5CFOA

Crystal structure of anemone sting (nematostella vectensis) in apo 'rotated' open conformation
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
182
structure length
182
Chain Sequence
b'KNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFWDDKIPGSDYDPQNRITFEGNTEPLEKTRGGVFLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDSEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stimulator of Interferon Genes
publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Immune system
total genus 52
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cfoA02
4LOLA 5CFMA 5CFNA 4LOKA 4EF5A 4LOHA 4LOIA 4EMTA 4F9GA 4YP1A 4F5DA 5CFQA 5CFRA 4F5YA 4QXPA 4QXQA 4KC0A 5BQXA 4F9EA 4KBYA 5CFLA 4LOJA 4EF4A 4F5EA 4KSYA 5CFOA 4QXRA 5CFPA 4JC5A 4QXOA 4EMUA 4F5WA
chains in the Genus database with same CATH superfamily
3QMVA 1TUIA 3G89A 2DKNA 2W6ZA 4D0LB 4OU4A 5KOJA 4IG9A 1W581 3WX0A 2YFHA 5T6BA 5COQA 4YJKA 4O4LF 2VDJA 3KR0A 2D2FA 5T57A 3KUUA 3EQ6A 2P6PA 3KG2A 2HL6A 4NYJR 5TX7A 4ITVA 4BLOA 1E8MA 4UASA 5H59A 3WXMA 2X3FA 4C6SA 1QLJA 2JVKA 3D4OA 1J6UA 2ZB2A 4L0QA 4AK9A 3D81A 1NJSA 1MPXA 2WSBA 3UMFA 1SM4A 1SURA 1NZDA 3GZNB 5K0LA 3NDIA 1R27A 4BP1A 4CDNA 4IGFA 1C4KA 4TSRA 4GLFA 2NT3A 3ZJYA 4X61A 2IOFK 1L1EA 1FYVA 1KP2A 1Z07A 2WICA 2H9IA 2IYNA 1P7PA 2PMWB 5E7QA 1Q11A 4Y1FA 4JOCA 4FPXA 3K70C 2GKGA 2GZAA 3W06A 2H2DA 4LWPA 2OORC 5TPZD 3VJRA 4AJ2A 4JI5B 3VPHA 4UVGA 2QN8A 3CUYA 3DG9A 3OJWA 1Q0RA 5EUCA 2FWBA 3UTDA 3IBTA 4HTAA 2IHJA 3CISA 2I67A 3KX2A 4EG6A 3C8ZA 1ZGAA 2CYCA 2BEUB 3GQBA 5A9SB 4YC7A 1ZD1A 1Q50A 3FH0A 1L8QA 3AFOA 3L9XA 2HNBA 3QM1A 3Q2OA 3SLRA 2N47A 1Z4NA 3KWFA 4F60A 3H05A 4KACA 1NP7A 2PT9A 4P8RA 4EATA 4ZHSA 2O3JA 1P81A 4C7BA 1FIUA 3H0CA 4YRMA 5J47A 3ZVRA 5FOQA 3CW8X 4TMXA 1JJVA 5C5IA 1N2IA 1WXHA 3DVSX 3FAKA 3FOBA 2GFIA 1J25A 1JKIA 1BD3A 1PTKA 4MGZR 3GJYA 3HKDB 5EIBD 5EP4A 4Y7DA 5LUBA 1VB5A 3GEGA 3PIRA 2Y0DA 3DLPX 2G9NA 2WWRA 4WZZA 3IBCA 3KFXA 5EINA 3ZGXA 4JBWA 3RG8A 3R2JA 5ELMA 5FTNA 1GTG1 2MYNA 2JLBA 3ITKA 4Y0VA 4RANA 4Y1GA 3RK1A 3Q8MA 3BCSA 2PHZA 4FFBB 3TFQA 4CBVA 2E4ZA 3TG8A 1A2BA 2KLBA 2FR1A 2GM9A 4QO7A 1PEDA 2X3YA 3RANA 3UQYS 4CIVA 2RGUA 4F4IA 2TRSB 4K6MA 2BM8A 4EDHA 2NVWA 4CKCB 3E18A 3GDWA 2B36A 5K3OA 4PRKA 4BYGA 3UT0A 4C21A 2PZFA 2XOKD 3ZWNA 1J39A 3LYAA 3CQ9A 4PS0A 4IDPA 4A92A 1T3HA 1ZG3A 2QVCA 2WJPA 3R4VA 4HZGA 4J1SA 3FTEA 1EX6A 1DARA 1R12A 4A6DA 1W0JD 1UMDB 2NPOA 3WSTA 4EH1A 1Q0PA 3MTJA 1BMQA 5FIUA 3LC1O 4Q3AA 1NT2A 5TS2A 3OKAA 2IXGA 3FYUB 1E63A 2FLVA 3BIFA 1VI5A 4JSTA 1Y34E 1DVRA 3HRKA 3PQ4A 5D3ZA 3A6HA 2UYYA 4AZ0B 2HCTA 4K7JA 3N3BC 3OTWA 5D3MB 1F2TB 3CUWA 1DTEA 3F74A 1V8OA 3AJEA 3CH6A 1X7WA 3RBAA 2FPUA 4NOKA 1ZU5A 1N6IA 4UU7A 2DJIA 4MCHA 3VXKA 5HGXA 5JPDA 4PSDA 4YAKA 3KHTA 2X7XA 3CTPA 2XMCA 2H11A 4RWZA 5D1HA 1Z25A 1U2SA 4D4GA 3S81A 3LDUA 3VO9A 5ADHA 1UXOA 4HB3A 1X7YA 3P9ZA 4PO8A 5KJCA 1SVSA 3SXUA 821PA 2Q6VA 2I1QA 2W8ZA 3RFTA 4DYVA 1E1RD 4KSYA 4YWJA 1RRVA 4IUBS 1G2OA 1WOMA 4RA6A 4WLOA 1FC0A 4LX8A 2B20A 2O7VA 1UFVA 3GJ0A 5HZMA 4ZZ3A 4D74A 2RHOA 2N46A 4EZEA 2PBZA 3L40A 1HDZA 3JD0A 4YT5A 4IO1A 4KXYA 4X92A 2OPHA 2WAXA 3C6QA 4IIJA 3A6KA 2Z1MA 4LI0A 3WMEA 3AY3A 4TSKA 3UFXA 5I7AA 3OIUA 3I9FA 4CT0A 1MXFA 5GONF 2QD4A 5DNDA 2HEIA 3BIXA 4FX5A 4TLCA 1ZRMA 1DG1G 3TGPA 1RPZA 2PR7A 3OH8A 2AVNA 4OLJA 2ZRNA 3BMNA 4Q3CA 1DAFA 4DUPA 3PHHA 3FG9A 1AVTA 3OJOA 3C3KA 5KDOA 4AYXA 1OVGA 2JZNA 5FQOA 1QTRA 3CF6R 4M49A 1YS4A 2WE7A 3S5UA 2DPYA 1DWOA 2VBGA 2VXCA 2XNJA 3H8JA 3Q9SA 4KJZA 2DQKA 3BK2A 3G2LA 4M7RA 5FL7A 2Z9DA 1WPRA 2ZI4A 2A5LA 4BEBA 1RLUA 3QVGA 1N2CA 1NMZA 2BGWA 3EVFA 2QTNA 5DNYB 4HEA1 5JPIA 1PT6A 3AHFA 4PPGA 2WU8A 1HDRA 3T1TA 3PQ8A 1ZOPA 4MR8A 3M5DA 4FT4A 1FXWF 4OQNA 1S2LA 2GSWA 3EIXA 3K9CA 5HP4A 2B8TA 2W8BA 1P0MA 4M0KA 4URYR 3R5JA 4TXNA 5HZHA 1ODJA 1TYEB 2Q5IA 1BXKA 1FUEA 2F3PA 3AMVA 3IJRA 4KGXA 3ORYA 4M88A 3WQSB 1Y37A 2CVPA 1C1DB 4TGLA 5A3RA 2R7KA 3V34A 4MVJM 1SB8A 1GOTA 1ZVMA 5IC6A 2VIIA 4KQIA 2EP7A 1E3JA 3H1BA 5E4JA 2VTDA 3WI7A 4G81A 4ETNA 1GU0A 1MVOA 2VZ0A 3CWZA 5G4KA 3GFFA 1YK0A 2ZBVA 3AZQA 3RVKA 4MV0A 1YQTA 3T0FA 2FWJA 2GSDA 1U2QA 3EZ2A 2HBRA 2VPXA 4M83A 2EKLA 1S8OA 3TBHA 2DPLA 1KR2A 2H2IA 2WAOA 3E9NA 1PR1A 4NCNA 3R7FA 4AFNA 1L5SA 1SVOA 2CHEA 1I2MA 4RIEA 4EUEA 4MI3A 4ZHQA 4D9KA 4Q02A 4EIWA 3JD2A 3KVOA 4HDRA 2CE2X 2OBFA 1X13A 1U5CA 2XQIA 3P0HA 3M6XA 4FOPA 3I09A 5K99A 3SC6A 2HDOA 5T4BA 3KUDA 3E48A 2QR2A 3OEHD 4DWOA 3U7GA 3G79A 3WADA 4PNPA 1I4TD 2WW8A 2O8BB 4NH4A 5ALUA 1MFPA 4QFCA 2FB9A 1KMIY 4EO7A 4URWR 5DGCA 2IIPA 3U7RA 4RKEA 3T1YB 2O5VA 2XMPA 4ZV9A 2CDNA 3KJGA 1NU6A 2X4DA 5IVKA 5LBUA 4QYWA 1WCIB 4JLWA 3PFIA 1HZZC 5KREA 2C7RA 4P7GA 3UT6A 3BA1A 4I5EA 5A9SA 1FQWA 3GUUA 1DEOA 3O3MB 3KB8A 1MB0A 3MILA 3LKBA 4AN1A 1U2GC 1VDMA 1U9JA 2JJ1A 4WKOA 5C9ZA 5IF3A 2V03A 4RMHA 1PBNA 1RZRD 2ZYIA 4PFKA 1WABA 2NYVA 4DLZA 3LM8A 4Z0PA 4A0FA 3BFKA 3CWQA 5FOUA 3T94A 5K1ZA 1K9SA 2DFPA 3GYGA 3ZU3A 1K06A 1R0CA 2BR3A 4G8CA 3K0KA 2NYUA 3RSSA 2EFJA 2Q1YA 2RGDA 5E2IA 2G82A 4M21A 4DCMA 5FLXA 3FOZA 3HTXA 3KKMA 2X6TA 5E9WA 4XIFA 4DDKA 3CZAA 3OU7A 3QVKA 4HDKA 3UHOA 5DK4A 1NNEA 3U7QB 1U7TA 