1DVRA

Structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
SSESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase (phosphotransferase)
molecule keywords ADENYLATE KINASE
total genus 70
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dvrA00
2J0QA 3QKRA 3AB3A 3BFVA 3K0FA 4M4SA 4PFSA 4QC2A 2DBYA 5EZ5A 5LPNA 2WIBA 3EA5A 2CBZA 3RAPR 2BKEA 2F1RA 2W0MA 3WXMA 2QTVB 4DLSA 3AVWA 1E79A 2A5GA 5IDVA 5DO9A 4ITRC 2O5VA 4UXHA 2P5TB 1IXSB 3BXZA 3HU1A 2ZJ2A 4P3YA 3TKLA 3RSOA 1TNDA 2J9RA 1ZUNB 3W6OA 1DS6A 4IJMA 4AI6A 2OCAA 4LHWA 2KJQA 2IHYA 2VP0A 4PHFA 2C95A 2HT6A 1P7CA 3DDCA 1TF7A 4PAOA 2GF0A 1IN8A 1BKDR 1QDEA 3C16C 1EESA 2O8BA 4IDHA 4TYNA 4V03A 2ZSDA 2VSFA 2F1HA 4LJ6A 5BQ5A 2CE7A 5SZIA 2GEUA 1US8A 2FN4A 2Y8EA 1XMIA 2ATVA 2QY9A 5K8UA 1HT2E 1ZNWA 4MRSA 3ADDA 1N5IA 4PTLA 4TLCA 4QJ5A 1YR9A 2A7QA 1FUUA 2VEDA 5FL7A 4YQFA 1KDPA 4C9BA 5E95A 5CLLA 1G9XA 3T15A 4RCYA 1U0JA 4K81B 1MO5A 4ACAA 1E0KA 1HT1E 4EFLA 3WP0A 1SKYB 3MJHA 2HYDA 3BK7A 4LJYA 1Z0KA 3DZDA 4ON9A 1COWD 4NE2A 2GRJA 4NONA 1N6IA 1R8QA 3A8TA 2J0UA 2J0SA 4ZI3A 4TYYA 1XWIA 1DTSA 3OE7A 5HTKA 5LD2C 2DFTA 1XF9A 1T5IA 3NIBA 5C46F 4TLAA 4BECA 4DDTA 1RKBA 3IHLA 2IC5A 4Q4JB 1R8SA 3KX2A 1E1QA 1GNQA 1WBBA 4NYMR 4Q47A 4Q4HA 2GXUA 2J87A 4JJKA 4NYJQ 1ZIPA 1F3OA 3PUZA 4CEJB 3C8UA 2FPKA 3FMIA 4G5GA 2GEVA 2P6RA 2O8BB 5EP2A 4JYBA 1I4DD 1XZQA 3DM9B 3MRSA 1N6PA 1NN3A 1ETUA 2GBLC 3L43A 4H9GA 2FNAA 1E9BA 1M7GA 2DWOA 3T5GA 2WIAA 5LD2B 1IN4A 1NLYA 4JIMA 4XSGA 2FGKA 4AC9A 2A30A 2HLDA 1J99A 1GL9B 1E9EA 3QEJA 4B32A 4Q7KA 1KY2A 2WWFA 1N6RA 1LS1A 1ZC4A 1WE2A 2ZJYA 4XSHA 1Z28A 2ZI3A 1S1MA 2ZE6A 4TMWA 3X1YA 2AK3A 1W1WA 2BCGY 3LQRA 3MWLA 1NMYA 3BS4A 2GCNA 2VYFA 1D2EA 3W3AA 4JLPA 2OLKA 3K70D 1ONBA 2QRZA 5CDFA 4A0FA 2R6FA 3BFXA 5AUOB 1KHTA 2H16A 4DDUA 3THWB 2A5FA 4JVMA 4V02A 4AYXA 2NPFA 1OYWA 5JWOA 1XTIA 4R2IA 3LXXA 4TQAA 3AVOA 4NZYA 1LF0A 4KODA 1KSGA 3SFZA 1AZSC 3MAAC 2IXGA 4A82A 3LW7A 4B33A 4NMMA 1M74A 5A4JA 1IQPA 1T3LA 4NYMQ 4HB3A 1D2MA 1KI4A 1XJ0A 2RB4A 3LVRE 3G82C 1JNYA 2ZVQX 4TYQA 4ZIRB 3GLIE 1AS2A 1N6NA 4D4MA 1T6NA 5J4KA 4Q4AA 1OSNA 3TW8B 1E2IA 4IHQA 1G5PA 2VF7A 1WCV1 3Q3JB 3FE2A 2DCUA 2VLIA 1H8ED 4IVQA 3SC3A 1R2QA 1FOEB 3GJ3A 3NBYC 2HEIA 3DMDA 3IQXA 2BHRA 2JLXA 3TSZA 1ZM9A 2IYRA 2JLQA 2OCPA 2OSBA 4EQ6A 3TUZC 3GLFA 1OH6A 5J47A 5UKDA 1OFTA 3KQUA 1SXJA 1QF9A 4S2EA 1G21E 2MSEB 1BOFA 2ONKA 3WY9A 1AS3A 4Q19A 3MGCA 4EPYA 1FX0A 2GCOA 1DOAA 3PEWA 1Z29A 621PA 4Q9JA 3SDZA 2C96A 2V54A 4LHXA 3CLVA 1G41A 3OF5A 4LV5B 2ZYUX 4URXR 3H84A 4HAWA 4PPFA 5CM8B 3QF4A 2C98A 4PC1A 2IT1A 4DLUA 4NU0A 3VFDA 4OJQA 4ACBA 3I4LA 2IA5A 3BIFA 3Q72A 4D0GA 4D4KA 3GEEA 1B23P 1XMJA 1BH2A 2QT1A 2YHSA 1MRNA 1OW3B 4F7WA 4TYPA 3A4LA 3I72A 1SVSA 3KJHA 5EE9A 2ZR9A 3K0EA 3OAAD 2WM9B 3W6NA 3TAUA 5AJVB 2X8AA 5K8TA 3PG5A 1KI1A 1NSFA 5HKKA 4L16A 2MMCA 2PT7A 2Z6VA 2ZEJA 4WVFA 4RJLA 1OXSC 3P26A 2NTYC 4RZUA 1UDXA 5EP3A 3QKTA 3ZIAD 2AD1A 2AX4A 2WZQA 3V4FA 2J46A 2D7DA 3CZPA 5TDHA 5CYPA 4Y0AA 2Q9CA 4BE7B 2JA1A 2QENA 4Q4JA 1G17A 3GPLA 3ASZA 1DO2A 1OF1A 1Z5ZA 2ZRJA 4HUTA 2ZRGA 3ND9A 3SR0A 1ZC3A 4Q4HB 1GKIA 2FE4A 4TLDA 2QGZA 3GP8A 4XTRA 3L2OB 3NXSA 5AR1A 4DB4A 1EFUA 3MLEA 1RZ3A 2ANBA 5FOXA 4ASUA 4OHXA 4HB0A 1FL9A 1OE0A 4R7ZA 1YZQA 4HAVA 2RCNA 3CRW1 1E99A 1XTRA 1ZM4A 1XEXA 1RRGA 3A1VA 3QF7A 1EFHA 4WAUA 3ECCA 1Q1BA 4LJ4A 2WMOB 1GNPA 2ZPTX 3A37A 4QKQA 1LTQA 4YMSA 3RWMB 4R2HA 4XIGS 2CDNA 1RW4A 2LKCA 3A1SA 3RWOA 3WNCA 1L4YA 5JRJA 3N2EA 2FJUA 1Y63A 4IFBA 4EPXA 3THXA 2VA8A 1XEFA 3RABA 2I1QA 3A1TA 2KWIA 2QT0A 3JZAA 3Q9LA 4DLXA 4A2PA 4KJZA 5JJKA 1AKEA 1F6BA 2Q0HA 1Z06A 4ILEA 5CK4A 1OFHA 2ZJ5A 4HEJA 4D26A 1P6XA 2CL0X 4C0QC 1NSTA 5H1YA 221PA 4XJXA 5AUNB 4BLRA 3IEUA 1VG1A 3CB4A 4P31A 3GLIB 2D3WA 1KI6B 2WTUA 4PHHA 4NDZA 3AF0A 4I81A 3U2QA 1OHHD 4DB2A 2ZIAA 2VH5R 4DSNA 2V7QD 4LHYA 2IUTA 3IIJA 4UNRA 4C7OB 2NPIA 1E2FA 1DAKA 3B85A 3HU2A 4ZCIA 4C4PA 4Q4AB 2E9SA 2WJIA 4XVQA 4URUR 1GRNA 4LYJA 2ZE5A 4QRHA 5IK2D 3K9NA 1G20E 1PUJA 1KJYA 4FMDF 2Z43A 2OESA 2WWWA 3DKVA 3T1OA 2RAPA 3PUVA 1W2HA 1E98A 4LK2A 4RFVA 3W9YA 3BE4A 1P9NA 3OEHA 5FR1A 2WWXA 2BJVA 1EX6A 1F60A 2REBA 3AEZA 3SJBA 4IXNA 1GVNB 1N0UA 2H8KA 4D0NA 1SHKA 2ZJOA 1UBEA 1R0WA 1ZM7A 4BASA 1KO7A 3U44B 1P62B 3AF1A 4FMBB 3THWA 3QPVA 3CW2A 3CUEF 4GI7A 3B6EA 3K09A 2NOAA 3FMOB 5L3RA 1VIYA 2C9CA 1LFDB 2XOKA 1S1CA 3HYRA 1YZGA 4JLKA 1E2MA 4AIIA 1A7JA 2VF8A 2V9PA 3SI7A 1U0LA 4TZ6A 2I4IA 5JJIA 2ZRFA 1SKYE 1KAOA 3OEEA 4LX0A 1XEWX 5JEDA 1W4BA 3F8TA 1Z47A 1M7HA 3LFUA 2YJTD 2FFAA 2IYWA 1UEIA 3CKLA 4RD4A 2R44A 3T35A 3JVUA 3PCRB 3FGNA 1JQLB 1NI3A 4PSKA 1GWNA 2DHRA 5CJ2A 5DI9A 5TXGA 2VBCA 2RGXA 1G6OA 2EWWA 4HUQA 2OM2A 4L8GA 3CNOA 4NHOA 4KXFB 2G9NA 4B3BA 1KNQA 4EJSB 1P60A 3AKCA 2GK6A 2ZJZA 3KQLA 1H65A 5L3SB 4UNSA 1ODFA 2AK2A 2JEOA 4DLYA 3ZQJA 1U8YA 3GMTA 4RVCA 5FPSA 2DFKB 3C5CA 3SQWA 4ZPXA 1OIVA 4K8OA 4C0HA 4LYAA 2GCOB 1FX0B 1DG3A 1OIXA 1W47A 3KKMA 4GSYA 4WZ6A 1SHZA 3FVQA 4V0OA 3I1FA 3AUYA 3AP1A 4PSVA 2GILA 2VP9A 2ZRHA 3BOSA 1PUIA 1ZJ6A 4FINA 5L3QB 2IYVA 5BN5A 4GBMA 1KNXA 3AF3A 2OCBA 3DM5A 4QHTA 2YNMA 3T1VA 