4RZHA

Crystal structure of fabg from synechocystis sp. pcc 6803
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
234
Chain Sequence
ALTAQVALVTGASRGIGKATALALAATGMKVVVNYAQSSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQKSGRIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIAPILQFIPLARYGQPEEVAGTIRFLATDPAAAYITGQTFNVDGGMVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Structure-directed construction of a high-performance version of the enzyme FabG from the photosynthetic microorganism Synechocystis sp. PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 84
structure length 234
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rzhA00
1PJBA 1P0CA 3BYZA 1EDZA 1HL3A 2AQIA 4A73A 3ENNA 4BQPA 1ML3A 3WMXA 3EZYA 2GN9A 4NJMA 4JIGA 1UUFA 2AG8A 2IDZA 2DTEA 2IYOA 2X9GA 4BV8A 4PLTA 1OZAA 1B16A 3H2ZA 2QYTA 4I9HA 4DGSA 1TT5A 1VKNA 1Y1PA 3OQ6A 3QIVA 4TRJA 3G79A 1A7AA 3WYBA 3E9QA 3GGPA 2CNBA 5CEJA 1LI4A 2BRUA 2CVOA 3IP1A 2VYVA 5A9TA 3ZHBA 4DWVA 2E4AA 1N2SA 5DULA 3WX0A 4NIMA 3Q2KA 5DCYA 3ZNOA 3EMKA 4XYMA 4AJJA 2UDPA 1R4NA 3UKOA 3LF1A 1GADO 4E13A 5EQDA 1CQIA 3GQVA 1LRLA 2J3IA 2O3SA 4YQYA 4B8ZA 3OECA 1UXKA 4HFNA 1GCOA 1A5ZA 2GN6A 2AA3A 4MVJM 5A05A 4FJ1A 3KUXA 1N9GB 4ALKA 2HK9A 3ZNNA 3F5SA 3N58A 1MC4A 3BHJA 1NPTO 3INTA 4DLBA 4E2WA 1U2DA 4MVJE 3U9LA 1J49A 5TRTA 5A06A 2OBNA 1JA9A 5IZCC 3I6IA 4EJMA 3LVFO 4DPMA 5H83A 3TL2A 5L4SA 2X6TA 3OIDA 5HS6A 1Q7GA 4YRBA 3DBHB 1QYXA 3LLVA 4QFDA 2I67A 2C20A 4ZRNA 1A7KA 1XR3A 2QHXA 3H9GA 4F46A 2VRCA 4RCVA 4TQGA 2VOJA 4PG4A 4FOOA 2I6TA 4U5QA 5MDHA 3COSA 2VZ0A 3AUUA 3JQAD 5L4NA 1X7HA 1K0UA 1BW9A 1NVTA 4HFRA 4M86A 4BNLA 1PL7A 3JD1A 3ZWWA 1E7RA 1ENZA 3T4EA 4CMGA 5CDGA 5KJEA 1E5LA 2ZTMA 4HNHA 4WLVA 3JQ8A 1RM5A 4BNWA 4NBUA 1EUCA 3Q11A 4Y67A 1GAEO 3RJ5A 4IS3A 2WYUA 2I66A 1LEHA 1PGOA 4YTEA 2Y1GA 1P1JA 5KKCA 4EW6A 1XSEA 3I23A 4M1QA 1LSUA 1MXHA 2BFMA 1XDWA 3S2IA 4BNZA 4S1VA 5EESA 5T8KC 2C29D 1ZJZA 2HLPA 3HADA 3WYEA 2W2KB 1E92A 2Y68A 1O5IA 4DC1A 2ET6A 2B83A 3WGHA 4PZEA 1O6ZA 3WTBA 4RPLA 4CLRB 1UDCA 1IZ0A 4Q3NA 2VWGA 4CQMB 4U6SA 1QR6A 4CUKA 2NVUA 3MJVA 4BHTA 2CMDA 3PLNA 4FS3A 5CAEA 4ND1A 3H5NA 4XA8A 4BNKA 1O9BA 2HQ1A 4IINA 2NSDA 1DIRA 3QA9A 5COAA 3KYBA 1A27A 4NG5A 3RUFA 4M49A 4YAJA 2EKQA 4QT0A 2NTJA 4YJHB 2Q46A 1XGKA 2O7QA 1O94A 3NJ8A 5IN4A 1ZZEA 4RL6A 3G0OA 3PTZA 3E5RA 3JQ9C 1W6UA 1NM5A 1DC5A 4ITUA 4TZKA 4OQZA 4BNIA 3SLGA 4O5OA 4IQ0A 1WW8A 3NDJA 1GUFA 1FJHA 3JQ7A 5CDYA 1DEHA 3OF2A 3PHJA 3QWIA 4KP7A 5G0VA 2EXXA 3KTDA 5CDSA 1IYZA 1K2WA 1XLTA 1P3DA 1PS9A 3QVXA 4LN1A 3HDJA 3K8ZA 4PG8A 2POQX 1E1KA 5IDQA 4NR0A 3RKUA 3PLRA 4YQZA 4MIYA 4RVFA 4A10A 3OQ1A 4OJNA 1T2EA 5HWSA 1NPYA 1LLDA 3ETEA 2VHWA 5HRUA 4CUJA 4U8GA 1KBZA 4BO1A 1YQGA 5H81A 1QG6A 1ENYA 3OJEA 3TNLA 1YOVB 3DO5A 2DKNA 3K96A 4OXNA 5ENDA 3WGZA 3NT5A 2FOIA 1PZEA 4AJIA 1T26A 4QSMA 2W8ZA 1LRKA 1PSDA 3FN4A 2IZ0A 3LT2A 3FNGA 5DP2A 3ETGA 5I9NA 2A35A 5LDGA 1R0SA 1DFHA 4Z9YA 4YB8A 3GGGA 2ZKLA 3I9LA 4MOWA 1X14A 4ZQBA 2Q4EA 3TOXA 4DMLA 2VCYA 1F8FA 3GMSA 2WD8A 3AM4A 1WMBA 3OBBA 4CLOA 1R4MA 4RVHA 2P9GA 4JN6B 5B37A 4B79A 4XB2A 1ZKMA 3WFJA 1A72A 2UV8A 1SCUA 5A04A 1LA2A 4L4SA 5CP8A 2V6BA 1VJ0A 2OL4A 2IZ1A 1A4IA 1ONNA 3RQSA 4B4WA 3W1VA 4XYBA 4GAEA 2GDZA 2RHCA 2Y0CA 2C7GA 3GHHA 3R6DA 1CWUA 3FWNA 4QFCA 3VPGA 3WXBA 3PJEA 1VL8A 3HQ4O 1JWBB 1K89A 5A02A 5L45A 2D8AA 4FFOA 4MDHA 3GG2A 2IZZA 4YDRA 3PQFA 4R1SA 4AJHA 1XQ6A 3FCOA 5TLSA 5K6AA 4KUEA 3JQBC 3VH2A 3B6ZA 3GA0A 3L07A 2DPHA 4TRRA 3DZJA 3PJFA 2CVZA 2TMGA 3E18A 3L4BA 1ZK3A 5A03A 4L4XA 3GHYA 3RSHA 4KDFA 2A92A 3Q0EA 3IUSA 2OMEA 5JAZA 5FFFA 1U3VA 4JNKA 4WE3A 1PQWA 5GMOA 1I33A 4MIOA 3ZGYA 1O89A 4FJ2A 1DFIA 2P91A 3WMWA 1UXJA 3HE3A 3IDSA 3RKRA 4CLHA 1AE1A 2VTDA 4RV9A 3FRJA 3LC2O 2HK8A 4R68A 2W90A 1PR9A 2ZB8A 4RGBA 4M54A 2QRLA 3ANMA 4RLSA 4NBTA 1W0CA 3WLFA 4PLYA 1ENOA 1EQ2A 1HDZA 2OXIA 1QLHA 4ND2A 3B1JA 4S3MA 3WNQA 1XG5A 3DAGA 5TC4A 4I5DA 4X54A 3I1JA 3QV1A 5TT1A 3HSKA 1YQXA 3X2EA 2VUSA 4W99A 4D0RA 5IDYA 5JYEA 1GUYA 2DC1A 4BO8A 4HBGA 5L51A 1XELA 1DBVO 1JKJA 2PGJA 4E2ZA 3C1AA 1ISHA 1GV1A 2DPGA 3BMCB 3MOGA 1PWZA 4J1NA 5TIIA 4ND4A 4JQCA 4YACA 1PS8A 2HMVA 2NM0A 2O3QA 1VL0A 3KSUA 1VJTA 2E6UX 1LDEA 2DAPA 4ZQFA 1GFSA 4JBIA 3FR8A 3NTRA 3N7UA 4L4RA 5ILOA 5DN9A 2BFOA 4LVUA 4ZQHA 2DM6A 3N74A 1VE9A 2YFQA 2X7HA 3PK0A 4TRNA 3L4SO 3KXDA 1C1DA 2AEJA 3OSUA 1EVYA 4MVJG 4YT5A 2GUGA 3EDMA 2EHDA 3WIEA 3S55A 1SNYA 2Z1NA 4DPKA 3BZUA 1I24A 4NNJA 5FWNA 3HN2A 1VKOA 4XQGA 2B5WA 4OH1A 1GZ3A 3ENKA 1KOLA 2BI8A 3GRKA 1ID1A 3HFSA 1LXCA 3SBOA 3A28A 4XIJA 4FBGA 2EF1A 5JY1A 1PGJA 1SPXA 4IBOA 4J0FA 2BMAA 3P5SA 4IIUA 4LCEA 4WNCA 4IDEA 1KEUA 1R16A 1NWHA 4DYDA 3ADOA 3BIOA 2EP5A 2ZB3A 3D1LA 5HTOA 3ZW8A 2HRBA 3QWFA 4E33A 1JKIA 5G4LA 1PJQA 1PX0A 3AW9A 1LC3A 3FWZA 4CV3A 1CJCA 2FN7A 3FTNA 3S2FA 4OL9A 2EJWA 5GZ6A 1EMDA 2WE8A 2RHRA 3MJCA 2VT3A 4I9UA 4Z9XA 3UW3A 4ND3A 2GZ1A 3O4RA 2P4QA 1VSUA 1NAIA 4OIMA 1M67A 3JQGB 3CZRA 4LGVA 1UP7A 3VPHA 1ZEMA 2HSDA 1GCUA 1SB8A 3ST7A 1GU7A 3ZHZA 4E31A 2NWQA 1LDBA 3SLKA 3DZGA 4GH5A 4XYEA 1EEHA 1DFGA 3RROA 3NTQA 1A71A 4Z0TA 2WM3A 4ALNA 3DAPA 4R16A 2X86A 5L9AA 