4RZHA

Crystal structure of fabg from synechocystis sp. pcc 6803
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
234
Chain Sequence
ALTAQVALVTGASRGIGKATALALAATGMKVVVNYAQSSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQKSGRIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIAPILQFIPLARYGQPEEVAGTIRFLATDPAAAYITGQTFNVDGGMVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Structure-directed construction of a high-performance version of the enzyme FabG from the photosynthetic microorganism Synechocystis sp. PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Oxidoreductase
total genus 84
structure length 234
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rzhA00
5JE8A 3C1OA 1TA4A 1VJ0A 3D7LA 3P7MA 2UV8A 3OP4A 2JL1A 4IIVA 3FSRA 2RH4A 1ZSYA 4FPXA 3D64A 2BFOA 2PFGA 3SJ7A 1V0JA 2QRJA 2ZCUA 1LEHA 1E77A 1BXGB 4FC7A 1CQIA 1ML3A 1NWCA 3GPDG 1M6WA 2J5QA 3MWEB 2QYTA 4UULA 3WGOA 3OQBA 3RUHA 4BKUA 4A10A 3V2GA 5EERA 3PHJA 5DCWA 2YY7A 3NGLA 4QQRA 3WYBA 4BNKA 5F1KA 4DC1A 4H3VA 1HE2A 3GGGA 3QWIA 5I7VA 1GDHA 4RVHA 1EE9A 2OP0A 5TSDA 5BSGA 1J49A 5JY1A 5IZ4A 4XA8A 4YAGA 3L9XA 1C0LA 4IPTA 1VSVA 4R9RA 1B3RA 1Y6JA 4GX1A 4Q3NA 2CDAA 3VAZA 2DU8A 1YQGA 4NBRA 4NPCA 1IL0A 3NYWA 2C0CA 2DPGA 3DTYA 5IDWA 3NDJA 3RJ9A 1RM3A 4BB6A 1LI4A 4QECA 2VNAA 3O03A 3X2FA 2VHZA 3HB5X 5AOVA 4QT0A 3GG9A 3OQ1A 2B4RO 4LN1A 5BNFA 1JKJA 3WOHA 1YS4A 3GZNB 4W4TA 1EEHA 4BNIA 4ZHSA 4J7XA 3UXYA 1I36A 1I2ZA 1QXSA 3GR6A 4YAKA 3F47A 4YAEA 4O63O 1B26A 1E3EA 5K6AA 4XZ3A 2C07A 3PWSA 2HRBA 1KERA 4G81A 3BMCB 3BMQB 3T4EA 1KETA 4BV9A 3U5TA 4N5MA 2H6EA 3QHAA 1NNUA 2VN8A 3ROKA 2ZTVA 4HFRA 3VZQA 1I3KA 3PJDA 4MVJH 3QA9A 4NBWA 4X54A 2IODA 3UOGA 2NVUA 2ZIZA 3EZYA 1M67A 1D1TA 2PGLA 1YOVA 3MJ4A 3WLEA 3PVZA 4PG4A 1YB5A 5THKA 3DAPA 2D8AA 4CQLB 3QVXA 4IXTA 8LDHA 1PS9A 2I99A 3JQ7B 4CMKA 1I33A 3DZKA 1DJNA 4DYDA 1RPNA 1HSZA 5A02A 4O6VA 4RZHA 4AJHA 1NYTA 3JD4A 2C82A 1E1NA 2AG8A 4FJ2A 3E9QA 1LRKA 3B6ZA 5AXBA 5A9SB 3QWBA 2DM6A 1K6JA 4WCFA 1PWXA 2E4AA 1CQJA 3DZFA 4WLEA 2E49A 2X8LA 3LC7O 5F21A 4DIOA 4BNXA 3W4JA 2E48A 3CEAA 1RM5A 4YDRA 1GEEA 1DHTA 3KOUA 3ON5A 4M89A 4QEDA 4Z0TA 5A06A 2AXQA 1IYZA 3MJCA 4J6FA 2NACA 3ZW8A 5JXWA 4K6FA 4NDNE 1XQ6A 3I4FA 1NP3A 3PGJA 4CR6A 1T4BA 2Y67A 3Q9UA 4QO7A 1SC6A 4PG6A 4BNVA 1Y9AA 4MVJD 3OICA 4IDEA 3NRCA 1FMCA 1E3WB 4YT4A 1HZJA 2DKNA 2R2GA 1R4NA 1WDKA 2JCVA 1FDTA 3DHNA 3PYMA 3HDQA 4NIMA 1Y8RB 5L4LA 3JQEA 4IMRA 4JNKA 4CLDA 3PWZA 1GAEO 4DTIA 5HM8A 4OKNA 4OQYA 2PH5A 5I9MA 4MOWA 1SMKA 3FNHA 2HJRA 3PIDA 4F6CA 4YRBA 3A9WA 2YHUA 2GZ3A 4E2ZA 1GQ2A 3ZDFA 1DRWA 3ZU3A 4DREA 2AG5A 4MVJI 1P1FA 4AFNA 3JQ6A 1SCUA 3GUCA 1SOWA 3VDQA 2YHIB 2X0RA 5COAA 1ZK4A 4YACA 3NGXA 4GH5A 3DBVO 2WD7B 3RKUA 3JQBA 1SZJG 4CM9D 4UREA 1JU9A 2JD1A 1QLHA 1Z82A 5TX7A 3TJRA 1QR6A 1HDGO 3P19A 5DOVA 4YWJA 1MXFA 5DP1A 1UZNA 3JD0A 1SB8A 4FBGA 3PGXA 3NT4A 5MDHA 5DCUA 2FZWA 5EESA 3QWAA 3COSA 1EDOA 4BO0A 4PVDA 4CUKA 3WSWA 2EHDA 3HB4X 5CG1A 2JHGA 3ADPA 2PD4A 1X7DA 1LSOA 2DBVO 4XYEA 1H6AA 7ADHA 2VT2A 1GR0A 3RI3A 4IY1A 2JFFA 1GY8A 1UP7A 3JYNA 2YYYA 2W4QA 3C1TA 3HE3A 5L4SA 3ROMA 4CQMB 3C85A 1SAYA 4XGNA 5DBGA 3Q11A 4OMUA 1WLYA 2QW8A 5I7EA 4O1MA 3CUKA 3MTJA 3F1KA 2VHYA 5G0TA 3RWBA 2IXAA 1E6EA 1P33A 4NQZA 5C5IA 4PRKA 1CWUA 2WSBA 5T5QA 2I76A 2ILTA 3TWOA 2BFAA 4LSMA 5CDTA 3BHJA 4R41A 1ISJA 2IYOA 1LQTA 4MIYA 3VPHA 2X4GA 3KYCA 4XDYA 1Y5RA 3VZRA 1H9BA 3GVCA 4YJGB 3KBOA 2FHSA 4B4UA 4CLHA 4OQZA 1KC3A 3H2ZA 4GGPA 2PKQP 3QY9A 2FZEA 1VJ1A 1BW9B 4WLVA 1DFIA 2ET6A 2WD8A 3EMKA 4H15A 2RHRA 3LZ6A 3SC6A 3L4SO 4BNJA 1HLDA 2X58A 2FMUA 4XGIA 4XIYA 4KP7A 5FI5A 3ZWPA 3KETA 1SEPA 1H5QA 3ZGYA 3OF2A 2AEMA 3KVOA 3OEYA 3VH2A 4A73A 3D4PA 5CPFA 4PIVA 1AGNA 1AHIA 3HQ4O 4QTZA 3AI1A 3OMLA 1KVTA 4L76A 3HN7A 3U62A 3L0DA 1H0KA 4TRNA 1C14A 1ENYA 3B1JA 3ZWOA 4PGFA 5A04A 4MINA 3WS7A 3ZU4A 1WP4A 2WJPA 3WFJA 5TS3A 1VE9A 4IGFA 1O0SA 4DL9A 3WYCA 5JNLA 1KYQA 3WGIA 1G0NA 1DC3A 1ID1A 4RDHA 4RPJA 1NFFA 4FGWA 1DPGA 4DBZA 4H16A 2UVDA 1P45A 1R37A 3BIOA 1YBAA 2Y93A 3LQFA 3OJEA 3JYOA 1E7MA 1Y7TA 1X0VA 2J3HA 5TJ9A 3ZWNA 1QV6A 3EW7A 4IZIA 1E6UA 5LC1A 3H6KA 4TWRA 3OBBA 1XQ1A 3LF1A 1N92A 3C24A 3JQ8B 4PZCA 5DCYA 2WDZA 3BMNB 1EMDA 4II2A 2AW5A 4QFDA 3Q9NA 3C7CB 5I8ZA 3DZIA 5BSEA 2GSDA 3X2EA 4E4YA 4BNLA 5U1PA 1R16A 4ZGWA 3P2YA 2HMUA 1NQAO 4PG8A 2FOIA 1UDAA 1CETA 4IQ8A 1R4MA 8ADHA 3K8ZA 5FF9A 1YBMA 4B7XA 2PKQO 3W8FA 2ZB8A 3RBVA 3AOEA 4CM7A 4B4OA 4BKPA 4XJSA 1RJWA 4Z9FA 3WQQA 1BDMA 2YQ4A 5CEJA 3AUAA 4ZA2A 4E5MA 2RAFA 4TRMA 3KYBA 3H9QA 3PDUA 2P68A 4FW8A 4Y98A 1B16A 4DRYA 1DIBA 4WUVA 1HXHA 4D45A 4WPGA 1EK5A 2V6BA 3JQAD 1LJ8A 1NASA 4BO2A 4I5GA 3RAJA 4DLAA 4XB2A 1LLUA 1PQPA 1V3VA 1AHHA 2UUPA 3C3XA 4UUNA 1GYRA 3H7AA 5ER9A 1E0DA 2Q45A 2XAAA 2WMDA 2RHCA 2NADA 1GUZA 1PQUA 1U1IA 1V8BA 1XU9A 4MVJM 4PG5A 5G4KB 5HS4A 1NPTO 2EXXA 3W4IA 4XQGA 3H5NA 3INTA 1P1KA 3PQFA 1PJ2A 4HNHA 4R5MA 4CMEC 4PLCA 3HN2A 4A7PA 3U4HA 2YV2A 3A4VA 2UAGA 4PCVA 4CR7A 3BHMA 2Q49A 1FK8A 1UUFA 2X22A 3HG7A 3NUGA 4CMGA 3DONA 3DB2A 3GN2A 2OMEA 1HT0A 3GEMA 2NU6A 3FI9A 2HK8A 3CIFA 4J9VA 4B79A 2VCYA 1VL6A 4B3HA 3WX0A 1J6UA 2VRBA 1V6AA 