1DVRA

Structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
SSESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase (phosphotransferase)
molecule keywords ADENYLATE KINASE
total genus 70
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dvrA00
3RRNA 2ZI7A 3U6BA 1NKTA 3R9IA 3GJ6A 4M1OA 3F5FA 1XTRA 2R6GA 4MKHA 4Q66C 1QHGA 3GEEA 2GZHA 4IVRA 2PZFA 3X2SA 1G8HA 5ANRB 2K5UA 2F43B 2CE7A 1S9HA 4MA4A 3W90A 4PO8A 3LVQE 3WBKA 4EFNA 1FUUA 4MQBA 4YLGA 4NH0A 1QF9A 5TDHA 1NVXQ 2AFIE 3TUZC 2O8BA 4XWOA 1R10A 2BMJA 2HCBA 2ZRCA 2O8EB 2QQ0A 1WMSA 1XD9A 1PZNA 5KO2A 1Z6GA 2ZUCA 3VNUA 5F9FA 4BZQA 1OPXA 2EYQA 4NCIA 3NHBA 4BFTA 2O8FA 4ON9A 1C9KA 4FIDA 1GKIA 1KK0A 2NGRA 4JKIA 5D3MA 5EE5B 3TSZA 2YOHA 3TNFA 2WVJA 3ASYA 3U3RA 2O0HA 2ZRPA 2JJ2D 4IDHA 4TLAA 4LC1A 3A1SA 1RRPA 2FPKA 4TMZA 4QC2A 5DI9A 2HT1A 2F1IA 2ZPTX 1E2JA 4HZIA 5B58C 5L8VA 2IYLD 5EP4A 1ZNYA 5BN5A 5HR5A 4LBZA 2Q9AA 4JJZA 2OAQ1 1VYVA 4KFSA 2JCSA 4OQMA 1U9IC 4PHGA 4Q7LA 2EWWA 3VHXA 1RZ3A 4A36A 2G1KA 1W7AA 2GRJA 2IUUA 2YKGA 1FTNA 2X77A 3KJEA 5H68A 3T1VA 3T34A 3KTAA 1K6MA 2F1JA 2GXQA 1XEWY 4NP6A 2WSSD 4Q9KA 3N70A 1AN0A 5FPSA 1B23P 2BM1A 4FW9A 1IN8A 1ZM9A 5FBVB 3TUJC 1W46A 4X8HA 4BFUA 5UKDA 1S8FA 2EFEB 4E5UA 3CW2A 3GLGB 1T4GA 3NG1A 4PC3A 1EFTA 1HQCA 3KKOA 1DAKA 1J7KA 1M7BA 1GL6A 3AKCA 3QF7A 1N6LA 1WRBA 3FOZA 4DXAA 3DHWC 3G82C 3A6PC 3AVWA 1U8AA 2FU5C 1T6NA 4GSYA 4IXMA 3FVQA 4ARZB 2A9KA 4LJ7A 1OXVA 3QOFA 3B9PA 1T8TA 4URVR 1BO6A 1KGDA 1SVLA 3CF0A 3X1XA 3X1YA 4YQFA 2DR3A 4F38A 1NY5A 4KLNA 1O87A 4BZXA 1NLYA 4QNRA 2X8AA 3BB4A 2GF0A 1XF9A 5HKKD 4GL2A 2RGNA 2V54A 5SZKB 1AK2A 1GL9B 1VCMA 2W2TA 2ZRIA 2ZRLA 4JL5A 2GXAA 4JLNA 4FINA 3THXA 2A5GA 4HLCA 2ZJZA 4CRWB 1G41A 2A5YB 3AEZA 2QAJA 2BBTA 1GKUB 4TMTA 1I4LD 1S4QA 3QF4B 4NTZA 2QSYA 3BC1A 2BKEA 2CVFA 5FTNA 5KSZA 221PA 4I1SA 4JT4A 1TQ6A 3B1XA 2P6NA 4AD8A 2ZYWX 4C30A 4LPSA 4RKFA 3JZMA 3CRQA 1L8QA 4LJ8A 3LY5A 4S35A 2A78A 1YU9A 2VA8A 4B74A 1TNDA 3QG1A 2OSBA 3MRSA 4YONB 3VR6A 1A2KC 1U81A 1ZM7A 5J4VA 2FSIA 1GNRA 2VSOA 4QG7A 5FOUA 1G3RA 1EFCA 1LTQA 4M21A 3QKTA 4TL6A 3S1AA 4O3MA 4PC1A 1TQ2A 3MWYW 2V1XA 3UK6A 2GK6A 2BIFA 3N2IA 4Q4LA 1COWA 3GLGA 2I1QA 4URYR 4XVUA 1N5IA 3LV8A 2XX3A 3ZZUA 5C2JB 2PX0A 2VSXA 3KFVA 4NCKA 4PFSA 1F48A 3MCAA 5DNYB 1OB2A 2WICA 1CIPA 1SVMA 3A8TA 2GETA 3C41J 3QXXA 2FWRA 2X2FA 3CRMA 2GAAA 1JEDA 2ZRFA 4Q4HB 2F1RA 3LLMA 1NG1A 4LYFA 4F91B 3U7GA 2VHQA 1OV4A 1GAJA 1HA3A 3EC2A 1E9DA 1II0A 1VG1A 1N0WA 1E6CA 3IO5A 4XVQA 1Z47A 3SHWA 1D5CA 1XEXA 5BQ5A 3K09C 1XTKA 2F3TA 3REFA 2F3RA 2OEPA 4BLRA 2XNDD 3GP8A 1GZSA 2ZSBA 4OHWA 2ZANA 1HURA 2ZI6A 3B85A 1JJVA 4HI0E 5FL3A 4GZLA 2WAYA 5KDLA 3IBGA 3MSXA 5J40A 4NKRA 3SOPA 3U44A 1NI3A 3RANA 1D2MA 2UVQA 1WXQA 3W8RA 1ZD1A 3CH5A 2FSGA 4JVLA 3UWKA 3DPUA 3DMDA 2KWIA 2YV5A 1U8ZA 2QG6A 5JI3E 2C8VA 1E2HA 3OFNA 1BMFA 1RJ9A 2OFOA 5EXPA 2Z43A 4U02A 4BLTA 3CM0A 3KFXA 3C14C 1E4YA 3IIMA 3KKMA 1EWQA 3AF0A 4DSTA 1EK0A 3NC0C 3SJZA 4DLSA 2J5XA 4IKEA 4C7OB 1XP8A 3L8ZA 4LHYA 3BJIC 2OCAA 5JS8A 4AI6A 2ZE6A 4FMCB 1XJCA 4PTLA 4A8JA 2ZR7A 2LKDA 2W83A 3C5HA 1OFUX 2V6IA 4NPHA 1US8B 1CTQA 2ZQ5A 3T1QA 3DZDA 4K8OA 3TVTA 2J59A 5EE3A 1F60A 1E2IA 1FTSA 2ZI3A 2IL1A 3DKVA 2WOOA 1IN6A 3K0AA 3EC1A 2JJ1A 2XB2A 3QEOA 5DE3A 5EUQB 4WVFA 4BE7B 4BQSA 2AXNA 3CBQA 4HSEA 1G19A 2BM0A 2J46A 1QHNA 2V8OA 2YC4C 1OIXA 2W2XA 1VG9B 3MLEA 3FB4A 1DAMA 1UDXA 4JKYA 1ZC4A 4PC2A 1JR3A 3TAHA 4V0ME 4KCGA 4DLTA 4M9ZA 3RABA 3QE0A 1E32A 1E96A 1KSFX 2Z5FA 2ZU0C 2XTNA 2JIZA 4N3NA 1YE8A 4ACAA 5GVSA 1D6JA 4I99A 2ZVQX 5CYOA 3I8XA 3MUFA 2OCYC 4G3XA 5L3RA 2EFCB 4IDOA 4MRRA 1MABB 3ZS9A 2WKPA 3E5HA 4JVMA 1RPZA 1VCNA 2G3YA 2C77A 1D9ZA 1ZBDA 2RGAA 1DVRA 4TL8A 1EFRD 4TTPA 1KI4A 1LV7A 3FHCB 2J0VA 3KL4A 3DO6A 4LBYA 1Z0DA 4B3CA 2QMOA 4S2EA 1Z22A 1YR9A 1CF4A 1WP9A 2NO1A 4US1R 4U00A 3RWMB 4LWZA 4CT4B 1E1RD 5EE9A 5KYKA 2QL6A 1XU4A 4FN5A 5KSPA 3CUEF 1ESMA 1L4UA 1R5NA 2ZRJA 4LJ9A 1XMVA 2JLQA 3EWSA 3GJ8A 2DWOA 2KJQA 3DVLA 4IEIA 3IILA 2CVHA 3T35A 2ORVA 1WB9A 2O8DB 5HE9A 1QVRA 2NO6A 3NBXX 1RYFA 1W0KD 3AF4A 3SI7A 4LBVA 3RRMA 1QG2A 1U98A 5DH9A 3BFVA 4HAYA 4RJLA 3WMGA 4JYCA 5FH9A 2JLXA 4DB4A 5JZVA 4B32A 1R5OA 4LZZA 4RVCA 3ZVMA 2W6JA 2Z83A 4D80A 2DWQA 1W4CA 1ZAKA 4PAOA 2H8KA 4M4SA 1GRQA 2VP5A 2FJUA 1N5KA 3TGPA 4PXAA 3GLHE 2QGZA 4LX0A 3TKLA 3EZ2A 2JGNA 4NYMR 4RZ3A 3TLXA 1GVNB 4Q21A 1A5TA 5A0FA 3CO5A 2N46A 4P4TA 1E0AA 3DKPA 3R7WA 5KOYA 3K8YA 1NSTA 1Z3IX 2Q0HA 4JBWA 3HPRA 1OXTA 4F4CA 3MJHA 4I1UA 4RFVA 1AGPA 3SR0A 5DSZA 4FMBB 4AYXA 2QU8A 4NMMA 1EWRA 1N5LA 3ZYCA 3VQTA 5HKKA 4WZ6A 1XTSA 3L0SA 4MDEA 2D3WA 2GXUA 1CJKC 2CLSA 2EVWX 3TQCA 1XJQA 1SHKA 3VAAA 4UNPA 3NIBA 4XIGS 2JLYA 1P9RA 2YWGA 4E03A 4DDWA 4OI1A 1G16A 1JQLB 3HR7A 2BOVA 4TMWA 1M2OB 3VR2A 4GT1A 4OI4A 3PIRA 3LW8A 1R7RA 1ZM4A 2VF7A 1VMAA 3CRW1 3R9XA 1E2FA 3EPHA 3OEEA 1LVGA 1QZXA 5FR2A 4Q1CA 4TQUS 5C46F 3VKHA 3BWDD 3QI2A 4YDHB 2J9RA 3AVXA 5D3MB 3EWAA 2MSCB 2R8RA 2NPIA 4AKIA 2NO7A 4YMVA 3C8UA 2QAGA 2ZS7A 1GNPA 4BFYA 2G1JA 4CW7A 5K8UA 3GLFA 1CRQA 4KODA 1G8GA 2BJWA 2AL7A 2IUSA 2V7QD 2ZJ5A 2SHKA 1NBME 1W2GA 2IC5A 