3I61A

Structure of mss116p bound to ssrna and adp-beryllium fluoride
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
509
structure length
509
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase MSS116
publication title Structure of the Yeast DEAD box protein Mss116p reveals two wedges that crimp RNA
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 197
structure length 509
sequence length 509
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i61A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i61A02
4M1KA 3CO5A 1GNRA 3E70C 3A1WA 5BN3A 2J0SA 4Z8YA 1K8RA 1G17A 3KJEA 4Q7LA 4RD2A 3NC1C 1D8TA 3C15C 4RZ3A 5FPYA 4JKIA 4GOXA 2JATA 1NVUQ 1S9HA 2GZHA 3B6EA 1JR3E 2ZIAA 4FINA 2F55A 1X3SA 3I73A 4ABYA 1KAGA 1KZGB 1E9BA 1TF2A 1QHXA 2QTVB 3A4LA 4CF7A 1WA5A 3OEED 2BDTA 5UKDA 2ZANA 4HUQB 4E07A 2J45A 1C1YA 2H57A 2MSCB 1X8LA 3CW2A 4TMXA 1JXOA 1DO0A 3BD9A 5TDHA 1ZCAA 2QMOA 2W6JA 2WWHA 4H1UA 2RGGA 2DWPA 2W83A 3D6TB 4IVRA 3F3YA 4RJLA 1Z06A 3RS7A 4EQ6A 2EW1A 4KYIB 3O8CA 1DO2A 2C77A 4TMTA 3OIWA 4ZPXA 4A92A 1AKYA 1G20E 1KO7A 2NQ2C 2WOJA 4U02A 1C4OA 2Q21A 2DHRA 2ANBA 4LC0A 5JZVA 1TL7C 2GZAA 1W0KD 2ATXA 3FFAA 3ZVNA 1ELOA 3QIAA 1BS1A 1D9XA 2VHJA 3PEWA 3U4QA 1KKLA 3QUSA 4DC9A 5LDDC 1M7BA 1YRBA 4NCHA 3UANA 4TQ9A 4A0GA 4DT1A 4RD4A 3X2SA 2GXQA 4HSEA 1O3YA 5HE9A 1E0JA 1N0VC 4FWTA 1GL6A 3KJHA 4Q47A 2ZAOA 3FHTA 1AJEA 3H4MA 5FPHA 4EPYA 2R65A 3UWOA 1GG2A 1NBMA 1ZAKA 3PG5A 2RHMA 4D4LA 3U6BA 1ZVQA 2IYVA 2QZ4A 4UQOA 5DI3A 2BWJA 4LHYA 5L3SB 3IQWA 1WF3A 2YWHA 2IYWA 3TUJC 1OV4A 2XZLA 1ZC4A 5EE1A 3TNFA 4YDSA 4M1SA 1NMYA 3KB2A 4AKHA 2IS2A 2BKEA 3IHWA 2QUZA 3K53A 2DFNA 3VR5A 5KPJA 3RSLA 1YHNA 4P32A 1VIYA 3ADDA 3L2OB 4XD7A 1WMSA 2ZTSA 1OIXA 2AWOA 2RGNA 5LBIA 5L8VA 2ZAMA 1ZP6A 1GUAA 3BC1A 4ZCLA 3WHKA 2IA5A 1YKSA 5AK0A 1F6BA 1U0HC 1A1VA 5L3QA 3THXB 3MCAA 4P4SA 3LAWA 4TMVA 1LB1B 3HU2A 1CEEA 2RB4A 3KKQA 4PX9A 5H8WA 5DHAA 2ZRHA 3SS8A 1T5IA 4A82A 1J7KA 2CL0X 1HURA 1A2KC 1N6PA 5JWHA 5HR5A 1G4AE 1OH7A 2ASEA 2WJHA 2WWIA 5DO9A 4Q4HA 5FOWA 3AVUA 3KJGA 3T06B 1T6NA 1RW4A 1QHYA 3L0IB 2PT5A 4QFMA 4EFLA 2D4HA 4URVR 3GFTA 1Z2CA 2OXCA 2R9VA 2DFLA 3AKEA 4HATA 2IXGA 4F7WA 4HAVA 5AJXA 4JIMA 3KQKA 1PJRA 2GKSA 2IYXA 2WTUA 3E5HA 3PFIA 1IJEA 4LJAA 3TSOA 1GILA 1SKYE 3T15A 3ZZ0A 4EJSB 4CW7A 2RGEA 4AURA 3RWOA 2J41A 2PCJA 2C5LA 3EIEA 4XTRA 1EFCA 5D3QA 5TXGA 1E2GA 3RHFA 4JLDA 1OHHD 1S8FA 3ZS8A 3K0EA 2ORIA 4UNSA 2QBYB 2BVNA 5KYKA 4YMSA 3TVTA 5J40A 4C3ZA 1HH4A 1RVDA 1XEXA 2GJAA 5LB4A 1NBMD 2ECKA 2QSZA 4L5BA 1XZQA 1GTVA 2J3EA 2GTPA 4JYBA 2FSHA 5FR2A 3TRFA 2E87A 4HZIA 2G3YA 5EE0A 1Z8FA 4DEYA 3FTQA 3IGFA 1XX6A 2EFEB 3P4XA 4JT4A 1X6VA 4B3FX 4XTCS 4LWZA 4BFSA 4B6EA 4QBGB 1N3BA 3MFYA 3W5IA 5E7IA 2PL3A 3BE4A 3EIHA 4RY2A 4I1UA 2A5DA 3OEHA 3VU9B 1UF9A 3PEUA 5DNYB 1Q20A 3A6PC 3Q8XB 4B43A 1VCOA 3WXMA 4QC2A 2IYLD 4Q9LA 4JLPA 2B6HA 3BOSA 3LWNA 4M1MA 4HDCA 5K8TA 5DHFA 1AN0A 3BIFA 2IS4A 2FMXA 4KFRA 4RCZA 3AP3A 3GQBA 3WY9A 4D81A 4Q19A 1NIJA 2H17A 4PZLA 1LY1A 5FOTA 3NHBA 4EPWA 1TNDA 3RRMA 2EYQA 2ZITA 3PVSA 1Q1EA 1KI6A 4BUJA 5B64A 3AUYA 3QF7A 3MG9A 3GJ8A 2IYTA 2ANCA 3K9GA 3FHOA 3SHFA 2PT7A 3EC2A 3GLHA 4L9SA 1W48A 5FUWA 4U5XA 1FP6A 1KMHB 4QXAA 5FPTA 5D3MB 1NL3A 3I3SR 4ARZB 1Z63A 2FSGA 2RGAA 2P67A 4Q02A 3IEVA 2MSEB 1RJ9A 1EWRA 4TQUS 4V03A 4FMCF 1T3SA 4TSFD 1LV7A 1F2TB 2VP9A 1N5KA 1AQUA 4BGDA 1JBKA 1HUQA 4DLSA 4KFUA 4MUBA 3T1VA 3Q85A 3QG1A 2G9NA 4Q00A 4GT1A 2WSSA 1E2EA 3CR7A 4CYMA 2WMNB 3B60A 2IWHA 1GITA 1S0UA 2QTHA 2ZRPA 3SQXA 3OESA 1G6HA 1Z0KA 4L9WA 2K5UA 4NKRA 1ZMXA 1SXJA 4D80A 5EQTA 1SULA 3GD7A 4XH9B 3B85A 3PUWA 4PAMA 2XAUA 2FSFA 3U3KA 1RC8A 3GFOA 4Y0VA 3AVYA 3OEHD 4M22A 1CIPA 4GNKA 1H8HA 4QJ5A 4C30A 4FN5A 1E2MA 2QP3A 4MGZR 4OQNA 3T61A 4MYUA 3H84A 2JCSA 3ND8A 4E09A 1N6KA 3KX2A 1P9WA 3CPJB 4RCYA 2QROA 2VTKA 1U8YA 3CPEA 4TQAA 3OIYA 4MGYR 4PAOA 2J5XA 2QMHA 3NEYA 4YLGA 3GEEA 3WYFA 4HAYA 1J90A 1FTSA 4WAUA 5JSZB 3AVVA 4W7SA 1SZPA 1JI0A 1U8ZA 4D25A 1E79D 1X1RA 2CJWA 1Z29A 1AKEA 1VG9B 1CLUA 4NYIR 4C0JA 3I5XA 2HV8A 2YNMA 2W58A 2JLVA 1F2UA 1SVWA 1ZNWA 4M1YA 3WP0A 4TMWA 1Z07A 2ZROA 3MAAC 1HA3A 2GA8A 3ZQJA 3NDBB 1FX0A 5KNDA 4HLUC 3UMSA 2H18A 4M53A 1DBSA 1P9RA 3MWKA 4K8OA 4LGMA 4BE7B 5K8LA 1UDWA 2NTYC 5HZHA 4TLAA 4QBHA 1FPMA 1NRJB 2P6RA 4JLKA 2VQSA 4X8LA 4JLOA 5HZKA 2VF7A 3Q9LA 4HAUA 4LUCA 4KBFA 4KJZA 2WIBA 1T3HA 2IW3A 2R44A 2VHTA 521PA 4Q5IA 4W5JA 3T1QA 1UBEA 2I4IA 4IOLA 5FTLA 2WSSD 2F9LA 5SZIA 5DIFA 5JI2E 4HAXA 4PHFA 2HYDA 2VA8A 4V0ME 5B30A 5KDDA 4HAWA 4LI0A 3FVQA 1M6NA 1NY5A 1HQYE 1HE1C 1P9NA 3JZAA 2ZUBA 2X2EA 2BCGY 3O47A 2OZEA 3ADCA 2O8BB 3KXIA 5LD2B 1XD8A 2G0TA 2OO7A 4WOPA 3I32A 1QF9A 4CEJA 2XNDA 2NPIA 5KDOA 3D8BA 4BRWA 1XBTA 1US8A 4IJMA 2GJ8A 4OI1A 2W6IA 1G21E 2Z5FA 4LHVA 1L7VC 1H8HD 4R9UC 2EU8A 2ZS8A 1E2FA 2J9RA 2JA1A 4LPSA 5B57C 2Z43A 2I1VB 2AL7A 2WVJA 3DVLA 3ZZUA 2BM1A 4Q9HA 3QXCA 4P31A 2DBYA 5FI1B 5TV2A 3F8TA 3ZH9B 1PV4A 121PA 1KMQA 1KK1A 2OFWA 2QRNA 3MWYW 4Q21A 1UBGA 1LF5A 3DL0A 3LQRA 4KSCA 5B2ZA 2QAJA 2IS1A 3AVOA 3H1TA 2GZDA 3QVVA 4BFYA 1P73A 3K9HA 3T35A 4E03A 1N25A 4XWKA 4OI0A 2D3WA 4KFSA 4M9ZA 2GK6A 