4BVLA

Structure of 202-208 deletion mutant of phaz7 phb depolymerase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
335
structure length
335
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
total genus 127
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bvlA00
2IX9A 1J2EA 5CT5A 4UHEA 2XMDA 4N5IX 2C7BA 2ZYSA 2Y2VA 4CI9A 1UOQA 3O0DA 5AIAA 4EA6A 5ISMA 4J0GA 1EX9A 2OXEA 5HK8A 4B84A 2DSNA 4PV7A 3QVMA 2BUAA 4JEIA 5FXMA 4LXIA 4JYPA 5E4TA 2WQZA 1CLEA 3G0BA 4L72A 1Y37A 3KDAA 4BP9A 3WKEA 4FNMA 1VA4A 4FMPA 4XJVA 1LPBB 1EDBA 2JGJA 3G0DA 3FVTA 3CXUA 1MT3A 4BVLA 4Q34A 2WJ4A 5CTAA 2WUFA 4OYLA 1UZAA 5DNUA 1F6WA 4AQDA 4UBLA 4UHFA 5CH5A 3EBLA 5LYYA 4EHBA 4Y2PA 2QTBA 2CUTA 1L7AA 4BE4A 1PV1A 3A70A 1BEZA 5AKIA 2YH2A 1XRQA 4DTCA 1ODTC 2BUCA 4G8BA 3W06A 2OCKA 3HSSA 4Y9SA 5D3KA 3WK7A 1NX9A 3I28A 2QRUA 3VVLA 4MEBA 3H04A 4J0IA 3O4IA 3IIIA 4X00A 1N5MA 1E89A 1YS1X 5AI5A 3FYUB 3L1JA 4X91A 1ZI9A 1XQWA 2VJAA 1DQYA 2BGRA 1E8DA 5BWCA 1ETHA 4GW3A 4I19A 1YSCA 1VA5A 4FFVA 5IVHA 1JT2A 4IH9A 1W76A 1QLWA 5LKRA 3VDXA 4KE6A 1SCIA 3EF3A 3R3YA 4UBNA 2AJBA 3M81A 2HA5A 4H0CA 4X90A 4BAGA 5EHXA 1YS2X 3W04A 1A8QA 3G8YA 2OGZA 5A62A 3D2BA 4HRYA 3EQ7A 2QT9A 2WLSA 2D5LA 1UT6A 3EQ8A 1H2YA 2PSFA 1JFRA 5ALQA 1YB6A 5T4FA 3U0VA 5D6OA 4FNGA 4ZGBA 4HRXA 3OC0A 4GXNA 3QMWA 2OGTA 3G02A 1WM1A 3I6ZA 4WY5A 1ZD4A 4EY7A 3S8YA 5HF9A 1TCAA 2VJDA 1F0PA 4HXGA 3STWA 4KAJA 1XLVA 3LP5A 1T2NA 1EA5A 1WHTA 3AZOA 3G9XA 5FLKA 1XZGA 2ZJ7A 2XT0A 2WJ6A 5CW2A 2FUKA 1DWPA 2HADA 1BCSA 1W4LA 1XZCA 1W6RA 4UHDA 4H7DA 3SWWA 4WDQA 2J3DA 4X3CA 4AZ3A 5I7UA 2HA4A 3OPMA 1MO2A 4AMYA 2RGUA 3R3XA 5EI5A 3R0VA 5JAPA 3HZOA 4JH0A 5HFAA 3I1YA 3IURA 3QPDA 4M0FA 4UPDA 4DGQA 3PI6A 5LIPA 2HA3A 3WYDA 3DDUA 1WPXA 2B4KA 1RYYA 1XZLA 1CV2A 1TCBA 3G9TA 2WIGA 2JGKA 1THGA 5JAOA 4KE8A 3MUNA 2RHWA 1R4ZA 2WU3A 3FYUA 4C4XA 5IH7A 3U1TA 1SOMA 4C6HA 5AOCA 3ANTA 4Z49A 1QIMA 3TGLA 1BN7A 3AILA 5AK6A 4WY8A 3O4HA 4GECA 1UK9A 1R1DA 3A2MA 1CUEA 4J3JA 2HM7A 1AC5A 4YX9A 3A2LA 3PE6A 1QGED 5FRDA 1AGYA 5ALHA 3E1GA 1C7JA 1HLGA 5JAUA 4Q1VA 4DLNA 4BTVA 3QH4A 1ACLA 2XI4A 1CUCA 2UZ0A 4B80A 1OILA 4HVTA 3WLAA 3E0XA 5CMLA 3O4JA 2VAVA 1A88A 2GZRA 4BE9A 2VT7A 3F9CA 3OURA 3KXPA 2VTVA 3MUOA 2PM8A 4N5HX 4H7IA 4TVKA 2DHCA 1U4NA 4AO7A 3JW8A 4B6GA 4EBBA 2XUOA 2PBLA 5AKLA 4ITVA 2OQIA 2ROQA 3NUZA 4N8DA 2HRRA 3QM1A 4BCCA 5EHQA 1DX6A 2I03A 4B81A 4BVKA 5AM3A 3OG9A 1CUSA 2QM0A 2RI6A 3JWEA 1WOMA 3ESCA 1IUNA 3GBSA 3ILSA 5A71A 1BN6A 3G9ZA 5C8VA 5CURA 4PSCA 2GBFA 1T4MA 2VATA 4X93A 2ZSHA 2WFLA 2G5TA 2X8BA 4B7ZA 4UBIA 4WJLA 1BRTA 1DT3A 3BF8A 2QUAA 4AN1A 1WB5A 2H9YA 4DNQA 5CXUA 1YB7A 4PSDA 4K6KA 2CBGA 4J0HA 1KU6A 3KD2A 2WKWA 2EDAA 1DTEA 3WKAA 1BEEA 3B3QA 3DYIA 3W9BA 5ALGA 4CIAA 1R50A 4B9EA 4UBJA 4U2DA 2K2QB 3K9BA 1NU8A 5JANA 4ZI5A 3C6XA 4BZZA 1HBJA 1CUIA 3RK4A 2OCGA 1UKCA 3DJYA 5DJ5A 5AKGA 1LPNA 2BUBA 2XQIA 3I6YA 2I78A 4AO8A 5ALIA 4LHEA 3AIKA 1CUDA 3LIIA 2G63A 5CT8A 2IITA 1WB4A 2O2GA 2V9ZA 1WB6A 2ACKA 4N8SA 4Y2TA 7YASA 3WWEA 2XQGA 5KREA 2OLEA 3O4GA 4FBMA 1LGYA 2C4HA 5T4HA 3C70A 3GA7A 3R3UA 4G4IA 4KE9A 1XRRA 3G9UA 4KR0A 3FAKA 5ALZA 4WFIA 4U2EA 3IULA 4QWMA 3WZLA 5ALOA 1H23A 3BXPA 5AI9A 2VF2A 3DNMA 4QWWA 1L7QA 3WL6A 3PDCA 2XUJA 1ZGCA 1HKHA 4MXDA 4H35A 2VEOA 1EXWA 3HACA 3QITA 4Y2RA 4XVCA 1TCCA 5AH0A 2XUPA 1LZKA 2I3DA 1KEZA 3P2MA 1UKAA 1ORWA 2C0QA 5DTIA 1J07A 2RHTA 2PX6A 1DU4A 3EIOA 2G4LA 4L0CA 5AI0A 1UK7A 2FJPA 3C8DA 2PUJA 1CUAA 5AKYA 5CH8A 1QOZA 1U65A 5K3DA 1LPMA 2V98A 5AHXA 5J3JA 3CCBA 4OU5A 1MAAA 4ZRDA 3ZLUA 2WHRA 5F4ZA 4G4GA 5IKXA 2HDWA 3WJ2A 1CUBA 4ZXFA 2J4FA 4BAUA 4X6YA 4QDZA 4OUKX 3V9AA 1JU4A 3VISA 4BRSA 3AFIA 4MYDA 2R11A 3C5VA 1UKBA 2ZJFA 5HZGA 3VVMA 1IVYA 3BE8A 4FDMA 2BAGA 1MX5A 1GKLA 4BDSA 4X7BA 1C7IA 4CCYA 3C5WP 1L7RA 3IUNA 5LZ4A 1HQDA 1XLUA 5I8PA 4Y7DA 3SK0A 1XQYA 1N8SA 1XZHA 3FWHA 4AO6A 5IVIA 2G5PA 2OGSA 1X2BA 1R3DA 4DMFA 1VZ3A 4KAFA 1USWA 3WK9A 4G5XA 3W05A 5JATA 1E8NA 2VJBA 4MYSA 1U2EA 3M83A 2GYVA 5ALSA 5D7BA 4KRXA 5AOAA 4FLMA 5DNWA 5SYMA 1EDEA 5DYWA 5H3HA 1XRPA 5KBYA 4QDUA 3DOIA 3LIPA 4Y2JA 3C87A 2QVBA 1LBSA 5AKHA 3H17A 1G66A 4U2BA 1ZD2P 1CUXA 2JEYA 1A8SA 3DYVA 3JYHA 1QFSA 4ARAA 3SC2A 5DLPA 3DKRA 3OM8A 4B82A 3I1IA 3F97A 5ALMA 1LPPA 1K4YA 1XQVA 2XMGA 3W9UA 4Y2VA 3D7RA 4TPKA 3QMMA 3VXKA 2WIFA 4GHWA 2OPHA 4B83A 5E4JA 1THTA 1AKNA 4YASA 3UUFA 1QZ3A 4BC1A 3BL8A 2YASA 3TEJA 1ZD3A 1W1IA 5AP9A 1H2WA 3KWJA 1I6WA 1LLFA 4WFJA 1CUZA 1QONA 3F67A 4F21A 3V1KA 3FLBA 5DNVA 5SYNA 5ALEA 1Q84A 4IO0A 4FKBA 4G9GA 3IUJA 5ALPA 4J0KA 4BYMA 3AINA 4K6HA 3H19A 1EB8A 2H1IA 4J0CA 1OCEA 5ALTA 2XQFA 3V1LA 5AK5A 1VLQA 1OXMA 1QIFA 1GPNA 4P08A 3F96A 4OSEA 2BGNA 2WG1A 4MQLA 4OB6A 2VSQA 3ESAA 6YASA 4DM7A 1PFQA 1MJ5A 3FLAA 4BB0A 3H0CA 5AKKA 1C4XA 3AIMA 1MPXA 2HU8A 3D5EA 3Q8WA 3FCYA 4EZIA 2H7XA 4ROTA 4CIBA 2WUDA 5HF8A 1P0PA 4W1SA 4BC0A 5HFNA 3ZV7A 1CRLA 4L9AA 4Q82A 1LNSA 3G0GA 1XZKA 1X70A 1EHYA 4INZA 4EY8A 5LKAA 4UHCA 4CCWA 4B85A 4A23A 5LLSA 2VJCA 5EHZA 5A2GA 3KSRA 2Q0XA 3DQZA 1SFRA 2XDWA 1XLWA 1CUHA 2V97A 2X5XA 1QIJA 4HXFB 3WK6A 5JD4A 2B20A 1MTZA 1E3QA 1GKKA 1YCDA 