2YYYA 1Y8RA 3DBRA 1XU7A 1E3IA 1LJ8A 4ZGWA 5JAQA 3BMQB 1E1NA 3ZNPA 4NFHA 1X1TA 4YPOA 4HV4A 4HX5A 4UEOA 5F21A 3CINA 3VH1A 1XQ1A 3D5QA 2BGMA 2GR9A 1Q7CA 1QXSA 1DDOA 4BMNA 4FIZA 5L53A 2XXJA 3GEGA 3CZMA 5G2OA 2JJYA 1HKUA 5AYVA 3PHIA 1PS0A 3MWEB 4BKRA 3HZZA 4R5MA 3AWDA 4URFA 5I9LA 4IGFA 4JX8A 1U8FO 1Y9AA 5B1YA 4UEJA 1WZEA 3AFMA 4JJFA 3WSVA 3DL2A 4J6FA 4E21A 5JE8A 1B0AA 3SEFA 2V6GA 1PZHA 1LDYA 2PD4A 2RIRA 1ZSNA 2DQ4A 2Y1OA 3P2YA 4RZHA 4B7XA 3CMCO 3L6DA 3WIDA 2G82A 2X5KO 2ZYDA 3UICA 1PWXA 1SOWA 1WDKA 2IEBA 3OH8A 4LCJA 1NR7A 4TWRA 4J49A 3Q9NA 3KETA 3ETDA 4UVGA 4DPLA 4K6CA 2SCUA 4ALJA 4BKOA 4N54A 3TQHA 4KWIA 4CM1A 1T2CA 4IDDA 4CM8A 3DMYA 5JDCA 4DBZA 3NRCA 3ZWNA 2D5AA 1D3AA 2YZ7A 5GZ3A 4Q9NA 3GVPA 1OC2A 3PFFA 1UAYA 3OICA 1L7EA 1L7DA 3F3SA 3K2BA 3QWBA 1DIHA 4EBFA 3SVTA 2UUOA 2JFHA 3ADPA 1S7CA 5LC1A 1LC0A 4E3ZA 1PJCA 5AVOA 2JFFA 2Y66A 4NPCA 3D4PA 3AI3A 3MJSA 1U7TA 3IS3A 1KC1A 1WLYA 3KO8A 3PZBA 5DBGA 5G4KA 4CPDA 4WPGA 4ZHSA 1CQJA 1OMOA 3PP8A 5JFOA 2CFCA 3WR5A 5DOZA 3DFUA 3ROQA 4J4HA 2IRWA 5AXDA 1RM4A 1G0OA 3G1TA 1GZ6A 2C5EA 3EY4A 3JQFC 5BQFA 4BL5A 4ZQGA 5KJ1A 1GPJA 3GN2A 1AHIA 1XHLA 2W2LD 5T5QA 3LT1A 4U6QA 2I5PO 2NTVA 3FD8A 4B4OA 3ZH2A 3DTTA 4W7HA 1J4AA 1GQ2A 1H6BA 1XA0A 2B4RO 3GAZA 2FR8A 1CETA 1F17A 2I65A 1GDHA 3PWZA 3R0IA 4NI5A 5IZCA 4BO3A 1JWAB 1NR1A 1T25A 4KTTE 4M55A 3ONEA 2FY8A 3WGOA 4XQEA 4BGEA 2VRBA 4WJZA 4RPKA 1HE4A 3KSZO 1YBAA 1X7GA 3I4FA 4E6PA 4XDYA 2F1KA 1BXGB 2HJSA 2PA3A 4M87A 2WSBA 3MTJA 2E49A 4QUKA 3OJFA 3OM9A 3VPSA 2EWMA 1Y7TA 5KVQA 1QV6A 4EUFA 4N7RA 4CV2A 5A9SA 4NJMB 2NU9A 3RASA 3NUGA 1H0KA 5DP1A 1HZJA 3BXXA 5JXWA 1U3TA 4BO0A 2GCGA 5L7TA 3F46A 3PFWO 1TT5B 2Y93A 2RAFA 3LSYA 3Q2IA 3PVZA 4BGUA 5JDIC 1ADCA 4AJ2A 1PEDA 4EUHA 2OFPA 1QRRA 4EDFA 1EE2A 4UVDA 1CRWG 2PZJA 2HAEA 3UHAA 3M1LA 1R4NB 1QYDA 2Y67A 5T8KA 4WK6A 1Z75A 1TXGA 2A9FA 1NQTA 3L6OO 4ALIA 4MVJA 5A5FA 5F5LA 3GNTA 3W4IA 3LT0A 4Z3KA 4M89A 2HJRA 4OGWA 4GI2A 4OSPA 3KHUA 4O63O 1DJQA 1R12A 4AJPA 1B3BA 1UZNA 3AOGA 4LMPA 4WNIA 2O3RA 4R01A 4DQVA 3GFBA 3GEDA 4NK4A 3RWBA 4RPJA 2J3JA 4NU6A 3GF4A 3OHSX 1HDYA 2DVMA 1B3RA 3H8VA 3W6ZA 3ZWOA 2ZTLA 3LQFA 5I7EA 3O8QA 1OBFO 4KQWA 3D7LA 3L6EA 1JU9A 4J7XA 3ITDA 8LDHA 3PDJA 4RZIA 1HDCA 3GZ4A 2I99A 2JCVA 2CD9A 3WDSA 1DLJA 2C0CA 4MJLA 4DRYA 5JC1A 3GDGA 2H6EA 1X7DA 3MZ0A 4GLOA 3QVSA 2JAHA 2PZKA 3JQ9A 4GMFA 2G76A 2CSUA 3HDHA 4F3YA 5BSGA 1FDVA 4DIFA 1EQUA 3HB4X 4AJLA 3NGXA 1AHHA 1BW9B 3CKYA 3G49A 4LMRA 2BELA 3ANLA 5C3MA 4ZRMA 4Z0HO 6LDHA 3ZU5A 3D3WA 3JQ8B 4FFRA 3UCEA 4YJFA 1P74A 2O3JA 4CQLA 2B4TO 2Y05A 2EW2A 4KZPA 1WDMA 1E3EA 1O95A 4P38A 1I2CA 4CJXA 2JHGA 2QYSA 3BTUA 1LDNA 5DNAA 3KEOA 4PN3A 1KVQA 2CVQA 3B70A 4BGVA 2RH8A 4LISA 2WD7A 4E5KA 3F9IA 1GY8A 1XU9A 1DAOA 7ADHA 3GC6A 5I7FA 4DXHA 1HYGA 4NJOA 4UVIA 1JDJA 3I52A 4WLEA 1RPNA 4CUZA 1BHSA 5C37A 4J16A 2NVUB 1Y5MA 1LQUA 3K73O 3QLJA 3X2FA 4YRAA 1Z73A 4BNYA 1DIGA 3PHLA 3NT4A 3E9MA 1PGPA 3GZNA 4LW8A 1XYGA 4WEOA 3GNQA 2YY7A 5MGBA 1N7GA 1WZIA 2BKAA 2YDXA 1Q0LA 1ZNQO 5B4VA 2B37A 2TMDA 3E6AA 2IYPA 1W73A 1DRWA 1OOEA 2HO5A 2NU6A 3HDQA 3VTZA 2P2SA 3FPCA 4EGFA 2HDHA 3R3JA 4PVCA 3ZWAA 2A94A 5DCUA 3RVDA 1TB4A 1SB9A 5BSEA 1Z7BA 1E7QA 1HSZA 3IKVA 1HT0A 1ZBQA 3C7DB 1YVEI 4D79A 3MEQA 2HKIA 4BIIA 2NTNA 3Q6IA 1KVUA 2GRAA 1B2LA 3JQ7B 3AI1A 4G2NA 2WE7A 4H16A 2GGSA 5JW6A 5AXCA 4CM3A 3OFSA 5A9RA 5AXAA 3JQBA 4IIVA 1NFFA 1LSJA 3HDYA 4NDNE 4CV1A 3K5PA 1WP4A 1Z7EA 3RUAA 5TQVA 8ADHA 3JD0A 1V3UA 3VKVA 4ZU3A 2XF8A 4UUOA 3JQDA 2AXQA 3QRWA 2AHRA 4GX2A 2YQ4A 2FR0A 4Y98A 4QX6A 4E30A 4CMKA 4E4YA 3QWHA 2Q1TA 1GTMA 4ZN6A 1Y81A 1NHWA 1CYDA 1SBYA 1P9LA 3RUIA 3SC4A 1NX6A 3INGA 4LSWA 1I32A 1MGOA 1P33A 3DC2A 3EHEA 3PEFA 5G0WA 1MFPA 3H9JA 4JBHA 4EJ6A 1I3KA 3I3OA 2D0IA 1ADGA 2WEKA 4RPHA 4YBZA 3UGKA 1YH3A 3WGQA 3WGYA 4ZICA 2D3TA 1HDGO 3RUEA 2BLLA 4CLOB 3M1AA 3EUWA 1R4MB 4FGWA 1PL8A 3P7MA 1YBMA 1HYHA 1ZVMA 1V35A 3E82A 1I10A 4EEXA 1FK8A 2UUPA 3GPDG 1BG6A 4XDZA 3RUHA 4ROSA 1UJMA 2W2LA 3GVHA 4PLZA 4CM9D 1LDMA 4KWHA 4ILKA 5DBFA 3U5TA 1LRJA 1SC6A 4HP8A 1YJQA 4PRKA 1MB4A 4RPGA 1NASA 1Y6JA 2YV1A 4YCAA 4IUYA 4IMPA 7MDHA 1BVUA 3MCVA 1U4SA 2DLDA 5C5IA 4GGPA 1GEGA 2CDAA 4N5MA 2DBZA 3BMOA 1ZIDA 4YEDA 3OIGA 3H5RA 1WNTA 3C1OA 3UCXA 2UVDA 3C8MA 2Q2WA 1XIVA 3D3EA 2EW8A 3GN1A 4GQAA 2ZB4A 1N1GA 1ZCJA 4R69A 1U2GA 5C7OO 2BFAA 4J1QA 3U4DA 4OOFA 3ZWCA 4W9NC 4FFMA 2Q1SA 1JAYA 3ZWVA 2EERA 4BNVA 4A26A 4ID9A 3S8MA 3P2OA 3D4OA 3LZ6A 3NV9A 4CMIA 2CDCA 1NAHA 3RI3A 3KRTA 3D0OA 1UAGA 1OC4A 1H6AA 1E1LA 2JCYA 1KS9A 1Y8QA 3MOIA 4IDFA 5COBA 4MP8A 2Y0EA 1T2AA 3V2HA 4TROA 1LTHR 1SZJG 1I01A 3JYPA 2VUUA 2WMDA 2NU7A 3GOHA 2EKLA 3AU9A 1DLIA 1N1EA 3DXFA 5DDIP 4R1NA 1D1TA 1MX3A 3C7AA 4IXTA 3WG9A 4IDCA 1U28A 4DREA 3LK7A 3A06A 3I83A 3UF0A 4RF3A 2JAPA 2X5OA 1TA4A 5TT0A 5JMWA 3HNPA 1PTJA 3KYDA 1F12A 5ENVA 4XB1A 5U4QA 3RFVA 3NTOA 3O26A 3RC9A 1C1DB 3I9KA 5BNIA 2WYWA 4CM4A 3PYXA 1W8DA 2AW5A 3ROPA 1B14A 3F5QA 3U4HA 1P44A 4E5MA 3WQSB 1HE3A 4CMEC 2DUWA 2G1UA 3RJ9A 1ZFNA 3VZRA 2JD0A 3BMNA 4HADA 5DCWA 6ADHA 3TF5A 3NX4A 1KEVA 3B1KA 2PNFA 1E3SA 4B4VA 4XJTA 3PWKA 1H6DA 4XKJA 3A4VA 2AEFA 2XPCA 4MVJH 4OKNA 1JVSA 4OO3A 