5FOSA 2KI5A 4O0MA 2P5TB 4PO9A 2VP5A 1P61B 2CHQA 4Q9IA 4RSGA 1XTJA 4PQYA 4Q66C 2C9CA 3BORA 4CEIB 2IF2A 2Z83A 3FMIA 2OFXA 3I92A 4MRRA 1FUKA 1AGPA 3K9NA 1Z0DA 3NBXX 1GNPA 2FA9A 1EFHA 1XPUA 1YZLA 5G3ZA 1G3RA 4TT3D 1WP9A 1OXUA 5AJWA 2F9MA 2F7SA 4I1VA 5DYIA 4ZDKA 3X1XA 2H92A 5E7JA 2CK3A 2R6CA 2OV2A 2ZI4A 4XVUA 2ZR7A 3THWA 3UATA 1IN5A 1IY1A 2W0SA 3IO3A 2YOHA 4MDFA 4AY2A 4TYWA 4Z8XA 5EE9A 2QEQA 1XFAA 3ZQ6A 3K9LA 2JASA 4R2IA 2ZE5A 1YZTA 1NKTA 2E1RA 4R7ZA 4UXIA 1XF9A 1OIVA 4RD6A 2XNDD 3FOZA 1DELA 2ZRFA 4FMCB 3LRPA 1DAGA 2R6GA 1T91A 1Q22A 3PJRA 2W6ID 4EQ6B 3ZYCA 1XD2A 4PZZA 3TSZA 1XJ0A 3B1VA 2AK2A 4RZXA 1L4UA 2PJRA 2IXEA 1B23P 1IONA 2ZSDA 3AEZA 4OHYA 1GOTA 2YV5A 2YYZA 2JIZA 1RYFA 2WM9B 3CH4B 5TVKA 1G8GA 1UEJA 5CM9C 3U4QB 1CBUA 4C4PA 3NIBA 4LJ4A 4IOMA 3WRYC 1OJLA 3MWLA 4RD1A 4ZV4A 4AYXA 421PA 2BIFA 2ZSFA 3X1WA 4DT1B 1YR7A 1WBDA 2FPKA 2NO6A 3K0AA 4TTQA 2A5JA 2D2FA 1I4DD 2LKDA 1UAAA 1DEKA 1OXVA 1Q3HA 5FTNA 4OQFA 1SVSA 2F43A 3GLFE 3W3ZB 1I4TD 3BS4A 3FDIA 3KQNA 5DI3B 2TMKA 3LD9A 4LYJA 4MKGA 2CMKA 4OK5A 4EPRA 2ONKA 3LY5A 3QQ5A 2QTFA 3QKRA 3GLIE 5AJZA 2XTZA 1IXZA 4AI6A 4UJ5A 2OBLA 4M21A 3CRW1 2J0VA 4LBYA 2CEAA 2H7VA 2O0HA 1W5TA 4LV5B 1CU1A 1KO5A 5G53C 2VYFA 3SDZA 3EA5A 3HU1A 4RFSA 2KB0A 2OE2A 1GKUB 4YMVA 1D2NA 5L3QB 1KDTA 1L4YA 3CKLA 4P4SB 4B44A 3DOEA 3CH5A 4Q1AA 3T5GA 1GKIA 4C2UA 1XEWY 1Z6TA 1BKDR 2AFIE 1Z6YA 2B21A 3A4MA 2QPOA 4R71A 2O5VA 3H86A 2A78A 2EWVA 2XITA 3K0FA 5P21A 4Q4HB 3NDPA 2Z4RA 3GJ5A 4B6FA 3DMDA 3REFA 3R20A 4ACBA 2GJSA 4I99A 2IS6A 1U0JA 3HPQA 1MABA 4ZCMA 3UMRA 4ZKEA 1CJKC 2OLKA 5C1BA 1VTKA 1MO6A 4Q7MB 1G6OA 3H2YA 5M04A 4CDGA 1KGDA 1M74A 2VPPA 4JLAA 5CK4A 4P4TA 5FTKA 4O3MA 3CF0A 3CRVA 3ZJYA 1Q1ZA 4NZYA 1MO3A 2WKRA 1OPXA 1XNJA 5GJWC 4BFVA 2O8EA 1S2MA 4POAA 3DO6A 1G7SA 5LPNA 4US1R 4DLZA 3CWQA 3TLXA 4ON9A 1KJZA 2P0EA 5CIWA 4BZXA 1OH5A 3TQCA 1GFIA 2PX3A 2WJVA 4PHHA 1ZM9A 1H8ED 3CNOA 1XEXB 3MSXA 1GKYA 2V55B 1R5NA 2ODEA 2VSFA 4KCGA 1I2MA 4BEBA 1G8PA 1TQ6A 3A8TA 1FP7A 2ZRIA 3WRXC 1DPFA 1LFDB 3BBPA 4IDQA 2AKYA 1R4AA 3AVQA 3SBDA 1XD9A 1G4UR 2CDNA 2RMKA 3QXJA 2IYZA 4G0NA 4PC6A 3RS3A 5EUQB 1KY3A 3T5DA 4IDHA 3TGPA 3GLGA 2V9PA 2JLQA 2ZE8A 1W2GA 4WVFA 1N5LA 2CE2X 2P5SA 3Q5EA 3THYA 2BHRA 3H0KA 1G18A 1F5NA 4A36A 1CS4C 3HP1A 3C4JA 4FCTA 3BFXA 2VL7A 3N5CA 2OT3B 1VYUA 2NO1A 2RH5A 3C7KA 4URUR 5FTJA 3KQHA 2HLDA 3UK6A 3O8RA 3B1ZA 2GESA 2FF7A 1QRAA 4OK3A 2Q3MA 4IVQA 4WA7A 4DLWA 1HY3A 4M1TA 4HDOB 4ZKDA 1KI6B 1I4LD 3K1JA 4I81A 4CIDA 2JJ2A 1Y63A 3OFNA 2QENA 5HCNA 2JJ1D 3GLHB 4OHXA 5F98A 2XGJA 1OF1A 3R7WA 1JEDA 4BFZA 1JALA 4QM7A 4TTPA 5CYPA 4NTZA 1NY6A 5E3HA 3C16C 3E2IA 5GVSA 2MMCA 3BWDD 1XXHE 3CLVA 1YQTA 2OCYC 5BQ5A 1E9AA 3AVPA 2H5EA 1DARA 1QZXA 1PUIA 1RZ3A 1AZSC 2HXSA 4DCUA 4Z1MD 5C2JB 5C18A 1FZQA 1NIPA 1W44A 3BXZA 2IWRA 5GADl 3DKPA 1GRNA 4ZDWA 3TR5A 4F4JA 2G1KA 2GCOA 2WAXA 3CRMA 3RANA 5GVRA 3ZIAA 2B8WA 1DAEA 4TMKA 3ASYA 2ZR0A 4JMPA 2ERXA 3NVAA 1XP8A 4FMDF 1T5LA 1HTWA 4TYYA 1SXJB 3RRYA 2V7QA 4LJ5A 4DCSA 5FPKA 1Z28A 1P72A 2JDID 2UZ3A 3C5CA 1Q1QA 3VNUA 1CJUC 1NG1A 4BLSA 4GP7A 2J87A 1KOFA 5CYOA 3AKYA 2QMEA 1OH6A 1E2KA 2P6NA 3U44A 2G6BA 2J1LA 1NVVR 2FX3A 2JLUA 3GCGA 3JZMA 1IAQA 1G7RA 2GBLA 4HYYA 4J0QA 4DBLC 4Q7JB 3AGQA 1J8YF 2GRJA 4LDJA 1QHGA 5CIQA 2GETA 3VNVA 1T4GA 2WJJA 3W3AA 3VKWA 3QXSA 3TUIC 4YMWA 1IOZA 1UJ2A 2HLDD 3DOFA 2CJWB 2NMVA 2DFKB 2IXFA 2ZJ2A 1SHZA 2QP9X 1J70A 3AV0B 5FTMA 2QE7A 3REGA 5JBQA 1F2UB 4BLOA 3CX6A 4JBWA 2Y8EA 3GPLA 4PPFA 3QE0A 3VR2A 1UEIA 3X1YA 5K8UA 5KPDA 1G3IA 2XNSA 3FGNA 3MJRA 3U7GA 1FX0B 1KO8A 4G5QA 4ASUD 3EWAA 1FUUA 5FBLB 2J7PA 4HZUA 1JAIA 1Q12A 4BLTA 1WDTA 4KSBA 1KDOA 3KXLA 1P5ZB 2BM0A 5DN6A 1EFRA 1JEEA 5C4MA 1J2JA 3AM1A 4A0HA 3W6PA 4D0LB 4B35A 1E99A 2QU8A 4OJKA 2VO1A 4X8HA 2F3TA 1IBRA 1U98A 4L8GA 4GSYA 5LD2C 3U3RA 3UXMA 1KZ7B 2RKOA 4MRSA 3KXKA 821PA 3ZIAD 3WMGA 4DSOA 2NIPA 2A2ZA 2ERYA 3A4NA 1NNEA 1NVVQ 2C99A 4BLRA 3KQUA 4A4DA 2YJTD 2KBFA 2E9SA 4Q4AA 3SQWA 4QJ3A 3N2IA 2XZOA 1GL9B 1TADA 2A5FA 2W6JD 3DM5A 4B3DA 2V7QD 3WBJA 1U90A 2QT1A 2R6FA 3VHXA 2HDNB 1M34E 3JVVA 2JLWA 3IIJA 4MH0R 2PBRA 4B3CA 2DPXA 4CEJB 2JAQA 2N1BA 4H1VA 3TVDA 2C78A 4F4CA 4PPGA 1SVKA 1US8B 4F93B 2CNWA 1G16A 4WIAA 3LFUA 1WE2A 1J99A 1IN8A 5HPYB 1W4CA 3ZLJA 2MSDB 3TBKA 1R10A 1NN1A 1Z3IX 3SC3A 4EFNA 4V0LA 1Q3TA 1BIFA 3K09A 2R6DA 4V0NA 2H1LA 1OFTA 4QGHA 1FMJA 2WBLC 4XSGA 3R9WA 2FWRA 3OE7A 4C0LA 3PENA 3EIQA 4TL7A 3NBFA 1E9DA 2GCNA 3BJIC 4HB4A 4W9MC 3CR8A 4K46A 4DJTA 3MJHA 3B7GA 1W2HA 2XXAA 1ZU5A 3QPUA 1OYYA 3PV0A 2QE7D 2EFCB 2ODWA 3U3JA 3QEJA 4NCJA 4A2WA 3G0HA 5IT5A 3CM0A 3MD0A 3NWJA 4EIWA 2AKAB 2HJVA 2J0UA 2OXRA 2W2TA 4JSYA 1AS3A 3CBQA 4RD0A 5AJYA 3ZD6A 2J7PD 3FFBA 4PAQA 5ANRB 4BPBA 2VHQA 2W2XA 5BW8A 4LBWA 5DN6D 3RAPR 3G82C 2F1JA 2ZRGA 4N1AA 1CJMA 5FUVA 3TMKA 1PLJA 5C4GB 3W34A 4XD7D 4LRWA 3RS5A 3LBIA 1LS1A 1HE8B 3GFPA 1NI3A 1W0JA 3QF4A 2RCNA 4EPVA 4A2QA 3ZD7A 2NZJA 3THWB 3PUYA 3KUCA 1XDBA 1XPOA 3NH9A 1VCIA 2OG2A 4HLQB 1KNQA 1F48A 3QOFA 1YZNA 3RSOA 2GILA 3IKJA 3NBYC 2QAGA 4NHOA 4QNRA 4LY6A 4YXWA 1OXTA 4NCNA 4B34A 5DLQC 1P60A 4TLEA 3TH5A 2MMGA 4BWYA 4UXJA 4MKFA 1E69A 2GBLC 5EE5B 