4BVLA

Structure of 202-208 deletion mutant of phaz7 phb depolymerase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
335
structure length
335
Chain Sequence
b'LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHB DEPOLYMERASE PHAZ7
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
total genus 127
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bvlA00
5DYYA 1QO7A 4EA6A 5AIBA 1SOMA 3M81A 4PV7A 5HF6A 2Y2UA 2OGTA 3IA2A 3G02A 2AJDA 2VATA 2ZYSA 3WZMA 1LGYA 2VAXA 1HPLA 4M0MA 5BOVA 3AINA 4AXBA 5BWCA 5AOCA 3FNBA 3WL8A 1G5FA 4M0FA 1UOQA 2WSLA 4EB0A 2XLBA 5DLPA 1SCIA 4OD0A 4KRYA 5SYNA 5ALVA 1GPLA 1XZBA 3H1BA 4HXFB 5IVHA 2BGRA 4W1PA 1VA4A 2QOEA 2QZPA 1LPPA 5C8ZA 1E66A 1JJFA 1ZGCA 4IO0A 1BRTA 5ALSA 2GYWA 4CG2A 2DQYA 4BCBA 4CIBA 2ES4A 4OCZA 2XMRA 3CCBA 3PFBA 1QIGA 1QE3A 1O6GA 3DQZA 1C7IA 4GWLA 3WYNA 2PL5A 2OXEA 2HHAA 2RHTA 2AJCA 4JH0A 2JEZA 3LLCA 4OUKX 2XMBA 5FV4A 3O0DA 1TRHA 1G4HA 1GXSA 4UHHA 3WWPA 3KDAA 5CMLA 2FUKA 2PSFA 3C6XA 4F5ZA 4V2IA 4B9EA 5HZGA 3UUFA 5AKHA 1UOPA 1WPXA 2XB6A 5AK5A 5AK6A 5LKAA 4Y2XA 4RGYA 4UBMA 4LXHA 3V1KA 3G0BA 2ZSHA 1EA5A 1ZJ5A 3G7NA 2JGEA 4YK7A 3IURA 3RM3A 2C5FA 1HKHA 4PSDA 3DL7A 1A88A 2WKWA 1L7RA 4BP9A 2H7YA 1IZ7A 4Q05A 4B9AA 5A2GA 5ALIA 5FOQA 4XVCA 1G66A 1XKTA 1J07A 5HK9A 3SK0A 3R0VA 3H2JA 3K2IA 4Y2RA 2J4FA 1AURA 1JT2A 3IUNA 5KWIA 3FVRA 4H77A 2PM8A 1MNAA 2V97A 1W1IA 2XUPA 3B12A 1FFCA 5ALQA 3W05A 3O4IA 3EIOA 1HBJA 4X90A 1BCSA 1CIJA 5AKEA 2W22A 2XUJA 3TEJA 1O6FA 4BRSA 3F67A 1XQYA 2WG1A 3ANTA 4W1RA 5EIEA 4MEBA 5JAPA 2C7BA 1E8NA 4C6HA 3H2HA 1BN6A 3IULA 4FBMA 3VDXA 3G0GA 2B61A 3C6BA 4C01A 1J2EA 3ZV7A 3I2FA 1LBTA 3U0VA 2QXUA 4MYDA 4MWSA 4B82A 1GT6A 3NOXA 3STYA 4LKOA 5AK4A 2DHEA 4FFWA 5K5EA 1VZ2A 4JUIA 2RHWA 1R4ZA 1UZAA 4PF1A 2UZ0A 2HU5A 1E89A 4AMZA 1BN7A 3UUEA 4Q1VA 1YS1X 2GBCA 4K2AA 1Y37A 3C6YA 2JEYA 3QMVA 5FP0A 1PFQA 3D59A 3I6MA 5CW2A 3QYJA 2IIVA 2BJHA 3R3VA 2GYUA 5JAOA 1C7JA 1CUZA 2HFKA 3L1IA 5AKYA 2WJ6A 4X85A 1OILA 3FAKA 1TCCA 1HDEA 4LHEA 3S2ZA 1UK8A 4XIIA 2VJCA 3I6YA 4B84A 1QIHA 4HVTA 2XMZA 4N5HX 5EHZA 3R3UA 3VVLA 3GFFA 3R3ZA 2QTBA 3EF3A 2D5LA 5LKRA 3DYVA 3GROA 3CCCA 3ESCA 5HFAA 3I2HA 1A8SA 3C43A 5AKZA 5T4FA 3WIBA 1JJBA 4QWWA 3STXA 3PFCA 5AK3A 2O2IA 2QJRA 2DQZA 1UK7A 1ORWA 4FBLA 1XZDA 4BVKA 1CUAA 5FPPA 1MN6A 4CG1A 3BIWA 4XX1A 2JGIA 1YA8A 2Y6VA 1GKLA 4HTAA 5HQ3B 4C4YA 5I7UA 5F4ZA 5HF8A 2PU5A 4Y2PA 5EGNA 4M0EA 4J0DA 3GUUA 1NU8A 1MAHA 4QDZA 2ZSIA 1CUEA 5ALXA 3TGLA 1N1MA 4KR0A 5T4HA 2OCKA 1CRLA 5K3FA 4UFPA 1ZI9A 1XZMA 3DLTA 3WK9A 1UOOA 2HA7A 2WHRA 5AKIA 1UWCA 4BATA 5AI5A 3ANSA 5T4BA 4UHCA 2PSJA 3G9ZA 1A8QA 4DMFA 1FFDA 1MU0A 2EDCA 2XMGA 5HK8A 1VZ3A 1MJ5A 1OXMA 3IUMA 2CMFA 1YA4A 1XKLA 3A2NA 5K3AA 2YASA 3ED1A 3H0CA 3K9BA 4KAJA 2ZYIA 2VTVA 4OU4A 2EDAA 3PE6A 2FX5A 1AGYA 3IB3A 3MUNA 4LYEA 4DGQA 2RGUA 1ISPA 5LZ9A 2HA3A 2G5PA 5ALKA 2E3JA 3AZPA 4MXDA 2PPLA 3IDAA 3OM8A 5AO9A 1XQWA 3A6ZA 1HLGA 1XRRA 1EINA 5KREA 5JYCA 4NVRA 4ZGBA 4WFKA 5C8XA 1A7UA 4OB6A 1MO2A 4DMKA 3OOSA 1CUXA 1AC5A 4P9NA 2YH2A 3DEAA 1N5MA 4J0IA 5JZSA 3O9MA 4LIPD 4WFIA 1Y7IA 3DKRA 3PDCA 1JU4A 2BAGA 2Y1KA 3CN9A 5FLKA 2LIPA 3H18A 5FUMA 4WFJA 1K8QA 3DDUA 4BCCA 4Y7DA 5JAHA 1P0PA 1ZICA 2OCGA 4P92A 5LZ5A 1YAJA 2VJBA 4FHZA 1CUGA 4X00A 4GHWA 4W63A 3C8HA 4IH4A 1RP1A 3GA7A 1JMKC 1WOMA 3IIIA 1CVLA 5AJHA 3KD2A 5CRIA 3DL4A 2B9VA 4UBIA 1XFDA 4JNCA 1EVEA 4G4GA 1CUCA 4H0CA 1LPNA 1ETHA 1YB6A 4GW3A 1KU0A 4BE9A 4G4IA 2BCEA 2PVSA 1R3DA 5AOBA 4BBZA 5D3KA 1IUOA 5EHQA 4G9GA 3SWWA 5JASA 3O95A 5C81A 4NZZA 2XQFA 5LZ8A 2WJ4A 3A2LA 4EUSA 3HXKA 5ISMA 3H2IA 4RNCA 4UPDA 2OG1A 2JGMA 1VXRA 5ALFA 5HFNA 4UHBA 1H2WA 4U2GA 4OB7A 3WWEA 4N8EA 3M83A 2XT0A 1N5RA 4XWGA 4E11A 2CUTA 4BYMA 1VA5A 3I2JA 5BV7A 5LZ4A 1TAHA 5AI0A 2QUBA 1WPRA 2HDWA 2JBWA 2GZSA 2WTMA 4MQLA 4I4CA 3W9BA 1CUIA 3STTA 1QIKA 4ARBA 5CH8A 4LXIA 1T2NA 4B0OA 3UMJA 1H2YA 4X6YA 2ZJFA 4EY6A 3ICWA 4A5SA 2HRQA 4BAZA 1CFJA 1ACLA 4ZWNA 2ACKA 4HRYA 3OC0A 3VKFA 5AM4A 4UUQA 2P8SA 1ZGBA 4J0CA 4GXNA 4E14A 4FDMA 5AI6A 4A16A 4EBBA 1XZJA 4NMWA 1DWQA 3LIIA 5E4JA 3WWCA 4MQMA 1LPBB 4PO3X 1OCEA 2XUKA 2PSDA 5ALLA 3EQ9A 3C87A 3L1HA 2Z8XA 1XRPA 1DQZA 3WKDA 4F0JA 5E2IA 3DOHA 2Y2VA 2JGLA 1CLEA 1F8UA 4UFNA 1QIDA 1B6GA 1QTRA 4NS4A 2OLEA 1MNQA 1CR6A 1XZLA 3G9UA 2AJBA 2OAGA 3H17A 2I3ZA 2HL6A 3B3QA 4EY4A 1FFBA 1TK3A 5A71A 4Y2UA 4X7BA 3VXKA 1BE0A 3RK4A 4FFVA 1GQRA 3O9VA 2QUAA 5AM2A 5D7BA 4Y2SA 3V1MA 4GDMA 4UHEA 5HF9A 3KSRA 4DMHA 2PSHA 3IUJA 5CH5A 2X76A 3KWFA 3BJMA 3FYUB 2XQGA 3FWHA 1QIJA 2VEOA 3X3HA 4KACA 3V1LA 4C4XA 1DU4A 2IITA 5DNUA 3ZPXA 4A23A 2C0QA 3H04A 1E8DA 4X97A 4DTCA 3VJMA 3QM1A 4UBOA 2H9YA 4ZRDA 3FYUA 5E4YA 3LS2A 3HRHA 4KE9A 3AZOA 4P93A 3VVMA 3OTQA 3EQ7A 2CEKA 4AN0A 2HFJA 2WIDA 3HACA 4FTWA 2OGZA 5ALHA 4F60A 2HM7A 4XJVA 2WUDA 3ESBA 3W2TA 1QZ3A 2WG0A 1FSSA 3MGAA 2BFNA 5AP9A 3STVA 2WHPB 4FNGA 3WI7A 5A7FA 4QZVA 4QEKA 5AI8A 4EY7A 1Y7HA 2YYSA 5LYYA 3HSSA 2PUJA 4HXGA 1CUDA 1ZD4A 2WHPA 3ESDA 2OCLA 4U2CA 1WCYA 1XRLA 2X5XA 2NW6A 3CXUA 3HJUA 1W6RA 4K6GA 2OGSA 1Q83A 5K3CA 3WK8A 2XUIA 4QE3A 3FLBA 2JGFA 1AZWA 2ZYRA 5AKXA 5CXUA 2WQZA 