4J90A 3PYMA 4MVJI 2YFHA 3IKTA 2O4UX 1VSVA 3MJ4A 1LSSA 2J3KA 1QYCA 1J5PA 3D5TA 3GUYA 4LRSB 2GASA 1M6HA 4OHUA 5H82A 5B12A 1CDOA 4C7JA 1Y9EA 4QXMA 3DB2A 3ZU4A 4D3DA 3T7CA 4WCFC 3ZWXA 4FR5A 4RO0A 5CPBA 1DHRA 2ILTA 3BHMA 2FPPA 3C24A 1U5AA 2E37A 2OP0A 4R1TA 3DDNA 2ZCUA 3L9XA 4BO9A 5JLAA 2XAAA 4MP3A 4XWYA 5I8ZA 1ISJA 4Z9FA 4NK5A 4CM7A 5KVCA 1E3WA 1CEQA 4WLNA 4AICA 3VC7A 1EUZA 2BFPA 3O9ZA 4TKLA 4Q3DA 1R66A 1V6AA 3H6KA 4J4BA 1YRLA 4XRGA 4BUCA 2G0TA 5I9MA 1YWGO 4D3FA 4BNUA 3K2EA 1P1IA 1B15A 4BMVA 1R0KA 1PJSA 2PGLA 1DB3A 3W4JA 2EEZA 3FR7A 3H9QA 3AK4A 4CL3A 5KVVA 5DOVA 4FSHA 4Q3EA 2NVBA 1Y8RB 3DBRB 4O1MA 1B8VA 4E12A 3CSDA 2WYVA 1DPGA 4E5NA 2AQHA 4NU5A 1GUZA 3CUKA 1K6XA 2Y1FA 4YXFA 2OBYA 5F1PA 3WLEA 1AXGA 3IL2A 1O8CA 1ZK2A 3AOEC 3M6IA 3V5NA 2O4CA 3TWOA 4PG6A 1JVBA 1JN0A 1EE9A 3U09A 5B4TA 3JQFA 3T4XA 2OORA 3WNVA 1F8GA 4HFMA 3Q1LA 4JXKA 1YL7A 4L73A 2B5VA 1HXHA 3ZWBA 4J3FA 1DC3A 1MV8A 4YAEA 4QO8A 2ZQYA 3JYLA 3WTCA 4A2CA 4CMHA 5K9ZA 3OP4A 2IODA 2EG9A 4ALLA 4LRTB 4OAQA 4GKBA 4BNNA 1ONOA 1ZXLA 1NFRA 3WICA 1LLQA 1E7YA 1WVGA 2NQTA 1EBFA 3TFQA 5L95A 1E7MA 1PZFA 4H7PA 1PQUA 3W8EA 5BSHA 4WLUA 3ZV3A 1M2WA 3DBLA 1T24A 1T1RA 4CL8A 5IF3A 4AVYA 1IL0A 4TMFA 3SC6A 4PG7A 4YAKA 1ZH8A 5A4DA 5J23A 1IUKA 3OEWA 1I0ZA 2D2IA 1ADFA 2B35A 3NT2A 5FI5A 1U9JA 1U3UA 3E8XA 4CM8B 1RYEA 1T2FA 3JQAA 3IAHA 3LF2A 1EZ4A 4KTVE 5JCJD 4HNGA 4RLHA 4D46A 4EITA 1I3MA 4J7UA 3CH6A 1IZ9A 3IJRA 1NXQA 4BO6A 2P9EA 3EYWA 4RVDA 3Q3CA 1I8TA 1YL5A 4R5HA 4YAIA 1IE3A 3WJAA 4BKQA 4BO4A 1KERA 1BTOA 1MUUA 4FGSA 3JQCA 4E32A 3QVTA 1HTBA 1RM0A 2O48X 1B8PA 1HLDA 1VM6A 2VUTA 3A14A 5C7LO 2I3GA 4FC7A 1M75A 4XGNA 4F6LA 5JDIA 4R3NA 3SJUA 3KVOA 1SEVA 5G4KB 3VZPA 3ONFA 4Z3DA 4BKUA 4BNJA 2AG5A 1NTOA 2PFGA 4KUGA 4RDIA 1GYRA 4OKIA 1AGNA 4ZQEA 1BDMA 1ZXBA 1E6UA 4AJ4A 4XYLA 1FMCA 2W4QA 2ZIZA 5I8WA 4CR6A 3AU8A 2BD0A 5U1PA 1HETA 2HMUA 3RC1A 3HG7A 4AJ1A 1E0DA 1N8KA 4WLFA 1NQ5A 3CXRA 1P45A 4CM9A 3LC1O 4D44A 1G0NA 4BNFA 2PV7A 1ULUA 2QQ5A 4LVCA 3F47A 1Q0HA 3DQPA 3VPFA 2Q1WA 4IDGA 1MP0A 4IZHA 4D43A 3G1UA 4DC0A 4NZ9A 1DHTA 1I30A 1K6JA 1V3VA 3ZI0A 5A5EA 4YWJA 4DLLA 4K6FA 1X0VA 3JQ6A 2JHFA 1SAYA 1DJNA 2VWQA 1UDBA 2D1YA 4CLXA 1R15A 4DUPA 1V0JA 1F06A 3QVOA 1XWFA 3EZLA 4MKZA 3JSAA 5ITWA 2J5QA 4ALMA 1HDRA 4FN4A 3TZHA 1FF9A 1I2BA 1UXGA 2VOEA 2FHSA 5AQ1A 2DFDA 4JP3A 4A5OA 2GYYA 3DFZA 1D1SA 5A9SB 1P0FA 1U8XX 4R54A 5CDTA 1N7HA 2ZB7A 3PJGA 5A1TA 3DBVO 4WGGA 3GVIA 5IDWA 3I4CA 4IJUA 1MXFA 2YHIA 1P1HA 1HLPA 3L77A 2PZMA 4G65A 1YONA 4PLVA 2E82A 3DWFA 3VDRA 3AI2A 1DOHA 2CF5A 2PD6A 1V9LA 2X8LA 5CEEA 1I2ZA 4R9RA 4B3IA 2Y1CA 3DONA 4RF4A 3OA2A 1VPDA 4O0LA 2OGUA 4J2HA 2P4HX 5JMPA 5IDXA 3TN7A 4K28A 3ZWPA 4QO7A 3GR6A 1N92A 3DHYA 4IMRA 1H9BA 2VWHA 2FZWA 5JS6A 3AY7A 2IE0A 4DQUA 5BR7A 3E03A 3GVXA 5JYDA 3I9JA 2HCTA 1D7OA 4BO7A 3ZNQA 4I08A 4D41A 2D4AA 3HJAA 3WQQA 1I36A 4UUNA 1R37A 4RORA 1UZMA 1I3LA 3KYCA 4HUJA 5EPOA 5KJCA 1HF3A 2GZ3A 4NFSA 2VNAA 4BKPA 3VHRA 2ZQZA 4O59O 3O8QB 1PGNA 3BA1A 1UP6A 3IOYA 3M2PA 2Y1EA 4W7IA 1RYDA 5THQA 3RU9A 1E6WA 3QSGA 4PLHA 4WOJA 2PWZA 1GPDG 1NPDA 5IXYA 3DMTC 3VZQA 5KIAA 4BMSA 3WOHA 3QQPA 4NBRA 5EMHA 1UDAA 1M66A 1EFLA 2EGHA 2P5UA 2OOSA 5L3ZA 1CF2O 1UXHA 5DF1A 4NQZA 2C59A 3GPIA 5A3JA 3H9UA 3HWRA 3D3WB 4TSKA 5ER9A 3WJ7A 3ZU2A 5CDUA 1YQDA 3GUCA 2AE2A 3QHAA 4YJFB 4CQLB 3L9WA 4EUEA 1T4BA 2UYYA 1P77A 1P1RA 4FFLA 5DZSA 5F1KA 4IZIA 1DIBA 1E7SA 4BQRA 4DTIA 5ILGA 1YB1A 3FI9A 2C5AA 4XGKA 1Q2XA 3KSDO 1NVMB 3ASVA 1GEEA 4ND5A 4A7PA 3ANNA 3TOZA 2X1HA 4FOSA 3ZZNA 2WD7B 2BHLA 1E5QA 4M8SA 4XRRA 2R00C 3E1KA 4I5GA 5TJ9A 1ZMTA 1ZK0A 3F4LA 3IQDB 3UFXA 2J5RA 2J8ZA 2QRJA 4DA9A 2VQ3A 3ON5A 4NFYA 5ADHA 4OM8A 5HS4A 3I9NA 1NYTA 1ORRA 1C1XA 1QORA 3PHHA 3GZNB 3NDRA 5G0UA 4E2YA 2QX7A 2EKPA 2P5YA 4MO2A 3PYLA 4WEQA 3JD3A 3H65A 3C7CB 2X5JO 3ZHYA 4YT8A 3K31A 1ADBA 3DZIA 2DT5A 3RBVA 4BVAA 3O38A 1OI7A 1E3JA 2WWRA 4IM7A 2LDXA 5KCZA 4I8XA 3WB9A 1XEAA 5ES3A 4AJKA 3STHA 2HRZA 1U4OA 4YT4A 4KMSA 3LLSA 3R1IA 4GWGA 2DBQA 4GX0A 9LDTA 4L9RA 2G5CA 4GGOA 3OIFA 5B4UA 2VWPA 3T7EA 2P9CA 4JLWA 4PIVA 2EGGA 3RBXA 2QW8A 1GR0A 4IQGA 4R3WA 2V65A 2HUNA 1XCBA 4CQMD 2WJPA 1A9ZA 1TT7A 4G5HA 4XR9A 4CV0A 3M2TA 2QIOA 3TRIA 3HFGA 5I7VA 5ICMA 4XYGA 4Y6RA 2QZZA 4CLEA 3EVTA 4WCFB 4NMHA 1EUDA 5TGDA 5TNXA 1U7HA 5IZ4A 2PH5A 4K9DA 4W9NA 5TJHA 4KDEA 2HU2A 5CEFA 3SXPA 3O03A 3G17A 3DAFA 1KY5A 5EN4A 3ZHXA 2GO1A 2GZ2A 3V8BA 1PU2A 1WPQA 3F4BA 4MKRA 1QV7A 1B7GO 2YQ5A 4FPXA 3U0BA 3RIHA 3D4NA 2GN8A 3GY0A 4GSKA 1PIWA 5KWEA 2VHVA 2X0IA 4OYRA 3GNSA 3NAQA 2R6JA 3TPCA 4WCDA 4W6ZA 3ZU3A 3RU7A 4FFPA 3AUSA 4XIYA 1M76A 1Y5RA 2X0JA 4EZBA 2C54A 1PJ3A 1PZGA 4YRDA 4JJGA 5FF9A 3DHEA 3EGOA 3LDHA 3QP9A 4DIBA 1WMAA 3RAJA 1ZUD1 2Q49A 2ZK7A 2P68A 3LT4A 4EEZA 4U0JA 2XOXA 1BMDA 5EERA 2RBEA 2O3UA 1FDUA 3LYLA 4P8RA 3VDQA 4K26A 4I5EA 4R4JA 5TS3A 2EP7A 4Q39A 1FXSA 4CMEA 1EVZA 1QYWA 2PK3A 3BMOB 3CPSA 3QY9A 1NNUA 4OXKA 1ZO8A 4CR8A 5GZ1A 1BDBA 1MG0A 4YJGA 3ZWYA 2BF7A 1T4DA 3DOOA 4B8WA 1RJWA 1NP3A 3AY6A 3K6JA 3QE3A 3IC5A 1UXIA 3A1NA 2OHXA 1VJ1A 5CPFA 5KOIA 4L8VA 2XXBA 4XGIA 5JAMA 3JYOA 1JKFA 1UR5A 3FSRA 1DAPA 2B36A 3RCBA 1BXKA 3OJOA 1KVRA 3K92A 2ZJ1A 