2BMFA 4A8JA 5KSZA 4GRAA 1T8TA 1JNYA 1NP6A 6Q21A 2ZJ5A 2FE4A 3RVBA 4IRUB 1E3MA 1XD2B 4D0NA 3FKQA 1COWA 2GWHA 2QI9C 2WWYA 1KDPA 1HT1E 1OFHA 1KNXA 2GAOA 2C95A 2OESA 3V00A 2YZ2A 3B5JA 1N0WA 1MO4A 5DSZA 2ZVPX 3WNDA 3T12A 2KSQA 5EP2A 1S1MA 4W5HA 4V0MA 3QBTA 5SZJA 2NPFA 4FMDB 3B13B 2W2VA 4V0OA 1L2TA 4YC7A 1UPTA 2CE7A 2FNAA 3FWYA 3EA0A 4WZBE 3K0AB 2JLSA 3WYAA 3EX7C 1PZNA 1E9CA 3KFXA 4ESHA 3MRSA 1G1MA 3AKCA 3CB4A 4BZQA 2F43B 3CPHA 2EQBA 4RVCA 1I2DA 4PANA 1E1RA 1VG1A 2Q0HA 5CJPA 5BN5A 4GMDA 4TTRA 2IT1A 1E0SA 1UKZA 1GRRA 3L8YA 2P2LA 1KO4A 1KIMA 1YR6A 2RGNC 3QKRB 1DVRA 4NU0A 3P27A 2LKCA 3OAAA 4MKIA 4LYFA 4A0RA 2EYUA 3LLMA 1SHKA 1R8QA 2REXB 2KBEA 3LLUA 1A82A 3O8DA 1G5TA 4NMMA 4UNQA 2WAYA 3KUDA 2HF8A 2ZM5A 1YRAA 3LX8A 1UM8A 1QVAA 1W0JD 3RRZA 4RZ2A 4RFSB 4ZIRA 1NSFA 2WJYA 1ZUNB 4M2LA 3V4FA 1Q0UA 2BEJA 4Q7KA 1BMFA 1ZYUA 4G5GA 5IHPA 1E9EA 1OB2A 3CUEF 3LBHA 1DAMA 3RYTC 4FI3C 3A1TA 4G01B 1TAGA 2Q6TA 4YXWD 1B0UA 1TU4A 1TF5A 1WCV1 3I4LA 3SU8A 1EWQA 1U81A 2XSZA 1QHHA 3EC1A 1K6MA 5FOXA 2I1QA 3VR6A 1YE8A 5G41A 3K09C 1WQ1R 3AUXA 3AGPA 3PUZA 1FOEB 1M8PA 1AS2A 3K0CA 1ZINA 1MABB 2FN4A 3B78A 2YC4C 1PLLA 2CLSA 2HJGA 2QN6A 4DLUA 4L16A 1RFLA 3A1VA 3SOPA 3ICEA 1ZD1A 4JJZA 1E96A 3NC0C 2GXAA 5KTYA 5DISB 2QT0A 4PSVA 4PO1A 3TW4A 4LJ9A 1E0AA 4NYMQ 4AKIA 2O8EB 4XWOA 4LC1A 1XPRA 4C7OA 4Q9KA 1S3SA 3U7FB 1WXQA 1KI4A 1T3LA 2OILA 1W7AA 2WKPA 2X8AA 4QOSA 5JFGA 2WPDA 2B92A 3HYRA 2O8DA 3GJXC 3RS2A 3M1IA 1E2LA 1Z0AA 2BBTA 4XVRA 2IEZA 1KK0A 1E1QA 4JLVA 3EXAA 3LDAA 2QQ0A 2QMUA 1A5TA 3M0EA 3VTKA 1SXJD 1CR1A 3Q72A 2FGJA 1VYTA 5JEEA 2WICA 3U6KA 3HPRA 1AS0A 1Z0FA 2WWWA 2IYSA 2YC2C 2EVWX 2ZJBA 1D2EA 3BH6A 3EG5A 3GLHE 2QNRA 3L82B 3OAAD 5HKKA 5L3VA 3C8UA 1ZD9A 3ADKA 4EFMA 4BFWA 4IDPA 1KSJA 2QM8A 4FWIB 2HT6A 3THOA 3AVTA 4TZ6A 4B3BA 3SJZA 2DYKA 1K5GA 1SVLA 5KSOA 3B8HA 3GLGB 2JEOA 2QAGC 4IFEA 4LPKA 2ZE7A 3THYB 3GLFA 2JLZA 1GWNA 3RC8A 1UKEA 5KU1A 1QVRA 4PR0A 4E5UA 1DG3A 1ZIOA 2PMDA 4IVPA 2GXUA 5K8IA 2EFDB 3AB3A 3IILA 2WIAA 3SHWA 4AKEA 4C0QC 3ECCA 3GLIA 2ZI7A 2ZRNA 4I1SA 1SVOA 2OCAA 1SVIA 2J59A 5JRJA 5JLJA 1W49A 1YZGA 2R6AA 3QPVA 3QSYA 5KSYA 1DS6A 2C03A 1VIAA 3LXRA 3IUYA 1U2RA 2X77A 1U99A 4FW9A 5FOUA 1N6IA 5JCPA 1P4SA 2IBMA 4JL8A 2NZ8A 4CT5A 3ICQB 1DTSA 3CRRA 3R7WB 1Z47A 1FNNA 1LNZA 1N6RA 1VDZA 3KQLA 1R7RA 2JLXA 5CB8A 3TJZA 1CF4A 4AC9A 1CRPA 1ZM7A 3IHLA 1ZJ6A 4NL4H 2XX3A 1Z6AA 4DKXA 4B3GA 2JLYA 4BEJA 2D7CA 4MUAA 4TYNA 1W4RA 1KO1A 1N6LA 1T0HB 3AH8A 2V1UA 2JGNA 4FIDA 1G9XA 4MYHA 3SFVA 3A1UA 1CR0A 1IHUA 1SVMA 2ZEJA 4MRPA 1SXJC 3NTUA 4DXAA 4V02A 3QEOA 2GCOB 4WZ6A 4ESVA 1XCGB 3KFVA 1X86B 4D82A 2RGDA 4NCIA 3EZ9A 5EXPA 1KJYA 1ZNYA 1E1QD 2P6UA 2FGKA 3UMFA 4LJ6A 1WB9A 2GDJA 4GMXA 4BFTA 4A2PA 2XB4A 3CNNA 3I8XA 2F1HA 1NLFA 2YWEA 3KL4A 3W9YA 2BBSA 1UBFA 2R62A 3FMFA 5TY0A 1QG2A 3UPUA 5HKKD 2JLRA 3BB1A 4UNNA 2VF8A 2V3CC 1CXZA 5FBWB 1RYHA 4GDFA 2RGCA 1X8KA 4DUGA 4B32A 2ZR9A 4IW3B 4GZMA 1R2QA 2CHVA 3F0TA 1E2JA 4PHGA 3BH7A 4FCVA 4JJKA 5KUTA 4MA4A 2OCBA 4AG5A 4HI0E 3HWSA 3I8SA 4R98A 3CWZA 1E9SA 4M9XA 3BH0A 3IO5A 4ZO4A 3C41J 3RDPA 5BXQC 4D4MA 5FBQB 3Q7PA 1LVGA 1Q1BA 3LXXA 2ZXUA 1BYIA 4C0AC 4OKSA 3TAUA 4OK6A 3FHCB 3NH6A 2GCPA 4CZ2A 1OFUX 1ONBA 1R0ZA 2Q9BA 4KV9A 4OQLA 4G5SA 4UKDA 5BYJA 4DDVA 2VHUA 2XTMA 4LHXA 3DMNA 2OLJA 4RKEA 2HYIC 1Q44A 2WMOB 2ZI5A 1OXSC 5F9FA 2GF0A 4D4KA 2A5YB 4DSNA 2ZJAA 5J4VA 3HR7A 4Z51A 2D74A 3WNCA 5JJLA 2F3RA 1NLYA 2FFAA 1M7HA 3JVUA 4HZUB 3LVQE 5JHGB 4JS0A 4P4UA 2ORWA 2VP4A 3QI2A 1KI3A 4GZLA 4DLTA 1P2SA 3KKMA 5E7MA 2IF0A 4RFVA 1PUJA 4CT4B 1G8HA 2AK3A 5EP1A 1CRQA 2FU5C 2D2EA 3GEIA 3IIKA 3BRWD 2B8TA 3IIMA 2CK3D 2WV9A 2PCLA 1TMKA 3TSWA 1MRSA 2YINC 3CX8A 4ZDIA 5KOYA 2ODNA 4LJYA 4LJ8A 3LBNA 1D9ZA 2IYQA 2ORVA 4M8NE 3DZ8A 4GPTA 3GJ7A 4KFTA 4NH0A 4P3YA 2XOKA 3SBEA 4Q4AB 3K70D 4S2EA 2AXNA 2RGXA 4PC1A 4NE2A 1ZBDA 4ERNA 1M2OB 5L3RA 2WHXA 2PZGA 1XXHA 4NP6A 4CGZA 1G3UA 3DKVA 3ASZA 3R8CA 2PEZA 1G8YA 5JMTA 4PZYA 2GAAA 3QXXA 4JZKA 4LV6A 1VHLA 2VSXA 4B71A 3GJ6A 3CF6R 4A6XA 3WP1B 1XTKA 2GXSA 5TB5A 1JR3A 1WRBA 2JIZD 4JL5A 1L8QA 2IUTA 2ZVQX 5JSZA 2ZRCA 4PXAA 1GL7A 1UKYA 4JBXA 4Q4LA 4ILEA 1KI1A 2QORA 1Z0IA 4Q1FA 3QG5A 3HU3A 2O8CA 1IXSB 1EG7A 3BFVA 2FDCA 3SYNA 1UADA 3L8ZA 1QDEA 3VKGA 2DFTA 3TKLA 4MITA 2XXAB 3IPXA 1JPNA 3P4YA 4QHTA 1SQ5A 1KSGA 4XIGS 2GHIA 3S1AA 4KODA 4BECA 4W5WA 4HLCA 4IKEA 4MRVA 3ZVLA 1KJWA 2HCJB 2R8RA 2J0UB 3KZ1E 4Q01A 1VPLA 1IJFA 1FMLA 4DDUA 2NGRA 1XEWX 3PXGA 1NJGA 3LVRE 5FL3A 5EP4A 4C2TA 4BLPA 4D2IA 1E4YA 1NLZA 2PX0A 3RWMB 5EXXA 4I1OA 3V9PA 3R8FA 2B7BA 1G5RA 1QHIA 4EKDA 3N2EA 1E2IA 3QBVA 4JVSB 4QHSA 5CM8B 1II9A 3B2EA 5JJIA 3K70C 1V5WA 3QF4B 2BBWA 4YONB 1KHTA 2N42A 1JJVA 3Q7QA 2C8VA 4PC7A 5A5GA 1P75A 1R0YA 4WXRA 1XMJA 1TQDA 3KKPA 1CR4A 4IHQA 4M1WA 3SEAA 1OB5A 4FXPA 2ZPTX 3TK1A 4QKQA 2QAGB 4URZR 1J8MF 4PSKA 3VHLB 3B9QA 3EPLA 1Z6GA 1BOFA 1CKEA 4A8JB 2V4ZA 4ACAA 2X2FA 1W0KA 5GJBA 1QG4A 1F60A 2AR7A 1D2MA 2IK8A 2RGBA 2ZETA 2CHGA 5GJVC 3RC3A 1VCNA 1JR3D 2QGNA 2ZS7A 1TU3A 2OM2A 2QPTA 1EGAA 2RAPA 1PLKA 2QP4A 3NG1A 1NVXQ 1RJ9B 3IEUA 3SZRA 3W6NA 3M6AA 4MGKR 4HUTA 3D7MA 1JJ7A 4U00A 2N46A 4D0GA 5J4HA 