5CFOA

Crystal structure of anemone sting (nematostella vectensis) in apo 'rotated' open conformation
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
182
structure length
182
Chain Sequence
b'KNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFWDDKIPGSDYDPQNRITFEGNTEPLEKTRGGVFLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDSEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stimulator of Interferon Genes
publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Immune system
total genus 52
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cfoA02
4F5WA 4F5YA 4LOHA 4JC5A 4KBYA 4QXRA 5CFMA 5CFLA 4F5EA 4EF4A 4QXOA 4EF5A 5CFQA 5CFPA 4EMTA 5BQXA 4F5DA 4LOJA 5CFOA 4EMUA 4LOLA 4LOIA 4QXPA 4KC0A 5CFRA 5CFNA 4KSYA 4LOKA 4QXQA 4YP1A 4F9GA 4F9EA
chains in the Genus database with same CATH superfamily
3G0CA 5HIIA 4JX8A 1WEKA 2HO4A 5DRYA 2HTFA 4MSUA 1OJLA 1ZW6A 3EXFB 2Y1DA 2PV0A 3V48A 3WAKA 1KRWA 2GCNA 3EQ8A 2BISA 3VFDA 1HFKA 3RODA 4PF1A 3V32A 1A2KC 2I62A 3EIHA 4YUXA 4RVUA 4LG1A 4KH1A 1N3YA 3NBQA 3OLYA 3DXZA 1LBQA 4U9IS 3GLUA 3UWPA 3WGMA 4LC9A 5IXSA 3PYMA 4RIHA 4S0XA 4AQ7A 1VL6A 1XAJA 1L7MA 3ND7A 3PC2A 1R16A 1A9OA 4ZEWA 4AURA 3WTBA 1M2NA 4C3OB 2C9MA 1A4IA 3E3MA 3H8JA 5E2IA 2GZRA 2OVFA 2X2OA 4F71A 5C8ZA 5CYGA 2BY4A 4EDFA 5JQGF 1YBAA 2P2DA 3L5KA 2NQ2C 2CBGA 2C5GA 2XKKA 1N1GA 2WUVA 5BN4A 3PC3A 4ZEVA 3LUGA 5TF4A 2OWEA 3F7MA 4QRIA 3WGIA 1DAPA 1RXWA 2CXPA 2SKCA 2B8EA 3ASVA 4N3GA 1AKQA 1V8BA 1XWFA 3CX6A 2BMEA 3LIIA 4X24A 5J1TB 3WICA 8ABPA 1Q1AA 3RAEC 1GDTA 4B3TB 3ZXUB 3IYLW 1N2JA 4G3XA 1CR0A 1T2CA 2BM1A 1UXGA 4Q3DA 2JFPA 3EGDB 1H4SA 2RBKA 4YMVA 4ZA2A 1VIYA 3L1UA 3QKRB 1T25A 2PGOA 3EZLA 1E7QA 5ILOA 1ZSVA 4RJTA 5ADUS 2Q5OA 4MO9A 2IXDA 3ET4A 2DCUA 1CQJB 3LFHA 5CIYA 2P4UA 4HMPA 5C3MA 2YOFA 3FYDA 2Q5EA 2QRPA 1DAIA 4F46A 3S1LA 2X41A 1X74A 1Y4SA 3AR8A 2F1OA 4Y98A 3PP8A 5CIQA 4TWZA 4ZAXA 5B6JA 4ZT3A 5KJ6A 2CDCA 2H8GA 1U7WA 5JADA 1P3JA 2QPAA 3AVOA 2VZ9A 3EXEB 4L8WB 1S5PA 1PR0A 1JHRA 1Z33A 6CHYA 3PJDA 3S27A 5DW0A 2PDAA 5K51A 4L08A 2VNJA 4R31A 5B58T 3W5VA 2O6HA 4Q4CA 4BV9A 1KYWA 2DZDA 3SZLA 3NCHA 1OBCA 4J0FA 4BGUA 1EQAA 2TYSB 3KZVA 3DFFA 5LZ2A 3CC8A 2PJRA 3EAGA 1WXGA 4MQEA 4TOIA 4B3GA 3DDHA 2YRXA 1MC4A 5AVRA 3NNNA 3FPFA 1E79A 2WM2A 3QLVA 1J99A 3T7DA 2ZATA 4Q4AA 5F9HA 1SVIA 2QUKA 1KTIA 1TF7A 2X7XA 4JASB 1F8YA 1QF7A 2NUPA 1JNXX 3DE1X 4RJ2A 2EKDA 4IOKA 3NTOA 4WK4B 3GP8A 1NBME 4N41A 3HLYA 1QCYA 3CQ9A 4OIFA 4F9EA 5I7HA 2PT9A 3BXOA 1K88A 4ZDKA 1C0IA 3CNOA 1VJGA 2G9RA 2WLTA 1NQWA 2WNIA 2DHDA 3AK4A 2EP8A 3ZY4A 1MOQA 4XGRA 5FFFA 4CUZA 5JD3A 4FK8A 5DGTA 5EZ6B 1A8SA 2PX2A 5CB6A 1FVFA 3CS3A 3OIDA 1X13A 2QSJA 4EY7A 1Z25A 5IN4A 5DNYB 2WQ6A 4QOEA 3QBTA 3PHLA 4QYTA 2GZ2A 3WMWA 1PLKA 3L40A 1YBFA 3R09A 1KQNA 4BZXA 3D8HA 5TDHA 3CEHA 2N3ZA 4B32A 1HMYA 2C99A 5DLYA 2EJVA 5DN9A 3SSOA 2WAXA 3MTIA 2HV8A 1RDFA 2YYAA 2ZPAA 4G1UC 4ISBA 5KQLA 1D07A 2KI5A 4G67A 3O8CA 1ODKA 2ZIGA 1WOMA 4Y6RA 2BUCA 4NZYA 2YICA 3JARB 3L6RA 4IJUA 3N86A 3KJQA 1Q7BA 1S3SA 1B26A 2FPMA 1FCJA 3DAPA 1YAJA 3G9QA 3HYSA 3KYIB 1BEEA 1OWMA 3JD0A 4G1FA 2IXGA 4IMJB 3HI4A 3QNWA 4OSEA 3FOAA 4GXQA 4Z8XA 4L5AA 5IABA 1FYDA 3ADOA 2FOLA 2PGJA 1Z4MA 5AVXA 5E1OA 5AVWA 1RVV1 1WZCA 2Q50A 3AZPA 1HDRA 4GMHA 3SZOA 2FN3A 4QECA 1PWZA 1U7HA 3MYYA 3I05A 4FFSA 3OZAA 3S2FA 1J8MF 4ND8A 4ODIA 1UAGA 5HQTA 3ESXA 1XTTA 2J5RA 2C82A 4AX4A 5C32A 1GWNA 5HGXA 2FEOA 3PA8A 4PG4A 1NXSA 4MLZA 3AKYA 3GLVA 4HJXA 4YFVA 4BFLA 4WOKA 4M22A 4MCAA 4O4IA 2WMOB 5AKIA 3SX2A 3QE4A 3OTOB 1IVSA 2IZ5A 1V1RB 3L43A 4RVOA 5IF9A 4B6OA 1BYIA 1BCSA 3C1UA 1JAHA 1LY1A 3L01A 4U6SA 5ALQA 1UMDB 3I1IA 5B57C 1QC5A 4LWQA 1LW7A 3FAZA 1A76A 2ZRBA 4CKEA 4QX6A 1L5KA 2AXPA 2QBYB 2FXIA 3MJVA 2I4RA 4A2WA 2BCJQ 5EJ9A 5JWHA 4LA4A 1DC6A 4KIUA 2W43A 1TI7A 5LWHA 4MUEA 1SBNE 4LRWA 5FFNA 3GGGA 4IHJB 3ZYCA 5JXWA 1YB6A 4WL0A 2BDTA 5KYXA 3L8YA 1WXFA 4E6EA 2RHRA 5HGJA 3DZ8A 1PTKA 3EULA 1SUCA 4QSHA 1SUFA 3R7AA 1JZSA 3P2IA 4G5OA 5EJGA 4GVXA 1JQKA 1Y80A 1A5SB 4MRRA 3TM5A 1NRWA 4AO7A 1J0BA 1WSBA 4MGKR 1OX4A 4P7GA 1N78A 2I0FA 1FPMA 3CX8A 3R2JA 1VL8A 1SUAA 2G7ZA 2QJTA 3RT7A 4JL5A 3KQUA 1HFJA 5F64A 3JZAA 4WLFA 4YECA 3L7DA 1RU3A 3HJTA 3OJFA 3R8XA 1E6UA 3C3WA 3GFFA 5I7AA 3JQRA 3T7CA 2BFDA 2JFBA 2Q5QA 3EVFA 4TMTA 4WZBB 3DM5A 1OLSB 3FIJA 1PYGA 2H7CA 3X1WA 2BMVA 3LGAA 1T1EA 3MT8A 4AY6A 3BSWA 4PZDA 1U6KA 4Q3OA 3LY5A 2QRUA 3MWGA 2D62A 3EG9A 4OLHA 5THKA 4JI2B 2MHCA 3AERB 3EBPA 4KQFA 3AW9A 4A0SA 1MQ9A 2FFQA 4EPVA 1AHNA 1QO9A 2AWOA 4OKSA 4Q7KA 3SS9X 4MR7B 1U8ZA 3D3KA 1DIBA 3F3SA 4PFKA 1KETA 2AFHB 3AEKB 1LPMA 4BP8A 3THWA 3ADKA 3L49A 3DWEX 3PQDA 3H2GA 1AGNA 1B15A 3HCRA 4WDQA 1KP3A 1DC4A 1Q1QA 2YJ3A 1L4FA 4FI3C 1NRJB 3ICQB 2E21A 3F9IA 3U3JA 4B4OA 3NHMA 1JR3E 5AW8A 5KTSA 1NAHA 2HHCA 1IPEA 2JEZA 3KV3O 1C3XA 3LDHA 1NV8A 3SC2B 3IAS6 1L5ZA 2F1JA 2QROA 4UHCA 4NABA 4XTCS 3F73A 3TPFA 4AKHA 4OU4A 4DC1A 2ANBA 5CM9C 2F8LA 2G8NA 3BHIA 2HQRA 2Q9AA 5FTKA 2GZHA 1G5IA 2NO0A 4UATA 2ZG6A 2HYIC 1RVDA 2AJBA 2EJCA 3QH4A 3UBMA 1VCHA 1E6KA 1VMKA 5IBCA 2BMAA 3GRFA 4KQ6A 3OZCA 3Q6IA 2FSGA 1PSWA 4R2LA 5U1PA 1TTQB 4C89A 1GV0A 1NONA 2W2LA 4A36A 