4RZHA

Crystal structure of fabg from synechocystis sp. pcc 6803
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
234
Chain Sequence
b'ALTAQVALVTGASRGIGKATALALAATGMKVVVNYAQSSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQKSGRIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIAPILQFIPLARYGQPEEVAGTIRFLATDPAAAYITGQTFNVDGGMVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Structure-directed construction of a high-performance version of the enzyme FabG from the photosynthetic microorganism Synechocystis sp. PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Oxidoreductase
total genus 84
structure length 234
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rzhA00
3IDSA 3VVBA 1FK8A 1HE4A 3NEPX 2HK7A 4OXKA 2Q2WA 2BGLA 4Q9NA 5HS6A 3ENNA 3ASVA 2GUGA 3DWFA 3LVFO 1NWCA 5JCJA 4E32A 1EQ2A 2OOSA 3NV9A 2HUNA 2P5YA 1HEUA 4TZKA 2W4QA 3SXPA 1ZO8A 3VH4A 3GVXA 1K6JA 4J90A 4FFLA 1GUFA 2VHWA 3QVOA 4YJDA 3O8QB 3TZCA 3U62A 3WBBA 1EVZA 3NKLA 5JMWA 4WKGA 1Y6JA 1PS9A 4JQCA 1GL3A 1EDZA 1XKQA 4PLZA 1I32A 2W2LD 4NBTA 4I9NA 3VDQA 1LC3A 2DQ4A 3W8EA 2O3TA 2O3SA 3TRIA 2VOJA 4J4TA 4YRDA 1E7SA 2Y0CA 1DRVA 1ZKMA 2X5OA 5IZCA 3CINA 3FPLA 3TPCA 4D41A 2G82A 3AFMA 1TXGA 3OP4A 1E7RA 4IZHA 1EE2A 1T2AA 4ZQHA 1R0KA 1V0JA 3P19A 1E1KA 4MVJH 3V1TC 4CMJA 2POQX 2VQ3A 4GL4A 1FMCA 1N1GA 4R41A 4WOJA 2PGDA 4E6PA 4NU6A 2Q46A 2X7HA 8LDHA 5ER9A 3EGOA 4AG3A 2WD7A 1H0KA 3I52A 5ILGA 5GY7A 1N9GB 2FSVA 2Q1WA 2VRCA 3PFWO 3QWAA 4J43A 1XR3A 2VTDA 4CV2A 1RM3A 1PR3A 3HSKA 1V9LA 4YRAA 3GK3A 5T67A 3JQDA 1ZK2A 3PIIA 3QE3A 5F1PA 4GKVA 3KHUA 1ZVMA 4BKQA 3LDHA 3I9NA 4L75A 2WWRA 1ZJZA 3RU7A 4CLRA 1LQTA 3R6DA 4G65A 1PR9A 2YZ7A 3QWBA 3KEQA 1Y9EA 2EG9A 1QYWA 2I3AA 2VUSA 3INRA 3UICA 1KVUA 4HFRA 1IUKA 5DP1A 1Q1NA 4N7RA 4NNJA 2AG8A 3TOZA 3NTOA 5JS6A 2ZCVA 2OORA 2NADA 2PNFA 3DBRB 4AJ1A 2GSDA 1YBVA 4YRBA 2D2IA 3VOSA 1H5QA 4BIIA 5IN5A 1DC6A 3ZWWA 2EP5A 5DF1A 3QY9A 5CDGA 3S2EA 4WNIA 3RCBA 3B20A 3AOGA 3GMSA 4RGBA 3X2EA 1DLIA 1WZIA 1DIHA 1DRWA 4LISA 1B0AA 4NBWA 1GU7A 1SEPA 1R16A 3UW3A 2Y1DA 3V2UA 5JXWA 1B3RA 3U09A 4YEDA 3WYCA 1R66A 3PQDA 4IDCA 3B70A 3KYBA 3GGGA 2DC1A 3HJAA 4BO0A 1YB1A 2AMFA 4BOYA 3ITKA 4GLOA 5TNXA 3WR5A 2GZ1A 2PTGA 3DZBA 1JWBB 1Z7BA 1HYGA 2OP0A 3H2ZA 3LK7A 4WASA 5CEJA 1YB5A 3QJ5A 4B8WA 5IZ4A 3JYNA 2JHFA 3WGOA 3MWEB 3E5RA 1MXHA 3RIHA 4UULA 4HUJA 1PX0A 4D43A 1BW9A 4EJMA 1NQTA 4DXHA 4XR4A 4C7KA 2OO5A 1IZ0A 5DN9A 3D5QA 3OIDA 1JQBA 3TFQA 4Z9FA 2Q1TA 3JD0A 3VH3A 3CE6A 3KOUA 5KCZA 5T8KA 5G2OA 5HWSA 1D8AA 4CUZA 3AY6A 1K89A 5G4KB 4EJ6A 1LU9A 3IAHA 4W99A 3RKUA 2EP7A 1HETA 1UUFA 4HNGA 2FY8A 1LA2A 3SC4A 1NP3A 2VHVA 4BUCA 3JYQA 2O7SA 1I5RA 2Y0EA 1NR1A 4GSKA 1U1IA 3W8DA 3WNQA 1I36A 2NU9A 3FCOA 4UUNA 5IZCC 3ST7A 3NX4A 3RUIA 3PLRA 2CDCA 2DM6A 1G0OA 4JXKA 4TRMA 2OGUA 4MPDA 4YQZA 1M76A 4Q3BA 2IEBA 1PWZA 3O8QA 1NASA 1NPTO 1X15A 2B4RO 4HP8A 1E7MA 4BGVA 3MJTA 1V8BA 1I8TA 5DDIP 4A73A 5K0ZA 4FOSA 2EW2A 1O94A 3ZV6A 2NV6A 1ZNQO 3BA1A 2P9EA 3G17A 3H9EO 4C4OA 3AU9A 1YOVB 2BGMA 4BO8A 3VKVA 1R0SA 2VYVA 1U9JA 1EUCA 3VH1A 4YAIA 1B8PA 2DTDA 4NJMA 3U4IA 4YB8A 3Q11A 4NK5A 1P44A 1QR6A 4HKTA 5EN4A 1E3JA 4K28A 1ONPA 1LDGA 2R00A 5BNFA 3DZHA 2OBYA 4LSWA 4IJWA 1JVSA 4Y67A 2GZ3A 1A9ZA 2EGHA 2DBZA 1EZ4A 1JLLA 3PGJA 4BNMA 4Y6PA 5ITVA 4QO8A 4TRNA 3TL3A 2ZYGA 4O5OA 1YBMA 1H6AA 1TLTA 4UUOA 4DWVA 4EDFA 1KEPA 1E5QA 1HDYA 3H4VA 3ANMA 4YA6A 1OZAA 5BNIA 1B15A 1LSSA 4TZTA 2XXBA 3ETGA 2RCYA 2X9NA 4YAEA 4OQZA 2G76A 5JYDA 2B0JA 4J1SA 1VL8A 1C1DB 1EDOA 3E82A 3WFJA 4LRTB 2FOIA 4Z0TA 1HKUA 4BNXA 3GHHA 4RVFA 1XA0A 3F4BA 3IIEA 4KUEA 1NVGA 3ZWPA 4GI2A 4ZRNA 4IJUA 3W8FA 2FR8A 1M6WA 2PD3A 5AQ1A 4BMVA 2BF7A 4MO2A 2YDYA 4RO0A 3W4KA 4FN4A 3C1TA 2O4UX 1HYEA 3EZLA 3DMTA 1DBVO 4BO2A 2GGSA 1QORA 4CMBA 1GYQA 2ZTLA 1KS9A 4R1SA 1GYRA 3GMDA 3TZKA 1ZXLA 3ZZNA 1IOLA 3PHGA 1UXGA 3ANLA 1TT5B 3R3SA 2YQ4A 4MVJD 1UP7A 1TT7A 1Z82A 5DZSA 3ZWXA 4B4UA 3BAZA 2FRDA 4UUMA 4LCJA 3UVEA 4EEZA 3WJAA 3T4EA 3DFZA 2FWMX 5L7WA 3DO5A 5IDWA 3PJDA 4K6CA 1HE2A 2FP4A 4YT4A 2SCUA 5G0UA 3UGKA 5F1OA 5EL0A 4F3YA 1N2SA 5TGDA 5T8KC 4D3FA 2NTJA 3ADOA 1IHYA 4IS3A 3UCXA 1IPFA 4JN6B 1W6UA 5L95A 3BMCA 3JQGB 1YQXA 9LDTA 1BDBA 3BTVA 2O48X 1YQGA 3I9OA 3VAZA 3JQ8B 4LMRA 4DC1A 3KLPX 2B4TO 1O0SA 4I9UA 3EYWA 1OBFO 3PJGA 2DT5A 4E5YA 2P4HX 4WLNA 1GZ4A 3PHLA 3KV3O 1ZIDA 3M6IA 1PWXA 1DIAA 2PGLA 2C0CA 3ASUA 4R9RA 3BMNB 3QA9A 4R5MA 4FIZA 4RDHA 4B7CA 4D42A 2VHYA 1PL8A 5G4KA 2X23A 2CY0A 3VZRA 3CUKA 6ADHA 2G5CA 1U5CA 2R6JA 4CR7A 3ROQA 3IUPA 3GLQA 4JJGA 4YAJA 4Z9YA 3VPSA 2GR9A 5GMOA 1F0YA 3ZHZA 3C24A 5AOVA 4DTIA 1E7YA 3JQ9A 1RJWA 5CHEA 4KMSA 4CM3A 3R0IA 5IXSA 1WZEA 5L4LA 2R00C 1UDAA 1YJ8A 3I23A 1PQPA 1RM5A 4FC7A 5KJ6A 1PJLA 5IN4A 3TOXA 3AM4A 1K6XA 1MG0A 4XGIA 4IPTA 1R15A 1T25A 1P77A 2G0TA 3O26A 3LC2O 3QVSA 4HBGA 1I33A 3UN1A 1Y8RA 4KQXA 1XQ6A 2FPGA 5G0SA 3V2HA 2QYTA 5C5IA 5CG1A 1PSDA 1VSUA 1QYCA 1Y8QA 1YOVA 3NT2A 2NU7A 3CEAA 3GC6A 4CM4A 2X9GA 4GX2A 3ROMA 1I3LA 4Q3NA 1E3WB 2C7VA 4E5MA 5KNLA 5A9SB 1JKFA 3WGQA 4LGVA 4BKUA 2YW9A 3FTPA 4YAKA 1LNQA 3QVXA 1ISFA 3JQBA 3VZSA 1VKNA 1LSUA 1JDJA 4XWYA 2PD4A 1AHIA 3BHJA 1FDWA 