4QM6A 4IXMA 1H65A 2OHFA 1S96A 5H68A 1N5IA 1W1WA 1N0UA 1IN7A 3CZQA 1AIPA 1G3MA 2BMDA 1AM4D 3GJ3A 1KAOA 5AUNB 4B74A 221PA 1XJQA 3VR1A 2DCUA 2ATVA 2VSOA 5DGXA 1D5CA 4NDZA 2WZQA 5AUOB 5FH9A 1W47A 5EP3A 2BJWA 3TUZC 4C9BA 4F38A 2C9OA 3FMPB 2C04A 3ND9A 4KBGA 3MWJA 5DE3A 3W8NA 5CDFE 2FEOA 1XMVA 1FQJA 3AKDA 1NKSA 1UBCA 2VP6A 3A37A 1KTVA 4G5OA 3MUFA 4KI0A 5LB2A 3M4YA 2ZSAA 5IK2A 3VR4A 3ZVMA 4AIIA 4BFUA 4OQXA 2PZFA 2Q3FA 3NEJA 4OJQA 1C9KA 2C2HA 5JJKA 1G19A 4TWZA 1W4AA 1YR8A 2BMJA 5SZHB 2BC9A 2J0QA 1E32A 4ZIRB 1TX4B 2ODBA 2Q9AA 5C46F 1OW3B 3A1SA 4LCBA 5EUMA 3SJAA 3AF0A 4MQBA 4C0SA 4AKGA 3A58B 1VKJA 1DADA 2F6RA 1N6NA 1YZUA 5JECA 3SJBA 1EX7A 1R8SA 1ZC3A 1TTTA 5IF9A 3TAHA 3CRQA 3VAAA 3VKHA 5KSPA 2DWOA 4A1FA 3TIFA 4DDWA 2FJUA 4Q18A 1X8JA 4Z54A 1QHHB 1U9IA 3L0PA 2F1IA 1M7GA 3LX5A 3K8YA 4PPQA 1SKQA 2JJ2D 3OFND 1IN4A 4KAXA 2IHBA 3QKSA 1OFIA 3IBGA 4P33A 4TZ0A 1F3OA 1EXMA 1N5JA 1OHHA 1OYWA 3BK7A 4Y0AA 1G5PA 4DHEA 2WJGA 4MGIR 2WSMA 2XJ4A 3W5JA 1LW7A 3CZPA 4FD2A 3GLGE 4RZUA 3QPWA 4TMZA 1ODFA 1MO5A 1R5BA 1HYQA 2PEYA 1XEFA 2XZPA 2OAP1 2IUSA 1G7TA 1R0WA 3NBZC 3OHMA 3UIEA 4C7OB 3BAFA 5KO2A 2ZYUX 3DPUA 2V6IA 3I62A 5ELXA 3U61B 4DLXA 4YMUA 3DDCA 4OBEA 5H1YA 2O8DB 2GVDC 2D62A 1T8UA 1TUEA 2O0JA 1JR6A 4JSTA 3U2QA 2KJQA 2GJ9A 3NXSA 1XRJA 4N3NA 3VQTA 3PEYA 2PLRA 2IEYA 3QJYA 1ZD8A 4KVAA 4LOAA 4QG7A 2X1VA 4G3XA 4KLNA 5B58C 1GRQA 1EFTA 4ZI3A 2FFBA 5BWMA 1FQKA 3FMOB 5F9HA 5J4YA 2UVQA 2ZSBA 1ZUHA 2P3SA 4OHWA 4AWXA 4D4JA 4EUNA 5IK2D 2BCJQ 4GL2A 3ZZTA 5A0FA 1GAJA 1QHSA 1RRGA 4AYTA 4OHZA 2WWGA 4A9AA 2VP0A 4DCTA 1VCMA 2EFGA 1E4VA 4PFSA 3W90A 1W36D 1KI8A 4BLQA 4QGGA 4IXNA 3QKTA 2AHOA 4RD3A 2A7QA 2L0XA 5FR1A 3GLFB 2ZJYA 2VIIA 2QRZA 1CR2A 5F2EA 4UNPA 1IY2A 2ZE6A 4B73A 3BERA 2LWIA 1OKKA 1OIWA 2AD1A 3P32A 3GLIB 1GZSA 4WW0A 2BBOA 3MMPA 2HEIA 4CEHA 4P0TA 4AG6A 4PHTA 1ZM3A 4URWR 3B82A 4Q03A 4KO8A 4PQRA 2WKQA 1NN5A 4OQMA 4E22A 1KKMA 4N0DA 4LBVA 3UG6A 2IX3A 2ZI9A 1Z6XA 4TSFA 2YKGA 3SYLA 3AVWA 3SJCA 1VG0B 4Q1BA 4HAZA 1E2PA 1U94A 4HLUA 4LHZA 3T34A 3W6OA 4EAQA 5EZ5A 8OHMA 1P7CA 1P2VA 5TMPA 2RHDA 1EFRD 3EZ2A 2QQEA 1XCMA 4GP6A 4B76A 5FBRB 1KY2A 1Z83A 4Q48A 5HCIA 1P6XA 1FW6A 4F4IA 3U7EB 4B75A 4LSGA 1IN6A 1JQLB 1V43A 4HLDA 1XB2A 2CVFA 5CK5A 2QA5A 2O52A 2WWXA 1ZCBA 2FZ4A 1TEVA 4KHZA 4GOKA 3MGCA 4B2PA 2J7KA 3L0OA 1E2DA 1AK2A 1IXRC 2XJ9A 4B33A 1G41A 4MDEA 1CTQA 2FH5B 1MKYA 1NBME 2OEPA 2PH1A 2CCKA 3K70B 3IDQA 1NMZA 2DR3A 3AQ4A 3AP1A 4IEIA 4C0KA 3CIOA 1II0A 1D6JA 1N6HA 1XMIA 4JVLA 1W36C 1HQCA 5JS7A 2CNWD 2ZS9A 2FOLA 4QL3A 5DI9A 1OLOA 2KWIA 4Q4JA 2ZU0C 3PUVA 4HB2A 5JRZA 2HCBA 4JL6A 1RE0A 3A36A 3Q3JB 1XU4A 4US0R 3U5ZB 3TR0A 4TYPA 3TW8B 4NBSA 4TYQA 1ZUIA 4I4LA 4O2LA 5J47A 1A4RA 3VR3A 4DCVA 1S1CA 2QG6A 3BB4A 1U9IC 2VEDA 1JQJC 5JEDA 1RRFA 3OE7D 4IOKA 1E79A 4LYAA 1DOAA 2VRWA 5JI3E 1KSHA 4JKYA 3PUXA 4JLJA 4DLRA 2AWNA 3E1SA 2A30A 1OKKD 1U0LA 2WJIA 3KTAA 2BKUA 4LV8B 3KDSE 1G8FA 3D31A 2IHYA 4DVGA 1E9FA 1KK3A 2CLDX 2OCPA 1CULC 3LW8A 1II8A 3P26A 4G1UC 4JLMA 4MRNA 3RABA 2BEKA 3WYGA 2O8FA 4XVQA 2ZREA 3P1JA 4M9SA 1PVOA 4AD8A 3AP2A 2Z4SA 4PTLA 4TL9A 1DAKA 2GEDA 3D3QA 3FB4A 4NYMR 2W00A 1ZIPA 5EZ6B 4Q1EA 2UZIR 4B3XA 3RS4A 4DCNA 2Z0MA 4JYCA 4R2HA 1FL9A 2ZRAA 1ZM4A 3DEFA 3SYKA 4CRWB 3VMFA 1YR9A 2BV3A 3CX7A 4M4SA 1CJTC 4DIEA 1T9HA 4HUQA 4B48A 2V6JA 3RS0A 3HDTA 1KI7A 2GEVA 5AR1A 2ZUCA 3ZVRA 4DIDA 2AX4A 2AD5A 1LTQA 4QGFA 5BN4A 3L43A 4KLZA 3EAQA 2HT1A 4YDHB 3IQXA 1VG8A 3U3MA 3WMEA 3X1DA 5FOVA 5G3YA 3UWKA 2HXYA 3WHLA 3K0FB 4LHWA 1XXHB 2ZYWX 3NKVA 4LYHA 2IUUA 2FZLA 1COWD 3MLEA 1VECA 1ZNXA 2ZJOA 3Q5DA 2OUKA 1E6CA 3BFKA 1DAFA 2ZU6A 1A7JA 2CL7X 2ZSEA 5FFMA 5EJEA 1RPZA 3LV8A 2ZQ5A 1XTSA 1TPZA 4A15A 1ESNA 1HEIA 1GIAA 2F1RA 4DB4A 2D06A 2YWGA 5AUQA 3EZ7A 2Z6VA 5DH9A 4MYTA 4DZZA 3C5HA 4S35A 3DZDA 1RRPA 2C96A 2O8CB 2XTNA 4O25A 4JVNA 5AJVB 4ZCIA 1AA9A 1XTRA 4AK9A 5L3SA 2AFHE 4D6PA 3B1YA 4BZPA 2X19A 4OL0A 5JWRA 1ZU4A 2PJZA 1NF3A 3IBYA 3ADBA 1UDXA 5FBVB 1E1RD 3L0SA 4QRHA 4NYJR 3S1AB 3SI7A 2JJ8A 2AN9A 1K5DA 2NO7A 1IQPA 1OXXK 4TT3A 1Z22A 1Z08A 4A6PA 1OT3A 2FPLA 1BYUA 1S4QA 1HT2E 1P2TA 3OZXA 4Q1CA 4OHVA 3T1OA 2DB3A 3F5FA 1Z5ZA 5BYKA 3PEVA 5FI0B 4FCWA 4EDHA 4K81B 4M9QA 2YHSA 3THXA 2VHCA 2V1XA 4X8OA 3WMFA 1XJCA 4IDOA 1G64A 1MRNA 3AF4A 3EZFA 4OYHA 2XEXA 4QHYA 5AUPB 3FPAA 1KI2A 1ZW6A 4ZDJA 2VLIA 1TF7A 1MOZA 1Y3AA 3PR1A 1BMFD 1MT0A 2YOFA 1S3GA 4A8JC 4O2RA 621PA 3DM9B 3EZ6A 3ZDQA 3SNHA 4JBYA 1UFQA 5SZKB 3OIUA 4Q9JA 1OE0A 2B7CA 2V8OA 2VH5R 2XSZD 2ZRMA 2NO0A 4GI7A 4XOIA 2BMEA 2A5GA 4NYIQ 1M1YE 2OAQ1 2V54A 4A0FA 5CB6A 4EJSA 1SXJE 3QNUA 3FE2A 1GNQA 1AGRA 2FFQA 1LS6A 2REOA 1DAIA 1DAHA 4WBSA 4FMBB 3UKDA 1E98A 5KNCA 5KHOC 3LQQA 3HR8A 1MH1A 2FV8A 1W4BA 1AZTA 1GVNB 4BQSA 4NYJQ 3RLFA 2QBYA 4MYCA 5CLQA 1JAHA 4PPNA 1G7CA 3B9PA 1QBKC 3PITA 5KDLA 2QY9A 2CCJA 3EW9A 4X8MA 1QHNA 2UKDA 3NHAA 2J46A 2GJKA 1G291 3VX3A 4CVNA 1ANKA 2WPDD 2AXPA 1GSIA 3N70A 2VP2A 1W46A 4QBIA 3EPKA 4NONA 4TL8A 3VFDA 4BASA 3EPHA 3FKSA 1ZM2A 4DSTA 1XZPA 5HE8A 5DYGA 1XWIA 2FG5A 5EXTA 4HB3A 5CLLA 2QPAA 5HTKA 1DE0A 3FYHA 1SKYB 2IYYA 4YQFA 3VU9A 2QL6A 4JLBA 4JVMA 4LJ7A 4GBMA 4IOJA 4GFDA 