1AGXA 1O94A 4IF4A 5GJWC 4WBNF 2YIMA 1GM5A 4GC9A 1WU7A 4DRXB 7AT1A 3OLZA 3X0DA 4AJ2A 3WGHA 1GU7A 1VSVA 2GOYA 4KIJA 2ZBVA 4KXUA 4NOKA 1S01A 1ZD2P 4EJMA 1C41A 2O2DA 4ZCPA 2FVYA 2QIPA 5FPQA 4BLVA 1IN5A 4Z49A 3Q8MA 2F9MA 3A6FA 3EGXB 1BMQA 1L9KA 3EEOA 4JVMA 1CNMA 1HE8B 3WZLA 5KC9A 2VDJA 3W6PA 3JD1A 5L51A 2BVNA 2YNMC 2BBSA 4WASA 4CQMB 1QZ3A 4RHUA 2A1UB 1BFKA 3QV1A 3U1VA 3VU1A 1H0HA 2J0VA 4IUDS 2OFXA 3DCYA 3DVQX 3NNSA 2YW2A 3WYAA 2ODPA 3LBIA 2EBHX 2NZYA 1RRFA 1TE2A 3H0KA 3NNDA 4BVHA 2VDNB 3CPSA 1SCKA 3RFVA 5HS4A 5JZSA 3WGUA 4DLAA 3TOZA 4HTFA 4XLZA 3VSAA 2DBYA 2HADA 1XMIA 2CK3A 3ENKA 3H11B 3IV9A 1EXDA 2VXBA 1DCTA 3OA0A 5IK2D 1CJTC 1TJ5A 4H1VA 3QVUA 1TYBE 2GFIA 5IVKA 4MW2A 4D26A 1USUA 2EBUA 4MQLA 4ZJUA 1ESDA 2L2QA 1SVUA 3NGLA 2XNKA 2FB9A 4JROA 4FZRA 5AK5A 4CKWA 1M74A 3WRYA 1KJWA 3T7IA 1TOAA 4M76B 3W5AA 4L9RA 1KYTA 3PE6A 4A1FA 4F4JA 1ZM9A 1VHWA 5AOVA 1PUXA 3TIFA 3W90A 1JECA 5UKDA 1XZJA 4D4HA 2JI4A 4XQCA 1SU6A 1XRRA 2KB0A 2E6UX 1TQDA 3M82A 1E64A 1E2LA 1KRXA 1L4HA 4B43A 3CRZA 4IIYA 1E7WA 1LVUA 3JVDA 1AX9A 2PJZA 3Q72A 3K6SA 2OPBA 4J0HA 3W9SA 2XQGA 4QHSA 1GTL1 3HVUA 3QE0A 1J8QA 1O6FA 1YVDA 2X9LA 4EDHA 4EATA 2LDXA 1Q7EA 3NEAA 2B7LA 2W2KA 4QQNA 5FBLB 4JQZA 3FKQA 4R6WA 3KUDA 3NJRA 5EP1A 2W6MA 3GDHA 2JA2A 4H4EA 1KGSA 3I6MA 4FFMA 3GG2A 4PONA 3JY6A 5EXTA 4JJ8A 5ABPA 4A8JA 3E0XA 1CUBA 1D7AA 1GGMA 2IBTA 3GRRA 1HNWB 1TD1A 5K8IA 4HLUC 1TLFA 1RQPA 2X0JA 2ZYTX 3HXLA 1DS6A 1Z6PA 1EFVA 2WZDA 5GGYA 4PBSA 3QVKA 3T4UA 3DOJA 2VK8A 4PPNA 2WVGA 4I7EA 1HLGA 5DHRA 2CB0A 1BWQA 3VH3A 4DUPA 2F1IA 4ZHQB 4KXQA 4QYMA 4TMFA 2XE6A 2VYQA 4Q9KA 1MPXA 3I2IA 3E70C 3K30A 2WI8A 4G8CA 1YS1X 1Q14A 2COEA 3HYLA 3PQ8A 2YJ4A 5FADA 3HKBB 3OE5A 3KJEA 3QF4A 1JFLA 5B4VA 4HDNA 4AY3A 1US8A 5KUTA 3GCXA 1MAVA 1V9CA 3EIXA 1C30B 1DV2A 3PPYA 4LY9A 3FZEA 1RPJA 1HA3A 1YULA 1EYZA 2JFVA 2PUJA 2EP5A 3ROZA 2CJWA 4UMEA 2ZBUA 1J90A 2PUBA 1VIDA 1ZGJA 2PIAA 3Q40A 1SN7A 2H31A 2HDHA 4KV7A 3C3JA 3NLLA 1CE8A 4ER7A 4CLOA 3OLCX 1RJWA 3OI7A 3A1VA 3BKXA 5AM2A 3QTBA 4MVJA 3OMWA 2FU5C 2JGRA 3M5CA 3SLGA 1OFVA 1LPNA 1QFMA 3CV3A 3QXCA 5DNUA 2XDQB 2FMHA 4MS1B 3MTGA 2VLBA 2NU8B 5DHFA 3B2QA 1ENOA 2Z58A 2X77A 1SZDA 2DOKA 3OJOA 4ZTBA 2J4CA 1AN0A 1N5OX 1RYDA 4H1HA 2CSUA 2GZAA 3VR4D 2GTIA 4N54A 3GFGA 4TL9A 2CHUA 3PGA1 1UPTA 4JA2A 3TLEA 4JI8B 1PQUA 5LOVB 5JFGA 3NBZC 4JBXA 3P0EA 2H5EA 3ENQA 2ZETA 3ANSA 1NW7A 1RPZA 1UFRA 3BMXA 1T4BA 5JSHA 2PLFA 4IDDA 1A7JA 1DO0A 2K7FA 4MGYR 1VLJA 1BNCA 1BHJA 1JIQA 1WVGA 1C80A 4ENVA 4QTYA 2F4NA 1NSFA 2P30A 1C8BA 1CQWA 3DP7A 4H27A 1S4MA 1T2NA 3D4BA 4YALA 1JU3A 1HSZA 2JD0A 3KL2A 4OB8A 1P2FA 3A3NA 3U4DA 3UXMA 1C1DB 2HCTA 2IEAA 4MKGA 4ZO8A 1JEJA 3W8NA 2WIBA 4YDHB 2PGLA 4TS4A 3JQBA 3ZVRA 2J48A 4LVUA 5K4GA 3TZLA 2ATEA 3R3SA 3QFTA 1M2WA 4HLCA 1WSAA 1PT8A 4TYYA 3JXEA 4MQFB 1XU9A 4CF3A 3KOXA 5CPBA 1ATZA 1S89A 1G8HA 5AKXA 1KR2A 1JYSA 2VHCA 5KI6A 2P5SA 4GPTA 3NU1A 4KWHA 1UBKS 1NF8A 4Y9SA 3C7TA 2GEFA 3QKWA 4BX0A 1YDEA 4N01A 2OQVA 3UC9A 3FNEA 2EDAA 5TS2A 1PCXA 3V8NA 1T3ZA 4NBUA 4UVHA 2EKPA 4D9NA 2XBMA 3E0QA 3MK31 5FOVA 3UT6A 1KSFX 4MPPA 1VRVA 2ON6A 1NVGA 1OE0A 2H17A 3K4HA 3MOGA 4FDLA 1D9XA 4RKQA 4W7SA 5DHUA 4DE5A 2OB2A 1WB9A 3OY7A 4LPSA 3Q3IA 1G55A 1KHTA 3ZWWA 5JNUA 2YWJA 3JWPA 2WYIA 2WZQA 5LR6A 5D5PA 1YUBA 5G0TA 2WILA 1H5NA 2NP7A 1JZTA 1AK9A 1W0JA 2OCYC 1KPGA 1GSAA 1GADO 1OI2A 1W87A 2AUTA 3L0CA 3P94A 5BN4B 2QGZA 4N3AA 5EUCA 3MCVA 2GUWA 4D6YA 1BROA 1PBNA 5GOTA 5F7OA 5IZCA 2I7CA 3CLTD 1QZXA 2DG2A 1CNEA 3DG9A 3JQAB 3PUHA 5T4HA 4NFYA 3VHRA 4RA9B 5KX5F 2ID4A 4I9UA 2FCAA 2R5NA 2ZZNA 3AHDA 1AKWA 2WSBA 3R3XA 1RYFA 1U7TA 4M0FA 1SXJB 4I2NA 4U7GA 3L4BA 3ECSA 2QG4A 5TY0A 2P3QA 3UGTA 4QA9A 3KQQA 2D2IA 4Y2TA 4C4RA 1OH7A 1A69A 4GDFA 5CA0A 3N0XA 4ZDIA 3T3OA 4EA6A 4J0QA 5FTWA 1MX1A 3E61A 1Z7WA 3JYPA 4PNEA 4DLKA 1SC4A 4WSOA 1JTFA 4BL5A 4EI9A 4ZOCA 4G24A 4TZKA 1NA5A 4GNKA 3QUSA 2QF7A 2ZRQA 4GYYA 2XRFA 2C3YA 4KYTA 5EP4A 1T8TA 1AA9A 1H2AS 3A11A 2BFEA 4KHZA 4RD1A 1PD0A 2FCRA 5FUXA 2VT2A 4YUVA 3RVNA 3DEZA 2BE7A 2HU2A 3THSA 5BWBA 2RBEA 3DHNA 3GEBA 3DZKA 5BUQA 5CDTA 3VO2A 4KGDA 4W6ZA 2A58A 3LCCA 3ROFA 1XVTA 3SYNA 3G7UA 1KFCB 3FNBA 4MQEB 4A0FA 1Q1EA 1AN9A 1IIBA 4R8LA 4Y1GA 4ZOLA 4DMCA 2QAIA 4MLDA 4RD4A 3U7HB 1C3VA 4RTMA 1UDWA 1NFRA 2IPNA 2ZPUA 2ZP1A 3O26A 1I4LD 3DBVO 1Q84A 1XEXA 3R5JA 2ZTUA 4FFRA 4KSYA 4Q6BA 4Q1VA 2GYUA 5GONF 1O6CA 3ZR4B 2EFGA 1XZHA 3AJDA 4FSDA 3C8MA 3H42B 3MCWA 4YA6A 4XYLA 4KPUB 4PVCA 4BOYA 1FMCA 1QIEA 1V9LA 2I4IA 2IUFA 4HEQA 4MI6A 1XP8A 2D13A 4CR7A 2D8AA 3QA3E 3GR6A 3K2IA 4H0FA 1PFYA 2NVOA 4Q15A 4F5EA 2RGRA 5AOBA 1KH1A 2WP0A 1E3TA 4D3ZA 3EISA 2Z83A 4BN5A 5A4KA 3AUYA 2G9QA 3B82A 4I46A 5DHAA 3HCAA 3D4NA 3GF4A 1LH0A 1X7DA 1XOIA 2YN2A 4C08A 5CD1A 3T15A 4JXXA 1ZISA 4G2TA 4QULA 4LNAA 1EVKA 4E1BA 3BFJA 3C6KA 3EXG2 3U7FB 1NXTA 1SIWA 2GEVA 2V3CC 1UOPA 1YHZA 3BIXA 3Q3VA 1UMBB 2ZBPA 1AS2A 4F72A 2XQVA 4ZEOA 3AF1A 3G6KA 3DBIA 3SK0A 1IJBA 2PZKA 1TA0A 4LTNA 3RHTA 5A3JA 3CRNA 5IDVA 2WD7B 2FN7A 2GVDC 2XNDD 2CUKA 2EG9A 4F6CA 4CIAA 2ZTMA 1WD7A 1EDOA 4EAQA 3H2IA 3K8QA 3KQNA 2QTLA 3UAGA 2G8LA 1CQXA 4JI3B 5K3EA 1XLWA 1RLJA 2C97A 5H68A 2Z4RA 2VHYA 3DLHA 