1BU8A 5AK3A 3AIOA 2C5FA 1UK8A 4DMCA 3WA6A 1ZOIA 2XMSA 1VOTA 2JGFA 1WHSA 1KU0A 2ES4A 3IA2A 5AM1A 4BBZA 4C89A 1CUWA 3WK8A 3WKCA 1K63A 3WIBA 4BTLA 4PF1A 5D3ZA 1IZ8A 4E46A 3HEAA 2O2HA 1WPRA 1DINA 1Q0ZA 4UBMA 1YA8A 1EDDA 2WFLB 1B41A 2CMFA 1ZI8A 1QIIA 2CJPA 4E11A 1EH5A 4I4CA 4GEGA 2WILA 1D07A 2ZYRA 4JUIA 1R88A 3I6MA 5ESRA 1ZI6A 4OB8A 2HIHA 2ECFA 4GWLA 2QZPA 2XUQA 4CG3A 1JKMA 1EVQA 1RP1A 3WJ1A 1VZ2A 1TKRA 5AM5A 5C8ZA 4TGLA 1XZDA 3IUQA 4WCVA 2XUAA 3A2NA 3N2ZB 1UOOA 4CCYB 1AZWA 3H2GA 3WL5A 3HXKA 4L3WA 4FHZA 3NWOA 5I9IA 3H2JA 1A7UA 2JEZA 3PF8A 4NZZA 2DR0A 1FFDA 4EUSA 3WWCA 3V1NA 2XLBA 3YASA 2OCIA 4AX4A 5A7HA 3D4LA 1K6EA 3SX4A 2XQJA 3PUHA 4Q3OA 2GZSA 2VQ6A 3X3HA 1JU3A 4W9RA 2AXEA 1CFJA 4MEAA 3LLCA 2WM2A 5AK4A 5HK9A 3R3ZA 1AQLA 1XRNA 1IZ7A 1QE3A 5FDFA 4PW0A 2DHDA 5JYCA 4G1FA 5HQ3B 1XZAA 1ACJA 1QO9A 2QKYA 5BOVA 1EI9A 1CIJA 1CUJA 3FNBA 1GT6A 2XB6A 4J0DA 1B6GA 2DHEA 3F98A 4S0XA 4E14A 3R41A 5JZSA 2YXPX 4KE7A 2WUEA 2JGIA 3O95A 4MWSA 3WZMA 3C6YA 1VXRA 3DL7A 4LYEA 2QUBA 4M0EA 5K3CA 1EB9A 1M33A 2XQKA 3RARA 1ODSA 4H7HA 3G0CA 5E4YA 1QIHA 1Y7IA 4H7KA 2XUHA 3G7NA 1XZEA 3C45A 3BIXA 3BWXA 3WQHA 3KWFA 4QNNA 4X6UA 1N1MA 2HU7A 5BV7A 5ALXA 4HS9A 2Z8ZA 2WFZA 5K3FB 3STTA 2HRQA 4NS4A 3OOSA 5C81A 1ZICA 3ZLVA 1CVLA 2XMQA 5AM4A 1LPSA 3I2IA 4H7EA 4J0JA 1VXOA 3PFBA 4ZREA 2RIPA 2CB9A 4CG2A 4CFSA 3H1AA 5A7GA 3BJRA 3A6ZA 4AB1A 4NVRA 2WTMA 5AOBA 4XWGA 2QXTA 3FSGA 1Q83A 2OAGA 3C43A 4QDTA 2IIVA 4QEKA 2BJHA 4B0PA 5IVKA 3BF7A 1XZBA 2PU7A 5AKJA 5FV4A 2HHAA 4M0MA 3HRHA 3PICA 5IVDA 3RM3A 2DQZA 4K6GA 5LZ7A 5DYYA 1BE0A 4C4YA 1W52X 4YPVA 4HXEB 4BZWA 2XUFA 2JGLA 4A16A 4I3FA 5EIAA 1YA4A 1AMNA 4ARBA 2WFMA 2PUHA 2W22A 5KWJA 3D2AA 2PSEA 1E5TA 1P0MA 5YASA 4UFOA 5LZ9A 4X97A 1CQWA 4AZ0A 1J06A 1JMYA 3F8SA 5K5EA 1MNQA 1TQHA 2GBIA 2OQVA 3IB3A 4HAIA 3D0KA 3BJMA 2C58A 2PSHA 4U2GA 2HA7A 1MAHA 2DCMA 4Y2YA 5LP1A 2XMBA 2JGEA 2BCEA 2J4CA 5JIBA 1ZD5A 2GBGA 3BDIA 3ESDA 4K2AA 5JAHA 5EIEA 3HC7A 4QLAA 3DD5A 5ALKA 3DLTA 1YR2A 4HZGA 2X76A 1XKTA 1U8EA 3WL8A 4Y2SA 4PQEA 4LIPD 4CG1A 2C5GA 2WIJA 2WIKA 2EEPA 1F8UA 2OG1A 4DNOA 1LZLA 5AKZA 3AZPA 5ALLA 5LZ5A 3TJMA 5HKAA 2GYWA 3UMJA 5K3FA 4P92A 5JZ9A 2GBCA 4F60A 4QZVA 2E3JA 4LKOA 5LZ2A 3H2HA 5JADA 4X95A 5AJHA 2ZJ6A 5C7YA 3K2IA 2ZSIA 4C01A 3FBWA 4U2FA 4BAZA 2Y1KA 4RPCA 5T4BA 4Q3KA 2PL5A 4PO3X 4E15A 2B61A 3NGMA 4DMHA 1F0NA 3WWOA 2XUIA 4GLBA 3FYUC 4KRYA 2DQYA 4KYVA 3QZUA 1IUPA 3IUMA 1YASA 3STYA 4RGYA 1P0IA 3WK4A 4FOLA 2PSJA 5AI4A 2O7VA 2P8SA 2CEKA 3B5EA 2XLCA 3ANSA 2Z3WA 4PNZA 4BCDA 4UFPA 4W1QA 4JYMA 3GROA 1DQZA 1XRMA 5AIBA 3L1IA 2GYUA 5FPPA 3HYSA 4BVJA 4FFWA 2BKLA 4KEAA 3QBJA 5FP0A 2AJ8A 3CCCA 2ZYHA 5AICA 4IH1A 5BWBA 1SCQA 3V1MA 3I2KA 3C8HA 5HF6A 2CKMA 4FBLA 1GPLA 1W75A 4O08A 3AZQA 3ESBA 1CUFA 3ICWA 4EB0A 1LPOA 5C8XA 3WWDA 2XUKA 4IH4A 4FWBA 3WMRA 2OCLA 3CN9A 3WA7A 4OPMA 3T4UA 3VKFA 5DYTA 5AI8A 4DSZA 3WI7A 4NMWA 1FFCA 5FUMA 5K3BA 2HA0A 4J03A 5E2IA 1UXOA 5FPQA 1EK2A 2JGMA 1H2XA 5DWDA 4DNFA 2H7CA 3OTQA 4DNPA 1R9NA 2ONCA 3V48A 4KAAA 5ALUA 4DSAA 1CEXA 3D59A 4LXHA 4P93A 4QDXA 2PU5A 4Y2UA 3DL4A 4OD0A 2WIDA 3IBTA 3DS8A 2WTNA 3NOXA 3R3WA 4UFNA 2WUGA 2BFNA 3AJAA 4DYHA 1DX4A 2C0PA 4JNCA 1HPLA 4V2IA 1GQRA 5ALVA 4QLOA 4Q3LA 5CBKA 3QYJA 4UHBA 5CXXA 2WG2A 1FFEA 3S2ZA 1A8UA 2JIDA 5ALJA 1XZFA 2RONA 3I2GA 4AXBA 1YAHA 1AX9A 5AKEA 1ODCA 1AUOA 2JBWA 3ED1A 5ALRA 1R9MA 4LYDA 3MVEA 2AJDA 1DWOA 2B9VA 2D0DA 3MGAA 1CUYA 1JMKC 3WWPA 4UBKA 4N8EA 4XX1A 3M82A 2HU5A 1UWCA 5CRIA 3ZWQA 4C87A 5A7FA 4QDOA 2W6CX 1J1IA 3ZI7A 5K3EA 4H7JA 2QS9A 3C6BA 4G8CA 1TAHA 4B0OA 1X2EA 1H22A 3GUUA 2WG0A 5JD5A 2QXUA 3E3AA 4BP8A 1TRHA 1E66A 4X6XA 5ALYA 2PSDA 5FOQA 2XMRA 1XZJA 4C88A 4UUQA 4EY5A 1CUUA 3G0IA 4ZWNA 2ZVDA 4RNCA 3IDAA 3PF9A 2HL6A 2QJRA 1XROA 1FFAA 4D9JA 5AM0A 3O9MA 5AO9A 2QJWA 1XQXA 1JJBA 5EHNA 2Y2UA 4KJXA 1QJ4A 2NW6A 1QFMA 3E4DA 1LPAB 4H77A 1JI3A 4GDMA 5EGNA 1QIGA 2XUGA 3D2CA 3QMVA 2VAXA 1WCYA 4F0JA 4MWTA 2WHPA 3H2IA 5AM2A 3FVRA 3WL7A 3DOHA 1K8QA 3H1BA 3HABA 3DCNA 3GELA 1TIBA 2XUDA 1EINA 3WYNA 3L1HA 5ALFA 4X71A 3K6KA 1H2ZA 5JASA 4X92A 4G8DA 4UHHA 5CT9A 1XFDA 3DEAA 3FYTA 1BS9A 1VJ5A 5AI6A 1VE6A 4Y2QA 1P0QA 1RWQA 2HFJA 3WKBA 1VE7A 5FKJA 1CUVA 2PPLA 3FOBA 3R40A 3Q0TA 5KWIA 1XKLA 4A5SA 3BIWA 3LCRA 4IHAA 3TRDA 1IMJA 3N0TA 3C6ZA 4WFKA 2AJCA 4EY4A 3HI4A 3BDVA 1ZIYA 3STXA 3H2KA 5A6VA 5HCUA 2ORYA 1PJAA 2HFKA 4W1PA 3EQ9A 3M3DA 4H18A 4AMZA 1E8MA 3WIOA 5JALA 4J7AA 1Z68A 5LZ8A 5ALWA 2WJ3A 5ALNA 3DKKA 2HA6A 1ZIXA 2OAEA 1G4HA 1JJIA 3HLKA 4K5QA 3I2JA 1BCRA 4FLFA 5EIHA 1LBTA 4YK7A 4X85A 1AURA 4RE5A 1MN6A 2I3ZA 3WK5A 1N5RA 5JD6A 1EVEA 4EY6A 1ISPA 2YYSA 4BDTA 3QPAA 1CUGA 2PVSA 3RLIA 3GZJA 4WDRA 3FCXA 4HTAA 4B9AA 3VJKA 5EFZA 5HQ3A 3VJMA 3ZPXA 1MX9A 4G4JA 1QIEA 2Y6VA 4BCBA 1XZIA 2WSLA 2J3QA 4KACA 4OCZA 3O9VA 2XE4A 4OU4A 4BRZA 2WHPB 3B12A 1G42A 1ORVA 3QPCA 3H18A 1SCKA 1GXSA 1MU0A 2HA2A 3FSGD 1QO7A 3IVMA 1GPKA 1ZGBA 5HF5A 3W2TA 4QA9A 3AUKA 1FJ2A 2Z5GA 2Z3ZA 1QTIA 1JJFA 2AJLI 1UFOA 4H7FA 4IQ4A 4W63A 4OYYA 1VKHA 3UUEA 2R8BA 5CT4A 2Z8XA 3I2HA 3RKSA 1S8OA 1CPYA 4FTWA 4X94A 1MNAA 2QR5A 2VA9A 3T52A 4U2CA 1FSSA 4Y2XA 1HL7A 1QIDA 1QTRA 2O7RA 1DT5A 3STVA 4ZV7A 4QE3A 2ZYIA 2RAUA 2WU4A 1QIKA 2V96A 3FLEA 3VJLA 1XZMA 1IUOA 2Y6UA 2JF0A 2XMZA 5JARA 2H7YA 4W1RA 3STUA 1GQSA 3ZLTA 1XRLA 1FFBA 4BATA 4PSUA 4MJ3A 3GFFA 4FLEA 4G9EA 1O6FA 5CH3A 3KOOA 3I2FA 4C4ZA 4LXGA 1HDEA 5CT6A 3HJUA 3ICVA 5T4EA 4DIUA 1O6GA 2EDCA 5ALDA 1TK3A 3LS2A 5K3AA 1CR6A 2XMCA 1BROA 4XIIA 1NU6A 2DFPA 1MX1A 1YAJA 1ZJ4A 1Y7HA 1EK1A 4F5ZA 5HKBA 1K5PA 1GGVA 5DTJA 4ETWA 3D3NA 1DWQA 3CN7A 2PKYX 3PUIA 2FX5A 1ZJ5A 2VT6A 4AN0A 2O2IA 1GZ7A 2QOEA 3WKDA 4OB7A 1SC9A 4GI1A 2FJ0A 2WHQA 4GBGA 1CQZA 5JZBA 4ZV9A 4UBOA 5AKXA 1Q0RA 2LIPA 2QMQA 2CZQA 4DMKA 4Q05A 1UK6A 4RE6A 3PFCA 4P9NA 1UOPA 2ACEA 1G5FA 3R3VA 4MQMA
