3I61A

Structure of mss116p bound to ssrna and adp-beryllium fluoride
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
509
structure length
509
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Yeast DEAD box protein Mss116p reveals two wedges that crimp RNA
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase MSS116
total genus 197
structure length 509
sequence length 509
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i61A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i61A02
5FOSA 2V1XA 1GNQA 5G53C 2V8OA 3S1AB 2CNWA 1VECA 5L3QA 1IXRC 4ILEA 2IYVA 3TE6A 4A0GA 5GVSA 1J8MF 5J4KA 2CMKA 4DRZA 3FMOB 1BYUA 4PQFA 5CDFA 2O8DA 3QXCA 4JIMA 1J90A 1CR4A 4A0FA 3RABA 1GVNB 2BCGY 1XXHA 2FG5A 3KJGA 4DCTA 4CEJB 3CUEF 2GJ9A 2XGJA 2QTVB 3C4JA 4BFYA 3TAUA 3GEIA 3WRYC 3TRFA 3AF3A 5EZ5A 4ZV4A 2D4HA 1RW4A 2WIBA 1N6RA 2A5FA 4B44A 2REXB 4X8LA 4LZZA 2AXNA 2IYRA 1UKYA 4Q4JB 2CVFA 2A9KA 2WJVA 1IY1A 5HE8A 3UMFA 2XNSA 4FCVA 5HE9A 2QAGB 3AVWA 4MRPA 1QHXA 3MJHA 3AUYA 2RGNA 2H1LA 2IEZA 2HYDA 1KY3A 3OHMA 1CP2A 5L3VA 1H8ED 4IKEA 4F92B 2QE7A 3I5YA 2R2AA 4TT3D 3MWKA 1W4CA 4C0AC 3OIYA 5KNDA 4L15A 1CJKC 1XB2A 4B73A 1DAIA 3QEOA 1ZCBA 3EW9A 4X8HA 1Q1ZA 4EJSB 4LJ9A 4CF7A 2F1IA 3GQBA 3GLGE 2ZJ8A 1G5PA 2NZJA 1J8YF 3H84A 1DO0A 1KO8A 4CIDA 3RANA 2OE2A 4B32A 4FWTA 4OJKA 4KLNA 4R2IA 3B5JA 1ESNA 4JBYA 4BFTA 4BWYA 5JCZA 1R0ZA 2GXQA 1NY5A 3SHWA 2ZRPA 3MCAA 3F0TA 3T12A 2FH5B 4LYHA 4CDGA 4LWZA 3QSYA 1IXZA 3DM9B 1FW6A 1R6BX 5J5CA 1BMFD 1YE8A 2XITA 2ZRNA 5K8UA 3PR1A 1XEXA 1NVUQ 1NY6A 2J7PD 3QE0A 5GVRA 1NSFA 5IDVA 2OBNA 4JJZA 4HI0E 4QBGB 2ZJZA 2PT7A 3IUYA 1ESMA 4NCKA 2YNMA 1UBCA 1N5JA 2QZ4A 3BH6A 1KMHA 4DB4A 1P9NA 3TR0A 3SHFA 1ZM3A 2ZUCA 5FBLB 2MSEB 2Q0HA 2ZM5A 1S0UA 5CIWA 3AKDA 4XVRA 1UKZA 3L43A 4PANA 3Q72A 5FTNA 1N6OA 2ZS7A 1HYQA 1P61B 1Z6TA 2CL0X 3LVQE 1XRJA 2ZVPX 2IX3A 3BB1A 4XH9B 3M6AA 1LFDB 2QEQA 1TPZA 5EXSA 2CLSA 1DS6A 2WAXA 3PVSA 3GLHA 3D31A 5E7JA 1TNDA 1G6OA 1EFRA 5KPJA 1XD2B 2JLVA 4BFZA 1UBGA 3GLFA 2VP9A 5HKKA 1WDTA 3DVLA 1OFIA 4D26A 1GDDA 5SZHB 2OT3B 3OEHD 2ZR0A 3X1DA 2DHRA 4US0R 5SZKB 4A2PA 2IF2A 4PHTA 1G21E 3V4RA 4RJLA 1EWQA 2BMEA 4YXWA 1IN8A 1GAJA 1IQPA 2AK3A 3K0FB 4B76A 3B78A 3DZ8A 2E87A 4DT1A 1E94E 5KNBA 1NG9A 1YZUA 4RKEA 1EK0A 3QJYA 2CL6X 3HP1A 3K09C 1VYVA 2VP5A 3GLIA 5JJLA 4TL7A 3SZRA 5CYOA 3FB4A 3GJXC 2KI5A 2AKYA 3PENA 5EQTA 3FHOA 4W5HA 3UATA 3HYTA 4B48A 1UBEA 1W0JA 1ZJ6A 4PQYA 5AR1A 1H65A 2RGBA 4D25A 4QC2A 4LPKA 2F7SA 4NMMA 4RFSB 1E6CA 5LPNA 3WHKA 1SGWA 1N6HA 3NTUA 2RCNA 4U7DA 3U3KA 1ZMXA 2A78A 2ZROA 5DH9A 3G82C 3MWYW 3EPLA 4DEYA 1VYUA 4G5OA 3QKSA 3MLEA 4Q01A 3E2IA 4URXR 2F1RA 1XMJA 4WW0A 1E9BA 4C30A 4GBMA 1CS4C 1Z28A 4XJXA 2REOA 4EAQA 3SJBA 1JECA 4YMWA 3HU3A 3VHXA 4MQBA 1OLOA 2L0XA 2QENA 3HPQA 2GXUA 4G0NA 3ADDA 2KWIA 4A9AA 4IXMA 1KI2A 3CX8A 4X8OA 3EZ9A 4HYYA 1ZM2A 2WKQA 2QE7D 3BJIC 4JT4A 2C95A 1DE0A 5F2EA 4YDHB 2B7CA 3F5FA 3CW2A 2J0QA 4CW7A 3MRSA 2ZE6A 4I1VA 4K8OA 4P33A 5EJEA 1YR8A 4HUTA 1DVRA 2RGNC 5KPDA 3C16C 1EFUA 3I5XA 4WOPA 5EE0A 4OI2A 1TMKA 3OEHA 