3P2OA 1DXOA 4Y6GB 3B6ZA 3NLLA 2VQFB 2PJUA 3GGCA 3UWOA 2C94A 2M9MA 4QQFA 1XD8A 2EZUA 3W5DA 2NUAA 4QDZA 1QRUA 1W1WA 1CQIA 2HHCA 1DLJA 5IKXA 3V9AA 5AVXA 2EZ4A 4HAZA 3BE5A 4L9AA 3UVEA 3AIOA 4R7TA 5AJUA 1BRMA 3RCBA 4F0JA 2ZBRA 5EP3A 3ND8A 2VDQB 3RC7A 3LVRE 2KS6A 4MDEA 5HS6A 4CR7A 3LBNA 4UU1A 3MEQA 5EYPB 1S7GA 5CT8A 4ZKDA 4L27A 2YHUA 2QN1A 1GT6A 3HBAA 4ZD6A 5KDDA 2G76A 3JQEA 2JGMA 2VI5A 1NVKA 3GLGB 4D46A 2X5JO 1XXHE 1VYHA 4IUYA 2XCOA 2Z98A 3TOCA 1TKAA 5ALDA 4IDCA 2D74A 3PDUA 2W6IA 1KDOA 3PK0A 2Z8ZA 4F8YA 4NK4A 1PT7A 1G7SA 3EMDA 4KH1A 2P4QA 2BF7A 1M8PA 1GQQA 1BTOA 4RW0A 1PL6A 4BO3A 3INYA 3KXPA 2KLHA 1I3LA 3JQQA 5E1MA 5EP1A 3WLHA 4HFMA 3COZA 1WBBA 4ZEXA 4I5IA 4JGIA 3JZFA 1A9QA 2HGSA 2ZQ5A 4UEQA 4XUGB 4DHEA 5IWCA 1Y1RA 2OB1A 4KN8A 4W4TA 2R7NA 1GRVA 3HLYA 1BEEA 5IXSA 4DQVA 1AH2A 4U00A 3V2IA 3T5PA 2LVBA 2BFEA 3ZD9A 4D4IA 5JISA 2DYKA 3BHJA 3DC2A 3KLMX 3ZX5A 1ZH8A 5DISB 5GQSA 1PZMA 4LNUB 4GT1A 5JW6A 1N3LA 1GTVA 2OEPA 1OWNA 5BOSB 3ZOKA 3PC2A 3STUA 3TJZA 3G88A 3OE7A 2J5XA 2PPVA 2ALJA 2UZIR 1XLUA 3EFHA 3HZHA 3IAHA 3I52A 5LZ4A 1W94A 3JAKA 3ORSA 4JLKA 3CKMA 1XZDA 3JS5A 2VQEB 3A2NA 1V5IA 3D5TA 3IILA 5M34A 2QZSA 2Z2IA 1R4ZA 2VTVA 3GJXC 3CSUA 2RIRA 3LFTA 4E09A 3NMUF 1NYQA 2C4TA 5CXSA 1X3SA 3REOA 1I3KA 3EZXA 1HT1E 2JHCA 5GAJA 1J99A 1FFHA 4FC7A 5FOTA 4YT8A 4K9SA 3VZSA 5LD2B 3E03A 2I1WA 2W2PA 3IH5A 3QU5A 2WPDD 4JENA 4INJA 4MKIA 5AVRA 3KQNA 2L82A 3WMRA 4R7ZA 1FJHA 5KCMA 1ACMA 2AN3A 3IQXA 5FEMA 5HM8A 2HF9A 3RIGA 5HDBB 3L0BA 2VNKA 4R41A 4Z86A 1T6ZA 1KK0A 3LX5A 5DVZA 3I5XA 3QRWA 1PYDA 4XR9A 3JWJA 3RYFB 1U2PA 3TD9A 4DIUA 5HRAA 2R9VA 5C37A 3P9XA 1SIBE 2ADFA 4BO4A 1WPQA 4V03A 1BWPA 3ZU5A 2J32A 1X7XB 3RVQA 4PG8A 3ZU6A 4QBGB 5G0WA 1QPGA 2FJ0A 3OJLA 3A1CA 4OFBA 3NIWA 3TUIC 4X3OA 3FDZA 4JUBA 1KGSA 3JQRA 1UK6A 1YMQA 3QK7A 4HGRA 2ZBEA 3IVGA 1E59A 5DNAA 3ZCXA 1VQ1A 2YFYA 3LUGA 3TS1A 3M4ZA 1IBSA 3FKSD 4JFRA 1NLYA 3B1VA 3BH0A 2EJBA 5F77A 4HOYA 5JC8A 4Z54A 4DR7B 3O47A 3KTDA 1G9TA 4ND1A 2Z2KA 4AZ3B 3L7JA 4DL9A 2ZZMA 3QTBA 4UZSA 1K8RA 4R54A 3KZMA 2YWEA 3BMOB 3RO7A 2WV7A 4Q4LA 4MW6A 5K5EA 4BYMA 1XYVA 4DTCA 3NTXA 1Q7BA 1U8ZA 1ZM4A 2GNOA 2I0FA 2JFZA 3UJPA 3TZQA 3E3NA 3ORFA 1X9GA 4A8PA 3KTAA 4DDWA 2FXIA 4MI9A 1YCFA 4R2IA 2YRFA 4XPIB 3WIUA 1IBLB 3A06A 4AG5A 3ZHRA 2EFCB 2XGGA 3CZRA 5EJMA 1WMDA 3MLEA 5H9VA 1RVV1 5LLDA 1WZUA 4NU6A 1IATA 3DZKA 1XHFA 4KR0A 2LDBA 4MPRA 1SRRA 5ERXA 3RUIA 2HJ9A 1R9JA 2WJHA 3OM0A 2XR1A 4D0RA 3R76A 2BY4A 4L4XA 2N3ZA 3TQIA 3OLVA 2CWWA 1CU1A 2O52A 1AKWA 3BCRA 3PUHA 1E9SA 2NN3C 5CFOA 3H3XA 1MAUA 3RH0A 1U8AA 2J0VA 3IUSA 4ZJPA 4G0ZA 2OMEA 2QYHA 2XX3A 1TOAA 1C9EA 3KOWA 4FOTA 4L0CA 5LLSA 4AJOA 4EY8A 2FFRA 1PEKE 2BUBA 4A3SA 4DM4A 1Y33E 1EYZA 1KH2A 2MR6A 2P1RA 3NR2A 2UYCA 1XTTA 4D6YA 1PL8A 1LC3A 4KLRA 4UTNA 5IYZA 2BCEA 3QTLA 1BAPA 2WYIA 4IGIA 3V80A 3FSRA 3QH4A 1QHHA 2P0EA 1N6PA 1EBUA 1T25A 5HPYB 4XFDA 1JWAB 1XZBA 1ZLXA 3DL4A 1TAHA 5DLDA 1CDZA 2VJKA 2J4FA 1ZJ4A 4ZVKA 1JDUA 1ZZEA 4IQ8A 4MUBA 5EIOA 3IT2A 1OXUA 1Z2DA 2QR5A 5BW8A 4GI7A 1ZCZA 4QUDA 2RCNA 2YXBA 1K2WA 4C30A 1GZ4A 3AEZA 3LH5A 1YI1A 3QNWA 2MSEB 2GCIA 5IW8A 4N82A 2ZWAA 2CB0A 3M82A 1XA3A 4XVHA 1NUPA 3ZK7A 5ITSA 3N59A 3GGDA 1CZNA 3HB7A 3IQIX 4FFMA 5DKFA 1NOIA 3R0ZA 1GA6A 2RC6A 4G1UC 3DBRA 1O6FA 2Y1KA 1WPGA 3FTDA 2M6SA 1FUKA 4AMGA 2EW2A 2NTVA 3O38A 3H7IA 4BUZA 3FVVA 2C7BA 5FUMA 2WP0A 2HA7A 3ZWYA 1MLDA 5TEWA 3T3PB 1CJBA 4BLRA 1Z4KA 1F2UA 3SZGA 2ES4A 3LK6A 3COPA 5BP7A 1UF9A 4Q4CA 4EM6A 4REOA 3UHJA 2PX0A 4FYPA 3SZLA 2XLBA 2QQ5A 2Z95A 5M04A 5B3LA 2FVXA 3CNLA 4OGGA 1D0VA 1NZJA 2DTXA 5AT1A 3ZLTA 4G0OA 5HBRA 1NC3A 1Z0ZA 3DOJA 4GO1A 3JYOA 4XUDA 4CL2A 5FO1A 4KQWA 1NRJB 1I0ZA 1Q74A 4KWHA 4DDMA 4F8JA 1JA9A 1SH7A 3E9CA 4MPPA 3RS9A 4NZ9A 1LZLA 4E15A 1GQYA 1V7PC 2EXXA 1T8YA 3C3AA 2ZE6A 3IVCA 3QSGA 4NBTA 4ZCMA 4C2UA 1NVVR 3SIPA 4E3WA 2JAXA 1FNMA 2HD4A 1NI4A 4YAWA 1REQA 2V6FA 1H0RA 4FSHA 5F78A 3RUAA 1RRGA 1MT0A 4TKVA 5BWLA 3B6MA 2PH7A 4CI9A 4MCAA 1JXQA 1EBBA 4US1R 5DLEA 2EBWA 3FMIA 1A88A 3BRWA 2CFOA 4ZWNA 3ZG6A 3JX9A 4LTMA 3WIDA 3SOZA 3QQ5A 3IAAA 3MCVA 2CJYA 4J0EA 4J3NA 5KNDH 1IJEA 2X2FA 5HW0A 3V42A 1OYOA 5F76A 3DE3X 4CMEC 4H7HA 3L1JA 2ZU0C 1Q17A 1CY8A 1VA4A 3GLHE 3DTVB 1WSBA 3M2TA 4NQZA 5E6SB 3Q72A 5ALPA 3WGUA 3LECA 3N0WA 1RP1A 4INPA 5EUBA 3VR6A 3A9RA 2Z6VA 2FZGA 4CQNA 3D02A 4MVJH 2KI5A 4IHJB 3WMXA 2B1GA 1FNBA 3WGGA 1ZAYA 1QTIA 2FMFA 4NDNE 4ZJYA 1DZIA 1LSUA 1YV9A 2JAWA 1OLOA 3PYXA 3K70D 2YIJA 1I6KA 2LE0A 5KMGB 4C3OB 4DV5B 3DVLA 3T8YA 3RGGA 4JJIA 5DGDA 1RVDA 4U2KA 4NPCA 3N5KA 1LV8A 1UC9A 2NTJA 2WFLA 4IM7A 3X1KA 4D4LA 4G5SA 3GOQA 4K81B 5A05A 3ZQUA 1H4SA 2YQ4A 3G85A 2R44A 1EUDB 3ZY4A 1J0BA 4REMA 3AC0A 2OILA 4YBRA 1X2EA 1K66A 3UJ8A 1KFJB 1WMFA 1YR1A 1IHYA 4I8DA 1PGOA 4IDEA 4BUCA 3E1SA 4GR9A 3FBWA 4ZVNA 4WZBE 4C2AA 1WKVA 2C4UA 5AIBA 4COOA 5JSFA 1WY7A 2UV8A 4PZYA 3TE6A 4WQMA 3KKEA 1P1BA 1Z4OA 4DMGA 1ZMRA 2AFHB 1JSLA 2ZYTX 3RU7A 2HRCA 5KJ1A 2OY0A 4WXRA 2GK7A 1UFQA 4NX2A 5BSTA 5K4GA 4W5QA 2I7VA 1HLPA 2YV3A 3CLRD 4FNOA 4UTVA 1JZSA 1I2BA 4WY5A 3B8EA 1Z2OX 4ME6A 1HI9A 4E51A 1X80A 2Q5QA 3OT1A 4P4NA 4ZCQA 3IUPA 3U1BA 2DRIA 2EHJA 4C89A 4Y2QA 4JYAB 4NBWA 