chains in the Genus database with same CATH superfamily
5A9TA 3IHLA 1XO1A 4OHZA 1KZ9A 1R8QA 2C83A 3NP7A 4OJTA 1YZHA 4PTLA 4MQBA 4DB4A 2DU8A 2EYUA 1OJLA 2J31A 1U3GA 1AGXA 1Z6XA 3GJRA 5JD3A 2H8KA 3VDNB 2ZP1A 3U3DA 2ZXUA 4N5IX 1IBMB 3COVA 4NMMA 1BXGB 2GERA 5ANRB 2CCKA 3QYPA 4UUMA 2RGEA 1QPGA 2DPHA 2OBNA 4CI9A 3GGOA 2BSXA 4B2PA 1UOQA 2P1DA 2P7HA 2WF9A 3RTBA 3P5BA 4LHZA 4CEJA 2AE1A 1XKXA 4K7JA 4EUKA 3M3PA 4J0GA 5EE1A 4ES6A 3I23A 5CGQB 3HN2A 4JQCA 2CL6X 2RK4A 1LK7A 2A0KA 3GVIA 1CB0A 1RNLA 3NJ4A 4MKHA 4PV7A 3UHOA 2KM1A 1CZRA 1G3RA 1EBUA 1W4CA 2GZ3A 3HXOA 2BKUA 5E4TA 4DM3A 3G0BA 1CLEA 1IBSA 1LBIA 1OKKA 1Y37A 2GKGA 3FCSB 5CG2A 1RIFA 3A9SA 3SFVA 1DAHA 6CHYA 5CPFA 4LTNA 3BMOA 4NJOA 4ZCRA 4KXFB 1P5HA 2FN8A 5IEBA 2QVLA 3TRJA 2J41A 5CEJA 2OL4A 1GPYA 4XJVA 4ZIRA 5BNWA 1NP7A 3C48A 3DE2X 3G0DA 1E6MA 3FVTA 4DA9A 3IAEA 1QZTA 1AKMA 1XNGA 4IWNA 4QDKA 5LQSA 3BL6A 2REQB 4Z4CA 4MULA 2VHTA 3ZZUA 3VDRA 1WXIA 2W6IA 3EGXA 3GRCA 2IZZA 1UBGA 5EMMA 4DCPA 2O8BB 3ZNQA 2Y4NA 3Q5EA 2F3TA 3GJ7A 4IZIA 2VDVE 4EJ6A 3QYAA 1GDHA 3OT1A 4AQDA 2QR3A 3DC2A 1M0TA 1XL1A 1KY5A 1U0HC 5EHIA 1E5QA 3ZI4A 4DZZA 5CH5A 3JQ7B 4HAXA 5L95A 4GC5A 4B87A 3EBLA 1N25A 1ZMRA 3QNUA 3HCCA 3OPQA 5JH7A 3CGWA 5IT9A 2QTBA 1JFFB 1P91A 1S2DA 1X19A 5B6JA 1C1DA 2YN4A 4QUAA 3D5TA 2QTCA 1ZRSA 1DIBA 1U3FA 4R84A 4TZTA 2WZBA 3HDGA 1PV1A 4FJ2A 1BEZA 4Y9TA 5AKIA 4AZ0B 1L3IA 4EGCB 4WZ6A 2I0FA 2YH2A 4IDGA 3GD5A 2OCAA 4X60A 3ZHOA 3RYCB 4MCAA 1EG2A 3ADPA 1LVHA 1T5HX 4FE4A 1Q2UA 4G8BA 3W06A 2XIQA 2QT1A 1MJGA 3IOMA 3OOJA 1HE3A 2OCXA 2FWAA 2OXCA 3HSSA 4R2IA 4DAOA 2PX4A 3I28A 3W4JA 1HRDA 2WMYA 1U8AA 3PITA 3GVXA 3A4VA 1Z37A 4RJKA 1MXHA 1TMGE 2TMYA 3LD9A 5CVCA 5DOVA 5FQOA 1U7TA 2BBWA 3VVLA 1UXIA 1T0PA 3H04A 4J0IA 1L9KA 4CMIB 4U7DA 1FB5A 1MGPA 1PX2A 4N3GA 1PYDA 4GZ3A 3AEKA 4G86A 1K8YB 3WRXC 3S1SA 3RUEA 4DR4B 3V7YA 1JHAA 1N5MA 1PD1A 2I2FA 2IYRA 4X3OA 4BB6A 3Q98A 4FW8A 5AI5A 1M6EX 1R4NA 3ENZA 4X91A 1ZI9A 3CW9A 1UDWA 2D2VA 2W48A 1DX9A 4RIGA 2W90A 3H9UA 3I1JA 1T8RA 2VJAA 2X77A 4UDNA 2ENWA 3O2JA 1E8DA 3MCZA 5BWCA 5K8VA 1ETHA 2R65A 3GJTA 1VA5A 2C7OA 2VUTA 1UAGA 1JT2A 5I8WA 3B82A 3T5CA 1ZOOA 2FYTA 5JS2A 1W76A 5DBGA 1U3DA 2POQX 3I92A 4M83A 3N07A 3VDXA 4WZBA 3F7TA 4A03A 1YZYA 3OBIA 1L4NA 3LPCA 3SR4A 2OR3A 4WL0A 2W00A 4IW3B 1PE0A 2PKRA 3L7OA 4YP1A 5IU6A 2VDWB 4FFPA 4LZNA 2PS9A 5E1BA 2QRQA 3R3YA 4C78A 2AJBA 5KHAA 3EXEA 1JN0A 2I4LA 2ECOA 4YYZA 5EERA 3HYCA 3L7CA 4HQFA 3U4QA 3VYRB 1P31A 1TC2A 1LF5A 2V3WA 3R8FA 4FP9A 4ZU1X 2KQUA 5LMNB 2A14A 4HHEA 2X1VA 1SIUA 3DO8A 3IX7A 3ST7A 1JHMA 3QMPA 1A8QA 1NMQA 4NMXB 4TLEA 3OJOA 3GP8A 2R2AA 3PC7A 3L77A 5IFLA 5FNVB 1WVGA 4TWJA 3HB0A 4AULA 4GLLA 1NOKA 4HRYA 2DBYA 5DMHA 5K51A 3UMRA 4N01A 4ZJZA 3I9JA 3EQ7A 3P7MA 4YS6A 4FNAA 4P7KA 4PE5B 3D3KA 1QS0B 1RAGA 4PZDA 4F04A 3H87A 3X1DA 2WLSA 4ZV4A 5BORA 1VJ1A 1NPYA 2R44A 5IARA 1HM5A 3EWSA 3IXLA 2D5LA 1V8PA 4Z9AA 2QTAA 2Y68A 2AG1A 3MW8A 4U9UA 4MWZA 1KIAA 4BHTA 4PLCA 5C7OO 4OQQA 3ZI0A 1N5JA 4NH0A 3OOEA 1JFRA 1U7WA 2VFAA 5ARBA 4ZPXA 2NU7A 1TTHA 2G04A 1U8TA 3ZKWA 2AQKA 5T4FA 3L4EA 1R6BX 2LP4Y 2ONZA 4MS4A 3BK7A 5FI3A 2H4XA 1KEVA 1FLNA 4ZVNA 5DN6A 2QZ9A 1A5ZA 1I3OA 1SVLA 3JZFA 3SR3A 1J8YF 3DA8A 1S89A 4LY6A 4B40A 1QDEA 1URPA 2BZ1A 4ZGBA 1TL7C 1AHPA 4PZ0A 2BZGA 3QMWA 2OGTA 3G02A 1A69A 1Y89A 3PR2B 2IYUA 1O94A 1WM1A 1GFZA 3I6ZA 4C4OA 1KH3A 4JV5B 1XD8A 1Y1QA 4K9DA 4EY7A 4XWWA 1E9VA 4G97A 3JYQA 1LEHA 2QTZA 1XD2B 5HF9A 3UTDA 1U7PA 3BKXA 4NDNE 4AJOA 4A8JA 3VNBA 5J2TF 4NI5A 2FQXA 1F0PA 3FYSA 4IQ8A 5E6UA 3X1WA 3PXXA 1P44A 1KJYA 2VYQA 3LDHA 3STWA 2A9FA 3N75A 2C03A 1A1SA 3INTA 4IM7A 4Z86A 5JMPA 2O3SA 4CDNA 3H5RA 5KB3A 3LP5A 4PC2A 4XM2A 4ANFA 2JVKA 3RAFC 4RANA 4TROA 1HDYA 2BDEA 2ZJ7A 3MTDA 5DTEA 3OQPA 2X1MA 2XT0A 3I05A 1HFJA 4KVZA 4ZMSA 3VDMA 2ZJ4A 1TA4A 3G2LA 5IJ0A 2Z4TA 5KYUB 2FUKA 4QYIB 4JXXA 1P2UA 3ET4A 2ZFUA 2Q28A 1TVMA 4M55A 1PVDA 1T5BA 1ZK0A 2AOTA 3GRKA 1KDVA 3DYBA 5HXAA 5AJUA 4R7GA 2AQ8A 5IAJA 4QL3A 1ZINA 3LC0A 2R7MA 4JK3A 4CIVA 1J21A 5A6SB 4CJXA 1XZCA 4DPMA 2WJWA 3V2UA 3PQ5A 2H5IA 1W6RA 5P21A 5C3MA 5A9SB 5B58C 1DCMA 3HMKA 4H7DA 3SWWA 4JR2A 3HR7A 4QBHA 1DKNA 5H80A 3TCKA 4DUYB 2HA4A 4KVGA 1BD4A 1MO2A 4AMYA 4D44A 4HYEA 3CSSA 3WSWA 4CF5A 3PFIA 2AN1A 1W19A 1M6VA 1VECA 3HZOA 5DCLA 5IW8A 1RXCA 1YZVA 2CJWB 4JH0A 5BNFA 3QPDA 1T36B 2IRWA 2WJJA 4ZCMA 2HXSA 3T95A 4I1PA 3WZ2A 3IIEA 4PGGA 4YAEA 