1H2ZA 2XUOA 4LXGA 3ILSA 1Q84A 3O4HA 4DMCA 5JZBA 4QLOA 4H7KA 2QKYA 4K6KA 3W04A 3D7RA 3HYSA 4IQ4A 1E3QA 5AHXA 4DIUA 3WA7A 2XQJA 4AO6A 3WL7A 3PUIA 1XRQA 2VAVA 3ESAA 1P0MA 3KXPA 5AM0A 2K2QB 3ZLVA 1WB6A 1TKRA 4FOLA 4JEIA 1VOTA 4ZV7A 1MX9A 3PI6A 1WHSA 5JZ9A 4PNZA 3VJKA 3EBLA 1U65A 5IKXA 5A7GA 1YR2A 4U2FA 1PJAA 4N5IX 1CUUA 4OSEA 4B83A 3SC2A 1K63A 2XMSA 2AJ8A 1K4YA 3R40A 1WB5A 1CUBA 5SYMA 1XQXA 5IVIA 3WL6A 2B4KA 1UKBA 4BP8A 4C4ZA 3G9TA 2FJPA 5JANA 3DYIA 1R50A 1XZIA 4X6XA 1IMJA 4Y2JA 4HS9A 1GQSA 5AI9A 4J0GA 5FPQA 1FFAA 1LPOA 4DYHA 1DWPA 5K3FB 4QA9A 1E5TA 4TVKA 2BUAA 5IH7A 4AO7A 3I2GA 5AIAA 4OU5A 5CBKA 4BC1A 1QTIA 1UKAA 4ZV9A 1ZOIA 2R11A 3FVTA 4U2DA 4W1QA 2I03A 4B80A 3N2ZB 4B0PA 4KEAA 2C58A 5AICA 3I2IA 3WIOA 4F21A 1U8EA 4X93A 4KE8A 3WLAA 4IH1A 4HAIA 3RARA 2GBGA 5DNWA 3AILA 1GPNA 3WL5A 2RI6A 4U2BA 3LIPA 2O2GA 3WKEA 2HA0A 1AMNA 3AFIA 3QZUA 2QM0A 3RLIA 1U4NA 1YCDA 2BGNA 3GZJA 1XZCA 3G0IA 1I6WA 4X91A 5EHXA 1SFRA 4QDUA 4DSZA 4QDXA 1QGED 3OURA 3G0CA 3HZOA 5HF5A 1DINA 1QOZA 4FLEA 4L3WA 4P08A 2XUAA 1JKMA 1L7AA 5IVKA 1KU6A 4CCYA 2DCMA 5EIAA 1VKHA 4DNFA 3WK4A 2G4LA 3E4DA 4W9RA 5EIHA 1THGA 4Y2VA 1WM1A 4X3CA 2AXEA 2PU7A 1EB9A 5ALWA 5LZ7A 3WWOA 1X70A 5I9IA 5LLSA 1XZEA 3HI4A 4WY8A 1QIEA 2VA9A 4OYYA 4J3JA 4FLFA 2XMQA 4S0XA 2PKYX 2CB9A 2CJPA 4KJXA 1ZD3A 5CT8A 1T4MA 1CQZA 1XLUA 1MTZA 3FSGA 3EQ8A 3B5EA 1Q0ZA 4LYDA 5K3BA 2WUGA 2DHDA 3BXPA 1RYYA 3OG9A 3H2GA 1N8SA 4WDRA 2WU4A 1K6EA 4BRZA 4QWMA 1SCKA 2WUFA 5ALRA 1ZI6A 1AQLA 4OPMA 2HA2A 4KE6A 4U2EA 4EZIA 3Q8WA 4G9EA 3HC7A 3ZLTA 1CUFA 1VE7A 4H7HA 3G9XA 2XLCA 2HRRA 3ZI7A 2RIPA 3DNMA 2H1IA 1XZKA 3WKBA 1R88A 1U2EA 2JGJA 2QVBA 1WB4A 5JIBA 4Y2QA 2ONCA 1J1IA 5DNVA 3HLKA 2ZVDA 1R1DA 5AM3A 1GGVA 3BWXA 3I2KA 1CUHA 2HU8A 3BL8A 4H7JA 2H7XA 1NU6A 3IUQA 4Q82A 1DX6A 3FBWA 3A2MA 4BAGA 5CTAA 5D6OA 1BS9A 1QIFA 1QFSA 1EI9A 3WMRA 2QRUA 2FJ0A 2G5TA 1LLFA 2WJ3A 2QMQA 1XROA 2VJAA 4KE7A 3C70A 2VSQA 1XRMA 4X92A 2QJWA 2WUEA 1F0PA 2WU3A 4HRXA 2WFLA 4DSAA 1YASA 2CKMA 1FJ2A 4C87A 4N8DA 1PV1A 4ROTA 5T4EA 5H3HA 1JJIA 4AX4A 4QLAA 3A70A 1VE6A 3QBJA 2DR0A 3PF8A 3P2MA 1M33A 3ICVA 2DFPA 5FXMA 4AQDA 1CV2A 3FCXA 2PX6A 4UHFA 3FYTA 1EXWA 1MX5A 4L72A 3BDIA 2PBLA 2OPHA 2WFZA 5JALA 4UBKA 2DHCA 5K3EA 2RAUA 1HQDA 5JD6A 4DLNA 3I1YA 2C0PA 3H19A 5LP1A 3STUA 4X6UA 4Y2YA 3G8YA 3LCRA 2OQVA 3U1TA 1W76A 5IVDA 3D0KA 4G1FA 4RE5A 1E8MA 3JW8A 4G8DA 3C5WP 5FDFA 5ALPA 4BAUA 3E0XA 4FMPA 4FWBA 5A62A 4EY8A 5LZ2A 5DTIA 1ZJ4A 2HU7A 2V96A 1XLWA 3GBSA 4ITVA 1BU8A 4Q3OA 5ALUA 4BZWA 3WQHA 2Z5GA 3DS8A 2VT7A 2WIGA 4KAFA 1W52X 4HXEB 5ALYA 1G42A 4KAAA 5A6VA 3G0DA 4UBJA 3SX4A 5YASA 3L1JA 4BTVA 1YS2X 2Z3WA 4GEGA 4INZA 2VQ6A 5E4TA 1LBSA 2OCIA 4AB1A 1IZ8A 4H7FA 4H7EA 1MPXA 2XUHA 3R3XA 2WHQA 3QH4A 1VLQA 5EFZA 4J0KA 4BB0A 2ZYHA 3FLAA 3W9UA 1EH5A 6YASA 2Z3ZA 1LPSA 2ORYA 3BIXA 3HABA 3M82A 4AO8A 3ZWQA 1H22A 1FFEA 3D2BA 1EK1A 3QPAA 2XUGA 4B6GA 5AKGA 2PUHA 5DTJA 2H7CA 4J0HA 1XZFA 5ALTA 4AN1A 1QJ4A 5HKBA 3PF9A 1DWOA 4UBLA 4AZ0A 3F97A 3AZQA 1IUPA 2XMCA 5DYWA 2XUFA 4PW0A 5CXXA 1CQWA 4BDSA 3IBTA 3PICA 1LNSA 3D2AA 1UKCA 3C6ZA 5AM5A 1ORVA 2EEPA 2QT9A 3MVEA 1MT3A 5CT5A 3V1NA 3F9CA 5KBYA 4RE6A 4MEAA 1ZD2P 1USWA 1A8UA 4G8BA 5K3DA 1DX4A 1CEXA 4MWTA 4WCVA 5JADA 2CZQA 2HA4A 1TQHA 3I6ZA 4I19A 5ALGA 1ZIXA 4B81A 3C45A 3LP5A 2XQKA 1H23A 3QPCA 5D3ZA 1YSCA 4L0CA 2BKLA 1LZKA 2Y6UA 1LPMA 1UK9A 2B20A 5JARA 1UT6A 4QNNA 4WDQA 2J4CA 7YASA 1YB7A 2WILA 2WLSA 1EK2A 2VJDA 1SC9A 1GZ7A 1X2EA 3QMWA 4FNMA 4Q3KA 3VJLA 4K6HA 4Y9SA 3WA6A 5J3JA 2WIJA 3E1GA 3R3WA 4J0JA 4DM7A 3FOBA 4D9JA 1DQYA 4YPVA 1LZLA 3N0TA 4IHAA 3JYHA 1B41A 1C4XA 1XQVA 3H2KA 4ZREA 4YX9A 2ROQA 1QONA 5EI5A 3OPMA 4H35A 1QIIA 2VF2A 3MUOA 4GBGA 1EX9A 3S8YA 3WYDA 2WG2A 4FKBA 4WY5A 2YXPX 1GKKA 5LIPA 3RKSA 3R3YA 3PUHA 1JFRA 5EHNA 4MYSA 5CT9A 4BDTA 4K5QA 1QFMA 2GBFA 2O7VA 1D07A 2Q0XA 5DYTA 5JAUA 1WHTA 5HCUA 2JGKA 3NGMA 3Q0TA 3E3AA 1XLVA 1MAAA 1JU3A 1BEZA 1KEZA 4JYMA 4DNOA 1ODTC 4BZZA 1UK6A 3M3DA 2GYVA 1CUSA 2QR5A 1CUJA 3QVMA 2BUCA 1EDDA 4ZXFA 2I78A 3AUKA 4H18A 4GECA 1Z68A 1UXOA 3WK7A 1CPYA 2XDWA 3F96A 3D2CA 5DWDA 1AX9A 5KWJA 3WWDA 3BE8A 3IVMA 4E15A 4EHBA 5AI4A 1ZIYA 1YAHA 3FYUC 4EY5A 2JIDA 5ALDA 3CN7A 3DCNA 3V9AA 2V98A 3O4JA 1XZAA 1AUOA 1JMYA 1ACJA 2W6CX 3DD5A 2C5GA 3T4UA 3BF7A 4X94A 1W4LA 3DOIA 1UFOA 3C8DA 4Q34A 3AIKA 4OYLA 3AIOA 4H7IA 4BC0A 3T52A 3I1IA 4CI9A 4BVLA 1BCRA 1XZHA 1DT5A 2ZJ7A 2BUBA 4RPCA 2JF0A 4J7AA 1BEEA 1ZD5A 1QLWA 2WM2A 4HZGA 2CBGA 2VT6A 2J3QA 4WJLA 2R8BA 2G63A 3DJYA 4G8CA 1QO9A 5HQ3A 2PSEA 2ACEA 4I3FA 3V48A 4GLBA 3KOOA 4W1SA 5FRDA 3FLEA 5DJ5A 4N8SA 5I8PA 1TIBA 4CCYB 2OQIA 5ALOA 3NUZA 3WK5A 5ALMA 1BROA 4ZI5A 1X2BA 5ALJA 4QDOA 5ESRA 4Y2TA 4TPKA 3D4LA 2WTNA 3KWJA 4X71A 1NX9A 2X8BA 4YASA 4UFOA 1RWQA 4UBNA 3TJMA 2D0DA 4L9AA 4O08A 4DNQA 1XRNA 4PSUA 3HEAA 4CFSA 2GZRA 1ODCA 2WIKA 2XUDA 5AOAA 5ALNA 1IVYA 3WJ1A 3WZLA 1ZI8A 2XQIA 5ALEA 5AKLA 5CT4A 4BCDA 4AZ3A 1F0NA 2WFMA 2J3DA 5FKJA 4UHDA 4X95A 1CUWA 5AKKA 4AMYA 1JI3A 1SCQA 1Q0RA 3D5EA 5JATA 4MJ3A 2I3DA 1J06A 5AH0A 1P0IA 3QMMA 1S8OA 3BDVA 1EB8A 1VJ5A 4J03A 2HIHA 3FCYA 1P0QA 4G5XA 3WJ2A 