4PAMA 2BJWA 1E69A 3Q3JB 2ZRCA 4PSAA 1DARA 1M34E 2WWHA 1FNMA 2LWIA 1I4DD 4WXPA 1P2UA 2GAOA 1G41A 4OI1A 1RRCA 1HURA 2EFDB 2JDIA 3FHTA 1ZNZA 3FTQA 3K70C 4PQRA 1NN3A 5FTMA 1N5IA 4R98A 5HTKA 4A92A 2GVZC 4WXRA 1W2HA 2FPLA 2XXAA 3K8YA 1GTVA 4Q4AA 2OFXA 4F4CA 2WM9B 4ERNA 5AJZA 1G3QA 1FMLA 1XCGB 4FWIB 4IEEA 4DLTA 5J47A 1FOEB 1YVDA 4LY6A 4TMWA 5KU1A 3KB2A 4KYIB 2RGEA 5BYJA 3ZYCA 4JVMA 3NKVA 3OIWA 5DO9A 1RIFA 5JECA 1QHGA 1VIAA 2OV2A 4C2UA 2CJWA 4EFLA 4GL2A 5IK2A 3SR0A 1HEIA 1F2TA 1KI3A 3QY0A 3ZVLA 1QVRA 3P4YA 1G19A 3T61A 2PBRA 4ZI2A 2WVJA 3G5UA 4E09A 1IN4A 4DDVA 4Q4AB 2W6ID 2H16A 3MFYA 2R6AA 5A4JA 4XOIA 5FUVA 5LD2C 2DCUA 4TQUS 2BCJQ 1GFIA 3H4MA 1Z0DA 3K0EA 1YQTA 1WF3A 1GWNA 1XZQA 3T1OA 3VR2A 2J87A 3KFXA 2W83A 3BB4A 4N0DA 3SQWA 3LW7A 2RKOA 1E0SA 1KSHA 4BFSA 4URYR 3KB1A 3TVTA 1KI7A 1NBME 2GZAA 1NN1A 3V00A 2HXYA 3DMDA 1OE0A 2W58A 1XNJA 5DI3A 2VSFA 3KKOA 4DUGD 2Q6TA 3CWQA 1JXOA 2FSFA 4YLGA 3L0SA 2XAUA 3B8HA 4N0EA 1XEWX 3KDSE 3P26A 4JLJA 3Q7PA 1QZXA 4M9SA 3P4XA 5G3ZA 4XWKA 1T8UA 1E79A 5BW8A 1DAMA 2VQSA 4V0NA 2QBYB 3IEVA 1XTQA 1W2GA 1FL9A 2PL3A 5HPYB 5EP2A 2WOOA 1HQCA 4K46A 4IHQA 1W48A 3GLHB 4RKFA 1L4UA 3UG7A 4B3GA 1NMZA 4MRRA 1DAFA 4BZXA 3LX5A 5TVKA 2D62A 4D81A 3RC8A 1OW3B 3VNUA 1WB9A 5D3MB 4BLOA 4O2RA 5AWFC 1JB1A 3AB3A 4GI7A 1Z5ZA 2HT1A 2WWXA 4LGMA 2W2TA 2BMDA 2NO9A 5B2ZA 3T34A 4DKXA 1CLUA 4JSYA 3T15A 2G3YA 1CXZA 5AJVB 5E7IA 1N6KA 3I72A 4E03A 1FP7A 2CCGA 4C0LA 3FHCB 1OH7A 2R44A 3QXHA 3U4QA 1Q0UA 2ZRAA 2ZS8A 3HJNA 1DAGA 3A1WA 1D9XA 3BGWA 3QKRA 4ZIRB 2QBYA 2ZRKA 2FEOA 3Q9LA 4I81A 2VPPA 4HAUA 2HCJB 3WHLA 1COWD 3Q7QA 2EWVA 4HLDA 4OYHA 1AM4D 4PPQA 2OAP1 1G4AE 2F1JA 3BXZA 4MRVA 4LC0A 4R7ZA 4RFSA 4QG7A 4P4SB 4F4IA 621PA 4IFEA 4V03A 5CJ2A 3AH8A 4OI4A 5FR1A 4TTPA 1GL6A 4M53A 4TMTA 4UKDA 1VYTA 5IT5A 4C9BA 4LBWA 3VR3A 1EFRD 2VLIA 1ETUA 1AS3A 5F9FA 1F2UA 2F9MA 1OV4A 2OEPA 1OHHA 2GJAA 4RD6A 1FNNA 3X1ZA 4R71A 4D80A 2W0MA 2IC5A 3QPUA 4LUCA 1TQ6A 2IYYA 2QPOA 2H57A 3AP1A 3KTAA 1HTWA 821PA 5EE3A 3U44B 1AZSC 2CDNA 3BFVA 3MJRA 4LV6A 1IOZA 1LV7A 3OE7D 1W36C 2GK7A 4LHXA 3NWJA 2P67A 3RHFA 4D4MA 1DTSA 2V3CC 4C7OB 3PUWA 2O0KA 4R2HA 2GESA 2XNDD 1XDBA 3SN6A 1T0JB 1GRNA 5EP4A 3UWKA 4Q4HA 2QM8A 3LW8A 4W5JA 2IK8A 2QP9X 3GLGB 3K9HA 2VF8A 4RCYA 2FPMA 3QKUA 4WIAA 3M0EA 1GIAA 4IW3B 2GCOA 1EWRA 2KE5A 4LJAA 2MMGA 1Q3HA 2QMUA 4LHYA 3CNLA 2ZJ2A 2YV5A 3QQ5A 1NMXA 2GJ8A 3RS4A 1KKLA 4G1UC 1J7KA 2WJIA 2KSQA 2W2XA 5HZHA 5CLLA 4LV5B 5JCPA 2R65A 3KFVA 2NG1A 3W5JA 4HZUA 4KFUA 2HLDA 1GKUB 1RJ9B 2F1HA 3EC1A 2MMCA 1NIPA 4Q1EA 3GLGA 3ADKA 1KK1A 3LBHA 4XTRA 2GHIA 3Q85A 2B7BA 3T35A 4CGZA 1XJQA 1QHIA 3KQLA 1W4BA 1NVXQ 4C2TA 2R6CA 3L82B 1DG1G 1NI3A 1SVLA 1HY3A 2VRWA 3WYGA 1E1QA 2OXCA 2RMKA 1YRAA 4MYTA 2HUPA 2R6GA 4A0HA 5FBVB 2Z6VA 3PJRA 4ESVA 1TUEA 4NCNA 1P62B 1VKJA 2ZRDA 2Q9AA 1JR3A 5FL7D 1XJCA 5BN3A 1M7GA 1HA3A 5KNCA 2J5XA 5DYGA 4LSGA 4WAUA 5IF9A 1L4YA 3TJZA 4B74A 1QHHA 1ZD9A 4HZUB 2ZRBA 3AVQA 2XB2A 1I2DA 2XTNA 3K0FA 2GEVA 2BKUA 4HLUC 4ZKEA 2VP2A 1WE2A 2G1KA 3QOFA 1S9DA 2NPIA 2OUKA 2FDCA 1OHHD 4D2IA 5JWOA 2ZE5A 