4BZQA 3AGPA 4EJSC 4EPWA 1GIAA 1XCGB 3JVVA 1FFHA 3G0HA 1MABA 1KGDA 2PMDA 2RGNC 3CF2A 4Q1FA 5K8LA 4DSTA 2CCGA 4W5JA 4BGDA 3QNUA 4JKYA 1UF9A 3GLHE 3CX8A 4R9UC 4RZ3A 5GJVC 1ZBDA 3QVVA 1D2NA 1PZNA 4DHEA 3QKRB 4ZCMA 4XTCS 3RRNA 1P3JA 3CR7A 1HV8A 3B5JA 3LAWA 4A15A 4HUQB 3U60B 3ZZUA 2XZLA 5F9FA 1E2PA 2FSIA 3AKDA 3LX8A 1YZTA 3MFYA 2RGAA 3GLGB 2ZS8A 3BJIC 2BBTA 4GOXA 1Z2AA 4KBGA 4ZDWA 2XOKD 1VHLA 4BFXA 2ZANA 1HE1C 421PA 3IPYA 2W6JA 3BFKA 2VTKA 2R2AA 1IAQA 3K0CA 4M53A 2WWYA 3B1XA 3F3YA 1U94A 5DI3A 2CNWA 2NZ8A 3B60A 4MA4A 1DELA 3KJGA 3UMRA 2BBOA 1JB1A 1DARA 2JJ1D 3FPAA 1R4AA 3NTUA 4OI2A 2A78A 2GESA 3A1WA 1SVIA 3GFOA 1ZNYA 2IBMA 3FMFA 4V0NA 5DLQC 3PR1A 1JBKA 3ZVRA 1DADA 1GFIA 1Z6TA 3H2YA 3LA6A 4JBXA 4D81A 1A2KC 3D3QA 3IGFA 4FWIB 1GSIA 2BKUA 2XXAA 2PLRA 3CRRA 2V7QA 4PPQA 2ZJBA 4YONB 5J5CA 1NKTA 2VHTA 3M0EA 1E9CA 2W58A 3GFPA 5FBQB 2ZI9A 2FFQA 1TQ4A 4BLSA 2R9VA 1WBDA 5HCIA 2QAGC 1KJWA 1CJVC 1OH8A 4M1SA 3P20A 3VHLB 1IONA 1A82A 4NCIA 3Q8XB 2E87A 1FZQA 5KYKA 1T3HA 2ZI6A 2QORA 4M21A 1CRPA 2AKYA 2IF0A 1FNNA 1VG0B 4LBZA 2OCYC 4AURA 2DPXA 1DG1G 5FFMA 2FSGA 5C2JB 2IYZA 3R20A 3VR5A 2AXNA 2R8RA 2ZRPA 1N0WA 1ZD8A 1HA3A 2ZRBA 3M6AA 4TLEA 4C0JA 2WKRA 3SBEA 3DL0A 1M2OB 3EWSA 5BN3A 1M34E 4E5UA 1TQ2A 4K46A 4P4SB 3TVDA 3EG5A 2FPMA 5D3MB 2O8DB 2NO1A 3B1VA 3Q5EA 2ASEA 1NY5A 3R9XA 3GLHA 1FP6A 3DOEA 4QJ3A 2PX3A 5EP1A 3BC1A 5SZJA 1YVDA 5FUXA 1W0JA 3CF6R 3I8XA 5CB8A 2CVHA 5C4GB 1SULA 2XTZA 1QHHB 4M9XA 1G7TA 4S35A 4TSFD 4TT3D 4BRUA 4Q9LA 4EFMA 4QGAA 4AKEA 1OXXK 3PEYA 3GJ5A 4GL2A 3K1JA 1XMVA 2KE5A 4I1OA 1P5ZB 1XX6A 2CLCX 3U44A 1DAHA 3FHCB 4BLPA 1NVVR 3KTAA 1GZSA 2IF2A 1G8GA 1O3YA 3LDAA 1YQTA 4NYIR 3KJEA 3AQ4A 3SQXA 1EWQA 3IIKA 5L3QA 3MJRA 1N5KA 2FOLA 3V9PA 4G5RA 4D80A 4NPHA 4BZPA 5G3ZA 3FDIA 4BFWA 4OJKA 5FTNA 3LXRA 1XCMA 1II9A 1R0XA 1DAEA 1L2TA 3R7WB 1KO8A 4PZYA 4DEXA 2V4ZA 1Z07A 3IEVA 2KBFA 2OG2A 1OT3A 1T4GA 4URWR 1X3SA 3W34A 4EIWA 2ZS7A 4F92B 5E3HA 3UG6A 3QKUA 4LZZA 4QNRA 2GDJA 2NO7A 4P32A 3THXB 2FFBA 1ZUHA 1VCNA 4X8LA 2EFDB 5JFGA 2MSCB 3EC2A 5H70A 4DT1B 2C78A 3A1UA 8OHMA 5A5GA 3EARA 1I4LD 1HQCA 3IBYA 3SYLA 3L0SA 2ZM5A 3VU9B 5JBQA 2AKAB 3EC1A 5AWFC 1NLZA 3O8BA 5KDDA 1D5CA 1E94E 3AV0B 3I62A 1IHUA 1W4RA 1KI9A 4B3GA 2P5SA 4KVGA 1VKJA 2J7PA 1CS4C 4QGGA 4YMWA 2Q3MA 1FQJA 3KUCA 5HKKD 1KY3A 2QROA 2WSSD 4UXIA 3QENA 1P2VA 1U9IC 2CJWA 3QIAA 5M04A 4ERNA 1CEEA 1G7SA 2DYKA 3C7KA 4JSTA 2XX3A 1E69A 5DSZA 2GJAA 1G291 4CYMA 5F9HA 3L8ZA 2AHOA 2EU8A 4B3XA 2C77A 4LHZA 3GLGA 1JR3D 4AYWA 1MO4A 1J8MF 1H8EA 2D2EA 2OLJA 3MWJA 4O2RA 2LCFA 2QAJA 3TMKA 2DFNA 4XWOA 3AKYA 5CIWA 2Z4RA 4LBVA 2O8FB 2CLSA 3ZZ0A 1JR6A 1QHXA 5BYKA 1QHSA 4GP7A 4DT1A 1HH4A 5JEEA 3TAHA 2BEKA 2OE2A 4M0LA 2ZTSA 3T12A 1U81A 4FCVA 2J59A 2ZS9A 4Q21A 1AGPA 3Q5DA 1G5RA 2IW3A 2O0JA 3VR1A 1PVOA 3A4NA 2J1LA 2YOHA 2IWRA 1W4AA 4XD7A 1E9DA 4C30A 2IYQA 4MH0R 3KZ1E 4Q1EA 1UKZA 2O52A 2RGDA 1C4OA 1HE8B 1FMLA 4L15A 1Z3IX 3LW8A 2GJKA 3NG1A 4QNMA 4DCVA 3X1XA 3WYFA 3T06B 3UWOA 3NVAA 4TTPA 4B34A 1DO0A 3ZVNA 2W0SA 3H4MA 1CRQA 2QU8A 2XITA 4BFYA 2YOFA 4X8HA 3EIEA 3LBNA 2CEAA 3KKQA 3LY5A 1IY2A 5EUMA 4DLWA 4JBWA 2WJGA 2KB0A 3EPLA 4M9ZA 4HYYA 4Q5IA 5L3SA 3EIQA 4GFDA 1N3BA 3EPJA 4IW3B 2JJ2D 5ELXA 1F5NA 1PLLA 4QFMA 3UXMA 4OKSA 3OZXA 4WIAA 1KZGB 3GJ7A 5CYOA 1W49A 3ZVMA 2C03A 3C4JA 1MOZA 1G18A 1E2KA 3TSWA 3KUDA 2HYIC 2BOVA 2J7PD 2RGGA 1XP8A 1YZKA 1Z6YA 2I1VB 4O2LA 4TQ9A 4LV6A 4TL8A 5KNBA 2YWEA 1QRAA 2A5JA 5E7JA 5JI3E 3QKSA 3EIHA 1SXJC 721PA 2C2HA 4US0R 3H86A 2KI5A 1O87A 4B48A 2W00A 5DHAA 3UANA 2HDNB 3UMFA 2HF8A 3C5HA 4L9WA 4W7SA 5EXSA 3ZD7A 2WJVA 3GLGE 2O8EB 2C5LA 2PBRA 2QPAA 3QG5A 3EZ6A 1EXMA 4PANA 1DEKA 2ZRMA 3AVVA 1ESNA 2WKPA 4TMTA 2REXB 2UZ3A 3DVLA 1BYUA 1XTSA 2BVNA 3FKQA 5J4VA 1E96A 3F5FA 2D7CA 4LJ9A 2RGNA 4YDHB 1K6MA 4Q03A 2VQSA 1G3RA 1Z8FA 3QG1A 3SE0A 5FBRB 3DPUA 5KHOC 3CZQA 1JALA 1E1QD 1S9DA 2I3BA 2WOJA 3CBQA 2IX3A 1YZNA 4F4JA 1E2JA 2CHVA 4ZCLA 2R65A 4F91B 3GLFB 4NBSA 4EUNA 5JCZA 1RRPA 2H57A 3HP1A 1G8FA 1FQKA 5JCPA 3BAFA 1MKYA 1GG2A 3U3JA 2IS2A 2HF9A 3GD7A 3RANA 1OHHA 1W48A 1UBCA 4NCNA 1FTNA 2NG1A 4BEBA 3I32A 4MKHA 3NH9A 2J45A 4LJ5A 1X8JA 2AWOA 1CBUA 1EFTA 1JECA 1XEXB 3QXXA 4C0LA 5JSZA 4IVPA 4KYUA 5F98A 3RS2A 4DIEA 2RGBA 5BXQC 1IY0A 5IK2A 4Q4LA 4M1MA 1SGWA 1HUQA 5KSYA 2OAQ1 1NBMA 5B2ZA 4ARZB 3OHMA 4ZDKA 1NIPA 4HSEA 1E1RA 5KSOA 5EE1A 3K8YA 1M8PA 3UMSA 4B76A 5B64A 3U3MA 3D7MA 2GJSA 1W4CA 4Q1DA 4CEIA 4UJ3A 2CMKA 1ZM2A 2BM1A 2QTFA 3OE7D 4WZAE 1KDTA 2PCJA 2FSHA 3AUXA 4Z8XA 4M1KA 3ZQ6A 4EAQA 1Q22A 2CL6X 2P2LA 3LRPA 1JPNA 2JLYA 1NN0A 4GP6A 4YXWD 5FPKA 4EFNA 4TMKA 4YMVA 1K8RA 1N5LA 1JR3E 3EPHA 3ZDQA 2RGEA 2N46A 3WHKA 3WP1B 2GCPA 2KSQA 1ZCBA 2PX0A 1VG9B 1W36D 4LJAA 2JATA 5D3MA 1KI3A 3PIRA 2OILA 3T1TA 4W5HA 2QE7A 3UKDA 5HZHA 1KJZA 4OHYA 3U3KA 5FUYA 1II0A 4OK6A 1ZD1A 4OHWA 1NKSA 3IBGA 2QQEA 2E1RA 2Q6TA 1TF2A 1RJ9A 4QHYA 3I8SA 4HAXA 821PA 4H1UA 2A5DA 2F6RA 1YU9A 2NO6A 4NCKA 4LBWA 3UK6A 2D2FA 3ND8A 4HDOB 4QOSA 1RRCA 4TQUS 3VAAA 2WSMA 3P4YA 4JL8A 2O8FA 2P65A 4IXMA 1BMFD 3VNVA 2JDIA 2GXQA 2ZU0C 3F0TA 3Q85A 5IT5A 5J4HA 3CWZA 