3I61A 1YU9A 4TLBA 3PIRA 4NCKA 3UG7A 1W5SA 4DEXA 4TN1A 4B2IA 2SHKA 3EASA 2IL1A 3O8BA 3U44B 2YWFA 5H70A 4KITB 1Q57A 2EFHB 4F91B 3ONWA 1GM5A 3CF2A 5EXSA 3I72A 4US2R 2NOAA 1W36B 4TLCA 3RNLA 1KYIA 2CL6X 2QM7A 2D7DA 1IY0A 1WBBA 2ZRDA 1YZKA 4BFXA 4LZZA 4B2LA 3GJ0A 1YZQA 3K0CC 4YMTA 1NN3A 2GF9A 4BRUA 2LCFA 3PCRB 5F3WB 3B1WA 5EE3A 2FFHA 1RRCA 1RIFA 1MR3F 2IC5A 2GVZC 2I3BA 4IEEA 4NPHA 1KMHA 4TLDA 3CNLA 2ZYVX 2C98A 5D3MA 5E4FA 5G40A 3QKUA 4ARZA 4UNRA 3U60B 4OI4A 1TQ4A 3J81k 4RKFA 3V4RA 5JS8A 1NSTA 1KSFX 4LX0A 4OI2A 3KKOA 3QKSB 3QVUA 1LF0A 1P62B 1X1SA 3U7HB 2G1JA 1F2TA 2BOVA 3OF5A 3EPJA 2PZEA 5KNBA 4II7A 4PSAA 1YVDA 2R2AA 2G77B 4UXHA 3OIVA 4PC3A 1ETUA 2FSIA 1KDRA 1N6OA 3P20A 2ZJZA 1H8EA 2Q3HA 4DB2A 2PLFA 1R6BX 2DWQA 4L15A 721PA 2IYUA 1G3QA 1T0JB 1XCPA 3QXHA 4MKHA 3SR0A 5IRCD 5A4JA 3T1TA 1NJFA 3BGWA 3FKSD 3I1FA 3AF1A 2KE5A 4DLVA 3GEHA 1CP2A 1TUIA 1EESA 4D26A 4DLYA 2H16A 1EFUA 3IPYA 5FL7A 2GNOA 5J4KA 1Z0JA 1E9RA 2G0NA 1AQYA 2CLCX 3AF3A 3LH5A 4G5RA 1ESMA 3SE0A 3AVXA 4UJ3A 3WBKA 3R9XA 4DUGD 1TQ2A 2HUPA 2OFOA 4QBFA 1FNMA 1P2UA 1HV8A 1ZNZA 4M0LA 3K0SA 3WNBA 1VMAA 2DY1A 4URYR 1GDDA 4HB0A 2VBCA 1VYVA 3SN6A 2XB2A 5E95A 1EX6A 3VX4A 1XMSA 4AYWA 4EJSC 3RRNA 4TL6A 2BJVA 1OH8A 3AF2A 3BB3A 2NO9A 3SFZA 5J5CA 2ZI6A 5FPSA 2ZYTX 3TQFA 3X1ZA 3CONA 2W0MA 5CDFA 5AWFC 2A3RA 4DDTA 4GOJA 3ETLA 4XSHA 2G83A 2C9YA 2JJ1A 4B47A 4CEHB 4M1OA 1N2CE 4WZAE 3W8RA 3ZGXA 4EPXA 2A9KA 1JPJA 3LNCA 4KXFB 1FFHA 2P65A 1NVWQ 2CVHA 2EWWA 3GJ4A 2ONJA 4HEJA 1RKBA 2G88A 3GMTA 3LA6A 3ZS9A 4KYUA 4XWAA 5FUXA 4Z1MA 3EARA 1R5OA 4LK2A 1JECA 1FTNA 5J4LA 4U7DA 2OBNA 4C0BA 2CXXA 3G5UA 3B1XA 2ZI3A 4Q1DA 4C0HA 5JWOA 2H8KA 1UKVY 3OEEA 3GP8A 1XTIA 2CCGA 2HF9A 4JLNA 4JT2A 5FUYA 2REBA 1TEXA 1SGWA 3KKNA 4KU4A 5CJ2A 5JCZA 5JHHB 4PQFA 2O8BA 2IYRA 2XOKD 2JDIA 4DSUA 3U3OA 1IM2A 2OSBA 3LO5A 4EPTA 1O87A 1BO6A 4ITRC 4DRZA 1U8AA 5FL7D 4WXPA 1DG1G 1KI9A 2YOGA 1P3JA 4URXR 4DWJA 2PMKA 1XTQA 1ZRHA 1E2QA 2ZRJA 1GP2A 2FPMA 2NG1A 2FEMA 2ZRKA 3I5YA 2YVUA 4H9GA 4Q4JB 2OBMA 4ZI2A 5CITA 2ZJ8A 3EWSA 1E0KA 4XJXA 1OSNA 2WWFA 1A2BA 1E2NA 4PO8A 3C14C 4KVGA 1E2HA 4LBZA 2O0KA 1NMXA 1S9DA 3HYTA 4L4UA 4PC2A 1JB1A 1NG9A 1JXMA 4V0KA 1EK0A 1CJVC 2CBZA 2GK7A 2ZRLA 3LW7A 1BH2A 3DHWC 4N0EA 4QGAA 3KB1A 4QNMA 5TARA 1E94E 1R0XA 2ZUDA 4IDNA 2QSYA 3PQCA 3HJNA 1NN0A 3KTAB 2WOOA 3TE6A 3QENA 4HDQB 2ZRBA 2GEUA 1Z2AA 1KK2A 4F92B 2QGZA 1II8B 4CEIA 2O8FB 4QJ4A 5IDVA 5GJCA 4ASUA 3KJIA 1Q21A 3R9IA 2Q9CA 1VHTA 1YJ5A 4IFBA 1MV5A 3QY0A
chains in the Genus database with same CATH superfamily
4M1KA 1G63A 1GNRA 3E70C 3A1WA 2V5AA 2WZBA 3K5PA 5I9MA 1ICIA 3FPHA 3KJEA 1NBIA 3G2HA 1OBFO 5AHXA 1VI6A 2BFBA 2FMIA 4JKIA 5FPYA 1K7YA 4JOCA 1VSVA 3LPDA 4BYMA 1DCTA 4LYEA 3U4DA 2PO7A 3T95A 4UBIA 5KHLB 1D2AA 5EXEA 3CT4A 4ABYA 4KREA 1E9BA 3IUSA 3CB2A 4ZC8A 2X0JA 2H1HA 1FX1A 2BDTA 2V3WA 4HYQA 2ZANA 3MUEA 3NYWA 5J9FA 3II6X 4HUQB 4CMBA 3RIMA 4UBJA 3F8SA 4GOND 4PZEA 4OQZA 1JXOA 1N2ZA 3ISTA 5J2UA 4HMPA 1T3GA 5TDHA 3TBFA 2C31A 3BDVA 3U48A 1KU0A 3LCMA 4PTYA 1OTHA 2DWPA 1P3DA 2RGGA 3KUKA 2FHPA 4FSXA 2PWPA 3D6TB 4IVRA 4MVJA 4RJLA 2ZYSA 5LBTA 3OOSA 2HQOA 1EVZA 2Y0BA 3UVEA 4E7PA 1RLUA 2JBWA 5YASA 5FNVA 3O8CA 1HRKA 1IPHA 2C77A 2CFIA 2YMMA 3R3WA 3P0IA 4TMTA 1G20E 2WOJA 2NQ2C 4NY1A 4U02A 1ODJA 3RVKA 5IFLA 4MI9A 3ZWYA 4I55F 5JFTA 1HNNA 3FFAA 3T4XA 3ZVNA 1JFTA 1EP1B 2QRLA 3S2IA 5JBNA 3QIAA 1D9XA 4WQMA 3PEWA 4KNWA 3U4QA 1YA6A 1LLDA 3UGTA 3FFWA 3OPYA 2VF2A 3QTBA 2I6FA 4S1VA 1VLJA 4HH1A 2FQ1A 1U5BA 3DD1A 1Y7PA 1A2QA 4WNAB 5BWLA 4CMAA 3C1OA 4BB9A 4XWWA 4A0GA 4DT1A 3SS9X 4R41A 1VE1A 3X2SA 1ENZA 2GXQA 1KPIA 1FLAA 2R1ZA 2O14A 2PT9A 2C0CA 3L8MA 4HSEA 2JZCA 1JMVA 1N0VC 3NNDA 4REQB 1Q92A 1L1QA 2HI0A 4U3JA 4Y6GB 5BWBA 4LTNA 1L5VA 1VJDA 3H4MA 3DHNA 1CUVA 3CZRA 4Z7QB 3HYCA 1JKJB 1D7OA 3U6BA 3PQFA 1CJCA 3PL5A 1YI0A 5T67A 1FFXB 4UQOA 1KFEB 3WLRA 4PX5A 1W85A 3TUJC 2QQ5A 2XZLA 4IRXA 1ZC4A 1RU3A 4OIMA 1OXKB 2DPYA 4IYRA 1NMYA 1PR2A 4RTKA 1MIHA 3DDOA 2W4MA 1U9CA 4WDQA 2DFNA 3VR5A 1JG6A 5KKCA 3WLKX 1Y3IA 5TQJA 3AOEC 4NZMA 3JQPA 3P0HA 1VIYA 1TM4E 2NXJA 4P32A 4XD7A 1WMSA 3QJ5A 1XT6A 2HRZA 3DF9A 3KD2A 1HPLA 4IV5A 1BGXT 4QECA 1USUA 2PMCA 4K9LA 4PGMA 4QUHA 5L8VA 4ER6A 4CQMB 3HB4X 1IBKB 4HQ6A 1S3FA 1RDFA 3GPDG 9LDBA 1U63A 4Y2UA 1VL1A 2IA5A 1X0XA 2IZ0A 4ZEWA 4HN4B 3MCAA 2CMFA 2EX0A 3N87A 4TMVA 2CXRA 3AY7A 1T4DA 3HU2A 3P2MA 5FIUA 2GCGA 5E9QA 4WRRA 3WJ7A 1ZCFA 2J07A 1V1RA 4KO3S 3VZQA 4TVKA 2IQIA 1HURA 2GYUA 1N6PA 3DWFA 5HR5A 3PS9A 1N5MA 2AXEA 4OLBA 3A0UA 2WJHA 2JAHA 1PEAA 3EHEA 1EDOA 1K8YB 1QVZA 3WOVA 3RF6A 1IE3A 1RW4A 3L0IB 4A73A 2PT5A 2D4HA 4XFJA 2MIIA 3ODGA 1A2OA 2R9VA 3IR5A 3Q9SA 3MJ4A 3EDMA 4HAVA 4F7WA 5JNUA 1PJRA 4WGFA 3A6EA 5BR4A 1RQNA 2WUGA 2CF5A 4LJAA 4E6PA 2PUWA 4DIOA 3D4PA 3GOHA 3QYFA 4C76A 4IGIA 1FY2A 5IJAA 3U31A 2YZNA 1RXCA 1YACA 4DGSA 2Q3CA 3ILYA 3GO4A 3MCUA 3QQPA 1P9OA 3GL9A 5EJMA 1OTXA 4BO2A 2Q2VA 1OHHD 4LRUA 5DN9A 1I1QB 1ZRMA 1S8FA 2FXIA 5I8WA 3K0EA 1AMUA 3HSKA 5L9AA 3E5NA 5FJIA 3H5OA 2QBYB 1XTPA 2OP0A 1Y80A 3TVTA 1YRQA 4DZRA 4LCJA 3R7LA 1UZAA 2IZOA 5JD6A 5ALSA 1D5WA 1R8YA 2HMYB 3WWYA 5DYNA 1A50B 1T2UA 5LB4A 