5CFOA

Crystal structure of anemone sting (nematostella vectensis) in apo 'rotated' open conformation
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
182
structure length
182
Chain Sequence
KNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFWDDKIPGSDYDPQNRITFEGNTEPLEKTRGGVFLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Stimulator of Interferon Genes
publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
total genus 52
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cfoA02
4QXOA 4F5YA 4EMUA 5CFLA 4EF5A 4F5DA 5CFPA 4LOLA 5CFQA 4YP1A 4KBYA 5CFMA 4KSYA 5CFOA 4KC0A 4LOHA 5BQXA 4LOKA 5CFRA 4QXQA 4F9EA 5CFNA 4LOIA 4QXPA 4QXRA 4F9GA 4F5WA 4F5EA 4JC5A 4LOJA 4EMTA 4EF4A
chains in the Genus database with same CATH superfamily
3GDOA 1HEYA 4V0NA 2QL7A 2XRZA 1Y4SA 3H5AA 4G26A 5I9TA 4QL3A 1VJDA 2XKAA 4LC9A 2WJPA 4LYEA 2OBFA 4JGGA 5JQGF 4QLAA 4XPIB 4QKQA 3H11B 5FO0A 4V0MA 3OHPA 1G3UA 2JCVA 5BSMA 2ZB4A 3QU2A 4IPTA 1P4JA 3T99A 2HJSA 4UOEA 2OUIA 2EJBA 2J9FB 2PH7A 1Z4JA 5EQTA 3V8MA 4BC0A 2YRXA 4IZOA 3VVLA 5AFSA 5LP6F 5KINB 5B3JC 3DCJA 3AM1A 4B34A 2UZAA 3EBPA 3R24A 4QSMA 4F0JA 1M2KA 2LE0A 4FGZA 4WQMA 1NM5C 1FLDA 4RYLA 3MUNA 3MXTA 1FBTA 5C18A 4TZ0A 3ZGNA 2PVCA 4YR9A 1P1BA 1E58A 3DL7A 3G6WA 3NONA 1JHAA 2Z04A 2PGNA 4ERNA 1RXVA 1UF9A 5CCEA 3NG1A 4FPXA 3KTOA 4N6OA 2XW6A 2W98A 4II2A 5IULC 1C50A 5KCMA 1GM5A 1CUFA 1ZVKA 2GNAA 2I6TA 1ULZA 3STUA 1PL8A 5J3JA 1PSZA 2D1TA 3T15A 3W8NA 5EVCA 4YP6A 1NLMA 4RNCA 1KNXA 1YHYA 4TXHA 4R2WA 4XIGS 4H08A 2PUBA 2O3QA 2OILA 4TXMA 1UMDB 3AXSA 4LF5B 2B36A 3QPUA 2P9CA 1L2TA 3PE3A 3KE8A 3TPZA 4D8TA 2APJA 3W5DA 2ASVA 3COZA 1CHDA 3O4FA 3HXQA 1TYCA 5H83A 3W5VA 4ENQA 1DQRA 3A2MA 4ZRMA 4P54A 3VAAA 3GJ5A 5H68A 4ACBA 3T5MA 3PHBE 2LDXA 1TJYA 1UBSB 3V1KA 4YJKA 4G67A 4N5IX 1MAVA 4NBNA 5JHGB 5JJ5A 2CJXA 1GV0A 1Z73A 1QJ4A 1MBZA 3GWGA 4B46A 5H59A 4L02A 3GLGB 2IPLA 1KK3A 4H7FA 2Z5FA 1SN7A 4OQYA 1AUPA 1EVIA 1R0KA 2HV8A 4YWJA 5JSZA 1KBQA 5JV5A 2XB6A 3W8RA 1CUEA 2M6KA 2N1BA 4DAOA 2WJHA 4DN6A 3MJVA 1J56A 2GMWA 3MINA 3T7SA 5DM70 2IRWA 3MAGA 1A9QA 2HLHA 3IT2A 4BNDA 3PEEA 4WK6A 4C06A 5CLLA 1M2GA 4ENSA 2IYPA 2XDAA 2FSHA 4KK4A 1V4BA 4JLPA 4MX8A 2AVDA 3ZDYB 1RKBA 4NNJA 4OGKA 4RTKA 3EBOA 4FNMA 2CLSA 3IMGA 3KHSA 4ARSA 5IHPA 4YRAA 3RUEA 3KR2A 5EP1A 2XGGA 2F64A 1KHTA 4GOMD 1ZNWA 3VHXA 4BO0A 4EGJA 4CG3A 4HEHA 3EIXA 1XHLA 5DHFA 3BMXA 3FPKA 2JGLA 2O2DA 2QLTA 2HK9A 1INLA 2V7QD 2J48A 3G5TA 4MNTA 4NJMA 4WFIA 5J2TB 4ESVA 5HGXA 1WMDA 4YRCA 3UJ8A 5IAOA 5JAPA 1M1XB 2ZIWB 3TEJA 2CXRA 5IK2A 4EJMA 1IHXA 3QVLA 2VP9A 4IDNA 1P3DA 5U9CA 1C7EA 2XQFA 1CUGA 1UH5A 2MYUA 3QF7A 5IUNC 3N86A 1W19A 2X76A 1T5LA 3M9XA 5AHKA 5IVDA 4AZSA 1IQ0A 2HSGA 5JG7A 2OFXA 4MLZA 5AM1A 3ZJ5A 2QM3A 2WWYA 2G04A 2HCFA 1IEQA 3E9EA 2G80A 5DNUA 3L6DA 3L43A 2B94A 1H6BA 1B41A 1RYDA 1O3YA 1X8LA 1IJFA 2IHBA 3R3YA 5EFOA 5EZYB 4B5LA 4PLHA 1NXQA 2O2HA 2O8DB 4G4SO 1EB9A 2KSQA 2UVDA 4LWZA 4C5BA 2X7JA 3M6IA 3ZHCA 1ZN7A 1TEHA 3HNOA 2BD0A 4NOMA 4JLBA 5ALOA 4HDRB 1EDOA 2VPXA 4BDTA 1NTRA 1HE5A 2Q8QA 2BY4A 3E0XA 3PFNA 2Q1YA 2EKLA 2QR2A 4XXHA 4HNRA 4EHKA 3Q11A 4CQMB 3SC4A 3ZU3A 1E69A 1EX7A 3U1TA 1AKUA 2GO1A 3OVMA 3KZOA 2BFDA 1B76A 4WDRA 4DIEA 3HKDA 3R5FA 2Z56A 3MK31 4KE7A 3FGNA 3I5XA 1L5GB 3JQPA 3HJGA 4G0NA 1WPGA 1RC8A 3F2IA 5DM0A 2PA3A 4OD0A 3U4GA 5TT1A 3T3NA 5EYPB 4DUGA 2QYTA 4IRUB 3BXHA 4DR1B 3OP1A 4I1OA 1ZGBA 4UAGA 1JEJA 2JFQA 4HH4A 4BZXA 1JA0A 1CETA 4QE3A 3SHQA 3WDSA 1UXJA 4M9UA 1STOA 3FJ1A 4HTFB 4UU1A 3EMKA 3TLGA 1QWSA 2AHRA 3CO0S 3ETLA 4QYWA 1QFJA 4AMBA 2HR1A 1U4OA 2FCRA 4NPHA 2OZEA 2FSVA 1TB4A 5TMDA 3TRHA 3Q2OA 3GHHA 3HEBA 3U4QB 4X41A 4MVYA 1CLUA 1GILA 2OCDA 3I9FA 2II6A 5B6JA 2QW0X 3RIGA 1L8XA 1XB2A 2YIMA 1B0ZA 3A1SA 3GIWA 3EPJA 4ZTUB 1FYFA 2FZCA 1H9CA 1TI7A 1TC1A 1ZOLA 2C9CA 2Z98A 5G4KA 5IFLA 5LLSA 1I3LA 3GZNA 1L0BA 2OO5A 4ILEA 2FSPA 2H85A 3CMCO 1D6JA 4FMDF 1FTWA 1ZC4A 3DZ8A 4EPWA 1M1YB 2WICA 1DKUA 1MHPA 1LQUA 1MRSA 1LEHA 3ZU4A 1RZRA 1IM8A 3E3NA 1B16A 1ZOIA 5KDOA 3GW8A 2AFVA 2M1ZA 4EH1A 5JY1A 3RKRA 1VLHA 1N3LA 3NI2A 3RS9A 2ADFA 2Q28A 2X3YA 1HOTA 1THGA 4HAIA 4ENPA 2WU0A 3KEOA 4HUQB 2VZEA 3HB7A 1OAAA 4O4JF 4TV8A 2X3UA 4ISBA 2HYIC 1O6ZA 4P4SB 4XPIA 1OXXK 3VR6D 3H11A 5F1KA 5FNVF 5ARBA 1LPBB 3H1FA 1X13A 4Z0NA 3ST7A 3ZKWA 2J9GA 2C5HA 2GNOA 2LPMA 2WIKA 3IC5A 4RPJA 3LSYA 3MWYW 4U7GA 1G0OA 5DLPA 2J9FA 4RGBA 1RQ2A 4O63O 3RHTA 5HKKA 4EUEA 5DGTA 5H1YA 3AK4A 3V1NA 4F3KA 3K5IA 2ZK7A 2ERCA 2VT2A 4ID9A 1NRWA 2OO5C 2EW8A 4NCAA 1JHPA 2Y71A 1J5PA 1OFTA 2K5UA 4K5QA 1W36C 2DBRA 4P35A 4K05A 4RL4A 4ZZ2A 2QNRA 5CDSA 3ELDA 1NBOA 1W4BA 1JQBA 3N8DA 5A9TA 2I87A 4HB0A 4DXDA 1KVQA 1M6VB 1WA5A 2WT9A 5A2GA 1RCUA 3DBLA 2AWNA 1XEWX 3CPSA 3PHIA 2OMKA 4E33A 1U31A 3SAJA 3BL8A 2BFCA 3N6XA 4FLMA 3RSLA 2CVOA 3MWFA 2VIIA 4HDSA 5DN6A 4WAUA 3HXKA 5AKJA 2ODQA 4Z6KA 1OXKB 2J7PA 3DZIA 3L3BA 4ZK6A 3ANXA 1AMUA 2L18A 4DV1B 4FFNA 4B3TB 4EG3A 1G9SA 1KJJA 2F2TA 2VS1A 2QLBA 4HFNA 4M1MA 4XWWA 1UMDA 2OVFA 4KXLA 4PFKA 4GXQA 2GBGA 4AYTA 3CUSA 5EL0A 5I48A 2Z1NA 3LECA 1GGNA 1VZ3A 3LQFA 1I01A 4HQFA 4KDRA 3WR5A 4HP8A 5F9FA 1PL7A 5DTIA 4YRZA 1JJVA 2UZ1B 