4MRSA 2I1VB 1A1VA 2WTUA 1S0UA 4A0RA 3KX2A 4DIEA 1G18A 2QMEA 3KTAB 1T5IA 1QG4A 2QY9A 1FP6A 1T91A 4UQOA 1E2NA 2LCFA 4OQFA 3EAQA 2HXYA 4MGYR 3A4MA 3L8YA 3GEHA 3IQWA 4XWKA 5IRCD 1E1QD 4XWAA 1D2NA 5FR1A 2DFTA 3C16C 3T06B 4CYMA 5JFGA 2G0TA 1DEKA 3CF2A 2A30A 2F9LA 3THYB 1W0JA 4DLRA 4CEHB 3QBTA 4C0KA 1IHUA 2IF0A 1I4DD 1M1YE 3LX5A 3KXIA 3QQ5A 5JS7A 3U44B 3L0IB 1P61B 3IO3A 3GMTA 1SXJD 4UNNA 3AUYA 5KNCA 3Q8XB 3Q7PA 3H2YA 2BMEA 2F55A 4Q02A 4DLZA 2VP2A 4WIAA 5AJZA 4GPTA 1NJGA 2AK2A 4URZR 1LF0A 4OI2A 2Z4RA 4GP6A 2RKOA 2VRWA 2WPDA 2C9OA 3L0PA 4M1KA 2H7VA 2BBSA 5TXGA 2R9VA 3EARA 1ZD8A 5H8WA 3RC8A 4PHTA 4AWXA 1HE1C 4II7A 1YR6A 4A8JC 1OXSC 4XOIA 4MKFA 2IYQA 4B48A 2CHQA 2JDIA 2AWNA 1GDDA 2AR7A 3IEUA 2OV2A 4JJKA 4D26A 1YVDA 3VTKA 1R0XA 3A36A 1YZNA 1TUIA 5HPYB 2BMFA 4LBWA 1NSFA 4OJQA 4P3YA 5LD2C 5EP1A 5BN4A 2GBLC 1N6IA 1M7GA 2AKYA 3G5UA 4LPKA 2LWIA 2PLFA 4V0KA 1U0JA 4DB2A 2DCUA 4GDFA 4G5RA 2QM7A 3I73A 5JJIA 1KZGB 3A1VA 5FPKA 4B34A 2PCJA 3LFUA 3RRYA 4IOKA 5IF9A 1P4SA 2OM2A 3KDSE 4V0MA 1NG9A 3ZLJA 1W44A 4YXWD 1E1QA 3LNCA 4C3ZA 5IK2D 4ZPXA 4EJSA 3VU9B 2GA8A 5JEEA 4FWTA 4OK3A 2H1LA 2BBWA 2QTFA 2CNWA 1G7RA 4IXNA 1AZSC 5A4JA 5CB8A 2OFWA 3CX8A 3BXZA 1IXSB 3J81k 4TZ0A 4W7SA 3FTQA 5JWRA 1DG3A 5IHPA 2XNSA 3WXMA 5E7MA 1YR7A 2ZREA 4LV5B 5GVRA 3UMFA 2YWHA 3NBYC 1N5JA 2ZIAA 1N6OA 4RY2A 1O3YA 4MYHA 3SNHA 1E79A 1Z6AA 4C0LA 4W5HA 1NNEA 4B6FA 1ZW6A 2VO1A 1J2JA 2XNDA 4GMDA 4IVPA 5FBQB 3UIEA 2ZR0A 1EG7A 3HDTA 4DEYA 3K53A 1P5ZB 4ARZA 1SQ5A 1JI0A 3KXLA 5AUQA 2WJIA 3NH6A 3B6EA 2N1BA 3PG5A 4Q4JA 3TIFA 4N0DA 1N6RA 3VR3A 5CLLA 3QXJA 2QPOA 5K8IA 3HP1A 5LBIA 2P6RA 1W0JD 2UZ3A 2OAP1 1YRBA 2OESA 4JL6A 1NBMD 2EFDB 4A4DA 3AP3A 4DCVA 4BASA 1YZTA 4B44A 4PO1A 5E3HA 2JIZD 4ESVA 2CCGA 1XXHE 3KJIA 5K8LA 4L5BA 1KDPA 2BMDA 4C2TA 5LB2A 4DKXA 1E4VA 3EIHA 4TLDA 2UZIR 4RFSA 2CLCX 3U2QA 2A5JA 5FTMA 4ILEA 1WA5A 2GVZC 3AGQA 5B2ZA 1MRNA 2JAQA 3WY9A 4E07A 1C1YA 2H5EA 1I2DA 4HLUC 3RSLA 4BFZA 3K70B 3B1YA 3LAWA 4YDSA 2OXRA 1P60A 2QUZA 4ZIRB 4EPRA 4KBFA 4YXWA 3GJ0A 4LOAA 4M53A 2IS2A 2YHSA 2V7QA 2VP6A 3MWJA 1GRRA 4XTRA 3QENA 2QBYB 1XEWX 1I2MA 3A1TA 3K70C 1T9HA 5H70A 1Q1EA 2P67A 4P32A 2QORA 1OYWA 5AUNB 1U0HC 1KI1A 1CBUA 2JASA 3DDCA 1VG8A 1D9XA 2QPAA 5CJPA 1RRFA 1NMYA 1OH6A 3FE2A 3QXSA 1MO3A 4WW0A 1OHHA 1MV5A 3HPQA 2GJ8A 4ZIRA 1R8SA 3M1IA 1NVVR 2A7QA 2GESA 1KDRA 2ZYVX 3GCGA 3HU3A 5TY0A 1ZP6A 5EJEA 1E9CA 3GLHB 4NHOA 1JNYA 1QHYA 3VHLB 5FOXA 1OXXK 3ECCA 4IDQA 4Q01A 3GEIA 3PUYA 3EA5A 3CR8A 3CZPA 2D4HA 4MKGA 2EFHB 4F7WA 1OT3A 4ZDIA 2RHDA 4L9WA 1X8LA 1BMFD 4R71A 3NBZC 1E2QA 1SXJC 3I32A 4RD6A 4TYWA 2D74A 2GJSA 3QPWA 4PZZA 2V55B 3U61B 1ZIOA 1P72A 1AQUA 3M6AA 3W3ZB 3UPUA 3LWNA 2C9YA 4N1AA 5JMTA 1P9WA 3P26A 2QQEA 1X6VA 2AX4A 4A0GA 2A5FA 2OT3B 2Z4SA 4MYCA 1R4AA 4NBSA 4LC0A 1GM5A 2WHXA 3SE0A 3JZAA 2OUKA 4M9SA 1HV8A 1XMIA 2CBZA 3EZ7A 3H1TA 4BEJA 4B76A 3A1UA 1KMHB 2RGXA 5G40A 2WWXA 3VR4A 1QVAA 2PLRA 4O2LA 1E69A 1LF5A 1OKKD 2BEKA 3O8CA 3ND9A 2VSFA 4QNMA 1J99A 1JB1A 2V9PA 1IBRA 2GWHA 4TT3A 5EZ6B 2ONJA 4C0AC 4KAXA 2HEIA 5D3QA 4GZMA 1L2TA 3ZIAA 3CX7A 2WMOB 2ANBA 1FL9A 2ZUBA 4K81B 4M1YA 4X8OA 2A2ZA 2HXSA 5CM9C 4Z51A 3NKVA 3R9WA 3ETLA 5JJKA 2V1UA 5J4HA 2GCNA 5DO9A 4YMUA 1KSHA 2C9CA 4G01B 3KQNA 1X8KA 4Q9HA 2AN9A 4K46A 4YMTA 1ZM3A 4TZ6A 4NDZA 4PQRA 3I5XA 2O8CA 1LFDB 5KDDA 5KNDA 2HV8A 1Z0FA 1KAOA 1S9DA 2GHIA 1F2UA 4BUJA 3ZVNA 3LO5A 4EAQA 2ZITA 1ZNXA 4FWIB 4Q18A 4A6XA 3LBHA 1PJRA 1OLOA 2REOA 1S3SA 1Q1QA 1W5TA 1AQYA 3PQCA 2WV9A 1W4AA 5EXXA 1KI8A 2FOLA 1LS6A 1A2BA 1KAGA 3RDPA 4BFSA 2ATVA 4BLPA 5DYIA 5JI2E 4GRAA 5J4LA 1OB5A 3C7KA 3IHLA 2DFLA 5C4MA 4RSGA 121PA 3BS4A 3PVSA 1NMXA 2GEDA 4DLXA 4PSAA 4PZLA 2C98A 4P4SA 2ERYA 4D0GA 1EX7A 1KMHA 1NIJA 1JALA 5EUMA 1N6KA 1G5RA 3FDIA 5FI0B 3EA0A 2GEVA 1T3LA 2J41A 1II8B 1MR3F 1SVWA 4HB0A 4MRVA 4RD1A 4RZXA 1XJ0A 2R62A 2B6HA 4KXFB 4Q5IA 1ODFA 3BORA 4W5JA 5CJ2A 3IEVA 1DOAA 1Q44A 1DARA 2R2AA 3MFYA 3RWOA 3TE6A 3V9PA 2FZLA 2ZJ2A 4AYTA 2ZTSA 1FNMA 4PPQA 2PL3A 2VP0A 4LK2A 1II9A 3VR5A 5GJWC 1PUIA 3FGNA 3EX7C 2VHTA 1CR1A 1FQKA 2J7KA 2QN6A 1NVUQ 4B43A 4LDJA 3C4JA 1H8HD 2ZI9A 4JBXA 2GVDC 2BCJQ 2ZU6A 2D7CA 5DYGA 4M1WA 5F9HA 3EG5A 2ZRHA 3U4QB 2GEUA 2Z6VA 3OIVA 1E2LA 1Z2CA 5FOTA 1M74A 1K8RA 1MO4A 1VKJA 1KI6B 3JVVA 5JEDA 4I1OA 5L3VA 4DUGD 1NN5A 4EPVA 4LHVA 3SZRA 3P1JA 3EPJA 2RGBA 2B8WA 3SYLA 3DM9B 3RNLA 1NF3A 1KMQA 2GJAA 3OIUA 3KB1A 4HB2A 4V0NA 1II8A 3AB3A 4C2UA 4JBYA 1ETUA 2GK7A 4HYYA 1KJYA 2R44A 2R65A 2ZSDA 1OH5A 2WWFA 3AQ4A 2D7DA 2IS6A 4Q4HA 3QBVA 4B71A 1E9RA 1S2MA 3GJ4A 5DN6D 3CPEA 3RRZA 1SGWA 3TSOA 4TMVA 4PC6A 2IA5A 5TB5A 2WMNB 4KO8A 3SYNA 2ZRDA 1DAGA 1WQ1R 1QRAA 2W0MA 1XCGB 3AVQA 4BFVA 3KKPA 3OAAA 4KFUA 2ZYUX 5JJLA 2QAGB 2ZSFA 1OFHA 3AVUA 3T1TA 4EPXA 1R0ZA 4POAA 2MSEB 4WA7A 2WKRA 2WAXA 2ZI4A 1SXJA 2GAOA 3T61A 3TR5A 2QEQA 2XXAB 4Q4AA 4Q9LA 1P2VA 4FD2A 1RIFA 4AKEA 3CWQA 2ZS8A 1ZNWA 2O8CB 4RCYA 3OEED 1MKYA 3AH8A 4C9BA 3DOFA 4JSTA 3VFDA 1WBDA 3IIKA 1EFRA 3WNCA 3ZGXA 4UXHA 2IWRA 1GFIA 3WYAA 4F93B 5G53C 2VLIA 3BFKA 2WWHA 2WWIA 2DFKB 3SDZA 1W1WA 3LVRE 1KI9A 1H8ED 3MWKA 4DLYA 