3WYGA 4JL5A 2V55B 5KOYA 1V43A 3KJIA 4HDQB 3W90A 2ATXA 2XTNA 2FV8A 3GJXC 2FZLA 4RZXA 2G1KA 3OFNA 1XPRA 2IYSA 4CT4B 2OV2A 4MUBA 4GDFA 5ANRB 4V0ME 4A2WA 1I4TD 2QEQA 3CRMA 2BIFA 3QUSA 1SVOA 3DO6A 2ZRAA 3VR2A 3R8FA 2F1JA 2OXCA 2V6IA 4PHGA 2YV5A 1OFIA 2CL7X 3EAQA 4RZ2A 1HURA 3QE0A 4V0LA 2J3EA 3TW4A 4IOMA 2JIZD 3K53A 3TH5A 3AVQA 4OQXA 3QQ5A 1AM4D 5CLQA 2XNDA 4NCHA 3UIEA 3SBDA 1RFLA 4BEJA 2PL3A 4N0DA 4YMTA 2WJHA 4TZ0A 1MR3F 3VKHA 3E70C 4JKIA 2FPLA 3S1AB 5EQTA 4B2LA 1XTQA 1M7BA 4KVAA 2CVFA 3K0AB 4JLNA 2HXSA 2IYLD 1LNZA 3PENA 2OFXA 3LQQA 1SKQA 2GZAA 3GJ4A 2GKSA 5HZKA 1S96A 1KKMA 1NNEA 4EPRA 1G8PA 2FU5C 4TMZA 4DVGA 4H1VA 1Q21A 2VP6A 4KFUA 2ZRKA 2IUUA 1GNRA 2PEZA 4JYCA 4X8OA 3KQKA 1XPUA 2NO9A 2VP2A 1AIPA 2EFHB 1X8KA 5KNCA 1KZ7B 4Q7MB 4Z1MD 1OH5A 2BMEA 3PEVA 2PLFA 4DIDA 1TQ6A 5G53C 2B92A 1XTKA 1KK2A 1UDWA 5SZHB 3NDBB 4M22A 1AGRA 2ODBA 2OO7A 5EXPA 1OXVA 1BS1A 2GJ9A 3HPQA 3KXKA 4TT3A 4HZUA 4TSFA 5E4FA 4DCNA 5HR5A 1P2UA 1S2MA 4W5WA 4FI3C 2FEMA 5EJEA 3CM0A 2ZI5A 3QSYA 2QSYA 3WYAA 2ZSAA 4LJ7A 1N6LA 2C9OA 2HJGA 3QEOA 4Q1CA 3FHTA 3TIFA 4PO1A 3EZFA 5CB6A 1VCOA 3L82B 1E0AA 1VMAA 1Z6GA 2JLWA 1BMFA 2PMKA 4OI1A 1FW6A 4HI0E 1C1YA 4TTQA 1TUEA 3PUXA 3MWYW 2WPDD 1R0YA 3LLUA 2FSFA 1IM2A 1R5NA 4DDVA 5DGXA 2OZEA 1KO5A 4JLOA 2BDTA 2OT3B 4IDPA 4B47A 2AL7A 2XJ4A 4YMUA 3U7GA 3CX7A 3NH6A 3RS7A 3B9PA 1XJQA 4DCUA 2VHJA 2X77A 4HLUC 3U5ZB 4WXPA 3UWKA 3L0OA 4AD8A 3ZYCA 2BV3A 4ABYA 1QVAA 4PC6A 4BQSA 4A8JA 3RRZA 3QBVA 3IDQA 3X2SA 4DWJA 1T3SA 2FX3A 4B43A 1Q3HA 2TMKA 2HV8A 3RRMA 4C0AC 1EGAA 2FZ4A 2ERXA 3QBTA 4JLAA 1ZAKA 4LUCA 1A2BA 1GITA 2Z5FA 2BWJA 4D4JA 1Z22A 1ZIOA 4PQRA 4J0QA 4B74A 3HPRA 4M9SA 2PZGA 3GLIA 3X1ZA 1AN0A 1Q3TA 1MV5A 5DI3B 1E2HA 1CIPA 1UM8A 2J7KA 5JHHB 5AJZA 4GPTA 4KCGA 3B1WA 3OESA 2O8CB 4PPNA 2WWIA 3HYTA 5H8WA 5GVSA 1BYIA 2OFOA 3LV8A 1J8YF 1Q1ZA 4RSGA 1WXQA 2ECKA 4A0RA 2XGJA 4KI0A 5L3VA 2ZVPX 4E22A 1Q1EA 5LB4A 4JS0A 5EXXA 3GLFE 1G3UA 2VSXA 2YWGA 2QM8A 4A6XA 1OXUA 3W8RA 4M8NE 4XD7D 3MSXA 2JDID 2OBNA 4PZZA 1CTQA 3LWNA 3U7EB 3UPUA 3BGWA 2Q9BA 2FA9A 2BMDA 3IO5A 3VX4A 1SVWA 1IN6A 1N6HA 1NMZA 2RHMA 1RPZA 3KB1A 1KYIA 1Z6XA 2ZJ8A 2RH5A 3TE6A 4A6PA 5TVKA 1XXHB 3OFND 1DVRA 4Q7JB 4B75A 4N3NA 4W9MC 4OI0A 3D31A 2G3YA 2HUPA 3SN6A 4QBGB 5JMTA 2J5XA 3SEAA 1WF3A 3RS5A 4F93B 1KI7A 4GRAA 3NHBA 4JSYA 3MCAA 1G8YA 3EW9A 4OQMA 3U3OA 2XXAB 1QHGA 1T0JB 4NYJR 2NQ2C 4E03A 4PAQA 4A2QA 1D6JA 1EWRA 2QSZA 2ZSEA 1IXZA 2QGNA 2ZUBA 3DEFA 4L5BA 4DRZA 2QPOA 1GTVA 2ZI4A 5FBVB 1XPOA 3AF4A 1K5GA 2XNDD 2OBLA 1EK0A 4MITA 4PPGA 1W44A 2QRNA 4MRPA 1E2LA 3LBIA 4LC1A 1Z08A 4ZKDA 4KU4A 2RHDA 4OHVA 5CM9C 5DH9A 5FBWB 4HB4A 2IL1A 1A1VA 4D4LA 3PXGA 1TU4A 4EDHA 1ZP6A 2CK3A 2EQBA 4FD2A 1YZUA 1DAFA 1TU3A 2G1JA 5SZKB 3LLMA 1CXZA 3IIMA 1N25A 1SZPA 1LY1A 4NTZA 5FOSA 5JSZB 2ZE8A 1W36C 4PZLA 4MDFA 1NVUQ 5D3QA 4Q9IA 4OQFA 5IRCD 4U7DA 2WICA 3I61A 1QG4A 1Q44A 3B13B 3U4QB 3P32A 4TL6A 3WMEA 3ONWA 4I4LA 3L8YA 3GQBA 4G1UC 4AG6A 5GJCA 3IUYA 3QI2A 2R62A 3PJRA 2VHQA 5FPYA 2KBEA 3B2EA 3W8NA 4UXJA 3C14C 1US8B 3B8HA 3QF4B 1ANKA 2K5UA 3ZGXA 4QGFA 1NN1A 4MYHA 4JBYA 4KFTA 1UPTA 4EQ6B 2QMUA 5FI1B 5FOWA 4I1VA 3BD9A 1N6OA 1NIJA 1OPXA 3QXHA 2YC2C 4G01B 2HT1A 3KFXA 4TMXA 2IHBA 2WPDA 3TK1A 5DNYB 1G6HA 1E3MA 3BERA 1C9KA 2G88A 5EE0A 1U90A 2B7CA 1GDDA 1OKKD 3DOFA 1KSHA 1W5TA 3OAAA 2EFGA 3HU3A 2ODEA 3BH7A 4PSAA 1A4RA 1NP6A 2VP4A 2DB3A 4CVNA 1W0KD 4RFSB 5FPTA 1NLFA 3NKVA 4KO8A 2XZOA 3O47A 4C0BA 5G40A 2ZQ5A 2REOA 1RIFA 5KDLA 4F38A 3GJ6A 5CJPA 5B57C 1G7RA 2HJVA 4KFSA 1AZTA 3NBXX 1NG9A 4G0NA 5HE9A 3NWJA 3FWYA 2GK7A 2YWHA 1ZU4A 2QN6A 3UATA 4QHSA 2XZPA 1T8UA 3L0IB 4LJ8A 5DISB 1UKYA 3AP2A 3NBFA 2CHQA 2GAOA 2O8CA 1U8ZA 4DLRA 4HLDA 1ZVQA 1ZUIA 4Q7LA 4ZO4A 3TBKA 2C8VA 4D2IA 3VTKA 2QBYA 2X1VA 3HWSA 2UVQA 1X8LA 2GBLA 1L8QA 2JLZA 2EW1A 1QHNA 3AVUA 4OYHA 4I99A 3U3RA 2D4HA 2YKGA 4TL9A 1F2TB 4IOKA 521PA 2IS4A 2R6DA 1AS0A 1G3MA 5FPHA 1XXHE 1E4VA 2A5YB 3QXJA 4Q48A 1U98A 1R7RA 4RD2A 5CK5A 1D9XA 2GHIA 2A3RA 4OI4A 1LV7A 1E1RD 2W6ID 4A1FA 1Z0FA 4Q00A 2JLUA 2N1BA 3U7HB 3R9WA 4GZMA 3FYHA 2GZDA 2IYYA 3GLHB 1Q1QA 1S8FA 2QP9X 5BW8A 2ZRDA 4O0MA 3CWQA 1L4UA 121PA 2F43B 5JJLA 1ELOA 1T91A 1Z0AA 1WQ1R 1W7AA 1ZW6A 2DY1A 5EUQB 5FTLA 2ZI7A 4KFRA 1XEWY 5L8VA 1IOZA 3MG9A 4P0TA 1OB2A 1CJKC 2V1XA 1R6BX 3ADCA 1G64A 5IHPA 1ZMXA 5G41A 3DKPA 1N5JA 4JMPA 3SYNA 3TSOA 4MRNA 4FMCF 4E09A 1ZU5A 2RMKA 2WWGA 2OHFA 5GVRA 3O8CA 2IYTA 3SJCA 4DEYA 2P6UA 2VIIA 3T1QA 2OAP1 3VX3A 2YYZA 4RKEA 1NF3A 4DCSA 1JAIA 2WVJA 2IK8A 1WDTA 1W2GA 2JCSA 1EFRD 4V0KA 2XTMA 3AH8A 4LYHA 2QP4A 2YC4C 3BRWD 4WZBE 1JJVA 1ESMA 2VHCA 3BB4A 3M1IA 2Z0MA 1Z2CA 1MO6A 4BFVA 1T9HA 3BBPA 1KAGA 3R8CA 3KDSE 2W2XA 3THOA 1UBGA 5FL3A 2EVWX 1CULC 3IILA 2ORWA 2LWIA 4HLQB 4U5XA 2GF9A 2ZR7A 1ZD9A 4MGIR 2IS6A 3SJAA 1WB9A 1XD8A 2QAGA 3W6PA 2PH1A 3WNBA 5E7IA 1VYUA 2SHKA 2WSSA 3MD0A 1R10A 1XD2B 4Y0VA 4C3ZA 2HCJB 2H1LA 4FCWA 4WW0A 1SVLA 4UKDA 3KKPA 4Z8YA 4ASUD 2ZUCA 2R6AA 5JZVA 4QL3A 3WMFA 1SVMA 4MKGA 2ZRIA 3MUFA 1G4UR 1YR8A 4AYTA 1P72A 3K0FB 3WBJA 3VKWA 4FN5A 5FBLB 1SQ5A 3VR4A 4LPSA 4FW9A 4UNNA 1UKEA 