4MITA 5FUWA 3W3ZB 5KSOA 1LW7A 4B6FA 3U7HB 1LTQA 3NEJA 3KL4A 2FN4A 3P1JA 5B58C 1IM2A 2DWOA 3SNHA 1ZD1A 4ZCLA 2YVUA 4ITRC 2NO7A 1OT3A 2JJ8A 3CM0A 3IGFA 3NXSA 4LRWA 2WPDD 1XCMA 4I1SA 2C9CA 2OZEA 2C98A 1PUJA 4V02A 3ZQ6A 2P6NA 2WWWA 4QGGA 5FPYA 4RD0A 3RDPA 4JLMA 3DDCA 4M0LA 2VF7A 2J7KA 4DSOA 3UG6A 1KSJA 1R0WA 3RYTC 3KKPA 2ORVA 2BOVA 3U7EB 1ZCAA 2QT0A 4RD2A 2NQ2C 1YZNA 1P2SA 1LF5A 5FI1B 3CZPA 4IEIA 1UADA 4Q1FA 4YMTA 2ATXA 1DAHA 4PSVA 1KK3A 4NONA 1F3OA 4JYBA 4TLEA 3MSXA 1A1VA 3EIQA 1E9AA 4H1UA 2C8VA 3PEVA 5EE1A 1XXHB 4UXHA 4CEJA 1PZNA 3QG1A 1MO6A 3EXAA 3TH5A 4A6PA 2CBZA 1SVKA 1JNYA 2G0TA 4LPSA 3W5IA 4GMDA 1ZM9A 4Q9JA 5FOVA 4Z1MA 3K0CA 3D8BA 3AF0A 4NU0A 2ZE8A 1F6BA 1NIJA 1M2OB 2QMHA 2QY9A 4D4KA 3A4LA 2KBFA 2NO0A 2EYUA 4NCHA 4TT3A 3JVVA 4KBFA 3FOZA 1RVDA 4NE2A 1T5IA 1KNXA 1X3SA 4K81B 1I2MA 1R7RA 1YZLA 1Y63A 1E9SA 2ZSBA 4OQXA 2O8EA 3ZD7A 3SJZA 4FMDB 3VKHA 3DKPA 1KI9A 4PC3A 3DOEA 4Q48A 4L4UA 2OHFA 4A8JC 2CHGA 3KKQA 3KXKA 4QKQA 1WMSA 1VMAA 3K0CC 5GJBA 1JJ7A 2GNOA 2YWEA 4AWXA 1E3MA 2BBOA 2EFHB 5AJWA 1E99A 4JBXA 4TL9A 5J4VA 2Z4RA 3M1IA 1Y3AA 1OYWA 4EJSA 5GADl 3CF0A 2BJVA 2V1UA 4DUGA 3LQQA 1G8PA 3TLXA 2P6RA 3QVVA 4JL5A 2PCJA 2Z0MA 3U3MA 1P73A 1AS2A 2AR7A 3RS0A 4IDNA 3L8YA 4C0BA 1N2CE 1YZTA 4QGHA 1NG1A 1RYHA 3H2YA 4G5GA 4KU4A 5F98A 2OO7A 4P4TA 1U0JA 1VHLA 1Z07A 4NCJA 1NLFA 2IXEA 5D3QA 1LS1A 1WQ1R 2PJZA 4RVCA 2G1JA 2IS1A 3VTKA 3NBZC 2B21A 1GG2A 2GCPA 1MABA 4M9XA 3IIMA 2NIPA 1N3BA 1ZM7A 2YHSA 2ZAMA 2DWQA 2QAJA 2ZI3A 2J1LA 1FX0A 3TR5A 5JRZA 2WJJA 5JWRA 1FMJA 3U7GA 5BN4A 5FOTA 1KMHB 2WBLC 4LYJA 2AD5A 3CX6A 4TYNA 4AC9A 1ZUHA 5HZKA 3DOFA 3ZJYA 4L16A 2Q21A 1HE1C 1RRGA 3RSOA 4Q19A 1A5TA 2GCOB 5L3SA 3U5ZB 2V4ZA 5KYKA 4LK2A 1VCIA 3PUXA 3TUJC 3AV0B 3GD7A 1N5KA 4JS0A 1DAEA 5K8IA 2IXFA 1O87A 4B71A 4BEJA 5DNYB 5FFMA 2MSDB 3VKGA 2G0NA 2C78A 2OCPA 3AF1A 3VKWA 3X2SA 3R7WA 3KZ1E 2WTUA 5DGXA 4G5SA 1A82A 1KI6B 3FFBA 1R2QA 3IBGA 3V9PA 4GFDA 2JASA 4DLYA 1T4GA 1FFHA 4DC9A 1XU4A 2CLCX 4FMCF 4W7SA 1KHTA 1W0JD 5C4MA 3A8TA 3NBXX 2ZSAA 3FMFA 2ANCA 4JL8A 4B2PA 2J0SA 1YKSA 1QF9A 1TU4A 5G40A 4PX9A 4JLAA 5B30A 1OKKD 2A7QA 5E4FA 4ARZA 5LB2A 2OFOA 1Z06A 4HUQA 3WMFA 4L5BA 1AS0A 3KQUA 3EAQA 3NDBB 1EFCA 3I8XA 4OBEA 5FBWB 4A15A 1VDZA 5E3HA 1P3JA 5J40A 4URZR 1KDOA 2K5UA 1U9IA 5FTLA 3BORA 3TAHA 1OF1A 4MRSA 2QORA 2Q3FA 3WMGA 4XD7D 5TB5A 3AVOA 1XFAA 4JLBA 4EQ6A 2GZDA 2QGZA 4ZIRA 3QUSA 4YONB 2CE2X 1CJUC 4JT2A 3BRWD 2JJ2D 3QPWA 2VTKA 4PZLA 3EIEA 1N6NA 1S8FA 5ANRB 3GJ5A 1FUKA 4CEHA 5L3RA 1VCNA 2W6JD 3IEUA 2IS4A 2OBMA 3QF4A 4TSFD 5L3QB 1UF9A 1P60A 2QMOA 1VPLA 5CK4A 1EXMA 2GCNA 3UKDA 4TMVA 3NG1A 4NPHA 3K1JA 3UMRA 3T1TA 3CLVA 2EU8A 1ZIPA 1Q1QA 3IILA 2WZQA 3PIRA 4LHVA 2W2VA 3AKYA 1E9DA 2D2FA 2GDJA 1TQ4A 4OK5A 2BBTA 4DLVA 5JEDA 4I4LA 4Q18A 1F2UB 2EWWA 3EPKA 4NZYA 3EZ7A 2O52A 3W34A 3K9NA 1MT0A 3QIAA 3KQNA 3UIEA 1CJTC 3RC3A 3AP3A 4PFSA 3U6KA 3AVVA 5C46F 2HDNB 3RWMB 4BECA 1BOFA 3QPVA 4IOKA 1F5NA 1IBRA 3W6OA 3LA6A 3U44A 5JMTA 3GEHA 5ELXA 4IDQA 1BO6A 1FPMA 4QBIA 3TW4A 4NYJR 2DFKB 3FMPB 2RHMA 2CE7A 3VNVA 3LO5A 1YZGA 