1DVRA

Structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
SSESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase (phosphotransferase)
total genus 70
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dvrA00
2OBLA 4TYQA 4NPHA 3KKPA 1IJEA 3X1WA 5FL7D 1KJYA 2RHDA 3W3AA 4JLMA 2VHJA 4GL2A 1RRPA 3B7GA 1CR2A 3DOFA 1E79D 1JQLB 1WE2A 2JJ2A 3H2YA 5ANRB 3GLFA 3AVVA 2XNDD 2A5YB 4HZUA 2QQEA 3JZMA 3T5DA 3VR5A 2GRJA 4URXR 5L3VA 5HKKD 1MH1A 2GBLA 3TUZC 2JDIA 2OBNA 2CJWB 2HJGA 2O52A 1E9FA 4K8OA 4PPNA 2QNRA 4WW0A 3MWKA 5IT5A 4I1VA 3T5GA 4TQ9A 2ZSBA 2J7PD 2LKDA 4WIAA 3R9IA 3IO3A 4HATA 1WXQA 2ASEA 3LBHA 4Z1MD 2QPAA 5AR1A 5P21A 3T1VA 3AKCA 2IYUA 3MFYA 2BVNA 3CF0A 2JATA 2VQSA 3K09A 3K0FA 421PA 3Q5EA 4B2IA 2ORIA 2OAP1 4Q4HB 5EE1A 2X77A 3QXCA 4X8OA 4GRAA 2WZQA 4NE2A 1I4DD 1KY2A 4QGGA 2QP4A 3EIEA 3WP1B 3CKLA 1CU1A 3A1SA 3DDCA 4IDPA 5BQ5A 1I2MA 1JAHA 2W6JA 3SE0A 5DH9A 4RD4A 5E3HA 4ZV4A 5FOXA 4I1UA 4QJ4A 2BMJA 4ON9A 3GJ3A 2D7DA 4OK3A 2HF8A 4GFDA 1U8ZA 2IWRA 1G3MA 5J4VA 2FPLA 3U4QB 1KO8A 5SZHB 4A0RA 1D9ZA 2IYVA 2GAAA 2CK3D 3V4RA 1WDTA 3LQQA 1XU4A 4QOSA 1HEIA 3AH8A 2WWXA 1FW6A 2FX3A 1YZGA 3ZIAD 3H1TA 2GVZC 1LNZA 2QA5A 4M1TA 3NBYC 1YHNA 2DWPA 2H5EA 4EPYA 1LFDB 5C1BA 4JBYA 1OXTA 3DM9B 4DCTA 3LLMA 1P9NA 2VSOA 1YZLA 3KFXA 4QL3A 4JS0A 4BPBA 4PQYA 1JAIA 1N25A 1UF9A 2QAGC 3B9QA 4KYUA 5H68A 3RANA 3U61B 3L2OB 4EPRA 1GP2A 1COWD 2REOA 2YWFA 5ELXA 4JLKA 2EYQA 5BN5A 1LS6A 2QTFA 1IXRC 3KZ1E 4NYIR 4US2R 1S1MA 1ZYUA 5DYIA 4C2TA 4XWKA 4UXIA 1HUQA 2V1UA 2GTPA 4UNQA 4N0DA 4LJ6A 1KDTA 3CPEA 3EARA 4DXAA 1GG2A 4DZZA 4IJMA 3K0EA 3K09C 1XJQA 3C41J 1OXUA 4RZUA 1GRQA 2GXQA 3KL4A 4TMVA 4HDOB 2O8FA 1W0KA 2WVJA 4ZKEA 1JEEA 2QT0A 1OPXA 5FR1A 1X86B 2QM7A 4FWIB 1CTQA 1DTSA 3Q72A 5J47A 5GADl 2JEOA 2Q9BA 1G5PA 2IYTA 4RD1A 1KK0A 2FV8A 3BFVA 3NC1C 1OH5A 2G6BA 4ZO4A 3EIQA 1FUKA 5CB6A 3BC1A 1KAOA 4BLRA 3GLIB 2AK3A 5FBRB 1RJ9B 5CIQA 1YR9A 2ZRJA 3BORA 5LD2C 2C04A 2B6HA 1G3RA 2F3TA 4EFMA 2WJIA 4BLTA 2X2EA 5K8IA 1G5RA 1G19A 4XTCS 1CJUC 5C18A 4AD8A 3PIRA 2VA8A 4PHGA 2O8CB 3GLGA 1SXJD 5JSZA 2FSFA 3LXRA 4WXPA 3R8FA 2IYSA 3GD7A 1DO0A 3I8SA 4OHVA 3SR0A 3THYA 1OT3A 1VG8A 2QM8A 2W2VA 4IVQA 1CP2A 1SVKA 3NBFA 4KODA 3K70B 4D26A 2HT6A 4DCUA 3QBVA 1BMFD 1BIFA 2QPTA 1P62B 1W2GA 3U7FB 2PZEA 4QBIA 3QKRB 1VCOA 4X8HA 1CRQA 3PVSA 2ZI9A 4CVNA 1G17A 3N70A 2H92A 1XFAA 2ZUDA 2ZI7A 3EA0A 3VTKA 4DDUA 5CB8A 4MGYR 2ZR9A 1YZUA 4ZIRA 1E69A 4LYAA 2FA9A 1OH7A 2Q0HA 1F48A 4PFSA 1XZQA 1X1RA 4L9SA 4LDJA 2HV8A 4L5BA 2FPMA 3G5UA 3BD9A 4RFSB 1BKDR 1R8QA 3RS0A 1J90A 5HCNA 4EKDA 1YZTA 2W0MA 4PANA 3RLFA 5JRJA 1NNEA 1KKMA 3DZ8A 4YMSA 3X1ZA 4JLJA 2O0JA 2PT5A 4Y0VA 2WOJA 1NIPA 2H18A 1G1MA 2WKPA 4OI1A 3FB4A 3FOZA 4Q9LA 3T34A 2RGXA 3HP1A 1IM2A 1XNJA 1II0A 4GT1A 4XD7D 3QPWA 2JIZA 2IYXA 3WRXC 3OIYA 1YKSA 5JWHA 1IJFA 1IY0A 4A8JC 4Q1DA 1M7HA 1CKEA 3IKJA 5DHFA 2V55B 3ZZ0A 1GFIA 2OLKA 5EUMA 5F2EA 2C77A 2BJWA 4AG5A 4Q21A 1QBKC 4NYJR 3IDQA 3RS5A 5L3SA 3UKDA 5F3WB 2ZQ5A 1IY2A 2RCNA 3GEIA 5GJBA 2GEUA 1YRBA 3EWAA 1YR7A 1U90A 4C2UA 3GJ5A 1N6RA 4MRPA 1FNNA 5L8VA 1D8TA 3SQXA 4XIGS 5HE9A 1Z06A 1OKKA 1MR3F 1ZNYA 4D0NA 2CL7X 3U2QA 3U44B 3E70C 4I1OA 3LAWA 2TMKA 3CRQA 1OW3B 4Q1BA 4C0JA 3ZVNA 1P60A 3R9XA 1NI3A 4B35A 2O8BB 2RGNC 1OHHD 1SVSA 3QIAA 1SGWA 3I62A 4HLQB 4C0BA 3ZS9A 1UDWA 3UG7A 4ILEA 1CJTC 1QVAA 2MSCB 1ZCBA 2V1XA 2AFHE 5FTJA 4BFVA 2FU5C 2WOOA 5J4YA 4MYCA 2QMUA 1R8SA 5LB2A 5JWOA 1OIWA 4LWZA 2ORWA 4PC6A 2IUUA 4MQBA 1E2FA 2ZETA 4GDFA 1QHYA 1AGRA 1ZM3A 3LBIA 4DC9A 2XZOA 3AVUA 4RFVA 1L2TA 3WMEA 2GCOA 3KXIA 1M74A 4P4SA 3QENA 5E7JA 3CB4A 4JIMA 5BN4A 3GEHA 3THWB 5FBWB 1KYIA 2ZANA 3P32A 1II9A 4BLSA 1P3JA 2NOAA 3IPXA 4U00A 3ZYCA 4B76A 1E32A 4W5HA 1Q0UA 3LW8A 3MD0A 2OFWA 3EWSA 1QHNA 2QSYA 3GFOA 4QBHA 4QBFA 3KQHA 2IK8A 2CHQA 1OFTA 1YJ5A 2BBTA 1M2OB 4AKIA 1GOTA 1N3BA 2ZS7A 4AC9A 1HQYE 3AUYA 3RDPA 4QFMA 3EPJA 2FPKA 3TQFA 2ZJAA 3I92A 3U7EB 2J45A 1KOFA 4IKEA 2J1LA 1VECA 5IK2A 2ZJOA 1E0JA 3A1TA 2DFTA 4DT1A 2XXAB 1XEXB 1AQUA 1RKBA 1W36B 1FP6A 3D8BA 4GPTA 4E09A 3NEJA 1JR3D 1FQJA 3B1WA 2DWOA 2IYZA 4DDWA 3PJRA 3CX8A 5FR2A 4IDQA 3BBPA 1VG0B 3D7MA 3W34A 1JECA 4HAYA 2HYIC 2PL3A 2ZI3A 3KQUA 4LC0A 3SU8A 4ZCLA 2WKRA 1VPLA 3CX7A 5AJVB 4ZDIA 4ARZB 1J2JA 1GRNA 2QTHA 2IYRA 3FMPB 2V7QD 1WCV1 3U6KA 1JR6A 1IBRA 2GJAA 1OH8A 3TSWA 4HZIA 4XOIA 3U3OA 4KHZA 1YZKA 4EQ6A 2GEVA 4PHTA 3NDBB 3BK7A 4CZ2A 4YMTA 4CEHB 2WJVA 3F8TA 1YZNA 4QJ3A 2ZRKA 2EU8A 1TL7C 1W0KD 4HLCA 4DSNA 2FNAA 4JYBA 4A0FA 2C8VA 2BKUA 4M2LA 4LBVA 5FL7A 3CF6R 3L0IB 4NCHA 4V0ME 1VTKA 1XTRA 1ZP6A 5EE3A 1L4UA 3LBNA 4KV9A 4F4IA 2O8EB 2AX4A 1AZTA 3L0PA 5CYPA 3H84A 2FGKA 1E79A 3VX3A 1GAJA 2Y8EA 2GILA 4FCVA 4IOMA 3NH9A 2DYKA 2XNDA 3CZQA 3HPRA 4JSTA 1XCPA 5TV2A 4RD0A 1M8PA 5HKKA 1TF7A 3AF1A 1Q20A 1QHHA 2Q9CA 5DN6A 4DLSA 1EFUA 1PUIA 2VIIA 2H1LA 4A2WA 1Z63A 3FKSA 1NF3A 4LPKA 1FX0A 1Z6GA 4OBEA 5EXTA 2KJQA 2O5VA 4OL0A 2GDJA 1N6NA 1ZVQA 3CF2A 3OF5A 2J7PA 1E2QA 2BMEA 2YYZA 3NC0C 1J8YF 3HR7A 2QTVB 4P3YA 1E4VA 3G0HA 2PX0A 4C0QC 5KPJA 4KLNA 5KOYA 5AUQA 5CITA 4RVCA 1R0ZA 4NYIQ 4Z1MA 