1GV1A 1I3NA 4E2XA 3JQCA 4QEDA 1VJ0A 3Q2KA 3D4OA 4J2OA 5JW6A 4HXYA 5TS3A 4XKJA 2UDPA 2V6GA 3S55A 2ZB8A 1RWBA 3JYOA 4CPDA 3BHMA 3TF5A 1E3LA 1NXQA 1UDCA 4W9NA 3HZZA 4BHTA 2G1UA 1QYXA 5B4UA 2Q1SA 2ZK7A 4EITA 1DLJA 4WLFA 4XYLA 3GFGA 4UEKA 2Q1UA 4RF2A 1U3UA 4Z6KA 3DMTC 1O6ZA 4J3FA 4FGSA 1LI4A 1NYTA 2EIHA 2VUUA 3N7UA 4ALNA 1O9BA 3DHNA 3PYXA 1U28A 4DIOA 1ZCJA 4RCVA 4RZHA 2AQKA 2P91A 2VWPA 3FSRA 4OYRA 4AJJA 1LUAA 3RUDA 4AJNA 4GKBA 3L6OO 2FN7A 1JAXA 1FXSA 2QHXA 4IQGA 1DFIA 2ZYDA 2AE2A 4CM9A 2VWGA 3E8XA 3RUHA 3H2SA 2VYND 3QWHA 4I8XA 1BHSA 4I5FA 4DLBA 2YUTA 4Q39A 1YWGO 2BRUA 4WGGA 4WE3A 4KOAA 5EPOA 1YVEI 1CIVA 2C07A 3H9JA 1PZEA 2CDBA 1TT5A 1UZLA 3LT1A 5A02A 1D7OA 3MJEA 1X13A 1U8FO 2D8AA 4WK6A 4E2YA 1NR7A 5ENDA 4HFNA 4MP8A 1GR0A 4J0EA 5THQA 1MX3A 4PIVA 4YWJA 3GDFA 3K5PA 1Y9AA 3MWDB 1CQIA 4JJIA 3L6EA 2OP1A 2WE7A 4I5EA 2PZKA 2HMWA 4UVEA 1C14A 1MA0A 3STHA 2VYVD 1N5DA 5DOVA 1DPGA 1DSSG 1PJQA 1C0KA 1Z75A 3KTDA 4E5NA 1WDMA 4CL8A 3E03A 3FTNA 3WWZA 4AJ2A 3JQ9C 1HDGO 1AGNA 5KKCA 1EFLA 3DFUA 5G4LA 4YPOA 1R4NA 5T64A 2VOEA 4INAA 1YKFA 4EUFA 1GUYA 4MKRA 4NFHA 2PWZA 1B2LA 2UAGA 4EYEA 2Q99A 3V8BA 2RBEA 2IYOA 2WMDA 2X5JO 1K5HA 1DIRA 1Y5MA 4IY1A 1GCUA 1PGJA 3JD2A 4X54A 8ADHA 1WDLA 4Z0PA 1OI7A 2J6IA 3PFFA 5FEUA 2GRAA 3GH3A 2X22A 1XWFA 3AI2A 4E33A 2O2SA 1SMKA 4QTZA 5JBIA 1DC3A 4MIOA 1EK6A 4AJOA 3LT2A 5I9MA 1PJCA 3HB5X 1DXYA 2IXBA 1AXEA 2R2GA 2AW5A 3ONFA 4M86A 2VHZA 4YYZA 2BHLA 3JQBC 3BYZA 2Q49A 3L07A 1PZGA 3P2YA 3WXBA 4WEOA 4ZA2A 3I9KA 1GZ3A 4AJ4A 1Q7BA 4FDAA 3C7CB 5KIAA 2GN6A 1YRLA 3PHHA 1LLQA 5L3ZA 4QECA 5IJZA 3JQ7B 3LZ6A 4M1QA 5JO0A 3CIFA 3LYLA 1NFFA 3UH1A 1FDSA 4ESOA 3G49A 2OZPA 4W9NC 3TN7A 3PWKA 1GQ2A 4G2NA 2X5KO 3UFXA 3HN2A 4DIBA 3FWZA 2X0RA 3GOHA 2NTNA 4RVHA 1VM6A 4DPMA 1ZH8A 4CM7A 2NVWA 3Q6IA 2AE1A 4ND1A 3D3EA 5JMPA 3HWRA 3JSAA 4B3IA 3LC1O 4NFYA 1YE3A 2O2YA 3IUSA 5ADHA 4FFMA 4WEQA 1I10A 1UH5A 4PFJA 1V35A 1LDMA 2NU6A 1OC4A 2EJWA 3HN7A 4KDFA 3NTRA 3OF2A 1CETA 2D0IA 3PEFA 4HX5A 3CMCO 1XCBA 1UDBA 3DQPA 5CFZA 2JFGA 2J8ZA 3AU8A 4Z3DA 4II3A 3A06A 1SPXA 4DC0A 4YTEA 4YXFA 2E48A 4R01A 3SX2A 2C2YA 2EW8A 2ZQZA 4OKIA 4UEOA 1A27A 4RF5A 3WMWA 2E37A 1MFZA 3IKVA 3L0DA 5FF9A 4B7UA 5KVSA 3LF2A 4BO5A 2C5EA 3KZVA 4E2ZA 4E31A 1C3VA 5MDHA 3QQPA 3ROKA 1YBAA 4HV4A 1WMBA 2NTVA 3QSGA 3FF4A 3UHAA 4WLEA 3GNSA 3PVZA 2WSBA 1F12A 1U3VA 3INGA 1XU9A 5FWNA 3FI9A 3AOEA 3DL2A 1PJTA 3NTQA 1JWAB 3G1TA 3JCZA 2AQIA 5ILOA 5HBRA 4CMCA 1WVGA 3ONEA 1VJTA 1N7HA 4J2HA 3OJOA 2VNSA 4B4WA 3RUCA 2ZTMA 3ZH2A 1T2FA 1O5IA 3EW7A 4PCVA 5B12A 3WOHA 4U6SA 3DOJA 1BMDA 3LT4A 2EV9A 3WGTA 4CLOA 1G6KA 3GA0A 3VDRA 2NVUA 3WYBA 3I4CA 3IMFA 1C0PA 5JC1A 1UP4A 2PKRA 2NM0A 1E6EA 4U6QA 3T7CA 3ZWNA 3E1KA 4RLHA 4D0RA 4RPJA 3L9XA 3OMLA 3ZNQA 1HTBA 4FFNA 3WWYA 5JFOA 4IUYA 4QUKA 4R1TA 1H2BA 3OBBA 1M6HA 1EBFA 3OJ0A 3GGPA 3K8ZA 1GPJA 3NT4A 3ZHBA 4FJ1A 4BNKA 2FR0A 3UXYA 2LDBA 2DAPA 1PL6A 1MUUA 1DIBA 3R3JA 5JAIA 3DDNA 2JD1A 3KSDO 4KZPA 1XGKA 3EMKA 1B8VA 3C8MA 4EEXA 1Q0HA 1L1FA 1WNTA 5B1YA 4YJFB 2AEFA 3KXDA 5TC4A 5BSFA 2Y1GA 4NFSA 2QZ9A 1MFPA 3DONA 4PVDA 3GQVA 2AEMA 4RORA 5TQVA 4EZBA 4JIGA 2HKIA 4OOFA 2IEDA 5DCUA 4NK4A 4H3VA 1ZEJA 3PWSA 1LRJA 3C85A 3V1YA 3OA2A 4ZQFA 1XYGA 3F1KA 3VTZA 1MC5A 1UZNA 1I2BA 2AHRA 4AJKA 4P4NA 1VL0A 4BL5A 2ZJ0A 4ZQGA 2F1KA 3EK2A 3RUFA 3UCFA 4XJSA 3DHEA 3MOIA 2WTBA 3PZRA 4FFOA 4YACA 5IG2A 1VE9A 5C37A 1P1KA 1PJBA 4F6LA 3IS3A 1MXFA 2YHUA 4LW8A 3EAGA 2QZZA 3TFOA 2IE0A 4MVJM 4XRRA 2UYYA 1Q7GA 1R4MA 2P9CA 5JO9A 5GZ1A 1E6UA 4DREA 4MJLA 2X58A 2A92A 1F8FA 1L7EA 2E49A 2HSDA 3PTZA 3RI3A 1MG5A 1LX6A 3C7DB 3PPIA 5L40A 4FCCA 3S1LA 1HE3A 2EWMA 1NFRA 2IZ1A 1E1NA 2YDXA 4W7IA 5L53A 2JCVA 2J3HA 4RL6A 4TRJA 4U7WA 2D4AA 4DPKA 1P0CA 3PIDA 3WQSB 2BLLA 3GFBA 3ICCA 1NVMB 3OECA 2NVBA 3HFGA 2I3GA 4E30A 1LTHR 3TWOA 3GDOA 2VWHA 2EGGA 3F4LA 3AOEC 1PL7A 3KB6A 4CQMA 2HRZA 3ZWMA 4JX8A 1ADCA 4CJXA 1VI2A 4S3MA 1ENYA 1NWHA 3HG7A 4FFRA 4M49A 3ULKA 4IXWA 3RC7A 4J9UE 2ILTA 2W2KB 5IDXA 2WEKA 4CM1A 2DTEA 3G79A 4L0QA 1R0LA 4QQRA 5L51A 3TZHA 1A5ZA 1N7GA 5U9CA 5CDSA 1B26A 1UXHA 4L4RA 5EJ2A 4A0SA 1JKJA 3RUAA 3M2TA 1IY8A 1DJNA 2C29D 1YQDA 3RQSA 3JQAB 2C54A 5EERA 2NUAA 1MV8A 2CZCA 1D1TA 4RPHA 2VT2A 3KSZO 3F9IA 1P0FA 2YV2A 5L9AA 1JW9B 5DBFA 2WD8A 4YJHB 4GX5A 3UUWA 4FB5A 3HQ4O 2LDXA 2Z95A 4PZEA 6LDHA 2Y66A 4FQ8A 4MVJG 3D7LA 2A94A 3RU9A 2VUTA 4N18A 3VHRA 4XB2A 2GN8A 4XX0A 1WP4A 2QQ5A 1A7AA 1YXMA 3DEYX 1QV6A 4PLGA 4DA9A 4B3JA 2IDZA 4OSPA 5A3VA 4BGUA 5JPIA 4PG8A 5BNTA 5H81A 4DMLA 4CV1A 2I99A 3OJLA 5DULA 5TRTA 3WX0A 1Y81A 3RAJA 4RVDA 3PQFA 2NACA 2CVQA 4OHUA 1OOEA 3LC7O 1NBOA 4GAEA 3KEOA 3P2OA 3OQ6A 3UOGA 3JV7A 3DZIA 5COQA 2RH8A 3B1FA 3MCVA 2Z1NA 4E2WA 2AQ8A 3PYLA 4I5GA 1ADGA 4UVHA 1JAYA 4PLVA 3CSDA 1ZK0A 4IBOA 2B69A 1VC2A 1T2EA 4WCFB 1N9GA 1NM5A 5A9RA 4MVJP 3H6KA 3PYMA 3DZFA 3WNVA 4BNWA 2D5CA 4BV9A 3IKTA 3SEFA 3HDQA 3CTMA 4JNKA 3B1KA 5JAQA 1NNUA 1PEDA 3TQHA 3KBOA 4YJFA 1RPNA 2X1HA 4Q3CA 1M75A 1LC0A 1PGOA 3FNEA 1AXGA 3GZ4A 4NQZA 3WGIA 2YHIB 4KUHA 3DC2A 3ZWBA 4ROSA 4ND5A 3HUDA 4WLVA 2C59A 4CLEA 1HLPA 3ANNA 1ZJYA 4L73A 4KWHA 2PKQP 4NI5A 3RVDA 3LQFA 3DBRA 3I9MA 3CZMA 5JNLA 1S7CA 