4BVLA

Structure of 202-208 deletion mutant of phaz7 phb depolymerase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
335
structure length
335
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
total genus 127
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bvlA00
2OGZA 3WIBA 4BATA 1IZ8A 1WCYA 5ALOA 1XKTA 1SCIA 1EDEA 5AK4A 1CUUA 5FP0A 2CJPA 4LKOA 3ANTA 2Y6UA 1U8EA 4A5SA 2XMZA 2OG1A 5DTIA 2JGJA 3G9ZA 3S8YA 5ALKA 4HXGA 1Q84A 2QS9A 1GGVA 2RGUA 3KWJA 3FVTA 1CVLA 1GQRA 3YASA 4OD0A 3DYIA 1AQLA 1JU4A 5JZ9A 4PSUA 3EBLA 2HFJA 4J0IA 4X94A 2QJWA 3I2FA 1QIKA 5K3FB 1A88A 4EY8A 5ALUA 4OB6A 3QBJA 1YSCA 4BYMA 5AKXA 2ACEA 5EHXA 4X7BA 5JAPA 3FNBA 2VJAA 4X95A 5ALPA 4BE9A 1BROA 3WWCA 1ZD4A 4H0CA 2CMFA 5HFAA 4DNOA 1D07A 1P0PA 3WL8A 3BIWA 4J0GA 1W76A 2ZYRA 2B61A 1E8DA 1CR6A 4GLBA 4IH1A 2DCMA 4F60A 1ODCA 1R3DA 1MTZA 1TCBA 4GXNA 4EZIA 2GZSA 1AZWA 3P2MA 4KRYA 1WHSA 4FOLA 3GELA 3D2AA 3WK9A 4BVKA 5SYNA 4P9NA 4A23A 3K6KA 5ALWA 1E89A 3AIOA 1THTA 2DQYA 5T4HA 2Q0XA 5BWCA 1LPAB 3R41A 1MAAA 4KRXA 3M82A 1U65A 1MNQA 4IO0A 5E4TA 3FCXA 3FYUC 3R40A 5CXUA 3VVMA 1SCKA 1MT3A 1MPXA 2VATA 4DGQA 4YPVA 4FLEA 4UBIA 3F9CA 4JYMA 2O7RA 5CBKA 5CT8A 4ZV9A 2J3DA 3DLTA 2Z8XA 3PFCA 4G8CA 4I19A 5ALLA 1C7JA 3Q8WA 1RYYA 4Y2PA 5J3JA 1E5TA 3SC2A 1XZCA 5A7HA 3AIKA 4OPMA 1EI9A 5CH3A 2JGEA 3QPDA 5LZ7A 1XRRA 4E15A 3E3AA 1CUGA 5LIPA 4OB7A 4GECA 4LYDA 5ALTA 2H7XA 3T52A 1HLGA 4PF1A 4P92A 3IIIA 4J7AA 3T4UA 2QT9A 1ACLA 4UHBA 1QIFA 5KBYA 3NUZA 4FBMA 5FXMA 4C88A 4CG3A 2WFMA 1CUEA 1CRLA 2HU8A 4BRZA 5JD4A 3DEAA 1HKHA 4OU4A 3W2TA 1HPLA 2J4FA 3KSRA 1ZJ5A 3BWXA 5IVIA 4BC1A 5AHXA 3WWPA 1VZ3A 3W05A 2XI4A 4K5QA 4BCDA 2ZJ6A 1ZIYA 3BJMA 5AI6A 4MEAA 2VT7A 4UFPA 2ONCA 4QLAA 1K5PA 3FBWA 1CPYA 1WB5A 4QNNA 2CEKA 3H19A 1YASA 4Z49A 5AOCA 4I3FA 2UZ0A 1CUAA 1XQWA 3QITA 1E3QA 3CCCA 4X6XA 5C81A 1VXOA 4FLMA 2WTNA 4GBGA 4BP8A 2G5TA 5FDFA 1DTEA 4DMKA 3WI7A 3FLBA 4CG1A 1J06A 1HL7A 3E0XA 1KEZA 3W04A 4CCYA 1G4HA 4UHFA 1XLVA 1WOMA 2WLSA 4X00A 2H7YA 3D7RA 3HRHA 4MQMA 4QEKA 2Z3ZA 3WKAA 4FFWA 2EDCA 1YR2A 2HL6A 4GDMA 3RARA 4FHZA 3FWHA 5ALXA 2Y2UA 5AKYA 4BZZA 4G4IA 4EY4A 3STXA 1EDBA 5E2IA 3DL4A 1ACJA 5EIAA 4C4ZA 4X85A 3TRDA 1DT5A 3GROA 1C7IA 3PF8A 5LKAA 5ALVA 4PW0A 2QKYA 2J4CA 4HTAA 3RLIA 5HK8A 4O08A 1K8QA 1UOPA 2WUDA 5HQ3A 3G02A 1B41A 5A62A 4Q82A 4J3JA 5AM1A 3C6YA 5K3AA 1XLWA 1G42A 5F4ZA 4L3WA 2O2HA 1JFRA 5CT9A 1CUIA 5AM3A 4X6YA 4UHDA 2WILA 5DNVA 1MX1A 3F67A 4ROTA 1FFAA 5FPQA 2GBGA 4K6HA 2ROQA 3KWFA 3D2CA 2OQIA 4J0HA 1LPPA 1MNAA 3F8SA 1QIJA 1G5FA 4CCYB 2XLBA 4H77A 3O4GA 4V2IA 1A7UA 3A2MA 3I28A 5KWJA 3BIXA 2WU4A 3GZJA 2HDWA 1JU3A 5D3KA 5K3CA 3WYNA 5CT5A 4IH4A 3AINA 1R9NA 2PM8A 4B7ZA 4XWGA 3MVEA 1Q83A 1CUYA 2O7VA 6YASA 1ISPA 5HKBA 4QWWA 4IHAA 2IX9A 4X93A 2QM0A 3FLAA 3GUUA 3QMMA 1QOZA 1BCRA 3QMVA 2V96A 4AN0A 3VJKA 2HM7A 3HSSA 4K6KA 4TGLA 5AIAA 3N0TA 3S2ZA 5ALNA 4Q34A 1LZKA 4G9GA 1H2XA 1ODTC 3ICVA 2VSQA 2ZVDA 3JW8A 2X76A 5HQ3B 4Y2TA 3HZOA 3VISA 3DL7A 5I9IA 2BGRA 3WLAA 3SWWA 1LZLA 4G1FA 4B80A 2PBLA 2D0DA 4G8DA 2HA3A 2JGLA 2OAEA 2VF2A 3I2JA 5EHZA 5T4FA 1TCAA 2RI6A 4ZWNA 3D0KA 4GHWA 2AXEA 1DX4A 4OUKX 5AK5A 1HBJA 2Y6VA 1XZJA 3D4LA 2AJBA 3H18A 2XMQA 4M0FA 2H7CA 2HIHA 4B6GA 3CCBA 5JIBA 1QTRA 5AK3A 1DWOA 4U2FA 4QE3A 5ALDA 1MO2A 1GPKA 2WJ3A 3V1NA 2XMGA 3QH4A 5JYCA 1XLUA 3AIMA 3DCNA 3H2KA 5CH5A 1VE7A 3B5EA 2WIJA 2ZSHA 4OSEA 1FSSA 5I7UA 4EHBA 5IVHA 5IVKA 4JEIA 4TVKA 3BF8A 5JZBA 3FAKA 3O4IA 5LZ4A 3U1TA 1UFOA 3I2KA 2WSLA 4L0CA 2PPLA 5EHQA 1N5RA 5JANA 1C4XA 3UUFA 4BRSA 1JI3A 2CBGA 4N8DA 4QZVA 4Q3LA 1AKNA 1VLQA 1XRMA 1K6EA 1BE0A 3G8YA 1EXWA 3FYUA 1P0IA 1F0PA 4U2GA 3EF3A 3WKEA 2Z8ZA 3QM1A 3L1IA 3K2IA 5CT4A 3AILA 5DYWA 1X2BA 3ESCA 1JMKC 1XKLA 4B0OA 4ARAA 3LP5A 1ZD3A 1YCDA 1UWCA 2CUTA 5T4BA 4BAZA 1XFDA 3ANSA 3I1YA 4AO8A 3EIOA 5ALFA 4LHEA 4J0CA 4B0PA 3HYSA 2OLEA 3NWOA 1J07A 1UK9A 4PO3X 1PJAA 2PUHA 4QDTA 4KE8A 3U0VA 1CUZA 3C5VA 5AM4A 3C5WP 1QJ4A 2HA4A 4W63A 5T4EA 2PU5A 3I6MA 1XZIA 1CUJA 4RNCA 2HU5A 1Q0ZA 4G4GA 3GFFA 3SX4A 1UZAA 5EI5A 3VKFA 1GQSA 1QONA 1F0NA 1CFJA 2JBWA 4FDMA 4DMFA 2JF0A 3GBSA 2XQIA 2XUJA 3R3UA 2G63A 3WIOA 3WA6A 1XRLA 1AURA 1XZDA 4TPKA 1WPRA 4DLNA 3FYUB 4QWMA 4LXHA 2VT6A 5JAOA 3M3DA 3HABA 2HADA 3H2HA 5EFZA 5K3DA 1GKLA 5AI4A 4AN1A 3FSGD 2DQZA 1Q0RA 1VKHA 5CH8A 2ZYHA 2VJDA 4C4XA 4OCZA 2Y2VA 3MUNA 1XZEA 1CUCA 4AQDA 4LXIA 3A70A 1LNSA 4B85A 2PU7A 3FVRA 1BRTA 5JAUA 5AP9A 1QFMA 4KR0A 3V1LA 1CIJA 2HHAA 3FSGA 5JARA 1EDDA 1TIBA 1L7QA 1QIIA 5AM0A 2YXPX 3WKBA 4QA9A 5LP1A 4X90A 1KU6A 4MXDA 3FCYA 4AO7A 3PE6A 3H1AA 1O6FA 3WQHA 1H2WA 4Q1VA 4LIPD 2DR0A 2ES4A 4GI1A 2VEOA 3L1JA 1AGYA 1FFEA 4UHHA 1BCSA 1T2NA 5ESRA 3SK0A 2AJCA 1CUHA 1E8NA 2Z5GA 2JGIA 2BCEA 1WM1A 1YS1X 1XQYA 2FUKA 1P0QA 1AC5A 1EX9A 4B9EA 2OPHA 4MWSA 5AI0A 3BDVA 3G0IA 5CT6A 4Y2YA 5AJHA 4L72A 3WMRA 2I3DA 5A71A 2WKWA 4KE7A 1SC9A 4NS4A 4FBLA 4XIIA 4C87A 4QDOA 4U2DA 4NZZA 4QDZA 3C6BA 5FUMA 3DDUA 1K63A 2BUBA 5DWDA 2XUGA 1QO7A 3WZLA 4K6GA 3OURA 3AJAA 3BE8A 4WDQA 4AZ0A 1CUSA 3W9UA 3H0CA 1GT6A 1LPOA 3AZPA 3OG9A 5AO9A 3W9BA 1K4YA 3G9UA 2WU3A 5A7GA 3STYA 