3DBRA 3H9UA 1K3TA 1M75A 3UFXA 2BKAA 4GVXA 4UUOA 3ZV5A 1PJTA 4FFRA 4UVDA 4XYBA 1WDLA 5BR7A 4BNYA 1SBYA 4B7CA 1B0AA 3MZ0A 3SXPA 5IN5A 4L73A 1JN0A 3GEDA 3KM0A 1HDOA 4I9HA 4BMSA 1J5PA 1OMOA 4ZQEA 6ADHA 3I4CA 1TT5A 1A72A 5CFZA 4XD2A 3WICA 3SVTA 3NJ4A 4P4GA 4TZTA 3PTZA 4GKBA 4PLYA 1IY8A 4J4BA 1B8UA 3WGTA 1ISIA 3M2PA 5CPBA 3IUPA 2DTXA 3DWFA 4IQGA 3ADOA 4RGBA 4GL4A 4XCVA 1AXEA 4LW8A 4DMMA 1EFLA 3GFBA 4LK3A 4GX2A 3Q2IA 3GUYA 3S2GA 1P1HA 4NBUA 1DLJA 3VZSA 5ILGA 3CXRA 4GQAA 3OJFA 3I1JA 4RJTA 5KJEA 4WE3A 5BT9A 3TFQA 1MX3A 4OH1A 3C7DB 4BNFA 2CVZA 1VJTA 3WFIA 2Z5LA 4YBZA 3GDGA 4HFNA 1LQUA 4XDZA 4AJNA 3ONFA 4UVIA 4Y67A 4WCFC 2EIHA 3IAHA 4C4OA 1GU7A 3KYDA 3FNFA 3GNQA 2Q1TA 4E5KA 2VRCD 4OOFA 4E0BA 4XYGA 1JLLA 2GR9A 1WVGA 2I3AA 2O3TA 4BNHA 1J0XO 3TN7A 2IE0A 4AJOA 5J23A 1ZKMA 4I5EA 4L4XA 2G76A 2X7HA 4ZQBA 4ZQGA 1XA0A 4XB1A 4YQYA 4JXKA 4NK4A 2AE1A 2YFQA 1V9LA 2W2KA 4AJ1A 3DHEA 3UN1A 3DBHB 4PRLA 4CLOB 2BF7A 3PJGA 4WASA 1ENOA 2TMGA 4OKIA 3RUDA 4F45A 4OM8A 4Z9YA 5ICMA 1OAAA 1UJMA 2J3KA 1KVUA 5CEFA 2QZZA 2X5JO 4NU6A 4BNTA 1PZGA 1VI2A 2GPTA 2PR2A 2C54A 4K6CA 1YDWA 4CJXA 3GNSA 2YDXA 4KQWA 4E33A 2Y1FA 4FJ0A 5F1PA 4O5OA 3P2OA 4CV1A 1PZFA 3NT2A 1U4OA 1U3TA 4FD3A 4PN3A 3KLMX 4B4WA 2HAEA 4II3A 1H2HA 1NHWA 4J2HA 2DBZA 1OBFO 3C1AA 1BMDA 3G3EA 2Q2QA 2Y66A 1LLDA 2GERA 1YH3A 1GV1A 1IOLA 1C1XB 3JQBC 3TOXA 4DC0A 1T4DA 2EKLA 2WE7A 1XLTA 2IEDA 5L7TA 3DEYX 5C37A 4K9DA 4A03A 1VC2A 5TT1A 5TQVA 4HP8A 2B36A 2LDBA 3VPXA 3JV7A 3WYEA 3DAGA 5TLSA 4YVFA 4DIBA 5LDHA 1DFHA 1LDEA 1UAGA 3H9GA 1YONA 5JMPA 5A05A 5HWSA 4IJVA 3H3FA 5A03A 5AVOA 4NZ9A 1W0CA 1PGQA 4CR8A 3D5TA 3VKUA 2EJVA 2JAPA 2D5AA 2EG9A 2W98A 2C2XA 1LRLA 1B15A 1ZW1A 1F06A 1H9AA 1IZ9A 2QRKA 4MVJG 5BNTA 3LF2A 2ZYGA 3PP8A 4MVJF 1RKXA 3TQHA 3WIEA 5DNAA 5KVVA 1D7OA 2GD1O 3DOOA 1PJLA 3AM3A 3NTOA 5GZ3A 4KTTE 1UXKA 4L8VA 5H83A 3LT2A 2G17A 4OYRA 4CM1A 4L4RA 5U9CA 3E48A 1YL5A 4K1LA 3UF0A 5FEUA 4BQPA 2VUSA 3AFNA 2PA3A 4NJMA 1Q7CA 1GPDG 5A3VA 4L4SA 5IDQA 3KRTA 3TSCA 2ZTMA 5IN4A 1K6IA 1UXGA 1NPYA 1HYEA 1ZMOA 3IP1A 1GFSA 4UEJA 2UDPA 2EKQA 4UEOA 1E7RA 2VUTA 4JP3A 4XQ9A 2BGLA 2NM0A 3S2IA 2HMWA 1F17A 3JQAA 3DC2A 3ZCXA 4FR5A 4DLBA 1HE5A 1NXQA 4HNGA 1UR5A 1YRLA 5IDXA 5DF1A 3A28A 3NKLA 1BDBA 5HRUA 1KEPA 2NVUB 1X1TA 4M87A 2CVQA 4MKRA 1TVEA 1F12A 4CM8B 3W6ZA 1BVRA 2I67A 1EVZA 3JD3A 3O9ZA 4Q3BA 3RASA 4Z3KA 4AJKA 2P5YA 4HFMA 5KKAA 1Y9EA 4ROSA 5CDGA 3HFGA 1SB9A 3QWFA 3UCEA 1ONNA 1E1KA 4XR9A 1PL6A 5JY6A 3ROPA 4HXYA 3GEGA 5KJCA 2DBRA 3ANLA 1EQUA 4E2XA 3I6QA 1UDCA 1T2CA 4M55A 1ISMA 2JD0A 2RH8A 3HADA 3IUSA 2QRLA 1NHGA 4I9NA 4WCFB 4D0SA 1ZO8A 3GOHA 2NLOA 3ZHBA 3T4XA 2VTEA 2XPCA 4E30A 4NH4A 3ICCA 1QSGA 1N7GA 4Q9NA 3RJ5A 1N9GB 4AJLA 5JAZA 1PS0A 2XXJA 3HDHA 1E7SA 1E3SA 4EITA 2W8ZA 3K5PA 1LBEA 2B35A 4J2OA 1QLJA 1EUZA 1K6XA 2VNSA 3GG2A 1XR3A 3V1UA 1EUCA 3GN1A 4WLOA 2JCYA 4I8XA 3QP9A 4AJEA 5G0WA 2WTBA 4RDIA 3ZWCA 4CMEA 1FJHA 2LDXA 2Y1OA 3IQDB 3UH1A 3K31A 4FDAA 3ZWBA 1R4NB 4XGKA 1W6UA 3TZ6A 5JDIC 1NR1A 3HUDA 1OFGA 2Q99A 1BGVA 4D42A 1ZNQO 3I3OA 2V6MA 4FOOA 4GWKA 2O3SA 5IAAA 4EJ0A 1KOLA 2ZB7A 3AM5A 2QX7A 4LISA 3T7EA 4ZJUA 4UAGA 1GZ3A 1Q1NA 4RORA 1T2EA 4ALNA 2VWPA 2NSDA 4IDAA 5G0SA 3FBTA 3ABIA 1HE4A 1CYDA 1FF9A 2O3QA 1OC4A 3AM4A 4W9NA 3AOEC 3FTNA 3D3EA 3FR7A 2I6TA 2GN6A 2FY8A 4ALKA 1XYGA 4WLFA 1P9LA 1H6BA 3AI2A 3JD1A 4GGOA 4KUHA 3E03A 4TKMA 5JCXA 1WMBA 1XKQA 4U8GA 2VRCA 1C1DA 1Z6ZA 1C0PA 1RM4A 3FPCA 5JCJA 4LRTB 1ENZA 4J16A 1UXJA 1O95A 4J91A 4YJHA 3ICPA 4BL5A 2VOEA 3UKOA 4EZBA 4GSKA 1MXHA 1WAMA 1SPXA 3ASUA 4J4HA 3K2BA 3TL3A 3MJEA 2H63A 3NX4A 1LDGA 2EF1A 2NU7A 4JIGA 2VZ0A 3K2EA 1PQWA 2C5AA 2Y05A 1E1MA 4FOSA 3SC4A 2CFCA 3RROA 3L6EA 4WLNA 2EGGA 3TZKA 5A9RA 1FDWA 1DC4A 2WM3A 3KEOA 5B12A 1D3AA 3HHPA 1F8FA 4D0RA 1E7YA 3ITDA 4WCDA 1P31A 3RUIA 1PTJA 2CVOA 4OJNA 5HA5A 4R4JA 5KOIA 3WQRA 4S3MA 1X7HA 4AG3A 2VWHA 4W82A 5JDCC 3NEPX 1NVGA 4NK5A 1JWBB 4BQRA 2YV3A 3BZUA 4JROA 2JFHA 3G1UA 5L9AA 3DL2A 3LC2O 3BTSA 1R0SA 3L07A 3L4BA 4BNNA 1MFPA 2Q1WA 1HZZA 1K5HA 4Z0HO 3Q6IA 2ZQYA 2GUGA 3KYCB 2Q50A 5CDSA 3WJAA 4BS9A 4XIJA 4LVCA 1E92A 1LNQA 2Q3EA 1MP0A 4FN4A 3SLGA 3WWZA 2I3GA 1BXGA 2JJYA 5F3RA 3IP3A 1YKFA 3QVTA 4PLVA 5JO0A 3IL2A 4P22A 1O9BA 3IDSA 4CMJA 1KEVA 1I3MA 1NM5A 2OHXA 5IJZA 5L51A 1UP6A 3ETEA 1YVEI 3I9JA 4EJ6A 5I8WA 2DLDA 3ZHXA 2QYSA 4D44A 3OA0A 3ZU2A 2FR8A 1O89A 4NI5A 3W1VA 4AJIA 2J3IA 4NNJA 3ORFA 3ITKA 1ZZEA 3U49A 3JSAA 4IINA 9LDTA 1UDBA 2CY0A 1X13A 5EIOA 2NQTA 1PGOA 1DAPA 1PGPA 4JP2A 2HCTA 1E7QA 1M76A 4HKTA 2DBQA 3NV9A 2VZ8A 2Q2WA 2V7PA 5T8KC 3OA2A 1A9ZA 4AJ4A 1GYQA 2YZ7A 2NTVA 5F5NA 4EUHA 2BMAA 2GF2A 1PJ3A 3H2SA 3OQ6A 3PYLA 2C7GA 4OHUA 3BMCA 4ND5A 1Z45A 2P4QA 3BMOA 3OIDA 3ZWYA 4ND1A 1LLCA 2OBNA 5A4DA 4J1NA 3WNQA 3GK3A 1NVTA 2YJZA 3KEQA 4GSLA 4J90A 3WQSB 2BFMA 4JLWA 4UUMA 3WBFA 2Y0DA 3BXXA 3F4BA 3GGOA 5JAIA 1A4IA 4IDCA 4YPOA 2HU2A 4J4TA 2X0NA 3CPSA 4CQLA 4E5NA 1P1IA 3QRWA 5IZCC 1WNTA 3AY3A 4BUCA 2NVWA 1I0ZA 1B7GO 4GLLA 1GTMA 2EWMA 1OOEA 4YCAA 3IIEA 1NAHA 3MEQA 4IQ0A 4XWYA 3DTTA 3CKYA 1NBOA 1NFQA 3DO5A 4OXYA 1DC6A 3VTFA 4YAJA 1N2SA 5JS6A 1M6HA 3GAFA 1FDUA 3IOYA 3ZWAA 1ADFA 3CINA 1B3BA 3LVFO 