5HS4A 1KC1A 3GRKA 3KETA 2TMDA 4Z3KA 3KYDB 1B16A 3H5AA 5CEFA 3DZGA 3BMOB 2Y1EA 3K30A 3WDSA 5DBIA 4GMFA 3DOOA 4IQ0A 5G0VA 3GEGA 5KJ1A 3VPFA 5JCJD 4R5HA 4J1QA 4OOEA 2F00A 3OJFA 4CLDA 2AA3A 3E9MA 1GTMA 1MGOA 1YJQA 4MP3A 4NPCA 3L77A 1SOVA 4FFPA 3DMYA 4JK3A 3AFNA 1E6WA 1M67A 4IDAA 2YV3A 4CLXA 3CXRA 3COSA 3BTOA 5ITWA 4CMEA 4NJOA 2V65A 1HXHA 2UUPA 2V6MA 1HLDA 4PG7A 4B3HA 4IDBA 4U8GA 1WAMA 1R12A 1P74A 3JYPA 4NU5A 1GZ6A 4MKXA 1VJ1A 4MVJI 3U4DA 3I5MA 1DFHA 4R69A 3GRPA 4XQ9A 3GUYA 5G0TA 2TMGA 3AUUA 1E7QA 1HDCA 4YJGB 4NDNE 4YT5A 3PZBA 4R16A 4R54A 2WYUA 3FPCA 2H5LA 3A1NA 1E1MA 4PG6A 4A27A 3NDJA 5CG2A 2FSSA 4E12A 1GD1O 1JTVA 3GG9A 4PVCA 4H16A 3H65A 3I3OA 1I01A 1X14A 3DB2A 1JN0A 1CQJA 3GN2A 3WB9A 3TJRA 2J5QA 2YFQA 3DBHB 1HZJA 2DBQA 3CPSA 3FWNA 5TT1A 1KY4A 3HE3A 2VRCD 1IYZA 3BMQB 3ZV5A 1FDUA 4D45A 4GH5A 1ZFNA 4A5OA 1GCOA 4M87A 5JDIA 3EUWA 1YL6A 3G3EA 2JFFA 3EVTA 4IJKA 3ETEA 4N54A 3WQQA 1SB8A 2HU2A 4XQEA 4H7PA 3U4HA 2D3TA 3EHEA 4KTTE 4CM8B 1SO8A 4OH1A 2JJYA 3K2BA 4S1VA 1DJQA 1U4OA 2CD9A 1U8XX 4CMIB 1IZ9A 4GVXA 4DLAA 1VL6A 1KYQA 3OQ1A 1DB3A 5CDUA 2BFPA 2X0NA 3EZYA 1P9LA 3BIOA 1P3DA 3JD1A 4WPGA 3SVTA 4XEHA 5DNAA 2OL4A 4R3WA 3N74A 4I1IA 4J7XA 1KC3A 4AVYA 1V3VA 4RQTA 4NBUA 3MEQA 5A06A 1LDBA 3O9ZA 4U0JA 4Y9DA 5JE8A 1BWSA 5A1TA 2A35A 3D4PA 3F6YA 4R1UA 4TROA 1GFSA 2VRBA 3MOGA 1UR5A 4RVSA 4XYEA 1VPDA 3K6JA 5DBGA 3H5RA 5B37A 1J0XO 1HF3A 2GF2A 3OSUA 3ZHYA 4IMRA 3E9NA 2HJSA 3GNQA 2C2XA 2VT3A 4E21A 2DUWA 3FN4A 4XD2A 1U2GA 1WW8A 4IIUA 4J0FA 1QSGA 5IDYA 2P68A 1HDZA 2PZJA 4OMUA 2GZ2A 5TIIA 3HDHA 4F45A 2W2LA 2FZEA 4ZN6A 4ALMA 5I7EA 2OUIA 1U3WA 2GASA 1JA9A 1F14A 1OMOA 2WYVA 4KUGA 1CRWG 4TQGA 4Y98A 2NU8A 4CR6A 5CPFA 4BNIA 3H9QA 4IQ8A 3LT0A 2ET6A 1BVUA 4BVAA 1FJHA 1ZSYA 4N5NA 4BNLA 1XG5A 2H9IA 4CODB 1Y7TA 2PV7A 3KYCB 3GVPA 1C1DA 4EUEA 3NYWA 2HMTA 4BGEA 2YHIA 1KEVA 5EQFA 4PLCA 4LVCA 4R1NA 3WIDA 1KVQA 4ZQBA 4AJPA 4PGFA 1BXKA 1EUZA 4IDDA 4K1LA 5AXAA 1G0NA 1Y1PA 2BFMA 3LSYA 3TZQA 5TF4A 3GHYA 3NAQA 4YT8A 1A7KA 3RJ9A 2JKVA 5TJHA 1NPDA 1P1IA 3H9UA 1HYHA 3PGXA 4PG4A 5JYEA 3KUXA 3S8MA 2X6TA 3PDJA 4DQUA 4LRSB 1XHLA 1RM4A 3OEWA 3ZWCA 4BKOA 4ZD6A 5HM8A 2VZ0A 5EESA 1PJSA 2FPPA 5COAA 4BNVA 4CMEC 3C7AA 3KYDA 1X1TA 3TZ6A 2P4QA 4LCEA 3KO8A 5EQDA 1ZSVA 5KVQA 2EJVA 2JCYA 1HE5A 1ISMA 1LDYA 1YL5A 1YGYA 1FDVA 3BTSA 2BMAA 3W4JA 1CERA 3DTTA 2D1YA 3RC9A 3VC7A 1U7TA 2I5PO 2GERA 4U5QA 4WLOA 1SEVA 3RROA 1L7DA 1H6CA 4OQYA 1N8KA 3UAGA 4J1NA 1P1RA 5GZ3A 3FR8A 2W98A 4BNNA 1HSOA 1I2ZA 4FD3A 2X0IA 1LRLA 4B79A 3O03A 1O89A 3ZU4A 5T6BA 2HMVA 2H6EA 5A5EA 1H6BA 3GZNB 1B14A 1E92A 4Y6RA 1H2HA 3I9JA 1AUPA 4D44A 3JQGA 2X86A 3ITDA 1CWUA 4RQUA 4OO3A 4DYDA 5H83A 3HB4X 4DQVA 1X7DA 2YV1A 1XELA 4YAGA 2Z5LA 5JDIC 1RYDA 4O0LA 2Q4BA 4I08A 3W6UA 3JQ8A 3NDRA 4ZJUA 3X2FA 3E5MA 1IHXA 1HDRA 5HA5A 4EUHA 4PN3A 4BB5A 1ISGA 4D7AA 1T1SA 4OKNA 2Q2QA 5AXCA 1Z74A 3VPHA 4IJVA 3BMNA 2XXJA 4BNZA 3IQDB 3IL2A 4EGFA 1DHRA 5BQFA 3W6ZA 1ID1A 2PK3A 4NZ9A 4XIYA 4ALLA 3G0OA 3GDGA 3RASA 3QHAA 4P8RA 4D0SA 1ULSA 4F6CA 4IDEA 4XA8A 5DCYA 1QLJA 1J6UA 2JD2A 2DPGA 3DR3A 4ZU3A 1AN9A 1V3UA 1XLTA 3SLGA 2NQTA 4CMAA 2E82A 4GPD1 1LJ8A 1E0DA 3AI3A 4R68A 2EEZA 4JBIA 1EFKA 4CMIA 3ZV3A 1PGPA 1DAPA 1ZUD1 4JBGA 2V7PA 1H94A 4MOWA 3WGZA 4E13A 1IB6A 1O95A 4XR9A 1P33A 4OL9A 4TVOA 3FRJA 1RYEA 1QKIA 1YB4A 4JBHA 3C3XA 5ER6A 4K9DA 3QVWA 2AG5A 4CQLB 5A05A 3OIFA 3HDYA 4PRKA 4H15A 2BI7A 3PI7A 1E3WA 3L4BA 5BT9A 4CMGA 5A9SA 3ZWYA 2YJZA 4BB6A 1B8UA 1UAYA 3Q3CA 4IMPA 1BRMA 1FDTA 3ADPA 1XDWA 3DOCA 4CLRB 4XGKA 3DAGA 3FBGA 4U0KA 1UZMA 3P5SA 3QLJA 1EUDA 2BFOA 1ZEMA 2RH4A 3D3WB 4G81A 1K0UA 1NAHA 1NQ5A 4MVJF 1W4ZA 2NNLD 3F3SA 3QP9A 7MDHA 5HTOA 1UXJA 3K96A 1BGVA 1ZSNA 3OH8A 4OAQA 4UAGA 3QWIA 5TSDA 1HRDA 2ZKLA 1U5AA 4DIFA 4KWIA 4PLWA 2Y0DA 3PWZA 4EW6A 2GN9A 3DXFA 1ZBQA 3M1AA 3FNFA 3Q9UA 1NX6A 4XIJA 2PA3A 2BD0A 2ZB3A 2QIOA 3C1OA 2QRLA 3WLFA 1LLDA 4RF4A 1Q0LA 1IL0A 2PR2A 5BR7A 4IM7A 5JSFA 2JAPA 2O7QA 4TMFA 2FZWA 3E6AA 4Q3AA 4YDRA 3MJVA 1SBYA 3WTCA 1WLYA 3RFTA 3SBOA 3RWBA 4IDGA 4RDIA 1EVJA 1MLDA 1U2DA 3KSUA 4NR0A 4XDZA 3WIEA 4BQPA 3LLVA 4EI2A 2EKQA 1MP0A 2HRBA 3H5NA 2YY7A 3ABIA 1QV7A 2RHRA 5J23A 3GT0A 2BKAA 3OEYA 3GPIA 4CMKA 1P1HA 5U1PA 3OIGA 1PJ3A 4WJZA 3WMXA 2WE8A 1JVBA 2ZTUA 1WWKA 5KOIA 3AI1A 3GVCA 4ZRMA 3OA0A 1K2WA 5A3JA 5B4TA 3RKRA 3IC5A 3WSWA 3OETA 4A2CA 4GGOA 2B37A 4NMHA 2PFGA 5KVVA 4E4YA 2YFHA 1DO8A 1GADO 1LEHA 4UVDA 5JCXA 1BW9B 1SAYA 2PH3A 3PJEA 4OIMA 1EVYA 3TL2A 4B4VA 5CDYA 3ICPA 4FC6A 5CAEA 4TSKA 1TI7A 4XYBA 4DBZA 5C3MA 1KVRA 1D4FA 4FW8A 2VWQA 4IZIA 4QSMA 4QXMA 1T4DA 5KKAA 1GPDG 3GAFA 4L4SA 1GYPA 3GZNA 3DBVO 3GPDG 5F1KA 2BH9A 2HMUA 2I76A 1SNYA 4BNHA 3RC2A 5BSGA 2DTXA 1V3TA 5F3RA 1XEAA 4J16A 4KP7A 1SZJG 3MJSA 2UVDA 3AY7A 2O3UA 4WECA 4YT2A 3GY0A 4MVJA 1E3IA 3ZW9A 3EC7A 1Z6ZA 5A04A 4CL3A 3SC6A 3S2GA 1H9BA 2IYPA 2VZ9A 3HADA 4XJTA 2PLAA 2B5VA 4TKLA 2E6UX 2RIRA 1SB9A 1JU9A 3U49A 5ICSA 2CF6A 2DBVO 3QIVA 4FJ2A 4W7HA 3VH2A 4EBFA 5I8ZA 3ONDA 2QG4A 5H82A 3WBFA 3I1JA 4Z9XA 4D79A 4O1MA 4W6ZA 4NJMB 1TEHA 5L7YA 4FPXA 4OXNA 3Q9NA 2GN4A 3QWFA 3U3XA 3CH6A 1IULA 3L4BC 1CEQA 4BNGA 1EK5A 4WLUA 1O8CA 2AEJA 3GUCA 