1DVRA

Structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
SSESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase (phosphotransferase)
molecule keywords ADENYLATE KINASE
publication title Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 70
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dvrA00
3T35A 1Q57A 2L0XA 3CX7A 1EFHA 3B2EA 5E4FA 4KYIB 1FX0A 4PANA 3CF0A 2FFAA 2GCPA 2W6JA 4RZ3A 1ELOA 1ZD1A 3I3SR 4RFVA 2WWWA 4HLDA 3F3YA 3ZQ6A 1ZUIA 5KHOC 1F2UA 1HH4A 5TMPA 2W2TA 4DLUA 2PZFA 4G5RA 3GLGA 1Z28A 2F9MA 4FMBB 2DFNA 4YMSA 2WAXA 3NIBA 1NN3A 2WJGA 1J2JA 3JVVA 4KYUA 4HUTA 1SHKA 3C4JA 1DE0A 1KGDA 4M8NE 3C14C 3IQWA 2IYYA 4EKDA 1L2TA 3TR0A 4AG5A 1E96A 1AZTA 3ADDA 1E2NA 1U8AA 2OCPA 3W34A 3A58B 2ZRMA 2GVZC 2FNAA 4DWJA 3B1XA 3UMRA 3CONA 3VHLB 2XEXA 1J99A 5AJZA 5F2EA 1XB2A 4RD3A 1ESMA 1QF9A 3LBNA 2GXUA 5DNYB 3KJIA 4TMWA 1VMAA 4W5JA 4TYYA 2OFXA 4JJZA 1DPFA 2IUSA 1IXZA 2OT3B 5DIFA 2ZSDA 3QF4A 3QPUA 1XNJA 1KO4A 1Q22A 2QU8A 2IEZA 2ZUBA 1EFCA 4HZUA 1Q1EA 2X1VA 1QZXA 3QSYA 4LHVA 1T3SA 1WP9A 4P4TA 4RCYA 1JPJA 4KSBA 3ZS9A 2DB3A 1MO5A 2DWOA 2W6IA 4ZDWA 4ITRC 1OIXA 3IPYA 1D8TA 3ZZTA 1G3MA 3VTKA 1FNNA 2PZGA 1AGPA 1P9NA 3WMFA 4A2WA 2F1JA 5FI1B 2JJ2A 4DLTA 3MGCA 4OI1A 4HAVA 3UATA 1FUKA 3HPRA 3NXSA 2IHBA 3OAAD 1U8YA 4XTRA 4M1KA 4O2RA 1LVGA 1IHUA 2D62A 1II0A 3G82C 2JA1A 1G6OA 4IVRA 1Y3AA 3NDPA 1Z0IA 3DM5A 1JECA 1CRQA 4QGAA 4Q19A 3PEVA 5CM9C 3PEYA 5FOWA 4IJMA 2R62A 2E87A 4YXWD 4WBSA 4YMVA 4TLBA 1N6HA 3KXLA 1E2FA 1IN7A 3FVQA 1GKUB 4OKSA 2MSEB 1FOEB 3QE0A 4E03A 1Q0UA 4IFBA 3RC8A 1RYHA 3SS8A 2AXPA 1BMFD 2WMOB 3NHAA 1X3SA 1JJ7A 3X2SA 4Q5IA 3KQKA 5BYJA 3GLIB 1NVXQ 2QSZA 3SBEA 4D4MA 4DLXA 2V3CC 1CR1A 3LW8A 4Q21A 3R9XA 4KO8A 1N2CE 3NH9A 1ZC3A 2IL1A 1YZGA 1U90A 2RMKA 2WM9B 3FYHA 4XSGA 5K8TA 1E9EA 3K1JA 3HU2A 5KSYA 5CIWA 5KTYA 2GHIA 2CXXA 1I4TD 1IN6A 3WNCA 3I73A 5C2JB 1P9WA 4BLSA 3GLHB 3B9PA 1XBTA 1OIWA 2NPFA 2HXSA 4ASUA 2BMJA 4D82A 1E9SA 4LX0A 2J46A 5L3SA 1DG3A 4PO8A 1TUEA 2Z83A 1TPZA 4IOLA 2UZIR 3FKQA 1Z6AA 4B33A 3PENA 2WKQA 3PFIA 4IOJA 1P61B 5JFGA 2IW3A 3EA0A 1AQYA 1ANKA 521PA 4PPGA 1MT0A 1W44A 1Z2CA 1K8RA 5C4MA 3NC0C 3PEUA 3ICQB 2EYUA 1CF4A 3M6AA 4B76A 3E70C 2EFDB 1ZMXA 2PZEA 3WNBA 5HZHA 4JLPA 4BRWA 4M9XA 1QVRA 4F91B 4TZ0A 4M1SA 2QENA 5DLQC 3W90A 4I99A 1H65A 4US1R 4D26A 2W2VA 3T61A 1KZGB 4GNKA 5DI3A 1XXHE 3QG5A 4DCVA 1NLFA 1OXVA 4ERNA 3U44B 2O8EA 1EWRA 3D6TB 4KFTA 2J9RA 3LX5A 5JHHB 2J0UB 5FR1A 4Q4LA 4M21A 3M4YA 4P0TA 1GTVA 4CZ2A 3HDTA 2WJJA 1OH6A 1HT2E 2B8WA 4LJ8A 1L4YA 2HJGA 4FW9A 5FOSA 3LRPA 2BM1A 4AWXA 1F2TB 2R6AA 1KI8A 2PEYA 2N42A 3IKJA 2YC2C 5CITA 2FOLA 2ZRNA 5CIQA 3T12A 1B23P 2BCJQ 3QQ5A 1AS2A 4D6PA 2HCBA 4O0MA 2QPAA 3FHTA 2FFBA 1OW3B 1XXHA 4I81A 2HDNB 1GZSA 3LH5A 5BYKA 3W6OA 4QJ5A 2ZM5A 2D3WA 2RGXA 2JDID 1WBDA 1YZTA 4HZIA 1NN5A 5K8IA 1E4YA 1FL9A 1Z0DA 3I8SA 5HTKA 4CVNA 4LBWA 1GSIA 3L0OA 1JQJC 1CRPA 1M74A 5TV2A 2BMDA 2XOKA 1G41A 2YOHA 1JAIA 2VH5R 4HLUA 1OB2A 1AQUA 3FWYA 3B60A 3C15C 2GKSA 4BLTA 2FF7A 3MWLA 4MYUA 3KKOA 4U00A 3EXAA 4DLSA 3BH7A 1RJ9B 2IYQA 3P4XA 5F9FA 4POAA 3C16C 1NKTA 2AWOA 3FE2A 2IF2A 2PL3A 1E1RA 4CT5A 2ZE7A 1TNDA 3TJZA 3R7WA 3RABA 1F3OA 2BV3A 2YWHA 1P72A 2R6CA 5FTNA 3UWOA 3U7FB 4I1VA 2YKGA 2C8VA 4JJKA 1G3UA 2H92A 4A2QA 1SVMA 3ZVLA 3OAAA 1ZC4A 3DOFA 3RRNA 5GJVC 3BFVA 1B0UA 4XVUA 1KKMA 3TNFA 4B3GA 1KTVA 1F48A 3NHBA 1XTRA 4KSCA 1FP6A 3NH6A 4C4PA 3MCAA 4LK2A 4H1UA 4Z1MD 3HPQA 2F9LA 1T9HA 4JS0A 4HB2A 1U9IC 4M4SA 2E1RA 2ZANA 1E2EA 3PIRA 4PX9A 4XWAA 4Q9JA 4A1FA 5KO2A 5SZHB 1KY3A 2ODWA 4PC6A 4QG7A 4YXWA 3D3QA 3OIVA 4MRNA 4FI3C 2VRWA 3QPVA 1OV4A 1P2VA 5ELXA 1XCPA 2ZUCA 1S9DA 1E2HA 1ZP6A 4KHZA 4I1UA 5BN5A 5DHFA 3SJBA 1QVAA 2GEVA 3PQCA 1D9XA 4LHWA 5JJKA 2G1JA 4KAXA 4HEJA 1YZQA 4IVQA 4LC1A 1ZRHA 2GVDC 2H17A 1OF1A 3SN6A 4ABYA 4ARZA 1KK3A 3K9GA 2R9VA 2F7SA 3FFAA 4Q03A 3WP1B 4C0LA 3CPHA 4M1TA 1GFIA 4YDHB 1E9BA 3LWNA 3TR5A 1XU4A 3OE7A 4W9MC 3HYRA 3AGPA 4KITB 2FG5A 4M1MA 3NBZC 4FCVA 4URYR 1UFQA 4NZYA 2WBLC 2ZJBA 4LPKA 1S4QA 1F60A 4PTLA 4F92B 4LV5B 1K5DA 1E2IA 3AQ4A 1RVDA 2EQBA 1XPUA 3KJGA 3VMFA 2ANCA 3TVDA 5A5GA 5JECA 2IK8A 3RWMB 2FWRA 1R7RA 4GSYA 2LKCA 4AURA 1YU9A 4W5HA 4JYCA 3LD9A 4MKIA 3CW2A 2YOFA 1F6BA 3KTAB 2AD5A 3ADCA 3LY5A 5EXXA 2IYTA 5JHGB 1JNYA 5CJPA 3X1XA 4UNNA 4PZYA 1CTQA 2Q6TA 3QF7A 4GL2A 4EPYA 4RVCA 5BN4A 4Q1EA 3GPLA 2HYIC 4RY2A 3Q9LA 4ILEA 5FL7A 2HEIA 3AF0A 1QHNA 3KJEA 3NBXX 4G5QA 4K81B 1E69A 3CX6A 4A6XA 2QBYB 3QI2A 1MRSA 1JAHA 3ETLA 3AM1A 2LCFA 3AVPA 3W3ZB 1FNMA 1FMJA 2O8DB 1IXRC 4G5OA 1PLJA 4EPVA 1GOTA 4JLDA 1Z0KA 1KMHA 4TSFD 4P31A 4Q9KA 2J7PA 3IPXA 3I5XA 1SVSA 2FDCA 4UJ5A 1R0YA 5JLJA 2YV5A 3QXHA 1NMYA 2ZROA 1I4DD 1IN5A 2JAQA 5FBVB 4IRUB 1CR0A 1IY2A 2G6BA 3FMFA 2ZR9A 4GMDA 4XVQA 4LJ9A 2FPLA 5GADl 4A36A 2IS2A 2ZI4A 3BH6A 3LX8A 1WE2A 2N46A 3SJCA 2CLCX 1DAEA 1EFUA 3SHFA 2OXCA 4L4UA 1KY2A 5HZKA 3A36A 4RD6A 1G1MA 3IDQA 4CRWB 3AP3A 5AUNB 3ZJYA 2ZRLA 2JASA 3IIKA 1EFRD 1U94A 1P7CA 1E32A 1XMVA 5G3YA 1X8LA 3A1SA 4PPFA 3MAAC 4DLWA 1UAAA 2OESA 3KJHA 2ZSEA 2OBLA 2WJHA 1VG1A 5ANRB 1WB9A 5FBQB 4JL5A 4Q18A 