 3LA6A 4JBXA 1RVDA 4CEIA 4NZYA 3LXXA 4PAQA 4LUCA 2WJYA 3FHCB 5ANRB 1BMFD 4PC7A 3ICQB 3GJ8A 3RRYA 1UBFA 1Z8FA 4QRHA 4RZ3A 4WXPA 2GHIA 2REBA 1QVRA 1AS0A 2C04A 2JGNA 1ESMA 2QAGC 3F3YA 3UG7A 1Z2CA 4X8LA 3WHLA 4LV8B 2HYIC 2G0NA 3FGNA 4A0HA 1GUAA 2BC9A 2BEKA 3CWZA 2BCGY 3QXXA 2ZYWX 3PIRA 5EZ5A 1VKJA 1T8TA 2CK3D 1W2GA 3L8ZA 5CYPA 3K53A 4DSTA 3U6BA 2JLXA 4GMXA 4GT1A 4GPTA 2Q9CA 3OFNA 3UKDA 5HZKA 4C7OB 4RJLA 1Z0JA 4Q00A 3TSOA 2ANCA 1OXUA 1NL3A 4F4JA 2C9OA 2IYXA 2ZS8A 4JLMA 2ODBA 3UK6A 1L8QA 3ETLA 4C0LA 4KLZA 3R7WB 2CHVA 1IXRC 1ZAKA 1KI8A 4BLOA 3T06B 5KSOA 4C0SA 4QXAA 5CDFE 4LC0A 3K0FB 5FL7A 3ZVLA 3AVPA 4JLNA 2D7CA 1Q21A 3L2OB 2IBMA 1Q57A 2ZJZA 2J0VA 3RDPA 3GLHE 4PX9A 4Z54A 5E95A 2BKEA 3PJRA 2J7PA 4TMTA 3P20A 4MRRA 4Q1AA 2J7KA 5EXPA 4IOKA 2CLCX 4NDZA 3AUYA 1NN5A 4IHQA 2ORWA 3ND8A 3PITA 4B74A 4TTRA 1XMJA 4BRWA 1JEEA 1G8PA 3T61A 2CLSA 5TB5A 3T34A 2A3RA 4C4PA 2G83A 2F3TA 2JEOA 3BFXA 3KUCA 1W1WA 4BFSA 2V1XA 1OH8A 1E1RD 4HLUA 3V9PA 3NEYA 4HAVA 1II8A 1ZJ6A 1LNZA 4JKYA 4O3MA 1TQDA 1ZCBA 5FUWA 2O8FB 1Z2AA 3T1QA 1F2TB 4RD1A 2FZ4A 1FL9A 2G88A 3WP1B 4RVCA 4PTLA 3HWSA 2QM8A 4JLAA 2P65A 3DOEA 1SXJE 2O0HA 2F9MA 5SZJA 2GJ9A 2HEIA 1W46A 4HLQB 3I3SR 4HB3A 3QVVA 1HE1C 1XEXB 4B3XA 2ZSEA 5FI0B 1OHHD 2C98A 1YVDA 2WOOA 2GXAA 1H8HD 1JJVA 2DFKB 2CEAA 1W0KD 5EE5B 3VR4A 1JPNA 2I1VB 3AVXA 5JI3E 1G6OA 4BFYA 1GWNA 4D26A 4EQ6B 1XFAA 4MGIR 3HU1A 1FTNA 1P61B 2LWIA 4C3ZA 1KO1A 1D2NA 1E96A 2ZJ8A 4L5BA 1TQ2A 3NVAA 3ICEA 2J5XA 2VF8A 1XF9A 2OO7A 2O8EA 3R9XA 4MRNA 4B48A 3UXMA 1T8UA 1X1RA 1VDZA 3BRWD 2PX0A 3MCAA 1SXJB 1TQ6A 3KQNA 3DZ8A 4AYTA 2GK6A 4XD7A 1J2JA 3BB1A 5EXSA 5EP3A 3CF2A 3FE2A 3HU3A 2JDIA 2ZRMA 4D0GA 2AKYA 1WMSA 4GMDA 4AK9A 1SXJD 1NY6A 4RD6A 4V0OA 1W36C 4URXR 5CLQA 3RC3A 1E1RA 1Q3TA 1SQ5A 5E3HA 1CKEA 4BWYA 1H65A 4L15A 4LPSA 4HYYA 1K6MA 4DLZA 2ZE8A 4K46A 4MDFA 4D81A 1M6NA 3VX3A 4QNRA 4UKDA 2OXCA 1ZM7A 3UATA 1DBSA 3MWKA 2FG5A 2UKDA 3EASA 3HP1A 1VPLA 3G82C 3FMFA 4JLDA 2AKAB 5FI1B 3ZS9A 3X1DA 5J4KA 1RYHA 4D2IA 2IYYA 2XTMA 4KFTA 4Q1DA 5BN3A 2XZLA 1YR8A 4PANA 1AZTA 1R5NA 3IUYA 2Q9BA 3SNHA 4GL2A 1Z0KA 2W58A 4FMDB 2WMNB 4S35A 4B2PA 3BD9A 4EIWA 2BWJA 4U02A 1KI6B 3CB4A 3IBGA 4JVLA 4M1KA 1UADA 5AUPB 1DAGA 3TW4A 5C2JB 5K8UA 1U0JA 4MQBA 3AGPA 4HDQB 4O2RA 3SEAA 3DEFA 3QXHA 1OH7A 4PC3A 2ZPTX 2C8VA 5EP1A 4Q1EA 1S1CA 5H1YA 1E4VA 1EFRA 4BEJA 3CLVA 1XP8A 4MH0R 2O8BA 1RRGA 4DB4A 3BXZA 4WZBE 2ZJYA 3RS3A 4QNMA 5FUXA 3W6PA 3HU2A 2NQ2C 1J8YF 4Q01A 2WWGA 1Z29A 1EFTA 3N5CA 4NTZA 1AJEA 3LBHA 1KO8A 1VYTA 4Z1MA 4IOLA 4G5OA 2C03A 2KBFA 1TEXA 2ZTSA 4TSFD 5DI3B 2ATVA 3BOSA 3X1XA 1T9HA 5KU1A 2BEJA 1NMZA 3LO5A 3VTKA 1VG8A 3EPKA 4LJ5A 3SJCA 3GLHA 1LF5A 3LW8A 4IDHA 1II8B 3AH8A 2RCNA 2RGEA 3P27A 4AYXA 2HCBA 3U2QA 3FKSD 3FMPB 3VHXA 3I32A 1GNRA 4TL9A 4YXWD 1V43A 4KVGA 4PSAA 1FX0B 4BFZA 721PA 1N6IA 5DE3A 1PJRA 1BYUA 1IM2A 2X2FA 2ZVQX 3FTQA 4YDHB 2GJKA 2JJ8A 4EPYA 3GLIB 4FD2A 4LX0A 2ZRGA 5B57C 4URYR 5LB2A 3QENA 2JDID 4TYWA 1E2EA 2JJ1A 2O52A 1HV8A 3WMGA 3BIFA 2OESA 4DLYA 3T5DA 4BZQA 3NEJA 5B2ZA 1QG4A 2J0QA 3LW7A 1OYYA 1JQLB 4P4SA 4LHWA 1OFUX 1WQ1R 3N2EA 5H8WA 3PR1A 5HPYB 1ZW6A 3K0SA 4F38A 1UKYA 3FWYA 3Q7QA 4Q1CA 5J40A 5K8LA 3ADCA 1DG1G 4M8NE 5FTNA 3KXKA 3TLXA 1GKYA 3WHKA 1J7KA 2V1UA 3A37A 2Z0MA 4DIDA 3X1ZA 1VIYA 4BLSA 4R2IA 4PQYA 1NJGA 1QHHA 1ZD8A 421PA 3B2EA 