1P9LA 3J80A 4WLUA 3AOGA 4IG9A 2I6GA 5ALFA 3EXAA 3D2AA 4HT3B 3AINA 3KDPA 1MVNA 1ORDA 5UKDA 3M3HA 4LSZA 3MFQA 2FPUA 5KQPA 1BE6A 1RXWA 5F4ZA 1JS1X 3GLGA 3N74A 3LX8A 2LKCA 2M32A 3OETA 4K9QA 4QZVA 1L1FA 4CCYB 2EIXA 3O5AA 3V33A 2D5BA 4GSKA 3E4DA 4Z9YA 4ND8A 2ZJ6A 1U3UA 4J1NA 5I4IA 1R8XA 2WNHA 3JAKA 4I14A 5BW8A 1R1DA 3PT5A 1IJBA 1F48A 4MV4A 5COAA 2QPAA 3PC2A 3WLKX 3I4CA 3EVDA 3HN2A 4QUIA 5ALQA 1TTQB 3VJMA 4RU1A 4FGJA 5B4TA 2QTNA 3NDRA 2WAMA 3CSDA 3G8AA 4Y2RA 1JLMA 1ONBA 1XTRA 4FFVA 4NK4A 2JCGA 1D1PA 3OFKA 4UMFA 4WX2B 5HF8A 4TWRA 3AHJA 1OILA 3S8YA 2PX5A 3QA9A 4LNHA 4P7JA 1PJCA 4PLGA 4BPBA 1JAYA 3DZDA 2XB2A 5BMVF 4Q03A 2XMBA 1BEEA 5JVDF 2XB4A 5JCXA 5J2TA 1NXTA 3SHWA 2YZMA 2JGRA 2FFHA 1SG0A 4C1BA 5J4VA 3IAAA 3RRBA 4LN1A 3T54A 2FXVA 4F4IA 1BNCA 1G6KA 3UGQA 3SEAA 3GLQA 1I14A 4IUYA 4IDDA 4AJIA 1HE2A 3E35A 2WILA 1SD5A 4JLSA 2NO7A 3PYMA 2RG7A 3BBLA 3SMQA 2A3NA 4ZCMA 5LDDC 3EZGA 3H5WA 1H94A 1PNQA 2V96A 3I2YX 4XIYA 2VDOB 2WFLB 1QIIA 4UVHA 3SHFA 1N6NA 4WESB 2AQHA 1ZJWA 3HYSA 3WHKA 3KT8A 2QR3A 2UZIR 2FR0A 4ASUA 4RTNA 2QRLA 2W70A 1UJNA 5CLIA 1SH7A 2OXIA 5LQAA 5JNSA 5M29A 1N5DA 1IM2A 5JT1A 3LBNA 1QS0A 1T0PA 1KKUA 2AG1A 1DKQA 4NR0A 1GTMA 4EAAA 3MPOA 3OZXA 5AP9A 1NF3A 1OVMA 2JH3A 3SE7A 4LYGA 2YHSA 1QRTA 3YASA 3U31A 4ML3A 3U16A 1SBZA 2P8JA 5EYPA 1NP3A 4LCBA 1I4TD 4DJDC 5KYTA 2VP6A 3F7MA 2HB6A 4OXKA 2V55B 1XWWA 5HRAA 5LJIA 4JBGA 2PZMA 2ZG6A 4B6EA 1CP3A 1Z45A 4HTFA 4DBZA 3W4IA 3JZFA 1E63A 4QUEA 3UT5A 3P2MA 4MKHA 5J1SB 3U4QA 4R7ZA 1PR5A 2I29A 1XMIA 2GDJA 1OREA 4X1OA 1P6QA 2ESRA 3BQNB 3MC1A 3QV1A 3HI4A 3R6WA 3SYLA 2V97A 3UFBA 3EVEA 3DOOA 2CVFA 4OB6A 5T64A 3W4KA 3WDKA 2OV1A 3MPUA 5BXQC 4FYMA 1I30A 2CNOA 1Q3TA 2R6DA 3HKCB 5KHAA 3VH4A 2P5YA 2YY7A 1K5DA 1QR2A 4NBRA 4I9FA 3GVXA 1QCDA 4IGFA 2GOYA 2F4NA 4PZ9A 2VYFA 3FI9A 2BGMA 1KP9A 1DAIA 1NW5A 2F9MA 3AVOA 4FFBB 4XGIA 1XPUA 2YH2A 3QJ5A 3VR0A 5GJVC 3VQTA 4EPVA 5K3FB 1RLTA 1YFZA 1YC2A 4GOKA 3C6QA 3RVJA 4CM3A 3W04A 4Z3KA 3FVWA 1XVIA 3DLPX 3O0TA 2HHCA 1RI5A 5ILOA 2PLNA 1LTHR 1LF5A 1XYYA 2JFOA 2V4MA 3GFTA 3HZRA 4JB0A 4P4SA 4ZT5A 1NZJA 1IPEA 5CVDA 2AXQA 1N7HA 3THSA 521PA 3E05A 3HM9A 121PA 4W9RA 3SR3A 3NAMA 3I58A 2ZDQA 4NMMA 1KC3A 5COBA 3T35A 1K92A 2DX7A 2IW1A 4FSXA 4M36A 3Q3VA 5TPZA 4KXMA 2O3SA 3OFND 2AOVA 3IHWA 3O03A 5CIWA 4OATA 5LPNA 1AF4A 3UXHA 3VSEA 4B44A 4WKGA 1LZKA 1B6TA 2ZRFA 4MW1A 4KDCA 4KQGA 1KDPA 1I2BA 1M6VA 2XYGA 4PFQA 2ACWA 2ZJ7A 4B3HA 4I81A 1VLLA 3A4NA 5HS4A 1DWOA 3RKUA 4UNIA 1BAPA 4UW9A 3WA6A 3RYTC 5E6RB 3IPXA 1G64A 1NMXA 1Z5OA 3FD8A 1JEQB 3LUHA 4KTVE 3STWA 3C3MA 3FWZA 1N57A 1P2DA 2QENA 2WU4A 4Y6OA 5DYTA 5B1EA 2O0HA 1K1EA 2YIJA 2ZYGA 2Q3FA 3IEUA 3R6GA 5EE1A 1SIWA 4HAUA 1ECBA 5AI4A 2OYRA 4EHIA 4AKIA 2CW5A 3WLOA 3BF7A 1QHHB 1JFLA 4DCMA 4S05A 1H1TA 1UJ6A 2VRBA 3AJDA 1VBMA 4D3DA 5CNJA 2O2ZA 3MS4A 4BLVA 3HCOA 4JI1B 2I3AA 4FKZA 3L4SO 4I9UA 1ZITA 3NYQA 5H7XA 1WB9A 1IWPB 1OOEA 2Q1TA 2XRYA 2AE1A 3Q41A 4U2CA 4IIVA 2W6JA 4YPFA 3I2KA 4DLYA 5AK5A 4EG6A 4B80A 4JP1A 1DBQA 4MH0R 3OLZA 4N01A 3UUEA 3HB4X 5ADWA 1MX1A 1S2DA 3MQ2A 5J2UB 1ZM9A 1CUIA 4L76A 1R4AA 5ALHA 1UK9A 4ZVQA 5JCPA 1D5CA 2XF2A 6ABPA 1TGVA 4Y2HA 3IQDB 5ICEA 1OH8A 3PCRB 4Q4AB 3IQXA 1ISGA 1JTFA 1AUVA 2E1RA 2G4LA 1B6GA 2OGUA 2A5FA 4Z4EA 1YNOA 1HLFA 3AWDA 3H4TA 4XQ9A 5F51A 3S2YA 4EG5A 1JE0A 4MVJP 3P4YA 2L17A 2QM8A 3LZDA 4FW8A 1NY6A 4NPAA 4TSRA 3R7AA 4DLXA 4EQ6B 1PEAA 3IL2A 1EFLA 1OGYA 1I80A 2HJVA 3PC3A 3TSCA 4YRKA 5L51A 3TD9A 4P7GA 1PFWA 2HMYB 1EK2A 4KFSA 1HPLA 3IOCA 5GM1A 2I0FA 2VHZA 4NBVA 3LT1A 2Q1UA 1ZL0A 4KJZA 3OWOA 2AMFA 3ZR4B 1S0UA 5EKXA 1HWYA 2WKPA 4M0PA 3BJEA 4MW4A 5HM6A 1CX9B 4MLCA 5HUQA 4CXMA 3EISA 2ZVPX 4FOPA 3AVYA 3U62A 4HNVA 3ZYZA 4AN0A 1KKLA 1R37A 3E27A 3G13A 3Q7TA 5D84A 3U2QA 2QRPA 1QIFA 2FETA 2JW5A 3FUTA 4KQIA 5K0SA 1NFQA 2ZW9A 3PZRA 2IUEA 3PDIB 5EIEA 4K87A 3S8EA 5I8ZA 4W8GA 5DH9A 4ATNA 4IJMA 5IYZF 3ER9A 5JCJA 1C9EA 1G20A 3ESBA 3MNFA 5BR1A 1YA8A 1UC9A 4OHBA 4ER0A 1R8YA 1VRWA 4D82A 1Y9AA 2CWWA 2BFMA 3UV3A 5KVSA 1L5VA 3CEPB 1G41A 3LT2A 1KMCA 4LX8A 5IP5A 5KHLB 2WP8J 4I6EA 4TTAA 2Z3ZA 4WESA 2OCYC 5HW0A 2WM9B 1JBEA 2HCBA 4F93B 3CEAA 1G6Q1 4MUYA 3M6MD 2GK6A 4JX9A 4PX2A 3HSKA 2I71A 4Y18A 4AQYB 1WF6A 2BSAA 2FJUA 3EGXB 1FLNA 1ZM7A 5TMEA 2Q5IA 1N6KA 4RVNA 3I39X 2D13A 3STVA 4E2XA 1SXPA 4J6FA 3ZQKA 3TR0A 5KMGA 3C41J 3GZ4A 3H87A 5AKHA 3E3MA 3S2FA 4CR8A 1R4MA 2C9BA 1KP2A 2GEKA 4O4HA 4TLBA 5DI3A 4DCJA 3PR1A 3CCBA 2NU8B 2OFPA 3LT5A 3QKUA 5BQ5A 1IUNA 4Z86A 2NT3A 3OX3A 1FVFA 1J49A 2K6GA 2WWRA 4LQCA 4YRTA 3SLGA 4G5YA 4LJAA 2HJRA 1R6TA 4UCXA 2WD8A 3I01M 4HVAA 2XUJA 1JA1A 2Z8XA 3TQFA 3VVMA 1L7VC 2WPNA 1KGSA 4LXIA 1AS0A 1WM1A 2XCRB 5DBEX 5BWLA 2CFCA 1SXJD 4B4UA 1JL3A 1WMEA 2JZNA 3EN0A 1RYNA 3JD0A 2H4WA 3E3LA 3TMAA 4BFYA 4FWTA 5F76A 1M2HA 4ZI7B 1ZGZA 4TM8A 5LZ9A 4W1SA 1OYWA 1OIWA 1SKQA 3HKCA 2RAVA 3M2TA 1HETA 1NG1A 3HUFA 4GBMA 4MMXB 4YK7A 1RD4A 3PDHA 4NBSA 1HO3A 3URKA 3W2TA 1HYGA 4R1QA 4YY3B 1BX0A 1XZGA 1AT1A 3L0BA 3QU9A 2YWXA 3V7YA 4FFBA 4R8SA 9MHTA 4BMSA 1Q0TA 5EUMA 1TNDA 5FBKA 2FDCA 1H6AA 4TMWA 4D9IA 1OD6A 2J3QA 4QQNA 2RBEA 3RSGA 4A3SA 4X95A 2BFBA 5BUZA 1CFZA 4AICA 4BASA 1ESNA 