1DVRA

Structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
SSESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase (phosphotransferase)
total genus 70
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dvrA00
821PA 2NGRA 3QOFA 1G7CA 1PVOA 1NJFA 3FWYA 1KAGA 1T3LA 1GNPA 5B58C 4EIWA 2FH5B 1IM2A 2ZVPX 3NWJA 3AKCA 3SQWA 5BN4A 5HZKA 1EX6A 1GNQA 1N0VC 2WKRA 3P32A 5CK4A 4FINA 1P2VA 1EFHA 2J0UA 1G7RA 3K9GA 4XWKA 2ERYA 4AG5A 4LRWA 4JYCA 5TMPA 1R0YA 1XMIA 5JJKA 1ZUNB 5EJEA 1ZJ6A 3B8HA 5DE3A 5AK0A 3GPLA 5KSOA 1KSJA 3PXGA 4ZIRA 3FKSD 4O2LA 4C30A 4Q7KA 2GEVA 1E2LA 1KAOA 5DI3B 1W47A 4G5GA 1BMFD 1GL7A 3W90A 2XSZA 2HF9A 2RGDA 3QJYA 1II8A 1G8HA 2ZXUA 3B2EA 4ZCLA 1M7BA 1P3JA 4D81A 5C1BA 5KYKA 5FL7A 2F1IA 3HR8A 4DCVA 4ZI3A 4DZZA 1CRQA 3GEHA 5FBVB 1W46A 2G77B 4EPXA 2IXEA 2EWVA 2Q21A 1HV8A 3X1ZA 4OI4A 2IYVA 4XSHA 3W34A 4U7DA 1SULA 2AK3A 4US0R 5GJWC 3FHCB 1HT1E 2N46A 4DT1B 2ZJ2A 3LAWA 1UJ2A 3LBNA 4II7A 2QENA 4A2WA 4KLNA 2PMKA 2EYUA 2XNDD 3J81k 1NG9A 4E22A 3R8CA 3RHFA 4RZ3A 4CW7A 1JEEA 1RRFA 2QAGC 3AUXA 4M22A 5EP1A 1P62B 3EG5A 3QXSA 1OXSC 3KJGA 1HURA 2IK8A 3EIQA 1Z6TA 1XD2B 3ZH9B 5FH9A 2AL7A 3X1WA 3C5HA 5JZVA 2FFAA 3TVDA 4KV9A 4MKIA 1W4RA 2P2LA 4BLTA 2QPTA 4M1MA 1L4YA 4XWOA 4C0KA 1HYQA 4NYIR 4WVFA 1J70A 4JLNA 3VR6A 1TEXA 4FCVA 4ZCMA 121PA 5AUPB 3IKJA 1OXUA 4XVRA 2ZVQX 3DL0A 4D82A 5HKKA 2NQ2C 2CJWA 4IOLA 2LKCA 3HWSA 4TTPA 1G5TA 5JEDA 3R9IA 1D2NA 3W5IA 1KO8A 3I62A 4OHZA 4KFRA 1MO6A 3W9YA 1KNXA 1PUJA 2R44A 3GLHA 4B76A 3MJHA 2OG2A 3U2QA 4XH9B 2GETA 4LYJA 5KOYA 1CJTC 3C4JA 2BMEA 1AJEA 4GOKA 2IA5A 3E1SA 3QEJA 3EPHA 1NVWQ 3KZ1E 2A5FA 3A36A 1SQ5A 3KFVA 5DYIA 4JKIA 4PSKA 5JWRA 5JWOA 2CE7A 4E5UA 3K9HA 4LHZA 3VNVA 3RWMB 5K8TA 3GLHE 5BWMA 4BFVA 1KDPA 5LD2B 1G4UR 2X77A 2OE2A 1Z22A 4I81A 4DXAA 2O8FA 5BYKA 1W36B 1UFQA 1TL7C 1SKYE 3SHWA 1ZM9A 3MUFA 3I5YA 1ZM3A 4G5QA 4ZI2A 1VMAA 5JCPA 2R6GA 1DAKA 3UKDA 4R71A 3CKLA 2TMKA 4OQXA 2D2EA 2E9SA 3B5JA 1T6NA 2NG1A 4ZCIA 3HPRA 4IDNA 4D2IA 5L3RA 2H1LA 2VIIA 2H7VA 2YJTD 3K53A 4JBXA 4Q1AA 1QBKC 2JDID 1NBMD 3PUYA 5AJWA 4C0LA 1VDZA 5KTYA 4HZIA 4Z8XA 5E7IA 3BORA 4P4TA 4QHYA 3SS8A 4D6PA 3D7MA 3NXSA 2J0QA 1NP6A 1CR2A 3K0AB 2ZTSA 2VA8A 3NBFA 4IKEA 2J3EA 1GITA 4EFLA 3N2EA 2I1QA 4GP6A 1C1YA 2ODEA 2VP6A 4LYFA 1RYHA 2FMXA 3BH7A 1IJFA 1ELOA 2GCOB 2YOGA 4ZPXA 4B75A 1X1SA 4LV6A 2VRWA 4DB2A 2JGNA 1IJEA 1EG7A 1AQYA 3PUZA 3OHMA 3AGPA 4O25A 2ZETA 3AP2A 3MGCA 3NKVA 3OIWA 4KU4A 2YWGA 4R7ZA 4A2PA 1IN8A 2WTUA 2FDCA 2RGGA 1EWRA 4C4PA 2V1UA 3VKHA 1GNRA 2EFCB 4EJSB 4F91B 2DFTA 2QRZA 4BPBA 1IHUA 4JBWA 2XTMA 5L3QB 5LPNA 1XD9A 1MO3A 3CZQA 4IFBA 1EFCA 1GIAA 2AWOA 4LBVA 1IQPA 2FGJA 2A7QA 3GJ5A 5G41A 4B3BA 4AKGA 3TKLA 2CK3A 1CR1A 3RRMA 4XVUA 2HLDD 2OXRA 3OEED 2GBLA 1N3BA 4UJ5A 2ZYVX 3I61A 4B43A 1N6KA 1MO5A 4HYYA 2QP3A 3MCAA 2WJJA 5DNYB 4LUCA 4DT1A 2HT1A 4OK6A 2R6CA 4KFTA 1IOZA 5FOUA 3U44B 4D4JA 1M6NA 3WYAA 2WV9A 3I92A 4XWAA 2VP5A 4DCSA 4Q7JB 4LHYA 4A0HA 2Q3FA 2ZAOA 4B73A 4RD1A 2QP4A 1MRNA 3UWOA 4MYTA 3A6PC 4CT4B 2CMKA 3CH4B 4LJAA 2NO0A 3SBEA 3X1DA 3AQ4A 1PLLA 4US1R 2W2TA 4A1FA 3REFA 4BFZA 1U9IA 2ZYTX 3KQKA 5SZKB 1J8YF 621PA 2LKDA 4JL6A 4BEJA 3KXLA 2PEZA 3K0FB 3L8ZA 3N70A 4XTRA 4DRZA 4WA7A 4FIDA 4I1OA 4PAMA 3FPAA 2OFXA 421PA 5HPYB 5EE1A 1YR6A 4JSTA 4F7WA 3PFIA 4RVCA 3WXMA 4ABYA 2J1LA 2Z83A 3GMTA 2ANCA 2GJ8A 3ZIAD 4MGYR 3EA5A 3OAAD 1UKZA 3QKTA 2RKOA 4B44A 4QOSA 4F4CA 4KSCA 1P2UA 3H1TA 3PITA 3AB3A 3BGWA 5ANRB 4OI0A 2D62A 3NEYA 1GP2A 3IQXA 4LV8B 1KSHA 3KXIA 2IYLD 1S3SA 3Q5EA 1QHGA 4Q9LA 1G9XA 4HUQB 1YHNA 2PBRA 2WJVA 4ERNA 3AM1A 4XD7D 1AS2A 3DM9B 1JNYA 2OT3B 2WWWA 2G0TA 2ORVA 3L0PA 3LO5A 1F3OA 3LNCA 3CH5A 3DMDA 4DIDA 1TADA 1XPRA 3TAUA 1QHSA 3IPXA 5J4YA 1IY1A 5EP3A 1XPOA 2GJ9A 4NCJA 1GUAA 2QA5A 3NG1A 5KPJA 3NC1C 1AA9A 1QG4A 2ERXA 1G3RA 3C41J 3D31A 3AKEA 5JSZA 1KDOA 1U8AA 2D4HA 2XOKD 3C7KA 3GEIA 4UJ3A 5D3QA 1F6BA 1VYTA 3QF4A 3IEVA 4M9XA 3AF4A 1E2HA 3UMFA 1SVLA 3PJRA 5E4FA 4RZXA 1W48A 4NYIQ 3TSOA 5EUMA 3TK1A 1T5LA 1WRBA 2ECKA 4CEJA 1T0HB 2N42A 1ZC4A 1XZPA 2RCNA 1GSIA 3S1AB 3EWAA 3BERA 3Q5DA 2ATVA 2IW3A 1FP6A 5J4HA 1KK2A 2AK2A 2C9YA 3W8NA 2HXSA 2EW1A 2CE2X 5FBLB 4C3ZA 4HLUA 1KO5A 4GT1A 1FPMA 4A0GA 1VIAA 1OXXK 2GVZC 3HJNA 3TR5A 5A4JA 1MO4A 3PUVA 3VFDA 1LFDB 4RCZA 1XF9A 4GDFA 4L15A 3PUWA 3U3MA 4UQOA 4A8JA 1YRBA 2VP4A 3U4QB 2RH5A 4QNMA 4LJ8A 1W4AA 5DN6A 5FBWB 2H17A 2W6JD 3BXZA 4M9ZA 4TQ9A 5DIFA 4CVNA 1Z2AA 4ZO4A 1XJQA 3BD9A 4M4SA 5L3QA 5UKDA 3FKSA 3QPUA 3H84A 2OFOA 1BMFA 3NHBA 1EWQA 5CM8B 2ZRJA 3NBXX 4Z51A 3PEVA 2VO1A 1CP2A 4U00A 1QHXA 3ECCA 1KI4A 2ZJYA 2JLXA 3U3JA 1XCMA 2PT7A 2FSGA 2JJ1D 1UBGA 4JVLA 2QGZA 2JLYA 1DARA 4JZKA 1ANKA 1E2FA 4LPKA 2CHVA 5CLQA 2JLZA 4RKFA 3AVOA 2QQEA 3M6AA 3U44A 2CNWD 4DSTA 2C99A 3TAHA 3DMNA 4ACAA 4EFMA 4JVMA 1Z07A 4GMXA 2REXB 4WZBE 4LBYA 1FQKA 1P4SA 3AF0A 2Z6VA 4DWJA 1ZAKA 1KI2A 3VQTA 2OCAA 4ZDWA 2AKYA 2QMEA 2IEYA 2HCJB 1QZXA 4RFSB 5FFMA 4B2IA 3IIKA 1J7KA 2Q0HA 1CS4C 1ZVQA 1KJWA 4HDCA 3IEUA 1OB2A 4OJKA 1RRPA 4JBYA 3NHAA 1H8ED 2RGEA 1JECA 2BM0A 2J7PD 2DBYA 2D7CA 3B1WA 3KUCA 3GJ4A 2PX0A 