1DVRA

Structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
b'SSESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase (phosphotransferase)
total genus 70
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dvrA00
5DE3A 1OHHA 4LUCA 3O8BA 2DHRA 5DN6A 4IVPA 3EC1A 2AD5A 3HPQA 1N0UA 2CCJA 2AK3A 4ESVA 1P2UA 2P6RA 1GNPA 1GKYA 2W6IA 4BLRA 1DARA 1OXXK 4ESHA 4PTLA 5AUOB 5DHFA 4F4JA 4YMWA 3LBNA 3VAAA 3ICQB 1YJ5A 5HCNA 3DKPA 2ODNA 4QGAA 3RRZA 2FE4A 4Q66C 4WAUA 4U02A 1D9ZA 3RWMB 4BRUA 2OILA 4A6XA 3AF2A 5B58C 4P3YA 1XMVA 4YXWA 4KXFB 1R5NA 3R9XA 3K0FB 2QP9X 3ZQJA 1Q57A 1GNQA 2J9RA 1DAIA 1LV7A 2ATXA 2FGKA 5FBWB 2GETA 1JXOA 2GF9A 4I1VA 1E1QA 1XTSA 2V7QD 3HPRA 3THYB 1C1YA 3NIBA 4O2RA 4HAYA 4C9BA 2O8DA 4AG6A 3RS0A 1WBDA 4Q9LA 2CK3A 4CIDA 2FZLA 4F4IA 1ZU5A 4PPNA 3QKRB 1HY3A 4BFXA 2EFCB 2ZRDA 3N70A 1SVLA 3TUJC 4BLPA 4PC1A 4E03A 4B74A 4X8MA 2IS6A 5AR1A 1GL7A 3R9IA 1KK3A 2P5TB 1EG7A 4TLEA 1XEXA 4JZKA 1VKJA 1PZNA 2FFQA 5EE0A 3W6NA 1SGWA 2UZ3A 3IGFA 3H2YA 1CS4C 2OFOA 3VU9A 1Z6TA 1G8YA 1Z07A 1ZM2A 2WBLC 3I3SR 3GFOA 3NHBA 4KAXA 2HDNB 2IS2A 1U98A 2ZJ8A 1KNXA 2IYVA 3LX8A 5DLQC 1UF9A 3TBKA 1M74A 1V5WA 3DKVA 4RD2A 2VTKA 2FSGA 1JALA 1HE1C 1W0JD 3CX6A 4RCYA 1AK2A 5FFMA 5BW8A 8OHMA 3W6OA 4TYQA 5DI3A 3THOA 3VNUA 5JCPA 2VF7A 4ARZA 2VP2A 3A1TA 1MRNA 2PMDA 3K9HA 1DAGA 1II8A 3IO5A 3PUVA 3H84A 3UMRA 4DT1B 4DSOA 2DY1A 5JBQA 2AXNA 5JSZB 5FOTA 4ZDKA 4DLYA 2XXAA 2IF2A 2GNOA 1NIPA 3L0IB 4OL0A 4BLSA 1U9IA 2OCYC 3GLGE 2IUUA 4HB3A 3EPLA 3AEZA 5KNCA 2H7VA 4B6FA 2WTUA 1F5NA 1HYQA 3CWZA 2W83A 1EFUA 4MRRA 1FX0B 1K5GA 3MLEA 4QBGB 3B1ZA 3LX5A 4GOKA 5EXTA 5J40A 3U7HB 2LKDA 3SFZA 1G1MA 4QJ3A 4G5SA 4MGYR 5DIFA 4IFEA 4LSGA 1KJZA 2ZI3A 3KJIA 2ZANA 3NEJA 4OI2A 1ZM4A 1BH2A 1WRBA 2V6JA 4PZLA 2CMKA 4MYTA 3ZZ0A 4F4CA 1OH7A 3SN6A 3Q7QA 4QM6A 4B3BA 3Q5DA 3T34A 3VFDA 1OLOA 2OESA 3DMDA 1MT0A 1W5TA 1AS2A 3HP1A 2WKQA 2QAGB 2QEQA 1UADA 4B76A 3THXB 2WMNB 3SC3A 5DHAA 4MRPA 3T12A 3OE7A 1OPXA 5D3MB 3TK1A 5F3WB 4B3DA 1Z2CA 2NOAA 2ZUDA 3A4MA 4U00A 2O8CB 3JZAA 2WJIA 1ZC3A 5KSPA 5H70A 4O3MA 1CRPA 2P6UA 1OH8A 5JHGB 1RJ9B 4RD3A 3HYRA 1G3IA 2RGAA 2H18A 3GLGA 1M6NA 5SZJA 1TF2A 2DPXA 1G4UR 1YRAA 3IILA 4MGKR 4A2QA 4W9MC 4D4KA 3KX2A 1WF3A 4NL4H 2IWHA 4GFDA 4K46A 2GAOA 1NVVQ 1XZQA 1XEWY 4IOMA 3RWOA 2ZJYA 3LWNA 1CR2A 1G17A 2J41A 3U44A 1OE0A 1KK2A 1ZM9A 1IHUA 2DFKB 5K8TA 1CKEA 4JLMA 3KFVA 4JLKA 4YQFA 4DLVA 4CEHA 1KK0A 2ZSEA 5EUMA 2B6HA 5FTKA 4LJ9A 1W7AA 1YKSA 3NDPA 4XVRA 4LBWA 3BIFA 3T5DA 1RVDA 3OIYA 1U94A 2QROA 5E7JA 4BGDA 3AGQA 4D4JA 1Q3TA 5FL7D 2W00A 2EFGA 3FKQA 4B6EA 3IKJA 2YYZA 1UBGA 2ZSBA 2YOFA 4BE7B 1J2JA 4JL8A 3R8CA 2GXSA 1Z2AA 3QEOA 2OFXA 3KB2A 5DYIA 3PIRA 3GP8A 2BM0A 1DAFA 1YHNA 2JLRA 1KMHA 5KUTA 4Q4AA 4CEIB 2BOVA 1LVGA 3OESA 4WIAA 3TKLA 1W1WA 4IKEA 4OYHA 4DLRA 5HE8A 2F1RA 2ZXUA 3B9PA 5CB6A 1TQ6A 2JLSA 2JLYA 4RD4A 2ATVA 4RD0A 2YNMA 3I5YA 2G83A 2E9SA 1PLKA 1G3UA 4OHZA 2G77B 1IN5A 1A2BA 2QBYB 2G6BA 3MUFA 1TPZA 2Q3HA 2QSZA 4DCSA 3B6EA 4QKQA 3U4QA 1Q20A 1XP8A 3A8TA 3C41J 3ZLJA 4NPHA 5FL3A 1YQTA 5HE9A 3SQWA 1OXVA 2FFBA 4TMXA 2HXSA 1CJUC 3IBGA 2OG2A 3X1DA 3CONA 1XTRA 2GF0A 3G82C 2O0JA 1ZD9A 3CB4A 3MSXA 1LB1B 4OK6A 1AS0A 4RY2A 5KHOC 5F9FA 4Y0AA 2XTNA 5E95A 3GLFB 5TXGA 2Q0HA 4Z1MD 2QAJA 5JS8A 3Q5EA 1ODFA 2YWFA 3EIEA 2RKOA 2OAP1 3K9NA 4IOKA 2NPFA 3PEWA 3BC1A 1IJEA 2Z83A 1GUAA 4GPTA 4BFZA 2ASEA 5EJEA 1QZXA 2W2TA 1JJ7A 2XTZA 1VG0B 5EE1A 4D0LB 3EPJA 5LD2C 3TSWA 2V8OA 1TADA 4O0MA 4WBSA 4X8LA 2AX4A 4BUJA 2FF7A 3AVXA 1Q1EA 1EFCA 4C0AC 1ZM7A 2FN4A 4URUR 3SJAA 3B9QA 3GLFE 1R0ZA 1KZGB 3AV0B 4V0OA 3J81k 1OV4A 2CL0X 4TYWA 4P4SB 2FOLA 1J8MF 4QNRA 4A8JA 1SKQA 2OFWA 1IJFA 1TF5A 3CPHA 2R62A 1T3LA 5J4LA 2X19A 2NPIA 3S1AB 3ZS9A 5GJBA 5FUWA 5JWOA 2EWVA 1D9XA 3FB4A 5A5GA 5K8UA 3UMFA 3T61A 2F3RA 2W0MA 1OFTA 2AWNA 4LJ4A 1ANKA 2FSIA 3L0SA 4JJZA 3IDQA 5E7MA 2O8EB 6Q21A 3QKUA 1US8A 4LV5B 5AJXA 2OSBA 4Q5IA 1F2TA 5FOWA 1NMXA 2GZDA 1OH6A 1XF9A 3B13B 2G0TA 4YMTA 1UKZA 1VHLA 3EA0A 2ERXA 2IW3A 3OF5A 2BEJA 1A4RA 1R6BX 4Q9KA 5EE5B 2IX3A 3OEEA 1OB5A 3LLUA 3AKYA 3BGWA 3D6TB 4G5OA 4Q7MB 1F2UA 3B82A 1P5ZB 4PXAA 2IYTA 3CM0A 5EP3A 4PPQA 1ZJ6A 2L0XA 2IS1A 2CVHA 1XFAA 4C2UA 2I4IA 4QNMA 2ZI7A 3L0OA 1G8FA 4BFSA 3FWYA 1E1QD 3FMIA 2ZR9A 1Z28A 3RSOA 2ECKA 3EXAA 3THWA 3KQLA 5CM8B 2IUSA 2WICA 4D2IA 3RNLA 1UM8A 4C0KA 1KDTA 1YZTA 1Z83A 4MH0R 5FI1B 4OJQA 5C4GB 1DO0A 1KDOA 1P2VA 5FOXA 5L3QA 2IEYA 2PT5A 2WKRA 3K9LA 4AKEA 1JR6A 1OIWA 4E5UA 4HYYA 1FOEB 4NZYA 3NEYA 2IYWA 3T15A 1N5JA 2ZEJA 1KJYA 1NLYA 4Q4HA 3U3KA 1ZRHA 2YKGA 1Z6YA 2VHJA 1QG2A 3AGPA 1Z29A 1OJLA 1SXJD 4EJSB 1E1RA 3HR7A 2C99A 1OF1A 1JPNA 2ZRAA 2FX3A 2CJWB 3QIAA 2O52A 1QHIA 3DZ8A 4KBGA 5BN5A 5G41A 2LCFA 1ZNZA 2VSXA 4KVAA 5CM9C 2PT7A 4OHXA 3AKDA 4TLCA 2FFAA 3QF7A 4L9SA 4B3CA 1UDXA 5CIWA 1N6HA 2WWWA 4BLOA 2BBWA 1T8UA 4FI3C 4XVUA 1I2MA 3IQXA 1E2PA 3HJNA 3ZD6A 4FMDF 5GJWC 2O8FA 4R2IA 1U0HC 1Z3IX 3CWQA 3QJYA 3B8HA 2ZE8A 4B2LA 1ZD8A 3LVQE 3AVWA 3MJRA 4G1UC 1P75A 3GLHA 4LX0A 1S4QA 2IYUA 4L16A 2J0SA 1XZPA 3SNHA 2PZFA 2CLDX 3PVSA 4D4LA 3TVDA 1JAIA 1DTSA 1BYUA 