4GI3A

Crystal structure of greglin in complex with subtilisin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
274
structure length
274
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords KerA
publication title Crystal structure of greglin, a novel non-classical Kazal inhibitor, in complex with subtilisin
pubmed doi rcsb
total genus 95
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4gi3A00
3VTAA 2WWTA 3LPAA 4H6WA 3DW1X 2W2NA 3DE6X 2WV7A 5FAXA 1BFKA 1GNVA 3A3NA 1SIUA 3TI7A 3F7OA 1GNSA 3I34X 3PTLA 1OT5A 2XRMA 3HJRA 1PJ8A 1SIOA 3PRKE 1SUPA 5FBZA 3VHQA 1GTG1 5CW1A 1TM3E 1EA7A 2SICE 3DE4X 3WIVA 3QFHA 5AQEA 3L1KA 4ZARA 1BH6A 3BX1A 3LXUX 4H6VA 5SICE 4C3VA 4Z2AA 2DUJA 2DQKA 1Y33E 1SBIA 4HVLA 3EDYA 3Q5GA 3EE6A 3BPSA 1MEEA 5B1EA 1Y4AE 1ST2A 5AVJA 3GCXA 1V6CA 3VV2A 5JXJA 1S01A 1TK2A 3P5BA 3VSBA 1YJBA 3A3PA 1BFUA 4OMDA 1NDQA 1TECE 4ZOQI 3DDZX 4LVOA 1Q5PA 2SBTA 4CFZA 5FFNA 4J94A 3H42B 3I30X 5AMXA 1T1EA 2ID4A 1SBNE 3Q40A 1JEAA 1IC6A 1TM1E 2Z30A 3QTLA 2PYZA 4HX2A 1Y9ZA 1OYVA 1DBIA 2W2PA 1PTKA 1BJRE 3I37X 3A3OA 4BWGA 1TO1E 3DVQX 1EGQA 5ARDA 2PWBA 1C3LA 1Y3FE 4OMCA 1ZVJA 2X8JA 1YJAA 2W2QA 3SICE 3DE3X 3WQBA 1GCIA 1PFGA 1GT91 1YJCA 1R6VA 2ZRQA 1TO2E 3OSZA 3DE2X 1WMEA 1AU9A 2PWAA 5ARBA 1S02A 4CG0A 4KG7A 1UBNA 1P8JA 3CO0S 4JP8A 1CNMA 1A2QA 1VSBA 5I9SA 1Y4DE 1Y48E 3DYBA 3DE1X 4DWWA 5JXGA 3D9QX 1Y34E 1V5IA 3DW3X 3VV3A 4DJ5X 1Y1KE 1SUAA 4NE7A 2Z2XA 2Z2ZA 1P7VA 4NE9A 3AJ9A 5JXIA 3QMPA 2IY9A 1CSEE 2Z58A 3SQOA 1R64A 4WOBA 3ZXXA 1BE8A 2ZWOA 1GA1A 2W2OA 1TM7E 3LPCA 2DP4E 4OV6B 1ZVKA 2WUVA 1GTL1 2PQ2A 5B1DA 2P4EA 1SCAA 1AVTA 1SBHA 4C3UA 2XTJA 4CFYA 1TM4E 1PEKE 1SELA 5JXHA 1AQNA 2TECE 1SCBA 2Z57A 4RYDA 1KDZA 1AH2A 5AVKA 1WMFA 2GKOA 1TMGE 1DUIA 1C9JA 1ST3A 3BGOS 3T41A 1HT3A 1SCJA 4K8RB 3DE5X 1GTJ1 3LPDA 1AK9A 1Y3BE 2PMWB 4B5LA 3DWEX 2Z56A 1XF1A 2IXTA 1R0RE 2SNIE 1SPBS 1KE1A 1IAVA 1GA4A 4FONA 3DVSX 1OYOA 3EIFA 3CNQS 4I0WB 1NLUA 3GT3A 1KDYA 5K7SA 2E1PA 1SIBE 3DE7X 1SCNE 3D43A 1SVNA 1C9MA 4KB5A 3VYVA 2WUWE 4LVNA 3ZXYA 1SUEA 1TM5E 3WIUA 1GA6A 1SUDA 3DVRX 1MPTA 1S2NA 1SBTA 1LW6E 1WSDA 1SH7A 4YN3A 4WOCA 4AKSA 1WMDA 2Z2YA 1KE2A 1SUCA 1WVMA 1T1GA 2W2MA 2B6NA 1AF4A 2ID8A 1Y3CE 2HD4A 2PKCA 1THMA 1C9NA 3GCWA 4MZDA 1T1IA 4H6XA 1Y3DE 3WHIA 3UNXA 3DE0X 1NDUA 1P7WA 5ARCA 1SUBA 3I2YX 3F49S 3AFGA 3GT4A 1SCDA 2ST1A 1BE6A 3TI9A 2QTWB 1KDVA 1SN7A 4KPGA 2ZWPA 4AKTA 1YU6A 3TECE 2PRKA 2X8JB 4NMXB 2SECE 2HPZA 2G4VA 1AV7A 3AJ8A 4M1ZA 4DZTA 1SBCA 3F7MA 2V8BA 4GI3A 5JMOA
chains in the Genus database with same CATH superfamily
3E8MA 4YGXB 5KYWB 2UZAA 3KLMX 1MAVA 1J39A 4YGYA 1KEEA 4X1YA 4GR9A 2JJ1A 1P4HA 2A4KA 4HQRA 1IJEA 4IG4A 4B81A 2D2XA 4JR1A 1GPBA 1SXJC 1EBUA 1XTTA 2Y76A 3AR4A 4HLCA 4J4TA 4RIFA 4UU1A 1D0IA 4DQXA 3K70D 1Q0RA 4YP0A 5FAXA 5KSYA 5AK6A 4OK5A 3TMKA 1E0SA 2GD2A 2ZRKA 1SIWA 2J3EA 4TMFA 3UXYA 3SP1A 4TWAA 3GEHA 5ADHA 2ECOA 2JW5A 3H8SA 3RWBA 2IVFA 2QRNA 4A2CA 5H3HA 5J9FA 4EEZA 5BPFA 4RH1A 3MUEA 4E2YA 3IV7A 1XNJA 1EFPA 2TSYB 3ZK9A 4MWCA 3STYA 1MTOA 2QPLA 2I03A 2QRGA 1WHSA 3OT5A 1Q7BA 4UM5A 4AQDA 3ND9A 1NXTA 3PQ6A 4V38A 3BMCA 2I6SA 1RYMA 1UQRA 1JECA 3ZOKA 4INAA 2PRZA 3P26A 3V48A 1AKUA 4JVLA 1HG1A 1TNDA 3HI4A 4M88A 3WV4A 5JAZA 4TYYA 3UPUA 3RRNA 3P8ZA 4QM7A 2QP3A 2WAYA 3P9PA 4GGPA 4OH7A 5CLGA 2O52A 5K6AA 5IYZF 2BP7A 2XH8A 2JH8A 4MWDA 1DZ3A 1CVLA 3M34A 2QUZA 3KU1A 4MR9A 4O29A 3BF7A 4Y67A 3TD9A 1SQFA 4CKWB 3G2LA 3CONA 3HBLA 3JAKA 4Z3KA 4RA6B 1L7AA 3W6NA 4OGFA 4X71A 4X91A 3L7OA 4DQVA 2IYRA 4GOLD 2O7RA 1I0IA 1OAKA 2Q3EA 3M7IA 1T5BA 4Y98A 2JAWA 5TQ0A 1JAHA 1WKBA 5DGHA 4ARBA 2G17A 3QYAA 3LX5A 3DXFA 3J7TA 3ETGA 3G5LA 4Q12A 3ND5A 2ZATA 1JG1A 4F60A 1I4OA 5LP6A 4EMTA 5I3ZA 1J22A 2WSMA 1H3NA 2JRCA 1NMZA 2FAXA 3B78A 5A4IS 1PYDA 4J2HA 3I5AA 3K20A 3RKSA 4IIBA 2C2XA 5EOVA 1W87A 3VR5A 1J4AA 4ES6A 2G1KA 3D3KA 1W29A 4BMOB 2Z04A 1LNQA 4IJMA 1YJQA 5DCUA 2B25A 3UJ8A 3OIVA 3RSHA 2XUHA 4RKFA 1LD3A 2AXPA 1KMMA 3VO9A 4PY2A 1X1BA 4OI2A 2C5BA 3I83A 5HOEA 5TIIA 5KUTA 4GVLA 1JKJB 1ZBQA 4MPDA 5SYMA 4EA9A 3GVIA 4EFNA 2XCQA 1SULA 2J85A 1WDMA 2BSAA 2IZ7A 3BJEA 3F5FA 3HBFA 2C9OA 3E9CA 2FUCA 3CHYA 3O91A 3WGZA 3ZGZA 3JQQA 1MPXA 4M37A 1NYRA 4MXDA 2EC5A 5EMMA 3CRZA 4BP1A 1WZIA 4K9PA 2O2JA 5DEIA 3NH6A 2V5VA 5IABA 3RC8A 4B6EA 3ZWAA 5HZGA 1VL6A 3K5PA 7REQB 5CLHA 3KAKA 1JQBA 3OZGA 3R74A 4LF9B 4XYGA 1IMJA 1SVWA 2C8JA 2GYUA 2YR0A 1MO3A 1TECE 3D7KA 2R6DA 3JZIA 1A98A 1KI9A 3NTRA 4N7BA 3IH5A 4BMXA 1CR6A 2GEVA 3PUYA 2C2GA 4R1UA 5DYGA 4GL4A 4G0ZA 1FFCA 2AX3A 3WXBA 2YY7A 2QXYA 4MDFA 1ZCJA 5CXQA 3PL1A 5DTIA 4IR7A 1T9GS 1W8IA 2HRDA 3R5XA 3WRVA 4IIFA 4EG3A 4M0UA 5HUQA 4RZUA 5IJ9A 2EFGA 4IDNA 4U0KA 1GLNA 3K9WA 5LQCA 4CR6A 4BLQA 2QMUA 5HF9A 2PIAA 3QE0A 4B4VA 1L4BA 5BURA 1YGPA 3CF4G 1DKLA 2XYVA 1S4QA 3KD3A 2RK4A 1G7TA 1DMSA 1IC6A 3B82A 4KK3A 3RUFA 3VJLA 4KPEC 3EF3A 1HFEL 2B99A 1QWOA 2V6MA 4G0MA 4LMAA 3BXPA 3UCFA 2DT5A 4H35A 3NTUA 1NP6A 2IXDA 1CPYA 1E1NA 1NQTA 3BL5A 5IU6A 1NY5A 4QUJA 1N5LA 2Q3DA 1LX7A 3KDAA 4UC0A 2HLNA 3MRVA 4WXMA 2ZIZA 5E7IA 3ZCQA 1DARA 4C7BA 2VJBA 2VK8A 3JQAB 1WCYA 4JYCA 2IV3A 1I1NA 4IQFA 