4PSAA 3AP3A 3RS7A 3RC8A 2MSDB 2YC4C 4WZ6A 3KJIA 4G5SA 1QG2A 1Z0IA 1ZM9A 4PO8A 1DADA 4B3XA 1KSHA 3CNNA 4MYUA 4ZPXA 2DB3A 1XD8A 4MDEA 1W4CA 3REFA 4C0LA 5G40A 2R65A 4XWAA 2FEMA 2ZRCA 1TMKA 5FI0B 3DHWC 2QUZA 3VQTA 5EP2A 2G0NA 3UPUA 5JI3E 4HZUB 3PEVA 5D3MB 1TNDA 4BZPA 1G7RA 2RKOA 4AIIA 2P6RA 1P4SA 1XXHA 4Q7KA 1GKUB 3SHWA 4DLZA 1E2IA 2QBYB 1TQ4A 4G0NA 4ZI3A 2QAGB 4QNRA 2CK3A 4PAMA 4CGZA 1QF9A 2JLQA 2GA8A 1R5BA 3IHWA 2GXSA 2F3RA 4TWZA 3ZIAA 3FHOA 3MUFA 4DDTA 4L4UA 4OQNA 4AYXA 3PUXA 4ASUD 2ZRIA 1XEFA 3WRYC 4OJKA 4JVNA 2KBFA 2O8DA 5FBQB 5JS8A 3OIUA 1LTQA 1DE0A 1IXZA 1MABB 3F5FA 3T12A 1COWA 3L8YA 4LBZA 1GWNA 1XMJA 2B7CA 1Q3HA 2ZE8A 2IXFA 2YVUA 1R5OA 1RFLA 1F5NA 2E1RA 3QF7A 3R20A 1W44A 1QHXA 4KAXA 4RKEA 4LSGA 5JCPA 2JLSA 3WYAA 3NG1A 4LRWA 4V0KA 4D0LB 2ANCA 4R2HA 4EPXA 4JVSB 5DSZA 4A0HA 3SBDA 4KITB 1YQTA 2F43B 2GESA 1KDRA 4LYFA 4CT5A 5FBLB 1HT2E 2GKSA 4RZ3A 4B2LA 1XD2A 3RC3A 2QPOA 4U7DA 2C2HA 1VDZA 2I1VB 3BB1A 2QMOA 1ZNXA 3VHXA 3O47A 1NMXA 1ETUA 2IXEA 5B64A 1DG3A 5EZ5A 2HUPA 2XTZA 3AKEA 3T1OA 4DUGD 2BOVA 4C3ZA 1EFRD 3PXGA 1GVNB 1UBCA 3GJXC 2AHOA 2V54A 1ESNA 4IVRA 1NVXQ 4PAQA 3VKWA 2OCAA 3U7GA 3BB4A 1JJ7A 1Q3TA 3A1VA 1N5JA 2PT7A 2UZ3A 4C0SA 2RGBA 4HB2A 5KPDA 4JT4A 2WJYA 2DHRA 1UBFA 4FIDA 4RCZA 3CR8A 2CNWA 1ELOA 2C9CA 4DEXA 3GJ7A 1QZXA 1RZ3A 4IOJA 3I32A 3R8CA 5HE8A 5AK0A 5JI2E 3QEJA 3Q3JB 2WAXA 4FI3C 1N6LA 1W2HA 2ZSAA 1TAGA 3EA5A 1IQPA 5HTKA 2QMEA 3GJ4A 1ZUIA 1SXJA 1NIJA 4GI7A 1KK3A 2DCUA 3PV0A 1S3SA 2A30A 2IYQA 1UKEA 4NU0A 4IFEA 5BXQC 1XCGB 2OT3B 2FG5A 5KO2A 2VTKA 3PG5A 2V6JA 4I81A 4NHOA 4NYJQ 5FPTA 2O8FB 1RE0A 4HLUA 3CRVA 1BMFA 2FSHA 1G20E 3KTAA 3TSZA 4C0KA 1Z6YA 3EZ7A 4Q02A 3V9PA 4E22A 4M9XA 1F6BA 1FL9A 1NVVR 2HXYA 1NP6A 1JALA 4Q7MB 4HAUA 1SQ5A 3VU9A 4D6PA 4JT2A 5CM9C 2RGDA 3I61A 1SVWA 4OHYA 3B13B 2W2TA 4D25A 1MRSA 3DL0A 4BLPA 3PEWA 4QGAA 5G3ZA 3VR6A 2VP2A 5J4LA 1G5TA 2NO1A 4PXAA 2R6AA 1NN1A 2FOLA 2AWNA 3A4LA 4JKYA 3IO5A 1KI3A 2F1HA 3CPJB 3IEUA 4L9WA 1Z0AA 3FHTA 1XX6A 2FE4A 5DGXA 4O3MA 4V0MA 3K0CA 1KNQA 1EX7A 1CJKC 3MJRA 1A1VA 1US8A 3FWYA 3MWYW 4BFUA 2B7BA 3LNCA 5IK2D 2QE7D 4FMDB 5JS7A 1G6OA 4YC7A 1K5DA 3LQRA 4DHEA 5JSZB 3OE7A 4Q66C 3TGPA 2ZPTX 1KZGB 2QI9C 1LV7A 2PCJA 1BS1A 2VHUA 1JPNA 1EG7A 1KMHB 1DO2A 4GP6A 1E2LA 3CONA 3LD9A 3THYB 2F1IA 4MGZR 1M7GA 3TUIC 5DHAA 4XD7A 3T15A 3HYTA 3LVRE 2KE5A 5DIFA 1ONBA 2SHKA 1NN3A 2V8OA 4KBGA 4Q4AB 4BFXA 1R2QA 2ZU0C 1G4UR 4OKSA 1R10A 5EP1A 5AUNB 2P67A 2YKGA 1A2BA 4QC2A 2ZRPA 3MAAC 3PUYA 1NJGA 4H1VA 2ZJ2A 1NLZA 2FF7A 3HWSA 4GSYA 1R0XA 2YOFA 3TW8B 2ZUCA 5B2ZA 1ZUHA 4NKRA 3AKYA 1XTKA 4ZIRB 4OQLA 5C4MA 1KI1A 821PA 4PC2A 1G8HA 3NIBA 4BE7B 3VKHA 1SZPA 1OXXK 3QVVA 4D2IA 2YV5A 1VYVA 2G9NA 2ZU6A 4Z54A 2WSSA 4KSCA 2Q3FA 3ZLJA 3A37A 5EQTA 5JJLA 1QHIA 1RIFA 1R5NA 3A4MA 2HEIA 1G3IA 3CRMA 1KI6A 1KDOA 3QXSA 4TYWA 1NKSA 1U0JA 1EFCA 2GNOA 3NBXX 3OESA 3DMNA 3IIMA 1P9RA 3K70D 1OHHA 5DN6D 4G5GA 3FMOB 3GLHA 2RGEA 5AUOB 1E4YA 4LYHA 4LJ7A 3RVBA 3UWKA 5K8LA 3FKSD 3QKSA 1UDXA 4PC7A 1ZCAA 2LCFA 3QQ5A 3THXB 1Z2CA 1Z6TA 3KKNA 4YLGA 4Q1CA 4TTPA 4W9MC 2OG2A 4OQMA 3ZS8A 4BFYA 3ADDA 1TQ6A 1EESA 3OFND 5L3SB 1R6BX 2PCLA 3SJZA 4LJ4A 3H4MA 1RC8A 3DPUA 4LHYA 3O8CA 4QBGB 4P33A 5HZHA 3AF3A 5FUXA 2WMNB 1Z3IX 3B60A 1FNMA 1QDEA 3TMKA 4B43A 1GNRA 3V4FA 1T8TA 2EFCB 3CO5A 3UWOA 1S4QA 3THOA 1OJLA 1UJ2A 4PPQA 3P4YA 5IRCD 1IHUA 2CHGA 3ZVRA 2ODNA 1NRJB 3VX4A 2I3BA 3B5JA 4BEBA 1LS1A 5BYJA 1BYIA 3SS8A 1GKYA 2BEJA 1JXMA 2YJTD 2ZJBA 1Q21A 3GFPA 3P27A 5DI3A 3QJYA 4AYWA 3X1XA 3DZDA 2XB4A 3HR8A 1DEKA 5IF9A 4H9GA 3PQCA 4B33A 1J7KA 2Q3MA 2QU8A 2QMHA 4PSKA 1P2SA 1Q57A 3X1DA 4GMXA 2WWWA 1V5WA 3IQWA 3EC1A 2ZRBA 4BQSA 3L0OA 2GBLC 1JR3A 2R62A 5LBIA 3GFTA 3VNUA 1ANKA 1PV4A 3K8YA 1E2EA 2J0UA 4DLWA 3UG6A 5FFMA 4ERNA 2JLUA 2H17A 1DVRA 3DO6A 4LV8B 4CEIA 4Q03A 4M1YA 3RRMA 3GJ0A 4HB0A 3GEEA 1W5SA 2KSQA 1WBDA 2X19A 3E1SA 2GCOB 4N3NA 2NMVA 1S1CA 2FH5B 3RS2A 2BCGY 4RD3A 1W48A 1GDDA 4C0HA 1M1YE 1FTSA 2V7QA 4KFRA 1Z29A 4PZYA 4BLOA 2ZXUA 1F2UB 2GK6A 3BWDD 5C4GB 1EK0A 4IDOA 3TH5A 4L16A 5KYKA 3B1YA 4WAUA 5M04A 4RY2A 5J40A 2OO7A 1RPZA 3B1VA 1S0UA 2EFDB 5KTYA 2BBSA 4QM6A 4KFTA 3I5YA 2BHRA 5HZKA 4RSGA 3CR7A 1F2TB 5DO9A 1CBUA 3U3JA 1JNYA 4D81A 3K9HA 1XB2A 4Q00A 4AWXA 3OEED 5SZIA 1N6PA 1RYHA 3NHBA 3SFZA 4PAOA 1H8ED 3VHLB 4DT1B 4MKFA 2C99A 2OFXA 4XH9B 1TUEA 1E3MA 2XJ4A 3SYLA 5JBQA 1CJVC 621PA 1ZD9A 2P65A 2D2EA 1OXVA 3CPHA 1D2NA 1XMIA 3RWMB 1J99A 2CNWD 3OIVA 1ZAKA 3OEHA 4JLAA 4UNPA 2PEZA 2IS1A 4LX0A 3DVLA 3VR1A 2Z0MA 4JVLA 3H86A 5TARA 5J5CA 1AKEA 1E2MA 1X8JA 1IY1A 2YC2C 3ICQB 2RMKA 3NKVA 2IYYA 2ZRDA 3LXXA 1E9CA 4DVGA 2GETA 1XEWX 2QQ0A 4NDZA 3W6NA 5EJEA 1AK2A 4M1SA 2A5DA 2A3RA 2HYDA 1D2MA 1PUJA 3MRSA 3GLIE 3QF4A 1S96A 4AY2A 1XP8A 4L15A 2ECKA 3RHFA 2N1BA 4ESVA 1TUIA 2ZI6A 3MWJA 3QNUA 4WZBE 5FUWA 5TMPA 2N42A 4GZLA 4XSGA 2B8TA 1ZNZA 1ZM7A 4ZKDA 1JI0A 2JGNA 2G83A 4POAA 4RD2A 3LA6A 3SJAA 1Z0KA 3NXSA 4PZZA 3CM0A 4R9UC 1Z8FA 3EX7C 2QRNA 1SVOA 3M1IA 2VBCA 4HAWA 4C30A 1OB5A 2C78A 1MO3A 3KKQA 2GVDC 4QKQA 4MKIA 4A82A 3T06B 1DG1G 2Z83A 4TTQA 4CF7A 1IOZA 1QHHB 