3FFAA 3HDTA 1T5LA 4Q01A 4AYTA 3LV8A 4MDFA 2ZQ5A 1Z08A 3N2IA 4A2WA 1E2MA 3EG5A 3FFBA 1ZAKA 2MMCA 4M9QA 3VKGA 2QNRA 4N1AA 2NO7A 4GMDA 2WJJA 4MKGA 3KTAB 1G7SA 5ANRB 5TARA 4B43A 2GTPA 2ZRIA 1ZCBA 4GOJA 2ZJAA 1XJQA 5CJ2A 4DLXA 2C9OA 3T06B 2ODEA 4HAUA 2OXRA 3FVQA 3QSYA 2HT6A 1HT2E 5KPJA 3O47A 2GJSA 4OHYA 4HEJA 4B48A 1BOFA 1KI2A 4JBWA 4ZO4A 4C4PA 1XMSA 3ZVNA 2XGJA 3WNBA 3V4RA 4LC0A 5SZHB 4GDFA 2NIPA 4PX9A 2A2ZA 2ZS8A 3SE0A 1FFHA 3IPXA 3KUDA 4B75A 1TEXA 2F55A 4XJXA 1W0KD 2FJUA 3KJGA 3QENA 3MWLA 4Q02A 4L5BA 2WWHA 3RDPA 3RHFA 4ABYA 4N0EA 1KO8A 3X1WA 1H8EA 3HR8A 4ZPXA 3MFYA 4DLTA 1V43A 5CK4A 3SYNA 3BB4A 3QKSB 4UJ3A 2BWJA 3GLIB 1ZW6A 2KBEA 1TEVA 1CR0A 1G41A 2QMEA 2CLSA 2JLWA 1AA9A 3A6PC 5CDFA 4ZDWA 4PSVA 3AQ4A 2B7CA 2D7DA 5FBLB 2H8KA 1B0UA 3BH7A 3X1ZA 4P0TA 4C7OB 4QM7A 2GA8A 4FWTA 4IOJA 3REGA 3A37A 3VR3A 1GWNA 2CCKA 1YZNA 3FE2A 2IYXA 3KFXA 2WAXA 4J0QA 1EFRD 1FUKA 1XWIA 4F38A 3WP1B 4B35A 2AWOA 2X1VA 2R2AA 1SVSA 4ZKDA 3GLIE 1Q0UA 2XZLA 4O2LA 4GOXA 1ZCAA 1QF9A 2GZAA 3KKOA 2Q3MA 4U7DA 3UIEA 1NLFA 5IF9A 3C14C 5BWMA 1O3YA 3CNLA 1COWA 1M2OB 2JDID 3LW7A 4PO9A 1OXUA 3SDZA 1KK1A 3W5JA 2G1JA 2QP3A 5JEDA 5FR1A 3WBKA 4EFMA 5JECA 4TN1A 4KLZA 5DI9A 3LRPA 2FFHA 2WPDA 1E9EA 5EP2A 1KHTA 2SHKA 4PPGA 3UKDA 4LHZA 3H4MA 1IBRA 1X8JA 4MUBA 2YWHA 1NIJA 1Z47A 3C15C 3X2SA 1G7TA 4RFVA 1FZQA 4ITRC 2JGNA 2CE2X 2VF8A 4DEYA 3ASZA 2RGCA 3SHFA 5KSZA 3Q72A 1L8QA 1Q21A 4NYMR 1Q1ZA 1KAOA 1E96A 2A30A 3PG5A 4V03A 5L3SB 4G5RA 5TMPA 3EIQA 1OXTA 4JLBA 2ORWA 4TMVA 1M34E 5JHHB 5FH9A 1GKIA 4C0SA 3SI7A 4YONB 1JR3E 3QNUA 4U5XA 2D74A 2BKEA 4TLBA 2IBMA 4M21A 1TU4A 1RE0A 3KJEA 5FOSA 2CHGA 2VRWA 3W90A 2F43B 2PZEA 4UQOA 2NGRA 1E2KA 5G40A 3FHOA 4JJKA 1KI1A 1DAMA 1HURA 2YV5A 1ZD1A 4UJ5A 3BORA 4EFNA 4KU4A 3AVTA 4AC9A 3EWSA 1R0WA 2QI9C 3SQXA 4CYMA 1HTWA 4TZ0A 1W36D 4ZIRB 2HXYA 4JLVA 4LOAA 3B85A 3DL0A 4URZR 1KI7A 3E1SA 3F8TA 4FCVA 2WIBA 3K1JA 2PX0A 4DHEA 1KI6A 4DZZA 4NYMQ 1N5LA 1OKKA 4JT2A 3FMPB 3SJCA 2X77A 5FPTA 4HDCA 3NBYC 3B1YA 1DE0A 2PEZA 3QEJA 4PQRA 4A8JC 2ZRHA 1DAEA 3BD9A 2PL3A 4LPKA 3OEED 1FTSA 4TMZA 4M0LA 3LA6A 1XPRA 3W6PA 1WMSA 1ZUHA 2PX3A 2ZUCA 4C0JA 3UWOA 4C2TA 5TDHA 2IYZA 2EW1A 1KY3A 4DRZA 1N6IA 4LJ7A 4M9ZA 1Q1BA 2IXGA 2VEDA 1J90A 2VHCA 3A1UA 2GEVA 1G8PA 2GK6A 1BIFA 4WVFA 2FDCA 1S1MA 2QL6A 1OYYA 1VTKA 1QDEA 3G5UA 1HH4A 2EYQA 1GP2A 3MWYW 4GP7A 1E0JA 3ZIAD 2G9NA 4EUNA 1AN0A 1R8SA 1G5PA 2WZQA 3AVQA 3PR1A 4BLQA 4BEBA 4GSYA 5CJPA 1W5SA 1NJFA 1I4DD 3I73A 2CCGA 1G3RA 3HYTA 1RRFA 2AK2A 4HUQA 4HZUB 3ADBA 2QRNA 3QXCA 2GHIA 3LQQA 4ON9A 4NCKA 3VR6A 1NN1A 5B64A 1CP2A 4JYBA 3MCAA 1XTKA 1E1RD 1MH1A 4XTCS 1SXJB 5GJCA 2EWWA 3QVVA 4TL9A 2KJQA 1ESMA 2AR7A 1AZTA 4RZXA 2JIZA 2IA5A 4Q1DA 1WBBA 4NHOA 4W5HA 5BYJA 1Q12A 1UFQA 4DCNA 1X8LA 5J4HA 5DI3B 2C9YA 3KUCA 3A58B 4PC7A 2W6JA 1LS6A 1F3OA 1KSHA 1P2SA 4OHWA 4TTQA 4WXPA 3RC3A 1KI9A 2QENA 2JATA 1DG3A 4EPRA 2XXAB 1XEWX 1O87A 3LD9A 2GAAA 4LRWA 4CEJA 1GIAA 3IUYA 4XIGS 3U2QA 1NKTA 3K53A 3GFTA 4Z8XA 5M04A 2QORA 4Q4LA 3GFPA 4MKFA 3TGPA 3AUYA 1HQYE 4QFMA 2NO9A 4YDSA 4IDOA 4CGZA 4PAOA 4M53A 1NKSA 4RFSB 4DLZA 3EARA 2HLDA 2V6IA 4FN5A 1TQ4A 4BZPA 4AKIA 4JSYA 4IXMA 3IQWA 2ZI6A 1GILA 2VP4A 4HB4A 1XJ0A 2CHVA 2GCOA 2A3RA 5B2ZA 2C04A 4G3XA 1QG4A 2C2HA 1E9DA 4H1VA 4HAZA 2WJVA 5GVRA 1S9HA 2BV3A 4Q19A 2VP9A 1ELOA 1S96A 3H0KA 3RRYA 5EP4A 2FPMA 3NVAA 4JLAA 4B44A 4PHHA 3CO5A 3KJHA 4UNNA 1AGPA 1Z6GA 5L3RA 4HAVA 4XSGA 1J70A 4KCGA 2QT0A 4Q1AA 4A36A 3A4LA 2ZRMA 4Q1EA 4W5JA 4W7SA 2AXPA 1NI3A 1RYHA 5TB5A 2V4ZA 2XNDD 4A15A 1XXHB 1JPJA 2GZHA 1UKVY 2GCNA 3IO3A 4C0BA 4EPTA 3WYGA 2ZRPA 1DO2A 4OQFA 3TSZA 1KNQA 4M1WA 3TIFA 1MABB 5KNDA 3I4LA 4QBHA 4Q9HA 2BEKA 4AYWA 4GL2A 1E2FA 3WP0A 1N6LA 3PUXA 3QBVA 1HT1E 3LBIA 1OFHA 2NZJA 4MYCA 1U99A 4DDVA 4E09A 1NVVR 1G9XA 3K0FA 1H8ED 5E7IA 4BFUA 2H92A 4CEHB 5AJVB 2C96A 2CHQA 3C5CA 4KFRA 1DG1G 3BS4A 4D80A 2QQ0A 3GEEA 4R98A 4NDZA 1BMFA 5IRCD 4EJSC 1JEDA 1RKBA 3THYA 4URVR 2ORIA 1G7RA 2P5SA 4F93B 5FTJA 2QMOA 2FNAA 3AKCA 3QKRA 3B1XA 2AD1A 1MRSA 4TL8A 1R7RA 5AWFC 1ZNXA 3VR2A 4I81A 2I3BA 5ELXA 2BJVA 1WB9A 1FP7A 3RVBA 2QE7A 2XSZA 3DO6A 3KQHA 3NTUA 4D6PA 2QPAA 1CIPA 5JS7A 4XWKA 1I4LD 4Q47A 2BIFA 5A4JA 1MV5A 1T0JB 3JZMA 1F48A 3GEHA 2IL1A 4RD1A 3UWKA 4AK9A 4LHYA 4Q1CA 4DSTA 5CLLA 4ZDJA 3AM1A 2IC5A 1FUUA 3VKHA 1SVIA 2R44A 3SHWA 1Z5ZA 1AS3A 4Q7JB 2WV9A 2ZRCA 4L4UA 4ERNA 2LWIA 3VMFA 3BOSA 2F1JA 2OO7A 1M1YE 4JT4A 1OFUX 4IVRA 3TR5A 2WPDD 4ACBA 4DT1A 5JSZA 2QQEA 1HA3A 3W8RA 4B33A 1GITA 4LY6A 1LNZA 1UBFA 2BBOA 4C0LA 2B21A 2C98A 3AKEA 1UEJA 4XWAA 4EPVA 1N6RA 1GFIA 1YU9A 2FA9A 2A5GA 2BC9A 2GVZC 3DM5A 4MRSA 1FX0A 4GRAA 4BASA 3CZPA 1NN5A 2IHYA 5EXPA 2WSMA 1RRPA 3UXMA 2WWYA 5DH9A 1T0HB 4YLGA 4KVGA 4IW3B 4B3XA 1NBME 4G5QA 3OHMA 4ASUD 2ZS7A 2IEZA 3KXIA 1XJCA 1NP6A 1GG2A 2N1BA 1E2QA 2D2FA 2GKSA 1A5TA 4YMUA 1G6OA 2FWRA 4JLJA 5HZKA 1E69A 2RHDA 3QBTA 2P65A 4FMCB 2IYQA 5JRJA 2H16A 3U7GA 4DLUA 3NH9A 4OQXA 5DYGA 1ZYUA 1VHTA 2QAGA 4DEXA 3TW4A 3ZVLA 1G291 3THXA 1T9HA 5H8WA 2MSCB 1KI8A 2OAQ1 5D3MA 1G6HA 1FW6A 4D25A 3DM9B 3RRNA 2DCUA 2IYYA 1QVAA 2O8CA 