1R4MB 2A94A 4BKQA 3B20A 3Q1LA 1XDWA 2ZTLA 1QMGA 3ZV4A 4BO4A 5A3JA 4Q3AA 4MP6A 2EV9A 1BHSA 3OJOA 4E21A 3F4LA 3UVEA 4BGEA 5EQFA 4HFJA 4EI2A 9LDBA 4QFCA 3RU7A 1KS9A 4YJFA 3VPFA 1E1LA 1SEVA 2OFPA 2CUKA 3GPIA 3CTMA 4N5LA 1E6WA 3CMMA 3E6AA 3GT0A 2G0TA 2O7QA 3AWDA 3E9MA 3AOGA 2X9VA 4B4VA 5KVQA 2BFPA 3IJPA 3ZNPA 1P44A 2D3TA 4GAEA 4KMSA 4I5FA 1N1EA 5T64A 3AU8A 1BG6A 3I9NA 4PG7A 1RWBA 2W90A 4XKJA 4DPMA 3N7UA 5JLAA 2P9CA 3FCOA 5BNIA 4XQCA 2PGJA 1V3TA 4P38A 1K89A 3D5QA 2BELA 3AK4A 4RL6A 3K92A 1MV8A 4J9UE 1N1GA 2VHWA 4XX0A 3GAZA 3EDMA 5DDIP 2WE8A 2A9FA 3O38A 2P9GA 3F9IA 3FNEA 2YHIA 2C2YA 1I24A 2QZ9A 3DMTC 4RPGA 1YJQA 4AVYA 3INRA 4A0SA 1LC3A 3TNLA 3DBRB 4XRRA 2P91A 2IYPA 3PEFA 2YQ5A 3P5SA 4Z3DA 4R51A 5L3ZA 1Q0QA 3RUEA 5C3MA 2X0JA 3A14A 1JA9A 4IDBA 5I7FA 3VHRA 1XWFA 2NV6A 2A92A 4Q39A 5JO9A 1Z74A 3MTGA 1LU9A 4TVBA 3QLJA 5JDIA 4NFYA 3MJVA 1XG5A 1TLTA 3H4VA 4BNGA 1H2BA 4BMVA 5C7LO 1TT5B 1L7EA 3GDOA 4ALMA 3FD8A 4FJ1A 2DC1A 2EP7A 1ZCJA 4ZU3A 4J1QA 1SNYA 3ZHZA 1Z73A 4HUJA 3I23A 1X7GA 2GN9A 3VVBA 3EVNA 3ZNNA 3H5RA 2O3RA 1ONOA 3KSUA 4IBOA 1SOVA 4F6LA 1CIVA 3S1LA 1ZSNA 1ADCA 4TSKA 3PRJA 4CQMA 3HNPA 2QQ5A 1LDNA 4J7CA 1B14A 1TXGA 3JYQA 4QXMA 1HSOA 1LUAA 2IZZA 4HY3A 3U4CA 3PLNA 2XF8A 4IGEA 3KYDB 4OAQA 4MO2A 2VYNA 4GMFA 1F8GA 4KWHA 5JW6A 3WXBA 2YV1A 4R69A 5B1YA 1E3LA 3VPSA 1PX0A 1CRWG 3S2FA 2ZTUA 3LT4A 4K26A 1PGNA 1DRVA 3JD2A 4R3NA 3ENKA 5H81A 1YXMA 3MWDB 4KTVE 1UZLA 2B5VA 1DFGA 2Z1MA 3RC7A 3Q2KA 3VKVA 4BV8A 1VSUA 1KC1A 5KIAA 5L7YA 4LCJA 2UUOA 4N5NA 1JDJA 3RFVA 2DTEA 4IDGA 4P8RA 3AY7A 4AICA 5GMOA 2WYUA 1PJBA 2B5WA 2DTDA 3LT0A 3G0OA 1ZEMA 3RQSA 4ALJA 1KIFA 1VL0A 4RCVA 3H9EO 3TF5A 1JQBA 1YL7A 1P1JA 4NR0A 4D3DA 1LA2A 5KTKA 1LRJA 5JDCA 2J5RA 2Q2VA 3PJFA 4BB5A 5L40A 2NU9A 1FDVA 2CDBA 2HMSA 4R5HA 4ESOA 3DHYA 2HK9A 4BO1A 4FFPA 3JQGA 5L7WA 4D3FA 7MDHA 1Y8QA 1YB4A 4ZRNA 4ZQHA 3UICA 5FWNA 1CERA 3Q3CA 1D8AA 3RUAA 2D4AA 3SLKA 4W9NC 3MJTA 4CLXA 3H65A 5JYEA 3TRIA 2C5EA 3HSKA 5DP2A 2ZYAA 1MC4A 4GKVA 4E3ZA 4JQCA 3HZZA 4ND3A 3JQFC 3GVHA 4H7PA 1DRUA 1EVYA 1WZEA 1XU7A 4MIEA 1EBUA 1Q0LA 2J8ZA 4KUGA 3RFXA 4RPHA 1S6YA 5TNXA 3A06A 5A5FA 3PLRA 2NNLD 1IUKA 2O50A 1UAYA 2FR1A 4WOKA 3F3SA 3PXXA 1MB4A 2PNFA 1U8FO 1ZJYA 1WWKA 5GZ6A 2OL4A 4R1SA 3IKVA 4XYMA 3RC1A 3GFGA 1CEQA 3OECA 1A71A 1S7CA 2EKPA 2X0IA 3TDKA 3DFUA 4RVSA 4YAIA 1O5IA 4JJIA 4PLHA 5T8KA 2AMFA 1ZEJA 4RF3A 1B8VA 4RF5A 1NPDA 4ZN6A 3GVIA 1H93A 1PEDA 4M1QA 3ZH2A 5JCJD 3IKTA 4KDFA 1HDXA 1I5RA 2F1KA 3IJRA 1PJ4A 4LSWA 4R54A 4PLPA 4NJMB 5T67A 4U6QA 1P1RA 2DT5A 1I2BA 4JX8A 4ND2A 2PH3A 3LLVA 3W4KA 2HKIA 1YDEA 4TRJA 4OIMA 1PR9A 3L4BC 5ENVA 1EZ4A 1KBZA 4PZDA 1R12A 2BH9A 2HJSA 3ETGA 3RCBA 3QW2A 2HSDA 3RKRA 4CM4B 1P74A 4CLRB 4CMHA 3O8QB 4GVLA 2PKRA 4M49A 2QHXA 1HDYA 4YB8A 2I5PO 5IZCA 3JQAB 3ZNQA 4N18A 1I32A 4LMPA 1A5ZA 5CDYA 2VHVA 3FBGA 3EYWA 3ZV6A 5C7OO 3I9LA 1YJ8A 3ZN2A 1YE3A 3BTVA 3KO8A 3W8EA 2HO5A 1T26A 2OGUA 1R0KA 1G6KA 2AEJA 2ZB3A 3N74A 2CSUA 2JCXA 2O3JA 1BXZA 3V1YA 3ZZNA 1AUPA 3G79A 4CM5A 1I3NA 3NJ8A 1QKIA 4D41A 4RF4A 4M8SA 3WGQA 4TKLA 2O3UA 4BMNA 4INAA 3CZRA 5B4TA 1IHXA 1KY4A 3PFWO 1VKNA 4R1NA 1HKUA 3GQVA 4KDEA 4CMIA 5HS6A 4E32A 1ZSVA 4PLWA 3WGYA 2HK7A 3ETDA 4L74A 1PL7A 3MOGA 4ZVVA 1GD1O 4DBVO 4UVEA 3ZWMA 4E13A 4KZPA 4Y6PA 5GY7A 1EBFA 3ONEA 3FWNA 3ZU5A 3EK2A 5H82A 1R66A 2FPPA 1E3JA 4GWGA 1W4ZA 1UXHA 4JJFA 1VM6A 4YJDA 5TIIA 3GVPA 3I9OA 1CDOA 3DZGA 3R1IA 4YR9A 3JQDA 1Z7BA 3KXDA 3SX2A 4BGIA 4OSPA 1V3UA 4BO7A 3L77A 2OOSA 3K30A 4YQZA 3W6UA 4MP3A 4RZIA 4YRAA 3GLQA 3QSGA 4FSHA 4CL3A 1DOHA 4EYEA 1E5LA 2EJWA 5LDGA 4NFSA 3DMTA 4N7RA 3SBOA 1W73A 3U3XA 4FFOA 1LXCA 1JAXA 2NQ8A 4G5HA 3IS3A 4XQEA 1ZVMA 3FTPA 3ZI0A 4QX6A 3PK0A 4KUEA 4JBIA 4WEOA 1NAIA 5EQDA 1WXDA 4Z6KA 3GMSA 3OEWA 2HMTA 1B8PA 4ZRMA 5U4QA 5DBFA 1NQTA 1GV0A 4CV3A 2P4HX 4EEZA 1PZHA 4FQ8A 4GX5A 2J5KA 2IDZA 1U7TA 4J0EA 3K9QO 4BGUA 1RYEA 4YJHB 2GZ2A 2J3JA 1YOVB 5DN9A 3GHHA 4DYVA 4MVJE 4NMHA 4CLOA 3U09A 5KKCA 1KVRA 1ADBA 2GLXA 4BNMA 4FFLA 2E82A 1DIGA 1HTBA 4LRSB 4RV9A 4D79A 1JKFA 3LK7A 4WNIA 3UW3A 4UVHA 3DFZA 4D43A 2GO1A 4OGWA 3DXFA 4RVFA 1WMAA 5ES3A 4FFNA 4R16A 1RM0A 1NR7A 1ZK3A 1GQQA 2GZ1A 2PD6A 5HBRA 3ST7A 3BAZA 1AE1A 1Q7GA 4U7WA 1T1SA 1CJCA 3RU9A 1BSVA 1KEUA 4RVDA 2IEBA 3L9WA 3F5SA 3U4IA 5G2OA 4XEHA 3WG9A 1O8CA 4C7KA 3M1AA 5TJHA 1ZK1A 3MJSA 4Z9XA 4CMAA 2GRAA 5AQ1A 1HYGA 3FHLA 4R3WA 5DULA 4G65A 4Q3CA 3V5NA 4CM3A 5FI3A 4HV4A 3WMWA 4BO6A 2G1UA 1DXYA 3I9MA 5JSFA 2C59A 3JQ9A 4MJLA 5KCZA 2ZYDA 3FPLA 1QYCA 4EUFA 1EVJA 1KVSA 3PDJA 5CAEA 4R01A 4I08A 4WKGA 3PHHA 1VPDA 5JAQA 1KVQA 5MGBA 1ZUD1 3WGHA 3A1NA 4QUKA 4Y8VA 3UCFA 1GUYA 1DC5A 1Z75A 2DPHA 6LDHA 5ITVA 5COQA 3ZWXA 2VZ9A 4TROA 5ICSA 1VL8A 4RLSA 4HBGA 1WZIA 3D3WA 3AJRA 4DPKA 4LVUA 2PY6A 3ASVA 1TT7A 3OSUA 4U0JA 3STHA 3DOJA 1HDZA 4YEDA 5GZ1A 2DQ4A 4ITUA 3GGPA 3PZRA 1BXKA 2FWMX 3RUCA 3EAGA 5ILOA 1EE2A 2O23A 3ZWVA 3ZV3A 2TMDA 3HDJA 4B8WA 4BNWA 3H3JA 3ANNA 3JQFA 5JC1A 3TFOA 3VH1A 1YO6A 4GMGA 4ZD6A 4RQTA 5AYVA 4E31A 5I7SA 2POQX 3QQPA 1UXIA 2B4TO 3AUSA 3R0IA 1K2WA 5EL0A 3SEFA 1JW9B 3EVTA 1KY5A 4ND4A 5BQFA 5L45A 2BGKA 1QRRA 3TZCA 4E6PA 3VTZA 1IZ0A 4UUPA 4DUPA 4Z0PA 