1KIMA 2R6DA 2EWWA 2WHXA 1JALA 2ZYWX 4GP7A 3EZ9A 1F5NA 4YC7A 3QKRB 2GESA 2WPDD 3DZ8A 4Q4JA 3T06B 4O3MA 3TQCA 2ZSFA 3UG6A 1BKDR 1XTSA 1EK0A 4AKIA 1JEEA 3B7GA 4Z1MA 3L8YA 4Q4HB 4IKEA 4NH0A 1Q1BA 2GK6A 1R5OA 2UKDA 4L9WA 1GKYA 2NGRA 1L8QA 4GRAA 4S35A 1FW6A 4MUAA 1GIAA 2BKUA 3B9QA 3C41J 4QHTA 5F98A 4Q7KA 4M9SA 4NDZA 4BFVA 1XEFA 1SXJD 5CM8B 3WYFA 4DLRA 3MD0A 3C5HA 5FBWB 3GMTA 1GRQA 2I3BA 2A5GA 4YLGA 4LGMA 2QAGB 2G9NA 1W2HA 3HU3A 3VNUA 1W4BA 4RFSB 2JLXA 5E7MA 4BFWA 2ATXA 3EIQA 1LY1A 4W5WA 4HUQB 1G21E 4HYYA 2OILA 2ZSAA 2OHFA 4D80A 3TW4A 4LCBA 2GAAA 1OH8A 4EJSC 1N0VC 5LPNA 4UKDA 2YINC 2W6JD 3VR2A 4EFMA 2QL6A 3K9LA 1DAIA 2W83A 3GEHA 2ZSBA 2NIPA 4N0DA 4E07A 3VX4A 2OCBA 3ND9A 2IYWA 1W4AA 1WXQA 1FTNA 3E1SA 221PA 3K09A 4Q1CA 1OSNA 4GBMA 2LKDA 4JLJA 5EQTA 5K8LA 2PT5A 4M1WA 5FBRB 1VPLA 2J0SA 3KKNA 1KJWA 2OV2A 4DSNA 1QHGA 5J4LA 3EWSA 1MABB 2QMOA 4X8HA 4MDEA 4LJYA 3KQHA 2ORIA 4DLVA 1T5LA 3AF4A 4LYFA 5FUVA 3THYB 3ZQJA 2R44A 2P67A 1SQ5A 1VCMA 2HUPA 1JQLB 2XZPA 4UXJA 2X2EA 4ACBA 5G41A 3A4MA 5KPJA 3GFOA 3SYLA 1T3HA 1TQ6A 3AEZA 3RS3A 4PAQA 1XEXB 1UPTA 2Z6VA 1OPXA 2QQ0A 5SZKB 4PC7A 121PA 4AYWA 3LBIA 2W6ID 4PO9A 2JLWA 3J81k 4JMPA 4EUNA 3NBFA 1GILA 1SXJC 2CJWB 4QGFA 4AC9A 4B34A 2ANBA 4KXFB 4F4CA 3KKQA 3GLHE 2VHCA 3TSWA 3EPJA 1KSHA 3W6NA 5P21A 1LF0A 2JJ2D 3T34A 4Q02A 3V4FA 5LDDC 4PPQA 1TF2A 1OHHA 1E98A 4TQUS 1SKYE 1ONBA 2UVQA 2ZQ5A 1XD2B 3N2EA 5KNCA 1YE8A 4LJ5A 3GLIA 2EVWX 2YVUA 4BFUA 2GAOA 3B82A 1GNQA 5CLLA 3KXIA 4A6PA 2BCGY 1Z08A 4F4JA 1ZD8A 1Z5ZA 3HJNA 3TH5A 4AKGA 3DKPA 4Z8YA 5UKDA 1ZM7A 2D74A 5EJEA 4BGDA 4GMXA 1GWNA 2ZIAA 4JBYA 4BPBA 3T1QA 4B3DA 4YQFA 2D2EA 2P6RA 1IM2A 2RGEA 3GLHA 3R9WA 1K5GA 2RGGA 1YHNA 2J41A 3TAHA 2C9YA 1E1QA 3EZ2A 4MKFA 4URZR 4BLQA 2WWYA 1OKKA 1W5SA 1G7SA 5FOXA 4D81A 1LB1B 3ZD7A 1W36C 1PVOA 3BK7A 4LHYA 4LV6A 1FQKA 4TTQA 4PC3A 5A0FA 2LWIA 3QG1A 4FMDF 5FUYA 4C30A 2ZRPA 4HB3A 1L7VC 5JEEA 1S0UA 2KWIA 2WPDA 4R2IA 4RKFA 2JIZA 3ZZ0A 2ECKA 1KYIA 3C7KA 4IOKA 4LC0A 1Q44A 2GJ8A 1GL6A 1GNRA 3OIYA 1SZPA 2QRZA 2EFEB 4HAYA 1KI4A 1NSFA 2N1BA 3RDPA 1NI3A 1Z83A 3A1UA 4ASUD 4TLCA 2NO0A 1UBFA 1N5LA 4Q1BA 4JLAA 4MYTA 1E0JA 5CLQA 3SNHA 1NP6A 1KO1A 3U44A 1R6BX 4O25A 3D8BA 2J7KA 2J0UA 5FUXA 2ODBA 2J5XA 1HV8A 1TADA 3K0AB 3DVLA 4LJ6A 1CXZA 2ZREA 2WMNB 3BFXA 3DMDA 2BWJA 5JZVA 2ZJYA 1T8UA 1CEEA 4MGKR 1FP7A 3Q72A 1XTJA 4PFSA 4R98A 2WWHA 4Q9IA 4MA4A 4ZV4A 4LJAA 1F2TA 3NC1C 1T8TA 5F3WB 4KFUA 5FOUA 4MYCA 3BC1A 1HY3A 4JLBA 1Q12A 4DLZA 1YR8A 2Q3FA 5B57C 3Q5EA 1R0XA 2G83A 4OHYA 2PX3A 1JJVA 2V6JA 1GKIA 4LUCA 4PXAA 3IUYA 5EP3A 5B2ZA 1N5IA 4URWR 4Q48A 1VHTA 3AB3A 2C9CA 3TAUA 3CR7A 2QMHA 1KMQA 3NKVA 2AX4A 3TMKA 2QT1A 1VIYA 2GNOA 4V0ME 1O3YA 1SVLA 2XITA 4ZCLA 1NN0A 1IOZA 1XD8A 1NG9A 4XD7A 4Q9LA 2I1VB 2GTPA 4TMXA 1XWIA 2GETA 3L8ZA 1E9AA 3F8TA 5CYOA 1VG0B 3NBYC 3WMGA 2XX3A 1WA5A 1RJ9A 3MFYA 2KSQA 3Q7QA 1YZNA 2ZRJA 3M1IA 1GITA 3VR6A 2QA5A 1GRRA 1J8MF 2XOKD 3VR5A 1G9XA 4LYAA 4LWZA 2PH1A 3QNUA 5JWOA 2VIIA 3QEOA 1X8KA 1P60A 3PUVA 4RZUA 3HYTA 2QUZA 3SEAA 4V0MA 2RCNA 4IXMA 4DZZA 2BJVA 5EXTA 3KX2A 4N3NA 3SR0A 3VU9B 4A0FA 4A9AA 2O5VA 1HTWA 4URVR 1IY0A 4LDJA 2GZDA 4BE7B 2VHTA 2VL7A 2CL6X 2JJ1A 2VHJA 2DFTA 5HE8A 4EIWA 1E1RD 2P0EA 3AF3A 3CIOA 3SYNA 5IHPA 2ORVA 3WYGA 2IHYA 4V0KA 1S9HA 2J87A 5IT5A 3I32A 2O8BB 2NO7A 3P27A 3U4QB 1FTSA 3CKLA 5H68A 5LB4A 3K0CA 1JEDA 2A5YB 2WVJA 2D06A 2OZEA 3F0TA 3P32A 1UDWA 4RD2A 4DBLC 2IC5A 3EPKA 1NN1A 2A2ZA 3QOFA 2V8OA 1RC8A 3RYTC 3C5CA 2FPMA 1P2TA 3LXXA 2VPPA 2OSBA 3A37A 2HXYA 1MO6A 2CE7A 5JJLA 4PSVA 1US8B 2G88A 1G8FA 3GJ7A 2KI5A 4IEEA 4QGGA 3U5ZB 4RD1A 4M1YA 3THOA 1TU3A 3FGNA 1MOZA 5DSZA 4R71A 1OFUX 4HAWA 1G7RA 2QPOA 1PLKA 1RPZA 2OEPA 1T0JB 3T5GA 2P6NA 1YR9A 2ASEA 4PPNA 3HWSA 2VP4A 2ZJAA 3LAWA 3CH5A 5IK2A 1P6XA 4GZLA 2DWQA 3CWQA 2KB0A 1G3QA 3QUSA 4QJ4A 1T0HB 2F43B 2GZHA 3OIUA 1V43A 2XJ9A 4DSUA 3VQTA 4B2LA 3TUIC 4DIEA 1XPOA 2J0QA 2IYVA 1KK0A 2OCYC 3K53A 2ZRHA 3B13B 3SZRA 4BWYA 4OK5A 2H7VA 1EESA 4QOSA 3VR3A 2FA9A 2FSIA 1FPMA 2ZAMA 3KTAA 1II8B 2GJSA 3OE7D 3W3AA 4HLUC 2B6HA 5TB5A 2IYRA 5EP4A 3H4MA 4QM7A 2PBRA 2CVFA 4KCGA 1MV5A 1SKYB 5FPHA 1AJEA 5FR2A 1ODFA 3TW8B 2XZLA 4C7OB 3D31A 3MUFA 2NMVA 3CRW1 5CYPA 3K70B 4XOIA 4HB0A 2PJZA 2ODEA 3BERA 3LO5A 4P32A 5AJXA 1Z2AA 3RS2A 1OXSC 1KSJA 5FPTA 4DJTA 2WSMA 2QNRA 1CJTC 2VF7A 3IO5A 3AKEA 3O47A 2QBYA 1XEWY 2CCJA 4QBHA 1KNQA 3AUXA 1G8YA 1U99A 3CF2A 4NU0A 4DHEA 1NIJA 5JS8A 2O8DA 1E79A 1T4GA 3PVSA 5GJWC 3U3MA 3UMFA 4DLYA 4EPTA 4OI0A 2ZTSA 2JLUA 1DVRA 1E2DA 3EZFA 3T1VA 3BOSA 3X1YA 3TSZA 1CJVC 4DRZA 2FFHA 4A8JB 1YZKA 2QAGC 3DMNA 5FL7D 4D25A 1DAGA 4DT1B 4V02A 2ZJ8A 2ZI7A 2G3YA 3I72A 3M0EA 5TARA 1IQPA 3FFBA 1LV7A 1X8JA 4Q1DA 5BN3A 4NKRA 5J4YA 2YZ2A 1QHHB 1ZNXA 1T3LA 4KBFA 1MRNA 2Z5FA 1JR3D 4PSAA 2J7PD 1J7KA 2PMDA 5DI9A 2WSSD 4B3XA 1DS6A 4A0HA 4Q1AA 3W9YA 1IN4A 3X1WA 2V7QD 3LXRA 721PA 4PQYA 3IO3A 3LDAA 1NKSA 1G3IA 1ZINA 1XRJA 2AHOA 1YRBA 1G8HA 3A4NA 1MO4A 2VP9A 5AR1A 3RLFA 4GP6A 3U6BA 3GJ6A 5JWHA 2QRNA 4Q1FA 4BFTA 5EE0A 2WWFA 2CLSA 2Q9CA 3ZVRA 4XVRA 3K8YA 1BOFA 3CM0A 1HT1E 3QKRA 2CVHA 4OQNA 