4OP2A 5GJBA 3HCRA 3V5NA 2RC5A 2YQZA 2VNSA 4G2TA 4TKUB 3GLIA 2AEJA 1NR1A 2PX6A 2XYPA 1JTEA 3QHQA 4LY9A 2BTQA 3TLXA 4EPTA 5KOIA 5COQA 1GUFA 4K26A 3A6HA 2AN1A 1VRVA 1DQYA 3KWJA 3ZY4A 4BNWA 1M6WA 4D4MA 4IXTA 4M6WA 4NIMA 5K99A 2AYXA 2O8VA 3RVSA 2QI9C 1DEAA 3O9ZA 1JYEA 3GGDA 4GR5A 2JIPA 3F3SA 3FY4A 3ZK9A 4YAEA 3WICA 4B82A 4HNSA 1Z5UA 3BB1A 3LRTA 4FHGA 3MWGA 4K88A 5TVKA 2H2IA 1T8RA 4TGLA 1ZR4A 1PL6A 2WZDA 1WXXA 2BF4A 2E4ZA 5DFAA 5E6RA 4YAIA 1JEQA 1YUMA 5JAHA 3PUHA 1Z83A 1UJMA 4KXFB 3DVSX 4GGPA 1JVNA 2D8AA 4OHVA 3VO2A 4E6EA 5EWLA 1TCAA 2DBYA 3KLPX 4JXKA 5FBVB 3BA6A 3HM2A 4TRJA 3EZFA 2HBQA 3CH4B 3AVXA 4AJKA 1CF4A 1X7YA 1TCVA 2E55A 2FZ5A 5NLLA 1PR4A 1UR5A 4XR4A 2RKOA 5I5EA 1IBLB 3T3MB 4P5PA 5LYJB 3ESZA 3AZQA 3QMVA 1LY1A 3VR3A 1ZHFA 1PGOA 1QDEA 1X0XA 2Q49A 1M8FA 5ITSA 1L4LA 1TM3E 4Q4HA 1RBQA 1HYBA 2ONZA 5EMMA 3S68A 4IF6A 4ZDIA 1NQUA 1QE5A 1SUBA 3B20A 2IY7A 2XMPA 2OV4A 5TY0A 1IDN1 2F67A 1WMBA 1B42A 2VEOA 4RKYA 5DI9A 5K0GA 1NJ2A 1KI6A 2WAAA 2XX3A 1CCWA 4HDQB 4JP2A 5HRUA 2Q0HA 3U40A 2DY1A 2JPDA 2YVUA 1O2DA 2GD1O 2N46A 1USKA 4QBTA 5JYEA 4EUNA 3CINA 3EZ2A 4C7XA 4EY7A 4F4CA 3NANA 4MRPA 3C1UA 1QO0D 4GWLA 2Y27A 2RHBA 4CLRB 4EQ6A 2GN8A 3G9UA 3R5JA 1U8ZA 3OQIB 3VR4H 4AECA 4GZLA 1V8OA 2E1PA 4OQZA 1B43A 4BPRA 1E2GA 1GGFA 3CW8X 3K0SA 3AQIA 3LP6A 3MMPA 1ISRA 1QJCA 2QX4A 3NHKA 1D2MA 3IV7A 4P81A 4YAOA 5E6SA 4ZAWA 4TL7A 1SFRA 2GSDA 4HAXA 4EMSA 4Q12A 1Q7CA 4GI5A 4RK1A 1FYVA 4HDAA 5GAJA 2J3EA 3A3NA 4C1NA 2GPTA 5I47A 3SS7X 2ERXA 4QFMA 1MGPA 3BGOS 2KB0A 3UO8B 1WR8A 1ZS9A 1UKBA 2F90A 4WUVA 2HTEA 1I13A 3D6AA 3ZE7A 4RVHA 4JHLA 3TQOA 1GPMA 2MYTA 3B70A 3QE0A 1XLVA 4U6SA 4YCBA 5C7IO 4ZZIA 1D2AA 3T1TA 4ZO7A 4LRWA 1QDUA 3F6RA 2I9PA 3LO8A 3MGAA 3FDXA 4XAQA 1O0BA 1Z9BA 2ZT6A 3H86A 4A2PA 3TBKA 3SQWA 4JBXA 1DDOA 2X0IA 5ULLA 1N9ZA 4XB1A 1KAOA 4Z9XA 2Y1OA 1TEZA 4G01B 2WWIA 3IX7A 4JY7A 4Q3BA 1BGWA 2QSZA 2VSFA 3TUZC 1UOQA 2ET6A 3EW7A 3DFZA 3GUYA 5I5GA 2VJAA 5AICA 3ZWDA 1Q14A 5SZHB 1TL7C 2IYAA 4M7OA 4M1WA 2OBLA 2PANA 4WNYA 2O8FB 4QO8A 1M2FA 3DHWC 4D8XA 3TLKA 3D7LA 4ZAXA 1T5IA 2ISCA 3QXXA 4GOND 4RIFA 2I8CA 3SJBA 4IKEA 3S7TA 3LCRA 3BCHA 2BEUB 3LCUA 4E21A 4KMRA 2WI8A 1KNQA 1XXLA 2LCIA 3EE6A 1F8UA 2Z08A 1KPGA 4IIXA 4NONA 5CLGA 3RV4A 3TZEA 4WNIA 4YQZA 1TLFA 3KXIA 4EJFA 3SYKA 5K8LA 5NULA 3GRKA 1TE2A 3EHEA 5ALKA 5F7ZA 3VPDA 3WIUA 2JGDB 4G2NA 3SIXA 2CE7A 2H4ZA 1X1BA 1QYRA 1YGPA 1W88B 3GUCA 2QBYA 2I3DA 1GQRA 4YRRA 1EVLA 1RWBA 4PSVA 4U7FA 5EKSA 1UJCA 2CWDA 3KKOA 3QV2A 2HTFA 4A0HA 3WFZA 5FLXA 4UBNA 1QF6A 4J94A 2HJWA 4FJ0A 2IUSA 3KOMA 1CP2A 4I1UA 1C0LA 4LJ4A 4EKYA 5BSWA 3GRAA 1KS9A 1SBYA 2D5AA 4NY1A 3IV6A 4BXOB 3ADKA 3OWXA 2DUUA 1CR0A 2IYZA 3G82C 5JARA 3UTDA 4PSDA 4ZI7A 1CDZA 4XYMA 1MAHA 3EIOA 2CYAA 2FMKA 3L40A 2HMSA 1Z28A 2ZXEA 3OKFA 3QVJA 4DDUA 3FLAA 5K3CA 1FVXA 4ZXPA 3TX6A 3U4IA 3A7EA 2GH1A 2PBLA 3GO4A 3AWIA 5DB4A 2AH5A 5DLQC 4OQ4A 4MP8A 2AEEA 1M34B 4FCVA 4DPLA 4WZAA 5CNIA 5D87A 1R6VA 4TROA 2PMFA 3BE4A 1EK1A 2PUHA 1ZN8A 4FW9A 2BMDA 2EQBA 2PX4A 4Y6GB 1KSGA 3GRRA 3LUAA 2HF9A 5BVGB 2O7QA 3DD1A 1A8IA 1NFFA 4RXUA 4ZEWA 2O07A 3LHDA 1DIHA 5THQA 4Q3OA 3LF2A 1UPUA 4XX0B 1S89A 1FU4A 4I1VA 4LYAA 2O2EA 1E18A 4YUXA 3CNHA 4I3FA 4XGQA 1Q3HA 1DC7A 4PLFA 2WM3A 1YASA 1E3JA 2G0AA 1G2PA 1LRJA 1TRHA 1M2VA 2Y68A 2ZSDA 2P0AA 2EDCA 4D9GA 4YLGA 5ALIA 5B57C 3KOWA 2XUOA 3X2SA 5A6VA 1YOBA 2H00A 2B98A 1ABEA 1H22A 3GMSA 1RQPA 3QEMA 4MPDA 3EQ9A 3R3WA 4OQFA 3DDCA 3P9PA 2YHAA 3FYDA 4RKWA 2REQB 1H42A 3F5FA 4EY4A 5C8ZA 4DY6A 4WBXC 3RBXA 1THMA 4FNAA 4V0QA 4NE9A 3M4NA 2YV5A 4PO8A 4RFLA 4RUKA 4BTEA 4C7MA 4BFZA 2JK0A 3DVAA 1YNSA 2O52A 3F3MA 4TL6A 3NP7A 3LHFA 1UPCA 5M3BA 3HDTA 1SCQA 1PZMA 1L7DA 4FDVA 4HGYA 4U0KA 2G63A 2VDPB 3WFIA 5IX8A 4L50A 1FSZA 3HUEA 4XYBA 2X4GA 3AR9A 1HQYE 1T8TA 2PKEA 3G59A 4LOLA 4BNJA 2Z43A 4ZAYA 2GM4A 2HU2A 3I6IA 3WXBA 4PPNA 2JLVA 2A30A 4PAGA 5CGZA 1Z8HA 2QVGA 3X43A 3ZHUA 2DRIA 4MK4A 3VPSA 4D8UA 1VKOA 2Q2OA 3RAPR 2F9FA 1D2HA 4IFBA 2QS9A 4IXDA 3PWTA 5AHRA 1S8NA 1C4WA 2ABWA 1D2CA 2AJTA 2HA0A 2XV1A 3PHGA 5FFNA 5BQOA 5LA6B 1LLDA 1BN6A 3T1NA 3BWXA 5FBRB 1DKRA 4ZQGA 1XELA 1V43A 1Y48E 3GAMA 3QUCA 3UAGA 5GV7A 1FUYB 5TIIA 2VBFA 1S1MA 2IIVA 3UC5A 1TLTA 4NH0A 3HNPA 4X6YA 5K8JB 4OHFA 1N5MA 5CU7A 4GMXA 2D5IA 5J59A 4B17A 1K88A 1KZ6A 4K81B 4QQRA 3VOSA 4WXMA 2CFTA 3WTCA 2MSNA 1GRRA 4Q5IA 5DCYA 3ROKA 1JR4A 2E0IA 1XQ6A 3HSYA 3OQIA 4FFOA 4UMDA 1L7EA 3R5TA 3TG8A 2O5CA 4EPRA 2Z5LA 4E14A 1WEKA 1PWZA 4XSGA 1RVV1 3A4LA 2JBWA 3N2NA 4MJ7A 5JAQA 3WLLA 4AG6A 3KYCB 2AFHA 5CH8A 4ZAVA 5KQSA 3C3BA 3ISVA 5ARCA 3EQ8A 3WGQA 2AZMA 4F4DA 3G0BA 2GNPA 1CEQA 4DQVA 2YVLA 2ZRHA 4OL9A 1DCKA 4MQ6A 1PR6A 4EPXA 3FNQA 1SOWA 3JCZA 4TWIA 1NX9A 3ROMA 4EKGA 2DHQA 4L95C 5JRJA 4W5TA 4UCWA 1PZGA 2NVWA 3QZUA 4MVCA 4TYQA 4EBFA 3OIYA 4F5DA 4JQSA 5EIOA 3RS2A 4ETIA 3EWNA 2WE7A 3EMDA 4OU5A 4QBHA 1PQUA 3WSTA 1GADO 3VMFA 1AQJA 2VUSA 3DS8A 3AP2A 1AM4D 3ZBPA 2YXBA 2YOGA 4JJEA 1Z4OA 5B64A 4YPVA 3W4JA 2IEDA 2C3YA 2ZYAA 4KXVA 1KK1A 3GJYA 4U2BA 1P1RA 3THYA 2O0JA 4AJ4A 3V1YA 3MHTA 2Q3LA 1TF2A 3EEIA 3IGFA 1Z36A 4X6XA 1U0EA 1LV7A 1U3FA 3ZD8A 3DNFA 1K9SA 3UK1A 1U1CA 4Y0VA 3K09A 