1UMDB 5LC1A 1MEJA 2QW1A 3QPDA 1LSUA 4I3GA 1KAGA 2GRAA 4DEXA 4IW3B 3DVQX 3ZWMA 1JQAA 2AHRA 1JTEA 2I3ZA 4WKPA 4OHOA 3WYDA 1DC4A 4ARAA 4O3MA 4UXJA 2IYOA 2I6GA 1RI1A 2WSBA 2DPMA 2YY5A 3HPRA 3AUXA 2E4UA 1HEUA 2B37A 3NIFB 4HGOA 4JDPA 4K3VA 1P7YA 3TQQA 3ZGOA 4AJ1A 2P5TB 3L7LA 3WL7A 1HY3A 3KYJB 4WK6A 4ZI5A 5BOSB 1HDXA 1WF6A 3U17A 3V1YA 5TRTA 5FA5A 4FMDF 3PNVA 2NV2B 2VP3A 2RGNC 3AY7A 2BTQA 4Z4CA 3ROXA 3IDFA 2VP6A 5HKOA 2D5AA 4JEUA 2AE1A 3K9QO 4LIPD 3SEFA 4ABYA 3AETB 3P0FA 5DGCA 4JUFA 1F2VA 3MSCA 4RTMA 3K32A 3E9MA 1SUWA 5ES3A 1XKXA 4PQRA 2YN4A 4F84A 2RHBA 5JBNA 1Z7YA 2I4IA 1YFKA 1Q50A 2IODA 3D0QA 4PNHA 2C88A 2H3HA 2QD5A 4MRAA 4CIBA 2AN3A 1SU7A 1A3CA 1FYVA 2ZRQA 4Y2HA 4GR5A 1A7KA 4GPAA 3QA9A 2YV5A 4IIGA 4U7GA 2ESRA 3CH6A 3GFPA 3WKDA 2E18A 3EGWA 3FZEA 3G2MA 3A6PC 2BN4A 2UXBB 2Q46A 3UJAA 3QYPA 1EWRA 3QHAA 1JZQA 5BXYA 5G4KB 2XVYA 3UN1A 5K8LA 5HP4A 3G5TA 1WB4A 4FFLA 3FCXA 3B5IA 4FYVA 1HO3A 4EZIA 4JT2A 4BTVA 1JVNA 2JBAB 4LSWA 2DQ4A 2HUNA 3EF1A 4QHYA 3TZHA 4CL2A 5F9FA 1LB1B 5GPBA 4CCYA 2PKEA 1ZUHA 3GVHA 4DSAA 1VYVA 4AF7A 4I14A 4JP8A 2OO5A 2AZDA 2Z95A 2R44A 1IK6A 2GTPA 4JMLA 1LF5A 2CL7X 4M9SA 5JAUA 5I9SA 4MP6A 4MQ4A 3QIAA 5I8WA 1S89A 3MRXA 5EXSA 2ZT6A 4WDQA 4R0NA 1NM5A 5GZ3A 2C2OA 1A8SA 1J20A 2DGDA 4J1QA 2MYUA 4I4LA 3CJRA 3HVIA 1MJHA 3OEHA 1IZ9A 4KYVA 4ZQFA 2XKBA 1SVIA 1V5IA 2V4MA 4ZV4A 1Q0HA 3GU3A 2CMDA 5E6SB 1LBHA 2WTXA 1Y1KE 3R0IA 1T9KA 3E0QA 1IE3A 3HWWA 2BHNA 4P7FA 4RZ3A 4XWAA 3B6MA 2EVWX 3EJWA 5AKXA 4B74A 3W5SA 5CDFA 2NP6A 2H7XA 4AN0A 5BRAA 2SKEA 4ZZ2A 4NE9A 4GBGA 2RH8A 4OXNA 4L9WA 4NHOA 1WWKA 3HLTA 1M8PA 1NHGA 4CQNA 2H4FA 4FUQA 2CKDA 1II8A 4Y2YA 1SURA 3CSSA 4W8GA 2IXAA 2J9GA 3NP9A 1YZVA 2X77A 4QGBA 13PKA 1NW6A 3U37A 3Q9NA 2XXAA 3OX2A 1RJDA 1R64A 4WOBA 2ZYTX 4FOPA 4KO2S 4S0XA 1QDEA 4KKVA 1X8XA 4Z0HO 1Q1GA 4QYIA 5AK5A 5B55A 1Z8FA 3EEYA 4HAOA 3T1QA 3ENVA 4LI3X 1OZAA 2PX3A 2XUAA 3KBBA 4ZHQB 4E5UA 2CFRA 5EIAA 1XAHA 2BCGY 4HDKB 4TS3A 4YONB 1PS9A 2R00C 2WYUA 3T1VA 5C18A 3SDZA 5EESA 2P7IA 1Q19A 3GNSA 3GPDG 4EPTA 2G7ZA 3AEQA 4BMPB 3KC2A 3AHDA 1QAQA 3A25A 3W77A 1LDYA 2P4EA 4YFYA 1C7QA 4MW9A 1OC4A 5AHRA 2BD0A 3FBWA 1RQNA 2HF2A 4B43A 4JOSA 1PSWA 4YQEA 4F2HA 1CTQA 3ZH9B 4F97A 5HFNA 4GSLA 1XR3A 1JE1A 4US2R 2IYAA 3NHRA 1MJNA 3UPTA 1PWHA 4PBTA 2RGUA 3K1TA 2O2EA 4YAEA 2OSBA 4ZVMA 2YYYA 4Q4CA 3OPXA 2IWRA 1E99A 3GLHA 4QPDA 1XKTA 3IEXA 3OJCA 3ZLVA 4B2LA 4J75A 4CEHB 1ST3A 3GJ7A 4ZAXA 3T0IA 1O03A 4JEMA 1WVIA 4KQJA 2BMFA 5DGXA 3VHXB 4LV6A 2K87A 1KK0A 2OOKA 3CRNA 4PZ9A 2BI7A 2FZLA 3JXEA 2G9RA 3WLAA 5A04A 4N0DA 1KJJA 4JB0A 4KLNA 1Q7RA 3E53A 3HYSA 10MHA 1Y1PA 2VYND 5EXPA 4FHGA 1QMGA 1CQXA 4ECEA 4M60A 2CMHA 3PC7A 4J1SA 3QKIA 4Q3BA 4DQ0A 4HZUA 1NLMA 2O6HA 4OK3A 3WGUA 4DRZA 1XHEA 1Q7EA 4FR5A 1I7SB 1SPBS 3HCCA 5KCZA 4Y0VA 2HF9A 4GBJA 3RAFC 5DYIA 1OPRA 3D7NA 4OLFA 1T0UA 3HY4A 3LECA 3OD1A 1E98A 4RS3A 4OG2A 2ZRFA 1O8BA 1JRLA 4DQUA 1JEYB 1TLLA 3QKRA 1OILA 3N87A 1E9AA 2QZJA 2QUKA 2R8PA 3H6GA 4UEQA 3ZCSA 1J49A 1SD2A 1IFXA 2PGJA 1RJEA 4GX0A 4WVFA 1R4MA 4AU1A 4K5QA 1COWA 4IICA 1N5RA 3H11A 5IKOA 1W6UA 3OESA 1RHKA 3HVJA 3ZHVA 5I5EA 3RODA 4F6RB 1P9LA 5K7SA 1UKBA 3V7WA 4EB0A 2II6A 3EXIA 3W2TA 4FKMA 5FJJA 1D0SA 2AFIB 3DE7X 1ORDA 3GUUA 3U16A 3ZUPA 3K2QA 4J1TA 4JQYA 2RE8A 2X2PA 1I80A 4B48A 4YBRA 5BMOA 3D43A 2QTZA 2C0QA 4X3CA 3U56A 1QO0A 1C9MA 2WI8A 4UMVA 5LQSA 3RUEA 2FWPA 3DZBA 4FX2A 4KB5A 2C2BA 1XAIA 4V0MA 4AMYA 4PIMA 3PPIA 4DM4A 3IOCA 2H07A 2PQ0A 5J5AA 3CIFA 2WMYA 1OFIA 3R6WA 1NP3A 4EP1A 1U99A 4EPRA 2H48A 2AYXA 4WTOA 1SUEA 3SLRA 3Q2KA 3HA7A 1TQ8A 4EYQA 4DBLE 1SJ9A 2AI3A 3D3WA 3TKLA 4GNRA 1RIIA 4ATNA 4TSFA 5TT0A 1UBJS 1WU7A 1H2AS 2AOXA 4FGLA 2HLPA 1JKFA 1TF7A 4CWAA 3CRVA 3IILA 3WK7A 3KETA 2OZVA 3L8ZA 4Q1VA 3F5MA 3TWOA 2AFHB 3S5JA 1VG9B 3F1LA 4HYEA 3RS3A 1KE2A 1SUCA 3IBYA 2EQBA 2JC3A 1RI5A 5CLIA 4KJZA 1PQWA 1T1GA 1YVEI 3HCNA 3HU5A 3MLEA 4KVAA 4LYGA 5EHNA 2ZYHA 3UT0A 5CEEA 1MC8A 4QYWA 1ZH2A 2ES4A 2OZLA 3CURA 4P3NA 4K26A 4QC2A 2PSJA 3RYHB 3TXAA 2IBSA 2WYIA 3AZOA 1Z4NA 4PIVA 2ARKA 3HCDA 2AEEA 3NUZA 1Y5MA 1TUGA 3AI2A 1JR3D 4YDRA 3TK1A 1IEQA 4II3A 4BVAA 2J5RA 4BTLA 5C5EA 4LXHA 3WJAA 2X22A 3B1FA 4MZDA 1UQUA 3RS5A 5K8UA 2ISCA 3LRXA 1WXEA 4H2DA 3V1TC 2INGX 3NDJA 4RSHA 4CIWA 3FD8A 1GAEO 2NT4A 4JJ7A 2BONA 1T9AA 2CE2X 3OBBA 3PCTA 4GO1A 5J3JA 4AJ2A 1H6DA 1I3NA 1NLZA 2BKLA 3JAWB 3FOCA 4OGGA 4DY6A 1UBEA 1U9YA 4UBNA 3QBVA 2ASVA 2H1WA 1CJBA 2W8BA 3HV2A 3S81A 2QLBA 1R10A 1CZOA 1NDUA 2Z1NA 3OO0A 5HIAA 1KDPA 1UJCA 2XV1A 2ZKLA 4CMEA 3QELB 1JIVA 4WGFA 1EB9A 1N8SA 4JP2A 4PV7A 1A5TA 3WRXA 2NUTA 1C1DB 3RS4A 3N75A 3I2YX 3CZMA 1AKRA 3OKFA 4IOJA 2LE0A 5JD6A 3V8VA 1HL3A 3NDPA 2BEKA 2AG8A 4KQIA 2ZI4A 3C3KA 2FW9A 2PT6A 3I9FA 3U3MA 4AIRA 3Q8LA 3KT0A 2B35A 2ZJ3A 4IMIB 1XZCA 3O9ZA 4ZQEA 4G67A 5SYNA 1S3FA 3WZ2A 3I1JA 1GN8A 3LX4A 1K27A 2B30A 2OMEA 2ZSEA 3HSYA 1T6BY 4JMPA 4R0MA 1RXSA 2EW2A 1JKIA 2KI5A 2NSDA 2WU8A 1KO7A 4ZOLA 1PL0A 3GP8A 1I9GA 1DCTA 2Z4SA 2VQSA 5CUQA 2JA1A 2HGSA 4EFMA 4ZK6A 3SHQA 4IOKA 2OCGA 3RH0A 4KQMA 3U4HA 1Z33A 3F3YA 2PUJA 2VTBB 1FDIA 4RUKA 4YUWA 2VOEA 2J4FA 2FKNA 1D1TA 6NULA 2XCRB 3PF8A 