1AZSC 5K8IA 4V02A 4D0GA 2ZYUX 3QUSA 1W36B 4M1SA 2GEUA 5JWHA 2REXB 1N2CE 1RJ9A 3K70B 4TL6A 3OZXA 2J87A 3KKMA 1QHYA 2FEMA 1KKLA 4JLNA 5FR2A 3MAAC 4LPSA 4PC3A 2W2VA 4HDOB 4QHSA 1KO5A 5BXQC 1MKYA 2OBLA 1W2HA 2WJGA 3E70C 4BRWA 1JEEA 1OW3B 3GJ3A 4EAQA 1L2TA 1E79A 3BJIC 3CX8A 1ZINA 1A2KC 5H68A 1P72A 3QPWA 2N42A 1NBMA 3Q3JB 1W48A 4KLNA 4NCNA 3KKQA 2G3YA 1G5TA 4D26A 1E32A 4DUGA 1QHSA 2IT1A 4AKHA 4EIWA 2Z4RA 3K8YA 2BKUA 1OIVA 3N5CA 1S0UA 2WIAA 3AH8A 2ONJA 5BN4A 3ASYA 4FCWA 1G8HA 3GJ7A 3THWB 2ZE7A 4LHVA 4NYJQ 1PV4A 2UKDA 3RABA 2RCNA 4BZQA 2HF9A 2RGXA 4NCJA 4CEIA 5TV2A 1KJWA 3U6KA 4WZAE 3SU8A 1T4GA 4XD7D 4I1SA 5F2EA 1IN4A 1XTQA 1CBUA 2WJHA 2Z5FA 4WZ6A 1K8RA 2R6GA 3HU2A 1NF3A 2P67A 1OHHD 1EK0A 3I1FA 5EQTA 5J5CA 5DN6D 1E98A 1ZIOA 1P60A 1NLZA 3SR0A 1E9CA 3B60A 3VNVA 4AWXA 4QGFA 2OUKA 1R5BA 2VA8A 2W6ID 4ILEA 4UNRA 3FKSA 3MWKA 1W46A 2QBYA 2V3CC 3SFVA 5LPNA 1F60A 3TH5A 1G3MA 4XSHA 3GD7A 2FU5C 1AKYA 4M9XA 3QVUA 2JIZD 3BWDD 1DELA 3I62A 3BK7A 2PJRA 4A82A 1U8AA 3N2EA 3QPUA 5FBVB 2W6JD 2HJGA 3PV0A 1TQ2A 3B7GA 2VP6A 2AKYA 4YXWD 1A82A 4DSUA 3GLFA 2B92A 2ZM5A 4BQSA 1AQYA 4OJKA 3V4FA 3WRXC 2BMEA 2HCJB 4KFTA 2VP5A 4GT1A 3CR8A 1RIFA 3W8NA 1WA5A 3Q85A 3ADDA 1N6NA 3QKTA 2HCBA 1FMJA 2J0UB 2ZR7A 2IYLD 1P62B 3AF1A 3OAAA 3MWJA 2CK3D 4LJAA 2REOA 2ZE5A 1OSNA 2ZRLA 4PO1A 1P9RA 4W5WA 2ZTSA 1DVRA 1EXMA 3V00A 2AN9A 3UG7A 1NVWQ 3ONWA 2HLDD 4N3NA 1VG9B 1M7GA 4A0FA 4EFLA 3U3JA 3RS3A 3NC0C 3CW2A 3Q9LA 2NMVA 3EW9A 4DSNA 4MA4A 2V1UA 3SOPA 2F9MA 1Y3AA 2ZJBA 2JCSA 1QRAA 4P4SA 3K09A 3P27A 3F5FA 4EPXA 3C8UA 4L8GA 4NYIR 3DZDA 3R20A 3QXXA 4PANA 5HKKA 5DGXA 4KSBA 3O8CA 3RRMA 1RC8A 1BO6A 1E9RA 2PLFA 2ZSFA 3S1AA 4TLAA 1OT3A 3UATA 2OEPA 2ZETA 2WKPA 4WXRA 3T5GA 2VO1A 4PHFA 1GL6A 2VYFA 1CRQA 4IJMA 2O8EA 4JL5A 1FQJA 4LHXA 1XCGB 1GNRA 2MSEB 4M1TA 1L7VC 3K0AB 4QL3A 1KO4A 3PFIA 2IXFA 1Z0IA 2DFTA 2F9LA 4Q9JA 3U6BA 3QXSA 1M7HA 4CZ2A 1AKEA 2DR3A 2V1XA 1KI4A 1T8TA 2VSOA 1TU3A 2ERYA 2QY9A 2ZRNA 3SBEA 3T35A 821PA 5EZ6B 421PA 2CDNA 1D6JA 1Y63A 1Z0FA 1Z0KA 4GMXA 3H86A 3WYAA 4NTZA 1X3SA 2KBFA 5B30A 4V0NA 5JRZA 2VHUA 4NYIQ 5JEEA 2F3TA 5GADl 1ONBA 3CH4B 4IHQA 4B32A 5FTLA 1XCPA 4RJLA 1OB2A 4EQ6B 2YZ2A 2D3WA 2DB3A 3LVRE 2XZPA 1EESA 1SQ5A 2RGBA 4Q18A 1KO7A 3BB3A 4PQYA 1YE8A 3IIKA 2QMHA 3LDAA 3U7FB 3OIWA 1WP9A 1ETUA 5EXXA 3OE7D 1XBTA 2ZSDA 221PA 4CDGA 5KPDA 1VCIA 2P3SA 2WOOA 3VX4A 2QE7D 3ZGXA 1IN6A 4GZLA 1NRJB 3TRFA 5E3HA 1XTJA 4M22A 3C7KA 2CVFA 4A92A 1Z6AA 4TQ9A 3CH5A 3JVVA 2WSSA 4AIIA 2J7PA 3GMTA 3MD0A 2BBSA 4EJSA 1G16A 1P9WA 4OHVA 5AUNB 3IEUA 4C0HA 1PVOA 3MG9A 5HR5A 2QZ4A 4FWIB 5C2JB 1RFLA 4LV6A 1KMQA 2CJWA 1T6NA 1W0JA 4ACAA 3L2OB 4PO8A 1MR3F 4UXJA 4POAA 1IONA 3RS7A 3K0EA 2HF8A 2OM2A 2XX3A 3PUYA 2NG1A 4G5GA 3RS2A 621PA 3DOEA 2FPLA 3CPJB 2FPKA 2ZJ2A 1E4YA 1P73A 2VP0A 1KKMA 1VCNA 3U60B 4FMCF 1DOAA 2XTMA 3B5JA 4R9UC 5FPHA 1HQCA 3BFVA 3GJ4A 3PJRA 1YZQA 2BVNA 4IDHA 3AVVA 4LYAA 3AB3A 1IN7A 5FOUA 2ZE6A 1E2NA 2JLQA 2PBRA 3QG5A 2EFEB 5J47A 1HE8B 4LWZA 1CTQA 4A0GA 3UPUA 3HU1A 4H9GA 3R7WA 2EFDB 3MJHA 5CK5A 5J4VA 3NDBB 5C1BA 4PR0A 4BEJA 3WNCA 1E94E 2ZYVX 1ZIPA 3CKLA 1XX6A 2R9VA 5JFGA 1UJ2A 1CEEA 2ODWA 4HATA 4US1R 4QHTA 2OLKA 4LGMA 4M9SA 4CVNA 3I92A 4LYJA 2O8BB 4P31A 4MUAA 4NU0A 3FHCB 1U8ZA 1E0KA 3KL4A 5D3QA 4PAMA 3KTAA 4X8OA 5KSOA 2MSDB 1S1CA 4IDPA 4DKXA 5LD2B 2VHQA 3RS4A 2XB4A 2J46A 2PCJA 3DMNA 1NY6A 3K0CC 2REBA 2ZRJA 1II0A 1YZGA 3QF4B 5UKDA 4DBLC 2VIIA 3LXRA 4CT5A 3OFNA 3QQ5A 4M1MA 4FMBB 2DFNA 2YC4C 3B1WA 5AJYA 3AVUA 4WOPA 4KFUA 2H1LA 2VL7A 1Z0JA 1CR4A 1G3QA 1NY5A 1VIYA 2QAGC 1M8PA 1UDWA 4AKGA 4LBYA 3L8YA 4FINA 1U81A 3IHLA 2Y8EA 2W58A 1E79D 2NO1A 3FGNA 1KI3A 4V0ME 5AK0A 4DC9A 2ZYWX 4JSTA 4LJ8A 2KB0A 4XH9B 2FH5B 5IDVA 1GOTA 2GDJA 2JLZA 3IHWA 1S9DA 2RH5A 3QKSA 1WDTA 3TUIC 4QHYA 3R9WA 3GLIA 1I2DA 2PEYA 4Q4JB 1IOZA 3CUEF 4HDQB 4JLPA 3DEFA 3AVYA 3LNCA 2Q9AA 4HLUA 4Q1FA 4B34A 4TTPA 2ZR0A 1NJGA 5JMTA 4PC2A 1VYVA 3FMOB 1E9FA 1SVWA 3E5HA 3V9PA 4C7OA 2HYIC 2XB2A 2Z43A 2B8WA 4XVQA 1QHHB 2KE5A 5C46F 3K9GA 1GRRA 1YR6A 4OQNA 5AUQA 3TUZC 2OT3B 2G0NA 4E22A 3WBJA 1ZUNB 5JI2E 2WAYA 1Z06A 2GJ8A 1EFHA 1QHGA 2QTFA 1B23P 5EZ5A 2VQSA 4DIEA 2GEDA 3NKVA 1K5DA 4N0DA 1ESNA 4IEEA 1NN3A 1NG1A 2BHRA 2LKCA 2P0EA 1LF0A 3O8DA 3AVPA 4RD6A 1DAKA 3P4XA 1YVDA 4XTRA 2OCPA 4CW7A 4JIMA 3L8ZA 1EWRA 3U61B 4RCZA 1S2MA 2AL7A 3BRWD 5HCIA 1UEIA 1IY0A 4WZBE 4TMKA 3ZVRA 2H17A 1E2JA 2YVUA 1OH5A 1P6XA 5JJKA 3ZYCA 2IYSA 1JI0A 1KDPA 4ZV4A 4AY2A 5FUVA 3VR1A 4A0HA 2D4HA 4FXPA 1W2GA 2MMGA 3B2EA 3AF3A 3H1TA 5G3ZA 3VKWA 3KQKA 2YINC 1AGRA 4QXAA 1XB2A 1S3SA 1JR3A 4ZKEA 2QA5A 3ND8A 4LV8B 1CJVC 3QPVA 4FCTA 4YDHB 4Z1MA 2J1LA 1U0JA 1ZNWA 5CYPA 2A5JA 2Q9BA 1YR7A 2XZOA 3PXGA 1FL9A 1N6KA 4KYUA 4P4TA 4AURA 1XDBA 2O8DB 1YZUA 2QN6A 5L3SA 1OXSC 1KOFA 4CT4B 2GILA 4BFWA 2GCPA 3U3OA 3FMFA 2ZRBA 4MYUA 3WMEA 1E2IA 4OI4A 2EYUA 3PEUA 4RVCA 3TW8B 2JLVA 5JJLA 3RLFA 3K70C 2BMDA 1GSIA 1XEXB 2OCBA 3BH0A 2R6AA 2GCOB 1AQUA 5K8LA 2ZI9A 5CB8A 2PJZA 5IK2A 1Z8FA 4BWYA 1G5RA 2BMFA 4OKSA 1ZBDA 4IVQA 3VU9B 3WRYC 1MOZA 2F43A 2QU8A 2XJ4A 3P20A 4Z54A 3CLVA 1VECA 