4ASUA 1R0WA 3V4FA 4NYJQ 4H9GA 1N25A 1ZINA 2NTYC 2ZIAA 1G8GA 3VR5A 4A2QA 1CJVC 2DYKA 3E1SA 3OAAA 5KNDA 2BKUA 4KCGA 2DWPA 1KO4A 3BFKA 2GXSA 3SFZA 4XIGS 3KQKA 4PR0A 3CRRA 5GJWC 1OSNA 3WYAA 1IONA 1KHTA 2DCUA 2PEZA 2W00A 1OXSC 1COWA 2RH5A 3AKEA 3FVQA 3WXMA 2CVHA 1IHUA 2VHJA 2WSMA 4I4LA 5TVKA 4L4UA 1E9RA 3TBKA 3BK7A 3IHLA 3KB2A 2SHKA 1TUIA 3NBYC 3OHMA 4DCSA 4CDGA 3VHLB 1E94E 2GRJA 5AR1A 2IEZA 1SVOA 4NU0A 4R9UC 2VP2A 4UNSA 2VL7A 4POAA 4BE7B 4XH9B 1HH4A 3FKSA 2O0JA 3BGWA 4XWOA 3HR8A 5CLLA 2Z4SA 3W90A 5G53C 4D4LA 5JHHB 2XZPA 3C5CA 1YZKA 1J99A 1ZM3A 4NE2A 2QPOA 3A36A 4URUR 4EFNA 5LBIA 1CIPA 1Q12A 3R8FA 3PUWA 4B76A 5DI9A 4JLVA 3R7WA 3VMFA 3ZH9B 3HR7A 3ZYCA 2VP0A 2QTVB 1WP9A 3AKYA 4P33A 3TIFA 5HE9A 3QE0A 2Y8EA 4IKEA 5SZHB 4TLDA 2FPKA 1CS4C 4B71A 2ZJ5A 4N1AA 4E22A 4R71A 5AJWA 2B8TA 3CWQA 1NI3A 1T5IA 1Z22A 3PCRB 3Q8XB 4US1R 1ZCAA 1R4AA 4Q5IA 3UANA 1I2DA 1KZ7B 1QHXA 3BB3A 4RKFA 2GJSA 3Q85A 1JBKA 5HTKA 3GLGA 3WMEA 5EE3A 3I61A 5DN6A 3EIEA 5AJYA 3ZS8A 3AKCA 2OAP1 5LDDC 1RKBA 2ZR9A 4AG5A 2R44A 3U44B 3DM9B 3EPJA 4M1SA 2QP4A 3KFXA 1JR3D 3B1YA 4OYHA 2TMKA 2QRNA 1TADA 1YZLA 2V55B 5H68A 4CEIB 3DO6A 1N6PA 2PLFA 2F7SA 1L2TA 2VP9A 1N5KA 3K09C 3U7EB 1G19A 3W5IA 3CZQA 2XB4A 3SBDA 2Q0HA 3BS4A 1Q1BA 3GD7A 4OQFA 4TMVA 3NWJA 2O8CB 2MSDB 1KY2A 2I1QA 4IFEA 2ZI4A 2NO1A 1O3YA 2E87A 2F6RA 3EA0A 5KTYA 1CRPA 1U0LA 3DOFA 4W9MC 2AWOA 2P5SA 3D31A 1G41A 1E99A 3RRZA 4XWKA 2H7VA 2FEMA 2FFHA 3VKGA 5GADl 3CRVA 2CXXA 4G01B 2UZ3A 5CJPA 2J0SA 3QF7A 2WSSD 2F43B 1AA9A 1OFTA 1U9IA 4CT4B 5AUOB 2REXB 2GJAA 4GOJA 1OXVA 2WJGA 2H57A 2VO1A 4UXHA 4MKIA 5FPYA 2Q3MA 1OIVA 1EFCA 1V5WA 1VCOA 2ZI9A 3W8NA 2QAJA 2QENA 2GF9A 3NHAA 3THYB 3OESA 1EXMA 4Z51A 1KTVA 1DAMA 3W5JA 3THWB 4A8JA 1EG7A 1QG2A 4HLDA 2ZU6A 4ASUD 2BOVA 2EFHB 2CL7X 3EX7C 4LY6A 3V4RA 1KI6A 1TMKA 2WWXA 1HQYE 4TL6A 2VHCA 3DPUA 3GJ0A 3LX8A 4GSYA 4K8OA 4CZ2A 4MKGA 1OH6A 2B7BA 2ZRBA 1SVLA 3CX8A 5IF9A 4MRPA 4DDUA 1SKYB 1P2SA 2GF0A 5KOYA 2XB2A 1VYVA 2IWHA 3SN6A 3F0TA 3ADDA 5LD2B 3VX4A 2ZRPA 3EZ2A 3U7GA 1P3JA 4N0EA 1NG1A 5A4JA 1X1SA 4LJ6A 2JJ1D 5FL3A 2WM9B 4B3DA 1IJFA 1EX6A 2WIAA 2XZOA 3I4LA 5J4LA 2DY1A 1M34E 3H84A 2ZROA 1YE8A 2UZIR 2LKCA 4MDEA 1IN8A 2IS6A 1OB5A 1S96A 4GBMA 3WYFA 1L4UA 3AB3A 2IYLD 1AGRA 1NMXA 3TGPA 5DLQC 1XEWY 3ADKA 3EA5A 5CJ2A 3TQFA 1JJ7A 3PVSA 4AKHA 4DCNA 1G7RA 1XZQA 3SYKA 4NCKA 1GL9B 3ZIAA 3CBQA 4D6PA 1JI0A 1AM4D 1JXOA 4IEEA 1QHNA 3QOFA 5AJXA 3QEJA 4F91B 4M0LA 1DAHA 1G5TA 1I4TD 4NKRA 1M8PA 1Z0IA 5AWFC 4C7OA 3LQRA 1SGWA 3D6TB 1P72A 2R8RA 2VHUA 2FPMA 4JJZA 2W2VA 1G9XA 3ASYA 3F5FA 5KYKA 3NTUA 2F1HA 2WBLC 1IXZA 3QKRA 2JLVA 5GJBA 2ZI3A 3B9QA 4JVSB 2QAGA 2VP6A 4EKDA 4TYNA 1KDRA 3W3AA 1Z0AA 3SBEA 4M53A 1M7GA 2NOAA 1ONBA 2VIIA 2ZM5A 2WHXA 2KBEA 1X3SA 4V0LA 5AK0A 1GZSA 4F4IA 4DCTA 4MKFA 2ZSFA 5IT5A 3CW2A 4TTQA 1J70A 4DBLC 3KKMA 2RGAA 2J0UA 2F43A 2AD5A 1IN4A 1F2TA 2ZYUX 1NBME 3IQXA 1RC8A 4P32A 2E1RA 3RWMB 2DWQA 3C4JA 4QHTA 2OV2A 2NPFA 1GITA 1Z3IX 3I92A 2D2EA 3MWYW 3L0OA 5EQTA 5J47A 2YHSA 4A2PA 3GQBA 5KDOA 3CRMA 4Q4LA 3TVDA 3BB4A 3CRW1 3KXLA 3VQTA 3GLIE 5AUNB 4LV5B 4KYIB 1G3IA 1MABA 1XTQA 2ZSAA 4EPXA 2O8DA 4I1VA 1QBKC 2YC2C 5HZHA 1LB1B 3RRMA 4IVRA 5AJVB 5TY0A 1NBMD 1KK3A 1MO3A 1N5LA 2B8WA 2OCYC 3R9IA 3I5YA 4Q02A 1TEVA 4LHXA 3R8CA 3CR7A 2CDNA 4IDPA 5C1BA 2BDTA 3IEUA 4DLSA 5JBQA 1CR2A 