1F0PA 3D7MA 3N2KB 1G20A 2XYGA 3NC4A 4RL6A 5MN4A 3Q8WA 4GI3A 2JEYA 4HX5A 5P21A 5REQB 3VPGA 4HDSA 3E82A 1VM6A 3PGA1 5FNZA 1SZCA 3PITA 4MVJG 4ZAGA 3HWRA 3L0IB 4UEJA 1LJ8A 1XN4A 3OY7A 5EFZA 1XAJA 2YHAA 2XRYA 1J2UA 3EODA 1DC7A 4RK0A 3OKAA 3X1DA 1JBEA 1KS9A 4MW0A 4X9XA 2RKOA 1M2FA 1L7BA 4DR6B 4QG7A 2CHUA 3ZTTA 2EFDB 1R12A 5HQTA 2K4MA 4HNTA 3MK31 3PZRA 1KZHA 5JARA 2RMKA 3AP1A 4L0MA 4N4AA 5BNWA 2GVNA 1G66A 4P2GA 4XI9A 3IVGA 4ZJYA 3H5NA 2P1DA 3FFAA 5F78A 2JLZA 5JNTA 3DH0A 1CVIA 2Q7OE 5KNBH 2H7CA 2X9VA 3OZDA 5C8DA 4EG0A 5M34A 1KH2A 2HXSA 721PA 1Y6ZA 1FX0A 3EDRA 2V4UA 4IXMA 3HJRA 5KWEA 2O8NA 3WLFA 3S29A 4C7OB 1IN8A 3H3JA 1PR6A 2UZ3A 2YJ6A 4ZOLF 4Z9FA 2ZIUB 1UT6A 1VCHA 1W44A 3WDMA 1CERA 4H1UA 2OFFA 4Q7QA 5E8RA 3DMRA 4GM1A 4FKZA 1GPWB 1ZD1A 2R4UA 5A9SB 4QTYA 1V8OA 2PR2A 2R8XA 4P33A 3GCGA 3PDUA 2HHCA 2CV2A 1PJQA 2OM2A 1TEHA 3OQHA 1XJ5A 2Y0BA 1CUDA 5NLLA 4B32A 4CF4A 2CV0A 1E77A 2RDMA 4OA8A 2VNSA 1IOWA 4D98A 5AW1A 1FW6A 2O5CA 1QIJA 5HFJA 2YJZA 3STXA 1FYDA 3EA4A 2Y1XA 2J3MA 2OQ2A 3EN0A 2DQKA 4EKYA 1ADFA 1E4EA 4LE0A 5TQVA 2OHIA 3PKIA 3EDCA 4KDEA 1N2EA 1YB6A 3PFWO 3HB5X 1AIPA 3ZZ1A 3HC7A 5TPWA 3M6WA 1FXWA 5U4QA 3AVUA 5H16A 1NVTA 1FB5A 3EDYA 4LI0A 1RKVA 1UM9B 2ECQA 4MW4A 2RI1A 1ZNYA 3GYBA 4IXDA 4OQZA 4RY9A 1Y8QA 1DAOA 2MSWA 2GM5A 5LKRA 3FVQA 3CRW1 5LPNA 3GMIA 4V24A 2E37A 3HLKA 4ND4A 1RT9A 1U28A 3FNBA 4GLJA 1GZHB 3OCZA 1JAXA 2IP4A 3WKBA 3NORA 5KNCH 2Q8QA 3WWZA 2XEDA 3UW3A 3P52A 3TLGA 1X0VA 2HSZA 2W7TA 4DCNA 3NVKI 3FVRA 4IIDA 1YJ5A 2RGEA 3JZFA 4RZ2A 5F1OA 1QKJA 1ISGA 5CFOA 1OB5A 3QTBA 1PZEA 3VO2A 1CR0A 1I2AA 1KXZA 1OGIA 4WW0A 4ZAYA 2BPOA 4DDUA 2HDNB 2XPCA 4HFRA 4KFSA 2B1JA 2RGYA 4NWIA 1R5NA 3BVPA 1EWTA 1TEZA 4DYHA 2ZT8A 5A4AA 4LRTB 4J03A 3A32A 2D6FA 3BXZA 2GLTA 4BC0A 4YASA 2RGBA 1YC2A 3OAAD 1U02A 3HJAA 5E4YA 3OU6A 3ASUA 1RXIA 4AJ9A 5IDQA 2ILVA 1V2HE 4PGAA 4AJHA 5EWLB 3L4KA 1T1EA 3ITDA 3JYQA 2OGZA 1WOYA 3CR3C 2OKGA 4OLBA 4ZMBA 4YAOA 3USCS 2NU9B 3GLFE 3AEYA 3I04A 2F1JA 3G0DA 3QU9A 2WIFA 1W85A 5IVPA 7MHTA 2QUBA 2B8TA 4G4SP 2BHLA 1V9LA 3U44B 3IEVA 3K0FA 4F1WA 1AM4D 2BFEB 4EK9A 5FR1A 2A1UA 1OW3B 4WAUA 3UCEA 1FXWF 1XJCA 2GN9A 5GVRA 1NDHA 3TNJA 3VMFA 1HDRA 4DR1B 1AGRA 4IGKA 4KXVA 4B4WA 1VBMA 1PYGA 2OQRA 2HSGA 3VO1A 5I3CA 4LNUA 1XTUA 3N8HA 1QONA 3I37X 1Z5PA 2WU3A 3K0BA 1XXHB 4ID3A 1HLDA 1TJNA 3GT7A 4IDGA 4EJFA 5EKDA 4INOA 5K99A 5CM9C 1NMQA 4BZQA 1AK1A 1OWPA 3T5GA 3KUUA 5A5EA 1QRSA 1I4EB 3HV0A 3A6LA 5LZ5A 2RH9B 3BRWA 5EP1A 3UFXB 1C3LA 4F5ZA 3SBEA 2GH1A 2NXJA 1NYTA 1Y1QA 3I4LA 4EUKA 2BKAA 1V37A 4GX2A 1XVIA 2E0IA 2FCRA 2PH3A 3ABZA 2W71A 3LV8A 1R6UA 1GHTA 4I99A 3D8RA 3O3CA 1G5QA 2Q5LA 1GRRA 1WQ1R 3IMCA 3P0EA 3H2IA 3H99A 4PCAA 2AC2A 3S28A 3QA3E 2F1HA 4J0GA 4MW5A 3UMBA 1SKYE 5K0EA 1H3EA 4HPWA 4DV2B 1FNBA 1ZC3A 3P45A 2F64A 4H27A 2XDYA 1FRNA 4QVGA 1CRQA 3AVQA 4EY5A 4JWKA 4EYKA 4ZJUA 5JSFA 4E70A 3LQRA 1JDBC 2Z5VA 1C9KA 3C16C 4HO1X 1L5KA 3Q3VA 1NTRA 1PV4A 3TKYA 2XBLA 4PC6A 1U1GA 4UTVA 5T7BA 3FUCA 3QLTA 3ZZNA 9MHTA 2HU8A 3S27A 2AE2A 2Z4RA 1FP2A 3PD0A 4IIEA 1NJSA 2XUPA 2R9VA 4M3NA 5EUQB 2ZI3A 1YS9A 3WLRA 4CUKA 4F46A 1G38A 3CLUC 4MWGA 4O2BB 1TW3A 2ORIA 2O50A 3GDWA 2Q7XA 3GVPA 3H87A 4FEAA 2QAGA 4QPZA 4S1PA 3KSUA 4QWMA 5AKYA 1RZ3A 2DQSA 4XPZA 3EXEB 5EFOA 4KTTE 4J0FA 3R9XB 2R25B 2P8JA 2X2FA 5EYPB 1I9CA 3W4JA 4CG0A 2MSKA 3REQB 1IBMB 5LOVA 3H0CA 3QJYA 2R2GA 2JL1A 4OYLA 4R9VA 1BHSA 2WU1A 4RQBA 3OHPA 5EKTA 3NDRA 1P8JA 1S9HA 2QL5A 2QYOA 3LRPA 3MWJA 4HWTA 5TC4A 3V42A 2FEXA 3ROGA 5I9IA 4B79A 5LZ2A 1S2MA 3G2KA 3V80A 4IDHA 1ZI9A 4E2FA 4HDRA 3H9JA 4LSZA 3CVXA 1EBFA 1GU1A 4OY3A 1L1RA 1KZ9A 1VSBA 1ZLYA 3MWEA 3AM4A 1C9YA 4WLVA 3I01M 4X85A 3EPKA 3D0RA 3EVFA 4KPUA 5LVAA 4GXQA 4EVQA 3FROA 1RADA 2PX2A 3KLPX 3Q3GE 4CT0A 2HKIA 1LQUA 4WNIA 1R8SA 3DONA 5D3ZA 4B6QA 1KH3A 2G6BA 2PZ8A 3F1KA 1MFZA 4ARIA 4BKQA 4HUTA 3WK5A 4G0OA 3N6XA 1SUAA 4UDOA 3W5DA 4EUHA 2QPOA 5AUOB 4KAAA 4N7JA 1WLYA 2HSJA 2DFNA 5GOTA 3P9KA 1NFQA 5HIJA 1EFVA 3X1XA 1S0UA 3QKWA 1H0KA 2OWEA 1E5TA 4DZZA 1SUIA 1ZBDA 3I9MA 1SCUA 1XCOA 4IS2A 1W88B 5FPSA 3RANA 1DC3A 1EYZA 2ZZKA 4FNMA 4N8EA 5LB2A 1CB0A 4RY0A 3LSTA 1LKZA 3NASA 2G3YA 16PKA 4KQEA 5IW8A 5IZCA 5KKNB 1FP6A 4NYIR 3RW9A 2MYTA 3MWDB 4F3RA 1OA1A 1MX5A 1GRVA 4PG6A 2XRFA 4EAQA 3OURA 1O5TA 4YXWD 3KEMA 2VHWA 3WNQA 4YREA 2XZLA 5A02A 1YVRA 1ESEA 5FWNA 3FOAA 4DY4A 1TYDE 1SU4A 2DCUA 1KBOA 2Q5CA 3ILYA 3Q7SA 4JVSB 1KOLA 3UKDA 4DVJA 2QVZX 4AUEA 3KSDO 3WDKA 2YOFA 3H5WA 1PHPA 3AJRA 3GEIA 4OV6B 2ZYSA 5PNTA 5T4FA 2WUVA 2YX1A 3KU4A 2W43A 2D2FA 3EPPA 3KXPA 4K6CA 4KYIB 1ZOOA 1MB4A 4LJ4A 3SKXA 1BQ3A 5DNWA 5LOVF 1VGRA 5CK5A 3L41A 3WKEA 2O0JA 1IY2A 4UEWA 3FYHA 3PE4A 4RANA 1S2IA 4JA2A 1CQZA 4M87A 3R7LA 5A3JA 3DMPA 3OFND 2F9LA 1ORRA 1OAOA 1UXGA 3CF0A 3DQQA 4K86A 1E62A 2OZKA 3BF8A 4UHHA 3DOFA 4BZWA 5HJ2A 3TG2A 5K0GA 3RRFA 4N0EA 4LHSA 2MT9A 2JFGA 2YS7A 3GZ4A 4I3FA 5IM5A 1TYCA 3KKQA 2X1MA 1NBMD 4D45A 1P61B 2WD9A 3UV7A 1RE1A 1FU7A 5ALPA 4OXXA 2P40A 1WPXA 2ODWA 2QD2A 2ZT7A 3BGOS 3MAAC 4HTFB 4LZZA 2JLVA 5GGXA 2N46A 3GF4A 2HDHA 1PJRA 4RF3A 4DCUA 1T2DA 1UZAA 1JHAA 1GNPA 2H1HA 3A9WA 3AFHA 3DZFA 3LHIA 