2IS4A 4BZXA 4PC1A 1LS1A 4DDUA 4PHGA 3AVVA 3GJ4A 4Q4HA 4NYJR 5KOYA 2EW1A 4MKGA 1G16A 3MJHA 2VBCA 3CR8A 1VHLA 1TX4B 1KAGA 1OLOA 1DARA 5KUTA 3RS5A 4B74A 3T5DA 4AD8A 1GUAA 1R5NA 1TAGA 4M22A 4TTPA 1A5TA 3A1WA 1ZVQA 2D7CA 1D2EA 1NJFA 2V55B 4P4SB 2QTVB 4URUR 3GQBA 4A0RA 4E22A 4DDVA 2ZUDA 4QNMA 4I1OA 4JVLA 4WZAE 4FN5A 1QG2A 1ZNZA 2CK3A 2AXNA 2DBYA 3B6EA 2ZITA 2XTZA 1MO3A 5EE3A 4K8OA 2QAGA 4KFRA 2VHUA 2IX3A 2G1KA 1KNXA 2QP4A 4RFSA 5G3ZA 1EWQA 2BBWA 2FU5C 2HLDD 2OCAA 4RKEA 3LA6A 4HUQA 4JYBA 2DCUA 2WTUA 4OHVA 3U2QA 3EAQA 3MLEA 3IBGA 3BJIC 3U7HB 2WJIA 3E5HA 5LD2C 4NP6A 3CZQA 5KYKA 2F6RA 4M1OA 1TEXA 5HCNA 4AYTA 4TL7A 3I4LA 2QPTA 3PEWA 4I4LA 3NG1A 2ZS9A 1I2MA 3E2IA 4GOXA 1KDPA 1XPRA 3P4YA 4DEXA 4Q4AB 4MRPA 4F38A 1KI1A 2XXAB 2A78A 2OAP1 1VG9B 1ZIPA 4LJ4A 4M0LA 4EPXA 2JLYA 2IF0A 1HQYE 4FMCB 4M9ZA 2VSOA 1AKYA 2ZU0C 4JT4A 2OFOA 4UXHA 1E0KA 4C0HA 4EFNA 8OHMA 5CDFE 3ADBA 3B1VA 3BS4A 2QQEA 3B1ZA 4Q7MB 1UBGA 4IDNA 2OLKA 4QC2A 3U61B 1XJCA 5JCPA 4LHZA 2BMFA 4Q9HA 4DCTA 2ZYVX 3AVTA 5FFMA 3KB1A 1MABA 4DDTA 4OJQA 1HYQA 1RKBA 2GILA 3PUZA 4JKIA 2AFIE 3QJYA 1KKLA 1R0WA 3NWJA 4YDSA 3ZVNA 4KLNA 3THYA 1PV4A 1GM5A 4V0NA 4PHTA 5K8UA 2Q0HA 5E7JA 3CRVA 4IFEA 4P3YA 1Z6TA 4DIDA 3UWKA 2RH5A 2QM8A 1E2GA 3Q85A 5J47A 4QHYA 4QXAA 1XEXA 2GXAA 1M7GA 3I92A 5DHAA 3TK1A 1XTQA 2MSCB 1WDTA 1JR3E 3UG7A 4CDGA 3T1TA 2ATVA 2ZI6A 2NO6A 3KQLA 3QXCA 3CPJB 2RGAA 2JLSA 4AKEA 2QEQA 5CB8A 3MWJA 2GA8A 5JSZB 2F1HA 2CJWA 2BDTA 2WJYA 4LYHA 1E0SA 2R65A 1EX6A 1ZW6A 4K46A 1LS6A 4CF7A 2G0NA 2RGCA 3B85A 1E9RA 4UJ3A 4BASA 2JCSA 1N25A 4DCNA 3BGWA 1N6KA 4IDOA 2BOVA 2C5LA 4UXIA 2ZR0A 2EYQA 1KJYA 1K6MA 2EU8A 4A4DA 1XD2A 4EFLA 3THXB 2O8FB 1E4VA 2PX0A 1Z22A 4V0OA 1W0JD 4HSEA 3FKSA 2VP6A 1JR3A 3CF6R 1KDRA 2H57A 4IOMA 4A15A 2O0HA 1BYIA 3S1AB 2R8RA 4XH9B 4BFZA 2NQ2C 2WSSA 1NBME 1ZCBA 2ZEJA 4HATA 5KDOA 1AIPA 4C0QC 3PCRB 2I4IA 2O8CB 3LFUA 3ECCA 2XNDD 1AS0A 4NBSA 1OHHD 1U0HC 5GJCA 1ESNA 1RRPA 4R9UC 2IEYA 2V7QA 1QHIA 2OBMA 4JLVA 2PEZA 3FMPB 4NMMA 4R2HA 1M34E 3EARA 3H2YA 5EUMA 4AK9A 3JZMA 1CKEA 3TVTA 4BLPA 4US0R 4Q7LA 1CBUA 1ZM3A 3EZ7A 4C2UA 3WY9A 4QJ3A 1UBCA 4L8GA 5DN6A 1G18A 1H8HD 3RRZA 3RSLA 2FE4A 5M04A 1IN8A 3EA5A 1WMSA 2WWXA 4DSTA 1NBMA 3K09C 3QXSA 3K0SA 1E1QD 1II9A 2OXRA 3BXZA 4HDQB 4N1AA 1OKKD 1NF3A 1NLZA 4Q00A 1KJZA 2AK2A 3OF5A 1N5KA 1KSGA 3VR4A 3RSOA 1H8EA 4M9QA 2ZYUX 3VAAA 1T91A 1IJEA 2ONKA 4B3CA 4XTCS 2VA8A 2NPIA 4LHXA 1SVIA 4Z54A 5C46F 2W0MA 5AUOB 4D4KA 1HE1C 2EFGA 2KBEA 2JIZD 1EGAA 2OM2A 3K0AA 3ND8A 2V1XA 3AF2A 4GZMA 4JL8A 2Z4RA 1G4UR 2D7DA 3SI7A 1BIFA 2C2HA 2DR3A 3A4LA 3RHFA 3VFDA 2GEDA 2PCLA 1N6PA 2VP5A 1TMKA 4LBZA 2BKEA 5AUQA 1W0KA 1IAQA 4A0GA 821PA 4B43A 2GJKA 2HLDA 3I61A 1D6JA 3AVUA 1M6NA 4CEIB 2Z0MA 4JVSB 3CBQA 4C0KA 1R0ZA 3IGFA 4JIMA 4X8LA 1G5TA 3UANA 2VHQA 5CK5A 5FPYA 1RRFA 2HV8A 1KK1A 5LBIA 3AVWA 1QG4A 5G53C 4OHWA 2GF0A 3VX3A 4BZQA 2VLIA 5EXPA 4WW0A 5DE3A 5H8WA 1O87A 4LRWA 4B73A 4CEHB 2ZVPX 1QHSA 2H18A 3QEJA 5EXSA 3U3JA 1CR2A 3C8UA 3SQXA 4HAUA 1EG7A 2HF9A 2ZAOA 2H5EA 3UKDA 2CHQA 2QAJA 1A7JA 3SE0A 4QM6A 4TL9A 4YONB 1ZBDA 1OYWA 2RGNA 2CHVA 1S96A 3LLMA 4G0NA 2ZRFA 2C04A 1DEKA 2WOJA 4LBVA 4QBFA 2BEJA 2HJVA 4LBYA 3HR7A 5FOTA 3ZS8A 2MMGA 4AYXA 5AJWA 2FN4A 1Z47A 2GBLA 5C4GB 1VKJA 2JLZA 1KDOA 1C1YA 2CL7X 4NYIQ 3W8NA 4C0AC 4J0QA 2CLDX 2AK3A 4QBIA 4S2EA 5D3MB 4DKXA 1VTKA 4KLZA 3VNVA 2XSZD 3X1DA 1LTQA 2JLQA 4XD7D 2HF8A 1DBSA 5IDVA 3L82B 4WZ6A 4UNRA 2IS6A 4MQBA 4WOPA 1J8YF 4ZPXA 4BFYA 5JCZA 3AH8A 2OAQ1 4YMUA 5KSZA 5FL3A 1AK2A 1NLYA 3VU9A 2KE5A 5JWRA 4UNPA 1PUJA 1E2PA 4D0NA 1S1CA 4Y0VA 1DAMA 3AP2A 4OK6A 4II7A 3T15A 4BEJA 5FTLA 3EWAA 5DO9A 3B5JA 4G5SA 4JL6A 4TQ9A 1KI2A 5TXGA 2EFHB 3HU1A 3U7GA 2O52A 1N0WA 2O8BA 4OYHA 3AVYA 1ZJ6A 3U4QA 4Q01A 3AKYA 1GG2A 2W00A 3MRSA 4NPHA 2B8TA 4M2LA 3ZYCA 1G5PA 2OE2A 4ZO4A 1VCIA 1W0JA 3N70A 1IONA 4OL0A 3QXJA 4NYIR 3LVRE 1HEIA 3NVAA 3A6PC 2JJ1D 4UNSA 5FOVA 4NCKA 4HAZA 2MSDB 3EPLA 3A1TA 1US8A 2VSXA 2O0JA 1NNEA 4CEJB 2XNDA 2VEDA 4KODA 4GDFA 4LZZA 2ZI3A 3CZPA 3Q7PA 4M53A 3VHXA 5KDDA 4LYJA 3ZGXA 4U5XA 2Z43A 4DDWA 2ZRGA 3O8RA 4WZBE 2FSFA 1ZNWA 1E9DA 1SVKA 2YWFA 4UQOA 3CRMA 1LFDB 1N6OA 2REXB 3CRQA 4BEBA 2IXFA 1H8HA 2F43A 4B35A 1E3MA 1KAOA 2C77A 4HDCA 1NVUQ 3BE4A 3GJ5A 1MH1A 1EX7A 1ETUA 2NTYC 4B6EA 2C78A 3LQQA 3IHWA 3O8BA 4JLMA 2ZPTX 3IHLA 3VR1A 4XWKA 5L8VA 2C98A 1G7CA 2ZS7A 4ZKDA 1AGRA 4TYNA 1XTIA 5JMTA 2GCNA 1II8A 4LOAA 5B58C 1DTSA 3T1OA 2ZRKA 5J5CA 3GLFB 4DSOA 2MMCA 3P26A 1W5TA 2A5JA 5IK2D 4GT1A 3QY0A 4C7OA 2Q3HA 2CMKA 3DL0A 2FEOA 1TQ4A 2X19A 4BFXA 1GAJA 1HE8B 2ERYA 3QKUA 2F55A 2ORWA 4TTRA 3TBKA 2BVNA 4IHQA 1UKYA 4RZ2A 1KO8A 3U3RA 4PR0A 4DCSA 2V6IA 4FWTA 1UKZA 2QMEA 3LV8A 3RVBA 2VYFA 1MKYA 2AD1A 3QXXA 1W46A 1N6NA 1GVNB 1VECA 4UNQA 4TMTA 5TVKA 4LSGA 2W0SA 3IQXA 4WA7A 3EW9A 3UMSA 1N6IA 2JLRA 2IUTA 3JVUA 4HB4A 1P4SA 1HA3A 4Q66C 3SFZA 1TU4A 1U98A 2REBA 2F3TA 1NG1A 1RFLA 4A8JA 5EE5B 2ERXA 2DFLA 2IXGA 5SZJA 3ZZUA 2JGNA 2NO9A 2PJRA 2ZRCA 2GF9A 5DYIA 4DT1A 4NHOA 1OXUA 3P1JA 2FPKA 3KQNA 1P62B 1X1RA 2J1LA 1LNZA 3X1ZA 2VQSA 1QHHA 3THWB 1E79D 4BECA 4DCUA 3GJ0A 