1TM4E 2CB9A 4LCBA 1Z3CA 4MVJE 4MTLA 4ND7A 1ZM7A 4J1NA 2ONYA 9LDTA 4IEIA 1N3IA 2EJCA 2VJOA 3RVDA 2GJKA 4ECEA 4TXLA 3FCSB 1KZ4A 4Z4QA 2O3SA 1AQ6A 2PMEA 2QLMA 3THRA 3CVYA 4MP8A 1H8EA 2ZSHA 2BLLA 4PCAA 3DFFA 2OV8A 1YVPA 1VXOA 4DZRA 3HB5X 4J94A 3K71B 1FL9A 2GZHA 1VCOA 2J5BA 2O14A 4WVLA 1UAYA 1CRQA 3OECA 3PJGA 3GLFA 3ECSA 3QF7A 3A0UA 1TX4B 4LFBB 4L4ZA 3OF2A 4CQMA 3IMCA 3GUCA 2XUFA 3LWZA 3GDFA 3T7DA 4MAFA 3QV1A 2X76A 2H1RA 2DETA 1JPJA 1L5MA 1F7UA 1G55A 3IYLW 4MDHA 1LSSA 4XWGA 1WV0A 3ETDA 5ISMA 1GPDG 2V0NA 3TRDA 1O3YA 1SQ5A 2NSLA 2ZUVA 3DSRA 4J0CA 4MQEA 5EHQA 3C16C 4ZT7A 1E6MA 2AYZA 2VXBA 3OSUA 3VNSA 4BQFA 4MA5A 2JJQA 1VFPA 2H7CA 3QEMB 2WE8A 5A2QA 3GBPA 3KJIA 5CDYA 2IZZA 2QGFA 3BXFA 3JQ9C 3UXHA 2RE8A 1WMAA 2PK3A 3PDIA 1Y6FA 4N65A 1D5CA 1SZDA 2QZZA 3MK31 5DN6D 3CV3A 3P9CA 3S8YA 5ED4A 4IJVA 4ZZ1A 4QQKA 5JAZA 4FR5A 1HF3A 3F6EX 3KOXA 3QKWA 4MICA 4X45A 2JDID 5BR1A 3RRBA 3HM2A 2OXFA 2HLPA 2ORED 1GGJA 4OHKA 3RHFA 1AS2A 2CY0A 1KYXA 3N86A 1JLSA 4MVXA 3ZGLA 4UM8B 4Q3BA 5KYYA 3STVA 3CX4A 3EY4A 1I1NA 3ZS9A 3IAS1 4KGVA 2PRSA 4BGVA 5DGIA 3UYKA 3AZOA 2VRCA 3BZBA 2WR8A 3E5HA 3D7RA 4BPRA 1Z5VA 3F5QA 4D8WA 3OX3A 4LOKA 1ECJA 2X4LA 1NQUA 1VC2A 2FSUA 5JAPA 4OHBA 2BL4A 1E1QA 5B1SA 3E58A 1GZVA 5JANA 5JATA 5JASA 4M9QA 4BFLA 1B43A 1J20A 1NW6A 2FFJA 3CF0A 1Q95A 5JNWA 1QQAA 3E9QA 4ILKA 3F78A 4MVWA 3QEOA 2E5FA 4HRYA 3GU3A 2RONA 5BSHA 2X0RA 1Q20A 1K89A 2GZ1A 2GCNA 2IZ5A 1JDBB 2NAPA 3OZVA 3NI2A 5E2AA 4TQGA 1WPXA 5K0EA 1BCRB 2ECFA 2QU8A 2GA8A 4ZRDA 3UENA 1W75A 4CL8A 1JIQA 1PV1A 1VE7A 3T1OA 4EAAA 2X6QA 1NUTA 3LU1A 4PN3A 2XMDA 4AQYB 3OPQA 4OBXA 1J06A 4ESEA 1QCYA 1CQJA 1O54A 5L8VA 1C3OB 4AO6A 4GP6A 3HFRA 4GI3A 5TT0A 4JVNA 2YJTD 5HJEA 2B1JA 3EDYA 3GC6A 2ZTMA 4I2VA 5AI5A 5DO9A 5KKAA 4DREA 5BVHB 1U9IA 2JRCA 2RGYA 5ILGA 4FD3A 1AY0A 2H9AA 3UIEA 4LDZA 4FHFA 1YC2A 2HAEA 3L7OA 4X93A 5C1OA 3IOCA 3MT9A 2PQ2A 4W5HA 1FNCA 2GMWA 3Q8KA 2PVSA 2DHEA 2C9MA 2GETA 3D8RA 3U7EB 1NIJA 1V43A 3PITA 1IEQA 4M99A 4ARBA 4QYIB 1DBRA 3GY0A 2VA8A 1NUHA 4LE0A 5EIAA 2X3UA 3KXDA 3B20A 3ESYA 3WB1A 3N05A 1XUOA 3HGTA 3HP1A 4MGYR 1BDMA 3U3DA 4LJLA 3ZNPA 2MSCB 2ZU6A 3LKZA 1SUBA 2DFVA 1UCFA 1G5TA 1Y3CE 4LHSA 5LVAA 3REQB 5JPCA 3OQMA 5HEKA 4I50B 2WF6A 3ZUGA 4R01A 1OZFA 5ERGB 3T3HA 4BB9A 4F1JA 2Q5CA 3IMEA 3WR5A 1KHTA 1WOYA 4F2DA 1PK7A 2WYOA 2FRDA 3A32A 4LRXA 2EGUA 4YK7A 4DCTA 4X65B 3RC9A 3RT7A 1DJNA 3PXEA 4UTPA 1J7KA 4E4RA 3B7PA 2CNBA 4QSHA 1SUIA 3HVIA 2C9OA 5D86A 1JIKA 1SOVA 3TNFA 2GOYA 3NM4A 4N3GA 4MUFA 1OQAA 3FB4A 4IOJA 4MCJA 4YRAA 1TB4A 3G9QA 4B76A 3B5JA 2E4WA 2EP5A 2H2FA 3VU9B 1T3GA 1XVAA 1Z0IA 4CTKA 1LSJA 1QS0A 3TZKA 1BGWA 2Y6UA 4I9GA 1AO0A 2OFFA 2A58A 3DDOA 1GRNA 3ABOB 3WWEA 4BWFB 1NATA 3JZIA 4F84A 3ZZTA 4XI9A 3UUWA 1JLMA 3ENNA 4N6OA 3MUFA 1G21A 4U9IS 2WHXA 1VCMA 2PSSA 1Y8QA 1KSJA 1PF7E 4V0ME 4E2XA 4RENA 1J0CA 2H4XA 4MGEA 3STXA 4XVCA 3C7DB 1UEXC 2PL1A 2R1VB 5HIMA 4LF6B 2PUHA 2PT5A 3KYBA 3DHEA 1CUFA 1JG1A 2XKJE 2X42A 4U2GA 2P79A 4MSUA 1CE8B 3SSOA 5SYNA 4ZTUB 2EBFX 4V0QA 2GEDA 3BXOA 1KIMA 2GBIA 2J9XB 2BCJQ 4G85A 4PFQA 4ZMRA 2PM8A 3H17A 5L9AA 5J1SB 3C41J 1LK7A 4Q4AB 4ZAZA 3T06B 1Q3TA 4CGZA 4EY6A 3HXTA 3W9YA 1QHXA 1OLXA 2OD9A 2H1OA 1KPHA 1ETHA 2Y67A 1YKSA 2IEIA 5BUCA 3ZOZA 1ZC3A 4HQRA 1ENYA 2Y1CA 2WIFA 4A5SA 1GRQA 2COUA 3RYIB 3ZDRA 3BTSA 2E1RA 3AL2A 5AK4A 5K6RA 2D5IA 3S2EA 1XPUA 3PBKA 1MMFB 4HTFA 1FQOA 2QQFA 2XMRA 4O25A 4OKSA 5TF4A 4FGKA 2GCOB 4O1MA 3JWIA 3ELDA 4KXFB 4MV3A 4NG4A 2VDMB 3EVDA 4BE9A 1VECA 2Q5FA 5TMPA 3FHTA 2GDJA 1GPH1 3FWNA 1CIJA 2K2WA 3EPPA 4HDNB 4UUQA 2IV3A 1MABA 3QVOA 4Y8VA 4HNHA 5T4FA 1CUUA 2ZYVX 3HDVA 3BH6A 2RGRA 4UNNA 5D6NA 1T15A 3MTQA 3UMSA 1XQ6A 3ZGYA 4DLAA 2Q4TA 4F2HA 1KTVA 1E92A 4F46A 3KJFA 1WB6A 5CTJA 2VAXA 1L3CA 5TQ0A 1RLMA 1V48A 3GNQA 4Q3LA 1Q84A 3A3NA 1Q0SA 1TXGA 4O8CA 2C31A 4RK5A 4YP1A 5FBKA 3OEED 4I1PA 5HDQA 1TI7A 2HA3A 3JPYA 4XGIA 3T9EA 1FSZA 3SM3A 4PM4A 1UZAA 4EGAA 4F72A 3D6HA 1WXWA 2IGTA 3NATA 2DR3A 1GSAA 4C06A 3IQHX 2OFWA 2WQ7A 2G6BA 3V33A 1IY8A 3MJCA 2V7QA 3DM9B 3CNBA 3OOWA 4GP9A 1NTRA 4G4GA 5AKEA 4G0XA 3GJRA 5KJ6A 1O4VA 1JA0A 2D0PB 4Y1RB 1Z2NX 3OOEA 1QQ7A 5DM4A 5CT4A 1YS7A 1P39A 4MV5A 4IKPA 1ONSA 2ERCA 2FXVA 3HB0A 3MBKA 5FA8A 2D1FA 2OZPA 1P7ZA 3JW8A 5LM3A 1XNRB 2IEYA 3F6PA 1OB2A 4LZOA 2R84A 2XDQA 4J75A 1J97A 2CVOA 3A14A 4Z99A 1T2UA 5B58T 2YVUA 2W37A 3AH8A 3EJ6A 1J1UA 1EXVA 3O82A 1GEGA 3ZZ0A 4J4TA 5HYVA 4BN5A 3B2EA 1I32A 2O06A 1T34A 3ILHA 2CDCA 3JQ7B 5LMUB 4ZZIA 2G0TA 4P98A 4K9LA 3GARA 3KQSA 4Q01A 3RYHB 1G41A 1MG0A 5HKAA 2WZQA 1P5JA 4YCLA 2BGGA 1Z5WA 4AXBA 4KBGA 4E5MA 4BS9A 1E94E 1B2LA 2QN3A 1GPJA 4R1NA 1BG6A 4BP9A 4R0VA 3AETA 5L6MB 2IW3A 4NENB 5CG2A 3UB4A 3AXSA 5FV4A 1TCAA 3IEXA 4XVUA 4BRWA 3C1TA 2OAEA 2XWJI 3DL0A 3R7NA 5L4NA 3GZJA 4B74A 1D5WA 1U0NA 1M1NA 1N6HA 2GFQA 3L43A 3IEUA 3RNOA 4N0QA 2JGNA 2OCDA 4PS1A 2PH5A 3CYFA 1X8KA 3L41A 4I46A 4M1WA 1Z26A 1E9AA 1G7RA 1JR3E 2MOKA 3LNCA 2W6CX 5GONA 2DWOA 3WJAA 3DE6X 4HJXA 1YCDA 2E1PA 3Q9NA 1EHCA 4NEQA 4O02B 4PG5A 1AXGA 3SSAA 4D6XA 3U31A 2JIPA 2VNIA 4G63A 3ZHTA 3R9KA 3AO0B 2I9PA 4ESHA 1EGAA 1CS0A 5EHNA 4JL6A 1QVAA 3RSCA 1H69A 2HIAA 5KTMA 2YBEA 4DDTA 