1MTZA 4PC2A 5KPJA 3EGOA 1ZUWA 3T95A 2YWEA 4XVQA 4G5SA 4Y2TA 1J9EA 2I78A 1CS0A 3AHCA 3EOZA 3L0ZA 4OAPA 1U8TA 4HDMB 2Z56A 3FCOA 3UMJA 4HR7A 4EQ6B 2CEKA 3TXYA 4ON9A 2QROA 1A2BA 4MYRA 1J7JA 2QTMA 4WN3A 2JGNA 3AW9A 3MUOA 4R9UC 4RGYA 4AJ4A 3EHEA 5DWDA 2V7PA 1JNYA 1BHO1 1JT9A 2BM0A 3CZQA 3HFGA 1SUFA 3HFRA 4BRZA 4F72A 3O9MA 5BO5A 2Q5EA 4C08A 1CY6A 1JAIA 2GYYA 3TKAA 2QSUA 2QVGA 1A2KC 2O2CA 2W0MA 3WRWA 3CJTA 2YDYA 3VH1A 4D0NA 4UJ3A 1JALA 1UBGA 1TT7A 4C05A 4F1KA 3HLYA 3IE2A 4BNZA 3IP3A 4UOZA 4MUYA 1IG0A 1GKUB 5ECWA 3K4HA 5F3RA 3ZQ6A 4DN6A 5C37A 3V8MA 1T2CA 3D4PA 2NO0A 2QRLA 1XLTA 2RCNA 3G6KA 4MUKA 4BVEA 3TAXA 3ZUGA 4X8OA 1OXMA 4YBZA 2PL5A 3KQNA 3RD5A 1A69A 2FN9A 3ELYA 3K05A 3KSZO 1OI7A 1UXIA 3FR8A 3X1JA 3LCUA 3M3DA 4YV1A 5CFLA 5ITSA 2PE5A 4RIEA 5AVQA 2Q1XA 1X7YB 2EKQA 2AG0A 2RGCA 4GVXA 2WHPB 1PR1A 3I9KA 4BKMA 4CCAA 2XNDA 5SZKB 5AW0A 1GL6A 2QX6A 2AA3A 3EDMA 2H8KA 4R6XA 4UARA 2HBZA 4Q4AB 5AHXA 4ZKEA 4C06A 1WP9A 3OJFA 3EXHA 2HHAA 4NMHA 4UTRA 2VHJA 2AOTA 3AOEC 4IQGA 3UANA 4YRBA 2HCTA 5FH9A 3FRJA 3C3DA 4LQCA 1UMCB 4TS4A 3K71B 5H8WA 3AKEA 1X9GA 5ABPA 4O25A 1U0JA 3A4MA 4WNYA 5JS2A 1QH1B 3CNNA 3FJ1A 3N2GB 4LTNA 4D97A 4GW3A 4HT3B 1WMDA 1ML4A 4BFSA 4F0JA 2WTEA 1T4GA 4MUXA 3RS7A 4OHWA 2RHWA 3UGQA 3TRIA 4QJBA 4JODA 4IDBA 3IKVA 3D5EA 4DR5B 3DCIA 3AVYA 5D8DA 1EXDA 2C9CA 4KTVE 3RAJA 4AB1A 1UANA 4EW2A 1SRRA 2PKCA 5HOQA 2IV2X 3Q2IA 3RUAA 3LIPA 1EK0A 1M7HA 4X5OA 1M1YB 4IHKA 5DYYA 4YJGB 3HU1A 2H8GA 1AS0A 1L1EA 3SC2B 3W6OA 1FP7A 3N7TA 3DAFA 2Q3MA 4CU5A 2AVDA 1WBBA 2VPWA 1Z16A 1GQ2A 3KX2A 1ZAKA 2P9CA 4RDCA 2W48A 4WQMA 3RVSA 1J25A 1CY7A 3L7BA 4Q1BA 5CVTA 1MDBA 2EIXA 5L9AA 4MUHA 4CJXA 2RGRA 1X0XA 2J9YB 2R1UA 3L7MA 4YJ3A 3ZDAA 3RK4A 5F5NA 3F6EX 4FN4A 3N5CA 3JARA 3ADBA 1F2DA 4JLVA 4WNAB 1GNLA 1GILA 1V2GA 3PUWA 4RZHA 3ZWQA 3HXPA 1D7AA 1A27A 1CQIA 4GMDA 3G9QA 1FK8A 2GOYA 3GPCA 5IAEA 5LL6P 3ZD7A 1YULA 4PBRA 1ZG3A 3ECAA 4QVKA 3IR6A 4RY8A 3RT7A 3DC7A 4INPA 2V9CA 3M5CA 3NDIA 4GOMD 2EZ8A 1RVDA 4ZA2A 5CAEA 1CUXA 1KGSA 3PA6A 4PZEA 1RZUA 3TAHA 1QQ5A 3E81A 3R7WA 1DO8A 2WMOB 2ZJ1A 3QW2A 3WYCA 1NVDA 2BMEA 1A0OA 2C97A 1SCDA 2F43B 3LS2A 1GD1O 4POOA 3IPAA 3KTAB 4KXYA 1HSZA 2X7XA 3EHDA 4J6EA 1CQWA 1T26A 4ZCPA 3RIXA 5CX1B 3WO0A 4LKOA 4E88A 4TMZA 3HK2A 5D5QA 2PRYA 3QSGA 3CG0A 1LPSA 2ZWPA 3CISA 4KPGA 4A92A 1ZRNA 3CZAA 5ES4B 3N2NA 1TZCA 3G17A 4P0TA 4RADA 4ZYLA 5JNWA 5DP2A 1ISFA 1P1IA 1BOFA 1JFRA 4IHJB 5FT9A 5CA1B 5B5SA 1FIUA 1E1DA 3AUFA 2Q1WA 4JQOA 4G0XA 3NW9A 2CHQA 1UZUA 2FPGB 2Q4EA 4B6SA 2AEJA 4Q01A 1TAGA 1VIDA 4MR7B 3NIGB 4ZQHA 1QNLA 2Q41A 1ZMRA 1FVOA 2IUUA 1GZ7A 1U1IA 3S1AB 4MV0A 4HGQA 5KYUA 3X1YA 2WQ7A 5F3WB 5DNEA 1XYYA 1YBFA 2OGWA 2ZSHA 4UDXX 4U2GA 1D4OA 3SMVA 1FXSA 1RRMA 2XCLA 1A1VA 3KT8A 2B1GA 3RBXA 1ULZA 1HE2A 2ONYA 2BHTA 4AS3A 4UCFA 4BO4A 4F3CA 5B2ZA 3ZEAA 3FW1A 4YJ3F 4Y2VA 2YXDA 1WETA 2FPIB 2B36A 3BA1A 4C6RA 4G0UA 4FCCA 2MTBA 1P1RA 2HNKA 3DE6X 4MW7A 1LTQA 1AG9A 1M7BA 2WHYA 4TQUS 2V6GA 3RV3A 3W8FA 1ZIPA 1KSHA 2G0NA 1DO2A 2GMWA 2OZPA 4GRDA 1SXJB 2DR3A 2CK3D 2FZKA 4WK0B 3GWZA 3NHSA 2GWHA 1GCOA 2PXAA 3JR3A 1GNVA 2VDUE 1RYNA 1T8UA 1KF0A 1D2HA 2XMZA 2YWRA 3LO5A 3O0DA 4PO1A 3EIOA 2PFKA 1QZTA 3TI7A 3ZJVA 1UCFA 3F7OA 3U7JA 5EA2A 1WO8A 3C8ZA 1UAYA 5DK6A 5JVDF 3PTLA 2ZS8A 1VDZA 1IM2A 3MJEA 3QOFA 5F5XA 3M4ZA 1XFAA 2CDNA 3SYRA 2C58A 4BCDA 4LQ4A 1CRLA 2RARA 4LXIA 5K0TA 1GITA 1P0QA 4FFMA 1B73A 4DWOA 1I5EA 3AF6A 2ACWA 2O1XA 3G89A 3PRKE 4F3NA 1EUYA 3TOVA 3JWEA 4MVJP 2PCLA 1YA6A 4EF5A 3BK7A 3IOMA 1MRZA 2LIVA 5CB8A 1KMHB 2V55B 2A3RA 3LP8A 3RAPR 1KXJA 4G25A 5DBGA 1CUJA 5CXSA 1M2NA 1QTIA 3WOHA 1WBDA 3TOSA 2LZ0A 1B1CA 2MSDB 1WTCA 1MB2A 4HNVA 1PZFA 1T2VA 3DWIA 4OU5A 3R7BA 1AGPA 3GV0A 5FBWB 3H6KA 3MXTA 5FHRA 4D96A 1O9GA 2AL7A 5DPMA 4D5EA 4ARUA 1XL0A 1EJ0A 4DSUA 2H7YA 3LLVA 2RBEA 3SZ3A 4R5HA 2XUDA 2YHIB 2YJ3A 3Q8MA 2RHCA 3RUPA 2CL5A 1VJCA 1WZCA 1VXRA 1M6VA 1PR3A 4FJ0A 4LOJA 1BVUA 5CTJA 1JQ3A 1TA0A 1YR7A 4TGLA 1CR1A 4NESA 3IHWA 3M6FA 2FSPA 2OXTA 3S2IA 2AXQA 4M8KA 3PC6A 4PQYA 3H05A 2DLNA 5CFMA 3LNTA 9GPBA 3KAJA 1DBPA 1G19A 1L7DA 2J67A 2PGNA 4Q4LA 2FZVA 4JI2B 2HT1A 4FYKA 4MQMA 4ENSA 2D2VA 3NHPA 3Q1LA 4TPKA 5HF8A 5AKEA 3RC2A 2CZCA 3KK0A 1JU3A 1XD8A 5HIMA 4GOND 3H9BA 1PFYA 1WUJS 3QHQA 1TK2A 1NONA 5F5LA 1AKTA 2CWWA 5L7YA 2BM9A 2TRSB 3RVNA 1Y6QA 2D2IA 3SFVA 5A4KA 5M04A 4ZVKA 3VNQA 3TAUA 2J4DA 1ZRSA 1PW7A 1MO5A 1TZ2A 4QIHA 2VYNA 5ERYA 4FYJA 4KR9A 3ZHRA 3CIOA 3MMZA 4N9WA 1NDQA 1TMKA 3HKDB 3IAUA 3OJWA 4WESB 3PTAA 2N1MA 5DHTA 3A27A 3THWB 1RBMA 1L7OA 3CMMA 4KVZA 4H1VA 1GZ4A 1K4KA 1UK7A 4K6KA 2HCJB 3NT4A 2DXIA 4I50B 4PQFA 2ENUA 1UJ4A 3FZQA 4ISCA 3T5TA 4YFVA 4QODA 4C9BA 1JX6A 2QN7A 3PPYA 4NYMR 2ACVA 2R6R1 3M9XA 1LVUA 4DBZA 1QIKA 3ANMA 4GMHA 3SQDA 1R5JA 1O6ZA 2I55A 2DSTA 2IQ5A 2VJLA 2IYVA 3TW0A 3T1OA 3JWPA 3IFSA 3OTGA 4GPIB 3KPUA 4X45A 4US0R 1ZYUA 2OBNA 3NTLA 1JEAA 3W8DA 5DTJA 5CCEA 2Y27A 3NWPA 5BYBA 1AUPA 3R7AA 2Q99A 5EJMA 3CH4B 4HXEB 4BMYA 4Y7DA 2EQAA 1HEYA 2DC1A 3AUYA 4KN6A 4ZOAA 5DM1A 1R7RA 4WZAE 1Z83A 1ZK4A 2RHLA 2QR5A 3TD6A 4PLCA 3MF4A 4ZZ3A 1YZKA 5EP3A 3WGJA 4DXHA 3RUIA 5DN6D 2XCSB 2I4OA 1ENYA 