5C18A 4LYFA 4EJSA 3ICEA 3WNDA 5TMPA 5KO2A 4PX9A 3TNFA 1NMXA 4BRWA 2H92A 1TL7C 3VKGA 1WRBA 4RD6A 2ORVA 2GXAA 1XZPA 4UQOA 4HB2A 3N5CA 3W5JA 2DWQA 3KKNA 2BBSA 4GMXA 3FOZA 4KYIB 2N42A 4DUGD 1VPLA 4A36A 2OBMA 1SVKA 2D06A 2QPTA 4ESVA 1G4AE 1CJUC 1GILA 4RFSA 4II7A 1YRBA 1MO3A 1T8TA 3Q7QA 1CR4A 3ETLA 3NBZC 2CCKA 4HAUA 5TARA 5AUQA 1TPZA 3K0AA 3V4RA 1G3IA 2HLDD 1E0JA 1GM5A 2L0XA 3ZD6A 3A6PC 4R71A 1S4QA 4JLJA 1TTTA 1Z83A 3U61B 2FMXA 3BWDD 5TY0A 2FDCA 4GMDA 5FUWA 5BYJA 2GZHA 2ZYTX 2ZU6A 3CNNA 2QM7A 4BZXA 3VQTA 3THYB 5KSZA 2MSDB 1KK1A 1KMQA 2JGNA 4MGKR 4QBIA 1OLOA 3EXAA 3OIVA 2J0UB 1B0UA 3HR7A 2WOOA 4RY2A 2P3SA 4P33A 4DKXA 3E2IA 4OHZA 5CDFE 1CR1A 2A9KA 1YKSA 2X2FA 3FB4A 4QBHA 1ZRHA 3PQCA 3EZ7A 2FWRA 3W5IA 2W6IA 1I2MA 5B58C 1IJEA 1JR3A 3RDPA 5P21A 1P73A 2BMJA 2QP3A 4JL6A 4JLBA 4ZDJA 2WMNB 1DAMA 5CITA 1W36B 1HYQA 3DMNA 4JT4A 5EP4A 4HATA 1D8TA 1LW7A 2V6JA 3Q7PA 2H7VA 4R98A 2O8EA 2ZE7A 1NBME 2ZAMA 5JECA 4KSBA 2OFWA 5FOUA 1YHNA 1E9FA 1Z6AA 1EG7A 5DN6D 5FOTA 1JEDA 4YLGA 1XJCA 4CT5A 1CJMA 1E2DA 3A58B 3REFA 1P4SA 3CPEA 1S3SA 3B9QA 3OIYA 4HLCA 2PT5A 1XCPA 4CZ2A 1LVGA 2ZXUA 5AK0A 2AD5A 2QNRA 5KDOA 3PEUA 3LD9A 4XWAA 4GNKA 1SXJD 2EWVA 3ADBA 3DZ8A 1UEJA 2ZREA 4M9QA 4PAMA 2LKDA 5KTYA 2P6NA 2O0KA 2P67A 4OBEA 4DUGA 5G3YA 3RSLA 5C4MA 2WAYA 3KFVA 5DIFA 4CGZA 4HDCA 1XTJA 5TV2A 2ZAOA 4LCBA 5H68A 2JLVA 4V0MA 1M1YE 3W3ZB 1VG8A 5HPYB 3JZMA 4G5QA 3R9IA 3RS3A 1UADA 2IWHA 1AQUA 1E9RA 5JLJA 4P4TA 2UZIR 3SFVA 1QBKC 1Q12A 3A4MA 4HAZA 1I2DA 4C2UA 5KUTA 4PO9A 2EYQA 3BB3A 3H0KA 1VYVA 4WOPA 3IQWA 4CIDA 4PC7A 2ERYA 2EFCB 3EWAA 3HDTA 5LDDC 2W2VA 4IDQA 1U9IA 2P0EA 1KDOA 1H8HD 1JAHA 1P9RA 3KB2A 4B35A 4BFZA 2XB2A 1XD2A 2PZFA 5HCNA 2QG6A 1V5WA 3QPWA 4BWYA 3SOPA 3CRQA 4B71A 3NEYA 4LDJA 3IHWA 4BLTA 1S9HA 5KPJA 2WJYA 4DLZA 2JLSA 1GRRA 4DBLC 2XJ9A 3KTAB 2YVUA 1TX4B 1OV4A 2IEZA 1U99A 2G6BA 4B3FX 5C1BA 1F48A 1L7VC 1VCMA 2D74A 1KSJA 3K0CC 1FPMA 2A2ZA 2GVDC 2WWHA 3RHFA 1J90A 3BH6A 3SYKA 1Z0JA 1NRJB 3CX6A 4IDOA 3R7WA 3ZZTA 1MABB 4YC7A 3UG7A 1OXTA 2V3CC 4TLBA 4CEHA 2ONJA 1JPJA 1P61B 3N2IA 4I1SA 4LC0A 4DLTA 5J40A 2Q3HA 1NN5A 3SZRA 4RD0A 2ZSFA 4NL4H 2ZJAA 4BPBA 4UNPA 1W0KA 1Q57A 1TMKA 5GJBA 4G5OA 4IOLA 4RCZA 4QBFA 2GTPA 3OIUA 4ESHA 3FFAA 4M1YA 2JASA 1JI0A 2EYUA 4GT1A 2F9MA 3GEHA 2YOGA 3D6TB 3TQFA 1II8A 1OIWA 4B2PA 4KITB 3NEJA 4M1TA 4PO8A 1OB5A 1HQYE 3B82A 4OQLA 1DE0A 4JVNA 2XAUA 1OKKA 2QTHA 3IKJA 1CU1A 1GKUB 3PVSA 3X1WA 3QY0A 3FMPB 3I92A 3MWKA 4IVRA 2W2TA 2VL7A 5DE3A 1AA9A 1RRFA 4MGYR 5JWRA 4AK9A 4DLVA 2Q9AA 3KL4A 4Q9KA 4NKRA 2QQ0A 5FL7D 4ZKEA 2ZETA 1IJFA 3CRVA 4N0EA 4Q18A 4JLMA 3T61A 4LHVA 1P2SA 1CP2A 4US2R 4EPTA 1Z0IA 1DAIA 1KKLA 3CH4B 3P4XA 4MYTA 4M1WA 2ODWA 2Z4SA 2FH5B 3QXCA 3AVPA 3ASYA 1Z0DA 3AGQA 4FMCB 2B6HA 3CPHA 1FUKA 5LBIA 4AKHA 3CO5A 1HTWA 3CPJB 3T34A 1PV4A 2CHGA 1DBSA 2CE2X 3X1DA 4MRVA 3ZS9A 1N6KA 1W0JD 4C7OA 1G8HA 3KQNA 3AF2A 2ZYVX 2XSZD 4I1UA 4NYIQ 1GL6A 2DR3A 3I3SR 4IRUB 4WBSA 2F7SA 4XWKA 2VO1A 2IYUA 2R6GA 2ZRCA 4WXRA 1JJ7A 1TUIA 4OK3A 3RS0A 1F2UA 4JVLA 2ZROA 1GRQA 1AK2A 4GOJA 4DCTA 3RC3A 1CR2A 3K0SA 1E79D 3CR8A 4B6EA 4F4IA 1E2EA 3PUYA 2JLRA 3GEIA 4OQNA 3NDPA 2OEPA 4P4SA 4FCTA 2GEDA 1XXHA 3B1ZA 4Z1MA 4C0KA 1AQYA 4OK5A 3RLFA 4TTRA 2DFLA 2WAXA 3PFIA 5EZ6B 1GKYA 2G0NA 4QG7A 1TEXA 1WP9A 2X19A 3ZJYA 3BB1A 1D9ZA 1XMSA 3H1TA 3SHWA 3GCGA 2ZITA 4EPVA 5A0FA 5FTMA 1ZYUA 5DYIA 3GJ0A 1MT0A 3LNCA 4B44A 5DHFA 4BFUA 4XVUA 2JJ8A 3CF0A 1G16A 2YINC 2B21A 3TUIC 3TGPA 4MDEA 5JHGB 2JJ2A 4B73A 2BJWA 3EZ2A 1ZCAA 1EFCA 2JIZA 4CEJA 3IPXA 1COWA 5B30A 3AM1A 3P1JA 4X8MA 3L0PA 2G77B 5LB2A 1R5OA 3NC1C 3SU8A 3LH5A 3RYTC 4Q66C 2BCJQ 2F43A 2AFHE 3K9LA 3E1SA 1XFAA 1LS6A 2F1IA 2ZSBA 3RRYA 4AG5A 2B7BA 4LSGA 1KMHB 4F4CA 4HZUB 1NVXQ 3B1YA 3REGA 2PEYA 4CW7A 1DAGA 1G1MA 4QXAA 2NIPA 5F2EA 1VIAA 3RS4A 3TR0A 4XH9B 1W5SA 1Q0UA 2XNSA 3THYA 4IOJA 1NJGA 3WMGA 1T5LA 2NMVA 2WKQA 4MKIA 1E0SA 4PHTA 1ZNZA 2J41A 2RKOA 2QMOA 3ADKA 1A5TA 1NJFA 1U8AA 3LVQE 4N1AA 1LF5A 4HLUA 2NO0A 2WHXA 3K09C 4IEEA 5TB5A 1DPFA 1G3QA 1QVRA 4MYCA 2QL6A 1HEIA 3O8DA 4KSCA 3QPUA 4RKFA 2H18A 3B7GA 4PC3A 5FR2A 3U4QA 1KI6A 2NGRA 5BN4A 1FNMA 5EE5B 2C9YA 4Z51A 5AUPB 1TQDA 2QI9C 1G5TA 1E9AA 1QZXA 2JJ1A 2ZUDA 1AKYA 1CJTC 3RNLA 3ZS8A 4B2IA 1YR6A 2BMFA 2FF7A 1U2RA 3I5YA 4KV9A 2FG5A 2B8WA 3ZH9B 2GAAA 1OH7A 2OUKA 3PUWA 3AVXA 1KMHA 1YRAA 3QXSA 1YJ5A 5KSPA 2AWNA 1FP7A 4LRWA 1M6NA 1KK3A 3TUJC 2VPPA 2H17A 1F2TA 1E4YA 4TL7A 3O8RA 2ZR0A 4B6FA 1G7CA 4L4UA 3QJYA 3QOFA 3LO5A 3N70A 3BORA 2BEJA 4MYUA 1E2GA 1UKVY 3IO3A 4FXPA 4PXAA 1PLKA 1XRJA 4U00A 2PZEA 1CF4A 4CDGA 3NC0C 5FI0B 4BLQA 4TMVA 2XB4A 4G3XA 1P2TA 4FMDB 4XVRA 1UAAA 3T5DA 1G19A 4UJ5A 1IN5A 2AN9A 1KK0A 2WV9A 4URZR 1II8B 3K9HA 4Q1AA 4URVR 2XSZA 5AJWA 3SHFA 4FWTA 1E2NA 1X86B 2CXXA 2FEOA 2HCBA 2CK3D 4YXWA 1TF5A 2NZJA 2FFHA 1Q20A 2H5EA 3CH5A 3VMFA 5DN6A 4L9SA 4B3DA 1IXRC 4QGHA 3I73A 4CEIB 1KOFA 1YZLA 3P27A 2CNWD 3KXIA 2GWHA 2IXEA 4MKFA 3FKSA 2PCLA 1BO6A 1VYTA 3OIWA 3TR5A 2QBYB 4Q9HA 1X1SA 2VSOA 1F2UB 1FMJA 3QKSB 3WHLA 3B78A 3KXLA 5K8IA 4DZZA 3RC8A 4PQYA 1WA5A 5KPDA 3WBKA 2IEYA 2Q21A 1IN7A 