1VCNA 5JV5A 1FW8A 3K70D 1XRSB 2WF5A 1CQXA 5LU8A 1JF8A 1V5WA 1XB2A 1T2DA 1VG8A 2C7RA 4DF3A 1ONSA 4GVXA 2B4KA 5JS8A 1JHQA 1TVKB 3C3MA 3K8ZA 3DEJA 3BSWA 4BWVA 2CXXA 2PMDA 2QQGA 1T1GA 3P2IA 1J99A 1QUFA 4D8UA 3MBIA 4E33A 3UMMA 2GPYA 3TB6A 4XTCS 2HO5A 1L5HA 2MIIA 3GJYA 3NP9A 1VSUA 4YJFB 1D0VA 4X7RA 2J0VA 2I7VA 1M0WA 1UC4B 3NTUA 2DPMA 5JAOA 2CFCA 3ZIAA 4ZU3A 4NSNA 5DI9A 2SBTA 2DWCA 3K0FB 3IB6A 4LX0A 1E1LA 5JXIA 2RHWA 1R4ZA 3EVNA 3P26A 1S5PA 3V3KA 2VVTA 4PXYA 4LJ7A 3FYUA 3C85A 3WRXA 4D9HA 2D5IA 1P8AA 5JMWA 4PYQA 2ZJ3A 2ZB2A 4NBLA 4XD7A 1ISIA 3EXG2 1PR6A 3MT8A 4OXXA 4IS3A 5J2UF 2YMQA 4M89A 2ZEJA 3ANTA 4KAXA 1M1YE 2O52A 4YJ3B 3TX6A 5KJ6A 3NETA 2HZBA 1YZ3A 2ADFA 2VPWA 3QVGA 4TYYA 2GKSA 1SVIA 1X7GA 5FOXA 2AMYA 4TYPA 1VDMA 1I1NA 2FEKA 3BPSA 6ADHA 3AILA 5REQB 4EFDA 4AY2A 3NNSA 2NV6A 1OX4A 3SNKA 1XK6A 3O4HA 1R74A 1DEOA 4PNHA 4L4RA 2O59A 2H2FA 4IQFA 4PFQA 3G7UA 3WYBA 1R1DA 1FYEA 4FB4A 3A1DA 4P3NA 1SB9A 4INPA 1W2GA 3OZWA 4HB3A 3KSBC 2W6ID 2QPTA 5KTRA 1P39A 1R8JA 3JQPA 3IVGA 5BSMA 3AVUA 4RH1A 5A2GA 1KYQA 1A9YA 2EW1A 1GV1A 1XBTA 4NOMA 4BWFB 1AC5A 4YX9A 3WGIA 3A2LA 5IYZB 2I7DA 4BMPB 4FS3A 1NVFA 5H5JA 4KLZA 4PZUA 3MJVA 4BQSA 1EWQA 5IT4A 1EDZA 4A27A 5KSWB 2VDOB 4ATNA 5BSUA 5T67A 3ZG6A 4BASA 1H0HA 4B33A 1ZMXA 1JYEA 2JCYA 4BKPA 3WGOA 4EQZA 5KYWB 3BXOA 1H5NA 1L4GA 4JQOA 4NZNA 4Q1VA 2A1UB 3RRZA 4DLNA 1B8UA 4L51A 1ACLA 1G6OA 5AXCA 2VJLA 1A2QA 1L4UA 2EV9A 1CQIB 4DQXA 2GX6A 1JHOA 2FHPA 4ZXPA 3VM6A 5CBPA 2ZI4A 1SA0A 5J5AA 3U80A 4RM2A 4C0WA 1T3TA 5BW8A 1MAVA 4RJJA 5JDCC 4B80A 4YONB 2OUIA 4HVTA 1I10A 2VT3A 3E0XA 4R9RA 5LYJA 2VBGA 4Q48A 1MX3A 4V2UA 4Z54A 3VKGA 2VAVA 2LVBA 5T6MA 5C31A 3TIIA 2PAAA 1AZLA 3RSLA 2VT7A 3F9CA 1GO2A 3OURA 5K6RA 3KXPA 5F12A 4M9UA 2Q8PA 4TSRA 2E0IA 4G85A 5F7JA 4BFWA 4G67A 3DOJA 4ZRNA 4QOSA 2ZKIA 1LW6E 1UQTA 4H7IA 5KCMA 4RZ2A 5GPBA 4L08A 2VC2B 2VHCA 3F49S 3JW8A 4P4SB 3N8HA 1X9HA 5JDIC 3COWA 4L4UA 2OYCA 1KKMA 3KB8A 4AP5A 2Q0SA 1GYPA 4LGCA 2XUOA 1MJGM 3MGCA 3VU1A 5AKLA 1BMFA 2GBPA 3T5MA 2JHPA 2H3EA 1ZISA 3LZCA 2QVZX 3H84A 2OQIA 4C08A 4GVLA 3CUWA 4XIYA 4B32A 1RHQA 1RWKA 3BVPA 2OZLB 2QB5A 2C2ZA 4GOLD 3VJRA 3BRCA 3LC1O 1BX0A 4BCCA 4D92A 3GCWA 4PGHA 4D96A 2HBYA 4BVKA 5ILOA 2QTGA 2R8XA 4P33A 1QOQB 1JU9A 2VTBA 3IQEA 1T5OA 1BSVA 2AFIE 4MGKR 1CUSA 2HF8A 2JA1A 2RI6A 3FPEA 5D5HA 5DU2A 1V1JA 3P9XA 1IB6A 3NFRA 3WNVA 1GNQA 1KI8A 1NTRA 2IYXA 1IHYA 1GPUA 3GBSA 1P1CA 3A1EA 3K0CC 5EKTA 3U7QB 2ONYA 4LZJA 3AF6A 1BC5A 3H5NA 1QLJA 3ILSA 3PUXA 5CX1A 4JBYA 1BN6A 5A71A 3TXXA 2Q5LA 4XOIA 4C2TA 1Z34A 3HB5X 4PSCA 4Z3KA 2VATA 2JJ2A 1PR4A 3PBKA 1RYMA 2VP6A 3ER8A 5FD8A 1WY5A 1YQXA 2X8BA 5BQOA 1NQ5A 3HKEA 3FFWA 4BMZA 3BF8A 3OJCA 1QH9A 1XP5A 3HP1A 4L27A 1FRFS 1TW3A 1UP7A 2EJWA 3DL0A 4TOIA 1WB5A 1YOVB 5AJTA 5THKA 3W9SA 4XVHA 1ZR4A 4E4TA 3FCEA 4IGIA 4KO4S 3MJFA 4L4YA 1NRWA 3K4HA 3FNGA 4J0HA 1RXYA 1WP9A 4GE0A 4K6KA 3KD2A 4MA0A 2WKWA 3AHJA 3ZZ1A 3GLFA 1UBSB 1EBFA 1XXHB 5AYVA 1J39A 1U5BA 3LGAA 3INYA 3ON5A 1K92A 2ANBA 2PPVA 3HDYA 4BJ3A 2XH8A 4IWYA 3QIVA 2A4MA 2ZE8A 3GGJA 3W9BA 4MDHA 5ALGA 1A9XA 2ZVJA 1UJ6A 2OAP1 5ELLA 3U3JA 4BNYA 4UBJA 6ABPA 4U2DA 3BRSA 5LR6A 5EY5B 1PWHA 4IV0A 2VHUA 3E58A 3AV0B 4P5EA 1XQ9A 2YN0A 3OE7D 4HAOA 1G63A 4IEIA 4JVSB 4Y1RA 4QXAA 4ZVTA 5GIOE 2HAEA 3KUUA 5F1KA 4BZZA 3QENA 4CKXA 3IPCA 3NPAA 3NKFA 1UR5A 4WZAE 3RK4A 4IEFB 3UJ7A 3AL0C 5DJ5A 1N8TA 4OFXA 5FLXA 1NVVQ 3GH1A 1LPNA 3MUFA 4ZAWA 4MLCA 1ABBA 1D0IA 5CDYA 3WGGA 3KOUA 2GD0A 2YJZA 3OZ7A 3H5WA 2CYAA 1AQNA 1PJRA 2I78A 1JSCA 2GDZA 4Q03A 3GLHB 3VKHA 1UBCA 3AIKA 3SLGA 3SM9A 3GFVA 3H9JA 2JATA 3EIHA 2WJYA 5EUQB 3EZ6A 4MR8B 3SSMA 3TAUA 1UBNA 2A1TR 2NUPA 2Q7XA 3PZRA 1EFPA 3B7PA 1WV1A 1J8FA 2CVFA 2IITA 2O0HA 2OD7A 2YZMA 4MV5A 3ZIDA 4OTZA 1WB6A 1Q22A 2QUJA 3K0FA 4ND2A 4S3MA 3EFOB 3ROQA 1T5DX 3TQCA 3ZLBA 1ARZA 2DRIA 2VLIA 2P3QA 1P2TA 2VWQA 4KPUB 3DZHA 2OLEA 1W93A 4CKCB 3TD9A 1GCOA 1QGAA 4RZXA 5C0OE 1E3WA 1AO3A 3GA7A 3LW7A 3EY4A 1JDTA 1C3OA 2VDNB 4KE9A 2FPIB 1QQAA 1YRLA 3L6BA 3F74A 4ZHQB 1VG1A 1YMQA 4WFIA 4EFLA 1PJ3A 3N59A 1Z6GA 2GB4A 1T0JB 2UDPA 3NT4A 2I9PA 1P80A 3OZTA 1BMTA 2QRVB 2VCHA 3E5RA 1L3BA 2OCYC 2O3JA 3TH5A 1GITA 5K6AC 3UJDA 1A95A 1G21A 2FOXA 5JNUA 3MPOA 5BT9A 2L69A 3AC0A 1OFIA 4BJ5A 4C0AC 3P2EA 3OEWA 3CEJA 1B76A 1IEQA 5DHUA 2FZEA 5BQPA 3SEFA 3TLGA 5L6LB 3QEAZ 2YUTA 1U2QA 3R75A 4Q3DA 3PXEA 1PFUA 4Q4JA 1C4OA 1IOVA 1QKKA 2ATVA 3IJPA 3S29A 1NLMA 4Z99A 4OMUA 2F43A 5JE8A 1TZBA 3ZU3A 5EZ5A 1U11A 3DM5A 1HKHA 3LHDA 5EJ9A 4N5NA 5C1PA 1NYRA 2VEOA 2V9PA 3GJ8A 3IAFA 1XTRA 4HCJA 4L9RA 5FWYB 1P1IA 3A06A 4KPFC 3HACA 4LW8A 2GPAA 3R4VA 1PJ2A 1GSIA 1EJ6A 1R5OA 1LZKA 3QBTA 3RIGA 2IW1A 3VMFA 3H86A 1Q1BA 2JGRA 2I71A 1TOAA 2D8MA 1UKAA 1QMPA 4MKXA 4ENRA 5BNIA 3OEHD 2ZUBA 2PGDA 3ZXSA 4EELA 1A4XA 1UKEA 1SKUA 3S81A 3HQ4O 1J07A 1X14A 3BFJA 4G1MB 4ZYTA 1VKZA 3GT4A 1CP3A 3PNLA 2BR3A 2NUBA 3A8TA 3EIOA 4MWEA 2WVJA 3RC2A 3ZS9A 2PZMA 3W5BA 5JS1A 1QHHB 2AI3A 3HUFA 4F71A 1NYTA 1XDUA 2PZFA 5AQEA 4CT4B 2DKOA 2V7UA 3R77A 3R7DA 5DHSA 1VCHA 1ZJZA 2QU8A 3M4ZA 2FJPA 3M49A 4RS3A 3ANNA 5G2OA 2PUJA 4FHEA 5AKYA 5CH8A 