1YZUA 3MJDA 1BD3A 2VYFA 1KS2A 4LN1A 3I9LA 4J0IA 3ZE8A 2H08A 3CM0A 5DJ5A 3WSTA 3M0EA 1XJQA 2F9MA 4PAOA 4Z7NB 1VL2A 1C0LA 4OL9A 2DWOA 2CFOA 1CUZA 1Z8NA 2B4AA 4PYOA 1KKUA 4DWVA 1OVGA 1GARA 1DS6A 4N9QA 2Z3VA 2DUUA 4UQLA 1HEIA 4XEHA 1QR6A 2BEJA 2J5XA 2OC9A 2CLFB 2F1KA 1T9ZA 1U3TA 2AKAB 2P9QA 3E18A 3GJXC 4QBTA 4ZEXA 1UIRA 3C5EA 4RESA 2FMFA 1KP9A 2OK8A 2YWBA 4X6YA 1XVVA 1YOVB 2YC2C 6CHYA 2ZRMA 4BE7B 3ELUA 1NSYA 2R60A 1CIVA 4HAXA 4MQ6A 5MDHA 2HW8A 1MH9A 5AHKA 1O9HA 4BQPA 1Q20A 5LYYA 4YHHB 1RP1A 1OLSA 3L9WA 4R1NA 3RG2A 4P4NA 3DZDA 4G41A 4MKXA 1MDFA 4WPGA 1NUUA 1U2GA 2O07A 2QJWA 3G5MA 1W6RA 4B9EA 4ZCMA 2BFPA 5TMPA 4PQGA 4HCJA 1ULHA 1Y6JA 2PVCA 1XQXA 4H3SA 1JIXA 2AZ4A 5HS4A 5EMNA 3GLGB 3NATA 1ZEMA 1RABA 4A0GA 4DDWA 3K6JA 3WBKA 3RABA 4V1CA 3E22A 3ONDA 4DPKA 1JR3A 1PG5A 3HUFA 5CX4A 1YJCA 4YMWA 4JWTA 3AP2A 1R6VA 2VQDA 3IVXA 3GC6A 4I5GA 4Y1RB 3OZVA 3OSZA 1GM5A 2B9EA 1ZN7A 3OEWA 1G8SA 3A05A 4XSHA 5KQLA 3DE2X 3NHAA 4LECA 2UZ4A 2ORWA 4TL7A 2YZNA 3LUJA 3GT0A 4UD6A 4F96A 1WV1A 4B6RA 3IUEA 5M3BA 4AZSA 3KZOA 1NN1A 3LY5A 1RWVA 4TWBA 5IBCA 2RHJA 2OHHA 2QGFA 2RAVA 4IJUA 4BJ3A 3A6EA 5C3UA 1B3RA 1G1AA 3L1JA 1E1RD 1WABA 1Y5IA 1U90A 3AL2A 4QD3A 1U8FO 3GRCA 3THXB 4QQNA 3WADA 2XB6A 1IOZA 5CG2A 2C5HA 3TOCA 2FG6C 1GEEA 1W5SA 3GLVA 5FBKA 4EO9A 4DARA 4MUIA 4RDHA 4HDNA 4GI5A 3OX3A 3ICOA 3KR9A 4XJTA 2DHEA 2LKCA 3A6KA 3CA8A 3E2PA 3AU8A 4MULA 3PGVA 5MN6A 4HAWA 3GR6A 3HDJA 1Y48E 3NUGA 2WWVD 3TINA 3F7TA 4NZYA 3G8DA 4MI3A 2YICA 1LFDB 5K03A 8ADHA 5CHYA 1JZSA 3L0PA 3KPWA 4Z1MD 5DHSA 3D6AA 4FFVA 3UV3A 1MKYA 3JQ8A 1DHTA 4XZ3A 1WB6A 5G3YA 5HJ7A 2AI2A 5F98A 1K97A 4RJJA 3L7KA 4PPYA 3RSLA 3UJPA 1U8XX 4KR2A 3NTVA 3O8CA 2VCYA 3PC8A 2BKUA 2XDQA 3AJ9A 4YP7A 1Q2XA 2Q6KA 2ROQA 2I2FA 3MT7A 1CBUA 1RCFA 1EZZA 1XDBA 1NATA 4OQQA 3ISVA 2WIJA 2N9UA 2QY9A 2X4DA 4NH0A 4KQGA 2AKEA 2OD7A 3OX1A 4KNVA 2XGOA 4KBFA 4A8JC 1U2QA 5IYZB 1GY8A 1ULAA 4EHFA 4DIOA 2DU8A 1BE8A 3U4QA 4ZC8A 2GETA 3OMWA 2YY6A 2BFBA 3GOQA 5DK4A 4YWHA 5K3FA 4B47A 2AX4A 3HKCA 1CK4A 3AM3A 2EDAA 1A88A 3NEPX 2O7NA 2VRCD 1SG6A 1FP1D 5LDGA 1RJFA 4MAMA 4C30A 2ZR0A 4KUGA 5B7NA 2F90A 3HEBA 3QV2A 3C7CB 4HRXA 5KOJA 1ES9A 2A0WA 4I55A 2AK3A 3R5FA 3UZUA 3CR8A 4NECA 3WYAA 4Q48A 5AI5A 2JVIA 3T3MB 3PDJA 2R87A 1W9HA 2OLJA 4MV3A 5K6TA 3G2NA 2R47A 3CB4A 1YR8A 5A5DA 3T12A 4AMBA 1SBHA 2P9BA 1SXIA 2XJ9A 4FGJA 2B5OA 4OKSA 3HDVA 3P71T 2Q1YA 3OU2A 4X1YB 1ZH4A 3QI2A 4B31A 4CFYA 3UOAB 1T3TA 4PE5B 2V6JA 1SCBA 2ODPA 4YLYA 2ZBDA 1PGNA 3AK4A 4D9EA 2ASEA 1N2CE 3C1OA 1N8TA 2IOHA 3RNOA 1NASA 4R7GA 4OJTA 1JLSA 1RM3A 5EHQA 1P2VA 1JJAA 4KIGA 1XMSA 5CDYA 4Y6RA 5BWLA 1EFPB 3T9FA 3L77A 1JA9A 4TUYA 5U9CA 2IDMA 2ANCA 4RD2A 2WJIA 3H1EA 3DE5X 2C9DA 4H31A 3FIUA 2F17A 4L16A 3DR5A 2YASA 3V9PA 2PU5A 2WHEA 1O94C 3ODPA 3UMSA 1N3LA 3RB8A 3QGMA 4NRDA 1R6TA 1IJFA 2GUWA 3I2KA 3D3NA 5E8JA 2Z08A 3V8NA 1B8PA 1PJLA 2SNIE 2E82A 3KTFA 2BP7B 4M1OA 2HMAA 1NA5A 3KLNA 4HZGA 4IVPA 2PGAA 1MO6A 3TLCA 3UMGA 1KFKB 5HXAA 1GA4A 4P6VF 1KYWA 1P6QA 4QYTA 3RKUA 3S99A 3W78A 1ZSNA 3JAKB 3G3EA 1USGA 3CTMA 3PDIA 1E60A 3I42A 4LJ6A 4IIHA 5AW9A 6REQA 1BKSB 1RAFA 3X1MA 1BVRA 2DSNA 4QUHA 1RC0A 2GN6A 4XW2A 1F3LA 4DA6A 1VOTA 4I55F 3GJTA 1DKQA 1HMYA 3NEYA 1VI5A 1Y7LA 5AJWA 3HACA 3F8TA 5LP6B 3G13A 2IYFA 4TRRA 1LBQA 5JZBA 3S68A 4R1PA 3DV0A 2IWHA 3CO5A 3TM5A 3K96A 3OIYA 1LX6A 4C4SA 2FGKA 3E5RA 4TN5A 5AK4A 3SJBA 4D44A 4JC8A 7MDHA 5FUWA 1SXHA 3VPFA 3FPSA 4C3ZA 2YXPX 4JA0A 4ROTA 1USIA 4B6OA 5B7PA 2ZGVA 2CLKB 2UVQA 4B84A 1QO7A 1XMVA 3EZFA 3JW8A 4AKHA 3CG4A 5K0BA 5F1KA 3VU1A 2OHOA 3FAZA 3UYKA 4R71A 1ZVVA 4CEIA 4YP6A 3U5ZB 1C8VB 1PTJC 1WZEA 3UJBA 1VJ5A 3EZGA 3BK1A 1M2KA 4LVNA 1P1FA 4F4JA 3OCXA 1ORWA 4WY2A 5TVKA 2AXEA 2GCPA 4TMWA 3ST7A 2YMMA 2KWIA 4EJ2A 4G8JA 4TUYF 2JAOA 1R0YA 4L3VA 5JISA 4JFAA 3GL9A 4IEFB 3RTCA 5KQMA 4OJNA 1T4DA 3AQIA 3DVRX 4EQZA 1LW6E 3ESRA 4P7BA 4DMCA 8AT1A 2QLJA 4F12A 3JU3A 5KYNA 2HPHA 3L6CA 2ZBFA 2OG2A 1J0EA 4FMDB 3IXQA 4PVCA 1JEOA 5DN9A 3ZK7A 3ROFA 4M7WA 1VKZA 4HN4B 1FDWA 4B7ZA 1HXHA 2FN8A 2OCXA 2PT7A 3D5QA 4BECA 2I4RA 3H18A 1H2BA 4JITA 3PXBA 1ZNWA 1XO1A 3HSSA 3FOFC 1DAHA 4R2HA 3KRTA 1JQ5A 4UNIA 1VKJA 1KYXA 3ILXA 1JHMA 1RLIA 3AXSA 4FU0A 4KJXA 5AKIA 4C4YA 1ND5A 2Q6VA 2YIMA 4LY0A 1BQEA 1YKFA 4WXRA 3ZHSA 1Q2UA 3U1TA 1THMA 2VBGA 4ALNA 4U3JA 3OOJA 1ONBA 3WJ1A 1J23A 1OPXA 1FRZA 3SHFA 1DCMA 3KSMA 3QF4A 3BE6A 5CW2A 1J90A 1S8AA 1ZK0A 3CINA 3EZ7A 2PJRA 1W36D 3QMMA 4ND5A 5JJKA 1UZMA 3WGIA 1R9NA 2J0SA 4RKWA 4H1TA 2DQZA 2PLNA 2PO7A 3FPKA 3N2YA 3TNDA 4IV0A 2MINA 5IHPA 2YOHA 3ETDA 5CVUA 3DAPA 4PBSA 4JIGA 1XRJA 5LBTA 1DWPA 2QXTA 3I28A 4CW7A 4BNDB 5C9ZA 1Q17A 2VTVA 2OXRA 1O58A 2IE8A 1J70A 1T8RA 3PC3A 3NBAA 1V7ZA 4J7CA 4MK4A 4R8SA 4W9NC 4ZALA 3IP6A 1W48A 1GGHA 4Q9JA 521PA 2OBFA 4DG9A 2C7BA 1Y1TA 1F8YA 1HTTA 2FTKE 5EI5A 2D62A 2NVUA 5BWBA 1CT9A 3F49S 4G5YA 5E1BA 4IUBS 2A30A 2X86A 4IDDA 4UNNA 5C4IA 1T3ZA 3REFA 4KV7A 1NJ5A 1G60A 1OTHA 4FFPA 4G09A 3S2SA 1V43A 3WIOA 2J7KA 4EB6A 1AQJA 1SQ0A 4XLLA 1V39A 4XB2A 2QLTA 2CLLB 3JVIA 1IOLA 4BGVA 3DMTC 1SN7A 4QICA 2BV3A 1IZ8A 4M9CA 1GPJA 2A86A 4HDAA 1YH3A 3C4VA 3QBTA 