4D4LA 5CIWA 4JLPA 1W7AA 1US8B 3KKNA 3KTAB 1AQUA 3CWZA 2ORIA 2ZS8A 2HT6A 4JLAA 2QAJA 1ZUIA 2JJ2D 4A6PA 4HZUA 4CEIB 3PIRA 1ZU4A 3T06B 5KNCA 3JVUA 4YMVA 4MITA 1N25A 2J0VA 1II9A 3SJZA 5JHHB 4C0JA 2ZSAA 4E03A 4HDQB 2OSBA 5EE9A 1SZPA 1KZ7B 2WMNB 1OIWA 1OYWA 3DKPA 4P4UA 4D0NA 2QNRA 1FUKA 5AJYA 4B71A 1OXVA 1F2UA 1XXHA 5LB2A 5CM9C 3GJ3A 4DLTA 2DCUA 1AKEA 4DDWA 2G83A 1KMHB 1P5ZB 2IUTA 2ODNA 5BYJA 1NNEA 5C46F 2J45A 4HSEA 4HUQA 3VKGA 4JLOA 5FTNA 5GJBA 5C4MA 3BWDD 1RW4A 3LWNA 5P21A 3H0KA 3ICQB 4P4SA 3T5DA 4RD0A 1G8YA 1E2IA 1OFTA 1XTRA 2QMOA 1E1QD 4AYTA 3NC0C 5KHOC 1AK2A 3CNOA 4TL6A 2ZANA 4PQFA 1XXHE 2CHGA 3DEFA 3RRZA 1G3UA 4HATA 2GXSA 2J0UB 2BVNA 3CB4A 2ZJ5A 4M9SA 2F9MA 3TW4A 1XMJA 1RRGA 1Q20A 1ZCBA 4BZXA 4LBZA 1G3QA 5H8WA 3CO5A 4TZ0A 3CX6A 5HR5A 4O0MA 3RNLA 1WE2A 4ZIRB 2XTZA 2VP9A 2CLSA 2CK3D 1II8B 1HQCA 3M4YA 5CJ2A 1NJGA 5CB8A 2KE5A 3NIBA 4FD2A 5LDDC 2JDIA 2VQSA 3U3KA 5EXTA 2QG6A 1E9RA 2GZDA 2FV8A 4UKDA 4V0OA 3V9PA 1Z0DA 1YE8A 3OFNA 2F9LA 3ZQ6A 2VHJA 2YWFA 2MMCA 4TL7A 2UVQA 1ESNA 1KI6A 5JBQA 3QENA 2HEIA 4UNSA 1AGPA 2WSSD 1IXSB 4IOKA 1UADA 2SHKA 1NRJB 3HP1A 2KI5A 4QJ3A 2R6AA 4PC1A 4M1KA 3CBQA 3K9NA 2YINC 2NPIA 2ZPTX 1X86B 3LD9A 3U4QA 4DEYA 2G1KA 5TV2A 2ASEA 1JPJA 5F9HA 2IYQA 1NF3A 1OJLA 3NBZC 2FU5C 3NEJA 5JECA 4M0LA 1Z6XA 1XJCA 1L8QA 4QBGB 4EPVA 3AUYA 1L7VC 1LVGA 3B9QA 4IVPA 3W6PA 1WMSA 4NKRA 2C04A 1Z47A 2FFBA 4LHWA 2A78A 3TNFA 4KBFA 3DVLA 3IQWA 4ESVA 1UKVY 1GL6A 3GLFB 2P6NA 2HLDA 1OIVA 2IF2A 2ORWA 2FF7A 3WYGA 1PJRA 4BGDA 1Q3HA 1DO2A 2PEYA 4XVQA 1OKKA 4HB4A 5F2EA 4DCNA 4E07A 2OCPA 3T1VA 1W44A 3ZGXA 1CLUA 1ZM7A 2X8AA 5K8IA 5DO9A 1E9BA 1UEIA 2ODBA 4PQYA 4JSYA 3GLHB 5J4VA 1KTVA 1JR3D 4LJ9A 4HAWA 2YWEA 1IXRC 3O8BA 1SKYB 4G0NA 2FZ4A 3EZFA 1NKTA 1X1RA 5AUQA 2IXGA 3VKWA 3B60A 4B2LA 1DO0A 2X19A 2X2EA 1YU9A 3DKVA 4TLDA 1UPTA 2J87A 4KI0A 1UDXA 5E7MA 1U8ZA 1WB9A 1ETUA 2O52A 1LW7A 3K9LA 1HY3A 1QHNA 2CL6X 1KK3A 2A2ZA 4C2UA 5JHGB 2QE7D 4GFDA 1PLKA 2IT1A 2YVUA 3JVVA 3N5CA 4JJZA 2V9PA 2MSCB 1AN0A 4QG7A 3EASA 2C2HA 3OZXA 3A1SA 2GVDC 2OUKA 1K8RA 3WP0A 4P3YA 1FTSA 1SVSA 1U8YA 5E3HA 2HYIC 2O8FB 2OV2A 3EAQA 1E2MA 3FE2A 4ZDJA 4EQ6B 3SJCA 1KY3A 1ESMA 2ZR9A 4IEIA 2D06A 5DGXA 1VYUA 4W5WA 1KYIA 3ZVRA 1Q22A 1QVRA 3NBYC 3P4YA 5LB4A 4MDEA 2FG5A 3AVYA 3GLIA 1HE8B 3QNUA 2YOFA 5ELXA 2IYYA 4IFEA 2IL1A 3L0OA 1G4AE 3FFAA 3MWYW 4R98A 4Q9KA 4PFSA 1L4UA 2WWXA 2QROA 1ONBA 4XD7A 1M2OB 2C8VA 2PZGA 1SVMA 4HB0A 2WOOA 3KQNA 1SVOA 2BWJA 4HLDA 2F1RA 1Q21A 3MJRA 5FBRB 4MH0R 2ZSDA 2KBEA 4EAQA 2WSMA 3AVTA 2HDNB 2V6IA 4NMMA 1N6HA 4QBFA 5J5CA 3FHOA 2KB0A 1T3SA 3GLIE 4B32A 1S9HA 5DN6D 1G16A 4PC3A 2P3SA 3TSZA 2BBOA 3U3RA 3CX7A 3EZ2A 2GF0A 3SZRA 4N1AA 1ZP6A 3TBKA 1N0WA 1N6LA 2IUUA 3WNBA 4EKDA 1TF2A 1FNMA 5DSZA 3AVWA 1KIMA 1N5IA 3SBDA 1TX4B 2XOKA 3GJXC 4V0KA 1XTKA 1KI1A 5FPKA 3OEHD 2FPLA 3GCGA 1M34E 3ZQJA 2P67A 3ADDA 4WIAA 4UNPA 1G5RA 1IXZA 4Y0AA 4Q1CA 1E0KA 1KK1A 4DSOA 4Q4JA 1NVVR 1W4BA 3QI2A 4FI3C 4I1UA 2AXNA 2H18A 2O5VA 2CL0X 1BS1A 2I3BA 1OFIA 1D2EA 5KPDA 1IN7A 1A1VA 1EFRD 1CF4A 1VHLA 1T3HA 1B0UA 1FOEB 1P9NA 4XSGA 1BIFA 4M1YA 3WMFA 3WHKA 4LJ4A 1OH6A 2R6DA 2ZU6A 2QAGA 4C7OA 4EPYA 1YJ5A 3O8RA 5J40A 2VBCA 1IONA 5EXXA 1F60A 2BC9A 3P1JA 4D25A 3GFOA 4LGMA 4Q9HA 1T9HA 2W6JA 1SXJC 2OILA 3Q3JB 3MWLA 1S1CA 1XEFA 2C96A 1XMVA 3VTKA 1BYUA 4B74A 1JXOA 3BB4A 3C15C 3UMSA 4Z1MD 3GLFA 5FPTA 3DZDA 1D5CA 1Z0KA 1S0UA 2DR3A 2JJ1A 2DPXA 1O87A 3K70B 1YR7A 2A5GA 3LA6A 1E9CA 1N5KA 3K09C 4QJ4A 2ZU0C 4BRUA 1LY1A 1Q57A 521PA 2CNWA 1G3MA 1ZCAA 1RRCA 3LDAA 1PLJA 3SYNA 2WOJA 1DAHA 2YZ2A 4B34A 3KDSE 3RRYA 2I4IA 4Z54A 5TARA 3QQ5A 3RAPR 5J4LA 4D80A 2ODWA 5FOVA 1AIPA 1RPZA 2WWGA 2QORA 3ONWA 3Q7QA 4MRVA 3GLFE 1IY2A 4K8OA 1NVUQ 2IYSA 2ZE7A 2DHRA 4H1VA 3CRQA 3GFTA 1YZGA 2ZQ5A 1OB5A 3IO5A 1H8EA 3HDTA 2ZE6A 2XTNA 3HU1A 1HA3A 2J7PA 1IN5A 1YZKA 2WICA 3EIEA 3BFXA 2F43B 1FMJA 1VTKA 1ZINA 2IYXA 1NY5A 3B1ZA 4HAZA 1S96A 2PL3A 3P26A 2JJ2A 5SZIA 3MFYA 4EQ6A 4ARZA 2BMJA 4PO9A 3BAFA 2BV3A 5EP2A 1R10A 2FOLA 5TVKA 5JSZB 2BJVA 1F2TB 3QF4B 4RZUA 4DLYA 3R20A 2GJKA 3BH0A 3GJ0A 2WIBA 2RMKA 3B9PA 4GZLA 2QTHA 3WBKA 4YMUA 2HYDA 4CEJB 1D8TA 2C95A 2ZRAA 3OFND 4LWZA 4OKSA 3ZZUA 2IUSA 1LS1A 1VECA 1CU1A 2GK7A 3L43A 4AC9A 4IDHA 2GXUA 2CVHA 1FTNA 2REOA 2CBZA 2JLVA 1XRJA 1OFUX 1DEKA 2AXPA 3GEEA 3RVBA 3KQUA 4AKHA 1S4QA 2F6RA 1IY0A 1E1QA 2B6HA 4OHYA 4CDGA 1FX0B 1R8SA 4A82A 3RRNA 1LS6A 2AFHE 3Q85A 2QPAA 3U7GA 4A8JB 2ZRMA 3W6OA 4IOJA 4AIIA 1NN0A 4KITB 4MQBA 5SZHB 2ZRIA 2NO6A 1VYVA 3CPJB 1OIXA 2GESA 3ADBA 1DAMA 3NH9A 4QBIA 3LV8A 3RDPA 3CW2A 4MRPA 4BE7B 1N6RA 1GFIA 1NIPA 3AF2A 4FCWA 4LJYA 5TDHA 1G1MA 1T0JB 1ZNWA 2WWFA 3JZAA 2X1VA 2OBMA 1G8GA 5FBQB 3GFPA 4DDTA 2EQBA 4IDOA 2Z0MA 2DY1A 4IEEA 4OK5A 3GD7A 5AUNB 2WAYA 4QFMA 4DCTA 1EX7A 4V0NA 1OKKD 2B21A 3SYLA 2RHMA 1E2GA 2JLSA 2ZROA 4OHXA 2NPFA 3FHTA 5TB5A 3HU2A 2IHBA 1FW6A 2O8EB 1G6OA 3VHLB 1UDWA 2BBTA 1U0JA 4OI2A 3THYA 3U7HB 2WSSA 2IWHA 1IBRA 4ASUA 5FOTA 4DEXA 3CF2A 2QU8A 4FMDB 3MMPA 2PLRA 4HB3A 1VG8A 4Y0VA 4I99A 2C78A 3BH6A 1X8JA 3CNNA 4Q48A 2VSOA 1NN5A 1KSFX 5AJZA 5DISB 4DUGD 