1YCGA 2V59A 3HE3A 2JBHA 3L1IA 3N75A 4YVFA 3PXXA 3ND5A 2J0EA 1J39A 4ZRDA 4M7OA 1MAHA 4OUDB 3TRFA 3M6XA 3NKFA 1GZVA 4DEYA 3FTQA 4MUEA 4B3FX 5DX1A 3VHRA 1X6VA 4G41A 4XTCS 4GGMX 4B6EA 1DQZA 4FBGA 4YI5A 1H2RS 3AFMA 5DHTA 4ZOLF 5AW7A 2BY4A 3AJEA 5HEKA 2JW5A 5REQB 3WLHA 1MDFA 3R0QA 4RPIA 3T3MB 4L0CA 5BMVF 1U7TA 7YASA 1K97A 2FMUA 3EGDA 3UFXB 4BUCA 4YR9A 2TECE 3DA8A 1OX5A 3BYZA 5CLHA 1OYVA 1QE0A 1VCOA 2JIRA 3V2IA 3WXMA 4EA7A 1THZA 2JIMA 3FLMA 1CDOA 3LT0A 3OX3A 4JLPA 3VYSB 5K03A 3C6YA 4M1MA 4Y2PA 3ZZ1A 3W6ZA 5KJEA 1DQSA 2Q6VA 3TN7A 1H2WA 3AP3A 1GYQA 3OQVA 5KQLA 3A6GA 2H1FA 3EAGA 1YS7A 4B7ZA 4Q19A 2H4YA 1NQ5A 1EQUA 1GLGA 4P92A 4Q4DA 4LXXA 1LY1A 4EPWA 2XDAA 3JAWA 4JOSA 1K7FB 1MVNA 3RRMA 3UO8B 2AR0A 5FFFA 1JUDA 1Q1EA 1L7OA 4A26A 1KI6A 4W6ZA 4BUJA 4LMRA 3MG9A 3GJ8A 5KYYB 4WACA 3FHOA 4JLSA 2GCEA 3AR4A 4G89A 3EC2A 4KK3A 4Z9YA 2XTJA 5FUWA 2Z8ZA 4Y67A 5C7LO 1J2YA 1NL3A 3KIPA 4ARZB 2QR3A 3P2YA 3TR6A 5J2UF 1G0OA 2P67A 3IDAA 4Q02A 3LDFA 5ENZA 1RJ9A 1WSWA 2VDLB 3NHRA 3ROFA 5BW5A 4TQUS 5DHSA 4DF3A 1ZQ9A 4MVJF 2CHUA 1XQ6A 2F3SA 3LHKA 2F17A 1TAUA 1LV7A 1UAGA 1YBHA 3NWEA 4LXYA 3OIFA 1R4NA 5FNVF 3ZIDA 4AL4A 1N5KA 2H31A 1C1XA 2IPAB 1JBKA 3OKAA 4QUJA 1IOLA 1JT2A 2QW1A 4JGBA 1Q2XA 3BDAA 1E7RA 2HU8A 4Q00A 1QOPB 4RSRA 1E63A 3DT6A 1A04A 3CR7A 2PNJA 4A2CA 5D1NA 3B60A 4CYMA 3EXFA 1GITA 2QTHA 2OD7A 1Y3CE 4WT7A 3T54A 4UOQA 4L9WA 4I55B 2QI9F 2JCBA 4LXIA 2XA1A 4NKRA 4PGAA 1ZMXA 1SXJA 4D80A 4CR8A 4CTKA 2OD9A 3SC6A 4XH9B 5I4BA 3IURA 1SIWA 4WOBA 2ZWVA 3ABZA 4FTWA 3ZWXA 1FCJA 2PYZA 3ZGLA 4MV3A 4ZVQA 3CHYA 1YS2X 3NRBA 4LYYA 3ZE8A 2ACKA 3R3UA 1SCIA 1P1KA 4HVAA 3OEHD 3AVYA 1RIIA 1WXXA 4GNKA 1FVOA 4WHMA 4C30A 1E2MA 1ZK0A 2QP3A 4N18A 3NB0A 5E3IA 3AUTA 2X3YA 1E6LA 3GT0A 5LP1A 4FUQA 4L4SA 3ZUPA 3BWYA 1XHEA 3KX2A 2V0CA 5DYTA 4DMRA 5KVVA 1VI2A 2J6CA 2NU7B 3DL2A 3G02A 3KVOA 3HDVA 3KWMA 4R05A 2QMHA 1L1RA 4K9MA 4YLGA 4BBJA 4NEQA 5LQRA 3KLNA 4WAUA 5JSZB 2GEBA 4KKVA 4PWZA 4PZ9A 4W7SA 5I5EA 3ZC3A 1GQOA 2J3JA 4DBZA 2XMDA 4X1YB 1XTVA 4FIZA 2ZUFA 2VH1A 1E79D 3K0BA 1AKEA 1VG9B 3I5XA 2DPHA 2IH5A 1RC0A 1SWVA 4V0QA 1UIMA 2XT0A 4ENTA 4KYVA 3WP0A 1Z07A 4MPPA 1MQ8B 1KAEA 4CN9A 5U1PA 2WJPA 5DM2A 3EFOA 5KI6A 4F2GA 2FN9A 2Z08A 3UMBA 1RWPA 2YVKA 1BD3A 3PI7A 3ZXSA 4HLUC 3QUAA 3UMSA 5EZQA 1M8KA 2RH8A 1SVUA 4GBED 3IP6A 2OXTA 3T5MA 3AM3A 4QT4A 1DBSA 1PG5A 2YXPX 3AHHA 2Y92A 4ZCPA 1UDWA 2NTYC 4CUZA 5HZHA 4HDNB 3L7CA 2WM2A 4QBHA 4JLKA 2VQSA 4NVRA 1RI4A 2YASA 2ZYRA 4HXGA 1A9ZA 2DCMA 4L5JA 4LUCA 1ZN8A 3ZZTA 1FJXA 2HW8A 1T3HA 1Z7BA 2IW3A 2VHTA 3PX3A 5JJ5A 4JXXA 3KPWA 5ESXA 3JATA 4NJOA 4PFJA 1UJMA 3BN3A 4DMUB 4U2DA 2O4CA 2WSSD 2F9LA 3V7NA 5EWMA 1BCSB 2VA8A 4NBNA 4GR4A 4QJIA 1X7XB 2XWBF 3ICPA 2QJWA 2R47A 4OSPA 4TROA 1NR5A 3S5UA 1CNMA 1BW9A 4QREA 2OZEA 3QM1A 1IZYA 2I55A 3KJQA 1ZICA 3DV9A 3IB6A 4ZVMA 4CEJA 1KYZA 4HXEB 3CX3A 2NPIA 2FTKE 2X8BA 4K87A 5TGDA 1JWBB 4BRWA 1PQPA 1QCZA 2GJ8A 1FLDA 3BJMA 4OI1A 4O4IA 1Z4KA 2GN8A 1VE9A 4RNCA 4R9UC 2EU8A 3RYHA 5B3AA 4F9EA 4HAOA 4LPSA 1KS9A 4JNCA 1LSUA 1H2EA 5HIIA 3ZLUA 2Z43A 2QV0A 2I1VB 1SCKA 3DVLA 5JANA 1FDSA 2BM1A 2FWJA 3RVLA 4E5SA 3EULA 3QXCA 1L1FA 2DBYA 3TLJA 5DWQA 3M3HA 5B4VA 4YCJA 2ZIXB 2AN4A 2GCIA 2P78A 2CFCA 3L7KA 3LLVA 3QVKA 3I04A 1E5XA 3IP1A 3R0ZA 1LF5A 3DL0A 3HN2A 3LQRA 2UZ1A 4G2NA 3VV3A 4ALKA 2IS1A 3I6IA 1L4NA 3DW3X 4O5OA 4BFYA 5E0KB 4J3NA 3RUFA 3SM9A 4JBGA 3K9HA 5JCJD 1DJNA 3Q7EA 3ZWQA 1ZJ4A 3IULA 3ZCTA 2FW7A 2QTCA 3EFHA 4CN8A 2B82A 1HFEL 1OV6A 1MB2A 1OU0A 4ZOLB 3WZMA 4M9ZA 2GK6A 2JGDB 1LC3A 3G9XA 5E6RB 3L05A 2X5KO 4U0JA 5BMVB 5F4ZA 4Q9IA 2O59A 2W5UA 1NMSA 4PQYA 2C9CA 5CBPB 4CEIB 2CXQA 2OFXA 3KKLA 4Z0TA 3VGJA 3DDZX 4C3VA 1FUKA 4UU7A 3K9NA 2BLNA 2WJ3A 3NVDA 3IUEA 3O6VA 2ZB3A 1GNPA 4K9RA 3T3GA 1IM5A 3DUFA 4M9UA 5G3ZA 1G3RA 3INYA 3UJ8A 1L7NA 1SIOA 2H5IA 1S02A 2PKRA 1YB1A 1JYSA 2DAPA 4ND1A 1KS2A 3OPMA 4R69A 5AJWA 2F7SA 1Q84A 1KYWA 3A4TA 3EC7A 3KSUA 4I1VA 3X1XA 3L7YA 4ZDKA 1ZJ5A 2BFBB 3BRWA 3DYIA 2H2AA 1YZVA 4K0RA 2VCYA 5IW8A 3ZOKA 3RK0A 4E70A 3TD9A 2R6CA 1SWWA 1E9VA 2JVIA 3NANA 3ND6A 3TM4A 1Z8HA 3UATA 1IN5A 1DP4A 2QLLA 3IO3A 2YZ7A 3DQZA 4GHWA 4RACA 3CW8X 4Z8XA 5A5GA 5HQ3A 3QUBA 2JCXA 3K9LA 4QQKA 4KXXA 3WHIA 5J2UB 1IEXA 5JH7A 4R2IA 2YWXA 4WZAA 3GZ4A 1NKTA 2AN3A 4R7ZA 1KEKA 4E6EA 3D02A 1XF9A 1EVEA 3RVDA 1OIVA 4KGDA 3TCXB 5K8JB 4EBFA 2HK9A 4CF3A 5FBZA 1PT6A 1F5SA 3HFRA 2FY8A 2PGOA 1DAGA 4KXUA 4OATA 3S40A 5DGHA 2QTBA 5FNVB 1XD2A 2B1IA 5DTIA 4UE6A 3TLBA 4CGYA 5JARA 3BE8A 5BSHA 4OYRA 4BAZA 3ZZMA 5A5VA 2LUOA 1P4JA 4U2CA 1IONA 3AEZA 4NZNA 1J00A 1E7MA 3A9UA 4NPCA 2WM9B 5CM9C 4BB6A 1T35A 2JI6A 3U4QB 2Q2QA 5GPBA 2XVAA 3VYWA 4C4PA 3MA0A 2YJ4A 3OPYB 2DHDA 5TGTA 1OJLA 1MJFA 3VBCA 1QR2A 2Q3JA 2Y68A 1U5BB 3FETA 4RD1A 5D3ZA 2Q9UA 3VTAA 5BRAA 2APJA 3DOHA 2WC1A 2CXTA 3KKZA 4DDMA 4DT1B 1LVHA 2TSYB 3TCKA 5JQWA 3K0AA 4OU5A 4RF4A 3A28A 4I6JA 2ICAA 4U3JB 3IQHX 4INPA 3BIJA 4YP0A 1OXVA 4OJYA 1J2UA 5JOQA 4FFMA 2XMCA 3L7MA 3MMNA 4LOLA 2UZ4A 3HZZA 3IP9A 4MOWA 4P9NA 2W11A 3EK2A 3KQNA 2BT4A 1XIVA 3TTWA 3QYAA 1I3NA 3LD9A 1W85B 5DM0A 4ESOA 2N75A 2PVPA 3LY5A 2JNWA 1MX9A 1GQ2A 2RSLA 3GVIA 1WLSA 3ZHBA 