1TEVA 1VECA 2ZYWX 4IFEA 1RVDA 3EX7C 1CKEA 4A9AA 3GJ8A 4NCJA 1XDBA 1T0HB 4PQFA 1KI8A 4BUJA 4KHZA 4MUAA 4D0LB 4URYR 1W46A 4TWZA 5AJYA 5FTKA 4YDSA 6Q21A 2OXRA 2QMEA 5FH9A 3U7FB 3WRYC 5EXTA 1OJLA 1KSFX 2ZRLA 2F3TA 1GAJA 2F55A 4QJ4A 1RJ9B 4AKGA 2ANCA 1JQJC 3ICQB 1IBRA 3CNLA 1AJEA 1QHHA 1VTKA 1TADA 4NH0A 3S1AA 2JAQA 3ZVLA 1MH1A 3KQHA 1KI2A 4AWXA 1JXMA 2QZ4A 1E9SA 5JRZA 2GVZC 4ZI2A 2BM0A 3AP3A 4OL0A 4Q01A 1P9WA 3EZ9A 3FFBA 2FGJA 1XU4A 1S0UA 1PJRA 5KNDA 4AKIA 2IYXA 1YR7A 5E7MA 4AY2A 1GUAA 3TLXA 1E32A 3NHAA 2ODNA 2Q3FA 4UNQA 1ZINA 4JT2A 2AR7A 1J2JA 1J7KA 1QHYA 3AKEA 1KO1A 4PC2A 1KDRA 1MRSA 5AJXA 3OEHD 1NVVQ 2PJRA 2G0TA 2O0HA 3CONA 3VNUA 3D8BA 4A92A 1S3GA 4MQBA 1X6VA 5GJWC 1NL3A 1EX7A 2R6CA 5FUVA 3ZIAA 1NBMD 2QA5A 4JVSB 3RVBA 1J70A 4XOIA 3PITA 4JLDA 4O3MA 2C99A 4RD3A 4TYWA 1ZNXA 2UKDA 4A0HA 4JLVA 2BC9A 2CCJA 2GJ8A 1XD9A 4ARZA 1PLJA 1N0VC 1P75A 2O8DA 2EFEB 4A8JC 1KTVA 1NG1A 4DC9A 1KIMA 4LOAA 4NP6A 5JS7A 4Q1BA 2VRWA 1NY6A 4IKEA 3FHOA 1WMSA 2B8TA 2D62A 4IEIA 4P4UA 3G5UA 3OEED 2F9LA 1H8HA 1SXJE 3AVYA 2IXFA 2GXSA 2XEXA 4Q02A 4HZIA 4D82A 5BWMA 1GP2A 4LI0A 4A4DA 4DSOA 4BLOA 3C15C 3A36A 4DXAA 3EPKA 2WJJA 3EA0A 4D25A 1RC8A 3SNHA 2QE7D 1K5DA 3MMPA 3LBHA 3HR8A 1OYYA 3M4YA 4LBYA 1RYHA 2MMGA 2F3RA 4LPKA 4WA7A 3K70B 4G5SA 4HAYA 1QHIA 3TRFA 4BFTA 3BH0A 4A8JB 1R5BA 5JS8A 2YWFA 5CIQA 4IDNA 4JJZA 2AXPA 3GFTA 3K9GA 4MRRA 4CRWB 3SJZA 2VP5A 5GADl 2J0VA 4KAXA 3SS8A 4RD1A 1R0ZA 4Z54A 1RE0A 3I5XA 1XNJA 3TQCA 2CLDX 4A0GA 1UFQA 3VR3A 1GL7A 1TAGA 2G83A 1HY3A 2Z83A 3EASA 1U0HC 4DSUA 5J4LA 2GNOA 2AFIE 4GZLA 4QM6A 1VCIA 2X2EA 1Z63A 2W83A 1UJ2A 1JEEA 1GOTA 1YE8A 1CLUA 2QUZA 2YZ2A 4LV8B 1BIFA 5JWHA 4O25A 4LGMA 4ZIRA 5JI2E 3K70C 3FTQA 1OFUX 4KLNA 4E07A 5KU1A 1N2CE 1VDZA 3AVTA 3HJNA 4B3CA 1EFRA 3WRXC 2C04A 5DYGA 5FOVA 3VU9A 5J4YA 1LB1B 1FTSA 2ORIA 4JZKA 4U02A 3VHXA 1UBFA 2RGCA 3KKOA 4DJTA 2HXYA 4M2LA 3U6KA 3ZLJA 5F3WB 2VHUA 2WBLC 3DHWC 4C2TA 3FKSD 4CEHB 1QG2A 4PR0A 2ZRNA 4DDWA 3V00A 5IF9A 4LWZA 3E5HA 1XBTA 4M1OA 2QMHA 3J81k 2V1UA 3PV0A 3QVUA 4FIDA 2DWPA 4C0SA 4QM7A 2CJWB 4KLZA 4POAA 1XB2A 3C41J 2PJZA 4EKDA 4ZDIA 3VR6A 4LY6A 2IS1A 1E6CA 4BFSA 4US1R 3CIOA 2IUSA 5FTJA 1ZM3A 1E2QA 1JXOA 2W6JD 1VHTA 3LX5A 3U6BA 4CF7A 4MGZR 1CR0A 1Y3AA 5HE8A 4KBFA 1RYFA 1X1RA 1NVWQ 2QAGB 4TN1A 2V8OA 4D6PA 1IY1A 5EE3A 3TJZA 2GA8A 1KO4A 4ZV4A 1SXJB 2GETA 4GOKA 2BBWA 3TVTA
chains in the Genus database with same CATH superfamily
2CT8A 4YRCA 1JHYA 3EQ8A 3L01A 2XQGA 1NP7A 4OB6A 3WE7A 3ORHA 2RE8A 4JROA 2GAIA 4MROA 4PFSA 1UPFA 4RMHA 5EZ5A 3IMCA 5LPNA 5DEOA 4LSMA 3BT7A 2WIBA 3M6WA 4QUBA 1H22A 3RTDA 3WDSA 2CBZA 2I0FA 1UIRA 4CNBA 2W0MA 3WXMA 2A1IA 4MMYB 1E79A 4P84A 3UA4A 5L51A 1G66A 4WLVA 1XZHA 4FKBA 4YJ2A 3A6LA 5HA5A 1SOMA 4IJKA 1MNAA 4UXHA 2P5TB 2HFKA 3VVCA 3HU1A 5CCDA 3WK8A 3N8HA 4BLUA 3TKLA 3GXBA 4XWYA 1UKCA 1ZITA 1ZUNB 4CL3A 1P4JA 3DVAB 1RWQA 1VMKA 2FWIA 4JOCA 1V16A 1T15A 4HMOA 4IJMA 6REQA 1IBLB 4PHFA 2E6UX 1R6VA 4C2AA 2WD7A 3KJZA 1IN8A 1GGNA 1Y1LA 3DQQA 4C05A 1QRTA 4HNHA 4V03A 4FGUA 4PLVA 5BQ5A 2CE7A 2GPSA 1WKCA 1OBOA 2GEUA 4JMLA 1US8A 2Y8EA 1IB6A 1U4NA 1K89A 4IIJB 1RAIA 5KTPA 2XUJA 4FFRA 1Z26A 3KU4A 1VP3A 4YQFA 1UKBA 3UUFA 4PNHA 1HNWB 2FEXA 3O7MA 2YCLA 4FGWA 4N5NA 1U0JA 4BLVA 4KQIA 5KJ1A 4EFLA 1PSZA 2A1UA 3MJHA 5ED4A 4A0QA 2CV1A 1B3RA 5BUQA 1AKWA 4NE2A 4TXLA 4D8XA 1IBMB 5BR1A 1I6LA 3C5EA 4Q93A 3VU3A 1WXFA 1ZH2A 4BX2A 5LNK1 1XWIA 4W5TA 1YV9A 2MINA 1NW6A 4NECA 2DFTA 3O93A 2CXSA 5FWAA 5C46F 5JD5A 2IJGX 3SNKA 3TI7A 4BECA 5CDGA 2W7TA 2X23A 3A05A 3KP1A 4QT0A 2WFLA 3EXHB 2PL9A 3IUQA 3IEXA 3RSZA 3JZFA 3MTEA 3C6QA 4Q4JB 4R7TA 4WWHA 4ZOQI 4ZI7B 3U1BA 4QVIA 3KX2A 3GGOA 4QOEA 1WBBA 4U5QA 5EI5A 5GV7A 1ZVMA 4ZYYA 2CMHA 2Y3IA 1UBTS 2JAXA 1PR5A 4IIDA 4K6CA 3EMDA 1RPAA 4PNZA 4CEJB 3RKSA 4G5GA 5JVDA 2GEVA 4QUDA 3ICWA 3P2MA 5BNIA 3IKVA 5EP2A 4JYBA 2P6RA 2X42A 1SEVA 2Z8ZA 1X1EA 1ETUA 2GUWA 1OI2A 2B9EA 2OOSA 5B12A 3OQNA 1EFVB 3I42A 2C9MA 3CCFA 1K4KA 2IZ6A 2PWBA 5HM6A 2XWBF 4E4RA 1IN4A 4XSGA 4P08A 5JH7F 2FGKA 4KXYA 1RPZA 4NCAA 3TLMA 1E9EA 4ZGWA 3COJA 1XC7A 1UT8A 4G9EA 1QRSA 1KY2A 5AM5A 4A5SA 4AJPA 1DX4A 1NVFA 1Z28A 3ASUA 1FMTA 2AK3A 2V4MA 1A8QA 3IQDB 1CY7A 3PTAA 4P7FA 3ZWBA 3AL0C 4I3FA 2QV0A 1ZJWA 4UD2A 5JAZA 4DQKA 3CPSA 1RJWA 4JLPA 4F5YA 3K70D 4Y6PA 4NZMA 4NZ9A 2IXBA 1PYGA 3BFXA 2EDCA 3D6VA 4S1OA 3W4KA 4AF6A 1GZ3A 4AX8A 3VVMA 1YSCA 3QJ5A 4ZK2A 1ULAA 1FDTA 1T0IA 1A76A 3T7RA 1AF7A 1PG5A 1XTIA 3ILHA 4N3CA 1H6BA 5FLKA 1E1MA 1JTVA 2EF0A 2I3AA 2VXYA 3AVOA 1T10A 3LXXA 3OCJA 4NZYA 4RADA 4TQAA 4UUMA 1J39A 4WY2A 5CURA 3V2IA 3ZDEA 2ZVJA 2IXGA 1RWMA 1CQIB 1SZCA 2DPMA 1Z35A 3LW7A 3QIVA 4YCAA 2PRIA 4NMMA 5TX7A 2AZDA 4PTYA 4PSCA 1IQPA 1T3LA 4QTXA 4NYMQ 4N76A 3LY8A 3DVSX 4BP9A 1N1EA 1O77A 3DFUA 4OLAA 1XJ0A 5TT0A 3L8MA 1P0IA 1WP4A 1JNYA 2ZVQX 1N6NA 2DPLA 3DMPA 5J4KA 1FBNA 4LMRA 4EI7A 1E2IA 3AUKA 3NKFA 4HTFA 5GWXA 4C6RA 3WVNA 2GBIA 2MSLA 4IV0A 2K2QB 4PBTA 1R2QA 5JAQA 2RAUA 1E0DA 1GA4A 1GPAA 2WE7A 4FYWA 3EQZA 3DMDA 5C7IO 4DIKA 1BXKA 3RFUA 1HFWA 3TSZA 2QRPA 3ISTA 4JJ4A 4RC9A 4X66B 3Q7EA 1YH3A 4OXKA 