1A2BA 4EQ6B 5DH9A 1JXOA 3K0CC 3BB3A 1G7TA 2QTHA 3DM9B 3RWOA 1YKSA 2YHSA 5EP2A 3N5CA 3KUDA 1FUUA 1UF9A 1PUIA 2GXSA 4B71A 1WRBA 2C03A 3UIEA 1U0JA 4Q7JB 2Z4SA 3GJXC 1RW4A 3SJZA 3CNNA 4RZXA 3H84A 3GEEA 3V9PA 1FMLA 1AA9A 1NJGA 4BUJA 5JRJA 2J45A 2HYDA 4QNRA 1CULC 5EZ5A 3WRYC 4C0JA 1ZCAA 1TUIA 4ZI2A 5HCIA 4NYMQ 1KSFX 4X8OA 3A1VA 3V4RA 2QROA 2XSZA 3PITA 1AZSC 2P2LA 5GJBA 1AKEA 4ZKEA 4TLEA 3BD9A 4C3ZA 4QHSA 1Y63A 2IWRA 1COWA 4MRVA 1RRCA 5C18A 2ZJZA 3RANA 4DB2A 3ZD6A 1KI3A 4DEYA 1TL7C 4CGZA 2A5DA 5FPKA 5L3QB 1NY5A 2PCJA 3TUJC 5JBQA 1JB1A 2WJVA 2Q9BA 2QP3A 1OFIA 2IXEA 4TYQA 4P4SA 4D4LA 4PAOA 4X8MA 1WF3A 1E99A 3KUCA 1XF9A 1Z3IX 3B1WA 2ZS8A 1CP2A 4IEIA 1W1WA 5HE9A 3IIMA 3ONWA 3REGA 4NYMR 3O8CA 3GEIA 1DADA 5J4HA 2QTFA 1VYTA 1R8SA 5J40A 3L2OB 4LV8B 3I5YA 3KB2A 2AFHE 2FSGA 4JT2A 4PC2A 1KI7A 2A5FA 4RCZA 3OFND 4B32A 3AF1A 3H0KA 2Y8EA 1U81A 4AKHA 1ZM4A 3FHCB 3ZIAD 1G4AE 2BEKA 4CW7A 1Z8FA 2CK3D 5EP1A 1ZU5A 4PSKA 2CNWD 1HURA 6Q21A 2FV8A 4FXPA 4O2LA 4XIGS 3ADKA 1NY6A 1UBEA 4Q4AA 1PZNA 2XXAA 2GCOB 4MUBA 3K0FB 5FH9A 1P2SA 4U7DA 4QL3A 1CJMA 1XDBA 1XZPA 5FBLB 3AKDA 1R10A 2X8AA 2QP9X 3NEJA 4V03A 5E95A 1M1YE 2ZVQX 2DWPA 2XJ4A 3Q3JB 3RS7A 4B6FA 3SDZA 1M7HA 3ZLJA 5JRZA 4KI0A 3CO5A 3FHOA 4TZ6A 5HKKA 2ZI9A 4JLOA 2JATA 3RC3A 4LY6A 1W47A 3EC2A 5AK0A 1KOFA 2A7QA 5SZIA 5TY0A 2H8KA 2VO1A 5KU1A 1XCGB 1DOAA 4AIIA 2WWIA 2KJQA 4D4JA 2C96A 2VTKA 1C9KA 1OXXK 2ZRIA 3HP1A 3G0HA 4MH0R 4TT3A 1G3RA 1G20E 4GPTA 2WOOA 2AKAB 1AN0A 5FPSA 5FTKA 3AVOA 3DO6A 2OFWA 4BZPA 4ZI3A 2NZJA 4EJSB 3FMOB 5JSZA 2A3RA 2ZI5A 4BRUA 4EDHA 1DAKA 2B21A 3QPWA 4AG6A 3FB4A 3CUEF 1TQDA 4ZIRB 2CCKA 1P9RA 2IYZA 1XMJA 2AKYA 2GXQA 2EFCB 3KKMA 1W48A 1W4RA 2FX3A 1Q20A 3EASA 1UDXA 1S2MA 1A82A 3PUWA 4AI6A 1XZQA 3THXA 2OLJA 1Z29A 3SYKA 3LBHA 2O8FA 2IYXA 2KBFA 4B44A 1ZM9A 3KKPA 4RSGA 5G40A 3KL4A 2XB2A 1U8ZA 3WYAA 1CIPA 5C1BA 4OHXA 4CYMA 3W6PA 4TMZA 3S1AA 4JKYA 4L9SA 3U6KA 2X2FA 1M8PA 4BQSA 1Z06A 4EAQA 1Q3HA 5DGXA 1ZUHA 1OE0A 2ZE8A 1UKVY 1P73A 2O8CA 5FTJA 1YVDA 2QORA 2HT6A 2WAYA 4B3BA 1TEVA 3QKSB 3ZDQA 2XGJA 1WQ1R 1YQTA 2C99A 2WIAA 4P33A 3KZ1E 5GVRA 3FKSD 2R2AA 3AGQA 2BMEA 2V54A 1CR4A 4NYJQ 1KHTA 1XX6A 3SBDA 1T6NA 2IYUA 2OUKA 4B3FX 4W7SA 2WIBA 3WHKA 4B48A 2IWHA 3BFKA 1SXJB 3EPHA 3VKWA 4TYWA 3WRXC 4RD0A 5F9HA 1Z07A 1E2KA 2V4ZA 2YWEA 3K0EA 2YC4C 2B92A 2YYZA 1KI6B 1NSTA 2YNMA 3QVUA 1QRAA 1YZLA 2ZRBA 3QENA 3UPUA 3MWKA 4PZLA 1VCOA 3BIFA 3NDBB 2GDJA 2O0KA 5DN6D 3QBTA 4TMVA 1FX0B 3REFA 4KJZA 4WVFA 4BFSA 4FINA 2OO7A 4NONA 1W4CA 2CHGA 4TWZA 1E9CA 4A92A 3SU8A 1NBMD 1BYUA 4ESHA 1CU1A 1F2UB 4NE2A 2QG6A 1BS1A 2FSHA 1NMZA 2J3EA 3CNOA 2XNSA 2IUUA 4B2PA 1I2DA 3GLGB 2JLVA 3RS4A 4CEIA 2YJTD 2DY1A 4MGZR 3EX7C 3Q8XB 3PG5A 3K9NA 1H8ED 3GFPA 4DUGD 3OFNA 3CWZA 4JVMA 1A1VA 1W36B 1OIVA 4TLDA 3LQRA 4OJKA 4H1VA 3ZIAA 4OI2A 2ZE5A 5CB6A 2A30A 3EIEA 2CNWA 4JVNA 4Z51A 4CEHA 2ZXUA 3DOEA 2FH5B 2GEUA 4OQXA 4KVGA 1RRGA 5HR5A 1SGWA 5B30A 1W0KD 1CJKC 2DHRA 1EFTA 1V5WA 3AP1A 4OQLA 4FIDA 3DZDA 1NL3A 2H16A 1R2QA 2BBSA 3QF4B 1XD9A 4WXRA 4GI7A 4QBGB 5E3HA 2I1QA 4LJ7A 1GL9B 1E2LA 3PV0A 4ZCIA 4HZUB 1E94E 4NL4H 4TYPA 2EWVA 1G291 2B7BA 1UKEA 3QKTA 4HAXA 4JZKA 1WBBA 4KVAA 1XFAA 4FWIB 2ZJ5A 3RNLA 3WP0A 2NZ8A 2NOAA 4NCJA 2BHRA 5IF9A 4ESVA 3WBJA 2QN6A 3AVQA 1NVWQ 1TTTA 2NO1A 2RHDA 4TL8A 2VSFA 4OQMA 3WBKA 1NVVQ 2BJWA 4OK3A 3LW7A 4XSHA 5D3MA 5L3RA 1Z0FA 2RKOA 2CEAA 2ZE6A 2PT7A 2BC9A 4CIDA 1BMFA 1OT3A 3LLUA 2UZ3A 1IBRA 3BB4A 3R8CA 4BLRA 3CX8A 3R8FA 3EG5A 1D5CA 1FZQA 4IW3B 4TMKA 3VKGA 1W2GA 2IYSA 3OZXA 3H86A 1XJ0A 4V0LA 2WICA 3U3OA 4OHZA 1NRJB 2WWGA 3W8RA 1YZUA 2ZU6A 1E2QA 3K9HA 3OHMA 1G5RA 1NMXA 4LI0A 5LB2A 2GJAA 2F1RA 3L0IB 4C9BA 2IA5A 2FZLA 4ACAA 4US2R 5CDFA 1G8GA 2D2FA 3U3KA 1XJQA 4G01B 1M2OB 2ZRAA 1YR7A 1NVVR 1RIFA 3LNCA 1YJ5A 2R6FA 3I62A 2JEOA 3SFVA 1TF5A 1UJ2A 2D4HA 3DDCA 1W7AA 1G6HA 3GD7A 5JI3E 2RGDA 3MSXA 4YMTA 4D0LB 1OFHA 2XZOA 1R8QA 1UEIA 4WIAA 2QGZA 4DC9A 4CEJA 1A4RA 3GLFE 2G77B 3CH4B 4N0EA 3R20A 2QMUA 1AM4D 1SVWA 3B78A 5BWMA 1KDTA 3JZAA 3WXMA 3I8XA 4TL6A 3WNDA 1D9ZA 4F7WA 5JEDA 1E6CA 5L3SB 3A8TA 4U02A 4I1SA 1Q3TA 1VG8A 3AVXA 1GNPA 3OESA 4KBGA 2DYKA 5DYGA 3TUZC 2BM0A 4H9GA 2VF8A 1Z6XA 1Q1QA 3KXKA 3RAPR 1GL7A 4NCIA 2QM7A 3NTUA 1U9IA 1OYYA 4MRRA 2RHMA 2F1IA 2QY9A 2YOGA 3QVVA 1KO5A 2C95A 621PA 2P3SA 3KFXA 3FMIA 2JJ8A 2FMXA 3H1TA 1XMIA 5BW8A 1X6VA 4G3XA 4E5UA 4JSYA 4NTZA 1XTKA 2F3RA 1DO2A 1GRNA 3KFVA 2RGNC 5FI0B 3TQFA 4KFSA 4RD4A 4B75A 1PLLA 4D0GA 3GLFA 2K5UA 3OIWA 1A2KC 1MR3F 2AWNA 4ON9A 5DI3B 4DVGA 1Z63A 1Z6YA 3RRYA 1GDDA 1XP8A 4KU4A 1VYVA 1KZ7B 1N3BA 4R7ZA 1QHXA 2XTNA 1RYFA 2O8EB 2DFKB 2P65A 5JS7A 3KQUA 3OEED 1G19A 3TSOA 2HT1A 1CS4C 2GBLC 1QDEA 2XTMA 4FCWA 2VP2A 1GP2A 3GCGA 4MKHA 5FTMA 3CRRA 3R9IA 2JDIA 4WAUA 1OJLA 2W58A 1OFTA 4EPWA 1P75A 4OBEA 4E09A 1R4AA 1N5JA 4KV9A 5GVSA 2GJ9A 1IXSB 2IBMA 3MJRA 4DUGA 3L0SA 1D2MA 4ZCMA 4L5BA 4JSTA 3UK6A 2FZ4A 2QE7D 3K70D 4MITA 3TE6A 1HUQA 4IDHA 1X86B 4AY2A 4MDFA 3SHWA 1W49A 2A9KA 1XXHB 3O8DA 4GOKA 2CE2X 3FDIA 4MGIR 2BBTA 5KSOA 4PQRA 4C0BA 4YMWA 5B64A 2ZJOA 2OBNA 3DPUA 3Q5DA 3DHWC 4IDPA 1P3JA 