1TF5A 1TU3A 3Q9LA 4IDHA 3K0SA 4HUQA 1EGAA 3TKLA 1TX4B 1G4AE 2EVWX 4H1UA 4O2RA 4ZCIA 2C96A 3SHFA 3QXJA 4HB3A 5FTNA 1GNPA 4LGMA 4Q1FA 2OILA 1DS6A 3OE7D 4UNNA 5G3YA 2BMDA 2D7CA 3BJIC 1DAHA 2EFHB 3QBTA 4HB4A 2OAQ1 2ZI4A 4M9SA 5IDVA 4ASUA 4RKFA 4A9AA 4LJ9A 4XWOA 4DLTA 1KGDA 1GITA 3TBKA 1XRJA 2FMXA 2ZIAA 2ZYWX 4M1OA 4FMBB 1JPJA 4Q7LA 4CT4B 4MUBA 5F98A 2DFKB 3HU1A 5JRZA 3D31A 5FOVA 4KSBA 1Z08A 1W46A 2GZHA 4TLBA 1T91A 1FMJA 1E9AA 2HCJB 3K1JA 1VCMA 3CWQA 1NKTA 4LBWA 4NCJA 5E95A 2C95A 1Q1BA 1P2VA 1Q22A 3C15C 1V43A 2W58A 1YE8A 3KJEA 3QPUA 4KLZA 521PA 2AXNA 4TL6A 1IN4A 2CJWA 1P5ZB 3Q85A 3AEZA 2ZRLA 4NTZA 4ZDKA 3HDTA 3TK1A 1SVIA 2ZYTX 5KDDA 2XGJA 1XXHB 1R0WA 1A82A 2WSSD 4NP6A 2NGRA 3MCAA 3C14C 3GCGA 1N0WA 3FPAA 4A2QA 5TDHA 4M0LA 4DUGA 1EFRA 2G3YA 1J8MF 2ZITA 2IS2A 2BM0A 3RSLA 1IN7A 3SQWA 3AGQA 3W9YA 3PEUA 4B3CA 3ZD6A 3FVQA 4JSYA 4WZAE 4CEJB 3ASZA 4TYPA 2AKYA 4LJ8A 1QRAA 1SKQA 3KUCA 2O8DB 1U81A 4URZR 2WIBA 4MGIR 2IEZA 4PQFA 2D62A 2A7QA 4IOLA 2F55A 1Z6AA 1CJMA 2QAJA 1HYQA 2J87A 3EAQA 3FE2A 4GP7A 3LDAA 1T0JB 1OSNA 4Q4JA 1KTVA 1ZIPA 2NO7A 4EUNA 4HAZA 1BH2A 2Q9AA 1MO6A 2XEXA 3QXXA 3AVXA 4Q4LA 4EJSA 4BGDA 1BOFA 4MH0R 3P4XA 1YR8A 3NBZC 1SULA 1XD2B 2I4IA 1AA9A 1B23P 2NZJA 1NBME 2IXGA 2ZTSA 4D82A 3TR5A 1UFQA 4P32A 3HU3A 4WBSA 2FSIA 1Z83A 4TLDA 5CYOA 2ZRMA 2ODBA 5FPYA 2ZE7A 3WMGA 1PLJA 2GCPA 2GCNA 1MOZA 1IN8A 4II7A 1GM5A 1O3YA 3C5HA 1FP7A 4I4LA 2GF0A 5CK5A 4UQOA 2ERXA 2FZ4A 4ITRC 1PVOA 2OSBA 2KBEA 4Y0AA 3T35A 5JEDA 4XTRA 4LOAA 2R8RA 2PBRA 3CRRA 1VCIA 3TAHA 2ZSDA 4G5QA 2OM2A 1NN0A 2QE7A 3TLXA 1VIAA 3ZQJA 1VYTA 4JL5A 1SXJB 5D3QA 2CCKA 1N6KA 2IHBA 4TN1A 1YR6A 4URVR 1II8A 5EZ6B 1OFHA 2CEAA 3ZZUA 3IILA 5AUPB 1P6XA 1XJ0A 2WM9B 4A4DA 4OK5A 2AFIE 1R0YA 2JA1A 1U8AA 5C46F 2ZRGA 4DLYA 5KNBA 1FMLA 2DFNA 2WAYA 3A58B 1VIYA 3SC3A 1E94E 5TXGA 4BASA 4DEYA 4EDHA 2AXPA 3KJGA 3VU9B 5JWRA 1ZC4A 4MITA 2NO9A 2O0KA 2NO0A 1TPZA 4KI0A 3AVWA 1RJ9A 4XJXA 2QN6A 2YNMA 2JLZA 3TSOA 3GMTA 4GMDA 1CR1A 2CLDX 2DY1A 4W5JA 3L43A 1GKIA 1XZPA 2BBWA 3CLVA 5JECA 4A15A 2QP9X 2G0TA 4D4LA 4HLDA 2A5JA 5TB5A 4E07A 3QKUA 121PA 1GL9B 5H1YA 2XTNA 2O8CA 3GPLA 2BDTA 4BFTA 3BERA 4FINA 3ADCA 2Z6VA 4QHYA 4G01B 1Z0DA 2GZDA 1ZRHA 1XD9A 1EWQA 4YQFA 4P31A 4TLCA 2QSZA 2JAQA 4B71A 2QROA 2PLRA 1KO7A 5BN3A 1T3HA 4NCNA 4U5XA 2PZGA 1M34E 5L3QB 3OEHD 5EUQB 2AWOA 3QKRA 1KJZA 4A36A 1E9BA 1ZM2A 5EE5B 4Q48A 1X6VA 5KSPA 1E96A 2OUKA 4PHHA 1Q12A 3RRNA 2PZFA 1XMSA 3BAFA 2REXB 2W2XA 3BXZA 4RJLA 3WXMA 1TQ2A 1X8KA 2KI5A 3OFNA 4M9QA 4Q9KA 4LZZA 5JHHB 2YINC 2ZYUX 4NL4H 4JJKA 2VP4A 3AKDA 4C7OB 3RNLA 1G9XA 3R7WB 2MMGA 4RFSA 4K46A 3ADKA 1N6IA 4XVUA 2Q21A 1I2DA 4BZXA 3NWJA 1AS0A 2CLCX 4UJ3A 4D4KA 3MLEA 5SZKB 1S8FA 3H0KA 4YMVA 221PA 3CX6A 1R4AA 4FWTA 2VEDA 4Q19A 3N2IA 1NJFA 4KJZA 1CIPA 3AP2A 3V00A 3QPVA 3TIFA 4BUJA 3A1UA 5EP4A 2W00A 5KDLA 4B73A 3GLFB 4IEEA 1KI6B 4TQAA 1XWIA 2EFEB 3SYNA 3X1YA 2E87A 2WHXA 1EX6A 3ND8A 4PPGA 1Q1QA 1NSFA 3W5IA 5LB4A 1UM8A 1MO4A 1S2MA 2AD5A 3P1JA 3EZ6A 2VSFA 3OIWA 4LHVA 2OESA 1N0UA 4JL8A 4B6FA 2FWRA 4NH0A 1U9IA 5TY0A 1U0HC 3KB2A 3EG5A 4LPSA 4R7ZA 5LDDC 2ZM5A 3JVVA 4TSFD 4DIEA 3CBQA 4CRWB 2J41A 2ZAOA 3X2SA 5FI1B 3MMPA 3T61A 4DCVA 4MUAA 1UBEA 4PHFA 1Z5ZA 1X1SA 4TYYA 3EW9A 5CLLA 1DBSA 2WJHA 1A5TA 1E2GA 3AUXA 4M22A 3SI7A 3I8XA 4Q47A 2XZPA 4B2PA 3K0FB 3U6BA 4JLPA 2VHTA 5FOWA 4ESHA 4TZ6A 2FZLA 1E2NA 2WJJA 5J4KA 1IONA 4QHTA 1NSTA 2P0EA 4I1SA 3WMFA 1E2DA 1QHGA 1P61B 1DAFA 3TR0A 4GNKA 3RRYA 3RWOA 3RS4A 2VHQA 3SZRA 1E0KA 2VSXA 3BB3A 4G5RA 1ZM4A 2YWHA 3QUSA 3PUWA 3KFVA 3EASA 1G64A 3B1XA 3W6OA 3ZGXA 3EZFA 4C4PA 2ZRNA 1R7RA 2EFGA 2H8KA 4URYR 1ZIOA 2WWGA 4TQUS 1KJWA 2GXUA 4IVPA 2A5GA 3ECCA 3OEEA 3P20A 4WVFA 5DI9A 1HQCA 3EPHA 3GP8A 1E9DA 1H8EA 3QSYA 1X3SA 4OHWA 2AKAB 5EE0A 1Z6XA 1XTJA 3BE4A 1AS2A 2VF8A 4OYHA 3SDZA 4ZCMA 1D2EA 5FOSA 1KDPA 4LJAA 1VCNA 3AF2A 1U9IC 3C8UA 3THWA 4UXHA 4HAVA 2RAPA 3DM5A 3EPLA 1OH6A 1W4RA 5BWMA 2ODEA 4DB2A 2XTMA 1E9RA 3CNLA 5KHOC 1HURA 2CDNA 2C98A 2CCGA 2X8AA 1W5TA 2PJZA 3A36A 1CLUA 4HDCA 2GEDA 4TT3D 3WHLA 2P2LA 2IA5A 3OAAD 1PLKA 2WWHA 2J3EA 5K8TA 3I73A 3SYKA 4JL6A 1SHKA 2XAUA 3VR2A 2W0SA 1GTVA 3LVQE 2H57A 5EXSA 1KY3A 1T3SA 4D4MA 4IW3B 3E5HA 2W6ID 4DCSA 1G8GA 3D3QA 2LKCA 3KB1A 1XEXA 1FTNA 2AR7A 4MGKR 4V03A 3LV8A 4FW9A 4X8LA 4XSHA 3WHKA 5KNCA 4V0OA 3BFKA 1LVGA 2F1JA 2J7KA 2B92A 4B3FX 3HU2A 4QGFA 1BO6A 2R6DA 2IWHA 5GVRA 3N5CA 3SN6A 2XB2A 1GILA 1UKZA 2NZ8A 1VYUA 2GF9A 1VKJA 5CLQA 2VYFA 2ZREA 3ZVLA 4QNMA 4FXPA 1H65A 1ODFA 1HE1C 1NMYA 1CEEA 4JLVA 1D9XA 5AWFC 1HV8A 1U99A 5E7MA 3GLGB 4AG6A 3U5ZB 1AGPA 5G53C 1TQDA 2ANBA 1E1QD 6Q21A 4OHZA 3RSOA 1DPFA 4W7SA 1KO4A 1TF2A 2VP5A 3AVTA 1E99A 2ZVPX 1NN5A 1XBTA 3K0AA 2ZS8A 4Q9IA 5H8WA 1SXJC 2PJRA 2XOKD 1K6MA 1OYWA 5GJVC 3ZZTA 1T5LA 4HAXA 1GRRA 1UPTA 1WF3A 3J81k 4WOPA 3DOEA 5FTKA 4A2PA 1FZQA 4MA4A 4GBMA 1MO5A 4UXJA 4AYTA 4DIDA 2FFQA 1IN6A 1KNXA 4HLUC 3TE6A 4MRRA 1S9HA 2HJVA 2QZ4A 4N0EA 3B9PA 1CF4A 1P2UA 1AJEA 1W4BA 1VG9B 4QG7A 1GSIA 1KK1A 1HY3A 1SKYB 4NMMA 2XSZD 4M1MA 1CXZA 2CMKA 1AKYA 1Z47A 5TVKA 2HDNB 4TL9A 4AKEA 5HPYB 