3X2EA 3E6AA 3ZHUA 1NHWA 5KVVA 1GITA 1N5RA 3QLJA 2VLIA 5BSVA 2DR2A 1G17A 3SBOA 2DXIA 1GTMA 2I99A 4XX0B 2E3JA 5F5LA 4Z4GA 2FPKA 3QKIA 4B3BA 3PQDA 3U5ZB 3MB8A 3BX1A 3HJGA 3JALB 3PCRB 3GUZA 3QE2A 4OQDA 4YRPA 3SOPA 3ZLJA 4LYDA 1TZJA 2QUHA 2WTMA 1U7DA 1WW3A 3D3WA 3GH3A 3N7AA 4IIGA 4PPNA 4RMJA 4QRDA 3IV9A 3WLPA 2GAOA 2YQZA 5KINB 3DTNA 3SX0A 1FXWA 1ORRA 3ANMA 2CLOB 1Q7EA 5KWIA 4YRGA 2XB4A 5HZKA 3P32A 2G07A 3QE0A 2PE5A 3BD7A 3S40A 1OUMA 2QP4A 2HXYA 4QYXA 1XROA 1EK1A 4KAFA 1TM2A 5IPFA 3MQ2A 5JEDA 4B80A 3AVXA 1W88B 4Q4JA 2UZAA 2B21A 4WLUA 1SVIA 3U4CA 1SHTX 2YC4C 2FI1A 2QVBA 4CV3A 4HH0A 2Q6TA 3I39X 2PCJA 1T36B 1LWOA 4HX9A 1C3EA 4CTOA 2W9XA 3TZEA 4DDVA 1XTUA 1W1IA 1A76A 3PPIA 3NDBB 4ENQA 1YR9A 3BD8A 4P38A 3ZY6A 5IMSA 2I2BA 3MOSA 2GN8A 3QU2A 1XWIA 2V5VA 4O08A 1O96B 3NGMA 1W34A 1MQ8B 2BISA 2JHPA 1O94A 2PV7A 2RDMA 1U3UA 1ZP6A 1JXAA 3HR8A 4LDAA 2YHSA 3EXFB 4NBUA 1N92A 1WCXA 3L1UA 3MPOA 1LF0A 1T5IA 5EZQA 1P9RA 2PGOA 3Q41A 2WI8A 2O5CA 4MP6A 4MYTA 1XBTA 3AYXB 5K0GA 2V98A 4DJJA 4M7OA 1RTTA 4CFSA 2V6MA 1SHZA 2H1CA 1F8GA 3I37X 4JEMA 1QBKC 2FFQA 4O59O 4UBNA 1PR5A 4XGNA 3NTQA 3RWMB 4EHBA 1DAMA 3L5OA 3S2SA 3BRCA 3A8TA 2XEDA 3RVOA 5KKCA 2C2OA 4FEEA 4LISA 1C4XA 4Y2HA 2C4MA 1X1RA 2WF9A 2JGFA 1EJ0A 1KJJA 4RL4A 6ABPA 3SKYA 4PCUA 3CVUA 1HDYA 4K9OA 1EZ4A 4MWOA 4ZEOA 4QM7A 2Q6KA 1VPEA 3AEUA 4X90A 1DO8A 5IBQA 2O7RA 4QPZA 1VLLA 4XIGS 2HWXA 4BFVA 2ZPAA 2GM3A 3L7MA 2CSXA 3PKJA 1DZ3A 2HXSA 4YAJA 1F0KA 4KDCA 1AOXA 1YA8A 3NRBA 1WUTA 3GLIB 1A4UA 4D3SA 3CR7A 5I9SA 4BMXA 1DX4A 4YV1A 1FSPA 4JT9A 3OJ0A 1ZD9A 4G9BA 2XB9A 3S2ZA 5JH7B 1ABFA 3AHHA 3AR6A 1WWKA 1BVUA 2CV0A 1FVXA 1KAQA 3EC7A 1GFZA 1WU7A 4WN3A 1OREA 1DRWA 2ZIUB 3QEBZ 4EOGA 5TR9A 4PC3A 1AC5A 5DWVA 4RZQA 2WWWA 1JSXA 3H5LA 4F7WA 1DC7A 4IHAA 5CK4A 4DMUB 2ECPA 3TAXA 1TVCA 2PY6A 4TS4A 3CE6A 1TM3E 1N9GA 2B4KA 4AJIA 1E96A 1T3LA 3VUEA 5B6JA 1FYXA 1KC3A 5BQ5A 1V8FA 4ARUA 4YP6A 5BV2P 3EMVA 1N36B 4EEXA 1H8HD 1P5RA 2WFZA 4BMSA 4G4JA 5EVJA 3SS8A 1CUYA 2N75A 4GLOA 3AI3A 3T7TA 4BJ3A 4JIGA 5CXUA 2HSWA 4KIGA 2XVZA 1TUEA 4M0CA 1I4WA 1KJ8A 2IYUA 4GQBA 4PC6A 3LC0A 1LVUA 3LJKA 3VR3D 4ZJZA 5AQ1A 1IUOA 1IRXA 5E1OA 2KBEA 1XE3A 4PQRA 4E4YA 2Z5VA 1TJ5A 4JB3A 3UNXA 1PJTA 1KWGA 1GKIA 3ZWWA 5IFKA 4LDNA 2V7TA 3G23A 4L51A 4KAXA 4EI7A 2XXAA 1UUFA 4OB8A 4CM8B 1JLKA 2PX6A 5JRDS 4MARA 3ZHZA 3IR6A 3ZZUA 3QVTA 2DJ5A 3AK4A 3SLKA 2D4AA 4ENWA 4F71A 4WJKB 5JG7A 4FFLA 3E5RA 5LFAA 4B7XA 1NJ6A 1GHTA 4K6CA 4BZZA 4IJUA 3TR6A 3BERA 9MHTA 1Q0HA 3E05A 4ESOA 2ZTVA 1TZCA 2IZ0A 3L04A 1T9GR 1VKHA 1K0UA 3OZRA 4DLKA 2XUQA 4O4JB 1OZ0A 1W4CA 1RAFA 2QM7A 1FFWA 4UCQA 4ZGBA 2J9FB 1WUYA 2FSGA 3W8FA 4CM5A 3V4VB 1VE6A 1T24A 1CULC 2WT9A 4RPGA 3D8TA 3FE2A 2J0UA 2R48A 4I66A 1VIVA 3PCTA 4RBNA 5HKKA 1IB6A 1J90A 1FVFA 5KVCA 1DRVA 2EFGA 5D87A 4AL4A 4CKBB 3NOQA 1KI8A 1PG0A 2G4VA 2QSJA 5FLYA 1BX0A 2IK8A 4RZ3A 4MQFB 1DOHA 1S89A 2IIBA 4FEAA 1GFWA 4LHXA 5K6AC 2ZCJA 1X94A 3ZE1B 2AG5A 2HBQA 3NIDB 3TLCA 2J07A 3PPYA 3AUYA 4PQEA 4UMFA 3N2IA 5TC4A 4EG5A 2OXEA 4BMYA 4WFKA 3SN6A 5BYAA 3ND7A 2LBPA 2R4QA 4J6EA 3P5BA 1LTQA 1IMOA 3CGWA 4NC9A 2GXUA 4P5PA 4KQXA 4HLQB 5LU8A 2WJ4A 3CMCO 1B0UA 3I1YA 2NM0A 2L0XA 4LX0A 2VJCA 2PS0A 3IQFA 1AUXA 2QN9A 3CM0A 5H70A 1RWPA 3K31A 5DFAA 3QBTA 2QYOA 3QX3A 5GJBA 2RAUA 5CW2A 5IJ0A 1JQAA 3OCCA 3KLBA 3TR0A 1VL6A 3AFIA 5DLPA 4NCXA 4LRUA 3QY0A 6AT1A 1EWRA 1AB6A 1BU5A 1YZHA 3AP1A 2O19A 4OPMA 1OU4A 3N7UA 4YP5A 3K1ZA 4INAA 2ERYA 4MIOA 1ONOA 2W2LA 2X0JA 2C2MA 4LF9B 1OTYA 1P5FA 1TEHA 3LQRA 1ZGHA 3RODA 1EWYA 2HK6A 1CY4A 3FPFA 1XC7A 3VNVA 3EC1A 4NZPA 1OH7A 2PU5A 2V45A 5CA0B 2FZCA 3FD8A 2EYQA 3BM5A 3UHFA 1TA4A 2HSZA 5G0SA 1Q1ZA 3DLAA 3Q0TA 1TO2E 3BWBA 3VJKA 4KR2A 1P9LA 3LXUX 4DSZA 1YA4A 3UGKA 2OO5C 3ZE7A 3C8MA 3FGOA 3NV9A 5C52B 5KVQA 1XL1A 1NBMA 3GEEA 1TW3A 3M1IA 2OCBA 1KRHA 2WYHA 1MCZA 2G72A 2B8NA 4YN3A 2QJTA 3AKEA 1SUFA 4B4OA 1T5OA 4GRAA 1CHNA 3TSZA 1W0KD 4EDFA 1SUCA 3V1TC 4L8YA 3QA9A 4LHWA 4I9NA 4YIHA 2CJWB 1UPCA 2DCMA 3QF4B 4II7A 1ZHHA 1HDGO 2BR4A 1DBQA 3LBHA 4GOMD 4BO8A 3VAYA 1FDOA 2P30A 3KPWA 1U9CA 1AKTA 4GYJA 3V4FA 4N01A 2QJWA 2ZSFA 1T8PA 2JGDA 3KQVA 3NHYA 5FHRA 4NESA 2I4MA 1RRPA 1E2MA 2C7GA 2FKNA 3V97A 3GQVA 3ZC3A 4FWTA 3LLCA 2NP7A 2TECE 2VJLA 1SOUA 1UT8A 2ZAYA 4ALKA 4I3GA 4BC1A 4DABA 4BFSA 3IAFA 1P3JA 1D4OA 5LP6A 5AVQA 2F9LA 4JL8A 1AF4A 2O54A 2EKBA 3HCPA 3R9IA 2Q3FA 2HA6A 4RKQA 1GSOA 1WP4A 4WESB 3AF1A 2BZ0A 4ZJUA 3MCUA 4J1TC 5KB3A 2GPTA 1QRRA 2XW6A 4MR7A 4MYCA 2BDEA 2G83A 4B3IA 2P3SA 5AR1A 5ALQA 4L28A 2EBUA 3S8MA 2WT4A 4CG2A 1VJGA 3DE0X 5CDFA 1J8YF 2PUTA 1ZPDA 2KBFA 4RZXA 2QXYA 4NEGA 2X23A 4XD7D 1UMBB 1XJCA 2XD4A 4PIPA 1S3GA 1ZIDA 4UHBA 4X8HA 1CETA 2QDKA 5BNFA 3PX7A 3SY8A 2HPVA 3O4FA 4H7PA 1VBFA 3HWX1 2JZOA 4NNOA 4EG8A 3K9NA 3NC4A 4NCBA 1C4OA 4KCGA 2D06A 2ZDGA 1RHQA 1ZQ9A 4JCOA 1WDTA 4WKCA 2VF8A 2R65A 3GFPA 4ARCA 3C6YA 4RTNA 1JI0A 1WMSA 1Z7GA 3K15A 5AXDA 5JYBA 1PL0A 1KFKB 5K01A 2HO4A 1SOAA 2H4FA 3D5EA 3WYEA 4DDHA 5IK2D 3VSBA 2AK2A 3DT9A 1ZL2A 1Y3IA 4MRRA 5JARA 2QZPA 1KVSA 2L2QA 1PGNA 1TLTA 1N7HA 5G4LA 2RHLA 1DELA 5EWJA 1PWHA 3TK1A 3EG9A 1N8NA 4YRFA 1U0TA 4RTOA 4TZ6A 4E33A 1MXHA 3EWNA 