4AY2A 1GL9B 2KJQA 4B2IA 2ZI5A 4M8NE 3DZDA 1CU1A 4TLDA 3W8NA 5BQ5A 4UJ5A 3SYNA 4A6XA 3KJHA 3THYB 3EPHA 1P72A 4I1UA 4JMPA 2FNAA 5FPTA 3RS2A 2NZ8A 2P65A 3CNOA 4NTZA 1X1RA 1OPXA 2MSCB 3VHLB 4EFNA 3FGNA 2IWRA 5FUYA 4F4JA 1U2RA 5KSPA 2R62A 2X2EA 1E9RA 3HYRA 3OIVA 4DHEA 3SFVA 5H1YA 1EFTA 1DO2A 1E2NA 2VHUA 3FMIA 3MWLA 5K8TA 1E2PA 4DBLC 3IHLA 1XD8A 3NC1C 2OESA 2ODEA 2JAQA 1O3YA 3CR7A 4NCIA 2D7DA 3DPUA 3BAFA 1OB2A 5G41A 2Z83A 2ZJ5A 2IL1A 2OLKA 4Q00A 4AIIA 1OH8A 3W90A 3WBJA 3GFPA 4C3ZA 4UNNA 3PEWA 3C7KA 1QRAA 2X8AA 1MRSA 1Z0AA 3AVYA 5TDHA 2IUSA 4Y0VA 4LJYA 1JR3E 1K5GA 3RWOA 5CM8B 4TMKA 1SKYB 2DR3A 3SOPA 3KQKA 5JS7A 1PLKA 4TYQA 1B0UA 1ZAKA 3SE0A 1JALA 1G5RA 1KMQA 2ZSDA 4EPXA 1Z08A 4Z51A 4YDSA 4QNRA 3THWA 4RY2A 3T1QA 1OKKA 4QL3A 5FBRB 4II7A 2HYIC 2DWPA 1F48A 3B2EA 4BRUA 4Z1MD 4DLWA 1CR1A 1FX0B 1Q22A 3IKJA 4AK9A 3DKVA 1XPOA 1IY0A 1G7SA 4F91B 1SVMA 1YRBA 3CIOA 3RS5A 3C41J 4NYMR 1R10A 1TTTA 2OBLA 4E5UA 3AVTA 4P3YA 1QVAA 4NYJQ 2I3BA 1E2JA 3MWJA 2IF0A 4RCZA 5H68A 3WNBA 3NHBA 4KVAA 2XTMA 4AYXA 1QHNA 2AFIE 2JLUA 1P75A 3ZQJA 2JLQA 3QBTA 1JI0A 4EKDA 1IAQA 2FSHA 4PZZA 4EJSC 2FWRA 3FKSA 1U8ZA 4P31A 4CVNA 4TSFA 3I73A 1NMYA 3LV8A 4JKIA 1XPRA 3RVBA 2B92A 4L8GA 2GBLA 3WNCA 4DIEA 1EGAA 1H8HA 4HAVA 2YZ2A 5FTJA 1HE8B 3EZ6A 3VQTA 2C9OA 2WMNB 3C15C 1IN5A 1AJEA 1COWA 1NJGA 2W00A 3TQCA 1Q3TA 1G6HA 3O8BA 3QXJA 2WSSA 3AVPA 5HCNA 1UEIA 1VCMA 1US8B 2V9PA 3DMNA 2IBMA 1Z0KA 3EWSA 4YMSA 1P9WA 2RHDA 2EVWX 4DZZA 3QKRB 3CRVA 1OFUX 4GDFA 3Q8XB 4FI3C 5C18A 2HCBA 1TX4B 4A2QA 1CRQA 4PC6A 4C4PA 2LKCA 2XB4A 3GJ4A 3EASA 4A8JB 2WJGA 1W0KD 4N1AA 3HWSA 4B3XA 1SHZA 2JEOA 1E9EA 1OXSC 4MYUA 1TF2A 1G1MA 2VSXA 4IRUB 3SYKA 2W6IA 4RD1A 4KITB 3ECCA 1XTRA 3CZQA 3TUIC 2YOGA 4EPRA 3E1SA 2XOKA 3LVRE 4PHHA 4AYTA 2O8CA 3B9PA 2I4IA 1MO4A 4J0QA 1VIYA 2ZQ5A 4LV8B 5FOXA 3OFNA 4KCGA 1KJWA 3AVUA 4IDHA 4TL6A 1GNPA 1UKEA 2F55A 1XF9A 2D06A 2HV8A 1AA9A 1KGDA 2FEMA 1XEWY 2EQBA 4G3XA 3W9YA 1ZM4A 2FFAA 1QG4A 3P32A 3UPUA 3SEAA 2ZYVX 1G20E 4TL8A 3CNNA 4AG6A 1V43A 3REGA 4Z8XA 1KDTA 4AKHA 2GTPA 3QNUA 3BFXA 3WMEA 2C04A 3OESA 4B2LA 2GEUA 4EPVA 2GILA 1NKTA 4M1TA 2JLZA 2DPXA 2XJ4A 1OIWA 2WIAA 3L0PA 3GJ6A 1YU9A 4LX0A 4MRNA 4ASUD 2JLWA 4ABYA 4GZLA 3OAAA 1HT1E 1X86B 4HSEA 4JYCA 5M04A 1Z6XA 1II9A 1DBSA 3FVQA 2PZEA 1M7BA 2IHYA 4QOSA 4WZAE 1EX6A 5AUPB 3I61A 4IJMA 2V55B 2JJ2A 1N0UA 3BFKA 1LF0A 1VTKA 3RLFA 2HXSA 3GFTA 3THYA 2ANBA 1G16A 3VR6A 5AUQA 4QJ4A 1NBMD 1E2DA 2UKDA 2DY1A 1W1WA 1HV8A 1OXUA 4HAZA 1ZNXA 4DLUA 3GLIB 2J0UA 4EPWA 1Z6YA 3KKNA 3QVUA 4ACAA 3WY9A 2ZU0C 4C0SA 4OL0A 1KO4A 4BLQA 4B34A 3JVUA 2PEYA 3VU9A 3LD9A 4HLQB 1ZU5A 4A1FA 2ZE7A 4HB2A 3CO5A 1UM8A 3IPYA 4PZYA 1Q57A 3K0AB 1DOAA 1Z0IA 3L0IB 4MH0R 4BZQA 4B47A 3QENA 4RZXA 1KI6A 2H7VA 3EWAA 1K5DA 1U81A 1E2MA 3MG9A 3VR1A 3DHWC 3OIUA 4FXPA 4LJ6A 4BLSA 3HU1A 3TSZA 1MO3A 1C9KA 3AKCA 3QKSB 4Q02A 2BEKA 1XZPA 3D7MA 2XOKD 2ATVA 2FSGA 3N2IA 4RSGA 4PPGA 4QHYA 1E2LA 4TTRA 3B60A 1Q21A 1ZNYA 1QHYA 2QM7A 3DL0A 2AX4A 2ZETA 1II0A 3FE2A 5IRCD 4ARZB 2CK3A 1CIPA 3TKLA 1J99A 2Q9BA 3SFZA 1E2KA 4ZDKA 