2EJVA 5DT9A 3LF1A 1Q74A 1U65A 4QTUB 4NONA 1Y6QA 2AG5A 4U63A 4ZU6X 3OY7A 4RM3A 2J5KA 1GYRA 5AW2A 3DCJA 2WA1A 4NFHA 5AHXA 5F7XA 5B4VA 2PV0A 4TS1A 3V46A 4BMXA 5G40A 3UB2A 1WHSB 3ILXA 4LZWA 3VSBA 1ZGAA 2I66A 2WHRA 3F3SA 3ZLUA 3THOA 4EKGA 3O94A 4O6VA 5I9BA 1BVYF 3MOIA 4KN9S 2DWQA 1NBIA 1R0BA 1MORA 1ULZA 3FTQA 3WJ2A 3WLPA 5F9HA 1WPQA 1CUBA 4X0EA 5FT9A 3ZJUA 3ZNPA 1ATZA 2REXB 4RJ2A 1TO6A 4BAUA 1KK1A 1NFQA 3UFXA 4ETNA 3TW6A 1YDEA 3NV9A 3L7LA 3TNJA 5IZCC 2ZI5A 2NV2B 2XWPA 1QE5A 4NYJR 3X44A 3V7NA 3NRBA 1KK2A 2X1LA 2XDAA 5H1YA 2ORIA 3AXTA 3KXIA 1LWNA 2HSZA 3V8BA 2I6FA 3SC6A 3GEDA 4FQ8A 2E85A 4OSOA 4BNDA 1TW2A 1RWVA 3C5VA 3C3JA 4DN6A 5HZGA 1IVYA 3I83A 4MQUA 2YXNA 3BE8A 4BFCA 1OWLA 1H6DA 5I9SA 1NW4A 3GLIB 1T29A 4OQLA 1ZS9A 4UC0A 3G5LA 4YP7A 5T8KA 4RENA 4RTJA 1P2FA 4H2DA 4QQFA 2J3HA 3IE2A 5KUTA 2EFYA 2P6RA 2B5OA 4A6EA 5JDIA 5GOZA 3BA1A 1L5FA 3E7PA 1FMJA 4H0FA 3R3HA 3OF3A 2LCFA 4I7EA 4Q4AA 5AFSA 1NP6A 5CFRA 2FPOA 4RFSB 1W88B 4N3CA 2Z4RA 1K5GA 1M2KA 4M21A 3HBLA 4P84A 5DBIA 5IFKA 2CVOA 5LZ4A 1MC4A 1O03A 3KSDO 3PYMA 3CLTD 5F5NA 4KO8A 4UTVA 2DERA 3CR3C 1X7DA 3Q3GE 4UTPA 2BTEA 1I1QB 2IU3A 4O4LA 3Q5DA 3UN1A 4DMUB 4F46A 3ASUA 1ZUD1 2CVHA 1UCFA 3RS2A 3ERCA 3TR5A 2YWRA 4IG9A 5BRNA 1PTJC 1VLVA 3CTMA 5IJWA 5I7RA 1GM5A 2H4JA 3I5UA 5E0KB 2WNIA 1J8QA 2XE8A 3C0KA 1WZEA 1R3DA 3INRA 1Z63A 1VZ3A 1KFJB 4KPGA 4XVUA 3NBZC 4NLLA 4OXYA 1B00A 4KAFA 2WSYB 2WAXA 3F3KA 3IDZA 4BO1A 3B2QA 1EFRA 2G6TA 2C82A 3DZFA 1SQFA 1DXYA 2VJBA 3DZ8A 2XCIA 1U2EA 5DTMA 1SOAA 4WZZA 4KRXA 3S2YA 2DBVO 2J7PD 2QTVA 3FRJA 3NJRA 4RULA 4KH0A 4FLMA 1ESEA 5DNWA 4RA6B 1ML4A 3GG9A 5D5PA 4AN4A 1NASA 2MINB 2SHKA 1IY1A 2JJ1A 3MN1A 4N0DA 5D1NA 1YI1A 4KW7A 2B8WA 1UBUS 4MAFA 2G5GX 3EG9B 1SXJC 2W83A 3QV2A 3C4QA 1EM6A 3CE9A 3DUWA 1C41A 1XRPA 2OESA 4M1ZA 3RYIB 5AVJA 3TIVA 5C8DA 5KBYA 1Z39A 5L7WA 3LIPA 3SJCA 1UMKA 4Y2JA 2AFHE 5K0NA 1JJVA 4LKRA 1YIOA 4Q3NA 1PNTA 4K6CA 1E4OA 1G66A 5E2BA 2XKKA 5K0TA 2DMRA 1QVVA 1W5FA 1CUXA 5J58A 4TLBA 2Z9CA 3HV2A 3BT7A 2OGWA 3FJ1A 3PXBA 5JY1A 2ZIEA 4L6CA 1QU2A 2H2WA 1NXOA 1RVV1 5EWJA 4UCWA 1G98A 3EWNA 1T8PA 5DRTA 1KQ3A 2E82A 4FIZA 4YLEA 1LFAA 1KORA 3O90A 4WFQA 1BCSB 4ARAA 7REQB 1OPRA 4D99A 2A1TS 3JTMA 3HGTA 1MC1A 2JH3A 3QUBA 1JDPA 4B82A 1X7XB 3IEVA 2WMDA 3CFYA 4MVWA 4A0RA 4BFUA 3JYOA 4UARA 1Q0TA 3AWIA 1EK0A 3W9UA 3O8OB 1TYZA 2P9GA 1DV1A 2JD2A 2K5UA 4MUXA 3QMMA 3VXKA 2C3UA 1QQ6A 3SZMA 1GL9B 2A0YA 2RK3A 3NAMA 4I08A 1KYVA 2OPHA 5BPHA 5CVTA 5BR7A 1AMUA 4W9NC 3JVIA 4IOLA 1EVYA 4EG5A 3L93A 2AGVA 2X0KA 2ZBGA 1G4UR 5LA6A 3EAFA 3BSYA 1AKNA 1Y6ZA 2ZJ2A 5GGYA 4JLUA 3AFOA 2JBAB 4IMRA 3RQIA 1UEJA 3LHIA 3PHGA 4PYMA 5GJCA 2EHJA 1FNCA 3FMVA 3NT5A 1ZPDA 3PTLA 2QM3A 2FSPA 1SVOA 1ZVKA 1ZD3A 4GX2A 4JT9A 1WS6A 3VU9A 4QJBA 5GTDA 4RK0A 1ZONA 5AP9A 3VKWA 5CA1F 4B34A 3N0RA 4M4SA 5LP6A 3KWJA 4CQNA 3CNEA 1CUZA 5E4FA 1QONA 1KY4A 4D9FA 3NONA 4KLCA 2H57A 4CI0B 4MK4A 4EG1A 4PYJA 4Q7MB 3ZQKA 1NT2A 3FLBA 1C2TA 1BRMA 2EZTA 2WVAA 4GYWA 2BDTA 4PBSA 3EJWA 4IXNA 4UNQA 3F5QA 2BFCB 4IO0A 4FKBA 4C9BA 1FUEA 4FZRA 4PYRA 4F1KA 5EE3A 1OXVA 3HBJA 1GZ4A 4F72A 1H9AA 1L1EA 3KTDA 3N8DA 2BKXA 4BYMA 4HLUA 5HIIA 4AP9A 7AT1A 1YB2A 2QRGA 3H19A 4TYMA 3GJ0A 4C3VA 3D4NA 4WERA 4G2TA 4KFTA 3OKCA 4J0CA 1I5EA 2GZ2A 5FA8A 4TQGA 5ALTA 2DQ4A 4P86A 3ZGVA 1G5QA 3TKYA 2D7CA 4DUGD 4IJWA 4A3SA 3C3YA 3FW1A 4YR7A 1SPBS 1JEYA 4A10A 1J90A 3GFBA 1H1LB 2A84A 1Q44A 5AK5A 2HLPA 2Q4BA 5CDFE 1V71A 2A9VA 4K0KB 5GINE 1CDEA 1RE0A 3V8QA 2JI7A 1VJGA 4F2WA 3OAAA 4GL2A 3ZV5A 3ABQB 1MOQA 4DVJA 5A6SA 3FCAA 3AJ8A 3NFYA 3TO5A 4JU8A 1E5LA 3JD0A 1NNSA 3EPJA 1I2DA 1TU0A 3ADOA 3GLRA 4MQLA 3U31A 4OB6A 5AXBA 1CJTC 4L6AA 3VR4A 1U2PA 4ZZ3A 4I1VA 2J87A 2HK7A 3OIVA 2FEAA 2NO5A 3L40A 3OZCA 5AJVB 1KEUA 2O8EB 3D43A 1X80A 3OLXA 1D2HA 1PFQA 2DY1A 1MJ5A 2PXXA 2RHRA 2VYNA 3MJRA 4BB0A 1FX0B 5FYDA 4ZTZB 2ZTMA 4IIUA 3LYHA 4W9NA 2PXCA 3U4GA 2DFDA 3AIMA 1MPXA 4ZYUA 1Y8ZA 1SUAA 5GOTA 1NVKA 1PZFA 2BFPA 1FQJA 3WBJA 4A26A 3QTBA 4TS4A 4U3JA 1GR0A 3HXTA 4RFSA 4Q4DA 4CIBA 4HBZA 4NK5A 1S96A 2O0LA 4YWJA 1RXUA 4W1SA 5DT2A 3U6BA 3KTAB 3I5MA 2CEAA 4E7PA 3C7TA 1I2MA 1Q77A 3O7MA 1JQLB 1E3MA 2XWJI 3ZWBA 3QI7A 3CX7A 3TW4A 5AVZA 1F9EA 1FBTA 3B2NA 2Q3BA 3CLHA 5AVXA 1XRJA 5CK4A 5B6IA 1LJUA 3T12A 4IUCS 4A23A 1NP3A 3P4XA 1WPGA 2VJCA 1KFCB 2OK7A 2W2KB 3DEFA 4GPZA 2R25B 1G3QA 3I58A 3KSRA 1WW8A 3MIIA 3UMSA 1FTYA 3W5CA 5DXFA 5K03A 3D8NA 4WECA 2VAPA 2I4MA 2X3FA 1UPFA 3BBLA 3CEHA 1OLOA 1CUHA 1DZ3A 1UP4A 4IZOA 5ENDA 3KVYA 2VP0A 3VR1A 3HZRA 2V3CC 2B20A 2WYIA 1M5RA 4C7VA 2CLOB 3KL4A 2JLZA 3ZHVA 3EEIA 3TE7A 2C96A 4LN1A 2CL5A 4KQWA 4QFMA 3S27A 3WBFA 1GKKA 3WGNA 5K99A 2CFTA 4M1TA 1XZQA 2JNWA 5EFOA 5K8IA 5EJ5A 3C16C 3AIOA 2C5FA 1WULS 1UC5B 3ORFA 2IUFA 4L95C 4WIAA 3ROPA 1OIXA 3CIFA 5TMEA 4RIHA 4CL2A 3HB4X 4P82A 5FJJA 2XVAA 4Q4HA 1ZOIA 1U9IA 5H8WA 2JGFA 3HKDA 3FNEA 5D6NA 2KX7A 3Q41A 3GHYA 2ZUDA 2RGAA 1KU0A 4D4LA 4GOOD 1ST3A 4B6OA 3ZTTA 4C89A 1CUWA 5I9TA 1V45E 1EJ0A 2AEFA 3RNLA 3NBFA 3EQZA 1ZJYA 5I47A 1JSZA 2MSLA 4ZANA 3GPLA 3FDFA 4DLXA 1IQPA 1UBTS 3EEQA 4BTLA 2JEOA 4ND8B 4WA8A 5BN5B 4Z7OB 