2AJLI 3F8SA 3QITA 2HA6A 3C5VA 2C4HA 4JYPA 1R9NA 4KYVA 5A7HA 3STWA 5C7YA 2ZJ6A 4C89A 1LPAB 2XI4A 1TCAA 4BVJA 3H1AA 4DNPA 2OAEA 4Q3LA 1W75A 1H2XA 1L7QA 1TCBA 2XMDA 1GPKA 3D3NA 2O7RA 4BTLA 3FSGD 4B85A 3AJAA 2RONA 3F98A 1THTA 4GI1A 1IUNA 4H7DA 4G4JA 3WK6A 4PQEA 3BF8A 5ALZA 5CH3A 1EVQA 3TRDA 3WKCA 2IX9A 4KRXA 4CG3A 2WFLB 5JD4A 2HA5A 1F6WA 2XE4A 1CUVA 4ARAA 2QXTA 1EDBA 3O4GA 1R9MA 5AKJA 2HADA 1ODSA 4OB8A 4E46A 4FLMA 1AKNA 1EDEA 3W06A 1DT3A 4Z49A 1EHYA 2QS9A 5C8VA 1CUYA 2ECFA 2O2HA 4C88A 2WIFA 3AIMA 1MX1A 3GELA 1QIMA 5BWBA 2DSNA 3JWEA 1XZGA 2V9ZA 3ZLUA 1K5PA 4BE4A 4ETWA 3I28A 3NWOA 4B7ZA 4QDTA 1VXOA 5CT6A 3DKKA 3K6KA 3YASA 2Z8ZA 4PSCA 2GBIA 3WKAA 4TGLA 3VISA 1HL7A 3R41A 2XUQA 5HKAA 3BJRA 4CIAA 5JD5A 4CCWA 5AM1A 3QPDA 1DTEA 4IH9A 5CURA
chains in the Genus database with same CATH superfamily
1NZFA 5KNBD 2ZJZA 4CM7A 1M8PA 2VLIA 1TJ4A 4EA6A 4FMDF 1MEEA 2FEKA 5EJMA 4OG2A 3UC5A 1XA4A 2YYAA 2RGEA 3AO0B 1VKZA 3BFXA 2O0KA 3NBYC 1NGSA 3PC8A 4RPJA 4DTIA 2OBNA 3IQFA 1KAMA 4HN2A 4CKZA 3PQEA 1EAMA 4FPXA 4JNKA 3W5JA 2DWUA 5IAOA 1T5OA 1PR6A 2O2XA 2BD0A 3OQIB 4WNIA 1OREA 4M1MA 4RGVA 3TBFA 4FC7A 1TEHA 1Z26A 4ECEA 2QRNA 4Y8VA 4M9RA 5DBFA 3NDIA 3ZCVA 1VL5A 2HZ7A 3PEYA 2G76A 4Y6OA 2ANBA 4ZVVA 2GOYA 3A1TA 3DAYA 5IHPA 1R0ZA 5J4KA 3ZKWA 1Q5PA 1U8AA 3DVAA 2WSLA 4N9WA 3PNVA 1OU0A 3DZGA 5JYBA 1GR1A 1ZEMA 1X1CA 3OSZA 4QM6A 3UJBA 1EG2A 1RLJA 4P3KA 2OV6A 4JSYA 1E5XA 4KRYA 1SXJD 5LMUB 3VDQA 1YDEA 4IXDA 3WDLA 4BNWA 2NO4A 2D1FA 1CFZA 2O8DB 2HWUA 4ND5A 2VWHA 2VZEA 1ZRMA 1DQRA 3F49S 3JAWB 2CJYA 3FDJA 5HILA 1EUYA 2G1PA 1X7ZB 3JQ8B 1V5GA 5CCBA 1UT8A 1V8OA 4TOIA 4XIFA 2GD0A 4B3IA 4JU9A 2Y1OA 3HMKA 4X62B 1TEZA 2V7QA 3F7TA 3NKLA 5F23A 1G2QA 1G21E 1O96A 4XA8A 1IHDA 3IHTA 1QHEA 2ZQZA 3RCBA 4BCBA 3WC4A 4CIBA 1WETA 4GKJB 3MBOA 2E4VA 4D42A 5JFOA 1BXKA 2PKWA 3LY8A 4KDRA 4LHZA 1J2UA 1OT3A 3QEKA 3M4NA 4DLUA 4HZUB 3O73A 4YNBA 2DJIA 2LKDA 4L5IA 1QE3A 4E5SA 5DEOA 5KYTA 3I01M 3DQZA 1C7IA 3IIJA 1IE3A 4MUMA 2PL5A 2IX3A 3I52A 2YVKA 2VPXA 1FNMA 3HKDA 2WVGA 3DXXA 4IX1A 4NPAA 3ZWOA 4MRVA 4ZKDA 1NW7A 4BMNA 1XIVA 4JSTA 2G07A 5ITVA 1T1EA 1H05A 1TIKA 2EJTA 1U94A 2C31A 1PJCA 1E92A 3LTNC 2FW6A 5HIIA 4UOEA 6LDHA 3JYPA 1X1EA 1DUVG 3RSLA 4MQBA 5B3JC 5FV4A 5B30A 3O0DA 3LWBA 5JXJA 1FUEA 1EVJA 3ADPA 3GAMA 4F1KA 4F9EA 1DFIA 1FP6A 4OLJA 5F33A 3N58A 1RJ9B 4NPCA 5CMLA 2FUKA 2QAIA 1G17A 1PCXA 4RV5A 5KX5A 2H2WA 4O2BB 2ATIA 1P2SA 3LT2A 1RWOA 4LC9A 4EG1A 3O92A 2VP3A 3V1TC 5JH7B 2FMFA 3NBKA 1SRRA 4V2IA 4D8YA 4F5ZA 5L51A 1GVHA 2J8ZA 4GX1A 4BO8A 1HY3A 1CQJB 4EKYA 3V8BA 2P5UA 2VG8A 2XB6A 1FCJA 1KDRA 3HWRA 5CFZA 5JQGB 4TYWA 1VG8A 4RGYA 3CF4G 4LXHA 1K9VF 1E9AA 2OZLA 3V1KA 3A1UA 2VDKB 3G0BA 1VSUA 4L5YA 1Y7PA 2JASA 1YUMA 1U5BB 4PYOA 4NFHA 5EMKA 2WOJA 2WSBA 2M6SA 4WRRA 3TIGA 4ZGGA 5ADHA 4TTJA 3GFOA 4PCLA 3USCS 1L5HA 1FZTA 5LP6B 2AXQA 3SBDA 3TKYA 3ZTWA 5EUCA 3UK6A 4LRQA 1KVQA 2J48A 4PVCA 1KJWA 4MUYA 4O4LF 2JA2A 1L7DA 1OAAA 1UPXA 2C78A 3IAEA 4M9SA 4MUGA 3KT6A 1KXJA 4PSDA 1SKYE 4GE0A 4RZXA 2P67A 1NL3A 3Q98A 4FN4A 4G07A 1AT1A 2Q1SA 3M70A 4YIHA 1A88A 3V8PA 2I33A 2LUOA 4WE3A 4GVXA 4NICA 4PR0A 5LVAA 1A9SA 2KQUA 1B3RA 4Z4QA 2BDTA 3A3NA 1U2SA 1Y1TA 1CZOA 2EFCB 3MS4A 4AFNA 4ESOA 5T8KA 5HJ2A 1IBKB 1M6VB 3OZVA 4B9AA 2B7BA 5A2GA 1KDTA 1Z5ZA 3QIVA 4XWAA 4D0GA 1VQ1A 2XD9A 5JU6A 5FOQA 1YB2A 4XVCA 5JBNA 4E51A 1G66A 3QLJA 2QLMA 3AK4A 3CV3A 3NH9A 5BUQA 5DM2A 2OFPA 4X44A 5I8ZA 4C3UA 2I6SA 1QH9A 2AN5A 4M55A 3GPIA 3R0VA 3H2JA 4HGOA 3ZXYA 1N57A 4WZAB 4XIGS 3W0LB 3FZNA 3AU9A 3EGEA 1T9ZA 3IUEA 3L40A 4RH1A 5LSAA 4LV8B 5C1BA 3HBFA 4P98A 3FVRA 1WUIS 2PM8A 3ICCA 4NYIR 1MXHA 4CBVA 4GNRA 4OQPA 1KYZA 4NY1A 1W1IA 4AF8A 5LM3A 4DV5B 3RAEC 1WBBA 3NHWA 2WF6A 3CRNA 3LPLA 2JC3A 3UJDA 4ME6A 3ICEA 5ALQA 4KR3A 2VDNB 1NF3A 5L7YA 3W05A 1ZA2A 3PFGA 4EYEA 1WG8A 1G8AA 3S0JA 3ELWA 3GJ0A 3QA9A 1HBJA 1P80A 4KUEA 2G80A 2O9JA 3CY6A 1P9LA 1IXSB 3WSVA 1JP7A 2ALJA 4ARSA 5AKEA 4B31A 3JCZA 2W22A 3U9LA 1UR5A 4DV6B 3GCGA 3MTEA 4DG8A 2I4LA 1HE8B 2AOTA 3B1JA 2YY7A 4Z86A 3O3MB 4ILKA 3S2FA 5G2OA 2WG1A 1WPQA 3ANTA 5AJWA 4BWVA 1N2IA 5BN3A 1RRMA 1S3SA 3TGPA 4M46A 2A92A 2DFDA 1C2YA 3EGDB 3W2FA 5THXA 5BPHA 4MVJF 5CXSA 5CFRA 2WJGA 5CFNA 5DYNA 2GTPA 3V1YA 4DS3A 4EYOA 3GLFB 1BN6A 3NC4A 1BO6A 1UXGA 2FPGA 3QEBZ 1YI1A 2W2NA 1TMYA 3SEZA 3W4JA 3ZHTA 1LFAA 3OLZA 1Y3FE 1YRAA 3MJEA 2PRJA 4ZMSA 2YIVX 1KZGB 5IAEA 3U9TA 2DT5A 2G1UA 3B3JA 3L4KA 4DR6B 4FK8A 1J2EA 3A28A 3WV4A 3HR7A 2IBTA 4HWTA 1HA3A 1S1MA 3VAAA 4JN6B 3KAPA 1SUFA 3PDUA 3ZOKA 3NDRA 1U9ZA 2PUCA 2HQOA 1T36A 3I2FA 4LCJA 1OR8A 1B6SA 3CH6A 4B4OA 1LBTA 1HXHA 1A7KA 4GZ5A 4C43A 2QXUA 5CB8A 4MWSA 4G5FA 3MIIA 5HQJA 2DR3A 2BMJA 4DQLA 1ZVKA 1N9GA 4R3NA 5IJWA 1T9KA 2E82A 4RTOA 1P74A 5BQOA 1JEYA 3UNXA 2V7EA 1TB4A 1QB7A 4YAIA 2Y1XA 3FGNA 1VZ2A 2BLNA 2Q4RA 2P30A 4JUIA 3D5QA 1NVVR 3CUYA 4BLWA 4B3HA 1H0RA 1TIPA 2ANCA 1N4AA 2HCTA 5DHSA 1HYGA 1LI5A 2YHIB 3STHA 1EFRA 2GPNA 1T0UA 1XUOA 3R3JA 1Z5GA 4HLCA 2F2TA 4NENA 3JASA 4PF1A 4D8TA 2UZ0A 2HD4A 2XX3A 4KVGA 4TL6A 2IS4A 4YREA 4B6PA 2NO9A 4NYMQ 3UJ7A 2HYIC 3UOWA 1J8VA 1TUBA 3IB6A 3IR6A 1N0HA 