3U3KA 4JLNA 1T0HB 3KUDA 5G41A 4NCKA 1EXMA 1WA5A 3B8HA 1U0LA 2GAOA 2WSMA 3SBEA 4IXNA 3B2EA 4MKHA 3KDSE 2OEPA 3WNCA 4ZI2A 3IIJA 3K0CC 4UNRA 3DMDA 2DPXA 2D2FA 2OCBA 3A1WA 4IHQA 5GJWC 3W5JA 3WYGA 1UAAA 1XTIA 2ORVA 3O8BA 3W90A 1ZJ6A 4MYTA 3KX2A 5B30A 4R71A 3BFXA 2UZIR 4AK9A 2EW1A 2Q3HA 3MJHA 4YDHB 1SKYE 1ZW6A 3L82B 1W7AA 1F3OA 5AJZA 3PCRB 3K53A 2FDCA 2IS4A 3S1AA 2VLIA 2BWJA 5JEEA 4W5WA 3ZQ6A 3I72A 2NO6A 1Q1ZA 1WP9A 1T9HA 4RZXA 2AK2A 2HT1A 3P26A 3A8TA 5D3MA 2IF2A 4DSOA 2IUSA 2QGZA 2L0XA 2HLDD 3LX8A 1P75A 1KI8A 4P4UA 2QBYA 2R44A 1KO1A 1OB2A 4ABYA 1XTQA 2QAGA 5DISB 2OBMA 2OE2A 2ZSEA 2REBA 4YDSA 3EZ2A 3UK6A 2GJKA 2YWGA 1EFHA 4OQXA 1VHLA 4ACAA 3NHAA 4EFNA 1ZBDA 3M0EA 4LUCA 5BYKA 2WPDD 4JLDA 4E5UA 2G77B 2R9VA 5KNDA 3M6AA 1A2KC 2JLXA 4UJ5A 2CL0X 3HJNA 3QVUA 1G8PA 3TVTA 3BS4A 2V3CC 1DAIA 4S2EA 1MABA 2J59A 2BJVA 2ZVQX 1LW7A 1W1WA 3I4LA 4LY6A 4Q9HA 3U3RA 2A2ZA 2OCPA 4RD6A 3DEFA 3IBYA 2X1VA 1NVWQ 3I3SR 1AN0A 2QL6A 4GOJA 3UXMA 4DDVA 4NYMR 3PFIA 2H16A 2F43A 3QOFA 4PPFA 4Q4JB 3Q7QA 2WJGA 1E1RD 4HDQB 5JLJA 2MSEB 2FGJA 2RH5A 4B48A 4BEJA 1FFHA 4EJSB 4KFSA 1WB9A 1G3UA 5DYGA 1D6JA 1N6HA 1JB1A 2YZ2A 5K8UA 3KKMA 4FMCB 4P4SB 2ZJZA 1C4OA 2QRZA 4GOXA 2Q6TA 3VKGA 2CCJA 4KVGA 2GXAA 1LF0A 2OXCA 3EIHA 1ZMXA 2OV2A 5JJIA 2GJ9A 4FCTA 3CZPA 3FTQA 4TLEA 4LK2A 1BYUA 2AN9A 2ZRAA 4B74A 1G18A 1NBMD 2ZE5A 4N1AA 5KU1A 4F4JA 4M1WA 4CDGA 4YXWD 3TQCA 3WNBA 5EP3A 2BCJQ 5B57C 1HH4A 1T8UA 5AJXA 3EPKA 1Z0JA 5AJYA 1TEVA 3WP0A 1VMAA 3AF0A 1XPOA 5F9HA 3CIOA 4Q18A 4KU4A 1QHSA 2PLFA 1J70A 4PC1A 1I4TD 5CJ2A 5A5GA 1E9SA 5DNYB 1KO5A 2DWQA 3B1ZA 3QG1A 1II8B 4JJZA 1FUUA 1P2TA 2KWIA 4JKIA 1YVDA 2JJ8A 4HSEA 4LBYA 2OFOA 4EPVA 3EC2A 3IIKA 4CIDA 2PMDA 2YOGA 1KK2A 3RRZA 2ZRHA 3Q7PA 4PQRA 4PO1A 1I4LD 4R2IA 4FD2A 2OXRA 2WWFA 2WTUA 2KB0A 1G291 3EZ9A 3M4YA 4EQ6B 2ZR0A 5FBVB 4Q5IA 4CW7A 4JZKA 2OLJA 3LO5A 4G5OA 4LCBA 2IW3A 5L3RA 1U94A 3NTUA 1JQJC 1Q44A 1E2KA 1L7VC 4MRSA 1SVLA 4FMDF 3SOPA 1Y63A 3NVAA 1TTTA 2WKQA 3ONWA 4JLOA 4DB4A 1W36D 5KSOA 1M6NA 2CL6X 4PZLA 2XX3A 4A8JA 2ATVA 3LLUA 3QI2A 1RRGA 3OZXA 1KMHA 4Q1EA 2EWWA 4DCNA 3IUYA 1XDBA 2EYUA 5SZJA 1LF5A 4GOKA 4QJ5A 3FYHA 3IGFA 1OXSC 1ZU5A 2I1QA 2IL1A 2FFAA 4Q4AA 5EE9A 2QORA 1HE8B 4Z8XA 2Z43A 4TL8A 5FOUA 4KYIB 5KUTA 3W3ZB 1W0JD 2BIFA 2LWIA 3N2EA 4UKDA 1FX0B 2C5LA 1RRFA 1ZNWA 1KI2A 2P3SA 2CLSA 3CRW1 2C9OA 3AVPA 4V0LA 2CVHA 4TSFA 3CH5A 3IBGA 1GL6A 1Z0FA 1E2HA 1N6OA 2G88A 4P4TA 2FFBA 4BRWA 1E9EA 3TW4A 1CS4C 4EIWA 1P73A 5FUYA 4M53A 1DAKA 2RGNA 3K9GA 4ZDJA 1NVUQ 2NPIA 1W47A 1ZD1A 3L8ZA 4KCGA 3A6PC 2ONJA 3C7KA 2NG1A 5FTMA 1G8FA 3NDPA 1P7CA 4LC1A 2JASA 4F7WA 5BW8A 1NY5A 2QP3A 1H8HA 4A6XA 4A1FA 1NVVQ 4IXMA 2VP6A 2YWEA 1GUAA 5GVSA 2D3WA 1XEWY 1GZSA 1E0AA 2P5TB 4DSTA 5JCZA 5IHPA 3QG5A 3AQ4A 1XJCA 4D0GA 4F4CA 2IHYA 3MG9A 1G7CA 3CUEF 4OK6A 5DLQC 3THXA 2VRWA 4KFUA 1RYFA 3ICEA 2G1KA 3UMSA 5CDFE 3JZAA 4YONB 5A4JA 1C9KA 5EXPA 5HR5A 1GL7A 4BECA 2K5UA 4OI2A 3KQLA 2OHFA 4HYYA 3ADBA 1VG1A 5CM8B 5F9FA 2ZE6A 2PH1A 1G3QA 4MKGA 1UKYA 4Q4HA 1JJVA 1N2CE 2B8WA 4OI4A 4U02A 2RGGA 4TL7A 2ZJYA 4NONA 1XXHE 5KSYA 3EXAA 1LB1B 4G1UC 3TUJC 2O0HA 1N5LA 2IUTA 2JJ2D 3CW2A 3ZJYA 3LRPA 4TT3A 3FHCB 2XJ9A 1NG9A 4B75A 2V9PA 2ZR7A 1DOAA 3OAAA 2JDID 4UNSA 721PA 2VPPA 2JCSA 4DLRA 1KKLA 1M7BA 2QENA 1XPUA 4XVQA 3U4QA 4DBLC 2ZJ5A 1U2RA 1NG1A 5JZVA 4D4JA 5FPHA 4PR0A 2R2AA 2ZI5A 1W49A 3OHMA 2W6IA 2GJSA 1DELA 2CVFA 3F0TA 1OE0A 4PX9A 3IEVA 4YMUA 2BM1A 2OCYC 3U7HB 1AIPA 5JFGA 4B3DA 2C03A 1B0UA 4BRUA 3SNHA 1TU4A 3QXHA 4FMCF 4QM7A 2IF0A 3FGNA 2XITA 4PC3A 3WNDA 2YOHA 3B85A 2IS6A 3ASYA 2W83A 4EAQA 2BBOA 2ERYA 2J9RA 1JBKA 5A0FA 3W6PA 3BH7A 2HXSA 4WA7A 1F2UA 4EFLA 1YRAA 1U8YA 1ESMA 2W6JD 3MWLA 4I99A 3PEYA 4OJQA 2CBZA 2RGCA 1A4RA 1E1QA 3PITA 2P6UA 1N5KA 1WRBA 1S3GA 4JLBA 1JXOA 2QEQA 2F6RA 3GQBA 4MRNA 4IFBA 4OQFA 2VL7A 2FN4A 1IN5A 1DAGA 3CWZA 4B47A 1F2TA 1XCMA 4LJ5A 1HTWA 3KTAB 2XOKA 2FEOA 1KSGA 4TYNA 5KSZA 4US1R 4HEJA 2V6IA 4KO8A 4RCYA 1AZSC 4EJSC 1KI7A 3GLIA 3A4NA 2PX3A 3K9LA 1SXJE 2G1JA 4B6EA 3REGA 4EPWA 4RZ2A 2RGAA 2WBLC 2JJ1A 3FFBA 4IRUB 3TNFA 1CULC 4LHZA 4PO9A 3HYRA 2J0SA 1RVDA 2ZSFA 4US0R 1TEXA 1UBGA 3CNOA 3VR4A 4B3GA 2GHIA 1AS3A 2GZAA 1EFTA 1U98A 2VP0A 2EQBA 2NPFA 1US8B 3PUVA 4TMWA 2XSZA 2F7SA 3QY0A 4DJTA 1F60A 4Q1AA 4BFSA 2DR3A 1T3LA 2D06A 1G6HA 1P9WA 1ZC3A 4KVAA 4C9BA 1G16A 1XF9A 4NBSA 4TMKA 4LHWA 2H7VA 1O87A 1G8YA 4Q9JA 2AD1A 1VHTA 3FKQA 1G41A 4NCIA 3C4JA 2FFHA 4F93B 2VHCA 3Q5DA 3BIFA 3QEOA 4Z8YA 4NYMQ 1OF1A 1PZNA 1UEJA 2ZROA 3FDIA 4LJYA 3QKTA 1N5IA 3FMIA 1OLOA 4MRVA 2GJ8A 4O0MA 3K0AB 1A7JA 2VH5R 2IX3A 1HT1E 1Z2AA 3WBJA 1ZU4A 3KKOA 1IXSB 1ZUNB 1OFIA 4DRZA 3WBKA 3IPYA 2QGNA 4AKHA 1KSFX 2D4HA 5CJPA 1KAGA 1OYYA 1NLYA 1KSJA 3UIEA 2BMFA 2HLDA 2E9SA 4OHXA 3LFUA 3IHLA 2VO1A 3TAUA 4HI0E 4TMTA 2JLRA 2P5SA 1Z07A 4URWR 4J0QA 2A9KA 3T1QA 1PJRA 4E03A 3C5CA 4DLUA 4MDFA 3LY5A 4JMPA 3AV0B 3LW7A 2WPDA 3PUZA 4BFZA 2CXXA 3C16C 5E7IA 4O2LA 5JJKA 1IAQA 1JEDA 2XNSA 3AVOA 1L4YA 2R6GA 2EWVA 3GJ8A 3F3YA 1KZ7B 2ZJ8A 1OFUX 4KXFB 5CIWA 1YU9A 4XVRA 5CDFA 3GLHB 3SFVA 3VAAA 4FN5A 3Q8XB 