3OIGA 3BMOB 3E82A 1RYDA 2ZK7A 4B8ZA 3PQDA 1HETA 4YXFA 1IPFA 1LLQA 1T25A 3AUUA 3K73O 4JCOA 2FSVA 1A9YA 1GUFA 1IB6A 3GDFA 4J3FA 4CM8A 2X6TA 4CQMD 1Q2XA 3H9JA 4CV2A 2BRUA 4DQVA 4A5OA 3ENNA 4RPKA 1U3VA 1JVBA 3G17A 3GC6A 3DBLA 1X14A 4E12A 2VYND 1ZXBA 4OO3A 4J1SA 1I30A 1YL6A 2OXIA 1PU2A 1PZEA 3E8XA 2D59A 3UGKA 1BVUA 1Q0HA 3GMDA 3WNVA 1IULA 3WR5A 4A27A 2WYWA 1LDYA 3RSHA 1F0YA 1B2LA 1MA0A 3TZHA 4XRGA 3KV3O 2CD9A 2RBEA 1DLIA 3CZMA 4U6SA 3F5QA 4P4LA 1BWSA 3W8DA 2OP1A 3TPCA 3QVOA 3GHYA 5KVSA 4BO3A 2Q46A 4YJFB 5EJ2A 1N9GA 1P0FA 1ZK2A 2F00A 4RO0A 2P2SA 3LLSA 3NAQA 1GQYA 3GF4A 3DMYA 2UYYA 1ORRA 5F1OA 3KHUA 4RVUA 3E5RA 2W2LA 3CMCO 3INGA 1I10A 5IG2A 2AQHA 4XJTA 1PJQA 1GADO 1XHLA 1HE3A 2BGMA 2RCYA 3QWHA 1M2WA 3L6OO 2C29D 3LT1A 2FRDA 4JBHA 1U28A 1U3WA 1U7HA 4YA6A 3WTCA 1U4SA 3BHIA 2Y1GA 2Y0CA 2HUNA 4WNCA 5TC4A 1LSJA 4D46A 1U2DA 2VHXA 1ZJZA 4PFJA 1PGJA 4N54A 1NQ5A 1X0XA 4WOJA 4FIZA 4TVOA 1HDRA 1DIRA 3FRJA 1QYVA 4P4NA 5K0ZA 1HYHA 3R3SA 1XGKA 1I2CA 3GZNA 1EUDA 1H94A 3PIIA 4YTEA 4YRDA 2XOXA 1LDBA 1NQOA 2B0JA 2JAHA 1LTHR 4OOEA 1T2FA 3KZVA 2Q4EA 3I6IA 4ZICA 4ALIA 3JTMA 5IXYA 3BMQA 4PLFA 1NVMB 4J7UA 3NDRA 3PPIA 4RVGA 4NG5A 2ZJ0A 3FN4A 2PLAA 4NBTA 4JK3A 5ITWA 3RC9A 3EY4A 5JMWA 1U8XX 2PZMA 4MKZA 1HEUA 3M6IA 2BI8A 2R00C 3S8MA 1MG0A 4MVJP 4M54A 3I83A 1V35A 4AJPA 4ZQFA 3TOZA 3ZW9A 5JAMA 1PR3A 4E5YA 3JQ7A 2AA3A 4B7UA 1Y5MA 3HFSA 3WGGA 4EGFA 4IDFA 4HADA 3ZWWA 1C3VA 5CDUA 2D1YA 4IXWA 4LCEA 4U0KA 5LCXA 1E5QA 2EW2A 4D3SA 1XELA 4JGBA 3RUFA 5B4VA 1XCBA 2V6FA 5A9SA 1CF2O 1T1RA 1WPQA 1FXSA 3GNTA 4ONEA 4PZEA 3AI3A 3WJ7A 4BIIA 1U2GA 1P0CA 1Z7EA 2IXBA 2DFDA 3R6DA 3TL2A 3FF4A 1Y1PA 3OJ0A 2DAPA 5JPIA 2DUWA 4TZKA 3JQCA 5BSHA 2Q1UA 1GCUA 4E2WA 1U3UA 4YT8A 4R9SA 3LC1O 3B1FA 3AFMA 2VWQA 2ZATA 3PQEA 3ONDA 3U0BA 3S55A 4JBGA 4IS3A 1N7HA 4D7AA 1E3WA 4L75A 3VH3A 5JBIA 4RF2A 4DMLA 1LSSA 5EMHA 4U5QA 1GEGA 1A27A 3VH4A 2PZLA 2X1HA 3V1TC 2WYVA 1Y8RA 2DUUA 4Y6RA 3DZBA 4TMFA 3WTBA 3GVXA 3OH8A 1DEHA 4QSMA 1N8KA 2YW9A 2EW8A 4TRRA 1R0LA 3PHGA 1P77A 2IZ1A 4R1TA 3LSYA 4F3YA 1PL8A 2J6IA 2O4UX 1GL3A 2D2IA 2VWGA 3WSVA 3KUXA 1M66A 2D5CA 4BGVA 1TEHA 3GA0A 2GNAA 5EPOA 2Y1EA 1ZXLA 5FFFA 5JYDA 2PGDA 1K0UA 4EJMA 2WD7A 4NFHA 3WB9A 2FR0A 4LGVA 4Q3EA 2Y1DA 3UUWA 3CSDA 2D0IA 1ISHA 3DR3A 2G5CA 4DVJA 4ID9A 3JQGB 1Y8QB 3OIFA 4M86A 1ZFNA 1IHYA 3N58A 1ARZA 1T2AA 2WWRA 3M2TA 4EEXA 2Y0EA 2GASA 4MIOA 2BD0A 2CF5A 2OBYA 1DHRA 3Q0EA 4NBVA 4J49A 2DFVA 3DQPA 2FSSA 4R68A 5C7IO 4IJUA 2GYYA 1PSDA 4R1UA 1L1FA 1ZBQA 5L95A 3PZBA 3GRKA 4JJGA 3AW9A 3V2HA 3NT5A 4BO9A 4DGSA 4OL9A 1QYXA 3OFSA 2H5LA 2VYVD 1ISGA 5KJ6A 3WLFA 3BYZA 4S1VA 2RIRA 3D1LA 5KJ1A 1AN9A 5TGDA 2IZ0A 3JCZA 4HWKA 1BRMA 1NFRA 2P5UA 5TT0A 4K28A 4NU5A 5CG2A 4IMPA 2YFHA 2CDCA 5AXCA 3L6DA 1EK6A 2NUAA 1QYDA 1LSUA 2HLPA 3TZQA 1QG6A 4UVGA 3U4DA 4E5PA 1A4UA 4BHTA 1MUUA 3HWRA 3FNGA 3PFFA 4BKOA 2EERA 1HWYA 3D4NA 4FGSA 4GPD1 1A7AA 4DLLA 2HMVA 2GCGA 4HX5A 1ZK0A 4IDDA 3HJAA 1QP8A 4I5DA 3B1KA 2I9PA 1XEAA 2QIOA 4I1IA 1QV7A 4YJGA 2I65A 1OC2A 2SCUA 4F46A 4TQGA 4WGGA 4RPLA 4BKRA 4MP8A 4ALLA 3JYLA 4WK6A 1BW9A 2W2KB 3MOIA 5A5EA 3RBZA 4EUEA 2JD2A 3JQ9C 1EFKA 1FDSA 2CF6A 4CLEA 2GGSA 1SO8A 4PLGA 4RQUA 2E6UX 2JHFA 4OSOA 4WLUA 2G82A 1J4AA 3QJ5A 3GZ4A 2Q1SA 3OHSX 4BO5A 2BI7A 2X23A 1MGOA 4MVJA 1UH5A 2B37A 1Q7BA 2AQIA 4IJWA 4Q3DA 3QV1A 2Y68A 2AHRA 5DT9A 3HDYA 2AEFA 1NWHA 2H9IA 1EVIA 2YDYA 1VLLA 3KTDA 4GX0A 1WW8A 4W7HA 2DVMA 3PJEA 4CUZA 2NTJA 4EW6A 4EBFA 4BNZA 5G0UA 1MC5A 1YB1A 3G1TA 3LU1A 2VUUA 2ZKLA 4BOYA 5JC8A 2VT3A 3G49A 4RLHA 3OETA 3VC7A 2YUTA 1YQDA 5HTOA 3T7CA 3K96A 1P3DA 1X1EA 1EQ2A 3QVSA 3WDSA 4C7JA 4DIFA 1T24A 1TB4A 4O59O 4CMIB 1U5CA 3I9KA 4WJZA 1T2DA 3ZHYA 1GZ6A 1XIVA 5BSFA 3OJLA 2OO5A 1ADGA 4CM9A 2BLLA 4MPDA 1F14A 1VRWA 1NTOA 2B4QA 4YYZA 3VPGA 5K6AC 2WEKA 5K9ZA 1DAOA 4CUJA 1DDOA 2H1SA 5JFOA 2EGHA 3DOCA 1JVSA 3U9LA 3JQ8A 3LYLA 3S2EA 4CV0A 3F1LA 3BMNA 2HDHA 1MLDA 4DQUA 1WDMA 5F5LA 3C7AA 3D4OA 3E18A 2Y1CA 4G2NA 3GH3A 3WWYA 2O48X 2VOJA 1C0IA 3E1KA 2B83A 1YBVA 2OZPA 1O94A 2Z1NA 1N5DA 2X9NA 3NTRA 5B4UA 4DQXA 3H5AA 3UCXA 2CZCA 5T57A 2I66A 1I8TA 2ZCVA 4CPDA 3QE3A 4J43A 4AJ2A 4Y9DA 2Y99A 4B3JA 1DIHA 4PLTA 1DJQA 1NX6A 2FPIA 2X9GA 4YT2A 1JWAB 3CH6A 2VTDA 4LMRA 2X5KO 2VQ3A 1DO8A 4A2CA 3WBBA 1G1AA 1GCOA 2GN8A 4BO8A 2PWZA 1OZAA 5DOZA 2PTGA 2R00A 1TI7A 5KWEA 1U9JA 1X15A 5L4NA 4YT5A 5IXSA 3BTOA 1PJCA 2XXBA 5A9TA 3VZPA 1LDMA 2HRZA 3PHLA 3RVDA 4IJKA 3I52A 4J1TA 5G4KA 1L7DA 4EDFA 1PS8A 1HRDA 1ENPA 1AXGA 5G4LA 1DB3A 4BVAA 2FPGA 5CHEA 1D4FA 3SJUA 4OXNA 2X5OA 4IZHA 5DBIA 1JKIA 5AXAA 1U5AA 4WECA 2CMDA 4L9RA 3FR8A 3ULKA 1E7WA 3DAFA 5G0VA 4CM6A 4UEKA 3KLPX 1YGYA 5TF4A 1ZH8A 1O6ZA 5T6BA 2HQ1A 1UP4A 2PK3A 4A26A 3JYPA 2JFGA 2FP4A 2Z95A 3B70A 3GRPA 1MG5A 1UZMA 4GI2A 4CL8A 4MDHA 1VKOA 1PIWA 1W8DA 2AE2A 2R6JA 1HF3A 3CE6A 4AJJA 1G0OA 1EDZA 1PWZA 4L0QA 3AUTA 4I9UA 4NJOA 3NTQA 2C20A 3DDNA 4IM7A 4W6ZA 1JAYA 1E3IA 3EUWA 5I9LA 2AQ8A 4NHEA 2NWQA 2W2LD 4B3IA 3ANMA 3O26A 3VDRA 4FCCA 2EP5A 3FWZA 3ROQA 3EGOA 3I5MA 2NTNA 1HDCA 1LX6A 1GPJA 1I01A 3ZNOA 1D1SA 3AY6A 2NVBA 3PI7A 4FFMA 3RBXA 3D0OA 1ULSA 2FN7A 2PZKA 3KSZO 1XSEA 4KWIA 2ZQZA 