3FLEA 4UPDA 2QUAA 4W1QA 5FOQA 1VJ5A 1YA4A 4YK7A 1BN6A 1ZGBA 1RWQA 1QO9A 2YYSA 3LIIA 4W9RA 2XUHA 2VJBA 2XQFA 2XUPA 4EB0A 1DX6A 4OU5A 3VJLA 3ZLVA 1MX9A 3ED1A 3G0GA 3KOOA 5AI8A 1B6GA 2OGSA 1QIEA 1DU4A 2X5XA 3WL6A 3ZWQA 5JAHA 3AZOA 2C5GA 2RAUA 5FV4A 4BAGA 5IKXA 1QIMA 3OTQA 1XRNA 1YS2X 3HJUA 1LPNA 4WFKA 4ZREA 3I2GA 5C7YA 4EUSA 1W52X 4ZXFA 4ZI5A 3WL7A 3ZV7A 1UOOA 1LLFA 4Y2SA 4BZWA 2WUEA 3H04A 1MN6A 2DSNA 3C70A 4N8SA 1N8SA 1VA4A 1MJ5A 1VA5A 3OPMA 1DWPA 2OCKA 5EIHA 2RHTA 5C8ZA 2C58A 4A16A 4KAFA 3JYHA 1GPNA 5E4JA 3IDAA 3A2LA 5IVDA 1P0MA 4G8BA 5ALJA 2ZJ7A 5AI5A 3G0CA 5AIBA 1CLEA 4I4CA 1XRPA 1CUFA 1BN7A 1WHTA 1ZIXA 4FTWA 1BS9A 4G9EA 3PI6A 4HRYA 2R11A 1H22A 4OB8A 1QTIA 1BEZA 2GBIA 3IA2A 2BUCA 3NOXA 4MJ3A 3IUNA 1R9MA 1UKBA 4BDSA 1UKAA 3F98A 4PSCA 3STUA 5HK9A 1A8QA 2WG2A 4Y2VA 5EIEA 3OC0A 4FLFA 3BF7A 2PVSA 4AX4A 1N5MA 4PQEA 3HXKA 2PSDA 5AKLA 2XMRA 3PUIA 4YX9A 1X2EA 5JATA 1U2EA 5AKGA 4NMWA 4Q05A 4C01A 4J0KA 4G5XA 1XZKA 5LZ9A 2ECFA 3CN7A 3IUQA 4BCBA 1J2EA 4KAAA 2WIFA 3VXKA 4J0DA 4BTVA 1FFDA 4HXFB 1A8SA 1HDEA 4H7HA 2AJLI 1Y7HA 3DQZA 1VOTA 3VJMA 1HQDA 2DHDA 2HRRA 5A6VA 4F5ZA 5D7BA 5DNUA 1DWQA 2VQ6A 3E4DA 1IZ7A 3WK8A 1UKCA 4DNFA 2WFLA 1NX9A 2I3ZA 1ORWA 4UBOA 4EA6A 1OXMA 1IMJA 4UBNA 3R0VA 3FOBA 3OM8A 5HF9A 3QZUA 1W6RA 2GZRA 4YASA 1DQZA 3WKDA 1PFQA 2QOEA 3WJ1A 1XZBA 3W06A 5ALQA 3H2IA 4H7KA 1LBSA 4X91A 3KDAA 2W22A 2ZYIA 3IUMA 4BC0A 1ZICA 2QZPA 2V98A 4ETWA 4H18A 3G0DA 4DYHA 4AXBA 2V9ZA 3WK7A 2BJHA 2RHWA 3C87A 2ZSIA 2OGTA 4JH0A 5HKAA 3TEJA 4DMCA 3Q0TA 3PICA 1VZ2A 1ORVA 4N8EA 5HFNA 1Y37A 4DM7A 2WJ6A 4BB0A 2XMDA 3PDCA 3LIPA 2WHQA 1UXOA 3G0BA 1XZAA 2H9YA 4M0MA 4CFSA 2VA9A 3EQ7A 3H17A 4GW3A 4BE4A 1JKMA 4EY5A 1IUOA 5ALIA 4F21A 3O4HA 4MYDA 4XX1A 1WB6A 4Y2QA 1RP1A 1BU8A 4M0EA 2WFLB 4BBZA 5K3BA 1ZI6A 2ORYA 2WUGA 5LZ5A 5HF6A 5IH7A 2BUAA 4KAJA 1TK3A 3R3YA 1EH5A 3KD2A 4KJXA 4QDUA 3LCRA 5AKIA 1EB9A 1EA5A 4BAUA 3C6XA 2WHPA 3RM3A 3C8DA 3IBTA 5ALSA 2X8BA 2NW6A 4FKBA 1AMNA 2GYWA 2QMQA 1IUPA 3UUEA 2WIKA 1YB7A 4HZGA 2C4HA 4E14A 4GWLA 5AKKA 3E1GA 1H2YA 3D59A 3R3XA 4W1PA 1JMYA 5A7FA 1TKRA 4WCVA 2J3QA 2XUAA 3BL8A 4DNPA 1EVEA 2EDAA 1LPBB 4UFOA 4KYVA 5JADA 5CW2A 5CXXA 1LPMA 3R3WA 4AZ3A 5HF5A 5CRIA 2D5LA 3G9TA 5D3ZA 2E3JA 3IUJA 4Y9SA 4UUQA 3VDXA 4B9AA 5SYMA 1GPLA 4AB1A 4KE9A 1W4LA 2WG1A 5CMLA 3QPCA 4LYEA 1BEEA 2QRUA 1TRHA 2G4LA 1X70A 4X3CA 3R3VA 2WIGA 1XROA 2BFNA 4H35A 3WK4A 1UK7A 2I03A 5BV7A 5ALGA 3QMWA 2IIVA 2CB9A 2XUFA 3DJYA 4C6HA 2ZYSA 3A6ZA 3H2GA 2XT0A 2YH2A 4FMPA 1H2ZA 4BVLA 1EVQA 1N1MA 2WHPB 1TAHA 3ESAA 4EY7A 2EEPA 1SFRA 3STVA 1CEXA 2K2QB 4P08A 5AKHA 3G7NA 3I1IA 1CQZA 5EGNA 1EHYA 4MWTA 4EY6A 2DHCA 1UK6A 4H7EA 5EHNA 4S0XA 2FX5A 4B84A 3C43A 1QLWA 4HAIA 2C0PA 3O0DA 2PX6A 4CG2A 4RPCA 4W1SA 3I6ZA 1JJFA 2HU7A 5LZ8A 3PUHA 2QJRA 2AJ8A 1LPSA 4RGYA 5FKJA 2OQVA 4DIUA 4L9AA 3I2IA 4H7FA 3RK4A 1XQXA 1TQHA 2Z3WA 5AKZA 4UBKA 3WWOA 4IQ4A 1THGA 4DTCA 2RONA 3X3HA 3ZLTA 3FYTA 4GEGA 4C89A 1QFSA 3WL5A 2QXTA 3JWEA 1CQWA 1ZJ4A 5KWIA 3LLCA 4UBJA 3GA7A 2XUQA 2WM2A 1YAJA 3AFIA 5C8XA 4PNZA 2JGFA 4WJLA 1R88A 3ILSA 2QTBA 3B3QA 3C6ZA 3O95A 1O6GA 3IULA 4J03A 4FWBA 4B82A 2OXEA 4Y2XA 4C4YA 1XZLA 5AOBA 2W6CX 1ZGCA 3WA7A 3O9VA 5KREA 4RE5A 2HA2A 2OCIA 2JIDA 1EK2A 5CURA 5HZGA 4U2CA 1QIGA 3D3NA 1NU8A 1EK1A 3DS8A 1YB6A 4ARBA 3WKCA 3BXPA 3ESBA 1CUDA 2RIPA 3ZLUA 4WFJA 1IUNA 1E8MA 2OCGA 2DHEA 1LGYA 2YASA 4G4JA 3L1HA 5DYYA 1OCEA 4Y2UA 3WWEA 4Q3OA 3WK5A 3WZMA 1GKKA 1MX5A 2DFPA 1NU6A 2XUDA 3D5EA 2HA7A 2G5PA 4OYYA 1M33A 1CV2A 4UHEA 1WPXA 5AOAA 2FJ0A 2XB6A 3WWDA 3DD5A 2C5FA 4Y7DA 3M81A 2HFKA 4WY5A 1YAHA 1JJBA 2VTVA 1SCQA 5ALYA 5H3HA 2WJ4A 4H7JA 4U2BA 1ZI9A 1AX9A 2WHRA 2WQZA 4WFIA 1QIHA 4ZRDA 5LZ2A 4ZGBA 3R3ZA 1ZOIA 2XUKA 3H2JA 2C7BA 5ALZA 2QUBA 4KACA 4MEBA 2GBFA 4INZA 4N5IX 5CTAA 4FFVA 2OCLA 1R4ZA 3MUOA 4MQLA 4XJVA 1F8UA 4Q3KA 4CIAA 3OOSA 3LS2A 4PV7A 1LBTA 3IVMA 2XE4A 2VAVA 2XQGA 4AMYA 3WK6A 1DT3A 4D9JA 2CKMA 3UMJA 3O4JA 3STWA 3I6YA 4X71A 4QLOA 4RE6A 3CN9A 1PV1A 4UBMA 5FLKA 5ALEA 5JZSA 3QVMA 2QXUA 2WIDA 5AICA 2P8SA 4LXGA 5DJ5A 1ZI8A 1W1IA 2JEZA 5HF8A 3V1MA 4WDRA 4HVTA 2XLCA 3TGLA 2PL5A 1OILA 5ISMA 5LLSA 1Y7IA 4FNGA 4E11A 1QIDA 1QGED 3CXUA 4X97A 2HA0A 4FNMA 4KEAA 4F0JA 4Y2RA 2O2GA 4HRXA 3HACA 2XUIA 1ZD2P 1TCCA 3V1KA 3HC7A 3STTA 3BDIA 3DOHA 2I78A 3F97A 5K3EA 2PSHA 5A2GA 1FJ2A 3EQ8A 5AM2A 1MAHA 5DNWA 2ACKA 1EB8A 5ALHA 1ETHA 1S8OA 1MU0A 4CIBA 4HXEB 3V9AA 2XMCA 5I8PA 3PF9A 2V97A 4JNCA 5ALMA 3NGMA 1CUVA 3ESDA 3N2ZB 2BAGA 3A2NA 4WY8A 3PFBA 4NVRA 3HI4A 2H1IA 5AH0A 4DMHA 2XMBA 2IITA 2XUOA 1T4MA 4U2EA 4CI9A 1AUOA 5JASA 3DKRA 4H7IA 1W75A 2OAGA 1VXRA 2HA6A 4W1RA 3K9BA 2JEYA 5C8VA 2PSJA 3DNMA 4CCWA 5AKJA 5FPPA 3BJRA 2B4KA 3KXPA 1WB4A 4ITVA 2PSEA 4QDXA 1USWA 2GYUA 2XQJA 4H7DA 1FFBA 2O2IA 4P93A 5BOVA 4UHCA 5FRDA 4BP9A 1QZ3A 4BDTA 4BCCA 2GYVA 2LIPA 5D6OA 5BWBA 4JUIA 4AMZA 5AKEA 1R1DA 5E4YA 2WTMA 2PKYX 3I2HA 5JD6A 1CUXA 2PSFA 2QVBA 1F6WA 5DLPA 4OYLA 3B12A 4X6UA 5JD5A 1CUBA 2HA5A 5DYTA 2CZQA 2R8BA 3VVLA 2VAXA 4XVCA 1UK8A 3MGAA 1E66A 4BVJA 2Y1KA 3AUKA 2HRQA 5DTJA 2XQKA 5AI9A 4UFNA 1XZMA 1I6WA 4E46A 4DNQA 1SOMA 5K5EA 4B81A 1R50A 1UOQA 3QYJA 1XQVA 3ICWA 1L7RA 3EQ9A 2WFZA 4DSAA 1XZFA 1DINA 5JALA 1VE6A 3ZPXA 4MYSA 4X92A 3ZI7A 2XDWA 4UBLA 1J1IA 1Z68A 2VJCA 4B83A 2FJPA 2GBCA 1CUWA 3TJMA 3HLKA 4PSDA 1DQYA 4BTLA 4DSZA 1XRQA 1ODSA 2BGNA 2XMSA 5YASA 1JJIA 3DYVA 1YA8A 4AO6A 3DOIA 1JT2A 5LYYA 2B9VA 3AZQA 5LKRA 4N5HX 3DKKA 3F96A 1FFCA 3H1BA 2JGMA 1GXSA 1L7AA 5AM5A 1XZHA 3WYDA 1QE3A 2PUJA 5K3FA 3V48A 4K2AA 3G9XA 2BKLA 3IB3A 5HCUA 2WG0A 2B20A 4ZV7A 1U4NA 3IURA 1EINA 3WJ2A 5ALRA 1G66A 1UT6A 3C45A 5AK6A 3M83A 1IVYA 4EBBA 1A8UA 4IH9A 1KU0A 3QPAA 4JYPA 7YASA 1H23A 2WUFA 3HEAA 3C8HA 1GZ7A 3RKSA 4HS9A 1ZD5A 2AJDA 1XZGA 3D2BA 2ZJFA 4J0JA 4KE6A 3O9MA 2JGKA 2C0QA 4Y2JA 2QR5A