2F9MA 5DE3A 1S9DA 3NEYA 3AGPA 2ZS9A 1CRPA 3QKSB 3TRFA 1GIAA 3E2IA 1WMSA 2UVQA 3RAPR 1Z22A 4HUTA 2J46A 2BC9A 3KQNA 2ODWA 4Z51A 3PENA 3ZH9B 3S1AB 5B58C 3K70C 2IEYA 1FQKA 3W8NA 2XZLA 1Q1EA 2D74A 3ZDQA 4M8NE 5JMTA 1E1RA 1X8LA 1D5CA 4LV6A 1HA3A 4JBXA 3GLFE 1NLFA 1E2PA 1T6NA 1MKYA 4M4SA 5JHGB 2PMKA 1MV5A 2ZEJA 4B44A 5H70A 1XPRA 4B32A 3PR1A 3UATA 4Q7JB 1Y3AA 4P0TA 2CE7A 3U44A 2CE2X 3FFAA 3GLHE 2ZYVX 4O25A 1KIMA 1MT0A 4IEIA 5FPSA 3O8RA 2BV3A 4A0GA 2IT1A 4TZ0A 2QY9A 1T5IA 3LH5A 5FPKA 3VFDA 2O8BA 8OHMA 4F92B 1FOEB 1E0SA 3DKVA 4TMZA 5C2JB 1H8HD 5FTLA 3TVDA 4PTLA 3MGCA 1OV4A 4M9ZA 4X8MA 2JLYA 4CEJA 1GNQA 5DI3B 2JIZD 1G7TA 4URUR 1NBMA 4NZYA 2WV9A 2DFLA 4YXWA 3VNVA 3LX5A 4JVMA 3BGWA 2WWYA 3B82A 1KHTA 2RHMA 2ZUBA 2JLVA 2ZAMA 1WBBA 2MMCA 2PEYA 5FH9A 3ND9A 3D6TB 1CR4A 1WQ1R 1K8RA 5FOTA 2J0UB 3KXLA 4DWJA 4B34A 4BFWA 1N0VC 3AF4A 4AI6A 3UMRA 1Z28A 4CEIB 2ATXA 3K9NA 3AM1A 1OKKD 2QT1A 4WXRA 3AB3A 3B78A 1L8QA 1KI9A 2NQ2C 4TLAA 1OIVA 1NL3A 1NMZA 1RW4A 1DARA 3KQKA 2BEKA 2J0QA 3JVUA 5LD2B 4LV5B 4KBFA 3RABA 3G82C 4M1KA 4A92A 2Z4RA 2Z4SA 4CYMA 1QG4A 2F1RA 2FSGA 1K5GA 2WIAA 1FPMA 1G7SA 1ZD8A 2IYWA 3O8DA 2IC5A 2OZEA 4QGHA 5FL3A 4K81B 4QRHA 1JR3E 3WY9A 4ACBA 4QXAA 3SEAA 3U60B 2IYLD 1W4AA 5KDOA 4YMWA 4PSVA 2GK7A 2ZRFA 5UKDA 2XXAA 4S35A 3WYFA 3AVQA 4G3XA 3U3MA 3TJZA 4BLQA 4M21A 4GZMA 4JBWA 1UEIA 3UMFA 3ZVMA 2GWHA 1MRNA 3L0SA 3I5XA 3SJBA 3SJCA 3RYTC 2VF7A 1E2JA 4LI0A 3R9WA 3DKPA 5EXXA 4AKGA 3BRWD 2HCBA 3GJ6A 5GJCA 1KMQA 3T1TA 1SHZA 5HCIA 4ARZA 4OI0A 1DAEA 3HPQA 1SVMA 5LPNA 1W0JA 2VP9A 3I1FA 3IQXA 4LHXA 1XTSA 2AL7A 2NIPA 4DLVA 1CR0A 2Z5FA 2J5XA 2UKDA 2B21A 1E98A 3KJHA 2HF9A 4CEHA 2A78A 4V02A 2QG6A 4F91B 3QF4B 4L8GA 1OIXA 3ZD7A 4DKXA 2A5FA 1G21E 2WMOB 3VMFA 3B6EA 2R6FA 4AURA 1LY1A 1UADA 4Q01A 2O8EA 2BKEA 1UKVY 2FJUA 4JYCA 3UANA 1YZQA 4B3BA 4C0AC 2WICA 4D80A 2IBMA 2NTYC 5E4FA 2C9YA 1KI4A 4LYJA 4FCWA 3BH0A 4QHSA 2N46A 4V0NA 4DSUA 4F38A 1RRCA 4IDNA 2RB4A 4A8JB 3MSXA 5CK4A 3GLGE 4EPTA 3ETLA 2X2FA 3VR3A 2JJ1D 1AM4D 3KXKA 2F9LA 5L3QA 2DBYA 4R98A 2WWIA 1PLLA 1NY6A 1DAMA 4TTRA 2JLWA 1T4GA 3QE0A 2R6CA 1W36C 1QVRA 4MYHA 3RS3A 4TMXA 4BZQA 3AVYA 2V4ZA 4HUQB 1E6CA 3NH6A 3LWNA 3AP1A 1C1YA 1AQYA 2YHSA 1EWRA 1ZINA 3BOSA 1XMVA 2CHVA 2P6NA 3BH6A 3FMFA 4A6PA 2ONKA 5FUVA 2J0VA 4ZDWA 1P72A 5AJWA 4C7OA 3R7WA 4BWYA 3W8RA 3CH4B 4DLXA 5J4HA 1TADA 4IOKA
chains in the Genus database with same CATH superfamily
3ZTTA 1L7QA 3KKPA 1QG0A 4CTJA 1PYOA 2FRDC 2ZYGA 2Z1MA 3F74A 4GI5A 3EODA 3EVCA 3IKMB 3WNQA 1YACA 3PD7A 4KIUA 3WTCA 4YMGA 3IXMA 1SVUA 1W96A 1SQGA 2VHJA 4JLMA 2A0WA 4GL2A 3OC0A 2NU8B 1J6UA 2F3UA 1SFRA 3B7GA 1E79D 4PZEA 1LRJA 1JQLB 2GZ1A 3SKXA 5CBPB 2R25B 5I3CA 4I5IA 1IDN1 1SOVA 3LMKA 4IY1A 1V1MA 3H2YA 3GLFA 1QZ3A 1J9GA 2WT8A 2A5YB 2XNDD 3AVVA 1NMEA 5IT9A 2X76A 1L5HA 1RAGA 1Y33E 1ID8A 2GBLA 2NSHA 4FD3A 3WKAA 8ADHA 4YWHA 3NO4A 2C7PA 5HIJA 2M6RA 1IBMB 4XEHA 2EKQA 2HJGA 4IS2A 4WL0A 4L4XA 1N9GB 4LVNA 4YB8A 1RJEA 3IUMA 5H7XA 3TKAA 4WW0A 5K8VA 1X1TA 3ACBA 1GQYA 3MWKA 2B2CA 2XADA 3OY2A 2FVYA 2UVPB 3JQFC 3MB8A 4MI6A 4B2YA 4WBNF 1QQAA 2LV8A 2R6R1 1U7HA 2ZSBA 1D2GA 3DWIA 2J7PD 1VLHA 2LKDA 2Y1GA 2D59A 3PHCA 4WIAA 5I4CA 1K6EA 1NM5A 3NTLA 5HEKA 3VUFA 1C8VB 3FTFA 1WEKA 2BFMA 1U8TA 1VBKA 3IO3A 3QIVA 1WXQA 4Z1MD 4U2CA 4MR8A 4U7JA 1E1YA 3SDSA 1SO8A 3LDHA 1H9BA 5TIIA 2IYUA 3DT9A 1A27A 3ETDA 2A92A 1VCHA 1HYHA 2VQSA 2MT9A 3K09A 2A84A 4B2IA 2ZIXB 3KWFA 5CJ2A 4YGYA 1SKBA 3L0DA 2FR1A 2ZG6A 1W8DA 4DA8A 4ZVMA 3DNMA 3EXIA 5LJLA 2QP4A 4D44A 3E4DA 3EIEA 3I9JA 5JZSA 3CKLA 1CU1A 3ZTWA 3ZXUB 1LBQA 1JAHA 3CUVA 4REQA 3E3MA 3NVKI 1U7XA 1RWBA 3KT8A 4ZV4A 5FOXA 1CJSA 1NR1A 3OQJA 4M87A 4ON9A 3DF7A 1MHTA 1E8DA 3GV0A 2D7DA 1C1XA 2W2LD 3PHJA 4GIBA 1G3MA 3OFVA 4PW0A 1J8DA 3ZWNA 4C04A 3HM9A 3U4QB 3BDVA 2Q5CA 3GH1A 1HK7A 5CYGA 1GZ7A 4YJGB 4REOA 1D9ZA 1Y4ZA 1Q0LA 2CK3D 2PKEA 5AVZA 3V4RA 4QOSA 3UA4A 1PWZA 1OWNA 1Y5NA 2FPIB 3ZIAD 2QA5A 4GICA 3VTZA 5JPCA 1UJNA 3U1BA 1D7AA 1YHNA 4KGDA 3WZMA 4OHOA 4M0EA 1LFDB 5K3EA 3COWA 1ZIDA 1NZDA 1P9NA 2E5WA 1QIFA 1V11B 1YZLA 2VSOA 2VYVA 3KFXA 1YTLA 3P2YA 4FMPA 4JS0A 1BE6A 3N39C 3R0JA 4PQYA 4Z9BA 3B9QA 4XX0B 1Z7YA 3LYLA 3R3VA 5CCEA 3U61B 3VMMA 1BXZA 2REOA 5ELXA 1NR5A 3DE3X 4JLKA 2PDAA 5E0OA 5BN5A 3SVTA 2XUPA 4RL4A 3RW9A 1T4CB 1ZYUA 2EZTA 2Q0QA 2YCLA 5DYIA 2CEKA 3DDUA 2GTPA 4UNQA 3L0ZA 2VLBA 4LJ6A 4N0DA 4DXAA 3TEMA 3GUZA 3C39A 1JJBA 2OCLA 1XJQA 2QN3A 4BVJA 1PQWA 1OXUA 1B1CA 3BZUA 5ITSA 3ORFA 4LXYA 2CLFB 2GXQA 4R3WA 4X65B 3N6VA 2JFYA 5KS2A 1HQDA 2A3NA 3SHTA 3EA4A 4L75A 1JEJA 2Q5LA 3M2PA 3CJTA 1M5RA 2WVJA 4OQDA 2PS9A 3KXPA 1OPXA 4EB0A 3NTVA 3Q72A 2Q9BA 1ABBA 4MZXA 3R0VA 3HCPA 3V1NA 1TT5B 3BFVA 2R1TA 1BGVA 4GOND 4R0VA 4UOZA 3Q87B 5CH8A 1GLGA 1L8XA 4ZAFA 2G6BA 1OH5A 1DBVO 4GECA 4D8YA 2G1UA 5CB6A 3BC1A 3C1UA 1KY5A 4PLGA 3L1VA 2CY0A 1OWOA 4FX5A 1RJ9B 5KI6A 5BUSA 4JWTA 5EMKA 3TIXB 1IUOA 3DQZA 3P0RA 2ZRJA 3S7TA 3K6SB 3HN6A 2OKGA 2QQ5A 4WZBB 3K1TA 5T67A 4Q3BA 5LD2C 2JH9A 3EDRA 4G63A 2ZGVA 3GGSA 4YJHB 4BLTA 2X2EA 5K8IA 2ZUTA 4AY4A 1G19A 4XTCS 5C18A 3D5QA 3PIRA 1TM4E 4IWNA 