3CIOA 3PUZA 4AKGA 1II0A 2PZGA 3B1XA 4HB4A 3T1TA 3TW8B 1D8TA 2F1JA 3AGQA 4LHZA 4YC7A 3VR3A 5JMTA 1W7AA 1YR7A 2D7DA 5EXTA 2H92A 1IY1A 4MRVA 4QHSA 4MUAA 1S4QA 2IS1A 4WOPA 3AVUA 1T3LA 2QMOA 5BWMA 2FGJA 3ZQ6A 4ZV4A 2ZRAA 1FW6A 1FPMA 2P67A 3EARA 2AFHE 5KSPA 3SE0A 5BYKA 5JI2E 1ZIOA 5JS7A 3PEUA 3NBZC 4CEHA 3TUZC 2ATXA 1E9SA 3ND9A 3QSYA 3PQCA 5JSZA 2WZQA 2C96A 3LD9A 3AF4A 4NBSA 2KJQA 2N42A 2Z83A 4PHTA 5E7MA 4OJKA 3RSLA 3AVOA 3UWKA 5FBWB 4P31A 1P75A 3VNUA 3W9YA 4Q47A 4M1YA 2RGXA 2QNRA 1KNXA 4QBGB 3K70D 1ZD1A 2BHRA 2W2XA 4FCTA 3TK1A 5B30A 4HB0A 4A4DA 2IF2A 4DDVA 4URZR 3LNCA 4DT1B 3NDPA 3ZVMA 1EWRA 1XTKA 1Q1EA 5FTJA 4PPFA 4HZIA 1PLLA 3L0SA 3QPUA 5FOTA 1T0HB 2IA5A 2ZETA 1DE0A 4L8GA 5FPHA 2BMDA 2ZRKA 3U3KA 2PJRA 1GILA 3U3MA 4CT5A 3K09A 4M2LA 4LYJA 1KK2A 4N3NA 4MA4A 3K0FA 5CIWA 1PLKA 2ZS7A 3RS7A 1AZSC 2KB0A 3RC8A 4L9WA 3THOA 2HJGA 1E2DA 4EDHA 1OW3B 3B9PA 5KPJA 1HA3A 4U7DA 4XVUA 3CO5A 2QAGB 2H5EA 1G20E 2AFIE 5C4MA 121PA 4OI1A 1OPXA 1GAJA 2OFXA 5HKKA 4Q1BA 1B0UA 5JJIA 1CR4A 4A1FA 4JL6A 2BBWA 1N5IA 4EPVA 8OHMA 4DIEA 3MRSA 5DIFA 2OCBA 2V7QA 2WAYA 5JWRA 2EFDB 2NO0A 4KSBA 4KSCA 1U81A 2N46A 3EIHA 1KMQA 3RS4A 1E79D 1U90A 3A8TA 1E0KA 4MGZR 4ESHA 2OBLA 2D74A 2EW1A 1TUEA 2G77B 2JJ2D 1K5DA 1G8FA 4PPQA 2R2AA 1I2MA 2J3EA 4TT3A 4NCNA 2PLRA 3QG5A 1NN1A 2Q6TA 521PA 3U6KA 3TAHA 3BWDD 4DWJA 1A2KC 2CMKA 1N3BA 2FSIA 3E5HA 3DKVA 1F2UA 3DMNA 4DLVA 1SVSA 1XXHA 4RFSA 2JLQA 4NCJA 5IK2D 1US8B 1YR6A 3AVWA 2QMEA 1NSFA 2HDNB 3KJHA 1DG3A 4JLBA 3Q5DA 1W4RA 4TLCA 4BEBA 3UMRA 2A5YB 1P62B 3CX7A 3QKUA 5JSZB 1PV4A 5GJCA 3KTAA 1AKEA 1OKKA 2EU8A 3Q9LA 4WW0A 1UBCA 1Z6TA 3SC3A 1AKYA 5AJZA 2QT1A 1TU4A 1XTJA 1HURA 3CF6R 2JA1A 2QUZA 3GCGA 4IXNA 5KDDA 2GAOA 2WSSA 1JB1A 2AX4A 4IOMA 3TH5A 4ZIRA 5IRCD 1GNQA 2EVWX 2NPIA 3W3ZB 1U8AA 4HZUA 3I1FA 4GNKA 4IW3B 2ZRJA 1G7CA 4MUBA 2VBCA 5TXGA 1X8JA 1G3QA 2Q21A 3FB4A 4ZI2A 2J41A 1R5BA 5CK5A 1P9NA 3KX2A 2YWEA 2IUTA 3L8YA 1Q22A 2ONJA 1XEWX 1P2UA 2ZITA 2D06A 4ZDJA 1G8YA 4Q7JB 3G5UA 2UVQA 1MT0A 4UJ5A
chains in the Genus database with same CATH superfamily
3UCXA 1VL1A 2EG5A 1JLLB 1KIAA 3N6RA 4D8UA 1AQJA 3JPYA 3TIXB 1QQ7A 5KWEA 1F8XA 3I8XA 3UMSA 1FDUA 1DMSA 4DBZA 4OSPA 4E07A 1NOIA 2V7EA 4Y6RA 5ILGA 4TXNA 1Y9DA 2XUHA 2GHQA 4FXPA 4N0PA 4RGBA 3HU5A 1XOIA 2OD2A 2VNHA 1FP4A 1F48A 2I6TA 2YCBA 3KVYA 5CXSA 3U49A 3H99A 1ZC4A 4QTXA 2PUBA 4WY2A 1HFKA 4YPVA 1XMIA 3ZOZA 5BSEA 2X3YA 3GLRA 4Q1FA 2QG4A 3JY6A 1F7UA 4KODA 1EFDN 2J9RA 3NNSA 5CFPA 2MYPA 4XR4A 4J0FA 3VXKA 3NWPA 3LX6A 4CCYA 3LX5A 3HYSA 2KYRA 2XSZA 4FTWA 1NVXQ 1VJ1A 1Q1GA 1V7ZA 2VZLA 4FX5A 3CWCA 4WKGA 4ZIRB 3BSYA 1EAMA 1TF7A 4YTEA 3HVRA 1W36B 4EHJA 1WW2A 4CL2A 4YMUA 2BI8A 3S7ZA 1KJIA 1JDTA 2IUSA 1FZQA 1COZA 4RTPA 2WFAA 4CF6A 3SQLA 1PDWA 3TSCA 3U7JA 4AJ2A 2CJWB 1Q0PA 2DPXA 4WLUA 3CVVA 1VSBA 5LQAA 1YQTA 4YRTA 4Q7LA 3G0GA 2IELA 3UKJA 1ZSVA 4AKIA 1L7BA 2OGUA 2XWBF 1SBIA 1JIIA 4X9XA 1QV7A 2WZCA 4OGGA 2ZI6A 2LTAA 5ICGA 5BSUA 1YFKA 2V6MA 1DQZA 2H2IA 3ONVA 3T15A 5CA1F 4NYIR 1N7GA 3ICCA 3L8HA 1HLFA 3P9YA 4AICA 4AI6A 2HWWA 3JQ8A 2AE1A 3IQWA 4AXBA 4BP3A 4OQMA 3WRYA 2V3VA 5L7YA 3RSHA 3F73A 1EEHA 1PZNA 2GLXA 2AX3A 4H1HA 1XDGA 4O3FA 3PC8A 5A4KA 2HRDA 3U9SA 1N6KA 3AOGA 1XZDA 2ZTUA 1KMIY 4XB6B 1NQTA 3HKDB 5ECWA 1TNDA 5EJ9A 1WXXA 2B1JA 2FU5C 3OEED 4PAWA 1SZCA 4ZT5A 4LSGA 4X61A 