2X9VA 4FW8A 5EIOA 2V6FA 1C0PA 1LLUA 1EBUA 2HMTA 4UUMA 3PQDA 2BGLA 2NUAA 1H9AA 4CMIB 3DZHA 1DC6A 4WCFA 4FD3A 2G17A 1SMKA 1YGYA 1YKFA 5IAAA 1NFQA 2YDYA 5CG2A 1Y8QB 4XEHA 1JLLA 3D64A 1QSGA 3RD5A 4TVBA 5ITVA 2FRDA 1PR3A 3AM3A 3HB5X 1GD1O 2AQ8A 3R3SA 4XJSA 1JQBA 5JDCC 3KB6A 3AJRA 3DZKA 1MC5A 3PGXA 3VOSA 1K6IA 3K9QO 2Q2QA 4RJTA 3UUWA 3BTOA 3VAZA 5IN5A 2PKQO 9LDBA 4BNXA 4CMAA 4IXWA 5L40A 4UAGA 3KLPX 3KYDB 4Y6PA 3JD2A 5AOVA 1LUAA 3FNHA 1MG5A 3PGJA 3DTYA 1E1MA 1X1EA 4I9NA 4OXYA 5I7SA 5BNTA 4IPTA 1P1FA 1R0LA 3Q9UA 4CM4B 4W82A 4IY1A 4YJDA 3AOEA 4PRLA 4D45A 4FCCA 4PCVA 4BNTA 2EV9A 4GX5A 5C7IO 5GY7A 4FJ0A 5BNFA 1YB5A 3DEYX 4JCOA 2OO5A 4PFJA 3UCFA 5TSDA 4BNHA 4IDAA 3BMNB 1BVRA 1ZW1A 3FHLA 4MINA 3MJTA 2I9PA 4WECA 3RC2A 4WLOA 3IMFA 1GV0A 4GPD1 3OMLA 5T67A 3KZVA 2FR1A 1HRDA 3NJ4A 3GDFA 4IS2A 3H5AA 2PH3A 4E2XA 1BSVA 3NYWA 3TJRA 2QG4A 3KV3O 4C4OA 1QLJA 1LNQA 5HA5A 3JV7A 3TDKA 2X23A 1PJLA 3B20A 4PLGA 5F1OA 1WXDA 1IPEA 3GVCA 3WGTA 4XD2A 2H9IA 2GD1O 3C3XA 2VHYA 5A3VA 3CTMA 3C85A 3OJ0A 1H6CA 4GVXA 3UH1A 3I6QA 1N9GA 4HFJA 4BB5A 1D4FA 1P1KA 2FSSA 5ICSA 3ZV6A 1FDSA 1DXYA 3EC7A 2PZLA 4TVOA 5JBIA 2HMSA 2PD3A 3QW2A 1E3WB 4XQCA 2CY0A 5EQFA 5JPIA 3HHPA 4EI2A 4II3A 4J43A 4GX1A 3DBHA 3QVWA 5EJ2A 3H3JA 4YA6A 2B69A 3ONDA 1EFKA 1VLLA 2ZYAA 3EK2A 3FTPA 3UVEA 2EJVA 4TRMA 3MTGA 3V1YA 1YE3A 5IFLA 3VPXA 3KLMX 2X58A 3BAZA 2HMWA 1H94A 3JYNA 5T6BA 1T1SA 1FDWA 2PGDA 1Z45A 2GLXA 2DBVO 1J0XO 3BTVA 4WUVA 4GL4A 5ER6A 1G1AA 4N5NA 3GMDA 3OQBA 1F0YA 4OOEA 3WSWA 3ABIA 1HE2A 2PKQP 1LDGA 3LC7O 4N5LA 4QEDA 3BHIA 1N5DA 3H3FA 1QMGA 4Q3CA 1Z82A 1UH5A 2QRKA 5FEUA 1T2DA 3ZCXA 2GPTA 2NLOA 4A27A 1HYEA 1KC3A 1KEWA 3L0DA 4P4NA 4DLAA 2X22A 1BRMA 3DBLB 1ZSVA 2W2KA 2IEDA 3OJLA 3PDUA 5G0TA 5JNLA 4BOYA 2CZCA 1SEPA 3CIFA 3RC7A 1ZMOA 2J6IA 4CLRA 1C0LA 2JD1A 4CQMA 4FC6A 1H5QA 2CDBA 1BGVA 1U3WA 4DVJA 1PJ2A 1E77A 3JQAB 1OAAA 1TLTA 4GBJA 4NH4A 1QP8A 3PIDA 5U9CA 3WWYA 2VHZA 1HE5A 3A9WA 2O50A 1K5HA 4RQTA 4INAA 2ZCVA 2NADA 2Z1MA 5T64A 4L74A 1DRUA 4YJHA 2BI7A 4J9UE 3NGLA 4AJEA 4UREA 4J7CA 4EJ0A 2D59A 3GG9A 5K0ZA 3E9NA 4BGIA 1OFGA 4IJKA 1IHXA 5HM8A 2Y0DA 4Y9DA 4XX0A 5L7YA 2AMFA 3WBBA 2EIHA 1LU9A 2Y1DA 1GYQA 2PY6A 4HWKA 3PZRA 1NVGA 1B26A 4GLLA 1VC2A 4R1UA 4PZDA 3ZV4A 4MPDA 4RVUA 4ONEA 4FB5A 1U5CA 3SJ7A 1HDOA 1KVSA 2YUTA 2FPGA 3I9OA 4RF2A 2I76A 3GDOA 4J4TA 4RQUA 3ROMA 4N18A 1SO8A 4J91A 4B3JA 4JK3A 2O23A 2OUIA 3AUAA 5LCXA 5JCXA 2C2YA 1YOVA 2CF6A 3VTFA 2GNAA 1I3NA 1YO6A 5HBRA 4Q3BA 3LU1A 1KY4A 1X0XA 1G6KA 4L76A 3WBFA 1E7WA 1ZK4A 1M6WA 4GWKA 5BSFA 4E0BA 2PKRA 4MIEA 4TKMA 4W4TA 4QQRA 4MVJD 4CODB 4YAGA 2Q2VA 3S1LA 4CLDA 3U62A 1ISGA 4FQ8A 3U4CA 1LSOA 2H5LA 2W98A 4PG5A 4L75A 3DMTA 4F6CA 2VN8A 3V1TC 3PI7A 1JW9B 4MVJP 3NDIA 1CERA 4PVDA 1Z74A 1YJ8A 2ZYGA 4PLPA 4CM5A 3ULKA 4B3HA 4IJVA 1IY8A 2O7SA 4E5PA 5CFZA 3MJEA 3PJDA 2YHIB 1PJ4A 1KETA 2YV2A 4AL4A 1C0KA 5JSFA 2C2XA 2AEMA 5TX7A 3PIIA 2J5KA 1NQAO 2YV3A 1F14A 2DTDA 5COQA 2VYND 1VI2A 3GLQA 2X4GA 3DR3A 2VHXA 3VKUA 3E5MA 1YDWA 4QTZA 3UN1A 4UUPA 2AQKA 1IPFA 4TZTA 3GGOA 4JBGA 5T57A 4WASA 3PRJA 1WAMA 2R00A 4LK3A 1WWKA 4AJNA 1YDEA 3DZFA 2IXBA 3GAFA 1EK5A 3JYQA 1IB6A 3FF4A 2VZ8A 3VVCA 1QYVA 1MFZA 4FDAA 1V3TA 1ENPA 2ZATA 4P4GA 1YXMA 4RVSA 3WFIA 4AG3A 2PLAA 3GT0A 3V1UA 1DSSG 1HZZA 2YJZA 3H4VA 5AXBA 2B4QA 3KYCB 1ISMA 1RM3A 1GZ4A 1MLDA 2X0NA 3WGIA 5KTKA 4U7WA 1PQPA 4XQ9A 3WWZA 4YT2A 4P22A 2VNSA 4H15A 3OA0A 3DZBA 4FFNA 4RF5A 3FBTA 4PLCA 2BH9A 4BNMA 3PXXA 3F6YA 2UAGA 3VH4A 1ZJYA 2VTEA 2Z5LA 2H63A 1S6YA 2FMUA 3KEQA 5IG2A 2VYVD 4YYZA 2B0JA 1V8BA 1C14A 3ICPA 1TVEA 1X15A 4Z0PA 3RFTA 2RCYA 1B8UA 4UEKA 2FP4A 2FWMX 1YL6A 2JD2A 3KBOA 3V2UA 4JGBA 3HUDA 4MVJF 4NBWA 3QWAA 4A03A 4J1SA 3BMCA 3U49A 4WKGA 3U3XA 2ZTUA 3VVBA 3G3EA 4I5FA 2GN4A 3JQEA 3PHGA 4I1IA 2E48A 3V2GA 3GH3A 5JY6A 1VRWA 2JKVA 1KEPA 1AXEA 4G81A 5JO9A 1HSOA 4OMUA 2NV6A 3FNFA 3KOUA 3NKLA 1LX6A 2VT2A 1R6DA 3S2EA 2NQ8A 1BXZA 2JCXA 1RKXA 2FPIA 1PGQA 4QECA 4CMBA 1BWSA 1NBOA 1ARZA 5K6AC 2Q99A 4OSOA 4PGFA 3UXYA 2O2SA 1Q1NA 4JJIA 3GK3A 2R2GA 1JTVA 3L4BC 1A9YA 1LQTA 3GEMA 4R51A 3ZWMA 1EVIA 3RUCA 4GSLA 1Q0QA 1H2HA 2RH4A 2VRCD 1NWCA 5EINA 4D42A 4BV9A 3FNEA 1C1XB 1YS4A 2I3AA 4KQXA 3K30A 3PPIA 5CHEA 5KJ6A 2FZEA 3QJ5A 3RUDA 1EVJA 2PTGA 1ULSA 4L0QA 4MKXA 4UVHA 1SOVA 2O2YA 2H1SA 2Q3EA 2WTBA 3E48A 2Y99A 4C7KA 3EVNA 3PQEA 1ZSYA 3P19A 1P31A 2FSVA 3ROKA 1IHYA 5JAIA 4OQYA 1AN9A 3DOJA 1ZK1A 4GMGA 4CM6A 4E5YA 2JL1A 3MWDB 5FI3A 4IJWA 1O0SA 2QZ9A 3IJPA 3ORFA 3B1FA 4YVFA 5KKAA 4AJOA 4BB6A 5CG1A 3JQGA 4ZA2A 1HWYA 1D8AA 3W8DA 1H93A 1LBEA 1GQQA 1HEUA 1Z6ZA 3GRPA 3W6UA 1K3TA 5KJFA 3W8FA 1JAXA 1KVTA 3EW7A 5L4LA 1ZEJA 2NVWA 1NQOA 2HK7A 2F00A 1YBVA 4Q3AA 3ZV5A 3AFNA 1C0IA 1I5RA 1UZLA 3BMQA 4PZCA 3AUTA 1HDXA 1ISIA 3IP3A 4IQ8A 4WOKA 4ZJUA 2YHUA 5TF4A 4KUHA 4HKTA 3VZSA 4BO2A 1UP4A 3DHNA 3H7AA 4GVLA 1PJTA 3BTSA 3OEYA 3IIEA 5F5NA 4UVEA 2AE1A 4DQXA 3ZN2A 3AY3A 2Q1UA 1EK6A 2A4KA 4BS9A 2GSDA 3RFXA 4DBVO 4H3VA 3TL3A 3CMMA 4DYVA 1IULA 2Q4BA 2NACA 1NHGA 2Q45A 1PL6A 2OZPA 2NNLD 4J1TA 2DUUA 4PLFA 4RVGA 4B7UA 2WDZA 4BO5A 1J6UA 4EYEA 4AFNA 2ZJ0A 4J9VA 2LDBA 3H2SA 3OETA 1QKIA 2DBRA 3TZ6A 4RDHA 