1OV4A 4TL8A 4ZV4A 4JT4A 4Q7MB 4P0TA 2ZRFA 1AS3A 4DBLC 5G40A 1E79A 4TT3D 1Z28A 3QXJA 4YDHB 3HYTA 3EX7C 1NG1A 1OFHA 2VLIA 3O8DA 2C9OA 3ZVNA 1HUQA 2ZRCA 2Q9AA 1DTSA 3AH8A 5K8UA 3AEZA 1P2SA 4Q21A 4R2HA 3FVQA 4JT2A 3OE7D 3R7WA 2R6FA 3W6NA 4JJKA 3KKOA 4EFNA 1QHYA 2NO1A 4HZUB 5C2JB 1E9SA 1HTWA 2H5EA 4H1UA 1T8UA 1NL3A 2BEKA 3I1FA 3B13B 4FCTA 4TYWA 1WA5A 3UPUA 1E9FA 4A36A 1YRAA 2GZAA 3MG9A 5JCZA 2XX3A 1P61B 4URXR 1GRRA 2GEUA 4ZDKA 2ZJ8A 4Q4LA 5G3ZA 2L0XA 4WXPA 3RC3A 6Q21A 1OH8A 1XMSA 2VSXA 2W58A 1KGDA 3RS2A 1U98A 1U90A 5H68A 3QKSB 1Q44A 1DPFA 2ATXA 4M53A 4OBEA 1F2UB 2DWOA 1DVRA 1XXHB 2P0EA 2RHDA 5DI9A 3EPLA 4U02A 2NOAA 4X8HA 1K5DA 4DSUA 5JI3E 4RY2A 1KOFA 1JR3A 1ZD1A 3QSYA 1LTQA 2F3TA 4PPFA 1N6OA 1XDBA 2XXAA 1GDDA 2CCKA 4W7SA 3ZS9A 5IF9A 1RIFA 3CUEF 3B78A 3RS5A 4AYXA 5D3MA 4YQFA 2IS2A 1TNDA 1NVVQ 4M1OA 4P4SB 2G1JA 3AVUA 3QKRA 1CJKC 1OW3B 4MA4A 3TE6A 2GKSA 1RFLA 1NN3A 3K0EA 2QGNA 4PPNA 3WBJA 4CEHA 2AX4A 2BIFA 3W3ZB 2OESA 3GP8A 2F43A 4QHSA 1UBFA 1HT2E 2QE7A 2O0HA 4UNQA 4FWIB 2ZR7A 1A5TA 1M1YE 2BOVA 4LJ7A 4PHTA 4BLPA 3LBIA 1JR3E 3LLMA 3SU8A 4A9AA 3P4XA 4DSNA 1IN4A 3E70C 4P33A 3SE0A 2QRNA 4OYHA 4Q47A 4HUTA 1G6HA 2Q6TA 2GXQA 2W0SA 1F2TA 4Q19A 4KYIB 4GNKA 4TLEA 1CBUA 2FPKA 4NCHA 2ZI4A 1KI8A 4W5HA 1R7RA 3I5XA 1P9RA 4Q1EA 5LD2C 3U7FB 1U99A 2DB3A 3AP1A 4L16A 1W36C 2FEOA 1MOZA 2PCJA 2ZJOA 3LRPA 5BN3A 1B23P 4X8MA 3VAAA 4MUBA 1YZNA 1H8HD 4Q9IA 1X6VA 4S2EA 5F98A 3QVUA 3ZYCA 4TL9A 3U60B 1P9WA 4RD4A 3CONA 1EXMA 2FZLA 4PPQA 3HU3A 2R2AA 3P20A 5FTLA 1EESA 1GRNA 2QM8A 2QUZA 2QZ4A 3KQHA 3PG5A 1KI6B 1RYFA 1TAGA 4PC6A 2Q9CA 4G3XA 2WJIA 2BM1A 1AGRA 4LYAA 1E4VA 5EUQB 5KDOA 1HEIA 2G6BA 1E32A 1HH4A 1OHHD 3TQFA 1FX0A 3ZD7A 2DYKA 2FPMA 5FL3A 2GDJA 3EXAA 1S8FA 1KJZA 4AURA 1G7TA 2GNOA 3NH6A 8OHMA 1QHIA 1Z0IA 3AVXA 2JLRA 3THXB 3E5HA 2ONJA 3PEUA 2W83A 1SXJD 3GJ8A 4CT5A 4LJ5A 3I8SA 4NZYA 4TQAA 1Z3IX 5EZ5A 3G0HA 3QY0A 2R65A 2A5JA 4KSBA 5CIQA 2C98A 3BRWD 3OEHA 1CR0A 4FMDF 4FN5A 2BKUA 1CJUC 2OAP1 4AI6A 3TW8B 4F93B 2BDTA 3O47A 1Z0FA 5LBIA 4EJSC 2K5UA 2O8EA 3QE0A 2CVFA 1W1WA 1YQTA 2JIZD 4L9WA 4NCKA 3FMFA 4JL8A 5KNBA 1HE1C 2N1BA 4I1VA 5B30A 2BMDA 3KKQA 5EE0A 5C4GB 5H70A 5BXQC 5C18A 1EFRA 3T35A 3VU9A 2RGNC 2ZI7A 2WWYA 1ZBDA 1ZMXA 3TSWA 3EPKA 2J7KA 4DIEA 3KJEA 1R0XA 1E3MA 2G3YA 3I72A 3AF1A 4PHFA 2J41A 1Z0JA 3LXRA 4IXMA 1ZD9A 3DO6A 4Q1DA 4TMXA 4CRWB 3TVTA 4DLUA 2ONKA 3AGQA 4BFWA 3I32A 3CRRA 3CPEA 4CIDA 1YKSA 2ZRHA 4P32A 4Q18A 5AJVB 3WRXC 4N0EA 1XZQA 1X3SA 5CYPA 3FMIA 4D0GA 3IGFA 2NTYC 3TUIC 2DFLA 5IRCD 4Q66C 3ZVLA 1RVDA 2OBNA 3R8FA 4GOJA 4A15A 1CJVC 3MWKA 4JL5A 2FGKA 1M74A 1T5IA 2KSQA 1ZM2A 1VCOA 2X2FA 5CDFA 4Z1MA 4B48A 4QM6A 1XBTA 5KDLA 3AP3A 2IYWA 4KLZA 1XX6A 2C03A 2PH1A 3WRYC 2QN6A 4RCYA 3TUJC 3QKSA 4HDOB 4KHZA 4MYHA 4MYUA 3L2OB 1M7GA 4RD2A 4NCIA 1RE0A 4JLMA 1MKYA 3UANA 3LH5A 1G17A 3A4LA 2AD1A 1DE0A 1P6XA 2CXXA 3BFKA 3UK6A 2GWHA 5JEEA 1JB1A 3GLIB 2J46A 2VHTA 1MABA 5HCNA 2YC4C 4JMPA 4BFXA 3T12A 5BN5A 1Z6GA 4OHVA 2XB2A 5CK5A 3R9XA 2HCBA 2V7QA 2ZSBA 5GVRA 5CDFE 3L0SA 2GEDA 1W5SA 1NMYA 1XJ0A 2ZYUX 4PAOA 2WBLC 1GWNA 2WKQA 3TR0A 4IXNA 5FR2A 1UBEA 2VF7A 3I8XA 1JQJC 4W5JA 3BOSA 3NDPA 3CR8A 2R62A 4HLCA 3B7GA 4GRAA 4NHOA 1KNQA 2ZRPA 3C14C 2REBA 1ZW6A 1V43A 3DZ8A 3WP1B 4WXRA 5EP4A 5A0FA 2OO7A 1NMZA 1LB1B 3K0CC 3A4NA 1EK0A 1XNJA 2PX3A 4PAQA 1S9DA 2IF0A 2QMUA 4YXWD 4DC9A 3VR3A 3QUSA 4LY6A 3RSOA 2WZQA 1OSNA 721PA 2JJ8A 4MUAA 2QT1A 4KVGA 1SHKA 1Z6YA 1G18A 3RSLA 1JAIA 3AF3A 4TLCA 5FTMA 3BJIC 4Q4JB 3QPVA 5EE3A 3MLEA 5KSPA 3D3QA 4ZKEA 4FW9A 2WHXA 4DDUA 3PEYA 2MMGA 3EZ9A 4LHXA 4ASUD 3LY5A 3ICEA 3RC8A 3QKUA 4UNNA 1NLYA 2GZHA 4MGZR 3A37A 2ZYWX 3KFXA 3LLUA 2JAQA 4F92B 3ZS8A 1TU4A 3DM5A 5BQ5A 1E2JA 3AVQA 1E79D 2QAGB 1GTVA 4C7OB 3CRMA 4L9SA 3A58B 4US2R 3SDZA 4AD8A 2NZ8A 2OEPA 1Y3AA 5GJCA 2RGAA 3SQXA 1VG0B 3W5JA 2IEZA 1DELA 2ZUCA 3ZDQA 2O8BA 5DYGA 4ESHA 5JI2E 5FUYA 2W00A 1AZSC 2V6JA 3FGNA 1COWD 4G5SA 3E2IA 2NMVA 3B1XA 2D3WA 4PO1A 4QM7A 3CF6R 5JRZA 1CIPA 1DS6A 1OF1A 1AM4D 4QGGA 3FFBA 2GJAA 2ZITA 2J59A 3LVRE 1Q1BA 2V1XA 1FMLA 2FJUA 2QT0A 2Z5FA 5HE8A 1IAQA 2R8RA 3WNCA 4M1TA 4PO8A 1GVNB 4DDVA 4URVR 1CJMA 1CXZA 3EWSA 1JXMA 3VMFA 1N6PA 1UF9A 3I73A 4LPSA 4D0LB 1TMKA 3MWJA 4LC0A 2E1RA 4BECA 2ZUDA 1PZNA 5G3YA 5A5GA 2KJQA 4A92A 2WJYA 3LVQE 4A0RA 3IIJA 3CZPA 4HAXA 3R9WA 4DUGA 5JRJA 1R6BX 4HAUA 1TU3A 3NTUA 4IDPA 2D7DA 1QVAA 2AKAB 4NYMR 1NY6A 2ZREA 4TT3A 4NP6A 1RJ9B 2CHQA 1TEVA 4KODA 4MRNA 3RS3A 4XOIA 4YDSA 5JJIA 2Z43A 1FFHA 1N6NA 2W6IA 4F38A 3RS4A 3LFUA 2RGCA 2JEOA 2XEXA 3KJIA 4M1WA 4YMSA 1ZRHA 4BFYA 2VEDA 1VHTA 3OE7A 1NSTA 1N6IA 1G291 1LF0A 1K5GA 5IK2D 4Q1FA 1A7JA 2MSEB 4OQNA 4Q5IA 1TQ4A 1WXQA 2XZLA 4ARZB 4URYR 1W2GA 1A82A 1XEWY 2FA9A 3IDQA 4XIGS 1SVKA 2G88A 4OQFA 2QI9C 4V0MA 2PT5A 2YYZA 1GRQA 3TLXA 3V00A 1SVWA 3TJZA 4TYQA 1QHHA 1W4CA 3BC1A 4NTZA 3KUDA 3QEOA 2A9KA 1OLOA 2YWHA 1Z8FA 1G64A 3M1IA 2IWRA 3VR5A 4IHQA 4DKXA 2J0SA 5JJLA 3B6EA 5CLLA 1P75A 4LK2A 4AK9A 2D74A 4NPHA 4KFSA 4URZR 2CCGA 2JA1A 2HJVA 4B3CA 5AWFC 2Q3MA 3IIMA 3QG1A 1Z63A 3ND9A 4MKHA 4TYYA 3MD0A 2F55A 2ZAMA 