1CY8A 3GFOA 2IUSA 2JAWA 1DADA 1NI3A 5REQB 2WHQA 4EHFA 3OFKA 3ZLVA 3KTAA 4DR7B 2Y1KA 1GKUB 2QE6A 3PB3A 3RK4A 2QU7A 1JEOA 1TFRA 2TMGA 4KFRA 2EZ4A 3F1KA 3W5UA 1DT5A 3SC3A 3FMFA 2CLIB 1YA8A 3SBXA 1ZM7A 2J9ZB 2W4MA 4FW8A 4Q00A 4LBYA 1F2UA 1KJNA 4OYRA 4UPDA 5DCLA 4QLBA 1Y4UA 4PVDA 1GGJA 2ZJAA 3HM2A 2VQFB 4GYJA 3NHKA 1ETUA 4MEJA 2NU6A 2EHJA 3H75A 4KO1S 5EMNA 1GU0A 2BFOA 1B73A 2FFHA 2BI8A 1V26A 3D6JA 5I45A 3DAFA 3TM4A 3OUZA 4XI9A 4D9CA 5FTLA 3PNMA 3AR3A 2UZ1A 1XF1A 4GQIA 5JNRA 4AKGA 2NUBA 2I2AA 3GA5A 4ITUA 2AFVA 5H3LA 5EWJB 3OM8A 1HE5A 1RWQA 3HL4A 4TS9A 4DG9A 3A1NA 4R2JA 5KOJB 2Y9MB 4IUCS 2C2MA 4ZO9A 5C5DA 5KNDA 4ER6A 1RZRA 3OTHA 1LV7A 1SHTX 1SU4A 1TD9A 1XZFA 4N0EA 1I5OA 3WJ2A 1N2HA 1XK7A 4CCAA 1C7IA 1N5KA 3N5KA 4H17A 4XFDA 1GRRA 1Q83A 2JGLA 2BGMA 3H7IA 1I5RA 5F3DA 5IMSA 4MDFA 4JXZA 2O3QA 3O2QB 2D1YA 4Z0HO 1U2EA 1WX1A 1ZWKA 3A7DA 1PZFA 1T2DA 1WW2A 5C0OE 3DZDA 4BVFA 3BMQA 3VX4A 4UTOA 3IIMA 4RK6A 3KKLA 4R98A 2Q1TA 2ACKA 4IQGA 4L0CA 1JAIA 2AWNA 3K96A 2OFPA 1R12A 1UINA 1GNLA 1TZBA 2QMOA 5ARDA 3VTKA 3RB8A 3ZDCA 2CWWA 2QNIA 2A9RA 2PTGA 1Z15A 3K6JA 4HNQA 3V80A 4DJEC 3M5DA 4ID3A 2B8WA 3C5VA 3EG9B 1I14A 1M8FA 1XJ5A 1A9TA 4O0MA 2Q6IA 3BD6A 1CLEA 3MGBA 4JEHA 3ZV4A 7YASA 1XZAA 5AM0A 3KJHA 4TM8A 1RRVA 4NZMA 4I3HA 2B2CA 1O7JA 2WHRA 3BWCA 5EFZA 2B30A 4FYVA 2YX1A 3VKFA 4F84A 2PWAA 1Q0RA 1EUQA 3SX0A 2XLBA 1PWEA 1WB5A 2R1TB 1A1VA 1U5BA 3UT5A 3RHZA 1M72A 4C4AA 5E2AA 5IDXA 1JDBC 1HG0A 1VDZA 2O3JA 3LQQA 1VRWA 3GLHE 2Z30A 4OJQA 5F78A 3UUGA 1IK6A 2OLKA 3LECA 3IBYA 4JENA 1E77A 2NTJA 2YWEA 3LVQE 5HOEA 1EXVA 4M8LA 1TQ8A 1YZGA 3F6CA 3LC7O 4RW0A 1N32B 1F14A 1L5QA 1ZOIA 1RYMA 4NV1A 3H1PA 3JYHA 4QRHA 2HA4A 1NPTO 1M1YA 1YE3A 2IXTA 4ITVA 4EFDA 4ALKA 2XE7A 3QI7A 1QHFA 2YVKA 3UYKA 4F11A 2HA7A 3QOYA 1Z35A 4X20A 1ZN8A 4COKA 3KS9A 3ZE0B 1C3OA 2CZGA 3HEAA 4FBLA 3RRXA 5G02A 4U0JA 1FUKA 2Z04A 2EOAA 1UBUS 2W8BA 3C85A 2DWQA 3UAVA 3WV4A 1E1MA 1FMLA 2XKBA 3IDOA 3ELDA 4BUZA 5HZHA 4BEVA 1GGVA 4REQA 3VYVA 3QZUA 4Q7MB 1IUKA 3IMKA 3G13A 3Q7RA 3O31A 2QTTA 1WHTA 2GEBA 3E7WA 2OYCA 3TQRA 2Z6QA 2LCIA 2VTDA 1MO4A 1WF6A 3OE4A 2I2DA 3T9BA 4R5MA 4UBMA 3GRAA 3W2FA 2CVOA 1RYEA 3GH3A 4CUJA 1CHNA 4D5GA 5K0BA 3MD9A 1CJMA 4C1BA 4DCSA 2PY6A 1LFDB 2QYOA 3RYIA 4MHOA 2ATXA 4Y2QA 3WLMA 3O4RA 2GESA 2BTQA 2OCAA 2LR0A 2Y1XA 5BPFA 4FT2A 4ND2A 2RJNA 1P6UA 1BD3A 2XHZA 4H3VA 4RIIA 1MABA 2HMYB 1K75A 1W5FA 3DL4A 3IQWA 3NYIA 4LF6B 3I6BA 4E70A 2P77A 2HRQA 3ODPA 1G9XA 1TA9A 4M1MA 3RV3A 4B81A 1UBSB 4B80A 5I48A 1HE4A 5AI5A 1PAUA 3TE6A 4C7BA 1I80A 3L0OA 2GN0A 4ZRNA 1JH8A 2HFJA 3OZDA 3S7ZA 4PNHA 4ZCSA 4HWRA 3O7WA 5HX7A 2O2EA 1FLAA 2W6CX 1BA3A 4LN1A 4KQKA 2GEUA 2OHOA 5TPZD 2CJXA 4O4IF 3RROA 1GZVA 2OQ2A 2WV9A 3RYHA 3QE3A 2A1TR 1M2EA 4B8ZA 3IQGX 2W90A 3JQ8B 3JVIA 4BQNA 4F3RA 4YIHA 1JDUA 3ASZA 4R9RA 1BVYF 4RD2A 4HMOA 4A6EA 1I2MA 4EVIA 2H4XA 2YUTA 2Z0MA 3DDUA 5IRCD 5A6SA 2AW3A 5F98A 1I3NA 4EKNB 3HLKA 2X0DA 2ZE8A 5IJ9A 1J9GA 3JYNA 2EKBA 5CVCA 3M3DA 1QQAA 4CKCA 2Q49A 2BBOA 4EO9A 2YJGA 2QP4A 1ZUHA 4OB7A 1XB2A 5AHKA 1JVSA 4D41A 4N5HX 1SCUA 2IP4A 2PM8A 4MMXB 1QVZA 3SXJA 1LUAA 5KTYA 1TYZA 3JZIA 1B8OA 4UM5A 5EUBA 4BC0A 4ZYZA 4LFCB 3UJAA 4JP3A 4M0MA 2CWDA 1UQRA 3AIOA 4TRNA 5CVVA 3OOWA 4W7HA 1UWKA 8GPBA 3N8DA 1A9XA 5F1PA 4MWOA 2Q0QA 4LXIA 5CLIA 1KSJA 3ZCQA 1KEPA 1XTQA 3OMXA 3QG5A 4JX9A 2FFBA 5AKGA 5E4FA 1GITA 4C14A 4CKXA 1KE1A 1EFVB 2BRUA 5JRDS 2GERA 3EVCA 3QGMA 4X6LA 5BNFA 5CDGA 3EVEA 4JKIA 1EGAA 2C29D 1G41A 1Q1ZA 1JDPA 1QGAA 1QRDA 3HWSA 3AOEA 1ZUWA 2J3HA 4FMPA 1W36C 1X0XA 2PH5A 4ZXPA 3P2EA 1XRPA 3GLHB 2JFGA 4I1VA 4TZTA 2KLBA 1G5TA 5BUZA 1VCIA 2YJTD 1CHDA 1XKLA 1CB0A 1D6MA 5IFLA 1EJ0A 3KQOA 4DUZB 3QI2A 3QF4B 1EGVB 2YHIA 4HDNB 4GMXA 4LZOA 3AIMA 1ZY2A 4RVHA 1GKKA 3IXLA 4HEA6 3U1BA 1GL3A 2YWCA 4UD6A 2X23A 1GNVA 4HCJA 1P1FA 2I7TA 3B85A 2HEGA 3JCZA 4YAOA 4HDKB 2EZUA 2WAYA 2Z5FA 2IHTA 3RT9A 1EAMA 3K1YA 3R3HA 4N3NA 4Q4DA 1UK7A 3PRYA 3AP1A 3O38A 1KP9A 5F33A 3GN2A 4JGBA 4RGYA 1JKFA 3BX1A 1KJIA 2ZM5A 5JW6A 3O92A 1QVVA 5HZKA 1CDDA 4MRAA 1V47A 5DO9A 3S3TA 4UTZA 3U13A 1OTHA 4H7KA 4OXKA 5BYAA 4YUYA 5U4XA 3QVMA 4CW7A 2CLLB 4BRWA 4XLTA 1MXFA 3GEGA 3KT0A 4RZIA 2OO5A 1GUBA 2X5NA 2DYKA 3C3AA 1V7CA 1I51A 1M54A 3AHHA 4M1OA 4PX3A 4XASA 2YFKA 2QR3A 4XCQA 3HHEA 5ITSA 4L74A 4XQ0A 5BOVA 3ANLA 1MEJA 4WUVA 3ERCA 3MB5A 4P38A 4TMYA 1WA5A 4ZCQA 2HNBA 3GARA 4LJAA 2X1HA 5G1OA 3PENA 1KQFA 2V8BA 3MM4A 4JK3A 4DEXA 1GGEA 1PX2A 2GLUA 2GN6A 2VT6A 2ZAGA 5JCXA 2Q5CA 2V58A 3AEXA 1J2JA 1KERA 2ZIAA 3OCZA 4Z1OA 3B8HA 3ECCA 3SEAA 3B5EA 3U9TA 5JTUA 3L82B 4ZI7A 2Q1UA 1TVKB 3ICCA 3OCCA 4HAZA 5EQTA 3JQ9A 1JJIA 1PK7A 3V8BA 4AMZA 2QRLA 1OVMA 4CUKA 1II9A 1J23A 1SCIA 3CBQA 4CMIA 1CVLA 5DTRA 4CL2A 4V03A 2IV2X 3ED1A 3D4PA 1U28C 1XJCA 2PKEA 4PN3A 1N2CA 2IYYA 2XADA 1UR5A 3RASA 4EKYA 4G0WA 4RX1A 3IHWA 5L4SA 3ZHRA 2CV1A 4NULA 3CSSA 1Y9EA 2YOGA 4J16C 2I6SA 4UFPA 3AJ9A 4RTLA 3SQOA 4F0JA 2OK7A 2JGFA 3WDMA 5D5HA 2I8CA 4DYDA 2ZDHA 4QDJA 3EQ7A 4J8PA 3TTSA 4M8NE 3U4CA 1SUDA 4GLJA 4XDHA 4MHTA 1Y1QA 2J07A 3CLSC 3K16A 1SVKA 1P31A 3X1DA 2W8ZA 3NIGB 4NAVA 4X1KB 4CQLA 1Y3CE 2YWBA 1NKSA 3CIFA 3DD1A 1VPLA 2PLWA 2UVQA 3HS3A 