chains in the Genus database with same CATH superfamily
4UE6A 1KNXA 5T6BA 4EJSC 3T5BA 1IZ8A 2GZMA 3DE6X 2Q46A 4PLTA 4U7JA 5CX1B 1EA7A 5KNBH 1SZPA 2JFUA 3QA3E 3T0GA 1YMQA 3NC1C 3THOA 1XKTA 1H8ED 1SOVA 3CY6A 2M6LA 1XVUA 5B1EA 3FHOA 3NCTA 2GS9A 3ZU3A 5AK4A 3R7LA 4TUYF 5FP0A 2CJPA 3CNEA 4WNAB 3UT6A 2WW8A 3FI0A 4AURA 2J4DA 4CR8A 1MB0A 3LX8A 5FO1A 4V24A 1N25A 5A9RA 1KGDA 2PGLA 3CLUD 4A5SA 2XMZA 2F90A 4PIMA 4OFXA 3UMYA 5CVJA 1RM0A 3L7LA 2IOFA 2BJVA 2ZITA 4S2UA 2B4QA 4HFMA 1YC5A 2FWJA 3LNCA 3Q11A 3NEYA 2JGJA 3G9ZA 4NYJR 2H4YA 2QPAA 3OECA 3AB7A 4NCHA 1L5MA 3B82A 1N7JA 1ESNA 3I0ZA 1LS6A 4HWPA 2DEUA 1EE9A 2UU9B 5FAKA 5ALKA 1Z56C 3PNQA 2DY1A 1GGVA 2EWMA 2ATEA 2QS9A 2PRKA 2VRWA 3DEYX 3P45A 4RM3A 4JSRA 3KWJA 3MC1A 4QQRA 4BJHB 3F5MA 4XB1A 1V95A 4PWYA 4INOA 3PHGA 4O4IA 4JNKA 4D4JA 4KO4S 3ZU6A 4WUTA 3AB8A 2V9CA 1Z2OX 5JZ9A 1GXSB 4DMMA 1V3VA 1SBYA 2CVHA 2VTEA 4MQ4A 3X1DA 1E58A 4TMVA 2CN1A 2NT4A 3A28A 2QJWA 3I2FA 3I6QA 4X94A 3TLMA 4Z53A 4DEYA 4MLDA 1TVKA 2FSUA 1HSOA 2D2VA 4MKIA 1HXHA 1A88A 2IY7A 3ICPA 3O8NA 1FDSA 4EY8A 4P2GA 3OUZA 1E61A 1QKKA 3EZ2A 5EVJA 4DJTA 4E32A 1UDXA 4V0SA 1Z4OA 3KFVA 2WU8A 4L85A 4TX1A 5FYQA 3PVSA 5TQJA 2C31A 4CF3A 1GUBA 2WJJA 4GR4A 5CCBA 2ZU6A 2ACEA 3W7VA 4EENA 1YJXA 3OKPA 4WX2B 3JPYA 3K6SB 3FPSA 3LUJA 4QO7A 2P5TB 2JAWA 2OCXA 5LMCA 5E6RA 4C7XA 3A2KA 1NUTA 4IZHA 3CRVA 4GU5A 5KYKA 4QHSA 4Q9KA 3QU2A 2N0SA 3NHRA 2VJAA 4IDQA 5ALPA 1RXVA 3I53A 1CBUA 4LBVA 1ULBA 3E0QA 3A1CA 1M0WA 3CUSA 3HPQA 3EA0A 4MMXB 1YQQA 2CMFA 3KQLA 2VHJA 1MENA 1NI5A 4KQ6A 4LZPA 1E60A 4FCVA 4OIMA 2X0DA 3VR6H 2V03A 4EGJA 4ZYZA 3WHPA 5C52B 5BSTA 1RI3A 3O7WA 3SAJA 1WCIB 2VDQB 2X6QA 5FPSA 2G88A 4CKBA 2V5AA 4OQZA 1QV6A 4M9UA 4E7PA 1P2FA 2YIVX 2JB9A 3PXDA 1FTYA 2DAPA 3ASZA 5B7NA 1EM8A 5EOVA 3LLVA 4MMYB 1E8DA 4Q3NA 1USUA 1YA6A 3SHQA 4IH1A 2B7LA 1XPUA 3QFFA 2YXEA 3HM2A 5A5VA 4QBKA 3UXYA 4PIVA 3A4TA 3F6CA 2WTAA 3QUQA 2WM9B 4KZKA 2V7QA 4RUKA 1ODCA 1RKBA 4YFVA 3L92A 2HQ1A 4JD5A 1NNEA 3B85A 4GXNA 4QAQA 3WGNA 2GZSA 4FU0A 4N82A 2CL0X 2FUG1 4KRYA 5EIWA 3UMBA 4FOLA 3WK9A 2HSJA 1DJOA 4UVHA 5EQJB 4DJFC 2P35A 4TMTA 5ESXA 2QTVA 4B4VA 1SVKA 4A23A 3DEFA 4HAUA 3K6KA 4Z1MD 2ODNA 3GFGA 3LUCA 4IMJB 2RGXA 1FRFS 3UO8B 5JSUA 2RGNC 3IDOA 1LI4A 2NZ2A 3RIGA 2AMFA 3AIOA 4Y6LA 2Q1TA 5JSYA 4N7BA 4WZBE 3IMCA 4CQMA 3TE6A 2Z5VA 1Y4SA 3EBOA 2B92A 1GGJA 1VHQA 3QEOA 4HDNA 2XITA 3EVFA 3Q72A 4DLAA 2QROA 1LPAB 4URUR 5EKDA 5C8YA 3Q2OA 3BIFA 1E3MA 3EC7A 1FUUA 4EUHA 2C9MA 3GVXA 1ZUNA 5FX2A 4O4IB 3EMDA 4N9WA 4P0QB 1ZCAA 1P8JA 1FNMA 3M82A 4M0CA 4RCVA 1U65A 4KHZA 3VSEA 2RFLA 3PXUA 2GBPA 1H5QA 1RKVA 1D2CA 3RO7A 1T5TA 3VVMA 2Q4DA 4KJZA 1L7XA 1TVKB 1J2TA 5FLYA 2VSOA 2H1VA 5JEEA 3OJXA 1XTZA 3BJEA 3DEKA 5BWLA 4M8LA 4PY2A 1FDRA 2BGJA 1MLDA 2ZWOA 5GJBA 4UBIA 1EMDA 3GAAA 5FBHA 2HR1A 5IARA 4KGDA 1U2PA 2HK8A 4JYMA 4FDLA 3I9MA 1GCIA 1DDOA 2AIRA 4Z9XA 4COKA 4QPCA 1U99A 1QYVA 4PNHA 1UFKA 4PLWA 5E6RB 2AUNA 2Z8XA 4Q7LA 3N8KA 3I61A 3CLTC 5ALLA 1RYYA 4Y2PA 4DY4A 2ANCA 1ADFA 1R0YA 3N76A 4BLRA 4TRRA 3BMNA 2E18A 2NPIA 1ECJA 1ONPA 4NFSA 3UATA 3I5UA 4F2PA 2SICE 1PR1A 5IRCD 2AFRA 1CEEA 1XX6A 3CZ5A 2AD5A 2BFFA 1Q95A 4PG4A 3MRTA 5T57A 2FQYA 3ODPA 5BV2P 3IS3A 4Q9JA 3TQFA 4CKBB 4LK2A 3E3AA 2WC1A 2W2NA 3NBQA 1I5OA 2G7MC 5L3SA 9GPBA 2WJPA 3KYJB 1HFWA 4GECA 2H7XA 1EM8B 3GPIA 3HB7A 2OSVA 4H16A 2OLJA 3I05A 1ARZA 1J90A 4PF1A 4GBJA 4EWLA 3FM9A 4I55F 3IIIA 4C5AA 1WB9A 5B1YA 4TMFA 3BTSA 3MCTA 1ACLA 3T4UA 2IPXA 1A8HA 5BQXA 1KDYA 2CVPA 4LGYA 5KBYA 3UAVA 2CL5A 3C41J 4B3DA 2WINI 2EBFX 5JDIA 3OMXA 4FS3A 1OWPA 3CURA 4F4DA 4ZCTA 1K06A 4ZT7A 4BNJA 3OP1A 4UEWA 1W5FA 1CUEA 1WNFA 2QTVB 3NUGA 4OAOA 4QXRA 5EJ4A 4YCLA 1PTJA 3AB3A 3N2LA 3ISVA 3ZOZA 1T0IA 4DG5A 3TUZC 3DGEC 1L8XA 4YQFA 3VR6A 1FUYB 1C2TA 2FHPA 1IM2A 5FWXA 4LOIA 3WNCA 2CHFA 3TRHA 4MUEA 1ZZEA 3IQHX 3RRNA 1QE5A 4M9ZA 4IILA 1GL3A 3ONDA 3MB5A 1QYIA 4O0LA 4FOSA 1M8GA 4CQMB 1JDNA 1P3Y1 1TJPB 5GOZA 3V1UA 4DG8A 1UWVA 5I7WA 2CF6A 2IP4A 4HDNB 5AHXA 1CE8A 1U9JA 2OO5A 4A8PA 4EIWA 2W2TA 3EVDA 5C18A 5C8YB 1XJWA 2A94A 2Q6LA 1MB3A 2XI4A 3PDWA 4DAOA 1ZUNB 2O19A 1ISJA 2YHIA 1ZIYA 1NMEA 3E5MA 3EQ2A 1RI1A 3NZEA 3VHQA 2C03A 3HDHA 3GJQA 3Q1LA 4DQLA 4D3YA 5AMXA 1GAEO 1GKUB 1Z25A 3LF2A 2NYRA 2OV1A 2ODPA 2CXPA 1KE1A 3D8UA 4BO7A 1VCMA 1JQLB 3LVQE 1QHNA 1K5PA 2R5WA 1CPYA 3AEYA 5M5BA 2PT6A 1L4NA 4Z0HO 5G02A 1YIAA 4IBOA 3MLAA 4MPRA 4UDOA 