1J8MF 1C4OA 3PQCA 1YVDA 1M8PA 1ZU5A 2B8TA 3JZMA 3FMOB 4V0ME 1Q1EA 4BWYA 3GQBA 3UG7A 2EFEB 2ZS7A 3ASYA 2R9VA 4TTQA 4Q01A 1OXTA 1BH2A 4MYCA 2P6RA 4D4KA 2FSIA 2VF8A 1E1RA 4Q7LA 3C8UA 4TTRA 2I1VB 3X1XA 1LF5A 4MRRA 5KDDA 2FFHA 1O3YA 4M21A 4NL4H 4EPTA 1JPNA 3NDBB 3IPYA 2JATA 1E2KA 1UKYA 2BJWA 2IYZA 3K0SA 4KO8A 3TGPA 2FN4A 1ZNXA 1G19A 4JVNA 1ZD8A 4TN1A 2ZI9A 2VL7A 4IVQA 3T5GA 3BS4A 3U5ZB 3ADCA 1DBSA 3GLGB 2KWIA 4LSGA 2RAPA 4I1SA 5CITA 1UKEA 2OLKA 4AYWA 3EZ6A 4Q4AA 2IS1A 5DLQC 4RFVA 4QGAA 1D2MA 5IT5A 1E9AA 2J5XA 1ZUHA 3VR4A 1H8HA 2PZEA 4BFSA 1P60A 1U2RA 3OESA 1CEEA 4PPGA 5CYOA 3B1YA 4TMWA 3T1QA 1XEWX 5J4KA 4JLKA 3KKMA 4QGFA 2XZPA 4B6FA 4WOPA 3RLFA 4IW3B 4BLSA 3THYB 1P73A 1GG2A 1DAGA 1F48A 4GMDA 3H86A 2NO9A 5EXPA 5FOWA 4PSVA 1OHHA 3U7EB 2IYUA 1DAIA 3LXXA 3EARA 3PENA 1Q1QA 4QKQA 1QDEA 3X2SA 4C2TA 5FR1A 3G82C 1E99A 5FPHA 3FB4A 2GXAA 4HB2A 2O0JA 5E7JA 1YZTA 2OCBA 3FDIA 2GCPA 2QBYA 1QF9A 5L3SA 1KHTA 1SXJA 1CRPA 4DVGA 1AZTA 4B3DA 2ZRGA 3R7WB 4B33A 4DB4A 2C5LA 2O8DA 3WMGA 1YZLA 5DH9A 3GJ7A 3CX8A 2YHSA 1VPLA 2VP2A 1XU4A 4OL0A 3KL4A 2EVWX 3UATA 4BLOA 2FSFA 3PVSA 1E0JA 2ZRNA 3IBGA 4XJXA 1TF7A 3K09A 2JIZA 1JR6A 3OIYA 2HF8A 1XTJA 3V4FA 5FOXA 1S2MA 2WIAA 2ZSEA 2V55B 1P72A 4QC2A 1SXJE 3MRSA 5F9FA 2B7BA 4BFTA 1N0UA 4CF7A 1TQDA 1D6JA 4FWTA 2Q3HA 2Q9BA 2V7QD 1KO4A 5JLJA 3OF5A 2XXAB 1HQYE 2O0KA 2GK6A 4TMKA 1U0HC 4XTCS 2QP9X 2P6UA 4M9QA 5D3MB 3X1YA 3QXXA 1XWIA 4OI1A 1RJ9A 4DLRA 5FPSA 3QKRB 3ZZTA 3QG5A 4TYNA 4CEHB 1WQ1R 4B3GA 4PX9A 2GHIA 4KYUA 1I4TD 1Z6AA 4DLSA 2Y8EA 4QL3A 4GOXA 4A4DA 3DOEA 5G53C 4BQSA 3SJBA 3KKPA 4PC2A 3OIUA 4FMCF 3KXKA 1A4RA 2QTVB 4H9GA 4YC7A 1WP9A 2XJ9A 4GBMA 3SYKA 3K1JA 3EIHA 1XEXA 4WW0A 2V3CC 4OQMA 1XTQA 4O3MA 4PZYA 1J2JA 2WVJA 2XB4A 2JLUA 2FEMA 3THWA 3W3AA 4J0QA 3LX8A 3FMPB 1MT0A 3U61B 3RWOA 3PUXA 1WDTA 3NVAA 2YKGA 3C16C 1I4DD 4B3XA 3EA0A 1FZQA 1T91A 4GPTA 4CYMA 4CGZA 4JKYA 3A8TA 2VHUA 4Q1BA 4WZ6A 1UEJA 4KAXA 3T1TA 221PA 1F5NA 2W2VA 1KSGA 1Z08A 2HXYA 5GVSA 4EPRA 1AKYA 4QNRA 3LX5A 3LW8A 4G1UC 4LI0A 2UKDA 1FQJA 1R5NA 3M0EA 4ILEA 4N3NA 3F5FA 5AJXA 1CKEA 1GOTA 5L3VA 1G3IA 4KJZA 4BZPA 4NCNA 3Q72A 1KMQA 2ZS9A 5B64A 4NYMQ 3Q8XB 5GJVC 1E98A 4POAA 1BYIA 1Y63A 2ZIAA 4K46A 3GLGA 2ZE8A 1EFUA 2J9RA 3DPUA 4IRUB 4KBGA 1GKYA 2E87A 1FNNA 1RKBA 4YXWA 1W5TA 5HE9A 4D26A 1OPXA 3WHLA 2H8KA 3ZD6A 4UXIA 5FPYA 1Q1ZA 4RD6A 1Q3TA 1YZQA 3VHXA 1VKJA 3C5CA 1R0ZA 5DI3A 4EUNA 1I4LD 3SHFA 4IDQA 2ZRBA 3IUYA 4WZAE 3BB3A 3TQCA 5KUTA 4URWR 4PZLA 3T1OA 1WF3A 3GLGE 1W0JD 2DWQA 3A4MA 2IXFA 3VU9B 1PUIA 5KSYA 2GBLC 3T15A 1R8QA 4X8OA 1DOAA 1E4YA 2BMFA 5FI0B 5BW8A 1PV4A 3ADKA 2GRJA 1OH7A 4EDHA 4TLAA 4DLVA 2ZRLA 4OJQA 4LCBA 4IOMA 2H16A 1KKMA 3QIAA 1TUIA 2IX3A 3EC1A 4NYJR 1FP7A 2BEJA 2W6ID 2ZI3A 4PC7A 4M1SA 3VX4A 1L2TA 2JCSA 2EU8A 3VR1A 2WKPA 4LX0A 1V5WA 5HCIA 1SGWA 4KXFB 3EW9A 5FUVA 3BB1A 4MKGA 1GM5A 2UZIR 3FOZA 3IHLA 4TSFD 1RZ3A 3EZ7A 2G0NA 4GZMA 1Q0UA 2C9CA 1COWA 5HZHA 1I2MA 3IBYA 3A1WA 2PJZA 1XD2A 2AWNA 2DWPA 1JBKA 4QXAA 1W0KD 4L4UA 1J90A 2IHYA 4NU0A 1U9IC 4RZ2A 5FUWA 1NLFA 1DAFA 1K6MA 3L0IB 3K8YA 4Q00A 1NMXA 3AVPA 1BOFA 2VPPA 4JLBA 5TY0A 2IS4A 5H1YA 3H2YA 4QBHA 1XPUA 1T8TA 1E2NA 4GSYA 1T4GA 2YV5A 2YNMA 3Q7PA 4RKEA 2IC5A 1UBCA 3VNUA 5FI1B 4C0AC 1MABB 3A1TA 4ON9A 2FSHA 3K70C 2VTKA 4HAVA 2IS6A 3CR7A 4B47A 2W2XA 4TYPA 4F4JA 3T34A 5J47A 5EQTA 3PCRB 4BLQA 3TRFA 5B57C 2F1JA 2P65A 1ZIPA 2CLDX 2WPDD 3FKQA 4WBSA 3U6KA 1E1RD 4HAYA 3HR7A 1E69A 2GAOA 4S35A 3GJ6A 4Q4HB 4TLBA 1N5JA 5KSZA 3P27A 5FTJA 1NIJA 4TMZA 5IK2A 4BASA 5GADl 3SOPA 2A5DA 1ZNYA 4TMTA 4TZ6A 4OK3A 4QGHA 1G41A 4DLZA 5F3WB 3UXMA 2P5TB 2AFIE 2FNAA 3CNLA 4G5RA 1DAEA 3L82B 4YMWA 4DCUA 3ETLA 2QSZA 4BEBA 2F1HA 1A2KC 2BCJQ 3VX3A 3RS7A 2H92A 2V8OA 3THOA 1XP8A 2XSZD 3QBTA 4MRSA 2NIPA 4RD3A 3SNHA 1GILA 4BZQA 2O8CB 4ZKDA 3F3YA 4G01B 1ZYUA 4M2LA 3TIFA 5HTKA 5FL7D 1KI7A 1YR9A 2Z4RA 4B3FX 3CRW1 3AKYA 4Q02A 1CR4A 4PSAA 4OQLA 5EXSA 1SKQA 4IVRA 4LC1A 1E0SA 4A0FA 4NH0A 5JS7A 1KDRA 2BHRA 1R5OA 4DJTA 3K0AA 2RGXA 3N2IA 4HLUC 1LNZA 1QRAA 5IDVA 1E0AA 1NSFA 2ANBA 3QF7A 4MDFA 2ZRKA 4DLXA 2HUPA 2O8BB 4JIMA 1R2QA 4C9BA 2GCOA 3REGA 3H4MA 4LZZA 2ZJBA 1KY2A 1X8KA 3IHWA 4LHVA 2GILA 3DHWC 3IILA 3OIVA 5AR1A 4A8JC 3AVVA 3PEWA 3MSXA 4LJ6A 1QG2A 3AKDA 3O8CA 4DLWA 3TUZC 2RB4A 3PR1A 3VR2A 1Z2CA 4RSGA 4LYHA 1TTTA 2NO7A 2OZEA 4EJSA 4TMVA 4MGIR 2OXCA 1TUEA 1N5LA 1VG1A 2B92A 2ZM5A 1DG1G 1MV5A 4F4IA 1JI0A 3LBHA 3FYHA 4WAUA 1XTSA 1JJ7A 1KKLA 4O2RA 2CEAA 2WJHA 4C0QC 4B35A 5HKKD 2LWIA 1XCGB 1E2PA 2VSFA 3B82A 2EFDB 2HJGA 5CB6A 2FFQA 3T61A 4PXAA 2RGNA 4V0LA 4PR0A 2YOHA 4C0HA 2OM2A 4X8LA 3KJHA 4NONA 4AKIA 3LQQA 1ZC3A 1OYYA 1G20E 1Z0AA 3Q9LA 5EE5B 1E6CA 5TXGA 2ZRDA 2LCFA 3CPHA 1XTIA 1KZGB 2ZI6A 5AUOB 1P7CA 2PLFA 2VP0A 3L8YA 4UXJA 2CCJA 1EFTA 2ZSFA 3HYRA 4HEJA 4EPWA 2XNDA 3F8TA 3F0TA 4PHGA 3SR0A 3RYTC 1G21E 1KK0A 2VHCA 4FXPA 2XAUA 1JQLB 5JWHA 2NZJA 1CULC 2B7CA 1KI9A 4TQUS 1U94A 2PZFA 1WBBA 1AS0A 2V54A 1G7SA 2ZE5A 4N0DA 4V02A 3B1VA 3QXHA 1VIYA 2P5SA 4K81B 3DOFA 4C0BA 5SZJA 3BFVA 2WM9B 2C77A 3K0FA 1N2CE 4A2QA 1QHHB 5KO2A 2VHQA 