3GLGA 1SU6A 1SXJD 3ORHA 3RFXA 3D8RA 1NUQA 1NFQA 1NI4B 4NF2A 4OA5A 4DJJA 3LXRA 2WF9A 3HXKA 4LWQA 1Q74A 2FVXA 2IYSA 3Q6MA 4JOCA 5H82A 3W2HA 3ZY5A 2W2VA 4CV1A 5T6BA 3V97A 1SVKA 2ON6A 4TXLA 2EEZA 2Y1XA 2IHKA 1E7WA 5BN3B 5JROA 3K70B 2W2NA 2BM9A 3B1JA 3OZ7A 2HT6A 4ZHSA 3QBVA 1K98A 4B4KA 2YQ5A 4QBIA 3QKRB 5LZ9A 1K06A 4E4YA 1CRQA 1K7XB 1ZH4A 2C88A 3DWGA 2H1CA 5TMEA 5GP1A 3VKUA 5MFPA 4PLTA 4BMOB 5C9ZA 4LSWA 3FSGA 2ZUDA 5I47A 5DM1A 3V3TA 1ACMA 2HB6A 3RSQA 3VTKA 4JY7A 5A4IS 3C3BA 4DWVA 4OJYA 3VR6D 3WWYA 5LZ5A 5LMZA 1G2QA 3DE2X 5C32A 1RACA 2YN2A 3ED1A 1OH7A 1F48A 1UOOA 3V34A 1V48A 1X1RA 4UU7A 2HV8A 1X94A 1BZYA 1FSSA 4RFSB 1VHDA 2RARA 2X6QA 1V1JA 2XVYA 3OY7A 1R8QA 4LI3X 4QUEA 3CLSC 5G02A 1YL6A 1EINA 5CLJA 3NHPA 3EYAA 3LY7A 4YJ2A 3CE6A 2WJWA 4QYIB 4J0JA 1PJ8A 5T4BA 2XQGA 1M8FA 3ND6A 1RRKA 4PGAA 4ZAGA 5JRJA 3C3DA 4JLJA 2O0JA 2QAIA 1NW9B 4Y0VA 2B61A 2WOJA 5KJEA 4GE0A 1L4KA 4YYEA 5CA1B 3PUKA 2GYWA 5M3BA 4F71A 2WQ7A 3RSSA 1XNJA 1JVNA 3OM0A 1Z7GA 4DLAA 3C0KA 4XD7D 3TZQA 2CNNA 2EBUA 3DAGA 3EBOA 1H5UA 3Q3GE 1YMUA 1J25A 3KTDA 3TLCA 2GKGA 4BO5A 2VT2A 2FP4B 4RSRA 1PS8A 4N5IX 2PRKA 5TGTA 1Z36A 1KU0A 5JWHA 5F76A 2I2BA 5DM4A 1A9QA 2X0FA 5EJ4A 5C8YB 1NZJA 5KTNA 4CDMA 4Q1DA 2GM4A 1CKEA 5DHFA 5IYZA 1FDUA 5EPEA 1WCWA 2C77A 3A26A 3KKEA 3QPBA 4Q21A 2IV3A 4E5DA 3HBAA 3IDQA 3DBVO 3PQ8A 1REQB 1IY2A 1ORIA 3GEIA 2V9CA 4EF4A 1RZRD 2GEUA 4WUVA 1YR7A 2W2KB 2A35A 1KZYC 3OJ0A 4LJKA 1NHGA 2B3DA 5ARBA 5GGXA 5HRCA 5DZSA 5BV0A 3E4CA 4MRPA 2DE0X 4M37A 3ZV3A 3WLQA 1KQPA 1WB6A 1ND5A 2D13A 4XIGS 5HE9A 2OKCA 3EXEA 3PFNA 1OKKA 3C43A 4BCDA 5BNFA 3CUTA 2CL7X 3W3AD 1IB0A 5HOEA 1R0SA 5JSFA 1SH7A 4YAUA 5ULLA 1FFGA 1PVDA 3LAWA 3MYRA 1B8VA 5I9TA 2TMKA 2WD9A 3CRQA 3NBQA 2D1TA 3R9XA 1T1RA 3K9QO 3KYDA 1R27A 5FO1A 4EK9A 3I62A 3TLGA 3G13A 3KJXA 3A6ZA 4MV0A 3WQSB 2H85A 4M9UA 4C0BA 1QVAA 1YK0A 2Y71A 1XN4A 1L7RA 3DZJA 2AFHE 2FU5C 2WOOA 2J5RA 4H6PA 2GEFA 3UCXA 1RHMA 1V26A 2Z2ZA 4Q3LA 1DV2A 1M1NA 1Q0ZA 1OIWA 5JWOA 4LVUA 4XDYA 5EIBD 1MC4A 5CT8A 1S2DA 5TPZD 1WR8A 2H2DA 2SBTA 1OLXB 1WLYA 2ZETA 5CDYA 3FH0A 5TT1A 1UT8A 4OGGA 3K4HA 5J23A 1IJBA 3C6QA 1F1BA 1H2WA 3D64A 4MV5A 3QYJA 1SD5A 5CEJA 3TPCA 2XYGA 4KXWA 1J9EA 3ICCA 4LWOA 2GCOA 3BQNB 3SKYA 3ZIDA 4AUKA 2B4KA 4KDRA 1M74A 2JEZA 4DZRA 1ZJ5A 1PNQA 3EVZA 4P80A 4RWEA 1T8YA 1KYIA 3EJWA 1II9A 1QIEA 1GAQA 1P3JA 2IJGX 2JK0A 5A3RA 1E32A 2XUGA 3F8SA 4W5HA 5DX0A 4HXFB 2OFWA 2QLFA 1JIXA 1KOJA 4E32A 2QSYA 3KQHA 3KHSA 4N7RA 4UBOA 3ZX5A 1KBZA 3H18A 1YQUA 3WK8A 4UU0A 4AKIA 2P27A 2AFIB 3UMGA 4IIDA 1MA0A 4FE3A 1M66A 3KOYA 3TG8A 4ENWA 3RDPA 1RXSA 2FR8A 2I4MA 5EMMA 3AY3A 2C4VA 1MB0A 2FPKA 1M2VA 1Z4QA 2PGNA 4G0XA 5AI9A 4CLXA 4R9RA 1XGKA 1X70A 3ODPA 4KN6A 4QAJA 1LLQA 4ZVVA 5IK2A 2ZJOA 3A1TA 4DT1A 7REQA 3GMDA 4KW7A 4UM5A 5AI8A 3V33A 4ZI7F 3ZU6A 1MZVA 5FEMA 3NEJA 1NU8A 3V4SA 2ECFA 1T9ZA 4WK6A 5H3HA 5TQ0A 2IYZA 3D5EA 3ZE2B 5AVVA 1KEZA 1QIGA 3CX8A 4JUAA 5FA6A 1MHPA 2WF6A 4PS1A 3BBPA 5IJ9B 1HLGA 3PCXA 4LHSA 3W34A 2QRLA 4R9SA 3HSSA 4HNHA 4OFZA 2ZI3A 2M6LA 3KQUA 4LC0A 4YJKA 2BY4A 1TW2A 2YYSA 2I2XB 1UC9A 1J2JA 1GRNA 2W6ZA 4KPUB 1O9HA 3E8MA 4IXTA 3HJUA 2Q4OA 5ALIA 4PG4A 3N9IA 5F7XA 3LP5A 3BE6A 1PRYA 1W25A 1OILA 2V3WA 1GDTA 4KHZA 5KTMA 2GEVA 3RC7A 2IDMA 3WB2A 4XUCA 2YYYA 4R0MA 4YMTA 1M34B 4MO2A 2LE0A 3JQAA 2D6FA 3B6MA 1TL7C 1W0KD 5I4BA 4HLCA 4DSNA 4EHJA 4LXXA 4KR2A 4A0FA 2C8VA 2BKUA 3MNFA 3GA0A 4M2LA 1V6CA 4LBVA 2WINI 3A3NA 4MHOA 1IJKA 3L0IB 4BNIA 1EE2A 4LE1A 4RIGA 1P2GA 1VLJA 4B4VA 1SBNE 4D41A 1F4VA 3LBNA 3S68A 3HY3A 4EX7A 4F4IA 4N40A 5CYPA 1EZZA 1UZNA 3H84A 2FR0A 2XUQA 1LJ8A 1F6DA 4FCVA 2G09A 2EKZA 2Z04A 5FT9A 1XCPA 5TV2A 4RD0A 1CDEA 1M8PA 4EO9A 3M33A 3KVNA 2P2DA 1ZW1A 3WRYA 3BL6A 4E1VA 4WZZA 3FKSA 4LPKA 1Z6GA 4ODIA 1ZD4A 1L7MA 1DKMA 3CQ9A 3B1KA 1UJ6A 4N7BA 5M5BA 1HEYA 4Y0NA 2YYZA 1JIJA 4RJ2A 2W8BB 2WAMA 3PK0A 2OHXA 1CLEA 2QTVB 1JHZA 5KZMB 1CJBA 3AI3A 4KLNA 3E9QA 1I2CA 3HZHA 4RVCA 1BCSA 1R0ZA 5AUQA 3L7IA 1ITZA 4K8RB 3RS7A 2MSDB 4NMWA 2BMWA 4WZ6A 5KC9A 1N57A 4WWHA 4BCCA 3WWPA 1N32B 3DZFA 4IEFB 4RELA 3CNNA 4B3XA 2WJAA 1L4GA 1UT6A 2PAAA 3DYIA 3QKIA 2HF2A 3G6KA 3HVJA 4IQFA 1XD8A 4MW9A 1WVGA 4JUBA 1E4EA 5NLLA 3VNQA 1WPGA 1SBZA 3CZ4A 4BGVA 2FEMA 1Y42X 1V1RB 3FUVA 1TMKA 1RCUA 1Q14A 1CR6A 2FUNB 3SIPA 3GPBA 4NEQA 3DPSA 5HVNA 1WDLA 1RJDA 4PZ0A 2YH2A 3MCTA 2YDXA 3V4ZA 1PS9A 1RI4A 3OJFA 4HZUB 5D3MB 4AULA 1E20A 1PX2A 1R9NA 5T4FA 4AIIA 4IICA 1H1DA 2X8JA 4Q7KA 2G76A 1KZ1A 2PBZA 4DMRA 5EN4A 1DUSA 4M99A 1QGUA 3OCXA 4CGZA 3L18A 3RASA 3SQOA 4BNVA 4JI8B 1EJBA 5L4NA 2GXSA 2DT5A 4I8XA 1CQXA 1WVMA 1YQ9A 13PKA 3FHOA 4TWZA 3TBFA 1PTKA 3EVTA 5IN5A 3O7MA 1J0DA 3FVTA 4ASUD 1TIPA 4GX2A 3M81A 2PAFA 4PR3A 3CVWA 3T3HA 4B6RA 4CCAA 3EEOA 4INAA 2AEFA 3DL2A 1U3FA 1QH1B 4DJDC 1O6FA 1M67A 4HVLA 1XXLA 1S3IA 4LBZA 5LQAA 3RKSA 2B7CA 2V74B 2ZVJA 1Q3HA 2ZE8A 3T1YB 1NUPA 2YVUA 1ZJ4A 5TQVA 3IMEA 2HEGA 4DCCA 2RDMA 4NOMA 3R20A 4O4LB 4RKEA 5C31A 4GC9A 4KKVA 4N4AA 4LRWA 3OOHA 4Z4CA 2ANCA 4CLRB 1KHHA 3G0DA 1KZ9A 2AMJA 4FHZA 3DFFA 1ZCFA 1SK9A 1CE8A 1KEUA 1CUYA 2G0AA 2JGIA 5THXA 3AR8A 