3QPVA 2JW5A 3UJ7A 1MDBA 1E1KA 3WV5A 1XQWA 2Y4OA 1Z4QA 4CLXA 2RHDA 1BIFA 1G1MA 1UJ5A 3NJ4A 2F3TA 4KCGA 1VXOA 4FLMA 3MTBA 2RK6A 3MB8A 5BQFA 4R05A 5HYVA 4NYJQ 5B4UA 2G5TA 5FDFA 1DTEA 2XRMA 3KZOA 4HV4A 4DMKA 4LJYA 2EFCB 3BMNB 3JATA 2RK3A 5JJCA 2VF4X 4OM8A 2WVHA 1UJBA 3ZD7A 1Q91A 4LZJA 4ZVLA 2ZJ4A 2WR8A 3ZW7A 4A26A 4KQIA 2BFFB 2QM3A 3INNA 1OIVA 2CFCA 2GEUA 1U4OA 3F1KA 3AVQA 4MRMA 5J2UA 1H0RA 1OBOA 3E0XA 4U63A 2C1ZA 3ZWKA 3E6AA 1SXQA 5KDOA 1KVTA 1UKVY 2I0FA 4HH0A 5D1NA 5L3SB 3NRJA 1YB4A 4GH5A 1TF7A 1ZC3A 3H3FA 1GG9A 4HBZA 1G4HA 1P73A 1U2DC 2CXUA 3E5HA 4IM7A 3RV3A 4Z3DA 3RGWS 1VI6A 4YMTA 3Q9UA 4F56A 4KMRA 1KF0A 1DS6A 1FP1D 4E31A 1OI3A 1JBEA 3E7XA 5EJ2A 1EHCA 2OC9A 4HLCA 1CJSA 2Z1DA 4MQMA 3CISA 1GZHB 3NOOA 2XDAA 1CYDA 3OEHA 4QEKA 1T8WA 1L8OA 5HQJA 3E7DA 3O3OB 3R20A 3VV2A 1A2QA 2QVYX 4ZMBA 4XUEA 2G1AA 5ICEA 1KIAA 5DYWA 4E7OA 3LF1A 4RYLA 3FN4A 5FV7A 3GB9A 1CJTC 2EC5A 2XVMA 2B9EA 3EWSA 2D7CA 2OV2A 3N7AA 1NBMA 2EATA 2LBPA 2ZUUA 4OKSA 4G4IA 5CM2Z 5DM60 2PUFA 4EYOA 2J9XB 1DBSA 4D98A 1I13A 1K27A 5FWXB 2P4HX 4MWOA 4D0LB 2CXOA 2GUWA 3IKMB 4O6VA 5CA1A 1N2XA 1QRRA 3LOUA 2PZ8A 2EW1A 1S2MA 1UMKA 3H2BA 1XKQA 3W9YA 1LK0A 3CBQA 2EP5A 13PKA 4YLYA 5HA5A 1AG9A 3WAGA 1DT5A 1CE8B 2J5RA 4PFSA 5JRDS 3DE5X 3GROA 4A10A 1C7IA 2RGAA 2G9ZA 2YY5A 2A7QA 3E70C 3PF8A 3O75A 2GK6A 2YHIB 4PW0A 4EM6A 2QKYA 2J4CA 1AXGA 3S40A 4MV5A 4YMWA 1RJEA 4KXUA 2QU7A 4M0KA 4EFKA 3I5MA 4R1OA 3EVBA 3P27A 3TL2A 1XZQA 3TSCA 5E0KB 1GG2A 5IAEA 3V33A 4O08A 1K8QA 5LWQA 5BUSA 5IZCA 3L0ZA 2EHDA 5JS8A 1JLKA 3G02A 2IVFA 3A3OA 3A6FA 5DIZA 5HQ3A 4N3CA 3UWKA 5B3JA 4C0HA 1R8SA 2QRHA 2XKAA 2I7CA 3ZHRA 3HL0A 4HEJA 4RTLA 5HVNA 1ZVKA 4NH0A 2V4ZA 5L7TA 1O9GA 2O2HA 16PKA 1B4DA 3Q9NA 1LJLA 1Z15A 1ZBDA 2VAPA 4JLPA 1CUIA 5AM3A 5GVSA 1AMOA 4MRRA 2WILA 1LA2A 3NR2A 4Q9HA 3F67A 3VNBA 4Q9LA 4ROTA 4HLUA 3GEPA 3JATB 2M98A 4XJTA 4Z8XA 3E5NA 4KO3S 1GITA 5SY4A 4NQRA 5FPQA 4AMGA 1SUEA 4B3JA 2Q2QA 3ELYA 4MRMB 1GOTA 2A0WA 1IYZA 2PKRA 1IAVA 2OQIA 1H0KA 3KWFA 3R0JA 4OOEA 5CHYA 5J2UB 4DQKA 4J0HA 1LPPA 2Q3CA 2YHAA 3NWBA 3K70B 1ZP6A 1FDIA 2ZIZA 5EA2A 3V1TC 3IKTA 3UEOA 2Q5LA 1NF3A 4K81B 3EFEA 3F7NA 2XLBA 4H77A 3OO1A 4G5OA 3ZBPA 4CTOA 3A2MA 1QV7A 3L40A 1E0KA 4KN8A 4KN5A 4MKXA 1M54A 1QG2A 4PTZA 5C1OA 4ZI3A 2WJHA 4E51A 2AZMA 3BXFA 4WTOA 2WYUA 2W4MA 3BIXA 3AI3A 1V39A 5ULLA 3KTFA 1RAEA 5AVXA 1PD1A 5D3KA 1X1TA 1VJGA 2OMKA 2TMKA 4ZARA 5HCIA 2VUTA 2X9GA 1ONBA 1R9NA 2PM8A 3AINA 4B76A 1ENYA 3GYBA 4HGPA 1BRMA 1Q83A 4YDRA 5EMJA 3IC5A 1C7ZA 1CUYA 2O7VA 4R7TA 4MINA 4QWWA 2P9GA 2WSSD 3DEJA 3I04A 4DDUA 1F12A 1JAHA 3GPLA 3QE3A 4MZDA 3GUUA 3BKWA 5FI0B 1JXQA 1ZN8A 3H9QA 2C2WA 3UMFA 1PG0A 2VBFA 4OKNA 5CA1B 4YJ2F 4D4MA 2V96A 1MEOA 3I32A 2QV0A 1IBCA 1EJ6A 1UZUA 2HM7A 1AQUA 1OBCA 4BNKA 1N5DA 3WGIA 4CM5A 4EVSA 4TGLA 1V1JA 4S1WA 5K0SA 3LPAA 4HY3A 3AO0B 2D2FA 3ACBA 4QXMA 4WERA 5DK6A 4CEJA 5GPBA 1DIOB 5DU2A 1SQFA 4OGKA 1CZHA 1M8JA 1GKIA 4G1VA 4LI0A 3U4GA 5IF9A 2HNBA 2ZVJA 1ZO8A 1F9EA 4CU2A 1IB6A 4RHYA 1HLFA 1HLPA 1P6XA 1QG4A 4NEGA 1DC7A 1LV8A 1O94C 4QO8A 1H2XA 2ST1A 2XE7A 2OD2A 3IP6A 3PR3A 2P4SA 4MRAA 2GVZC 3PKIA 1E62A 1WUYA 3JW8A 3O8OA 5HQ3B 5EUBA 3LK7A 4YRTA 5LM3A 1U3WA 1NW9B 4H6XA 1H6AA 1E1YA 4WNCA 2Y1DA 4JJ8A 2RC6A 3KOXA 3WLAA 5FD8A 1JNYA 1R74A 3OCVA 1C3VA 3HU3A 2PXAA 4EECA 3ZVMA 1VPDA 2PBLA 5BVHA 1XMQB 3Q3VA 1PFUA 3UUWA 3BFVA 4HB3A 2BHRA 2C2ZA 2WSYB 2OHOA 1Y3IA 5EHZA 2HIAA 1GAQA 2RHCA 1D8TA 3KV1A 4CL0A 1MG5A 2YZKA 1NP7A 4FYXA 3O3MB 2OA0A 2E4UA 3D0KA 2QN8A 1ULAA 1QX3A 4HN2A 4AJIA 2CUZA 4MO9A 1I4LD 1ZGAA 4N1AA 5C4MA 1XAHA 1XTQA 2VQ3A 3MRSA 1XP8A 5IASA 3TPFA 2YR0A 3H16A 4RDXA 1UEXC 2BSAA 5AK5A 1HBJA 2Y6VA 3G5TA 4ARVA 1RADA 1OOEA 1ADBA 2FWIA 2JHGA 5EP2A 1XZJA 2L69A 1SCDA 1GPBA 3LKBA 1V6AA 3ZWPA 2MYNA 2IJGX 3I3OA 3VH4A 4RTRA 3H18A 1RAGA 2VUHB 3QLJA 4BQIA 3BRWA 4GC9A 4M55A 1C3OA 2XMQA 4XKJA 4UTNA 2IXDA 1FSZA 4IZOA 4OFZA 3RIYA 2BBSA 2W7TA 3LDHA 4JZKA 2IRWA 3NO4A 3W2GA 4OGLA 4LECA 4OI0A 1P19A 1O6ZA 2HIHA 1PGPA 4B6GA 4LPKA 3C3DA 4FE7A 5BR7A 2ZJYA 1WUJS 3EH1A 5DDIP 4XFKA 1BEUB 1CRQA 1ZN9A 1DWOA 4QE3A 4X54A 3VTAA 2OCDA 1IWOA 3CV3A 3GX1A 2HUPA 3CIFA 1W48A 2I65A 3GGOA 4GM1A 4BVEA 1KWGA 2ZETA 4DLRA 5TF4A 5UKDA 5DGTA 2WJ3A 5CVTA 1GSHA 2EKQA 2ZRGA 4MS3A 3V1NA 4KOEC 3E2PA 3R6WA 2D2IA 5JYCA 2Q9CA 3QPBA 1Y1PA 3DCNA 3H2KA 4HEA6 4RY0A 2NTYC 2UDPA 1JTEA 1G2IA 1TW3A 3B53X 1LVHA 1OWNA 1T3ZA 3D0RA 5GONA 3FJ1A 4KI7A 1FXSA 1QGUA 3BDAA 4BWFB 4UXJA 5JU6A 2QSJA 1CJVC 4TVKA 1E4VA 3ZZMA 3W6NA 1JHMA 1T1SA 3VR2D 3ON5A 4UU8A 3S2GA 5JZBA 1QP4A 1WZ2A 3FAKA 3IV9A 4CEJB 3G59A 1D09A 3DMDA 4QNRA 5H80A 3KSAC 3LPMA 1G41A 1HE3A 1RS0A 2JFHA 1EBBA 2HXGA 2NSDA 3RE1A 2HF8A 3QIAA 1VKOA 3P96A 4F7WA 1HZJA 3IH5A 6LDHA 3BWMA 3OLWA 2PPLA 3EGOA 3M4XA 4ALMA 3CLTD 4N3BA 1N5RA 3HB4X 1C4XA 1ML3A 1C9KA 2IYZA 3ECAA 5JANA 1FYFA 3MBIA 3LHIA 1HFJA 1M1NB 3O8OB 1N2CE 1PZXA 3AJEA 3JD1A 3LFUA 1VLQA 1LC0A 1QDUA 4Q3LA 3INYA 3URMA 2QEQA 3BWCA 3MIZA 2QLMA 1QAOA 2PH7A 3OZTA 5GJCA 3P4XA 1O4VA 1QTNA 3QJ5A 4N54A 1SH7A 3G8YA 1A95A 1EXWA 4V2UA 3IP3A 2R66A 3FYUA 4A1OA 4ZHSA 5BVHB 1KFEB 5AVUA 