5HKKD 3D3QA 4ZCMA 2H5EA 2EFHB 2F7SA 1U8YA 4GBMA 3SZRA 1XMJA 3LFUA 4M4SA 4OI0A 4GNKA 1N5KA 1TL7C 2EQBA 5H1YA 3LXXA 3C4JA 2XJ9A 2X2EA 3GQBA 3NBZC 1R8QA 1FNMA 1E6CA 1VCOA 2P2LA 4TYNA 4ARZB 2V54A 1RYFA 1G7CA 4ZIRA 2R8RA 5HPYB 2ORVA 5AJWA 3Q7PA 3KKNA 1II8B 2A5FA 3M4YA 1L4YA 1R0XA 3DDCA 4C0QC 4TTRA 4RZ2A 1I4TD 4UNPA 1D2MA 1S3GA 1T3HA 3K09C 1SXJE 5TY0A 3X1XA 3BFXA 1NSTA 3WMGA 5FBQB 4Q9IA 4QJ4A 4PSAA 2AKAB 2DWPA 5EUQB 1AM4D 5JJIA 3ECCA 4TL7A 5P21A 3TQFA 1C9KA 2R6CA 2I1QA 3FTQA 2GXQA 2XOKA 4KJZA 3EWAA 2NO0A 3CX7A 2A5YB 4MITA 4B47A 5BYKA 3O8RA 1XEFA 4PZZA 2OBNA 3UG6A 2GXAA 4JS0A 1NN0A 4URWR 1Q22A 4LK2A 3TR0A 2FSHA 2KSQA 5C4MA 3WHLA 1TUEA 1Z22A 4V0LA 2NZ8A 3WNDA 3EC2A 2FMXA 1XD2A 3F3YA 2N46A 5E4FA 2GESA 4IDQA 2AHOA 3AF4A 1GAJA 3PQCA 4TYPA 3KDSE 5KO2A 4LYHA 5J4YA 2OXCA 4P4UA 4HUTA 3WHKA 2PMKA 2JA1A 3RS5A 3DPUA 4LBVA 1XU4A 2QTHA 2Z4SA 4Q7KA 4HZUA 2CXXA 3QOFA 5SZKB 1GKUB 5LDDC 2ZREA 2PCLA 3T1VA 2WSSD 1KO1A 2J7PD 1SXJA 5AJZA 4P33A 1JECA 3GLGB 1DAHA 4GI7A 3LBHA 1W4RA 1P9NA 4PC6A 1UBEA 4EKDA 1KSJA 4JVSB 3I72A 3PUWA 4JVLA 2OE2A 3GCGA 2V9PA 3OEHA 4V0KA 3ZH9B 1EGAA 4PAQA 5L8VA 1S8FA 721PA 1D2EA 1H65A 4A2PA 2E1RA 2C9CA 3QXHA 521PA 1E2GA 1XCMA 3U44B 2HV8A 1EFTA 5KTYA 5AUPB 1VIAA 1HEIA 1Z0DA 1OYWA 1XXHE 4JBYA 3CBQA 1N5IA 3K0SA 1TNDA 2FG5A 1N3BA 1GTVA 1CJTC 1TQDA 4TMTA 5IHPA 4LBZA 4M1YA 3JVUA 1TF7A 3UK6A 3VR4A 4ZCLA 4LJ6A 2ZJOA 2ZPTX 5FPSA 3GJ5A 3UMSA 1IXRC 1IN8A 3LQRA 4KFSA 2IWRA 2JJ2A 4MYHA 1ZNYA 2WJYA 3W3ZB 1P61B 1WCV1 4RFSA 3DOFA 1KMHB 4Q4AB 3SS8A 2GXUA 4NP6A 4MGIR 3CZQA 4JL6A 2FV8A 3ZZTA 1NMYA 4LCBA 4KYIB 3HU3A 1SZPA 3RSLA 3BFKA 2ODBA 2B7BA 2JJ1A 3WYFA 3NC1C 5J4KA 4HAXA 4BFYA 2YC2C 3ZD7A 3GJXC 4OQMA 4C3ZA 2ZS9A 1P7CA 3AVOA 1COWD 2K5UA 1X8KA 3M6AA 4A0RA 3EAQA 2OHFA 4FMDB 5FPKA 4TSFA 2OZEA 3U4QB 3TAHA 2C8VA 4KBFA 2A5DA 1GZSA 1KY2A 2ZAMA 3CRMA 2QGZA 1LW7A 4QBFA 4RKEA 4YC7A 2JLUA 1NL3A 2ZROA 1SVKA 3AP2A 2GVDC 4F92B 1XXHA 2V55B 1QHXA 1R2QA 1LS1A 3OFND 5JLJA 3CRRA 2Z0MA 4IOLA 4NMMA 4A4DA 1QHNA 4B73A 1ZVQA 2AFIE 3I8SA 1MABA 4TT3A 2ZUBA 3KKPA 1GVNB 2IXEA 2IUTA 3BERA 1JQJC 2KI5A 2F1IA 3A1SA 1W0KA 1YRBA 3LLMA 5KDDA 2XITA 1PLJA 4M1OA 4PSKA 4UNQA 1W44A 1NVXQ 1SHKA 3E2IA 4Q1BA 2ZYTX 3K0CA 3WXMA 3ZVMA 3IPYA 4H1UA 2CE7A 1GRQA 2E87A 4TYYA 5KDLA 1KZ7B 2B8TA 3FYHA 4IXNA 2NQ2C 3GEIA 3U3MA 1E2HA 3ZS8A 1JXMA 4A8JB 3KQUA 2JEOA 1X1SA 2J7KA 3IIMA 3Q8XB 4NYJR 3EZ6A 4I4LA 3FPAA 1EFRA 121PA 4DDUA 1N6PA 4TQAA 4KO8A 3TSOA 2R65A 1YR9A 2GBLA 2JASA 1G64A 2J45A 4II7A 2RGNC 3NG1A 3MGCA 2PLRA 1MO6A 2ZJZA 5C18A 3NXSA 4HLUC 1F6BA 1US8B 1OKKD 1UPTA 2IF0A 2ZRKA 2JDIA 1F2TB 4MDEA 2ZU0C 2QP4A 4S35A 1LFDB 1CJKC 2H57A 4JLOA 4TQUS 4JBXA 2BMJA 1U90A 1Z0AA 4PHGA 2EVWX 4A6PA 1F2UB 2DFLA 2FEOA 5CITA 2IK8A 1X6VA 4NCHA 1D2NA 3KQNA 4HLQB 4MRNA 3A4NA 2ZRFA 1X86B 3P26A 4CRWB 1JR3D 1GM5A 4TWZA 2IHBA 3WMFA 4C30A 4KITB 1RW4A 4NBSA 1OIXA 3GJ6A 3D8BA 4UNSA 2FSFA 4KV9A 5DISB 2DWOA 3QE0A 1GRNA 3P4YA 3NWJA 3CIOA 1G20E 3LAWA 3CF2A 1PJRA 2I1VB 3CRVA 5CIQA 1TUIA 4MKHA 1J99A 2J5XA 1U2RA 1TAGA 1IAQA 1C4OA 1VYTA 4GP6A 2Q9CA 5L3QB 2GWHA 2HEIA 1II9A 3T1TA 5EXSA 3M1IA 3GJ8A 3AUXA 4MRVA 3AP3A 5LB4A 1TMKA 4I1OA 5BQ5A 2X8AA 1LF5A 2C95A 1R10A 3W34A 4HSEA 3I8XA 5FBRB 4B3GA 4A1FA 1D8TA 1JBKA 5IK2D 4Q4HB 3PCRB 3A1VA 1L4UA 2FZ4A 2ANCA 4R2HA 4AG5A 4PQFA 1VMAA 2IYRA 2RGGA 3W9YA 5F9HA 5JWRA 1Q3HA 1PUIA 4L15A 5KDOA 4DCVA 5SZIA 2QMUA 1XD8A 4IRUB 5FTMA 4PHTA 1CLUA 1SHZA 4DLSA 2XAUA 4OK3A 4Q48A 2WWGA 2QM7A 3L0PA 3LO5A 2QT1A 1NMZA 3FHTA 1VG8A 1MO5A 1OFIA 3QXJA 3C16C 1PUJA 2YOGA 1LY1A 4EDHA 1EWQA 2JLXA 3WY9A 4KODA 3B1VA 1R0YA 4HB0A 5KYKA 2RGDA 3SJBA 1DADA 1KSFX 2XEXA 1AJEA 3IBYA 3PITA 5DO9A 3TJZA 1XNJA 2CEAA 3TLXA 5G53C 4AD8A 1P4SA 4LJYA 2A78A 3TVTA 1FNNA 3MRSA 1Z6XA 1XD9A 1SKYB 2YJTD 4NKRA 3TMKA 2ZVPX 4JVNA 4DCUA 2CNWA 3PENA 4L9WA 1NNEA 2O8FB 1N6OA 4HLDA 2BCJQ 1HUQA 1KSGA 2F1HA 2XOKD 5HZHA 1XPOA 1CF4A 3W5IA 1N0WA 2YWGA 3ETLA 3QG1A 5TVKA 3GLHB 1J8YF 2VBCA 4AI6A 3QY0A 1D5CA 3KB1A 4GZMA 3OIUA 2ONKA 5G3YA 1H8HA 1SKYE 1CR1A 3A1WA 3EPHA 3ADKA 4RSGA 3ZIAA 2CL7X 3FOZA 2ZJ5A 3GJ0A 3ZZUA 3U5ZB 2OV2A 3CNNA 1VDZA 1E99A 1ZP6A 5B57C 3GLHE 2RAPA 3QI2A 3ZQ6A 4KI0A 4ZI2A 4LHWA 2HT1A 4BPBA 1CU1A 1U0LA 2CL6X 3U7EB 5GVSA 1ZUIA 4M8NE 3LW8A 3M0EA 4G0NA 1R4AA 1E2EA 3VHXA 3U3RA 4DLWA 1KDRA 5FPYA 1UBCA 2ZI5A 1BS1A 1RRGA 4NCIA 2WWFA 4OQLA 1FTNA 1NVUQ 4TLDA 4HZIA 3RYTC 2GJAA 4IFBA 4BFVA 4DDTA 1E9BA 1JJVA 1YZLA 3OEHD 5FUXA 3F0TA 1IY2A 2RGEA 3CNOA 1KYIA 4D4MA 3IIJA 2ZU6A 3EZFA 1DEKA 1CULC 2QTVB 2O0HA 3P1JA 2G1KA 3LY5A 4F7WA 2HYDA 1RRCA 2ANBA 3DHWC 2R6FA 4G01B 1BMFD 1JNYA 3ADCA 1EX7A 2RHMA 3NBFA 1SXJC 2V7QA 4BLTA 2J0UA 1DBSA 4DCTA 4I99A 4XWOA 2C03A 3A36A 3D31A 3ZDQA 2D7CA 1NSFA 2NTYC 5IT5A 1Q1QA 1UKEA 1RZ3A 1KTVA 2JJ2D 3NBXX 4URYR 4DVGA 1E0SA 4UXHA 3T1QA 2EU8A 5L3VA 3R7WB 1E9SA 4HAWA 4MGZR 2RB4A 1IXZA 1K6MA 2XSZD 5LB2A 1KGDA 4KHZA 3P32A 1SVOA 4IDNA 5DNYB 2IS4A 1U9IC 5BN3A 2WHXA 2JJ1D 2JJ8A 5KNBA 4I1UA 1VYUA 4B2PA 4BZXA 1CXZA 1QBKC 5CDFE 4LYFA 5EE3A 4R7ZA 1DPFA 2Q3FA 4M2LA 5FOVA 1N25A 4TSFD 1QVRA 1EX6A 4Z51A 2GJKA 