3H9EO 1DC4A 1X13A 3RBZA 2IXAA 4KOAA 2JFGA 4NHEA 5DT9A 2GF2A 4A0SA 4CMCA 3ZDFA 1ISFA 3JTMA 3WYCA 1L1FA 5THKA 4II2A 4IDBA 4GKVA 4D7AA 1TI7A 4XZ3A 4K1LA 4B4UA 1EDOA 1ONPA 4MP6A 1IOLA 3TZQA 3KM0A 1E3LA 3ICCA 4PLWA 1FDTA 4DL9A 5KNLA 2J3HA 4IGEA 4ESOA 3TFOA 1GL3A 3HN7A 1KYQA 5LDHA 3CEAA 4J0EA 3ASUA 1DIAA 3PWSA 3S2GA 3SX2A 3F1KA 1W4ZA 2V7PA 4LSMA 1U1IA 4UULA 4D0SA 1GYPA 4P4LA 4O6VA 3I9MA 5JO0A 3UOGA 2Z95A 2BGKA 1DO8A 3TSCA 4CMJA 3INRA 4JP2A 1A4UA 4JROA 2D5CA 1VL6A 4YJGB 3W4KA 3CE6A 4R9SA 4ZD6A 4U0KA 3IUPA 5DBIA 2DFVA 5FYDA 3UAGA 1DRVA 1YB4A 1XKQA 2GERA 4CR7A 4Y6SA 2YW9A 3I5MA 4YR9A 5IXSA 1MA0A 3C1TA 5G0SA 2NU8A 4HY3A 3NEPX 3JCZA 4XCVA 2Q50A 4BNGA 3ITKA 3TZKA 2C07A 1CIVA 1Q7BA 4Z6KA 4D3SA 1WDLA 5JCJA 5BT9A 4Y8VA 3JD4A 2VZ9A 5JC8A 3AM5A 1C3VA 3EAGA 3U4IA 4B7CA 4DIOA 2O3TA 3ZW9A 1KIFA 2X9NA 4J2OA 5F3RA 2V6MA 3DOCA 4XR4A 2C7VA 1RWBA 2VYNA 2CUKA 1GQYA 3TZCA 5IJZA 3WS7A 3FPLA 3F1LA 4NBVA 3WQRA 4F45A 2PR2A 2DTXA 5EL0A 4HXYA 3GFGA 1LLCA 5L7WA 1E6EA 1H2BA 2C82A 2X0RA 1AUPA 3FBGA 3WGGA 4R41A 2ZTVA 1BXGA 2OP1A 3VH3A 1TEHA 4ZVVA 5KVSA 2DU8A 4DMMA
chains in the Genus database with same CATH superfamily
3EHDA 1NT4A 1VP3A 1A4RA 1HL3A 3R3UA 3GP8A 1L5SA 1RXCA 2VC2B 2UVPA 3FZNA 2Y71A 3WMXA 3HEBA 5MF6A 2AD1A 5D2CA 1ZAKA 4LDAA 2GN9A 3WB0A 1I0LA 1XK6A 2GS9A 3OLYA 4JIGA 1QQ7A 4LY0A 3HXTA 4IIJB 9ATCA 3J7AC 4LNUB 3BGWA 1Z29A 1B16A 1PFYA 1VMDA 5IKPA 4ENWA 2JLWA 4TSFD 5LB2A 1SVUA 4Z8XA 1E20A 1TT5A 3PUWA 5ALVA 4D1YA 1KYTA 3AF1A 2FXIA 2NN3C 1WL8A 3OQ6A 4TRJA 2I4IA 4FHEA 3E9QA 1MRNA 3GGPA 3VOBA 3CFYA 4PC3A 1OLUA 4QYIB 2ZDQA 2BRUA 4Y2UA 3N70A 4BAUA 3E61A 3KUKA 5CEJA 2HBZA 2RH5A 1GPWB 4OBXA 1QHHB 1U8EA 1JT2A 3TZLA 3ZHBA 4DWVA 4ZHQF 1DX4A 1ST3A 3WX0A 1E2FA 3SSMA 1DWOA 3KHTA 3OQHA 1VLVA 3ZNOA 3HYCA 1JJIA 1XAHA 3OE7A 1GADO 3SFZA 3UW1A 4INZA 1GGEA 2A9VA 1G21B 4MKGA 4OFWA 2QJFA 1LRLA 1LBTA 2J3IA 5DLYA 5EQDA 3RS0A 4ZPJA 1UXKA 2D00A 4NS4A 2WSMA 1CUHA 3DLIA 3O8OA 4JWKA 2AA3A 4RYDA 1JEQB 3RHTA 1P6XA 2J32A 2MMGA 4ZP1A 4L4UA 3KZMA 1FFWA 2B34A 2HK9A 4RLQA 3U26A 3ZNNA 1TO1E 5JPCA 1JHMA 2XB4A 2YHAA 5FV7A 1EVLA 3VU9A 2FR8C 3INTA 5BY2A 2RDMA 3BPSA 4MVJE 4Q4HA 4RK5A 3EFHA 5AVJA 5A06A 5EMNA 1IEXA 1JA9A 1A0OA 2DECA 1TQDA 4C76A 3KAQA 5H83A 3KR2A 3TL2A 1B42A 3CXUA 1WY5A 4N5DA 3KOWA 2WF8A 5HS6A 1PLKA 4X8LA 4YRBA 3H2IA 2GM5A 3BL5A 3UJPA 1QYXA 1IDOA 2XVYA 3QLUC 5JQGF 4H1TA 2C20A 2ORVA 4ZRNA 4D9NA 1ORHA 4R05A 4F46A 1LWOA 4TQGA 2VOJA 5ABPA 1NQVA 2EBFX 4QDJA 5HRAA 2QAIA 4PG4A 4YP7A 5K8LA 3DYVA 4S2EA 3TW0A 4U5QA 1TVMA 3COSA 3K9GA 2VZ0A 1COWD 4BZXA 1LJUA 2FHPA 2PHZA 1K0UA 3NS7A 4GZLA 1IC6A 4TT3A 4HFRA 4F4DA 4EJ2A 3ZLJA 4LZLA 4AY2A 4FXOA 4ILEA 3NBAA 4IJ5A 4BNLA 3S0JA 3ZWWA 1U0RA 1WW3A 3DDOA 5E6SA 3U7HB 1UDXA 1X9GA 2EJCA 5HUHA 5CDGA 5BSWA 1ECCA 2EFHB 4WLVA 3C43A 1I9GA 4QUEA 1P0PA 4EHFA 1UZUA 1E2UA 3OG9A 4MUKA 2ZI4A 3AVTA 4C87A 1PT9A 2Y1GA 5KKCA 4QLBA 2D4HA 2DMRA 3RS7A 5BR8B 3FGPA 1XSEA 3WNBA 4X1KA 1J0CA 3I23A 1F3OA 4LG1A 3W5CA 4ZCTA 1P72A 3G2QA 4BNZA 5IJXA 1OILA 3PKJA 3X1KA 5M29A 1ZJZA 1COZA 2YYAA 3HADA 4F84A 2Y68A 1O5IA 4I4TA 4PEVA 4DC1A 4WKCA 2OGWA 3ABZA 3EN0A 3HA3A 4NC9A 3NP9A 3WGHA 3HPRA 3ZK7A 4RPLA 3HR8A 4Y2TA 2H9YA 1AK1A 4C08A 3KR0A 1QP4A 4U6SA 5FUWA 3ZGNA 3O8LA 1AS3A 1A9QA 1QR6A 2AJTA 1CQPA 3KKNA 3LKZA 1QHSA 1XV5A 3D7MA 1SOUA 1Y3CE 4BHTA 4IIEA 4DHWA 4YRNA 3RRMA 4KQKA 3H5NA 2QLTA 1O9BA 4IVNA 2NSDA 2CXXA 2XCSB 2JAQA 3QA9A 2P35A 2R4TA 3EX7C 1A27A 3J81A 3MJFA 5FR2A 2EKQA 2WDPA 2FVYA 4JJAA 4MR8B 2C4HA 3ZBPA 1VLMA 2GKSA 2ZROA 1R00A 1GTVA 1XGKA 4YMHA 4GZ3A 4PHFA 1VBKA 4ZALA 4EY7A 1FSGA 4ZI7F 3RTDA 1VLQA 3FTEA 3FUXA 1V3QE 2XHEA 1QU3A 1JHUA 1EZZA 3N2NA 4XSGA 4JMLA 3JAKA 4UBNA 5IABA 1DC5A 2YQZA 4ITUA 4UJ5A 4UHEA 1P1CA 5CLQA 4DCCA 3SLGA 4QTYA 4O5OA 3AJAA 1YZYA 2EWVA 1L4LA 2BEUA 4BCDA 3EGCA 3LHSA 3GFPA 4UTRA 3JQ7A 5AJXA 3HFJA 2OBMA 4Q37A 3IBYA 5CDYA 1UCFA 1A96A 1WNFA 2RHGB 1Z4KA 3EPJA 1SIOA 2V58A 1UK8A 1XLTA 3EGDA 3QPUA 2FPGB 2OCAA 1P3DA 2RMKA 5AW0A 3HDJA 2UYHA 2IU3A 4QQFA 3PNYA 3RKUA 5G1PA 4JB0A 2I33A 2IEYA 2VK4A 3ZCPA 2JGKA 3AEUB 2MSEB 2BUBA 1NPYA 2R79A 3HVUA 3ETEA 3KWLA 3M6FA 1YA8A 4KQIA 2WTUA 4GBGA 4D6PA 4BO1A 4DM4A 5H81A 1H2FA 3PQ6A 3OJEA 4B9AA 1R0YA 3TNLA 4YDQA 3SQNA 1G55A 1YOVB 2HU5A 3AGQA 4GG1A 4D9IA 3WGZA 2OD2A 1GTG1 1TJ4A 4EK9A 3KTFA 4NNPA 3B1YA 4H1HA 2XUKA 3U7EB 5FT9A 4QJ3A 4QSMA 2GM3A 1LRKA 3COPA 1MDBA 3FN4A 1NW3A 2F4NA 4TV8B 5I9NA 4V0SA 2LXNA 1JJBA 2VP4A 2CUZA 2DBYA 2A35A 2WHYA 3QNMA 1O87A 1ZRMA 1KY3A 1T6ZA 4Z9YA 5BUCA 1A5AB 2MSNA 2WVHA 3EH2A 2ZKLA 4ZQBA 2Q4EA 3RGGA 4YMWA 4DMLA 1U8AA 2IZ7A 5A2QA 3AM4A 1G20A 3OBBA 2HF2A 4EHAA 4R9VA 3UAWA 1E8DA 4EIWA 2FEKA 4B79A 3N86A 4JKIA 3V32A 1E5DA 4O5AA 5DHFA 3WFJA 1SCUA 3INNA 5BRAA 2WRZA 2BZ1A 1EFAA 3M4XA 2FKNA 3N9IA 1CUWA 1ZVQA 2L2QA 3DL0A 3VNUA 4GAEA 2H54A 2C7GA 1XU4A 3R6DA 4OUDA 3IQWA 4QFCA 3TR5A 1VLHA 1WCYA 2ZR8A 3P2KA 3WXBA 4EMUA 5BWOA 5DNCA 1E98A 1OZ0A 3ETLA 4U9HS 4F0JA 2RBGA 4YAFA 5L45A 1FFBA 1XROA 4FFOA 1KEKA 2EFJA 4Z99A 1IQ0A 2QTHA 3PQFA 4L7QA 4R1SA 4N6NA 3G82C 3TINA 1VKHA 1XQ6A 5TLSA 1E2KA 4X24A 3QI7A 1U6KA 4CIAA 2NPFA 1CUAA 1KI8A 1FRQA 1ZXXA 1F2TA 