1I2MA 2P6NA 2AN3A 2RDMA 4HGNA 4IAOA 5FL7A 3W5IA 4LK3A 5L9AA 1N3IA 2JDIA 1CF2O 4I4NA 4DKXA 2R7KA 1YR7A 3LQ4A 5EJ6A 4EEKA 3EOBI 1BZYA 2YN2A 1EUZA 1UFRA 3SKVA 2Q3DA 2W2PA 5CXQA 4YRSA 2WWGA 3GT4A 4TQAA 1E2QA 3TM4A 4QM6A 4AUNA 1KJ8A 1GU7A 3C24A 1C1HA 1TC2A 1XKXA 1HE5A 3B7GA 3W9SA 2D5CA 5JZMA 1JMKC 4QARA 3BK2A 2KJQA 3PTLA 1FS5A 1U0RA 1CZKA 2P2NA 1YCDA 3G82C 1SXJA 2GJAA 3QRWA 4M6WB 1B16A 1ITZA 2CNKA 4BAZA 1KFBB 1XFDA 1YQDA 2NVUA 3C74A 3I1YA 4PLCA 3KELA 3AKDA 2QZ9A 2GK7A 1C3OB 4CIVA 1BFUA 3OQNA 2Q21A 4MOWA 3DVAA 2VP9A 1JIQA 5I4CA 4N3AA 1GILA 1DC4A 4J0CA 4ZOQI 3A9CA 3G0HA 1P9WA 1U3FA 2PKCA 2CKDA 2F9MA 4HR7A 1ZXLA 3HLYA 4CU5A 4R8LA 4QTZA 1J07A 2FFBA 4G67A 5EP4A 1TOAA 1V45E 4XWAA 2QX6A 4DABA 3IE0A 5JDCC 5TY0A 4HYEA 3WYFA 2V0CA 3KQNA 3UV6A 1C3EA 2PUHA 2G76A 4MS3B 2V54A 2RH4A 4H59A 3GUCA 1ZVVA 1K66A 5CJ2A 4BMNA 1W73A 3A7EA 1IH8A 2X1LA 2ZJ8A 5T4EA 1YE5A 3WFJA 3PFHA 5LUBA 2O20A 2ZDQA 4URHA 2X8JA 5GONB 3IOYA 2R8EA 2WWXA 1QGUB 1W5EA 2VDRB 2DFNA 1CUJA 1JYEA 5DI9A 1DDIA 3UAWA 2IK8A 4RNCA 2X9NA 1FL9A 1A77A 1XYGA 4JJ4A 2WPNA 4MKRA 4EABA 3ESRA 5KUTA 5KHLB 5ICFA 1WMAA 3GFFA 5HCNA 4RENA 3RRBA 4L16A 2ZBFA 1SIWA 1Y8ZA 1Y5LA 1E6UA 1CXZA 1C4WA 5CDHA 4FDMA 2PH5A 1NULA 1IQPA 1ZJZA 2D1SA 2JF0A 5JAIA 5KS2A 5A9SA 2ZM5A 2B94A 1QP8A 3ETCA 4W4TA 5FUYA 4RULA 3C4JA 4LS3A 3L4JA 2NNLD 2VDPB 4CM4B 2XZLA 4HB4A 4RU1A 1TX4B 3B60A 2BGWA 4HQOA 3LSYA 5M29A 1KAOA 3R6LA 1DBRA 1P4SA 4LQCA 4TKLA 3KKPA 1J2UA 3FYUB 3K0SA 3A1DA 3CF0A 3QUBA 2QN1A 4IZIA 4JJ7A 2Z2XA 4LXHA 1LUAA 2YUIA 4OQMA 4XI9A 4FDVA 4XH9B 1G8SA 3TH5A 2GZDA 3HABA 3KHKA 5DASA 1SB8A 1QOQB 2F59A 2HADA 1D04A 4R1UA 5DKFA 4UTVA 1YFLA 4I5EA 3RFFA 2OHHA 4MUHA 2WJZB 2I6GA 3GT7A 5GV8A 4F6RA 4BMVA 3ZDAA 4AN1A 3TM5A 1ZDMA 2NTEA 3ZXYA 4YAKA 3RBZA 1PFYA 3RUDA 2Q3JA 3QY9A 1G18A 1XD9A 5JJLA 1ECLA 1NF8A 3ASVA 2B8WA 3C3KA 3MCAA 2MYUA 5KNLA 5JS7A 1HNZB 1Q0RA 2V4MA 2C4WA 2ZYHA 1B8PA 5HBRA 3RSFA 4JJ6A 3Q40A 4ND4A 4DA6A 1R9JA 2IFTA 5F77A 4PXSA 1OGIA 2QW8A 1SXJB 4OCZA 1NN0A 4AS3A 4B45A 4JQSA 1FRQA 2QF7A 4ZO7A 2NVUB 5IT4A 3WQRA 1CUCA 2BGIA 3E22A 1PJRA 3I9LA 4AQDA 1U63A 4JR2A 4M8IA 3RVKA 3FNQA 2IOHA 2XNKA 1GUYA 2EZ8A 3O1HB 4K46A 2RD2A 3DVAB 4KQMA 1BX3A 4RABA 4LYJA 2EKPA 4BNVA 1K7EB 2PU7A 3UVEA 4BMYA 3EMKA 3TSOA 1I7QB 4KKXB 4NBTA 2NUTA 1H1LA 4L0DA 3O47A 4KR0A 2FR8A 3KVRA 5C51B 1NN1A 3ZUPA 1ANKA 1IE3A 2FPUA 4BS9A 3GXOA 3FSGA 4YP9A 4Q3CA 1T3GA 4HT3B 3PFIA 2NQ2C 2OXRA 1RU3A 3A06A 3EGDA 3F1LA 4ZT6A 1JGTA 1H05A 1L7QA 5EZ5A 1CQJA 5AM0A 4WK6A 1KBZA 3WKBA 1XBTA 3T0IA 2XKBA 1H4VB 2FDXA 1E7YA 1KU6A 2X8JB 4MXDA 1E20A 4XZ3A 5FOWA 3SZUA 3BE5A 4I99A 4G01B 1F51E 4HAZA 4GI2A 2TECE 4O2RA 5J5VA 4YTEA 2BMEA 4HQ0A 2PKXA 2VK2A 1NPDA 3COWA 5AW3A 4DA8A 5ICCA 2F8MA 2HSDA 4KXYA 3V4OA 4IL5A 4RKRA 1E4YA 1QGYA 2JZOA 3DLIA 1ONNA 2GDZA 3L1JA 3MCWA 4JVSB 3ZW9A 1IZYA 3L8EA 1NI4A 4MZXA 3ZHUA 2HXSA 4PBTA 5DRTA 3IE1A 2A5FA 5AVRA 4HUTA 3ML1A 1Z4MA 1X0XA 2W00A 2GA9A 5A9SB 3AH8A 1TKCA 2NP7A 1RR6A 4FS8A 4B7UA 1Q0LA 3T12A 1Z6QA 2GYYA 1Y9EA 1VE1A 2AJCA 2PIDA 1CUHA 3F6SA 1G17A 3FPJA 2WKPA 3PQ6A 1Y8QA 2GPWA 3VKVA 2JGIA 5LBIA 2BCEA 5TLSA 3HJGA 2D1YA 3FBTA 1YS1X 3KUKA 2FUKA 3PVZA 3QEKA 4JU8A 4M37A 4D9MA 3A3KA 821PA 2ZBQA 2WKRA 2F67A 5TEVA 4L0MA 1X1DA 3WHKA 4CV2A 1UZLA 1GIAA 3BDVA 3JRNA 4R0VA 3FRJA 4U7HA 4F6RB 3G0IA 3CO0S 4Y2YA 5CT6A 1LRKA 1MH1A 5HG0A 4BVAA 3QFCA 3U56A 5DLYA 4BWVA 5HUJA 3OESA 2FLVA 3ZGNA 3I09A 1CIPA 4BLUA 3PRHA 1P0CA 2CNWA 5A71A 2WKWA 5K8LA 1WTAA 1APBA 2IH2A 2JI9A 4FBLA 3ELUA 1OGYA 3TR0A 4URZR 2QUKA 4QDOA 4D0NA 5A3QA 4JGBA 4U2DA 3UXHA 5LQDA 4DY6A 1PFKA 4DNXA 1KY2A 3FJOA 2H6EA 3MMNA 4UUOA 2X4DA 5DTRA 3X2EA 3E22B 2FZEA 4DPLA 4MUJA 4BNFA 1K63A 3H9EO 2C5SA 4OK3A 5FWDA 3TQQA 2A9PA 2Q2VA 5DEOA 4HFRA 2A30A 2OBMA 2QW1A 1H2RS 3NHSA 2OV3A 2IOYA 3SLGA 4BRUA 1GT91 1CW2B 3FGNA 1ZX1A 4JUFA 2NUTB 5JLJA 1H1LB 1UKZA 1Z6ZA 3AJAA 1OB2A 5L51A 5DCYA 4DMLA 1FRNA 3ZWAA 1CUSA 1RCTE 1TUEA 3RWBA 5TGZA 4CR7A 2WAAA 1GT6A 2XOKD 4ESEA 1U9IC 3AZPA 3EGDB 1VPEA 3OG9A 3W9BA 4MI3A 2BE9A 4GZ3A 4C4AA 4DILA 5K0GA 1CQJB 1ZKDA 2DBZA 1BHO1 3H5LA 3L6RA 3JQEA 1GGKA 1H4TA 1NYLA 2DPGA 2GD6A 2QT1A 1E9CA 1T5DX 2WU3A 3BAZA 5EPOA 1B00A 1M3SA 1O94D 4RHXA 4KLRA 4QT4A 5JHHB 2XRZA 3NYIA 5A7GA 2QIPA 4WAUA 1XEXA 4WHMA 3STYA 3PYLA 3ZDRA 4F4CA 3GJTA 4IIVA 1W6UA 1AMUA 2YIMA 2PJDA 3D7SA 3NI2A 4W1QA 1WX1A 5WRFA 4BN5A 4ENQA 1T8TA 3U80A 2P6UA 5B58C 2HLHA 4KIWA 1TJ4A 3NEAA 2WJWA 3OM9A 4LNAA 4EGFA 4G0VA 4P5PA 2D2XA 4QECA 2VQFB 1QVWA 4N7RA 1Y6GA 3H7IA 3H2SA 3W3AA 1NI4B 1QO9A 2NZYA 4AF7A 1TJ5A 5EIXA 2QQEA 1QQBA 2V9PA 4D80A 4M6WA 1JHZA 1Y4ZA 5LN1A 3PUKA 1IJFA 1B43A 2VJBA 3JU3A 4LWOA 4X8OA 1Z4PX 4F04A 1AZLA 1NAIA 2AQ8A 2XHEA 2V8BA 4NG5A 3SS7X 1NSFA 1P61B 2Q9AA 1RAAA 3T6KA 5LMNB 4O2BA 1KORA 1MX9A 1L3BA 2FAXA 1Q1BA 2ZTSA 1VPWA 3ZHTA 2CSXA 1Y8QB 1Q74A 5AI8A 1XSEA 3QY0A 4QPPA 5J2UF 3PE4A 4E88A 3INGA 1I14A 2XKKA 3EY4A 1S8NA 3DUFA 4KVAA 4QNMA 4GYKA 3SVLA 1I1HA 3WL6A 3ZY2A 2NYUA 3DEIA 3P9CA 4QBFA 4Y0NA 4RVNA 3TFOA 3FAZA 1C1XA 2AYZA 2WJIA 5F2OA 1R5NA 3LVRE 3VVCA 1ZUWA 5JW6A 2CMGA 2HD4A 3TNDA 2VDMB 1E2GA 4UQPA 