1WQ1R 3EZ2A 4ZCIA 4TMWA 4KSCA 1JB1A 2HJVA 4WW0A 2WOJA 4FW9A 4TZ6A 4QC2A 4JKIA 3UANA 1E0AA 1JQLB 4A9AA 2XNDA 2D62A 3K0AA 2PH1A 1G19A 3SYLA 2BJWA 4FIDA 2QM8A 3BAFA 2QSYA 2RMKA 4F91B 2QUZA 3RANA 4S2EA 2J59A 3CF6R 4NONA 2PZGA 4XOIA 4PFSA 2OCAA 4OBEA 4TT3D 4URXR 3T1OA 3DVLA 4OI1A 3KXKA 1Z63A 2Q6TA 4DDWA 1LTQA 1VCMA 4JKYA 2Z6VA 1W4BA 1CJMA 4DWJA 1W4AA 4MKIA 1ZMXA 2XNSA 4UKDA 4D82A 1UKYA 4B3FX 1GDDA 4FD2A 4QGGA 3KZ1E 3EASA 3BB1A 3RC8A 3VR5A 2O0KA 2R6DA 2UVQA 5DSZA 5FI0B 2UZIR 3ND9A 2GJ9A 4LC1A 4EQ6A 3G0HA 3IEVA 2D06A 4QJ5A 2QPOA 3EIHA 4OK5A 4RZUA 5KSYA 1IXSB 1Q44A 1YZKA 4DIDA 5KU1A 2DYKA 4K8OA 3TAUA 3NH6A 2CBZA 1WE2A 2YHSA 1J7KA 3I32A 2ZIAA 3PUZA 1IM2A 4O25A 2ZVQX 3TE6A 4Q7LA 3AP1A 4LDJA 4WA7A 1G4AE 4DXAA 1XMIA 3SJZA 4CF7A 3REFA 2BBTA 5A0FA 1JAHA 1M7BA 4DB4A 3VQTA 5CYOA 3VX3A 2BDTA 1YR8A 1DS6A 1KAGA 2DBYA 2WWIA 2QGNA 4PPFA 3OIVA 1KI6B 3L43A 3BXZA 1ZC4A 1E4VA 2D2EA 3SEAA 4ZDIA 4B71A 4ZI3A 3PEYA 2WM9B 4US0R 2G88A 3EX7C 4YMSA 4JYCA 2P6NA 4Q00A 4UXIA 2ZAOA 5HTKA 2C5LA 1NBMD 2GBLC 2YOHA 3CRQA 3EZ9A 3I61A 5F98A 1T91A 2QRZA 1R5OA 1MO3A 2W0SA 4D0NA 4HLCA 5EP1A 4DUGD 1MO4A 2RGNA 3SYKA 1NG9A 1P3JA 4QBIA 4Y0VA 5KOYA 5FL7A 4P32A 2TMKA 3L82B 1W47A 3CF0A 4E07A 4JMPA 5EE9A 4R71A 3R8FA 4RKFA 4QRHA 4Q21A 1W49A 4LZZA 4JVMA 2WMOB 4JLDA 4Q03A 1T5IA 3CR7A 3EZ7A 4LI0A 5JI3E 1PLLA 1FQKA 4RZ3A 4ASUA 5JZVA 4PZYA 1HV8A 3X1YA 4D81A 1WXQA 4NH0A 1BKDR 4EPYA 4QG7A 2VHTA 1E9AA 5CLQA 4HUQB 3RAPR 1G18A 1A7JA 1VG1A 1RPZA 1GL9B 3VTKA 1N0VC 3ICEA 1A1VA 3CRW1 3FKSD 1XPUA 1XTIA 2C78A 4NE2A 3C5HA 2Q21A 2J0QA 3TNFA 2O8BA 2A9KA 3BBPA 1UAAA 3CPEA 4BFTA 1ZU4A 2OLJA 2KWIA 2X2FA 3I5XA 4US2R 1IY1A 3BH6A 2J0VA 2C77A 4Z8YA 1XRJA 3AF0A 2ZI4A 4V0MA 1T3SA 3HWSA 4EPWA 2F6RA 2GK7A 3D7MA 3QF4A 2CLCX 1TTTA 1IQPA 2ZITA 3KXLA 3K70D 4DB2A 3FDIA 4MQBA 2VPPA 4HB2A 4M1KA 2BCGY 4CEJB 2ZSAA 3EA5A 2HUPA 4DJTA 1G8GA 4YMVA 3LH5A 1KIMA 1BYIA 2QG6A 3OAAD 2YWEA 4QGHA 1E2LA 4AYXA 1AIPA 2CNWD 4HI0E 1VPLA 4LJ5A 2WVJA 3EPKA 2FGJA 2W2XA 2ZRGA 5FUYA 3PEVA 1TX4B 4B2IA 3SBDA 2O5VA 5JCZA 3VHLB 4BECA 3BE4A 2VH5R 2OBMA 1W36C 2BM1A 1E2DA 5FTNA 4QOSA 1FPMA 1X1RA 1ZM3A 4X8HA 5GJVC 4Q4JA 2J3EA 2QPTA 3B78A 5LBIA 2GRJA 4K81B 1G21E 2AFHE 1FMLA 1H8HD 2VSFA 2JAQA 1XD2B 3TQCA 1QHHA 1SULA 4IEIA 1SVMA 2WWXA 3W3AA 3NHAA 2VLIA 2A7QA 4XD7A 3GPLA 1E3MA 3ZJYA 1P2TA 1FP6A 2DWQA 1W4CA 3MMPA 2NO6A
chains in the Genus database with same CATH superfamily
4EM6A 1N8TA 1OHHA 4LUCA 1LLDA 4FM9A 2DHRA 2G82A 2YWJA 2AD5A 1XAJA 2I7DA 3WE7A 4M9RA 4ZI7B 3E9YA 1GPKA 4HLNA 2AEJA 2AK3A 4ESVA 4ZEXA 4AO7A 3ZBQA 4PVCA 3BQMB 5DHFA 5KU7A 5FNVB 5B3KA 2HREA 1GUYA 4GGMX 4GBJA 5HCNA 5LN1A 3FUVA 2A6PA 1J1UA 3K6JA 1PWYE 4E0BA 2ETXA 4DIKA 4FEAA 4Y2QA 3DFKA 4DMGA 3TLBA 1NAIA 4RPGA 2FE4A 3IR7A 1SCNE 1IZYA 3RRZA 2HLPA 1D9ZA 4WLUA 2FUCA 4H0CA 3RWMB 2HBRA 2M98A 2WM8A 3VH2A 3ZY5A 5B58C 3AYZB 1XMVA 4RQBA 4YXWA 3R9XA 2QP9X 1LGYA 1Q57A 2YWRA 3GVHA 4YFYA 5EVJA 2OAEA 3K6RA 1TA4A 1QRDA 2FZGA 5LOVB 1OYOA 3LPDA 1C1YA 1LVUA 4W9NC 2AUMA 2I2XB 4HAYA 4O2RA 4Q05A 1CZKA 2HWXA 4MROA 5C5IA 3T52A 5BMVF 1V1JA 3QEAZ 3PPWA 5BWBA 2R7LA 3WTCA 5HCUA 1E1DA 4O33A 2FZLA 3HY6A 3L6BA 4ND3A 1H22A 1LD3A 1HY3A 3LWBA 2IV3A 1FYFA 3U09A 4BV2A 1QGAA 1E1NA 1SVLA 2AOUB 4I1IA 3AHDA 3NHYA 4E03A 1R4ZA 2UVDA 2J6IA 1YB4A 4MUIA 2ZAIA 4OIFA 4X5OA 4I4NA 1QFJA 3SC2A 2X15A 3WGNA 4PAWA 1XEXA 1VKJA 4EB3A 3L9WA 4YWHA 1LBHA 2FFQA 5HP4A 2UZ3A 3IGFA 2QVCA 3VU9A 4NZOA 13PKA 2I2DA 2WBLC 3I3SR 1IHOA 1B8UA 1J24A 1M75A 2HDNB 1GQRA 3BFJA 2R1VB 3NJ8A 5DLQC 3KCQA 1B15A 3F73A 1M74A 1V5WA 1USWA 1P19A 1XQVA 2B4RO 4MR9A 2I3DA 4RCYA 2C94A 1T1RA 5DSTA 8OHMA 1ZZEA 4RK5A 2FEKA 2MSKA 2WZBA 4TLMB 4TYQA 5DI3A 2QY6A 3THOA 3R0ZA 4DQDA 2VF7A 2XAAA 3A1TA 4O4IA 4ZARA 4I0WB 1MRNA 4KEAA 3K9HA 4EJMA 1KC3A 3EPPA 4JP8A 5C8YF 3WWCA 1II8A 4BB0A 5A04A 2DY1A 5HGJA 1GKLA 2AXNA 5FOTA 5JBQA 5IM4A 5CA0B 2XXAA 2WAAA 1WO8A 1A9XA 1C7IA 2GASA 2HPAA 1JDSA 2OCYC 3AB8A 2N75A 4HB3A 4OGLA 3EPLA 3N2YA 4GM1A 4IJKA 3HLKA 4NBRA 4DWOA 1YTUA 2H1FA 2V3VA 3C3MA 3K30A 2P0YA 3CVWA 4WXMA 2CSXA 1ILEA 1ZOLA 3O9MA 4WVLA 3HO8A 1CZLA 3MLEA 3L8HA 1BAPA 2FY8A 3B1ZA 3LKDA 5B7QA 2JGEA 1Y8QB 4YRSA 1FSSA 1PR6A 5D3ZA 3BL6A 4Q3EA 1G1MA 1P18A 3HZHA 4KWCA 3RBAA 2C2ZA 3GVIA 3A1FA 2ZANA 3ED1A 1Z37A 3UK7A 1E18A 1WRBA 2GS9A 2V6JA 1F3LA 3RK0A 4F4CA 4UEQA 1RPAA 3Q7QA 3MMXA 5IZCC 3L5OA 2HC9A 3DMDA 1MT0A 3F6BX 2WKQA 1NXWA 3E81A 1M9NA 2XYRA 2B4QA 3RSQA 3KZVA 4LNUA 1NULA 4JJFA 1W5AA 1ZBQA 4CQLA 3TTTA 1J4AA 3U56A 2WMNB 2BFEA 4O0LA 2VPZA 4MRPA 3ILVA 5G0SA 1VBNA 4Q39A 4BVAA 4J8PA 4B3DA 3H3XA 1HRDA 2ZUDA 5F77A 4DQVA 3HL0A 3R5FA 4U00A 3PQ7A 5GQSA 2O8CB 2O19A 1RWOA 5KWSA 4Y1GA 5BN1A 2ID8A 3GLKA 3MIZA 3DB2A 1ORDA 5H70A 5TF4A 4QBTA 4CKEA 1KRWA 1UC4B 1OH8A 1DSSG 2QR3A 4U7FA 4RPCA 2RGAA 4QQFA 2AI2A 4P3XA 3OT1A 1HEYA 2DPXA 3E35A 1FP4A 4AF6A 3UMMA 3IILA 1EE2A 4A2QA 2G4LA 3WKBA 2CY0A 5DZSA 3CG4A 5L53A 1YT5A 2WU0A 2B35A 3NOVA 1GA4A 2RI1A 1XZQA 2W48A 3AJDA 3IA7A 1OZHA 2EZ4A 4OB6A 2ZBEA 3BDVA 5DBOA 1PFGA 2HQOA 1CR2A 1TM3E 1G17A 2G07A 2J41A 2DFKB 5JD6A 1OBHA 1WXXA 4AN4A 1YBVA 