2Z5FA 4JC5A 4NMMA 1I4LD 4M99A 2OHOA 1B93A 3ABOB 2X9NA 4ER3A 4N18A 1QUFA 1VP9A 1XYGA 2QN3A 3FRHA 3VR5A 1VSBA 3QMVA 3VNQA 5J59A 1GRNA 4CIYA 3D59A 2QLNA 2BGIA 3EMBA 2GI4A 1WU7A 3LQ2A 4JIGA 2C5LA 3FUTA 5CW2A 3QVVA 2CUKA 3ZXUB 4DDMA 5I3ZA 1GRVA 2ZWPA 1A2KC 4TMXA 1EFPA 2ZANA 3F9RA 4J76A 4PLWA 5H16A 5AW9A 4IMPA 1HZZC 2RHDA 4KMMA 1MV5A 4FR2A 4J2HA 2AI1A 3FG9A 1T1GA 2BHTA 2UZ1A 1YL6A 3AY0A 3L46A 5J2UB 4XM2A 1I3MA 3P9QA 3AP3A 4RSMA 4F7WA 1C7FA 2GN9A 2P4QA 3ABQB 4FCWA 4PRLA 4CMHA 2JZOA 4TLEA 3ZTYA 4YP9A 5C1PA 2I2WA 3IQXA 4BVEA 2NV6A 3IL2A 1WV1A 2ZTSA 1H3NA 4JU8A 4CRWB 1V37A 1BYUA 1N2CB 1T9AA 2Z30A 3PJFA 4JEUA 4DRXB 3H1GA 1X7XA 2AQKA 3ZBUA 4W7HA 2VJCA 3I6YA 4HB4A 1ZUD1 2NNLD 3GLHA 3GFSA 4E70A 1ESEA 1IDN1 3K53A 4UEQA 3L0ZA 1KO5A 1I4OA 2ZJ5A 1NC1A 4PLTA 3UAVA 2XMZA 1Q2XA 4I9NA 3HM2A 5EHZA 2WV9A 2GPSA 1R0SA 2Z8YA 3R3UA 1KYQA 3ZQJA 1KP9A 2PS0A 3GFFA 1QF7A 2AG1A 3V4OA 1T5TA 4PHHA 1KSJA 1U28A 2WF8A 3O47A 3T0GA 1XPJA 3EFEA 1AA9A 3DYVA 4FP9A 1DP4A 1JL3A 3VC7A 3B8HA 4XR9A 4MWZA 1VJDA 2E5WA 3HXPA 2GK3A 2I4MA 3LLVA 1SWVA 3B85A 4L85A 3W77A 3P4YA 4AXXA 4CLEA 3TD9A 4DCTA 1EFLA 4XAQA 1YB5A 4Z9FA 5BMVB 2C1XA 1M2HA 5AKZA 4RQAA 4REOA 3AHCA 1JJBA 4Z8YA 1PTJC 2NZ8A 3VR5D 3ZIDA 1GGJA 1Z2CA 3FZGA 3WNDA 2H59A 1SOVA 2A5DA 5KINB 3GCDA 5AK3A 1W8IA 4JP8A 5LP6C 1ORWA 2OG2A 4L9SA 1PL7A 1YKGA 2QRPA 2AMLA 3RAPR 4Q48A 2RB4A 3BIWA 2GD1O 4KQIA 1MH9A 1H6AA 3DZFA 5CA0A 2JGIA 1KI2A 3VI3B 1G6HA 2NXEA 2OFXA 3CH7A 1V5FA 3VUEA 1EBFA 1UBOS 2HYDA 2RGDA 1ZAYA 8MHTA 2VPQA 4Y2PA 2YN2A 4O2AB 1MAHA 4E07A 4JJKA 3V8EA 4QDZA 1NKTA 1P2FA 3NAGA 5ALXA 2LP4Y 1AH2A 1FA9A 4J3NA 5FI3A 1N1MA 3T3OA 3VSBA 5EN4A 3RTCA 5F2NA 5JFTA 1ZUHA 2JFWA 1SD2A 4QFBA 5K3FA 2UZ4A 1Q1AA 2C8LA 1RTTA 1O89A 1K6IA 3EN0A 4Y0AA 1GO2A 4FNAA 1X0XA 1XZMA 2HMAA 2JKYA 2W7TA 3M3PA 3OIFA 4MZXA 5JD3A 2CHQA 3V7NA 1ISSA 5FUQA 4NDZA 4KPEC 3CVOA 1ZXLA 5JMPA 1CRPA 4E1VA 4KQXA 3AF2A 2YZMA 5AKIA 1QLHA 3CRRA 1URPA 1K06A 2XHEA 3BH6A 1D4OA 3EH1A 1UDAA 2D2IA 4PZYA 4BOYA 2EKDA 3HU5A 4EPXA 4Q9JA 4N7RA 4TKVB 5ITZB 1ZW1A 1QWSA 2NIPA 1Z75A 4BATA 2P7HA 2AEMA 2JAPA 3NORA 3TIIA 4J9UE 3ANSA 1DPGA 2GJ9A 4PHCA 2QGNA 3GJ5A 4RIHA 4UHCA 5EKTA 3DW1X 4Q4AA 5T4BA 4BLTA 1XK6A 3OFKA 2HSEA 2PSJA 4OXKA 4MEJA 1G5IA 1FU8A 5U9CA 2QVLA 2O8FA 3H11B 1DC3A 1F1JA 4MQ5A 1KF0A 5ILQA 2O1EA 2EDCA 2SBTA 3RS7A 5JR3A 2YQZA 2R68A 5ICSA 1WXEA 3DEZA 3EFOA 3U4HA 5KOJA 3GAFA 3REQB 2A0YA 4AX8A 4TSFA 3J7TA 3R7BA 3V4PB 3BFKA 2PUTA 2VJMB 2MJLA 4PGAA 3L1UA 3NAZA 3A04A 3VOBA 4KYTA 3NTXA 5SICE 3S2EA 1NP3A 1WXGA 3BICA 4G5HA 2VF8A 1H65A 1VMDA 5FNZA 5A4KA 1RPTA 5K51A 3EQ6A 3R7DA 3V4RA 1QX4A 1LY1A 4MI3A 2HEIA 4KXXA 2C9YA 2W2OA 4X61A 1WXXA 1D0IA 4KAJA 3BWVA 3OQHA 2NU7B 2Z58A 4PTLA 3PV0A 4Y2HA 5AFSA 4E4TA 3NEAA 2EDAA 3OLXA 4JLWA 5JCXA 3PHLA 1F5NA 5TJ9A 3C6QA 3LY5A 2OHGA 1XTUA 1BE8A 3MUNA 2PFKA 2H7VA 3JWGA 3N39C 4J7UA 1N5LA 5FOVA 2C7VA 3SU8A 3WL3A 2YR0A 1SD5A 3GJRA 2FMTA 5ERYA 1OIXA 2X2PA 5A3SA 2HA3A 2Q3BA 1HC7A 5JZMA 2E3JA 4KQFA 3TINA 2I1LA 3JZAA 2Q5QA 2QBYB 1H2HA 4IVRA 1FVOA 4PCUA 1ZY2A 1OV6A 2PPLA 3LY9A 3IDAA 5G4LA 1UAGA 3OM8A 3WOHA 2J9ZB 2R6ZA 2Q9BA 4O4LB 2O06A 2XYHA 1FQKA 3EA0A 1XQ6A 4BE7B 4RLFA 2AMFA 2HLNA 2NTYC 2YV2A 1YZNA 4N0MA 2KE5A 4NBUA 4BLSA 1FPMA 5KREA 3VGPA 3EFBA 1F2UB 2H6EA 4LJ4A 3VPXA 3SBXA 4C0WA 1KK1A 2PUFA 4ZGBA 2I7XA 2QJTA 4CM1A 2PS9A 4NCKA 2ZIXA 1L1RA 3K32A 2FYTA 3QVJA 4ENUA 3KX2A 5KYXA 5IXJA 3SC4A 1BE1A 1NBOA 4LGYA 4DMKA 5EP4A 3FJYA 2PKXA 3FTCA 1XVAA 2JCXA 2O8EA 3TW4A 1CUXA 4P53A 2GBLA 2UYOA 4OJNA 3ZV6A 3DEAA 4D6XA 5I5GA 5DTEA 1N5MA 3L3BA 5LLDA 1VSTA 3N7TA 3CR7A 5CJJA 5JZSA 3T3HA 1WDTA 5H3CA 2WTAA 4LIPD 4IIEA 3BMOA 3JQ7B 4Q9NA 1Q20A 3NWEA 4WFIA 5DXFA 2QZ9A 4F9FA 1FSZA 4COOA 5HVNA 1PL8A 3QLEA 4LMAA 2V7UA 2XIJA 3ND5A 1RPJA 3BH0A 2V7WA 2Y1KA 4FHCA 4M83A 3UGTA 2VTBA 3ADDA 1U0SY 1KETA 2HH9A 2OPBA 2PMWB 1Z6GA 3CN9A 3HUUA 1BDMA 3HWX1 1AKQA 2HIGA 2DXIA 3RVSA 1K68A 3VNAA 5K0FA 4GKKB 3CKKA 3D6TB 3UYLA 3LHSA 4CQLB 3DF7A 1E5DA 1ADCA 3KKPA 4WFJA 1K8QA 1Z8HA 5DCWA 3VPFA 3KSMA 1FDSA 3DDUA 1RM3A 2O2YA 3E3LA 3SJ7A 1WCIA 1GWNA 3V8QA 3C16C 4S35A 1JHPA 2DTXA 2BEUB 3AG5A 2QD3A 3M4JA 4P7JA 1JHZA 4F3NA 2A9FA 1OBOA 3IT3A 4L5BA 3HTXA 4B6QA 2OCGA 4JOBA 1CR0A 2EHJA 4NAVA 1BEUB 1ONNA 1IL0A 4GYWA 5LZ5A 5TF4A 1YAJA 4WTOA 4NZYA 4XD2A 1CUGA 3R7WB 3MWKA 4GHWA 1W19A 1I2CA 1I6LA 3C8HA 2LWIA 1SKBA 1CJUC 3O4FA 4JLSA 4XB6B 1RP1A 3MT8A 2TS1A 1ZD1A 2MINB 1JMKC 5JVDB 3UXMA 3TAHA 2MTBA 1US8B 1FL9A 1YFLA 4KQKA 1WOMA 2QP9X 3UJAA 1XCLA 2XPCA 3ROTA 3SHQA 2UV8A 4JHLA 1ULBA 3SLGA 3WBBA 4DIBA 1KEEB 1WDMA 4L16A 3IEIA 4IDFA 4UBIA 1KSFX 1WXQA 4I4LA 1I24A 1U2RA 3E03A 4G4GA 4AJIA 4AWBA 1YB6A 4YUZA 4IJQA 4BE9A 2NTJA 4XQCA 3WLKX 2XKBA 3UTDA 5EOVA 2FSVC 2J46A 2QN2A 1C14A 5LB2A 3WNZA 4JQYA 5F2EA 4LBZA 3K70D 3V2HA 4S2UA 3H6GA 3C3WA 1KJYA 3SKXA 2PGOA 3VZQA 3LDGA 3Q5DA 3QOYA 2C5BA 3GRYA 4EG6A 1SUPA 3RRJA 2J9YB 4E5NA 4QFMA 2XQFA 1W59A 2HO4A 1ZZGA 1GAWA 3A6DA 5MN5A 1L3BA 3RRYA 4F2GA 3HXKA 2WM3A 5LWHA 1NYQA 3L5OA 3ME5A 4RNCA 4D3XA 1NQTA 3KR1A 3VKHA 4GC9A 2W6MA 5ALFA 3M7IA 4OMDA 1KORA 4FIDA 1E18A 3SJCA 2FVYA 3C14C 