4YUYA 3VKHA 1H0KA 2I66A 2JFYA 1H2BA 3BH6A 1CXZA 1VOTA 1C8VB 4OAOA 5A7HA 4WCDA 4UTRA 2YVUA 3KWMA 3LPDA 2CFCA 3MK31 4BNYA 4BN5A 4D8TA 1T5DX 2P8JA 2BM8A 2VLBA 3NG1A 2DFTA 2VNAA 3DW3X 4PHCA 1KZGB 4L8YA 4WINA 3GZJA 3B9BA 2OHIA 3MJVA 4PHGA 4UBMA 4RHUA 4TMYA 3RS9A 4D44A 3MFYA 1H1DA 1NFFA 4GYKA 1T4MA 2B2NA 4IIXA 2C7BA 2BFEA 4YO7A 2Y3IA 3PD0A 4RKQA 4R7TA 4RGYA 3WQQA 4KAAA 2O2YA 1YZTA 1VFNA 3H1TA 4TWZA 4JP5A 2CYCA 2IEAA 2X8JA 2PVSA 2WHPB 1MAVA 1JKXA 5F12A 3BICA 2FW8A 4AF7A 4NMLA 2L19A 3TUIC 4ML3A 4MAFA 3LDHA 3QNUA 4MI1A 4ZDKA 1PGOA 1LLQA 3LOPA 1GR1A 3FGZA 4ZI7A 2ZJ2A 4AZTA 2ZQ5A 2Z56A 5SV2A 3D8HA 1PAUA 3G7UA 4M0EA 2N1MA 3GVHA 4Y18A 3U3OA 3VJRA 2FW6A 4OD0A 3THYA 2HPAA 3PC7A 3EZ7A 2A5GA 3VZRA 4I6GA 4R7ZA 4I14A 5EPOA 3MB8A 4UCFA 4JGBA 2A78A 4ALMA 1KO5A 5DNVA 1QC5B 4CHTA 1JEJA 2QBYA 2IP1A 4S2UA 2GZ3A 4V0MA 2AQ8A 5F1PA 5B1HA 1KO7A 4RVOA 1R4NB 1EFPA 1ML3A 2GH1A 2NAFA 2X76A 2ZVPX 4RA9A 4FQ7A 1TK3A 4DMKA 1AOXA 1V1JA 3P2EA 5DBOA 1J06A 2Q41A 4GZLA 4ZQBA 1LK5A 3COVA 1L1QA 3V2HA 5IM4A 1K7XB 1Q0QA 2OBMA 1PW7A 2OOSA 3M1LA 2O1EA 2FR8C 2VFAA 3C3CA 3VSCA 2X41A 1Q6ZA 3RGGA 3GHHA 3QLUA 4K8RB 1E59A 2DR3A 3DDZX 3EBLA 3EQZA 4QRDA 5KAPA 4A0GA 5JNUA 3AOEC 4F4JA 3NHLA 1W34A 1VCMA 4L0QA 5I9SA 2NSHA 1FP6A 1WA5A 2P3OA 3DHNA 2PBRA 3HUUA 1GADO 3C14C 4MV4A 4YDQA 1DS6A 1YQEA 3LK7A 4CIDA 2G80A 3HY6A 3HM2A 3ZVNA 3A31A 4ZDWA 5CVEA 3CLRD 8AT1A 4UUPA 1SC9A 1JTFA 5HVNA 3FM9A 1HOTA 2ZWIA 1ZI6A 3L84A 2EYQA 4TRRA 3UQYS 3EGXB 3DL2A 2GPBA 2HF8A 1R5OA 1CULC 3IIEA 2XCSB 4KAXA 5TMPA 3DNFA 4X65B 2XOEA 1UANA 4OO3A 2IS2A 3HVUA 4JHLA 2GWHA 4ND5A 3SVLA 1P29A 4BO3A 3DD1A 3GC6A 4Q4AA 1U1IA 2PT5A 2YXLA 2HMVA 5EIFA 1BRMA 2A0XA 2EAUA 1DXQA 4LKRA 4RULA 2YJNA 4JASB 5TMBA 1UAYA 1UC8A 4EG5A 5IAKA 1QYCA 3QLTA 2DSTA 1E32A 3DJFA 4DDMA 4R8MA 3T41A 3C6YA 4B2YA 2OZPA 2XVAA 2Z6VA 1ZD4A 4G0ZA 1T2EA 1QIFA 4HXYA 2A4MA 2H48A 3R5FA 3VH1A 4CG2A 3DMTC 3L1KA 4HCJA 1ESNA 1VJRA 4JNCA 3EZNA 4QXQA 3BA1A 3ETHA 4A36A 2EX1A 4RV9A 4NU5A 1PVVA 1QHEA 3HNRA 3L43A 4PZEA 4IX9A 4E7PA 1FB5A 4QZVA 5JWHA 2JI4A 4IDOA 5KSYA 1HRKA 2DEUA 2B20A 3K2IA 1VBMA 4H60A 2RHJA 1L5HA 2R8YA 3AP2A 3M1IA 1RJ9B 1SR8A 5IEJA 1BWRA 4MQEA 4EI7A 3RRFA 2B69A 1XP5A 4P08A 2B4QA 4FINA 4U63A 4X1OA 3OURA 4HDRA 2IXGA 3LKBA 4NICA 3AYXB 5FUVA 4ETMA 1TUBB 3AILA 3WO1A 1BKDR 1OAOA 4QQKA 1CUIA 2M32A 2Z8YM 4RHTA 3SLGA 1U1FA 3TDKA 3VFDA 3RC7A 2JGMA 1JVBA 1OTYA 2DUJA 1Y1PA 1KMNA 2R00A 3DDWA 4OOEA 1OGYA 2LCQA 1RCUA 4OI2A 1U7TA 3C4QA 4R3WA 4RMGA 3WAGA 3K9CA 3C1OA 4ESEA 1VKHA 4KXMA 1I0ZA 5LL6P 3I5AA 3L7DA 2IYWA 1CHNA 3SYTA 4NABA 2RONA 4W5HA 3U4DA 2PVCA 1M0WA 2D0PB 3KJIA 5EOVA 1I0LA 1F3LA 1ECLA 1T9BA 5LLTA 3NQ41 4GPAA 1MIOA 3FI0A 1LSOA 3HA7A 4X45A 2IYTA 4H6PA 4NULA 2BMEA 4BKOA 1E4OA 1H8EA 1T43A 2DQKA 2A67A 3F5QA 4TL8A 3CTPA 4ZAXA 1T9ZA 2NTVA 2PX8A 3K4PA 1U2EA 3KKPA 3PSAA 4QE3A 3VZBA 3W2GA 4DABA 3J7TA 2GI4A 2ZVJA 2JI6A 3FCEA 3BWXA 1Z47A 2C42A 3EOBI 4DRZA 2QLLA 2ZCVA 1JHVA 1V7PC 1C9NA 4H7FA 2GN0A 4JDPA 4KIJA 2DPMA 1G5FA 3B6MA 4JI2B 4RSRA 3DDNA 1GPWB 1W9MA 2JGFA 4DZZA 1SULA 2R6JA 4HR7A 3OU7A 4P92A 3V46A 4YT2A 2BKAA 3NJRA 3A6HA 1JA1A 1X1AA 4WESB 5DYNA 4KO4S 3SE7A 4TV8F 3WK5A 4YXWA 4EYGA 5AKHA 5ALNA 2P9EA 4O8CA 3S2EA 3UC9A 3UQZA 2XCRB 1J90A 5AHXA 5A71A 2Z3WA 1P4SA 4KBFA 1DC5A 2A0UA 1MAHA 1UOQA 3GRKA 4L5CA 4F5WA 1W59A 2Q6LA 3VH3A 