1LFDB 1Z3IX 1RLMA 3WYDA 3BAZA 1E1QD 3GX1A 2EFYA 4M3NA 1JDUA 1Q91A 2ZB7A 3NASA 3USES 4J1TC 2GLUA 5JZMA 1AH2A 3R7FA 4F8JA 1QONA 3TNLA 5A3VA 1QHEA 1UP6A 3WB2A 4OJYA 1J1ZA 1J97A 1UC5B 1SPBS 1V45E 2GBCA 1EAYA 2IYWA 3FFXA 3KL2A 2IIBA 3PPVA 1EFAA 2XECA 5HKBA 2PUFA 3KD2A 1ZCJA 5DRYA 5DX1A 2XZDA 3LPDA 3W5CA 3H5TA 2O14A 3CLUC 1T1JA 1ZY2A 4KLRA 5FTKA 1MPTA 4FEGA 4YJ3F 5IM5A 3SS8A 3HBLA 4ZKDA 2NM0A 1E3WB 1W88A 1D6MA 2W8ZA 3O82A 1M67A 4ROSA 3ZQUA 3LJKA 2OXFA 1THZA 2GVDC 2EEPA 2WYIA 1DCFA 2YC4C 4PC7A 2ZJ2A 4UVGA 2QXUA 1WD5A 1MB2A 3VR5A 1N7JA 3QBTA 2BAGA 3RSCA 2AN9A 2GM3A 1UPAA 2XEXA 1ZOOA 4PICA 4RKEA 4U8GA 1KRHA 5C2JB 3NKFA 3ZGOA 1HNWB 4PSCA 1D09A 4R8RA 5CTAA 4KSCA 2JKYA 4Z7OB 3C39A 1Z0ZA 3OD5A 2HQRA 5KNDA 4HGOA 1XKLA 3JTEA 3ZE1B 3CR8A 2XB9A 2AZXA 1JECA 2MYPA 4DDHA 1ZM2A 5K6TA 3MOIA 4KP7A 5C8YB 3OOEA 1T25A 1GRCA 4B3CA 3G2LA 5ESRA 1TT5B 2A9VA 4XDYA 7GPBA 3GUVA 4RXMA 1BXRB 1FFYA 1WNFA 1MOSA 3G49A 4ZD6A 2V6IA 4QYSA 1OT3A 1J0AA 2FWRA 3RGWS 4EA8A 1WZCA 2C5EA 3R3SA 1IQRA 1FFBA 2OK8A 2QV7A 2X6TA 5I7FA 1N5IA 1A77A 5JH7A 1Z4IA 4V1CB 5DZSA 3PI6A 1GT91 4Z99A 4YRPA 4I1RA 4UM9D 4E13A 4B6GA 2JRLA 4OK6A 1NIPA 1EGHA 4JCCA 4QHSA 4AYXA 1CHNA 4DR7B 1MTZA 4KBFA 3HKBA 4QVGA 1KVTA 2GERA 1GCOA 4EUFA 4MPTA 5TPWB 4FB4A 2EBHX 2GCEA 3DE7X 4GBGA 3CLRC 1PR3A 5DW3A 4JFRA 3F49S 2D00A 2EZ8A 4PM4A 2VK4A 3LO5A 4AZ3B 5L53A 2DR3A 3EVTA 3PA6A 1TMGE 1R74A 3KXPA 2YWEA 3F71A 1UOOA 4LPKA 1I5RA 2GN4A 4O6VA 5HK9A 2FCAA 1P44A 2H9AA 1NLZA 2IYLD 2ZRMA 2REQA 1FQWA 4FOTA 4JK3A 2V7PA 1FXWF 4BMCA 1CQIB 2GD0A 4TLEA 4E1AA 2X0KA 2I8AA 2P6PA 1PGQA 1QWOA 1VXRA 1OC2A 2EARA 2Y2UA 1U0BB 4D02A 1I33A 2O8CB 1O8BA 4C0JA 1Q17A 2RGGA 5FL7D 4WNCA 1V8DA 2C1EA 2NO9A 3U3RA 1VMEA 2O8BB 3DEHA 4EG1A 2QRZA 4GZ6A 2QL6A 4RVOA 1PS9A 4PPQA 1K8RA 1SK9A 4KGZA 2PXCA 4IGIA 3VV3A 4P08A 5ALXA 4HRXA 5BYJA 4FEEA 1IAVA 2F4VB 2X5XA 2BRUA 5CYPA 5DCWA 2I2XB 3OC0A 1XYGA 1H65A 3IQHX 3K0KA 2BH9A 2R44A 4J0FA 4PTLA 3QYJA 5AQEA 2VP2A 1LCIA 4HOYA 5SYAA 2HQOA 1A76A 5LDHA 1IZYA 4M8KA 3K71B 2B4KA 4KLNA 4XFJA 1GAEO 1U7TA 5EHGA 4KDEA 2PS1A 2XR1A 3A25A 1A4UA 3BL6A 2HDWA 4J76A 3ZV4A 2PGLA 4KWCA 3NLLA 1C0IA 1X1QA 3HLTA 4I5FA 3SBXA 3SLRA 1JI3A 4CCAA 4E2WA 3FMIA 3SQOA 3I12A 5BSUA 1CJUC 1YZ3A 1MFZA 1P72A 2BBOA 2OCGA 1Q50A 4FZ5A 3CY6A 2UUBB 5IXSA 4ECAA 5C5CA 2ZUDA 4Q3NA 1BWSA 4KAJA 1B15A 4UHJA 1BN7A 2FPPA 1X1RA 4G0PA 4NBLA 4AZVA 4GLFA 5A4IS 5AHWA 4C4AA 4CLEA 3AHEA 3GAAA 4PLCA 3H83A 4WECA 5CT5A 4GBED 5G3ZA 3VR6H 2J5RA 3KYCA 2FZEA 3V1MA 4CNQA 1XRQA 3VX3A 1VFNA 5D01A 3JYHA 1T9KA 1U3WA 2AJ8A 9LDBA 5KQMA 1TAUA 3O4JA 4CM9D 4C88A 1PJ8A 1GEEA 4MUEA 2RKWA 4H3VA 4Y9TA 1UBNA 5IH7A 3VZDA 2QTFA 1VYTA 1IZZA 2C4UA 5J63A 5P21A 2JLQA 3DT6A 3OLWA 4NWIA 4MV3A 1Y37A 2NX2A 1RYHA 1X9HA 3E9NA 1A8PA 1MTOA 3PV0A 3MMSA 4QUDA 5D8DA 2QT0A 3ND5A 4OMDA 1GPKA 3IVMA 1D9XA 1WABA 4P34A 1DAPA 5T7BA 1FDIA 1HI9A 3NOOA 4MXDA 2Z09A 1FVHA 2DKNA 3G5MA 1MIHA 2C4HA 1IIBA 4HWKA 2IIPA 4XIFA 2QVZX 5D5PA 2G17A 4KN8A 1PP4A 2OCAA 3GJSA 5JQWA 4GYWA 4ND6A 3PXXA 1HOXA 4KHZA 5IBRA 3DXXA 4QRHA 5EHZA 1P0PA 3DT8A 3A10A 4BQFA 4YNBA 4RMNA 3RVQA 3COJA 1JG3A 3KXKA 1Q0PA 2H1WA 1WV1A 1ZBQA 3KTFA 4LHSA 1YZTA 1IOWA 4AZWA 1ZOPA 4EYSA 1CEEA 1TVKA 2H92A 1JFVA 2P6MA 3GLKA 3VDRA 4BATA 5BT8A 4NARA 3BWCA 4GKBA 4M0MA 1QLJA 1KEWA 5TE9A 1K6MA 1P7VA 3INRA 4QUAA 2FWIA 3D6JA 4OXYA 3OFJA 5IZ4A 4OX9Y 1J4AA 5BN5A 2H4JA 1VGRA 5I4BA 4CKCA 1RRMA 3JQCA 4H7KA 3R7WB 3UMVA 1Z75A 3O84A 1M6NA 4DA7A 4Z7NB 4AKHA 1E0DA 4FC6A 4JZYA 1J06A 1HT1E 2B4QA 2UVQA 4G0MA 4KQWA 5EIBC 4OOEA 1RPAA 4R1LA 1IC6A 2CJWB 1JVBA 2VRWA 1QRSA 1MXHA 3AO0B 2UVPB 5FKJA 1H9AA 3BXGA 4FU0A 3HA2A 3L8DA 1EK6A 4KDFA 5IM4A 2REXB 3FPCA 1R5OA 4IUDS 1THTA 3T7AA 3CS3A 2NP7A 3NW9A 1QG0A 1YJ8A 2UZ0A 4MQUA 3EFBA 4UEKA 4ENWA 3CIOA 3N8GA 3VHRA 3ROPA 4C4SA 1Q3KA 1WLSA 2H59A 2YIDA 3L7CA 4Z3DA 2AUTA 4EA7A 1QGYA 5CHEA 1NV9A 3WLEA 1JV2B 2BN4A 5FEMA 1G5FA 1G8YA 4BB9A 1JIIA 3WNDA 2PH1A 5LMNB 3TW0A 3NAZA 4NLLA 3K8YA 4WW0A 3WZLA 1XALA 4E08A 4HADA 5HTKA 3L1UA 3SQDA 3QNUA 3ZWXA 4GBJA 1YXMA 3ZK8A 3WNZA 4I55F 2BYTA 2VC2B 5B2ZA 2FPXA 3C6KA 4BDSA 1G1MA 1G7RA 3NKVA 4YRJA 4V1CA 3DCYA 4MAMA 2GPNA 1ECFA 1GAWA 5IT9A 4FEAA 1P5ZB 1NE2A 1PFYA 2F48A 1GZ4A 1JHUA 3PFWO 2B1JA 5C34B 2F17A 3KPVA 1FFDA 3DAOA 2BHLA 1RHJA 1MVLA 1TF5A 5TPWA 5ALUA 4E4YA 3PJGA 1ZQ1A 2J4DA 5A06A 2BBSA 3VVBA 3WBFA 4HGQA 2VXCA 3RNLA 1XCGB 1DV1A 2ZSUA 4DSAA 1PCXA 3HV2A 1O5TA 2ZRLA 3DE0X 3DJYA 1T9GR 4EMBA 4F9FA 1JT9A 3HP4A 3RC9A 4A82A 5KB3A 4UPDA 3WWYA 1JG7A 3VR1A 3SF8A 1SUEA 2C97A 1W85B 2AKYA 3D3QA 2WJJA 3UAWA 3WQHA 4CWAA 5ALEA 2G9RA 3RVNA 3RS5A 1XDSA 1N4AA 4N7RA 3GT7A 2GETA 3E5MA 3NS7A 2O8BA 3RT9A 2ZJBA 1XG5A 2EYQA 1J2RA 1VBNA 3H5VA 3PC4A 3O1HB 4NENB 1USGA 3FWPA 3TGWA 3TSOA 4I19A 3JQAD 3LPMA 1MMFB 2OB2A 3RJMA 4F86A 5KOHA 2C7RA 2IYOA 3G2QA 5J1TB 1M1ZA 3PF8A 3UJHA 5DXJA 4D4HA 5MF6A 3FLEA 3HRIA 1YS6A 4WKPA 3MTDA 4KX3A 1B0AA 2W71A 3NUGA 3QENA 3F8TA 5G53C 4B79A 1D1SA 1PGJA 2EAUA 3R2JA 3DGFC 3R8XA 4CEJB 2D6FA 1GTSA 1G4UR 1DXOA 1YB7A 2R96A 2YWRA 3K2IA 4ITVA 1TGYA 4JZKA 5KSWB 2UU9B 5KVQA 2DWUA 3DOEA 5HIJA 4N47A 2XMGA 1DEKA 1SXIA 3C5CA 5ECYA 4UPEA 