5JSZB 4JS0A 4C0HA 5FUYA 3THWA 1GOTA 4UJ3A 1SVIA 3R7WB 1XXHB 3K0FA 3CIOA 3I5YA 4GOKA 3UG7A 3VR1A 1KK3A 5KDOA 2IHBA 3EW9A 5SZJA 1Z29A 4V0OA 3CNLA 3FHTA 2FEMA 2C2HA 1N0VC 3LA6A 2ODNA 1IXZA 2GZAA 3HU2A 3RYTC 1DAFA 2NZJA 2O0JA 5DHFA 2ZSAA 2WWWA 5DHAA 2J87A 4MUAA 3AV0B 1TL7C 1U8YA 4MYTA 5AJXA 2YVUA 2Q9BA 4W5WA 3LDAA 3KXKA 3OIWA 3IDQA 3P4YA 4IW3B 4BGDA 4CEIA 3NTUA 4HZUA 1IN5A 1Y63A 4US0R 3DZ8A 1FW6A 2ZM5A 3ZVLA 1Z6XA 3BGWA 2HF8A 2OZEA 1AGRA 4DDUA 1Z07A 5KSYA 5E7IA 2G83A 3GLHA 2ZROA 2IYXA 2F1HA 1F2TA 1HUQA 1X8JA 2IS1A 2BV3A 4LJYA 3VNVA 5A5GA 4D4LA 6Q21A 1A4RA 2AK3A 5JWHA 1Z5ZA 2ZRBA 5FFMA 3GLIB 2IYRA 3SQWA 4AK9A 3BB3A 3SBDA 4A0FA 4A2WA 4ZI3A 4LRWA 2ZYTX 4OQXA 4QXAA 4DDTA 1J70A 1K5DA 1H8EA 5CIWA 1OIWA 4PPNA 3IQXA 4RKEA 2EFGA 2Q6TA 3W6OA 3CPHA 4B6EA 2QT0A 1XCMA 2CJWB 2F6RA 2FFAA 2XB4A 3WMEA 3AGPA 5EP3A 4NONA 421PA 4AKGA 1XNJA 4Q1BA 4V02A 1XZPA 3QKRB 3H4MA 2H17A 2ZAOA 2FN4A 1E2MA 4HAXA 4KU4A 3P20A 4M22A 4YMWA 2V4ZA 5CDFA 4ZI2A 3THWB 4HLDA 3OEHA 1E9FA 3ZZ0A 2AFHE 5J4KA 4TT3D 2O8FB 1KJWA 4CEJB 2DYKA 1NBMA 2FE4A 3QVUA 4HZUB 1JAHA 4Q48A 1YKSA 4PQFA 1MH1A 1E2PA 3GJ7A 4NYJQ 3PXGA 3AKEA 4KSCA 3WBJA 5JBQA 2ERXA 3W9YA 4IDNA 5BN3A 1RRCA 4U5XA 2DWPA 1TEXA 1CP2A 1TQ4A 1V43A 3B9QA 3PV0A 1E0SA 3WHKA 4B3BA 2F9MA 4AYWA 3KQUA 4PAMA 1TQDA 2HDNB 1KO4A 2XAUA 2CCJA 2QSZA 1G4AE 1TF7A 4G5SA 3T5GA 1Q1BA 3O8DA 4KSBA 1U0LA 4O2RA 4DVGA 3U7HB 1UBFA 1IY2A 3M0EA 1N6NA 1YZUA 3Q3JB 1RRGA 1KK1A 1UFQA 1UM8A 2VQSA 3AUXA 4F92B 3SEAA 5TARA 1EFUA 1XCPA 3RLFA 3SS8A 2Y8EA 4PPGA 2OG2A 2EQBA 5CIQA 2PEYA 3V00A 3C15C 5KUTA 1TF5A 1M8PA 1W2HA 3UMRA 3GLFB 4JLMA 4JL8A 1DAIA 4LJ6A 4D0LB 4LJ5A 2MMCA 3FMOB 3I61A 2H18A 3O47A 1MOZA 2C78A 2ANCA 4JT2A 1HT2E 4DIDA 1JR3E 3SQXA 2BVNA 3K70D 4A8JB 3LQQA 2QP4A 1K5GA 3DEFA 3AVVA 4UKDA 2P0EA 5LPNA 4Q03A 5FBLB 1CXZA 1J8YF 1ZINA 4M9XA 5P21A 1BYIA 2GKSA 2W2VA 3FKSA 5SZIA 3ZZTA 3EZFA 4QM6A 1UBEA 5IT5A 2IS4A 5HZHA 2CK3A 5L3SB 3V4RA 5F3WB 1KO5A 3WRYC 1DS6A 4ABYA 4IOLA 2PJZA 3EASA 1BIFA 1NY6A 2C95A 2N42A 2ZJYA 2C99A 4E09A 3OF5A 4B3FX 3VKGA 3SN6A 4FMCF 3U3MA 2CLDX 2GJKA 2ODBA 2J0UA 2JLVA 2IK8A 2JLUA 4JLBA 1G21E 4EJSC 3KB2A 1KY2A 3SHFA 3FPAA 2GNOA 2AD1A 1VYTA 4HLUA 3V4FA 1KKMA 2CJWA 4AY2A 5JHGB 1OSNA 4ZO4A 3SFVA 4G5QA 1FP7A 4B3DA 5KU1A 4ZDWA 1IOZA 2OHFA 2O8EA 3FYHA 4QJ5A 3MD0A 4PX9A 1TAGA 1G5TA 2NZ8A 3QXCA 4XVRA 3LBIA 1J90A 4EFMA 4C0BA 2F43A 4LJAA 4AG5A 4DCNA 4DUGA 2V6JA 3Q5DA 2V3CC 2XSZD 4NYJR 1ZM2A 1OHHD 2BHRA 2OCPA 3B2EA 3LXXA 1XX6A 2RAPA 1KNXA 2FSFA 1P2TA 3EPKA 1FZQA 2A3RA 2OO7A 3K0CA 2ZVPX 2NO9A 3ADKA 4LCBA 4QGGA 1P2UA 3B7GA 3QY0A 1ZC3A 4NCNA 4NU0A 4DT1B 1WDTA 1B0UA 1XTJA 2W6JD 3K0EA 1P9NA 4KYIB 5JHHB 1KOFA 2WWGA 4DLVA 5FUVA 1IY0A 4H1VA 4GP7A 4WAUA 5JECA 4WZBE 5K8TA 2ZS9A 5BW8A 4QFMA 3BBPA 1ONBA 3B8HA 3B1VA 4GBMA 3QUSA 4IEEA 4D4KA 4EUNA 4Z54A 821PA 4OHZA 4R2IA 3TK1A 3E1SA 2BC9A 2XEXA 5AUPB 2JLZA 4CEIB 1Z28A 3CRVA 3IUYA 3WP1B 4KV9A 1XZQA 4Q47A 2IYTA 1OW3B 3D7MA 2CMKA 1CKEA 4QHSA 2W0SA 2YWFA 2JLRA 3ADCA 1H65A 3DMNA 5CYPA 5J5CA 1Z0KA 3W5JA 2IX3A 4Z8YA 2FNAA 4XH9B 1IAQA 1NN0A 5FBRB 3PUWA 3CPJB 2WJVA 4RCZA 1XEFA 1DADA 1G7SA 4HUQA 4MDFA 3BRWD 2Q9CA 1QBKC 4BWYA 4XSGA 1GRNA 1JPJA 2XITA 3BERA 3FKQA 4TLEA 2NMVA 2WJYA 4JVSB 3R8FA 2PJRA 2VBCA 2MMGA 4O25A 3TW4A 3GLGE 2PEZA 4EFLA 1VECA 4Q4AB 5C18A 1KHTA 1XD8A 3A4LA 5JRZA 5KHOC 1SXJB 3PR1A 3Q85A 1ZIPA 4M2LA 1DELA 3VKWA 3ICQB 2F7SA 4JLDA 1MABA 3EXAA 3PUZA 4XD7A 2RB4A 2CXXA 5BWMA 1ZNZA 4NCHA 5IDVA 1KDOA 1P75A 2PZGA 5TV2A 1IONA 5CB6A 1F5NA 1N6PA 1P6XA 1PV4A 2HYDA 2D2FA 1VCOA 4JLAA 3Q5EA 2WM9B 2IXEA 1QHIA 2GILA 3BH7A 5L3QA 1EGAA 3NWJA 1ZUNB 1UBCA 3PITA 1AS3A 1UAAA 5FL7D 4G1UC 4TQAA 2HCJB 1BH2A 2W58A 4AC9A 2PBRA 1UADA 2REXB 4KJZA 2GXSA 3KUDA 4ITRC 4KYUA 3B60A 4TYNA 1DPFA 1U2RA 1IXRC 3R20A 4LI0A 2XZLA 4HDQB 3TBKA 1UKVY 4M1TA 4CF7A 3U3KA 4HLQB 2VIIA 3KQKA 2QM8A 3C5CA 3OFND 3RS2A 1Z0IA 2WIBA 4GNKA 4B3GA 4I4LA 2FZ4A 4WZAE 3UANA 4CDGA 4C7OA 5EXTA 1GILA 3SFZA 2QT1A 3OAAD 3ZD6A 2XXAA 4U7DA 2BBOA 2FG5A 2B7BA 1RKBA 1NKSA 3WP0A 1G6HA 3FMFA 2IHYA 2W00A 4LYAA 2OILA 4PC7A 2CCKA 3RS7A 3GLIE 1CJVC 2DB3A 1RW4A 3B1WA 2L0XA 2GDJA 4X8MA 3MAAC 2DBYA 2OXCA 4PO9A 4Z1MA 1RYHA 1ZD9A 2ZJAA 3LLUA 4TMXA 1J8MF 2O0KA 3T12A 4C0SA 2GCOA 3OE7D 3LQRA 4LYHA 2WOJA 3FFBA 3GPLA 4HAWA 5BXQC 3TW8B 2ZUDA 4CEHA 1HEIA 1PLKA 4URUR 1R0WA 1G4UR 1XD2A 4TL9A 4OK6A 1QHHA 2RGGA 3K9LA 2IYWA 3L43A 4KITB 2X2EA 2WIAA 2G9NA 4L9SA 1LS1A 4HAZA 3H86A 1OKKA 4LUCA 4QHTA 4IOJA 5LB4A 1DO0A 1UF9A 4GOJA 1JR3D 1FX0B 4ERNA 3OZXA 3CX6A 4LV8B 3Q9LA 4Q1EA 1Q3TA 4D6PA 3QVVA 1Z08A 4JLOA 5FTLA 4LV6A 1VPLA 2QBYA 1UKYA 2J7PD 2XGJA 4M1MA 3WNDA 4W9MC 3QKSA 2W6ID 3KQLA 4D0NA 1G8FA 1GUAA 3GFOA 5FOWA 1W36C 1IN7A 1PLJA 4HDOB 3W6NA 1Q3HA 1S3GA 1VIYA 2J7PA 4QHYA 4JZKA 4HAVA 2W6IA 3K9GA 3T5DA 5HZKA 4CEJA 1KO7A 2PT7A 3PEYA 2CHVA 2FFQA 2UKDA 4LGMA 1S96A 5JWOA 3PFIA 1CULC 3IIJA 4CIDA 3QF4A 1OH7A 4Q00A 4US2R 1T3SA 1GL7A 2BJVA 4IHQA 1Z63A 1E9AA 1SKYB 1WF3A 3VU9A 4BRWA 3SJAA 3CRRA 3BFXA 5JSZA 4IFEA 2E87A 4D82A 3N5CA 1Z06A 3MWLA 5H1YA 2QP9X 2C04A 1X1SA 5HE8A 2QE7A 3AKYA 