4M89A 4HWKA 4CM5A 3L4SO 4CUJA 2ZYAA 3IJRA 5KWEA 4CMHA 4Q3DA 1LSOA 2BI8A 3DBLB 3EY4A 1LXCA 3H3JA 1PZFA 3E48A 4JJFA 1DFGA 3EVNA 4RPLA 3KVOA 2HJRA 4QX6A 4DRYA 4HFJA 4MDHA 4PLHA 2X8LA 1R6DA 3JQEA 1SC6A 2H1SA 3JQ7A 3OJEA 4CM9D 4CQLA 5IAAA 3ZW8A 3OHSX 3ZU3A 2G17A 3KLMX 4J91A 1ONNA 3WICA 4QFCA 4RVGA 4J4HA 5LDGA 4CLHA 3DAFA 3A28A 1KETA 4TRRA 2VN8A 5CP8A 4LVUA 1NVTA 3ZNNA 3IP1A 1RM0A 3TSCA 3VVCA 4W82A 1UXKA 4L9RA 5IFLA 4LSMA 2A9FA 1C1XB 2O50A 3D3WA 5GZ6A 3W1VA 4XZ3A 3T7EA 3ZNPA 3NT5A 1B3BA 1ENOA 4CUKA 5L4SA 4YR9A 4ZHSA 3O38A 3WTBA 1S6YA 1KEUA 4XGNA 2Q2VA 4AICA 3AY3A 2HMSA 4YVFA 3HFSA 1CJCA 2OFPA 4PZDA 1E3SA 4J7CA 4AJLA 3WGHA 3A14A 3HHPA 1EMDA 2O4CA 2Y93A 3L9WA 3U9LA 3B6ZA 1ADBA 2C5AA 1CDOA 3NJ8A 4OJNA 1HT0A 1M66A 4YCAA 5ICMA 5DT9A 1GV0A 1P45A 4WNCA 5JLAA 1UAGA 2V6BA 4GBJA 2ZB7A 3I6IA 2W8ZA 4GMGA 4PRLA 2PKQO 4OGWA 3QRWA 4ZQEA 1NHGA 1ZK4A 4GWKA 2CFCA 1HZZA 3DTYA 1LQUA 1WXDA 1RKXA 3NRCA 3KM0A 5A4DA 2GYYA 1V6AA 1EBUA 1E7WA 1BDMA 2Y05A 1BG6A 1DC5A 3TNLA 1ZW1A 1A72A 4IXTA 4RPGA 4J49A 5FI3A 5AVOA 2CNBA 3OFSA 4LN1A 3OQBA 4I9HA 3WFIA 4DMMA 4DUPA 5T57A 1Z73A 4BNFA 1HSZA 3F1LA 3RBXA 4ND3A 3BMCB 1MB4A 1ZK3A 1GUZA 4AFNA 1K3TA 4ND2A 4PLTA 4ALKA 4TKMA 1EE9A 3A4VA 2ZCUA 5JY6A 3PDUA 4D46A 3JTMA 2ZIZA 2Q4EA 1NTOA 3ZDFA 4WOKA 1X1EA 4BMNA 4JLWA 2FPIA 2E4AA 2QW8A 3JQ6A 4ZICA 2FMUA 4ND4A 3C1AA 4UVIA 3RFVA 2IRWA 4I5DA 4BGIA 1X0XA 3NGLA 1I3KA 2CUKA 2VYNA 2Y1CA 5LDHA 1DDOA 2C7GA 2EKLA 3RD5A 1QP8A 3BXXA 1LRKA 3NDIA 3O4RA 3QW2A 4CM6A 3MTJA 4WUVA 1AE1A 3E18A 1J5PA 4PLYA 4HADA 2B83A 4FBGA 2OMEA 3RBZA 1C0IA 1X7GA 1X7HA 4M8SA 2ZJ1A 1WPQA 4GQAA 3ZI0A 1Q0QA 3ZWAA 3ZN2A 1T4BA 1BXGB 1I0ZA 3K92A 4QFDA 5ENVA 3VPXA 4Y8VA 2J3IA 2Y67A 1A9YA 4RPKA 2WDZA 3PRJA 4NIMA 3ON5A 2ZB4A 1Y8RB 4ALJA 3WJ7A 1YO6A 4N5LA 3QVTA 4RVUA 1Y8QB 2GDZA 5DP2A 1T2CA 4CM4B 1K6IA 4D3SA 3DZJA 1DIGA 1BXZA 2Y1FA 3IOYA 4IIVA 1TVEA 3QV1A 3JYLA 3LF1A 1F8GA 1U7HA 4GVLA 3ZWOA 3ROPA 2ZQYA 3FNHA 2DLDA 5IDQA 4A10A 1H6DA 3GEMA 2NLOA 4AJHA 3DBLA 4K6FA 5AYVA 2EHDA 3WGGA 2FHSA 5K9ZA 5FYDA 2XOXA 4J9VA 4TWRA 3H8VA 5I9LA 1ZXBA 1XIVA 2HK9A 3GR6A 3H3FA 3WYEA 1TB4A 1DAOA 4BNJA 4GX0A 4DLLA 5I7SA 3ORFA 3CKYA 1KY5A 4PLFA 2NSDA 3F5SA 3D4NA 3TDKA 2BFAA 1Q7CA 2I67A 3S2IA 1ML3A 1PZHA 1GEGA 1LLUA 5A5FA 3UF0A 2VCYA 5KJFA 3RJ5A 1C1XA 4XQGA 3AUSA 2P5UA 4NHEA 4DL9A 1R37A 1T24A 2CMDA 4Q3EA 2Z1MA 3G1UA 1OAAA 4CV0A 1PJ2A 3I6QA 3IJPA 3PK0A 4GSLA 5AXDA 3K2EA 3ZNOA 1W73A 3JD3A 4E3ZA 1QRRA 2JCXA 1QYDA 3VZPA 2D5AA 2BGKA 2X9VA 1ZZEA 2ZTVA 1X0VA 3D64A 2OBNA 1W8DA 3GGOA 1HDOA 2QYSA 3NJ4A 4L76A 2O3JA 4C7JA 4O59O 2QX7A 3U5TA 1NAIA 5TT0A 4KQWA 3BZUA 3VTFA 2YQ5A 3AJRA 3CMMA 4JP2A 1ULUA 2BELA 2GO1A 2IZ0A 2W2KA 3BHIA 3MJ4A 2GCGA 3HNPA 3H9GA 2I9PA 2DKNA 1GDHA 3B1JA 3OM9A 1KVSA 2VTEA 4FOOA 4XYMA 3RUEA 2XAAA 1H9AA 2B4QA 4BKPA 1T1RA 4J1TA 2RHCA 4D3DA 1PS8A 5THKA 4E0BA 1LBEA 2O3RA 3JQAA 3GAZA 3D0OA 1J49A 3M2PA 3Q2IA 4F46A 3KRTA 5TJ9A 3S2FA 2HK8A 3ZHXA 4ILKA 2DFVA 3RC1A 4XB1A 4AJIA 4UUPA 4YJHA 1KOLA 1YS4A 1LLCA 1R4NB 1ISHA 4E5PA 2HDHA 3D5TA 2DBRA 3E9QA 5F5LA 1VSVA 1ZMTA 2I65A 5T5QA 5A03A 1IPEA 1QXSA 3ENKA 4IGFA 1ENZA 5K6AA 4XCVA 2PZMA 1D3AA 4M55A 2CVOA 1ISJA 1P1FA 4EJ0A 2DPHA 2X4GA 1M2WA 3ZV4A 2XPCA 2EXXA 2J5KA 3WS7A 1U3TA 5AXBA 2XF8A 3RBVA 3ZCXA 1ORRA 3A9WA 3V5NA 1NPYA 4RLSA 1CF2O 4JROA 3VKUA 5IXYA 2B35A 3F5QA 4JCOA 1BXGA 4B8ZA 1HWYA 4XYGA 2ZATA 3UCEA 4L8VA 2JHGA 3M1LA 4DVJA 2RAFA 4IS2A 4BMSA 4W4TA 5CDTA 4MIEA 5JC8A 3SLKA 5JAZA 4URFA 1YL7A 4CR8A 3ZGYA 4AL4A 4BQRA 3T4XA 1FF9A 5DCWA 5ES3A 5B4VA 4J6FA 2I6TA 1F06A 4RF3A 1LDNA 1J4AA 1XQ1A 1Y5RA 1F17A 1GQQA 4WCFA 1PIWA 2VHXA 4HFMA 4GGPA 5I9NA 1UJMA 3I83A 2Q3EA 3FBTA 1WMAA 3PHJA 4G5HA 4FS3A 3LU1A 1I24A 3JQFA 2EKPA 4MINA 4Y6SA 5U4QA 1B7GO 1QMGA 4N5MA 1SOWA 4FJ0A 1EEHA 3AK4A 1QLHA 1DEHA 1QYVA 2W90A 1ISIA 4R4JA 1T2DA 4L74A 3PXXA 3U4CA 1CYDA 1YH3A 3AWDA 4BO7A 4CQMD 2X0JA 1A4UA 4BKRA 4PLPA 2Q50A 3ZU5A 1PGQA 2IZZA 4OSOA 2FR1A 1MC4A 2Q45A 4HNHA 2VZ8A 3NUGA 1U4SA 4E5KA 5KTKA 3RFXA 1E3EA 4KDEA 4BNUA 1I3MA 1C0LA 4YBZA 3SJ7A 1YONA 4IINA 5KJCA 3OICA 1HL3A 5JDCA 2YYYA 3GNTA 2P2SA 2JAHA 3FR7A 3BMOA 3PHIA 5I7FA 4ID9A 3EDMA 1P31A 4OXYA 3PLNA 1XU7A 2NWQA 3Q0EA 4YQYA 5BSHA 4UEJA 4DBVO 4BNYA 4P38A 5TLSA 2DFDA 3WLEA 2HAEA 4FSHA 4DPLA 2CF5A 2IXAA 2UV8A 3HDJA 4LMPA 1DC4A 4NBVA 3GVHA 4RZIA 4ZGWA 5L4NA 3RSHA 1NQAO 3V2GA 4XQCA 2QRJA 2WJPA 2WYWA 1A4IA 5C7OO 1KEWA 4L4XA 2CSUA 3IP3A 4O6VA 4ZVVA 4BS9A 1UP6A 1Z45A 5JY1A 4PG5A 2CDAA 4BNTA 5LC1A 1DHTA 4R3NA 2D59A 3DAPA 3P7MA 4HY3A 4IDFA 3AM3A 3ZWVA 4UVGA 1W0CA 1NQOA 1QG6A 4BO3A 1OFGA 1EVIA 1A71A 1PQWA 4YJGA 3CZRA 2AXQA 4WCDA 1YDEA 5C7LO 3I4FA 1GQYA 7ADHA 2JL1A 3LLSA 5EIOA 1SCUA 3NGXA 2JFHA 4R51A 5EINA 5K6AC 2HO5A 2GNAA 3I9LA 3DBHA 5KVCA 2A4KA 2CVZA 4A7PA 1PJ4A 2PGJA 3Q1LA 2GD1O 3AW9A 4CLOB 4ALIA 2NVUB 3BMQA 5F5NA 2EF1A 2J3KA 2Y1OA 1PS0A 9LDBA 1KERA 2AQHA 3K9QO 4BO1A 3INTA 1P1JA 2HLPA 4MP6A 4MVJE 4CV3A 1ZK1A 4CM8A 1KVTA 1XSEA 5MGBA 5HRUA 3AUTA 4O63O 4GWGA 1PU2A 4NBRA 1UXIA 5L7TA 2GPTA 3W4IA 4A03A 4B7XA 5C7IO 4DQXA 4DYVA 4RV9A 1Z7EA 2C20A 1EQUA 2WD7B 1E5LA 4QO7A 2QRKA 3L6DA 2Y99A 4XRGA 4R9SA 4P22A 2HCTA 1E77A 