1GPLA 2MTBA 2L82A 4D8WA 1DIOB 4KYTA 4PR0A 1XMVA 4MKGA 3AEKA 4D74A 3N9IA 4AD8A 1Z6GA 1L5ZA 2ZBPA 4OAPA 3C16C 2PPVA 2NTNA 2PG3A 3MJSA 5PNTA 1R12A 4TTPA 1I94B 1X1SA 1EINA 4LF9B 5SY6A 1E1DA 1RP1A 3K9BA 3U7EB 3PYXA 2HJ9A 3M4ZA 3VFDA 1ZYUA 4AP6A 1YBFA 5K1ZA 4UJ5A 3TRDA 1TW3A 3KZNA 4D6XA 4G4JA 5DEOA 2FVYA 5I7OA 1GZ7A 1QAQA 3C85A 3D6VA 2GEFA 4WINA 2BJWA 5E1BA 3VDQA 1IY8A 1IN7A 2QMQA 1ZXLA 1NVEA 3BMCA 4IEEA 2X7XA 3CCFA 3IUMA 3RYFB 1SKYB 2PRJA 5AKXA 5J4HA 3WKCA 1AQYA 4LBVA 4MI6A 1K3TA 1NPYA 4LRYA 4FDAA 3TFQA 2GJAA 3W79A 4MS1A 3DE3X 2VDWA 4Q15A 3Q12A 3QVUA 2X41A 1JEDA 3G9QA 4PXYA 3UB4A 5HMMA 1JU9A 5KSYA 2RD2A 1XMXA 5J5CA 5BOSB 2A58A 3P20A 5CNMA 4TN5A 5FWNA 3UEOA 5DWVA 4L4XA 4RZ2A 1QVAA 1JEEA 5IH3A 1U8AA 5A9RA 4LGYA 3T12A 2HUPA 2UXBB 1IPHA 3IXLA 5C46F 3AV3A 3F74A 3IP9A 2F55A 2IS1A 1M54A 2C96A 3QVXA 5KDDA 1J90A 4Z8XA 4RCVA 5EEHA 2DQ4A 1HSZA 4OK3A 5SYNA 1IZ8A 2HPHA 2Y05A 3HYCA 4IL5A 4PRZA 3ID6C 4A36A 3WDLA 3UHJA 3JPWA 1GKLA 3LHSA 1I6WA 4CMGA 4OGFA 5BPFA 1UXOA 4M8LA 5ALJA 5JBQA 4XW2A 3BWBA 3GAZA 1AG9A 3AI7A 5BSTA 3V3TA 1NVXQ 3C48A 1E61A 2JI4A 4TMTA 1GKKA 1P9WA 2PZJA 2PYDA 1I9GA 2O2GA 2XAAA 2YFHA 4CV2A 4FWIB 3CH7A 2ORED 3KQUA 1R5NA 4L3VA 1KHHA 4FR2A 1IY0A 3TZHA 4IO0A 4TLCA 1C3EA 4LZAA 2ZBGA 4MRMA 4Y6PA 3WV5A 1C9NA 1JQ5A 2V6MA 4OMUA 1CR1A 1XEXB 2WSSD 4M46A 4Q7MB 4QEDA 4R4JA 1RFGE 5IKOA 2JJ2A 1U7WA 3WLJA 3IA2A 1EVKA 1ZI8A 5BYBA 3G89A 4G41A 3T9DA 9ABPA 1DZ3A 1QU2A 3JAWA 1CJSA 1MNQA 5DTMA 2CBGA 3BFKA 1P2GA 1NXSA 3KQMA 4ZCPA 5CG2A 3UFXB 2OENG 3A3KA 1YU9A 3DTNA 5EKTA 4PX9A 3RAGA 3IKTA 1O95C 2GUWA 2QTBA 3D8TA 3OCWA 3G8DA 1QH8B 4L7QA 5D85A 1PFVA 5CBPB 2A88A 1UAGA 2G5PA 3LTNC 1F2VA 1WBJB 3H3XA 2A1IA 2CE2X 4KODA 2VYVD 1VPWA 2PEZA 3E7FA 1Y0BA 2BC9A 1U0LA 2Z57A 3QE4A 2AOUA 3F98A 4JJGA 1R4ZA 1BCSA 3WZ2A 1CR6A 3BILA 1FP1D 3O9VA 3FSJX 4LS3A 3LBIA 4MQ4A 4MV1A 3V7NA 1D6NA 2G7ZA 3WNVA 1I1HA 4TUYF 5HJ7A 1PZFA 2OGWA 4INPA 4KPUB 3ZDBA 2ZI6A 4NCBA 3ZVNA 3PC8A 1S1CA 1SZCA 3E84A 4HL6A 5IJ9B 2OEPA 1W4AA 4KPFC 1U2GA 1OZHA 1O96A 2XIJA 3VUFA 4D0RA 4RTRA 3T7JA 4FI3C 1FF9A 3N2YA 1XMSA 1C8VB 4D1YA 1FX0A 3W9YA 1LW6E 1ETUA 3SQNA 3JQ9A 4OXIA 3FB4A 1UKYA 2C5FA 4OAQA 1E32A 3MGKA 2A8YA 1O57A 3MM4A 2WPDA 3E3AA 5TNXA 4ZYTA 2GCGA 2PFGA 2LD4A 3AYXB 2XT9A 3VYRB 2OXCA 3OQNA 1UXHA 1DIAA 3WYAA 5B7QA 3C7TA 1VL6A 3AU9A 3HS3A 3RWBA 1M1NB 5G41A 4FYVA 5EJ9A 1II8B 3LDGA 2JIRA 2MJLA 4Q9IA 4XSHA 5AVOA 3VPAA 5KTOA 2X9GA 1HDYA 2IVFA 1GOTA 1T8YA 3W5AA 1L4EA 4QELA 2QVLA 4P31A 4XQEA 2A1TR 4RSGA 5CRIA 1T8SA 4JGIA 3ITKA 4DC1A 2X3FA 3GY0A 1XZLA 3OKAA 5CJPA 4IINA 5F5XA 1A9PA 1U2GC 3GK3A 2YOHA 4EX6A 1U7UA 4L9AA 2QMZA 4UQOA 4AL4A 3FBWA 2JATA 4JSTA 5TX7A 3N7UA 4AMGA 4CLDA 3D4BA 1HGXA 4URZR 3T7RA 4BNMA 4B0OA 1G42A 4QA9A 3VTKA 1DC6A 2EWMA 3JQ9C 4RPHA 1YZQA 5D1NA 2OG1A 4UCQA 3S40A 1YBAA 2VJQA 3GLUA 4UU0A 1E9EA 2WB2A 1XDWA 2Q9AA 3TEMA 3K1AB 4FZJA 4MWTA 1DWPA 2OP0A 4P3NA 2ZRBA 3Q88A 4HH1A 1YRYE 5HJ5A 3KUXA 3IEKA 1OKKD 3BGIA 4GKJB 4IY1A 3I2GA 3WGGA 5K3EA 2ZT7A 2ZTVA 1C29B 1KJZA 3EIEA 4CCWA 1RU3A 1Y5LA 3P0JA 1Y1PA 3QVMA 1P29A 1A5AB 3ZUPA 1E96A 4HEQA 4X7BA 4B9EA 2EWWA 4MCIA 2ACEA 1EH5A 1XD8A 3M49A 5F7OA 2O1EA 5LB2A 4B85A 3K7EA 1KKMA 2JD0A 3KO8A 1J2UA 3R6DA 4E31A 1NL3A 1I7SB 2PZ8A 2CXHA 2XQJA 4H9GA 5KNBA 4G97A 3MOSA 2ENWA 1WXHA 4I2NA 4DKJA 5HQJA 2PBFA 2P41A 4X3OA 3QBVA 1UDAA 2VDKB 3EGOA 3T4UA 4WERA 4H18A 5AW7A 1ZX1A 1KY2A 3E5NA 2V59A 13PKA 2VYNA 4P2BA 1ZUIA 1UP4A 2I2CA 3I9NA 4QFBA 2F9LA 3ZCVA 5JC1A 2L0XA 2PY6A 1LGYA 3KHKA 1R9JA 4YAGA 4Q7JB 3QLVA 1IUPA 1T1RA 1J0BA 2H4FA 1QFMA 3ASUA 5CB4F 2WNSA 3F97A 4LGVA 4AJNA 2V0GA 3C70A 2FGJA 3KELA 2IHUA 3D6TB 3I5UA 3E3OA 4QICA 5FUBA 1RLJA 1HG0A 4AO8A 5D3MB 5B1HA 5BT9A 1NVFA 3E7WA 3BXPA 2EX1A 4C6HA 2GZMA 2WJIA 3BWMA 3V2HA 3P9SA 4WXEA 1X7HA 5BQ3A 3DL2A 5BOSA 5DYIA 2FMIA 1DC4A 5JQGB 4MVXA 1H2WA 3D7KA 3FA2A 5CA0A 1NI3A 1Z56C 3GMDA 4HGZA 3I9V6 4HMPA 5ENDA 3GIDA 4CMEA 3E7PA 4MRSA 2H0AA 2K7ZA 2VFAA 3WK4A 2Y9PB 3DUFA 2R1TA 3L1HA 4BRZA 4KCGA 4ENVA 1JEOA 3ESDA 4R7TA 3CBGA 3QUAA 3FDFA 4AF6A 1KIMA 5LP6B 4DMKA 1VYUA 1N78A 4TWZA 1JIJA 1FUIA 2VA8A 3QLVC 3W2GA 1YE5A 5HKLA 2FHPA 3FVQA 3H17A 3HJAA 2BEKA 2IZ5A 4QU5A 4S1OA 4C4PA 4UULA 4NJEA 1N0VC 2Y3IA 1YRAA 4GI1A 3V4FA 1UUFA 1K6EA 3IAS6 1OX4B 1PHPA 1EBBA 3R0VA 4ZPJA 3IYLW 1JKIA 2CKMA 4CMIA 2ZRIA 3ZE0B 1TTTA 1KU6A 3BORA 1FDWA 5C1OA 4HDNB 3U6BA 1ULSA 3U6KA 3NC1C 4HNAB 1JB9A 4X1IA 5BW4A 4WVFA 4JT4A 2ZIXA 2TMKA 1V8FA 5D7NA 4TLMB 4E2ZA 4LAFA 3U1VA 4F84A 4CMEC 1Q0LA 1SUWA 3CRNA 3GFOA 3RK1A 3ZZUA 4FYYA 1ZJJA 3GPCA 2GHIA 1RYFA 4RK6A 3F46A 1E8DA 4CGYA 1J20A 2NU7A 1NP7A 4P4TA 3VO8A 1ZVVA 1RRVA 3E82A 1M2OA 2CL7X 3CNEA 1YR3A 3H2YA 3P2KA 4WK4B 5AM5A 3LKVA 5F21A 5BN1A 5IC4A 2H1VA 3FCEA 4ZCRA 1N7GA 3NCHA 4IH4A 4KN9S 5F1PA 4GYYA 4B81A 5CCDA 3VMMA 4EFNA 2QE7D 5CBPA 5I7EA 3NXKA 3D0QA 4RORA 2Q5HA 4PSAA 3RROA 4YR7A 4PFJA 3CTMA 3MG9A 2OWDA 3CE6A 4JL5A 4YAUA 4HQ0A 3RF7A 3I04A 4OKNA 1CIVA 2IYSA 5IZCC 5LN1A 3OM9A 4RK5A 3H9EO 1TRKA 4JEHA 4LRUA 4RTMA 2WTBA 3WWDA 2P9BA 3EVGA 2NVUB 5AIBA 3BB4A 3FHTA 3ZUGA 1QGUB 3I53A 2JI8A 1X15A 3PUXA 4RHUA 1E6WA 5IJAA 4AP9A 3QW2A 3ACBA 4CI0B 2Y1WA 4G56A 