4NL4H 2I3BA 4G5OA 1GG2A 4PQYA 2PMDA 1SXJE 2KB0A 3M4YA 3RS5A 4PAQA 3THXB 3W3AA 2XZOA 3BB1A 4MYUA 1N0UA 2AXPA 3LD9A 4B73A 2ZE8A 3QSYA 3WNBA 2JA1A 1KZ7B 2JDID 2VHJA 4PR0A 2RMKA 4TQ9A 4C0JA 1T0HB 4MGIR 3TRFA 1OJLA 4ASUD 2IYVA 1YJ5A 2EWVA 5AJVB 4DEXA 1MRSA 1ZU5A 5L3QB 2HYIC 1CJTC 5B64A 1TU4A 2Q21A 1ZYUA 1P62B 1D2EA 2ZJOA 1NJFA 2HT6A 4QBHA 1EFHA 3U7EB 2HJGA 1PUJA 2J45A 1X86B 1M7HA 3ZDQA 1N3BA 4FMDB 2C5LA 4WOPA 1IJEA 4UNQA 2FMXA 5AJYA 1C4OA 4IJMA 4Q1AA 4B35A 3F8TA 5E7JA 5AWFC 2QRNA 3O8RA 4BFXA 2YYZA 1Z6YA 1KTVA 2VP4A 3B1ZA 4G5GA 4LHXA 5LDDC 1T8UA 3NDPA 4HEJA 3THOA 3CKLA 4BPBA 1OIVA 3KUCA 2FPMA 3H0KA 2NPFA 4QJ4A 4JMPA 5DN6A 1E98A 2E1RA 3LBNA 2ZI5A 4ZCIA 3K1JA 3AVOA 1QHHB 2AKAB 3T1OA 1RJ9B 2H16A 1KO1A 2WSMA 4L16A 2IT1A 4DHEA 4YC7A 3U4QA 1ESNA 2QE7D 4DWJA 5KSOA 1E2GA 1Q22A 4IOMA 2ZEJA 4LYJA 4DSOA 1AIPA 3NBFA 4QGFA 1JPNA 4QKQA 1KDTA 1E9EA 1L4YA 1NMZA 3LW7A 4ZCLA 2GCOB 2B8TA 3PUVA 2PX3A 1A7JA 1ZCBA 1ZRHA 1QHSA 2C03A 3ADBA 1GSIA 4M1SA 3AM1A 1R5BA 2WKQA 2ZJ8A 3HJNA 2B21A 4BZPA 1E2EA 1Q12A 3AP2A 4KBGA 4UNRA 4BEBA 2KE5A 4HUTA 1BKDR 2P6UA 3QKUA 3QIAA 1E3MA 4V0LA 1X1RA 4YMSA 2RGEA 5JCPA 2AWOA 3EZ9A 4JSYA 1G3MA 1XBTA 2Q3HA 4RFSB 1E2KA 2AD5A 4DCUA 4QBFA 4CGZA 2OBLA 3U6KA 3CONA 2QA5A 4DBLC 2FSHA 4HDCA 1KY3A 4B3XA 2AHOA 5DI3A 3SYKA 4NE2A 4TTRA 5FOSA 3WYFA 2A5DA 4ACBA 4Q4JB 1U99A 1E9BA 3I62A 1G7CA 1JAIA 3HYRA 1VG0B 5CK4A 1DG1G 2BKUA 4A2PA 3S1AB 4HB4A 4R9UC 2QI9C 3F0TA 4FMDF 1T3HA 4CVNA 1E9SA 4EJSB 1VHTA 2HJVA 2NG1A 1KSJA 2CK3D 3FFAA 3PEVA 4TLBA 3I92A 1NVVQ 1VIAA 3GLFE 1VYUA 1ZUIA 3I8SA 3RAPR 2PH1A 4MRPA 4BECA 3PEWA 3P4XA 4L8GA 2KSQA 5EXSA 1G3UA 3AVPA 4GOXA 4L4UA 1JQJC 4PHHA 2OBNA 4Y0AA 5G3ZA 3TJZA 2VEDA 3QEJA 1TADA 3O8BA 4P31A 1U94A 3IKJA 3IBYA 2KI5A 4NYIR 3RS4A 5LD2B 3EIQA 1ZMXA 3BD9A 3A4NA 1FOEB 5EE1A 4B2PA 2XOKD 4PANA 2XTZA 4DSNA 1AA9A 2KBEA 1P2SA 2R6CA 4IVQA 5AJWA 1A82A 1OXUA 2WBLC 1HE8B 2OLKA 1PLLA 3CB4A 2YOFA 3ZQJA 3PENA 4AURA 3E70C 1Q20A 4Q7JB 4JYBA 4P0TA 4DLUA 1DE0A 1UEIA 4KFTA 2CE2X 4R98A 3SU8A 3T15A 2ZE7A 1VTKA 2NOAA 2IXGA 4QBGB 521PA 2J0SA 4KLZA 2NTYC 3KKQA 3OHMA 5G41A 2QGNA 4JLKA 1OFIA 4M8NE 3K0CC 1IM2A 4B2LA 1KI7A 4EPYA 2IF2A 1RVDA 1VCIA 2IYZA 2BWJA 1ELOA 5J47A 5ELXA 4F4JA 2ZJBA 2EU8A 3UATA 3E2IA 4PPFA 2FH5B 621PA 4QM7A 3OEHD 4PHFA 2ZAMA 3BE4A 1NIPA 5BYKA 2ZSEA 4Z1MD 1S1MA 5CITA 1Z83A 3QKSB 2IWHA 1NN1A 3RVBA 4F4IA 1XWIA 1ZU4A 4RD0A 2Q3FA 4RD4A 1ZUHA 1UJ2A 3H84A 5FBWB 1HQYE 1NRJB 4URWR 2QMHA 4X8LA 1Q0UA 5FPTA 3TMKA 2ZXUA 2XTMA 4RZUA 5FI1B 3EPLA 3DOEA 5DGXA 4TMKA 1G5PA 2TMKA 4EDHA 2R6FA 1SVKA 1LB1B 3AF1A 1KKLA 1M6NA 1HYQA 3D6TB 5GJCA 2O8DA 1GTVA 4NYMQ 3THYA 3DL0A 4DZZA 4OHXA 3ZIAD 4GFDA 1FQJA 5B57C 1P7CA 3NH9A 1CJMA 5JCZA 1CJUC 4FXPA 4MGKR 1QDEA 5GJBA 2IYUA 4N0EA 1N2CE 2CL0X 4OYHA 1XRJA 3KQHA 4KHZA 3P27A 4OK5A 3LXRA 4TSFD 4TL7A 3K0AB 3K0SA 3KZ1E 4DJTA 4ZCMA 5KNBA 3JVUA 4JLJA 1R6BX 3B82A 1AS0A 5F2EA 4HATA 4PSVA 3GD7A 3ZQ6A 4A9AA 4KFRA 3LX8A 1AJEA 2PZEA 2VF8A 2RCNA 3I1FA 3BIFA 2ODEA 4B47A 2IEYA 1R8QA 3NEYA 5EZ5A 3UG6A 3GFPA 2JEOA 4JLPA 5DLQC 1DTSA 1G3QA 1OE0A 2MSDB 4PZYA 1G7TA 5JRJA 1YZGA 5BYJA 1AS2A 3KJGA 4XSHA 4TYYA 1XTQA 1UPTA 2G6BA 3AVYA 4DDVA 2X1VA 2IXFA 4IRUB 2VYFA 8OHMA 1SVSA 4M0LA 5AUOB 5E4FA 1UKEA 2DY1A 5FPYA 5J4YA 4DCTA 3D8BA 2GBLA 1W4RA 3QNUA 1YZQA 5GJVC 3W34A 3A1WA 1QHXA 2KBFA 4A15A 5AR1A 4D4JA 1U9IA 2BEJA 2Z0MA 2QMUA 3A58B 3NXSA 2P3SA 4H1UA 3VMFA 5FUXA 1MO5A 4LY6A 1HTWA 1YQTA 4D25A 1US8A 3QXHA 3KJHA 4Q9JA 3U7FB 1W4BA 3EZ6A 2ATXA 4ZDJA 1FFHA 3GJ3A 3ADDA 4B33A 4EPTA 4LHWA 2IYSA 2GF9A 4MRNA 3NVAA 3U3OA 2ZR9A 1SKQA 1JXOA 2IW3A 3EIEA 2VL7A 4FI3C 1HH4A 2Q3MA 1COWD 3D3QA 3IPYA 2HLDA 4OQLA 4QGHA 4A82A 2WZQA 3PEUA 1AKYA 4GI7A 1TPZA 2CNWD 3FMPB 2HUPA 3N2EA 2O8BB 3WRXC 4HAUA 4Q7MB 2JJ8A 2ORIA 4R2HA 3AF2A 3U5ZB 2RGCA 1MO6A 3SJBA 1KJZA 1U90A 1EESA 5M04A 2ZRKA 4HUQB 5SZHB 5DISB 3QG5A 2R6AA 4Y0VA 1KI2A 1YZKA 5TMPA 1EX6A 2GJ9A 1V5WA 1W5SA 4JVNA 3TSWA 1CRPA 2P5SA 3QPUA 4FCWA 4Q9IA 4P4SB 1XTIA 4JIMA 1KSGA 4CZ2A 3ASZA 1W36D 2FA9A 4Z8XA 1GNQA 1F6BA 2J0QA 2OLJA 1XMSA 4XTCS 5CK5A 4Q1FA 3OIYA 1CR0A 4V03A 4ASUA 1GKYA 3REGA 1E2DA 4QRHA 2ZE5A 4A1FA 2GCPA 2FFBA 5HTKA 2YJTD 2YWEA 2H57A 2H92A 2FV8A 1W47A 3P32A 4P33A 4OBEA 2BCGY 2R6DA 3GJ5A 1YRAA 3AKDA 1GIAA 2IUTA 4KI0A 2XZPA 1FMJA 1TU3A 4M9QA 2JATA 5AK0A 4KVGA 1JBKA 4DT1A 3UWOA 1XPOA 1FX0A 1T5LA 1RFLA 4MKIA 5FL7A 4DCSA 3LRPA 1Z2AA 2RGDA 4DSUA 3RC3A 1PVOA 1GITA 1RE0A 3AF3A 1OYYA 1HT1E 3QKRA 1JECA 1G20E 2XSZA 4DLWA 1JR6A 3MGCA 1XPRA 1WE2A 4OHVA 1NVWQ 3K0FB 2FX3A 4ESHA 4MUBA 1TMKA 2B92A 2VTKA 4JLVA 4R7ZA 721PA 1AZTA 2IYYA 1FPMA 1XFAA 5KPDA 4A92A 2WJHA 1EXMA 5CLQA 3L2OB 2JLWA 1N6HA 4G0NA 2FDCA 1NLZA 1Z0JA 2GZDA 2QTHA 3HWSA 1KK2A 1H8HA 4A6PA 4MH0R 1YZLA 3HU1A 1GP2A 1FUKA 2HLDD 2J0UB 1SZPA 2ZRGA 2X19A 3QPVA 2OFXA 3KKNA 4UNSA 1G291 4TWZA 4IFBA 2QZ4A 1ANKA 3ZD7A 3ONWA 1Q21A 3CH4B 1Z0AA 1ZJ6A 3HR8A 3VX4A 4EQ6B 2YNMA 2REBA 4FCTA 1G1MA 4ZKDA 2FFHA 2VHCA 1XMJA 4QBIA 2QROA 3RS3A 1G3IA 1DO2A 3NC1C 3QJYA 1G17A 4HB3A 5C1BA 2LKCA 1P3JA 2C96A 3OE7A 4KVAA 2FF7A 3RS0A 2CL7X 3CNNA 2ZETA 3U3JA 