1Y81A 3PHIA 3GY0A 3NDIA 2OORA 1JTVA 2B69A 3WGZA 1DSSG 5EN4A 4GBJA 4XYLA 4CODB 5IFLA 3UAGA 4ILKA 3VOSA 5CEEA 2A4KA 2VYVA 4W99A 2QG4A 3OM9A 3EHEA 2EEZA 1I3LA 1ULUA 4IUYA 1HL3A 1QORA 3QIVA 3UHAA 1KEWA 2P9EA 3D3WB 3E5MA 5KVCA 2BHLA 2JKVA 4QO8A 4AL4A 2V6GA 2PD3A 3BTUA 3E9NA 3WIDA 4E2YA 3RC2A 5ER6A 3F6YA 5DZSA 3PWKA 3K6JA 4IS2A 2O7SA 3MCVA 3M1LA 2C7VA 5TRTA 3R3JA 2OUIA 1MFZA 1OI7A 2O2SA 4O0LA 2V65A 1IE3A 4DA9A 4IIUA 3RD5A 4URFA 3QVWA 3WMXA 5FYDA 3KSDO 5I9NA 1C1DB 5EINA 2CNBA 4PVCA 5KNLA 1YQXA 3F46A 4J0FA 4WEQA 5KJFA 1ZIDA 4MKXA 2O2YA 3AU9A 3RIHA 2ZJ1A 1GZ4A 1YWGO 3DBHA 3EZLA 1BTOA 3V2UA 2ZB4A 3C8MA 4XR4A 4CMBA 1IPEA 3IMFA 1DIAA 1QYWA 4CM4A 4GLOA 3H8VA 4CLRA 3O8QA 4PLZA 4OXKA 2A35A 2Q4BA 4DPLA 5IF3A 4BNUA 2O4CA 1ZMTA 1ONPA 1PJSA 2AQKA 3EC7A 3LDHA 5THQA 3PYXA 4DXHA 1HLPA 1R15A 1R6DA 3DZJA 1ISFA 1H6DA 4CMCA 4JN6B 2IRWA 4FC6A 5ENDA 4FS3A 3BA1A 5ADHA 1LC0A 4KQXA 4FB5A 2GN4A 3DZHA 5B37A 3O4RA 2E37A 2GDZA 3VVCA 5L53A 3RFTA 2X86A 5A1TA 3DBLB 4KOAA 5AXDA 1DBVO 1C0KA 1A7KA 4W7IA 3KB6A 3IC5A 3V8BA 2PV7A 1GYPA 1C1XA 4DWVA 1H6CA 2NU8A 4Y6SA 5CP8A 5COBA 5IDYA 2PZJA
chains in the Genus database with same CATH superfamily
4OHMA 1US8B 3TB6A 2COKA 5BVHB 1W9MA 2H1LA 5FPYA 2UV8A 3OP4A 3AXSA 2JL1A 2RH4A 3BPSA 4FPXA 1EFVA 3AYZB 3D64A 4ISCA 4RWZA 5AK3A 1V0JA 2QF7A 3ZQJA 2ZCUA 1M2KA 1MRZA 2WQ7A 2XEDA 4LV6A 3MJDA 3Q40A 3GPDG 4G25A 5E1MA 4UULA 1DQNA 4BKUA 1Y9ZA 1OIXA 4M0PA 4PNHA 1U3CA 1J70A 2YY7A 3PQ8A 3NGLA 4MRNA 5DCWA 5EMKA 3WYBA 2XZTA 4HAIA 4UE2A 2QTNA 4ETWA 2ZDGA 5I7VA 5JANA 1GDHA 2KS6A 4TL8A 2WIFA 3O3NB 4X7RA 1VIVA 1UKBA 5K0FA 3THXB 2ZUWA 1J49A 2HT1A 3T9BA 4KPFC 4PGMA 4L95C 3TS1A 1F2VA 3K70C 1TW2A 2AXNA 3W2EA 1O4WA 1BCSB 3FKSD 4GX1A 5H3CA 1YQGA 3KT8A 2E89A 3BE8A 4ZU1X 5J9FA 4CIDA 4PRYA 1NW9B 1I7PA 4N5IX 3WLSA 3ND7A 4BB6A 1LI4A 1QHFA 5E6RA 3VHLB 4GMKA 3C6BA 1ZH6A 3O03A 4MW5A 2A9RA 2CDRA 5LD2C 1TEZA 1M8GA 4D5EA 2QL5A 5BRJA 1FQJA 1YS4A 1AQLA 1CXZA 1OKKA 1FP7A 1RU3A 3W04A 2RC6A 3L92A 3V48A 3RJMA 4F8YA 4YAEA 1SG6A 4O63O 1E3EA 1YDMA 5K6AA 2Q0QA 2I8AA 4B3GA 4P3OA 4PCAA 3QLUA 1M5RA 4HNAB 4M1MA 3U5TA 2J32A 1GIAA 4BV9A 4EPVA 1KK2A 2H6EA 2QJWA 1FCJA 1RQPA 1EINA 2GFQA 4M0DA 5BN5A 1YKGA 2WWFA 1CNMA 1NNUA 2PUVA 4BZPA 4BVEA 3M5CA 2YTZA 2OUKA 4NBWA 2NZ8A 1QGDA 3UOGA 4UNPA 1K8YB 2ZIZA 4TTTS 4XWOA 1KO1A 1M67A 3PX2A 1D1TA 4HAZA 1OH5A 1N5JA 4XEUA 2JJ2A 3PVZA 3QLEA 4CCAA 3DAPA 4XD7D 2D8AA 1KMHB 3C3YA 5CLQA 5HEKA 4CQLB 1PEYA 4F93B 3BXEA 3F67A 1PS9A 2I99A 1G5PA 3LRTA 1CUFA 2WOJA 1MQAA 3R3YA 5DLEA 5GINE 4CMKA 5I4KA 1LK5A 4PYKA 2IYFA 2I7VA 1UINA 2VJMB 5AI8A 3ZHOA 1CY7A 1RPNA 5A02A 3QVJA 1ZNWA 4RZHA 5C18A 5CA0B 2HBRA 3LFUA 3JD4A 4W9RA 2ILVA 1C1HA 1N2HA 2AG8A 3E9QA 1DAIA 4RSRA 2JHPA 3G9ZA 5AXBA 3FHOA 2XB4A 1CTQA 3HGQA 2BW0A 4GLBA 4WCFA 2X0FA 2PUDA 4HDRA 1CQJA 2CHUA 3DZFA 2E49A 4OEHA 3LQRA 4ZCSA 1JNXX 2H07A 3ICWA 4N8SA 4QPPA 4DXAA 4BN5A 5D5HA 3KIPA 2AXQA 2CJPA 5BQXA 2YXNA 3L1UA 3ZW8A 3QKWA 2XWSA 1UPAA 2QT0A 4Q01A 5AVWA 4P54A 1HFWA 1CZKA 3G2JA 4QDKA 3Q9UA 1V9SA 4QGAA 1PLLA 1BMQA 1O96B 4Z8XA 3STUA 3NHUA 2WV7A 3IKJA 4E46A 4IDEA 1YR6A 4NWIA 1KR5A 3FX2A 1WL8A 1RT9A 5EHXA 3PE3A 3JPWA 4HRYA 4OU5A 2W2XA 3W5AA 2OFFA 2GEUA 2AKAB 1FDTA 2V58A 1FUKA 3DHNA 3DTNA 2HWKA 3PYMA 1WXWA 2IWRA 4BEWA 3W6PA 3VU9B 4IMRA 5EE5B 3PWZA 1P7VA 4JB2A 3KTFA 3MTEA 4OKNA 4N6NA 3T41A 4RIFA 4MQ4A 2C31A 5DBHX 2OWEA 1VE7A 2ACVA 2A1UA 4WXHA 2W9XA 5B53A 3DPSA 2PH5A 1SXJE 1F60A 1LI5A 1Y4SA 4MV0A 5AVRA 1IRIA 4NYIQ 3U3RA 5JZMA 1PP4A 2JKZA 1LPBB 2HJRA 3AW8A 3KSAC 3DDUA 2G40A 2GZ3A 1SUSA 4QLAA 1PT7A 4HEA6 3ZDFA 3UMFA 2AG5A 2QPTA 4C7MA 3TM5A 3LUGA 5L6LB 2R60A 2ZSHA 2FMTA 3SQMA 3HCOA 3GUCA 2RGWA 3VDQA 5L3QA 2O6LA 3KTAA 5K3CA 1ODFA 5LL6P 1RWXA 2NXNA 2WD7B 1UC9A 1SZJG 5AUOB 2IYUA 4AUMA 3NOXA 4IIDA 4UREA 4X1IB 2BMEA 3DNPA 3EAFA 3QEBZ 2JFPA 2NUBA 3VU1A 2PVCA 4BLTA 4YAFA 1QR6A 1Z2PX 3A4IA 4U2BA 4EPWA 4QOHA 3MUFA 1QC5A 3GFSA 4HUTA 4LFBB 5JXGA 2Q3JA 1RKQA 2I6FA 1VKZA 3OIVA 3QVGB 2YNMA 3ZK7A 1E9EA 2Z4TA 3HP4A 1UZNA 3AINA 4FBGA 3I6BA 4S0XA 2QG9A 5DYGA 3EXAA 3NT4A 1T5OA 4CT5A 2VDUE 1FRNA 2FZWA 4MX8A 3ZDEA 1XOIA 5K0CA 1M74A 3JZAA 5EESA 2ZRIA 1Z0KA 1O94D 4F9GA 3OX1A 1L7NA 4J1TC 2EHDA 5GQSA 3NMUF 3NHJA 1VHTA 3BCSA 3WK4A 2PMDA 2BHNA 2KMLA 2IV2X 3S2UA 3T95A 2ZUUA 3AT1A 2JHGA 3KFXA 1GOTA 1PWHA 1ZGBA 5G02A 4BVFA 4YDQA 5IHXA 1LSOA 2YOGA 3FETA 1RQ2A 5KYUA 3L7CA 1GR0A 3FROA 4AURA 3JYNA 2VK4A 4GPAA 2A6PA 1NY5A 3C1TA 3N2YA 2AFHA 2Z58A 4I55F 5JT1A 1T2NA 1VYHA 5D8DA 5FBQB 4CQMB 1VPTA 5CCXA 1TO2E 4MW4A 2Q07A 4OMUA 1GPKA 1RPTA 2NTYC 3JVIA 4O1MA 3A9TA 3MTJA 1K4MA 4XLZA 5AI5A 3TD9A 1NUSA 1AQYA 1G4UR 4U02A 3CPJB 1LK0A 5LKAA 3TPZA 5CDTA 3PQ2A 4LHXA 4WN9A 4CEHA 1H9BA 4X0EA 2VPZA 2CXXA 4HXEB 1J5EB 4YCJA 2E55A 1E9RA 2R96A 1DAHA 1W35A 3SDZA 2FZEA 1OBCA 4WVFA 2SKDA 1WXGA 3C3KA 4F7DA 4WW0A 4M1WA 5DMHA 4FGLA 4Z7NB 2ET6A 3PRYA 4NBLA 4BNJA 3SC6A 4C0XA 2XT0A 2P75A 2X58A 3AL3A 4LZLA 2P6UA 5HOQA 13PKA 1E61A 3EH1A 4XVQA 3VC1A 4OX9B 4V1CA 4FI3F 5ALHA 4QZVA 4NS4A 2AEMA 3NZEA 4XUEA 1LBSA 4X97A 1WUTA 3B2EA 3IP6A 1KK0A 4DQKA 2C2BA 4UW9A 5CPFA 5FBVB 4MNTA 1AGNA 2Y6UA 1WHTB 3AVXA 3PNLA 1W0KA 3HQ4O 