4U7TB 3ZV6A 4BAGA 1XRSB 5B58T 3ZE7A 3NTUA 3A10A 5L53A 3A11A 2A59A 5IKXA 5FOXA 1CR2A 1QZZA 1ZU5A 3DOOA 4QUKA 4YRBA 4WFKA 4G5GA 4QBHA 3I8SA 1O9BA 1T9CA 3MOSA 1EEXB 1PWXA 1U31A 3I2GA 4M1EA 3HLTA 2D2EA 6PFKA 2EFHB 3IO5A 4D57A 5C7IO 1D1PA 4UEOA 3AI7A 1W52X 4ZXFA 3VYWA 3D4PA 1A2BA 4ZI5A 2Q8QA 1YR1A 5L45A 4D0RA 5F4BA 2Y1FA 4BFCA 4HZUA 4WK4B 1AQIA 3QOWA 4LJAA 4CT4B 1K97A 1ECFA 2CMKA 4U0JA 2I1QA 3C70A 1N8SA 4I1OA 5LVAA 1YRQA 4V0RA 1OT5A 3PIIA 5CA1F 2WWTA 3PQ2A 1O5TA 1DSSG 3VNRA 1LD3A 1VHDA 1YHYA 5BUZA 1Z0AA 1HYQA 4F71A 2OCKA 3RIHA 5CIQA 2RHTA 3S1LA 1GCUA 3RT1A 5TRTA 5C8ZA 5CFQA 4NICA 1FLDA 1NVXQ 2DYKA 2Z9DA 2IYAA 3C1AA 3GP5A 3TW8A 4KAFA 3JYHA 5E4JA 2ZAYA 3C3WA 1P7CA 4NMLA 3A2LA 3DKPA 3HBFA 3R7DA 3KETA 1H3FA 3JD3A 3NVAA 1S3FA 4IIGA 3QV1A 4G8BA 3LOQA 2FX2A 2I6XA 1GUZA 2EIHA 4Y0AA 4CXMA 3CWCA 5AI5A 2QT0A 1U8CB 3BCRA 1EFPA 1XEXB 3G0CA 5AIBA 3F6RA 2QK4A 4IIHA 1XRPA 3PGMA 3P0IA 3V6MA 4CLEA 3NGXA 3ZQKA 5FIUA 4DV2B 3IP8A 1ATIA 1GAXA 1O95A 4D9CA 1NWHA 4HC4A 4M7WA 4Q7MB 1D0IA 3C48A 4HRYA 4JKIA 1U7TA 4NU0A 3RC3A 4LYAA 1P18A 1H22A 4N0MA 4XW2A 2I91A 4WN3A 2C82A 2FW7A 4JMPA 3K71B 1EVJA 1IG0A 3GMTA 3ETDA 3FPAA 1CKEA 2BUCA 3H87A 3HJRA 2HF9A 3IUNA 1DAIA 1IJKA 3DLCA 1U7XA 3LWDA 3NOXA 3R6DA 3FTEA 5BORA 4PSCA 5HK9A 1QB8A 1A8QA 3KVVA 2BGTA 4A92A 2B0JA 5CLIA 1XN4A 1D0VA 1JDBB 1YUMA 3FPLA 3PEEA 4O2BB 3WTCA 4A0QA 3OC0A 1ZVJA 4HWOA 3GW8A 4YA6A 4FLFA 1E2PA 3CEAA 9LDTA 2PVSA 1MW8X 2W93A 4JI8B 1N5MA 4PQEA 2YJ4A 2FPPA 5K0TA 1Z22A 3DUFB 1TRKA 2ZIWB 1ZH0A 1WVIA 5D00A 4DE5A 2IXFA 2VOEA 4PFKA 4CJXA 1H2BA 3D4IA 4ZTUB 4N03A 5GAJA 1C1XB 3FDJA 3NETA 4F2WA 2A9QA 3T3GA 4NH4A 5IJWA 1FYWA 2XXAA 4AWBA 2F64A 2GSDA 1V41E 3CLRD 3HB5X 4M9CA 4MWEA 1U2EA 5AKGA 4L78A 3GRYA 4POOA 3TF5A 1ESDA 4FKZA 4HS4A 5LYJF 4Q7KA 5BR8B 1PWEA 3AUXA 1WPQA 4ZC8A 4NSNA 1XZKA 4IDPA 2C5EA 4AUMA 2VDWA 2HRBA 3G2QA 3WIVA 2I4MA 3C1OA 4HZIA 1QDLB 2A1IA 3AL0C 5IJ9A 3IUQA 1PUIA 1VKZA 2OAQ1 2IS1A 4ZQHA 4E94A 4GPBA 4HZUB 2ZSDA 4DEVA 1CZNA 2P6RA 5ECYA 5JNRA 2O57A 4I4TA 3NHLA 1JKFA 3EHDA 3TUIC 1U7UA 1L8LA 1TVMA 2AJLI 3B8HA 3LX4A 1K5DA 1Y7HA 3CVUA 2G1KA 3LDFA 1FMLA 1Q3HA 1S1CA 4G5RA 1W49A 3VJMA 1CJKC 4OFWA 2D5AA 2GGSA 4CHTA 3TW8B 1U8AA 2AOUA 3IP5A 4Q4CA 4O4HA 4LI3X 2V7GA 4D02A 1SVUA 2IDMA 1XJ5A 5LXTA 4UPEA 5J23A 1P9LA 1IXRC 1NNI1 1G6Q1 1ZK3A 3WB0A 2PX5A 4QQKA 5EKXA 4BMZA 4OGWA 3SXJA 1IQUA 4MV4A 3H1TA 2G5CA 5FBWB 1Y3FE 1HDOA 4PCVA 1S3GA 5AFSA 4ZYXA 1EXVA 2WHXA 4QXPA 1IMJA 1EFPB 4R1PA 2YJ3A 3KE9A 4L3OA 1A9XA 2DHQA 1S4MA 3EW9A 3IQZA 5J4KA 2ADOA 5CIYA 2XB2A 2CB0A 3QZUA 3FTDA 3OBIA 3PQ5A 3JD0A 4FFNA 4MITA 4EO7A 2CLFB 5JLAA 2IXTA 2AI1A 4YASA 3T1VA 1PTJC 3OU6A 1H65A 2UZAA 2I4TA 2Y9PB 3UG6A 2QOEA 2XGMA 4WLVA 4DLPA 2J09A 3WJ1A 4QGSA 3OWOA 4AP5A 2FOLA 4AZTA 4JBWA 1XIVA 4KO8A 1U3CA 2LWIA 3ELBA 1GTL1 3ANYB 3HGMA 3NIDB 3EZ9A 5COBA 3DMYA 1V5FA 1VRCA 4BP1A 1RJGA 1G16A 3KIPA 2IV3A 4DHWA 1A7AA 2A1TR 4L5JA 1FIUA 2QZPA 3L6OO 4MIOA 4YAOA 2OO5C 1JVNA 3ADPA 3JD2A 4YAIA 5CCEA 3VKHA 1KSGA 2PXCA 2AMLA 2C2GA 3IESA 2JIQA 2C2OA 3SQXA 1OXXK 1T29A 4IYRA 2P0AA 2FPPB 2H1WA 1BC5A 3EHEA 4WESA 3WLNA 5AVYA 3LUGA 1HLDA 2JCBA 3NNDA 5BMVA 3C7CB 5IH3A 2A9KA 2HRCA 5J58A 4AP6A 1WG8A 4AXBA 1JFLA 2CXHA 2XXAB 4C43A 3GPDG 3ZY5A 3U37A 4IV0A 3GHHA 3OY7A 3C87A 5HKAA 1R64A 2PL1A 3H5OA 4MYCA 1BH2A 1L1FA 1SHKA 3A6JA 4YCAA 3TEJA 3DQQA 1R8QA 1ZCBA 1MDFA 1C14A 2D6FA 3PICA 1VZ2A 1ORVA 5JSZA 3BD8A 1MG0A 2VDWB 4ZEOA 4PYJA 1ZYUA 3C5HA 2WJ6A 2G80A 3PDCA 4EX7A 1HOTA 5IJ9B 2WHQA 4MI1A 3TBFA 3HBAA 1UXOA 1VSBA 2R6HA 5G3ZA 2FVYA 1NRJB 4JV5B 1G8GA 3TOSA 1SOAA 1VYVA 1ZXXA 3JZAA 4Z6KA 2VJMA 1SG0A 4I4TB 2YWHA 4ZT2A 4CFSA 2WJGA 1GQOA 4TWAA 3QSGA 4JJIA 4UJ3A 4NFHA 3EQ7A 4ZJZA 2WF8A 1Q7EA 1UDBA 1NR1A 2H16A 2YFYA 5GONF 2DPLA 4II7A 1QLJA 3K70C 2KS6A 1MQAA 4RKWA 4FPXA 2FFJA 5ELLA 3T7KA 1JVBA 1GPWB 4XCQA 1KZ7B 2QTGA 4I5DA 4JXJA 1YHNA 4MYDA 4O4HB 3PUZA 5CFMA 4C0SA 5LXTB 1T9ZA 2AZ4A 2RJ3A 1BO6A 1BMFA 1GRCA 1BU8A 4YT4A 2P9JA 4F96A 4QSHA 1A9YA 3ZCTA 3MS2A 1X6VA 2R79A 1SOUA 3AF4A 1ZI6A 4Q1BA 3W8RA 1IOLA 1E2LA 2ORYA 3E35A 4R98A 4LJRA 4ND5A 1A9XB 1W30A 5HF6A 4RPLA 1V8PA 3FOAA 2OV4A 5KQSA 4A1FA 2X7JA 3GYGA 3VPXA 2WF6A 2QRKA 3CB2A 1TK3A 2BDUA 3HCWA 2W48A 3PITA 4IP0A 1IEWA 3NB0A 3JPWA 1XVVA 3WR5A 1SC3A 4CG0A 5M3BA 1QR6A 4P8RA 1R0CA 2RG1A 4AKSA 4JLVA 1MA3A 1EH5A 1OLUA 1NA5A 4Q4JA 1DEOA 1EVIA 1HTTA 4K26A 4MW4A 1JUDA 5AKIA 2VTKA 1DZIA 3V34A 1E9FA 2XTJA 4HHEA 2Q50A 4FNAA 1OPXA 1RIIA 1E69A 2EFEB 1EA5A 2G6TA 2GN1A 2IELA 1H0HA 2NTJA 1Z83A 4G1CA 2F1IA 1J8DA 4K6CA 2WHPA 4EAQA 4FCCA 4P34A 3RM3A 2I2DA 3PUWA 4J3FA 2TSYB 2EL9A 4WA8A 4ZAGA 2EKBA 4DR6B 4R9RA 2X40A 1TW2A 2IXEA 5I9TA 4FHCA 1LLQA 3UJ8A 2X8BA 3H8WA 1SZCA 5AD1A 4QTYA 1EWQA 3ZCPA 3QTLA 4KO1S 1GAWA 4PO9A 1Z0FA 1ZR4A 3O0TA 4GBMA 4HWSA 3W1VA 2CNNA 4WESB 1IUPA 2NXCA 4QU9A 1L5OA 1B76A 3Q41A 4HZGA 4NK5A 4IHQA 2L2QA 5K3OA 3CPHA 5BMVB 3Q7RA 4JJEA 4A8TA 1DQSA 4ETNA 2B99A 3VQTA 1V3UA 1IBRA 1XD8A 2HCTA 2JH8A 2ZPAA 1VIYA 2FP4A 3GNLA 4FEEA 2FW1A 4TXNA 3V8MA 5A03A 4HMQA 4IOKA 3RUHA 5L7WA 3EZNA 5J2TF 4D3SA 1D7OA 5THXA 1XO1A 1JMYA 4WOJA 