4LHZA 3SBEA 4H9GA 3TUIC 5TVKA 1LNZA 4XJXA 3FMIA 1R2QA 5JLJA 3SC3A 3I3SR 4E22A 1KO8A 5DIFA 1KIMA 3RSOA 2YZ2A 3AVTA 2QP3A 1RC8A 1XPUA 1DAEA 3R8CA 4LJ4A 1SVOA 3CF6R 5KTYA 2O52A 5EQTA 4URXR 4PSKA 1E0JA 1W48A 3GQBA 5KPJA 4AG6A 2GTPA 2XJ4A 1ZCAA 3K9NA 3MG9A 3CZQA 1BOFA 4XD7D 4BLSA 1XEXB 4NCJA 3K09A 3WHLA 1W0KA 3I4LA 4I1VA 4OQNA 2IBMA 4QJ3A 3L82B 3B78A 2WPDD 2NIPA 1CU1A 1SULA 1F3OA 2PMKA 3MJRA 5FUWA 1TTTA 2DHRA 1Q57A 2YC2C 3BH6A 1YHNA 3PUXA 4TTQA 2QNRA 3F3YA 1Q1ZA 1SHZA 4Q7KA 4EKDA 1E94E 5CDFE 1BYUA 3CWZA 2VP9A 3ZS8A 4RD2A 5EP2A 1IQPA 1TX4B 3G0HA 4MITA 1LW7A 4L15A 5EE0A 2VH5R 2XJ9A 4A2QA 1UKZA 3X1DA 4AIIA 2QAGC 1FMLA 3B5JA 1SKYE 4NYIQ 4OJKA 1XB2A 3MMPA 5IK2A 4EIWA 4B75A 4A0HA 2ASEA 3VX3A 1OF1A 4QGAA 1ZVQA 4D4MA 5FPHA 3WMFA 5DI3B 3Q7QA 2ZRNA 1CLUA 2FPLA 3CR7A 4MGZR 1JXMA 1S1CA 4I81A 1WBBA 1DAHA 1JEEA 2G88A 1YR8A 3ZH9B 1DBSA 1NLFA 2XOKA 3W8NA 2ORWA 1XD2B 3GFTA 3IPXA 3HYTA 2JJ1D 5G3YA 4BLQA 1UEJA 1VHLA 4O0MA 2OE2A 2QENA 2VPPA 1GWNA 2P65A 3X1WA 1OH8A 2QRZA 3BOSA 2OBMA 5FTJA 2JLSA 2O5VA 2NO0A 1P73A 2G77B 3I72A 4OI0A 3IGFA 1G6OA 2FEOA 1D8TA 1AKEA 1UDWA 3X1ZA 1E99A 1KNQA 3FWYA 3NHAA 1UBGA 3SJCA 2ONKA 3D31A 3OESA 2ODWA 3DM5A 4ZV4A 2ECKA 2HF9A 3AP1A 2J1LA 4B2IA 1CEEA 1KYIA 4UXIA 3K9HA 1BS1A 5C4GB 4EQ6A 3W5IA 1NP6A 1W36B 2B7CA 1CR2A 4J0QA 2ZRAA 3W6PA 1NL3A 2VHUA 3TR0A 3GJXC 2E9SA 3UXMA 2BDTA 1T0JB 4TYQA 3GLIA 4Q19A 2EYUA 4OL0A 3A37A 4UJ5A 1F2TB 4IDPA 4CT5A 1G8YA 4DC9A 5F98A 3LH5A 4C0QC 5FTKA 1XXHA 2FGKA 5HCNA 4C4PA 3NEJA 1AM4D 3PJRA 4RZ2A 2D62A 2JJ2A 2IEZA 2CDNA 1E1RA 1L7VC 2CEAA 3UMSA 2CL6X 3Q72A 4BFWA 4OHYA 3TAUA 2DFNA 3IHWA 2WJGA 4ZKEA 2G0NA 2WWYA 2FGJA 2ZRMA 2PCLA 3TVDA 3TH5A 4WXPA 1Y3AA 1F2UB 1IY1A 1IN4A 1Z8FA 2I4IA 2WSSA 3BH0A 4TLCA 2YOGA 1FNNA 3L0OA 4RD3A 3WYGA 4FCVA 1JJ7A 4P4UA 4TYPA 3CNOA 4DRZA 1WCV1 3UKDA 4EPWA 1KI3A 2D2EA 3BK7A 4BLOA 2D06A 1CR4A 3TQFA 4ZDKA 2WJJA 3U60B 2NQ2C 5E95A 3FHOA 4WBSA 1W49A 4TSFA 5B30A 3NDBB 1VDZA 3FKSD 3B13B 1G64A 4OKSA 4WXRA 1E0KA 2J3EA 5L3SA 2YINC 1HY3A 3CLVA 5FOVA 4BRUA 2CHGA 3ZVRA 2RHMA 4D2IA 4GMXA 4Q1DA 2EW1A 2RGNC 1N25A 1OFTA 1R0YA 1Z6TA 3PCRB 3ICEA 1IJFA 5CM8B 1LY1A 4UXJA 1MT0A 2OCBA 4D81A 1I4TD 1G9XA 4QL3A 4TN1A 1G8PA 3ZJYA 1CS4C 3ND8A 2P2LA 1E79D 1M34E 2P5TB 1X3SA 1TF2A 4AKHA 2PT5A 2QPTA 2RH5A 4LSGA 3BAFA 2QTVB 4QOSA 4NZYA 1NN3A 1TUEA 1TEVA 2DPXA 1XDBA 5HCIA 5GADl 3RHFA 1KI6A
chains in the Genus database with same CATH superfamily
1F4LA 3HFJA 3PHCA 1U3WA 1EUYA 3C8ZA 1FXSA 4FGZA 3M6VA 3AJ8A 5DULA 3NFYA 4KV7A 4HYQA 1J5PA 1GYRA 3HCWA 5I7HA 4M6WA 3OM1A 3R3HA 1IG0A 1ZW1A 1L7EA 4IIEA 3G2KA 2YXPX 1ADYA 1XXLA 2CE7A 3MWFA 2PUAA 4MA4A 3W90A 4MEJA 2VT3A 5G0WA 3X1KA 2DPYA 3TAXA 3UHFA 5HQ3B 3ZE7A 1K2VN 4PRYA 1SXPA 5TDHA 1MVOA 2P5UA 4YLGA 1G66A 1HGXA 1JS1X 3TUZC 1L5FA 3A3OA 3DFKA 1DIOB 2XVZA 3IXQA 3NBUA 3DWEX 1R10A 2HCBA 2HRZA 3PE3A 1RYDA 2Z2ZA 2QQ0A 4FDTA 3OQ6A 4YAEA 5KO2A 4JNKA 4LXIA 4X91A 3ROPA 4BZQA 2EYQA 4YAWA 4BFTA 4RPIA 1Y81A 3B51X 2F4VB 3ET4A 2O8FA 3WI7A 1ODIA 2FUG6 2JLCA 3W77A 4P6VF 1KOGA 3B3JA 3TNFA 3ASYA 4PTYA 2FPPB 3ZW9A 1YIDA 4FHFA 3QZUA 5LWHA 2QW8A 4Z49A 5DI9A 2WIDA 4QC2A 4XJTA 5ECDA 5FEUA 1E2JA 5B58C 3T7DA 1FDIA 1ZNYA 3DS8A 1QFSA 4CV3A 5KQLA 3W5BA 4JJZA 3JQGB 2JCSA 3CTMA 1C1XA 1WXXA 1RZ3A 4H31A 3VZCA 3PFWO 2HBYA 3LQ2A 4AZVA 4MP3A 1R0RE 3ORYA 4B0PA 3OPMA 4C5AA 5EEGA 2FG6C 2X77A 3KJEA 1PU2A 1V41E 5H68A 1QRUA 2WABA 3IKLA 2I55A 1PNTA 1PGNA 3V8NA 2GXQA 5BN1A 3RIYA 2DR0A 3QTBA 2VK4A 4HFMA 1WL8A 3ZBUA 4IEFB 2I8AA 4WZAA 1UKBA 3ZGVA 4DM4A 1ZSNA 3T9FA 1YZYA 4DNPA 1YS2X 1Z35A 3P5SA 1Z0UA 1LA2A 5DM60 4Q37A 2WTXA 2EFEB 1T4GA 1VIVA 1TKAA 2IODA 3NG1A 4MI9A 3KKOA 1M7BA 3EC7A 5KZMB 1SR8A 3ANSA 3QF7A 4X1IA 3ER6A 2QG4A 5DDIP 1GQQA 3FOZA 3A6PC 3G82C 3NUGA 4HMPA 2QTTA 4JXJA 4UHHA 5MGNA 1I3NA 4IXMA 3FZQA 1U4SA 1A4XA 1TCBA 1QH8B 3EXIB 3UAOA 4AZTA 1PL0A 2QY6A 3IJRA 4K88A 4CQLA 4RJKA 3SCZA 1WKVA 4TMYA 3N07A 3FPGA 1T8TA 3RUIA 1BO6A 3GT4A 3ZU6A 2R68A 4AG3A 4D41A 2VHXA 3CF0A 2AOUB 3Q9NA 1QP8A 4DUZB 4F38A 4JP2A 2AEMA 2OKCA 4KLNA 3RUEA 1T9KA 4QNRA 3BB4A 5COBA 2GF0A 1XF9A 3NTVA 4H6XA 1LJ8A 1PS8A 2HPZA 2HLHA 4QRDA 2OYRA 4D4HA 2CLLB 4DRXA 3H5VA 4EB6B 5K5EA 4GL2A 4BQNA 1K7XB 1VCMA 2W2TA 2ZRIA 3HYSA 1Q3KA 4NAVA 4OMDA 1QAQA 2A5GA 2ONYA 3OICA 5BQOA 3INRA 2R8OA 2VTBA 3ADPA 4G63A 2BRUA 2C57A 1I4LD 3KZOA 4CJXA 4N6OA 5IH3A 3ZXSA 5DK4A 2BKEA 3F5DA 3OUTA 4K9LA 3UGJA 3KUUA 2I6QA 5K3AA 1NHWA 2P1RA 4NPCA 4CMAA 5DKFA 3ZC3A 5JNLA 3B1XA 4FSHA 3HU5A 4EB6A 2P6NA 1UOPA 1GTG1 2H5JA 2IHKA 3DWIA 1EE9A 3GZNB 1W88A 4J3FA 3K94A 1FE8A 3JZMA 3KQYA 4RKFA 5JCJD 3LY5A 1WZEA 5C1OA 3L01A 4TTSA 4XEUA 5CVTA 4P83A 1ATZA 5AXCA 2A78A 4O4JF 1RZRA 1YU9A 2DJIA 2XB8A 5EHXA 3E7DA 2OSBA 1EE1A 3MRSA 3DVSX 3VOAA 1A95A 2QTGA 4CQLB 1U81A 1SOVA 2H31A 4PZPA 4ZAZA 2V0CA 3PD0A 2ZB4A 2FSIA 3CIFA 3FPBA 3HJCA 8ADHA 1J00A 4OQPA 5IAKA 1G3RA 3FZNA 3LQYA 4TL6A 5FWDA 4PC1A 3VSEA 3UFXA 1VM6A 3UK6A 4BVFA 3U5TA 3N2IA 2R6JA 4Q4LA 3SQOA 4K6FA 1KQGA 4XR9A 3IAUA 4URYR 1VPEA 3ILYA 4C4TA 5TJHA 1BROA 3R0JA 2CJXA 1X9GA 1P1RA 1KH2A 4PFSA 3X0DA 4IZHA 1UANA 3E48A 