1Y6RA 3FZQA 2WFMA 1ZCFA 4TT8A 3U3OA 5FPKA 3HN7A 3R6WA 3STWA 1RE0A 3L0DA 3U62A 3BFJA 4M0LA 4TRNA 5KDLA 2FLWA 3G8AA 1YIDA 5K1ZA 1KI6A 2D0OB 1GPLA 2O52A 3TR5A 3I5UA 4YMIA 1T0BA 1O0SA 4K88A 2H4YA 2QAGC 4X94A 2WWTA 4Y7DA 3WAJA 1DKUA 5AM2A 1RRPA 2F3QA 5CVVA 1ZN8A 4RDHA 2MYTA 4FGWA 2XGMA 2M6RA 2P6NA 3DVAB 1PHPA 4FDTA 4I36A 1R6BX 4K2HA 1P45A 4BVLA 3GCXA 5JOQA 1RYZA 2XVXA 1SG9A 5K0LA 3BIOA 4N0QA 4RS4A 4MUAA 3U39A 3UJ3X 1W87A 3LQFA 1U2RA 3OJEA 4DDTA 1D1PA 2C4KA 4REMA 2IS6A 1E0SA 1JQAA 2HT6A 3PXDA 3BXHA 3I6MA 4PYNA 3EW7A 3NPAA 1WDTA 4Q4HA 1CY6A 4LXQA 4TWRA 2VTBA 3LF1A 1LK7A 2OAGA 4NYJR 1ST2A 4B6PA 4Q4LA 4KIJA 1DOAA 1L5WA 3K8OE 2WDZA 3BMNB 3Q1KA 4PZCA 5DCYA 4YREA 3W6NA 4YXWD 3O82A 3LHIA 1TMKA 2JBAB 1Q3TA 4F3KA 3VOTA 2YJ4A 2PMKA 1CB7A 4DRXA 5HIJA 3GJYA 3SHQA 3FI0A 5FQNA 4ZGWA 4PG8A 4JJEA 2JGAA 2XOEA 3RVOA 2OZKA 5FUBA 4DG9A 3SYRA 4AP6A 2YS7A 3IODA 1G8MA 4H6PA 4GHWA 2J4FA 4IQ8A 2BGIA 3K8ZA 1YBMA 1J0EA 4RXMA 4C9BA 5I7RA 5EKUA 2ZB8A 1Z7YA 3LCRA 1ES9A 4H31A 4OGFA 4CETA 3LTNC 3EBOA 3N86A 3M4ZA 4UM9D 3D2AA 1UCFA 3AUAA 3R7WA 3T35A 3GT7A 2VXBA 3ELWA 1L4MA 5DSZA 1IATA 4IZOA 5AM1A 3MWKA 3PDUA 2JLYA 2PJDA 1FNDA 2WVJA 2Q6VA 1BKSB 2A58A 5JATA 2FN8A 2R5NA 3EVAA 3GNLA 4MQFB 1DIBA 1RLTA 4D45A 1DUIA 3JQAD 1NASA 3R41A 3L41A 1JECA 3ZI4A 4I5GA 4BO2A 4OP3A 5KBYA 3A9RA 3UKDA 4XB2A 1LLUA 5LVAA 5WRFA 1QTQA 4GKKB 4Z4GA 1GYRA 1SIUA 5ER9A 1GFWA 2NN3C 5FRDA 1Q0RA 3PUXA 3WGMA 4BNDB 2NZYA 2RKWA 2X6QA 1XFDA 1PQUA 3RT9A 5CXUA 3OLVA 5I3ZA 4KDCA 1DNPA 4WZAA 1LTQA 1NJGA 5DM60 2B6HA 3C4QA 5A6SA 1RC8A 5P21A 2F3UA 3HBJA 2ZS9A 2FPMA 2PEZA 3H5NA 4YCLA 2FPGB 1SQ5A 5BQOA 2REXB 3PQFA 1NUPA 3HEBA 4HH4A 2KE5A 3K09C 4NCHA 1J24A 4LHWA 1F0PA 4P7GA 1T5HX 4A7PA 1VJRA 5IAEA 5TGTA 4FGZA 4PCVA 5KTNA 3T0GA 1GPYA 3HNOA 4OGLA 2B1RA 1UUFA 3VZDA 3F6RA 4EQZA 2O8DB 3A8TA 3CVOA 4CMGA 2J9ZB 3B1XA 4YX9A 4CKWB 4ZDJA 3DB2A 2Q7DA 1XYYA 5JWHA 4E7PA 5JMOA 4D3YA 2F48A 5DLDA 3TCKA 1TL7C 3LZCA 1VL6A 3ND6A 1QGYA 1JAZA 1EK0A 2QTMA 3ZJYA 4MLCA 1RTKA 2ZRFA 3RYCB 2VRBA 3CCFA 3OAAA 1CHNA 1V6AA 4W5TA 3DBRA 2NV0A 4AZVA 1Z29A 3H9UA 4DFDA 4FZ5A 2QD2A 4BYMA 1RADA 4GVXA 1K9SA 2PANA 4UUOA 5LA6B 4UVDA 1KKUA 1RCUA 1P3Y1 3KX2A 5C9ZA 5BR7A 4Y1EA 4BNYA 5FT9A 1B0AA 3MZ0A 3SXPA 2Q5CA 1H23A 3IT1A 1ABFA 1T3HA 4X3OA 4KE6A 1VLJA 5ALNA 3QEOA 3BD6A 3KM0A 4RKWA 3PDWA 4OB6A 2C8JA 4BMSA 3JZDA 3HR8A 3LGSA 3F97A 4RHUA 3GCWA 2C9MA 3IVXA 4DOMA 1A5TA 3SVTA 3NJ4A 2H52A 4B35A 3A9SA 4J16C 3X2SA 1O95C 3NG1A 3NHWA 3P9CA 4GKBA 4PLYA 1T9KA 1U5BA 1OASA 1YJXA 1B8UA 4CGYA 1ISIA 1QRTA 2DTXA 3LUDA 4IL5A 4JA0A 2PAFA 3TLZA 4GL4A 2FSGA 5E2IA 1AXEA 1Z68A 1K4KA 4JZKA 2GAOA 2WSMA 4GX2A 2GYWA 3PFHA 5HKAA 1P1HA 2CXQA 3T3DA 4NBUA 2EZ8A 4MWBA 5ILGA 3CXRA 4ZOCA 1JPUA 4RJTA 1QIMA 2BP7A 3C7DB 1UDXA 4KW7A 1ML4A 4LWPA 4BNFA 1XEXA 3KVRA 2VPQA 4I5IA 2JFZA 4KK4A 1AMNA 1BQ3A 1QBGA 2AF4C 2CFTA 1W96A 2QX6A 2Z5LA 3GDGA 4MW2A 4G0NA 1LH0A 1T15A 4HD8A 3GD5A 4X24A 4O4IB 1GGHA 4XDZA 3ONFA 4UVIA 3ADCA 1N8SA 4WCFC 1AUOA 1J0DA 1VMAA 2EIHA 1GU7A 1QF9A 2REQA 2VHEA 3D1JA 2ROQA 3IAHA 4OCZA 4B85A 5CD1A 3U7FB 1I13A 1NJ1A 4HWPA 1E18A 1GNPA 3JW8A 1V4VA 2FMKA 1TU0A 2GR9A 1WQ3A 3AFGA 3B6KA 1O95D 3B9QA 1WVGA 3FNQA 5CJ2A 1PV4A 2QN8A 2O3TA 1ZIYA 4HGRA 3H5TA 2JJ2D 4FUQA 3H1GA 3IGFA 1GG2A 3KWMA 1AIPA 4ZQBA 2JLSA 2X7HA 4JXKA 2WQ6A 4AJ1A 2BKLA 3QU7A 4UM9B 3IOCA 1XTJA 3ZD7A 2B7LA 1HZZC 1JF8A 2HTFA 3FH0A 1M7HA 1WTAA 1ENOA 3R6LA 2YV5A 5FR2A 3GROA 3RFFA 4CG3A 5A7FA 4X65B 2OBMA 3FTEA 1VI6A 2P3SA 4G1VA 4QRHA 4YONB 5JPDA 1NVWQ 4ME6A 4DLRA 3ZI7A 1R5OA 1CE8A 3W5BA 4P0QB 3AIKA 4O3MA 4F2WA 1L5MA 2GPTA 1L7QA 2PR2A 3EX7C 4YV7A 5K0EA 4PSVA 4YGXB 3MB8A 3ZU6A 2I2CA 3ZEAA 1JALA 4ER6A 5T4BA 3P2OA 2XCTB 1PZFA 3L0IB 5JAHA 1UKVY 1U3TA 1FSGA 1TYCA 4P86A 5FBWB 1OR8A 2UZIR 1NHWA 4LX0A 2O20A 4L8WB 4GE3A 2L18A 2XQGA 3FNIA 3P5BA 4JLMA 4IVPA 4NEHB 1GT91 2FR8C 3BJIC 1MOSA 2D8MA 3G3EA 2ORVA 2Y66A 2V1XA 1NRWA 2HBQA 3EUEA 3WRYA 5IXJA 2GERA 1YH3A 1C1XB 3HK2A 3Q0IA 4LV8B 3NBKA 1CUGA 4R2IA 7AT1A 5KQPA 1OSNA 6AT1A 3G7NA 4Q66C 1T4DA 3KJHA 2FEXA 1C9KA 3UMJA 2IEDA 2ZM5A 5C37A 1AUQA 1NZDA 3IUMA 1USUA 5FAXA 2YL2A 5G3ZA 5LDDC 1FPQA 4UD2A 3N2IA 4HP8A 4IYRA 4F9EA 5IJ0A 3WYEA 1OWMA 3JV7A 1FNNA 4M2LA 1B0PA 2FGJA 1Q3KA 4I8IA 2ODWA 5SY9A 1EA5A 4QU0A 1IC6A 3D7KA 4KFTA 4JQZA 2JK1A 4A2PA 4B6GA 3U17A 4YCNA 1LDEA 1QQ5A 2C4HA 3BXFA 3QBEA 3FGZA 4LFAB 2HQBA 3PICA 3H3FA 1T9BA 3ZCQA 5AW7A 5SZKB 4OFXA 3VNVA 2V8BA 3IMKA 5THXA 4DA4A 2WZCA 4BFSA 2FSUA 4CR8A 3VKUA 2FUG6 3CUTA 3V8VA 1W19A 2ZVDA 3OZFA 2XZDA 3GYBA 2QMEA 1LRLA 1B15A 2Y6VA 4MJ7A 1XAGA 1ZM7A 4R2WA 1Z16A 3NWEA 4X1KA 1F06A 3K71B 2GVNA 2FPOA 4HPJB 1D2GA 4MVJG 4UDOA 3KQLA 2YR0A 2ZYGA 1E62A 3LF2A 3PP8A 4GDMA 1AKRA 3S2ZA 3TQHA 3WKBA 1ZJWA 3OY7A 4IEFB 2GK3A 1P91A 3OT4A 4AXXA 5C5EA 5GZ3A 1VZ2A 1UXKA 2D1SA 1KY2A 4OYRA 4UDNA 4L4RA 1KDYA 5U9CA 2K7FA 4EGCB 3A1DA 1DT3A 5FV7A 5B1DA 2BM0A 3D6UA 4FLMA 4K1LA 2RGCA 1V1MA 3UF0A 3VNUA 1ZA2A 2VUSA 5E6RB 2OSBA 4L5AA 4FKZA 2ZWIA 4PX5A 2IHVA 2XUJA 2WJVA 3ZE6A 1TMOA 3L6RA 4C01A 4D8UA 4A0GA 1MZPA 1DAKA 4X3PA 2DWPA 4BZQA 5IN4A 1K6IA 1JHOA 1HYEA 3ZHTA 1GNSA 3H16A 3IP1A 3W9SA 3U4MA 1N2EA 2UDPA 