2EERA 4WCFC 5CPBA 5EMHA 4K26A 4LK3A 4JP3A 3ETDA 1NFQA 2PH5A 1IE3A 1I30A 1E1LA 3GF4A 3JQFC 1GEEA 1ZMOA 3VZQA 4BO9A 3K31A 5LCXA 1H93A 3UKOA 3GEDA 4BO6A 1YDWA 4M54A 3BTUA 4II2A 3FHLA 4JGBA 4MKZA 3ZU2A 4Z0HO 2J5RA 4ITUA 4J4BA 2GLXA 3K73O 1VKOA 1KBZA 1VRWA 1N92A 3WG9A 4UREA 1TA4A 4J7UA 3SJUA 2UUOA 4MIYA 5G0WA 5COBA 1DRUA 3VPGA 3U0BA 5TX7A 1T26A 1HDXA 4OM8A 2HQ1A 4BO4A 2IODA 3R1IA 5JAMA 5BSEA 4FR5A 2JD0A 2PY6A 3KYCA 3GVIA 3DHYA 5DOZA 3WQRA 2DUUA 1DOHA 5JDCC 1ONOA 4NG5A 5IF3A 3PP8A 5F21A 4P4LA 1R4MB 4FGWA 2DU8A 3MTGA 4XDYA 2OHXA 3FNGA 4B4OA 1GY8A 1OC2A 1N1EA 1ADFA 3AM5A 4P4GA 1BSVA 1GAEO 2P9GA 3GN1A 2DVMA 4PZCA 1VLLA 3DZKA 2Y68A 4NH4A 2OXIA 3V1UA 1BTOA 1PGNA 3JQAD 3MZ0A 4KTVE 5A9TA 1JKIA 1BVRA 3AUAA 4GLLA 4RJTA 1ENPA 2I66A 1NHWA 2B5WA 3MJCA 5L45A 3PJFA 1LDEA 2B36A 3N58A 5CEEA 1I2CA 4CQMB 2WM3A 2H63A 1Q2XA 2PD6A 3FD8A 3PQEA 5FFFA 1PTJA 4AJEA 4DGSA 2C82A 4BV8A 1KIFA 3F46A 3JD4A 2PZLA 4ONEA 4IGEA 2V6FA 3F47A 3WGYA 1ARZA 4TVBA 5FI5A 3WSVA 4QT0A 2VNAA 5I8WA 2O23A 2NQ8A 4GX1A 1D1SA 3GG2A 1G1AA 1AHHA 5I7VA 3D1LA 2J3JA 1PQUA 2O3QA 1WDKA 5KJEA 4A26A 1LSJA 3H7AA
chains in the Genus database with same CATH superfamily
2ZYRA 3TZBA 1YJ5A 4BPBA 4RK5A 3WOVA 1Z2NX 3I2FA 2H4JA 4HNQA 5F1PA 4EFLA 3ASVA 3TL6A 2NAFA 5JCJA 5B1EA 4MB0A 2NU9B 1N9KA 4C87A 2RSLA 2OOSA 5LIPA 3H0EA 1IAVA 1I7LA 4HPWA 4TZKA 1D2GA 3SXPA 1MAVA 3LKVA 4P3OA 1J24A 2G1KA 4N3AA 4FFLA 3QE2A 4LXXA 1GZVA 2VHWA 3SG0A 2QM7A 2XVYA 2Y9PB 5F9FA 1Y7LA 1MRSA 3RARA 4MJ3A 1L9XA 4JQCA 2W2OA 4KDCA 2WSLA 1P9OA 1J1IA 5BQXA 1GAJA 3A1TA 4PLZA 3WBKA 2O8DB 1B93A 3BWCA 3P9QA 4NBTA 3VDQA 5CM2Z 5AW9A 1ST3A 2DQ4A 1S7GA 4NMWA 1SC3A 2AJBA 1RSZA 2IPLA 3I30X 3MTQA 2P3LA 1DAEA 2CB9A 2VOJA 4HQNA 1E7SA 1NC3A 2JGKA 1ZBDA 1XCJA 1ZKMA 3O8OB 1K63A 3H2BA 3FPLA 3TPCA 3BS4A 1VIVA 3IAEA 2PO5A 4OHVA 2G82A 3QFCA 4D41A 1E7RA 2A57A 4IZHA 3ZQUA 4R6WA 2FG5A 1M6VB 1F1BA 1R0KA 4ZQHA 1TJ4A 4EGAA 5CW2A 1S2GA 1L5LA 4CL2A 1MABB 1F0KA 2Q41A 2VQ3A 4GL4A 2RI6A 1JLLB 3TEFA 4R41A 1U7WA 1GTVA 2PGDA 3KJQA 5E6RA 3TUJC 2H4WA 2C42A 2OUKA 4N5HX 3O4VA 5LP6A 2W37A 3LQQA 2WD7A 3K0SA 1GGEA 1H0KA 2JFQA 2BM1A 2V9CA 2FSVA 4I1OA 4RK4A 1ULAA 3B13B 3QWAA 5DYGA 4UKDA 1XR3A 2E1PA 3HA2A 3V9AA 3ABRB 4B17A 1GWNA 1PR3A 3HSKA 4LQ4A 3SI7A 2NZJA 3ER8A 3Q40A 3JQDA 1NI4A 1ZH0A 4KIUA 3KR2A 3X1WA 2OO7A 1FQWA 1WUJS 4DDWA 4CEJB 2PEZA 5AKHA 2NPOA 5JECA 5KSOA 3QELA 4KODA 3T34A 3F74A 2P9BA 1KFEB 3I9NA 4L75A 3FB1A 1RHJA 4BUJA 1A9XA 2QRVB 2W6JA 1IWPB 5CLJA 3RU7A 4CLRA 3G59A 2D4HA 1B0PA 1H2FA 3N9IA 4G65A 4DCJA 2YZ7A 3TXXA 1Y9EA 2VJAA 1TM2A 4ILEA 5C8ZA 3AJ9A 1W5FA 4NP6A 3QE0A 1E4VA 3OZ7A 2YBEA 1XVUA 3UICA 2I80A 3KCNA 1KJWA 4OP3A 1YKSA 2HA2A 4M53A 4WXEA 1KI3A 4JXZA 1KJIA 3VNSA 3TOVA 5IKMA 2ATEA 1SXJD 3SQWA 2W6MA 3BG5A 2OORA 4INPA 4ZU6X 5ICCA 2B82A 2EZUA 4WZAB 4YRKA 4IH4A 2C9ZA 4YRBA 1ZHHA 4LHZA 2OXTA 4DCGA 1IJEA 1E1RA 1DC6A 3ZWWA 4E4RA 2VCEA 1NVFA 5HF8A 3AEUB 5H9VA 2J9RA 5CDGA 1IK6A 5DTMA 4FQ7A 5KTOA 2FMXA 3GMSA 2EFEB 3JPYA 2XNDA 1IBMB 3W3ZB 1NATA 4LISA 2VNHA 2AUMA 1XMJA 2E4WA 4NBWA 4IYJA 1V47A 2QI9F 4RIHA 1P9NA 2XMZA 3G2JA 4L50A 5K5EA 1SEPA 1QK3A 1R16A 5F76A 4EJ2A 4Z3OA 1XJQA 5EQJB 3V2UA 1BMFA 1DE0A 2Q5LA 4J7AA 5CFOA 4N01A 3WYCA 1NVEA 4IDCA 1CZRA 2OHIA 3B70A 4H3KB 5AMXA 4D26A 2FP4B 2DC1A 1YB1A 4UCWA 4BOYA 2WJ3A 7ABPA 5JD5A 3M1IA 2JGEA 4G26A 1R88A 3BXEA 1BCRB 1BNCA 4EUKA 3ECAA 2MSKA 4IV0A 1JWBB 4XM0A 2OP0A 3H2ZA 4JDPA 5CEJA 4AI6A 2WFLA 3WMRA 4DB2A 5JXIA 5DKFA 3PXDA 3PFNA 1L7OA 3D3QA 3A1EA 7GPBA 1H0RA 2W7TA 1F2UB 1T0PA 3MWEB 4QVIA 4F4FA 4U2EA 4JL5A 4MVCA 1QVWA 3EVAA 2JLUA 1U8UA 4HYEA 3UJAA 1A2KC 4D43A 1EDEA 1BW9A 1RI5A 2ECOA 2X2FA 3RAPR 3T0IA 2A1UA 2HPZA 1XLUA 2QN9A 1JBQA 2OO5A 3NTUA 4M22A 2G77B 2PWBA 3EEQA 4UBMA 1JQBA 1MB2A 3C5HA 3KOUA 5AI0A 2YS6A 4O8ZA 4BFSA 1URPA 4S1WA 2XR1A 4DDVA 4MRPA 4XASA 1O95D 3Q3EA 4EJ6A 3MB5A 4U7PB 3S5UA 4KZKA 3U3DA 2F1OA 1HETA 1J97A 4PPNA 3GUZA 4L6CA 4BQNA 4DCUA 3BFPA 4BUCA 3G13A 1T8TA 1DAKA 2HYDA 2F8MA 2Y0EA 3KPUA 4GSKA 1ZL2A 3SICE 3NYQA 4C5BA 1J8DA 1QGUA 1G3QA 1I36A 2W6PA 4M1SA 1U8YA 4KMMA 2JNWA 3MYRA 3UATA 2OHHA 4AS3A 1I2DA 1TOAA 3AR2A 3BWXA 5CDFA 3HYRA 4QWWA 1RWNA 4TWAA 3B5EA 5FWYB 3CUUA 4NMXB 3H9BA 3SMQA 4TRMA 2OGUA 4OGFA 3V4LA 3IBYA 3ELYA 3CJQA 1J42A 3OKPA 1UKZA 3HPQA 3KJGA 2IEBA 4AG6A 1ZHOA 2F3PA 3LC0A 4PLHA 1X15A 4TKZA 3MJTA 5DDIP 3EC1A 4YH1A 3GRAA 3MYYA 3SZLA 2EW2A 4LJYA 1O94A 1VJGA 2PZAA 3KKPA 3L4JA 3ZK8A 1D0IA 2B8WA 5KNBH 1FW6A 3LW7A 5TS2A 1Y1TA 1E2LA 1Y1QA 2BGMA 2PWYA 1D1PA 2ZJOA 4GR5A 4PICA 1FFHA 1ZCZA 3WL6A 1EUCA 1T9BA 4XCXA 1B8PA 1BJTA 4YJ3B 1GFZA 4I9FA 2FN9A 4NJMA 2QRPA 3QX9A 3U4IA 4LBWA 4U7TB 1VLQA 4MUBA 3RRXA 4DLKA 5I6DA 1W0KD 1E3JA 4K28A 2OESA 2YHAA 2Q0XA 1K8ZB 4LSWA 3H2JA 1MAUA 3D6FA 1GU0A 3CVJA 4Y67A 2GZ3A 5IEBA 4BLRA 4ZREA 2R5WA 4UM8B 2CFSA 1WXHA 3ID6C 1QJ4A 1EZ4A 4CFZA 2MWMA 3LE8A 1WW2A 4Y6PA 3CNOA 3LAWA 3NHYA 2JZCA 5FTMA 6YASA 4O5OA 2BFDA 4B80A 5JT1A 1H6AA 1FNSA 2H1LA 1ECCA 1RCUA 3N07A 3IR5A 1HFJA 4NESA 4UUOA 5REQA 1OZHA 1HDYA 4WKPA 4IDPA 1H2EA 1K0FA 4LF4B 3RK4A 3TZEA 4FDUA 5HW0A 4BLWA 1M1YB 2GYUA 4HAUA 3OVMA 1NVUQ 5I9SA 5MGNA 3RAFC 1W93A 2RCYA 1SHJA 