4L15A 4MGYR 3THWA 2AN9A 1FQJA 3B8HA 4NCHA 1M7BA 1U0LA 4EQ6A 2V9PA 2ZETA 1X1SA 2IS1A 2J59A 3BAFA 5AJVB 2P6UA 2HCJB 2FGJA 2XAUA 1CLUA 1Z0JA 1WCV1 3EC1A 3L43A 1XMSA 1JI0A 1SVOA 3B1YA 3G5UA 5KSPA 1N6LA 2RAPA 3MG9A 4QGHA 2QI9C 1D2NA 2CBZA 4FMDB 3BB1A 1ZU4A 3LVQE 1ZUNB 4FMCF 5A4JA 3PXGA 4B47A 2H1LA 3CNLA 1VCNA 3U60B 3BRWD 1QHYA 1YR6A 2RB4A 1JXMA 1T5IA 3R7WB 3MWYW 4ZDKA 1ZNYA 3VKHA 1DELA 1R5BA 4TLAA 4CT4B 2W2XA 5H70A 4XWOA 3SQWA 2RGBA 3CPEA 1SKQA 3OEHD 4GFDA 1BH2A 3SC3A 1KI9A 3QIAA 4PHHA 2X77A 3FOZA 1U2RA 1PJRA 1ZD9A 5KDLA 3FTQA 2PLRA 1S3GA 2GRJA 1ZYUA 3DEFA 4HLCA 3SJAA 1C4OA 1QBKC 1SHZA 3EZ6A 1E9FA 1ZAKA 2IT1A 5EZ6B 5L3QA 3TKLA 2GZAA 2SHKA 4LPSA 3MMPA 2FJUA 1UM8A 3V00A 3ICEA 2OG2A 1E2MA 2G0TA 4F4IA 4OQFA 3IEVA 2GK7A 421PA 2FFQA 4QFMA 2YWGA 3IBYA 2C9OA 3BORA 1IY1A 2ZYTX 1IJFA 1COWD 1Z6GA 3PUXA 3ZH9B 5E7IA 2ZJ2A 3EIHA 3K70C 2V1UA 1DAHA 3GJ3A 3L0PA 1J70A 2NG1A 4MRSA 3RS0A 3GJ8A 4IXNA 2FEMA 2Q9AA 3D7MA 1CJUC 2VP0A 1HQCA 2GWHA 4ARZB 1LF5A 1DO0A 4FCTA 5L3VA 1DAFA 1W36D 4QKQA 3NEYA 1NIPA 3W5IA 4TN1A 1P2UA 4QRHA 5J4VA 1I4LD 4XJXA 1EXMA 4NCNA 4A8JC 4JBWA 3HR8A 5FUWA 1UEJA 4C2TA 3F5FA 2GCOA 3K0FA 3N2IA 3CLVA 1P5ZB 2P5TB 4EPRA 5AJYA 3ASYA 1AS3A 3GLIE 5JJIA 2DPXA 1Z0AA 4TQAA 4HI0E 4Y0AA 2ONJA 3QBVA 5KNBA 5IRCD 1TQ2A 4RJLA 5DISB 4HLQB 2E9SA 4F93B 2AL7A 2QT0A 1VYUA 1J90A 4A82A 4OI4A 2AR7A 1RZ3A 1N6RA 4TSFA 2QSYA 1JPNA 3IIJA 4B2IA 3TLXA 3IEUA 4ZDIA 3ASZA 3WHLA 5BXQC 3PUYA 2CCGA 1OH5A 1SULA 1KO7A 4GOJA 3OEEA 2PLFA 4HDOB 1BO6A 2REOA 3W5JA 2PMKA 4C0SA 2J0VA 1S3SA 1ZIOA 1VIAA 3BBPA 5JI2E 5LD2B 2ZR7A 5HKKD 4EJSA 2ODNA 2TMKA 3AKCA 1KMHB 2QGNA 4P4UA 3FPAA 1TF7A 1FFHA 1ZM2A 3DKVA 1XCMA 3IILA 1G64A 4ZIRA 3KDSE 3UXMA 3BWDD 2P5SA 2QE7A 5BQ5A 4IVPA 1L4UA 3CB4A 2Q21A 2BIFA 4TT3D 4G5GA 1Q1ZA 1E2JA 3TGPA 1JBKA 1EFRA 3PR1A 1G17A 4WXPA 4Z8XA 4A2PA 3I1FA 3GP8A 3SOPA 1S8FA 4PHFA 3ZVMA 3WMEA 2BBOA 5H1YA 1SXJE 5TDHA 1JR6A 5J4KA 4PAMA 5KPDA 2CDNA 5KNDA 4G1UC 4MYHA 5AWFC 1Q21A 1VDZA 4L16A 2WZQA 2ZRDA 5D3QA 1UADA 2Q3MA 3GFTA 2IYLD 4IDQA 1OB5A 1S1MA 2XB4A 1E0AA 4FD2A 1RE0A 2WKPA 3P20A 4PO1A 3BH0A 4PQFA 3QKSA 2WKRA 4DXAA 3AV0B 2FGKA 4URXR 1XEWX 2WV9A 1G8PA 5EE9A 1LW7A 4JLNA 3OEHA 4PZZA 1YRAA 2R6GA 5EE1A 1SXJA 4JBXA 3U7EB 4DB4A 2B7CA 4Q4JB 4BLOA 1DG1G 4ZDJA 5AUPB 4D2IA 3GLGE 5EUQB 3TIFA 2CL0X 1OXTA 1OH7A 1N0UA 2QZ4A 5CK4A 1KI6A 4JLKA 3AUYA 5HPYB 5CJ2A 3PJRA 4Q47A 1KK2A 3TRFA 3RRMA
chains in the Genus database with same CATH superfamily
1Q17A 4YJ3A 1T2VA 3B2EA 3B2QA 1EP2B 4PANA 3CF0A 4NV0A 3ASUA 4CL0A 2YR0A 2FFAA 4O02B 1N7JA 3TZEA 1PG2A 3ZCSA 1KYQA 4CTJA 1AY0A 3ED5A 2AJ8A 1ZG3A 3BL6A 1TQHA 1XZ8A 2I80A 4O29A 2C59A 1WHSB 4ZVTA 1YRWA 3S29A 1GKKA 1YS9A 3TL6A 3IJ5A 3TZLA 5KEIA 1ZUIA 4GMKA 2H1HA 3DAOA 5E6SB 3WHIA 3GPDG 1U2PA 2W2TA 3M6MD 1BCRB 4DLUA 3H2GA 5E7MA 5TMPA 3GLGA 5SZJA 1CUAA 2P27A 5K4HA 3NIBA 3DT6A 3JVVA 4KR3A 3HVHA 5EVJA 1CE8A 2PWBA 2QIPA 3R5XA 3HKEA 1KGDA 1F20A 3O3CA 2OCDA 4GEGA 3ZCQA 4EKDA 5BR7A 1ECGA 1WKVA 1E96A 5FEMA 3QPCA 4NE9A 1U8AA 2CC2A 1BA2A 4Y2SA 4FZ5A 4PG4A 4C7KA 2Z2YA 3A58B 3JAKA 3IH5A 3CCCA 1A5AB 1EJ2A 3G02A 4GR5A 5DBGA 3UMRA 2OOKA 2Q5CA 5C80A 5HUJA 3EAGA 3LPMA 3EZNA 1ESMA 2PQ6A 1UT6A 2CJXA 4EECA 5DNYB 3LBNA 3AL0C 1X1AA 3LM8A 3BIJA 3KJIA 4TMWA 1VMAA 2R4QA 2CMFA 3KUXA 1XO1A 2RIPA 3OZWA 4JJZA 4OHBA 1GLNA 1GUYA 2IUSA 3Q11A 5BSHA 1YMVA 4F3RA 1DEAA 5LLTA 4B6PA 4R01A 4DNOA 1IWPB 5LXTA 2C0CA 3QPUA 3K94A 1OGJA 5BW5A 4P92A 1GTL1 2QU8A 2LCIA 4W1PA 3RU2A 2ADOA 5C37A 3SP1A 1TKAA 1XSEA 3MMNA 4LISA 2FQWA 4BP9A 3VVCA 4OAQA 3RG2A 2WPNA 3K8QA 4TKMA 2IEIA 5HA5A 2W7TA 3ZDEA 3CA8A 1L5ZA 4ZDWA 1EE2A 5JQGA 1OIXA 2IHNA 3SHVA 3R7LA 4DR7B 3BXHA 3E8SA 1WVIA 3BGIA 5DX1A 1ZXLA 5JIBA 2DBQA 2VHXA 4J7UA 1Y3CE 4MLPA 4S1TA 5AXBA 2A86A 2RAUA 1AGPA 5KQLA 3FKJA 3D6UA 4WXYB 5E1DA 3UHFA 3LUKA 1T25A 5FI1B 3KYIB 3KYDB 3ZDCA 3B9BA 3MJFA 3MGCA 4OI1A 1D03A 4L95C 3HPRA 3SVTA 1P6QA 2Y1EA 4XTRA 3IT0A 1IHUA 3HJFA 1I8TA 2PVPA 4Z9AA 5GZ6A 2XKAA 2XQVA 5G0WA 3LCRA 1SC3A 1XV5A 1YS2X 1CRQA 2IGBA 3O75A 4BEVA 3MIIA 3C2QA 3GRAA 5EVCA 4BQFA 5F76A 4CBVA 1ORTA 1NM5C 2R62A 3D2LA 4U9UA 5C8YF 4O4LF 4YXWD 4P35A 3D0OA 1DJNA 2PY6A 4WBSA 3TW6A 5IJ9A 2Y0CA 4I3FA 1PK8A 3FPEA 2CF6A 5FWAA 2I6UA 4OKSA 3QE0A 3ZZNA 3GXOA 1WEHA 1QG6A 1X70A 5TQ2A 2JJYA 5HRAA 1Q0UA 4IFBA 2R1ZA 4RY0A 4OYLA 2AXPA 3F6EX 3KD2A 3NHAA 4MVJE 1X3SA 4C06A 1Z15A 2AJLI 1OVMA 3GLIB 2HGZA 2JFZA 4B3HA 1Q0ZA 1M2OA 3SBEA 2VWGA 2Q4RA 1QM5A 5J1TB 2BYTA 2YQ5A 3QNWA 2C2KA 3D3KA 5KX5B 4DA8A 1ZC3A 3LUPA 3FYHA 4QULA 3PX2A 4YJKA 2JNWA 1MAUA 4WGGA 3EODA 5KTYA 5KJCA 2CXXA 4IV0A 2VYQA 1TKRA 1XUOA 3WJ1A 3I73A 3WNCA 1HDEA 2XWBF 5C2JB 2CLOB 3MTIA 4GI5A 4BLSA 4WJZA 4JMLA 4MWZA 5LOVF 2BMJA 4D82A 3QFHA 1KPIA 1E5VA 1DC3A 3NX4A 5HF5A 1EVYA 3H13A 4CLHA 5IZCA 1TUEA 4G0VA 1L1QA 5DYYA 4IOLA 3H1AA 4QUIA 4YHBA 3T0IA 3ZIDA 4EG1A 4B33A 3T52A 4R2IA 4IOJA 4WASA 1XMOB 1DJMA 2IW3A 1RBMA 3KOUA 1ES9A 1TM7E 3IX7A 4NK4A 2FUEA 5AI4A 5B7NA 1ANKA 3OX1A 1MG0A 521PA 4PPGA 1DBVO 1Z2CA 3AMVA 2FRDC 1N2CA 1U2GC 3PEUA 1A9TA 4B76A 4OFBA 1KEKA 1ZMXA 5JATA 1GYRA 3BYZA 4JLPA 5H5JA 