4ZU1X 2FGJA 1DDGA 1DJLA 1KNQA 2D2XA 3MJRA 4BV2A 1YRAA 5LBIA 4D9IA 1DHRA 1RKVA 3KT6A 1M0WA 1KH1A 4RXUA 1ENZA 4PZDA 3FJOA 2ZFUA 5I4CA 1II8A 2ZG6A 3CZPA 1Q2XA 1X87A 4QXRA 3WK7A 4AECA 1FX0B 1RBMA 1XDZA 2ZRLA 3I83A 5I8ZA 3WKAA 1SCUB 4I4TB 4QBFA 3CY6A 1FY2A 1GIAA 3LUDA 3GGSA 5I7UA 1TL7C 1UQUA 1AQUA 1DIBA 2EW1A 3HY4A 2PTGA 4DA8A 1GCGA 4JWTA 5AVWA 3MERA 2FR8A 4QRIA 1MOZA 2PKQP 2ZRPA 3LLMA 5K6TA 1N75A 3HVRA 4D96A 1Y9DA 3L9WA 3WICA 4B6SA 1KS2A 3D0RA 3K1JA 1XVLA 2VNAA 4XFKA 3VI3B 4WFJA 4B3JA 1MF7A 3R7LA 5H3LA 4CIDA 1HC7A 3NAQA 5C8YB 1SXJE 4BQPA 2PKYX 1HLGA 1P1JA 2WWIA 1B3RA 2Z3ZA 4TYQA 2C88A 3QGMA 3U60B 2AOUB 3DEIA 3ZDXB 5B3JC 3R9XA 1N7GA 2XKBA 4QE3A 3KZCA 3O8RA 1IG3A 1UJBA 2X5XA 2WJ6A 3GGOA 4OQZA 3UM9A 1QMPA 3ROMA 4BN4A 4BQRA 3C6ZA 2BHSA 2WSMA 2XRMA 1EHIA 1NFRA 1ELOA 1RCTE 1Y8RB 3H2GA 3HDJA 4B40A 5I7RA 1VKOA 1DMSA 1EESA 2FJPA 3U81A 2AA3A 4EGSA 4FHZA 2IELA 5AI4A 2TMYA 4D9EA 2MSKA 5ENDA 1IXRC 1FFAA 1ZSVA 2CN1A 5E7IA 1HT3A 5M7EA 1GL9B 2MT9A 4N49A 2OK7A 4HQNA 1URPA 2VPQA 5DTMA 3QUQA 4OHRA 4QUGA 5CBKA 1US8B 3JR3A 1L5QA 3EZLA 2J3MA 4AJNA 1QDEA 4Z51A 1P74A 2J31A 4RPHA 2JFQA 2WIKA 2YHIA 1BX1A 1JJFA 2A9VA 4JS0A 2YCLA 3QLUA 4TWRA 3IHLA 1G3RA 3PRKE 4UVDA 1EINA 1V47A 4G1EB 1LJ8A 4WMLA 221PA 2IZ6A 1U5BB 5G3YA 3K2BA 2PSJA 3B82A 2VP5A 4AZWA 2ZUWA 4X7PA 2R00C 1H4TA 3I1FA 5T67A 5C1PA 2JFGA 5EWMA 4ND2A 4F6LA 4RJTA 1W5FA 2UVDA 1VJ0A 4A82A 3O73A 2Z5LA 1YO6A 2WJ3A 5FX2A 2R1ZA 3N2KB 5HGJA 2RFLA 2P7IA 4NU8X 4JKYA 1PVVA 3OU2A 3CPEA 4M8NE 4BNGA 3FZGA 3LT2A 5J2UB 4YJFA 5HXAA 2PTHA 3UT5A 5J63A 2WVHA 4CTMA 2LRHA 3RFUA 1RC8A 3KRTA 3VHLB 5CCDA 1B8NA 4CIWA 3H2JA 2H4HA 4ZDJA 1GUZA 2H5JA 2QVLA 1A98A 2FW9A 2GTHA 3BF8A 2YWHA 2NO1A 3AZPA 1E7QA 5HK9A 4Q9AA 4DPLA 4GM4A 3SDBA 3G2IA 5A3QA 1IBMB 2WD9A 3BMCB 1EDZA 1U3TA 4OI1A 4L07A 3K4PA 3QFHA 2O3TA 3UY4A 3HDGA 1IYZA 3U4GA 2I6TA 4YT2A 4EITA 1CZOA 3R7WA 1UQRA 1T4MA 3R23A 3MYYA 3RAGA 1F51E 1DJPA 1RWWA 1JXMA 2DR0A 2FMUA 1JDSA 5EPOA 2WU1A 4C3VA 1O87A 3PZRA 2OBNA 3QYFA 4OBBA 2HZBA 4TTSA 3EPJA 3EGCA 1DJQA 1L4NA 5FTKA 3UK2A 1CJTC 3KHSA 5D3QA 1ZJJA 3UJNA 2IGBA 1U7ZA 3LVBA 1E7RA 2C2WA 3QYJA 3KZKA 3NOVA 4KKVA 5CRIA 3VTKA 1Q15A 1EFTA 5ECGC 1PQWA 5SYMA 3MUOA 1ZD4A 5JSUA 2CNWD 3SLGA 5LQNA 1TYDE 5ULLA 2QYSA 2UZ1B 5AW6A 4LWZA 3CVOA 3HKEA 3OQ6A 1CJCA 3ASUA 3RAJA 3HXPA 3TX2A 3VJMA 1TMOA 5FI5A 1W52X 3CSDA 1E9BA 3ICQB 4JP5A 1JS1X 2B3DA 3EODA 2VCHA 3IB6A 1CNFA 2A0YA 5JDCA 2HLNA 1W0JA 5F4ZA 3G0GA 2H1IA 4YMIA 2V4MA 4OSOA 2EIXA 1USWA 3JY6A 2W2KB 3BULA 1OI3A 3UKOA 3A6EA 3KB2A 2WDPA 1H2AS 1BWRA 2EDCA 3S2UA 1ZJZA 2NIPA 4AU1A 4BNDA 3K70B 3WS7A 5M5BA 2FN3A 3P0FA 2GZ2A 3W6UA 1XEAA 5CDUA 2FN4A 2RI1A 4PG7A 1PSZA 2G0NA 3NEAA 3F1LA 3QVXA 2Q4DA 4V0KA 3THWB 3GWZA 4JASB 3DKPA 4UQLA 5FO0A 3OOSA 4KWEA 4HWPA 2QJRA 3HKBB 3OIWA 1JHQA 4WSOA 3L82B 5C1BA 2PSEA 3WQQA 3EXIB 1BEUB 2VHXA 4CUZA 2GXAA 2GGSA 4P81A 3S1AA 4IQFA 3SJBA 4RM2A 4Z1OA 4FMDB 4O4HB 1HSOA 1SOMA 5KX5A 3PSHA 1BFKA 2VAMA 2V96A 4CGYA 1NLFA 1E1RA 3ND6A 4W82A 3VC3A 1M0EA 1M76A 3WGHA 3FNHA 3WDMA 5CYOA 5GP1A 4XCVA 3H97A 3OFKA 1OSNA 4IMIB 3BHIA 2ZUBA 1M34B 1Z88A 2HLDD 1OC2A 1XNGA 4GXTA 4TKZA 1HQCA 2Z2YA 1XOIA 4KO8A 4BVAA 3P5SA 4JOQA 4RJKA 1K27A 4W9NA 2W83A 5IG2A 3FVTA 3E9MA 3HN6A 1ZH4A 3DO8A 3ELUA 4QQNA 2BFBB 2KE5A 3J7AC 1JHRA 5H3CA 1LDEA 1GNVA 3RS5A 1XF9A 3ZW9A 1JJAA 1QYRA 4S0XA 2ZCUA 1JV2B 1JAIA 4HZUB 4F4JA 2G7ZA 2WHYA 3Q6NA 1NZFA 2OGTA 2V1XA 4H6XA 3ZH2A 4C01A 4CM1A 4EA7A 4KITB 3E7FA 1I13A 2EZ8A 1NL3A 2WU4A 4X8OA 2QI9F 2XWSA 4PICA 1OLUA 4ZANA 1ZNWA 2POQX 1RI1A 1YULA 3KQQA 4N5DA 4BVFA 2XNSA 3Q10A 2W7TA 4RQUA 5T3UA 3UUFA 1FS6A 5AICA 3RRJA 4GKVA 4KGDA 2AI3A 4JA2A 4WK6A 3VNRA 4DVGA 3RFVA 5BSRA 2WWFA 4FU0A 3R3UA 4CMAA 4K1XA 4KQGA 4R1SA 4CKXA 5C46F 1HE8B 1OH8A 1F12A 3AUSA 3JVVA 4Y7CA 1NR7A 2D5CA 3LLVA 4JX9A 3TTXA 5IX8A 1M2WA 1OV4A 4LGCA 4E2WA 4PPQA 4TLDA 3R4CA 5B64A 3MINA 4PW0A 2WB2A 1FW8A 4N6GA 3L7NA 3HEMA 1EG2A 1RU3A 4D43A 3VU1A 4Z5XA 3HI6A 1OXMA 1Z5PA 1WHSB 3H5OA 4KRYA 1ONBA 4YO7A 4RTQA 4ZIRA 4R40A 3OO1A 5E6UB 3E70C 4I1RA 2HF2A 3AHEA 4X64B 4TSFA 3NVAA 2QTVB 3ACBA 4X24A 1H5UA 4II3A 1XTRA 4H3HB 1L4YA 4O1IA 5TQ2A 1QFZA 5BWOA 4CEJA 4DYHA 4J7CA 4H9GA 2FWNA 1KXZA 2I7XA 2B34A 4JX8A 3H6HA 2QPTA 5IDVA 5HMMA 1DFIA 4U2BA 1JNYA 4LF5B 4ZODA 2VT3A 1TKCA 4MGKR 1ZOIA 2BW0A 5TRTA 1H5QA 3IXMA 4MK4A 5CM2Z 2VATA 3SIWA 3OCYA 2FUEA 3LBFA 4XIJA 3CCCA 3S2FA 5GZ1A 3N6RA 4W1PA 3DDSA 2R8PA 4TYPA 5KEIA 4J0GA 2P2GA 2VPPA 5GJCA 4OL9A 2RH5A 4EVQA 5JS6A 2BPOA 4IHJF 3OEHA 3CRMA 2NU7A 5LZ7A 2OOKA 4IRUB 3T95A 4KVGA 1JALA 4BNMA 3SX4A 2XXBA 3T1QA 4Y2YA 3DCYA 2B7CA 2DOKA 3WGMA 3IAEA 4B33A 1L4EA 3TINA 1Z4JA 3H2BA 3L8GA 2O6LA 4GNKA 2P9HA 2FEOA 2IPNA 2O8CA 2HU2A 4FQ7A 4GPZA 2OBLA 4IV8A 2JGAA 4F4DA 2IEZA 4N76A 1GNQA 4AMBA 2CZGA 3I53A 5JD5A 1Y7PA 5GIPE 3LUHA 4P2GA 5F73A 4GXRA 3SF0A 5J5CA 5BQOA 4IIUA 5ALNA 1CR6A 2RHCA 2P6OA 3DB1A 3ODPA 4PXAA 3CXRA 4PZ0A 3VPXA 2OQVA 4MKZA 1A0OA 5AH0A 4DIMA 1E8DA 2AZXA 2AZ4A 1WB5A 1XTJA 2PQMA 3CVJA 3SNKA 5JNTA 4PNHA 1ZVJA 3UBMA 1H9BA 1P1CA 3Q3VA 2BKUA 3IUQA 4R1QA 2DPGA 1HORA 4TTIA 2NO0A 3CXUA 3U09A 2AMFA 4F3YA 1ODIA 4XSHA 2J59A 2PR2A 4JIMA 5J5VA 