1UMKA 4FHGA 3UBTA 2X9NA 3K0EA 1ZJ5A 3OG9A 3P2MA 4YAEA 1A76A 4MROA 4GIBA 1Y6FA 4CEIA 2B0JA 3GAMA 4FI3F 3RG8A 3QMMA 1C1DB 3HKCB 4EA9A 3SD7A 4A1FA 4ENQA 4TTPA 4C7OA 4LRTB 2FOIA 2RHMA 3EXHA 4YMWA 1JEQB 3QX8A 5TEVA 1CF9A 2E85A 4DLVA 2DR0A 2BT4A 3K53A 1KI2A 1OX4B 2YWJA 4AIRA 2Q9CA 3GHHA 1XA0A 1UMCA 3VMFA 4KUEA 3NFRA 4C1BA 3ZXSA 3G6KA 4ZRNA 1E89A 1LW6E 1NVXQ 3PX2A 1ZOOA 4IJUA 4MR7A 4Z54A 3T7RA 3SHWA 5KYKA 3THWB 3AFHA 2PD3A 3LFUA 5AVTA 4FQ5A 3EEYA 1MJGA 5A4FS 4CKXA 3KIPA 2C4TA 3QPVA 4M0MA 4BMPB 4JLPA 4JZKA 2O4UX 1HYEA 4MCJA 5AW2A 4LQCA 4UOZA 3EGXA 4R05A 4HLDA 2GGSA 1QORA 3P2JA 4RSRA 3ZLVA 5BN1A 1K4KA 2ZTLA 2BP7A 3MJHA 2ZRGA 1R6BX 1BQ3A 2NZ8A 1IOLA 3BM5A 2O5CA 3FKJA 1TT5B 5JQGA 2H0AA 2HBYA 1L8OA 3QIAA 1TT7A 5T41A 1K8XB 1YCFA 3COZA 4B4UA 1WF6A 3UVEA 5KYUA 1QGAA 3WJAA 3T4EA 5JZVA 5IVKA 1SXJB 3DO5A 3NBFA 4H4EA 1P5JA 3PJDA 5IDWA 1HE2A 4QOSA 4RIIA 2SCUA 2JLZA 4Q4HB 1SWWA 1GZUA 2C31A 3N6VA 2CL6X 3DJFA 4F3YA 5EEHA 1B1AA 2L82A 4V3CA 1R0BA 3LHFA 1H3FA 2LZ0A 1PW7A 3MTAA 3QUSA 5BPFA 4R2HA 4AJ9A 1VA4A 3UCXA 3PUZA 1IPFA 4HXFB 3GDHA 3UGTA 5L95A 3BMCA 3K09A 4EBBA 3E4DA 4YJ2F 3SZGA 5EZSA 2O48X 2UU9B 3Q7QA 2H4XA 5CIQA 3VKWA 4NZPA 5K8CA 4LMRA 3MW8A 4Y0AA 4DC1A 5EC8A 2AR9A 1OBVA 2B4TO 3T0FA 3H97A 1JPVA 3BBLA 2GWHA 1XAHA 2RH9B 1U7PA 4E5YA 1D8TA 4YV0A 4K6KA 1GZ4A 2C7BA 3RYHB 4AQYB 3VSCA 1ZIDA 4WZBE 5FA6A 1DIAA 1NZFA 2J33A 3ASUA 4HEQA 2OOKA 4KR9A 3TTXA 4NYMQ 1JB9A 3PTAA 3T41A 4B7CA 1D03A 4D42A 1HQDA 1PL8A 2HY7A 2X23A 3OX1A 4NMMA 2A9VA 5BQOA 4OA5A 2APJA 3HCWA 6ADHA 1WNFA 3L8EA 4CR7A 1QHXA 4FINA 3IUPA 4JJGA 1ATZA 2L69A 1XCLA 2V8BA 5GMOA 4O25A 4G8BA 5E4TA 3QU9A 3JQ9A 1RJWA 3C3BA 5AW1A 5I7WA 1X9GA 1G4HA 3WQBA 1CY1A 1YR9A 4PZUA 5L4LA 3GJ4A 2L17A 1UDAA 1YJ8A 4FC7A 5CTJA 3COWA 3LUKA 3RQIA 2P40A 3TOXA 3AM4A 4XGIA 3GIWA 2QXUA 4UHCA 4GZ3A 3HYLA 3RVQA 1R15A 4PE5B 3SDZA 1L5RA 1OREA 3ZXIA 2YC2C 3FPGA 3SSAA 4NBSA 4PTZA 5BWCA 2PT6A 4YDHB 2C8VA 2FPGA 3B82A 3V2HA 2QYTA 3RVSA 3GJQA 3TQQA 5CG1A 4Q16A 1I5EA 1G41A 4ED9A 4BVKA 3P4XA 4OXRA 5CJPA 3TQFA 3L02A 3O7MA 5CH3A 5ENZA 4Q3NA 1QHHA 5LZ7A 4E5MA 1JKFA 3SP1A 3CIOA 1OTXA 4HDNA 4JWKA 1N0IA 1QOPB 2YW9A 5FULA 1LNQA 2IY7A 2XXAB 4LYFA 1C41A 1U9IA 2JA1A 2WG1A 3G9TA 3PNSA 4OQXA 5DI3A 4ZGBA 4XWYA 2PD4A 2VDWB 1DXQA 4CKBB 4NSNA 2J45A 4WN9B 1KAGA 1VJ0A 1D2NA 2GARA 3D4OA 4X7BA 5BN5A 1HLGA 1PLKA 3ODGA 3WXMA 4HXYA 1IHPA 3RSQA 3CPJB 5F7XA 1TW2A 2HCBA 2UDPA 1C9NA 4HTFA 2JGIA 4ZEOA 2XLCA 2AX3A 4EF4A 1FB5A 3TF5A 3U5ZB 3J80A 5LMNB 4YJ2A 1DKOA 1G2PA 1RDFA 1E6LA 2E4VA 1F8YA 2JHCA 5B4UA 1EFVB 2YXBA 4EG0A 5CA1B 5ADUS 2PSFA 1TEZA 4JT9A 1NMYA 1TTQB 1X7ZA 1E1YA 4RHUA 1SPBS 4RJLA 3V4ZA 1ZCFA 2QVLA 3IOMA 4KYVA 3MJFA 5AK4A 4FGSA 5BYBA 2P4EA 2VUUA 1G5HA 4ZIRB 3S81A 1O9BA 1ZOLA 3DHNA 4IDNA 4DIOA 1ZCJA 3H1TA 3U16A 4KRFA 2BSAA 4RZHA 1Z0IA 2AQKA 1AGRA 1DQSA 2VWPA 1ZD3A 2FW6A 3FSRA 2AG6A 1Z22A 2WY2D 4CTMA 4AJJA 4XJXA 4ZYLA 4GKBA 1WPXA 1NW6A 1R5JA 3K16A 2BTOA 2OZLB 1AX9A 1RW4A 5IFKA 4M1EA 1UPBA 3GLFA 2QHXA 3K0KA 3FYSA 5GOZA 4GZMA 1NBEA 4TYQA 4ZT7A 4HPJB 3V6MA 2VWGA 3D3JA 3KLNA 3RTAA 3LVRE 3V4PB 3GLGA 5CNIA 2BYTA 1JSXA 1A5TA 3I8XA 4GP9A 4DLBA 3EJWA 4ZQIA 1FNMA 4W1RA 4Y2HA 1L4FA 1VRVA 1TE2A 2BRUA 4LPSA 4WGGA 2Y4OA 4KOAA 2IL1A 1SR8A 5EPOA 5A71A 7YASA 2A0WA 3DOEA 1CVRA 3PA8A 4BCDA 3A4YA 2TYSB 2WUDA 3LT1A 2L2QA 2N0SA 3OAAD 3LMKA 4GG1A 2PU7A 4JB3A 2GJKA 4QEZA 3QG1A 3KQTA 1X13A 1U8FO 3QMVA 2ZPAA 4E2YA 2WJWA 1IHUA 2Y6UA 1GL6A 1KZ9A 2G9QA 2Q5OA 4HZGA 2HXGA 4Q3KA 4AP6A 1Z8FA 3ZHOA 3AL0C 4EY4A 3K5PA 4OFWA 1NXWA 4NENA 2IYYA 3AFOA 1CQIA 4JJIA 3KJFA 4AS2A 1CUBA 3MLEA 5KOHB 2HMWA 2HWKA 2A5FA 4G23A 3TZLA 5EJ4A 3U7QA 3EIOA 4OG2A 5DIFA 1P80A 4MV5A 1FLVA 1ZYUA 3DWIA 4B74A 1C0KA 4OVKA 4PAWA 1QR2A 1RWWA 2X13A 2RK6A 3LQ4A 4E5NA 4I3GA 5LQAA 2PX2A 1GIAA 3OOSA 3WWZA 1Z4OA 4AJ2A 4WBXC 2AYZA 5BUZA 1EFLA 4Y2RA 2QRUA 4RXTA 1N77A 3C3JA 3UHJA 2WQZA 4P98A 1YKFA 5EZYB 4EUFA 1D4ZA 1GUYA 4JSTA 4URZR 4NFHA 2XTZA 2PWZA 1L5HB 2HADA 4OUKX 5FV4A 4U3JA 3TR5A 4EYEA 3V8BA 3DLIA 3GZTB 1JLHA 3W2TA 4C78A 1RQNA 2IYOA 1DINA 1TYEB 3V8EA 1GCUA 1MKYA 1PGJA 3W5JA 3AF6A 2HXYA 4Z0PA 1Q21A 2ERXA 1OI7A 3FKQA 4ZODA 3PFFA 1OU0A 2PUHA 4JVLA 2JDIA 3GH3A 1E8NA 4C04A 4C01A 4MIKA 3DQQA 3FAZA 3RF6A 4F8JA 2O2SA 3L5OA 4QTZA 5JBIA 2Q8NA 1NKSA 1GNSA 2W6ID 3BCSA 4RHTA 2LXNA 3STVA 2WW8A 4Q0MA 4AJOA 2GD2A 2RGEA 1BZYA 4A5SA 3R09A 5I9MA 1WV0A 4PSDA 1L7MA 2OZKA 2IXBA 2QZ4A 2R2GA 3DTVA 4OP2A 2VJOA 5FPTA 5BMVF 2UVPB 3WXBA 3BYZA 1N0WA 2P62A 3HP4A 3R6WA 1AMUA 3UT5A 2XKJE 3GFFA 3UGQA 2JIOA 3GLUA 4GF5A 2XNHA 1XTPA 4CT5A 2G5TA 3M0EA 3S27A 2GN6A 1YRLA 2HSWA 3PHHA 1LLQA 1JDTA 5FOSA 4D4GA 4IO0A 5FKJA 2PYZA 5CBKA 3JQ7B 1TFRA 1XF9A 4MA0A 2HBQA 2W6ZA 4UHFA 3ONVA 4N40A 5JHGB 3UH1A 3PC7A 4LY3A 4MYDA 4JBXA 4ESOA 2O19A 2QL7A 1GQ2A 3STYA 3IOBA 4FE7A 4AURA 3FYHA 1TKAA 4DCVA 1IY1A 1FTQA 3ROGA 2QAGB 1OX5A 4RVHA 4D4MA 5AM1A 4BE7B 3E7PA 1ZH8A 4RS3A 4ZCPA 3NVAA 3WV5A 3D31A 4RH0A 5KSZA 2QN2A 3T0GA 3RNLA 5E38A 5AVVA 4BFUA 1SH7A 3V55A 1JDBB 2WJYA 3JSAA 3VJMA 5ECWA 5DYIA 4R81A 2NUPA 1YE3A 3KTAA 1O1YA 3OFNA 4WEQA 1WMSA 1I10A 3TGLA 1UH5A 2C1XA 2OPHA 2ERYA 2EJWA 3L0PA 4O4LF 1TF7A 