5ECYA 4DDMA 4M1SA 3H5WA 1BHO1 1MB4A 3BKXA 2Z2XA 5DLQC 3ZDBA 2OAEA 4US1R 3J81A 3B51X 1BGWA 2C7VA 3P2YA 3CSSA 4N01A 4MKZA 1T6YA 3G8DA 1CZLA 3OPXA 1XXHE 3N8GA 3AUTA 3QG5A 4DCVA 4X3OA 3WGJA 5ER9A 3VR4H 5JAOA 1XRQA 2UVPA 1L4FA 2AOTA 3FXAA 2DTDA 3OP4A 5JHHB 4Q4LA 4KUHA 4OAOA 5CVEA 5FD8A 1KGSA 5K3FA 4QXPA 3UPDA 3TPCA 4D3FA 3RUEA 3TLBA 1E9VA 2WJJA 2DUNA 2B8WA 1NV8A 2CF5A 2XY4A 3HB0A 2HWUA 2HRDA 3CF4A 3L9WA 3LBAA 3OD5A 3THRA 3VUFA 2RG7A 2C4UA 1SZDA 1DX6A 4OHKA 2BM1A 1FDTA 1X7XB 3A10A 3T4XA 4I4CA 5G0SA 2C42A 1RZRD 3T54A 3UKOA 4UFOA 5KTMA 2FOLA 2W2LA 1SIUA 4WACA 5J59A 3M3DA 1AQNA 1NNI1 1CQIB 1PL7A 1OUMA 2HI0A 4D6PA 2YJNA 1L0BA 3K5WA 1N2GA 1KF0A 4QYIB 5A04A 1M6VA 2B3TA 4EBFA 2FFBA 4HQKA 3OKAA 3KWLA 3NUGA 4XPIA 3LH5A 3MBOA 1SUBA 1VPVA 1QCCA 2Y0EA 1BHQ1 3HDJA 5H4HA 2ZM5A 1HNXB 1N2SA 5I9TA 1FL9A 4NI5A 5HTKA 1C1XB 4HX5A 4OO3A 5I51A 1RKQA 5B7GA 1AH2A 3L0OA 3MS2A 4CE6A 4B3TB 3PDUA 4P08A 4P7BA 1IPEA 2FPIB 2BMDA 2ID4A 3L6UA 1PQWA 5JZMA 2YOHA 1T5HX 2VH5R 2XKJE 4HLUA 1PZGA 4OBBA 4IY1A 3MLBA 5AKEA 1AF7A 4HNGA 4NJOA 4BOYA 1PX2A 3DEZA 2GBGA 1FYWA 4XIIA 2PMEA 4JU8A 2OC4A 4YCAA 4CF6A 2COUA 1OX4B 2FUG1 3V7NA 5BVGA 4KIFA 4FW8A 1GCUA 1C0EA 1PJSA 4DBVO 4DLSA 1D0SA 3WGLA 3LLSA 3O2SB 1ECBA 1VMKA 2FF5A 4OVKA 3RUDA 4POAA 3MJSA 4JI8B 4JUCA 3UHAA 3FE2A 3CU5A 3KR9A 4FNMA 1AKRA 1NHWA 3E61A 5IKOA 1M1ZA 3ZWVA 4ZTBA 2APJA 2P6MA 3AIOA 1TNDA 3MFQA 1GXSB 3IQZA 3R7WA 4CT5A 2YXBA 1GN9A 5AHRA 2WMYA 3HI4A 1UBMS 2C8VA 3IVMA 3H7IA 4YJDA 3ZVLA 1K6EA 4CQLB 4Y9TA 1J42A 2YFKA 3WJ2A 4RNCA 2HAEA 3RRNA 4B87A 2H1RA 3BFVA 3T4PA 2Q29A 1M66A 4UEQA 5D8DA 2GFQA 1XTRA 1FP6A 1KA9H 4LK2A 4F96A 4N6GA 4Z1MD 4FYXA 1YBVA 1JFTA 1T9HA 4JS0A 4HB2A 4PX9A 1YOVB 2E1RA 4OFXA 1E2EA 2QE6A 4TRJA 4EHKA 4WN3A 5SZHB 1KY3A 3KT8A 2ODWA 2QB5A 1BVUA 2W98A 1H0HA 4JGGA 4QG7A 3R3YA 3TFQA 4A0QA 5LZ9A 4QQRA 3LA8A 4M60A 5J5AA 5L45A 1GTMA 1W9HA 2GCGA 4AZWA 4EY8A 2WDZA 2JAUA 3G5TA 4HDRB 1NW3A 4OB7A 1SRRA 4TROA 5ELXA 1FJGB 1QK5A 3AUUA 2YASA 4C3OB 2GZ1A 1QWOA 1ZJ5A 3OQMA 2ZIEA 4B3RB 3AINA 1DMSA 1QVAA 3V4VB 2PXCA 2XKBA 2V58A 4CTKA 1TB4A 1RJWA 1WDKA 2VAPA 2A1UB 3Q0EA 1PTKA 1HFJA 5T6MA 5JJKA 1YTLA 4K2AA 1SC6A 4L78A 4C5CA 4KAXA 1O97D 2IPNA 4Y0NA 1YZQA 2GPYA 4GE3A 3K9GA 1LCIA 2OO5C 1V48A 2HZ7A 1JA1A 2VJMB 2JVJA 1L4BA 1QJ4A 2XODA 3CPHA 2J31A 3H4IA 3ZJVA 1QRTA 3TR5A 3UXYA 4W8OA 2CBGA 4W9MC 5LMNB 3DF9A 3ZHYA 3ZXSA 2IOFK 2FG5A 3GNTA 1DQZA 4OP2A 1QHEA 4URYR 1A9RA 2OHIA 4NZYA 3BTVA 5E2BA 1ADCA 4IL5A 3S0JA 1WULS 3IV9A 4ZQIA 4LV5B 2SKEA 2EOAA 1T10A 3CW8X 7REQA 1NATA 5ETJA 3ZHSA 1XPUA 4MYRA 2I2WA 4G36A 5CVUA 1FYFA 3VMFA 3JQPA 5A5GA 2HXGA 1JMKC 2FWRA 2D2IA 4ZOCA 1R7RA 4GSYA 4EA7A 9ABPA 1H2HA 2QNIA 1B1CA 1YF3A 3VNAA 1WQ4A 5G0UA 4JYCA 3LD9A 3LQFA 1SVUA 5THKA 2B36A 4HMQA 1LNQA 3O2QB 3AEUB 1VCHA 5C1DA 2A84A 5FHRA 4FB5A 1YVPA 1XZNA 1GQOA 5EXXA 3LS2A 5DXFA 1CQZA 3FDZA 3KVNA 3WK9A 4PZYA 1CTQA 5K6TA 2GMWA 3ABRB 3GFFA 4AJ2A 4Q1EA 4ALJA 4BAUA 3ZWOA 1DWQA 2VDMB 3PX7A 1GZHB 1RQRA 3LUDA 5IN4A 1ZN7A 4BO9A 5A62A 4ILEA 5JSUA 3AEQB 1KQGA 2HEIA 3AF0A 1HMYA 1JWAB 1QHNA 3KJEA 4RE5A 4JBHA 1SCBA 4A6XA 1NVKA 1O9HA 2QVXX 4BNZA 3BJEA 4DA7A 3G9XA 4R1MA 1FMJA 2DGDA 3LFTA 4IGEA 3S44A 2AFVA 1KMHA 1V8OA 4CDRA 1XIVA 3JALB 4TSFD 1RJEA 2VDRB 2VFAA 1XQWA 2J7PA 3T7SA 1QGUB 4JX8A 4J0JA 1R0YA 5H59A 5JLJA 3P9RA 4MPTA 5ALRA 7MHTA 2WU0A 2GX6A 4LTDA 5KNDH 2ZROA 3ZXXA 4YNBA 2HDOA 1I13A 3F6CA 2VC2B 3P7MA 1IY2A 1LA2A 2IV3A 3ASVA 3GBSA 3EA4A 4QJBA 5TQ0B 2MINA 1GPAA 3L6BA 5KB3A 1R3DA 5DM0A 5C31A 2FPLA 3WAJA 4UCQA 3ZBUA 3B8EA 4FE7A 5KYWB 1Z5VA 4A36A 1EK2A 1EUCA 2A9RA 2ZI4A 3N2GB 4P36A 5JRDS 3UAYA 3G9ZA 4FE4A 2CLCX 3RIYA 5HZKA 4JOSA 5SV2A 3FNQA 1WHTB 4UNIA 5EWLA 1JSLA 3I0NA 3IDSA 3L6RA 1C50A 1A72A 1IG3A 1KH1A 4JC5A 4CRWB 3EVEA 4YK7A 4AFNA 1RQXA 3CS3A 1FSGA 2ZSHA 3D1VA 4L8VA 1XMVA 4WNIA 4DIFA 2JKZA 4LN1A 2W2PA 3O4VA 2D5CA 4MS4B 2J3DA 2PO7A 4HGRA 1T8PA 2ZSEA 2EGHA 4ZOBA 2AUNA 4X1OA 4BVFA 2OB1A 5HBGA 1P0QA 4ZT6A 1KIMA 2OBXA 2PYZA 2WHXA 4BNKA 4DR6B 4B4KA 3RROA 4EUSA 3DOOA 3U4CA 1N32B 5C5EA 1X14A 1NA5A 2YJZA 1PJ2A 3RSCA 3UG6A 2ZB3A 1BKDR 4AKIA 1NURA 3JQEA 3KIPA 3KO8A 3WTBA 2G9UA 4E70A 2QUKA 2MSNA 5C52B 3KB8A 3OUUA 1YDMA 2GK6A 1R5OA 4AMBA 3E4DA 4YUXA 1O9GA 2BI8A 2P3QA 1K97A 1L5OA 2A7XA 5J2UF 4MUAA 3M6UA 3RODA 4F9GA 1EZ4A 5D3KA 3HRIA 3FM9A 4CF5A 2H4HA 4EP1A 3IT2A 4MXDA 5F98A 5DHRA 1GM5A 2B3DA 4M9SA 3FYCA 5B5SA 1SXJD 1ZGBA 1ZX1A 5CM8B 3WYFA 1RYYA 3MD0A 2VT2A 4RLSA 4WDRA 5FBWB 4YEDA 5AK4A 5L4LA 2A5GA 1SIBE 2PQ2A 4YLGA 1GNTA 3G59A 3GRUA 3EEFA 4FGUA 5H3LA 1ZMTA 3SOZA 4MSUA 2Q45A 4CIAA 4BN0A 3VNUA 1W4BA 4WWHA 3UK1A 3D8UA 3V4ZA 2VVTA 4W5WA 4AJIA 1LH0A 1E58A 1JLHA 2V9ZA 2A57A 4IQGA 4QUHA 2V3WA 2LE0A 3TW4A 4D80A 5IJ0A 2O2XA 4K9QA 1NBEA 1ZONA 1IHYA 4O4HA 3MGBA 4P5DA 1OH8A 1I94B 1Q77A 2C9ZA 4FBMA 5C7OO 5LPNA 2A0XA 4UKDA 1M2VA 4G56A 4U8GA 1KYZA 1T9DA 1M6WA 1AT1A 5F78A 5K0EA 1AB5A 4BNJA 4K40A 4N41A 3HJCA 3K3PA 2NIPA 1E63A 1RT9A 4NEGA 1CRZA 4OIFA 5GGXA 3VX4A 5EWJA 3B6IA 1O54A 3PXXA 3H5IA 4QPNA 1Z12A 3DDHA 3H5VA 3MEQA 1V5EA 3QFCA 4AZSA 4G81A 3E1SA 221PA 1Y8RB 1H3FA 1OSNA 1PJTA 