3HBJA 2DPHA 3K1ZA 1JMKC 3NBFA 3RRNA 1E6MA 1P8JA 3ELDA 1DKNA 3PJFA 5A03A 3L4BA 1QVZA 1R6TA 2YWHA 3GHYA 1ZGGA 3RSHA 4KK4A 4B33A 1TGVA 4KDFA 3FPKA 3MRTA 3Q0EA 5KYXB 1N8NA 2B1RA 4NICA 1XPUA 1NBMD 1D0VA 2VBFA 3TDMA 3NHYA 3K0CC 2XD4A 3C39A 4MS4A 1ZS9A 1FRVA 4BE4A 1ZLYA 2W90A 5D3MA 2ZB8A 2YXBA 1Z6TA 1L7MA 3ANMA 3OKCA 5ALIA 5DYYA 1MX1A 4IUCS 1VXOA 2NSJA 2OXIA 4ND2A 1XG5A 4KIUA 4BCBA 3EQ6A 4GMXA 3LCMA 3OTWA 2LTAA 4M6WA 3K5HA 3M6LA 4JC5A 4ISBA 4WOBA 4ZCQA 1YQXA 4DLWA 3E23A 3DMDA 5FFMA 4ZDJA 2OKGA 4CKZA 3WWEA 1QUFA 4YMVA 3P9YA 4GNRA 4HBGA 4XCQA 2FP4B 1XELA 9MHTA 1GTZA 3UK0A 2PGJA 1WPRA 1P4JA 3H2JA 3R23A 1NP7A 4NJEA 5FWDA 2R97A 3C1AA 5JNTA 3BJZA 5J2TB 2DPGA 4F5EA 1PT8A 5DCLA 1YR7A 3MLAA 4MROA 2NM0A 1C3EA 1E9SA 2GZRA 1K92A 2HMVA 3NHAA 4LV8B 4DDUA 2O3QA 2J3MA 3KSUA 3TBFA 4YXWD 3N6XA 1VJTA 3KT6A 5FL7A 2JJMA 2RGXA 3VZBA 3TVDA 4L4RA 4ZTBA 3BCUA 3RIMA 3RYTC 5F9MA 2DHDA 2BFOA 3NC1C 3QKTA 4LVUA 1GG9A 4N3GA 2IV3A 3U56A 2I7CA 2GHIA 3QGMA 5F73A 2DY1A 2KHZA 1RMQA 2X7HA 4TRNA 2GO7A 1ISSA 1XLUA 3FDXA 3KXDA 4GPBA 1D2CA 4YECA 1Z8FA 3EMVA 1UOEA 3HLKA 4UM5A 2GUGA 3WXMA 1WB5A 2GAOA 1YDFA 4R2IA 1TKCA 3R7DA 4DCSA 1SNYA 2Z1NA 2AOTB 3LC0A 3PD1A 4KQEA 4OH1A 4B3DA 5DGXA 2QBYA 2BI8A 5G53C 1N9KA 2IOQA 5AVXA 1NVXQ 1X1DA 2BGTA 3HCFA 1E6CA 3HFSA 4EYGA 4BP3A 1LXCA 1C29B 4F92B 2BM8A 2D2EA 2HIMA 2EF1A 3D1JA 5JY1A 4OKSA 5ALWA 4DUZB 1YVPA 3MD0A 3K70B 1Z5ZA 1O96B 4GZ6A 3VYWA 3P5SA 3V3KA 5ES4B 1NYLA 3QX9A 4ZO6A 3F8SA 4LCEA 4WNCA 3WLMA 3HS3A 4IDEA 4A6PA 1J8DA 4PSDA 5JS8A 1R16A 1CDZA 4YAWA 4DYDA 3BIOA 3M82A 2GKGA 2FW8A 4X6XA 3L0IB 5BSTA 2WYHA 5C1IA 2EP5A 2ZB3A 5GAJA 1XEWX 3AUXA 5IM5A 3QWFA 3PNMA 1V5WA 5G4LA 4MS1B 2X41A 1PX0A 1AU9A 1N7IA 2H06A 2YCBA 3AW9A 3WIBA 1P7ZA 1LNSA 2O2HA 3FWZA 4Z2YA 3BB3A 1NNEA 2O1XA 5CXXA 1G5PA 1QCZA 2FVXA 2QMHA 2VJPA 3IT0A 2P27A 5ANRB 4ND6A 5FTKA 1UFRA 5GZ6A 1XLWA 2RHRA 1TM3E 2XYVA 4FHFA 4B2YA 5BPFA 1EXDA 2PZAA 4D96A 1PR4A 5T3UA 3Q7EA 2HU8A 2X5XA 1O7JA 1M67A 1S0UA 1XAJA 3JQGB 4O4HF 4OIMA 4PV7A 4C7MA 3D5EA 4QU8A 3GDWA 3EZFA 3R7LA 5IYZB 3VBCA 3HJRA 1PDWA 1V96A 2HSDA 3MPUA 4XQ0A 3KL4A 1VL5A 1RHRA 4XUCA 1HQKA 4KR3A 1JQEA 1UF9A 1A71A 4N40A 4BQFA 3JZFA 2A0FA 2X42A 1KI1A 4R16A 1Z9BA 2H1LA 2YYYA 2CXPA 2MSWA 2HQOA 4LDNA 4NFHA 1X1TA 4RHEA 2XWBF 2XW6A 5TMEA 3GO4A 5G1OA 1PT7A 3DMHA 2CLSA 5JWOA 4U00A 2XNCA 3DWEX 3N6VA 5A4KA 5CITA 3CINA 3ORYA 4OI1A 1P2TA 3KP1A 2J3DA 3KLBA 3EXEA 3GJTA 5D5HA 3ESDA 3SQLA 5HCUA 1IZYA 4C0LA 3FMGA 3J80A 1QRSA 1YI1A 3E5HA 4RHYA 5G2OA 2JJYA 3IO5A 4H7IA 3F78A 1P0IA 1PS0A 3R3HA 4FFSA 1Z4OA 3GLFA 2WVAA 4LJ5A 5LA6B 1CUUA 1MRSA 4LX8A 3LGXA 4IGFA 1PLLA 4JX8A 1Y9AA 3LUBA 4MB2A 4IV8A 4A82A 2XE4A 5CA1A 2QLBA 1IZZA 3AFMA 4JJFA 4R2HA 3TTXA 3T5PA 2WC1A 1Z0JA 2VPIA 1PZHA 3JRWA 2OAP1 1VHQA 1FFCA 3UUEA 3WLPA 2BZSA 2GI4A 1WBDA 3L1VA 1K88A 1DV1A 5AI8A 3BB4A 3L6DA 2G82A 3WIDA 2X5KO 2XT0A 3V6MA 1WZ2A 1Z6AA 2ZAGA 3HEAA 3UICA 4UM9B 1XF9A 1MAVA 3B85A 3FMIA 3PVCA 1U1CA 4LCJA 4DQKA 4WBNB 1TYZA 1MZPA 2R4UA 3I73A 5EIBD 1M7BA 2SCUA 2VDRB 5ALTA 4ALJA 4KWIA 2QL7A 1T2CA 1KO4A 1TMYA 3B3JA 3SCZA 5JDCA 5CDFE 5JZVA 4Q7QA 4YONB 2YZ7A 4I6EA 1H66A 4NX2A 5EVJA 3GVPA 1OC2A 2P1DA 2DFPA 4PN7A 1UAYA 3OO0A 1L7EA 4KMMA 1XDSA 1WPGA 4RKRA 5CGQB 5I9SA 1ZMXA 1M3SA 2G07A 1R0ZA 5AHXA 1DIHA 3KKKA 1ORIA 1RWKA 2HPHA 1FE8A 1CBUA 1LVHA 1JEEA 3ADPA 3HCPA 2R1TB 4JJ4A 1WSAA 3EBLA 5DSTA 1YDMA 1CV2A 1JDNA 2JFVA 1V8PA 1XTSA 2VAXA 3FKQA 4U3JB 2BCJQ 1IY2A 1A9SA 2Y66A 3D4PA 3DM5A 4GRDA 4NPCA 2AFHB 3EOAI 4DV0B 1Z16A 3BIJA 3FKSA 3OTQA 2JVJA 3KO8A 4UKDA 3K0HA 5DBGA 1DOAA 2IGBA 2E2WA 2QLMA 4N8EA 1CQJA 4PFKA 1OMOA 3TQOA 3B6MA 3EAQA 4ZHSA 2XCTB 3VR4H 2AV6A 2ROQA 5F7ZA 4Q5IA 1WLSA 3DFUA 3ROGA 3UB2A 4B3CA 4DCGA 3L4KA 3K16A 3VMMA 4YUWA 3A25A 4UTOA 3UOWA 4BL5A 2B8WA 4HH3C 1XAIA 2BKUA 3ASYA 1WCXA 3P1JA 3T95A 2FQXA 3DGEC 3PNBA 4XIIA 1K8RA 1WEHA 3FFXA 4FDUA 3RLFA 2XITA 3AIMA 1AHIA 4C5CA 4MITA 3LT1A 3O91A 3C3MA 3PNQA 4U6QA 3K9BA 1Y3HA 3H0KA 2I5PO 4Q3KA 3TRJA 5CT6A 3MSXA 4IHQA 5CVCA 4MYCA 1ZM9A 4X62B 1STOA 3ZH2A 3H1AA 4F06A 3L8YA 4AXXA 3CONA 2CFRA 2ATEA 1UMBA 1KGSA 3LGSA 1EWYA 4DFDA 2XYPA 3L01A 2GN0A 4NL4H 4D81A 1USGA 1KFEB 1QO7A 2HSJA 4HO1X 3TW8B 3OQMA 1T9CA 1V25A 3KZKA 3OKFA 3T9CA 4TTQA 4NI5A 3SJAA 1NR1A 1H3FA 4RH0A 1T25A 4KTTE 1E1RA 1MVOA 2FY8A 2MU1A 3ONEA 3WGOA 1K75A 3MUOA 1K06A 4XQEA 4BGEA 4IDHA 1G38A 4HXFB 3KSZO 2M6LA 1YBAA 1YZKA 3DFKA 4LSZA 2PLNA 3HU1A 4XUGB 1SXJA 1IFXA 3REFA 2CDNA 5JCPA 5KNCA 4HAXA 4MV0A 1E2GA 1WUHS 3A1EA 4M87A 4QXAA 3WHLA 3WLHA 1GP2A 3OWHA 2ZJ8A 3E0XA 4PS1A 5HQTA 3R2JA 3QA3E 2B78A 1SXHA 1QV6A 2EJUA 2WZDA 4RBNA 3T41A 1JJFA 1XEWY 1GU1A 2NU9A 3PGVA 1WUJS 1HZJA 3BXXA 4R1LA 5SICE 3WMRA 4CGZA 3P97A 3ZK9A 5GV7A 4KPFC 1WHTB 2ZBRA 1Y4UA 1KQ3A 1P6UA 2YASA 1JP7A 1YNSA 3AIOA 3H7IA 4HBZA 4OGKA 1AKQA 4RD2A 1TIKA 1RPJA 2VF8A 4BGUA 4IGKA 3ZOKA 5HF6A 2IF0A 2ZSDA 4QRDA 2PE5A 5K05A 4EGQA 5FOTA 1DTEA 1QRRA 2HCFA 1EK2A 5CHYA 5JUWA 3QEJA 4UVDA 2GPAA 4FFLA 5EWJB 5F76A 4G4SP 1I4WA 2ZDGA 3M1LA 3N2IA 4CN9A 2NP6A 1S3FA 3LPNA 4WFKA 3S7TA 1TXGA 1I6MA 1P19A 1BS2A 4MVJA 3RYFB 4ALIA 5A5FA 2ECQA 3W4IA 5DBEX 3THXA 2Z8ZA 1SBTA 2XODA 4KGXA 3CN7A 