2BTQB 3L7CA 3ROMA 5L3SA 1YE5A 1A7AA 3CW2A 2VPPA 4F85A 1USUA 1N6KA 1P5HA 1YCHA 4NMXB 4PXYA 5J5VA 3DEHA 5J2UA 3DFMA 1E2UA 2EZ9A 4KN8A 3L06A 2D8AA 4D43A 3BG5A 2OILA 4FINA 2AZTA 4FC7A 1FYFA 2ZDHA 2HPZA 4B6GA 1SD1A 4N0QA 4JUBA 1TPYA 4LRUA 4DIBA 1JHUA 2XGSA 4UXIA 2V8BA 2WZBA 2Y0PA 1R5OA 2GFHA 5KHAA 5BW6B 4LYHA 4DLVA 4LZOA 2WSYB 1GOTA 3HP4A 4BRUA 3M4NA 1BXGB 2Y92A 2P2GA 3RWMB 1Z3IX 4ZOCA 3KM0A 2GO1A 4KDRA 4CLOA 4XIYA 4BZPA 2H00A 5CGQB 1PT5A 3F78A 4N1AA 4O4HA 3H7IA 4RZXA 3GFTA 3X1WA 3KQUA 3B9QA 2ZSAA 1HSOA 3NHZA 4RHXA 5IFLA 2P68A 4Q34A 4C4ZA 2AOUA 2ONCA 3IEKA 3NWOA 2OAP1 2QGZA 2D06A 2W6PA 3M9LA 3KPYA 5BQXA 3G0BA 2O7SA 5FOVA 1P9WA 2CF6A 1CFZA 4RBNA 4BP9A 5DRYA 1AKVA 2CLDX 4RTNA 3WGMA 4XB6B 4BKPA 4DZRA 3L6RA 3TZCA 5IJ0B 4B3RB 3W3ZB 1C9EA 1J0XO 2QD4A 2E4VA 4PYKA 4BVBA 1RZVA 4YAWA 2YV2A 4XRGA 5DXFA 2LUOA 1GNSA 4L6CA 1MNQA 3L8HA 4BNLA 1PNVA 2ZRHA 3D3JA 2C96A 4K9DA 3HZHA 5F2OA 4Z4QA 1OT5A 3JQ6A 4PXSA 4AJPA 4NQZA 1SKQA 4LCBA 5JCOA 4PC3A 4MCIA 1K5HA 1SUPA 1QF7A 3K5IA 4RHUA 4HBGA 4KN5A 1Y89A 3MQFA 3R8CA 3UXMA 4DSOA 1DRJA 3ANLA 2OFOA 5AJHA 2WPDD 5J2UF 4TVBA 3TR0A 4WOKA 4P3YA 4X20B 5DP1A 4YXWA 1IN1A 2WHQA 2UXDB 1XVUA 3ZJ5A 1HI9A 1VJ1A 1QZ3A 2EBUA 2DH6A 2QZ4A 5I9TA 1QCYA 1II8B 3E8XA 3OT1A 4ZU3A 1BH6A 1ZXXA 3BX1A 3BFXA 1LZLA 1BOOA 5CT8A 5GQSA 3R7NA 4X66B 3PEWA 4M1SA 5EEHA 2XXAB 1XZFA 2OB1A 3IAAA 2PMBA 2PX8A 1BA2A 4ETWA 1GZ5A 1KP3A 2XNJA 1L4LA 5FADA 4LOHA 4BUZA 4Y0NA 2GEFA 4DCTA 3JVVA 4QYIB 1E0KA 2B61A 3NU1A 2F9FA 2BYTA 1Z0UA 3OOEA 5EZ6B 3TLBA 3BB4A 1G3MA 4HD8A 1RYFA 3JSXA 5T8KA 3V32A 1XMQB 3AG5A 3LGXA 1U8CB 2XOKA 1CJKC 3AWDA 3O90A 3OFNA 4O4HF 2WQZA 5DXAA 5IRCD 5EJ5A 2JGRA 1IUNA 2AFVA 3B3GA 3U7GA 3AVTA 1L5OA 1KQFA 1P2UA 3AEQB 1Q0TA 4MJ7A 1BS9A 1D7OA 4TN1A 5D1NA 5CRIA 1TKBA 1L5YA 4PHHA 1BMTA 3QBEA 1NBMA 4HAUA 2GKSA 3RVBA 1PFVA 4HYQA 2WA2A 4P54A 4M7RA 4HNUA 1LWOA 3ACBA 2RHDA 2XF8A 3CTPA 3IT3A 3TFQA 1PSZA 4LDPA 1KPGA 1G2IA 1B6SA 5DW0A 4UNQA 5IKPA 1M34E 1G7SA 4ECAA 5D2CA 4D3ZA 3D8NA 1RAGA 1ZL0A 4YAJA 2JGAA 3GLHB 3RJZA 1E8MA 3I53A 1IVYA 5LN1A 3MBKA 3K31A 1C1HA 2FMTA 4UM9B 2E3JA 2FCAA 2O05A 4B34A 3Q9SA 2ORVA 2C42A 1RLTA 3V46A 3ACCA 5JH7F 3D6UA 2AJTA 1PUIA 5AJUA 4ZAFA 3UJ7A 1JHDA 1JE0A 1HDOA 1N6PA 3LE8A 3WWCA 4LFAB 2FUNB 3KOMA 1XD2A 1Z45A 4HZUB 3NYRA 5HF6A 3RI3A 3GLQA 4MGIR 1GQRA 5DDIP 1TM1E 4FMPA 1X6VA 2RH5A 2YQ5A 2ZJ4A 3DM5A 5BRJA 2ZBEA 4LOLA 1JQJC 3COVA 2CY0A 1QHYA 1NXOA 1W4ZA 5KTPA 2CHGA 2Z5LA 3QKRB 4BNIA 4HX2A 1DP4A 3IV6A 1G2OA 4X6LA 3M70A 3RYFB 3IQEA 4D99A 1SBZA 5A3QA 1XIVA 4H3KB 1ZNXA 1BJRE 4GMFA 1UBKS 3VR4D 1ONNA 1IZYA 1R4MB 2F55A 4WCFA 1K4YA 3ONVA 3H11B 3O7WA 4D57A 2PX5A 5J2TA 2GXAA 4BJHB 1YASA 4BQQA 1TQ2A 2VHCA 2W42A 1YHNA 4G0WA 2QRHA 1JBQA 2X2OA 3GOHA 4DMHA 3U40A 3FPCA 1JHPA 1QYVA 3D6VA 3IUJA 4FNAA 4TLBA 3I2JA 5EIOA 4QFMA 1GQQA 1JR4A 3ANYB 4TYPA 3MJRA 4Q6WA 4XWKA 1U2EA 3C7DB 3I58A 1ABBA 4ALKA 4QLOA 1GRCA 4OSEA 3IJRA 3UH1A 4NONA 3K0CC 3COJA 3I62A 1ZVJA 1ZN9A 3D3WB 1FRQA 4A10A 1NXPA 2Q1TA 4QT4A 1YJAA 3DAGA 3D6HA 3L1UA 1HWYA 5I8ZA 4CMIA 1A7JA 2VZ9A 1KFCB 4NENA 1KIFA 5AI0A 2EEPA 1IB0A 4IDCA 3R8FA 3PWTA 1K1EA 4OP1A 1PLLA 4FZJA 3QSYA 3L1HA 3FI0A 3EC7A 3S7ZA 1CX9B 3DWFA 2GS9A 3U7QA 2A0YA 3PFFA 3S1LA 3PE3A 4TRNA 1U0SY 4K46A 1XTSA 1IXZA 1UKCA 1WMEA 2WF5A 3MLBA 3G9ZA 2OZLB 3Q6MA 3VZRA 1P1BA 5DZSA 2V5AA 1SCKA 2XE7A 1YBAA 1ZY2A 3UFBA 2J3QA 4UUMA 2JLSA 5HZMA 4GL2A 3B53X 1TE2A 4GPBA 1K7YA 1EIZA 2CXTA 1S02A 2PV7A 3QVKA 2X5XA 4EI7A 1JLKA 1IXYA 2QUIA 4OA5A 1SM4A 3EWSA 4ND7A 3R0QA 2C5EA 3J7AC 2HBQA 1JDVA 3EK2A 4K03A 4WLNA 3A4YA 3EYAA 4TLEA 2FK7A 2IEIA 2CYBA 5J2TF 3D4NA 3VNAA 1Z5VA 2VDWA 4XGNA 4A3SA 5LXTB 2FPXA 3KQSA 4EB3A 3CVOA 4L0CA 1OGYA 2WAOA 3FPGA 1FTWA 1AT1A 1GFZA 3QFSA 5ICGA 1HX7A 1QGUA 4P08A 5EJIA 3TBKA 4BFCA 4NMWA 2VP5A 4PONA 2HT6A 1XZKA 2CJFA 3FE2A 3WMFA 2BF4A 3IAS6 4XSGA 1QWSA 1ZMBA 1NJ2A 1FDTA 1GGJA 4BB0A 2ZVJA 4D6PA 4IRMA 4B0OA 1JIUA 2X76A 1DG1G 3Q4GA 1NWCA 4AECA 3LPMA 5LSAA 1BW9A 1V5WA 4F9GA 1VYTA 2FWMX 4LNHA 4X62B 2ERCA 1KTVA 1QOQB 2B20A 2NO5A 3G2HA 3WX0A 3F71A 1WOMA 3N6RA 1HLGA 2AI1A 3TZKA 4XRRA 3TH5A 3CUSA 1SOAA 1D09A 4OBXA 1BRTA 2VJMA 2HRRA 1JUDA 3ETHA 2V7QD 5CJPA 2P67A 5EZYA 1X1AA 4TV8B 3E1SA 1XZIA 4YCDA 1L5RA 2B3DA 3EUEA 3QNUA 5L7TA 2DFDA 3PHBE 1GA1A 3T4UA 4D26A 4EJ0A 3UGJA 2VQ3A 5HBRA 3IPXA 1U8YA 3F47A 5BWMA 4JGIA 4K9LA 5B12A 121PA 2QTBA 5B3JA 4L02A 2WA1A 4UE6A 2JFZA 2PANA 1MD9A 3G2JA 3TQIA 3DL2A 3P27A 1DKPA 1VFNA 5T3YA 2ZUTA 3WQHA 4AROA 4EX7A 5A71A 2AMYA 2R7NA 1G20B 4CL8A 3AERA 2IEBA 3GEMA 4LF8B 3CZRA 1O7JA 1MUUA 4HDSB 5BW5A 5BN1A 1IIRA 1EJ6A 4BUCA 2MMGA 3QFCA 2CK3A 1E79D 1UFKA 2XHEA 3IUSA 1AGYA 1UJ5A 2BR3A 5F4BA 4A0HA 2C7PA 1DAFA 3JQEA 4J91A 2YVQA 2JVKA 2NTYC 3C7AA 3B89A 1WLSA 1E2HA 3D4BA 3SVLA 1X7GA 1XWFA 2JATA 1TO6A 5EGSA 4B76A 2CLEB 4Q02A 1NVVR 1XDZA 4DXAA 4EGJA 3UF0A 4ZIRB 5EQDA 4ZRMA 2O5VA 4GZ5A 3HVUA 3U3DA 1TTHA 5IANA 4ARZA 4QSMA 4IILA 1ZCAA 5A4DA 2GK3A 3LW7A 1DWUA 4AKEA 4BEBA 4CIAA 5FTMA 4LDNA 4KAFA 3LMKA 4PZ0A 5H9VA 5JWOA 2PMWB 3BSSA 4J0DA 3HTXA 1HKUA 2MSEB 3LUPA 4P83A 2WF7A 3MYRA 1C3JA 1G6HA 1XCMA 3MC1A 1FVHA 5JJ5A 1NM5C 