4XVQA 1GP2A 4DDUA 3CONA 3QEJA 4Q7MB 5AJYA 2AWOA 2WWFA 1WBDA 3CF2A 4EDHA 1Q1BA 2VHJA 4LBYA 1Z2CA 1NN0A 4M2LA 2W6JA 4Z8YA 5KOYA 2LKDA 3AEZA 4JLPA 3THXA 1NVVQ 3C5HA 1CTQA 3P27A 4QNMA 5DISB 2ZSFA 1MH1A 2EYQA 2RGAA 2BBWA 1JBKA 3ZVNA 2PMDA 2QI9C 4IOJA 1D2NA 2CLDX 1FP6A 2ZITA 2PX0A 2XSZA 1CF4A 1KTVA 4XSHA 2JLSA 1U90A 5BWMA 2NO1A 3X1XA 2QPAA 2Q3HA 4QFMA 2QP4A 5C1BA 2H18A 2VYFA 3KTAB 5FUXA 3RRMA 1HUQA 1M8PA 2BM1A 2PX3A 4IDPA 1OH5A 2XTZA 2XJ9A 4KBGA 1W36B 4PHGA 4L9SA 3IBYA 4NHOA 2YKGA 8OHMA 1KI1A 3WNDA 1U8AA 5TY0A 1RPZA 2PJRA 4AKGA 4UXIA 1YR9A 1E32A 3PV0A 4MYCA 6Q21A 3B7GA 4MYHA 2R8RA 5EE9A 3SBEA 1E79D 5A5GA 3ND8A 3BOSA 1SVSA 1YZKA 4DXAA 1G7CA 2C99A 1DADA 3CBQA 4IDOA 3SU8A 2Z4SA 4BUJA 3AKEA 1VCOA 5JJIA 3ZD6A 3S1AA 3A1VA 2P2LA 5FBQB 4U00A 2OFWA 1A2KC 3AUXA 3EARA 4KYUA 4DCUA 1IN7A 2Z5FA 4ZCIA 4QJ5A 4KAXA 4GRAA 3NIBA 1NN5A 2JLRA 4QGAA 4PHFA 3ETLA 2O8DB 4Q1CA 1GNRA 3RAPR 1RRFA 2QL6A 5F3WB 1C1YA 1KAOA 2FFHA 1YZQA 2OCYC 1KI8A 1XTKA 2CK3D 5DHAA 3J81k 5LB4A 2C77A 2CNWD 2AFHE 3CR8A 2WICA 1BS1A 1PV4A 1TQ2A 1RKBA 1WP9A 3B82A 2FGJA 4D4LA 4HDQB 1SKQA 3Q5DA 1L8QA 1X8LA 1KYIA 3GLHE 1P2VA 4JVLA 2VP4A 2RGGA 4RZ3A 4UXJA 3WRXC 2ASEA 4HAXA 1U99A 2RB4A 3GJ0A 2IUUA 2OXRA 4C0KA 4HB3A 4PPFA 2UZIR 1Z8FA 4TQAA 3KQHA 1G17A 1N6LA 1ZU4A 2FZ4A 2WWGA 2ECKA 1JQLB 2EFGA 1XPUA 4HB0A 1DEKA 4GNKA 4QBFA 4BRWA 4BEBA 3A4MA 1BYIA 3LQRA 1IHUA 2R6FA 3CPHA 2ZYTX 2HEIA 2WOJA 4LJ8A 2GF0A 1TUIA 2J0VA 4B3CA 2P6UA 1Z47A 4Q1AA 1WXQA 3X1YA 2QPTA 3GEEA 5B64A 2PZFA 4OQLA 5EXTA 4ACBA 2ZREA 4KO8A 2NPFA 4V0ME 4EIWA 3K70D 2O8BB 2ZPTX 3LNCA 2ERYA 5L8VA 1MO5A 2IT1A 1XJ0A 3TUZC 2FJUA 2IYWA 2PZGA 3C5CA 4DJTA 5TMPA 4B75A 1ELOA 2XX3A 4X8MA 2VL7A 1Q1EA 2GVDC 4OKSA 2QTHA 5AJXA 4TYWA 3N2EA 3UK6A 4PO9A 1W5SA 4DLSA 2DFTA 1NNEA 5DLQC 2O0JA 4O2LA 1K6MA 3BK7A 4ON9A 1N6PA 5H70A 1QHHB 2D7CA 3NDPA 5LBIA 4DSNA 3A37A 3T06B 4PO1A 4JL6A 1R8QA 2QGNA 3A1SA 1E9FA 3O47A 4E07A 4GMXA 2Z43A 3CPJB 3U3OA 2NMVA 4Q5IA 1YR7A 2ZUBA 4DLXA 3R8CA 2XSZD 3CRQA 4HB4A 5FR2A 3B1ZA 2ZRGA 1IJFA 3OFND 2WPDA 4NP6A 1XMIA 1OXXK 3U3RA 4RFVA 1ZRHA 3I4LA 5H8WA 1CJMA 1XD2A 4DCSA 4OI0A 5C2JB 5J4LA 3B1VA 1U0HC 1OYYA 1XTSA 1IXSB 3CB4A 1LVGA 1ZC3A 3GP8A 1RZ3A 4GOKA 1U98A 3ZZ0A 1QDEA 1CR2A 1E9CA 3D6TB 4PC2A 4W5WA 2ZI9A 1MKYA 4ASUA 1OFHA 2JGNA 4KFSA 4CT4B 4WZBE 2A5DA 3SQXA 2VP0A 2A30A 1P2TA 1ZUIA 4A4DA 3A58B 1PUIA 4B6EA 3SJCA 2Q3MA 2C03A 4EPYA 5DIFA 4EQ6B 3LH5A 5HKKD 3EIHA 2ZI7A 2G77B 3A1UA 4TTQA 3K70B 2IYQA 1KO7A 1UKVY 3LLMA 5FI0B 1G7RA 2VHCA 4MKIA 3IQWA 3OEEA 2ONJA 5KUTA 2GXAA 3PEYA 1Z6AA 2H5EA 4NBSA 4YXWD 3QF4B 5FH9A 4UNSA 2A5JA 1KY2A 2CHVA 1KIMA 3FKQA 1GUAA 1G3MA 3ZVMA 1UPTA 4LCBA 5JBQA 3NBYC 2DFLA 2OILA 2PLFA 3LXXA 2ZTSA 1S9HA 3ZVRA 2G83A 5CYPA 1I4TD 2G88A 2AWNA 2ZEJA 2ZRFA 5KO2A 2V6JA 2WJHA 3EC2A 2W0SA 5SZJA 4DB2A 1FTNA 2HT6A 3NH6A 1Z29A 2FE4A 1P9RA 2YOHA 4URUR 1GITA 1C4OA 2QROA 3DM5A 4S35A 2JATA 3PXGA 3TSWA 1G8YA 1MABB 1A2BA 2F3RA 2F43B 3U6BA 4NH0A 4ZKDA 4D0GA 1Z22A 5FOWA 1G3IA 4IOMA 3W8RA 4WVFA 1Q12A 4BQSA 2OCAA 4G5QA 2BIFA 4FN5A 1AGRA 4UNRA 2RAPA 4CEIB 2EFEB 