4IIDA 5B3JC 2IBTA 2D5IA 4EHDA 3EAQA 2Y71A 1GNTA 3K8QA 3UGKA 2O2EA 4L2IA 1TKRA 1TZKA 4WCVA 1A27A 4LY9A 4ZVVA 3ETEA 4JBXA 2WNSA 3B5IA 3C3BA 4J4TA 5JSZB 3A0RB 2XUAA 4AMUA 4DNPA 4EEXA 4KFUA 4EAAA 5KYYA 2EDAA 2Q4TA 1W5TA 4RFLA 2YMQA 4PYQA 1DUSA 4YQZA 3PNKA 1B0ZA 2FGKA 3DPUA 3JVEA 3T54A 3K1TA 2CDAA 4JBNA 5LBTA 2VJMB 1X8XA 4Q39A 4YONB 1Y4DE 2CCKA 4IV8A 5F1KA 4AZ3A 2QVXX 1HDZA 5HF5A 1YL5A 3KUCA 2HWKA 3PEVA 2D5LA 2ID7A 1RRMA 1MIOA 2PJUA 3E2MA 3M5WA 3LWZA 1OH5A 1IZZA 1AXRA 5ADHA 5LJIA 4FB5A 4NCNA 1BNCA 2M6SA 2VYVA 3IUJA 3I52A 4M7OA 4Y9SA 4UUQA 2K6GA 2YHUA 4AB1A 5BV8A 3U7JA 1W4LA 4OI1A 3A27A 3DTTA 3JQ7A 1PFVA 4F1KA 4RTPA 4EF4A 2CT8A 2FMTA 3LFHA 4Y30A 2PFGA 3BSYA 4Q1AA 3HBNA 4HRVA 3KG2A 4MW5A 1AKYA 1DO0A 2Q45A 3A4MA 4TZ0A 3U3ZA 1JIKA 2V7XA 4UAUA 2WSBA 1X70A 3K9FC 3KQMA 3VSCA 1Y5NA 4O33A 5FQNA 3W3ZB 4LJKA 2Z4RA 2ZRJA 1P91A 2BFNA 4I08A 4H35A 1II0A 5I01A 1QCZA 2DSTA 3IPXA 2ZRPA 2H5IA 4AS1A 2PHZA 3LBAA 3QMWA 3AXTA 1OQAA 2IIVA 5JVDA 2JK0A 1N32B 1Q0PA 1YDFA 3FI9A 3V4FA 2XNCA 1OLUB 1MA0A 4Q4JB 4ASUD 3PPWA 3IXQA 3N0VA 4TL6A 7ADHA 2Q28A 2EJCA 1P5JA 2YH2A 4ILEA 5JNVA 1ZMBA 3WL3A 4UARA 1AB5A 1CJMA 1P31A 4ZAYA 2WHPB 1E79A 4F2HA 2Z2IA 3TQHA 3GXBA 1M2NA 1Y6RA 1YZ3A 3VR5H 4N18A 3NHKA 2BI4A 1VLMA 3DHNA 4LV6A 4LRUA 2FNAA 2XD9A 4H3HB 3IAM6 3U5TA 1M6EX 3ZY3A 4I4LA 1MT0A 2M9MA 1YS4A 3ER8A 1F5SA 1VL6A 2K2QB 4MV0A 4GGOA 2OYRA 4KNYA 3AU8A 1UP6A 2LVBA 521PA 5A3SA 2AR0A 3L0BA 3V7FA 3J81A 3K1AB 5EGNA 2FP4B 1NYQA 4GX5A 4MWTA 4EY6A 2EXXA 2DHCA 3D9QX 4XUCA 2HNKA 4GQBA 4J16C 4CDNA 3OZVA 2NSLA 1VJDA 4YT8A 2FX5A 1UZMA 5ITSA 4L2IB 2C3MA 2PFSA 3G88A 3L93A 3EJ6A 4HAIA 2A8YA 3ZK8A 1SM4A 3A9RA 4GGMX 1RKUA 5KYYB 3PTAA 1K3FA 2PX6A 4DEXA 3ACDA 2VHWA 1UJ2A 4IX9A 3F6PA 2EOAA 4RPCA 5ED0A 3TDNA 1TUGA 4PSAA 3ST7A 1C4OA 2GO7A 1R18A 1TO1E 1S8AA 4Y7CA 1DXYA 1JJFA 2XCIA 4L8YA 5F9MA 5KSZA 1I8TA 4FGUA 3LSTA 2ZAOA 3N28A 1B6RA 3FR7A 4AZ3B 2Q4RA 1NR7A 3KXIA 2BJWA 4MKZA 4NNJA 1D6NA 1RXUA 2W6IA 1MIOB 2QYOA 4UNRA 3W5DA 2XGJA 1Z4NA 4C6SA 3HH8A 1LDNA 2H1LA 3SBOA 2UUBB 1ZGHA 2AT1A 3RVRA 3DB1A 4D9KA 3Q1KA 1H2EA 4IQ4A 3ZLTA 3FYTA 3RVNA 4GEGA 5CDYA 2ZBGA 4ZZ3A 5I9BA 1PWZA 2JCVA 1KKUA 3JQ7B 1ZNQO 4MQ5A 1KSJA 3W6PA 4BMOB 2WVGA 5D5QA 1LTHR 1E2IA 4C89A 1L5QA 1RYZA 2GF9A 4FFSA 4KQEA 4PE5B 5IUKC 1K98A 1VG8A 3BMQA 1DRWA 4UNPA 5ADWA 4Q18A 1QF7A 1RQNA 2GEVA 2IU4A 3GJ6A 3TE7A 3FNIA 4LTDA 4M53A 1IHUA 1PZFA 3JALA 2PT7A 5HJ5A 1WW3A 4X60A 3WQSB 1Z3CA 3IT0A 3PHIA 3IDZA 2QVLA 3UY4A 4IOMA 1Y5IA 4D44A 5JVDB 4DJAA 2GN4A 2O7QA 2DULA 1J0AA 4XM0A 3TI7A 4BBPA 3AF5A 4B35A 1KEUA 3O95A 1NQUA 1HNWB 3HO6A 2A84A 3NAZA 3N6RA 1M76A 5A4JA 4CKZA 1KRXA 1MB4A 2R7MA 3KQHA 2RHRA 2J87A 2Q5FA 3UMGA 1XTBA 2WPDA 1WUHS 4YJFA 4BNIA 2OXEA 2Q1YA 3MEQA 2PRZA 2E1PA 3MJCA 1LV7A 3GAMA 3N8NA 2QLBA 3BBPA 4OHRA 1HRKA 2EQAA 1JMVA 4GX2A 3CHYA 5AOBA 1QU3A 4E2WA 1OU0A 4AMBA 1T3TA 1CR4A 1XK6A 1Y9JA 2FFHA 2ZYGA 3USCS 5IP5A 3IBCA 1ORRA 3EWNA 4H6PA 4PANA 1IWPB 3PXCX 5DHAA 3ZHZA 3EEOA 3WGHA 4Z51A 1DBWA 5K20A 3P5BA 2VPXA 2EX0A 2ZU0C 5AJWA 3K53A 1TF2A 1UC5B 1ZM9A 3KSDO 4OL0A 4OYHA 4B4KA 5B2FA 3GGJA 2OHVA 5EC8A 2XTMA 3R7WA 3AMVA 4N47A 3VU1A 4BX0A 4D7AA 3CX4A 2PZBA 3MJHA 4UU1A 3P9NA 1KO4A 3TJRA 4YRIA 3A8TA 4L50A 3UHJA 4C1NA 2C9ZA 2WNHA 2DH6A 1CLUA 1MF7A 1RIFA 2XGOA 3JQFA 3B6IA 2IE0A 1C7QA 2ORED 1L4HA 1QIGA 3RU2A 1GHTA 1ZCZA 3NTXA 3PYMA 1U8TA 3Q87B 3PNLA 3VOAA 1E5XA 1NU8A 2C57A 4BNLA 3UCFA 3FE2A 4QKQA 3JQDA 3DS8A 2UZ3A 4LRTB 2EARA 3ZHCA 3ESBA 3NEPX 3UOGA 3RC8A 4NZYA 1MXFA 3F7MA 3ZLUA 5A6SA 2JAHA 3ADCA 1FU8A 2ZK7A 4GSLA 4JENA 3SEZA 4WFJA 4EDFA 2QX9A 5HP4A 2OCGA 4E4YA 1CZRA 1DBQA 1OUMA 4C5CA 2EBHX 4HVAA 4N9QA 1SUPA 3UJ6A 2GRJA 4O2AF 1I4TD 1KYZA 1Z7WA 3LWNA 4POAA 3REGA 1E7QA 3M1LA 3MJEA 5IAJA 1VGQA 2PX8A 1SBCA 4H7PA 5K0LA 4MMZB 4WD3A 4DJ5X 5DYYA 1Z28A 1L7BA 1OCEA 4Y3UA 3QNWA 1SKYE 2MR6A 1GKKA 1Z6GA 4DV1B 5HOQA 4ZYVA 2VHTA 4R83A 2P9YA 1B8NA 5C3UA 2FZGA 4GE3A 3WIEA 2BT4A 1NU6A 1YE3A 4BX9A 5EE1A 1EESA 2ODQA 1T1EA 4UDYX 1GGEA 3ZIDA 1G8FA 4ZOAA 5KWSA 5IYZA 2VWPA 3BMQB 3SJCA 2FEMA 1XPOA 2G77B 2VZ0A 2CF5A 1FF9A 1XLTA 3DM5A 4YREA 3ZWOA 5LR6A 2YZGA 3JALB 4JEUA 2FJ0A 4JVNA 3S29A 4O2BF 4XGIA 2XB6A 4FUTA 3LRPA 1U2SA 1YKGA 1EWYA 4BO0A 3SZRA 1Q15A 2C5FA 3MCVA 2J7KA 3FPCA 1HDGO 1FCJA 4XPIA 1YAHA 5I9LA 2OV6A 4ID3A 5K0ZA 2ID8A 1XVLA 2NN3C 1N5LA 4HAWA 1U2GA 4MV3A 5H3HA 1UH5A 3QNUA 1CEQA 5CK4A 1I01A 3OU2A 5FEMA 4E5UA 4YJFB 1ZI9A 2WHRA 4RS3A 1JSCA 3CQ9A 3OI7A 3AGPA 4CL8A 1D4ZA 2VRCD 3NBXX 4WFIA 3BTUA 1T5SA 3KCQA 1O9HA 3AHCA 4LOHA 3WBFA 1JHAA 2BKXA 5B55A 5LZ2A 1ZHFA 1F4PA 2I9PA 3H4IA 3V00A 1UPUA 3R1IA 2IF2A 3LBIA 3R4VA 4ZQIA 1Z26A 2HPZA 2NAFA 2XUKA 1SU8A 3H2JA 4L08A 4QQ8A 2H0RA 2IW1A 1ODFA 1RXCA 4YRDA 5ALZA 4ZALA 3SFVA 1Z45A 3AJDA 3E58A 2QE7A 3HBMA 2ODAA 2PV7A 3G3EA 1GADO 1BSVA 3B38A 1U0EA 4KXNA 4R1TA 1PL6A 3R7WB 3CJQA 5EIBD 1BDHA 4WLUA 1P3DA 4IS3A 1DRUA 4MPJA 3BGIA 4OXKA 5E9JA 2ZTHA 3D6FA 3DTYA 4DDWA 1I6LA 2UYOA 4AYTA 4BZPA 1K92A 5JYEA 4HQ6A 2YQ5A 3MW8A 1R0RE 1C9MA 4AC9A 5H1YA 4RKQA 4AY2A 2AC2A 4PAQA 4B43A 4MWCA 4CMJA 1PVDA 5A9TA 4KYIB 3VPGA 1T1JA 3IVMA 