1RMQA 2GZ3A 2ZJ5A 4QTXA 4Y2QA 1PQUA 3G1TA 3OD5A 5EZYF 2VOJA 4CL0A 2ZU0C 4ND8A 2CXSA 4I3HA 1G3IA 1ZD8A 1E0AA 5LD2C 5CH3A 1MH1A 1LI7A 1IY1A 2GERA 2BKEA 2B9VA 2I29A 4DAEA 3BB1A 5COAA 1MX3A 2CSXA 5K0SA 3GBSA 4GI1A 4YWJA 4EJSA 2FN3A 2P2YA 2JLCA 2NUAB 1HQYE 3GHYA 1KJ8A 1PR5A 2JIMA 1RU3A 1UBUS 3QVSA 2FPMA 4OTZA 1UOOA 3OPYB 4JT8A 4Q05A 4XCQA 5FOWA 3E9NA 4KPYA 5AW3A 3E0XA 1VQ1A 4XDYA 1E4EB 3DD5A 3SPXA 3OWXA 2OQIA 2ZJ2A 3CX6A 4FBMA 4J1NA 1TU4A 4UQPA 3DMYA 5KJFA 4R9NA 3ESCA 4RFVA 2CLOB 4DREA 4AZVA 2A5LA 3LJKA 1Y8QB 1QC5A 4PYJA 2RK3A 4TTRA 1G5RA 2OO7A 5K8JB 1N2ZA 2PMKA 3EDOA 1D0VA 3A6GA 2GCOA 2OBBA 2A92A 4Q9DA 1HDGO 3Q7PA 2B1RA 3M81A 4D7AA 3EWAA 1M0EA 1NIPA 2PGIA 4W5HA 2ZJ7A 1IY0A 1CUGA 1SBTA 4UFOA 1ZUIA 3BULA 4B73A 4NZ9A 3GP3A 4EEKA 3LUHA 4EIWA 2WABA 1A9PA 1GCGA 1SA0A 1SB8A 3MD0A 4BXOB 3QMWA 2NUBA 2VXYA 3KTOA 4CHGA 2NZWA 3OF5A 4MVWA 2BL4A 2HYIC 3UWMA 4HS4A 2WJ3A 1HM5A 1DX4A 1YZNA 2WJWA 2EX1A 3UQYS 4RFSA 3WLHA 2GAAA 2GDJA 1JXAA 2XXJA 2G28A 1Z0FA 5C1DA 2VZ8A 1MQAA 4FLFA 4DMRA 2FQXA 1TK9A 4OQDA 4ALLA 4XJSA 5FIUA 5DN6A 2X6QA 1XBTA 3HCFA 3IVRA 3H2KA 3NJRA 3KT6A 2FW1A 6GPBA 5KQPA 5FBHA 5A5VA 1C4XA 1L5NA 1U0HC 2JEOA 5AUQA 2XVZA 1Q16A 1RPAA 1WD7A 1EE9A 2AEMA 2EFJA 3GEDA 3ZWPA 3BRSA 3KKZA 1UK9A 1NVEA 2DFVA 1N1GA 1KNXA 2ZYDA 3FWNA 4Z4EA 2J59A 1U2ZA 2A1UB 4OOFA 4IFTA 4RJLA 5HMMA 3CRQA 2G82A 1CF9A 1DQZA 4EA6A 3MTJA 4PLTA 5DF1A 1K66A 4P0QB 1LLDA 1Z6AA 4HK4A 2EFHB 4MJ3A 3VYWA 2HV8A 1L4MA 1AJEA 5A2GA 3TVYA 4NNOA 2Q1SA 4MUFA 2CFIA 3EIEA 1TVEA 2DHDA 1PZNA 3UK0A 3QVGB 3CCFA 3AFGA 1GG8A 1OLOA 2BHSA 2PKXA 3B1WA 3FSGD 4JB3A 4RH3A 4XA8A 4BV9A 1T36B 3TGPA 5FD8A 1N8KA 3GMDA 5DWVA 4D82A 3SSAA 1YFJA 1O4VA 3DNMA 3N86A 1JR3E 2RFLA 1ZGJA 3TTVA 1P45A 4GPD1 3TSZA 5T64A 3VX3A 1WXFA 4CLDA 4X1KA 2W4QA 5BSEA 1DE0A 2QIPA 3NMUF 1EX7A 1EB8A 1FJHA 5BV7A 3KQKA 4BMVA 2EJCA 4FNGA 1NBOA 3VOSA 1Q21A 4N18A 4CE6A 4C5CA 4DCOA 4DDKA 2A3NA 4YX9A 1CYEA 3PWZA 3TGWA 1CD5A 3IQIX 2X4IA 2Z8YA 2R6ZA 2E9SA 2O1WA 1EXMA 3NV9A 3AJ8A 4LBVA 4AO8A 2AS0A 3Q9LA 2XKKA 3JZMA 2Q0QA 1GP2A 1HDCA 1A76A 3PRHA 3TUZC 4EL0A 4R0VA 1E1RA 3UC9A 2A7XA 3KJQA 4AN4A 4AFNA 5ETJA 3I45A 3RTEA 4YO7A 4B7AA 4FGUA 4LGVA 4DADA 5JSQA 4GEGA 2OENG 3KKEA 3Q3EA 1ATIA 3VTAA 3FWPA 3WB1A 1BMFD 4W9RA 3PTZA 1Q91A 4ACBA 4IL5A 4AJOA 2YHUA 4OMUA 4PAQA 4XSVA 5HILA 1PP4A 5HKKD 2IHBA 4E5DA 3ER6A 5CD1A 1UBOS 3HMQA 4L3OA 4OO3A 1H6AA 2Y1LA 3BK2A 1PJAA 3SYLA 5ILGA 5LOVB 2FNAA 1Z29A 4RGVA 4FEYA 3LH5A 3PVCA 1OBHA 3EWIA 2J0UB 3D6NB 3WTBA 4NBWA 4Z1MA 4A73A 2WU4A 4ZICA 2B4YA 3FHOA 2CXRA 2SCUB 4MR8A 4E14A 4WUVA 4D0SA 1E92A 1Z6PA 4HDRB 5ER6A 5KQRA 1NQAO 3QE3A 3A3NA 3L82B 4Y1GA 4A5OA 4ZI3A 5BUQA 2FFJA 5FFFA 3NTXA 4KPUB 5D3QA 2PNFA 3V2GA 4HB3A 4Q9NA 2JLYA 3R5TA 1Y4UA 3P7MA 3WRYC 2X5KO 1OX4B 2JK0A 3B7PA 3HCPA 3FUVA 1ISIA 2R85A 4WZBA 5B36A 1B76A 1HE3A 4FYHA 4B87A 1AN9A 2AC4A 3VJMA 4DQKA 1XEAA 2I7XA 1E3JA 2FPLA 2RGGA 1W4BA 1OFGA 1C8KA 2HXYA 2XAUA 3CVJA 4C0LA 1EFVB 5B6JA 1DBSA 3EBPA 2IE0A 4LUCA 3FJOA 2VRCA 4FUTA 3L1KA 4ZARA 4DW8A 1SCUB 1WUHS 2PX0A 3FFTA 4PNZA 4DJTA 1BIFA 1E1CA 2BEWA 4N3BA 3R6DA 2OLKA 1ABFA 5F21A 3WMWA 2C61A 3SX0A 3ORQA 4EYEA 2J6BA 4BAUA 4WECA 4NCXA 1YS1X 3DOUA 1H22A 3I0NA 4LDRA 4C3VA 5IH3A 3I8OA 3UHJA 5FI0B 3N28A 1Y33E 3GFBA 4PXAA 5H68A 3Q87B 2XITA 1E2MA 3AM5A 3DZKA 1ZI6A 4BGEA 4K1XA 6YASA 2IBMA 1VBFA 3SQWA 2WKSA 2Q21A 4IIYA 2YJ4A 3RIYA 5F35A 3CPSA 1E1KA 2ZCUA 3KWMA 3SKYA 3UA3A 1YVPA 3AEXA 5B1EA 3OKPA 3K70B 4IXTA 1RPNA 4PN7A 2QTRA 4H3HB 4U7FA 2L19A 3I2GA 3LDGA 1WJGA 1NAHA 4BE4A 4L4ZA 3ZG6A 4RY2A 4B7CA 2NWQA 1VKRA 2XVXA 4CLEA 2FEPA 3QFRA 2R79A 2IYWA 2YYAA 4P98A 2IS4A 4RA6A 5EPOA 3SD7A 4ZGWA 2V9PA 1O87A 1FY2A 2MSNA 4PZCA 1FU8A 1YJBA 3NANA 2JK1A 1E6EA 1BFUA 3L6OO 1CQJA 1I6WA 1DG3A 1LNSA 3TBFA 3WK9A 4TSKA 1RC8A 5JS1A 5SYAA 4BLSA 3GJRA 3O4IA 4DMFA 4Q9HA 3A26A 2JLBA 4M9XA 3SSMA 1ODIA 2Q0HA 3K4PA 3M1AA 3KQQA 4P7GA 2ID9A 3RT9A 4LBZA 4KQHA 3RVQA 3GNQA 1IWBB 3P9YA 1QOZA 1XQ1A 3NHJA 2CVFA 3X43A 4QQKA 3ZBUA 5LUAA 3U7HB 3CRRA 1N57A 4LWOA 3CJQA 3L8FA 4R5MA 5FXMA 4Z7QB 4ZRDA 1E6WA 4BNNA 2JGJA 1CS0B 1CY4A 4OUKX 1UEXC 2IYQA 4URUR 5CU7A 2PZFA 1KK3A 5EWMB 3VTFA 3NI2A 4MPTA 3LGSA 4XVCA 5JAIA 2ZB7A 4DEVA 1VRWA 5G41A 3UK7A 1QGDA 1V16B 3CX3A 1A8IA 1WEKA 4B71A 4YACA 2Q3HA 4C6SA 4MVXA 1JKJA 1W49A 2VIIA 2FSUA 4LXYA 4BO8A 2O4UX 1RD4A 1VLLA 4PZDA 1GNTA 4QXMA 4X1IB 2HQBA 4EGSA 4ESHA 4ZGBA 1SK9A 5MGBA 2RBKA 2VZ0A 3KEQA 4GBMA 1FLDA 2NZVG 1B00A 2VPTA 3I9JA 4JCOA 5F52A 4XVRA 3HDYA 4EI9A 3G8CA 4HQNA 2ZBPA 4ASUA 1PGJA 1YRQA 2GHQA 7REQA 2PBFA 2QVCA 1RYDA 2NW6A 5BVHA 2AN5A 3I1FA 4EABA 2PEZA 3W34A 3M6IA 5KO2A 1HQKA 3ND8A 3IR7A 1V35A 3FETA 3I04M 1OLUA 5E4JA 1F6WA 4Y2UA 4TMYA 3HJNA 1Z0SA 3NEJA 4G8DA 5LMZA 3GGJA 4C78A 4JBXA 1SC1A 3ZBQA 1KRXA 4HB0A 2IY8A 1T2AA 3AJAA 1KEUA 1XA0A 1W1IA 4RIHA 3U9LA 2EHDA 3KUKA 3UUWA 3I6BA 3G0CA 3RSQA 5KTKA 4G85A 2XA2A 4JLWA 5L6LB 1N75A 2CJYA 2AG1A 2NPIA 2O8EB 1FFGA 1YTUA 1DIHA 2GILA 5G2OA 2WG0A 1T4CB 3Q7RA 1QCCA 3EXHB 5CHEA 1DUSA 2C57A 2VHYA 5LNK1 2AOTB 3DTYA 1C50A 4PNPA 4HNSA 3ITKA 3OQJA 1QORA 3FTQA 2QY6A 3WL6A 4BB6A 2I8CA 1K0FA 5IAOA 4DS3A 