2I62A 1FFXA 5CNKA 5DK6A 2DVMA 2GPJA 4A8HA 1P81A 2F1KA 5DYYA 4EG3A 2BN4A 5DGDA 5KWEA 1ULZA 1K63A 1G21E 4G37A 1BOFA 5ER6A 2C7GA 2CNLA 3ZJTA 4MIOA 1Y7HA 3VGJA 1FX0A 4LKRA 5ADHA 2FW1A 2ODQA 1B43A 1JIQA 4OJTA 3W05A 1VLLA 2WJ4A 3A06A 3T5AA 1J5EB 1Z4KA 3GY0A 3OF5A 2C4NA 3G8BA 4RLFA 5FHQA 1ZOPA 5JC8A 4PC1A 3FPHA 1R9GA 3TTVA 3MRXA 5FHRA 4ACBA 1EB9A 3I4LA 3Q87B 3BIFA 3Q72A 3ZXYA 4D4KA 1JE0A 1EK2A 3LPLA 4ZO9A 2FDXA 3GEEA 4Y2UA 4D9JA 1B23P 2QK4A 2OWDA 1RLJA 4P3NA 1OW3B 4F7WA 4QLOA 2HU5A 3ZLBA 3NYWA 3W6NA 2ZR9A 3K0EA 4NENA 5AKLA 4YRBA 1HDYA 1GD1O 1A9ZA 1LRJA 2YJZA 3O0TA 4AP5A 5HKKA 2PT7A 3G5AA 1E4EB 4YYEA 1UZAA 3FUXA 1S2DA 1FMCA 3PD7A 4FNGA 4DRXB 1NQTA 2NTYC 3E2PA 3VVBA 1TO6A 2NXCA 3FOAA 3ZH2A 3T9BA 4PSUA 4O59O 4OKIA 1PX2A 3QKIA 5EP3A 2AD1A 2AX4A 4W7IA 4D4HA 4Z4GA 1CY0A 4CKCA 3INNA 2FSVC 4KQFA 1HO3A 4EJFA 2ADFA 3DGFC 3NNSA 2D7DA 3EISA 4HGPA 5CYPA 1D2AA 4AUEA 3L7OA 1G17A 3DYIA 1YRLA 4WLNA 1OF1A 4MLZA 4B3HA 3D4OA 3DOJA 3GFQA 4UCQA 3QELA 4Q4HB 4TROA 3WGIA 1EFKA 1YAJA 4LQLA 4Y8VA 4BX9A 2DBRA 2LR0A 3DTNA 2EV9A 1MUUA 4G4IA 3RU2A 4GU5A 2Y4NA 1T2AA 2I6UA 3ZHXA 2Y6VA 2EG5A 3H83A 1YZQA 4TWRA 3BVPA 5JR3A 4OMCA 2OGTA 4BNIA 1C50A 1XEXA 2PFGA 3PEEA 1RRGA 4R6WA 5DSXA 3W5HA 1EFHA 4YV2A 3ECCA 3SEQA 4MJXA 1GPYA 2PO5A 2ZPTX 4XQ0A 4B6RA 2AZXA 4UAGA 2BUBA 4S0XA 3WZMA 1O96A 2A3NA 3RWMB 1HWYA 4R2HA 4XIGS 2QLBA 2LKCA 1QONA 1UMDA 4I6EA 3P71T 1PVVA 4W5NA 4DBVO 1Y63A 4IFBA 4EPXA 5JSQA 3THXA 3NTQA 5A03A 4X7MA 4Y1GA 5AXAA 4BNLA 2CDCA 1NBWB 2I1QA 4RK6A 3ZI4A 3ZTWA 4JASB 4BNNA 4ZICA 2KWIA 2QT0A 2UU9B 1RRKA 3CE9A 4WNAA 1Y1PA 8MHTA 4DLXA 3B9RA 1MG0A 1B26A 1SOUA 2D5AA 3OICA 3IMKA 2AVNA 1GPH1 3WGJA 2PU7A 2WAOA 3HKDB 5J1TB 5CK4A 1NX9A 4AZ0B 4RCVA 4HEJA 2C4KA 3TOZA 3FNBA 1P6XA 1M0SA 2CL0X 2XXJA 3BWVA 3PLRA 4X93A 4J3NA 4B81A 5KVSA 3SXPA 1BX0A 2HPAA 1ZLYA 4RNDB 1QTIA 3CB4A 2ZDQA 5KTKA 3H1FA 1W5BA 1WLYA 4EO7A 1V4NA 3MJTA 3AF0A 3LSTA 3KCNA 3NHYA 1H94A 2FPRA 3NGXA 4RHEA 1I3KA 5ES3A 3STTA 1K8QA 3ACDA 3LWZA 3WNQA 4C7OB 2R86A 4GDFA 3LPCA 1E2FA 1DAKA 1L5LA 4AJ9A 2BEUB 2W8ZA 1XELA 3H0EA 2OB2A 3DFMA 3RKUA 1HZZA 1XFDA 2C29D 2GB4A 1T0BA 4Q4AB 3OSZA 4LTNA 1GRNA 4K6KA 2ZE5A 1IU9A 4EMTA 1WXWA 3QE2A 4WKNA 3K9NA 1G20E 1OA0A 1KJYA 1PUJA 1KY4A 3M5PA 3VZQA 2OY0A 1EEHA 1S8OA 2SBTA 4QYMA 4UOZA 5J2UA 2XCRB 1VSTA 1W2HA 2O2DA 1E98A 4LK2A 4Z86A 1B8VA 2VVTA 3BE4A 3VVLA 1XK7A 2V45A 3HJFA 3D6MA 1EX6A 1Y1KE 4EEKA 2BELA 2QE6A 3WWDA 1N0UA 2JIOA 3C8ZA 1W8IA 1ISRA 3RR2A 2H2IA 3BD8A 1GQYA 1XKLA 4L0CA 3RVNA 1JDPA 3HBJA 3PF9A 3N2YA 3BHMA 1EVZA 5BQXA 1SCNE 1QCCA 2F3QA 3NRBA 5THQA 5CP8A 4DWVA 2XQVA 2F8LA 4HS9A 3QPVA 4AJNA 2YY6A 3B6EA 1XKTA 3HKBA 1NBEA 5L3RA 1QIIA 3IVGA 1F2DA 1NVKA 2VYVD 1LFDB 1HDZA 1MC8A 4HFMA 3U7RA 4P22A 1E2MA 2P11A 1L5FA 3R5KA 1LC3A 4FGSA 1LW6E 3BMNB 5JCJA 4TZ6A 2JCBA 3WLAA 5ALWA 1SKYE 1KAOA 4I8IA 4ZOLB 5IYZB 5BV7A 1TZ2A 1W4BA 4XUCA 1IATA 2V7PA 4K6HA 2V9ZA 4IIUA 4GH5A 3IOMA 3UKOA 2YJTD 2FFAA 1NRIA 1P0FA 1JRLA 3F7MA 3P96A 3V33A 2R44A 5BVHA 4ZAWA 3T35A 3G68A 2B35A 2GFIA 3FVTA 3PCRB 4DUPA 3ZKWB 4FE4A 5FUMA 1WJGA 4YWJA 3KUUA 3L1IA 4RORA 5H81A 3R5TA 1G6OA 1BA2A 2OM2A 3CNOA 4KXFB 1NNUA 1NJ5A 1KNQA 5H7XA 3W5AA 3KQLA 1VL2A 2PSDA 1ITZA 3COZA 4LMAA 4NU5A 4AIRA 3CEJA 4TKLA 4II3A 2GNAA 4B4WA 1XN4A 1Y82A 1H4TA 2OYSA 1LPPA 1XI2A 4MEBA 2YXDA 3ZQJA 3GMTA 4RVCA 1RAGA 2APJA 2R68A 3MJEA 3C5CA 4ZPXA 1OIVA 1QIFA 1IQUA 4K8OA 4ZYWA 3SHQA 4C0HA 3RG2A 2GCOB 4YUAA 4LOHA 4WZ6A 3KKMA 3U3DA 1SHZA 4NFHA 3AUYA 3LZDA 3EXEB 5IAOA 4IJ5A 1MH9A 4ND8A 2GF2A 2EJWA 3FDXA 1H0HA 4FINA 1UFOA 3BHNA 5DNVA 3NT4A 5KSWB 1XL1A 2NUBA 1P33A 1GU0A 3AF3A 3BWCA 4QHTA 4BZQA 1QF7A 4O2BA 5EJ8A 3NJ8A 5DTRA 4EJSC 3WLMA 4RPCA 2VDWB 4TMYA 4D79A 1XCGB 1PEDA 2FHSA 3JVVA 2HA7A 5C1DA 1HE5A 2PMDA 4R1OA 1ZUD1 3CF2A 4GL4A 5K8LA 2VLBA 3RHSA 3VC2A 4E08A 1E1CB 1GV1A 2B7LA 4CLXA 2J3KA 5AVUA 3TN7A 1NM5C 2DUUA 1Y34E 4YJ3B 5ES4B 1SCQA 2ZYIA 2YZMA 3OJOA 3QKRB 2JGKA 2ONYA 4OHPA 2ET6A 4RVUA 4XYEA 4XTCS 5DBIA 4Z0TA 1P3JA 2WVAA 4BV9A 1HV8A 1YR3A 2YZNA 3PGA1 1RVV1 4R3NA 1DIBA 3F6RA 4G4GA 3VU1A 3VXKA 4KIGA 1WPXA 2FSIA 3QVTA 1M2VB 4MMZB 2Z95A 2PX8A 3LX8A 4RGYA 1YZTA 2H29A 3IJRA 2H1RA 3BJIC 2BBTA 3QUCA 1Z2AA 1Z13A 4KBGA 1UC5B 2ZANA 1HE1C 1RC1A 4FZ3A 3IPYA 2W6JA 3BFKA 1KORA 4M53A 4E5SA 3NHMA 3B1XA 3ELYA 3F3YA 1UBSB 5CFZA 4OO3A 2NZ8A 2YVLA 1M2OA 4KWIA 4O2BF 2W71A 2D6FA 1PEAA 3LDHA 2AOXA 4FFVA 3IESA 1JB1A 1NJ2A 1V6SA 2JJ1D 3EWIA 3HRHA 4F6RB 3B2QA 1K0UA 4B4DA 2INGX 4RTQA 4RQTA 1P0QA 3W5CA 3TX2A 2VBIA 3NUGA 5JJBA 1G21A 4I3GA 3FMFA 3IA7A 5DLQC 4L78A 1T4BA 3O4JA 4KXMA 4REOA 5EIAA 4PNPA 3T38A 3ZVRA 2NTNA 4M1EA 1GQRA 1P4GA 2HOQA 3RYHB 4QXOA 1GJRA 3W1WA 4BU1A 2Z30A 1V8DA 3ONNA 1GUFA 4QYIA 3CRRA 2WHEA 3WTCA 4AM8A 4DAOA 2YZ7A 3FGPA 5INTA 3U5TA 1WKVA 1NASA 4G5HA 3FHJA 3PHGA 3PSHA 1V2GA 2A1TS 2OO5A 4ROSA 5IMBA 3FLMA 2XMDA 1TQ4A 2NYAA 4K9PA 2I8AA 3SZUA 5BWNA 4WCDA 3WB0A 4DWWA 2X8JB 2JW5A 3FYDA 3H65A 1VLHA 3M1LA 4DV4B 4KIFA 1WBDA 4EHHA 2QAGC 5DEIA 1OH8A 2O1SA 4H7JA 2QRJA 2R85A 4M1SA 1IONA 3W9SA 4OAQA 1RM3A 3JWEA 4R5HA 3QWFA 5CH8A 5TSDA 1SU4A 2E87A 3HEBA 1RMTA 