1HOXA 3RH0A 2GUGA 2XV1A 2M32A 3OQIA 1Z2PX 3R77A 1FPMA 2J85A 2WYVA 3FWNA 2PIAA 5A6SB 4LF6B 2PX0A 1GRVA 4IFEA 1MO3A 1MRNA 1PJLA 4GT1A 3WK6A 4AFNA 3HWRA 4IFIA 3RSSA 4YXFA 1IBKB 5BNFA 3AK4A 1H3EA 4LY3A 4ZANA 2QTCA 3H84A 4Z9BA 3STWA 3TSWA 1T2CA 4X71A 3KOUA 1OF1A 1GD1O 3SSMA 1AUPA 1G9XA 4LKRA 3DOFA 2NM0A 1PV1A 3GIDA 3OLXA 3QU4A 4UBMA 4IHJB 1QRAA 5DBGA 3TTXA 3ZGZA 5ALEA 2CHQA 4X64B 3QVTA 5SYAA 1EFRD 4ZIRA 3A1WA 5AESA 3R7AA 1ENOA 2ESRA 2GAFA 2NO4A 1N6KA 2AC7A 2YVQA 3QHPA 4BQSA 3N86A 3WJAA 2LCFA 1GSAA 3CU5A 2QXUA 3KKNA 4JR0A 1PYOA 4RH1A 4FFRA 1JXMA 4UU7A 3RTGA 3SIWA 5AICA 3WVNA 5IYZB 2HU2A 3IJEB 4KMOA 5DJ5A 1E0DA 4HEHA 3Q7SA 4I6EA 4MUBA 2VCYA 2FR8C 6AT1A 4DV5B 3PHLA 2QLLA 3SR3A 4D79A 5KOYA 2CHVA 4I5IA 4HVTA 4PZ0A 1PT5A 1AK2A 3GU3A 3TX6A 2PZJA 1Q14A 1Z5OA 4Q0MA 3LXUX 2NMVA 2P3SA 1UM8A 2F1RA 4XPIB 4E11A 4M9QA 2BRUA 4FGZA 4MA4A 1QGED 4X97A 1AIPA 1FDVA 4FNMA 1L5ZA 4KEAA 1A0OA 4QHTA 2P2ZA 2PBFA 2NSHA 3FW1A 3O2NA 3DTVA 1PWYE 3IV7A 4TRJA 3TMAA 4F0JA 3LLSA 1G59A 4BO2A 1VSQA 2FGJA 4PU0A 2GILA 4RELA 1XJQA 2PLWA 1ZD2P 5G1OA 2QL6A 3X0DA 3I83A 4LVCA 5EJIA 5JR3A 5IAOA 4B3BA 4UM9B 1T3LA 1U28C 3KB2A 3STTA 3OJFA 2VSNA 4F4FA 1KOJA 1U2QA 2WEKA 4ZV4A 2I78A 1MOSA 4PZCA 3TSYA 1RHJA 5D86A 3F97A 1R8XA 3GWZA 2WICA 2ZPUA 1Z33A 4UMDA 3G2LA 5K3EA 4F7DA 4LF9B 2FMKA 4KYTA 1ZH4A 3IIMA 5A2GA 2UYHA 3DPSA 2WMDA 2IIPA 5IBPA 1G8KA 2EQ5A 1ZMTA 4M83A 4I4TF 4MPTA 3R0IA 3HB9A 2AMJA 3G2NA 1ETHA 4OUDA 4ES6A 1Z29A 3AUFA 1EGVB 5L4NA 2CD7A 1I80A 2V6FA 2GRUA 2PRJA 2Z83A 3THXA 4WVFA 1UJNA 4Q9NA 3EPPA 4IS2A 2B4RO 2V97A 4R8VA 5L6LB 3AVVA 4S1VA 3OQIB 1N0IA 3WNDA 1CUVA 5C5DA 1THZA 2BKEA 2ZE7A 1A9ZA 1JA1A 1ORDA 4B73A 5JS1A 3M4ZA 1NMXA 3N2ZB 3E9MA 3A2NA 5GP1A 5H68A 4U7PB 1QH8A 3PFBA 1ESCA 4YECA 1JE0A 2QAIA 3HI4A 4NVRA 5EJMA 1KAGA 1JH8A 1AZSC 1T2AA 1IRXA 3JY6A 3N2KA 4NCKA 2Z57A 3FMOB 1BE1A 1A69A 2VCHA 3NQ41 4FD2A 2E4XA 4I36A 5JCOA 2XMBA 2NIPA 1KZ4A 1NVDA 2MCFA 1W35A 3QU5A 1IHDA 4L7VA 3RIXA 4ZIRB 2H65A 1OWOA 1T0PA 2Z1MA 2OILA 1JEDA 4MW2A 2PX2A 5KMGA 4GMKA 4RZHA 1KAQA 2ZYAA 1VLJA 4YUYA 1Z9BA 4D9EA 5JASA 1R6VA 3FGPA 5LQUA 4LCJA 3DKRA 1JTFA 1A3CA 2OAGA 4BMXA 3L43A 1N8NA 1WR8A 3MJVA 4ND2A 4LA4A 1VXRA 1G5HA 4W1RA 3BX1A 3BFKA 3L4SO 4ZDKA 4XR4A 3PC7A 2QD2A 2VPPA 2W2XA 2AW3A 3RRYA 2VS1A 2F8TA 3M6WA 2F2TA 1RWNA 3GJ4A 4Q5IA 3T1HB 2N3ZA 1KS9A 4RTQA 2XNDD 1Z0IA 1ABFA 2CWWA 2H0AA 1U1CA 3DNMA 2JLSA 3VZSA 3WX0A 2NV6A 5BMVF 3AFNA 3DTVB 3HJAA 3BJRA 2A67A 4P98A 3FIJA 3CC8A 1JSLA 3K9CA 1SU4A 1RAIA 5THQA 4M1WA 2XWPA 2XQJA 3E5RA 4H7DA 4LYGA 3SN6A 1Y1LA 2ZYWX 4G37A 5A06A 3SS8A 3Q6IA 2QL5A 1NBEA 3LC7O 1PJCA 2GT1A 3R7FA 4KX3A 3D1VA 3HU5A 1KDRA 3TWOA 4BB5A 3GMSA 1X15A 1F2DA 4LZLA 2YRFA 3TI9A 3QYFA 5LNK6 2OFWA 3SM3A 4BXOA 3SZMA 3ZU5A 4TV9F 3QVVA 5IT0A 3DDHA 1E2MA 1GPH1 1NFQA 2PNFA 1JR2A 3IV6A 3JYPA 1DKNA 5D6OA 1KK3A 2GN8A 3QVXA 3BCHA 3C0KA 4KQ1A 4R1LA 3SR0A 4A91A 4AMZA 2FSGA 5DULA 3GAZA 2BN4A 1KS2A 4NFYA 2PKYX 4V0MA 4OUDB 5AW4A 2DWOA 4LSMA 1U94A 3E82A 1SBZA 4FJ1A 5CGQB 5JD6A 1ETUA 3H0KA 3G8DA 3LDGA 1KEKA 2VP4A 3N7UA 1JEEA 1SQ5A 1G8MA 1Z5UA 2MJLA 2D0IA 1QM5A 3LT5A 4J0FA 4UJ5A 2DTEA 3E8SA 3M70A 4DBVO 4IJWA 4L28A 3ZDFA 3ZJYA 4JT8A 3THXB 1KK0A 5MN5A 1P7VA 3ENZA 4ZT3A 1AV7A 4LOJA 5DLPA 5HE9A 5CT4A 1NOJA 4X6UA 4AW9A 1MX3A 5HJ7A 1KHHA 5IDVA 2IV7A 3H83A 3VAYA 4PC7A 1A82A 2E1RA 2FFQA 4Q4DA 4Z0PA 5LQCA 1W5SA 1HY3A 1DADA 2VK4A 1QH8B 3IR5A 5AUOB 2R8BA 1AUQA 1G6OA 1E5VA 2FFAA 2I7DA 1FFGA 4C4RA 3EISA 2VAXA 1VMEA 3F49S 3N2KB 2JS7A 4FEGA 1T8RA 4TVBA 1UK8A 3MGAA 3TZQA 2WKQA 4EB3A 4ESOA 2UVQA 4P22A 1JLRA 1M0SA 1U1GA 3HCCA 4QTUB 2BZ0A 1G55A 1XEAA 2BF7A 2Y1KA 3EZFA 4PNPA 3AL2A 1CQPA 1Z6PA 2HRQA 4YBZA 4MW0A 4QTXA 1NQWA 3AVPA 3KYCB 5KMGB 1E1QD 2XZOA 3ENQA 2HHJA 3AOGA 1FXWA 1M2HA 3A9WA 3CINA 1U04A 4I50A 1XB2A 5A0TA 4UFNA 1XZMA 1ZNYA 1I6WA 3Q7PA 2NQTA 3E8XA 4GM0A 4RL4A 3TZKA 3U16A 3JX9A 5AVKA 3WAKA 1SOMA 4Z3OA 1M2KA 2MMCA 4WEOA 4US1R 4ZZ2A 1P5FA 3V8EA 5ILGA 5DNUA 2CFSA 4QYTA 1YS6A 2ZJOA 3ICWA 3DT8A 5LFAA 3NFRA 1QQ6A 4L5IA 2C20A 2RI0A 2P9CA 2XCRB 5AVWA 4QQNA 2RAVA 1SVSA 1DVRA 4XYLA 1KH3A 3BQ9A 1YRBA 1AD2A 1VE6A 1ZG3A 2OD9A 3ND6A 4MUXA 4JLAA 1YVUA 1QK5A 2JJ1A 1PZNA 3ZY6A 3ZCUA 4X92A 2C7PA 3VPHA 5KX5F 3DOJA 1MH9A 5SZKB 4IWNA 4KNVA 4BE7B 1C0IA 2VJCA 4B83A 3KLNA 2GBCA 1JXOA 4BFVA 1Z3IX 4IG4A 1XXHA 1K08A 2UUCB 4LF8B 2YV2A 3DLPX 4ERXA 2H1SA 3A25A 3SXUA 3A6KA 4AKGA 1B0UA 1O95C 3BM5A 4PHGA 2AN9A 4DSZA 1NVBA 2PS9A 1XMSA 3OZBA 4IGFA 4GBED 4HGRA 4PFJA 2EGHA 5ERXA 1ZESA 1B74A 1YR6A 1R0BA 1WEHA 4HWKA 1JFTA 1I0ZA 3UA3A 1JJIA 1A04A 4BXOB 1HZZA 1RQ7A 4AYXA 4TVSA 3ES9A 3CEMA 1M75A 2VP6A 4N12A 3P7MA 3BYZA 4BVGA 1R4AA 1PW5A 1NJ1A 2B9VA 3NVDA 2R7AA 4XM2A 2OTCA 3SEFA 3SHFA 3AZQA 2FZ4A 3T3DA 3DVLA 5JS6A 4TT8A 1N78A 4C76A 3QTBA 2UUPA 4URXR 3SBDA 4CUKA 1I4DD 4L8WB 3OZRA 4BFLA 4DIMA 1NT2A 5FO0A 3ZJ4A 4ATNA 4OYRA 4CMEC 2IXAA 1FC0A 3PEUA 1IN5A 2OENG 2VUUA 3VI3B 1FFCA 3H1BA 3PKZA 3ZNOA 3Q4GA 3QBTA 4UVIA 3IBSA 4DR4B 3GNSA 2P4QA 1G8PA 1OAKA 3RIMA 1XZHA 2EIXA 2ZUWA 4I14A 1WZCA 4EHHA 4RFVA 1W1WA 2TMYA 1QE3A 2XB8A 5CNKA 3UT0A 1NW3A 4F5WA