1XMJA 4AJLA 1RZVA 3P0EA 3K5HA 2Q5JA 3PHBE 3QZUA 4H3VA 4YFVA 4C3UA 3B9QA 3FCYA 3ROQA 2QLBA 1GFIA 1B8OA 1LD3A 4JYPA 3ABZA 1DMRA 4YI5A 1CY6A 1Q0ZA 3ET4A 2O1EA 1UBTS 3SVLA 5LQKA 5GV7A 1BKDR 3AFGA 3C7TA 1RRMA 1YR8A 5EC8A 4HC4A 2YBDA 4FX2A 4DSUA 4DDUA 3EGDB 4R1UA 1POWA 2OZLB 1SKQA 4QU5A 1RE0A 1AF7A 3HHEA 2QORA 3DV0B 1FRZA 4BMPB 4D8VA 4G23A 1AGXA 5GTDA 1DC5A 3IESA 1HV8A 4P92A 1XZCA 2CLCX 5JAMA 1OASA 1VBNA 3IPRA 4MLPA 2MTBA 5C81A 1Z0FA 3E5NA 3MGCA 3QVWA 1CF9A 1IXZA 1Z36A 3EMKA 4J0DA 4HXGA 3ETCA 3X1XA 1H2HA 4G09A 4M7PA 1NBIA 3G1TA 4P33A 5A4JA 3GCDA 1C9NA 1II9A 2P77A 1NXVA 3NNSA 4HO1X 4HNVA 3EPKA 4PSUA 1LZKA 2RKBA 2IRWA 3ILVA 4GPTA 4RHFA 3IKJA 5DDIP 2XCSB 4O63O 4X1YA 1K7CA 1SXJC 4ENSA 4XZ3A 1SPXA 1TVMA 1RMYA 2G77B 3BJEA 4ESVA 2Q49A 3W9SA 3ZD8A 1EFRD 1JKJA 1ZIYA 4CLEA 3FF4A 3W3ZB 3IEIA 4O1HA 1AKQA 4YRTA 3HBFA 3TFWA 3OQOA 4TTJA 4ADSG 4IIHA 1WSWA 1HRKA 3WZLA 2W2OA 2HJSA 3LL7A 5H4GA 1QYWA 4MH0R 4NSNA 3EA5A 4IXTA 1GPBA 2WIGA 5EJAA 1NXPA 4KIFA 1PHPA 1P9NA 3M34A 1KBQA 1ZKMA 5JWHA 3K2QA 2Q2NA 3NRJA 4UMVA 1OH6A 1LDBA 3SZ3A 2IPOA 2JK0A 4C78A 4YQFA 2UU9B 3UAWA 2CVZA 3IQGX 3JZAA 2ZROA 1C0LA 1KH3A 3IEKA 3GLTA 4K9QA 4YJHB 2ZIXB 3UYLA 1XDWA 4DNQA 4OYYA 4QPDA 5JQWA 5DSXA 3UXYA 1KO7A 1JKXA 3R3JA 3HJFA 1WAMA 1NDUA 5MF6A 3OTQA 4XJXA 5CVVA 3KPVA 1O6CA 1PZEA 1CIVA 2I4LA 2IDMA 1W0CA 3LT5A 4J9UE 4N7MA 5FD8A 1WCWA 4X6YA 3ZKAA 2PBRA 4CM6A 3A4VA 4EI9A 2O8FA 2V9PA 3CO5A 5I47A 3QJYA 4MHSA 3P27A 2O8EA 1D2EA 3EJWA 1G8MA 3KQHA 3MMSA 2NNLD 1LA2A 3M83A 2C82A 3ZYZA 1PHRA 4RPJA 3MF4A 4NULA 5B1IA 3K1AB 3QIVA 4YMWA 1IG0A 2WPDA 2GZRA 1J1IA 1Y42X 3FKQA 3KL4A 3SIRA 1F8UA 4CG1A 4XQ9A 5KYWB 3T41A 3PEWA 5A03A 1XMIA 3EEFA 5JYDA 4HVCA 2CYBA 1SRQA 3N76A 1M3SA 4EBBA 1MRZA 4XUEA 1EI9A 3L1KA 3NUZA 4IPTA 3H9EO 1JEOA 4L5YA 4ZU6X 1E3WB 1F8XA 4UTZA 3AW8A 1DEAA 3N2GB 2GN4A 3NIGB 4UBLA 5DI3B 3ZHXA 3I5MA 1HH4A 4WBNB 3U4QB 1GZ6A 1XU4A 1V4VA 3EZGA 1DOZA 1JG2A 4MW7A 4L73A 5ALZA 5FOXA 1ECGA 1MO5A 2QIPA 2WYWA 2LKDA 2B4YA 3BORA 5CFQA 3OY7A 4MQBA 3EVNA 1D6JA 1MDFA 1EX1A 4LCEA 2GVNA 3ZK8A 3GLFE 4GFDA 5DV9A 4D9HA 1R5OA 4C03A 3FUVA 3OC0A 1PP4A 3TW0A 4IUCS 3OG9A 4PHGA 3HYRA 2N0SA 1ZGGA 5BQPA 1NN1A 3FPHA 3ANTA 5KTKA 4GHWA 2P2SA 3TZLA 4CLOB 1I0IA 3WB9A 3QX9A 4G1FA 1SNYA 4P3PA 4H08A 3GUVA 3AW9A 3QUSA 4HJRA 3ZTWA 1MDBA 1YE3A 3BOSA 2IYWA 4NY1A 4ONEA 2C98A 5DT2A 2D1RA 3RS0A 3TGLA 4GBJA 1O95C 3BDIA 4I50F 4WERA 1FXSA 4HWSA 3OPXA 3BT7A 3KT3A 1RXVA 1NOKA 3JARA 4V3BA 5EJEA 3MT0A 3C3WA 4DIFA 2YW9A 5CVUA 1J70A 1FPQA 1RJWA 3RIXA 3VR4D 4U9UA 4G0PA 2XGJA 2H2AA 2XZDA 1EB9A 4YQZA 4O2AB 4BKPA 4MKHA 2RIPA 2WKRA 2C7VA 4MA4A 1E60A 2GJSA 4MUAA 1ACJA 5HUHA 1RFGE 1KEZA 3E9EA 4XJVA 2GZMA 4W6QA 2PLFA 1P8AA 2QL9A 3A3KA 3M8KA 2ZS7A 1MP0A 2AG6A 4MYDA 2IPLA 2XB2A 4AYWA 3EEYA 1MR3F 4KLZA 1PYGA 1AURA 1TE2A 2V7BA 1P60A 3W90A 4RGYA 1YQEA 4RIHA 1UINA 3ROFA 2PEYA 3VOBA 1VHLA 3WTBA 3DQPA 1X8LA 4Q3NA 4MB6A 4X8MA 3NHSA 4L5JA 2ID4A 5BMVB 1RWNA 1M2JA 4YRJA 2YXLA 3ADDA 1H0SA 4ZCIA 1RJ9A 2BP7B 4ZI7B 4PYNA 1GPMA 4C4TA 3W04A 5IC4A 1B7GO 1I1HA 4KFSA 5DM70 3LX8A 1HFKA 2ZITA 3AUUA 3N8IA 3UAZA 3TYXA 3WJ7A 4WUTA 1DDOA 3NIFB 4IFTA 1W93A 1ZUHA 4A2QA 1Q1NA 1RI4A 4WL0A 4C08A 4EUFA 2C3MA 4QNNA 3MHTA 5FB3A 1WW8A 2A5GA 3M6MD 4BNHA 2P3OA 2WNIA 2J4CA 3ZWAA 1R6BX 3EF0A 4I1UA 4PGMA 2J3IA 2YVLA 3H9BA 3OD5A 3JVUA 1A4RA 2EC5A 2H92A 3IELA 1C8BA 4KE7A 3T7IA 1OFUA 3UJ3X 4L72A 4ALLA 3K8YA 4ARAA 2A0XA 5A4AA 2NU6B 1BVRA 5CBPA 2YWJA 3GK3A 5CB8A 5TMDA 1P2BA 1R7RA 4E4TA 4KIJA 1AS3A 1A4IA 1Z38A 4FFPA 3ZV7A 4D80A 1A7UA 2E9SA 1R15A 3N70A 3TSOA 3QQPA 3JD1A 3X44A 3HC7A 3LLUA 1U28A 1Q0LA 2J9ZB 2XMQA 1K5DA 2R62A 3CE9A 3HKDA 3IT3A 3EARA 2QUBA 4JJGA 4A8HA 3L05A 4AX8A 1N1MA 3NBMA 4IYRA 1SHLA 1S4MA 2ISCA 3DMDA 3F3SA 4G4SP 1U1IA 2H9YA 1TTHA 1P3Y1 4FFBA 1OV6A 1EBFA 3FYCA 1NI5A 4HWTA 2NTEA 2A4KA 2HDWA 3DJFA 3MRTA 4WUVA 1O58A 3ZGZA 5HUQA 4OYRA 3LT1A 2VWPA 1FA9A 4FMBB 5B37A 3K16A 3G9UA 5KU1A 1NVMB 1MEOA 2JI9A 4GECA 4S1WA 3FPAA 4YACA 4N1AA 4E70A 3GLGE 3FGPA 4KFCA 1GNTA 3EEQA 4WOKA 1A72A 1H3EA 3NHWA 3JQ8A 4OJMX 3PVCA 1Y1TA 3LY9A 3P8ZA 1UMDA 3HCOA 4R2KA 1H94A 2GJ9A 3PQCA 1D6NA 5L7TA 1OWMA 1UZNA 2KB0A 5K45A 3P4XA 4UVHA 3G0OA 3N28A 4NZZA 1FSGA 1QZXA 1IOVA 2J3JA 5IM5A 2ZDQA 3A3PA 4DAEA 2VSQA 3LIPA 4LC9A 5AK0A 4E22A 1FFYA 3CUEF 1NBEA 5D3MA 3ESAA 4DRXA 3P2MA 1KERA 4XJTA 3VV3A 5IAAA 3Q0EA 1ZVQA 2YN2A 4I55B 4KQ9A 4PLTA 4GC5A 2IHZA 1CJKC 1PFWA 4AG3A 3QKRA 5AW2A 3LCJA 2O6HA 2Q5EA 3OIFA 4FYXA 2P4UA 1DKLA 2XH8A 1KY3A 2PCLA 2VBIA 3T7EA 2XZOA 3AU9A 2VA9A 5IN5A 4AURA 5L4LA 1XL0A 2J9GA 1U2DA 2XT0A 3C5HA 4WW0A 2HPZA 1E99A 4PVDA 4QTXA 5ESXA 4JJKA 4OSEA 4U1RA 4V0RA 3VYTB 3H0KA 2GJAA 2E87A 1H9AA 2Z56A 1G42A 3HGMA 3RG2A 3WKDA 3VKWA 1Z6GA 1V16B 1M8KA 1USKA 2AHRA 4P0TA 4QNRA 3W3AH 3MWDB 3KSBC 4BNLA 4F96A 3U7FB 1N6NA 3DF7A 2B78A 2BE7A 4G0UA 3GMSA 3NDRA 5JMWA 3O8QA 4M9XA 4RNDB 2I33A 5DXJA 1Y3DE 3FZQA 4Z0TA 3AVWA 2Q6OA 5CP8A 4CMBA 5GOZA 2HW8A 5JSYA 1JU3A 2ESRA 1M7HA 1U81A 2RB5A 4LPKA 3QE4A 5T41A 4FCCA 3RNLA 3T3IA 1PK8A 5LNK1 3MJHA 4QOJA 1UZMA 3E61A 2FSSA 2PZLA 2G1UA 4N0MA 3ESDA 6PFKA 1A69A 1P1FA 4XWTA 3GLVA 1OYVA 4IVQA 3C70A 1TAUA 4KN6A 