1PR5A 3B12A 1G2IA 1EDDA 1B93A 3DUWA 2XDWA 4DV2B 2PGAA 4LKOA 5ERYA 4S04A 3CH6A 3FYUA 2ZJ6A 5BN1A 5AVOA 1IVNA 1G21A 3KVRA 1VPLA 2O7VA 2J0SA 1RWXA 4LECA 1A9PA 2Q41A 4K9OA 4IILA 4ENTA 2BUAA 3EWSA 1B6TA 2QMOA 5H3CA 4NHEA 3CLSC 3KQHA 2O06A 4DLVA 1T5LA 1YA8A 1JSRA 4G5XA 4LYFA 4KAFA 3N2KA 5F73A 2IY9A 5FUVA 3W8FA 3G7UA 2R44A 3JQFA 4HXGA 2P5UA 2HUPA 1Y4UA 2XZPA 2X2EA 2QOEA 3DZJA 4CKWA 3GFOA 3K16A 1T3HA 5LZ4A 1AKQA 1P9OA 1JQ5A 1TQ6A 1QRSA 4EF5A 2X1HA 4PAQA 1AV7A 2KQUA 3A11A 2KMLA 4KXVA 3STTA 5A0TA 2WI8A 4C1BA 2V7VA 4DLBA 3T9BA 4F12A 2WJPA 3NIDB 3OFSA 4KO3S 5SZKB 2ISSD 121PA 2WP0A 4PRLA 1L4MA 4PX2A 4IIJA 4AYWA 4UTRA 1IU9A 1MFPA 2W6ID 4PO9A 3NHMA 1CDZA 3BL8A 2E5LB 4B34A 1D0VA 3DPSA 3FUWA 3H11B 3OZIA 3EPJA 4L6IA 1SZJG 1B3BA 3KOMA 2RHLA 4IM7A 4HWPA 4TSKA 1F38A 2ZAGA 2JJ2D 5TMBA 4O2AA 3V4FA 5LDDC 1KZYC 1OFVA 3GRZA 5D1HA 4TQUS 1D2HA 4KR6A 3O8OB 1TK3A 4OHFA 4DPMA 5KNCA 3V32A 4DZRA 2PUBA 5LQKA 4I4TF 1UFKA 1QS0B 1YT5A 4LJ5A 4Y30A 4J1TC 2EVWX 4RVUA 3EXG1 1HOTA 5JQWA 5LNK1 3B82A 2O05A 4IUCS 4EL0A 4N65A 1KEEA 4A6PA 4B7UA 4MWCA 1ZD8A 2G1AA 3HJNA 4ZZ2A 1NJ6A 4AKGA 2I55A 5LR6A 4UBNA 1TJPB 5UKDA 4MUXA 2XV1A 3EVTA 1WY7A 3HWX1 3QE2A 4OGFA 4X63A 1JZQA 4FJ1A 4D3DA 1FW8A 4BPBA 5BP7A 4YQFA 2RGEA 3GLHA 3K9QO 1Y48E 3PJFA 1DG9A 5BV8A 4RVSA 1KZ6A 2DHCA 2AN1A 1N2ZA 2RGGA 1KQPA 2J41A 4N3CA 3LP8A 4RORA 1U7WA 3TPZA 4URZR 4BLQA 1EQ2A 1OKKA 4OOFA 3CLRC 2V7WA 5F5XA 1LB1B 4RLFA 1DDOA 5SYNA 3I1YA 4TV9B 5PGMA 4BMYA 4LV6A 4IS3A 4PC3A 4K28A 3T3MB 4XEUA 2TMGA 2PWYA 4NFLA 3CT4A 2EZUA 3HJRA 3LPDA 1J24A 4FFDA 4RF5A 2CY0A 1L7VC 4C30A 1IHXA 5L53A 2WPDA 5JJBA 3KSZO 2ECKA 4ZD6A 1AGXA 4QDXA 4ZYXA 2HDWA 2XMDA 1GNRA 1O4WA 1JHPA 1SZPA 3E0QA 1H0SA 3AUKA 3F46A 3OIYA 4R3NA 5EMMA 3OZDA 1NI3A 2I6XA 1OFGA 1M54A 1FQWA 4TLCA 3EXG2 3I45A 3IYLW 1A77A 1GU1A 4YB8A 5K0NA 3RTCA 4CCAA 4HRVA 2GLTA 4AY3A 3SPXA 4MPRA 1B16A 1E0JA 1ZISA 3BMQB 3F6SA 4MYTA 2OHVA 3C7TA 3D8BA 3PXDA 2WFAA 4RELA 4CKZA 2J7KA 1ECCA 4NJMB 1P5RA 2J0UA 4S05A 2FPOA 1TADA 3FRHA 5LLSA 2FSVA 4MVJI 2VDNB 2WMNB 3DMDA 5JZVA 3O4GA 3DHVA 2FWPA 3ZHUA 2DUMA 3D7LA 4CMIB 1FP7A 3Q72A 2ZYIA 5GV8A 4K1LA 1HE2A 1KRWA 2QR2A 2C4WA 4XIYA 2DPHA 4LJAA 2O5CA 1F2TA 2ZYAA 3NC1C 2X76A 4C2AA 1FFSA 5FOUA 1GARA 1QUFA 1UJCA 3ABQB 4MYCA 4EYQA 4DDHA 4JLBA 4HMOA 3U4GA 1KQOA 3GT0A 3SXUB 4MZXA 1Q12A 3R3XA 2D5BA 2GYYA 3T7JA 2VAVA 3VPBA 1RADA 4TYYA 1XL0A 4K0RA 2GYWA 5BRAA 1T2NA 1RYNA 5FAKA 1HRKA 1RP7A 2QL9A 1GKIA 2SICE 1OR8A 2V6JA 1ADBA 3DMPA 3IUYA 3C6QA 1ESCA 3PTLA 5E8JA 3KAQA 4Q48A 5B2ZA 4AJ9A 3DEHA 2OBBA 1NF8A 5FWXA 3TQQA 1WU8A 4Y2VA 2PVCA 5EIAA 5EIHA 3EUEA 3NOXA 1AKNA 1KMQA 3OHSX 4AJOA 2PFGA 4FOPA 1EAMA 2QVZX 2QT1A 1HFKA 2AOUB 1O3YA 1SVLA 1NXVA 4IIFA 4RHTA 2KS6A 5F5NA 4N6OA 1EXDA 3M4JA 3D02A 1YRHA 1YB6A 4XD7A 4PG8A 3IP7A 1LDYA 1CS0A 2I1VB 3I76A 3OTWA 4RGYA 5HWSA 3QLTA 4TMXA 1OI4A 2ZWIA 1XWIA 2ZDHA 1G38A 3L46A 1JHXA 3F8TA 3QA3E 1XXLA 2FMIA 2V96A 1RJ9A 1FDRA 2GZRA 3DNFA 3GH1A 3MRVA 3R6LA 5ILQA 3Q7QA 4Q9NA 2ZRJA 4J29A 3GT3A 3VR6A 5DTIA 2QA5A 4XW2A 3HA3A 5IJ0B 2QTTA 2XOEA 1GRRA 5CA1B 1ZNQO 2P9BA 4HBZA 4QUBA 1RQ2A 2ID9A 2XOKD 3VR5A 1BDMA 2WWRA 1TVKB 4RL6A 2X9QA 3OLQA 4LE1A 4LWZA 3HFGA 2VCHA 5JWOA 4JR2A 4X44A 3ERCA 2I62A 4LHSA 4EGJA 4QLAA 4BO1A 5IZCC 1SUAA 2JFWA 4RZUA 3SEAA 3L93A 4V0MA 2RCNA 2Y05A 4KRFA 1RLMA 3JY6A 1O03A 3P9XA 2PX5A 1RSZA 2O5VA 4FT2A 1RM3A 1GA1A 2FQ1A 3TTWA 1G55A 3U49A 4ARBA 3H6GA 4MVXA 1RJFA 1TMYA 3DDZX 3DE1X 5IC4A 1RXEA 5HE8A 1E1RD 1RPNA 2P0EA 3AF3A 4UD6A 4CLDA 2ORVA 2J9YB 4FI3F 4Y1GA 4V0KA 3WTCA 3RADC 1L9KA 1Z5PA 3SR3A 4TXMA 3HKBB 4LZNA 1FJ2A 3K1TA 3TOVA 1FTSA 3U4QB 5CXSA 4B6QA 4R8KA 2CV2A 3K0CA 1C7JA 1SEPA 4DJFC 1JEDA 2A5YB 1OILA 2HPAA 1A8UA 3F0TA 1UDWA 3L4BA 2IC5A 1NN1A 2A2ZA 3QOFA 1E89A 2RKBA 3LC2O 2V8OA 2DQYA 3LUBA 4HQ6A 2FPMA 1P2TA 3AESB 3LXXA 3SZ3A 2VPPA 2OSBA 3H3FA 4YAJA 2LTAA 1YBMA 3OFVA 1P1BA 1NVTA 4WKGA 2WAMA 2P75A 2I8AA 2VBFA 4PSVA 4F8EA 4EHJA 4ZMBA 3OP1A 3L40A 4CWAA 2H5JA 3GJ7A 3LKBA 1WB6A 3O3MB 2G70A 1NYQA 1TU3A 3PTZA 5DSZA 1FDVA 1B41A 3OPVA 1G7RA 2I8LA 3P0JA 1BE6A 1YB4A 3UM9A 4ZTZB 3VPSA 2ASEA 2OGZA 2PGDA 2IP4A 2XA2A 5T67A 1YI1A 3PXBA 2WD7B 2YRXA 4HPWA 2P3OA 3PF9A 3CH5A 5EQFA 3S1LA 1P6XA 3DV9A 4GZLA 2FMKA 3N07A 2R6R1 1NJ1A 3QUSA 3ROZA 4ITUA 1KAHA 1T0HB 1U0GA 4EARA 3NFYA 2O2CA 1C7EA 5BSWA 3C8DA 3ZC3A 4DSUA 4DLNA 3TUIC 3WLSA 1SQ0A 1TI7A 1K86A 3TTXA 3K53A 5EG5A 3EGDA 1XPOA 2ZRHA 2GEJA 4LZOA 1W4LA 1JQBA 3WGQA 1N0HA 5KS2A 3RQSA 2FA9A 2FSIA 5TB5A 3PGXA 1P1HA 3W3AA 4HLUC 2WQ7A 4KRGA 3OZAA 4I19A 3ZBTA 4TRRA 1AJEA 4QVKA 3WB9A 5AD1A 4XIJA 1NTRA 1M73E 1COZA 4AKSA 2BE9A 3H87A 2HNKA 2ZIZA 3TLEA 4HNUA 3DUFB 3U37A 4Q15A 4MCJA 2BR4A 3QELA 3T3OA 1K8QA 2WIKA 2PJZA 1SKUA 4C14A 2DETA 4MUHA 1VKHA 4MUNA 4WUVA 3NXKA 2H3EA 3EDYA 4B79A 3TDMA 2J0EA 1CJTC 2VF7A 4GG1A 5JE8A 3AKEA 2YVKA 3D6NB 1NXTA 2VKTA 4K9SA 1YB1A 1TE2A 2WV7A 3GOQA 3CF2A 4QBHA 2O8DA 1NIJA 1E79A 1SWVA 3K20A 3UMFA 3U3MA 2WDPA 4KLAA 1KH3A 1RCFA 1W88B 1TJNA 2ZTSA 3CLKA 3FJYA 4WY8A 4AN4A 1DVRA 1QQ5A 3ET4A 4OAPA 3ETEA 1JYSA 3TSZA 1BCSA 4NNJA 2GI4A 1EAYA 3I9JA 3ZK7A 1OX5A 