2ZIFA 4BNHA 5E38A 4ZI7F 2OHVA 1NPTO 1J0AA 4RDCA 1SUSA 1N2ZA 2IOFA 4KK3A 4P4LA 5DLEA 3LJKA 2JJ1D 4MWBA 4O4HA 3RYFA 1GG2A 3FUCA 3GGSA 2NPIA 4HWSA 1VJTA 2YQ4A 1ZIOA 5ITSA 4ZQCB 2XQVA 5EE0A 5BN3A 4W5JA 3AVTA 1EDDA 4XDGA 4HXYA 2CMFA 3L4BC 5M29A 3U81A 3ESYA 3L6UA 4IDFA 3II6X 4I4CA 1Y6RA 4JC0A 5EJ2A 1D07A 2BLLA 2FR0A 3LGSA 1BMQA 4OGFA 2AH5A 3TX2A 3H6GA 3U7QA 4OQDA 1PS0A 1UWKA 3DHWC 1ULBA 4PFKA 2HIHA 5ESRA 3UF0A 1K68A 3E03A 1N2GA 2ARKA 2FLVA 1YJXA 2XTNA 4FU0A 1W34A 1ZC3A 1KPIA 2BE9A 1PNQA 1A8PA 3CLUC 4UZEA 5B7PA 2Z95A 1E6LA 1G5PA 3SXPA 2GWHA 4WMLA 4WWHA 4B47A 1F6BA 2RGXA 4HGNA 1BWRA 2FEXA 4BQIA 4LF8B 4EP1A 2AF3C 4Y6RA 3CNBA 4PNEA 2X9VA 1W46A 2ONKA 2G4CA 2ZRDA 3EIEA 3L0CA 1E7SA 4Y9DA 3AI3A 1S2LA 2C9MA 1RM4A 4E6EA 2PH3A 4F9EA 4HEJA 4R81A 2VF8A 3AFHA 1SHTX 5K2MA 4QOIA 3RS8A 4C05A 2CNWA 1U31A 5LL6P 1P3JA 4RXMA 3G7SA 4E1VA 1AZWA 1AUXA 4KGDA 2B4AA 2MR5A 1IBKB 4X1KB 1T2EA 3JQ8A 1RQGA 4EGJA 5KYXA 5EUCA 1GEGA 1T4GA 1Z15A 4GZMA 1NJGA 2M6LA 1QYCA 4BVEA 1A7UA 3IKLA 4FFNA 3RS3A 3W6PA 3LXMA 2JEZA 1JFFA 4MKRA 2DR0A 4AZ3B 4CKCA 4EUSA 1KA9H 2GVDC 2Y8EA 2ZKLA 2BONA 3WNCA 2CJYA 2HQOA 1U7UA 5LYJB 1YMVA 2XLBA 2A8YA 1BHSA 1MB2A 5ULLA 2C2YA 4OK5A 3UATA 4U8GA 2DWOA 2C5EA 5E1OA 4R8VA 1NXQA 1AKWA 3HCPA 4J16A 2VDKB 2XNDD 4JKIA 4QICA 3EYAA 1XHLA 4TKLA 3T06B 1E98A 5A7HA 3ZGYA 5COAA 3FH0A 1KMQA 1EGQA 3O6VA 2XQJA 4LNHA 3MBKA 3RRXA 3SX4A 1ORRA 3EVTA 1VYTA 3I4FA 4I2VA 1EHIA 4DIFA 5ITVA 3ZGZA 3NO4A 1C0PA 2COKA 2JHGA 4NULA 3D81A 3QW2A 2C3YA 2JB9A 2VQ6A 3KVRA 4GAEA 2QTNA 5HBGA 3LHFA 1DI0A 3NDJA 1ICEA 4W9RA 3AL3A 4ZIRB 2V8BA 3I3SR 3X2SA 1MJHA 1ODFA 4INOA 4M7WA 3FLMA 1ADYA 4PS1A 3PIIA 4W6QA 4YMSA 3PWKA 3RS0A 4CMHA 4DY4A 3KLPX 2HC9A 3GRUA 5JHHB 1MQ9A 1RBQA 3R3ZA 4JYCA 4KMRA 4XVQA 3CRW1 1C1HA 4QJIA 5EXXA 1VQ1A 1IZ7A 2BM1A 3F4LA 4R7TA 3SG0A 3W8RA 10MHA 2GFIA 1QWSA 3JQAA 2WK1A 1QQBA 1HE2A 3A0UA 3A3KA 2VDRB 3L1UA 4H08A 4IX9A 4P8RA 3HLTA 1JNXX 2KPOA 4ZDKA 1YI8A 4GR5A 1AQJA 5HQ3B 1C5KA 1ACJA 1U9YA 2C8KA 1QO9A 2QL6A 2QKYA 3DVSX 4R0NA 4XX0B 3T5GA 3WGYA 1CIJA 4YCAA 4A92A 2HSWA 4AJ4A 1CUJA 1CKEA 4Q66C 3TZCA 4ENQA 1NBWB 4EI9A 4CLEA 3ONDA 1GT6A 2VK1A 2G7ZA 1E7RA 4CM9D 3BIJA 1EFAA 2B7CA 5JZSA 3LOUA 1MG0A 5EQFA 3EFHA 2JVJA 1BGVA 1MIHA 4MWSA 4RW0A 1Q15A 4GI2A 4L8GA 5D1HA 3SC2B 4E0BA 3OCUA 5A4KA 4M2LA 3HY4A 1E2NA 4EYGA 5HUHA 3K1TA 3GLGE 3D4BA 5K3CA 4OP2A 3VAZA 3CVWA 2Y93A 3T3EA 2LDXA 4K3VA 5DIFA 2ZT6A 1DSSG 1SK8A 1YIDA 2Y92A 3G0CA 2JCXA 4WD3A 3W2IA 1CE8B 2AS0A 5JMTA 1ORTA 2G4VA 1HDIA 3N2KB 4N4AA 2P4EA 2FMUA 4LYFA 3A6PC 2NYAA 2WF7A 3LUPA 1I3MA 5L45A 3KG2A 1D2EA 4K86A 1GL7A 2P6NA 3IXQA 3S2IA 4E03A 4TKUA 2X4LA 1XZEA 5HSGA 4JP3A 1WZUA 4MPPA 1WKVA 3ZGOA 4BUCA 4GKKB 2VQDA 3BIXA 3COYA 2E5LB 2O0JA 2IF2A 4MV3A 2B78A 3F3MA 3FPHA 3K35A 2GPWA 3TLBA 4JOSA 2H9IA 4X64B 3WQHA 4R1MA 3UAWA 1NVWQ 3WHIA 5JQGF 2HU7A 3L6EA 3FA2A 4CUKA 3MJ4A 2F1RA 3MGKA 2IHBA 3CUTA 3BE6A 4XFJA 3ZNNA 1IBCA 1F1BA 2WFZA 2YBEA 3GUCA 2R5NA 3STTA 4KO1S 3TAXA 4NS4A 2B4RO 4IXMA 4WBNA 4JD5A 2I1VB 2OT3B 2ZPAA 2ZU0C 1Z4JA 4OG2A 4R2WA 5K3SA 4ZGWA 1ZNQO 3D3EA 4U9HS 4NBRA 4D0GA 4D9BA 1CVLA 1XCBA 2CNDA 4JASB 2XMQA 3SLKA 3EFOA 1X3LA 4PCVA 1QRRA 3AEUB 2J0UA 2R1VB 1T9AA 5KYVA 3H5VA 3I2IA 2ZUTA 1GU1A 2A30A 3BWCA 1A4IA 1CWUA 3FPLA 3G8AA 5EOVA 3V4LA 1ZWLA 2BN4A 1RTTA 3PFBA 4J0JA 4MR8A 4RL6A 5AVTA 2XRMA 1ZU5A 1KP3A 2YFQA 1L5SA 4N3BA 3KEMA 1KR2A 3QLEA 3A3YA 5H02A 4F45A 4X20A 5E7MA 4BLQA 4I4LA 4XFDA 1UODA 3A6ZA 1GD1O 1N9KA 2V6JA 4AB1A 4GIBA 1M7BA 3B9QA 1OGIA 4QDTA 5SICE 4D5EA 4L5BA 2OFPA 2IIVA 4FMCF 1V5GA 4J07A 4QEKA 5K4HA 1G19A 4RWEA 1ZC4A 5KYNA 4BNXA 2I29A 4RZSA 3UWKA 3TN7A 3WL4A 1TB4A 2V0NA 5IVKA 2VK4A 5JFGA 3FXAA 4RLSA 5FOUA 1NRXA 2WOOA 1W49A 3C7DB 4I1RA 4Y6GB 3TZHA 3ZE1B 5KNCH 2ZSFA 3PNYA 3CPHA 1MG5A 2FUNB 2X6TA 2X0EA 3HRHA 3PICA 1VMKA 4KKXB 3SI7A 3T7DA 1MDFA 1N2JA 4K6GA 1SGWA 2A3NA 5LDGA 2XCTB 2L19A 1KZYC 3D8HA 3DFZA 1BE0A 2NQTA 2VG8A 1EEHA 1SBHA 2INGX 2XECA 3K5HA 3LKVA 4C4YA 4X8LA 4RV4A 2X14A 3FROA 1FP4A 1T91A 2RC6A 1QM5A 1NUUA 2W98A 5J9FA 4FYIA 3ZJ5A 4BZWA 1RRPA 3RBVA 1RM5A 3T5PA 2V6BA 5C4GB 4ARBA 1JMVA 1Z0SA 2EC5A 2J07A 4KR7A 3G2IA 4DRXB 3KU4A 4H4CA 2PUCA 2CCGA 5L4NA 3D2AA 4ZALA 4MUYA 5CFZA 1TZCA 4QU8A 1P0MA 5YASA 3U26A 3IBFA 1GUDA 3HCRA 1YFKA 3EVDA 4B4UA 5KQLA 2CXNA 2ZWAA 1CQWA 2VO1A 1FXWF 4M1OA 4AZ0A 1WXEA 1CCWA 1P2DA 1UFRA 1ZA1A 3F8SA 4NWIA 4ZOLB 4C5BA 4DXHA 2JG3A 3N28A 4TX1A 4DWJA 2GBIA 1BDJA 5FBKA 1M72A 1XELA 1ZM9A 2VL7A 2XGSA 3UKOA 4QGSA 3O3OB 3H5LA 4QQ8A 4GO1A 3DHEA 1L8AA 2A9KA 2VDMB 3DG9A 2DWPA 3D0KA 4HAIA 1M2OB 3TUIC 2ENUA 2PSHA 2I2CA 1RDFA 2YRWA 2WB4A 5B3AA 2AG0A 2OM6A 2IUSA 5JCXA 1SD2A 3K1AA 3PYXA 1JDUA 4YCJA 2C9BA 3WHLA 1YV9A 1Q6YA 4LYJA 4ETIA 3GU3A 4HH0A 4Y3UA 4YT4A 7ABPA 5MHTA 2IW3A 5DLDA 2RB4A 2ZBEA 1V3QE 5IXSA 1T6ZA 2XGMA 1KP9A 5E0OA 5JAHA 4IDPA 4RPIA 3V3TA 2O2SA 3NTVA 1RC0A 3C4JA 1GA4A 1FNNA 1PL6A 1SAYA 2OVFA 3S68A 3C1AA 2L0XA 1P1BA 1FQKA 1UDXA 2DECA 3QNMA 4MO9A 4HZGA 1XKTA 4I6JA 4Y2SA 1GN8A 3EGDB 1P5FA 3THRA 2C2OA 3MRXA 1HG1A 1R0KA 1XK7A 1R4NB 1K7CA 2N0SA 4PHGA 3UY4A 4RHCA 4DBVO 4Q00A 4ZCTA 