2GCPA 4EKYA 1CUGA 3EIUA 4EJ6A 4BO6A 4Y2TA 3MOGA 2DQZA 4C6HA 1V9LA 2HY7A 1W5EA 4NAVA 4BU0A 1EVEA 3PR2B 4NATA 4RFSB 5DM2A 1SULA 5DXFA 1E79A 1JR2A 2A14A 4YONB 2W42A 2HN9A 4IWYA 3X43A 3O9ZA 2MINB 1P7WA 2W6JD 3E1KA 2CLKB 3HMKA 3IUEA 3L0ZA 2W2QA 2PZEA 2H52A 4OTZA 1Z82A 4PLZA 2X1MA 3ENZA 4YRZA 1GQSA 4J7UA 5AKGA 3RR2A 3DV2A 5NULA 3WAJA 2WJYA 1NDQA 3R6WA 4OA8A 4QASA 4NV0A 2FPSA 3PXCX 5KYXA 3VDMA 4FB5A 3BB3A 5SY9A 1TUBB 2QP9X 3RE1A 4EW2A 4U2EA 2SCUB 4FDAA 1JG3A 1JQKA 1ZU4A 3HCFA 2M6LA 4L16A 1DXQA 1PJBA 1Y1KE 2YXDA 1DADA 1E20A 2QUIA 2VDWB 5G2OA 5J58A 2Q4EA 3GP5A 3WYAA 3QKSA 3BXPA 5K8IA 2ZWMA 2RGNA 3CN7A 2D1TA 2XRFA 3GGJA 3K9HA 3WLFA 4B2PA 3H5TA 3K7EA 3ZLUA 1OT5A 3G68A 5JALA 3RHTA 5B7GA 2O8BA 2CJPA 5FUVA 3M6WA 5B4TA 3RPEA 2VK8A 2UZ4A 5ERYA 3O93A 3L0YA 4IS2A 4TT3A 4UM9D 4BX3A 5JEEA 5LQCA 1ZIPA 3SHOA 3VH3A 4P58A 2FQYA 1HG0A 4P35A 1YZQA 4JYCA 3H11A 1T5HX 8LDHA 3O26A 2VYND 1B8UA 4KQ2A 4EHJA 2Y0BA 1WCIA 1LU9A 4QREA 1XVUA 3RJMA 1D7OA 2EJUA 3AGQA 4M87A 3WP0A 4AWXA 3GFGA 5ICGA 1EP1B 3DFZA 1OBFO 2VP0A 2ZI3A 1MTOA 3D6VA 3K96A 3MJEA 2FZEA 2JAPA 2YC2C 4IDHA 4W8GA 4ZDKA 5I7HA 2MYUA 4CUJA 5U9CA 2BHNA 2WIAA 1X7GA 1MGPA 1MQSA 1RDFA 2HMAA 3NEYA 1U3CA 4PONA 3M4JA 2Y0CA 2R6R1 1JSRA 2G5CA 4UPEA 1P4RA 3BSFA 3F6RA 3JPWA 1H6DA 5KYUA 4Z7OB 3RFFA 2UUAB 3F8SA 4RAOA 4YQEA 3RSHA 1WCV1 1YJCA 4KX3A 3KL2A 3F5FA 1LCIA 2ZSIA 1RXEA 4MJ7A 1DBVO 3IERA 1PLKA 2PS9A 3PHGA 4B6FA 3DCJA 4HT3B 1QUEA 2FPWA 4U7WA 3RVMA 3FZYA 4KLAA 1O5OA 3U7QA 2JKYA 3CPJB 3VKVA 3TNDA 3B1XA 4C22A 4C0KA 3GFOA 1TIPA 4JVSB 3KAKA 3RUHA 2ZVPX 3R0JA 4OKNA 1PNVA 3HXKA 1SFRA 1V1JA 1SKAA 3FRHA 1VE5A 4Q3DA 3NEPX 3EYWA 2ZIEA 3HJRA 2CLLB 3LHSA 4IHQA 4QUBA 5JTTA 3QOXA 3BD9A 4J0IA 1NQTA 5E4FA 1DB3A 3TUJC 4BQQA 3UH1A 1XALA 1T9AA 3FVRA 3E3OA 2I2FA 2F43A 4OP2A 4NBNA 1E89A 1UKEA 3VZDA 4Z9FA 3ZXUB 3IKLA 3WIEA 3UGQA 1GNRA 3SQMA 2AR0A 5F7XA 3ETNA 4MYUA 5EYPA 4BMDA 1A95A 1D1SA 3OLWA 3D8SA 3JRWA 4LXQA 4P31A 4DEVA 3J81A 4ZQGA 1LGYA 2ZIWB 4PNZA 1F38A 3Q8LA 3BWCA 1GARA 5C8VA 1LW7A 4OBWA 2HGZA 5FFNA 1XU9A 5TJ9A 3PGKA 1AZTA 2OFXA 2YWFA 3NNNA 1Y9JA 3PUZA 3WHPA 1F48A 3JYQA 1QHGA 4BGUA 2H4ZA 1OXVA 4E13A 5E4YA 3D3KA 1FMFA 4U6QA 1SIUA 1SCKA 3ETGA 4YPFA 2C59A 2GAAA 4AXXA 5JRZA 2EX1A 4DOMA 4WNIA 2VC2B 4MOWA 3KZVA 2J1LA 1OXSC 3W9UA 5FAKA 4B43A 3VA7A 2IZ7A 1DKMA 4PO9A 1TF7A 3GR6A 3RTAA 4ER6A 1ISIA 4WV3A 1OD6A 5HOEA 1OZAA 1I36A 1E4VA 4V39A 5LA6B 3U3JA 2RGEA 2WINI 4K3VA 2HIHA 5ALMA 1YB2A 1OLSB 4CW7A 3TBFA 2UXBB 1WB9A 3LT0A 4WK4B 4OO3A 4FB4A 4KO4S 4O4JF 1D1TA 1T35A 1H85A 2EYUA 2OCPA 3R6LA 3T9FA 2WMDA 2Q29A 4HUTA 3L0OA 5DRTA 3HRHA 6ADHA 4K6KA 1ZK0A 2G06A 4LNUA 3HDTA 3LCVB 1E5XA 3LUJA 2A33A 4NXNB 5DSZA 1UAAA 2I62A 1ZSNA 4HWOA 2JPDA 4LKOA 4B7ZA 3UB2A 1MO6A 1T4DA 5K8VA 3MIZA 4N8DA 1W25A 3ZU4A 4YV2A 2JLWA 1G20E 2BMWA 3Q3JB 2O50A 4Y9TA 5TJHA 1P4GA 1NVTA 4JDUA 1L5LA 2YV5A 4KQFA 4L8LA 1VOTA 2VHQA 3RGWS 5GZ3A 1PDVA 4DXHA 2QW8A 1QP7A 3I92A 4KYVA 1U0GA 1VIYA 4S0ZA 4AJKA 1WU8A 1Y0BA 1MOQA 4U8GA 3ZV5A 4EHHA 4ZAFA 5AW0A 1EK5A 1T9CA 2GHTA 4RK0A 1T2AA 1QDLB 1KL7A 2VRWA 2ATXA 4KNWA 3D3QA 2HHAA 5H83A 2Q27A 1TYBE 1V1MA 4GP7A 2RK4A 3K53A 1QJ4A 1Z5NA 3O21A 3AM1A 1R5BA 1UOPA 4GVPA 4J91A 2O4UX 3NETA 4LVCA 4LBWA 5BN1A 1BHQ1 3RBZA 5D8DA 2GRUA 3IUYA 1QORA 4H2DA 3P0RA 1XTIA 2O7QA 3ZV3A 4LHYA 4JVLA 1AM4D 2GCGA 1R88A 2ZJ6A 1EIWA 2G9VA 4JNKA 5FEUA 5JZ9A 3BFJA 4JJ6A 1V1RB 1NW7A 3BMXA 3RC1A 1JAZA 3A1EA 1X7XA 4LJ7A 2DX7A 1X1AA 1CVLA 2O59A 2Q1SA 4NPAA 1WS6A 3N8NA 5CA0F 1ICEA 1X42A 2AW5A 2YXNA 1YAHA 3LCRA 4P2BA 2V65A 3GFSA 1IU9A 1LY1A 3AFMA 3SE7A 5BUSA 1A8SA 2ZRCA 4W6ZA 1DWPA 2GZ3A 4L95C 2GEVA 1ZX1A 1IJKA 3T3DA 4EAQA 4JXKA 2FN7A 1O8CA 3FM9A 3RDPA 3AEKA 2FEXA 3L4EA 3BGWA 3SVZA 2IU6A 3JAWB 4LHZA 2BSAA 1JTFA 4MRPA 1Z6PA 1MVLA 1IN1A 2I4RA 2H0RA 3IAUA 4E32A 4DMRA 4RHYA 1J8FA 2R3SA 1ENOA 1NP6A 4QM6A 1MA3A 1ND5A 1I51A 3VVCA 3KP1A 1N1GA 3R3WA 1FE8A 3GCXA 2PRIA 1YDEA 2AN5A 4IQ4A 1NE7A 4UBOA 1X7ZA 2C5BA 3CLSC 3PXGA 5TB5A 3LP5A 2W90A 2FRDC 3GG2A 4S12A 4D9BA 2AJDA 1WIWA 1Y82A 3IX7A 3HXQA 2OQRA 4LVUA 4OATA 1QNFA 2QLJA 1R0XA 1RWOA 1WVIA 4U7HA 3TZBA 3DT8A 4L8WB 3T38A 3G0IA 5TEVA 2KPOA 3R44A 2JKVA 4BNIA 1U4NA 2CFIA 3C3JA 2PAFA 2ZR8A 1JSZA 4I8XA 5HIIA 1O03A 5A1TA 1JECA 3KJXA 1DDIA 1XVVA 2C07A 3TPZA 3WVNA 3BXZA 2ZYHA 2ZW9A 4HAUA 4RF2A 3VU3A 2JJ1D 1T4GA 2NTNA 3TEFA 2X58A 1UJ2A 4L15A 4ZVUA 2AEFA 1M5TA 4PYOA 1J4AA 3ITEA 3QPDA 2HB6A 1K68A 1VJDA 3G59A 3I58A 3HRIA 4GX1A 5DX1A 2X0DA 5K7SA 3ADOA 3V8NA 1QVWA 1PEAA 1HM5A 5FPYA 1ZZGA 2EQBA 3HZOA 1V45E 1TEXA 1VBMA 4PHTA 2AGVA 3CBGA 1ADBA 4KOEC 1E4EB 1OAKA 2HSGA 4I6EA 1VHTA 2OCYC 4MVYA 4DMKA 1A8PA 1IPEA 2Q3MA 2WHPB 3AHJA 3PA6A 4OGFA 4OIFA 2PUDA 4GPIB 1N2ZA 4LJRA 1JPUA 3DEAA 4RZUA 5GM2A 5HS4A 1HMPA 3IFSA 2BTQA 1UPAA 1XK7A 4ID3A 1OX6A 1LBIA 2C9YA 2WC1A 4EFLA 2QX7A 2Y27A 3I9V1 2GHRA 2EERA 4YIKA 1A4XA 5ELLA 5TMEA 2XB8A 4N54A 5FKJA 2ILTA 2GYYA 2IEDA 1XJWA 2BFDB 4GGMX 1DBSA 4HATA 2QVZX 2P2DA 2VDKB 2XDAA 4N40A 4WI1A 4GC9A 1HT2E 2WKPA 5IEBA 3D6NB 1W36C 1GGKA 3FW1A 3AI2A 4TRJA 1SA0A 2QBYA 3FNGA 1WXXA 3W5CA 2C9DA 1CX9B 2BMJA 1VJ5A 2W0SA 5LOVB 1AD2A 1OXBB 5JNRA 4TKUB 1KBOA 1LDNA 1RXWA 