2QTFA 3AFOA 4X7RA 2PVSA 4B40A 5CEEA 5KC9A 1FSGA 2JFQA 3HI4A 3RSQA 5C51B 2PUFA 4AI6A 4UJ5A 4CM5A 2ZB7A 4P98A 3CRW1 3ZZNA 2J0VA 3S81A 1P44A 3A6ZA 3IQIX 2CEAA 4LBYA 2O0HA 2WILA 4GLBA 1W5TA 3AG5A 3U3DA 3VYRB 4LV5B 3KHUA 1CU1A 2CJPA 1YDHA 2OCIA 3RSSA 4DIBA 1B3RA 3EA5A 3HU1A 3EY4A 4Q3CA 4RFSA 2HUNA 3CIFA 3I83A 3MQFA 2JARA 2VA9A 2LVBA 4K1LA 4DJEC 2XAAA 4YMVA 5IDQA 1L4YA 1CYEA 4ABTA 4KNYA 3DOEA 1AC5A 1CY1A 5AVJA 2RJ3A 1O1YA 4F45A 3THRA 5BV7A 1GKIA 1YR2A 4RMHA 1V1RB 4LK3A 1E64A 2PRIA 3WK9A 1W76A 1BKDR 2AFIE 1Z6YA 2IDKA 3LO8A 1BE0A 1SUBA 2YMQA 2B2XA 5ICMA 1VJCA 3AYZB 3H86A 3SBXA 3IXQA 2EWVA 3K0FA 5JY1A 4S04A 4UEKA 2CV2A 4P38A 2Z4RA 3KPUA 5B1EA 2DZDA 4HP8A 4N76A 1B8OA 4KBYA 2GJSA 4I99A 3L40A 3LUHA 2IS6A 3HPQA 3BGOS 3I2KA 5FO1A 1TYEB 4GG1A 4M0EA 4P3OA 4ZKEA 3BAZA 2OLKA 1VTKA 3PHLA 1ZUD1 2FCRA 4QNNA 5IWCA 3H2YA 1RXSA 1V16A 5CK4A 4P4TA 1I36A 4MVCA 2YXNA 1H94A 1Q1ZA 1TA9A 3MF4A 5EWJA 3ZJYA 3G0IA 2I65A 1XNJA 2I67A 3VOTA 1S2MA 2JKZA 4IAOA 4POAA 3ZVKA 2HAEA 2X86A 1E20A 1MA3A 3CWQA 3IA2A 4MP8A 4O4IF 4ON9A 4CODB 1KJZA 3NTRA 4P5DA 4XIIA 4E0BA 1C3JA 4INAA 5JAHA 1J8FA 5KWEA 2BEWA 3F6YA 3L6RA 3TQCA 4REMA 2WJVA 2R5NA 2GPTA 5BXYA 1TZ2A 1G8MA 1H8ED 3WGNA 3CNOA 4KQHA 4X91A 3VNAA 1EE1A 2CMHA 2FXVA 3DKKA 2V55B 3IT1A 1R5NA 3QXGA 3WL6A 3AKZA 2VSFA 5K0ZA 2WW8A 2CXHA 2ZJ1A 3AESA 2C9BA 1Y6JA 2H1OA 2GN4A 1BG6A 1GADO 1IAVA 4FKBA 4TRMA 3UV7A 1JZQA 2Z1DA 1VJ1A 3A8TA 3I6ZA 4MR7A 1QH9A 4DQKA 5BVHA 3LCCA 3D0QA 3R7SA 1LFDB 3PFBA 2PZJA 4IDQA 3PFWO 5AKXA 4BNMA 2FEWB 3V8VA 3DBRA 1LRLA 1XD9A 2CDNA 1TVKB 2PJDA 4F8EA 2IYZA 4PC6A 1RJWA 5HRCA 2QXUA 3R6GA 4IM7A 1MQSA 3R7BA 2X0FA 1KY3A 5BVGA 1W52X 4N9QA 1Z56C 1PT5A 4EK9A 1DZ3A 2X40A 4PAGA 4A23A 4EB0A 2JFWA 2FE1A 3EGDB 4HO1X 4CQLA 5DJ5A 1PGJA 1W8DA 4RIHA 4D8TA 2YH2A 4EVQA 3QMPA 3COZA 4M6WA 4HNHA 4K1XA 1T2NA 2P91A 1CS4C 4NMWA 5FTWA 2ADOA 4I5GA 3KSAC 1CUCA 5IS2A 4IJWA 3EVZA 4QWWA 4B4DA 3JQAA 5CT4A 1NOJA 4JJEA 4IJUA 1VYUA 4URUR 1OU4A 4X24A 4YECA 3RB8A 3KYDA 2WUFA 5GZ3A 4R2LA 3QVXA 3BGSA 3JAWB 2Q3MA 1UCFA 1KI6B 5CH8A 2WE7A 2E6KA 3MTBA 1Q1NA 2C9MA 1XTBA 4LXTA 3CVUA 3NC4A 2JJ2A 3SWWA 1JDZA 4RMIA 2IH2A 2BHNA 3OFNA 4KUGA 5I7RA 1UT5A 3OBBA 4MUGA 3M83A 5BYBA 2XGJA 3NYRA 3LBFA 5CYPA 5JH7F 1HKUA 3C16C 1TJPB 4AUEA 4HGZA 4MO9A 3K9QO 4C5BA 3QMVA 3BWDD 4CM9A 1LZLA 3DMHA 4DBVO 4DN6A 4JN6B 3GVPA 4EUSA 2LTAA 2OCYC 5I9TA 5C80A 1E9AA 3AVPA 2OHHA 1RZ3A 1PUIA 2HXSA 3JQ8A 4HDAA 4R2WA 2ZUVA 1R4NB 2B36A 2DKOA 2IKSA 3KOOA 3RTBA 1C1XB 1FZQA 2BHLA 1YV9A 5SYNA 5JYBA 1Y89A 5EJFA 1PG2A 1YNSA 4FHEA 4ZDWA 2G1KA 2WAXA 4BV8A 3LUJA 2J4CA 3CRMA 3PLRA 4G85A 2F48A 3DLTA 3MUOA 4LY3A 1ZJYA 4MIOA 5A3SA 4H6WA 3RU7A 3T5BA 2P8JA 2ZRQA 1DAEA 2W90A 1K6IA 1O6ZA 3A32A 3F1KA 4QL3A 3EXFB 5AVKA 3HB7A 3HNRA 4WFJA 3IEXA 4UM9D 1JKFA 3JWIA 4EMSA 1FW8A 1U0OC 1S2IA 4KXNA 5B7NA 5DXJA 1SXJB 3RRYA 2VZ8A 3UHPA 4NH4A 1E58A 1EGMB 1P72A 1Z28A 2JDID 1HDCA 2UZ3A 2XMSA 1Q1QA 2HN9A 4ODIA 4NEHB 3WL4A 3VNUA 4HWOA 1NG1A 1OR8A 2G36A 3S2YA 2R8XA 1PZFA 2VSQA 5IVDA 1P2DA 4CLDA 5IBCA 1Z4NA 3FW1A 1OX4A 1PT9A 1Y5RA 4WXMA 2DWUA 2FUG1 4ZO9A 2G6BA 2J1LA 2DE0X 2E85A 4NWIA 1EK5A 4QDJA 1J8VA 4MUNA 4JV5B 1MAVA 1KH2A 5HF8A 4XJSA 3GJRA 3ES9A 1F6DA 4F8YA 4B9EA 4D8WA 1V6CA 2GRJA 1BX1A 3WICA 4ZYWA 5HIKA 2EG9A 3CZAA 4XLZA 7ADHA 4ZZ3A 1QG0A 3W3AA 3KJNA 1TK2A 2WFLA 3EDQA 1FYFA 2PUAA 2ZZKA 1CETA 4MWTA 2AOVA 2WHYA 2MINB 1UJ2A 4QYMA 3DR5A 2C5SA 3GGOA 4RZSA 4XSVA 5HIMA 3U4HA 5F7XA 5KTKA 1NXVA 3EYWA 4GM4A 5EQDA 2IXFA 2F62A 3AV0B 4XJVA 3ZGYA 4B3SB 2WG0A 3FY4A 3H97A 3FCXA 4R2XA 4BNDA 1LXCA 5JBQA 3ZX4A 1BN6A 1NU8A 1JSLA 1WZEA 2FR1A 1UEIA 1MFZA 5LZ5A 2AZTA 3W5VA 3EFOB 3WWDA 3FGNA 4D5GA 4EY4A 4OYLA 1DKRA 3CRNA 4G5QA 3UENA 3GZTB 3EWAA 2Y1LA 2VUHB 2XDWA 1H3NA 3Q11A 3RUAA 1WDTA 4K2HA 3SF0A 1U9JA 5KCZA 4EVIA 2KLBA 1EFRA 3K1YA 3LYHA 4TWRA 1FF9A 2A0WA 4K6GA 5LJLA 1B7GO 4MWGA 4BMOB 4YLYA 2QU8A 4X8HA 5HMLA 4N5LA 2F3TA 1JLMA 1YR1A 4HFRA 3GR6A 4E08A 2O1XA 3JATB 4J91A 4C88A 3UXMA 2VDMB 3KSRA 4IZHA 2RFLA 1E1LA 3K1TA 3KXKA 3ZIAD 4BLWA 5C3MA 2NIPA 821PA 2A2ZA 3T5CA 5EWMB 3FTEA 4BLRA 4JBNA 4C0XA 5KNLA 3R0IA 2A9QA 4L22A 1QH1A 4QO8A 3LIIA 4Q4AA 3V2GA 4QJ3A 4ZYXA 1QO7A 2B94A 1BW9B 3DM5A 4B3DA 1UBMS 3WBJA 2P0YA 4MVJI 1M34E 2DHEA 1JA0A 1HDEA 1L9XA 1WTCA 3IIJA 4KIJA 4BP3A 1QPGA 3NIFB 4MJ3A 4NABA 2N1BA 4H1VA 4MUXA 3SXPA 4CMGA 4CEJB 1SVKA 1XVVA 4BX0A 1PTJA 4O4IB 1KEUA 4H4EA 4WIAA 1J99A 1DQNA 2ZKLA 3JZIA 3UJDA 5C5DA 3S1SA 4QPJC 3RYHB 3ZCRA 3A3KA 3AEKA 3S2UA 3RTCA 3RKUA 3K2IA 1J6UA 1AQJA 1TMGE 4Z0HO 3M82A 1UMBB 4G25A 2IH4A 2CNDA 4P7GA 1UWLA 3FYDA 3R5FA 4V0LA 5CNKA 1BIFA 1E3JA 2MCFA 2ECQA 3OPYI 2R6DA 4LA4A 4UM7A 3WA6A 4OXIA 1FMJA 4H4DA 4YRAA 3PLAE 4JEIA 3I12A 1L7MA 8ADHA 2UZ1B 2QUKA 4TL7A 3NAZA 3NBFA 2GCNA 3BJIC 3RYCA 1ARZA 1V95A 3ACCA 4W9MC 2KQUA 2PWYA 3DFUA 3CUUA 3G49A 3M89A 1CQIA 5JI2E 5BWCA 2BM9A 5GIPE 1WB4A 2QJTA 1L8OA 3T3NA 3JYHA 1MAUA 1A9RA 3L8HA 3OO1A 3OQIA 2QE7D 5JE8A 2EFCB 3U3JA 4NCJA 4O4HB 4OHRA 4A2WA 1MEJA 3G0HA 3BHMA 2GYWA 1RRVA 3HABA 3ROKA 4EIWA 4AQ7A 4IIDA 5ICFA 1E3WA 4M0PA 1WXEA 2J0UA 2PS1A 4JSYA 3RFXA 1AS3A 2PUTA 1H4QA 1NBOA 3N6VA 2J7PD 3FFBA 