4YRCA 2J9YB 2AZXA 3ITEA 4BX9A 2XF2A 2H29A 2YMQA 4QYWA 4G4JA 3ZWXA 3ZCRA 1TKCA 2QRUA 2RGUA 4N7MA 3QYPA 5TGZA 1VDZA 3RYFB 3EDCA 4CBVA 5L9AA 3FGZA 4ZV7A 3VHXA 1H2EA 2JA2A 1JXAA 2XR1A 5G0WA 2JNWA 4C6HA 3ITKA 1CUHA 1H6BA 1AQ6A 3HYNA 3GRCA 4MMYB 5DNUA 2QK4A 3SSNA 2ZJ7A 3CE9A 3I52A 5JAUA 4C3ZA 2BFPA 3GJXC 4G8JA 4OU5A 3E9YA 4KXVA 3TCXB 4AS2A 4IVRA 4E5MA 4TLBA 4OM7A 4B4WA 2WDZA 3ZR4B 1RQ2A 3T7KA 4AQYB 4V39A 2JVIA 4C0SA 3A70A 3IAS6 1CNMA 3OLZA 5LYJF 2RGBA 4HB2A 2R00C 4HR7A 4JT4A 2H8GA 1Y5IA 3PD0A 1WY5A 4PYIA 4TROA 4FIDA 4CE6A 4DM7A 1K3UB 2ZAYA 4FIZA 4HH1A 4E1BA 1UXJA 4Q05A 3WC4A 4DEXA 1XV5A 3GJ7A 1QZXA 1RZ3A 4IOJA 4Y9DA 2W42A 5HE8A 5JI2E 1G5QA 3BX1A 3Q3JB 1QR2A 1IPFA 4FI3C 4AY3A 4HBZA 3HO1A 3OHSX 3EA5A 1CDZA 2X3UA 3IMCA 3GJ4A 4N5DA 5HTKA 1SOUA 5IG2A 1EK1A 1V7CA 1ZUIA 5AYVA 4FONA 5D6NA 1I5OA 2DCUA 2GM9A 3PV0A 4L4RA 4MW1A 4CI0B 1TCAA 4TTJA 1JDBB 4IFEA 3NGXA 3V42A 1YVUA 2OT3B 2BM8A 5KO2A 2VTKA 4NHOA 2V6JA 3H83A 4I81A 3SFTA 2O8FB 3PZBA 2Z09A 1U1EA 1THGA 4RVSA 5HW0A 1QYVA 4NICA 5CFOA 4HV4A 1Z6YA 4ZK2A 4EA9A 4E22A 3AUAA 4M9XA 1F6BA 4MS1B 4Q7MB 1JALA 1F17A 4G24A 2GEKA 1SQ5A 4HEQA 4XQ9A 3AEYA 4GMKA 2RGDA 4JT2A 4LNUA 3I61A 2W2TA 2NV6A 1MRSA 3Q0EA 3DMTA 1BQ4A 2H0RA 1A9SA 2QL9A 3DPIA 3IP9A 3P9YA 4WV3A 4IUDS 4IXDA 4CV3A 5C5IA 5G3ZA 2AS0A 3JVDA 3L4BA 5FOQA 4AO6A 4I5GA 4I6GA 4JKYA 2M1XA 1GEGA 3OCWA 3VOBA 2P2GA 1FYEA 1JKJB 1O94D 1WSAA 1UPAA 2O9JA 2R11A 2QRGA 3L6RA 4OLJA 4RV9A 4V0MA 2GTHA 5K4AA 3WGTA 4FGUA 4HJRA 3PSAA 3DB1A 3MJRA 5JSHA 2XT9A 1A1VA 6GPBA 3MWYW 2HPHA 4OMFG 4KR7A 4OAPA 2BW0A 2H7CA 1IOWA 1QOQB 2QE7D 5JS7A 1YTUA 1LJUA 1X1QA 5JSZB 3C2QA 4P3PA 1KZGB 4HZGA 4CKCB 1D6MA 1EZ4A 1LV7A 2QI9C 4FLFA 1VP9A 1DC4A 1V96A 1MBZA 3R6LA 4GP6A 1O2DA 3CONA 3TEJA 3VI4B 4BWFB 3THYB 1BGWA 1D4OA 4HMOA 4I4TF 3HCAA 4MGZR 5F12A 3WGJA 1T2DA 3WLKX 4A6DA 1NW5A 3HYTA 4BFLA 1ONBA 2V8OA 1XQWA 1GZUA 2GBCA 3ZWVA 4BFXA 1MMFB 2PA3A 2RHRA 3KTOA 4L3OA 3SE7A 4ZICA 1J4AA 4WVLA 1OJ7A 1HQKA 2CZCA 3U9SA 1A2BA 4ONEA 1NURA 5JS1A 2ZRPA 2YWXA 3MAAC 5AKJA 3JYPA 1NJGA 2O1WA 1SRQA 4H1VA 3W5VA 1I8TA 2QS9A 4M9CA 4L6IA 2B0CA 3ZWPA 5B7GA 1VB5A 2X23A 3OTQA 3A3KA 1K08A 1U8UA 3AKYA 4RPKA 3VYRB 4ZIRB 2P3QA 4PFQA 4OSOA 3M3HA 4ALJA 5C4MA 5JTTA 3GGOA 1RPAA 4IQGA 5DLEA 2EDAA 3ZJUA 4BE7B 1JTVA 1RWVA 3CG4A 4NR0A 4IWYA 1I6WA 2J3QA 3FPEA 4MPPA 4DJEC 1P1CA 1HDGO 2B9VA 4Y1EA 3DBHA 4D2IA 4F1JA 3M5DA 1T1IA 1LTHR 3KEMA 4GPZA 4R8LA 3T9AA 2ACWA 3R40A 4IXWA 3ZLJA 4CM6A 2VSNA 4XCXA 1TB4A 8MHTA 1QHIA 4ZFNA 3FCCA 2YFKA 3NNNA 1JG1A 2QX8A 3AR6A 3FOBA 3T3MB 3M49A 3QXSA 3NW9A 4TYMA 4RVHA 4DNOA 4LGCA 4ZHQA 1EFCA 2GNOA 3H5IA 3HABA 5BT9A 1OHHA 1SUPA 4HQKA 4KC0A 4R01A 1VSTA 3N28A 4R9NA 4MB0A 5DM0A 1I9GA 3GLHA 2RGEA 5AUOB 3RVBA 1EFVA 3UWKA 2OFPA 5K8LA 3SYMA 1Z4NA 3TOSA 1J24A 1UDXA 4NZMA 2ZWOA 1BA2A 1ENYA 2ZBUA 1A76A 2BHLA 1PZMA 3KYCB 2OV6A 4B7ZA 2FK8A 2I8CA 3ORQA 4U2GA 4IDFA 4M0MA 5DHRA 1EQUA 1Z4PX 2H11A 2YYAA 4LY3A 1W35A 2OORC 4BFYA 5IKXA 3OFND 3R3ZA 1R6BX 2P35A 3PIIA 4KRYA 3SHOA 3SJZA 2P30A 4RVGA 1C41A 3EY4A 4R8KA 4BO8A 1HETA 3G0OA 1K5HA 1OZGA 4UBNA 3PA6A 2SNIE 1NTOA 2BGTA 4FFBB 3AF3A 3SSOA 4ADSG 1U0EA 3F1LA 2ABWA 3F6BX 4FZ5A 2BEVB 5HIMA 5KVAA 1JS1X 1UQUA 5DYTA 2H4ZA 1GNRA 3V4FA 5B3KA 1C0EA 1ODIA 3A06A 2EFCB 3AJAA 4R1SA 3UWOA 4OCZA 4QDXA 1I2AA 3BGOS 3RR2A 2CHGA 2LDXA 5H3LA 5JDCC 2M32A 2ODNA 1NRJB 4S1PA 1SIUA 3DZIA 1Q7GA 3DR3A 5F1OA 1KJJA 2ODTX 5BYJA 2BHNA 4GKBA 4MWCA 5DGDA 4YREA 3IKTA 4F56A 1AQLA 1TD1A 3C8MA 5HJ5A 4LF6B 3OX4A 5IF3A 3OCJA 2J6IA 2JGDB 2O2JA 5ED0A 4KWEA 3HR8A 3DA8A 1NDQA 2AJLI 1NULA 3T0GA 4FYVA 2PO7A 2Q3MA 2Z3VA 5PGMA 1IQ0A 1JEQA 3FNFA 5KNLA 4Z9YA 1W94A 1JHUA 4DNPA 4WDRA 4UTRA 1PJZA 4QU0A 3D43A 2GBLC 2GFIA 4IILA 2D4AA 3PHHA 1YZYA 4NI5A 4XKJA 5EIEA 1PV4A 2I62A 3K8YA 3HNOA 4ARUA 3GEPA 3MTAA 3CZMA 4G0YA 2PXHA 4CEIA 4Q03A 4RQUA 2C1EA 3DZKA 3TD9A 3AF5A 1HR0B 1A9TA 3NHWA 2P4UA 3GEEA 5BO5A 1R0LA 3HVHA 1RHQA 3F7MA 2FEKA 2VS1A 2AOTA 2X19A 1OC4A 1Y4DE 2VRNA 4YV1A 2FH5B 2BCGY 3FPJA 4M0FA 1NM5C 1W48A 1UMDB 2REQB 3H5NA 5A9TA 3H5LA 1U02A 2F67A 3L9XA 4BLOA 1YFZA 3M6MD 5AMXA 3P2JA 3T5BA 4DAEA 3OF2A 1USVA 4L16A 3PICA 4UM9D 3GRPA 3TTUA 4E4RA 1HXHA 4WAUA 3FTDA 1C50A 2HHHB 4OSPA 5HA5A 1GGKA 2ICAA 5KJFA 3NETA 4H27A 1UEXC 4FNMA 3T5PA 1ESZA 5DCUA 1F1JA 1QLHA 3MRXA 4C6TA 3AG5A 4GKAA 2EFDB 4QDJA 5DV9A 2P9FA 2BBSA 5E9AA 4RSHA 1BN6A 2FCRA 3T1HB 4KFTA 3I5YA 3EOAI 3HJGA 5BVGA 1QPZA 1J8VA 1SIBE 4LOIA 4RSGA 4HDSA 4OXXA 3OWXA 3LU1A 4K26A 3HA5A 3SLGA 1J22A 2GHQA 4Q00A 4AWXA 3OEED 1N6PA 3NHBA 2Q3LA 4Y6OA 4CTNA 3VHLB 4IR7A 5JOQA 2YDYA 1QGAA 5FBWB 4XH9B 2YJ6A 3LM8A 1FTGA 3PX2A 1E3MA 2AXEA 2RAVA 5E8RA 3C3JA 1HEUA 1YBVA 1ZD9A 1G21A 1RAHA 1XN1A 2D2EA 2P65A 1U6KA 1OXVA 3H87A 3HEBA 3HKCB 3JVEA 4B6QA 3RWMB 2XUAA 1BU8A 5EMNA 3ZCSA 2CNWD 4JLAA 4K9OA 1ZAKA 3GVXA 4LOHA 3AI7A 2QJRA 4DARA 2IS1A 1WP4A 2HAEA 3D0RA 3DVLA 5BRJA 2PVCA 3H86A 1E62A 3O4VA 4YR7A 3O1JC 1AKEA 1X8JA 2BZSA 2CSXA 3L7AA 2A58A 3L06A 2AC4A 3EZGA 1PNRA 3M1AA 3ZLVA 3N2KB 4DVGA 2GETA 1XZHA 2HFKA 4NDZA 4L9RA 4YT2A 4Z2AA 1AK2A 3D0QA 1QUEA 1O6BA 3DJYA 3GIWA 