5K8TA 2NAPA 3NHKA 4NCAA 1NJ5A 5CHYA 1FTWA 2JBHA 4K6GA 3GCWA 1NMSA 2JGLA 2ZIXB 5EUMA 4ZVOA 2WWVD 3RJZA 2EFYA 2WDPA 2JBAA 1D6MA 1E1LA 3G2OA 3KOOA 3LQ4A 3BIFA 1T4BA 1PFWA 3G85A 3IQIX 1U94A 3N59A 4LBWA 5E7JA 3T5DA 3TIGA 3O4JA 4OATA 4UM5A 2EFGA 2N47A 3N39C 3IKJA 4B6EA 1A8IA 3CE9A 2CT8A 1SHJA 5E1OA 3PUJA 5GZ3A 4JJ4A 1IB0A 1KU6A 1GUDA 2OFXA 3HBMA 3ZW7A 4NJEB 5DYIA 4DJFC 3AOGA 4OH1A 1V7ZA 4KXMA 1TCVA 1WXEA 1YACA 3AR2A 2B83A 4FBGA 1MVOA 4DLRA 1A4XA 2DBRA 1UBRS 1QIHA 3HEMA 5CNMA 1QC5B 5AKGA 3IXLA 2JLYA 2FCAA 4JC8A 5IUJC 5IANA 2OHVA 2VSNA 3MTDA 4RD4A 1RQGA 2APJA 3BMOB 3I04M 2ATVA 4RD0A 2R00C 3TX2A 1PFKA 2YNMA 5BSEA 1C1HA 2G83A 1N2CB 1ECJA 4OHZA 1IN5A 1L4GA 1MB2A 1W73A 1A2BA 4IRMA 2QBYB 2Q4BA 3I6YA 1TPZA 2QSZA 3MUFA 3AK4A 1DEAA 5JE8A 3UHPA 3ZC3A 2EF1A 3H18A 4K86A 4EKIA 4IXDA 4U8GA 1QFXA 1RTTA 5T4BA 4CR6A 1GPWB 6NULA 1P1JA 2HXSA 1TA0A 4DR4B 5JSQA 3IBGA 2ZB7A 3AERB 3G2NA 2CUZA 2O2JA 4KPEC 3TFWA 2PPVA 5JVDA 2IVZA 2OYRA 1GEGA 5DGIA 1KR5A 1K5HA 5ELMA 3G82C 1NQOA 3HYCA 1YMQA 2O0JA 3LLSA 3LHIA 3MSXA 4OK6A 1AS0A 5KZMB 2H0RA 5LMNB 1L4NA 1IU9A 3VNQA 4I1RA 5EJGA 2QN1A 4B85A 3W6UA 3QMWA 3DL7A 5D51S 2IHZA 2Q2QA 3AW8A 5IABA 4NC9A 1H1LA 1OBOA 1ODFA 3EIEA 2RKOA 3K9NA 2EOAA 4H7EA 4KX3A 3UCEA 3G0OA 3BC1A 6ABPA 3HBJA 1Y42X 1G6KA 2HA4A 2HH9A 3ORFA 5TMEA 1KXZA 5EJEA 2QVLA 1HSZA 1T2DA 3AFHA 5EE1A 4D0LB 3L5KA 1F8YA 3N58A 1EH5A 4WBSA 3RQIA 3OTIA 4BKOA 2QE6A 2CUKA 2X6TA 2JVIA 3FZYA 1RI4A 1TVEA 3JQFC 3W34A 1L8AA 1EFCA 3K9QO 1GTZA 2PX6A 5I8WA 4LQDA 4KQ9A 5BT9A 3SJAA 5ECYA 3GLFE 1I1HA 3THSA 3KG2A 1KZGB 1NNI1 4V0OA 2AXQA 3COSA 4F5YA 1EQ2A 3WWEA 4OA8A 1OV4A 3ESQA 4XUEA 5E1MA 4IGAA 3L0ZA 3BN3A 1GV0A 3QITA 2C88A 4UAGA 4Y18A 5E6RB 5HDBB 1A50B 4J91A 2QG9A 4H3HB 5A9RA 4BVHA 1XG5A 2FOLA 5KYUA 3I6IA 1AQIA 2JFPA 4R05A 1YB5A 1IJFA 1TF5A 1SCJA 2JJQA 3CPHA 3GQVA 5JH7A 1LX6A 2AG0A 1H4SA 2Y71A 3BFPA 3RUAA 2NPIA 3ENNA 3S1AB 3BK2A 2R7NA 1EHIA 5AQEA 1U28A 5GJBA 3ZJ5A 1C1XA 3KOZA 1OI3A 2SKEA 1N0HA 1RYZA 3G7SA 4FC7A 3ZN2A 4C2BA 4WBXC 2W0MA 2QVBA 3AEYA 2AWNA 3WAJA 3QLJA 4UOZA 3IDQA 3HCNA 4U9UA 4PNPA 4DLBA 5AJXA 5K0NA 5AYVA 2HJWA 3JVDA 3QFHA 4RVDA 4ZOLB 1NMXA 2PBZA 1J42A 3BRWA 5EMNA 1OH6A 3B13B 4YMTA 1E5LA 1UJCA 4EYSA 3PPIA 3OF5A 2BEJA 4MCHA 4QPNA 1K3UB 4YRMA 3OEEA 1OB5A 4Y9DA 1FFAA 4G5OA 4IDCA 3D6TB 1UBUS 2RJNA 3ED5A 3Q9NA 3ZY4A 4HG2A 3UJ8A 4PXAA 4KQ6A 1PZHA 3KEMA 4TLLB 3QBEA 2CVHA 1HL3A 1RBYA 2I4IA 2IGBA 3PGA1 3R7SA 3RFXA 1FQOA 5CB4A 2EGUA 1FE8A 2EW8A 3NU1A 3OLZA 4RFLA 3TXAA 3CZCA 3RYFB 2ECKA 1IZ8A 4INZA 1C7QA 1RJGA 1SFRA 4PWYA 3UENA 1SUAA 4ALNA 1D8AA 1EEXB 3DQPA 2IUSA 4KUEA 1Z35A 4P1ZA 4PCLA 4R8KA 1CIVA 3RNLA 2Y2VA 2PRJA 1YZTA 4I4TB 3GA5A 3Q9SA 3UHOA 4MH0R 3NHZA 3U9SA 2P9EA 2VYVD 2YJNA 3OWOA 1PUXA 4RH1A 1IMOA 3A04A 4ER0A 3A2MA 3QP9A 4NATA 5L3QA 1IIRA 3K9LA 4AKEA 2YW2A 1A9PA 1OIWA 2H6EA 3H1GA 7ABPA 4E5UA 2DR2A 4YJFB 4HYYA 1FOEB 3W4JA 4NZYA 4ES6A 3NEYA 3NHPA 3T15A 1NQWA 1EK5A 1QLHA 4EY6A 2HEGA 5JY6A 1A8SA 1GQ2A 3UK0A 2VHJA 1QG2A 4X66B 4MUFA 1A7AA 1DRUA 1XDUA 1ID8A 4G0QA 4MZDA 1SXJD 2I0FA 2GZSA 4JQSA 5AIAA 1U3VA 3HR7A 4BJHB 1IWBB 3A3NA 3OCZA 3P2KA 1FRNA 4LZOA 1RJEA 1HFEL 2FX3A 2CJWB 2GH1A 4BTVA 4CLXA 4I55B 4WJLA 1CS0B 1EP9A 2ID9A 2OQVA 5F7OA 3LUPA 2C2WA 3H0CA 2PGAA 3PHGA 4KBGA 3S5JA 2LCFA 3GNTA 4LSZA 4NAUA 1DUVG 1JT9A 4BEVA 1ETHA 2ZJ3A 2XYHA 4E2FA 3ZZMA 2PK3A 5ECDA 3GLRA 1CDEA 1ZN2A 1FSPA 2QTWB 3QU5A 1M5UA 1QXSA 3LYAA 1W6UA 4L9SA 5ALOA 5CIWA 3TIIA 2KQUA 3IOEA 3MOIA 4XLTA 4IQFA 4EARA 2E2WA 4UREA 2V6GA 5KX5A 5G02A 3H4TA 1T8UA 4FI3C 3VKUA 3GUYA 1CY8A 1E2PA 2KM1A 5EJMA 1OA1A 4FMDF 1HE2A 5GJWC 2GM9A 1EFAA 4LYEA 1J8DA 2O8FA 1U0HC 3JZIA 4F3YA 2ZE8A 2XQGA 1YJAA 3A9TA 2IDKA 5CFNA 1XRPA 4FYMA 5G0WA 2NO5A 1UZUA 3AEQB 1WLYA 4G1UC 5DTJA 1NUAA 1XVTA 1YI0A 3GLHA 3HC7A 4GX2A 1J8FA 1S4QA 2BUCA 4PU0A 2W90A 1MOSA 4TWJA 1QR6A 5T4EA 4G23A 4YCMA 3PUIA 4DZTA 4MRNA 3K6SA 4G2NA 1BRMA 5CEFA 1C0KA 4HF7A 1CWUA 1NKVA 1JFFA 2W98A 2BZSA 1BYUA 1JR2A 2PH7A 2WZDA 3HDTA 4Q01A 3ST7A 1H2RS 3OFKA 4YBRA 5FORA 3U9LA 1M73E 1LW6E 3M9LA 2ZQ5A 3N2IA 1MPTA 3J7AC 2VHYA 3C3WA 3X44A 3HXOA 4XX0B 4QECA 1ZZGA 4N1AA 2ZJFA 2WJJA 2A59A 1HLDA 4EG3A 2UZAA 3DSRA 3NT5A 5F4BA 5ANRB 4BAGA 2X0FA 4B43A 5I7VA 3VSEA 1TI7A 4GI1A 4CDRA 1GGKA 1EP3B 1GSHA 2ZJAA 1XJQA 4ISCA 4J1TA 1Z4JA 4Q16A 5JCJD 1X14A 1RXVA 3FVQA 2E6KA 2WABA 4MR8A 4OHYA 3O47A 2JFXA 1BOFA 2C5BA 2YVKA 3QVKA 2VQ3A 3VDQA 5E9AA 4C4PA 2ZCVA 4F3NA 1CZUA 3ZVNA 2IYPA 3AZPA 4FLMA 4NDAA 1VOTA 5LKRA 5I9BA 1V3QE 3WLRA 2DULA 5AVWA 3AW9A 4DMLA 1FZTA 3IPXA 4XJXA 1W0KD 3U7IA 3MBKA 1U9CA 3QENA 3ENQA 4IV0A 4R84A 2J3IA 3MWLA 4Q02A 5FT9A 2RGRA 1TKAA 4S1TA 2QTVA 1EZZA 1KO8A 2Q6LA 2XDWA 3B51X 4O4LF 3JAKA 4HNTA 1TPYA 2PTHA 2Q49A 3DLIA 1BX1A 3LPCA 4TS4A 1AQ6A 4J2OA 3MFYA 3I01M 3PFHA 2SICE 4IDGA 4DLTA 3BREA 2H4XA 3BB4A 3TLAA 3QKSB 4L07A 4UJ3A 5CB0A 3TOXA 4OGGA 1P74A 3GLIB 1ZW6A 1MQ8B 1ODTC 2H07A 2QMEA 3LWDA 2JLWA 2V5UA 1AA9A 2FRDA 3D8UA 5IYZA 4ZDWA 5DHTA 4PSVA 3FPCA 1LPSA 1RQ7A 2Z3WA 4MV4A 2D7DA 3R4CA 2H8KA 1VMKA 4HPWA 3F96A 1B0UA 1PDWA 2JGMA 3H2GA 5BYAA 4C7OB 2GA8A 