3QXCA 1GKIA 2GA8A 2A5YB 1E9EA 1CTQA 1OE0A 4MKFA 5IHPA 3BIFA 4URUR 1YR8A 3CM0A 1NN1A 4BRWA 2GAAA 2EYQA 1OH5A 1DADA 3CF0A 2OHFA 3AV0B 1NLZA 2JASA 4YONB 2VH5R 2XITA 4AG6A 3TH5A 1E9DA 1Z06A 1KJYA 1MRSA 4DHEA 4JLVA 4FMBB 1TQ2A 4JLDA 2WAXA 1EGAA 3HPQA 1UAAA 3BBPA 1X8LA 2H57A 4AY2A 5M04A 4KCGA 1J99A 4Q4HA 2QSYA 3BE4A 2AHOA 1U81A 1Z29A 4A6XA 1NVXQ 1R5BA 4TWZA 2EFGA 2DFKB 2QTFA 2A30A 4NE2A 2ZJZA 3UMRA 2D2FA 4LDJA 1KDTA 3B85A 3BK7A 2FWRA 3K0CA 3KB2A 4NYJQ 1A2BA 2F7SA 2XZOA 3UWKA 1YZUA 4QJ5A 1GKUB 3ASZA 1TQ6A 3KB1A 3RS0A 2QY9A 5B2ZA 4Q4AB 4AWXA 2JLWA 1KO7A 2FX3A 1BKDR 1P2TA 4NDZA 2CL7X 4G5OA 2DFNA 3D8BA 2B8WA 2RGBA 1OT3A 1KO1A 4D4MA 3W8RA 5K8LA 2QL6A 3CRVA 2JLQA 1ZNZA 2AN9A 3SEAA 3WNDA 4W9MC 1R4AA 1G8FA 2O8CA 1XFAA 2BBWA 1C9KA 1ZIOA 1I2DA 2MSDB 2Z4SA 1JEDA 1SVIA 2WMOB 1XCPA 2FE4A 2OBLA 1GL9B 1S1MA 3S1AA 4JVSB 2ZEJA 4CZ2A 2AD5A 1NBMA 2IYTA 2WWIA 4L8GA 1ODFA 4I4LA 4OHWA 4PHHA 4E09A 3ZZ0A 1H65A 1Z5ZA 4UNRA 3ZVMA 1D9ZA 2QMHA 3QPWA 2QBYB 1TF5A 5L3SB 1Q12A 2EFHB 1IN6A 1E2QA 3WYFA 1SXJB 1W49A 3TMKA 4R9UC 1GZSA 1WBDA 2EWWA 3LW7A 4JS0A 4RJLA 2O8DB 3CIOA 1JJVA 4LV5B 2V4ZA 3PV0A 2HV8A 2IYRA 4HI0E 4YLGA 3V4RA 2QEQA 2F3RA 2ZJAA 1NBME 2OLJA 2CDNA 4QRHA 3MAAC 5KU1A 4R2IA 2XGJA 3SFZA 3KX2A 3WMEA 1E96A 4V03A 1VG9B 1NI3A 5DHFA 1JALA 2PCLA 2QM7A 4PZZA 3SJAA 2CLCX 3A1VA 2XJ4A 3EC2A 3RANA 1W2HA 1E2DA 1UM8A 2AR7A 2QPOA 4JLJA 3D6TB 4ITRC 2GCNA 3QVVA 1XD8A 2XNSA 4BLRA 1W0JA 4M8NE 3I3SR 1FL9A 1E94E 2UZ3A 2CJWB 3K70D 1BO6A 4GP7A 3OEEA 3SC3A 1G5PA 2ZR0A 4QHTA 1MH1A 1LV7A 1XB2A 4GL2A 2GTPA 4PTLA 3SFVA 3SI7A 4PQRA 5E95A 2WJGA 1TPZA 1II0A 3ZLJA 1Z83A 2IBMA 3UG6A 1E2EA 4JYBA 1U0LA 2BCGY 3WY9A 4RFSA 4TSFA 4GI7A 5FUXA 4Z8YA 1S3GA 3UIEA 2OAQ1 4PANA 4MGKR 4L5BA 1G8PA 5L8VA 2KBFA 4ZDIA 1W0KA 3SN6A 5FTKA 4LBWA 5KNDA 1XEXB 1GAJA 3RABA 4KFUA 3CLVA 1US8A 1NKSA 2GF9A 4Q03A 2ZI5A 5CJPA 3KTAA 4BFUA 5JFGA 3THXA 1W36D 4CEIA 1D9XA 3I4LA 3THWB 2WWHA 3G5UA 3LQRA 3KQLA 4FMCB 1VCMA 1FUUA 3DDCA 4YMTA 4IJMA 4C0SA 4KVAA 2GJSA 2G9NA 3ND8A 1KI3A 3QBVA 3CWQA 1WCV1 4HLQB 4B6EA 1SHZA 2BKEA 4U5XA 5DHAA 1VCIA 3IO3A 2BBSA 5JMTA 2ZUBA 4BUJA 5JS8A 2PMDA 4P31A 2VYFA 4UXHA 3ZIAA 3U6BA 3EPJA 3OAAA 1VCNA 2OFWA 3FTQA 3U3OA 4B2PA 1KMHA 2PJRA 5EZ6B 4AKEA 3ZJYA 2WPDA 1MR3F 2A3RA 2W0MA 4Q9JA 5FOSA 4ACBA 1RC8A 2OCYC 2YC2C 3A1UA 1JAHA 1M7HA 4LOAA 1R0WA 2QQ0A 4NBSA 1DG3A 1ZM4A
chains in the Genus database with same CATH superfamily
1RZRA 2NGRA 3GRKA 2I6XA 4MUFA 4BNUA 4Y9TA 3L8EA 3NB0A 4I55A 4PCUA 2Q2WA 1H0RA 1PZHA 2R87A 3EEYA 3HS3A 3KWMA 2PHZA 3UAVA 4BEWA 2YYAA 2MSLA 3P2OA 1IB0A 3U9LA 2ZJFA 2ZJ1A 1GNQA 1N0VC 5FFFA 4J0DA 3WLOA 2CLOB 5BWNA 1BDMA 2NO5A 5CK4A 3WTCA 2VTBA 1EFHA 3EZXA 2C4TA 1EJBA 4MA0A 4F5YA 3JVDA 4DR5B 1K75A 5EQFA 1DJMA 1XMIA 2XVYA 2P62A 4GMHA 4HTFB 5H3LA 2I55A 5DE3A 5AK0A 3GPLA 1GRCA 4Z9XA 2WYOA 3HJHA 1KSJA 3PXGA 1Q7GA 3OU7A 3RUDA 4O2LA 4TRMA 4C30A 4BJ6A 5DI3B 2BE9A 1KAOA 2OBYA 4V0RA 4YUYA 1AVTA 1BU8A 1FFDA 4G5GA 2XSZA 1QC5B 3QJYA 5D85A 5T7BA 1U1GA 2E4ZA 3PX2A 3ZY6A 1N8NA 1XFDA 5DTEA 3I9V6 2YVLA 1MN6A 3TD6A 4DZZA 2GVNA 5FBVB 4N3AA 1TC1A 1H2AS 1WXGA 2WI8A 4EPXA 3QVWA 4WNAB 5DK6A 2F64A 2G08A 3B6JA 1HV8A 4X1KA 2A35A 1T2FA 2IYVA 2RIRA 4OI4A 4COOA 4CMIB 4U7DA 3Q8KA 1XG5A 1UP7A 2VVTA 3PDIA 2E5LB 2N46A 2VK1A 1NZJA 4FK8A 1U0RA 1HWYA 3O4FA 1FVXA 1UJ2A 3HA3A 3KOXA 1XA0A 2EJBA 4YRLA 3D3JA 4IDFA 5LL6P 1OC4A 3LX4A 5BV1A 1D1SA 3OT4A 2IH5A 4RZ3A 5H83A 1KFJB 1NZFA 3PFCA 5HGXA 5SV2A 3UTCA 4EA8A 3IMGA 2LTAA 3KJGA 2I6UA 2OC9A 2WD8A 4EKNB 2FQWA 1Z6TA 3ZH9B 1T0UA 2HPAA 2AL7A 5FH9A 4DVJA 5JZVA 1Z13A 3ICWA 3Q0TA 4I4TA 3TVDA 1Y8AA 2HGSA 4KV9A 2P2LA 5IUKC 2QPTA 1WU7A 3KOYA 5A03A 2CLMB 1J70A 1MJGA 4G4SP 4AY5A 4JN6B 4JLNA 3VR6A 1S01A 1TEXA 2I3GA 5IAGA 4TS1A 3SAJA 1YV9A 2VN8A 2XRFA 4IUBS 121PA 1UK8A 4XVRA 4MB2A 5K03A 2PV7A 3DL0A 1NQXA 5ESWA 3PTLA 4FT2A 3OIDA 3R7LA 5CTJA 2I33A 3R9IA 4LQLA 2QNBA 3R09A 3E9DA 1RRVA 4KFRA 4HQ6A 3VR6H 4H16A 5ESDA 4U6SA 1KNXA 3U81A 5GONB 4JUBA 5FWDA 5B3JC 5K3CA 2G04A 3GLHA 4B76A 3MCZA 3MJHA 2AFIB 3C4JA 1QU3A 4KN5A 3RSSA 5LP6F 3GNQA 4FD3A 4YJGB 1UXOA 4YQZA 4EOGA 3EDYA 3TX6A 1I4EB 2HDWA 3QEJA 1NVWQ 1U1EA 4F4UA 2XCIA 4MP8A 2A5FA 1CY7A 2AG1A 3ESBA 4M1ZA 5AVZA 1V6AA 1V3UA 2C7RA 1YU6A 4F4HA 3KOMA 2QF7A 4AN4A 1MEEA 5DYIA 4EY8A 1RC0A 4QDUA 1R37A 4JKIA 5KYUA 4FZ5A 4JXKA 3CCBA 3FCYA 5JWOA 4OFWA 2CE7A 4RDIA 4FGUA 5AJUA 4MZXA 2CD7A 4GYYA 2OFFA 4TXNA 4D02A 5JAHA 3O8NA 4NZNA 3GLHE 1W76A 3DB1A 4P0QB 3WIUA 5TIIA 2OE2A 2GKGA 4AVYA 4D9BA 4KW7A 3VVCA 3ZHTA 1NJ6A 2GUGA 4FYHA 4UTOA 4DY6A 1ZN9A 4ZI2A 3ADPA 4U7HA 1YA8A 1KEEA 3PXAA 4JQYA 4R71A 5F23A 4DZRA 3KD3A 4OQXA 4PBTA 3JYNA 4BNDB 3ED5A 3QA3E 3P96A 5CB0A 2ABWA 2E9SA 1USKA 2WIGA 2OYCA 3U1VA 2ONYA 3HPRA 1SUBA 3ABRB 4YGYA 2GSDA 5L3RA 1IJBA 1DWPA 2VDNB 3TQHA 4CUJA 4ZODA 4MINA 4Q1AA 1QBKC 1NW8A 1HSZA 1MEOA 3H8JA 5HDQA 4JI3B 4O2BF 1DFHA 5AVOA 1Z68A 3PQ3A 1VDZA 1FP2A 3L1VA 2IPAB 4R9RA 2B4QA 4EUHA 3BORA 2E4YA 5CJJA 3MJSA 3O5AA 3RU2A 1HKHA 5BVHA 4QWMA 5LNK1 2QUKA 4L08A 3IBSA 1WSWA 2FEXA 2H1FA 3OUZA 3MAJA 1C1YA 3BH7A 1ELOA 4RNDB 3CLTD 3DQPA 