3KU4A 3OLQA 1O9BA 2FFJA 4R0NA 1LC3A 2CMGA 4I1YA 1K5GA 2VT7A 3TVDA 4B76A 1RWXA 3HY4A 3HCCA 1D2HA 1P7PA 5DBFA 1J5XA 4BFUA 2C3OA 4EKIA 1PJSA 5J63A 4CDGA 1CU1A 4ZCTA 3RF7A 5COAA 2CVPA 4CETA 5I51A 1YKSA 5AUQA 2QP9X 4QDUA 3VI3B 3VSCA 1NZJA 5BSGA 4M1KA 1LI7A 2MSCB 4BV8A 1N25A 3DMPA 1VCNA 1RRPA 2ZYSA 2V55B 2IOFK 3CUYA 1GZ3A 1E3IA 1ABFA 1HBJA 1V5EA 4J1NA 4B09A 5K03A 3HFSA 1E2QA 4E5SA 2FQXA 2F55A 1R2QA 1M0TA 4JXJA 2ADMA 3DQQA 4BX8A 5LBIA 2QPLA 3ZC3A 2XMZA 3KPUA 3D6VA 1J39A 3LQFA 2BGIA 2RAUA 3D31A 1NMXA 2ZCUA 2ZJOA 4K3VA 3PXBA 3OAAD 1N0UA 3BOSA 4TXHA 4IDAA 3NHJA 3U44A 2W2NA 2OL4A 1K0FA 3N2KA 3ZNOA 1VJRA 3BVPA 1ECPA 4Y6QA 1D4OA 3VSBA 2BFEB 2FPIA 4UUPA 2ADFA 1IY9A 1DBQA 1OREA 2HXYA 3STVA 1H1LB 2XH8A 1NRIA 1PNOA 3HYRA 2DPMA 3IUJA 3WGYA 5DYYA 1MC8A 3SX4A 1GZUA 1TJNA 1L7RA 1J6UA 1JHMA 1ULTA 2FV8A 1MHPA 2H1WA 4B45A 4EVQA 4ZOLB 1T0PA 2PO5A 5DWVA 3BWDD 4KZPA 2D0OB 4P3KA 4OH1A 3WISA 2ZRDA 1GV1A 1XEXB 3AMVA 1W6UA 3CKLA 1EZ1A 3ETDA 2RH4A 3ZWOA 4HNAA 3PTAA 1GCGA 1OX6A 4IVPA 1WEHA 4KGVA 3UMMA 3NHRA 3RSHA 3BT7A 1E0AA 4NOJA 1UP7A 3QUBA 2ENUA 1VHDA 5D3KA 4HQRA 4JLPA 4E5NA 4BBPA 5HM8A 5L4NA 3RHSA 4YXWD 3HV2A 3HFJA 3DSRA 3PQ7A 4URZR 5E1MA 3V4VB 4EPTA 3DBOB 4BNHA 5HQ3A 2DU8A 3FZYA 3O3CA 1ZMRA 2EL7A 1Q2UA 4YONB 5SY6A 2F9LA 4L4YA 3WFJA 4EEZA 1HEUA 4JJ6A 4PX2A 5EE0A 1G8PA 5BW5A 4TXLA 1E2DA 1XN4A 3FR8A 3WL8A 5LQMA 1E7SA 4DSAA 2PG3A 2ZIEA 4MJ7A 1I7DA 1ZNWA 2EIXA 3EB9A 1SOMA 3AI1A 3SFVA 2YZNA 1SKYE 2VF4X 3QBVA 4K6MA 4ZAWA 5AYVA 5IBRA 3UMRA 2Y1FA 1FDOA 3EDMA 2YXLA 4FOSA 4R2WA 4XGKA 1Z6TA 3DOEA 3AY6A 4EA7A 3DR3A 3TG8A 3KQHA 1VMEA 2H2AA 4ERXA 2IZ0A 2Q9BA 2ZI6A 3NV9A 1WBJB 1NQOA 2RH5A 4N8EA 5FD8A 5TS3A 4RYLA 1QAQA 4WHMA 1J22A 4B71A 4QT0A 5H59A 2QLMA 1UQTA 2QDKA 4A3SA 3TF5A 4HRAA 2IS6A 4A92A 1OIWA 1Y3DE 2D5AA 5LIRA 2P4SA 3LYLA 4R7TA 1VSQA 5KSOA 1SURA 3WL5A 1O54A 4GGPA 1W76A 2RDMA 3CRW1 3GVIA 1HE3A 4C88A 2X5XA 1HYHA 1Q6YA 4BB9A 1W46A 2X42A 3EVZA 3GFVA 2P9EA 1F2UB 1QRTA 4URHA 1ADJA 4QTTB 3OC0A 3ROQA 1V1JA 4YR9A 4ENUA 2QYSA 4HVAA 3EGOA 3SNHA 3VPBA 1JKJA 1VRCA 2ZB8A 4LDAA 4MS4B 5KQMA 3K9WA 3PR1A 3B6JA 4RDCA 4QXOA 2ZREA 1R4NB 2D5LA 1TKAA 2WHEA 4DARA 4TL7A 2YKGA 3GT4A 3PPXA 4OJTA 5DHPA 4NPCA 3K1AB 3VNSA 1JIJA 5L45A 2J3EA 2ZIWB 2QRGA 4RKFA 3K9FC 4D9BA 4FGLA 4ZIRB 1UMKA 2I6FA 1N6KA 2H1FA 1X2BA 1KQPA 1MQSA 1H3NA 1QO0A 2AYYA 2Y0DA 2XMPA 2FRDC 2FX3A 2J31A 1UBOS 3MBIA 3N70A 4YN3A 3EMDA 4L72A 2Y1GA 3DPSA 1X7HA 2LIVA 2WWXA 3GJ5A 1D4ZA 2QRJA 4QJ5A 5KTNA 3LXMA 1AUPA 3B78A 4RHYA 4G5SA 4PYKA 1R8YA 2FN4A 4PX5A 5DTQA 4QYXA 3WIEA 2RGNC 3K9BA 4BASA 1QU2A 1AUQA 4MKZA 1OVGA 1WSWA 4B3JA 7GPBA 3AI7A 4DL9A 4OPMA 3N8NA 2ZRKA 5D01A 3THXA 1QH8A 4CT5A 2A30A 4OXNA 3I1JA 3T34A 2PL3A 2E48A 4QAQA 3CPJB 3TEJA 1A5AB 1EWYA 1LK0A 1R0RE 4NTZA 4OP1A 3UXYA 3EEYA 3AINA 4Z7JA 3IUYA 3UK2A 1QOPB 3BMQB 1MENA 1USWA 5LLSA 3RS4A 2GWHA 3EZYA 2JZOA 4OQQA 5C1IA 4RL4A 1XNQB 2BC9A 3G2HA 1W75A 4DY4A 1K06A 4PLVA 2O1EA 3LSYA 2BJHA 3OEHD 3FCYA 4IG9A 3TW4A 1IXKA 5CDYA 1JNYA 2VJYA 1FZQA 2X3FA 1PTJA 3EZGA 4JI5B 3D3EA 4FHZA 4DDUA 2Z3VA 3ZQ4A 5CBPB 4M9SA 2ZBEA 3E7PA 4BNKA 2AXQA 3SR0A 3K9LA 5FX2A 2ZRCA 5CFLA 3M4NA 3RC3A 3GLGA 3QMWA 5CA0F 3S99A 1GQOA 1E1CB 1ZXXA 1YIDA 4OP3A 3K9GA 1Q1NA 1K3FA 3I83A 4HH1A 5T4BA 4UUOA 4L3OA 2NZ2A 2A88A 2H1OA 1JWBB 1GR0A 5DM4A 2I1VB 1QFZA 1B41A 1O6GA 1P62B 5KQGA 3G2KA 4C0WA 4ZD6A 3UT5B 2XOEA 3IAS1 4XWTA 2AZTA 4J0CA 1UWVA 3VVBA 1OR8A 2C4NA 2V3WA 1BS1A 3LCRA 2OM2A 4EY6A 1V8FA 3MBKA 4K9SA 2HF2A 5EN4A 4DV5B 4R1TA 1G21E 4B33A 2L69A 4F3YA 1Q0TA 4N8DA 3HBJA 2RGAA 4X60A 5AVOA 1AMUA 1A8HA 3EW7A 1U0GA 3WYEA 5H82A 1XPUA 4HDRA 5FBRB 1X8KA 1NMYA 5BR8B 4Y2HA 4N65A 1QZUA 1WS6A 1XZMA 2D5IA 3KLNA 4HYYA 1G5PA 2OZLA 1WV1A 5DIFA 4U3JA 2GILA 1C3OB 4JJ7A 4EY8A 1M6VA 1PL8A 3UG6A 1UBTS 1NW5A 2A5LA 3LJKA 4LZPA 1B8PA 1PL7A 4LC1A 4YRQA 2C1ZA 4YASA 2VJAA 1UDAA 5ETJA 4JI1B 5DULA 4KYUA 1A5TA 2ZYDA 2JLRA 1ISJA 1KY2A 2CB9A 1QV6A 1CQIA 1OHHD 1UKVY 2JATA 3AG5A 3OPXA 4REQB 5DISB 5FAXA 4DHEA 3DH0A 3BXGA 1LSOA 4LJLA 1OZFA 3UJ8A 3ZBQA 4BNWA 2VEDA 3R9IA 1P33A 5LUBA 3GGPA 4MQMA 1YB5A 3WOHA 4ZI3A 4V0SA 1JR3A 4O8ZA 1GTZA 1DOAA 2QPTA 4X45A 3NVAA 1O8CA 4C0JA 1JJ7A 2OXCA 4UVGA 3DE4X 4Y7DA 3P20A 2DVMA 4HGZA 5BSFA 5IT5A 3RYIB 4CMEC 3FOWA 2OBLA 3K73O 1E4VA 3ZUPA 4TS3A 4AUMA 1KYQA 1ORHA 1B3BA 4G8JA 3UAYA 4ZCIA 4XJSA 1MABB 2P6UA 2BZSA 4B6FA 2CYAA 2DQZA 3AFOA 3IT1A 2WJJA 2N1MA 3EXHC 4OYYA 5F4ZA 3RRFA 2VPTA 4Q01A 1D2EA 4C7KA 1EESA 3LL7A 3TKYA 1JPJA 1LEHA 2IE0A 1HOTA 4LXYA 4KLRA 5FOTA 5I5EA 1NXOA 3OD5A 3RSLA 3ZU4A 1EMDA 1Q16A 1H6CA 3BJRA 3QY0A 4AS2A 2VL7A 2P41A 3B2EA 4MGHA 4TXNA 4NEQA 5EY5B 1JFTA 1J2TA 1SZCA 2L18A 3SZGA 4EMTA 3FVQA 1ZS9A 5KAMA 4I8IA 1M5TA 4LZWA 3DFIA 2H48A 4IVRA 5E7QA 1O95D 4FR0A 2WG0A 2P9QA 1GGFA 4R84A 2WUEA 1EQ2A 3CF2A 1A8UA 3KLMX 4H1WA 2E3JA 4N5DA 4X91A 4G37A 4BYMA 4FQ5A 4DAOA 5E9AA 1GOTA 2JFXA 2C04A 4MWSA 3OFJA 5IJ9B 1ZA1A 3ONDA 5ICGA 3W3AA 4OQNA 2IU0A 3SM9A 3J81A 1XQ6A 2JJYA 5A0TA 3EPJA 3EDCA 3NBXX 2G4CA 4X5OA 3UTDA 1JR4A 4I66A 3R6GA 4G1MB 2WU8A 1L5HA 1P7VA 1SCUB 4TLLB 4E3ZA 3PVCA 2BR3A 1YZ3A 2XEXA 3H9EO 3SSMA 3BCHA 3NW9A 2V0GA 4WXMA 1MH1A 3FPJA 