3C48A 4FWTA 2HB6A 3A37A 2AZ4A 1GPAA 3OQIA 3QPDA 1PEDA 2IV2X 1YZNA 3ZEIA 2HMSA 1G2OA 4EGJA 2IYXA 1WMAA 3KFXA 2I6SA 1ZJYA 1QVVA 3ZX5A 1FUKA 4ZANA 4F38A 3WP1B 1UBHS 1B8PA 2RG7A 3KALA 1UBMS 1FNDA 3WLMA 4KLCA 4O6VA 4KQWA 2R5NA 4PG4A 1J1IA 1ORRA 4D8YA 1RLTA 4GOXA 1C7JA 1QF9A 2GZAA 3KKOA 4DARA 3FNIA 3IMKA 1XLWA 4MJ7A 4ETMA 1NLFA 1TM4E 3HA3A 4QDKA 4DIFA 1EVJA 5BWMA 1G9TA 3P9YA 5B1IA 5E38A 2KW5A 3B12A 2W2OA 2XCLA 2YHIA 3NYQA 4Q7EA 3REQB 1L4LA 2A0YA 2Y9MB 3DNMA 4A16A 4HFNA 4DVJA 5D1HA 4PO9A 3UQYS 4EHIA 2FRVA 2XBLA 2X0NA 3SQLA 3CLRD 5B6IA 2G1JA 2IPLA 2QP3A 5JCOA 3UUGA 3C8DA 3LDUA 4NARA 3Q0IA 4KRFA 3N1UA 4TN1A 3IJ5A 3LRPA 2P1DA 4XDZA 1PF7E 1DAOA 1IATA 1KHTA 1QLWA 4MUYA 3UKDA 4XEHA 1M34B 3FMVA 1L5YA 1NIJA 1NHGA 1O9BA 2YNMC 2A9JA 4RFVA 2WE7A 5CFLA 1VA5A 3VU1A 2FZCA 4B83A 4IG9A 1FZQA 4ITRC 3W1WA 1GAXA 2CE2X 4BLVA 1GZVA 3CA8A 4H7IA 4RENA 5HF9A 3FOWA 4DEYA 4YXFA 4FOOA 5GY7A 5HUHA 2B0JA 2IBTA 3T3HA 4ECEA 4BC1A 4FBLA 1XN1A 1L8QA 4NYMR 1Q1ZA 1KAOA 1T6XA 1E96A 2W2QA 3TFOA 2XMDA 4DTIA 1S89A 1YCDA 4G5RA 5CT6A 5EINA 5TMPA 5DMXA 3CW9A 1U5BB 5EHIA 4CL8A 2PXAA 2V9CA 4MARA 4GUDA 1BKYA 3DUWA 4L08A 1GKIA 3IT2A 3SI7A 2FKAA 3JWPA 3NBUA 2C9DA 4FR0A 1GZ5A 1SZDA 5C7YA 2HJSA 2Q6IA 1XZKA 3Q3HA 4DSZA 1C8BA 2B4KA 3VPFA 5EJ4A 3F5SA 3TX6A 5HRCA 4P54A 3DT6A 1DO8A 2QMQA 4ND5A 4C6TB 1EHYA 1N77A 2CHGA 3W90A 1R6DA 3T7KA 2PZEA 4IUCS 1T9KA 2X8WA 4GPBA 2FW9A 4YUZA 1QPZA 2GGSA 3CXUA 5G40A 2ISCA 3IVGA 4JJKA 3IIIA 1KI1A 3SHQA 1QAMA 5TGTA 2AZMA 4WZBB 4YV7A 2MYTA 5AHOA 3U7QA 3DW3X 3UGTA 3W06A 4UPEA 5LLTA 5EIXA 4FFMA 3RSHA 4K7JA 3AVTA 4J0HA 5A1TA 3P9IA 1OTXA 1R0WA 3PC8A 1X7ZA 3EXIA 4TTAA 4NI5A 1PRYA 1QGZA 1UR5A 4ZVNA 4TZ0A 3EFOA 5KS2A 3I2JA 4LFBB 2IZ5A 2KMLA 2W8BA 3DL0A 2P4EA 4QJIA 1X9GA 2PS0A 2MIIA 2WIBA 5K4HA 3L04A 1Z74A 3L41A 1C30A 4YJHB 1KI6A 2PQ6A 4H7PA 3ZDFA 1OZFA 1OKKA 2J5KA 4BQRA 4ZOQI 5GWXA 2X77A 2I8CA 3B1YA 4NZPA 2FPXA 4BMPB 1C7ZA 3A0UA 2WJAA 3BD9A 1J8QA 4LPKA 2IIPA 2XUAA 4CNBA 3U16A 4TTIA 2YZKA 3D5QA 4TMZA 3RRFA 4N7MA 1U28C 4M0LA 4KQMA 3PQ2A 2ZYHA 3P9KA 3UWOA 3OKCA 4C2TA 4DYDA 1VL0A 3LP6A 2QKYA 2VHZA 1XKLA 1YVPA 2J85A 4U2DA 4NU6A 3TW6A 1A9RA 5HF5A 1J90A 4ONEA 4HTAA 1SPXA 5F3RA 1GT6A 4PG8A 3IEPA 1MORA 4CMGA 4ENRA 3L6EA 2WTNA 3L4KA 4KO4S 3PXBA 5REQB 2PD3A 4GRIA 1C7FA 3G88A 5LA6B 2DPYA 1XC7A 1XZGA 1T15A 1AB5A 4MS1B 3T4XA 4YR9A 2G5CA 2ZJ6A 3HN6A 1ZSNA 4EUNA 2RHBA 1R66A 2BKVA 4HTFB 1AN0A 2IEBA 4IH1A 4X20B 3ZJTA 3H5TA 4GSYA 5CJPA 4HEA1 1W5SA 4LRSB 5EZSA 5SY4A 1TAQA 1QH9A 3BF8A 3E6AA 3LCJA 3G5LA 6REQB 3SEZA 1ODIA 3O4FA 5CNIA 1DINA 2QRNA 4P4LA 4WLVA 2ZWOA 5A4KA 5BSGA 1YIAA 3I64A 3PRYA 1L7DA 4C5CA 3NT4A 5B64A 1CP2A 5AJTA 3D2AA 1E1RD 3EQ8A 3WA6A 1JEYA 3K9CA 2EFJA 5I9IA 1J5EB 2HLHA 3UJ7A 4G25A 3PGMA 3SZUA 1W76A 4MV3A 1U2SA 4PZUA 4W7IA 2FZWA 5TPWA 2JIZA 3TAXA 2WD7A 3LCUA 4Q1DA 1N57A 4NHOA 4W5HA 5BYJA 4D5GA 1M5RA 4HNSA 1X8LA 3M6LA 3RCBA 3JU3A 3A58B 1BCRB 4C3UA 1EVQA 2W6JA 1XRQA 4P36A 5KYWA 1EXNA 2P2DA 1CDDA 4ZTZB 5CPFA 4HOYA 1RXCA 4OMDA 4EPRA 2AJTA 4LRWA 4M36A 5JAOA 1B1CA 3H1BA 4ZHQB 4DCSA 3NAQA 1NKTA 5CR9A 1X13A 2VRBA 5HG0A 1JFRA 2Z09A 3TGPA 1HQYE 1GGEA 4JMLA 3D54D 2J3HA 4CGZA 1S8NA 4FK8A 3S1LA 3ETNA 4XXHA 4MVJF 3JWGA 1N8SA 2FW7A 2WF8A 3II6X 4PZ9A 4F8YA 5KTRA 4ZCQA 1N2HA 1JXAA 3F9RA 3GEPA 4BZPA 4JSYA 3IQWA 2VP4A 1UBJS 1ML4A 5B2ZA 4KOEC 4YJKA 2GPYA 5FB3A 4JEUA 1E9DA 1OFVA 5GVRA 3WBBA 1NNSA 5KNBD 4Q19A 2A92A 3CLSD 5EP4A 1N4DA 4G24A 1WCYA 1WPQA 4DPKA 4FTWA 3ZXYA 2H5JA 3O5AA 3WFIA 1FBNA 4B44A 1QQ5A 3BF7A 3N8GA 2MWMA 1R15A 4XQGA 4ZZIA 1LQUA 2HO5A 3IP9A 3KJHA 5T4HA 5DW0A 4G1CA 1Z6GA 2D1RA 3TIVA 1EK2A 4Z0TA 2W4QA 1LV8A 3EZLA 5CDTA 4H1TA 3EG9B 4Q1EA 3CKMA 5DTEA 3IHKA 1VL8A 4DXDA 1ZG3A 3WYCA 2WW8A 1KPGA 1SCQA 1RYHA 5TB5A 1AURA 1H4TA 1JDVA 3DE7X 1UKVY 4DJEC 4NABA 4IYJA 1XQWA 2GCGA 2ZRPA 4OAPA 4OQFA 3RLIA 1RHUA 3BJZA 2GD6A 1UQTA 2PKQO 4M1WA 1MABB 5ALPA 2HY7A 3DHYA 4Q9HA 5DWDA 1C8LA 2P2ZA 4K87A 4QOJA 3GCXA 3MIIA 1QANA 4Y8VA 1KVUA 1N6LA 3PUXA 5K0GA 3AIKA 1R3UA 2NZJA 5I01A 3HE3A 5HWSA 1U99A 4CETA 1I80A 3T3GA 4J1TC 4GKBA 1G9XA 4DM4A 4E09A 5DX8A 4BFUA 2H92A 2C96A 2QTCA 2C61A 3QVOA 1OAAA 1Z26A 2WT4A 1JLLA 4R98A 3T7DA 1KYWA 1AGXA 3HSSA 3KKEA 1RKBA 3THYA 1QQTA 3UK1A 2ORIA 3PFBA 4FFLA 4M1EA 1BWSA 3QWIA 4KZPA 5BR7A 2R751 2XGGA 1RJDA 4PX2A 4F93B 4KLAA 3GT0A 4KAFA 1J2YA 4DIOA 1KEUA 5K2MA 2HBYA 2WTMA 3RKRA 4CFYA 1UMBA 2GRAA 1P2GA 2AD1A 5BSHA 4FHEA 1CPYA 1DP4A 2XEDA 3ZDDA 3BX1A 5TS2A 1V9LA 2X0EA 2QDKA 3BYZA 5A2GA 5ELXA 2BJVA 1WB9A 3HRKA 3RVBA 2QE7A 3W1EA 2Q29A 2VYNA 4AX8A 1J2RA 4LRYA 3V7YA 4XWKA 4Q47A 2Y0BA 4Q9AA 1MV5A 2ONYA 3M6MD 4ZYVA 3JZMA 1QM5A 1ZCJA 2H4HA 2Y67A 3GDWA 4MGHA 5CU7A 3VU8A 3ER8A 3ZHUA 5K8JB 2FRDC 3LL4A 4Y2JA 3SXJA 1JDZA 4LHYA 4LTDA 4QJBA 4FYJA 2Y1OA 1HYHA 1VHDA 4G1EB 1X7DA 3V34A 1LI5A 1N2JA 1XCLA 4ARVA 1SVIA 2I6QA 3B5EA 3IBSA 1M1UA 3SHWA 1Y6GA 1YV9A 3TS1A 3INGA 4ZVMA 1VYHA 4ERNA 1DRWA 4BNMA 2Y99A 1T0BA 1BG6A 1PGQA 2ALJA 2CZQA 4IVRA 3V33A 2WPDD 4ACBA 4LWOA 1JDBC 1JH9A 2VSYA 4CM4A 2VWQA 4LK3A 1HA3A 3W8RA 1V8FA 1EJ2A 4B33A 3SSNA 2WF7A 4DA9A 5J58A 3G2LA 