2WU0A 5F5XA 1X1SA 3I28A 3BWVA 1GZ4A 3EJ6A 3RF7A 1ICEA 2JGNA 4BGIA 1IJEA 2NYUA 3G7UA 1EG7A 1AQYA 3M49A 3OHMA 4H3VA 4DNPA 3AX6A 3H9BA 3WKCA 3AP2A 3NKVA 2GEFA 4P4GA 4Y7CA 4FP9A 4WEOA 3WWZA 2WTUA 1WXWA 2RGGA 3W06A 4D8YA 5G2OA 2Q41A 2YX1A 2EFCB 1SD2A 2DFTA 1BJTA 2QRZA 2VYNA 1D0IA 1AN9A 3B7WA 2XD9A 3JS5A 1H2FA 1R0LA 4JI0B 4EBBA 2CZQA 5L3QB 4YO8A 1XD9A 3DMGA 3VC3A 1GIAA 1CNMA 4O08A 2F62A 3GJ5A 3ZPXA 3SXUA 4BB5A 2EKLA 5DGHA 5LLSA 1JVSA 1XWFA 4RIEA 4J0GA 3RQIA 3IC5A 3Q4GA 2I03A 3EDOA 1A9ZA 1L5YA 3DGFC 4O6VA 3RRMA 4XVUA 1X39A 2BP7A 1P74A 2XH8A 3FBTA 4Q0MA 4E33A 1N3BA 1UXIA 1S7GA 4WUVA 4RL4A 4UREA 1MO5A 5ITZA 4G8BA 5K3EA 4HYYA 1S2LA 4OIMA 4LUCA 5BWLA 2Q2NA 1DV2A 2OORA 3U44B 4HADA 3V4VB 2HDHA 4ARCA 1GZDA 4RLFA 4JR0A 4D4JA 2ZAYA 4QREA 1L4BA 1Y33E 4Q3NA 2WV9A 3O9MA 4CCYB 4XWAA 4C7MA 4HWKA 2YHIB 4ZGWA 2BRUA 4BN0A 1NV8A 3FZGA 2GAIA 3O4GA 3ZXXA 2ZAOA 3BAZA 4RHXA 4RD1A 1MRNA 3TL2A 1YVUA 1O77A 1E1YA 3S7TA 3CH4B 3IUJA 4LJAA 4X92A 5F12A 3AW8A 5B6JA 6REQA 3U4IA 1SIUA 3HCCA 3AQ4A 4MJXA 3SC6A 3UB3A 1IVYA 2ASVA 3EYWA 4BIMA 5A4KA 1KC1A 5JVDA 2H5IA 1IZ8A 2JIPA 4BU0A 1E4EB 4HPJB 2P2ZA 3L92A 5SZKB 4W6ZA 4DL9A 1QFJA 1Y98A 4ENSA 3RIXA 1KPGA 1PX0A 1GPLA 2FAXA 4BEJA 2BM8A 2O3JA 5K4GA 1QYRA 3P9IA 2FP4A 4Y18A 1Y8CA 2ODQA 1YRYE 3H75A 4XTRA 4EA9A 4DRZA 1T2EA 2OMEA 4Q24A 2ESRA 2C5EA 3FPAA 421PA 4RDXA 2WD9A 3P71T 3GV0A 5AHRA 3G6WA 3OQIA 1QTNA 3Q8LA 1L7QA 3WXMA 5K0ZA 5K3BA 1KOLA 2QYSA 1LZKA 1QYXA 2ANCA 1U9CA 1YA4A 2BFFB 2GJ8A 2XNCA 2NXCA 4FU0A 3IV9A 2ETVA 4U7GA 4XIFA 2QZSA 3OAAD 4AT1A 1UKZA 1W2WB 3NRJA 4PZ0A 3THSA 3FFWA 3QKTA 1YQDA 5DBGA 2ZTUA 3AY6A 3U4HA 4F4CA 3NETA 1N1DA 4LY3A 2VJQA 3ZWNA 3AB3A 1XDZA 3BGWA 4OI0A 4ZEVA 3LO8A 7REQB 3HCRA 3IQXA 1KSHA 3KXIA 4KIWA 1QH9A 3LL7A 1S3SA 1E3JA 3E58A 1QHGA 3HY6A 1U5BA 5I8PA 3D3WA 5H5JA 4ARVA 3RIMA 2WJVA 4ERNA 4FILA 3OJ0A 2NT3A 5IN5A 3DM9B 4DR6B 2OT3B 5LXTB 2WWWA 4UM9B 1MBZA 1WMFA 1ZG3A 1QCDA 3T3IA 2HB6A 4QQKA 1YL6A 5DM1A 1F3OA 2FMKA 2QN3A 3V8PA 3IUBA 2G9QA 1CUGA 4IV0A 2I22A 1QHSA 2HRQA 2JL1A 2HSJA 1XPOA 4TSKA 4RTJA 4N8SA 4N12A 3OICA 1GUAA 5EZYF 2ZT6A 3NG1A 5DASA 3NDIA 1AHIA 1KYQA 2E4VA 3NC1C 5J5AA 3LIIA 4L8VA 1J0EA 5KPJA 1QG4A 3CVVA 4L5YA 2JIBA 4RXTA 4TMFA 3LP8A 4B1FA 4LY9A 5JZSA 1GAXA 1KRXA 2H2AA 2D4HA 2P9FA 1LJLA 2XOKD 1CDOA 3GEIA 3P0EA 5BNIA 1F6BA 1VYTA 2EP7A 3DZIA 3ETJA 3NGXA 1D0VA 2HSEA 3LF1A 2ZQYA 3AF4A 4M9XA 4Z0PA 4Z5XA 5CT4A 1W48A 3WIBA 4AICA 1H42A 2GHTA 4LXXA 2FFJA 4RQUA 2PSFA 1T5LA 2HU2A 3NHYA 1T0HB 2N42A 5FUMA 6CHYA 1XZPA 2CJFA 4R2MA 5EN4A 5JNRA 2CLHB 2HDOA 2RCNA 1GSIA 5I01A 4BC1A 5CAEA 2AEEA 2B34A 3EWAA 3SC2A 5FDFA 2ACWA 4KSYA 2UYCA 1R1DA 3ENZA 3FNHA 3JQ9A 5TSDA 2WM2A 1KK2A 2AQKA 2YVAA 1NOJA 1X74A 4K9SA 3I1JA 4C3ZA 3FNRA 2NXEA 2E82A 2G17A 4WFIA 1OR8A 5DRTA 4A0GA 4S24A 3VBCA 1K06A 1MO4A 2BY4A 1VMKA 1LFDB 3PUVA 1DOHA 2P7IA 2WHQA 4RZIA 4FBMA 2WC1A 3COZA 5LZ5A 1X2BA 5LQUA 3PUWA 3WYNA 2PUVA 1HDXA 3WLPA 3CUVA 4UQOA 2WT8A 3A27A 3IODA 3O9VA 1T34A 3OZGA 3ITDA 4X54A 3LTNC 3H5RA 3I2GA 1PQWA 3MRXA 4GECA 4LJ8A 4QNMA 2YXDA 1OI3A 1YJCA 3GRUA 1W4AA 4CM6A 4D9KA 1QRTA 2GRAA 1HRDA 3V46A 1GPKA 2H17A 1RJGA 5DM2A 4M9ZA 3BXZA 4C4RA 4FFBB 3D8TA 1Z2AA 5AVVA 1QANA 5BR1A 1X19A 4D74A 3DCYA 1T0PA 2OFOA 4Q05A 3E0XA 5K3DA 2ZDQA 2WM3A 3BWMA 4AJLA 4BNGA 3ECCA 5ELLA 1HTBA 1XTVA 3QVLA 3HL4A 1TLTA 2PT7A 4GD3Q 4GX5A 2I62A 3ZX4A 3AFOA 2QGZA 1U2GA 3GUVA 3KTOA 2JLYA 1E1CB 2XQJA 4LDPA 3ZBTA 1U7HA 2FOIA 5K3FB 3M33A 4DJEC 4LPKA 2CHVA 2JLZA 2Q6OA 2C99A 3NYQA 4FNMA 4ZVTA 2D0PB 4BKPA 4RYLA 4ACAA 4FFWA 4JVMA 1XTUA 4GMXA 4RTPA 4BVFA 4LBYA 4GBED 2Z6VA 4UM7A 3KPVA 1KI2A 2BGLA 3C5WP 2OCAA 3JATA 5DNAA 2JPDA 5FFMA 1ZVMA 1OWMA 2VR1A 4NR0A 2ZTLA 4KDCA 1HZJA 2RGYA 2Y1WA 4UTNA 4JA2A 4P82A 1Y5RA 1JXAA 4ZVSA 4W99A 4FJ2A 4PAGA 1JECA 4X60A 4C14A 3GY0A 4LOKA 2D7CA 2VCYA 2XA9A 2PX0A 4GWGA 5EJMA 1YTLA 2VF2A 3P9XA 3KTAB 4ND4A 2G8NA 1YVRA 4CMGA 1DTEA 2ISQA 2ZS8A 5A1TA 1ZCFA 1ZUIA 2QAJA 4DLBA 3PIRA 5A6SB 1YCDA 1ZU4A 5AMXA 4FBGA 3T06B 4MQLA 4EUSA 2B2NA 3ONFA 5CDGA 2JGDA 3AKZA 4LZOA 1N25A 5FNVA 3VC2A 5JHHB 3LCMA 4ES6A 1ID8A 1IBCA 1KZ7B 1K97A 2BTOA 4RK7A 1OYWA 2G0AA 2WZDA 3DKPA 5MGBA 3H6GA 5AJYA 2PUWA 5K0JA 1ZDMA 1F2UA 2DUWA 1OROA 5CM9C 4M3NA 1LLCA 2DCUA 4XX0B 4ND3A 4GXTA 1KMHB 1P5ZB 2IZ1A 2VWQA 1T36A 2IUTA 4R3UC 1U0OC 4Y9SA 3MIZA 2J45A 3EVNA 4GS5A 1X7DA 4HUQA 5GJBA 2FZCA 2RHGB 4KN6A 4YA6A 1YDHA 3ZY5A 3BWDD 5LU8A 4N9QA 3LWNA 1UK7A 4A8HA 3E3AA 3S2UA 1F06A 1OZAA 2PD6A 3W4IA 4LZLA 1ADBA 1JFLA 1G8YA 1OFTA 1RQGA 5FX2A 2CJXA 1GPBA 2O3UA 2QMOA 1E1QD 1OGIA 4WCFC 4BFCA 1FJ2A 3FVWA 2VDPB 4GICA 2ACKA 2P77A 2D3TA 4PQFA 1SELA 2NO4A 3D0OA 5BN4B 1IRXA 2D1SA 3PNSA 1ILWA 2H5LA 4ISCA 1G0NA 2GXSA 3CB4A 3EIWA 2ZJ5A 4GR5A 3CX4A 1CRWG 3TW4A 4ZEOA 3HXLA 2IEGA 1ZCBA 2GQ0A 4JCCA 4JUDX 1JU9A 4I36A 2V7GA 2G4CA 3CO5A 1XIVA 3BTVA 3PJEA 1QGUB 3P2KA 3TZKA 1J24A 9GPBA 4XDGA 1IBLB 5L7YA 4U63A 2RIPA 4UU7A 3NOXA 4XDYA 2YN0A 4FZ3A 1VKHA 3FBWA 4D9GA 2EX1A 1B2RA 1GPJA 4AJHA 1URPA 3PHLA 4PZUA 2BF4A 4R6XA 5H4HA 1PK7A 5LQKA 3PNQA 3NT4A 1RP1A 3WL8A 1QDUA 2ZB4A 2JDIA 3UMBA 5B2FA 