3PIDA 5LYYA 2BFCA 1GSHA 2WIGA 3A7EA 1WZIA 4KMSA 3QPVA 4C7MA 1A9XB 3MWEB 3LVRE 5ALIA 1HM5A 2IXFA 1BRTA 2J5BA 4YGXB 1OFTA 1LS1A 1LRJA 1ZWLA 1I2DA 2O20A 1YKFA 2FSUA 2Z2JA 3ICVA 5IJAA 4Z2AA 3A2NA 1SC6A 5F1YA 4HNSA 4AULA 2SBTA 2N42A 1NI4A 4MARA 4DGSA 4WA7A 4GICA 2FE1A 3NYRA 1JSZA 4MIKA 3IBGA 1VA5A 2AEEA 1LU9A 4CV0A 4JB2A 4WFIA 5K8VA 3I0ZA 1Z36A 1NLMA 1XRSB 1V7ZA 2OWDA 2YFYA 2I7XA 4L50A 1BKDR 3ZX5A 1O0BA 1MAHA 2V7QA 3EZ7A 3NTXA 4EJSC 3NUZA 3WLFA 5F9FA 2EJTA 2JGMA 1NF2A 3TZKA 3SIRA 4DM4A 2LVBA 2H2FA 4PHFA 1K5DA 1P4RA 4V24A 1JLKA 2PVPA 1X2EA 4FGKA 1I5EA 1JVNA 2ZBDA 5SZJA 1SD5A 5JDCC 5ER6A 1SO8A 4X7PA 5E4YA 1Z37A 2QUJA 2V59A 3KKEA 4GM4A 4JODA 4OSOA 5EUMA 3TLZA 2FEAA 5JNWA 3O73A 3OO0A 3R41A 1NR5A 5JSUA 3UPUA 1TUBB 4CG0A 2IH2A 4F91B 5LXTB 3DHYA 3UK7A 4OUDA 2H2IA 3D8UA 4OBXA 3H83A 5DTMA 2XNSA 2ADOA 2CDAA 4TWAA 4BP1A 3WFZA 4CR8A 2DAPA 3RT1A 4WKCA 4QJIA 5C7LO 1JF8A 1MO6A 1BG6A 4HQOA 4TTIA 3EPHA 3DWFA 4N3CA 4B2PA 3VKGA 3ZGVA 2DPXA 2PSFA 5JAIA 3CKYA 2ZPTX 5COBA 2PA0A 4OL0A 2IYEA 3PCTA 3ITEA 4AM8A 1G19A 3V4SA 1DKPA 4Z86A 3KYJB 2WWGA 4MRMA 3JAWB 4LYGA 3SF8A 2PN1A 1BWSA 4CT0A 1T8SA 2OB1A 3FNGA 1N2XA 4OATA 4UAGA 2WBLC 5AIAA 1J1ZA 3OE7A 3BFPA 2Q21A 2B8NA 3KALA 1MCZA 4FCTA 3WHLA 3WIUA 4LDJA 2NP6A 2IP2A 4AJHA 1DRJA 3K9HA 3WLQA 2PFSA 1SUBA 1Y1KE 4Q9HA 1OLUB 4CV3A 3M5PA 4ZI7B 1TC2A 4G9GA 1EGQA 4HUQB 4MV5A 3EGEA 5CU7A 3FMGA 1U90A 3KBOA 4XA8A 2UXDB 1RCFA 2H52A 3D7SA 1XV5A 2VWGA 3PI6A 1E6LA 3OP4A 4FJ1A 1KO8A 4KXMA 4BLWA 5D3QA 2AA3A 3K35A 2VHJA 4NP6A 1U2TA 4FDMA 4TVOA 1SFRA 2PEYA 3BMNB 4P3PA 3ZU2A 4IBOA 1XRLA 1XR3A 5IKPA 3H9UA 1JQBA 3C3XA 5CFQA 1AS0A 1Y42X 1ZIYA 1TAHA 2B9VA 3DM9B 2O0JA 2F8MA 3LKBA 4B5LA 4H7PA 1EUCB 2AT1A 3ZS8A 3ON5A 1RAAA 1VP3A 3AKDA 3OPMA 4N9WA 4CQLB 1EFAA 2GD1O 1T43A 1TIBA 2BPOA 4NMMA 2C7OA 1IK4A 4O4HA 3LP5A 2V03A 5HFNA 3MAJA 4JEIA 3JQPA 3RBXA 4BWYA 4GKJB 1JEDA 3JQGA 1TQ4A 4R3UC 4MCHA 5GVRA 4JNKA 1IRIA 2J6BA 3RSSA 4LXQA 5G40A 4CIVA 1Y8AA 3KQSA 3UBTA 3KWMA 1PFWA 1RI3A 3JWJA 1O89A 3ZUGA 2GRJA 5AW4A 3GAFA 1Y1LA 4MROA 2JLSA 2XGGA 3VMMA 4MW4A 3W5SA 3P9CA 5KCZA 3CR8A 3N3BC 4NV0A 4YFYA 2E18A 1I36A 3HGTA 4D44A 4ZK6A 1DJPA 1RACA 2JKVA 5HMMA 3EY4A 5E3IA 1C9EA 1DTWB 2ZBGA 2AMYA 1STOA 3GP3A 4MB2A 4XPZA 1FSSA 1ZL0A 1A9ZA 3QKSB 1ESCA 4B6EA 1V11A 3CCFA 1YOVA 3BRSA 3OM9A 4BQPA 3P7MA 4DXDA 1WPXA 4OFBA 4X90A 5JH7A 3U44B 1QG2A 3TJZA 3VZPA 3ZVMA 3QK7A 2OP0A 5GM1A 1E1QD 3Q5GA 1I94B 1OYVA 2DFLA 2FPIB 4RF4A 1ZFNA 2R0QC 2V1UA 1GPJA 1HDZA 1CLUA 3W05A 1Z0KA 4MKRA 5BNIA 3I12A 1T35A 2WA1A 3VU3A 1SQ5A 1S2LA 1YR7A 2J59A 1VSUA 2I3GA 4G41A 1RYBA 3FOFC 3EIUA 1P77A 4BDTA 1I2ZA 4H7EA 3ZD9A 2J0SA 1UJNA 5SYAA 1LNSA 2EQ5A 3OZWA 3VDXA 2UYGA 4DV1B 3IJRA 5A3RA 2J9RA 1IBSA 1MJFA 1NVWQ 5JCJD 1FFSA 1ZD8A 1I9GA 5T41A 1N5RA 1M33A 4W1RA 3D2AA 5A9SB 1LK7A 1GSIA 3JASB 1X3LA 2V0NA 2XCOA 4MV1A 1PL6A 3HU2A 5DIZA 3DLBA 1TKCA 1XEFA 3HZRA 1JBEA 1M1NA 4BO7A 1GPBA 3G2IA 1EFRA 1SA0A 3A04A 3SQWA 2QUAA 3ZDBA 1ECLA 3I3OA 3ME5A 1EK1A 1V41E 4C0KA 5KTOA 3SBEA 2X8WA 1FFWA 2JGJA 4DLZA 1YJ8A 4YB8A 3RIYA 3T12A 5HQ3B 3PWKA 3PUIA 3E1SA 3ZD8A 3HNPA 4EG7A 1J2EA 3UGKA 5CT9A 3PK0A 1DBPA 5EOVA 2HU5A 2D1FA 2Z2IA 4BNGA 4OH7A 4LDPA 1L7DA 5LA6F 3W5CA 3SGLA 3N6RA 4J7AA 2IYUA 4YROA 4DC9A 3B8EA 3VZBA 2Q3JA 4JJAA 1SELA 1N9GA 1Z83A 1UDBA 1IM5A 3OZXA 2KWIA 3JU3A 2QJOA 3PZRA 1MLDA 4KIGA 4KWTA 4MMYB 5A9TA 4GM1A 4TKVA 4JJZA 2CCGA 3FXAA 4DW8A 1BH2A 4UZEA 4HQFA 1X7YA 1Q15A 1T91A 4JLAA 1GRVA 2Q4DA 1YU6A 2Y2UA 2DE0X 1ZSYA 3U16A 1F1JA 2M2IA 5AVUA 1J42A 1R27A 3PFGA 4OFZA 2PRIA 4UCQA 1F6DA 3N7UA 2AH5A 2ZRMA 1H4QA 3NYQA 1KC3A 3A4TA 3B51X 1OYYA 1GPNA 1RWBA 4GOND 3F3YA 4IDBA 3CX3A 3L8MA 4OKIA 5KHOC 4GL2A 3MERA 4I55A 2GMWA 4IHQA 3M34A 2OESA 2R68A 3KTOA 3G2LA 5BN3A 4H9GA 3F6PA 4XVCA 5EHXA 5EP3A 1OXUA 1YE8A 1YI0A 3VU8A 1T9AA 2PKQP 3KSZO 1AV7A 1T2FA 1KDTA 1ADCA 3E22A 3URMA 3JWIA 2YW9A 4RV9A 4IV5A 4TXJA 4B85A 1JXOA 1RKXA 1CJBA 3IRUA 3E7XA 3WGVA 2M9MA 4OFXA 4PSKA 4BMYA 3UJPA 2X4DA 5EHIA 2XUQA 4YIKA 3T52A 1W49A 4RHEA 9LDTA 1GRCA 2GHQA 4NBSA 4BGIA 4WW0A 4B6GA 1KS9A 4CG1A 1YQDA 3STXA 4UHHA 4OREX 2NPIA 3RDPA 1SB8A 4DNFA 2Q1WA 2WJGA 1V3TA 4K9PA 2ZQZA 4IZ6A 4UE6A 3AL3A 1JQEA 3EPKA 2Q4EA 5C80A 2AKEA 3QNMA 1B1CA 1BS2A 2YDXA 2G09A 5I3ZA 2BTEA 1V71A 2YASA 1MT3A 1ZUD1 5T3YA 4AF7A 1NBEA 4RM2A 3TAXA 4HRXA 1P1CA 1T26A 1F1BA 2XTJA 3OIFA 2RAVA 3I92A 4D0NA 1SKMA 3FHTA 3AM1A 2AN1A 2ASVA 3H18A 1POWA 4HO1X 3ISVA 1U1FA 4IIJA 1TO2E 2R84A 2H06A 2Z1DA 5EWLA 3UJ7A 3BQ9A 3JQDA 3UJ6A 3THXB 3K4QA 3PD7A 4OGKA 4XEUA 3ZWAA 4YRNA 3KLBA 4MUIA 2NZVG 3M6WA 3NYWA 4ZZ0A 3EPRA 3TCXB 2RARA 4PO8A 4TT3D 1FS6A 3HK2A 2ZI9A 3PQ6A 5FXMA 1C8VB 1HEIA 3IUSA 4FC7A 4YH1A 5A4FS 3OX1A 5HZGA 2J3DA 3BB1A 4NAHA 1NOIA 5KNBD 2VHXA 2YR0A 4MVJH 4EH1A 5HBRA 1W48A 3VO9A 2XCTB 2YFHA 3FHOA 3L7LA 4CV1A 3H1EA 1NU6A 2FMFA 4L8LA 4DMMA 3AEUA 4ZVNA 2IY7A 2V65A 4QWWA 3DTTA 4RPIA 4I9GA 1KA9H 2AJ8A 5IP5A 3VOAA 4D02A 1OBVA 4JBLA 4HP8A 1YNSA 4IJVA 4EUNA 1FFYA 1X87A 5KZMB 3CUVA 4RHTA 1T9GS 4WINA 3GLGB 3G17A 9MHTA 3LCVB 1QGUA 3E84A 3RBVA 3RANA 3PXXA 3QE9Y 1Z5WA 1LLDA 4DCTA 1YR2A 1RI5A 2G17A 3AY0A 3RVPA 4KEAA 1Z6AA 2VJKA 1PL0A 5DYGA 