4M0CA 5A2QA 4N03A 1TVCA 3EVZA 3AR8A 4LRYA 5DNYB 3JQ7A 4LJKA 4GHWA 1AKMA 3C41J 3RIHA 4IUYA 4RACA 3WL6A 2FWRA 2X2FA 4L4SA 4F1WA 1NOIA 3H3JA 1Y89A 4EY5A 3TJRA 1WTCA 1Y3CE 3H5TA 2WP0A 4X1KA 1J2EA 4NXNB 2QM0A 1ADCA 1QGUA 2Z5VA 1N5MA 1MNQA 1N0WA 1E6CA 2D54A 3PZBA 4XVQA 4UTOA 1XEXA 2J6BA 1V4VA 4U6SA 4BLRA 3GP8A 1ISRA 2HBRA 4OHWA 3QUCA 1CZLA 1UDBA 1JJVA 3K1ZA 5FL3A 3WAKA 5DYYA 1SXQA 1HM5A 4H0CA 2VH2A 3T9EA 3G7UA 3IBGA 3NHZA 1Y5LA 3HJGA 2PBZA 4NKRA 4L8VA 5KDLA 3SOPA 3U44A 3JU3A 3RANA 1B26A 1OGJA 5A0VA 3CCFA 1HYHA 1O9GA 1VLLA 1WXQA 2UVQA 3K16A 3QFHA 4B09A 3EQ8A 3CH5A 3BMCB 3KPJA 3TRKA 5D5HA 2FSGA 1VRVA 1I14A 3EGIA 4MPJA 3AXSA 2LW7A 1ZK0A 1VE3A 2AMLA 2Y2UA 5H02A 1ORWA 3BZUA 4RQAA 4A03A 4CGYA 4R2LA 1BMFA 2AR0A 3DAPA 4BY9E 4MCAA 2Z43A 1ZUD1 4F2DA 1ZJJA 3CM0A 3KFXA 4ID3A 1E4YA 1CZKA 1WUIS 2J85A 1I01A 1LC3A 4PYRA 1JJIA 3OLZA 3IAHA 1CQJB 1A72A 1OROA 4IKOA 4KHPB 1U2GA 3PC2A 5EG5A 1XP8A 3TJMA 3T3GA 2D2XA 4GZ5A 1IZ7A 2OCAA 4GX1A 3D8SA 3GFSA 3QUTA 4ZT5A 1U7TA 3AQIA 5T7BA 1FYXA 1E5DA 3GCDA 4RQBA 4FONA 1EJ0A 1I2AA 1AUVA 2X9LA 3MFQA 1C8KA 5DGDA 1N4AA 2ZR7A 3JASA 3NHMA 3PDWA 5A3SA 2LKDA 3C7DB 3RU9A 3V3KA 1M2VA 4UTRA 4TTIA 1ZN2A 2IYEA 5CMLA 2FW1A 1A9RA 5EIAA 3PL5A 4K8OA 4PG8A 4S1WA 5AKKA 4D8TA 1SEPA 3H2HA 1FDTA 1Y1TA 1TUBB 3DVAB 3PKIA 4XPZA 5H3HA 1M5UA 4AULA 1F60A 1E2IA 5A3VA 3DKVA 2GI4A 3AR4A 1Z4JA 1ZLXA 3SX0A 5JYDA 3GY0A 5AHWA 4QELA 5EUQB 3EIOA 2HOQA 5EQFA 4BQSA 1FU8A 4KOAA 1MOSA 2AXNA 3S55A 4B6OA 1D2GA 1YB4A 2PPVA 1DJNA 4MW5A 1OI3A 2OFPA 3FNQA 4YAOA 2PD4A 1V0JA 1MB3A 3TN7A 3N6RA 4QOIA 1Y8AA 2BGWA 3ESRA 4JKYA 3KYCA 3Q3HA 3DP7A 1E3TA 1JIXA 1JR3A 3FUWA 2I22A 3EXEA 1CUEA 4M9ZA 4XDYA 1SC1A 1YI1A 4G4GA 4ZRNA 3GNLA 4BE4A 1IBMB 4WJLA 1KSFX 4ACAA 4TKUA 2FEAA 5C3UA 3K6SA 2JANA 1DV1A 3GCXA 5HYVA 4RHFA 2IPLA 2O3RA 3DUWA 4U3JA 2G08A 1B3BA 1YC5A 1EVZA 3I8XA 1XRMA 5CYOA 2RHHA 3E2PA 2OCYC 4G3XA 2Q5OA 4ZVSA 3TZLA 1WD5A 4N3BA 2RHOA 3QV1A 3VU8A 4E14A 1IJBA 3X2EA 3OJXA 4FW8A 2WKPA 1OX6A 5CLGA 4E70A 1MF7A 1D9ZA 2C77A 5AHXA 1DVRA 4J2OA 3H9QA 1SKUA 3IMEA 3BGVA 2GN0A 3C6KA 4TTPA 2M6SA 4LBYA 1O8BA 1Z0DA 3ZI4A 1BE0A 4GEKA 1XQ9A 3HN7A 3L40A 4YGYA 3W9UA 3N8HA 5EZYA 2BEUB 4KLCA 1EXWA 2XUQA 4TVBA 3AUUA 1WP9A 2CUZA 3KFLA 3N75A 3NOQA 4IUBS 3U17A 4C22A 4PPYA 3GBPA 1H5NA 1CHNA 4N18A 2HPVA 4LI3X 1R5NA 4KR0A 2OO3A 3DV0A 4WNIA 3ABRB 3CLKA 2XOEA 3R3WA 3EK2A 4Q7EA 1AGYA 1EAMA 1QVRA 1YJCA 5CLJA 3TYXA 3KWJA 1AV7A 1W0KD 3JYHA 3AF4A 2CUKA 4PGGA 3RRMA 4C7BA 1QG2A 2H5IA 4RJLA 1YQGA 1A8UA 5CH5A 4WOBA 4ZT3A 5DX1A 3WMGA 4QTYA 5EWMB 4B32A 2J31A 1R5OA 1FSFA 2XMZA 3G68A 2HDOA 1A98A 1T8WA 4LE1A 4LZZA 3OLXA 4QNNA 3WHIA 3WICA 3UPTA 4D80A 4XRRA 4ZAYA 2YN4A 2ZSKA 3ZHRA 1QAOA 1DQPA 3TLMA 3PI7A 3NUQA 4P82A 1IHPA 2FJUA 2DXIA 1PGOA 1ECGA 3OT4A 3GGSA 4TKUB 1ZXBA 4PXAA 1CUFA 3SPXA 5B5SA 4LX0A 4G1FA 1BJKA 1ZMOA 3RREA 1KVUA 1WVMA 2FOIA 5E0OA 1R15A 4GQIA 1Z62A 4Q21A 1A5TA 5A0FA 5BW5A 4LQCA 1XK6A 4UBLA 4DBZA 4TVKA 4IKPA 4HNUA 2OQIA 2IP4A 3PTZA 5AK5A 1FSPA 4I1RA 5BNTA 4RFVA 3N86A 2OM6A 4EMTA 1U9JA 1N5LA 4LVUA 1O6ZA 1WIWA 2HREA 4ZZ2A 1CIVA 4OKIA 5TPWB 4B3HA 3JWHA 1Q7GA 3F71A 5K0CA 1GAWA 3R5KA 3MA0A 3WGNA 3L4JA 2VHYA 3GRRA 2EVWX 3BL8A 3VAAA 1RQ2A 1V7QA 3NIBA 3FB1A 1P9RA 4MVXA 4K9QA 1T34A 1E5LA 3CQ9A 5ICMA 5L51A 4E03A 3IJPA 4LHSA 4OI1A 1G16A 1JQLB 2H2WA 3ELYA 2VTBB 1IHDA 1S2GA 2BOVA 2XA2A 3A0RB 4DDKA 4XIIA 5MF6A 2CXNA 3PIRA 4X5OA 4ZMRA 1ZM4A 1JEQB 2W4MA 2X1LA 5KTSA 4G56A 3R9XA 1D2RA 3VU3A 3OEEA 3OTIA 2E48A 2OCIA 4MS1A 4PLPA 5FR2A 3EPHA 1ZITA 4TS1A 3HL0A 4RENA 3SQMA 1P29A 4C76A 2QE6A 3AVXA 1H2EA 2FUNB 1U5BB 3I4CA 2OORC 1RXIA 2PIDA 1ZIYA 4MRMA 5IDQA 2DE0X 2P2SA 3HXTA 4AKIA 5I9MA 3UJ9A 1RXCA 5BVHB 3FNFA 5F51A 5BSHA 4YMVA 5LZ9A 3D2LA 2ZS7A 4PW0A 1O95A 1GNPA 5AKJA 3AF6A 5K8UA 3GLFA 4BJ3A 4RTKA 2QUAA 5IBRA 1EFPA 1R3UA 1DXYA 5AMXA 2XCRB 3TWOA 1L7BA 1SH7A 2IC5A 3PWTA 4X66B 2JW5A 1A1VA 2R8ZA 3PCTA 3S0JA 2I7DA 5LOVB 1NURA 4RHEA 3VU0A 4XVCA 3GWGA 2WAOA 1G18A 1W1UA 2QMEA 2VH1A 3DZIA 5EYPA 5IJ0A 2QY9A 1FP6A 5AJHA 1T91A 4UQOA 1XNQB 3KVYA 5E3IA 3AETB 4JOCA 4LRXA 1H3NA 2E55A 1YS4A 2IHTA 2P35A 3FUUA 4MV1A 1CUCA 1PL7A 3TX6A 3KYDB 1U0RA 3PKZA 4OHYA 1Z7GA 1L1EA 2HU7A 5IRCD 3VBCA 1MEEA 1PG0A 4D42A 2VS1A 5JAQA 5IUKC 2BGGA 1D2NA 5AI6A 1UBRS 1P7ZA 3PQ8A 3T06B 4CYMA 5JFGA 4LKRA 2A30A 3OPYA 1RQLA 5K01A 5HRAA 4EWLA 3ZD9A 4ZWNA 3FOEC 3LX5A 3QQ5A 1E4EA 3L0IB 3JQBA 4MWBA 2XXBA 1SXJD 1SZDA 3AUYA 1O97C 4L6CA 3H2YA 2XUPA 3QU7A 4ENQA 4R9NA 3UJAA 1QCZA 4BQRA 3SVLA 1NJGA 3AUTA 3ZHXA 2RKOA 2WPDA 2C9OA 4MEAA 3HJAA 1CUSA 1DKRA 3JD1A 4TS9A 3B6JA 4EZIA 5KX5B 1QH1B 1IB0A 4D56A 5B6PA 3GZJA 3UOWA 2WG1A 5BUSA 3JR3A 1LI5A 1UT8A 1YR6A 3LUGA 4XOIA 4MKFA 5HJ5A 4I4TA 2Q29A 4DLXA 1QBGA 3L7LA 1QK3A 1TVMA 2A4MA 4N3AA 5KQRA 1EZ1A 4LZAA 2VUIB 4XX1A 2LCQA 5A4DA 1OZGA 4JJKA 4NSNA 4Q82A 4CLDA 1R0XA 2VTEA 3A36A 3S8MA 2QX8A 1TUIA 3K31A 4DY4A 2L42A 3O91A 5HPYB 2IY9A 2J32A 2I65A 4P3YA 4PFQA 5IVPA 4S1OA 1N6IA 2OECA 3EGDA 3G02A 4G85A 2JZNA 1K68A 1KFCB 2LWIA 5C5DA 3SJUA 4D6YA 3NVDA 3WKCA 4DB2A 2X0FA 5BUQA 3G7SA 3HTXA 4CM1A 2QM7A 5JJIA 1M9NA 2ZAGA 