3M7IA 3N7TA 2HJRA 4OGWA 4GI2A 1D2RA 1Y1RA 4XWTA 3T9FA 3TG8A 3KHUA 8OHMA 3VKFA 2WIFA 4HYQA 5FPTA 3C15C 4FXPA 2HOQA 4W1SA 2IEAA 3IQFA 4ZAWA 1DJQA 3ZE9A 4HDOB 4AJPA 1CT9A 1K63A 1PE0A 1UZNA 2OCGA 3AOGA 4D8WA 2Z8YM 4IIJF 4R01A 2XYHA 2C9DA 2DE0X 3PDHA 3IAXA 4C03A 4LJ4A 4YAUA 3W6ZA 1FRZA 1G8MA 3ZWOA 1HDYA 1W19A 4HDMB 4MMZB 3HH8A 4AK9A 3GQBB 2ZTLA 3AR3A 5I7EA 1OBFO 4KQWA 2CHVA 3U9SA 1KKMA 1ZC3A 5JTTA 1EHCA 5DHUA 3B1VA 1BX0A 1RKUA 3GZ4A 2EU8A 1QPZA 1RJDA 2I99A 3ISJA 1DCTA 1ZPDA 3A3YA 4UBIA 1OXKB 4ZMBA 1SXQA 2H6EA 4WXMA 4GLOA 4HF7A 2JIDA 3BHNA 3HCEA 1RAEA 1KY2A 2PZKA 3JQ9A 3QVSA 3RAGA 4F3YA 2GEDA 1AKWA 4ON9A 2I87A 2HX1A 3ICWA 4AJLA 3IPRA 1BW9B 5DBHX 1RKQA 3PD0A 5AKJA 4LF9B 4OMDA 4RJKA 2OT3B 3ABRB 4ZRMA 4Z0HO 4KAAA 4BPBA 1U8YA 1YVRA 1X3LA 3BERA 3LPMA 3H6GA 2R6DA 3UCEA 1DRKA 4E7OA 4PBRA 2B4TO 2Y05A 3S2SA 3CNLA 1ZIYA 3Q3IA 3NHKA 2EIXA 3ZKAA 1FVHA 1EJ2A 1SHTX 1CR6A 4HEA6 5CM2Z 1I1OA 1M74A 5JJKA 1A9PA 1USIA 3AZOA 3KEOA 4GNKA 3LHFA 3WLQA 4F93B 3TO5A 3A3NA 1XCLA 2XGGA 2Z2XA 3IE0A 3RF7A 2P6NA 4DGQA 1JSCA 1E32A 4E5KA 3CVJA 3OPQA 5D3KA 1TO2E 2XJ4A 5BQ3A 1JQ3A 1QF6A 1RBYA 4XOIA 2AC4A 1QO0D 1XDGA 4PC2A 4NJOA 3P9SA 5LBUA 3UHJA 4B6OA 1HH4A 1WW2A 2WTNA 4WLEA 1RPNA 1BHSA 2RGNC 4J16A 2NVUB 1Y5MA 1LQUA 2OFOA 3EGWA 3K73O 3AUYA 5ICFA 3TIVA 1I4OA 3PHLA 5CAEB 3NT4A 4A8TA 2IYRA 4LW8A 1XYGA 1FFDA 4EP1A 1YFLA 3CLUC 1N7GA 2CVPA 1SUIA 1E4EA 5JEDA 2H1RA 1SXPA 2EVWX 3C16C 3ZGVA 2F1OA 2IYPA 3TLGB 4AKIA 1GPKA 4IAOA 4LZJA 3KX2A 1NXTA 4XRGA 2IZOA 3HDQA 1CX9B 1K27A 1LF5A 2CW5A 2G80A 1G2QA 3FE2A 1AGXA 3FPCA 3IGFA 3KPYA 4LC0A 2HDHA 5IVHA 1T5TA 4TUYB 3PSHA 2FETA 4OQFA 4PVCA 5DTEA 1KHHA 2H17A 2K7ZA 4RIGA 8ATCA 2PBLA 4REMA 3VYSB 1NN5A 2WUWE 3SWWA 4ER7A 4DR7B 1E7QA 1HSZA 2C5GA 2YVAA 3MEQA 3IV7A 1VCMA 3OKAA 1B2LA 1I0IA 3TSWA 3Q72A 4OHMA 4G2NA 1RADA 3ZQ6A 2GGSA 5JW6A 3TLCA 2WJVA 5FKJA 3OFSA 4NDNE 4JSRA 3X44A 4MJ7A 4ZZ3A 4RZUA 2IYNA 3M5WA 4CV1A 2LPMA 4AM8A 3CO5A 3RTAA 3H2KA 4EOGA 4U7TB 2AG0A 2JGLA 1N5JA 2DKOA 2HHLA 4U2FA 2PIDA 1TCCA 1IM8A 3H83A 4X90A 4F3TA 3JQDA 4C0XA 3PT5A 3BGDA 2Z3VA 5B1SA 1T35A 2BGRA 1SFRA 3GJ3A 3EQ2A 4D9EA 2FPKA 1FLAA 3FAZA 3GP3A 4K9NA 1TKRA 3MTIA 3AFHA 2YQ4A 221PA 2WK1A 3RNOA 2QJWA 3YASA 3QWHA 1EGVB 3OLVA 4NECA 3MTAA 1GTMA 3D8TA 4UAJA 4BVBA 2QW1A 2BM0A 4M83A 1W4BA 4J0GA 3AF4A 3ZZUA 3UPTA 5IJ9B 4UC0A 3IPYA 1S2GA 1OAKA 1OXXK 1RT9A 4AY4A 1K5PA 1GWNA 3WQHA 2H07A 4HEA1 5B5SA 5J4KA 1MGOA 1VE5A 2PH1A 3EG9B 2EG5A 3PEFA 3DP9A 1OLOA 1UKZA 3NYQA 4O4JB 5AHOA 2PS9A 3TEFA 3WGYA 2WEKA 5A5DA 4UTXA 4ZICA 3DBIA 1P7CA 4PAQA 5JD6A 1WKVA 1HDGO 2D3TA 1T5IA 2BLLA 2NZXA 4LF5B 2VDOB 2QK4A 3M1AA 2WYOA 3N8HA 3BDIA 2JAXA 3P7MA 4ASUD 1XCPA 2VBGA 4OY3A 5L8VA 1C80A 1V35A 4LY9A 1RYBA 1Z34A 3SHVA 4DF3A 3OT1A 1PR2A 3USES 3TQRA 2ADMA 3FDFA 2J6CA 2WTAA 4HS4A 1ONBA 5TQ2B 2SBTA 5B30A 2Q3MA 2NIPA 1M2GA 1OT3A 1S9DA 2OSBA 2W2LA 4H6XA 1IY0A 3IP8A 1FTQA 1MQ8B 2HM7A 3TTWA 4ZEWA 4KWHA 1J7JA 3ZXSA 1AVTA 1YJQA 1ZHFA 1MB4A 2O2CA 4HP8A 4N39A 4RPGA 1YZUA 1KYYA 3VGPA 4S1WA 2AB0A 4WZBB 3VSDA 3I53A 5EKXA 3VYTB 5H8WA 2YV1A 2PEZA 1BVUA 3GFTA 2DLDA 4C2TA 2CUTA 1DBQA 3OF5A 3VJLA 2AFIB 4TV8F 1KYIA 2H7YA 1KDVA 1JLMA 2O0MA 4HRXA 4AUKA 2YYSA 4HTFB 4ZOLB 4BNDA 2H4ZA 4DRZA 2XTMA 4W7SA 3HXLA 4L5IA 3CURA 4QVIA 5ED0A 1DO2A 4KSCA 4X97A 1T8SA 3UCXA 1C4XA 1V37A 3G2NA 3LYUA 4LV5B 4TMVA 3U1TA 2EW8A 3FGZA 1WS6A 1JAHA 1KJNA 4E07A 1GAWA 1EBBA 1WHSB 2QWXA 3I6BA 5C7OO 4A0FA 1U1GA 2QYOA 1ZOSA 2LKCA 1VSTA 4W9NC 4X7MA 2B25A 3LS2A 4K6KA 4PQGA 1XPRA 2X77A 2OV2A 3P2OA 3KQHA 5LU8A 2QR5A 5DNEA 1KE1A 2XTZA 1GGHA 3NV9A 2WOJA 1D4OA 4DILA 1UC4B 2WFAA 1V7ZA 4NZNA 4FGZA 2V4UA 1E1LA 1Y4ZA 1DEAA 1IG3A 2GAFA 4H6WA 1Y8QA 1U11A 4L6CA 4Z9AA 1AKTA 3V3TA 1Y5LA 4J3JA 5B3KA 2VQ6A 3BRSA 3FRIA 4TROA 1LTHR 4NZOA 3HSYA 1V8OA 1TYBE 4UARA 4DIEA 3JYPA 5LZ5A 1FTSA 2WM8A 3H11B 2NU7A 1THZA 3GOHA 1UK9A 3O2JA 5AW2A 4RZXA 3AU9A 3RT1A 3SDZA 3UXHA 1N1EA 4E5SA 3MGBA 3OOSA 4XWAA 1FP4B 1D1TA 3B1ZA 4F4JA 2IUTA 2J85A 3AH8A 3MMSA 3QI2A 4IDCA 2YH2A 3RRFA 2UZ3A 1EFPA 1U28A 1YA6A 3LK7A 4PFSA 5AI9A 3A06A 3I83A 3NBUA 4RF3A 2X5OA 1YCGA 1YK0A 2XB9A 3UF0A 3WFZA 3HYSA 4ZV9A 2IZ6A 3TE6A 3FNQA 1QO9A 1AMNA 4IV5A 3THSA 2YL2A 4GD3Q 1RWOA 1C1DB 3TEMA 3I9KA 4QYWA 1WP9A 3A9CA 3ZS9A 2WYWA 3OPXA 4CM4A 2F17A 2O2JA 3PYXA 5HP4A 4BFLA 5LOVB 4E5MA 1FXWA 4OV6B 3HXQA 3I0ZA 3KKPA 3VC1A 2VDKB 2G1UA 2A6PA 5HDBB 2OCIA 2Q3FA 1ZFNA 1VZ2A 3NHMA 4B6PA 3UC9A 1RIIA 2D5BA 1XZHA 1ZCBA 3NX4A 1KEVA 4B47A 1T0PA 2JW5A 3O8DA 1RYHA 2A1TR 2UZ1A 4MPPA 4OU5A 2ZTHA 3CUSA 4TT8A 2F7SA 2BMJA 3VJMA 1AQJA 1IN5A 2AEFA 4KH1A 4W5RA 1OA1A 4L9SA 1J5XA 1C0EA 1H1DA 3A4TA 3IUBA 4NABA 5J2TF 4QYSA 1NY5A 2YFHA 3IKTA 2QTAA 5GQSA 5HOQA 1VSVA 3KPJA 3MJ4A 5SZJA 4P5EA 3U6KA 3I37X 4YPVA 1W30A 1QYCA 1J5PA 2J3KA 2JCSA 5B12A 2QN2A 4UDXX 3TD9A 1GSIA 1R9GA 2R68A 4XM2A 1Y9EA 2WPNA 4QXMA 4DCTA 1C2TA 3ZU4A 4J29A 1O0CA 2CMHA 4LPSA 4FR5A 4RO0A 2RI1A 5CPBA 1C4KA 3BHMA 5DM0A 4ZAZA 3SMVA 3V46A 2E37A 2H3HA 1WB6A 1Z88A 2OP0A 3KKMA 3M0EA 4R1TA 1S8NA 5TY0A 5JU6A 2BMWA 1ESCA 2ZCUA 3L9XA 1Q50A 1RCUA 2FUNB 3PI6A 5CD9A 2C1XA 3OF3A 2CV0A 1S3GA 3RJTA 4MTCA 2XAAA 4QPNA 3WNCA 1IY1A 