4CLRA 2VSOA 1IHOA 4JOBA 1GT91 4JC0A 3KCQA 3EXAA 4WBNA 3BN3A 4FEEA 4JNCA 3RUPA 1E8MA 2QG9A 3O7MA 4FP9A 2OMEA 4R6XA 3GEIA 4HS9A 5DRTA 3Q7TA 2YMLA 1E62A 4QT4A 4UM9D 3D6FA 3WRVA 5K05A 1U2SA 2JH9A 1ND5A 4PXYA 5JXJA 3BG5A 1BHO1 1JDVA 3I1YA 4NICA 3M5WA 3ZWKA 1SD1A 1QS0A 1HNXB 3N58A 4TRRA 1GXSA 3BTVA 3PQ4A 3X1XA 3VR2D 3IVXA 3L8DA 1OCEA 3ZKWB 4PG8A 2QN2A 1QTQA 1EDDA 1U98A 3DEAA 4Y9UA 3RWOA 1RE1A 1YOBA 2WZBA 2YBDA 3KYCA 4E2XA 1SWWA 3QU9A 3UUFA 1GCOA 5EA2A 1NC1A 5AUNB 1LKZA 2GNOA 4HYQA 2I4OA 3A6DA 3FROA 4GQBA 3FJ1A 2XXAA 1DZIA 3OX4A 4DLYA 5K3FA 4A7PA 3DJFA 1YASA 5EIBD 2IHJA 2CL7X 2XMQA 3ELUA 2IYZA 5IWCA 5L3SB 4M7WA 1SIOA 1FQJA 1VMIA 2J45A 3MLAA 3NTRA 3NGXA 3O4FA 4NJEA 3H1GA 3A3OA 1RAHA 2WYHA 1NVFA 4X66B 1KH3A 2OBBA 5ALZA 3LHFA 4Q4JB 1JDTA 2BEWB 1W19A 2YV5A 4ESOA 1LBEA 3NDPA 3RS0A 2NO9A 5AKYA 5TJHA 4ZREA 5JALA 1UBLS 3B9BA 2MMCA 3HA2A 3LK7A 1C7RA 2H92A 1QIHA 2NZJA 2PBFA 4XUDA 2R6DA 3AB3A 1V4VA 5JUWA 2NQ8A 3DOHA 1F20A 3WLPA 4YMUA 1YFJA 1P61B 1U3UA 2Z5GA 5AW5A 1VPTA 2UXCB 5AJUA 4C4PA 2EZTA 3ACCA 4M0EA 5CCEA 4YCMA 1ESMA 3GPLA 5EIXA 5HDBB 3RU9A 4TT8A 1EZZA 4G8BA 4QYWA 5DT2A 2GZ3A 4XM2A 2GM3A 4ZAYA 4Z0PA 4FZ5A 3RSZA 1ZK3A 1USVA 5ALVA 4J1SA 2ZK7A 3GAZA 1ZQ1A 1U5CA 2RHHA 3KZCA 3PC6A 4KAFA 3USES 1UJBA 3GNLA 1EWTA 3FYUA 2C2HA 1TM2A 2ORYA 4JP2A 3REOA 3H2SA 2V7EA 5TQVA 3INGA 2WTNA 1NJ6A 3LRPA 3H7AA 1Y81A 4IGAA 1LS6A 5DXFA 4F92B 1FQWA 2WUGA 3DL2A 3OC6A 2J3KA 2P9CA 4RD3A 1D4FA 3T0IA 1IU9A 5HKKA 3EIQA 1ODCA 3OPYA 1UJMA 4G5YA 3ESDA 4Q12A 3ZHXA 1PJBA 1ZL2A 3D6MA 3KUXA 3QUCA 4ZP1A 5C7IO 4GKKB 3ZJYA 5B7PA 5EJ5A 3ER6A 1OXVA 3QU4A 3UVEA 5FJJA 1P0PA 4XOIA 4ARZA 5K6AA 1QCCA 1QYXA 3A9SA 4XPIB 2C5EA 2R4QA 1TMOA 3ESBA 3FKSA 3UGJA 4LYHA 4CMAA 4UW9A 1G0NA 1YZUA 5IXYA 3EZFA 3LRXA 2XNCA 3ANXA 4KPEC 3IBSA 4XZ3A 4KR7A 4E5YA 4RJIA 5LNK6 2C0PA 4TV9B 3TCNA 3Q9SA 3EDRA 3TAUA 4U7WA 2PMEA 4EPYA 4LZZA 1L5HB 4FWIB 4X3CA 3LM8A 1K63A 2JI7A 1YQ9A 2UZAA 3IMEA 3WMRA 1SAYA 4YJ2F 2IE8A 4UAJA 1LVHA 4FPXA 4N5LA 4GZLA 4LYAA 1QGDA 1R0XA 3BC1A 1JLRA 1XCLA 4ZRMA 5A4IS 2OXTA 1E1RA 2D0PB 5AH0A 1QTNA 4K6CA 3X1MA 5IVIA 2ZE5A 5CMLA 2WKPA 5BWNA 4F06A 1P2SA 4C7VA 1C1HA 3K2EA 3PL1A 2BGNA 2QTMA 2A1IA 3MJHA 4RDHA 4XB1A 1MDFA 4LY3A 4PGAA 5FPPA 4TV8B 1KY5A 3OCWA 1R6UA 1K2VN 2GPTA 3HO6A 1FYEA 1KFBB 1S3FA 2J9GA 1Y6FA 5A2QA 3K20A 5C3UA 2XB2A 3Q6NA 2AOWA 4YJ3B 5CX4A 3DKRA 4HEA1 1T36A 5DBHX 1N4DA 4D6XA 1HDIA 2W9XA 4RF3A 3VZDA 4YCCA 1ZNYA 3NANA 1AXGA 2GTHA 4XFJA 1KL7A 4EI7A 4PLFA 3IR6A 3AU9A 3MAAC 3WADA 4FHEA 4BZQA 1SUSA 3F6YA 4FSHA 4RSGA 4IMPA 3SYKA 4BO2A 2GKOA 5E6UB 1HV8A 1T4GA 5MHTA 3NHBA 3WRYC 3IEVA 1SKAA 3IJPA 4PZPA 2PMWB 1S96A 3U7JA 1M2KA 3CCCA 3BZUA 4D4GA 1UC8A 3ILXA 2ZRJA 3PL5A 3DZIA 3MSCA 1S7GA 3LA6A 3P9QA 4UEJA 1L8LA 1E4YA 1CJVC 1QTRA 3U62A 4OUDB 3VKWA 5CFMA 2NO4A 2FXVA 4G5QA 2C20A 3I76A 5T4EA 2EWVA 2EATA 1H2HA 2QI9F 3BIWA 4MDHA 4W99A 1WO8A 5EYPB 3TSYA 5AESA 1PD1A 2Z56A 4QRDA 1H5QA 1HDGO 2VDWA 4GRAA 1JBQA 3AHGA 2PXCA 5E1BA 1QK3A 2AE2A 3FLAA 1I7LA 3LY7A 3BM5A 3B3JA 5EVJA 4EG4A 1JFRA 1ZR2A 2FMKA 4J03A 2WJAA 5KYUA 4P4UA 2OHJA 1FK8A 1FBNA 5DTJA 1HEYA 3CZRA 3KOYA 1XROA 3LD9A 1G20B 1MEEA 2XBUA 3HSYA 2A0KA 4U2KA 2C2GA 2EBFX 2X7JA 2F1RA 3VHQA 4A8JC 1AMOA 4M0LA 3G5MA 2VYVA 4UASA 3QX3A 2GA9A 3GX1A 4BU0A 3VZRA 3SF8B 1L5YA 5HXAA 4Z1MD 4IIXA 4TMVA 4J6EA 3V1UA 2C2KA 3QU5A 3UA3A 4J4BA 2NPOA 5TQ0A 1RLTA 4X7RA 3JRNA 5D7BA 5A0FA 3RARA 2HO5A 1DKQA 5CVEA 2VRCD 3RTBA 4HNTA 5DTEA 2QV0A 3AKEA 2CNKA 3HWRA 1VKRA 4QU0A 2JI8A 4C0HA 1PBTA 4MR9A 4FFLA 3OTQA 3EZ2A 4I1IA 4V02A 1FJXA 4PS1A 2R8EA 3V1TC 1XZEA 5FUWA 5KNDH 2RGXA 3AJ8A 5D1HA 5D3ZA 4M4SA 4PRYA 2FJUA 4D81A 4QDZA 3L8GA 1G6HA 3GLFB 1S2OA 4BNXA 4XR4A 1HYEA 4QFMA 2IX3A 4IJKA 2FSSA 3DKPA 3LOQA 3S1AB 3UUWA 3O82A 2QVGA 4HXYA 4WZ6A 1DI0A 1YCFA 2XQFA 3GG9A 4QNRA 3VO1A 3PLRA 4QDTA 3NALA 3GHHA 1EKXA 1O58A 3HN6A 5F5XA 1TX4B 2P65A 4E1AA 2POCA 2VBIA 1PYOA 5A4AA 1RLMA 1WHSB 4RMIA 3D02A 3WE7A 3FCSB 1P1JA 4YRGA 1ODFA 4MW9A 1H3EA 3EC1A 3N9IA 1ZGGA 4KB5A 4OQMA 3ZZ0A 4EX6A 1WCV1 4YR7A 3PHCA 5EZ5A 3VUFA 2P8SA 3QEMB 1T0UA 2QTVA 2XT9A 3HDJA 4H7FA 4ROSA 3CB2A 3FVVA 5BUCA 4R1MA 2ZR8A 1RAEA 2BD0A 2REQB 1ZK4A 2JIBA 3F3MA 3QTLA 1GA6A 3GT3A 2Q27A 1ISHA 1EUDA 1U4NA 2VJBA 2X5JO 1KKUA 3IE2A 4Y6PA 4OXYA 3ZE9A 4UPEA 4BN0A 1P75A 4WOBA 3AEZA 5KS2A 3MA0A 2XCRB 3RFUA 2QENA 4MUKA 1Y8QB 3CINA 3CEJA 3LDAA 3FGNA 4J9UE 4ZQGA 4D99A 4ZTUB 2OAQ1 3R7WB 5TR9A 5LD2C 4R1UA 3K8YA 1V11B 2CFOA 1XF9A 1YOVB 2DWPA 2HWKA 3C7DB 3F7NA 1N9ZA 3EFEA 3GBSA 3JQBC 4G6ZA 4E30A 1ZXBA 2G1KA 2W48A 2XMRA 5JH7B 3GU3A 1R64A 1IZ9A 3AXTA 4QGAA 4G1CA 4NDNE 3NWPA 3A6GA 4BLSA 4B5KA 4WKOA 5J58A 3ZDEA 2WVHA 2P0AA 5D1NA 3TLYA 5FFMA 4PE5B 3K70D 4MV8A 2PQ6A 4RWZA 5IH3A 1YTLA 1VYVA 2B5OA 2AK2A 2OCIA 3QVSA 3DMNA 4ISCA 4GX2A 3ZWQA 3DS8A 3VVMA 2B5WA 4WOCA 3K5PA 2J4FA 3GZNA 1CPYA 3MMNA 1MOSA 3AW8A 2WJHA 1TPZA 2CLCX 2IFTA 2VYND 1GTSA 4MI1A 4RKYA 4KR6A 1E0JA 5TPWB 4B34A 3PRHA 3V9PA 5LZ5A 1W7AA 4OCZA 5ICEA 3KFVA 2G0AA 4AMBA 4I4TF 3W2EA 2RH8A 3O2SB 4DLNA 3LPLA 4QFCA 4XD2A 2JL1A 2VPZA 3IO5A 4LDQA 2CHVA 2FUG1 4JBNA 5IKEA 4W8OA 4BP9A 4NDZA 1EWKA 2AF4C 2ZTHA 3R5XA 2JD1A 5KKCA 5EPUA 