4B5LA 4CTMA 2BBOA 3FROA 3N07A 4R2LA 4Z9XA 1BVHA 1UPBA 4HPJB 3RC1A 4AO8A 3AKEA 2B5WA 5E9WA 1OA0A 3G1TA 4CM7A 1FTQA 1LQ2A 1KF0A 4XJSA 4MRSA 2BFFA 3DM5A 5IJ9A 1J0DA 1GCGA 1FX0A 4GRAA 4NK5A 4BASA 4V1CI 3CZPA 1NHWA 5IEJA 4MV9A 1J2EA 3CEPB 5ENZA 4H15A 3UXMA 2OORA 3DBLA 2G1PA 3AR5A 3G8DA 1NZDA 4B3XA 3ITKA 1SCAA 5AOAA 2D1SA 4YRLA 4A8TA 5JMWA 4YLYA 1KEKA 1NP6A 4LXIA 2GKSA 3AT1A 3HDJA 3RC9A 3UJ3X 2GCEA 3KLNA 1F2VA 2W6NA 5DGTA 1MHTA 4NOJA 4JLJA 3QNWA 2RSLA 2WM3A 4KQ2A 1XU9A 2P65A 2PUEA 1X38A 4FMCB 3G3EA 2IHNA 1UDBA 2JGKA 1FPQA 2WF5A 2NU6B 2I4NA 5TEWA 4D56A 5B2FA 2OR3A 1RAAA 3JARA 3SKYA 3I9KA 1UC8A 1VHTA 1RLMA 3TW4A 2NZYA 3DDUA 3HMQA 3QE4A 3DB1A 4MQFB 4RF5A 4XX1A 3THXA 4CV0A 3ZD8A 1KI8A 2OAQ1 2PXXA 3QOWA 1HDEA 4PLGA 5D3MA 4WFKA 5IH3A 3STWA 5LLDA 5CD1A 4LA4A 5F5NA 3RRNA 1KS9A 4Q9DA 1LVHA 1EFVA 2FQWA 5B4VA 3Q41A 1AZSC 3DEZA 3CN7A 4V02A 2ZYUX 3GBVA 3OKPA 4D0GA 2GEUA 2Q5LA 1IZ7A 4L9AA 3B2NA 1N2CE 5LUAA 4QNNA 5AVRA 2QRQA 3K70B 1H0KA 1DIHA 4DMFA 3I6MA 2J87A 4NU8X 3ITDA 4BNDB 2UUOA 1R6XA 2B4AA 3FVRA 1PJ4A 5LNK6 4MYDA 4RMGA 4ZU6X 1TFRA 4HFRA 4TUYB 4EHLA 1E4EB 4GOLD 3AY0A 1RAFA 1ZLXA 4QHSA 4O2BB 1D6NA 1QV6A 1W2HA 1E6UA 1NQTA 2WJGA 4JIGA 1L5SA 1V37A 1L2TA 5J2UB 2MSLA 1SOUA 2VDRB 3CX8A 3LBFA 3MWDA 3LY9A 4YPOA 4BO9A 3QPWA 4WZAB 3PC8C 4ZZ0A 1XVLA 4G37A 3FR7A 2Z6UA 1HT0A 1UZAA 2B5VA 2PGOA 4GG1A 1R74A 1CLEA 3MHTA 1HI9A 1PI3A 1JLSA 3E22B 4DUGA 4ZJPA 4M83A 5K7SA 3ABIA 3MMNA 3WK8A 1OLUA 1TO1E 2C97A 1V5EA 1QYWA 2X8JB 3FYUA 1S0UA 3K8YA 3O8OA 4LQCA 3OQNA 1H0SA 4DSAA 2VDNB 1G8HA 1GZHB 2ZBPA 4F12A 1VMEA 5K3OA 1LWOA 3LPNA 5BNFA 5A7FA 3TL3A 4BO3A 2ZZMA 2Z2IA 3Q8KA 3RABA 2HF9A 2RGXA 2XH8A 4GZ6A 5TV2A 3IDAA 3U6KA 1T4GA 4XD7D 1RHRA 3BULA 4CKWB 4G63A 2WJHA 2VXCA 3I6ZA 1F06A 3HXLA 4TROA 2R87A 1NF3A 3H11B 5HHTA 2NUPA 2K7ZA 5C7IO 4JQZA 3R0JA 1E98A 1UWCA 4L5CA 1Y81A 4OXIA 3IEKA 3K4PA 2EKBA 1NLZA 2QMYA 2HOQA 3AY7A 4U7GA 4PYJA 1NVAA 3VNVA 3G9TA 3CUKA 2GUGA 2X4LA 4H27A 2VQFB 3PQEA 4U7PB 4F5WA 4GEGA 3SFVA 1R64A 4LZPA 1WF6A 2JW5A 3HUUA 1JHDA 3GD7A 1A5BB 1CDZA 1Z4QA 1EGQA 1FDOA 4N54A 1AKYA 4P6VF 3T4UA 4M9XA 3QVUA 1JKJB 4N76A 3D02A 3AR3A 5LZ5A 4CHGA 1GL3A 1V7CA 2I80A 1ZVJA 3HU5A 1KMCA 3MD9A 3PQDA 5BN5B 4ZCSA 1Z5VA 3QPUA 2WA2A 5FULA 2JIOA 5IBQA 2HJGA 1QPGA 1TQ2A 4UD2A 2VP6A 1QQBA 3DV0A 4TWBA 4OP3A 1TRKA 4MWTA 1GZUA 4PXSA 3RREA 1E6WA 4LZWA 3GLFA 3NRJA 2YICA 4MB2A 2B92A 4ZO8A 4BFCA 4EA8A 2HCJB 1C0IA 3ESZA 4KFTA 3O6VA 5KBYA 4B2YA 2UUPA 1S2NA 4Y1EA 5KQRA 1MQ9A 2M6SA 2J4FA 4RVUA 3ZK8A 2F00A 1A2QA 1P62B 2IYLD 1BEUB 3KHUA 5CXXA 3OAAA 3T3DA 3W5SA 2CK3D 2Z9BA 3G2PA 4X62B 1MTZA 4LJAA 4O1MA 4U5QA 3W0LB 4KREA 4KWTA 3H99A 4PO1A 4W5WA 5JFOA 1Q77A 4C04A 5U4QA 4D92A 3DGFC 1KRXA 3ZU6A 1E3IA 1FNCA 1DKOA 4EFLA 1KZ6A 4OSEA 1R0SA 4P53A 1GGHA 4BOYA 4Y6RA 4W7HA 5T57A 4DC0A 1Z0UA 4ZVTA 4R3WA 3LT5A 3NGMA 2Q2OA 3OMXA 2F3UA 2IODA 3ZY3A 4L76A 5CA1B 1Y3AA 2ZJBA 2ZUUA 3F5FA 1PR0A 2MSWA 4LHSA 3DZDA 4PANA 3H87A 1XI2A 1GZ6A 2VLBA 2EIXA 3E1KA 2XWSA 3FYCA 4KSBA 5GONA 1F8GA 4RH0A 3RQSA 3RRMA 1QOQB 3O8CA 3GXBA 1GCAA 5BY2A 1RC8A 1QZ3A 3CC8A 3O84A 4B9AA 4E5DA 1OT3A 1PEAA 3LLVA 3MHPA 4ZHSA 1VMIA 2V7UA 2WKPA 4QDZA 4MW5A 3N8DA 6YASA 3ES9A 1ST3A 3LC1O 2Y68A 2AJDA 3O95A 3SZ3A 3V7FA 1UKBA 2GCIA 5EJ7A 2BDEA 3V1YA 1N9ZA 2O8EA 4JL5A 1YA4A 1XCGB 2MSEB 1Y1QA 3DVAA 4C7MA 5IKPA 4CTNA 3JWJA 1X19A 2A9QA 3WK6A 4UE2A 1Z0IA 5KNCD 4Q9JA 3OOYA 4ZMSA 4YT2A 3U6BA 3QXSA 1AKEA 1IBCA 4I66A 4PFKA 1T8TA 2ERYA 1P5FA 2IZ6A 1KMIY 2P5UA 2QY9A 3K6KA 3SBEA 4GC5A 3UOGA 3U4MA 421PA 2R1ZA 3S28A 3CX4A 3COPA 2RHLA 4IFTA 3P45A 3RRXA 1ZI9A 1Z68A 1NXXA 1UPAA 3FWZA 1ZWKA 3CZ4A 4GMXA 4TV9A 2QGFA 1RP1A 1I6LA 3D2CA 3HGMA 5B30A 4G9EA 4WA8A 4W5QA 1QIEA 3O73A 4MWZA 1X2BA 4KPGA 1J2TA 5GADl 3AU9A 3OKAA 3W8EA 2J09A 4LRUA 1YL5A 3OWHA 2JI8A 3V4ZA 5IEBA 1O57A 1XAHA 1GYPA 4UBLA 2DB3A 4CLOB 1BNCA 3MRXA 4AXXA 1WZUA 1H2ZA 2XZPA 1Y3DE 2RGBA 1EA5A 3OA2A 3QPBA 4OJNA 1KO7A 3BB3A 4P98A 1UXIA 5FIUA 1XNRB 3JD3A 1TVKA 3N2KB 2UYHA 3QLEA 3OT4A 1FC0A 3PD0A 3WQBA 2QMHA 3K5WA 4BB6A 3U7FB 1WP9A 1BCSB 4MRAA 1ETUA 3O4VA 4BBPA 4QEKA 1Q7TA 4TVOA 3VX4A 3HM9A 3TOCA 2YFQA 1NRJB 1F14A 5H82A 2CVFA 3NNDA 4A92A 4GU5A 1CUUA 1CFZA 2YXPX 4GQBA 2J7PA 3CH7A 3GMTA 2D0DA 1P9WA 2RD2A 2XD9A 1OASA 3C87A 2VOJA 4MVYA 5AVZA 1PVOA 1FXSA 3HCBA 3MG9A 2QZ4A 5KIAA 3SSMA 1RFLA 4LV6A 2YJ4A 4XQ9A 5T8KA 3DH0A 4FKBA 3MJ4A 4P7KA 4JI6B 3RS7A 1IONA 2UYYA 3FPEA 5C0OE 3UWDA 4D99A 2OM2A 5AM2A 3W2TA 4J0KA 2FAXA 4RMIA 5DSXA 5CXUA 3ZDEA 2FPKA 4DW8A 2Y1DA 1XA3A 2TMYA 5LP6A 2VP0A 3IKMB 5TE9A 5HKOA 5B1SA 3T7EA 3DMYA 2A1TR 1DQNA 1I24A 2FUNB 4MAMA 4WDQA 4R9UC 3U1TA 2JH9A 1TB4A 4N6GA 4Z86A 3DMGA 2GN6A 4BB5A 1MB9A 2WG2A 3NUZA 1YRHA 1YZQA 1VI6A 3AONB 1J0AA 1P2BA 4ND8A 4DLPA 3WLPA 5EFZA 1NRXA 1VZ2A 5FOUA 1SAYA 2V97A 3G89A 2EFEB 3NRCA 5J47A 1IK4A 2DHEA 1M2GA 2UYGA 2M6KA 1T9CA 4LWZA 4K1XA 2UAGA 4IMPA 3HU1A 1PNVA 4KXYA 1F7UA 2LIVA 2X9QA 3EH2A 4ZAGA 2C3PA 5JD3A 5AW7A 4PR0A 1ZWLA 1TTQB 4O8CA 2WU8A 2X8BA 2ZYVX 3ZCUA 2ISQA 1ZIPA 1Z88A 3R76A 1NA5A 3GPDG 2PBLA 5IAGA 4F1WA 2PWYA 2VNKA 3EUFA 2CFIA 5JFGA 1DC6A