2VEDA 2A2ZA 2ZU6A 2BKEA 4OK3A 1PLJA 4DLZA 3GMTA 3TIFA 2XNDA 3K09A 4IVRA 1JJVA 4LC1A 2ZJAA 2IS2A 2B8WA 1SXJD 5JS8A 2JIZD 3AM1A 4OQNA 4MDEA 1AGPA 2JJ1A 1KK2A 1I4LD 1T5LA 1SXJC 1XTJA 1NL3A 2R6DA 1FUUA 3LFUA 3TK1A 3X1WA 4DCNA 3PFIA 4NYIR 4MKGA 4F7WA 4LDJA 4E22A 1D2EA 2A5YB 4GP6A 2J41A 4D4JA 1AKYA 4F93B 1W46A 1ZBDA 3H1TA 4GPTA 2WWIA 3JZAA 2AN9A 1AN0A 1G18A 2BVNA 4DDWA 4IVPA 3FPAA 2D3WA 4C0HA 2O8FB 1S4QA 1V5WA 2P5TB 4GT1A 5JLJA 3AVXA 2HF8A 2IHBA 4QGFA 4Q9IA 3VMFA 4B33A 5KTYA 1DPFA 1F60A 3F8TA 5E95A 2AKAB 4F38A 1SQ5A 5EE5B 1UFQA 3CRRA 2BMJA 4PC1A 1OSNA 4QHSA 1NKSA 1T0HB 2QP3A 1GM5A 5J4HA 1E1QD 1TF5A 2B6HA 1T3SA 2QN6A 5CLQA 3K0AA 1W5TA 2WAYA 5C4GB 2KBEA 1U0LA 4M4SA 2AL7A 4HUQB 5TXGA 2YYZA 5JSZA 4MGZR 1JR3D 2RH5A 5FL7A 3BD9A 3TBKA 4POAA 1WBBA 3KXLA 1SZPA 1SHKA 5L3SB 1XEXB 5F9HA 4CRWB 4BLTA 2QRNA 4KV9A 1WA5A 4V0OA 5BYKA 5KSYA 4IXNA 3AGQA 2QT1A 2RGXA 2N42A 2VSOA 5EP1A 4A36A 1JQJC 2V6IA 1TU3A 3H0KA 5B57C 3GJ8A 3WYAA 3HU2A 1MV5A 3ZH9B 4O3MA 3R9WA 4A0RA 1QBKC 3MMPA 3OZXA 1TF7A 4DDTA 5JHGB 1FQKA 2O0HA 1Z6GA 1S2MA 4LJ7A 2CXXA 2EW1A 5LD2B 3B9QA 4JSTA 4TMZA 3TQFA 4A2WA 3DO6A 1LB1B 1JR6A 4HAWA 5JSZB 4QHTA 2DYKA 1L7VC 3KUCA 1UAAA 2IWHA 3VFDA 4XIGS 3W6NA 2IW3A 2ZR7A 4M1SA 5FTKA 5KDOA 3L0OA 3QG5A 1M7HA 2YC2C 1HT2E 1Z2AA 4Q4LA 1E1RA 1EFHA 1E2IA 4O0MA 2H17A 4XVUA 1J70A 3EA5A 4B3BA 3ZZUA 1T6NA 1Z83A 3CX7A 5GJWC 2J9RA 4Q66C 2OSBA 2FZLA 1YR6A 1JXMA 4MGYR 2BMFA 1GOTA 1PJRA 2QRZA 2WWYA 1Z63A 3BWDD 4PAQA 2E1RA 1US8A 1JPJA 1ZD8A 4TYPA 3WXMA 3B1YA 4JVSB 2WHXA 5FPKA 1II8B 1AK2A 3SJAA 3K0SA 3TVDA 5CM9C 1VG8A 4HZIA 2X77A 2N46A 4TYYA 3KJEA 1VG0B 1P7CA 2GK6A 4R9UC 4D0LB 1R4AA 3H86A 4JVNA 5CB6A 4YC7A 3BERA 4KVGA 4Q4JA 4PSKA 2ZS9A 1SVOA 1N0VC 2FX3A 2J45A 3LDAA 4US2R 1KAGA 2V7QA 1G8HA 3KUDA 3AQ4A 2C5LA 4Q7KA 4Q9HA 2ZANA 4ZCMA 4H1VA 3HR8A 5G3YA 3PUZA 4Q1BA 2GJSA 3U4QB 3RSLA 1CRPA 2GBLC 2IEYA 3K9GA 4AURA 1ZINA 4C0QC 4MKHA 5FL3A 4U02A 2QA5A 1U8YA 2GAAA 2UVQA 4B3FX 5TV2A 1R8SA 2ZI6A 2XXAB 3TMKA 2GETA 2ORIA 4TLCA 1CULC 3BC1A 3A4NA 2G6BA 4FMCB 1W7AA 3SBDA 1QG2A 3ZIAD 3TGPA 1EX7A 4KJZA 4MUAA 5GJCA 1TEVA 4XWOA 5A0FA 3GPLA 2ZRHA 2PEZA 4JLNA 4TLAA 4DIDA 4AKIA 2VIIA 2ZJYA 2J46A 4DEXA 3W3AA 2VHQA 3P20A 2RGCA 2IA5A 3REFA 4WZ6A 1S96A 3MGCA 3KXIA 4MKFA 1UDXA 2PLRA 4FD2A 5CB8A 3AF2A 2CL7X 1QHSA 2H8KA 4HEJA 1XMVA 3R8FA 1HH4A 1E1RD 3ASZA 3B1XA 1JAIA 3R9XA 3VX4A 2P5SA 3FDIA 4LBVA 4M1WA 1OJLA 3B6EA 1BMFA 3I1FA 3GJ3A 3E70C 3EZ2A 1RRPA 1RE0A 2ZJOA 3PCRB 3T5GA 5FPSA 1R0XA 1DAKA 3BBPA 1PLLA 2RGDA 4I1OA 2GA8A 2HJVA 3LX8A 4TN1A 4DSTA 4CEIA 1VG1A 4D0NA 2IYTA 1D5CA 3AF4A 4DCVA 4NKRA 3BH0A 1XXHE 3KKMA 1MRNA 2AK2A 4U5XA 2C2HA 4M9ZA 4BASA 5LDDC 2J3EA 1XD9A 1G3RA 4B35A 1KNQA 4MGKR 2J0UB 521PA 1R5NA 3FFAA 1KO1A 1KDPA 1P5ZB 2ZYWX 5GJVC 1H8EA 3I3SR 2CEAA 3L2OB 4C0JA 2X19A 4IVQA 1N6IA 2GWHA 3N70A 4KSBA 2GF9A 4UQOA 4LHZA 3NHAA 3GLFB 4D82A 2ODNA 2REBA 4LYAA 3NBFA 4RZ2A 3ZZTA 2HF9A 1DELA 4DT1B 1J2JA 4M22A 5DYIA 1NP6A 721PA 1JEDA 1TAGA 1SXJB 1X1SA 3OF5A 1A4RA 1G291 4LJ4A 3NEYA 1X6VA 5CDFE 1AQYA 1E0AA 2NTYC 3RS7A 1FZQA 