2FPRA 4WCDA 3R3WA 2QMYA 3F4LA 1D1TA 4B3HA 1O6ZA 5IZCC 4AKTA 1DEAA 1GPH1 1L0BA 1TEXA 3VU9A 1PV2A 2FK7A 3CKKA 4D3SA 3QUTA 3BGOS 3BXPA 1MG0A 3K0FA 1DE0A 1SCQA 3JPYA 2FE4A 3OZFA 4A1OA 2B8JA 2RG1A 3IP9A 3TNYA 1E60A 3WXBA 4M49A 3CEPB 4E09A 1KS2A 9ATCA 2V45A 4F2WA 2HZBA 4QOIA 1UBHS 5B7NA 1ZCAA 4TKVB 4B79A 4FB4A 3F96A 4PYIA 3I39X 1AK2A 5ALDA 1X7YB 1R5NA 3PNVA 4GE3A 4IXDA 4V0RA 5CUQA 2EHDA 1W4BA 4IO0A 2P40A 5M04A 4QBHA 5JVDF 3LBAA 1CF4A 2MSNA 2GCGA 4QG7A 1JLLA 2YVQA 4H31A 2NG1A 4NH4A 2AR7A 5E9WA 1H2FA 1XCBA 1BC5A 2J33A 1T1IA 5EGNA 2IH4A 2RIPA 1ZLYA 1GZDA 2RAPA 3CTPA 3PQFA 4N7MA 1YBMA 2BEVA 3DGEC 4XW2A 4D2IA 5BN3B 3D2LA 3F0TA 1NATA 3OSUA 3VXKA 3H8WA 4HJRA 3N07A 4KIWA 1Z2DA 5FA8A 2CLOB 5DLEA 1RD4A 2BGWA 4NBLA 1IBMB 2OGWA 4C29A 3FSRA 4YV0A 3OTGA 1UK6A 2IJGX 2E4ZA 4P4SA 3WMXA 1N33B 3AUUA 4KN8A 3QKTA 1XMOB 3JQFC 1XELA 3ZV5A 3LUCA 3QELB 3R3UA 4IDOA 4MGEA 4RKRA 4IIBA 1VHTA 3NHUA 4G8DA 4OBWA 1U0JA 2NNWB 2JLQA 1Y5NA 3AF5A 5K8UA 1PR5A 1QHIA 3FUCA 2P9TA 1V4BA 3MF4A 4KJZA 4N40A 3RU2A 1A9PA 3S8EA 1DIRA 3H8SA 5HUJA 4IEFB 4NHOA 4ZYUA 5I9LA 1E3SA 1XXHA 1OXKB 3UENA 5F77A 2AEFA 4KQ1A 2AXEA 1J0CA 1RJGA 4HFRA 3RABA 4C4YA 2CXHA 2C2XA 1KI7A 5AO9A 5K3DA 4X1YA 3IXMA 4EW6A 2PX3A 4QM7A 3E53A 4YAIA 2X13A 1A82A 3DE6X 3DGFC 3WL6A 1U7PA 1X1TA 3IEUA 3Q3HA 3QJGA 1RZ3A 2VJQA 4L16A 4XB6B 5J2TA 1EE1A 1SKUA 3DT8A 3EVAA 4HVTA 3TRDA 1C3EA 2WT8A 1EFPB 4D0SA 2JLBA 2B4KA 2GYYA 4M2LA 4O4HF 1GTRA 4OY3A 3UB2A 4NE2A 1RW4A 1SU8A 4HNRA 2QD4A 2CYCA 3ACDA 4OHBA 1BZYA 5ERXA 1WETA 2NIPA 2RGCA 2WM3A 3OQIA 4ZKEA 1SRRA 5JISA 2QORA 5ESRA 4X6UA 5CT5A 4PLTA 3TLAA 4G63A 1P4AA 4WKPA 1HFEL 3HA7A 1UXOA 1V16A 3A9CA 1HKHA 1YS7A 4QGGA 3T1HB 2CXUA 2PAAA 2W6JD 3W79A 2UV8A 3DO6A 3PGKA 2C5FA 3R6TA 1PF7E 2ZIXA 4RY2A 5ESXA 2AFRA 3RAGA 3K05A 4XVHA 5BSUA 1G8AA 3ZKAA 3GFBA 1ZUNA 1QANA 5K3CA 2LV8A 1N6HA 2CNWA 4NL4H 3ABRB 5CA1F 2M98A 3UXEA 3VBCA 3PFWO 5H9WA 2R1VA 4DIDA 1NASA 3CPHA 2AOVA 4IPTA 4UBOA 1SCNE 3MELA 1CS0A 1TJYA 1FL9A 2BKUA 5F9MA 3TQIA 4LK3A 2PD4A 3HUUA 3KJFA 4W5TA 2Q1XA 2ID7A 4UREA 4P86A 1WY7A 1Z4JA 1U8AA 2NZ8A 3CX7A 4V0ME 5DVZA 5IM4A 1AXRA 4JC4A 1E9AA 2EDCA 1AQUA 3LUFA 1EA7A 1FTQA 3OPQA 1YTUA 1QYVA 3IVCA 2QRNA 1QS0B 4PFSA 1Y4AE 2ANCA 2OUKA 1C29B 1TM4E 3AM5A 3QVGA 4S3MA 4NNJA 5TVKA 3ZDXB 1GQSA 2G82A 1JJAA 1FXSA 3PKIA 4YBRA 4BKUA 3FGOA 1M8JA 1KWGA 1EI9A 2WTAA 2C03A 4ZT4A 5JI2E 3KYCB 2C5HA 2Y27A 3RVLA 1P6QA 3U3DA 1W34A 5FPKA 3GJ8A 1E3DA 1JHQA 5A5EA 4OHXA 1ZHHA 5CNMA 1YZKA 3P9RA 1TM7E 4I08A 3L7KA 1PJTA 3UWDA 5EPEA 1DFGA 2FWIA 2PPLA 4AP5A 2VTBA 4KHPB 1OZ0A 1AQLA 1PR1A 4FFBA 5EIFA 1RWOA 3VPXA 2J0QA 4U02A 2PXAA 4NJEB 2D4AA 4Q1AA 1RWKA 4TWBA 1SG6A 2LP4Y 3U7EB 3BCUA 1KVUA 1C0KA 5BNTA 1Q12A 2YNMA 2H5JA 3MJSA 2UUBB 1Z7EA 2VUSA 4H6XA 1NU8A 4PHHA 5BRNA 3TEFA 3U17A 3BBLA 1JLMA 3HUTA 2DUNA 3KWFA 4MYRA 4P58A 3OIYA 5AVYA 3HCNA 4LHEA 3DL7A 4JCCA 4ZQFA 3SKYA 3BILA 3DOOA 3F7OA 3G8YA 1JIVA 3EYAA 4BZPA 2B34A 1W581 1UF9A 5KJEA 1QDUA 2CVFA 2YQZA 4RK1A 1X7ZB 1X9IA 4TTJA 3ZDRA 3ZWBA 4D4MA 3UWSA 2GETA 3W8EA 1DLIA 4LQCA 2MU1A 1N34B 4CDRA 3A27A 4I5FA 1E2PA 1GUYA 3DZGA 5H0IA 4PBTA 5DDIP 5IK2A 2QXYA 1CD5A 4QREA 2PSJA 2BZGA 1YSCA 3BL8A 1CJUC 4I55F 4GLBA 3UMYA 2JCSA 1QIJA 1Z5OA 1P5HA 4HL6A 4XYBA 2QD2A 3LDGA 3BAZA 3NZEA 4ZWNA 4WTOA 5BWMA 3QOWA 4KWCA 1PGQA 1YRHA 2VQ6A 2IQIA 4UHBA 2GJ8A 1ZN7A 3H2JA 2B0CA 4ZQHA 2BV3A 2FPWA 3K9CA 2QEQA 2JFQA 1X77A 2LPMA 4G0PA 2HHAA 3T5DA 2II6A 4LYJA 4OM8A 1K5HA 2HQBA 4I0WB 2R6FA 4RCVA 3Q7PA 4QPJC 4D8XA 4DG5A 4ETMA 3HVRA 4OHZA 3AFNA 5FI1B 4F2GA 1VLVA 4ARZB 3FGPA 3DOUA 2W2MA 1OC4A 1OILA 3FTNA 1NVEA 3ZCXA 4FN4A 1IVYA 2JPDA 4EA9A 4MUHA 4C6HA 4QOHA 4GLOA 3E8XA 5FO0A 1MA3A 1NHWA 5AI6A 2H85A 2Y1WA 1WPGA 4MVWA 1B00A 2WAOA 4OJKA 4N49A 2ISSD 1KK1A 3D43A 3EW9A 4O4JA 5B6PA 2G9ZA 4ZJPA 3IPRA 3X1YA 1DCKA 2GGSA 3DFMA 2N46A 1NFQA 2HEIA 2W71A 3T7AA 1P0IA 1JA1A 2ZRGA 1HORA 3ZQKA 2OR3A 1XYGA 5T3UA 1PWYE 3GRPA 4B4WA 1DAFA 4IXWA 2ZDGA 1L8AA 2WFMA 4UBLA 2DMRA 2XECA 1T8RA 3CWCA 4YPOA 1BXRA 3GUYA 4IIJF 4JFAA 4YP1A 4WWHA 4LXTA 3NAZA 3LGXA 3FH0A 2D7JA 3SEZA 1Z28A 3KKPA 5AHRA 1W4RA 3IJ5A 4JS0A 4WESA 5FOWA 3WWZA 5BN1A 4PGMA 1RP7A 3BE5A 3AR4A 1F4PA 2WWHA 3H1BA 3V33A 1XK6A 1E9VA 5C5IA 1HE2A 2O2XA 4KTVE 3ZXYA 4F7DA 5HKBA 3WIOA 3KYBA 4KTTE 2P0EA 4BVAA 3D0KA 3WA7A 2YHUA 4PGGA 3JD4A 1S9DA 5FF9A 1CUHA 1XA3A 3D8RA 1RM3A 2A9VA 2R1UA 4K03A 4UVEA 4LZLA 2BF7A 4OQYA 3R9WA 2LXNA 2ZSAA 3R7BA 1Z74A 4RPGA 1B6GA 1F0PA 5KOHA 5FOSA 1SXHA 3ICPA 1PR2A 3HKDA 4I50B 5SYNA 3H2YA 2IXAA 4YRFA 3QLTA 3Q11A 2GF0A 4Q3EA 3SM3A 2F6RA 4FFVA 2BYTA 3EZXA 2WR8A 3M1IA 4GI5A 4UARA 4ARSA 3OOYA 3IDFA 2ZUBA 4R40A 4QUJA 2I22A 3O0DA 1JIXA 3G8DA 4ZRDA 1VHJA 4L8FA 2PCLA 2DFDA 2YQ5A 3QPBA 3VR4A 1JG3A 3HB7A 3P5BA 3RW9A 3SBDA 1G7CA 1PK9A 1YNOA 2AUMA 4FUTA 4JUDX 4PFJA 1JKXA 3TSWA 1JXAA 1OGYA 1DJOA 1NNLA 2Y1LA 4MW1A 2FDRA 2ORWA 4UDNA 1QGZA 2GXSA 4WPGA 4XIFA 1RI1A 2LCQA 4YX9A 1TZCA 2VUUA 3KFXA 4X8OA 1TU4A 3AM3A 1XSEA 3B70A 4PPYA 1IMOA 2OHXA 2K87A 1IOLA 3EUAA 2PGAA 5KVSA 4TTRA 3KUKA 2QOEA 5EAIA 1QHEA 2PR2A 3HZHA 2GDJA 1GUDA 3T4EA 1HT0A 1YZTA 2PS3A 4LMAA 4ZVPA 2HF7A 2FOIA 1ZITA 1EK6A 3WJAA 1FYXA 2PS1A 