3T1TA 1WJGA 3E2MA 1D2NA 3JZMA 4A91A 2OXFA 4REMA 1F2DA 2OG1A 4BXOA 4DNOA 4HGPA 4KWCA 3QUAA 4RABA 3TJMA 2EGHA 2KSQA 2DGDA 4YBRA 2BEUA 1KRWA 1OSNA 1OTHA 4FGZA 5K3FA 4PXSA 5BV0A 1U8UA 3MWGA 2GA9A 2VHWA 4JLWA 2GBCA 4Q6WA 3NB0A 4MINA 4YJ2F 3NBAA 4MYHA 4ND1A 1N9ZA 1MB3A 1JIXA 3UPDA 1W88A 3DWFA 2YVLA 3L0SA 4GNRA 5K4AA 4YMVA 4PGMA 4A8PA 3ES9A 3PC8C 4RKQA 4B6RA 5LZ2A 1ZN7A 2I5PO 5AJHA 1ZH8A 4CVNA 4CF4A 1W4AA 3C8MA 3MGBA 1KJ9A 4M49A 3KQUA 4FHDA 1QC5B 4GMKA 2WJPA 3I42A 1MABB 3B6JA 1XZNA 1PP4A 1FYWA 2CFOA 4C22A 4RPCA 4Q3BA 4TTIA 1ZWKA 2NQ2C 3IELA 3OJFA 3QA9A 2J08A 3DFUA 3OLYA 2ID7A 4R2LA 3I76A 3BRWA 2V4MA 4IL5A 3LDAA 1XVTA 5EZYB 2P0EA 4E15A 2H08A 4BJ6A 1MCZA 4I4TA 1P2GA 3NGMA 5JH7B 1F0NA 1ZBQA 3WWOA 4ZQIA 2CXTA 2PZBA 4IF4A 4F2HA 2PS1A 4UMEA 4GLBA 3ETCA 4JC5A 3FYUC 3KEQA 5CLGA 2ICAA 2J45A 5EMKA 4B79A 1BVHA 1KERA 4P7JA 3TRFA 5H3LA 3QZUA 1DUSA 3STYA 1XSEA 1P0IA 1Z29A 4RGYA 1RPTA 1E32A 4FOLA 4JBGA 5AD1A 1OHHD 2WD7A 3DMPA 2CNBA 4NU5A 3RRJA 1T9GR 2G5CA 5MGBA 2PSJA 1Z7WA 3SXJA 4RYDA 2OBXA 2PD6A 4G5FA 4HAUA 3I34X 5ESDA 2O7VA 1XI2A 3CF2A 5JQWA 1QZXA 3FYHA 1SUEA 2CXOA 2NXNA 2P8SA 1O4WA 2Q5JA 1XTPA 4ONEA 2GQ0A 3SQLA 4CBVA 3ANSA 2B82A 4TS3A 1C50A 4C1NA 4PZAA 1V26A 3AK4A 2XUZA 2BBTA 2ZSBA 1DELA 4BP3A 4DARA 2IHJA 1IM2A 3GLQA 5IBRA 5CB4B 1U9CA 2IV7A 1KQOA 1UAAA 3ILYA 1BXRB 1Q20A 1KQNA 3JQAD 1XC7A 3L79A 4JBNA 5AIBA 5L4SA 1HT0A 5H0IA 1K4MA 2J1LA 5FPPA 4LOHA 4BN5A 2XTMA 4KEAA 4LC1A 4DDMA 2OOSA 5ER9A 1Z6AA 5DK6A 1XX6A 3UICA 3K9FC 4MWGA 621PA 4DABA 4EEXA 1G8SA 4XYBA 1JWBB 1RJEA 2Q5OA 3R74A 1E1QD 3KJZA 1ZRMA 5CPBA 4G25A 4JYZA 3IV9A 5AICA 3A36A 5HGJA 5JXHA 4NYMR 5HX7A 5FQNA 2IE8A 3I2KA 3PR3A 3QKRB 4ND3A 5HF6A 2WQ7A 1OYWA 2V6GA 1JHPA 1ZH6A 4FBLA 5IM5A 4CKZA 1GPLA 2AW5A 2RHMA 3G6WA 4LZLA 4O08A 3F5MA 4BRWA 3ESBA 4MVXA 1C2YA 1CUFA 1O9GA 4NFSA 5C8XA 4WSOA 5C9ZA 1OFVA 2QTMA 2XUKA 3IV6A 4Q3CA 5FCDA 4WZBE 3PGLA 4HWKA 3MSCA 3ANMA 4FWBA 4JLNA 4JSTA 3WMRA 4QAJA 1FE8A 5C37A 3C15C 1NL3A 4QVIA 1EXMA 1SUPA 2BFFB 2K7FA 4OPMA 2PUFA 2WWTA 2CSUA 4F5EA 3FDZA 3KLNA 1JFLA 2FUG1 4LVOA 1LDGA 1SWVA 4GP6A 4M76B 4C29A 1A3CA 1TEVA 3VPSA 4M87A 3HBFA 5KHOC 1SVKA 4IF6A 4ZVKA 1Y6GA 4HD8A 4HVLA 4HPWA 4WBNB 4RHFA 4BWGA 4PLTA 2NTYC 3GH3A 4P6VF 2GZAA 3HGQA 1LY1A 1HF3A 2I1LA 3DXYA 3VSEA 1A96A 4G56A 4L4SA 4ENPA 4JYAB 3IBGA 4J03A 1QSGA 4MDFA 3A1CA 1NC3A 1UXOA 4O63O 1Q21A 3OZXA 2XB9A 1SXHA 1G21B 3OD1A 4XDYA 3THYA 3E5MA 5L6MB 2PUAA 5DWDA 2RHBA 4TYWA 2HEIA 5KX5B 3KM0A 2W6PA 1H65A 4C7JA 4JOQA 2PRYA 1RBMA 4KOAA 3KKQA 3NNNA 1OASA 4P83A 3OTQA 3ISTA 4HEHA 1O97C 2Y0BA 4BQRA 4DNPA 3Q7PA 3QF7A 4XH9B 2H29A 2YW9A 3CUEF 3FOAA 3WRWA 2LW7A 1OAOA 2AXPA 3DNPA 1ZMTA 5ALUA 1V5EA 4DSAA 4L02A 4MW0A 4HMOA 3H9BA 1KEWA 4YC7A 2CLLB 1LSOA 2JLYA 2JH8A 4QX6A 3U7HB 4KYIB 3WMFA 4Y2UA 4OK6A 1EQUA 3W6OA 3W79A 1V1RA 5CAEB 3P2KA 4MYUA 1RI1A 3AF1A 4AUMA 1Y4AE 2WM3A 4J0QA 3CA8A 1BKSB 4C04A 3AEXA 3HP4A 4O2BF 3DS8A 1K7XB 3KLBA 4HDSA 1SULA 4TWIA 3KXDA 3RSFA 3JPWA 2DOKA 3K0KA 2YY5A 4R8KA 4PZEA 1SHJA 2AXQA 3O31A 1KZ1A 3IV7A 2WWXA 1G8HA 3AJAA 3IO3A 5JAQA 1XJ5A 3LZDA 1PNRA 2G3YA 2CDRA 3PKZA 3UM9A 2V58A 4X62B 3GLTA 3MT7A 5DN6D 3V80A 1YZKA 4IILA 1H69A 1GQRA 2B2NA 3KWMA 3LW8A 5ALVA 5IXJA 1YFZA 2J09A 2HK6A 2P9ZA 5CDSA 1X94A 1HTWA 3TEFA 1PYGA 5CBKA 1Y8QB 2GI4A 1I4EB 2WG2A 2QRLA 3O3CA 3OJEA 5CXXA 4FUTA 4DRXA 5LC1A 3RKRA 1A8UA 3LBIA 3ESRA 3ETGA 1YFJA 4KXUA 3JQAB 3GAFA 3KVVA 2FFRA 2QE7A 1TT7A 1YXMA 2OWEA 1WMSA 3MTJA 4GOKA 2C29D 3FJYA 3I2GA 3QWIA 3SQMA 4MVJG 3BCHA 1AKYA 3H9QA 3IP8A 1RYBA 5TE9A 4GM4A 4O3MA 1VPDA 3QU9A 1AX9A 2PMKA 4OP3A 1DKUA 1IZ0A 1ODCA 1AUOA 2WICA 3KB6A 4WNYA 1V2HE 3ED1A 2R87A 3MNFA 4BNGA 3TXAA 3PLNA 2D62A 1T9GS 4LYDA 3WYFA 3CZPA 3O3MB 4B7AA 4D9CA 1TM3E 4X6LA 2AJDA 2IDKA 2WF8A 1Z82A 3DZBA 3QIAA 4RY0A 5IWAB 2O54A 1DWOA 1VL6A 2F64A 5JCOA 5JRDS 3JPYA 3UWSA 1M34B 4KQ6A 4XZ3A 3MGAA 4C0KA 2Y1CA 1CUYA 1EFVA 1D0SA 1JMKC 1GGMA 1T8TA 1YOBA 2P5TB 2YHSA 3GEPA 4MAMA 4N0QA 5IJAA 2TSYB 3VKVA 1U0TA 2EATA 2P41A 4JVNA 1TF5A 1Z28A 4YRLA 4NCBA 1C8VB 2JHAA 5KKNB 1JPJA 3E27A 5LOVF 4OHXA 4TM8A 1I80A 4GEKA 3ANXA 1GADO 5FI5A 5CFPA 1IHUA 1Y3HA 3SZOA 2OBYA 3OFND 4FMCB 3ZWQA 3RRBA 1XMVA 4I1SA 1GPWB 1KZ4A 1Q7TA 1WDLA 4MWCA 4QDOA 5LBUA 2VXYA 1NR7A 4CDRA 1PWEA 5A5FA 5LXTB 1EFDN 2JHCA 4Y9UA 3ICEA 4OH7A 3LFUA 1JW9B 1C0IA 3GWGA 2FPMA 1FU7A 3AHIA 3JVVA 1BWSA 2GT1A 2LCQA 2QS9A 3C6BA 3V4ZA 4OAOA 4B0OA 1P2BA 1A04A 1H22A 5IJZA 1SR8A 3EGDA 4PYLA 4BOYA 2GTHA 3R1IA 1EE2A 2D1YA 1P6QA 3C3PA 1LF0A 2PCLA 5CM9C 2QXUA 1T1SA 4CLOA 2I8LA 1H1DA 1E66A 3A2KA 3MMXA 3PUZA 3FSRA 2IEGA 3C5HA 2Q6OA 1USVA 3EVCA 2PLAA 2FR8C 3QG1A 3RV3A 1Y9DA 3O74A 3H4VA 4RLQA 1WWKA 1SXQA 1TU3A 4UUQA 3EIFA 1SWWA 4OLFA 3BXEA 5BUCA 3VQTA 1NOJA 5E1MA 4PEVA 3ZXYA 5KOJB 1AUQA 4Z53A 3JD4A 1E7YA 3HA2A 1C9YA 4ZWNA 2ZVDA 2Z4SA 3IDAA 4K1LA 5T7BA 4RVNA 2VJQA 2QRVA 4CTOA 1DTWB 1XMQB 3H75A 5ENVA 4EHDA 2HL6A 2H31A 1JLHA 1JR4A 1B43A 1EFUA 1PQUA 2R6GA 1FPMA 3E7XA 4D9JA 3X2FA 4KJZA 5AO9A 2JARA 1M0EA 2B1IA 5HHTA 4BGUA 1BHJA 3CKMA 4Z4GA 2JLUA 2Y2UA 4MPTA 3OCZA 1QFMA 3OLZA 5KOIA 3PRJA 4XRGA 1BX3A 