4URWR 2Y8EA 4CZ2A 2BDTA 5IK2D 4CT5A 5E7MA 4OHYA 1Q20A 3KX2A 1MR3F 3BE4A 1H8HD 3VAAA 1UDWA 4QM7A 1OIXA 1XX6A 4FMDF 4GZMA 4M21A 3JZMA 4KFTA 4RD3A 4Q9LA 4OJQA 3THXB 4FCTA 2I1QA 4XD7A 3B1WA 1XBTA 4A82A 2PMKA 3BS4A 3R9IA 5EXXA 4JLVA 3U61B 4JLOA 1G8FA 1VG9B 4EUNA 1M6NA 3F3YA 5SZIA 2AHOA 2AD1A 4UNQA 3RRNA 2FU5C 2JIZA 1GKIA 2BWJA 3BIFA 3E5HA 5DI3B 5JFGA 3ZDQA 1GRQA 1KJZA 2FFBA 3NVAA 4DLRA 5FOUA 1OXVA 2ZAOA 1T8TA 1E2FA 3FWYA 3QI2A 1W0KA 4G5RA 1LS6A 5DSZA 1FQJA 1Q44A 1R5OA 3LY5A 4HLCA 5FPHA 3SS8A 1R0YA 2D2EA 1P6XA 4OHWA 4BZPA 1G4UR 2YWFA 4PTLA 5CIQA 4AI6A 2DBYA 1E98A 1EG7A 1RYFA 2O5VA 1XCPA 3O8DA 5K8LA 4HDCA 1W44A 2BBSA 1E2EA 2FV8A 2QQ0A 1T91A 1JPNA 2ZSEA 4ZO4A 2GZHA 5DI9A 5JEEA 3IO5A 4ESHA 3PQCA 1G7TA 3CKLA 1AZTA 3UANA 1X8JA 1XTIA 2JCSA 1XEFA 5D3MA 4DSUA 2D74A 4A8JA 4BFUA 2QAGC 4IOLA 5JHHB 4MUBA 1ONBA 1GSIA 4IFBA 4QXAA 5EZ6B 3I32A 4OHZA 4ZPXA 4M1MA 5IHPA 1DG3A 1U9IC 3LLUA 3V4FA 3VR5A 1CEEA 4KXFB 2YOFA 2FOLA 2GXSA 5CJPA 4CYMA 1OXTA 3ZGXA 4JKYA 4C7OA 5EXPA 4JBWA 2ZRLA 1ZC4A 2N1BA 1E2HA 3M4YA 3SC3A 2KB0A 4FW9A 1G3UA 3WP0A 1KZGB 1AQUA 1ZYUA 3IPXA 3GCGA 2WKPA 4URVR 4TWZA 2I1VB 2FFQA 4V0KA 3PITA 1JAHA 1W47A 4RZUA 3LXRA 1NJFA 1NLYA 1NRJB 5KDLA 3ZS8A 1T9HA 1FTSA 2QSYA 2BV3A 2JDID 4G01B 4NYMQ 4ZDWA 2CJWB 3IO3A 1S1MA 3OAAD 4BFVA 1G9XA 2F3TA 2ONKA 1SXJE 3U3JA 3PUVA 4Q21A 1GL7A 4PR0A 4OQMA 1RJ9A 4P4UA 1TEXA 4L9WA 3THWB 1RFLA 4M9QA 3QBVA 1A7JA 2OG2A 4LJ5A 1IY2A 2GRJA 3I62A 5KSZA 1F2TB 4LHWA 2OCBA 3QXXA 3GLFE 221PA 2NOAA 3LAWA 4YMVA 4NYIQ 4Q1DA 2WJYA 1WRBA 1YHNA 2HJGA 1D2MA 2PCLA 1KK0A 1L2TA 4BE7B 3EZFA 3SI7A 4JLKA 1XMSA 3CWZA 3DEFA 4I99A 1D6JA 3GFOA 2YJTD 3GJ7A 2HLDD 2O8BA 1XP8A 1UEJA 3TW8B 2CHQA 2DFNA 5HCIA 4ZDJA 2E9SA 3MAAC 5JJKA 3L8ZA 3HDTA 2IS6A 1KDRA 3LWNA 4JJKA 4KLZA 1ZNWA 3OE7A 3R20A 3RRZA 4BGDA 1TL7C 2ZJBA 3IHWA 1E2QA 4LYFA 4HLUA 5DN6A 2QU8A 1G5TA 2VH5R 2NGRA 3A1TA 3ADCA 2P0EA 3VU9B 4PPNA 1NSTA 1NVVR 2IYXA 1LNZA 2QQEA 4LI0A 3B13B 4OQFA 2X2FA 1PVOA 1OH6A 3NC0C 2WV9A 2ZUDA 1SVIA 2FA9A 1CR0A 4TQ9A 3UMSA 5HR5A 1ZUNB 2BEJA 1S3SA 3IQXA 4OHVA 3EA0A 1SULA 4Z54A 5AUNB 1Z3IX 4JLDA 4PAOA 3EX7C 2XZPA 2OLJA 3NH9A 2C9YA 1G8GA 1XWIA 3ADBA 3FKSD 2CCKA 2WMOB 3B85A 2ZXUA 3PG5A 4BPBA 1W4AA 2CCJA 5EP3A 1SVWA 5EUQB 4Q47A 4LBZA 1BIFA 3EG5A 4BLPA 1NF3A 4Q7LA 1ZIOA 1T3HA 4EPTA 3T5DA 3THOA 4WBSA 4PXAA 3CRW1 3EPJA 4OHXA 5AUOB 1BH2A 1VHTA 4Q9KA 2QSZA 1HQYE 2WKRA 2A5GA 2JJ1D 3CRMA 1TQDA 1W4RA 2PH1A 4GSYA 4NL4H 3ICEA 2GKSA 4TZ0A 2BM0A 2XEXA 1UJ2A 1GKYA 2IUTA 3Q5EA 2QAGA 1SXJA 3QXSA 2O8CB 5BN5A 1ODFA 2QNRA 3IIKA 2CVHA 1JEEA 1AIPA 1II8A 3CH5A 3G0HA 2LCFA 1ZW6A 3ONWA 4BLRA 4W9MC 2ZI4A 4KFRA 1TADA 4QM6A 5JI3E 4BFXA 1OIVA 4P4SA 4MDFA 3QKTA 1UBFA 1CKEA 2ZYUX 2XZLA 4NDZA 2G9NA 5J4YA 4B3DA 3O8CA 1M1YE 4M1OA 2UZ3A 1KOFA 1S3GA 1KZ7B 2WSMA 2X1VA 1NVWQ 4RD4A 4AD8A 3HPRA 3U2QA 2O8EB 2IXGA 1IN6A 3A36A 3SYLA 3T1VA 2H92A 4D6PA 2NO6A 4FCWA 5JI2E 2FSIA 1E96A 2A3RA 4AG5A 1E0KA 3WP1B 1ZP6A 4QJ3A 5KDDA 4S2EA 4BFWA 2FPKA 2IYSA 2VHTA 3AGPA 3IIJA 2JLYA 4CEHB 2F43A 1CBUA 2QUZA 2QMEA 3ASYA 5KHOC 2GEDA 2IYZA 4LOAA 