5J4YA 5K0JA 4M4SA 2HNAA 4OUDA 4OP1A 4F3NA 4OYLA 4YB8A 2WTAA 3FVVA 1VSQA 2K7FA 3FKSA 3KSRA 4DC9A 4OJTA 1D5WA 5HZKA 5IDQA 4K6FA 3CG0A 3D7RA 2GJSA 1P17A 4DV2B 5DCUA 5EQDA 4EDHA 3G8YA 2RE8A 2E87A 1II8A 2B2CA 4UHEA 2EC5A 4WRRA 3HWX1 4WEOA 2ZOSA 3RK0A 1Q1NA 1JFTA 3QFCA 1QX3A 2BDTA 1KZ7B 1RLOA 1YQWA 2ANBA 1BFDA 2H65A 1TYAE 3GELA 4TXNA 3UY4A 5IXYA 3FXAA 4A1FA 3IULA 3TOZA 4IJ5A 4KNWA 3C24A 4AN1A 2ZRCA 2QUBA 3BRCA 5FOVA 3VZRA 4BNXA 4F85A 4WBNA 4GS5A 4FMPA 2J6CA 3KKKA 4Q7KA 3UXYA 5JYBA 1X7GA 3HBNA 2KYRA 2GPYA 2VF8A 3GWZA 1E4VA 3OE5A 3LKDA 3WQSB 1YT5A 4B4OA 2VJLA 3EOBI 3ORSA 3U9SA 4DV7B 1DVRA 4ZEXA 3W1EA 2WHYA 2E2WA 4DJ5X 5JCZA 1AQUA 5JD3A 2QW1A 2DCUA 4NCIA 1GLGA 5JSFA 2OBBA 1XE3A 3OZFA 1ID8A 3K73O 3PQDA 2B25A 4GLBA 2CXPA 1MV5A 2XSZD 3IDQA 3OT1B 4KO8A 1SO8A 3X2FA 3IEIA 5F1YA 4Q4LA 4ITUA 4J9VA 5BYAA 4IOKA 5CYGA 2X58A 4RZXA 2BZSA 2W6IA 2PZAA 3H5OA 1J22A 4NFHA 1C2TA 4EJSB 4YROA 5H9WA 1XD2A 4M53A 3RREA 3TJZA 3N0XA 1IUOA 5A3SA 3U49A 3FYHA 5ITWA 3V8PA 4V0OA 3TYXA 3H6GA 1SUFA 1F1BA 1MRZA 3E1SA 3PG5A 1KH2A 4DYVA 1G21B 1ESEA 3WAGA 2EP7A 1TA4A 1LKZA 4MTLA 5JLAA 2PJRA 5EJAA 2EG5A 1QAOA 4JEIA 1T0IA 3OKPA 4KO4S 1ZICA 3Q7QA 3SZRA 1W35A 3VH2A 3TXYA 1G8PA 2IS6A 1UQRA 2AYYA 4NSNA 3C3EA 1H2RS 2VF4X 1V9SA 4OA8A 4J6EA 3U44B 3AZOA 3HH8A 4GI3A 2Q0XA 5LC1A 1SOVA 2WJGA 1W0JD 4GICA 3SPXA 4EFMA 3ZZNA 5A02A 3P32A 4KVZA 4BHTA 2ZWAA 1BMFD 3L0SA 1ZI6A 4FMDB 3R7DA 3RHZA 4H2DA 1ABFA 4QGBA 3R74A 3OF3A 4GZ3A 1L4NA 3EGIA 3MWEB 1AO3A 4PY2A 4GH5A 2Y8EA 1P6XA 4DV6B 3IS3A 1NC1A 2EFCB 3EVBA 3F8SA 5AJTA 1AV7A 2ID9A 5CXQA 1V16A 4M86A 5DTJA 3ZBTA 1SHKA 4TL9A 1R9MA 4FQ8A 3E23A 4BZZA 3RS4A 4O4JB 3IVRA 1MZPA 2VRCA 1W44A 1RSZA 1X94A 4C9BA 2FUG6 1UDCA 4HZIA 3EOAI 4NMLA 5AJHA 3Q7IA 3PPIA 3R44A 4OEHA 1K7CA 5JJKA 4BKOA 2YS7A 1I1QB 3PYLA 1ZD3A 1MJFA 2WF5A 2ZBQA 3MRXA 2HDNB 3SDSA 3UWMA 4N48A 1JHVA 5LU8A 5IJ0A 2G5GX 2V7XA 3MUFA 5IBQA 3N1UA 1A88A 4PIVA 3CNQS 2CL5A 1H3FA 3BAFA 4MIEA 2FPGB 3T06B 4UUOA 1ZIPA 1P18A 1E7QA 2FE4A 3NYRA 1S8FA 1VHDA 1NBEA 3K9CA 4HDNA 1ZU4A 4UDXX 1G2QA 3MXOA 4OXNA 2VNAA 3BMQA 1Z47A 1KY5A 4QOFA 2VTVA 1AIPA 1DAFA 1K4YA 1Z6XA 4MWGA 4CM6A 4YMHA 1D3AA 1WBBA 3DBRB 4UBLA 3WIOA 5CLQA 1KAGA 2FEXA 3QXGA 4K6GA 2R85A 1T0JB 1Y8RB 3P9KA 4TXLA 3PVSA 3RJ5A 2HSEA 1J5XA 3P4UA 2P2LA 5HRCA 3F78A 2XADA 3D3KA 3H4MA 4DSOA 3RUPA 5IUKC 1OZFA 4L28A 4HAVA 4PG7A 4Z2YA 2NUBA 1H4TA 2V03A 3LA8A 1K63A 4WOBA 5EPOA 1U4SA 2WG0A 3I6BA 3E0QA 1Y80A 4CM1A 2LV8A 3NHUA 4OLFA 2JBHA 3QKWA 4LQLA 5DLYA 3ZVKA 2J9YB 1U2DC 3OHMA 5H3HA 3RU7A 4ANFA 1QYIA 1UPTA 2AX4A 4HRAA 2IYYA 2B0CA 3MBIA 1TYZA 4Y2XA 3UMCA 4BLTA 4D4IA 5H8WA 2HH9A 2F8SA 3HU2A 2P3LA 3FE2A 3ZXIA 2GXSA 2CHEA 1FSSA 2EATA 4DB4A 1U7DA 1WUHS 2IP2A 3NM5A 3VC1A 3INYA 2QYOA 4O4LA 5E7JA 1VSVA 1T29A 3L4EA 3FOWA 3LDAA 4GU5A 3USCS 1UPXA 2GCNA 4MIOA 4UEQA 1VP3A 2R8RA 4UDYX 3WISA 4DBLE 4H27A 5JAIA 5JXJA 5HFAA 1XRMA 2CLHB 5ED4A 3OUUA 1LPMA 2H1CA 3TLMA 2A0UA 3PE6A 3S2UA 4K9KA 4L0CA 2DBVO 5EJ2A 1SU6A 1B7GO 1V11B 3BJMA 4LBWA 3OLVA 2ACVA 5DM2A 1ILEA 2Q8PA 4WSOA 2W9XA 3K8OE 2YCLA 3N3AC 2Q29A 4V03A 4MRAA 4BX2A 1AA6A 5T4FA 4LFBB 3ZDCA 1H1LB 1JI0A 3CKLA 5BMVB 1R0SA 2FMXA 2V9PA 3NVKI 2AMJA 4CT5A 5JVDB 4PBTA 4ESHA 5FR2A 2IL1A 1Y3BE 2HBRA 2OP1A 2P77A 2ZWOA 1PNRA 4RA9A 4HWRA 4YRQA 1BCRB 3EGDB 1MF7A 4D3XA 1GXSB 2R87A 2XWQA 1KP3A 4M98A 3AVUA 2C2WA 3L93A 3OPYI 3RUFA 1R6BX 3O1LA 4DEVA 4Q1FA 1L4KA 1MIOA 4I36A 1YUBA 3SC2A 4PZUA 3DE1X 5EJ4A 1F2TA 4TV8F 3LQ4A 1JEAA 3ENQA 3I1JA 4P84A 2AW5A 1CLEA 2Y76A 4FR0A 4DJAA 1MO3A 5EWJA 2GJ4A 1SCJA 3H9GA 4TM7A 2RGCA 1N0HA 1GYQA 4OBWA 2Q1XA 2Z9BA 1ZZGA 1IG0A 4CR7A 2WF9A 4FHZA 2XNDA 1A8QA 1PJQA 1D07A 3HI6A 1VE7A 3KSZO 3CMMA 4RAOA 5AKEA 1WPQA 5LUBA 1POXA 3L8HA 1ZK2A 1GPYA 5L3VA 3EULA 3VKUA 4BGVA 1L7OA 2DC1A 1NT2A 4QTYA 2O3UA 1HT2E 4DV4B 2AG0A 5FQNA 2PUGA 4GMHA 5IK2D 2D2VA 1L6IA 2DECA 2R00A 3V1UA 2O1XA 3EUAA 2BZGA 1M3SA 4ES6A 1EKXA 1PT9A 3NORA 3WOVA 4F1JA 1ZAYA 1U7XA 2Q4RA 2R1VB 1L7RA 2E82A 3BE6A 1VKHA 5AK0A 3UJCA 4P0TA 1T4MA 1KDRA 2XD9A 2ZYIA 3GA0A 1JPVA 2YW9A 5EJGA 4DKXA 2P9FA 2BJHA 1Z4NA 4RD2A 2ISSD 1AU9A 3VX4A 1NNEA 2XYHA 3LFUA 4Q47A 4EF5A 4BV2A 1I2DA 2VWPA 1M72A 5IVIA 4N5DA 2WDPA 1A7AA 5AJYA 4F6RB 5FBZA 3I1FA 1RM5A 2JAQA 3KJXA 1ECGA 4YXFA 5IN4A 5TQ2A 5IAJA 2IJGX 2PA0A 2XE6A 4CM4B 3UMBA 5HXAA 1F9AA 1UEJA 5DRTA 1JQLB 2G07A 4F96A 1TMYA 1E1LA 4LK3A 3F7NA 3CPJB 3RE1A 1QE0A 3KRTA 4PNHA 3BIOA 3DMFA 4S1PA 1YR9A 2B61A 1UJ4A 2J5QA 5FPKA 2I3ZA 4ZC1A 3DW1X 1WXGA 2FQ1A 5JYDA 3PFBA 1ODSA 3PGKA 3KU1A 1NJ8A 3Q3JB 4Q4JA 2B7CA 5EIFA 2VTBA 4II3A 1QQ7A 3IAUA 4L4RA 2OHHA 4WCFC 3FOZA 2H8GA 2RB4A 1L1EA 3DGEC 4WZBE 3AT1A 3I62A 4DUGD 4KRXA 2C5GA 3CUUA 1U8EA 2P35A 1SCAA 3TLAA 2FWMX 4QULA 2AI2A 4LC1A 1V7QA 1NXVA 3IVGA 3DYBA 2PGDA 3UUWA 1QU3A 4IQ8A 2YYYA 2HPZA 3IBSA 2GJKA 3LM8A 2IZ0A 3O1IC 3UAOA 4B71A 2MR5A 1NN5A 2DM6A 2VPQA 3IT3A 3BA1A 4LY0A 5GP1A 4LDJA 3WO0A 4NBKA 1L9KA 3WXMA 1XCJA 3ESQA 5BV1A 1NMEA 2PT5A 3R5XA 5HYVA 2G7MC 5BSGA 5BSHA 1IVSA 1VG1A 2JC3A 2QTZA 1JALA 1X7ZB 2ZRAA 4YDRA 1W36D 5JMTA 2QF7A 1CWUA 1GUZA 3NV7A 5DM1A 1W59A 4NNPA 4ZV9A 3VOBA 3I37X 4TMXA 3MT0A 4HYQA 3WIDA 3V8EA 