3E4DA 1VKJA 3DO6A 3FF4A 1A9TA 3NOQA 4H77A 4TQAA 1CZHA 1LCIA 3OFSA 5DGTA 4EGAA 2KYRA 1JI3A 4S1VA 3IQFA 3VTAA 1L5WA 2KLBA 5F2KA 1NXPA 1X87A 4OFWA 3EEYA 3WB9A 4KVAA 1QIGA 2WHEA 2XUGA 1N77A 1I7PA 2NUPB 5ETJA 4O4IF 1J4AA 2P4HX 3D2CA 4TQ9A 1GTZA 2IHUA 2HMYB 4GKVA 4Y0VA 1IXRC 5AR1A 4UEWA 3AKZA 1K6IA 4KI0A 3WLRA 4OGKA 1EFVB 3S1LA 3FKJA 3WL7A 3VYWA 1AH2A 1HDXA 3H1BA 1GPBA 2RAVA 2GEUA 1JYFA 2ASEA 2FPPB 2YINC 3GELA 1KI9A 3AESB 3N6VA 1GGHA 3ZHSA 1VSTA 4QODA 1KHTA 4TLCA 4CPDA 4RORA 3RBXA 3O93A 4BX9A 5HKOA 5JASA 2CDCA 3A4IA 4G8DA 4GFDA 1KAEA 1MZPA 2E4WA 3DEAA 1L7OA 3NDRA 4TSKA 4J3FA 2Q4OA 5CLQA 1NG1A 1RVDA 3INGA 4OREX 4NY1A 4EMSA 3N7UA 1BS9A 1PJBA 1UPXA 4CNQA 3B7WA 1VJ5A 4P7BA 2HYDA 1VE6A 2PKEA 2QP9X 2QBYA 2GSWA 4OFBA 4OK3A 4Y2QA 5J59A 5BT8A 3FWKA 2B7LA 4LF5B 3U7JA 3RV4A 4ZEXA 5J2UA 4ZCQA 4F11A 4IJUA 3A6EA 3WNDA 1NI4A 2VPTA 3EVEA 4TZKA 2V7EA 5G4LA 4QPPA 3AO0B 2IOYA 4L0QA 5FKJA 3FOBA 1SOVA 4OQNA 4HVCA 2HBZA 4I55B 2CXUA 2FR8A 3QY0A 3V6LA 5AWFC 3GVCA 4IHAA 1IMJA 1ZGGA 3AETA 3N0TA 1B74A 5IJXA 3ZCTA 1SU8A 1PDWA 5ERGB 5FWYA 3PIDA 4ZVPA 5KYGA 1DZIA 4HDMB 4LBVA 4EY4A 5JC1A 1FSGA 3BFXA 2M98A 2XKJE 3BZWA 2C2KA 3HI4A 1XXHE 5IM4A 2G9QA 1H85A 1LBHA 2CVZA 3E61A 3STXA 4L15A 2D4HA 2V5AA 1Z5WA 1C0KA 1CK4A 3W9YA 3VSCA 4EYQA 1F3LA 1JEQB 1NUPA 4D9NA 1GVHA 2BFEB 2NPOA 3KQVA 2NNWB 4H18A 4CCAA 5KMGA 2ODAA 3TFOA 3SQOA 2LR0A 4GBJA 2I55A 1U0LA 4CV3A 2P4QA 3OIFA 4IOMA 4NQZA 2YWBA 2P2GA 2YNMC 3M6LA 1RHRA 2XBUA 3FFBA 2IYZA 1C8KA 3QFFA 3MS2A 5LZ8A 3JYNA 4HLNA 1Q57A 1TQDA 2WT9A 4JI5B 3RBZA 2X40A 3FMFA 4EL0A 5ALNA 5C1DA 1QP7A 4EF6A 2PX2A 4QNRA 1RI3A 4RCYA 5HRAA 2B92A 4WNAB 4MLZA 3NEPX 5TRTA 1I2ZA 1FNMA 5BWLA 2BM0A 2AC7A 2JHFA 2X5KO 3JAWB 1I5RA 5L8VA 2P65A 3I2JA 2FCRA 1BCRA 1OOEA 5ICGA 4JI3B 1AK9A 3ZWVA 3QA3E 4F9FA 4Q16A 3WXBA 4U9IS 2JKVA 4GRIA 3Q10A 4H7PA 4KBFA 2B69A 4M99A 3RC9A 3AR8A 4CM5A 3T94A 1FZQA 1NATA 1WSDA 2O2XA 2GXAA 5KJFA 4UKDA 3OOYA 1Y1LA 4EY6A 3LUDA 5H83A 4DG5A 1MGOA 1ODKA 2IP2A 4DJDC 4CEHB 1CX9B 2PVSA 4GYJA 1YB1A 2EF1A 3SJBA 4UCXA 1D8AA 5K05A 3RLIA 1UANA 4KR3A 3TQRA 3G49A 3GT3A 3RPEA 4HTAA 1YBFA 2NP6A 4JSRA 3CNOA 1H4VB 4WXMA 3OFJA 1C7ZA 3LWDA 1M8JA 4F6RA 2BTQB 1RPNA 2ETXA 1QR2A 1UZLA 4BTEA 1WKCA 1E6CA 4I9GA 4G0UA 5JYDA 3L4SO 3H3JA 4BZPA 3K1ZA 3JARB 4NR0A 1K4KA 4LRXA 4YPOA 2AMJA 4EB3A 1AS3A 5B7GA 3CZ4A 2WSLA 3BGSA 2A0FA 2J3QA 4K0RA 1JP7A 4KFRA 5JAIA 5BRAA 4O29A 3ZZ0A 3TGPA 2OFOA 3JQGB 4YMHA 3H1FA 4EB6A 4OX9B 4DLRA 1YK0A 1VIAA 5L3QA 2PH7A 3HUEA 1WDTA 4LTMA 2BW0A 4YLGA 4E5NA 1SZDA 4KIJA 4OU4A 4OUDB 4UTZA 3ET5A 1T9DA 4LRWA 1XF1A 4LNUA 4YQZA 2IYWA 3B12A 4HX2A 1E9FA 4AL4A 3A6HA 2ZJOA 4QTTB 4MHTA 5F98A 1GUBA 2HZ7A 2BTQA 4QXRA 1PJCA 2FUG6 4UQPA 4F56A 4QQRA 1AM4D 2C2HA 3I9KA 2IY7A 2VZ0A 3FSGD 4NH4A 3LRXA 1V5IA 5B12A 5DV9A 1BXKA 3KQNA 5BURA 4AMUA 4BNWA 1X13A 3GYBA 4MS1A 4PU0A 5HF5A 3W2TA 4FN5A 4B75A 2W6NA 1ONOA 3NH9A 2DR2A 2NIPA 1SKAA 4G8JA 1WY7A 1N3LA 3CH4B 4QA9A 1AQ6A 3E7WA 3OIWA 4IY1A 4N6OA 1ZHOA 2FMKA 3AUKA 4RK1A 3BERA 3CGGA 4DQVA 2DUJA 3CW8X 1FJ2A 2QHXA 3PPWA 2YCLA 3A37A 4GR9A 4NG5A 1U7XA 2MCFA 4G2NA 4MKZA 3KX2A 3LL4A 1YKGA 4YTEA 4ZQEA 3BBPA 1HFWA 4W63A 1SZPA 2Q3EA 3JR3A 4OHUA 5ECWA 1IOWA 4ZKDA 5KOHB 3LBFA 1H2AS 1VJCA 3BMQA 1VKHA 4MEJA 3ZHUA 2GCPA 5FYQA 4TMYA 2HW8A 3IEPA 5FBZA 2WEKA 3HYNA 1F51E 3FWZA 4J49A 1L5HB 4PGAA 3RRNA 1Q12A 5EVCA 2E37A 4HAVA 1B0ZA 4V24A 1PJ4A 2R8BA 4L7VA 2O8VA 3I0MA 2Z8XA 3IMCA 1OI2A 1U8FO 6REQA 1VRCA 1PFKA 2PT6A 1RQLA 4YACA 2QP4A 5A4MS 2O5VA 1MO4A 3A4MA 3KYCB 4AG5A 4CYMA 2IPXA 4F4UA 1ZGHA 2YJNA 4PLGA 4CF3A 4XWKA 2IDMA 2M1ZA 3C5CA 4P1ZA 4CM7A 4E2WA 3WGUA 5GIPE 1NONA 4TLLB 3ZE2B 1MNAA 4A2PA 2FW6A 3U44B 1UXHA 1WMBA 5DWVA 4IIJF 1ABFA 5EZQA 2ZIXA 4U2CA 1FSSA 3UJAA 5A3SA 3IRUA 4S1OA 1DIOB 2QMUA 4DQDA 1E9EA 2EWWA 1DIRA 3MA0A 3K32A 1OBHA 3BCUA 4S2UA 3R9WA 1HL7A 1N5OX 2Z5LA 4CQJA 1E2KA 4YHBA 3AEKB 1BH2A 1KL7A 3E3LA 4Z8YA 2SCUB 3ZDAA 4MP8A 1YQUA 2NZUG 3MXTA 2PJZA 1NNUA 2WSBA 1Z6QA 2RAUA 2JZOA 1AB6A 4QT0A 1Z4OA 3ASVA 4Q1AA 3PZBA 2CVQA 3AT1A 3OEYA 1XZMA 3GYGA 4LV5B 2NO9A 4BU0A 5IPFA 1IUOA 3B8EA 4AICA 2HHCA 1IZ9A 1Y4SA 3CEPB 1ZNYA 2Q1SA 4GX1A 4F9GA 5AW8A 4BMYA 4TMXA 2FZGA 1WQ3A 2AK2A 3S7ZA 1JEEA 2XMZA 5BSFA 4L3VA 4P3XA 1M2OA 1WNTA 4H6WA 2VA8A 4BV9A 1Q1NA 2ODNA 2TYSB 2XEDA 1X7ZA 1GQSA 2H11A 4YFVA 4AKIA 3U4CA 3PNMA 2WB2A 2XB4A 4TV9F 2DBRA 3AG5A 3QI2A 4BATA 1QHYA 5BVHB 1QGZA 5EXDA 5AVVA 1YQTA 4FYMA 1XTBA 3CZMA 1SPXA 4JDPA 3T9DA 1WTCA 2CE7A 2WF6A 4PQRA 4QOHA 1YA6A 4EKEA 3OT1B 2F7SA 3KOOA 1WLSA 1DB3A 3A6KA 3I2FA 3PCXA 4R8LA 5E6SA 3VSDA 4BVAA 3KZVA 1KAOA 2C8JA 2FA9A 1JA9A 3OMWA 5CT6A 1PAUA 2SICE 4M8SA 1L1FA 2FG7C 1V35A 4LWQA 2DBQA 3FCOA 1YRWA 4US2R 4DADA 3JQ9C 5T4EA 2LIVA 4DDKA 1S8FA 1O57A 1W8DA 3H65A 3KV3O 3PHIA 4CMJA 1MH1A 1FP4B 1W47A 4LCBA 4MHSA 2OBFA 3LS2A 3LCMA 5TV2A 4DW8A 3ADBA 2HEGA 3H5OA 3O8OA 2XMCA 3ROKA 1JIUA 3BE5A 4KLNA 3X1MA 1G8PA 3BTUA 3PRYA 3NHSA 3GPCA 4OQ4A 3RASA 5FAXA 2P27A 3ITEA 1JKJA 2NSJA 5DNCA 4C5CA 1HQCA 3TDKA 1Z2CA 1XMSA 2DFPA 2ISQA 2CLDX 3D2LA 1DAGA 1GTL1 1PYOA 3DE4X 1M1YA 1Z8HA 3JQBA 1MX1A 4EW3A 3P0EA