3LT4A 2PMCA 3K31A 2GSDA 2J9RA 4RDCA 5K0LA 3Q85A 2W2VA 3AF3A 3LFTA 3H4VA 3ZI4A 3CNHA 1EUDB 4U2GA 3VNUA 3E70C 4N8EA 3U39A 1J33A 1OBHA 3C41J 3CH5A 4E30A 4HL6A 4ML3A 1LVGA 1XV5A 4W8GA 3DV0B 3UAGA 5E6RA 4ZOLA 4IFTA 4XWGA 4JI5B 1E1MA 5FI1B 2NXNA 3AW8A 3QFSA 2M32A 4BIIA 1II0A 1KBQA 3CR3C 1SA0A 1T8YA 3HCFA 3M5DA 1SZCA 2J6CA 2JBAA 5TPWB 4FXPA 3VTAA 1A0OA 1RBQA 4M6WA 1U0LA 3LUPA 1CULC 1TGYA 1XAJA 5DLDA 4RY9A 1M6EX 5E3HA 5M29A 4GI7A 3JWHA 5GOZA 2W70A 5LZ4A 3IVRA 4HYQA 5JJBA 1J8QA 1SUCA 2JBWA 2XXAA 3C8UA 3UT6A 1SVSA 1U9IA 4M36A 1H4SA 1Z6XA 2FN4A 2WTMA 2VNJA 1NNI1 1NSYA 2HHHB 2BDUA 1K2WA 3W9BA 1CUIA 4LRYA 1ZCFA 1QIKA 2W6IA 2O8BB 4KUHA 2AFIA 3S27A 2JARA 4OYRA 4D9BA 2RARA 2QTVB 4PNPA 2XF8A 1XXHE 1SBNE 5E7JA 3ZGYA 5ABPA 1II9A 4X6YA 3F5SA 2YWGA 2GXQA 4BGVA 1GZDA 4O25A 3UEOA 4UVHA 2ZRIA 4N82A 3NLLA 4M7OA 4MYRA 2FEWB 4XB1A 3BMCB 1J23A 2H5JA 1GGMA 2PZAA 3Q7RA 1MVLA 3P2EA 1CF9A 3V3KA 4ZWNA 4BAZA 3SDSA 4PLGA 3OLVA 4N1AA 2GB4A 2ZUUA 3L6BA 4AQYB 2K87A 4F85A 3FMGA 3N8HA 4U7GA 1SZPA 2OCXA 3CRW1 1UBNA 2ORIA 2P41A 2P8SA 4UUQA 2Q6TA 2VP2A 5CDTA 5GADl 1G38A 1B73A 3D31A 4GXNA 4V0QA 4CEJB 3VPBA 2OQ2A 3U3DA 3ASZA 4EBBA 1DWQA 3W7BA 4I36A 3LIIA 2RGWA 3HXOA 4BV9A 1LV8A 2W2KB 3GOHA 4US1R 1YZYA 4HLQB 4CG0A 1FDIA 3WLMA 3HYLA 3P19A 5CFLA 1A98A 1TYEB 4QL3A 2P2CA 2X5NA 3LBAA 2BL4A 3TM5A 2W8BA 3HN2A 3QFTA 5ARDA 2RHMA 2OP0A 3LPCA 4TKLA 4ZT6A 3I9LA 2PLRA 4U8GA 5ALLA 2CXNA 2JHPA 1Y8RA 3DAPA 3IQIX 2OFWA 2NADA 4C5CA 3I53A 4HDNA 2QDXA 4RK7A 4R71A 1XSEA 5B7NA 4JLAA 4F0JA 3VGJA 2IIPA 1ZWKA 4D97A 3DOHA 3THXB 2HQRA 1BYIA 3JR7A 5I51A 2B30A 1M6NA 3FDZB 3F9IA 4ZD6A 3A1CA 5EJ7A 4QASA 2B35A 2BZGA 2GF0A 2ZREA 5TR9A 2ZB7A 3IP7A 1CRZA 1M1UA 1XELA 3HKEB 1JQLB 3QKRA 3UIEA 2JH8A 3ZW9A 2DFVA 1CNMA 4JGGA 1FMJA 1KIAA 1Q19A 2A67A 1S01A 1QIDA 1QTRA 3DXZA 4G01B 2EZ4A 5L3SA 3HJFA 5ESDA 1CZNA 2NTVA 1XQ1A 2ASVA 3JD0A 3ZHRA 4ZJYA 4TLLB 1G2IA 3K94A 1S89A 2MU1A 2NUPA 4Q4HB 5ICGA 1JFTA 1A4XA 1Z15A 4Q4CA 1XZLA 3KKKA 5JWRA 3QW4B 4KI0A 4MB2A 1UJMA 1NFFA 1N2BA 1QRRA 2JFGA 3G1TA 4GX5A 1K0UA 2OAGA 3PEVA 4NFLA 4NZNA 5EZ6B 3RUCA 1GTSA 2HTEA 2HL6A 4F6LA 3I8XA 1GAEO 4XPZA 4NJMB 4Q93A 3VR4D 4EGQA 3BVPA 1FYFA 1NMZA 1DAGA 4Y2UA 4EECA 2VXCA 3KHKA 4NBVA 1DAFA 1G6KA 1JTVA 1Q12A 3CE6A 5IRCD 1GSAA 4G0WA 4MP3A 3NTQA 3UPDA 4ZPXA 1ML4A 1RCUA 2B2CA 5JNSA 2GXSA 2PZGA 4JB2A 3O31A 2BHRA 1XCBA 1UINA 4U63A 3OF5A 4H1TA 3IGFA 5EJ8A 3VQTA 3PUYA 1MG5A 2FMHA 2XOKA 3KTDA 1ZQ9A 2Z43A 4K6CA 4RPLA 4YQYA 5A9RA 1ZM7A 5JS8A 3IODA 4YROA 3N2YA 3UATA 3WGIA 1YJCA 2BI4A 3UUWA 1WY7A 1RI3A 1E2GA 1PHPA 2C92A 3NOVA 4GDMA 1NN5A 4LYGA 4AS1A 4DMHA 2IYTA 4LVOA 2PSHA 2B6NA 1WVGA 1RPNA 1VCOA 2A6PA 2EF1A 2FOIA 2Z4TA 1CCWA 1YNSA 3D1LA 3NONA 1C81A 3GGDA 1EM6A 2XR1A 3FD8A 1V3UA 2WJVA 3H87A 3UWMA 5L4LA 5IKPA 1JGTA 1L8QA 3D6NB 1ZMTA 1Z2NX 4KTVE 4KVFA 5IJAA 3RC2A 2L18A 3AV3A 3R0ZA 3ZE7A 4OA5A 3DP7A 3RVOA 2Z2JA 4D8WA 5IT9A 5T3UA 2FFAA 2XQGA 2H1OA 1X19A 3Q12A 1A9XB 4QOGA 1QIJA 2VEOA 1U1DA 4MULA 2FE4A 3X3HA 5JHHB 5KNLA 3Q8MA 3I83A 3DDCA 3R0QA 4KACA 3ED5A 1C3JA 3UFXB 3OD1A 4FZRA 1E6KA 3PA8A 4KFRA 3S70A 3V1LA 2IITA 3GFRA 5DNUA 1SURA 5EINA 1X1BA 3LLUA 1JXOA 4QBHA 1E8DA 5EJ9A 4FQ7A 5IW8A 2PZJA 1SHUX 3FPGA 3UOAB 2XA9A 1JB1A 2R97A 4Q47A 3DBRB 3R9XB 2FQYA 3UHFA 2E4UA 1N2HA 3G68A 4D3YA 1Z39A 3MJ4A 2QQEA 2GEFA 3HRHA 4KE9A 1ILWA 2HSJA 5FA6A 4ZVRA 4TSKA 2I67A 5HJ5A 1E3WB 2IFTA 4DJ5X 3MBIA 1LV7A 2IOFA 2ZUWA 3WP1B 4BYGA 2A5YB 3UAZA 4D9KA 5CD9A 4QYSA 4OATA 5BPFA 3T0FA 5KVVA 5I7AA 1IG0A 2YZ7A 1D6NA 3HXQA 2FEPA 3KCQA 1MA3A 5C7LO 1GZ4A 3TOCA 5IYZB 1C1YA 4BWFB 1PTJA 1EKXA 2GQ0A 2CHUA 2NUAA 2ZI7A 4EPWA 5TQ2B 4W5WA 5B4TA 3GFVA 2J7PA 4KR9A 2DZDA 2YRWA 2GCOA 3QLVC 1L0BA 1E7YA 1WL8A 4OA8A 3GD7A 2C3UA 4YS6A 3U3KA 1HT1E 2AL7A 4FTWA 5TQVA 4MWOA 4Q00A 4CPDA 4S04A 1HRKA 4C7OA 1VMEA 4HG2A 4MVCA 4K6OA 1LRLA 2DTDA 3CEHA 2C8JA 4IIDA 1CNFA 4DAOA 1X7HA 5SZJA 4DMMA 3FKJA 2W4QA 3OQ1A 1ZFNA 3N8GA 1CJCA 3UWPA 4WOKA 1CBUA 5JZVA 2R65A 2EARA 3PGMA 1ZHOA 3C3XA 2NVUA 3DW3X 3U60B 4PLVA 4A15A 4FI3C 3MGAA 3NHBA 3KQLA 1M7HA 1QB8A 5AP9A 1VSVA 4BJ1A 1NONA 4ENSA 1J24A 1ZMBA 2D59A 2WD8A 5EQFA 4CZ2A 1UIMA 3ER9A 4IXNA 3N2KA 1DS6A 4FNGA 5IF3A 4EHIA 3P0IA 4RFLA 5T3YA 2KBFA 4M0CA 1TZ2A 1ZRNA 3RTAA 4WACA 4NNPA 4KPUA 3GLGA 3HPQA 4WKBA 2YYSA 1C8LA 1JW9B 4X5OA 4R5HA 3KZOA 1JSCA 3KCNA 4MJLA 1N6NA 5C5IA 5IK2A 1Z35A 5TQ0B 1JQ3A 2ZWOA 2ZZKA 2C1ZA 1XYYA 3DM9B 2FP4A 2ZI5A 1ZSYA 3JRNA 4JZYA 4RENA 3AC0A 5COAA 5B1IA 1ENPA 1LI4A 3ESDA 4BQQA 1E61A 1T5IA 1IM8A 2DECA 4EEKA 4RPIA 3FTDA 3VH2A 4Q3DA 1DZIA 1YXMA 3HJUA 1EMDA 1W6RA 9MHTA 3EODA 3HYCA 4K6GA 3OJ0A 2OCYC 1MC4A 5FQOA 1A8IA 2FZGA 3LKDA 5K3CA 1O7JA 3UK1A 3HSYA 4H7PA 1IEQA 2XUIA 4Y0NA 5F78A 4AD8A 3FTNA 5J2TF 3CGGA 3D43A 4QOHA 1QG0A 3UAOA 3WYFA 1IEVA 1KTVA 4MHSA 1EFAA 3ACBA 2XUOA 4KXFB 2JAUA 4LXGA 3BWMA 2VSXA 3ILSA 3RASA 2CFRA 4AJ1A 4DLPA 1V35A 2AK3A 3O4HA 5JZBA 1SXPA 2AQ8A 1O87A 3E3OA 1LX7A 3OIGA 3PT9A 5D5PA 3CW9A 4D81A 2KLHA 2ZJ4A 4K6KA 4L15A 2H1RA 3IT2A 2ZPUA 1GPJA 4KKXB 5F7OA 5EWLA 2RKWA 5DM4A 3JU3A 1RPAA 4PBSA 5FX2A 3H8WA 3F8TA 3FX2A 3M33A 1E4EA 4MV1A 3WA7A 