4CTOA 1RZRD 4HH0A 1Q22A 2QPOA 1G7CA 4S0ZA 5H82A 2JHGA 3DMRA 1JHYA 1Z4PX 2QMHA 4ECEA 3QEBZ 5KYWA 3DEIA 1OTXA 1SQ6A 2E18A 3NJ4A 2IHKA 2AKAB 1T10A 1W4ZA 2FWNA 4CHTA 4E5PA 5HOEA 1OXVA 3BJZA 4TT3A 3TB4A 2QX7A 3KHUA 1FFXA 4MWDA 3V7UA 2BCEA 1NDQA 3P19A 1VKZA 2CYCA 2UYOA 4MPRA 5HKKD 3AKZA 1IJEA 1FBNA 1PG0A 2BKXA 2OZLB 2QZSA 2NQTA 2ZULA 4OCZA 2HWXA 2J33A 4QTUB 4BWFB 2ZTLA 4J9UE 1EFRA 4IW3B 1EGVB 1YB6A 1YA6A 1B8NA 3TAHA 1EVQA 1YA4A 4WXHA 2C95A 1C1XB 4GEKA 1QO7A 5C4MA 1ZW1A 4DR4B 4BE4A 1L7XA 1VL1A 1PYDA 3EIHA 3H75A 3IESA 3IHKA 3JQ8A 2I1WA 2VLBA 3PRHA 3SU8A 1HEUA 3C6MA 1I0LA 3B1KA 4JUDX 1DKLA 4AXXA 3TI7A 4N5MA 3TE6A 3SWWA 1YK0A 1VGQA 3WHPA 5DN6D 5LQJA 3EXEB 3KOUA 2LNDA 1S9DA 2J7PD 5C32A 4W5WA 1U63A 3O6VA 2AMVA 4H3HB 2BMEA 1RI1A 2RHRA 2FZWA 2W6QA 1P4SA 3R0QA 3ZHRA 1JMYA 1RYEA 1WHTA 2P79A 1ODJA 3DWIA 2YV4A 4A73A 2ODAA 1CVRA 2C59A 3UJBA 3ADCA 2G08A 2PS0A 1NRXA 3T4PA 3UGTA 3WKDA 3UCXA 3KKZA 4YACA 5B7NA 5JHHB 2ZTMA 1GQQA 1PSDA 2PKQP 4ARBA 4YV2A 2FHSA 3HBAA 1U65A 2Q21A 3GDHA 3AJ9A 4FFSA 4JWKA 1H1LA 1QVRA 5ERGB 3S99A 3AERB 1DFGA 2GPSA 5EHNA 4YRBA 3QMWA 1D4FA 1KJ9A 2AOWA 3KJQA 3LOQA 1VP9A 2JHFA 3EB9A 1NUUA 4L57A 1CZUA 2Q1WA 5K7SA 4C2TA 3SJUA 1BXGA 4QLOA 4TTJA 4L4ZA 4RSRA 3WG9A 5JCOA 4IFIA 4TYPA 3PXGA 2BGWA 1VIDA 3RC7A 1GKYA 3EWSA 4EELA 2YNMA 1BHJA 1CUUA 5E3IA 3ZWPA 4ZVOA 1C80A 3ZKAA 4DXHA 1BKDR 3AESB 4UKDA 1HTTA 1C3OB 4GRAA 5BORA 1H3NA 3TSAA 4AUNA 5FI3A 1HT3A 4NX2A 4DDVA 4FFDA 2IPMA 4B3DA 4C20A 3RU9A 2FPSA 5H16A 1IEWA 3CBQA 3GMTA 4KYIB 4MMZB 4Q0MA 5CFNA 1Q7EA 3E70C 1GSAA 4B47A 4G9BA 3NNSA 1T6BY 2Y1KA 2IYQA 2I34A 2IYEA 4S35A 2PAFA 1VECA 4F6CA 2QG9A 3IOMA 5ALMA 2I7DA 4Z2AA 2IXTA 1VKNA 2XDQB 3AF5A 5EP2A 4YRMA 2W48A 2ZYSA 1A2KC 3WLTA 4EABA 5JSUA 3PK0A 4J29A 4U1RA 4OLJA 2YNMC 3F47A 5A3RA 4WOCA 3U13A 4DF3A 1YUNA 3EFOA 1DXQA 2R1VA 3K8ZA 4DIFA 2OV8A 3GD7A 3KL4A 4YP5A 3KSBC 4AJLA 3FJYA 4JBHA 4NMHA 2JGJA 1ISFA 1W93A 2OXEA 4Z1OA 3OEHA 5ALNA 4KGDA 4RABA 4F71A 1WVGA 1TFRA 2MSCB 4HBGA 3LCCA 3F96A 1YKSA 4F6RA 4JBWA 4RIGA 3GPIA 1VE5A 4ASUD 4DR3B 2BTEA 5FBWB 4CM4A 3LP8A 3HO1A 2BLLA 2HCRA 1KMHA 2F1KA 3ENNA 1K8YB 1XEWY 1E9SA 2EOAA 3C97A 3CVUA 1J9EA 4CV3A 2NP6A 2I1LA 4XYLA 3CR7A 4YJGA 1GPWB 4CQMD 1AQLA 1IQPA 3O31A 3NBAA 1WCIB 2PCLA 2UYYA 2XOXA 3O3CA 5DP1A 5EI5A 2IU0A 3WBKA 1JKXA 5JZOA 3IA7A 5FNZA 4UTOA 1E59A 2A7QA 2FN9A 5EHQA 1DV2A 5DTRA 1JDSA 3GH3A 3DV2A 2OGTA 4H60A 4JI2B 2Q46A 3D64A 4JWTA 1MC1A 3ZTWA 4DLPA 1V26A 5IKEA 1N2SA 3WK9A 4GNKA 4P32A 4DLLA 3SYMA 3EVNA 2KM1A 1WVIA 1JDTA 1S3GA 3PKJA 1LSOA 2ZJ5A 4YBZA 1G3MA 1E2HA 1COZA 2C2HA 4AIIA 4F2HA 1YL6A 2G1UA 3BRWA 3MAAC 5FOWA 4YXWA 3WGYA 4CF6A 1YFJA 4B7XA 1Z7WA 2ZUSA 2GKGA 2OXRA 4IJWA 4L8YA 1YACA 4IOJA 3P27A 3SI7A 5KJ6A 3SK0A 2YVQA 4HVTA 1BS9A 1AK2A 1GITA 2FA9A 3QW4B 1M2EA 2ACKA 3AKCA 3NBMA 4TTSA 3VDNB 1EK5A 1M66A 2P4UA 1N5LA 3AU8A 2PT6A 4F3YA 3UJPA 1UXKA 5CM9C 2QZ4A 1VG8A 1X7ZA 1YQQA 4QUJA 2BELA 3DF9A 2IEGA 1OYOA 4QPCA 3NFRA 2VKTA 1Y8AA 2V9CA 2ZSAA 2YJ6A 3A8TA 4LY3A 4R81A 2O2XA 1LH0A 3FLMA 5I3CA 3CWZA 3TR5A 3EXIB 1J70A 5CB8A 5FUMA 1MEEA 2I7TA 2P68A 2HK6A 3FFWA 1EFVB 3KQKA 5FOSA 4B3RB 1OA0A 2JK1A 1BZYA 4HQRA 4JUBA 5EMHA 3V7WA 2DKFA 4MARA 3W05A 4B8YA 1T6ZA 2H9IA 3DOFA 1IPFA 4MQMA 2CBZA 4WLFA 3DZJA 3PQ5A 4GHWA 3VKFA 3W5UA 4F5YA 4F72A 1Z37A 2J3KA 2OL4A 3MJCA 1Y6GA 2Q62A 1YMQA 2CHUA 3ZV7A 3N87A 3BBPA 3D7SA 3PKIA 4FSHA 3WWZA 1T5HX 2JLXA 1SQ5A 1W0CA 4H1WA 3AC0A 1FFEA 3IBCA 1KYWA 3VJKA 3FYUB 4H4CA 2OZLA 4Y9UA 2P9JA 2Q5QA 1FDVA 4W7HA 5TPZD 4G0ZA 5AQ1A 5JBIA 3ZDQA 3NBUA 3TE7A 4CKWB 4PRYA 1UBMS 4YDHB 1DOHA 1OWMA 2IH5A 4UBOA 3MTBA 5CX1B 1U0RA 3MWDB 2R8EA 4JYPA 1E9CA 5ARDA 5EINA 1GNQA 3DVRX 4NZMA 4OJMX 4QOJA 3N8NA 1YBMA 1T2VA 2IHTA 2GVNA 2W0MA 4O4HF 3RODA 1Y63A 1OPXA 4XQ0A 2DSTA 3WYCA 4IDEA 5L3SB 2QT9A 2C94A 2BFFA 3F6YA 3K6SA 1IAQA 1U6IA 3RSZA 4D5GA 3THWB 1O6BA 2NZ2A 2IXGA 3MD0A 3ETEA 4HXGA 2GK3A 5BSVA 2Q3HA 1QF7A 3GUHA 1IZ0A 5T4EA 2QRVB 3V4OA 3OZGA 1ENZA 4WH0A 1TZBA 3D8RA 2YWCA 5JE8A 1Q21A 3PP8A 5CLJA 1N3BA 3NHRA 1MPXA 2X2FA 4DL9A 1QH1B 2JCXA 2NTEA 1JIXA 3GUZA 3BEOA 4QDOA 3FETA 4WUTA 2XJ4A 5JY6A 1XCLA 4KREA 2CCGA 5ENVA 4R0NA 3RHFA 4J8PA 1ZH4A 2D0DA 3INGA 2P7IA 1LLCA 2X5JO 3AERA 2BI4A 2DTXA 3D0OA 2CF6A 2FB9A 4HAWA 4IICA 3A0UA 3ILVA 3HACA 2QI9F 4ZQCB 4C14A 1KVUA 5CNKA 1K7FB 1LVHA 2O2YA 3NJ8A 1QOPB 3ORRA 4PGFA 2XLCA 3ZCQA 5CDFE 3BN3A 2ONKA 3P2JA 5K0CA 1OLOA 1U11A 1ZCAA 4K9DA 3DH0A 1KSFX 2BZ1A 2FPLA 3GR6A 2B9VA 4QEZA 1YMUA 2Z58A 3HV0A 4PGMA 1C3OA 1ENOA 4DT1A 1RRGA 3LOUA 5EOVA 3OOWA 1GV1A 1V9LA 4II7A 2BHTA 1TX4B 2BUCA 5CVJA 4DIMA 1B8OA 4FE4A 3V32A 3LL7A 2C9OA 3MIZA 1T2FA 3CTPA 1FJHA 2FKNA 4G5GA 2FI1A 4JI5B 3K4PA 4RW0A 2GBFA 5T67A 2P3QA 1QHXA 2J45A 4U6QA 3L41A 1BA2A 5EZQA 4BJ5A 3WHLA 4HBZA 1CY2A 1SHJA 4B40A 2EF0A 5I4KA 3DAHA 1XBTA 3WGHA 1G3IA 1SWVA 3K6KA 2PHZA 5JCJD 3TZCA 3MEQA 2IP1A 2I3GA 3M6LA 4LJ5A 1R0LA 2AJCA 2XUDA 2ZITA 3W3ZB 1T13A 5CFOA 1EP3B 1XQ1A 4TYYA 1NRJB 1PK8A 2PD3A 3WLQA 2GEVA 5AESA 3RRYA 4PXSA 3REOA 3FN4A 4J0DA 3O4HA 3CZ5A 2E4WA 4HPJB 5G1OA 5E2IA 1Q15A 2FWAA 4J7XA 4R0MA 1UAAA 1FRFS 4TMZA 1P39A 1R88A 2FDXA 2ZBFA 1XVLA 2D06A 3LX6A 