3GRCA 1ZNZA 2V7VA 1EE2A 1LK7A 2JGDB 2ZAGA 5TV2A 3SFVA 3CEHA 4D9MA 4EPTA 3Q15C 4LN1A 4KO8A 1Y1QA 4MP6A 5F73A 2QGNA 3NATA 4DDWA 3WRYC 3MG9A 1RM0A 1M6VA 3EUAA 2YN0A 1SB9A 2GN9A 4P2GA 3MBOA 4X7BA 1DJPA 1OHHA 3VYTB 2KE5A 2GSWA 4M88A 1Z74A 2I8CA 4JQZA 5JMTA 1EDDA 1M2FA 1ZVQA 2AFIA 3MRVA 1PKEA 5HKLA 2PM8A 5CB4A 5CM9C 4I5GA 3MCWA 2OMEA 1SXGA 2PX2A 3PYLA 3Q41A 4BNVA 2BP7B 3LAWA 1E1DA 2AJTA 1OFGA 2C61A 2SICE 5GJVC 1YF3A 4NE7A 1VIVA 3P2IA 4XWAA 2E4YA 5BR8B 3GEGA 3N7AA 1E1YA 4OIMA 1UBHS 5E2AA 3NLLA 1TLLA 4CL8A 3E7FA 4WZ6A 2WP8J 4AURA 4BL5A 1G42A 3PHGA 1JR3E 5D2CA 5AK3A 1SA0B 4CNQA 2QRMA 4EL0A 4FJ1A 5FOQA 3BL8A 3IKLA 3A1UA 4MUJA 1NVVR 2GYWA 4E4RA 1OFIA 2FEOA 5B5SA 1YR9A 4ZJUA 5AW3A 4BGDA 2POQX 1IG3A 4IMRA 1W4CA 5GAJA 3WGMA 5AUQA 4TVSA 2Y1EA 2LKDA 3ETGA 4JDUA 3UM9A 5B6PA 3K0SA 2YJTD 3EK2A 3NTQA 2NUBA 4EI8A 4B3HA 4Q18A 1OV4A 4BQOA 2HU8A 4GICA 1VE3A 4IY1A 4E15A 4LRTB 3C6ZA 2R79A 1WAMA 3WLAA 3M6IA 3HSSA 2W0MA 2GJ8A 1ZEMA 4UHEA 2WJ3A 5G0WA 1BHJA 2CLKB 4Y6SA 2PNJA 4C88A 1G3MA 1JDUA 2YV2A 1V7QA 2GEVA 1BE6A 1XB2A 1OZGA 2H0QA 3CJTA 3CNOA 3M9WA 2C58A 2YR0A 4L9AA 3P9NA 4RDHA 3FAZA 4UUNA 3VR6H 1A4UA 1YS9A 1PNRA 3TSYA 3GMIA 4FEYA 3FDIA 1W87A 5AESA 4R01A 3GNTA 1FYWA 4L4SA 1GKUB 1G8HA 2NXJA 2Q1TA 4V0RA 2C3YA 1OLUB 1MX1A 3TCKA 5A62A 4BJ1A 1XZPA 3AW8A 5DW0A 1ULUA 2FFAA 1TJ5A 2OV1A 3W0LB 1L8AA 1GO2A 2HSEA 3FMIA 2Z95A 4HN4B 3G2NA 3KD3A 2CKDA 2IZ5A 2BR5A 2K87A 5J4HA 4D4MA 4A92A 5JECA 4ZAGA 1CJMA 4TWIA 1DEAA 4QPDA 3KJNA 2A92A 3A1DA 3IUSA 3I23A 4PSUA 5CT8A 1ZK2A 3TRKA 3I53A 4J1QA 2GKOA 1QVAA 5H9VA 3WYNA 3TGWA 3ZHUA 2VPIA 3HDQA 5J4YA 1Y5NA 2QTAA 5C53B 1N6LA 2JFWA 4L7QA 4G5YA 1Z5NA 4DCCA 1RZUA 4QREA 3TOCA 2O2EA 4MCAA 2ET6A 4G0UA 2J0UB 4C1NA 4IKPA 1MP0A 4PSVA 2XZTA 2ZJAA 2P3SA 1XYGA 3KT6A 5KYUB 3R9XB 2WWYA 5EIAA 3ZD6A 3ONWA 2YZ2A 3KUDA 4LOHA 1D09A 3UAWA 5I45A 1T3SA 4N3BA 1WW8A 4Y2JA 3WGJA 2OAQ1 3PGMA 2OYRA 3STXA 1X9IA 3G8YA 3L7YA 1N6OA 2G09A 2WLSA 4OXIA 3DLAA 4HS9A 3GPLA 3ZGVA 2ZCUA 1JLSA 3UPUA 1XR3A 3WOHA 3CVOA 1KS9A 2ZRQA 4FS8A 4K9NA 4M76B 4TRNA 4YJ2F 3TUJC 1E5LA 1SXJA 2RAVA 3U3RA 2Q4EA 1O6CA 4M1OA 3VSEA 2GZAA 4PLYA 3BGIA 2EFEB 1OYWA 2PS1A 1DBVO 1SY7A 2X8WA 3IKMB 3G2QA 5JC8A 1Q1QA 1J8VA 4KQMA 2UZ0A 4R2JA 2B99A 3QPWA 4JT9A 1CF9A 2CVFA 3VNRA 3JZAA 2PKCA 1JR2A 1LWOA 2AMFA 4M9QA 1G7SA 1XCBA 3COPA 1PEAA 3JATB 1U63A 1ZUIA 2FETA 4NPCA 4HT3B 2I2DA 4TLEA 2INGX 1NWHA 2QD2A 3KTAB 1LQUA 4PZZA 3BIXA 5E8RA 3R3VA 2NXEA 1ZK4A 3FPFA 3MWJA 1JR4A 4PZUA 5F98A 5CITA 5AKLA 4HVCA 1R6AA 1SOWA 4GX2A 3MS4A 4BQIA 3W6NA 5KEIA 2VHYA 1AHIA 3DBIA 3KR2A 4FSHA 1HXHA 4I50A 4BO5A 4F3NA 3BMCB 4LF6B 4B87A 5AVTA 2Z2IA 1N7JA 2O2CA 2MYUA 5BSRA 4I2VA 1DIRA 3STWA 1Z08A 4DYHA 3U60B 3OKFA 3GI1A 1O6BA 5TEWA 5A5FA 1RYBA 1F2UB 1MRZA 2A14A 1IZ8A 2R1VB 1SPXA 1NLFA 2H0AA 4HNTA 5HUHA 2MYTA 5INTA 3CVYA 1CJKC 3UJCA 3OEEA 4B3MB 1WU8A 2CJPA 2OO5A 1SFRA 3W6OA 4AJPA 3ESYA 1TAQA 1RXVA 4BMVA 2F3SA 2UXBB 3SQMA 3BQNB 1F2DA 1S2IA 5LDHA 2P9JA 1JR6A 3VDQA 3D3NA 1VECA 3M7IA 1FFXB 1HEYA 1XTPA 2Z43A 4E11A 3L6EA 3ORSA 4E51A 2JBAA 3V4PB 1S01A 3PJEA 2DTDA 1BOFA 1EM6A 2IYEA 4URVR 3HBLA 3TRJA 3RUIA 3MM4A 4GVXA 3SKYA 4WESA 2I78A 3JQDA 3AVVA 3DH0A 4BRSA 5L3QB 4YXFA 3IMEA 1NNLA 2YZKA 3I1JA 5D51S 1WXIA 1VMDA 3PHJA 5JVDF 5ENZA 3LHIA 3LKVA 4C2AA 3LUPA 4GR4A 5DP2A 4DV5B 1IOVA 1XC7A 3TX2A 2I4IA 