2C2WA 2CXQA 4PS1A 4N3AA 3GLRA 1CRPA 3KYIB 3FCOA 4P81A 2CNDA 5SICE 5TVGA 3ZXIA 4QPCA 3GFBA 1W96A 5HIKA 1JW9B 3GP5A 1KMMA 2DPXA 1ZI8A 1BG6A 1DG1G 1ADFA 1JZQA 1ZXXA 3VR5A 5FDFA 3VH2A 1L6RA 2R8ZA 2EOAA 2ZRPA 3L4SO 4MRAA 3OOHA 4OFZA 4C0JA 4XIFA 4Q7QA 4KACA 1B6GA 1GA6A 1PFYA 3L79A 4GC9A 5SYAA 2P8JA 2EBWA 4IDAA 4PIPA 4RTMA 1TQ2A 4IQ0A 4P4SB 1QYVA 1ZKDA 3TVDA 3MCZA 3NFYA 1P2FA 2NO1A 5H0IA 5JSHA 2ASEA 2EKQA 4P36A 2ISSD 4TZTA 5BR4A 1U0GA 1U1IA 4DRXA 3UW1A 1P31A 3NDRA 1FYDA 5E1BA 3SP1A 1QP8A 2YWJA 1YVDA 3BEDA 2Q0QA 2RGUA 4R9SA 4IGKA 4FOLA 3L3BA 5C4GB 1SULA 2OMKA 2XTZA 3T7EA 4ZJYA 3QEMB 3RBAA 2NSLA 1MB9A 2ECPA 2Z1NA 3KYBA 3SZGA 3HDJA 3HR4A 4PCAA 1XLUA 2AF4C 4OB7A 4TSFD 4XFKA 4YCBA 1CJSA 1W29A 4Y2QA 4MIKA 3X0DA 4E11A 4EFMA 1ZOOA 3QUTA 4QGAA 1TTQB 1BC5A 2VNSA 3PEYA 1KEZA 1R5JA 3CLTC 3GJ5A 4O2AB 5JFTA 1M83A 1XMVA 4EHFA 1EGHA 3GRPA 2JH9A 1CUVA 1R6DA 3P2KA 1YZFA 2BONA 2KE5A 5LMUB 3L9XA 1HRDA 1P5ZB 5J9FA 3U44A 2QN3A 5B4TA 2XRMA 1F14A 1HETA 1GZSA 2WF7A 3N87A 3HXPA 3ZE2B 5I9IA 1V8ZA 3LDAA 2P2DA 1K88A 5CT5A 4FLMA 1DAOA 3SC2A 1NI4A 4RNCA 2RG1A 1T4MA 1EWQA 3MJRA 5JH7A 5D01A 5A5VA 4MB0A 2Q6KA 4RENA 3U17A 5G3ZA 5C5IA 5A4KA 2ZUUA 3FCSB 1XCMA 4FZVA 1DAEA 1J09A 1GNTA 1KO8A 1T8WA 3CIFA 3HNOA 4GR4A 2AXQA 2BUCA 5FYQA 4QASA 3KEMA 3CZ5A 8ADHA 2OHIA 4RKYA 4HN9A 1EJ6A 1OT3A 1T4GA 2X22A 2VYND 4KK4A 1U6JA 2QZJA 4QQKA 3D4BA 5C1OA 4LZZA 1LD3A 4NAVA 2FFBA 3WKDA 2FVYA 5ALNA 3CUYA 4UDYX 2MSCB 5H70A 3E58A 1V8OA 1VE3A 2RG7A 3ASVA 3RLIA 2VAWA 3CXUA 2Y1EA 4PWZA 4WOCA 4DA6A 2XHEA 4R68A 4BZZA 4UBLA 2B4KA 3GAZA 4B3RB 1CF9A 3O95A 4BKOA 4EZBA 4LXGA 3UK1A 1ORWA 1I1OA 1MMFB 4BN0A 1F4VA 3TIGA 3SICE 3VU9B 1I5OA 3EC1A 5AWFC 1D8AA 1NLZA 4GSLA 5KVQA 2HX1A 4K1LA 4P92A 3AV0B 1IHUA 2I3ZA 1ZEJA 1GVHA 1W4RA 1UM9A 3BSSA 2O0MA 4JSRA 1KI9A 5H9VA 2P5SA 4GOLD 4XCXA 4KVGA 4CG2A 5JNVA 2FRDC 4QGGA 5AOAA 5L4LA 1ENYA 2AMVA 3N0VA 2IFTA 1I5RA 2BFAA 3C70A 2CJWA 1O9BA 3E8SA 1PEKE 2FFJA 4WKOA 4LWPA 4AL4A 1G7SA 2DYKA 2FPUA 3C3AA 3C7KA 4JSTA 2Y1FA 4XUDA 5FNVB 1X7WB 4P4NA 4E1VA 4ML3A 2XDAA 4HLNA 2C77A 1T2FA 3SMQA 1XLWA 4AYWA 1MO4A 1UIMA 4C7KA 2OLJA 5JDIA 1A96A 1NC1A 2D8MA 2O4CA 2JVIA 1LSSA 1GARA 3AKYA 1CUJA 1VGVA 3D9QX 3NTRA 4X97A 1HDOA 2W98A 5CIWA 3D0KA 4N5IX 2O8FB 2PUEA 3K0KA 3S2GA 5JPDA 5DNAA 1RP1A 5BYKA 1QH8B 3BMQA 4Q24A 2ZDHA 3K2QA 2P3QA 3TAHA 4YAGA 4WA8A 5BYAA 5JEEA 3QLUA 4HMPA 4M0LA 4MZDA 5EZYB 3ZBUA 1QHFA 1Y6GA 1F1BA 1G21B 1A88A 1U81A 2QVCA 1DOHA 4FWBA 4URHA 2PT6A 3TQHA 2CC2A 4A8PA 4EJMA 5EGNA 4V3BA 4DTCA 3SIWA 4FB4A 1AGPA 1QRDA 4DUYB 3C3MA 4RACA 3BXOA 4RH3A 1GO2A 1KJJA 2HA5A 1W4AA 4WLUA 1DTWB 4IQ8A 4HD8A 1L5KA 3KVYA 4MH0R 1AOXA 4KMSA 1P6QA 4Q1EA 4QTZA 1P2GA 1QK3A 3AUAA 3ROXA 3I0MA 2ECOA 4R1MA 4NZPA 4BNXA 3EUFA 1Z3IX 3GRAA 2FB9A 4L15A 3NG1A 4M6WA 3JRWA 4WGFA 5I7WA 4X00A 4DCVA 3UWOA 1HL7A 3NVAA 3K73O 4TTPA 3EN0A 4QICA 3CSSA 5EZSA 1XUOA 4PYMA 5A7GA 3QXGA 3SZOA 1JWLA 1J8QA 2JFGA 2P79A 1H9AA 3G2JA 2PKCA 1BHO1 1GUDA 1Y37A 3KEOA 2K6GA 3PF8A 4MUIA 5EUMA 4CMGA 4DLWA 4H1WA 3BDVA 2NPOA 2UVPB 3IQEA 3HUTA 3PPXA 1BE1A 5DLYA 3OO0A 2FW7A 2QOEA 4Q3BA 4RV9A 3DEZA 1N3BA 1P0CA 4Q3OA 5E8RA 1H5NA 2JJ2D 2PWYA 3T7AA 4LW8A 1U0EA 1AMOA 4JENA 2EX0A 4MVJE 1Y7TA 3WB9A 2P6MA 1BEEA 3ZVMA 3ILVA 4DG8A 1XTVA 1MOZA 3C4JA 4GVPA 4UE6A 1EJBA 1SH7A 4M55A 2Q4BA 4MS3B 2BOVA 3GRCA 1EK5A 4X6YA 2J7PD 3G2HA 3IALA 3WGKA 2DUWA 2I1VB 3M6XA 1SU6A 2AUNA 4MV6A 2C3MA 4TL8A 2XUFA 2GZ3A 4BJHB 5DLDA 5KNBA 4L1KA 4DLAA 3DP9A 1XJWA 3EGDA 4KPUB 5IVDA 2A5JA 2CVPA 3P19A 5IWCA 3MFQA 1YQEA 1WD7A 4UUPA 3ID6C 4I1YA 1SXJC 1S02A 5E1OA 3ESQA 1YBVA 1FNCA 1O87A 1Y4UA 5T8KA 5BSEA 4XM0A 4AWBA 1L5YA 4R31A 4YO7A 4YT4A 1MJ5A 2G5TA 2B0JA 1NRWA 1VL1A 3UMFA 2ZIZA 4RTRA 1SN7A 2OHGA 4JI4B 2OC9A 5FP0A 2YVKA 5JMWA 2WJVA 3U81A 3GLGE 2O8EB 1ORDA 2PBRA 3FW1A 2NU6B 5THXA 3EZ6A 1EXMA 4PANA 1DEKA 1UJBA 3BSYA 3BMXA 3AVVA 1ESNA 4WOBA 2UZ3A 3DVLA 2BVNA 3FKQA 3DZKA 5JS6A 1WETA 2D7CA 3TGPA 4BVGA 3UAYA 2C2OA 1BMTA 3OCXA 1HE2A 1Z8FA 3FWKA 3QG1A 2JNWA 3INTA 4MWTA 2XRFA 1EUCB 1PL8A 3MGAA 1E1QD 4J7CA 4KGZA 2IX3A 2WB2A 2DAPA 2AE2A 4EX7A 5ALUA 2WILA 4C4ZA 1IXKA 1E2JA 5JXGA 3TLBA 2UXDB 1P4RA 4GHWA 2R65A 4D96A 4F91B 4G0ZA 2QL5A 1LJLA 4Y2JA 4NBSA 4AF8A 4EELA 1TMYA 2ZJ0A 1EUDA 1RRPA 4HNTA 5WRFA 3U62A 5JCZA 2H57A 5HP4A 4FDTA 2XADA 2QIOA 3PDWA 4J0GA 3SQNA 1NX6A 2H7YA 1IWPB 1GG2A 2IS2A 4JY7A 3T52A 2ISQA 1JAYA 1Q83A 5D6NA 4MCJA 3C6MA 3BAZA 3GD7A 5AKGA 4LFCB 1W48A 1UBCA 2JD2A 1ACMA 1FTNA 4J2OA 2FG6C 4BEBA 4H4CA 4IJWA 4EB6B 4MKHA 2P4QA 3NH9A 1I94B 3C0KA 5AHWA 1J20A 1X8JA 1EFTA 1S3IA 3QXXA 4L3VA 5F98A 5J1SB 4IWYA 4KYUA 4TV8B 5U4XA 1QFYA 2RGBA 3HN7A 3B7PA 2UYQA 3JQCA 1KH2A 3HGQA 2WSYB 1L7QA 1FXWF 2X3UA 4Q4LA 3E1KA 1L7DA 2WF6A 1IQ0A 2BKLA 2OAQ1 2BFCB 1JZTA 2C5GA 3OD5A 4RA6A 5KSYA 3LHDA 4PLZA 2X7JA 2I66A 4RLSA 4ARZB 3FWPA 3OHMA 2RGRA 3GUZA 3GRVA 3RVQA 2I2AA 1MC4A 3UMSA 5B6JA 1U7WA 4K88A 2QTGA 1D1QA 4PSDA 1ZJJA 3RFVA 5HX7A 1W4CA 4K9SA 1ZM2A 3GVPA 3OE7D 2RIPA 1M2JA 4HQKA 2JI8A 5CH3A 1KDTA 1E77A 5F4ZA 2EIXA 2PCJA 5AH0A 2CZQA 1V48A 1P1RA 3A9RA 4IUDS 3DE5X 4JYMA 3VJLA 4EAQA 