4OP2A 5CB0A 3GDGA 1D2MA 1YB7A 4LRQA 5F5XA 3M6WA 3SIWA 4UW9A 1YIOA 4AY2A 3GT3A 3G3EA 4O4JB 4K7JA 5I8PA 2E4AA 4WZBE 3TOZA 4YASA 5TMPA 5B6JA 1WCIB 3AEQB 4XSGA 1H4SA 1MENA 1ZNZA 9LDBA 2NSLA 1CVIA 1C1DB 4UU1A 1JI0A 4JJ8A 2YXBA 1FP4B 4EUEA 1EHIA 4RD2A 2JFXA 5KNCD 3CURA 3NXSA 2BE9A 2DKFA 3ADPA 1SQSA 5ENDA 1Z8FA 3CTMA 4NFHA 3T94A 1Z0SA 4ESVA 5ALUA 3KKQA 3E8XA 2Y77A 3JAWB 3G0BA 1A9YA 4ARAA 4QKQA 1GTSA 1DG1G 1NJ5A 2E4ZA 4C3UA 3VHQA 2Q49A 2A6PA 3KUUA 1UJMA 3UO8B 3K0SA 3N8DA 3WKEA 5NULA 1T4MA 1EGAA 1IQRA 3ESRA 4TSRA 3S29A 1G4AE 2AW3A 1OZAA 2WUFA 3QELA 1L0BA 3N59A 4IX9A 4ND5A 4O2RA 5ECYA 4ZCIA 3AUTA 3DFIA 5CFMA 4LF9B 1EUDB 1MTZA 2ZUUA 3EMKA 3PFCA 3PTAA 5IDWA 1XAHA 2OILA 5BR8B 2DUWA 1U5CA 2Q1XA 3BJIC 3QBTA 4M9SA 4HB4A 5IDVA 4DA0A 4YHBA 4HGQA 3EIXA 3W5UA 4C43A 2CB9A 2OCKA 4X1KB 3L1JA 4Y30A 3NAZA 1B8PA 4FXOA 4G36A 3TXYA 4XWOA 1JYFA 2IZOA 1A69A 1GITA 1X87A 4QJIA 2H2HA 4IIEA 4RDCA 2ZYWX 2HNKA 1YO6A 2ZIAA 3TLMA 1A88A 4FMBB 3WQQA 1ODSA 4Q7LA 1JIVA 4MUBA 2DFKB 5BWOA 4JBLA 1MC8A 4LA4A 1Z08A 3U31A 4YRQA 3PL1A 4OJMX 1LI4A 2OCGA 2MYUA 3KQOA 1T91A 2HCJB 3K1JA 3CNEA 3R5TA 1VCMA 3CWQA 4YRIA 2DCMA 3GJYA 4I19A 5EKXA 5HS4A 1Q22A 3C15C 5I7AA 3UV7A 5C1PA 6PFKA 1T8WA 4AN0A 3QPUA 4K0RA 4UUBA 1MJGM 1SD2A 3IUBA 3CXUA 5FDFA 4RWZA 5IJXA 2UYHA 4A5SA 1LDEA 2PMFA 3NYQA 1A2OA 3AEZA 4FEAA 3FYUA 2C2WA 1O96A 4ZPJA 3HDTA 1JAXA 4BRSA 2AF3C 1VPDA 3DDSA 4NE7A 4Z6KA 2JFNA 3GCGA 3L8DA 5H59A 4A2QA 5TDHA 5DBGA 5KYVA 4CKYA 1IQUA 3PBKA 1GPKA 1NRIA 1EFRA 3F47A 1J8MF 1USUA 1FNDA 1P3DA 3HKDB 4IF6A 4G0PA 3AFHA 1U0NA 4UDXX 2CYCA 4ND7A 4QPCA 3RSLA 2Y9PB 4D9CA 1FK8A 3AGQA 4UHJA 4B3CA 3HGQA 5JQGB 4JSYA 1PT8A 4DXDA 2AKYA 1LI5A 4LG1A 5LA6A 3GUUA 2GFHA 1EQAA 2ZSKA 4M0PA 2O8DB 3S4YA 2YASA 3U49A 1NOKA 2PNJA 4BB0A 3AEKA 4PQFA 3B70A 1MFPA 1JPVA 1U2DA 2HH9A 3WBFA 5FADA 1CJMA 1IDOA 1ST2A 3MM4A 2CXTA 3EAQA 3FE2A 1EK6A 3O83A 3LDAA 3NVMB 1NLUA 4LMPA 4L51A 3ACDA 1E3WA 1QAOA 1T0JB 3A6KA 2VYNA 1GZHB 1U1GA 4NS4A 2TMGA 2VPZA 4R1LA 4WOJA 1EWYA 4WXEA 4EUNA 3L07A 1CUWA 1N4AA 4CCYB 2LIPA 4BUZA 3AVXA 3ONDA 3ROKA 4Q4LA 4BGDA 4ERXA 5JR3A 4FEEA 3MTEA 2GCIA 1C5KA 3ZVKA 4I4NA 1SULA 2GQ0A 3T3DA 4AJ9A 2R8OA 3IP3A 4F4FA 1B23P 3MQFA 4PTYA 2DH5A 3BEDA 4FOTA 2PJDA 4Y18A 4KE7A 4OHKA 1UFQA 3ILYA 1JA9A 1JWAB 3A10A 4TLDA 3LHFA 5B6PA 2ZRMA 1SURA 1KZ6A 4P9NA 5FPYA 2GCPA 1K8YB 3ESXA 3FZNA 4II7A 4R1QA 3OM1A 4ZVLA 4BQNA 5CAEB 3A4VA 4GGMX 3C5HA 3PWSA 1IM5A 1FP7A 4YAGA 2Q2NA 3VYVA 5EHQA 1GCAA 4AAYA 2FZ4A 4ITRC 5FLEX 1PVOA 1XQ1A 2OSBA 5H0IA 3VU8A 4LOAA 1USKA 4Q34A 4E7OA 1T0IA 4D43A 3TAHA 1ZGHA 3BWEA 2IPXA 2Q7XA 1DKNA 4HLNA 5FI3A 3IVMA 4X66B 1WB5A 2CXNA 2QL7A 1NN0A 4B6SA 3PUJA 1E6UA 3OQIB 1PFYA 1VYTA 4LDAA 4JL5A 2IPNA 5D3QA 4N0MA 4F2PA 3JWEA 1QS0B 5D2CA 2AUTA 2DUUA 4D4HA 4EG1A 5LP6A 3NOQA 4UDOA 2CEAA 2Q4TA 4HWPA 1K75A 4ALLA 4OK5A 4RQTA 2AFIE 1QYDA 4EHAA 2QYHA 3ZXXA 4MLPA 4OQ4A 1Q7RA 5EJ2A 3COPA 1U80A 1FZTA 2QW0X 2L82A 5JNRA 3ONVA 3SC3A 2VNJA 4BASA 1C9NA 4BV2A 1YK1A 1KYZA 2OAEA 4MITA 2NO9A 4HP8A 4BP1A 4WRRA 1TPZA 3KYBA 2VAPA 1YSCA 4BKQA 1I7LA 3KR2A 4I3HA 1C29B 3SKVA 1PJ2A 4F04A 1M1UA 2I1WA 4N3CA 3DTVB 3GMTA 3IESA 1Q84A 4Q3CA 2AI3A 2DY1A 4MJLA 2B9EA 4ZVPA 2YWDA 4W5JA 2BBWA 2HBRA 1ZITA 1RM0A 3CLVA 3LK7A 1M6WA 1MOPA 3HJRA 3RVRA 4F3YA 4A15A 2QP9X 4WQMA 2PRYA 2ZTLA 4E51A 1FQWA 3CNBA 4E2FA 3QA3E 3NRCA 4FINA 3LFTA 2ZT5A 1FDWA 3ADCA 1EYZA 1WXEA 2Z6VA 4LDPA 5EFZA 4PCUA 1XD9A 1AKUA 1L9KA 5DTIA 1CY1A 1NF9A 4PWYA 4P31A 4DGQA 1IY9A 1KR5A 2YY7A 2FR8C 3C3YA 1V5EA 3CVJA 3P0EA 1UDCA 2B3TA 4EI8A 1VI5A 2PZGA 1M34E 1RR6A 3IOEA 3M1LA 1WW2A 3C3PA 1JDUA 3IOCA 1A9ZA 3UJ3X 4QO7A 1XHLA 3GX1A 3DE6X 5KSPA 2NP7A 3I37X 1DDIA 3F97A 1OXMA 4R8RA 5EKUA 3FDXA 3WMXA 4RTQA 1SUIA 3BCUA 3KAPA 4QWWA 3NHZA 5I7UA 3IRUA 1FFDA 1X8KA 1Y9AA 4S1TA 4KXYA 3F3MA 3GVCA 4YRLA 3HG7A 5ALOA 3CKKA 1DBRA 2VHZA 4NL4H 3ZCTA 3P9SA 4JJKA 2FE1A 1EDDA 1GUBA 5B1HA 1MLDA 2MMGA 4PSUA 3R7WB 4J91A 2DEUA 1N6IA 5T64A 2O3UA 3RRJA 1XTUA 4BZXA 3NWJA 1AS0A 1XVLA 2O57A 3MLEA 5SZKB 3H0KA 3GWGA 3I9V6 4YMVA 2X4GA 1Y9JA 1R4AA 3FBWA 3AINA 4U9HS 2PX6A 3HWRA 3JWJA 4WCFA 4Q19A 4DCPA 1Y82A 5B37A 4P86A 1XKTA 4W5QA 3DNPA 4KJZA 1H4TA 2V6GA 4I1RA 4NJOA 1EP2B 1UJCA 2UZ0A 1MX9A 2ONCA 2WJ6A 3MTDA 2VDNB 3X1YA 1G66A 4L27A 1EX6A 1LKZA 1NYRA 1Q1NA 1Y3DE 3EQ9A 5LB4A 4F0JA 1MO4A 4EF5A 5DWDA 5F7JA 4Q3OA 2H07A 3O82A 3QM1A 1PEAA 4MUKA 2HTFA 5K0TA 1CETA 3KO8A 4OFWA 3R7SA 3HL0A 4E15A 3WA7A 4H7PA 3KB2A 4QDOA 2JG3A 3H5VA 1H2ZA 2LVBA 2ES4A 2H2GA 3X2SA 5FI1B 1P17A 4MUAA 4WZAA 4NXMB 1LSOA 2G9ZA 2Q3JA 3LC0A 5CFZA 3W5SA 2E5LB 1SCAA 2FRXA 4M22A 5B2EA 3SI7A 1P1FA 2Q6IA 1ATIA 2XZPA 1H3EA 4MB6A 1A7KA 3LQYA 1SD1A 4Y2HA 1ZJWA 5FOWA 3HCOA 5E6SA 2FZLA 3OPNA 2HRBA 4FI3F 1O95D 1VC2A 2XMDA 3Q3CA 2V5AA 5ALPA 3CMMA 4OHFA 2A57A 3C6BA 1NSTA 1Y7PA 1NQTA 2P0EA 1Q7CA 4I1SA 4RK7A 1P61B 4FE7A 4M7WA 2X0NA 1R0BA 4GNKA 4R2XA 3RRYA 4LZNA 3RWOA 3DXZA 2VHQA 3SZRA 1MRZA 4IFIA 1JSZA 1E0KA 3HXPA 5DXFA 1VMDA 2HRQA 2W48A 3E9RA 4J0KA 4G5RA 1ZGAA 3ZLBA 4DDKA 4TM7A 1ZM4A 2YWHA 1LSJA 4KJXA 2WMDA 1JDPA 3PUWA 2SKEA 1D2RA 3VUEA 3RB8A 1XIVA