3OQIA 3NKFA 3ZGYA 3IBSA 5AJYA 5EMJA 4BAGA 3E6AA 3IOEA 1QPZA 2QUHA 3HGMA 3HU3A 3QOWA 4D9NA 2OZEA 3JQAA 4H7KA 2FHSA 4IGAA 4XM0A 1SD5A 5E6UA 4F91B 4IV5A 4M0DA 2PQMA 2QDKA 4I9HA 4ZQBA 4E46A 1YRYE 2F3RA 2M2IA 2UYHA 1ZU5A 2O2YA 1SG9A 4DMUB 2PWAA 3WDLA 1VE3A 4EM6A 5AVVA 1PLJA 3C3JA 3QENA 1XQYA 5CPBA 2OAQ1 1T9GR 3WP1B 4IOLA 3MAJA 2O8CA 1QX3A 1KA9H 1W5BA 1FX1A 3BGDA 5ARBA 1KEKA 5AK0A 2I3BA 3GLTA 3N0VA 2G8NA 4JH0A 1EDOA 4QXQA 1UXOA 2H2IA 2YNMC 2JJQA 3ZE0B 4WI1A 5BOSA 4YJFA 4TTJA 3PT5A 1E2FA 2W6ID 2ZAMA 1RVV1 3JWIA 4LQLA 3U4CA 1KJIA 5C34B 1QF9A 4PYQA 2GD1O 2IXGA 1A9ZA 3P2YA 1J2JA 1RBYA 3IEIA 3ROKA 3ASZA 3H97A 1GU7A 2B8JA 3U81A 3WMGA 1GNRA 3QKTA 4DIEA 3PGXA 1H0HA 3K6RA 3FMVA 1R6XA 4GGMX 4LZWA 1CQIB 3TW8A 1CR2A 3PYXA 5LQJA 4B9AA 2VS1A 2OO3A 3IO5A 4DJ5X 4IX1A 3KEGA 2I7VA 2J3KA 2P27A 3IEUA 4IX9A 4M9UA 1W30A 4AZWA 1E2GA 1OFTA 2JIRA 3BD6A 3L07A 4HGZA 1XDGA 1BN6A 4NE7A 1ODFA 3H1BA 5G53C 3UGTA 1BXRA 2YN2A 4Z3DA 4PR3A 1L2TA 3KSBC 5HVNA 5T67A 5TMBA 4UXHA 4X7PA 2NO9A 1PR0A 3SSNA 1P4GA 3CWCA 2MWMA 2NZUG 4S1NA 4TMVA 1VGQA 1JEQA 2Z83A 3LO8A 1HNWB 3OOHA 3ENKA 1NI4A 2RHTA 4MYUA 3WNVA 1FFXA 2CNWA 2H2FA 2O3TA 4HWKA 5GJWC 4CM6A 2E55A 3BN3A 3WKCA 1Y8ZA 1OBCA 4ZVTA 2JFFA 2V0GA 2BEVB 3UHAA 2JA2A 2ZWOA 3O0TA 2ODAA 3AESA 2X8AA 4ZYXA 1T5IA 1CU1A 4DR2B 1SHTX 5K09A 1JWAB 4FZ3A 3VZQA 4XVUA 3QVTA 1TU3A 4FR0A 4QHTA 5CYPA 3NAGA 4MGZR 2VUUA 1SU6A 2WOJA 5C1PA 4HWRA 1QYCA 3B2NA 5DFAA 5J1SB 3OIGA 4P92A 4D9GA 3DLBA 5KYUB 4QO8A 3PHCA 3EZLA 3WB9A 1RLOA 2IC5A 3FIJA 1W46A 3N7AA 2ZIVB 2C94A 3HM2A 3FCEA 3MWFA 3R0VA 5E6SA 1P5FA 2GK7A 3W6PA 3LRTA 2OUKA 4NCHA 3AUJB 5IC5A 3U7RA 2Q3LA 2X0KA 2ADFA 4ERXA 5JSZA 1MC4A 3EISA 4JJ4A 5C4GB 4EI2A 2K7FA 1U2PA 4MPRA 4N03A 3I76A 2NV6A 3K0HA 3ILSA 1MABA 4TZTA 2GBLC 2O1EA 4D42A 2PWPA 4ZCSA 2B2NA 3LLMA 3LT5A 2GCIA 1PGQA 5E9WA 4DDMA 1FJGB 2P3LA 4Z1OA 3V3TA 3CLSC 5F9HA 4XUDA 1AN0A 2IGBA 2A59A 1GPLA 1Z6GA 5LZ7A 1ZJWA 5FUXA 3NM4A 2QMEA 2XHZA 2FJ0A 3WLQA 4EG4A 1XCJA 4GZ6A 1NE7A 3TLJA 4E21A 2WPDA 4PWZA 1JR6A 1OC2A 1YIDA 3OU7A 4XARA 2A8YA 2PVSA 3T3HA 5A06A 4HDKA 2FR8A 1BD4A 2OYCA 2IEZA 1PX0A 3BM5A 5KU1A 2XNHA 2BRUC 5GP1A 1TKRA 2QL9A 1U0RA 1RXCA 3CEPB 4Y6PA 4PTLA 2PUBA 3QQ5A 1HT2E 4BMCA 3CRMA 3R2JA 2H0AA 4HYYA 1ILWA 1VJDA 3LCCA 4K88A 4M1YA 1YZGA 4NR0A 4G89A 3QU7A 4ZO7A 3FSJX 2OPHA 1JEDA 3NTOA 1OE0A 1GQFA 5AP9A 4WJLA 3SDBA 1NUSA 2A7QA 1IRIA 5DI9A 4BDTA 4V03A 2B92A 1EAYA 1XZHA 2C7VA 1XZBA 4TTAA 1F48A 5CFRA 5DOZA 3A1WA 1NLUA 4LJAA 5CITA 4S2EA 2DPHA 1GZVA 5EE5B 1UC5B 2V6IA 4TTIA 4OQ4A 4QSHA 1QG4A 1RAIA 3F74A 1D2AA 1LI4A 1NBME 1DI0A 2JB9A 4NDNE 1NGSA 5DI3A 3CU5A 2A94A 3PFGA 2KB0A 3GJ0A 5DH9A 1IXRC 4KKXB 3EXG2 2O2ZA 4CMCA 4CMJA 2XWBF 1CCWA 2BZGA 4HC4A 1YZHA 4YJ2A 1D8AA 1FFSA 1RJ9A 1QKKA 4MI1A 4U2DA 2B4RO 2EP7A 3BIXA 1OXTA 2TS1A 4K2AA 4R01A 3VKUA 2HIHA 4MRSA 1TK3A 3K8ZA 3L18A 3T99A 3FSEA 4AKGA 3GW8A 4J0JA 5BNZA 3RADC 1QGYA 3HCBA 5HUJA 2V1XA 3PNSA 3KJXA 4R1SA 3ZX4A 2WWYA 3H04A 1CDZA 2A0UA 2GTIA 2GUGA 1MT3A 2J08A 2Y1FA 3H9QA 4RMHA 4LYDA 3RTAA 3ENQA 4G0QA 4DQDA 4LZPA 1KYVA 4X24A 2ZWIA 1WPQA 3GY0A 3QK7A 1MPTA 4J49A 2KBEA 3BCHA 2CC2A 5FWXA 4BLOA 4JIMA 1JEYA 3BJIC 3ZTYA 1IPFA 1NTOA 4GFDA 1LK0A 3ZK8A 1E18A 1L0BA 2KLHA 1OAOC 1FUEA 2EJBA 3GI1A 3GNLA 2OYSA 3PQFA 5ULLA 1NKSA 4NCNA 3SZLA 4C87A 4BO6A 2XCTB 1VJGA 3QVLA 1YK0A 1P2GA 3F73A 3R4VA 1OFVA 4RV9A 3D2CA 2B6NA 1B8UA 1LTKA 2FOXA 3UMVA 4Q3CA 4F6RA 1G8AA 1QRUA 3L4SO 3P1JA 1A9RA 3R5JA 3N2EA 4AY6A 2AFIA 2QTHA 2V6FA 3AF0A 2Q3FA 3A9TA 3MW8A 3BUSA 2WPNA 4MVYA 3UWKA 4DSTA 1Y81A 1SVLA 2OV8A 1H69A 4KLAA 3SDSA 3TLYA 3BB3A 1T1IA 2Q5HA 2VBCA 2X8BA 1KL7A 1V11A 4K6OA 4OBBA 3SQMA 5DISB 3TIXB 5B57C 3O2QB 6Q21A 2Q4OA 2ZE6A 4PZZA 1Q74A 4WV3A 1IM5A 1RI2A 1R9JA 2NU6B 2QENA 2QU7A 5GONF 4B7XA 4C5BA 2XDAA 1RRPA 1U31A 1IK4A 2YVLA 1FFAA 3MCWA 1S7CA 4FDAA 5L4NA 1V5FA 4FHCA 3SLGA 1G4UR 2QN6A 4TV9A 4Q39A 1HL7A 4DWJA 1JJFA 4C4PA 3LZ6A 4YJ2F 1W1UA 2CDBA 2CVQA 5EPEA 3FPLA 2Y71A 3IP7A 5A2QA 1S2OA 1KYYA 3HABA 2JKZA 4IQ8A 4UAGA 3ZVNA 3LLSA 2AFHA 4TWRA 5CP8A 2F4VB 2WE7A 3PQ3A 3RJ5A 5AVYA 5FAKA 4NZZA 3C4QA 3KHKA 4JN6B 1L7MA 2C5FA 4C1BA 4HNGA 4ETIA 5B3AA 1BXKA 1Z25A 3GD5A 2OD2A 2WUGA 1XZ8A 2DZDA 1EP3B 2RHGB 3GT4A 5ALXA 5ERXA 4B3HA 4BQRA 1RYZA 2BIFA 5FWAA 1S2LA 3IDAA 4ZDIA 1RQ2A 2QRKA 4E30A 3L7IA 5BN4A 5F51A 4ZN6A 3NTQA 1T0PA 3G1WA 1M0SA 4YPOA 1EVJA 2QTWB 1Y7TA 5ALUA 4DC1A 5JQGF 4RD6A 1KDVA 4QPPA 2R1ZA 4R2IA 2HWXA 4GKJB 1P4SA 1TADA 3FWKA 5KBYA 1JAZA 1VHWA 1XZNA 2OAEA 3UC5A 1Q95A 1P4RA 4TWJA 3ZE7A 5BQ3A 3MGAA 5CDHA 1FLNA 2IXFA 1J0AA 4O6VA 4CLXA 3T3EA 1Z4KA 4DLRA 2XYPA 3DOEA 1TI7A 2B69A 1E6KA 2PQ6A 1W4CA 4AF6A 4JKIA 3AR5A 4V1CB 1KRHA 3FG9A 1P3DA 4IDOA 1NZFA 3UMCA 3UQZA 3D4OA 5IBRA 1KOFA 3FYCA 3RSZA 3BL8A 3GO4A 4GR4A 5H80A 4JJEA 2P2SA 1KVTA 2RB4A 2J5KA 2M6RA 5JYCA 4NAVA 1NPDA 2J30A 2Z09A 4PN3A 1VJTA 3KIPA 2I80A 2FPUA 1CEEA 3FYUA 1Z28A 1HETA 5ESXA 1T5DX 1VI2A 2CNOA 4ZXFA 4CNBA 2C03A 2A9QA 3AO0B 2QRPA 3KKOA 2HJGA 4TV9F 1V4VA 3QMVA 2QE6A 4U2CA 4D79A 3E5NA 2GJ4A 2JD2A 5FI3A 2PPVA 2VN8A 3AKYA 2J45A 3R3WA 2XQJA 3ZV7A 1JJBA 1QHFA 1QZUA 1Z08A 1KQOA 3W5UA 3CW8X