4RXTA 3L41A 5HQJA 1S7GA 1TTHA 2BFBB 2NTJA 3AEQA 3LRPA 5FPKA 1AQJA 2JLYA 5EC8A 4ZO6A 3M83A 1JR3E 5DVZA 3EPHA 3GRZA 3PUJA 4E33A 5JASA 2RGEA 3WP1B 1PDOA 4HBGA 1PO7A 4QJIA 1ZCBA 4B3JA 1PNVA 2EG9A 1GN9A 3BEOA 3STWA 1UK7A 1QYWA 2Y1LA 3QEKA 4I66A 4PGHA 1UPBA 3T1TA 1LFAA 3RV3A 4OHYA 3RUAA 4OQPA 2OXEA 4AUMA 5HXAA 1O4VA 1E7SA 1USUA 4OM8A 5HRAA 4GPBA 3IBGA 2QQEA 3MMNA 5H3HA 4EG6A 4OUDB 2Q6TA 3ROTA 3B38A 1FYXA 1RBMA 5F35A 3N6VA 4UATA 8ATCA 3I8SA 5DYWA 821PA 1ZSYA 3U7QB 1YBAA 4H1UA 2F6RA 3H9BA 3P0FA 5IX8A 1ZO8A 5K7SA 4H3VA 2PX4A 1PNRA 1OFGA 2JBWA 1QGDA 5I47A 2II6A 1C3VA 4XQ9A 2AG8A 1RRCA 4DWOA 1NTRA 2WSMA 3TNJA 2BFOA 3QQPA 4ZVKA 3MJSA 3IQIX 5I8ZA 1VGQA 2VNIA 3C6YA 4YRJA 2GXQA 3D54D 1C7ZA 3RUHA 4RDHA 1UBLS 3UFXA 4DDKA 1RQRA 3CWZA 3WYGA 1OVMA 4DHWA 1I1HA 4JL5A 2A0YA 3Q2KA 1D2RA 5FF9A 3WC4A 2OWEA 3K31A 1E3DA 1SU8A 2ATXA 3KSMA 5IKOA 1AMNA 2IH2A 1AV6A 3KQYA 5TNXA 1HX7A 1EI9A 4CU5A 1U7ZA 4Q9AA 4QFCA 5BNFA 3ABQB 2IYSA 3M8KA 4CT4B 1JFFA 1LVHA 1YFJA 2J9YB 4GX5A 2W6NA 5ANRB 2JAHA 2A9OA 1AKNA 3FDJA 1IRXA 3ZEAA 5K0NA 2QEQA 3CRMA 3V5NA 1SVOA 5ERYA 4ZWNA 1ZD3A 2F1JA 3ZUPA 5IDQA 1E58A 3S2YA 1QIKA 1S5PA 4WK4B 4AZTA 1E1YA 1NT4A 1H0KA 1FP4A 4RZ2A 3MBOA 3VPDA 3QE0A 2J3EA 3CN7A 1W88B 4MQMA 2JIZD 2L2QA 3K53A 5NLLA 3PQ6A 4N6NA 5AP9A 5MN5A 4FN4A 1UINA 3WLRA 4XQCA 5CLQA 1G2IA 1L9XA 1I7LA 2PRJA 3UIEA 4HK4A 3GUCA 1HYBA 3I53A 16PKA 5HIIA 3SBDA 4BNZA 4BEJA 4QFDA 2JIPA 5B3JA 1R6UA 3K16A 4X84A 3UV3A 4OQYA 1ZK3A 4B2LA 4PGAA 3DCJA 1XTQA 1PDVA 1QSGA 2CVFA 3EGXA 3FPSA 3K0AB 1D6SA 4J75A 2Q7OE 3IQHX 1Y4ZA 1SBIA 5C1PA 3ZIDA 4H7KA 1C30B 1LNZA 1ORIA 2JHAA 4PYQA 1QGZA 2GZAA 3GJ4A 3IP3A 1ISHA 5ALKA 4JK3A 3R0XA 1KKMA 3B3FA 1NNEA 4XEUA 1F0YA 3PI6A 4ZEWA 2FU5C 4YLEA 4DVGA 3K94A 2VP6A 2DEUA 3MQFA 1N3IA 2ZDGA 3HUEA 4KFUA 4Q7EA 2YXNA 1E66A 5JAHA 1EVJA 2FJ0A 2HMTA 2SKEA 4A1OA 3ZCPA 2RIRA 3QJGA 3QVSA 4Z1MD 1OH5A 3DZFA 2PLFA 4NOJA 1YBMA 4CNQA 4RULA 1Q50A 4C14A 5H82A 2J9XB 1VM6A 3IEIA 3OQOA 1FLNA 2EL9A 5SZHB 3IEPA 1LZKA 2FCRA 2ENUA 1UOOA 2FMIA 2ODBA 2OO7A 3BXPA 1UFVA 3B7WA 4TWBA 3M6FA 4X91A 5HR5A 3IKTA 4EF4A 3FXAA 1XNHA 4N8DA 3CM0A 2ZI5A 3QSYA 3RTBA 2ZYHA 3DL4A 4WDQA 3PC8C 1KRWA 2QX9A 3EVEA 1XR3A 4Q1CA 2O7NA 5BVHB 3JYOA 4FE7A 3FHTA 3A6GA 3HEAA 5ESDA 4PO1A 3EZFA 4G0OA 1SK9A 4OV6B 1JFRA 4I7EA 3DC2A 4ZVMA 3ZHTA 5DULA 1SG0A 1ST2A 2Z3VA 3DMFA 3LFHA 4H0FA 3OQIA 4PIMA 4PM4A 4HI0E 4MUXA 2J9FA 2YHUA 3ER6A 1A98A 3IAS6 3MWYW 3LLUA 4NOMA 4ALLA 3EIXA 2XE4A 3FYUA 4CIAA 4DTIA 2BDTA 2OT3B 2WJAA 1AGYA 4M0EA 5EIEA 2XJ4A 5EJFA 3U7GA 1YIAA 4Z4IA 3ADOA 3NORA 1B93A 1NT2A 5HM8A 3BWBA 4HLUC 4W99A 3U5ZB 1JYEA 4Z9AA 3DDUA 3HO8A 5KBYA 4LZNA 4AD8A 4ENVA 3ZYCA 4AY5A 2IU0A 4M8KA 4K2HA 4CM9D 1Q92A 3OOEA 4WADA 1WXEA 3C6ZA 2R5NA 4MA0A 5IKEA 4LF7B 5JADA 2C07A 4KNVA 5AFSA 2W2KB 4PCUA 4QDXA 3X2SA 4DWJA 3OMLA 4K8RB 2OV6A 3EQ2A 4MDEA 2WTNA 1W1IA 2O50A 4F4UA 4B43A 2TMKA 2JCGA 3DWGA 4U2CA 2YY7A 5E6UB 3RRMA 2ERXA 3QBTA 4LUCA 4PTZA 4KR2A 1A2BA 3D7RA 4GRDA 1ZIOA 2B0CA 3ZDCA 2VUUA 3GVCA 5LQDA 5LBTA 2PZGA 1SC3A 3VPSA 2F9FA 4V0SA 3DV0A 3UK2A 4HQLA 5AW3A 3SDSA 3SLGA 1ZZGA 5DBOA 2VDVE 1THTA 2R11A 1AHPA 3D6UA 1L5HA 1T8RA 3S8MA 3HGMA 2XA1A 4GPTA 4MV0A 3OESA 2A59A 1RMYA 2XDWA 3NO4A 5DM2A 1NSYA 3V7NA 4CBVA 1LUAA 4A0RA 3MYRA 4MAMA 5BQPA 4KI0A 1IEWA 3A1EA 2ZVPX 3IDSA 4L74A 4E22A 3QWIA 4DL9A 4D0SA 2VAMA 3E7PA 4MWOA 1ETHA 3LGSA 4MVJP 3MHTA 5A9SB 2YWGA 4X1YA 4A6XA 3TJMA 1O08A 4RF4A 2OBNA 2QT9A 3KB6A 2QXYA 1KOLA 3VPHA 4IMIB 2OCGA 1C1HA 4Z9FA 2ZUWA 3U19A 1J1UA 2NADA 4L4SA 2FA9A 2BMDA 3IO5A 3VX4A 4CF6A 5AVXA 2QTCA 2J33A 3EVNA 4MJLA 1N6HA 4F9TA 3OU6A 1X1AA 1O8CA 1U5AA 4EUKA 3C8HA 3TE6A 4LF5B 1PR3A 4A6PA 2XOXA 3FZYA 1JIUA 1C0IA 1JR2A 1WB5A 3G1TA 2FQYA 2DC1A 3SN6A 5JMTA 4K9NA 1SQSA 2H5LA 3SEAA 1TVKB 3RS5A 4F93B 1GFSA 3RODA 4B7AA 1IOVA 2I4RA 2FR8A 4GRAA 4PONA 2PGXA 3AFOA 4GNRA 4L7QA 3RC2A 4D4GA 5J2TB 4YMLA 3AL3A 3EW9A 3AIMA 1PHPA 3U3OA 1EFLA 1UWVA 2JJMA 4IILA 4NRDA 1T0JB 3ZV5A 2XXAB 3AUSA 2NQ2C 4E03A 1N2HA 5K5EA 1V5FA 4RDCA 1EWRA 1GXSA 3U1VA 3UICA 2J9ZB 4R2KA 2ISCA 2Z6AA 1MW8X 3DEFA 4D44A 5JXHA 1BN7A 3AF4A 4O0LA 3H1BA 3LFTA 4PY2A 1EK0A 3UJHA 2I55A 1C30A 1H5QA 4PPGA 4ECAA 5BP7A 1QUFA 3KOWA 3WNVA 5FAXA 2QRNA 5DIZA 5B55A 2XE8A 1K8ZB 4NESA 3HLTA 4RVDA 4KU4A 1DT3A 4E3WA 2RHDA 5CM9C 3E18A 1RXIA 3WBBA 3D1JA 1GY8A 1A1VA 1U28C 3J81A 3CUKA 1ZP6A 2CK3A 3STXA 4F8YA 2E5WA 2G1JA 1QDLB 2MYUA 2YJ5A 2IP4A 3IIMA 4CFYA 2XKJE 1N25A 1C9YA 4NTZA 3WLEA 4OREX 1BH6A 3ZHQA 2ZE8A 5JSZB 4PZLA 4GR9A 4P35A 5D3QA 4OQFA 5JXWA 2WICA 3AKZA 1T5OA 2C2ZA 1U2GA 4X9XA 4OVKA 5FOQA 2HU2A 3PRYA 3Q2IA 4RGVA 3UAOA 1RHQA 4NENB 4TL6A 4MR7B 4I4LA 2CJFA 2E37A 1PV1A 1BX3A 2WU4A 3L8YA 3P9NA 3VOTA 4GLFA 2R62A 5JSKA 2VHQA 4LDAA 5JD3A 3U9SA 1N57A 3ZWDA 3TQQA 2BEWB 4BWVA 1Y9DA 4E2WA 3URMA 2C7VA 2XW6A 4CCSA 4F72A 1DX9A 3QF4B 2OO5C 4EG0A 4DV1B 2RAVA 1ZAYA 2O7VA 3JW8A 2DUJA 1QTRA 1L0BA 2EFYA 4I9UA 3L92A 4I14A 2WQ7A 1VE9A 2HCFA 1XE3A 1ESDA 1YQ9A 4MVJF 4EQ6B 3HV0A 1C9EA 4N39A 3RVKA 5KYWB 3E3OA 5CX1A 3QXHA 4G01B 2XQKA 2OQVA 5AVWA 2HT1A 3PDHA 4NPCA 3AMVA 4LGCA 4HADA 4MPRA 2G88A