2HZBA 2BP7B 5J1TB 5HX7A 2D1RA 5SYNA 1KZGB 3A05A 4JC8A 4PNZA 5HDBB 1JG1A 2Z2JA 4CKCB 1FX1A 1P4SA 4JUCA 4QQFA 4V0MA 1NG9A 3ZLJA 1Y8CA 4G0OA 1PZMA 1C9DB 3U9LA 4MLPA 3OPYB 1NFRA 1ORTA 5IK2D 4ZPXA 5JEEA 5JR3A 2IHNA 3KAKA 1ZIXA 1ISPA 4OK3A 3SHQA 1JGTA 2BBWA 2VT2A 2QTFA 2GZ2A 5FLKA 4C4SA 1G7RA 4F5ZA 1UKCA 4JI6B 1AZSC 5A4JA 5CB8A 2WEKA 1VLQA 3HZRA 1POWA 4B85A 1O5TA 3S7ZA 5KYVA 2O2HA 3SOZA 1HR0B 3QV2A 2NT4A 1NYRA 4R01A 4WN9A 3FTQA 2VHZA 3J7AC 2AJTA 2AFVA 2MCFA 4RTPA 1L7XA 1O94A 2E6UX 3BEDA 4LDZA 3WXMA 2Q4EA 3QY9A 4Y2SA 1JE1A 3AM4A 4LV5B 3H9BA 3WB1A 1GFZA 5BR1A 1CUJA 2PVPA 4BMYA 2D2VA 4JYPA 4Y3UA 1CVIA 3OWHA 4RETA 1N5JA 1N6OA 4EHBA 1E79A 1NNEA 5BV2P 2Y27A 5FBQB 2DSTA 4IVPA 1ZMTA 1CYDA 1BWRA 3MELA 3H9EO 5JH7B 3DDZX 4LNHA 5LNK1 2C0CA 4B46A 4KGZA 4QRIA 5DU2A 3KR0A 2ZG6A 4DXHA 5A1TA 1MOPA 1P5ZB 1UL1X 4TUYF 1KH1A 2WJIA 4WQMA 2N1BA 3SGLA 3AJAA 5CLLA 1UIRA 5DV9A 1TCAA 2GHTA 4QPJC 2OHHA 1BZYA 2P6RA 1W0JD 1GPBA 3MBOA 2OESA 1W6RA 1H6CA 2EFDB 2XCOA 2ZW9A 3WWPA 4TKVB 4A4DA 2C0PA 4AMZA 4F3TA 4BASA 1AKUA 1TYEB 1BEZA 1SCQA 2Q6VA 2XYPA 1XXHE 3BMXA 4Q3LA 4R41A 5ILOA 2IH2A 4C2TA 3EEQA 2V5UA 4DKXA 1J21A 5JY6A 1NQAO 4BBZA 2PV7A 1N8TA 3U2QA 2WC1A 1DDOA 4BLUA 1GPYA 4HNQA 2XE8A 1AU9A 1WA5A 2K6GA 3VVMA 5B2ZA 3WY9A 3IEXA 3S27A 4EO7A 4KFCA 1Y1RA 3M6WA 4RKYA 4E07A 3PEFA 1I2DA 4PCLA 3TRJA 5BN3B 3ETGA 1A8PA 4II2A 1SM4A 1WOYA 3H3XA 4OX9Y 1FRNA 3B1YA 3LAWA 5GZ6A 4X6UA 2UZ4A 1TVEA 3W4KA 4NBUA 1Y1SA 3BCSA 3GJ0A 4LOAA 4M53A 5KJ6A 1WMBA 4XWWA 1YUNA 2IS2A 3DA8A 2VP6A 3WWYA 4DJDC 3MJCA 3CEHA 2GBGA 3KJZA 3ZHZA 2Y66A 3RFVA 2GA9A 2FRVA 2OBYA 1Q1EA 3V42A 1UC8A 4AUMA 2QORA 1RMQA 3WQBA 5AUNB 3O21A 1AKQA 1RJEA 2WV7A 3DDCA 3L7MA 4I3HA 1VG8A 1C3VA 1LDNA 1NMYA 3DZKA 1IPEA 4GSKA 3TZQA 5CNJA 3IP9A 4WW0A 5KJ1A 3KSBC 1XLVA 4BCDA 1R8SA 1AQIA 3WLNA 1U9ZA 1G59A 4G4SP 3EPRA 1ECBA 1QLWA 4LQ4A 1DIGA 1MTOA 2JBWA 5AT1A 1GZVA 2P11A 2WNSA 1Z45A 1UC4B 1DIBA 2UXBB 2ENUA 5BORA 2DM6A 4KPFC 1M0SA 4H0FA 1SD1A 4NHOA 4REQA 1VXOA 3QNMA 3FOFC 1OXXK 1VCHA 1E18A 4MV6A 2P9TA 4R69A 3RPEA 2WG0A 3AHGA 3G8CA 1ZDMA 4IDQA 5HZMA 1U7OA 3HEAA 3O3CA 1JWLA 2R85A 4MKGA 3P96A 1CUDA 4F7WA 5KYTA 1E7YA 1OT3A 2Y0EA 4L9WA 1BMFD 4MUKA 3NBZC 4B4VA 3CZMA 1SXJC 2DKNA 2D74A 4INPA 1RDFA 2C2WA 1JWAB 1AQUA 3M6AA 3FDJA 1NJ8A 3W3ZB 1ODLA 1TU0A 3LWNA 3UPUA 2IXDA 4LCJA 4OLHA 1N1EA 4K1LA 1NW4A 4PYQA 5JMTA 2HSJA 3P26A 2PZLA 1PFKA 1X6VA 2QQEA 3A1FA 3LHSA 5ILQA 4I4TF 4R4JA 4FVTA 4MYSA 4RZQA 3ZGOA 5KTTA 2Z4SA 4MYCA 4YR7A 5L40A 1SKMA 1GM5A 1W5AA 3N3AC 3JZAA 3C3EA 5DP1A 5B1DA 4R6WA 4QE3A 4BEJA 4KXUA 1T13A 2RGXA 3CLSC 4W6QA 2WWXA 3VR4A 4ARCA 3O7MA 1ZR2A 4O2LA 3VTFA 1LF5A 4QUHA 2FPGB 2DUNA 1VE9A 2X5JO 2HJHA 1J99A 2V9PA 3KR2A 4KQEA 2GWHA 4QNMA 1OC4A 3ZTWA 4CM4A 4DJJA 3BT7A 1RTTA 1M2OA 4WFQA 1CY1A 4GZMA 4V2UA 3WMRA 4OB8A 2ZUBA 4LGYA 1KHHA 1D6MA 4Q24A 4ZZ1A 2I0FA 4IO1A 4Y7DA 4EI8A 3DL7A 3VNSA 1IL0A 2BI8A 1U2DA 4BNKA 5J4HA 1JDPA 2XDQA 4M88A 3M5DA 3KQNA 3AWDA 1X8KA 4BKRA 2A1UB 1TYAE 4IH4A 4Q9HA 3WGUA 5BSKA 1JDJA 1K66A 1YBVA 2YW2A 1GXSB 3DOUA 4O4JA 4PQRA 3SICE 5ALPA 1QH0A 3I5XA 1I0IA 2VQ3A 1JQKA 2WDPA 2I80A 2HV8A 5EKUA 1Z0FA 1KAOA 1S9DA 2A3NA 3AZPA 4J8PA 1Y8ZA 3WTCA 1WSBA 4CUKA 2CXQA 3LK7A 1ZNXA 4QARA 3ETJA 3LBHA 4M8KA 1NMEA 4LVCA 4AAYA 4ZMBA 1PR9A 2CMGA 2HJRA 1QCYA 1S3SA 1Q1QA 1W5TA 3GNTA 3FYUA 4RZIA 2P27A 4WKOA 3PQCA 3ZGYA 3ZZ1A 4ZYVA 4YV7A 4RPGA 4X1IB 5EXXA 3Q0EA 1KI8A 2FOLA 5L6LB 1ZR4A 1FQOA 4Q3BA 5TX7A 3TTUA 2VNJA 3L1IA 2M6LA 3UJBA 3L05A 2SCUB 4DV4B 4BLPA 1QQ6A 1J25A 2HA2A 3MT7A 4IJKA 5I7UA 1A7UA 4YMIA 3IHLA 3OZDA 5E1BA 2DFLA 5MFZA 1OB5A 2F59A 1IBLB 4RSGA 1XZMA 1KA9H 1WB5A 3BS4A 1DJOA 3PVSA 1EA5A 4O2BB 3EFOB 3CZ4A 3F6YA 3F8SA 4RIIA 3V1YA 2HDHA 1EX7A 4CLOB 1JALA 1GJRA 1N6KA 2WHPA 1C0LA 3CZCA 3EXHB 4Q15A 4X20A 5C7LO 4E5SA 3LT5A 3WWEA 2J41A 1MR3F 3P0EA 4RZXA 5CCEA 1WKBA 4YRZA 2R62A 4JVOA 4WK6A 4U8HA 2B6HA 3EVTA 1N7GA 3KOMA 4W5JA 2OVBA 3UHPA 4C4OA 3ZDBA 1U7ZA 3IEVA 1DUVG 3HQ4O 3WJ1A 2WJWA 3WYCA 2ZJ2A 4AYTA 2ZUUA 2IU4A 2AZXA 4KREA 2VEOA 1IULA 2VP0A 4LK2A 1LPAB 3GJQA 4JKOA 1II9A 4D4GA 4F5WA 3L5OA 1TAHA 1PUIA 2HO4A 4A2CA 3EX7C 2VHTA 4YRSA 1CR1A 1OFVA 1XMQB 3VO1A 4PRKA 4UULA 1H69A 4D43A 1QQ5A 4KE8A 1H8HD 3JALB 3ER9A 1U0OC 4J6EA 4JBXA 2GVDC 3ZCUA 2ZU6A 1N0IA 2AT1A 2A0FA 1SC4A 3UMYA 3ANLA 3E4DA 4EHNA 2ZRHA 5IWAB 1C1DB 3BF8A 4HSGA 1YFLA 3EXG1 1J49A 1YBAA 1Z2CA 4ROTA 4Z0TA 1YUMA 3C2QA 3F9RA 1KZYC 1VKJA 3K2IA 2NUTB 3QPAA 5J9FA 1MHTA 3HGMA 2KHZA 3R1IA 1LLFA 5B7NA 4OQDA 2YN2A 5BN4B 1ZSVA 4DUGD 4EPVA 5L3VA 5LQDA 4KGVA 3O9ZA 4LHVA 3C45A 5CNMA 1JIVA 5FNVB 5IJZA 2B8WA 3ILSA 3FIJA 4NOJA 3MPOA 3JR7A 2HN9A 4NFHA 3SYLA 2GJAA 1EZZA 5LLDA 1RWQA 1UJCA 2XGGA 3M4JA 1ETUA 3NRBA 2R44A 3UJNA 3I9LA 3A2LA 2EX4A 3LPAA 1NUAA 1KAHA 2I8LA 2WWFA 1Q0QA 3AQ4A 4M1EA 1N2SA 1NM5A 5BSVA 2EJUA 1E9RA 1S4MA 5C8DA 4DADA 4AMYA 3CPEA 2VDKB 4KIGA 1SGWA 3RBZA 1AZLA 2YHIB 1SG0A 2R1TB 2Y0CA 1DWOA 3FM9A 5DB4A 2BSAA 3D8NA 1VKOA 1M8FA 4KO8A 2G0AA 2QZJA 1DAGA 3CEMA 5CJJA 2BHTA 1OD6A 2I29A 4MQMA 3KEMA 2VQDA 2J67A 1QRAA 5GV7A 2ESRA 1C5KA 1XCGB 3KKPA 3GLSA 3H2SA 5K09A 