1GZ7A 2YMPA 3D8NA 2FV8A 1HOXA 1IAVA 3KU1A 2Q7OE 3V9PA 1N1EA 5IEJA 3RODA 3EDCA 4XVHA 1UWVA 5DHUA 3FCUB 1V5FA 2MMCA 1ESNA 1Q1NA 3SQOA 2HEIA 3ZG6A 2XY4A 3NBQA 2SHKA 4LKRA 5JBIA 1N75A 3AETA 1O5OA 1A8SA 3QPAA 5TQ2A 4PAWA 3WJ1A 2R6AA 3GDHA 4QJ3A 2AGVA 4ND8B 1NXQA 5DT9A 5F73A 3ROKA 3TL3A 2YINC 3FVTA 1L8AA 4XCVA 2MTBA 5IARA 4BKOA 2N75A 1QE5A 2PXCA 1PSZA 1Q11A 4B3MB 2ASEA 2WY2D 1IBMB 2GNAA 2IYQA 2OYSA 2OZLA 3AY7A 1OJLA 3NEJA 4GRIA 2FU5C 1D1QA 5EKXA 1PWEA 1T8WA 4QXOA 3W4KA 2FTKE 4C5CA 3OZWA 5JECA 3AF6A 3FTFA 4XRGA 1GVHA 1L8QA 1MH9A 4LW8A 1UPAA 3D7SA 4QBGB 4ZOBA 5FJJA 1OGYA 4UHBA 3VV3A 1JMYA 3OZVA 3AUYA 4LNHA 1ZHOA 2I80A 2DKOA 4F9GA 3B9QA 1K63A 3FY4A 2J3LA 1U5AA 2E5WA 4NKRA 3UCXA 1XMXA 5DBFA 2PKRA 3JALB 4EUFA 1PSDA 1V11B 1WSBA 4MS1B 4BNNA 2KLBA 4LHWA 3D0QA 4C0XA 3SX4A 4B5LA 2WKWA 2H1VA 3IQWA 2I2XB 4ESVA 3ENKA 2I4TA 2WP0A 3GLFB 2BTEA 2HJRA 3T7AA 1OIVA 2IF2A 1XTPA 1XLTC 2ORWA 4XB1A 3WYGA 2PEYA 4XVQA 4EY6A 4Y0NA 4HEQA 1MNAA 4HFRA 5K3SA 4CLHA 4D8XA 1EUZA 3RAJA 1ZM7A 1VL2A 4PQYA 1L7NA 3SVLA 3AR4A 1Q15A 2Y27A 3KYDB 1KTVA 2HIGA 5CNKA 2FDRA 4K40A 4LJ9A 5AVWA 1HE5A 1B93A 1IXRC 1P45A 1SKYB 3DS8A 4MVJM 2FZ4A 3EZFA 1NKTA 3CUWA 3MB8A 2IXGA 4YH1A 2HNBA 5AUQA 1JHOA 1G98A 4RM2A 1DO0A 5KOHA 2V65A 2V6FA 3K9WA 4UPVA 3H9JA 3VBEA 2CHFA 1H66A 2JHPA 5I7VA 1D4OA 1TUGA 2F59A 1QSGA 1ETUA 1CDDA 4JP5A 1WB9A 4YXFA 1NW6A 5J43A 2NYAA 1J49A 1H6CA 4L95C 4UEQA 4C2UA 5JHGB 3RHZA 1PLKA 3JVVA 3ON5A 4JJZA 3HBJA 1AN0A 2C2HA 3A1SA 2UU9B 2OUKA 1UC5B 2RI1A 1K8RA 3U3DA 5ALEA 2I7VA 4LKOA 1QTQA 5ER9A 2HYIC 1A9SA 2E0IA 1MQ9A 3AJDA 2OV2A 3WWCA 3EXG1 4IFIA 4W6QA 1P3DA 1GDHA 3SJCA 4B9EA 2UZAA 3KBBA 1HQKA 1JYSA 2BMWA 3A6LA 3TPZA 1RXEA 5C3MA 5ES4B 1UPXA 4ZTZB 4OA8A 4H6VA 2D06A 2SCUB 2XVAA 3AUSA 1FFYA 1VYUA 2UYOA 4J8PA 5K3AA 1U8UA 2WZBA 4JJ4A 3G8YA 3K2QA 3KCNA 1PL7A 3O4VA 2QYTA 3ZVRA 5JCJD 1E6MA 1QVRA 3HMKA 4INJA 1XELA 4RVFA 5DX0A 4A23A 4CKXA 1MVLA 2XWBF 5CG2A 4MV0A 2FG5A 3T1HB 2N0SA 5D6OA 1OT5A 4CUKA 1LVHA 1QCYA 1A7KA 4GR9A 4IFEA 1DGQA 4DUZB 4IGEA 4RO0A 1Q77A 1SJ9A 5EWJB 1YQQA 4LOLA 4R98A 1TUBA 1L4UA 4UD2A 4RBNA 3VISA 3NYWA 1MFZA 1PJ8A 2D8MA 1O95A 2QROA 2X0KA 2Y1XA 3GFQA 4N5IX 5ALLA 3W5UA 1SG9A 5JH7F 1YVPA 2DLCX 2C8VA 2J4DA 2FMTA 3EVCA 2PRJA 3IKMB 1VZ3A 1RLMA 4QUGA 3GEBA 4FHFA 4N5NA 4HLDA 4O2BB 3IFSA 5FBRB 3L0ZA 3NDRA 4MH0R 1Q91A 2KBEA 3CLSD 2WSMA 3EK2A 3QE4A 4GX2A 4L6IA 4QEKA 5TQVA 2VQ6A 4N7MA 1N6HA 4P98A 4IJWA 4BO9A 4D1YA 3U3XA 3L4JA 5DN6D 1G16A 2CNLA 4MMXB 3MNFA 4B6SA 3EZ2A 2GF0A 3L77A 1M6WA 2BEWB 3GDOA 4N1AA 5L3ZA 3SZRA 3TBKA 1JHMA 2PL1A 3DF7A 4GLJA 3QPCA 2IUUA 1NKVA 2C29D 4CDRA 1QS0A 4EKDA 2NUTA 1KIMA 1N5IA 1PTJC 1S2NA 1WD5A 3GJXC 3F4BA 3NATA 1XTKA 2JD2A 1KI1A 3LUJA 4EZEA 3H19A 3PRKE 5FPKA 5EPEA 3NZEA 3UWSA 1N36B 1MENA 1YIDA 4ENQA 1YBVA 2X1HA 2PLWA 2WIJA 4J0FA 4R8RA 1IXZA 2ZWOA 3EF1A 4Q1CA 5CVVA 3WBBA 2MDTA 5J2TA 2B5OA 1E0KA 2DXIA 3DLPX 1B76A 1R88A 3F8WA 3H9CA 4Q4JA 1W4BA 1EUDA 4XJTA 4FI3C 3AR6A 1TA0A 3G2LA 4ENPA 2CL0X 1UODA 1BZYA 1NWHA 2BI4A 3L1KA 4BNIA 5A7FA 3A3NA 5H4GA 4LOHA 1D2EA 3E1KA 5KPDA 1APBA 2AOUA 3HCFA 3H7AA 4G0MA 1B16A 2P9CA 5E6SA 1I80A 3GFBA 3WMFA 3CLRC 4OUKX 1BIFA 4M1YA 4PONA 1OH6A 3HZZA 3JTEA 2VRCA 1DQPA 2CNBA 1Y6JA 2C54A 2J9GA 2A1UB 2V9CA 4OGFA 3K0KA 1RAAA 3BKXA 4C7OA 4GZ6A 4EPYA 1YJ5A 1GYQA 4CR8A 4D96A 2YFHA 5EXDA 1OA0A 5J40A 3MOIA 4BGEA 1JJIA 4C03A 1IB6A 4X20A 5C80A 2HOQA 1RYDA 1F60A 5IDYA 4GNRA 1TI7A 1SC6A 1Y7HA 1J8QA 2AXQA 3WL7A 4LTMA 1QKIA 3Q3JB 2NQTA 1SBCA 2C92A 4QQ8A 13PKA 2R8OA 3NHSA 1X14A 4WXHA 1XMVA 3U3ZA 1E8MA 4J2HA 3N9IA 6PFKA 4MIEA 5L45A 1BYUA 4KPYA 1PW5A 1NRWA 3BRWA 5BT9A 4EEKA 1P8AA 2QRVB 4C3VA 1F7UA 3H99A 4U4AA 5FPTA 1JEJA 3SICE 3M3PA 4IL5A 1FC0A 1OYVA 1S0UA 4DQVA 1SHTX 2JJ1A 2PS9A 3OA0A 1I3KA 1AD2A 1CJCA 4JP8A 4DMFA 2A5GA 1UWLA 1YDMA 4CIYA 1E9CA 5FWNA 4X1YA 2ADMA 1PZGA 2ZU0C 3CPSA 4QJ4A 3U9SA 1ISMA 5EIAA 5ELMA 1PFKA 3KEOA 1NE2A 1P33A 3OKCA 5HGJA 2HWYA 1SCBA 1X7XB 2AZTA 1G3MA 4Z3KA 3LDAA 1Z63A 2BFDA 5JE8A 4OP3A 4YRZA 1ZRMA 2MT9A 3G23A 3N0RA 2X6TA 3FHJA 3FYUC 4B34A 3RRYA 2I4IA 2JCXA 3ASUA 3TR6A 4UEKA 3U7QB 4KRFA 1DHRA 3UAOA 3X2FA 5FOVA 1AIPA 3DZHA 1YS2X 2CVZA 3HUUA 3ONWA 3W1WA 3Q7QA 3ZE9A 4AY4A 1IY2A 1U7XA 2DR2A 3F7TA 2IYSA 2Z1DA 2PKCA 2ZJ4A 3DEJA 4AJJA 2OOSA 1B6TA 2B8NA 2I0FA 3CRQA 2ZQ5A 4PZDA 4DW8A 1AO0A 4ZHQA 2PE5A 2ZE6A 2NSJA 3KHSA 2J7PA 3QBEA 2F43B 2IYXA 1ZVKA 3EUFA 3EXEA 3O8LA 2CNOA 1VQ1A 4E12A 2Y68A 3AHIA 1ESDA 3GRZA 3CWCA 3P26A 3UA4A 4MMYB 1HTTA 4JI4B 1NOKA 1JDBB 1IG0A 1Y4SA 5DHRA 4MJ3A 3WLKX 1QO0A 1YMQA 5BSGA 3PHHA 2BV3A 5EP2A 3F1KA 4KXUA 2UAGA 3JWPA 3PC7A 5H02A 1PFWA 4GX1A 2RBEA 4FX2A 3IDFA 3NAMA 2BELA 4RZUA 3HVJA 2ZCUA 4IWXA 4ZOCA 2VQEB 3JQCA 3R20A 1GQ2A 2RMKA 1RKXA 3K3PA 5J23A 4Q12A 4AZ0A 4RTQA 3F9IA 5H0IA 3WBKA 3OZAA 2HA5A 4UVDA 2AFHA 3DDNA 4QIHA 3D6UA 2G9UA 3HFGA 1Z56C 1XU7A 1N77A 3OFND 4S05A 6ADHA 4LWZA 4YRPA 3WLNA 3ZZUA 1QRUA 2V6BA 1B15A 3JD4A 3S5JA 2GXUA 1BDJA 3JWJA 2REOA 1OFUX 3VDRA 2COKA 3M6UA 3FRIA 2EARA 3KQUA 1BWRA 4AKHA 2I1WA 1X9HA 2P9YA 1S4QA 3O4RA 1YS6A 5GIOE 4O4JA 1IY0A 1FDVA 1H1LB 4MPPA 