4HGPA 2R5FA 4MB0A 3K0AA 3WL7A 4Z4GA 3KQQA 4R51A 4WXEA 3TPCA 4N0QA 2SECE 2ISSD 2P0AA 2F43B 3T3PB 4EDFA 5AVSA 2ZBDA 5WRFA 1TAGA 3AUTA 2VBCA 2LCIA 4LV5B 4N3NA 3ACCA 1AMUA 3WDMA 3ROXA 5DM70 5AM0A 3OEWA 3C48A 4WA8A 3F0TA 3ROPA 3F4BA 3DWGA 1TKRA 4UQOA 3ZXSA 2Q2OA 4JEIA 1VOTA 4D5GA 5IK2D 1ZONA 1HX7A 1L5YA 5SZKB 2R85A 1L2TA 1NTOA 1R5OA 2CXHA 2AV6A 2CNLA 2NU9A 3B1FA 3EOAI 4J94A 4OUDA 4V0NA 5J1TB 3SEQA 1S5PA 2BW0A 2NYRA 2IY8A 3PI6A 3E9RA 5TEWA 1F38A 1RFGE 2KMLA 2J30A 1R8QA 4E2ZA 3DVRX 1K8YB 2B2NA 1Q7BA 3I3SR 4MUXA 2F59A 5IKXA 4NEHB 5DYGA 2QE7A 1N25A 3EHEA 1N6IA 1YR2A 3GLUA 4X7PA 1KJNA 4U2FA 4UHJA 2OXFA 2P9GA 3SG0A 3TLAA 2I76A 4F5YA 5EVJA 3V80A 5JS1A 4QGSA 1CZUA 1V1RA 4B83A 1QRSA 4WV3A 1CR1A 2WVHA 2XMSA 5DMXA 1TADA 4RTSA 5K09A 4C7BA 3UMSA 2DBZA 2YWXA 4FDLA 4RZSA 4RZQA 4UDNA 5CR9A 1KYTA 2VHYA 2IHTA 2IH4A 2I6QA 5IVIA 2VHTA 5JBQA 2I5PO 4JI0B 1EAYA 3EXIB 3QGMA 2H1LA 4YMHA 1JG2A 3KKEA 1T4CB 4AC9A 9LDBA 1DQNA 4E5YA 2Z83A 3FVWA 3PTZA 2FJPA 5H1YA 3V1UA 5JANA 3I9KA 3W9SA 3SZMA 4OIFA 1ZX1A 2CNKA 3FUVA 4X6XA 4C7MA 8LDHA 3IBCA 2FSIA 1CS4C 2Z08A 3OCWA 1RKQA 4TN5A 2ZZNA 4GI5A 4BUJA 4N3BA 3F8WA 3T4EA 2NSHA 3LMKA 3SEFA 4AZSA 3VR3A 1NA5A 5FPQA 3ZYCA 2RAVA 3MB8A 1JG3A 3NTUA 4LPSA 1FFAA 1LPOA 3E1KA 1FBNA 3VHXA 4CMKA 3EWSA 1D8AA 4XZ3A 1ZG3A 2X8JA 3D3WB 1WSWA 3A6LA 4QA9A 5SZHB 2XHZA 2CXUA 2ZYWX 3F6RA 3PQ3A 2C00A 4MI1A 4OHWA 5C0OE 4FFBB 3CO0S 2QYOA 5AIAA 3ABIA 4EG7A 1TA4A 2XRZA 1IN7A 3QG1A 2AQIA 5ELMA 2P2ZA 2XEXA 2PH1A 2XAUA 5HUQA 3M1YA 3WB9A 1P3DA 4QKQA 2BM0A 4NCJA 2Q6LA 4RCZA 3WS7A 3ZN2A 4IVNA 5BYBA 1XDUA 4BMDA 2C61A 3UW1A 2K2WA 5HR5A 1VL0A 1PJ4A 1J5PA 1XMSA 3JYQA 2PZLA 3PQ5A 2PYZA 1GU1A 4KIWA 2B99A 6AT1A 1NQUA 1MW8X 2WZCA 4MV5A 1IJEA 1P18A 3L6OO 4L2IA 4WNAA 5DFAA 3N2ZB 2AKYA 5DXAA 4ZC8A 4KEAA 5F1KA 4PQFA 4JI6B 4F71A 3LX4A 1Z0UA 2PWPA 3E05A 5JMTA 1W36B 4AF6A 1YNOA 2IYWA 2XNCA 1D8TA 3F3MA 3BRWA 3G5MA 4DSOA 3AHHA 4PYQA 1PD1A 1XFAA 1NN1A 1K7EB 1MO4A 4AKGA 1YFJA 3O21A 1JF8A 1H69A 1U8EA 3Q9LA 3NFRA 4QO8A 3T99A 3FHLA 2DKNA 3CIFA 4Z9BA 3ZVNA 4TKUA 3WLAA 7REQA 4RYLA 1XTQA 4HAIA 3LCJA 3HU2A 3MS7A 3LC1O 1YZQA 3HCRA 1E2IA 2ZU6A 4G0OA 2HRBA 3TRFA 3WL5A 3DYBA 4NZMA 3ZGNA 1NJ1A 1NHWA 1RMTA 3KB2A 4U2BA 4JB8A 1S9DA 3JXEA 5DK6A 5A4MS 3DO8A 2AN4A 3VR3D 1AMNA 1QRTA 4YHHB 1TYZA 4NE2A 3QWBA 3C7CB 1TZBA 5C46F 1U4NA 2BGNA 3ZHVA 1W73A 3K4HA 1AKVA 4KX5A 3F6SA 1J2RA 4EMBA 4U00A 4G0QA 1XZCA 3G0IA 4WZBB 3S6JA 3LD9A 4JVOA 2OILA 1F60A 2A94A 4U9HS 4WZZA 4M7WA 1JLMA 3N0WA 2DERA 4LRWA 4QDUA 3OLCX 2XCSB 3JQFA 3FOAA 3PFIA 3ONEA 1U3GA 2OO7A 4B6FA 4CTNA 5LQMA 1JYSA 4RCVA 1IOZA 1OY1A 3GMIA 1M1YA 1ZS9A 4KQEA 3G0CA 4Q3NA 4E5KA 5AJVB 1FOEB 1X80B 4G5QA 5JRDS 3QUTA 1QOZA 1QRDA 3OCXA 2PGJA 3ZHZA 2ZXEA 3DOUA 4L3WA 4TMKA 5FJJA 4P08A 2XUAA 1ZOPA 2XADA 4ISCA 4YRPA 4DR3B 1P6UA 2LCFA 3TR5A 2XCOA 2K6GA 3OJOA 2B7LA 4AMBA 4CNQA 4CCYA 1SUIA 2DCMA 1Q1NA 5EIAA 5AVOA 3VTKA 3BHNA 3KQUA 1A2OA 1VKHA 4GPZA 2A9QA 3BRWD 1RYNA 3F6EX 4RPGA 3WK4A 2H1SA 3K4QA 2HLDA 3L1VA 3BMQA 4KXVA 1P7PA 1JAXA 4BRUA 4EA7A 1Z6PA 2C4UA 3R44A 3IYLW 5KSZA 1UZLA 3FIJA 3TQFA 4HQOA 3WRXA 3GIWA 5K0NA 1N5JA 1Z4LA 3OX3A 3PD0A 3VR0A 1EB9A 1E5VA 5A4JA 3B1WA 3FMPB 1X70A 2XSZA 1QCCA 1XN4A 3VPCA 3G2JA 3GJ8A 3LDUA 2JEOA 1SUSA 1XTTA 2J85A 3KTAA 3O94A 4WY8A 4FT4A 5F76A 1DCMA 2AR7A 1N9KA 5L53A 3ZKAA 4BL5A 4OYYA 4WXHA 1STOA 1Y4SA 5DBIA 4RZ3A 3G6WA 4XFJA 2D00A 1FNDA 3ZCUA 221PA 4A5OA 2O5CA 4FLFA 2AOXA 3R7LA 2A86A 4MKGA 5TRTA 4BX8A 4DB2A 1P7WA 4S0XA 4HGRA 1QORA 1HOXA 1JR4A 3S8EA 2CJPA 3J7AC 2X7JA 1AGPA 3Q3CA 5FUXA 4D80A 4ZJUA 3LL7A 3NIBA 1MTZA 3WR5A 4JBLA 3GFPA 1T5HX 2C1EA 4FB4A 4RD2A 3BEOA 3MW8A 4TKMA 2DHDA 1DXOA 2GILA 4N49A 4A0SA 1KJ9A 4F4HA 5FHQA 1EDOA 1Q3TA 4Q3CA 1KBOA 5BRJA 1FNNA 2IGTA 3DNFA 2O8CA 1X8LA 1L5MA 2WU4A 4B35A 1Z45A 2FDXA 5AT1A 4NZ9A 5H80A 4BRZA 2C9MA 3ROMA 1X74A 2WUFA 1KMHB 2VHXA 3DVSX 5DN6A 1ZI6A 4UPVA 1AQYA 2D5IA 2WJYA 2WYWA 1TT5A 4OPMA 1TLTA 4V3CA 3SF8B 3X2EA 2CBXA 2HA2A 4GP7A 1J9GA 4UEWA 5LYJF 1IB0A 3OLQA 3Q8WA 1KL7A 2X2EA 4F11A 1SEPA 3MINA 3INNA 2PZBA 4YRLA 1LK7A 1U9YA 2NZJA 3LQYA 2Q2WA 5JNTA 4N40A 1RBYA 5TT0A 1Q7RA 5BSGA 1WUKS 3CTPA 1T0PA 2ZJ0A 4V0SA 4NV1A 4OI1A 2BM9A 3DDNA 3JZDA 4EL5A 5IU6A 1CS0A 1VIAA 2H1IA 1U3WA 3HCDA 1KDOA 3H84A 1NDUA 4Q4LA 1LVUA 3CEAA 3W5IA 3K1JA 4MKXA 4DV3B 3BL5A 4PG5A 2PO5A 4WOPA 1H1LB 1KI6B 2AYZA 5H3LA 2OY0A 1YBHA 5IG2A 1GSIA 2PT6A 3UO8B 1I4TD 3AHJA 4X54A 3IP6A 4AP9A 3ABZA 5K6RA 2RHJA 1QAMA 4G5SA 2O0MA 1UDBA 1FFYA 4Q03A 1SUWA 3WGGA 3KVYA 3OUZA 1EFHA 2GD2A 2XYGA 3HY6A 2W8ZA 3S1AB 1KAGA 4BNTA 4GX2A 4DVJA 1OU4A 4XDGA 2NO1A 3CUSA 1QK4A 3TAUA 1Z0JA 3D8HA 2ZVDA 5LFAA 4BQRA 1IULA 5CDYA 1X1AA 4UCFA 1GGVA 1CUHA 2BFBA 2C2KA 3TLKA 1WY5A 3CLSC 1OWMA 4HNGA 4ZQEA 3IUQA 2P3SA 5AVZA 1PWXA 2X6QA 4TRNA 5J2TB 2Q27A 1JIIA 3FBWA 2GM9A 1OUMA 4BNXA 1OVMA 1XTRA 1SBCA 1VHQA 4M38A 4FYVA 5DN6D 2R7AA 5FULA 5JSQA 4UQLA 1T24A 1Z74A 3KPJA 1TQ6A 3KJHA 3EH2A 1E6MA 4QX6A 1E62A 1EI9A 4U39A 3GLHE 3K09A 3CLRC 3KWLA 3QVWA 1E1NA 3MLBA 2B8TA 1G7CA 3VO1A 2HSWA 2OP1A 1C30B 4EZBA 1ISHA 1FQOA 2HWXA 1AKTA 4O1MA 1KO1A 1OXBB 3NKFA 4ZPJA 