4H6WA 2VAPA 4EF5A 4OM7A 1XO1A 1GQRA 1ZOIA 3OF2A 4HX9A 4LBYA 5H5JA 3NATA 1RNLA 1YZTA 3A25A 2PRIA 4YO8A 4CRWB 4OQNA 3TYXA 2A9PA 1N6IA 2YOGA 5K0LA 5CFZA 1N6KA 3SY8A 4MGKR 3PUXA 2IQ5A 4MWCA 2EKDA 2PN1A 2VDNB 5JPCA 4II3A 3A06A 3AUFA 3ZCPA 2GXSA 2OGZA 2W22A 3VO9A 4YTEA 1ZGAA 1F48A 4ZQCB 1NQWA 3EOAI 3OOWA 4BVHA 3ZJUA 1NBHA 3HGTA 1A27A 4UEOA 4RF5A 3CT4A 5E1MA 3WMWA 1YIDA 1MFZA 4IIDA 1BYUA 1LPBB 3VUFA 4BEJA 4D4LA 5BVGB 2Z04A 3FMPB 3LF2A 4CG2A 2D0DA 5J2UF 3C3AA 1Y6ZA 4E31A 1C3VA 1K75A 3O1LA 2IC5A 3LOQA 4G85A 3R9KA 4QL3A 1S2IA 5KYTA 1OLXB 5FA5A 5MDHA 2ZSAA 3Q9SA 1BE8A 4HDSA 2ZB2A 4E15A 3S1SA 2NTVA 3LPLA 4LJ8A 2FI1A 4MPTA 4JWTA 2GF9A 3HBLA 3PVZA 2WSBA 3L0OA 5BMVA 4GBGA 4DCOA 3MGBA 2O06A 4MKIA 5JH7B 5CURA 4LHWA 1JFVA 2R87A 4X90A 3B12A 2GAAA 3CS3A 3SYKA 4F06A 2G9UA 2ZJ7A 4HR7A 1JWAB 1GGNA 3JCZA 1QO0A 4M46A 4PYIA 3M6FA 4MA4A 16PKA 1M54A 1MJFA 4K8RB 3CWCA 3B3QA 4D97A 4UNRA 1YAHA 1U11A 2ZZKA 4LYGA 3PVCA 3MUFA 1A5SB 1NKTA 1REQA 1VJTA 4U39A 1DAFA 1CHNA 1VZ2A 3OJOA 2I2CA 3V1MA 3WYFA 4M37A 5DBEX 1F2VA 1R64A 2ETVA 5A02A 5KU1A 3KFVA 2J4CA 2IYUA 2QR2A 3EBLA 2C2ZA 3ORRA 4M0DA 5J4LA 1KMHA 2BL4A 4DW8A 1O5IA 3EW7A 3FNQA 1FMLA 2ID9A 4UDYX 1O58A 1SC4A 3U3ZA 4TMXA 2GWRA 3WOHA 3UFBA 4RGQA 1JR3A 1TUBA 2C4UA 4DB4A 1EKXA 1JJVA 1Z28A 3P0JA 4INJA 3HYNA 3L3BA 3WYBA 4BX2A 2ZREA 3IMFA 3COVA 2Q5IA 1EZZA 1S4QA 1UP4A 2DPXA 2PKRA 1VLZA 4GKAA 1Q1GA 1H2XA 5ARDA 3T3HA 3MG9A 1MHPA 1RWOA 3EN0A 4U6QA 3T7CA 3WADA 3LYUA 2PRSA 3IPCA 4ZYZA 1C9EA 1B42A 3DPSA 4RPJA 3OMLA 4OBBA 1XXHA 4RZQA 3RSSA 1OH7A 3VI4B 3U7IA 2R1TA 5E6UA 5JFOA 1N5RA 2I7VA 2XHZA 4BV2A 1KR2A 1M6HA 3COJA 3VKGA 1EBFA 1NMSA 2AI3A 2V7VA 1RTKA 4FKMA 3RS0A 3OFKA 3GGPA 3BWEA 3ZZTA 4E07A 1FXWF 4F6RB 1T5DX 4EKGA 1AGYA 2CYAA 3ZHBA 3M7IA 4FJ1A 1G7RA 3C5CA 4HDOB 4AF7A 9ABPA 2HLDA 4JV5B 2IHUA 1FQKA 3DDNA 2Z09A 5MN6A 1ZD5A 2IUEA 4QVGA 3C8MA 4GMDA 4IDOA 1OLOA 2FWJA 5DI9A 4F3CA 3NUQA 2HT1A 5CLGA 2V5AA 4DAOA 2FCAA 5JAHA 5B1YA 3RAGA 4YJFB 4KWEA 5BSFA 2GEVA 1EP1B 2Y1GA 3VO1A 4FLFA 5J2UA 1MFPA 1M7HA 3DONA 1PD0A 1SCKA 4PVDA 4Q7MB 1XTSA 1ZUHA 4CIYA 2ZYVX 4OOFA 3SYRA 1V1MB 1QG2A 2F3RA 4NK4A 3D9QX 1JHAA 2EQ5A 2VZLA 3C85A 5ALKA 1ZRMA 5BWLA 2RHTA 2GBGA 1WX1A 2GBLA 3IDQA 2FG7C 1DEOA 4WH0A 4XD7D 4HVCA 5FBVB 1I2BA 2BFBB 3F90A 1MOZA 4ZOLF 5FUWA 3TLBA 2PZEA 3W2EA 1MBZA 2ZJ0A 3PQ4A 4H0CA 4X45A 4ZQGA 2F1KA 2VCHA 5EZQA 4BZZA 5A4AA 2XHEA 3UCFA 1JT9A 4J0IA 5FRDA 3OU6A 4R84A 5TMPA 3V00A 1PVOA 2BHRA 4ZEWA 2G7ZA 5E9AA 1VE9A 2CK3A 1RQGA 1TO1E 3PUHA 3EIXA 2FOLA 1QIIA 5EFOA 2PMEA 1QTNA 3DVSX 4X97A 1PV1A 2BGTA 5B2EA 2GKSA 4R2WA 1Y3BE 1JPUA 3MRSA 4HDKA 1CNMA 5AICA 2ZBGA 5IJ9A 1KEKA 1S1MA 1ZUWA 2IE0A 3QITA 1QIJA 1Z88A 4XRRA 2CXHA 1V26A 1CJBA 1V16A 3OIUA 3V97A 5ELLA 4EZEA 1Z83A 1GKYA 4YCCA 5IKXA 4MJLA 3RYTC 3TM5A 1XXLA 1F8FA 2E4YA 1QE5A 4KO3S 5CX4A 4CG0A 2V0GA 1O5OA 2RAVA 7MHTA 3RI3A 4LDQA 1LX6A 5L40A 5I8PA 4FCCA 4EG3A 4I1SA 3S1LA 2EWMA 5AVJA 5K3DA 2N47A 3L8DA 2VF8A 3EYAA 4KK3A 4W7IA 2C92A 2ZEJA 3F7NA 1XMXA 2QLFA 4TRJA 2D4AA 4U7WA 1V71A 2XLBA 5EUMA 1W5BA 3PIDA 1NW3A 3RHFA 1CR0A 3WQSB 1M73E 4JJKA 3GFBA 4L08A 2H16A 5BN4B 1WQ3A 2B4YA 3HFGA 2I3GA 4IIBA 1DX6A 4KXVA 3SC2A 3EDQA 2B34A 3NO4A 3OPYI 4BZQA 5A4KA 2BCEA 3DQZA 3NANA 3F4LA 3QBJA 4G9GA 1WEKA 3PFHA 3VVLA 4I55F 4CQMA 1FS5A 5BR4A 3H05A 1Z7GA 2IX3A 1SQ5A 1YZVA 3H2KA 3KEFA 4AYTA 2PRKA 3QSYA 1ENYA 4M49A 1GARA 2KYRA 2OCDA 2R66A 2H9AA 3L7IA 4W8HA 3ULKA 4B6FA 3D7KA 5NLLA 2XZPA 4CM1A 1MQSA 1KR5A 1JZQA 2HK6A 3G79A 4L0QA 2DBYA 1N7GA 3L1JA 1JGTA 5U9CA 2Z5VA 1UXHA 4L4RA 5K2OA 1JKJA 1FMFA 3MUEA 1B73A 2F59A 2QGFA 1IY8A 3N2NA 5EKTA 3JQAB 5F1YA 3WB2A 2Q29A 2YIDA 1M0TA 4E3WA 2WJVA 2GHTA 3C7TA 2NUAA 1YR1A 4GYKA 3DO8A 1RAIA 3V7UA 3I53A 1N57A 3DTVD 3GOQA 2WD8A 1M2VA 1UKAA 1DG3A 2BJWA 4GX5A 1GTJ1 4X41A 2D1RA 2Z95A 1UPAA 3EZ2A 1VYVA 2Y66A 3OF3A 1JSZA 4DLUA 4ZOLA 1KJ9A 4KN8A 2W83A 4ZCSA 2Q6OA 1CRLA 1W88A 4K5QA 3K0FA 1YDFA 1N7JA 2PXCA 3P9YA 5F7ZA 3QYAA 3LUCA 4GR9A 3DEYX 1SHTX 1H1LB 1GPNA 3QPUA 3VYUB 1SBHA 2ZWIA 3CKKA 3DPUA 3A6GA 4DA9A 4KKVA 4JT8A 2GZMA 3U3KA 2IDZA 3NKFA 4OSPA 4X7PA 5JPIA 4BGUA 5JZ9A 3RRYA 1C3XA 1C9JA 2X8JB 3PGA1 2X8WA 2PO7A 4CV1A 2I99A 3KZNA 3PC6A 3PNOA 1XUOA 4BC1A 1Y81A 1ZUNB 4N5DA 3GCDA 2CFOA 1TZKA 1NE2A 4TV9B 4RVDA 1Z6PA 2JZNA 3U37A 4OLFA 4F5DA 4DBLC 3PQFA 4W9MC 2CVQA 3D4BA 4OHUA 3SYLA 4AKSA 4UAVA 2VR1A 4PYRA 1RRMA 1OBHA 3JV7A 3S2UA 3WGUA 3IPAA 3BULA 4F93B 1X94A 2R3SA 1V11A 4JC4A 5KOJA 2PXHA 2J9GA 2Z1NA 4NX2A 1R7RA 1KSJA 1H0HA 1Q6YA 4I5GA 1ADGA 3OFND 1JAYA 1ICEA 2IZ5A 1FDRA 1ZK0A 3BE6A 4Z1MA 3NYRA 4PSKA 1VC2A 1MNAA 4QLAA 3OQMA 3UHPA 2XNJA 1OHHA 3BWDD 1L3BA 4HQLA 1XZPA 1PE0A 3PYMA 4MVJP 5K01A 4ECEA 5AVXA 4PO9A 3P32A 4JU8A 4V0OA 1EWKA 3K0HA 3QF4A 4BV9A 2WG2A 4NDAA 1DDGA 1Z38A 4I55A 4JNKA 3B1KA 4ND8A 2AN3A 5JAQA 1NNUA 5EKXA 2YOFA 5IJAA 3EZGA 2IQIA 3VHQA 4GI5A 4R8RA 3TS1A 5A5VA 4NVRA 1LC0A 4LRYA 1AXGA 3E3NA 3V4VB 1EGMB 3K1TA 4TTAA 1H85A 3GZ4A 5E3JA 5E7IA 221PA 2W6OA 3EXEA 3PGKA 3HVJA 1YBFA 2H31A 4KUHA 1TZBA 1JDBC 3NUZA 4RHXA 1E32A 4LIPD 1DL5A 1JLSA 1AUQA 1O6CA 3DH0A 5DU2A 1ILEA 2JFUA 1HLPA 2ORYA 3TH5A 2QPTA 4MR8B 2HJHA 3AP1A 3BPSA 4NI5A 