1A69A 1VRCA 2HLDA 3L7AA 4FKBA 3L9XA 4NY1A 4B3FX 1Y6JA 3VVCA 5H9WA 1OXTA 3TDMA 1QHYA 3BCHA 4PPNA 1IG0A 1NPTO 1YDFA 3DPIA 1VSVA 1XMSA 4JL8A 4O0MA 3ETEA 3U7FB 1E1QA 1W4AA 2Q0SA 5IAJA 5FPKA 3OLVA 1RQGA 5LYJB 1Z13A 5DWDA 3V4VB 1FYVA 3R0QA 4Z86A 3MSXA 2NNLD 4IGFA 4P4SB 1DI0A 3TI7A 1X1QA 1YJ5A 1U0FA 3M33A 3ZR4B 3O8LA 1XJ5A 1A2QA 1YJBA 1QV9A 4U5QA 4ID3A 2ERXA 3VDXA 3TE7A 4CUKA 5A3QA 1DVRA 1H05A 4EARA 1JALA 1ZIYA 2A3NA 1T9GS 3PENA 5K8IA 3PG5A 1BROA 3PZRA 1FX0A 1VA4A 4KXLA 2IXFA 4BOYA 3COSA 3UMYA 4CVNA 1MC5A 3IPYA 2WU0A 3AU8A 5AT1A 4G4GA 4NS1A 1JEQB 2XAUA 4MQFB 3WHPA 3Q7IA 4FGWA 2E3JA 2OV4A 5GPBA 1EFLA 4O4JF 4JMPA 5ALIA 5MGNA 3CO0S 1YB7A 2Z57A 1SOAA 4NCAA 2Q8NA 2YWDA 2OG2A 3NZEA 2H1RA 5EZYF 4HAWA 1L5QA 1ZHFA 4F4CA 2P11A 3GN1A 2AT1A 3ORFA 3JRWA 2JLRA 2QPAA 4CG1A 1D5CA 3OZVA 2XQFA 5EP2A 4ZXPA 3PEYA 1DEOA 4GRIA 3HS3A 2J4DA 1QH9A 2OBFA 4I6JA 3EMVA 3VBEA 1G6HA 3REOA 2DOKA 4ZO8A 1AKRA 3BRQA 1R27A 4K05A 3KQVA 1PDVA 3TSAA 5HJ5A 1PGQA 3NBMA 4HOYA 3UH1A 2FDCA 2I1WA 1DJMA 2Z2XA 4QUAA 1JI3A 5ENVA 2OFWA 4F5YA 1WB4A 1MEOA 2PH3A 3O7MA 3FLEA 3PKJA 3LUHA 4C5CA 4IQFA 2XUKA 3KUXA 5C80A 4DJFC 5K4HA 3KQOA 1PFWA 2DHDA 3HM9A 3KIPA 3KSUA 1FE8A 5CDSA 3TEFA 4P93A 3K96A 3I09A 2LCIA 1MC8A 2PQ2A 3ZV6A 1EESA 1SD5A 2ONCA 1C7QA 4ZVUA 3TFOA 5EZYB 1WUKS 2HOQA 5HCNA 2IC5A 5T4FA 1D7OA 3BQ9A 4YNBA 1IDOA 1U6KA 2EFYA 4O25A 1MRSA 3OZFA 2PY6A 2QX7A 1PR4A 2G9RA 4U2GA 5D3ZA 5LOVB 3C74A 4LZJA 1PX2A 2OCAA 3RU7A 2PKYX 2XMCA 4NHOA 3OE4A 5C1OA 3HV0A 1T3TA 1V9SA 4UUAA 5FO0A 3PV0A 1C81A 3A6GA 3AFGA 4E7OA 1SVMA 4TOIA 1B1CA 3DCYA 3W8DA 5LXTB 2HWUA 5JRJA 1CVRA 3KOUA 1HOXA 1IMJA 2V6IA 2Z04A 3GO4A 2VJCA 2ZUCA 1SURA 2IPLA 3IQGX 4JHXA 3AF0A 1G18A 4B75A 2X4LA 2ZT6A 5I47A 2AKEA 2WJVA 2JH9A 2QLMA 5J1TB 4AUNA 5A3JA 5E4FA 5IKPA 4ZEXA 2VYVD 1OVGA 1XAHA 1T2AA 1U98A 2I29A 1R10A 4TYQA 4MNTA 1Z0FA 2NO6A 4LJAA 2W2MA 3GFOA 5HKOA 2CLIB 4X93A 3RIMA 2EKQA 1YASA 1BDMA 3HY3A 4GXNA 3X1KA 4YT8A 1CF4A 5DGIA 5LQCA 1ZN2A 4AJ1A 2H54A 4ENWA 1J2YA 5HNKA 1SIUA 4XXHA 1DO2A 2B7CA 2VJLA 4WBNA 4AY2A 4LNUA 1N3YA 4UZFA 1KAGA 1YR2A 4YCNA 1K0UA 4J4HA 4Y9RA 3W2FA 2ECKA 2JAWA 3FLMA 1AO0A 1SVNA 3VPHA 3B3GA 2QLNA 4QJIA 5FOWA 1MQ8B 2JFHA 2OYSA 1DQYA 1QJCA 2DWOA 2HDHA 3KJEA 4GSKA 3AEZA 4WZAE 4N5LA 2DWUA 3T9FA 3WK6A 5AW7A 2HUNA 2OCPA 3N58A 1OT5A 2PIDA 2R86A 2ZKIA 3CSSA 2J3QA 3E0XA 5SYMA 2FE4A 3DTNA 2RGGA 1X7ZB 4MWGA 4UPVA 1IPFA 5AIBA 2EZTA 2GAAA 4R54A 2W6NA 5IKOA 4DGSA 2C5GA 1W30A 1YHZA 2Q0XA 3C15C 2G8LA 3PX3A 3E9YA 1QOPB 1BYIA 5P8WA 3PNVA 1I1HA 4ARZA 1DOAA 1UOPA 2XKJE 1O0CA 4CN8A 1Q0UA 1OMOA 5ESXA 2J67A 4EFLA 2QU8A 1G55A 1OV6A 2R7AA 1TMYA 4PO1A 3RRNA 5BSGA 1WUJS 5I9MA 1GGVA 4X3PA 4EY7A 2JCYA 1QH1B 4RVUA 1SCUB 3DHVA 4NRDA 4QJ5A 5D86A 5IW8A 5HFNA 1NN3A 1SH7A 4CQNA 4N5NA 3HP7A 2FEPA 2VQ3A 2VC2B 3G2JA 4L75A 3RODA 2XCIA 3D3WB 4KSYA 1QHSA 1M83A 4J3NA 1DADA 4Q34A 3GLHB 2OUKA 3JSAA 3GFTA 3O4IA 2HSJA 2I67A 2YMQA 1D2EA 4IRXA 2P9BA 4J2HA 3WL8A 4BFWA 2FG7C 3NIFB 1R6DA 3QV2A 4YCCA 4OKNA 1HE2A 2GYVA 3I4CA 3X43A 2I9PA 1QFYA 1CLUA 2OSBA 5IHXA 3HPQA 1E7WA 3AEUA 1AUPA 1HF3A 4BLUA 1TPZA 4QPJC 3ODGA 3AUXA 4C0JA 2FEKA 3C6BA 5AHWA 1NW7A 1QGED 3E2PA 4CUJA 3JVVA 1C0LA 4TRJA 3ZVRA 2FMXA 1O2DA 4FHFA 3V8NA 3LY9A 2ANBA 1R3UA 4NSNA 2XWJI 3A3NA 1LV7A 5K20A 3PGA1 1AVTA 3B12A 5KOJB 4OK5A 2CLMB 1HDZA 2ODQA 2ODEA 4P7JA 