4ZEOA 4CLOB 4MCHA 2VJAA 1I5EA 2Q4DA 3I9V1 3C70A 3NNDA 1I33A 1OT5A 2BEKA 2VBGA 4MW5A 4N5MA 3DPUA 4AZTA 1XTSA 2HO5A 2V03A 3S4YA 4PS1A 5K4HA 3J81A 1AJEA 1JQAA 3WLQA 4O3MA 3QNUA 1WZUA 1YT5A 1YASA 3L01A 2VT3A 1FJ2A 2KLBA 1JEDA 5BRAA 4C87A 8GPBA 1A95A 1G3IA 2F1IA 2J67A 2C83A 3D6JA 2QPLA 1U99A 3GYGA 3I3OA 4FNOA 4EEZA 2E4ZA 4E2YA 1XMPA 4KXMA 4N5DA 3SE0A 5FWDA 2FK8A 1ZKMA 4DLZA 4GKBA 1IIRA 3KIPA 1M33A 1WKBA 1EXDA 5JXIA 4RU1A 2ZWIA 1WSBA 4QOIA 3ZY3A 2WSSA 1Z8DA 4HNAB 3JVVA 2WUWE 2PX6A 1ZXXA 4UHFA 4MR8B 3OZWA 3WOVA 5C5DA 3FYTA 5DTRA 1R6UA 2DHRA 3IMKA 1I51A 1RC1A 4WKNA 2FFBA 4UEJA 2HF2A 4RF5A 4XIYA 4YJFB 1BD4A 2ID9A 4RIFA 2Y3IA 2V65A 3GJZA 1VJ1A 3EXEB 5JALA 5KMGB 1X1TA 1FF9A 4YJ2F 4O8CA 5K3EA 2A9OA 3FRJA 5M5BA 4A6DA 3MLEA 4G23A 4PHFA 3MM4A 4DLNA 1UBUS 4FILA 3O2SB 1F9AA 3FSRA 5LP1A 1OLSB 4XQ9A 1PU2A 1UEIA 5THQA 1EX6A 3ID6C 1OA0A 3N3BC 3U1TA 3ONFA 1ZOSA 4U8HA 1X92A 4E13A 5JW6A 3T9CA 2BF4A 2GVNA 1J42A 3N9IA 2Z57A 4RE5A 2MSCB 4G1FA 5IVDA 4LGVA 2D7JA 4JFAA 4A82A 1CQPA 2J4DA 1DRKA 1XDBA 1IN1A 1UOEA 4DHWA 5LUAA 1QR2A 3B9QA 3VZBA 3BIJA 1KO4A 2AYXA 4OMCA 4DSNA 4MDFA 1BHSA 3ZR4B 1VPVA 4M1OA 1MGOA 2REQA 1MD9A 2GEBA 1K98A 3KB1A 3NJ4A 4W5TA 5JO9A 2DM6A 1VPEA 4X1YB 2GMWA 5EMHA 3AEYA 5MN6A 2WZDA 1ZJ4A 2CLIB 5DHUA 3BGOS 3CO5A 2PIDA 3FUXA 3P4XA 4Z7OB 4UXJA 1XLWA 3V4ZA 3W7VA 4MTCA 4W5QA 2VP0A 4XYEA 5EEGA 4YJKA 3BHJA 1D6SA 3M8KA 4Q3OA 1A8HA 1FYXA 3L4BC 2QAJA 1CY8A 2XE8A 2CXXA 2WSSD 1A50B 4H3KB 4NTZA 4QODA 4ZI3A 1F8XA 4ARZB 3WQHA 1GGFA 1PTKA 2Z5GA 3QXCA 2VT7A 3UV7A 4DUZB 1ESNA 2GPBA 4KAFA 4CKBA 4HXEB 4BNNA 3WLLA 3R6LA 2XTAA 3GAAA 1RSZA 3K30A 3TZCA 4RZ2A 4DT1B 3LXUX 4GWKA 5CA1F 4OP1A 2BGMA 1ESCA 1DJPA 4UBJA 2GPJA 5YASA 4EPTA 1NKSA 4PYMA 1YS2X 1HDZA 1OWNA 3E5MA 3KJZA 4G25A 4Z51A 4S1OA 1DTWB 2RHLA 2GPAA 2PD6A 3TQRA 1X9HA 2KI5A 1CE8B 4C04A 3U5TA 1ST2A 3SJBA 2LDXA 5JI2E 3RD5A 3JALA 1C7ZA 5FBZA 4R31A 4RY8A 4YRNA 1KY5A 1IBMB 1AD2A 1HI9A 4HATA 1QS0B 4RH0A 2XUHA 4EI9A 5F52A 5DF1A 1X1SA 4E2FA 5TT1A 4YYZA 3QH4A 2BP7B 1U0GA 1V1MA 2O5RA 3NWPA 4KGVA 4D4HA 3IKTA 3ERCA 1TX4B 3CBQA 5TSDA 2F4VB 1Z3CA 1R6TA 2QL9A 4ACAA 4P3PA 2Q5OA 1M8JA 1WUTA 1PRYA 4J0KA 4ZAYA 2ZYHA 1HK7A 2B4AA 3MWYW 3W9UA 3OQMA 3BERA 1EH5A 4EGAA 1IHXA 1UAYA 1UEXC 3D4PA 3CZMA 1W93A 3G8BA 2GEUA 1L5KA 1QVZA 3EIWA 4D4JA 5EXDA 6YASA 3LRXA 3BIXA 3SQWA 4EK9A 2JD0A 4H1VA 1YHZA 2F4NA 2PBZA 1OYYA 1PO7A 2J0QA 3RAFC 4LQLA 2VNSA 4L50A 4KWHA 3M82A 4IRMA 3DZHA 4TUYA 1WOYA 3PNYA 3ZK8A 3AGPA 4AO8A 1P0CA 2YWHA 1XMXA 4JGBA 5KU7A 1FFEA 2IYQA 3IRUA 4IDHA 4WESB 4E32A 4B4UA 3D2BA 3A31A 2V3WA 2FUG6 4B6GA 4F8JA 4YRBA 1Z83A 2O3UA 1X77A 5DHAA 5D3MA 1VGVA 4RUKA 1XL1A 3Q3GE 1R5JA 3R5XA 4YCMA 2DPHA 1NVDA 4UAJA 1TKBA 1OLOA 2VJOA 3QXGA 4XVQA 5E9AA 1AB6A 4A1FA 1YVPA 4REQB 1M1ZA 3LQ1A 2PUDA 5KWSA 1OI2A 2B8WA 1WU8A 3PCXA 2RI1A 3FGZA 4AN1A 1HT2E 1J6UA 3DDWA 3SAJA 5TGTA 4RMJA 4HQFA 4PX3A 3GCZA 3M3HA 3M5PA 3EC2A 1L9XA 2FRXA 4HP8A 1DWOA 2IDJA 4MS4B 5AJZA 4BKOA 3HCOA 3TCKA 2ZIGA 2NU8A 3H4IA 4GYYA 1IH8A 3S28A 3NP7A 4L3OA 3TSZA 2HW8A 1YCFA 2RK3A 1N6RA 4FHFA 5DYWA 2XUFA 3TZKA 4F6RB 2JLXA 3O8OA 1FVFA 5FUVA 5CXXA 5C8YF 1NLYA 3HV0A 3UPTA 4MINA 4L5AA 2CVZA 4QXOA 3IBTA 1DQPA 3SYNA 1A96A 1E6EA 3UKJA 1RWBA 1LNSA 5HZMA 5L7TA 3BYZA 5AM5A 3JQRA 1ORVA 3HJNA 5HOQA 4ETIA 2QT9A 5A3VA 3MVEA 1MT3A 3MNFA 3RVLA 4A10A 1E59A 4XSGA 1C9DB 4ZOQI 5KBYA 3OLYA 4X1OA 1IY1A 3IHLA 1OHHD 3NBXX 3T1YB 2GPYA 3FBGA 4QU9A 1EJ0A 2BRUA 4LDQA 2VF4X 4WERA 2HDNB 2NO0A 4IF6A 5K3DA 3TLEA 5A04A 4JLDA 4X0EA 1R3UA 2QM8A 1N1GA 2ZJBA 4PE5B 5K6AC 4LJRA 4WJZA 3A4MA 2DPLA 4WCVA 1C4WA 2AIRA 2HA4A 4CW7A 3VZPA 1G8PA 1NSFA 3DMYA 3I6ZA 5I5EA 3COYA 4F7DA 2XNHA 4GQBA 2IE8A 2H16A 1J8DA 3OOEA 4OFBA 1ZIXA 3OFJA 5EWJA 3VNRA 3OKAA 1NSTA 1QH8B 2HV9A 3QPCA 1S02A 2FLKA 1BW9B 4EDHA 3EAGA 4X8HA 4OFXA 3GMTA 4N4AA 4L0CA 3BFPA 2XW6A 5K05A 4CGYA 2VJKA 5L3ZA 2X4DA 3CWQA 3UXEA 1FY2A 2VHZA 1NFRA 4K9PA 4KXNA 1N92A 2Q45A 2AOUA 3JS5A 3S99A 4F4DA 1NUUA 4RXUA 3LVFO 4GVPA 2IKSA 4K7JA 1EE2A 2P1RA 2HT6A 5AJYA 3U3JA 3IAS1 4Q15A 3HZRA 3VSCA 2UDPA 1AA6A 4PNEA 2VHQA 1PSWA 1RKBA 4LHVA 4Z4CA 7YASA 1WMFA 2E85A 1GZSA 1KQFA 2AS0A 2CVQA 3EDOA 1NVTA 3VU9A 4NF2A 3MC1A 5G0VA 1KVUA 1LBEA 3DGEC 3QMWA 2C7QA 1E7MA 1E2KA 1ZQ1A 5EJ4A 2ZBPA 3O2NA 1ZNZA 4Y9SA 3KQNA 1Q44A 4RTLA 4O63O 2QVYX 2VXBA 4J0JA 1ODKA 2EP5A 2EZTA 2Q28A 1HGXA 3GRFA 2HY7A 3CNLA 3TKAA 4NL4H 2YW9A 2ODPA 3GZ4A 3QMPA 3GHHA 1D9ZA 2VDRB 3EEIA 3JYHA 3OI7A 4OXYA 3TTTA 2H2AA 2YZKA 1XQVA 4OSOA 4PONA 2FW8A 1X7YA 4HH1A 1U7UA 5ENDA 3IH5A 3B20A 1CK4A 4YX9A 1C3EA 3A7EA 3DEFA 1X7WA 2ZG6A 3HRIA 3MTAA 3DE4X 3OPMA 3MHPA 4H35A 2R1VA 4CETA 3LBIA 1QIIA 3MFQA 2VF2A 3KQTA 3MUOA 3ONDA 4H15A 3BD6A 4PC1A 5ANRB 4RTMA 4EJ0A 1RDFA 3GZTB 2CVOA 1IQUA 2WG2A 4WY5A 2JAWA 2ABWA 3TE6A 4PQYA 1L7NA 5CBPA 5JS2A 3RKSA 3BB1A 4RSGA 1SVIA 3UPUA 3GNLA 3OFND 2CSXA 5DGTA 1QG2A 1ZHHA 1QZUA 2CL0X 2ADOA 3F5FA 4L6AA 4MRAA 1LF5A 4LQDA 5EHNA 3MS2A 5CAEA 2TRSB 3T4XA 1GV0A 3SQDA 4GSYA 1E98A 3VYWA 2HWKA 4DZTA 2F8TA 1W30A 4B6JA 2AFIE 1QFMA 2YOFA 1QF9A 1T9HA 3S40A 2O7VA 1OI4A 2QTAA 3VNVA 1D07A 1HNNA 2JK0A 2P7IA 3KYCB 