2P2YA 2WIDA 5ANRB 1E7QA 1R18A 2XUPA 5CU7A 3UBMA 1B42A 1PZGA 4OFWA 4I14A 1QB8A 5DEOA 2G5PA 2XF2A 4QIHA 3DUFB 4PNHA 2WIFA 3AFIA 4N1AA 4QLBA 2RCYA 1ZGCA 3Q9UA 4RLSA 3W34A 1SXGA 2ODTX 3RS5A 3LBIA 1VLHA 1LS1A 1U3VA 4FDLA 1JDVA 1KRHA 3GFPA 4NBKA 5M7EA 2X6QA 5E0OA 1RAGA 3WMRA 5CG2A 3QF4A 4JBHA 2C07A 3C97A 3JQGB 2GVNA 4A2QA 1XVTA 2F64A 1IVYA 1CS0A 2NZJA 3KYBA 5G0WA 3RU3A 4RUKA 4Y7CA 4XASA 1HL3A 2CDCA 3CFYA 3WKBA 3B7PA 3K2QA 4F46A 1PNRA 3CSSA 4Z53A 1Z6PA 3RAEC 1H2BA 2AFHA 2FKNA 2RGYA 5HQ3B 3I05A 3IKJA 3NBYC 5JH7B 1NXPA 2A9RA 4YXWA 1EH5A 1OXTA 4WESA 4ZRNA 4GGOA 3PT5A 4DCJA 1CUBA 1SJ9A 1NW3A 3FTPA 1JG7A 1N8NA 1OROA 3AHJA 3ITNA 3TXAA 3W6UA 2OHOA 1NP6A 1FBTA 1ZOOA 1HO3A 1XD2B 2HNBA 3FKQA 1L6IA 2QI9C 1KDPA 1FDIA 3CPSA 2A9OA 3IR7A 3M4NA 1ACLA 4EW2A 4FGLA 1OZ0A 3Q8KA 1CZKA 2YZ2A 2OFPA 2ZIUB 3GRCA 4JQSA 2RGRA 1U7ZA 2ZVPX 2KSQA 5ECWA 4KIGA 1S1MA 4UVDA 2OXIA 4YGYA 2NPFA 2HQSA 4FBMA 2QDXA 1QSGA 3ANSA 4YC7A 4DG8A 4JC0A 3IE2A 1P80A 2VVTA 3FLEA 3K0AB 2JLSA 3DEYX 3JZFA 3ZWBA 5IG2A 5C4IA 1PZNA 4QYTA 4Q1VA 3MRSA 1G1MA 2EERA 1JHDA 1TIBA 3VPGA 2QXYA 1OX6A 3CVYA 4MV9A 3V8RA 1JIJA 3C6XA 5CJPA 3RROA 2B5VA 2NXNA 3HCNA 4Y1RA 2ZTVA 4UTVA 5KTPA 2XUKA 4GMDA 3NYIA 2IT1A 4WPGA 3VPCA 1T9ZA 1GRRA 2PH7A 4EWLA 3NMUF 1MOSA 2FPGB 2ZSUA 3B2NA 3V1UA 1DL5A 2L17A 2NLOA 5FQOA 2GD1O 3AFHA 5EKSA 4LYFA 2BGMA 1H6BA 1ODSA 3ET4A 1SHKA 3GP5A 1QV9A 3I34X 3Q3VA 3D3WA 2EIHA 3OLCX 2KBEA 3SHTA 1VHDA 4OXYA 2Y66A 3C4VA 1WMDA 2WAYA 4NMMA 1UPCA 1W0JD 4C04A 3RRZA 3GLVA 4RFSB 4MDHA 4U6QA 4QPNA 4EZEA 1FTQA 4ZIRA 2ZBQA 3BZUA 2GTHA 1NW5A 2WJYA 2VAWA 4NCXA 4CMKA 5FBHA 1J33A 1FRZA 13PKA 1Q17A 2BEJA 2VBGA 1HEUA 5IHPA 4IVNA 2O2EA 4ZZ1A 3LBHA 1DAMA 3GJYA 3NIDB 3RYTC 1TD9A 1Q95A 4JB3A 3ZCVA 1T4CA 1VB3A 3PUHA 4PEVA 4C08A 3TLAA 3OQHA 1TF5A 1XZHA 1NX9A 3K9WA 2IU0A 1DXQA 4B5KA 3EC1A 4MGEA 3UMGA 5IZCA 2WTAA 4JJ6A 4PNPA 3WSTA 1YCFA 3F47A 3KKEA 1NPTO 3Q87B 2OCDA 3PUZA 3KPYA 5TPZD 1GJRA 2NTEA 2FN4A 1P2GA 2CLSA 4QOJA 2PIAA 1RACA 2J30A 1K3FA 2VDVE 1H5QA 1V16B 4MUJA 5T57A 5JBIA 2QT0A 4CV2A 5EWJB 3TW4A 4AKIA 3LC2O 4D92A 3E23A 4LC1A 4ZT4A 3ESZA 1JJAA 1XPRA 1XA3A 1C14A 4C7OA 3GJQA 1WXQA 1O6FA 2OWDA 4MXDA 3P2OA 1Y5LA 4D3ZA 1N5DA 2WKPA 1PHPA 4QOSA 2TYSB 3JZDA 2HO5A 1E8NA 2QTTA 5JMPA 4A0QA 4ZV9A 3PXCX 2BEWB 4MARA 4NFYA 3NM6B 2O8DA 3NTVA 3GJXC 3RS2A 3VR4H 2B8JA 3HFJA 1E2LA 2EKZA 2V7GA 4LGYA 3H2KA 4HRXA 3E9QA 1WU8A 2BBTA 1TAHA 4EITA 3KSMA 4PGFA 3QH4A 2Q7OE 1GQQA 4G24A 4JLVA 3FCOA 2XQIA 2XYQA 3Q7RA 4HPWA 4JELA 4RJKA 3I9OA 3AESB 3QK7A 1KRWA 4ZYUA 1EPUA 3AI3A 3W7VA 1VYTA 5JQGA 5BVHB 4MR7B 2WWWA 3BH6A 3KUXA 1JN0A 1ODKA 3EG5A 4HXYA 4Q16A 4HX9A 3VU3A 1G6KA 5L3VA 4GWKA 1ZD9A 2FPPA 4EFMA 1NXOA 4M49A 5I4CA 3DBRB 4QVKA 1KSJA 4RPCA 3IJ5A 3AVTA 2HT6A 2WU4A 4TTTS 4B3BA 3SJZA 2VSNA 1FDTA 4KXWA 2X15A 5BVGB 4WFKA 3SX0A 1IIRA 1O7JA 5KSOA 4K9QA 1DKNA 4CQLB 3ZTWA 2IYFA 1TJ4A 2QRUA 1IG3A 3EZXA 1XI2A 2XVYA 3NGLA 3O8NA 1Y98A 4M6WB 2JLZA 1E7WA 2VHWA 2G8NA 1QKJA 4G0XA 4YUYA 3RC8A 1V96A 1UKEA 3GARA 4KG7A 4PX2A 4DPLA 5KU1A 4PR0A 4E5UA 3CR3C 3KYCA 5HG0A 3DTVD 4D3XA 2IW1A 2UXDB 2GXUA 1XDWA 4JQZA 1X1TA 1I5EA 3K72B 3JQAB 1Q0TA 3GLIA 2H6EA 4QQNA 3TEMA 3D4LA 1XQYA 2C5BA 3KYDB 4I1SA 3RVOA 1WCXA 4F4DA 1XG5A 1YZGA 1EB9A 1I7NA 1NRWA 5E38A 1X14A 1X80A 2BSAA 2Q41A 1UBSB 1DS6A 3B8EA 5KSYA 2JD1A 3R7AA 1U99A 2ZGVA 1N6IA 4KJXA 2IBMA 1ODIA 2BR5A 2WQ6A 3D8RA 2OO3A 4HLNA 5DCWA 2B4YA 3EFEA 2AW3A 2Q4TA 5I5GA 3NRCA 1YOBA 4R6XA 1G5HA 3DBLA 1N6RA 5IJ9A 2JAUA 3F6BX 3DEJA 3K31A 3TJZA 3VMMA 5JDCA 5D5QA 3EF0A 2IIQA 4J0GA 4N12A 2C92A 4DV3B 2IYPA 1BH6A 1UBTS 2JLYA 5J59A 1D6MA 3MQ2A 2D7CA 2VQ3A 3A6HA 1XYVA 1K4MA 2XDQA 4KACA 4OB8A 1N6LA 1T0HB 1ZI8A 2E55A 2B99A 3JQ8B 3ELDA 5CR9A 3SEFA 4MYHA 1PF7E 3SFVA 2ZEJA 1JEAA 4R9SA 1SXJC 4GX1A 3N6XA 5AVOA 1PT8A 4WZ6A 5KTRA 3QKIA 1X86B 1QWOA 1FYDA 2P6UA 3G5AA 3L01A 4FFDA 3S2FA 2FGKA 4ED9A 4LJ6A 4FYVA 4GMXA 4BFTA 4JGIA 2VTDA 1SB8A 2HHCA 1KEVA 2BD0A 2DUNA 2ZJ3A 4FGWA 4LRXA 1N1MA 3FMFA 4Z2YA 2OTCA 2Q4BA 4X71A 5HKKD 2W6PA 4H7DA 2W22A 3AL3A 4EYKA 1ULUA 2RGCA 5HTOA 3F7OA 3NFRA 4YV0A 4ZANA 3I3OA 5HKOA 3BX1A 2ZR9A 4OAOA 4JXZA 1E2JA 4PHGA 4BZZA 4HMOA 1EAYA 4MA4A 3SS7X 5BNIA 4HPXB 4AG5A 4HI0E 2R1TA 4L51A 1EZ4A 2IXTA 3MLAA 4TMYA 5AKYA 3UPDA 4FOOA 3I09A 3TW8A 4DIMA 3CWZA 3SIXA 2GK4A 2D5LA 5DLPA 3UT5A 3C41J 5BXQC 4F3NA 4ZTZB 1FYEA 2BAGA 4LVUA 4MR9A 2NXWA 3H1PA 5LQKA 4GPAA 1FFBA 5EKTA 4D4MA 1Y9EA 2HHAA 1JAYA 1QV6A 1MEOA 2FJ0A 1C3EA 3AO0B 5ALHA 4F85A 2ZXUA 2VBFA 4C0AC 4OKSA 1W581 2WFLB 4BVBA 2VK2A 1NVTA 4KK4A 1J49A 4R1TA 1ONBA 4KV9A 4U39A 4BO9A 4DMMA 5CEJA 1Z0ZA 4MWEA 4Z4FA 4FWBA 1EBFA 3OX1A 3DMNA 1WXGA 4RKEA 2V65A 1Q44A 5IVPA 4EARA 4BNDB 1OXSC 3KBOA 3GIDA 1BGVA 3S3TA 1GZDA 1T9CA 3J7TA 1BFKA 4M87A 4D25A 3DPSA 3IV7A 1ZDMA 3IH5A 4JFRA 5AOBA 3VZSA 5J4VA 2R8YA 5JJLA 5B1IA 1DX4A 1ZSVA 2PSEA 2F3RA 4UUQA 1K08A 1N7JA 2Q8NA 4CR6A 5JHGB 1F6WA 2VOEA 4A5OA 4Q3LA 3S8MA 1A4XA 2VP4A 3QI2A 1KI3A 2P9TA 4GZLA 4UARA 1U2SA 3ESAA 1P2SA 4RX1A 3HBFA 3SZOA 4B6JA 4EJ6A 4CT4B 5BPHA 1RYYA 2XMZA 2AA3A 3PBKA 1CRQA 3W1VA 1JLRA 2D2EA 3IIKA 1YZHA 4ZOEA 1Q7GA 1LX6A 1ZXXA 3SX4A 4HQ0A 2PCLA 5ALNA