1Y1SA 2FFHA 2J8ZA 3H05A 5DP1A 4X20A 2PH7A 3ZY4A 1ULSA 1XKTA 3NHKA 1GY8A 5KVQA 1T13A 2G1PA 4IRXA 1SCDA 3CSUA 3GRPA 3WRWA 4BJHB 1UK9A 1XVIA 2Z1MA 1MA3A 5BN3A 1VLVA 1WW2A 3G1WA 3MPOA 1YVUA 5CFQA 2VNHA 1QHHB 5D00A 1ZNXA 5FBZA 5I7FA 1JH9A 1T5TA 4HMPA 1K8YB 3CUWA 3ISJA 4B7AA 5TEVA 4PSAA 3UK7A 3V8PA 4CG1A 4KSYA 1O5TA 1E3LA 1NQXA 4DQXA 3Q9NA 5ITSA 1QIGA 5AQ1A 1PT9A 2WSSD 3KJFA 3KVYA 1TYCA 1E7YA 4PLFA 2JIMA 1WWKA 1DS6A 1GCIA 5F21A 2C7QA 2ESRA 3ZI4A 2VRCD 3MHPA 2HLPA 1CNEA 2BH2A 4BP1A 2CWWA 2JJQA 1KYYA 4WNCA 1TT7A 2BUCA 2A1IA 3V2UA 721PA 3IO3A 1QSGA 4X65B 2VHYA 1B74A 1ZINA 3LDAA 4DBZA 1XRJA 5JNVA 1M67A 2AHOA 2QS9A 2RE8A 2VP9A 3JX9A 2JIPA 2ODAA 3LQ4A 3V2GA 2OOSA 3AL3A 4CU2A 4P93A 3TOXA 4BQRA 2FI1A 2X1MA 4ID3A 4MAFA 3VZDA 7MDHA 3I04M 3D81A 1XAHA 2H2AA 3QKRA 3JZDA 4WOJA 5AM2A 3CZRA 3LQ2A 3MT7A 2R8EA 2Q5QA 5HKOA 2RKWA 1DCFA 4WSOA 2BFOA 4JXZA 3AVVA 3I9V1 4EG7A 3TSYA 5KOYA 3T4UA 4I7EA 2GLUA 2OA0A 3GQVA 1G16A 3EZXA 5FORA 1VHLA 1TX4B 4ZHSA 2CLEB 5CXQA 1OLOA 2MOKA 1HMPA 3T7EA 4B74A 1T1SA 2EZTA 5A02A 1ORRA 1P0CA 1XTPA 4RPCA 2PD4A 1PS0A 4P4SB 2Y93A 2ZPAA 1XZLA 4UQPA 4A0RA 2YHUA 3Q0TA 3RVSA 3JVIA 3SY8A 2ZUDA 1UT5A 4JVLA 3WGZA 3UXEA 1QTNA 3N3AC 4F4HA 1ZNZA 2YIVX 2RJ3A 3V4SA 1KQFA 3DAYA 4R31A 4DNQA 5A6SA 2I34A 2C00A 2P6PA 4H7KA 4K8OA 3UFBA 2IX3A 2VF5X 1BE1A 3UMCA 4KWCA 4LOKA 2EP8A 1W5BA 2OCAA 2HLDD 3AEKB 4A8HA 5A03A 4RKEA 4FB4A 1N34B 3JQDA 1BGVA 2H7CA 4DDTA 5IYZB 4Z4FA 2DCUA 2WTUA 5GZ1A 4YJ2A 1VPDA 1BN6A 2ZIWB 1JDNA 3MIZA 4RK4A 5JT1A 2AVNA 4LWQA 5LD2C 1HM5A 2E5WA 3LGAA 4NP6A 2D3TA 5EMHA 2F6RA 3HNRA 3R3SA 1TEXA 5KYKA 3ZVKA 1V96A 3HDGA 2AXQA 2H2FA 4F3KA 3CEMA 4I4LA 4KDRA 4A3SA 5AW8A 4MW7A 2Q7DA 1N3LA 4RQUA 5KX5F 5CVCA 2I2AA 2LD4A 3IXMA 5M5BA 1JJBA 2WHPA 4Q3DA 1KDPA 4HDSB 4Y98A 3X44A 2Z9BA 2G9QA 1SBZA 1RI4A 1ZD5A 3QUQA 1U5AA 4FQ7A 3RKRA 4BKMA 4DEXA 2XXAB 1MLDA 1TA9A 1ZIPA 2A78A 3AEYA 4X97A 1HQYE 2FHSA 5EMJA 2ZU0C 4OXKA 1G0OA 4C0HA 1SXQA 1E0KA 2UV8A 4YRGA 5CDFE 4RM3A 1JFFB 2Y66A 3SR4A 1U0NA 2ZSIA 3EIFA 4H6WA 1UBGA 5AI9A 4IDNA 4M1QA 5HMMA 3W5SA 2W5UA 4N7BA 3M8KA 1DC6A 4Q12A 4QC2A 3U61B 4L0QA 5D87A 1RHMA 3RHZA 5JCPA 3S2EA 4N5LA 1B8VA 1R0SA 1MABA 3LUHA 1NHGA 1RKBA 1W35A 5PNTA 2GILA 4JKIA 1XZBA 5HF9A 4HWSA 5LA6F 1R6TA 1KKLA 1XNGA 2BMWA 1C7ZA 4YDSA 3THYA 5H02A 4N3BA 5EINA 4V0NA 1TUBB 4PBRA 3JQAB 4B7XA 5IJZA 2HO5A 2EX0A 1IHDA 3T9DA 2I2DA 3CRVA 4YI5A 1D2AA 4IFEA 2N75A 1GADO 1NUUA 1KKUA 3PD0A 2RH5A 2QM8A 4L3VA 1E2GA 1H69A 2JGRA 2HFKA 2GXAA 4QHYA 1VLZA 1XEXA 4PIPA 4PU0A 4UOQA 5HRCA 5DHAA 3WWCA 1XTQA 3B6ZA 3BWMA 1A8SA 1FBTA 2CWDA 2ATVA 2Y3IA 2PWZA 3VAYA 3UK2A 3CPJB 4X00A 4UVEA 4C6RA 1KQNA 5IFKA 1M1YB 2RHRA 4L8WB 1Z62A 1FVHA 1EH5A 1L7DA 2BDTA 2NYAA 2WJYA 1JE0A 4PRKA 2PZ8A 1ZW6A 4K46A 4YT5A 1LS6A 4M49A 2NU7B 3LWZA 4CF7A 2RGCA 2HFJA 2ZJFA 3BHJA 5KKNB 4BASA 4B84A 5TJHA 1SXGA 2QN9A 2RHWA 2ZLBA 4IDOA 1N6KA 3F47A 1JSXA 4RL4A 3WX0A 3G2LA 4R81A 2Q4DA 5TQJA 4KW7A 1Q14A 4A4DA 4NU5A 4DAEA 3PLNA 3U26A 1A9ZA 2O8FB 3QBEA 2AHRA 2RHGB 4CKEB 1K92A 2XMCA 5KYYA 2FZEA 1LDGA 2GJ4A 3FKSA 1JIKA 1ZJ4A 1N77A 1XQVA 2VP6A 1JR3A 1IZZA 2FEXA 1V6CA 2H57A 2VPTA 3CF6R 3S1AB 4MLDA 2WVGA 5ALVA 3NTVA 5ALPA 3RIMA 2ZEJA 1GTJ1 1AIPA 1GUDA 4YQYA 3VYWA 4C0QC 4LY0A 1C30A 5IM4F 2O8CB 3LFUA 4HNAB 2BTQA 1V11A 2W2KB 4MIKA 1OHHD 1U0HC 4GMFA 3PHLA 4G5YA 4OJNA 2IEYA 5ALZA 2IPOA 4HH1A 4BNDA 4CDMA 1A71A 5CA0F 4D3SA 3FMPB 4NMMA 4JI4B 3H2YA 1TVEA 4AK9A 3JZMA 2IYNA 1JHAA 1J1IA 4G9EA 1YHZA 2K6GA 1CBUA 3EZ7A 3OUTA 5HJEA 2EP5A 3WY9A 4ZVNA 4QJ3A 1MD9A 4L8GA 3UPTA 3ES9A 2AJBA 4XFKA 1CERA 5ER6A 3RSLA 3G68A 5K1ZA 4AQDA 2QN7A 4MB0A 4D4HA 3FF4A 4DMRA 1AD2A 2A0KA 2ZK7A 1B1AA 3EA5A 3F9IA 3HBAA 4UHFA 3ROTA 1ZSYA 1WMSA 2XB9A 3MCWA 4XX0B 3WLKX 4RHYA 4D9JA 3DVAB 5BQFA 3QVWA 1JEJA 4CPDA 1JDJA 5EUCA 1USKA 3HFSA 2FZCA 1K63A 3VZRA 5A9RA 1II9A 4N1AA 3LIIA 3HFJA 4GKVA 4Q00A 2FX2A 3WZ2A 3EJWA 2PUJA 1D07A 4V39A 1N5KA 1UR5A 1KSGA 2A67A 4MHTA 4WQMA 4M9QA 4NZNA 1OZFA 3GW8A 3TM4A 5FFFA 1OWPA 3ETJA 3QU5A 4S0ZA 4B3CA 4XTCS 1WMAA 2NPIA 1SVIA 4GKBA 3A05A 4NEHB 2EFGA 3K0AA 2JIZD 3JU3A 2PRZA 3QFTA 1Z2OX 3WQSB 1MPXA 4MHOA 1BIFA 3A4LA 3JQFC 2ETXA 3QV1A 2CXQA 5AUQA 1U7XA 4P2GA 2PL1A 1GG9A 4OM8A 2ZCUA 3IE0A 3A6HA 4UVDA 821PA 1ULZA 3I4FA 3O4HA 1D6JA 3AFMA 1M6NA 4CEIB 3AVUA 1R0ZA 3D6AA 5BPFA 1NOIA 1W0CA 2OZKA 4UMFA 5CK5A 2L17A 5LOVA 3EEQA 3T3DA 2C88A 3CZ4A 3TG2A 3LYUA 2J3JA 3UBTA 3TQRA 4L8LA 2Z6UA 3VX3A 1FRFS 2PU7A 4BZQA 3ZWMA 4ETWA 4YLYA 4HRAA 5LU9A 1EUZA 5DE3A 1WCIA 4CEHB 5KWSA 3TTSA 3WICA 1CUWA 2YFQA 3O03A 2H18A 4B4VA 3QEJA 4QOHA 3FUXA 4IF6A 1WX1A 3U3JA 1N1GA 3QEAZ 4PIVA 4TRNA 2Y1GA 4ND4A 4A23A 5LU8A 5DMXA 1R4ZA 4HPXB 3UKDA 4DYDA 1LPAB 2B99A 2CHQA 4JC8A 5EKSA 1P8AA 3ZY2A 2Y27A 4KV7A 4QM6A 4H7PA 4U7FA 1EA5A 5U4QA 4HYEA 2CHVA 1S96A 1O94D 1XPJA 3GWZA 4OHCA 5EFZA 3VR5H 1CW2B 2WYUA 4NMXB 1DEKA 1HYBA 4MLZA 1K6XA 2ZBVA 5DNEA 5HRUA 2BEJA 2HJVA 3QVLA 3EFOA 1IOWA 2MMGA 2R7AA 3JQ7B 2XF8A 1G2OA 1PD0A 3LCCA 3LCVB 3MUEA 2E3JA 3GVPA 4GOND 2RONA 5C4GB 1GZ3A 5HXAA 2V6BA 4YO7A 3PDHA 4EFKA 4EHFA 5GM1A 1QPBA 4C0AC 1ID8A 1L5KA 1YAJA 3R3JA 4S2EA