3RQSA 2IVFA 3V4SA 4A82A 2B8JA 2AFHE 4V2UA 5TGDA 4A8JB 2ZRMA 1XZBA 4I2NA 4IOJA 4U8HA 1YK0A 4YQEA 5AD1A 5TE9A 5BP7A 3FOEC 5FBHA 2ZRIA 2CDCA 3U13A 3DOCA 2C7PA 1SKBA 1UQUA 1T8RA 2BEVB 2DSNA 4JJAA 3S2EA 4MDHA 2GESA 3R3WA 1SQFA 4OLFA 1CS0B 1ULBA 2NWQA 3RDPA 5KOJA 3CW2A 2XB9A 3R0VA 1PT6A 4BE7B 1NIPA 1OI7A 1ULSA 4LJYA 4UHFA 3FPSA 5TDHA 3VC7A 5CEJA 2WWFA 2BUBA 2ZUWA 1U6KA 2V96A 1NQWA 1ZA1A 2OBMA 3GFPA 3PDJA 3RJ5A 4AP6A 3RUCA 2QG9A 4DSAA 1VPEA 2Q2OA 2DY1A 2ZTVA 4IEEA 4LYYA 4PLVA 3L7LA 4QUBA 4RJIA 5E6RA 4FB5A 1MZPA 4OK5A 2LCQA 3UVEA 3EVAA 3FNIA 3GJYA 2OTCA 4GM0A 1EX7A 2VKQA 1OKKD 4V0QA 1P6QA 4LWPA 1E2GA 2V98A 3BQMB 3SYLA 3ZV5A 2EBFX 1QZTA 1P8JA 4PV7A 3WGHA 5FQNA 3PKJA 3H1FA 3VHLB 1U0JA 1ZONA 2HV9A 2ODTX 2ZKIA 5AM4A 2WSSA 3DFFA 1IBRA 3T38A 3UTDA 1M2NA 1T25A 2PLRA 3NHJA 1VHWA 4I99A 2C78A 5E4JA 3TTWA 2Y0BA 3TJMA 1U9JA 1JR2A 3R7DA 1XO1A 3CNNA 3RK1A 4TKMA 1NN5A 1KSFX 5AOVA 4DUGD 4DA0A 2H29A 1W1UA 1A71A 4GLLA 3TMYA 2ZRFA 1AS3A 2CJYA 4HGYA 4DBLC 1WV1A 2JW5A 5A62A 1KL7A 2EBUA 3IUNA 1HRKA 1Z28A 4HWTA 1AV7A 2PZBA 4YDHB 1I0IA 3EX7C 1I3OA 1OFHA 2GOYA 2R1VB 3O8OA 4IIYA 2VLIA 4ZQHA 1V71A 5I9TA 1UZAA 3TTYA 2C9OA 3ZVNA 1P80A 3E7XA 1E59A 1D7AA 3OCCA 1DTSA 5IBRA 2IPLA 3WGQA 1W5AA 2BFMA 2FEAA 3UMJA 3KR1A 1P2SA 4Q21A 1GTRA 2GPJA 3FVQA 3IVMA 4BMDA 2XF8A 3A6FA 2GN2A 3A6JA 5AHWA 1OBVA 4G2TA 4JJKA 4PU0A 5JMPA 2VAXA 1ZUD1 4DCPA 3MWDB 4EFNA 4BGUA 3WZMA 3AQIA 4YCDA 3JWIA 4BRZA 1E9SA 3I53A 4G9GA 4YMIA 4CL2A 4G67A 4MI6A 2C4MA 1WA5A 3UPUA 3Q9NA 5JCZA 1K1EA 1FDIA 1GRRA 2GEUA 3DF9A 4ZDKA 6Q21A 4E51A 3JYPA 4RABA 1XMSA 2JANA 3UK1A 2W58A 1SCDA 1KGDA 4ALIA 2ZCJA 1Y82A 3TZLA 3NOVA 3A06A 3E7WA 4ADSG 4DLLA 2PFKA 5IJWA 4AXBA 4M53A 4NPAA 2DWOA 1DVRA 1XXHB 2W2LA 5EWMB 5EIEA 4U02A 3SGLA 1RXIA 2W2KB 2YNMC 1M1YA 3EVDA 4HQLA 2BONA 4IG9A 1J4AA 3DOIA 4RY2A 4UE6A 3ZHBA 4OFXA 4BQNA 4RH1A 3B70A 1V1MA 3DONA 3FCSB 3PGXA 5I9SA 3WGUA 2I6FA 5CT6A 4C21A 1DKPA 4JLWA 1DZIA 3ZHYA 4FR5A 1V3VA 4V38A 3CUEF 3UWMA 5IF9A 1TM7E 1PEYA 2CXHA 4M1OA 4XIYA 4P4SB 4EKIA 3JQAB 3QKRA 4G4IA 4HY3A 4RORA 1W1IA 2YS7A 3Q41A 4XUCA 4JOQA 2GKSA 1RFLA 5EGSA 3K0EA 2QIOA 5CVUA 1IHXA 2E2WA 2JFWA 5DWQA 3WS7A 5FAKA 2EDAA 4GL4A 4X7BA 1UMKA 2XUIA 3JAWA 1UBFA 1HT2E 2QE7A 1ISGA 1YRQA 3RTBA 3K6SB 4FWIB 3T3OA 1X70A 2QZJA 4FE3A 5LZ9A 1A5TA 3N6RA 4MVCA 4R81A 5BQ3A 1ZJWA 3J7AC 1IZ9A 2VNIA 1GTG1 2FUEA 1M1YE 2BOVA 3BMNB 3HXTA 4PHTA 5DP2A 5T4FA 5HRCA 2C00A 3NBMA 3LBIA 1QMPA 4DSNA 1T6ZA 1KH1A 4DPLA 1C50A 1ZMBA 2H3EA 3LKDA 4OJYA 2RAVA 1J8VA 2WWRA 3RAEC 3PNPA 1RE1A 1C2TA 2GXQA 2FSUA 1F2TA 1F2VA 4Q19A 4HNGA 2FPKA 1JEQA 2ZI4A 3BULA 2XXJA 4MWZA 4W5HA 4YALA 1JSLA 4I1YA 3MXTA 1Y42X 2PGXA 3WADA 4NBRA 3LBFA 3O1JC 5L53A 3KYIB 1ZITA 2SBTA 3EOAI 5C9ZA 2PCJA 3JSAA 5AVYA 4F2GA 1B23P 4X8MA 2GYWA 1VRCA 5C1DA 3VR4D 4KFCA 1H8HD 2FXVA 4NS1A 5DJ5A 1X6VA 3O4IA 2AJBA 3QU9A 3QVUA 5F98A 1K8XB 3CA8A 3FWHA 4AF8A 3DVQX 3U60B 1MU0A 1EXMA 3KE8A 4IQGA 3ER8A 3MJ4A 4UDXX 4DMUB 4Y2HA 1EP1B 1GRNA 3N58A 1SHJA 1SM4A 3PG5A 4DLNA 1KI6B 3Q12A 3BUSA 3R3HA 3HYCA 2KQUA 3ELWA 4M83A 4PG6A 1A7UA 5B7GA 1KAHA 2Y1LA 4JHLA 5LNK6 1HEIA 3L93A 2G6BA 2Q5IA 3CLRD 1HH4A 3HRIA 3IDSA 3OH8A 3ZXSA 3TQFA 4D41A 2QNIA 3DHVA 3IMEA 1CQWA 2FPMA 5KYYB 1WXEA 1KVRA 3EXAA 4I50A 4TTTS 1S8FA 1KJZA 3QEMA 2P2YA 4HUJA 3ZVKA 1QV6A 1Z0IA 5HRAA 1GL3A 5C51B 3AVXA 3LDUA 2JLRA 2OB2A 3WO0A 3BFPA 1A2OA 1GQRA 1E3TA 1U1CA 5D5PA 1Q14A 2JGLA 2WTEA 3LUDA 1N2IA 4DARA 3AUFA 2JNWA 1TT5A 2EZ8A 4ZI7A 5BQOA 4ER6A 3GJ8A 4TQGA 2WMYA 5JMOA 1KAEA 1XRQA 3I8SA 4CLOB 2R48A 1I10A 3R6TA 3I9KA 3EBOA 2C98A 3MGKA 3QP9A 3UHJA 2HSWA 2FY8A 1L8XA 1E1KA 2PS1A 4WDRA 3CVOA 3TLBA 4P84A 4B3IA 5JNSA 3EPPA 3UJHA 5GIPE 2E7ZA 3TW8B 5G4LA 4F93B 1CZNA 3AESA 2ETXA 3WKEA 1AGNA 2HQBA 4H7EA 4MARA 2O8EA 2G9VA 1U65A 5JZBA 1YQTA 2VLBA 1PIWA 3L79A 1JVBA 2IDMA 3QU4A 3CUKA 4JL8A 3U0VA 5KNBA 4D97A 2Q0QA 2N1BA 5B30A 4ZANA 3LQ4A 1WETA 3C3EA 5EE0A 2PKYX 1LEHA 2YXLA 1XRMA 3MA0A 4MVWA 2CSUA 3ZBUA 2GO1A 3FDXA 5KQGA 3P9CA 1ZMXA 2WWYA 4LFBB 3KJEA 3OIFA 4LEIA 3I72A 3K0HA 4GDMA 1U0EA 4F9TA 4J4TA 2ZIEA 1FDUA 2J41A 1PW7A 3LXRA 2XR1A 1JZSA 1ZD9A 1PNVA 2J4FA 2X0JA 5KNBH 3TVTA 4PS1A 2ONKA 5C1OA 4U3JB 2PZKA 3O8QB 1PUXA 2GF2A 2HA6A 2GM3A 4P32A 4Q18A 4Y6LA 5JO0A 4N0EA 3WGZA 1NUTA 5AXDA 4Z4QA 1XZQA 3VYSB 1KJIA 2JD1A 3TSAA 3ZZMA 1AHPA 3NDJA 2Q5OA 3IGFA 3WDMA 2NTYC 2CDAA 2DFLA 3ZVLA 1HF3A 3R8FA 3QBJA 3I37X 2QXUA 1O94C 4LVUA 1DIOB 5LN1A 4IFTA 3K5WA 4A15A 4G25A 2BD0A 5CT5A 5JDIC 2I2WA 1M74A 2X2FA 3OT1A 5CDFA 4EL5A 5BR4A 1E89A 5IP5A 4IG4A 4H1TA 1FYXA 3ORHA 2Y77A 3IP7A 3NGLA 1IHPA 2IRWA 3R3SA 4B4KA 5AKYA 4YJ2F 3QKSA 4HDOB 4FMPA 1M1NA 3ZWVA 5CT9A 3BIWA 4GOND 4AJKA 4JLMA 1A5BB 1W29A 1LV8A 3NCTA 4YECA 1MKYA 5ALIA 5BWBA 1A88A 5JD4A 1G17A 2Y66A 4DDKA 2CXXA 2I71A 4F04A 1RBYA 2XMCA 3DMTA 2C5HA 2GWHA 3JYOA 1JB1A 3PYMA 2AMJA 3OJWA 2DRIA 2C8KA 2J46A 1L3BA 2VHTA 4C6SA 3FGOA 4AO6A 2FPXA 4BFXA 5JFOA 4WOBA 4OHVA 1ADGA 1SCAA 5CK5A 2W6MA 1QUEA 4WLEA 1GAWA 1QZUA 5CDFE 2OQRA 1JLRA 1EHIA 3SMQA 4OHRA 2E6KA 1A8PA 1R64A 1XJ0A 4YJFA 2C9DA 4BCCA 3WLFA 1VGVA 4D6YA 5FR2A 1VC2A