1UOPA 2VA8A 1S8AA 2OR3A 2XUOA 3EAFA 4CM7A 4BZPA 4NK5A 3HLTA 3PA8A 1E3WA 1CY1A 2MR6A 1X7XA 2AS0A 4QLAA 5GTDA 1CEQA 4IUDS 1LPAB 4P7JA 1BQ4A 2CD7A 2WHPA 2I8AA 1CHNA 2DG2A 3KXIA 3N8KA 4TKLA 3VC7A 5I3CA 1VB5A 1C1YA 1ZM4A 1CEYA 1R66A 1TIBA 1V6AA 2JH3A 3H6KA 4I9GA 4R8RA 4V0NA 2XZOA 1E5VA 4AG6A 5I9MA 2YXLA 1JIUA 1YWGO 5AUOB 4JYAB 1HTWA 1QFMA 2RARA 1P1IA 1B15A 2X2OA 2LRHA 3DDCA 1M1ZA 5FLYA 4MPTA 1EA5A 1GPAA 1TVKB 1V2GA 2EEZA 3AK4A 3K9HA 4FYIA 5EHNA 5FA5A 1UJ5A 2UZ4A 4G5GA 2QD3A 4R6WA 1L9XA 1Y8RB 1PFGA 2VF7A 1JEDA 1M5RA 2G9RA 2YWXA 1NBIA 3CSDA 3X1ZA 1X6VA 2EFCB 1GUZA 3KSRA 4YXFA 5F1PA 5K3AA 1CS0A 1JSZA 4A0RA 4AX8A 5LWHA 2P6MA 2ZUDA 2ZVPX 3WYDA 5KHLB 4CEHA 3RNLA 3M6IA 3V5NA 1ZD5A 2B3TA 1JEOA 2IYVA 3ZE8A 1JVBA 4S1PA 4D0LB 3U3ZA 2FAXA 3JQFA 3T4XA 3WNVA 1SKBA 3Q1LA 4WT7A 5IXJA 1K7SN 2CKMA 3AM1A 2C5LA 1F1BA 3CVXA 3OU7A 2QPOA 4FHZA 1CUYA 2H16A 2XA1A 2ZQYA 3DC7A 4QO8A 1HQDA 2IODA 4KKXB 5FQNA 2JGNA 3SHOA 4FLFA 1ONOA 3AVPA 4RH1A 1NFRA 4B3MB 2NQTA 1WVGA 2IPOA 2VQSA 7AT1A 1OT5A 5BSHA 4WLUA 5CDFA 5BUSA 3NHPA 5E9QA 5IYZF 4C4XA 4RVNA 1O08A 4KBGA 2HY7A 3DBLA 4PX5A 5HPYB 1II0A 3SX0A 1DKMA 1TECE 5FI1B 3A05A 3OPMA 5TPZA 3SC6A 1GNRA 2IL1A 1QZUA 1ADFA 2IYAA 3NT2A 3CNNA 1E9VA 1R0RE 1U3UA 3LOPA 3BILA 2I2DA 2R8XA 3JQAA 2AJLI 3S8EA 3IAHA 2AUNA 3LF2A 4KTVE 5EE1A 5GGYA 5FUVA 3WGUA 4D46A 3OC0A 3MMXA 4EITA 1SQSA 3LY5A 5JBNA 2OD7A 4YUXA 1CDEA 3EXG2 3QF4A 1OTYA 2WU4A 3L0CA 5L3QA 2Y27A 2P9EA 3CN9A 3EYWA 3HCWA 4BO6A 3FDZB 3Q3CA 3DOUA 2NAFA 1NGSA 1MOQA 3RWMB 2E87A 3WJAA 4M1KA 4BC1A 1MUUA 1BTOA 4L0MA 3W06A 3JQCA 2GD0A 5ARDA 3DOHA 4F4UA 5LMNB 4BXOB 3F9CA 3T6KA 3QVTA 1HTBA 3O7MA 2O48X 3N0WA 4K40A 5LA6F 1B8PA 4X84A 5C7LO 2HN9A 5FULA 4O1HA 3FCUB 4W6QA 3QUSA 2V7WA 3PPXA 3N6RA 5B58C 3VPAA 2HXSA 2VPWA 2QT1A 4WOPA 1SEVA 2W2VA 3HJTA 5D51S 5G4KB 2OCBA 5DHAA 3STTA 5ED4A 2EYUA 4BKUA 4PTYA 5LMZA 2HBRA 4C2UA 3FZEA 2AG5A 4G9EA 5LP6A 2XRMA 4KUGA 1GYRA 1NY6A 2J9XB 2CNWD 1QX4A 3AB7A 5DN6A 3KT8A 2P2ZA 3X1JA 4ZQEA 2Z8XA 3HR7A 1D0SA 3A10A 5E8JA 4WBNF 1X1AA 3R8CA 5HSGA 5IWAB 2BD0A 5U1PA 2WAYA 2BL4A 4IWYA 1F2VA 4G2TA 3IE1A 2ZRDA 1WR8A 3RC1A 4AJ1A 1T0IA 4KE7A 3CXRA 1LK5A 4DMFA 4KQ2A 3K6SA 2BBSA 2FUG1 1O58A 4DV2B 3QX8A 3Q88A 4I6GA 1NN3A 1G0NA 2QLJA 2WHQA 3KOZA 3NKVA 4R8MA 3RIYA 3ZY3A 4BNFA 2JHCA 1R74A 2IHYA 4M7PA 3C45A 1W0JA 2JJQA 3VPFA 2CFOA 2Q1WA 2XGMA 1SA0B 1JR2A 4QVGA 4B82A 3PU6A 4TVKA 4ZVKA 3ADDA 5HEKA 2JGAA 3NOVA 4NZ9A 3P4UA 4OUKX 3ZI0A 1L3CA 3AI7A 4A8JC 1T4MA 1EWRA 2HCRA 4IMIB 5ILQA 3UJ6A 4CI9A 3E8MA 4K6FA 4F38A 1I9CA 3Q8XB 4O2AA 3JQ6A 5CYFA 2ZOSA 4FFBB 4LS3A 2VWQA 5A0FA 4DUPA 1RI2A 1USUA 1R6XA 3I5AA 5BV8A 4F2WA 3EZLA 4MKZA 1L7BA 1TMKA 2IYUA 1Q22A 2J5QA 4E09A 1UBRS 2P8JA 1Z4PX 1KZYC 4HMPA 2VOEA 1UXGA 2DUMA 1YCHA 4ZXPA 4AKSA 5JXHA 3HJBA 2QI9C 2CWDA 2GYYA 1D1SA 2YVUA 1P0FA 1U8XX 1NVVQ 1J1IA 1Z2AA 3GA5A 3I32A 2H4XA 3NCHA 4KV7A 4ND8A 5CDTA 2ZB7A 1EGQA 3PJGA 5A1TA 3DBVO 3ZCRA 2IIVA 1CIPA 1BNCA 1OFVA 1SVKA 1O5TA 1OLXA 1ULHA 1XOIA 2NYVA 5KQSA 3LRXA 1XRNA 1JH8A 3HKEA 3IT3A 4DJAA 3HKCA 3V1LA 3QLEA 4G65A 3GJ4A 1KI4A 4FUQA 1UM8A 4Y1EA 2VPPA 1FP2A 2F90A 3VDRA 1NZFA 3AI2A 2UU9B 1DOHA 4MVYA 3SYLA 3TLZA 5MGNA 4KXLA 2W6PA 4HEQA 1SHKA 2VXBA 4R9RA 1M2FA 4M38A 1H23A 1IVNA 1P0MA 2DFNA 2EZUA 5DNVA 1OJ7A 1Z3IX 3IH5A 4B80A 1NBWB 3RVRA 4DJ5X 5LJLA 1AG9A 1ZUNA 4BFCA 2OGUA 4L5YA 3OU6A 3U17A 1QAMA 1T5SA 3A6PC 1J1UA 3CTPA 1VHWA 2HF7A 1N92A 3DHYA 4AUEA 3CX7A 2BKLA 5I3ZA 5JS6A 3ZDQA 3AY7A 2IE0A 3R7NA 3ZY6A 1DX6A 3LP6A 4DMRA 2V3WA 4OX9B 3ZGZA 1Z3CA 1DG3A 3MT7A 2DQYA 4HDQB 3U7QA 1P39A 1XUOA 2DUNA 3WE7A 1T4GA 3HSSA 3ZDAA 1M2NA 2CGEA 3JASB 4G0OA 3X1WA 2ZUEA 1XQYA 4KVFA 4O2LA 4RK6A 1XTZA 3H2YA 3LKBA 3ZGLA 1JHDA 2GM4A 5CX4A 4EPVA 1P7WA 5A0TA 1SIWA 4NFSA 2EJTA 5KSYA 1X1BA 1YJBA 2BEWA 3FW1A 2Z4RA 1RLOA 1ZR2A 1GVHA 1PGNA 2A5LA 1V9CA 2W48A 3BA1A 3HVJA 2BEVA 4K6OA 5ECYA 1UP6A 2HK6A 2NXWA 2COUA 3SC2B 2KBFA 3E22A 1M8PA 3OPYA 1W9HA 4Q6BA 1JEYB 1GPDG 1NOKA 3GUUA 3QVMA 5C8DA 3DMTC 3VZQA 1W88A 1B8OA 5C1PA 1DUSA 5KIAA 3QQPA 2XNDD 3USZA 3N0TA 1M66A 1NLFA 1JLSA 1RWNA 3SIPA 2XIJA 1EFLA 2XT6A 2IYFA 3M81A 3N2KA 4JI5B 4EG8A 3JXEA 5K0LA 4U1RA 4YASA 1UXHA 4KYVA 3A1FA 2JFYA 1K8QA 1AZWA 3IQEA 4WJKB 5A3JA 2G06A 3MA0A 1XI2A 3CZ4A 1YC5A 4MW0A 1J42A 5ER9A 1IN7A 3WJ7A 4LI0A 1DV2A 4YJFB 1EA7A 4CQLB 2FZCA 3L9WA 4JC4A 3SE0A 4P4SB 5H70A 3GARA 4BVGA 4ZEVA 4BWFB 1P1RA 4IZIA 1LI7A 3VR5H 2LKDA 1U0HC 2ZBPA 1SKMA 2CSXA 1E6KA 3FUVA 3F97A 3IOEA 3KJIA 1NVMB 1KZ7B 1GEEA 2JGJA 2BHTA 1QE3A 3FYCA 5CFMA 3L79A 3ZHTA 4CCYB 2FSPA 1C30A 3DO8A 2FWPA 3AINA 2AJBA 4M8SA 3V1KA 1T36A 2R00C 1PR6A 5IJ0A 2LR0A 2QRVB 5CFNA 4KR7A 2V4MA 3WGMA 1AK2A 2TSYB 4WVLA 2J8ZA 1XKXA 1GZSA 2NNWB 2QRJA 4Q48A 2Q5OA 5BWBA 3LV8A 3BH7A 4R9UC 2XMBA 3VR4D 1Z4NA 4IP0A 3VHLB 5DV9A 4B4KA 1ZOPA 3VV3A 1TTTA 4NCNA 2G6TA 5AJWA 5BN4B 2Q7OE 4I8DA 1C1XA 4CF4A 2PBFA 4JUAA 3P94A 4JU8A 1HZZC 3JY6A 1JPJA 2EKPA 1V4BA 2REBA 2HZBA 3PYLA 1T8YA 1C9KA 1HPLA 3JD3A 5EJ5A 4ZI7B 3RBVA 5CLHA 1UL1X 1Z36A 1N4AA 1A5SB 3W6PA 1HDIA 1N1DA 1K5GA 2LDXA 4EPRA 4MAMA 3UWMA 4RSGA 1EI9A 3STHA 1NBHA 3Q87B 4X66B 3G2OA 4YT4A 4KMSA 1F5NA 4WZAB 2QTRA 2DBQA