1FDSA 4B2YA 1RXEA 3EHDA 2P11A 5C9ZA 10MHA 3U1BA 3HKEA 2O6HA 3U3OA 1JSXA 4UZFA 4X24A 2XBMA 1VI2A 3EXHA 1FP4A 4OJKA 4F3TA 2BT4A 1O54A 2NYRA 4LJYA 3QEKA 4HFRA 4OQPA 1Y6RA 5L45A 2CJFA 2D4AA 1KFEB 2Q99A 1GPAA 1UXGA 5FDFA 2EBFX 3QUSA 2IYRA 1UWKA 2O4CA 2XGMA 1Q2UA 4IDCA 3B78A 1ZH6A 3BHIA 1VKRA 2J3HA 5C1IA 4JLKA 4TT8A 1RZUA 4KQEA 1T0HB 2H07A 3AQ4A 2I65A 5D51S 4JX8A 2PDAA 2CC2A 1H0SA 1W29A 1DIGA 2HQBA 3IP3A 4KQHA 4TMVA 2BEVA 3HDGA 1UBKS 2Y67A 1Z39A 5TS3A 1ESCA 1AXEA 1XNHA 3TW4A 2C04A 3V00A 5B36A 1ECPA 1LBIA 2OAGA 2I6FA 3ANSA 4EK9A 3FTQA 3Q9SA 4X94A 3C7KA 4XM2A 2R7NA 3KYBA 3AR7A 2IEBA 3JATB 3V97A 2OAQ1 1PS0A 4TSFA 2ANCA 2RGAA 1SXQA 2JFNA 3EXHC 2IW3A 2O9JA 3L18A 3LC0A 3UK7A 4A0RA 5K5EA 1P1IA 1E3LA 3CRVA 1L8AA 1OTYA 1G5PA 3I9V1 2HC9A 4US1R 1H05A 3UQYS 5AUOB 2IX3A 3HJFA 2IXBA 2Y2VA 2WIJA 3BE8A 3P9CA 4PAWA 1MO6A 3JQFA 1BGXT 3SJZA 2D59A 3KT3A 3PTLA 5FTMA 4PF1A 1CUZA 1AS2A 2XCUA 3FUXA 3ZE9A 2AEMA 4KKXB 3HU3A 4RVDA 5FWDA 1U1FA 1VM6A 4B87A 1MHTA 2G36A 2BWJA 3JW8A 2XOEA 5F3DA 1Y7HA 1R0YA 2EHDA 3BMNA 1RW4A 1WVMA 3IO3A 3ONFA 1XXHE 1EFVA 1HZZA 1Y1SA 2YJTD 2QEQA 4H16A 5IC6A 1RE0A 2VSNA 2XF8A 3NETA 4ZCLA 1G55A 4AWAA 1PQPA 2EWVA 1N5JA 2IOFK 5A4AA 1YS4A 2WZBA 1T9GS 3DVQX 4KITB 2J59A 2RHHA 3UMYA 1P0CA 2HK7A 5JIBA 1K2VN 5DU2A 1H5QA 2VG8A 2ZJ4A 2ZS8A 4URUR 3RR2A 4A0GA 3IIEA 2HFKA 1U3DA 1G8GA 2QQGA 3L7BA 1B2LA 2J9XB 4BNTA 3Q7RA 3A1DA 4D2IA 3L7IA 4PPFA 1T9AA 2IA5A 2WF6A 4X45A 5CK4A 5A5GA 1DTEA 4QOSA 1RDFA 2DT5A 3HR8A 1C1DB 2CZCA 2B4RO 1HZZC 5ILGA 5J9FA 3DDOA 3K5PA 4IJQA 1XZ8A 5ISMA 3UUGA 1HORA 2PBRA 4Q9HA 2BI8A 2BUAA 5L3SA 5CDYA 4JBIA 4KK3A 1Q2XA 5AYVA 5JU6A 5KYYA 3ZQ6A 1A82A 5LXTA 2C9ZA 1Z15A 3FZYA 1C3VA 2HV9A 4N65A 3GGCA 5AW3A 1A98A 1IWOA 3D6FA 2SHKA 1L4UA 1L7QA 2QRVA 3H9CA 3I6QA 3PIDA 1TA0A 1N0IA 3TSZA 4F46A 4Q9JA 2NSJA 2XUAA 3B1JA 3VR3D 4YFYA 3WNQA 3VC3A 3F5QA 4BO3A 3HADA 4OIFA 2P1DA 1WKCA 2ZWMA 4F56A 3NGMA 4ZU1X 4AJ9A 4EI8A 4QRIA 1QMPA 4HPWA 5CB6A 2NO5A 3CXUA 3EWAA 4BKUA 4Q6BA 5FX2A 1NOKA 4ZI7F 1T9HA 5DNAA 1QIKA 2NSYA 1MLDA 3PRYA 3LVRE 4BO2A 3FSRA 1Q7GA 4MGZR 2BGUA 2IP4A 2P2SA 4C7KA 2FN7A 4QG7A 4RA6A 2XWJI 3H8JA 4X1YB 5IARA 4ED9A 3CU5A 5AUPB 2QIOA 3EDMA 3GZJA 1ENYA 1NVKA 2UDPA 3PGVA 4OK5A 4Q93A 4QATA 4W4TA 2ID7A 1JH8A 3TUIC 3ZXSA 1MN6A 1W30A 1EFDN 1ZSNA 2B8JA 6ADHA 2HF7A 3FVRA 3IP5A 3HB0A 1WW8A 1XVVA 2XLBA 3IAHA 5J5AA 3IE1A 2JJYA 5L8VA 2HM7A 2ZYWX 3HJRA 1VE1A 3JQGB 4ER3A 1S3FA 2Q2QA 1NHGA 3CN9A 4ZO4A 4A03A 3QU5A 3DMTA 4A8HA 3RUAA 3NEAA 1JZTA 1OFHA 2YOFA 3PGMA 4JA2A 4M9RA 3Q5EA 4YV0A 1QGED 3ZOZA 2IEAA 3I34X 4LE1A 1DIBA 2IS4A 3IVCA 1BXZA 1DBVO 2RGNA 2WFZA 1I7PA 3JASB 4YFVA 3LIIA 1XF9A 1COWA 2HIMA 4L08A 3UTCA 3ORQA 1CZLA 5AI9A 3RC2A 2C54A 1XRJA 1S2LA 1XDGA 1CC1S 1N5KA 1P9RA 4RF4A 3RI3A 3DEAA 4S1NA 3AX6A 3RRNA 1CNMA 1X7WB 3Q3CA 1XEFA 4FBMA 2GWRA 2IUYA 3JV7A 1YOVA 4WKNA 2H2GA 3PD1A 2CKDA 2Q5LA 3IJRA 2OZVA 4QXAA 1ENPA 2IU3A 4XZ3A 3BHMA 3M4JA 1FNDA 1NBIA 2CMDA 3RBVA 5B7PA 4BNZA 4RF5A 4M9SA 4DDWA 4YA6A 4YJ3B 3G2IA 5HUJA 4Q3CA 4FHEA 1GL6A 3OX1A 5L6MB 1WWKA 1REQA 3X2EA 1J9ZA 3WGJA 4EEXA 1KXJA 3L7MA 3O74A 1PJZA 1U9YA 2WB4A 2RGNC 1LK0A 5I8PA 1O9HA 2OR3A 4CG1A 4EGFA 3HVHA 7MHTA 1XZEA 1VCOA 2QRKA 1FNMA 4B3XA 2ZZMA 1BH2A 2OD2A 1Y3AA 4FDTA 4N0QA 4IVRA 3COVA 1ARZA 1X7XA 2GAIA 2Z1MA 4IWYA 4OFZA 3W5BA 4PG6A 4BBJA 1LK5A 1MA3A 4MW5A 3GLFE 1J6UA 2W6ZA 2HMVA 1XL0A 1XZNA 3EDYA 2C77A 2ID4A 4PC3A 2P6UA 4G85A 3KE9A 3TXXA 3VXKA 2WQ6A 2H1OA 3KQNA 3PVCA 4AU1A 1H2ZA 1VTKA 3HXTA 4FGKA 1ZGJA 3T1HB 1T2DA 1JBQA 4W6ZA 1RR6A 3CVVA 3BD6A 3L6EA 2ZUVA 4KR6A 4EDFA 3AEUB 1DTWA 4NQRA 1KJIA 4DLSA 1AXGA 3A1CA 4P6VF 2JLRA 3MTJA 3TBHA 1MR3F 2EKDA 3E61A 1XTKA 3PEUA 4GMGA 2CNLA 3O2QB 1K89A 5FPSA 1DJLA 1W6UA 1WLYA 3BHJA 1YQDA 2O3RA 1GRNA 1RMQA 2AW3A 4O02B 2E5FA 2IPNA 3FWKA 3WB9A 1JR6A 1WXDA 1PNOA 1E1CA 2EGGA 4DJFC 1V2HE 2GSWA 1T9ZA 3FKJA 3H1GA 2JLWA 1X3SA 1EUDB 2AFIE 4R16A 2FSIA 2HIGA 4QPJC 4NZYA 4DSZA 4WLVA 4J2OA 3I0ZA 1KH3A 3IPCA 1JIUA 3RGGA 1MC8A 5JSQA 4J07A 4A2QA 4F91B 4PWZA 3ZV3A 1QHIA 1Z2DA 1CQXA 3AM3A 2O57A 1YCGA 3IIIA 5JNWA 2NAPA 1V35A 1UBGA 4BLPA 1P91A 1XMJA 2CB0A 1OWPA 2J5KA 2X1MA 5AO9A 4AC9A 4ISCA 3ZGXA 2E6UX 1AKNA 1DZIA 1PDVA 2QQ0A 3PVZA 1PDWA 1MDFA 4R05A 4V38A 2Q7OE 3PUWA 2A1TS 1RIIA 4GQBA 1CUCA 5EESA 4F2PA 4FN5A 4CIYA 4JL8A 5EUCA 5A04A 4RKFA 2QKYA 5DLDA 1W5TA 1WE2A 3CGWA 1UZAA 1ZGHA 1XCPA 5JWRA 1IK4A 1QKJA 4Q19A 1MD9A 1X2EA 1L1QA 1Y81A 2WIDA 4OPMA 4KLZA 1Y9ZA 2X86A 3ND7A 4MA4A 5ALZA 4PHTA 5SYMA 2JFPA 3UGKA 3UOWA 3VVCA 5KC8A 3LH5A 4MEBA 1RMYA 2C5BA 4V0RA 1LWOA 1SQSA 2BH2A 1ZOSA 2CK3D 3SZGA 3CUTA 2DHRA 4KG7A 4B6RA 4J90A 2GN0A 5JO0A 1WZNA 4X0EA 2TMDA 1SULA 2GS9A 1GJRA 2G1PA 1UMBA 3M2PA 1D4AA 5F52A 1QKKA 1KQOA 3OZTA 1RE1A 3GBPA 4CDNA 4Z1MD 5K0TA 5B6PA 2HBYA 3GEPA 3NHBA 1JLLB 2XCOA 3LBFA 3OZIA 1JX6A 4MVJM 4R54A 2NVBA 4AJ2A 4E07A 1G9TA 1R6XA 4Q82A 3VYUB 2ZRKA 2RHCA 1E1KA 5HK8A 3GVCA 4EAQA 4HX9A 3CLSD 4D5EA 5IVHA 2FPWA 2P62A 4AMUA 1Z3CA 4KC0A 2V1XA 2XITA 2G72A 2HRBA 2PD4A 2XMSA 1SEPA 3LYHA 3QWBA 4PYNA 4WY8A 3V2UA 3OQJA 4KQ1A 3WGKA 4IIEA 1MC5A 1OI7A 1FP6A 1JSRA 3L8ZA 2ECQA 4CR6A 5JS7A 1C9JA 1DFIA 4O1HA 2PL3A