4UEOA 2VUHB 4JP3A 2VUTA 2BGLA 4G5RA 4QG7A 3CLUC 1Z62A 4GR4A 2W37A 3BGDA 3P0HA 4A82A 1NKVA 4G6ZA 4PHHA 1O9HA 4EECA 1ZD5A 3TE6A 4QJ3A 3DC2A 1BFKA 5EJFA 1TA0A 3TCNA 4DR3B 4G9GA 4DLBA 4U63A 5JECA 2VJDA 4XM0A 1C8KA 3DMFA 4YMLA 2ON6A 3CVYA 1N25A 2YXBA 3BL5A 3PR3A 5K09A 3TRKA 3TYXA 1X1TA 1ZP6A 4FU0A 4M87A 3Q10A 1F12A 1UK8A 4MUYA 5EUMA 1FTGA 2OA0A 2AI1A 1EVZA 3JD3A 2QYHA 3O9ZA 5E7QA 2W2VA 1P9RA 1Z8DA 3RASA 1VOTA 1M72A 5JZOA 1TQ2A 4AKGA 1XK7A 4IFIA 3ZGLA 1DBQA 3IPLA 4HFMA 5EJAA 1GL7A 1DBRA 3L02A 5J1TB 1DE0A 1PVDA 3DKIA 5KKAA 3ZS9A 3IVMA 1W4LA 5CDGA 1JWLA 1BWQA 3EXG1 1R8SA 2JIZA 2I22A 1QUEA 1X74A 4HQLA 1EFAA 5F98A 1CJVC 3ANLA 3ZDBA 1I2MA 3DEAA 3OQVA 1X7XA 1UDCA 1Z8FA 2PGIA 2JIOA 3QELA 3TLAA 1JEDA 1C7FA 4YECA 5JI3E 1KTIA 2JD0A 1S8OA 2CJFA 2QRLA 4I9NA 1IFXA 2AF3C 4WCFB 1ZO8A 4HDRB 3BRCA 3OOWA 1CQJB 3QHQA 5LXTF 5CBPA 2O8EA 4W8OA 4U7TB 5DYYA 1S4QA 4UMEA 5J5AA 4ENVA 4FCTA 4ENRA 2BE9A 4ZT4A 4RK4A 1NXOA 2YJ6A 3Q7RA 3UV7A 3OKFA 4KN9S 1B4DA 2XXJA 3RAPR 3DLIA 4EH1A 5IKEA 1SHUX 1ZYUA 1LBEA 3K1TA 1Y4ZA 1QIKA 3E35A 1EUZA 2C03A 4O4HA 1K6XA 2GBIA 1V39A 3GG2A 1KORA 4CKXA 1RLIA 3CR3C 3GN1A 3UJBA 2FX2A 2QQGA 2RKOA 4DDUA 2V7XA 4PS0A 3QP9A 3EF1A 1K6EA 4RHFA 4B81A 5G0WA 4NNPA 1W0KD 2QM7A 4ZV9A 4CMEA 2VHQA 3RRNA 4YIHA 1KMCA 2LDXA 1T5IA 2Y1OA 1E9FA 3IQDB 3K31A 4NJEB 4Z2YA 1UC5B 3L8HA 2CVFA 4LDAA 1OTYA 3I73A 1EQAA 1UKAA 2JASA 2NXJA 2PIDA 1JS1X 3KAPA 3P9QA 4OBXA 5HILA 4DSZA 5JDIC 2IHBA 1FP6A 1YRBA 8AT1A 4EYQA 1FJ2A 5EOVA 2Q99A 4D42A 3MERA 4FBMA 3AHDA 1WPXA 3DMPA 5FUWA 3OPMA 2A1UB 4WTOA 4KKXB 2R751 3HKEA 2PYZA 2QX7A 1NT4A 3GYGA 4ZJUA 1G8AA 2R4TA 4WI1A 4GR9A 4V3CA 2EJCA 3S28A 3R9XA 3DOUA 2O1WA 4ALNA 2VWPA 4OLBA 2VCHA 4BBZA 1IG3A 1IBCA 3EVEA 3R20A 4EPTA 4EVRA 3ABIA 1HE4A 1CYDA 3B5EA 1OC4A 1WPRA 1T13A 1NSFA 4POAA 4UEQA 4E3WA 3WFZA 1RYNA 1UK6A 2OYSA 2H1HA 2VRWA 5L3QB 3IR6A 4E88A 3D3EA 1TZMA 5HRAA 1VIDA 2Q8PA 3OZUA 2ZSUA 4DGQA 5JCXA 1E2HA 1RNLA 4P32A 1XKQA 2ES4A 2VRCA 1BH2A 1YFLA 4GBGA 2PQ6A 4JEIA 1QC5B 1C0PA 5AJUA 1W4BA 4JBNA 5JCJA 5I7WA 2ATVA 2IY8A 3DULA 3FTDA 4JJZA 3O8CA 4QQFA 3PFKA 4J91A 4G0OA 4BL5A 4EZBA 2VOEA 3UKOA 1MXHA 3ASUA 3L6UA 4J4HA 1G6HA 4JCCA 4XWAA 3VHQA 4B4KA 2QN1A 1N3LA 1LDGA 2C3OA 2HEIA 5J2UA 3KB1A 4AMZA 1J1UA 3IP8A 3VJRA 2VZ0A 2JJ1A 4HTAA 3W5JA 5AKJA 3NXSA 4MRPA 1XVLA 3GMIA 2RB4A 4BMYA 3I2YX 5A9RA 3PL5A 3LDUA 1WMFA 3ELYA 2QLTA 2AWOA 3GRCA 4GM1A 4TSFA 1JLMA 5GGXA 1HM5A 2A57A 4DN6A 2ACKA 3A1WA 5AVXA 3AJDA 4B45A 4KG7A 4YFYA 1F7VA 5KYUB 5LP1A 1FU4A 1BEEA 1R0XA 2REOA 3B3QA 1CSEE 3NHRA 1Z26A 1PTJA 2AFHB 2CVOA 4ADSG 4J6EA 5GADl 1FFDA 1JP7A 4R4JA 1Q1EA 3RSQA 1BWRA 3QXCA 2WVGA 1X7HA 1LBIA 2CNKA 4W82A 5JDCC 5K3BA 3NEPX 4DNOA 2I4LA 1E1DA 1T3TA 2I2BA 3BZUA 2P3LA 3G1UA 3DDZX 3GZJA 3E53A 4HGOA 2BPOA 4K9NA 3WHPA 1R0SA 4F2DA 2XJ9A 3R0JA 4BNNA 2V7GA 5MHTA 4E7OA 1XROA 4LF8B 1DU4A 4WN9B 1BCRA 1QPGA 2GHRA 4OXIA 2GUGA 4JXJA 4CEHB 1OLXA 3MRVA 5TVKA 5FOXA 3PNYA 2I3GA 5ALXA 1ZX1A 5AKEA 1WZ2A 1AKMA 3IL2A 2DFLA 2NOAA 2WF8A 1E2QA 4B9EA 3BQ9A 1L4FA 2OCAA 4IDOA 4EY4A 5JZVA 1BS1A 2KWIA 1O9BA 3L5OA 2ECPA 2AN1A 1I3MA 1NM5A 2OHXA 2PLWA 4RD1A 2FWNA 4WFQA 3RK4A 3ETEA 4V1CB 1SBIA 3I9JA 3QPAA 3CVWA 2Y1WA 3GH1A 1FYEA 4P3PA 1M2NA 2VVTA 4H2DA 1LPNA 5H7XA 2QYSA 3V3KA 5CTAA 3ZC3A 3ZHXA 2IYTA 1XEWX 4BMZA 3UTDA 2OBLA 2ZBEA 5MGNA 3OAAD 3W1VA 5M29A 3NW9A 3DXXA 5E2BA 1J5XA 2OCXA 4PAGA 1YQWA 1IHPA 1E0AA 3M70A 1RYYA 4G56A 3U49A 3EEOA 3FZGA 3FOFC 2OENG 2VA9A 4NQRA 4DIEA 3WC4A 1CDDA 1X13A 2NQTA 3OTHA 1XUOA 4FZJA 4Z7QB 4H35A 3A25A 3DG9A 5JQGA 5DU2A 1KI6B 4HKTA 2XAUA 3LSTA 2IPAB 5BUQA 4GYKA 4C08A 2VZ8A 5FIUA 3AG5A 4P34A 2FA9A 2JGIA 3UJAA 3KEGA 4JQYA 1GYQA 1TKRA 4LHYA 5CK4A 1IXRC 1WKCA 1ZVQA 4ZYZA 4LJ9A 3SGLA 4MZXA 4WAUA 2DEUA 3ASYA 3F7OA 3GRAA 3HCPA 4ZXPA 1H66A 1NUAA 2BMAA 3OQ6A 3ANYB 1U7PA 1BAPA 2Z04A 3H2SA 3O7MA 1R74A 1VBKA 1H9CA 3OOSA 4LBWA 4G97A 4QG3A 1CNEA 3BMCA 2RH5A 3CWCA 3BMOA 4ND5A 1C4XA 2BDEA 4ND1A 3TSZA 1UDWA 5BSKA 5KC8A 1J39A 3RJZA 3AUXA 4EENA 1AQNA 4J90A 4B6QA 1NN5A 1POXA 1CLUA 4Q4HB 4L78A 3PEWA 5IS2A 2DT8A 3VTAA 5JAIA 3WO1A 4YPOA 1ZRSA 1R1DA 4U9UA 2Y4NA 3QRWA 4J7AA 3TVYA 2NVWA 3NBZC 4BLRA 1JSXA 1VHDA 4GLLA 2C99A 2HNAA 4WFIA 2H08A 4TMXA 2GLUA 2NPOA 2WB4A 4DRXB 1NFQA 1QKJA 1GUAA 1V7PC 5ALOA 1RC1A 4M0FA 5FYQA 1DJMA 1A2BA 4KVAA 1N2SA 4WH0A 4YAJA 1PO7A 3EZXA 1D5CA 1M6HA 3VTFA 3MWGA 4YJ2A 1KOGA 2FH5B 1KI2A 4F2GA 4KXQA 2JCSA 1XDWA 2CDNA 2ZTLA 4RY2A 3ZV4A 4BO4A 2P65A 3C6XA 4ARSA 1W1WA 5F4ZA 5EQFA 4BMDA 1U7XA 4R2XA 3D0RA 1FXUA 3R5JA 4QEZA 1NE2A 1E1LA 1SEVA 3GPIA 3HUEA 3NR2A 3OEHD 4OIFA 5TQJA 4J8PA 5C4MA 3K4QA 1E6WA 4GLJA 4LY0A 2ODTX 3L84A 3TQSA 4C6SA 1Y3IA 3QPDA 5IU6A 4B4VA 3KQSA 3MJFA 4Z7OB 1Y5LA 2D62A 1L1EA 1ORIA 3QMVA 2D6FA 2I3ZA 4G5YA 1P44A 2D3TA 2Y77A 2AOXA 2VHCA 4KMSA 1KJIA 4EF5A 4I5FA 2VNIA 5MN6A 1N1EA 2YBDA 3SU8A 3AU8A 1XKXA 4NDZA 1B41A 3H7IA 2W90A 1NDQA 2P9CA 4WZAB 2YKGA 4M21A 3N2EA 5CTJA 2ZXUA 4GUAA 5A6SB 1F5NA 1FC0A 3K1ZA 4OBWA 4P38A 2O2JA 2XD9A 1CVLA 2AI2A 3CWZA 3F8SA 5LMZA 2OHFA 3N0XA 1YJCA 1Y48E 1SXIA 4JGGA 3K92A 4PO3X 3BWMA 1B00A 1KU0A 1YNSA 1N1GA 4UNNA 3TNYA 1L8LA 3VYTB 3A32A 4CQJA 5HJ7A 1XD2A 3EEIA 