1V11A 1APBA 4F46A 1A4RA 4U2FA 1WTAA 1X74A 2HA2A 1X39A 3VOTA 4H6WA 5KNBH 2Q3EA 3GY0A 4AUKA 3HK2A 1DRVA 2PLWA 1LA2A 2IZOA 4GECA 2C5BA 3TI9A 1K8RA 4XSHA 3KLBA 3DMPA 3EJWA 1E8MA 5CJJA 2XLBA 5C8YB 1D4FA 4FR2A 3LLCA 2QX6A 2B36A 1ONPA 4DJ5X 5SY4A 3X0DA 3ZU3A 3RS2A 4MUGA 1U2RA 1BGVA 1UFRA 3OPXA 2HV9A 5HK8A 3O8DA 1WLSA 1UPCA 5F33A 2GCNA 3IDZA 3ZXUB 2QQ0A 3WGOA 4MQ4A 4FDLA 1Z4KA 2IITA 2KW5A 4KI7A 1BIFA 4AP6A 2K5UA 2W71A 5CX1A 2C7OA 1HZZC 3MTQA 4JLSA 3O3MB 3PDIB 3KT0A 4LCJA 2Y0DA 4PZLA 4X95A 1FTSA 3WDLA 1I30A 3PEFA 1QS0A 4FYIA 4HDNB 5KJCA 2DKOA 1KJZA 1E3IA 1UPFA 1W85B 4EL5A 1Z06A 2B82A 2FN4A 4G4SO 4DEXA 2DERA 5AKGA 3UOWA 3A58B 3RABA 2VAMA 1G64A 3EZGA 4GF5A 5FA8A 3GAMA 4MS4A 1ENPA 3O8OA 2RB4A 1ZRNA 3CKKA 2HAEA 2CCJA 1EVKA 3BH0A 3LBAA 3RVNA 5CHEA 3VM6A 4I66A 2HA6A 1ZOOA 3E3NA 3PUHA 4DCVA 3G85A 1M33A 4LS3A 4TL7A 4MJXA 4XYLA 3VZQA 3A1SA 1K89A 1MOZA 1A04A 2FPGA 2GPSA 3PPYA 4X7PA 2IXAA 3NEPX 2Z3ZA 1F0YA 4QICA 4DQDA 4X6YA 3FX2A 1RPZA 4M7WA 3VC1A 1VG9B 4EEKA 2J85A 1NZFA 1Q20A 3QG1A 4GC9A 4MR7A 1UBKS 3ZGNA 4D80A 3PNSA 3FY4A 3V7WA 3IC5A 4NZPA 3SJZA 1E77A 1I3NA 3EZ6A 4KU4A 3K2QA 5HA5A 3R5SA 4U2BA 1ZMTA 3Q72A 1QHFA 2WG0A 2VWQA 1P0PA 1WF3A 1YIOA 3AM4A 3ITEA 4OSEA 5HUJA 1NBAA 2J08A 3QFTA 1U65A 1C9YA 2PWYA 1XU4A 1J25A 1EVJA 2HA4A 1S5PA 3KWFA 1VJDA 2O48X 2QY9A 3IELA 4MW5A 3S81A 2BFFB 4MCJA 1E20A 4O2AF 2YWFA 2NUTA 3OZUA 1TA9A 4JK3A 3JZMA 2FUG1 1E1LA 3ZQJA 5ILOA 1H23A 3WGUA 2D59A 1JT2A 4G5GA 4FWBA 3SR0A 3Q5GA 9MHTA 3IKTA 4GPD1 4ZQGA 3BWYA 3WOVA 2HQSA 1NQAO 2JIRA 3GQBB 4HYQA 1HY3A 3QEOA 4HMOA 6Q21A 1XA4A 1NW8A 1OZAA 5FRDA 4TV9A 2Q9AA 2HTFA 3FVRA 3B6JA 1UKZA 1SZDA 1SQSA 4JLKA 1GV0A 1XRSB 1RE0A 2FOLA 2QHXA 2ZYDA 3B6EA 3IOBA 4OHUA 5LN1A 1MRNA 2PCLA 3OX4A 4G2NA 4MV8A 4NBLA 3KKNA 3C8UA 1WZCA 1R9NA 4LWPA 4RU1A 5C5IA 3O3OB 1E2HA 4LXYA 1R0ZA 4HNUA 5C4IA 1YUNA 3R5KA 3C39A 4GBJA 4OK6A 5BNTA 1T8WA 3T3GA 4FGUA 1CUXA 3AUFA 2ILTA 4DIBA 4WIAA 5F2NA 4WV3A 3ZDEA 5EIWA 1Q77A 3I6BA 2XRFA 2ID8A 3B70A 3BA6A 2CFTA 3QKSB 4S1TA 4WE3A 4B73A 4TKUA 3SICE 2ZRCA 4Q4HB 4ENUA 3HN6A 3ZNQA 1U8XX 2NUPA 5D3MB 2DTXA 5FIUA 3TDNA 3VYRB 4C4AA 4Q6BA 4G5SA 5HGJA 2QBYB 2CXPA 3CFYA 3NEAA 5EMMA 1DB3A 2HW8A 4YI5A 4CR6A 1EQAA 4KE9A 3OFVA 5A5DA 4H1UA 3OCJA 4KWEA 5HRUA 5C7LO 3E61A 2WC1A 4ILKA 1M2JA 2Z08A 1FSFA 1OI2A 1E2GA 1ZOSA 3OCXA 3DLTA 3R20A 2GO7A 3BERA 5TMEA 5KQPA 2ZE6A 2DLDA 2EL7A 2HNAA 2M1ZA 4L08A 4U0JA 4LC1A 4BNFA 1B8VA 4F86A 4TZKA 1MG0A 2ZZNA 2H4XA 2AOVA 1Q7EA 2NUAA 3D6NB 4TGLA 4MQ5A 2Q2OA 4PC2A 4PGHA 3N8DA 4FW9A 1XEFA 2VWHA 3TRFA 5L3QA 3G89A 3G1WA 1L5LA 5BORA 1ISJA 1J56A 3HG7A 2YYSA 3JQAA 2JHPA 1J33A 1T8YA 5BV8A 3PX7A 1G20B 1E69A 2C9ZA 5BUZA 1ZDMA 1E2NA 2HLHA 3L1VA 4AN4A 3NC4A 4OVKA 1FUKA 1TM2A 2V54A 4HP8A 3SMVA 4RMIA 1LTQA 4UVIA 2A1UA 3T5BA 2FZ5A 2J9FB 4YJHB 2XXJA 3FTCA 1CQJA 1KDVA 5C1IA 3TZCA 1R0LA 2ZUTA 3Q7TA 3QX3A 4FT2A 2ZQYA 1SCQA 3WMWA 3UK0A 1W6RA 1HT2E 2GOYA 3OOYA 4IYRA 4JLUA 4R0NA 4WNYA 3QKWA 5ICMA 5K0CA 3AXSA 1ZGBA 3K1TA 3TCXB 3ASUA 5ECDA 2GVZC 3UB3A 5J23A 5DHFA 1XQXA 4J8PA 5L3ZA 3ASZA 1XAJA 1YXMA 3PFWO 5HS4A 2X0EA 3D6JA 4NV0A 1O5IA 2QLJA 4DA9A 4BQQA 1IY0A 1OH5A 3K4QA 1VG1A 1XWWA 1SN7A 1OFVA 1WCV1 4O4HF 2XJ4A 2YHUA 3CZ5A 3UK2A 3KWLA 4CTOA 4KLAA 3H2KA 1CQJB 4QUHA 3ESDA 5D1NA 3EHDA 2GCGA 3WNBA 2P90A 2GEUA 1PZGA 3HCWA 2SCUB 4HRXA 1D03A 5DN6D 