3ZWMA 2Q2NA 1WUTA 1BMFD 3HB0A 2VXCA 3GA7A 2XRMA 4LCEA 1KJQA 2BMWA 2OZVA 2H63A 5HKLA 2ZJ2A 4B7CA 1P1RA 1KU6A 1NF3A 1Y9JA 2J6HA 2BRUC 4OMUA 1GU1A 1PS0A 3B1KA 4FMCB 4RH3A 1Y6JA 1E89A 4WADA 1RYNA 1XE3A 3K1ZA 3WWYA 2V4UA 4OKNA 2BGJA 3CW8X 4S1OA 3AOEC 3BCRA 1C1XB 2YYYA 1MC5A 5CFPA 5HKAA 2PWPA 1C3JA 1SXGA 5CRIA 4R01A 1RYYA 3IQIX 5FLKA 2IHYA 2XZOA 4FYJA 4PZCA 5AHWA 5JEEA 3PRKE 5F73A 4BQEA 4NATA 3CUTA 4F4IA 2RHLA 2GD2A 1HLFA 2E5LB 2XITA 1NZFA 1VE7A 2DGDA 3AHJA 4HWKA 3V34A 1KJ9A 3BRWD 1AB6A 2X0IA 3OU2A 2QG6A 3FDIA 4KBYA 3MILA 3QE2A 1XTIA 4A6XA 1MF7A 1B93A 2Z6UA 1LW6E 3GJ7A 5G41A 3B52X 4PW0A 1H6BA 4X93A 5HWSA 2JHPA 3L77A 2OGSA 2PBRA 3X2SA 3IPXA 4DR3B 2P2LA 1Z16A 1FOEB 3S70A 2PGIA 2YDYA 3N7TA 2D3TA 4A0HA 3I61A 4FE7A 1VSTA 4W5WA 4DWWA 5LM3A 3BRQA 3DV0A 1T9HA 2FEMA 1L8XA 3FTFA 1PVVA 2Z6AA 3OWHA 2DTEA 4MULA 2OO5C 3MJCA 4CM5A 3DR5A 2A3RA 5EGSA 2ATVA 4RVGA 4HX5A 2W70A 3U5TA 2QZPA 1O08A 2W22A 3SS7X 1EUDB 3UT0A 2Q8PA 3Q15C 3HR7A 3FLEA 4G4SP 4P2GA 3WDSA 5DOZA 4HDMA 4ZZIA 1TDJA 2WSSD 3PFKA 4URUR 2HT1A 3ZE1B 2PT5A 4BNNA 4HQKA 3WLJA 4CL8A 1GZ4A 3P2YA 3GEMA 4BPRA 3IAEA 3C5EA 3F4KA 2Z95A 3H3FA 3MFQA 4GXTA 1JHUA 1Y9ZA 4R7ZA 5FLYA 3SJBA 4WGFA 4AUEA 4BCCA 3UV3A 1QQBA 1SBZA 3ZWDA 5K20A 5DGXA 4BLUA 4D4LA 1X80A 3EEQA 3ORSA 3JQ9C 3GLIB 1H05A 1JHOA 2RJOA 5IJ0A 3VKHA 1YFLA 2JLVA 3T99A 5EHQA 1MPTA 2FFAA 2W83A 3D0QA 1BHQ1 4CM9A 2CC2A 2DH6A 3WNDA 1VKJA 4F2PA 3D5TA 3CZ4A 4ZICA 4LKRA 1E0DA 2XGOA 3RYFB 2A67A 3TO5A 2NVBA 2VP0A 3UEOA 1OH6A 6REQA 1A27A 3P0RA 4RSHA 1HQKA 2D6FA 3MUEA 2HQ1A 2AG8A 1DRKA 4AP9A 3KUCA 4KXFB 1G3QA 2G9VA 2VRWA 3EHEA 4W1QA 3ZPXA 1G3RA 3FPGA 3IHKA 1PV1A 2V97A 3IBTA 4K9RA 5CT6A 1EXNA 4FNOA 5IW8A 4AJNA 1SR8A 5T5QA 4A5SA 1P1BA 5BVHA 4QNNA 5HCNA 5IJWA 1L7QA 4OHFA 1J0EA 5T64A 1NOJA 4NYIR 3LY8A 4P34A 1SC3A 2RHOA 1T4DA 1OY1A 3BWBA 4KSCA 2I2BA 3L6OO 4FD3A 1XZCA 2VDVE 2CYBA 4D98A 3ZE2B 1WD5A 3C2QA 3LF1A 2OCBA 2H1VA 3AG6A 4LC0A 5FV7A 5BV8A 2BW0A 4XX0B 4TTVA 4PU0A 2J08A 4ML3A 4IJWA 4RSMA 1XFAA 3VU9B 1M2VB 4FYPA 1CZKA 1IEXA 5BN5B 3M3PA 3RFFA 2UDPA 3A2LA 3CY6A 3VTFA 2ZZKA 2XCUA 2ZRNA 4PC6A 4YCSA 4DV0B 3NPAA 1M75A 2ZT8A 4KOAA 2O2CA 4QOFA 3GRKA 4MQUA 3DEJA 1YJBA 3KV1A 2XUZA 4C78A 3C5CA 3ESAA 2BGUA 3NVMB 3LPCA 2WM9B 4KU4A 1I4TD 1ADBA 1XAHA 1IOVA 5BO5A 3VMFA 4JZYA 2QM8A 4C3UA 5I9IA 1MB0A 3MIZA 1QH0A 1L4UA 3NUGA 3QUQA 3O8NA 4AI6A 1C4WA 2YMQA 1P18A 4P7JA 2IPOA 2WVJA 4YPFA 5KVQA 2D0DA 3TXXA 3O9ZA 1L1QA 4JC5A 1EDZA 1WQ3A 2FMUA 2O57A 3KQVA 2BHLA 4C6TA 3F49S 4KVZA 4JR0A 3U81A 1J06A 4INPA 1RAIA 3KE8A 4V0OA 3SXUA 1NURA 2J7PD 1GP2A 2F8SA 4QG3A 1TUEA 3GQBA 3JYQA 1QFYA 1YONA 1V37A 2ORVA 1QJ4A 1SQ6A 1W9HA 1ZI6A 2AC7A 1WR8A 2EZ9A 4PCAA 1LBSA 3KOMA 3LVFO 3QVVA 4LXHA 1MB9A 5E38A 2V98A 4ZT5A 4RE6A 1FU8A 2HA5A 2XZLA 1MNQA 2O8BA 1T6ZA 4PLGA 3W3AH 3G2PA 2IVZA 3UF0A 1OFHA 4QGFA 3QJYA 4Z4HA 1JI3A 4ZC8A 1Q3KA 3TGLA 1KZ6A 2A5GA 3ZBPA 1QG4A 4EY3A 5JHHB 1P9OA 4URFA 4MUGA 3T54A 3TFOA 2DETA 5K0ZA 3I6ZA 3QWAA 4WERA 3AKZA 4FMBB 4C7JA 4EGSA 1TO6A 1PSDA 2FQ1A 1J70A 3GT0A 2ZUTA 4DFDA 2ST1A 4IKPA 4KYVA 1IAVA 1DTSA 3PHBE 4EFKA 3AT1A 4V2IA 2HZ7A 5B4TA 2Q3DA 3GRUA 1T2AA 2ZUCA 1M34E 2XDYA 5H7XA 1XXHB 2TMYA 2ZXFA 4FD2A 5ERYA 4HXFB 4BE7B 4ZK2A 1KXZA 1CS4C 3UV6A 3FOCA 3AP2A 1RS0A 2I3BA 4L0DA 3CONA 5ELMA 1UPBA 3ZWVA 4X1YB 4DCPA 1L7VC 4ALIA 2FMIA 1KY3A 1Z62A 4R8SA 4BN4A 3ZXSA 1Z4IA 3SQDA 3U80A 5SICE 1MH9A 3STUA 2IEYA 1ULHA 2ICAA 4ZT7A 3G0HA 4YO7A 3IAXA 5J2TB 4R4JA 2GNAA 3ORHA 5AICA 3T3IA 4S04A 2PYIA 3G2OA 1V3VA 4QBFA 2BGKA 3W77A 1XP5A 1JKIA 5KKNB 2QK4A 3GLSA 2AX3A 1NBMD 2DRIA 3OQIB 1DX9A 4K9MA 4XWKA 3WGZA 3A70A 1NY6A 4RC9A 3TXYA 3ST7A 3CWQA 3I6QA 4E12A 5IH7A 3DDWA 1ML4A 3GVHA 3CN7A 2XMCA 3F9CA 4RZSA 4ESVA 3PXGA 4V0LA 5E6RA 5K1ZA 1UOEA 4LNHA 4A0RA 5HE8A 1B3RA 4IICA 4MS3A 4FFNA 2X0FA 3WLNA 3S4YA 1P7CA 1N2SA 1MB3A 4GGOA 3UY4A 1CIJA 2WIAA 3GJQA 2GBFA 1YACA 4MGZR 3HN2A 2Y1EA 1O03A 4DIBA 4M9ZA 2R1VB 3R5KA 1TQ6A 2Z5LA 3GQVA 3LHIA 4LHVA 1T5IA 1QDLB 2HD4A 3FNHA 4C6SA 3BREA 1CS0B 2HWWA 2XMGA 4QDOA 3T4XA 1ZX1A 4J43A 1N8NA 3OTIA 1CWUA 1K7SN 1T5SA 5LFAA 3Q9LA 5J4KA 3N2GA 4W8HA 1UP6A 1QR6A 3IB3A 4D7AA 5LKRA 4AXXA 4EIWA 1MX5A 2YZ7A 4XYGA 1MB4A 1K6MA 2OZKA 1NW4A 2OO3A 3IOMA 1P9WA 2PFKA 5C1OA 3QVGB 5KWJA 3BORA 1Y48E 2O0LA 5EIHA 5LCXA 2KJQA 4TQGA 1SCDA 2NUTA 3KKOA 3ZH9B 5GAJA 5DCWA 5C31A 3EIFA 3W4IA 5DBIA 5I7WA 2PKRA 1JA9A 1RXSA 2O23A 3CF4G 4P53A 5HF5A 3UHPA 2AMFA 5AQ1A 2PZLA 1XMSA 2FR8C 4NE9A 4B35A 2WDZA 5KINB 2CV2A 1D2RA 1ZC4A 4FZJA 3TRJA 3L6CA 2V6FA 1I4EB 4I4CA 4FBMA 3V4ZA 5M5BA 2B1QA 1KZ4A 4KPGA 2VTBB 5DCYA 2FFRA 2I2XB 4CQMD 3HRKA 4FFBB 1DCFA 2QZJA 3B5IA 4L75A 2YS6A 3O93A 2BFNA 4YCBA 1OASA 1LTKA 4RHFA 2GS9A 2ZRLA 3RWBA 4WY2A 3HXMA 1FP1D 2ZUWA 1N2ZA 5HIMA 3L84A 2ISQA 3RS7A 1ZCFA 2JGEA 4GRIA 3V1NA 1Y3BE 4C05A 1PUIA 5KHAA 2OBYA 3KDSE 4OXRA 1KIFA 2X1MA 1CZUA 4ZVLA 5BORA 1H1DA 3MS2A 4MUYA 4IX9A 2JCYA 4N18A 5DW3A 3A05A 5CJJA 1EG2A 3N2YA 5KTKA 2D5BA 4RLQA 4EYOA 2PZMA 5E7JA 4CCYB 3ZI0A 1SUIA 2FDCA 4O1IA 2KYRA 3L0DA 2O5CA 4YCAA 3ONNA 1YJAA 4GIBA 1IEWA 3SQMA 3U4QB 1DAKA 1GNQA 4UHFA 4L2IB 4K81B 2G9UA 3RQSA 4OIMA 3L7MA 3KVYA 4ZOEA 1U9YA 1VLZA 1ECCA