4KAJA 2NW6A 4P7JA 3ZOZA 1L1QA 3GAZA 1K3FA 3AV0B 3CRW1 3EDMA 3IAEA 4FGUA 5DDIP 3IPAA 2IV3A 1TF7A 3KKKA 2BJWA 1EGVB 2DSNA 2GN0A 3CKKA 1IBSA 1RZRA 1GZ7A 3S70A 1BJKA 1TPZA 3AJ9A 3B2NA 5AHXA 3ESZA 4TX1A 5TMDA 1PX2A 4ENSA 2OLKA 4HH0A 4JENA 4AVYA 4JLAA 1XJCA 1XXHE 2VNKA 4FOLA 3MT0A 4J0GA 4C0HA 4EELA 4TXHA 4XCQA 4CFZA 3DBRB 3PEFA 4I3HA 1TKBA 4KNYA 4R51A 2PX8A 1Q0QA 3X1XA 1OXVA 2AFIA 1KDVA 1PVOA 4R2HA 3F5MA 3A14A 2D0PB 3TVDA 1UIMA 1OBOA 3VHRA 1XWFA 4JLUA 3GLGB 5JJIA 2XITA 4L51A 1ADJA 1LU9A 4TVBA 3L7BA 3HJFA 1I4LD 4NFYA 3S7ZA 3QJYA 4BFTA 1J8FA 4K9PA 3I58A 1ANKA 2BZGA 2DOKA 2XY4A 3REOA 1XCGB 1YI0A 2J6CA 4BMVA 3C7KA 3PCTA 1YSCA 3R77A 1XBTA 3HFJA 2ZIAA 2JNWA 2XE8A 4ARZA 3ILSA 4IX1A 5IASA 3NO4A 2EWVA 3L82B 1M2OA 2QN2A 3IBYA 1CJBA 4ZU3A 1CVIA 1SNYA 4UPDA 2RE8A 4X1OA 2GN9A 3FHJA 821PA 2HCFA 5LQAA 4ND8A 1PD1A 3CUVA 3VVBA 1U9ZA 1NUHA 1RIIA 2GM9A 2O3RA 4EO9A 2FMXA 1F0NA 3BZWA 4MK4A 4K6MA 4KYVA 3KXKA 1JEEA 1JSRA 4F6LA 4HZIA 4B2YA 1CIVA 1ZG3A 1GKKA 1ZSNA 2CD7A 3DVLA 4QDXA 1XEXB 4M0EA 3RTGA 1NXXA 1QGUB 2J45A 2QQ5A 1TXGA 1KBQA 4ZC1A 4DDKA 1HSOA 1VGVA 1XU4A 3VSDA 2F62A 3U4CA 1K92A 4ZYYA 3AP3A 2REQB 1YUBA 2VJCA 2HU7A 3H8JA 3E7WA 3N6RA 1PL0A 3ZTWA 4GMFA 4KWHA 5D87A 2OECA 4G4GA 2YV1A 3FE2A 4R69A 1DUVG 3WXBA 4P93A 4QYIA 4QTUB 1JIIA 2A33A 1G3RA 4TYNA 1PGNA 3NHBA 2Y71A 3JD2A 4FOTA 3ENKA 4R3NA 2QTWB 3W1WA 1YXMA 4RW0A 2B5VA 2RH9B 1UFVA 4MKIA 2PRJA 3I1FA 4H7FA 3RC7A 5LLTA 3VKGA 1E32A 2OHOA 4LS3A 4MR9A 5EUCA 1AKVA 4LCJA 4N5NA 2JAOA 3AGPA 4HDSB 4P8RA 2O9JA 4CF3A 4RENA 2DTDA 3IA7A 4JUBA 5CFNA 1VMDA 3A9CA 4V2UA 5EG5A 1ZEMA 3STVA 3ZUGA 4PC6A 3A1SA 3H9EO 1JQBA 2Z3VA 4IO1A 2Y76A 1Z3IX 3IRVA 4DAEA 1LA2A 2Y2VA 4I1OA 1MJGA 5DV9A 1N6PA 1OU0A 2OVFA 3ACBA 3B3GA 4BB5A 5B7NA 2PAAA 5BUCA 3P0FA 6PFKA 5L40A 2IYEA 4IV8A 2NU9A 4LOLA 4R5HA 3R9WA 3DCJA 4ZAVA 1DWUA 2HK9A 3HN6A 1CIPA 5JNUA 2PZAA 3CF4G 3FA2A 4H7HA 4ZK6A 4URZR 2FXIA 1TCCA 1VE6A 4P4TA 2OQIA 1IOZA 3FVTA 4ZRNA 1CERA 1HQDA 4RIHA 4AP5A 3RUAA 3SLKA 4NF2A 2X0EA 4WJKB 1XPOA 1GZHB 3MFQA 3TAXA 4CLXA 1IRXA 1R6TA 4IYJA 2ZUBA 3H65A 5JYCA 2H92A 5AJHA 4K9OA 4DIUA 4KQHA 4A8HA 4MPPA 4JQCA 4ND3A 1E6MA 2OXCA 3K8QA 3MQ4A 4B3TB 2PE5A 4MIEA 4EDHA 1PLKA 1WW3A 2Q3LA 4UMDA 1GTL1 1S6YA 1JXQA 3A06A 4PTLA 1W47A 3HVKA 1K7XB 3LCMA 5IJ0B 4BX8A 1I14A 1ZIOA 1EH5A 2JI8A 4LYFA 2FR1A 4KKVA 3N7AA 4WOKA 2H7YA 3HB0A 1EBBA 1U8FO 1NNEA 1RQRA 4GP7A 3WYFA 2NX2A 3D7NA 1ZJYA 4I4NA 3V6MA 1U11A 4LVOA 4X71A 1OAOC 2Q5JA 4KR3A 4GRIA 3KKOA 1RHUA 3BREA 4P53A 4D8XA 2CYCA 1JL3A 2XB8A 1A71A 3OECA 1E9CA 3CR8A 3QEJA 2A5YB 4X1KB 4M36A 4QOEA 1S7CA 4LA4A 4ZOLF 1JQJC 2PX2A 1ZPDA 3LO5A 4YAIA 4JJIA 2PUAA 3MD0A 1ORTA 1EGMB 1WCIB 2JFXA 3IVAA 2H2DA 1NVVQ 4N7MA 3KD2A 4RF3A 1V8DA 3QPUA 4RF5A 5DB4A 3BD9A 1PTJC 2BHTA 2VBIA 3GRRA 4IIEA 2E4UA 1PEDA 1DMRA 1WUJS 3P2KA 4M1QA 5JCJD 3G9QA 1NW7A 3PDIA 5DTRA 1PFQA 1V1MB 2JFUA 3IJRA 3H2KA 4CKCA 3RYIA 3BIXA 4RH3A 4ODIA 2PMWB 4NLLA 4BWYA 1C9YA 3CN7A 3CUWA 2O1XA 1I4TD 2DT5A 3CNLA 1I2BA 4N1AA 4ND2A 4PAQA 4FMPA 1Y8ZA 1W0JA 1G20A 2JGMA 2VP2A 4TLBA 2JJ1D 5JSYA 2GYVA 2PV0A 2QY6A 4OHOA 1CZUA 2AD1A 3D6TB 4IKEA 1CZNA 3QW2A 1CUCA 1P74A 4CLRB 2QU8A 1Q0ZA 3ES9A 4IV5A 4WNYA 1KO7A 3O73A 3CZPA 4TSFD 4ER0A 2NGRA 2FEKA 2OO7A 4GYJA 5H5JA 3RYCA 3L8MA 4N18A 5DM70 2BGTA 1AD2A 2VHVA 2WIAA 5KNDH 1FP4A 5E9QA 4E03A 1P6UA 5DTMA 1E9SA 2ORWA 3CRQA 3CVUA 4YMTA 2OCYC 3GFVA 3OQIA 2F4NA 4FEEA 4JC5A 3BULA 5EHIA 1YE3A 3M1YA 2HO5A 3RVSA 1SXPA 2OGUA 2BR4A 4RJJA 1UJNA 4B9AA 3M6MD 2CSUA 2JCXA 2O3JA 2VDOB 3MQFA 4IXNA 1TRKA 3KXLA 4WX2B 1Z39A 1CP2A 4QVIA 5LQSA 5IMSA 1QKIA 3L3BA 1TM4E 2XRFA 4S1TA 4RF4A 4AB1A 2MR6A 4DAOA 5JS7A 4INAA 3ZJ4A 1C3JA 1CUAA 2OFOA 1IHXA 3IJEB 4IDPA 5EPEA 5IVIA 1H0RA 1MENA 5B4TA 5CA1F 3UMSA 5AJXA 4AMGA 3TLJA 1X7XB 2PU7A 5AIBA 3QELB 4KDEA 2F8LA 2OBFA 3GQVA 2JEZA 3U1VA 5BW4A 4HGYA 2QM3A 3LKZA 3VNSA 4EPXA 4YP1A 2X8BA 5FHQA 4DW8A 5CBPB 2O8EB 3KCQA 3SXUA 1CYEA 2C7PA 1WCXA 2DY1A 1F2UA 1TNDA 2IU3A 2V7BA 1N9ZA 4MV3A 4N65A 3OCXA 3ZWMA 2WA1A 5C32A 2WPDA 4TV9F 2A88A 2PUGA 1I3CA 3ZU5A 5J3JA 4IOJA 5CB6A 1R66A 4P4UA 4O4HB 1TLFA 2FPPA 4ABTA 1CQXA 1R64A 1YJAA 1XAJA 4FSXA 3LH5A 5AD1A 1W4ZA 3OFJA 2OT3B 1ETHA 1ZL0A 3T1HB 3PC6A 1L7RA 3T5DA 3R1IA 4YR9A 1CRPA 3ZY3A 4RKRA 1QOQB 1R10A 1RWKA 1II9A 1ZWLA 1W76A 3FPAA 3KXDA 3SX2A 1D7AA 4N6GA 4OSPA 4P3YA 1NJFA 3HA7A 2EU8A 3W6UA 2J67A 3II6X 1G60A 2V5UA 3GLQA 3E05A 2YWXA 4AKSA 3VYUB 2E5WA 2G28A 4ZAWA 1Y3FE 4TV8A 4ZI5A 5LPNA 1UZAA 1ZY2A 4NFSA 1QTIA 3HKEB 4N7RA 3SBOA 2M2IA 3X1KA 1LXCA 2NQ8A 5G53C 3COZA 3EG9B 3TQCA 5ITZA 2FI1A 2N3ZA 3TK1A 1WZUA 2O2EA 3ESYA 4XQEA 3R9XB 2GD2A 4LQCA 4QX6A 4NYMR 2H5IA 5A7GA 1Z0UA 4PHFA 4Z6KA 1H85A 1WXDA 4WZ6A 2R3SA 3MRXA 3WMEA 3AJEA 3R6GA 4UAVA 3S2YA 2JLBA 1NIJA 4F85A 2GPJA 4PSDA 3UJ8A 1GV0A 2CFOA 1EU1A 2D5IA 4FE4A 3RRXA 3VUEA 3WB2A 1XLWA 2BZ1A 3TUZC 5EE1A 3KPUA 3GEHA 1J2YA 1GUDA 3SI7A 1K8QA 4OHPA 5KNBH 1S2OA 1TIKA 3VNRA 3I6ZA 5ABPA 4OY3A 2ONJA 1QRUA 4TLLB 3IMCA 4PTYA 1YOVB 3NATA 2R8YA 3DXZA 5DXJA 4PYMA 3RVNA 5KWJA 2ZPTX 4NMHA 2HIAA 5J2UB 4QOGA 3HY4A 4MQUA 3S44A 4C21A 3KC2A 1M2VA 4P36A 2AS0A 3ROFA 1V11B 2HC9A 2GK7A 5JNRA 4PO1A 3TCXB 4LF7B