1SBYA 3IHKA 1G5TA 3QUSA 1Z2AA 3K6RA 1WHTA 4R2JA 1I3CA 1Q57A 5JAUA 1CVIA 3UTCA 2JGKA 3FFXA 3GJ3A 4JJGA 1H1DA 3Q0TA 4L4UA 1OAOA 1ZGJA 2G6BA 2PNFA 3PYXA 3ZJ4A 2R6AA 4GWGA 4NCXA 2D1SA 1BFKA 1JJAA 1MAAA 5IAGA 1K4MA 1V3VA 3OT5A 2ZB2A 1PG2A 2ZAIA 4M1TA 3DUWA 4L9RA 2YVLA 3AF4A 4CN8A 2H1FA 1XDWA 4DNOA 4F5WA 5LWQA 3TFOA 3IEPA 3PHBE 3QNMA 1CY6A 1U31A 3T3EA 4NABA 1ULZA 3O1JC 3S55A 3K35A 3W7AA 3OZIA 1RRGA 1VHWA 1W2WB 2GYVA 4GC5A 3IC5A 4XQGA 1I7DA 2QR5A 4MMYB 2J45A 2QTHA 2P4HX 3QVMA 2Z2KA 2P11A 3QU2A 3I04A 4IIUA 3ON5A 1FLNA 3QENA 1Z4QA 2CMGA 1EWVA 4M2LA 4V02A 2X0DA 1W2HA 3A58B 1GYPA 1TO2E 3PXGA 3HO8A 4N6GA 1TU3A 5BO5A 4BV8A 3ETHA 2NVOA 3ETJA 1UXOA 1GFSA 2EFDB 3KU1A 4TZKA 5FPHA 2WJAA 5KJEA 1EUCA 3F96A 4DREA 1Q0QA 1NAIA 2ID8A 2POCA 1NM5C 2P9JA 3L02A 4QU5A 3C3PA 3LQFA 2YIJA 5IBPA 4AZVA 1O4VA 1KERA 1ZYUA 1OFVA 1NNUA 1PUIA 1WZCA 2GT1A 5KTNA 5KWJA 1EQAA 4YJ2B 4JUAA 1GTVA 1A2BA 3IVMA 3UV3A 1C3XA 3WWDA 4DBLC 4I9HA 3DMDA 1NOJA 1VBKA 3CWZA 3VTZA 4PN7A 1J56A 2AFHA 2G36A 2VDPB 3KUUA 4RBNA 3RSFA 4CEIA 4K9DA 2P9ZA 4I9GA 3QWHA 2H5LA 3GBVA 2P91A 5KVQA 1DDOA 4Z7QB 3ZW7A 4YV0A 3U49A 4IIGA 4HQLA 5IMBA 1GUYA 1OXUA 3IO3A 4I7EA 5AI4A 3TVYA 1YAHA 3FYUC 4US2R 5CDHA 2PMFA 1IFXA 1OFUA 1W87A 3A1VA 3E4CA 4IAOA 4P33A 4DLTA 1E2DA 2SCUA 1DARA 1MAVA 3M6IA 1XRSB 1YR3A 2UVPA 3EISA 5IBRA 2QRJA 2CYAA 2Q9AA 2XNKA 4O59O 4JAVC 1V96A 3OX4A 1APBA 4TX1A 5ULLA 1Q7CA 4XVHA 3CN7A 1R4MB 1JG6A 4P5PA 1CP3A 5E1DA 1UXKA 5HRCA 3HB7A 5AXDA 2FRDC 3IQDB 2G5GX 3P9PA 1AUOA 2HMVA 4P8RA 3VPAA 3BPSA 3DMTC 2I2XB 2QRLA 3U4GA 3GY0A 1E99A 2NV0A 4RZIA 3LYHA 1DVRA 2R25B 4X94A 4R2MA 5ETJA 3KAJA 4Q34A 4C76A 3GZNB 3PXEA 4KLAA 4NHOA 4WSOA 3PC3A 3A6GA 3H3FA 3NGLA 4I1SA 4OYLA 3ZBTA 1XD2A 4B48A 721PA 2XNDA 3AIOA 4BC0A 3AT1A 1T8PA 3FHCB 2QD1A 3BULA 2DT8A 1GQ2A 2IZ6A 1OXSC 4CI9A 4LTNA 1L1FA 1VJCA 3L7IA 3OPNA 1EFVA 1PLLA 2QRQA 4NP6A 2AWOA 3IVAA 3S7TA 4RPCA 3SE7A 5GVSA 3E3NA 5CA1B 4IM7A 1GZ5A 2JVKA 3M6MD 4LE2A 1ZD5A 1VB5A 1F6DA 5CLQA 1QLWA 2Q1YA 1E1QA 2G82A 3PGLA 4L4XA 3EVFA 2N1MA 2R1TB 2VT6A 2YUTA 4TKZA 4C21A 2A0KA 3G79A 5FT9A 1MRZA 2VVTA 3NNNA 3LQ4A 4RA9B 3PE4A 2BLLA 4ND8A 4B87A 1QCDA 3RVKA 3OZRA 4DWOA 8ATCA 5HQ3A 2UYYA 1CT9A 1YR1A 1BVRA 3PJDA 1NXPA 1XMVA 4FHGA 3R75A 2HXYA 4YH1A 1Y9DA 5FRDA 3KJQA 3EG9B 3UGQA 3KOZA 4U5XA 1G21B 2HU2A 4DDTA 2BBSA 3AXTA 2RH5A 1GUDA 3T7KA 3VKWA 1D9XA 3UZUA 3E35A 5CHEA 4DRZA 3NKVA 2C7RA 2YWDA 4A2WA 5BURA 4RS4A 3AP1A 3WK5A 2PV7A 4R4JA 4PNHA 1BROA 4FCVA 4YP5A 1KO7A 2HJRA 1G20A 4GGOA 4DUYB 1J20A 3O75A 3QBEA 3EGWA 5ESRA 1QDLB 3PQ7A 4N3GA 4WI1A 1F7VA 1QR6A 3UXYA 3AB7A 4TPKA 3LGXA 3VR1A 3V32A 3KWJA 4B75A 1EDZA 2BE9A 4X71A 4BMVA 2XNDD 2X8BA 2OBXA 1FQJA 2NSJA 2F3RA 1RWQA 4IQFA 2FMKA 3TJMA 1NXXA 4L9AA 3GO4A 2ZBFA 4JODA 1T29A 2HBQA 1KNQA 1VKNA 2EV9A 3G8CA 4O08A 5F1YA 5KOHB 3NS7A 1AN0A 1R6VA 4EHJA 1HO3A 2REXB 5J9FA 3JQAB 4S2EA 5FBKA 1KA9H 3DPSA 1P6QA 1ZNWA 5HDQA 4M8IA 2OV1A 1E1RA 3VX3A 1SU7A 3S5JA 1E1QD 2CFTA 1AE1A 2GZRA 1YJ5A 5GGYA 5E1MA 4OOEA 5TXGA 3RU7A 3U3XA 1UBEA 2AMVA 2ZK7A 3EGXB 3IJEB 3HCBA 1A1SA 1ISIA 1LBQA 1DE0A 3B89A 4G2TA 5LB4A 3FDIA 2R7NA 2XUDA 2CLCX 1N77A 5AOAA 2AXPA 4C2BA 1ADYA 2Q62A 1JKIA 3LL4A 3WJ1A 3KETA 2HGSA 1NRIA 1FXWF 2NSLA 3I12A 1LD3A 3RQIA 4HQ0A 3E27A 1NF9A 3U62A 2QGFA 2WNHA 1YL7A 3PRKE 1YCHA 2FUEA 2PN1A 2LZ0A 5C8YB 3WXBA 1XEWY 2I87A 3UCFA 4IG9A 4G81A 4YECA 4P4TA 2I9KA 7MDHA 1B6RA 5HZHA 2Q9UA 3QWAA 4PG6A 1NASA 5C34B 1XALA 4DV0B 3L7NA 3GLGE 4YAWA 5IBCA 1E6WA 1T5BA 1VCMA 4LJ6A 4ZT4A 3TVTA 1I1NA 4C1BA 3ZU3A 3I58A 2RGRA 2HHJA 5IABA 4MICA 2X22A 2DC1A 4RZHA 1NOKA 4DMRA 3ZDCA 3SXUB 1SCQA 1Q0RA 3CVWA 2VF5X 1VJRA 1E1CA 1F0YA 1NR7A 2B69A 2O3JA 4MJ3A 1KDZA 2FPKA 3E6AA 4QJ5A 5CGQB 5MDHA 1Q3HA 1U3UA 4NDAA 3K6SB 1VIYA 1Q1EA 4EQ6B 1SKYB 5FEUA 1M1NA 3B1ZA 3O9ZA 4GOLD 2YJ4A 4JCCA 4ZYXA 1J06A 1K3UB 3AVYA 5K7SA 1W4ZA 4CT0A 2BR4A 3KHUA 5FFNA 2QW1A 4B4DA 3TCNA 3AM5A 1XA3A 4DF3A 2ODBA 1H4QA 4KXUA 3ET5A 1UFVA 3CF6R 4ZVNA 4LF6B 1E0JA 4JBXA 1RI5A 1HLFA 3FCYA 3F7OA 5E6UA 521PA 5T67A 4BP1A 3A32A 1P3Y1 4G5XA 3L4BA 4V0KA 2ZJ2A 3B70A 4GS5A 3I37X 4IIJB 4D4GA 1KQPA 1KVRA 1PWYE 3KLOA 2F6RA 3C5VA 2F9MA 1ZVMA 3O90A 2JZNA 3PXXA 2NU6A 5L95A 1U2PA 2XEDA 1Y4ZA 3ROGA 4LHXA 4XDYA 5DM60 1KS2A 3FWZA 4KYVA 1DADA 2Q3CA 4EP1A 3OTGA 2CJWA 1G18A 2ZJ6A 4YCAA 1NBEA 3AETA 5BNZA 3MRVA 3ZXXA 2EGHA 2I80A 2BFDA 3D6AA 1YJ8A 2DPXA 4LE1A 1YIOA 4K9QA 3H1AA 1WNFA 3Q6NA 1MQ9A 2IEZA 3H4MA 3Q5GA 3WL4A 4IMIB 1FXSA 1JECA 2OAEA 2OSBA 4MCIA 2OLJA 4DDVA 3O1IC 5HIKA 3AV0B 4Q3LA 2VQ3A 1WABA 2XKKA 2WHYA 4CMJA 3L8ZA 2XMDA 3KTOA 3KV1A 1GPKA 2FHSA 3D3NA 2O7RA 3E22B 4BTLA 5K0EA 4B85A 3PEWA 1HR0B 4O4JB 3GUZA 3K1TA 1T9DA 4JR0A 5DB4A 4UVGA 4I5FA 2XCQA 1CR2A 4Y6LA 3FPEA 4XSHA 5DBGA 3ROEA 4LDZA 4YAJA 2XAAA 2LKCA 1OH7A 4OHVA 2OYSA 3F98A 4JLJA 2IWHA 1PGJA 1HTTA 2DFNA 2NPIA 3AGQA 3QYFA 4M0KA 1JA0A 1II8B 1T9GR 3TS1A 1B2RA 4L4YA 2E37A 3I76A 1KOLA 5ILOA 1JR6A 1U2GA 4KVZA 2QTRA 3WK6A 4PQEA 1E1LA 3AEQA 3BF8A 1Z5UA 4Z0TA 4DYVA 1ZSNA 4RDHA 4P35A 4DLKA 4DR2B 3WV5A 4UAGA 4FZJA 4HDSB 4WBSA 2CXPA 4PYIA 3H86A 3V00A 4P3XA 5BNWA 3DLHA 1NI4B 3P4UA