1ZH2A 4KFUA 2ZYUX 5JJLA 4C2BA 4FU0A 3C1AA 3HKBB 3OH8A 3VDRA 4ZVKA 3B12A 3TCXB 4DAEA 2YH2A 3H8WA 4KQ1A 5IT0A 3F4LA 3AY3A 1K7FB 2GBFA 1HMYA 2WKRA 2Z8ZA 2ZI4A 3H9GA 3QLJA 1RIIA 2FEWB 4A27A 2K7FA 5HP4A 4I8XA 3TW0A 1JLKA 2ZYSA 3CWQA 2YQZA 1T2FA 3FI0A 3OEED 1GXSA 1ZUWA 2V59A 2A0YA 1M0TA 4UHCA 3CURA 3OMWA 2Y0BA 1KBZA 2HTEA 3IIKA 1NNSA 4UQPA 2YFQA 1R00A 4V0SA 1YSCA 2XNKA 3EBPA 4UXHA 2IWRA 5IT5A 1ORHA 4PZDA 4CDMA 5BRJA 3CMCO 3ROXA 2SCUA 5HUJA 1PD1A 2CXHA 1ZAYA 2G9ZA 2WWIA 3VR4D 3DHEA 2EKDA 2ZCJA 1PJSA 3B5IA 4PWZA 5A7FA 1J56A 2H1VA 1KI9A 3LVRE 3HXMA 1K86A 1V9LA 1NR1A 5JSZB 2UYQA 1C3OB 1V16B 4RANA 3THWA 3N6XA 3ZV7A 4UJ3A 2HAEA 4XIYA 3R7WB 3SS9X 4G1EB 3K0FA 3CIOA 2FPGA 3UG7A 5JD4A 1DMRA 5F5XA 2ZJ6A 3PQ3A 1KOLA 3CNLA 3W4JA 4F4HA 4U5QA 1NWCA 4RNCA 5EE9A 1QJCA 4E30A 1T2DA 2WMDA 4WD3A 1N0VC 2PUBA 3LA6A 2ODNA 5E7QA 2AE1A 3W2TA 1EM8A 3L8DA 3F96A 3ONEA 1CDDA 2B3TA 2O0JA 1PFQA 1XK7A 2DETA 3AV0B 5K0ZA 3ZK7A 3DLCA 3GAMA 2YVUA 3IYLW 3G2NA 1TFUA 4BAGA 4ZK2A 3QVGA 2BFAA 3IDQA 5K9ZA 3QWFA 2CXTA 3GGOA 1KJJA 4J3JA 5GV8A 1Y5RA 4LOIA 1FW6A 2ZUVA 3ZHCA 3KAPA 4UHJA 1KR5A 2HF8A 4QWMA 4E4YA 3IEMA 1AGRA 3ZHBA 1D1PA 4EUHA 4CKYA 4AVYA 3DAFA 5I8WA 5KSYA 2G83A 3E35A 3ZGZA 1K7CA 1SOAA 4REQB 3S99A 2LDXA 5E1OA 2BTQB 3JPWA 1R50A 2XKKA 5EGSA 3AHDA 1RRMA 1NQ5A 4LDQA 1A4RA 3KVNA 5JWHA 1Z5ZA 4A5SA 4YRNA 3MIIA 5FFMA 1EXNA 1X1CA 1ZI9A 5CW1A 2JFOA 5AK3A 1EVKA 2NU8B 3SQWA 4MLZA 4PX5A 3T9AA 2AN1A 4EW6A 3TI9A 1BKSB 5TQ0B 3GG9A 3P0HA 1BD3A 1YRWA 1VBFA 3JQDA 4OQXA 4QXAA 1TCVA 3U49A 3G8DA 2XTJA 3PGKA 1DXHA 3PUKA 5CIWA 1OIWA 5AQ1A 4PPNA 2YUTA 4UUQA 3LDHA 3Q41A 4F8YA 1K5HA 1GZ4A 2MYPA 3OETA 4PVCA 5H4HA 4O2BA 3S6JA 5IG2A 2W9XA 4YI3A 3QKRB 4N8DA 1N34B 3BXFA 2ZAOA 2RHLA 3BWMA 3THWB 4E5MA 1RAGA 3OEHA 4MJLA 3H42B 5TS3A 4GGMX 2O8FB 4CEJB 5JXWA 2DYKA 3FPFA 3QVUA 4HZUB 3PXGA 1VYHA 1MH1A 4GXTA 5A9RA 2CZQA 7YASA 2F64A 1I2CA 2ERXA 1Z4LA 4MVJA 4IDNA 4EGQA 2DWPA 1XHFA 2DG2A 1TEXA 3PV0A 1QZUA 3B9QA 3HKDA 3E2MA 3X3HA 2F9MA 3H6KA 3KQUA 2HDNB 2FK7A 1NC3A 1R8YA 4N5MA 3K9FC 1GNVA 3O8DA 3M4ZA 4O2RA 1I24A 3N39C 1QTRA 3N76A 1IY2A 1U3GA 1BE6A 1UWVA 1X80B 1U6JA 4HDSA 4PONA 4TKMA 4ZALA 5CAEB 4CT0A 5CCBA 2HQBA 1BDHA 4BEWA 4IILA 3MQFA 3PBKA 3KU4A 4KACA 4PCAA 4XD2A 2IE0A 3SEAA 4DVJA 3L6BA 5TARA 2X6QA 2EFYA 4WOCA 4YACA 2Y8EA 5LOVF 3BMQB 2FCRA 5CRIA 2NXCA 1Z13A 3OY7A 5KUTA 3CZAA 3EXFA 4J4TA 7GPBA 3OKPA 2B8NA 1NT2A 1W2HA 1YQQA 1Y5IA 3HXLA 3IV6A 1DAIA 4JLMA 4JL8A 2JARA 2F48A 3OM0A 4D0LB 4D3DA 1C9JA 1P0QA 2PT9A 4EI9A 4KVFA 2H18A 4OF4A 3I61A 3DCYA 1RXVA 4RXUA 7MDHA 4BMPB 4KPEC 2ANCA 2XVMA 4IX9A 1HT2E 4ZVVA 1ZK3A 1CY7A 3PUIA 4BV8A 1U8TA 1EWVA 1H6AA 4J1SA 3TB6A 2Y92A 3LQQA 5EJGA 1B41A 1Z16A 2YTZA 4B5KA 4XQ9A 3DO8A 3IMGA 3HV2A 4XM2A 3VVBA 1V2GA 4AO6A 1Z4NA 4ITUA 4P08A 3GUCA 1ZJ4A 4ZQHA 5FBLB 3CV3A 3SE7A 4N49A 2GKSA 3MTDA 3ZZTA 5I7EA 4BVJA 1UBEA 3OOHA 2AJ8A 4TRRA 2RAUA 4BJ6A 4XB1A 4HNVA 2AG8A 3H0CA 1KO5A 1X13A 4PLZA 2PO7A 5L3SB 4IOLA 2PJZA 4M0UA 1BIFA 4PYLA 3Q6IA 4YROA 4C3OB 4QZVA 3Q8MA 2ZJYA 4BMDA 3TRIA 4M60A 4OBBA 1KVTA 1KAMA 3C85A 3U3MA 2ODBA 2GJKA 3RROA 3PDIB 3GDWA 4RPCA 2JLUA 5JS6A 1R6XA 1V37A 2X7HA 3KB2A 2UZ1B 5EWLB 3IVCA 4K9DA 3IDAA 2W2LA 3W5CA 4CR8A 2JKYA 2J3JA 3V4FA 2VYCA 2HU2A 3SZGA 2GPSA 3O2NA 1E5VA 5BR4A 3T95A 2W22A 1E62A 2AOTB 4ZO4A 3SFVA 1ESCA 4B3DA 2XKBA 1B8PA 2YZMA 2XD4A 2J6HA 3RYCA 3LX4A 2FZKA 4QJ5A 2E4YA 3LDUA 3DWFA 3EGVA 2HQOA 3GR6A 3L0YA 1G5TA 3GARA 3IOMA 1MA3A 2BFDA 3E9RA 1ES9A 4YDRA 5IDWA 3X44A 4XVRA 3F74A 3MK31 4ZU6X 4P5DA 4CIVA 4F46A 1IG3A 1FP4B 2IPMA 3DTVB 3K9QO 2ZBRA 3T7SA 5LA6A 3ZE6A 4ER3A 5DM70 4RLQA 5CT8A 4UE6A 1UPBA 1MUUA 3W5DA 1ZM2A 1BCRB 2BHRA 2OCPA 3B2EA 3V4ZA 3A7DA 3ZDRA 5I7RA 4XQCA 3UENA 3UAZA 1JLHA 2FSFA 3DFZA 5C1IA 4X1KB 1BVYF 3W5AA 2WHPB 4GMKA 1N2BA 4WASA 3QY0A 3JZIA 4NCNA 3P7MA 4HL6A 1U02A 2C31A 3D2CA 5JDIA 1QGYA 4QTZA 3FTFA 3T0FA 1G98A 5GM2A 2E5WA 2RHBA 1KOFA 3AFIA 4DUYB 2QYHA 5K8TA 2I34A 2WD9A 5ERXA 3FYTA 3DE0X 1AHIA 2H1OA 1H42A 4POOA 3CE6A 3I9JA 1ZG3A 4R0VA 4GOND 3B8HA 3EODA 1DX6A 1QG0A 4Z54A 3B6IA 1P7YA 3OU2A 1JG6A 4Y8VA 5DRYA 4R2IA 1IBCA 3TK1A 4ED9A 3AKZA 1FDWA 5CHEA 4HRYA 1ST3A 3H5AA 1D2AA 4AUNA 4C87A 4CEIB 5JNTA 4B6RA 3SHVA 3C3KA 1UJBA 2WTMA 3F78A 4ZAVA 3V1LA 3D7MA 2CMKA 5A06A 3O93A 1NX6A 4NC9A 4UAUA 1G4HA 5CNKA 1KEKA 4BKMA 2YWFA 3GXOA 3LNTA 1H65A 4ECEA 4OSEA 3FCCA 2J6CA 1Z0KA 1NASA 5CYPA 4ENTA 2HHJA 3D6HA 2BM8A 2FNAA 4Z8YA 5EINA 4M0MA 2RG1A 1N3YA 4FK8A 4DCGA 1PBNA 1J4AA 4O2BF 4ZP1A 2VDWA 1B0ZA 2IDKA 1EAYA 1USIA 3FNBA 4RCZA 3KWMA 3N28A 5JY1A 1NOKA 3A6LA 3BL6A 3D2BA 4M46A 1RQGA 4QQNA 4V3BA 5CDGA 1EP3B 1RR6A 1UJ5A 4LTMA 1QBKC 1YMUA 3GEMA 1FBTA 1ZK4A 3L9WA 4XSGA 2QRJA 3NPMA 2UYGA 4L0DA 3R8FA 4A23A 2PJRA 2HSZA 2GSDA 3O1JC 4GE3A 3HDQA 2O3UA 4LNUB 4I2NA 2KM1A 2VXBA 1IM8A 1Y8RA 3VPGA 4M2LA 3ICQB 1ID1A 3VKWA 2F7SA 4C7JA 3KD3A 5H82A 3IE1A 1MABA 1D03A 3N2KA 4MUYA 3K6JA 4XD7A 2PBLA 3MRVA 4D9FA 1YL7A 3OQBA 4XM1A 5CYFA 5LUAA 1HI9A 3PL1A 4S1PA 4EVSA 5JDCC 3RBXA 2DECA 4IG4A 4QQ8A 6REQA 4DV7B 2Q4DA 3OBIA 2PZGA 1DL5A 5TV2A 3UJ7A 4DV1B 1F5NA 4AUEA 2HYDA 1VJTA