3AO0B 3N53A 2FN8A 1TMOA 4G9EA 4MYRA 2WTNA 1RPJA 1VIAA 2VTBB 1MQ8B 3FDZB 4U63A 3DBRA 4MW2A 1GKKA 4BUZA 3QEAZ 5JNLA 5HS4A 2JIBA 3GRKA 4WDQA 5FLKA 3KETA 3GJ3A 3Q6NA 3A7DA 4DF3A 2RKWA 4JXXA 2B1GA 2NXCA 1FSPA 1Y7IA 3H5AA 1SM4A 1T6BY 2ZBPA 5EMKA 3MS4A 1YUBA 2IV3A 3UK2A 2Q9UA 1YJBA 3I2KA 1JH8A 3RAEC 3AETB 4DCSA 5AWFC 3VDNB 1Y3IA 3F3KA 2ZBVA 4X20A 1N6OA 1EK0A 2PZBA 4J1QA 4ACAA 4YALA 1AQUA 2ZI3A 1QS0A 4PGMA 3ZBUA 2AA3A 3BGDA 1GTMA 1MGOA 3E9MA 1X77A 4ZRDA 1W0JD 2F7SA 4JR0A 5K8TA 2WZBA 3I3SR 4NPCA 3L77A 4ZV4A 3TLZA 3NTLA 2XH8A 4URYR 4JK3A 3N3AC 1GDTA 3CEJA 1ORHA 2IZOA 5IK2A 3EIUA 3AB3A 3EA5A 2YNMA 5TPZD 2ZPUA 3LPDA 1X7WA 4FYXA 4A8JA 4DYHA 3AB7A 1XNJA 2FW8A 1PBTA 2XQJA 3A6KA 3IQXA 3NAGA 3QBDA 5A7HA 2C2OA 1G8AA 4L8GA 4B3HA 3IAFA 4V0LA 4EGSA 4Q1CA 1CS0A 3HO8A 4U8GA 4S1OA 1YGPA 1P74A 2PSEA 3A9RA 3K8OE 3MUOA 4QTXA 2FPWA 1VJ1A 4MVJI 1T3TA 4R8KA 3LW8A 3RO7A 4C7VA 2GKOA 2ZROA 4H77A 4XQ9A 3BFKA 2WPDA 4AECA 4WXYB 3OLVA 1E7QA 2C7OA 4UM9B 5JVDF 4YJGB 4YT5A 1M2HA 4CIDA 3TEJA 2K87A 4DEVA 4ETIA 4DV7B 1X80A 3NDJA 4E12A 4KRXA 4BEWA 3JZAA 1JXQA 1ZITA 1D5WA 4MV3A 1E1CB 1RKUA 2XUJA 3ZS8A 3IH5A 1GA4A 3DB2A 1JN0A 1FBNA 3WB9A 1XEXA 1N3IA 1SVKA 2EQBA 1EX1A 1XZQA 2E4ZA 3KR0A 4IGKA 5FUVA 2MCFA 2RD2A 5IF3A 2HLDD 1IZ8A 1ILWA 2XBLA 3F97A 3ZV5A 2EDCA 2PRJA 3MF4A 1EUYA 4HQ0A 3EDYA 3R0ZA 3LD9A 1IRIA 3RVOA 1ZFNA 4D6YA 4PXAA 4NWIA 2PBZA 1EXWA 2F1JA 5JDIA 4PSUA 3G3EA 4H7IA 5FYQA 4GI1A 5MN5A 2HU2A 2ZS8A 4XQEA 3Q8XB 3JYHA 2RGBA 4CM8B 5DN6D 3EC2A 5CB8A 5CJ2A 4DRZA 2ATCA 1UANA 4WJLA 5L6LB 2EFJA 3EG9B 1LS1A 2ACVA 3KE9A 3MERA 4GEGA 3VU9A 4AUEA 3AL2A 4CMIB 3D7MA 2JLBA 3GFQA 3OQ1A 1U6IA 2HTEA 2I4IA 2P3QA 1G3IA 2AXPA 3OZEA 1QRAA 4ID3A 2X0NA 4P08A 5DHUA 3VRHA 3VR2A 3L7OA 4WPGA 1HQYE 4XEHA 5F2NA 5DNAA 3SVTA 1AS2A 2X41A 1ZD2P 3N74A 5L45A 4C43A 2VYQA 1M2OA 1CUVA 1LNSA 3MGGA 4GC5A 1CZNA 1II9A 1IN6A 2F1RA 3MEQA 2E5FA 1LDBA 3PT9A 1Q50A 5A06A 3PXCX 2A35A 4ENVA 1NSYA 4TROA 4ZVTA 3T9EA 3UJBA 1M34A 5JNWA 1R27A 3B6MA 1VPDA 3K6JA 1H69A 1AVTA 1RXUA 5DBGA 4EP1A 1J0XO 1QRUA 4JELA 8MHTA 4X65B 3P4UA 4FYJA 4QICA 5C31A 5KX5B 4MICA 3GNQA 4D25A 2P6MA 2VT3A 4FDVA 4HO1X 5EWJA 2QT1A 5DFAA 3V8QA 5A4MS 4OK6A 3W5HA 4EA7A 3ZY3A 1WW8A 3IA7A 3G0GA 3O8NA 3WRVA 2JW5A 4AY4A 4BECA 1JE0A 2JGFA 2O0KA 2FWAA 2VO1A 5TIIA 1XOIA 2ZR9A 2ZE8A 3ZLUA 2FZEA 3UB3A 5CLIA 3EEIA 1U3WA 2GASA 4TQGA 3GFVA 4KO8A 3C6YA 4H6XA 5KYVA 4CDMA 4NOMA 1FPQA 4BNIA 1K3UB 4IQ8A 3A4NA 1BVUA 1J20A 1FJHA 1T91A 1WSWA 2CJPA 3LXXA 5CUQA 4BNLA 1FXUA 3W9UA 2H9IA 3VNVA 1LPMA 3A6FA 5JVDA 2ZSEA 3OTHA 3ZX5A 4ZMBA 2VH1A 1G8SA 3RVMA 4Z1MD 4Q1FA 4BGEA 4NH0A 5H80A 1Z4LA 2WINI 4MKGA 4AJPA 3U1BA 4TTJA 2NSYA 1FRVA 1X8KA 1Q57A 3FCCA 4PGFA 3ZWKA 1CZOA 1JJBA 1SUEA 1T0UA 1Y1PA 2BFMA 5AI6A 2D62A 4TGLA 5A6VA 2QTRA 2IVZA 3NAQA 3CPEA 1D2MA 5EP3A 2WPNA 1M6NA 4LOAA 2BGJA 4MXDA 2FDCA 2B2CA 2W2XA 1RFLA 1XHLA 2XZDA 2KX7A 4JP5A 5FFNA 5TMBA 2VZ0A 5FWDA 5ITZA 4DR6B 1Y4SA 3ETNA 3FSGA 3RRZA 4BNVA 1OZ0A 3M5DA 3TZ6A 1X1TA 2BFFB 3NM6B 1KTIA 2VXBA 4AX8A 1R8QA 2XUZA 3OE4A 4PY2A 2OCYC 1KZHA 1ISMA 4DY6A 3JPWA 1FDVA 2XE7A 2BMAA 2FXIA 3W4JA 1IN1A 1SHLA 3VC7A 5TPWB 1U7TA 4Y2QA 2CZGA 3N7TA 4Q7JB 4K9PA 1SEVA 2H4HA 4CKCB 1H6CA 3JASA 3TFWA 3N86A 3QOFA 4CIWA 1N8KA 5J5AA 2Q6IA 2G1AA 2AH5A 1P1RA 4KN9S 3RRFA 3UAGA 3M5CA 4QNMA 4WSOA 4BNNA 1J90A 1I2ZA 2J4FA 4FD3A 4NQRA 4B79A 3O03A 1O89A 3ZU4A 4EHKA 1FFWA 1H3NA 3BHNA 3MCUA 4BLQA 4YRGA 1R0RE 3BXZA 3WL3A 3MRXA 4LHYA 3WLAA 1U8CB 4Y6RA 4B3BA 4YRFA 2Z2YA 4DJDC 1F1JA 1Q1QA 1AUPA 3GEEA 3FMGA 3W04A 5E3IA 3RSZA 1PR6A 3OBIA 3SJCA 1FU4A 2R5NA 2Q2NA 3IJEB 4OO3A 5JJIA 1KO5A 2DWOA 4EJSB 1XELA 2V7WA 1S8AA 1ZIYA 2YKGA 3W6UA 3MWFA 3NDRA 1H4TA 4ZJUA 5FOUA 2WA2A 3ZLBA 5HA5A 4PN3A 2XAUA 4G0MA 5CXQA 4MR9B 4YMIA 4D7AA 1WXGA 3AERA 3I0MA 4LQDA 1BMQA 4GU5A 1JJAA 2Q2QA 3OPMA 5AXCA 1Z74A 3RSGA 3ZX4A 2HC9A 4BDTA 4IJVA 2B25A 3BMNA 2B20A 2PBRA 1Z5GA 2PX4A 2XXJA 1NYRA 3DDWA 1L5QA 3NI2A 4CCYB 4Q3OA 2FF7A 3ZDRA 1TVMA 2PK3A 4NZ9A 5E2IA 5SZIA 3EF3A 2CN1A 2O6HA 3DD5A 3G0OA 4FFBA 5E7JA 4P8RA 1SD1A 1KI8A 3KJNA 4JJ6A 1SIBE 4WNAA 2D00A 4F6CA 4R8LA 3RRJA 1XD2B 3A9VA 3FUCA 4YO7A 4ASUA 4Z99A 1Z4KA 3K4PA 4HJXA 1Y7HA 4LY6A 4ZU3A 3U9SA 1KP2A 1Y6GA 2NQTA 1GQFA 4KB5A 4RA9A 5BNWA 5DHFA 4M7RA 4GPD1 1TAUA 3I62A 4BMZA 4MITA 4C05A 1BC5A 3NXSA 4ZO9A 1WL8A 3KHSA 3OCXA 1UBNA 1E60A 1VMEA 5FTKA 3TCNA 1DX4A 1ZUD1 3AHJA 4JBGA 2BGRA 2P1RA 3EVBA 5ERYA 5F98A 1E18A 3BD8A 3WGZA 4OL9A 1AC5A 2OC9A 3EULA 3BN3A 5EXXA 2BSXA 4K9RA 5LWQA 3QKUA 1SVUA 5ER6A 2B7LA 2AG5A 2XMQA 3NEAA 3RF7A 3D8SA 5KNDA 4OBXA 3G7SA 4H15A 1FP4B 1E3WA 1FFCA 2LGJA 1RLTA 2ZBFA 3D54D 5BT9A 4CMGA 2AT1A 1J0EA 1WETA 2YJZA 3LFTA 3Q8KA 4RNDB 2YH2A 4O2BB 3VU1A 3J7TA 2A1TS 1BRMA 4M1KA 3SJBA 2KI5A 1OB2A 5LQSA 4KI7A 3FBGA 3RNOA 1SOMA 3NBZC 3EQ9A 1UZMA 5D3MB 1VBMA 5A0FA 2YJNA 1QTQA 3LP6A 4RDCA 1M0EA 4G81A 3D3WB 1K0UA 4MK4A 4QDZA 1NQ5A 2IPNA 4P58A 1OE0A 2KB0A 2VPWA 5HTOA 1U2EA 1YR2A 1RQLA 1G2OA 1UBRS 2DPYA 2GM3A 2BZSA 4HQKA 5GP1A 3ZY4A 4JUAA 1VGVA 3ETLA 2GA9A 4N8DA 4PLWA 4BYMA 3DXFA 4N6NA 1DDIA 2ZSUA 3FNFA 3M1AA 1VE7A 4DAEA 1JSCA 4XIJA 4WY2A 2J7PD 5EUCA 5KQMA 2FPUA 2BD0A 3HRKA 4Y7CA