3R5SA 1NBME 1SU8A 3SJUA 3KQLA 4I4TF 4JI7B 1KJIA 1E2FA 3E2MA 3L4KA 5T5QA 1J2YA 4Y6RA 3WYNA 3ECCA 1VRVA 3I05A 5BXYA 2NTYC 1POXA 3OA0A 4TV8B 2IXFA 5AW5A 2NU8A 3QHAA 3TXAA 1NBHA 3MD9A 1V8BA 2OOSA 3KO8A 4YMLA 1ZUWA 4QJ5A 1IVYA 5G0UA 3RWBA 1TT5A 1IY0A 1XA4A 3WGOA 3SFVA 3BCUA 3WE7A 2CD7A 2GPAA 2IYSA 1L7DA 1E2NA 3BFXA 4TMYA 4X66B 1AQYA 2W6ID 2WNSA 3EGOA 3KPJA 4YDHB 1CUDA 4KE8A 4UBIA 2VUSA 2LWIA 5C8YF 2H18A 3S4YA 3CX8A 4AZVA 3GG9A 4H60A 4MUEA 4X84A 3TTUA 5DHUA 2J6HA 3GZTB 4YFYA 1B16A 1W44A 5TGDA 3BVPA 4GGPA 4BGDA 2I2CA 1AGRA 4MLCA 1XZHA 4P83A 4KTTE 2FUKA 2QMYA 4WLNA 3CH7A 4Q9KA 3BRSA 5AVTA 2ZB7A 4TUYF 3ETHA 3B7WA 3DKIA 1GYPA 1M9NA 1QIMA 4TMTA 2J7PD 1Q7GA 2QROA 3KKPA 3IUBA 3M5WA 1OFGA 3FX2A 4GX0A 1QE3A 3OJEA 4BRSA 5B7NA 1MH1A 2EFDB 5I9BA 5KVSA 4MWDA 4Y18A 1QGOA 5CDFE 1B8PA 1R66A 5FR1A 1DQRA 1K8ZB 4NOLA 3DTVA 3BSYA 1DCTA 5JJKA 2I54A 1WL8A 3OE7D 3DW3X 1LBQA 3RJ5A 3A11A 3PUIA 1J0DA 4CF7A 5KNCH 3NHKA 3LXXA 3UPUA 1UM8A 2FDRA 2VP2A 4IHJA 4RY8A 5C1IA 1ICIA 4ZTZB 4WCFA 2WYVA 1QGUB 4J7AA 3V8MA 4NKRA 1U1EA 1P45A 1ZNQO 2IP4A 2DT5A 1CR2A 2WJZB 2RGCA 2PZKA 2XD9A 3JASB 4KW7A 4WKPA 2YN4A 3ONFA 4L57A 1UKYA 2YICA 2BI7A 2I6XA 3H9UA 1W5AA 2AX4A 2P65A 3IMFA 4I14A 5H82A 4ECAA 1DUVG 4NYMR 3VI4B 1DX6A 4WZBB 3WNDA 4KUHA 4DLYA 1EWQA 3PFCA 3LY5A 2R6DA 5C4GB 4IVNA 2F7SA 4IJKA 1P75A 2DH6A 4DGSA 4REQB 3SMQA 1R0KA 3H16A 1KI6A 1SBNE 4BZQA 1RHUA 4GAEA 4DR5B 4RYLA 3CLKA 3GWGA 4HS4A 2PUCA 5JI3E 1IZ9A 1KU0A 2LKCA 4NQRA 2RAVA 3HBJA 2AFHA 3OMXA 4V1CA 1YFLA 4MMXB 3O8BA 3A1FA 1VI2A 2JLZA 5J2UF 1SZCA 3GMTA 3KT8A 5FTWA 5A3VA 1KYIA 1YFJA 1WETA 4LHVA 1T5LA 3G1UA 3IUNA 1Q19A 4OQFA 4TL6A 2OE2A 1HKUA 1M7BA 2OV1A 4H0NA 4BNTA 3PYLA 1Z37A 2IE0A 2ORVA 4URUR 5KWJA 2IS4A 1XZNA 3S27A 4NBSA 3R3XA 4XYMA 1OA0A 2W22A 5HQ3B 1NFQA 3ESZA 4DT1A 4OQPA 5M2QA 1L1RA 1Q83A 1M8JA 1TK9A 2P91A 2VYFA 3GPIA 1V3TA 2FPIA 4M1SA 2C96A 3EQ7A 3QPVA 1X38A 5DHSA 5CPBA 5BYJA 5LL6P 4RTKA 2QRZA 1UJ4A 2CJFA 1BVHA 2VDLB 5DCWA 4U8HA 2QX4A 4PBSA 1IC6A 3IP9A 4LYYA 3UJ9A 2Y2UA 1T43A 2I22A 3B60A 3P9QA 5G1PA 4E5UA 5MGBA 3NB0A 3EAGA 4LSGA 3RFCA 3GFVA 1XZKA 2AUTA 5C7LO 2FCRA 3HV2A 1D04A 1Y5LA 1FNSA 4HXFB 5HIJA 3RC8A 1UFRA 2ADMA 4F86A 3L7KA 2VDPB 3GUHA 5KAPA 1J5PA 1SMKA 1GUDA 2AWOA 5HG0A 1AQJA 1OF1A 1T1RA 1C1YA 4ZRMA 2RK6A 5G02A 4YV0A 2V9ZA 3VR3A 4A10A 2OV4A 4FD2A 3D5QA 3T9DA 3W8DA 4JVOA 5SYAA 3V4PB 2P5YA 5K8LA 2OHJA 2QAGA 2XNKA 3OFSA 3Q7TA 1YI0A 4X97A 3TL2A 3RLIA 4C0BA 3JCZA 3EG5A 4ATNA 4AO7A 1VPWA 1JEDA 4YTEA 3C97A 3SEFA 3N39C 2WKWA 3QEMA 4IQ0A 4LNHA 4O4IB 4UQPA 2AR7A 5ABPA 3UMBA 2E4XA 4CF6A 5KHLB 3D4BA 4MPDA 2IYEA 3LPLA 4AC9A 1XD2B 2J0SA 5D1NA 5AI0A 2V5UA 3AB8A 3M7IA 3O0DA 4FMDF 1GPYA 3H9GA 4O4HF 4UE3S 3RRXA 3RS7A 1Y6GA 4HX2A 1GCOA 3VHXB 2IS1A 4B3MB 2VZEA 4B3TB 4DB2A 1UFKA 4WRRA 4ZEVA 1XJ5A 3KU4A 3D0OA 5ILOA 2FX2A 2PAAA 1Y5RA 2VK2A 4KUEA 2QA5A 3SM9A 4ZVQA 4H4DA 4IO0A 1YB7A 2ZDHA 4BASA 2DULA 1TEVA 4D3DA 3A31A 4YCBA 1E2DA 3VZPA 2YW2A 3RIYA 3LP6A 3ZV4A 2FZKA 2H29A 2JIDA 4KZKA 4QEZA 1BWSA 2Q28A 5DHAA 5ITVA 4FT2A 3R0QA 3MUEA 4NCHA 1Z7WA 3EA4A 2ST1A 4UBMA 1Q6ZA 1I3NA 1ML3A 1B14A 3EH1A 3NH9A 4H7DA 5CA1A 4B3RB 3EVEA 1AXRA 2VQ3A 1LLUA 3OIDA 1U7OA 3WBKA 2P4EA 2ZM5A 4BQEA 1BCRA 2NZVG 3RREA 1YTUA 5TGZA 4QO8A 2PNFA 2IJGX 3B53X 1VGRA 4CHGA 3EUEA 1YZGA 4S1NA 1IY2A 1BVYF 2C2HA 3B6JA 2FEAA 3MTIA 4IZOA 2DUUA 4NICA 5EP2A 1RE1A 3B3GA 3KJNA 3FPJA 1N5KA 3QBEA 3O7MA 4O33A 3PICA 2FQXA 1LNZA 5PNTA 1QC5B 4RDCA 1KDTA 3LZCA 1V25A 2OWEA 2Z2XA 4JBNA 4JUFA 2Q6LA 4MKRA 4CV1A 4J03A 1I9GA 2P1DA 2PSDA 1KOLA 4YMGA 5BVHA 1XQVA 3U80A 2VKQA 4NDAA 1N5MA 1XRRA 3H04A 5IN4A 3IVXA 2YVAA 3C5WP 2V7VA 3DXFA 5J4LA 1WVGA 2PKXA 1LPSA 5IKOA 2EWMA 1MNAA 1UC8A 2IZ1A 3L6DA 1JGTA 2XUDA 1Q92A 2NSDA 4Q9LA 1RAHA 2DBQA 1QM5A 2IUTA 2YHBA 5DGTA 3WWPA 3GP8A 2CVFA 3IAM1 3H9QA 4ZI3A 3NYRA 2XYVA 2VLBA 3TRFA 4K2HA 4EJSC 1R4NB 4Q48A 4CQLA 4MRAA 1M2OB 4CKWB 4QL3A 4DLBA 4KVFA 3INGA 2BGRA 3X0DA 1TIBA 2X15A 1Z45A 4UNQA 4IGAA 4YYEA 1QVZA 3CURA 3VKFA 5HKOA 2XSZD 1W96A 4ENUA 2H1LA 3AF4A 3DL7A 4LYEA 3CX6A 2OD2A 3KE9A 3MOIA 3ZCQA 1UBEA 4PTLA 1M2VB 1NXXA 2BKXA 2QN6A 1FS4A 1VPDA 5DZSA 1QQ5A 4HY3A 3G9ZA 2R47A 3BXHA 3FMGA 4B35A 3M5PA 3QLTA 3VR6D 4A2CA 3MWGA 4D5EA 3PEUA 2C42A 4DC1A 4BKOA 1HFJA 1RWXA 1RRFA 2Q2OA 2WEKA 2ZXEA 3GLUA 4XYGA 2BKVA 2ZIFA 4N0DA 4A2WA 1BGXT 3CH5A 2JS7A 1EE9A 2PBLA 2ZTSA 2HX1A 1L7AA 2X8JB 1NYRA 3G2MA 3KJEA 1BXRB 2A1UB 3VU9A 2BEKA 1NMYA 2FN9A 3GEPA 5ICFA 1DBWA 3LI2A 3U26A 1R4MA 3FMVA 4JGBA 4UC0A 4DZZA 4TLMB 3E1GA 4J90A 1LDGA 3F9RA 1R8YA 1PWYE 1PDWA 4KXNA 2F4NA 4YROA 4GR4A 2ZAIA 4EZBA 2R6CA 3LHKA 3HKCB 4LFCB 2VH2A 5GV8A 5BN5A 3NBFA 4MRMB 3V1YA 2WWHA 4PYJA 4JI8B 2OQ2A 3DR5A 3EUFA 2OXRA 1I2AA 2HNKA 4AWAA 3I45A 2NYAA 2R1VA 2RMKA 3N1UA 3HO1A 2YV4A 4ND8B 1WSDA 2XZTA 4LTDA 3VVBA 2BBTA 3KKNA 2XITA 4TQAA 3I5YA 2P68A 1CIPA 1Y3HA 3LHDA 4D9NA 1UJ6A 2IX3A 1CE8A 1HMYA 2QTHA 4LDRA 4C7OB 5HF5A 4I6GA 1N2EA 3O8LA 4H0FA 3UAGA 1EEHA 2PKRA 1JKFA 1YNOA 2XV1A 3H83A 1MC4A 1TCUA 2R5WA 5FT9A 1IEVA 1C1HA 1QZ3A 1KMHA 1XP5A 4L1KA 4NYIR 1K8QA 4GICA 4LJYA 3W4JA 2VEDA 4ZVLA 4BAGA 5EIHA 1JTVA 4EI8A 3VH2A 3B3QA 5ALYA 4L9SA 3CUVA 2O0KA