4X71A 1CVLA 1NZDA 1SU7A 3F46A 3SSAA 4BLRA 5GZ3A 2RD2A 1PYDA 4L50A 4D4IA 4FLMA 5A3RA 4XQ0A 1MH1A 4OMUA 3GELA 3AR6A 1M2VB 2UUPA 3WWEA 1XEAA 3MWGA 1FSPA 4DJAA 1EX1A 4C2UA 1MV5A 5CIQA 1TT5A 2WR8A 2WU8A 5FOXA 2ZFUA 1N0HA 4B35A 4XDHA 1QLJA 2J3JA 3AI2A 1QDLB 3OM0A 2AUMA 5KNCA 1XALA 3BE4A 1HT1E 2I3GA 3NOOA 5COQA 3UAOA 3W8FA 1MFZA 4F93B 3ZWOA 4OL0A 2FFQA 5TEVA 3OQMA 5BRJA 2Z8YA 1SUEA 1PV2A 3KZVA 1KVSA 2AGVA 1T15A 3FDZB 1E7MA 4Q66C 4CE6A 1J0BA 1ELOA 2HA0A 4DQLA 1XHEA 5DM1A 4KNVA 1FIUA 3I6YA 3IPAA 1X7XB 2ZYAA 3NIBA 3IAEA 1R37A 2HYDA 1U9IC 3WGQA 3EF1A 4KR2A 2Y1GA 5ALDA 1RR6A 1QCDA 3PCXA 4S2EA 1UWVA 4RE5A 1VHWA 3KKQA 4L6CA 2GM4A 3GP5A 4D5GA 3R24A 2IBTA 2VRCA 3PFGA 1NJ6A 3MD0A 1GKIA 4YCBA 4ER7A 5HWSA 1GZ4A 4FVTA 3C6MA 3QF4A 3B20A 4HDRB 3EMDA 4Q3AA 3P7MA 3RIYA 1SRQA 3BFJA 4LV6A 4F6CA 4IJKA 2IU3A 1QZZA 2SBTA 1ABFA 1M1NA 1B8OA 3ZWVA 3WK7A 2J9XB 1Z6PA 1GAXA 3NCHA 3AJ8A 2VJNA 2VA9A 3QWIA 2JHAA 2AWNA 3DT8A 3DYBA 3UICA 1WD7A 2VRNA 4EPWA 4ZWNA 3F6SA 4G0XA 4OA8A 4Q7KA 4CDNA 5DM70 4OJNA 2VDRB 4OK3A 4KWHA 3BMQA 2CMDA 1P81A 5EJAA 3VO8A 4HPJB 4ZK2A 1EB8A 2XQVA 2ZR7A 3AHFA 3L6BA 3TZBA 3WB9A 3L93A 5BT8A 4TYYA 3RUCA 2YZNA 3HYLA 4KX5A 5AH0A 4ZAVA 3DB2A 5IVDA 4QTUB 2RHHA 1DZIA 4CIWA 1FXUA 2YNMA 3FCSB 4HFNA 3OE7D 5JXIA 4WKCA 1P2VA 3KPUA 3G2HA 5U9CA 2JCXA 2FH5B 3PNBA 4W5WA 3DUWA 3FOAA 4ZODA 3WS7A 4QM6A 4NMXB 1JG1A 2QTLA 2V9PA 4BO9A 2FZKA 4LRYA 5EWJB 1QVVA 1TI7A 1PKXA 3WP0A 4B84A 2BKXA 3JARB 4W6ZA 4WBSA 4KR9A 4DSUA 1T10A 1A9QA 5FOUA 3KLMX 2DJ5A 2X5NA 3PXGA 1XXHB 1NYQA 3FZNA 3V4OA 2XH8A 4FYVA 1S3FA 1ZM2A 4EA7A 3IP1A 2IYNA 4CKWA 1QP7A 4PLTA 3ENQA 3IVAA 4WOKA 3WIVA 5F9FA 4XPZA 4W8GA 5EHNA 5BOSA 1PTKA 2JJ2A 3TJZA 5KTSA 3P9KA 3PDJA 1PZFA 1NFRA 2QL5A 4YY3B 1R0RE 1NLMA 2W6CX 3ENNA 3NT5A 2HB6A 5F35A 1H2YA 4L78A 4BZPA 3PIIA 1EK5A 2EJUA 1SC4A 2EF0A 2VYQA 3TN7A 4CDRA 2NU8A 2LUOA 3CT4A 3GJXC 3MS7A 4QRIA 4B7XA 2NV0A 2HIAA 5KNCH 4LF7B 4YS6A 2WAOA 4MPJA 1X9GA 2IDJA 1M2HA 2QU7A 1JHAA 5FFMA 1RZ3A 4Y98A 4E12A 2GUGA 4GH5A 3ZG6A 1R4MB 2C29D 1NPDA 5C1DA 3AHEA 5CFNA 3BXOA 3MJHA 1Q0SA 2Q5CA 2CXHA 3ZCRA 3VOSA 2PZBA 2X8BA 3W2IA 2FNAA 5FYDA 3SOZA 3AIOA 3OPYI 1RFLA 4ROTA 5DTIA 3N76A 3QYAA 2Y1CA 5C0OE 1GGJA 3RHFA 5KC9A 1F6DA 2IQIA 3H7IA 1AUVA 4M9SA 4P4UA 4CBVA 2OHXA 4M9CA 2PSDA 3MEQA 5CB4F 5EKXA 4NAUA 1SU6A 1ID1A 1V96A 4WGGA 4RANA 5BSMA 3ZWDA 1QZUA 1L4BA 1PQWA 1SG9A 5KUTA 1YBVA 4MGKR 4F0JA 4K88A 2DR2A 1E6MA 3AR9A 1R00A 2RHOA 3Q7PA 3SLRA 3VNBA 4LJ8A 3T6KA 1F12A 2C2HA 2COUA 3BGVA 2O5CA 5J9FA 4Y2PA 1M2OB 3K9QO 3VNAA 4A10A 2P0EA 2HEGA 1TM7E 2C0CA 1T3HA 3OC0A 5B64A 4IF4A 4WZZA 1DCMA 5DHQA 1PD0A 4KK4A 2SKEA 3LDAA 4XJTA 1RMYA 4OHWA 5IASA 2BW0A 3A2KA 1EK1A 3H86A 4MUIA 3GEMA 4RM2A 1E98A 1YJQA 4UREA 4LJSA 4HTFB 1MG5A 2CF5A 2GKGA 4UEWA 3T1OA 4K6CA 1RZRA 4KXXA 2F3RA 2GN1A 2AFHB 4QLAA 5TF4A 3GJZA 4NYMQ 3PNLA 4IGKA 2NU6B 2WVJA 4ZPXA 1D8AA 2WJJA 2X1VA 3EE6A 1DTEA 1NBIA 1U8YA 1FFAA 3ZXYA 5TGDA 4ER6A 3AWDA 1R8XA 2GZ2A 3DOOA 2R65A 4XQEA 2Z9DA 4UUOA 4EI9A 2IL1A 3HWRA 2OE2A 5KNDH 3TLZA 4GP7A 2AQIA 3KS9A 4XCQA 3G2PA 1PEYA 3LQ2A 3QOXA 1DJNA 1NUAA 1UZMA 5DTMA 1ML4A 4MYTA 5BY2A 4D3XA 2A9FA 3CEPB 4IJUA 1EK6A 1ZIDA 2RKOA 2QTMA 3H6GA 3M6WA 4PQFA 2OZLB 2JAOA 4FMCB 3ZI7A 4DYVA 5FPPA 3THSA 1W0KA 3HQ4O 4AJ4A 5HYVA 3TNFA 4I1SA 1SKQA 2DFNA 1QR6A 3K72B 1L3IA 3OQBA 3H19A 4AZSA