2SHKA 4XSGA 2PT5A 1KI4A 1GRRA 3QF7A 1Z0FA 5TARA 3FYHA 3N5CA 3TSOA 1KJYA 2P3SA 4KSCA 4Q4HB 4GOJA 3D3QA 3KJIA 5BXQC 2XZOA 1KSFX 2ZVQX 4XWAA 2GJKA 3U7FB 2VP6A 1OFTA 4M1KA 421PA 1Z0JA 4YQFA 1W36D 3UXMA 1ZVQA 2ZIAA 2R9VA 4B43A 1KKMA 4DVGA 3WBKA 3ZLJA 1R5BA 1E2GA 2QG6A 2VBCA 2F9LA 2ZRMA 1U94A 3C14C 3C8UA 1K8RA 1T3LA 5DE3A 3RS3A 3PEUA 3MD0A 1GZSA 2YWHA 4JZKA 3W6PA 4Q03A 2Q9CA 3RRYA 4FIDA 1D8TA 4FMBB 4ZDIA 3RNLA 2B8TA 2ODWA 2DB3A 1RC8A 4AKEA 2BHRA 5JRJA 2O8FA 3K9LA 1AKEA 3U60B 4AYWA 2OM2A 4Q7JB 4V0MA 2ODBA 3LRPA 5JZVA 3LBNA 1NBMA 5DN6D 1B23P 4GOXA 4HDOB 3LBIA 4HATA 4US1R 1CJVC 5EUMA 3HR7A 4KI0A 1KSGA 4N3NA 2ERXA 1E0JA 3A6PC 4OK6A 3CF6R 3VX3A 4WA7A 2C96A 1X8KA 1N25A 2V54A 2OAQ1 2ZRJA 1M74A 1D9ZA 1W49A 4HAYA 2VO1A 3CPEA 4MA4A 4ZI3A 5DHFA 4YMUA 1E4VA 1SKYE 1P4SA 5CITA 1IJEA 4O25A 5AK0A 4P32A 1YJ5A 3CH4B 3R7WB 1EESA 5JWHA 5UKDA 1S1CA 3GLIE 2TMKA 1NLZA 4QRHA 3O8RA 2YINC 1BKDR 1E4YA 3MUFA 3VR4A 2IYUA 4GP7A 1MOZA 3AP2A 1N0WA 3WYFA 3OEED 2YWGA 2QTFA 2EFCB 3ND9A 4PO8A 2V7QD 5P21A 4TLBA 1KO5A 2YC4C 3BH7A 4H9GA 4KODA 3SDZA 4PC7A 4EFMA 2FGKA 2BC9A 1IONA 2JA1A 2FMXA 3ZS9A 4KHZA 4DWJA 1N5LA 4P0TA 4QBHA 3ICQB 4UJ3A 4Y0AA 2ORWA 4TZ6A 121PA 1OB5A 2VA8A 5CK5A 3PUYA 4TMXA 3I8SA 3IDQA 1LY1A 2FF7A 4UNPA 4V0LA 2ZRIA 3I92A 3BB3A 2J59A 2F6RA 4FINA 4XTCS 3UWOA 2JLXA 2J7PA 4M1YA 1G64A 3K53A 2AXPA 2ZR9A 3TNFA 3ZIAA 2IYLD 1GILA 4MGIR 1ANKA 2WSSD 1WCV1
chains in the Genus database with same CATH superfamily
4IINA 1BDIA 2BM8A 2V1XA 5ALMA 6REQA 4TS3A 2MYPA 5JCJA 2CNWA 1VECA 3S1AB 5J2UB 2SECE 4KE9A 4UOZA 5JAIA 3H6KA 1ZXBA 3UWMA 3VYWA 3TDMA 2BFMA 4C78A 4DRZA 5JXHA 4MRAA 3H16A 4RKWA 2XQIA 5SV2A 4RLHA 4YUXA 3R3WA 4XGRA 5A4IS 1Y5IA 5EIEA 4A0FA 1J90A 2O8DA 3BQNB 3OEYA 2XZTA 3DEZA 1THTA 2BCGY 4BZWA 4S05A 3KJGA 4CEJB 4DCTA 1ZEMA 3C3AA 3CUEF 3DMYA 3GEIA 2ECQA 3WRYC 2X0IA 2X3UA 3IULA 1YOVB 2IQ5A 2AEEA 2REXB 2IZ7A 3QW4B 1Q3KA 2Z8XA 3H8SA 1NW9B 1Y33E 1XA4A 4D56A 4K6GA 3M9XA 2E4WA 1S02A 4JEIA 4YJKA 4RE6A 1Q11A 4CI9A 3ZWKA 1IY1A 3ZTTA 3GF4A 3OP1A 3WGGA 5IKEA 2YQ5A 3KR1A 5HE9A 2QAGB 1QF6A 4MJXA 1A69A 2O14A 4GXQA 3VZQA 3MEQA 5AQ1A 4JUFA 1L3CA 1P33A 3O2SB 3WGLA 1O97D 3AUYA 2RGNA 1A9SA 1TVMA 2QVZX 4HXFB 2OHOA 2IEZA 2ZSUA 4QOHA 3UGJA 1J42A 5L3VA 1U0NA 5DXJA 4BTEA 3I5YA 2VK8A 3RW9A 3MWKA 4C0AC 2B9EA 3LF1A 3VNAA 3VYUB 3OIYA 4OP1A 5COBA 5AW3A 1CJKC 1XB2A 3OUUA 4KGZA 2NAPA 3QEOA 4B4KA 3DEHA 5H80A 2A9RA 3LT2A 4LJ9A 3GLGE 3KPYA 2ZJ8A 5TGTA 1EFVA 2V8BA 3DV9A 3H84A 4JY7A 4UBNA 2VDQB 5KKAA 1I51A 4JI3B 1U2DA 3ME5A 4FHDA 4WKBA 4BFTA 4JBYA 5EL0A 3RRFA 2DT5A 2NXCA 1UEXC 2GXQA 3SHWA 5IJZA 4KK3A 2QI9F 1H5UA 5B37A 1PZHA 2Y0DA 3KAPA 2ZATA 4Z86A 2FOXA 1U5BA 4FYWA 2X7XA 1I13A 4A73A 5KYYB 1BMFD 1PEYA 4MUGA 5LQMA 5B53A 4QDZA 2J7PD 1E5VA 3QYFA 1JKFA 1UMDA 1TI7A 3FM9A 1V5GA 2ZJZA 4L5AA 4XJTA 3CVWA 5AI0A 3GN1A 5TQ0B 4WBNB 3FOCA 4HNSA 3AR7A 3NCHA 4B3HA 5F64A 1QO7A 2QZ4A 3K16A 1KMHA 3KQVA 3LF2A 4GEGA 4I08A 5D5PA 1P9NA 2RK4A 4AQYB 1S89A 3ZVKA 4EO4A 1XYVA 2ZUCA 2AR9A 1EDBA 2WJZB 4ITUA 4HH3C 2NXWA 1DOHA 2MSEB 3R9XB 1EEXB 4F04A 1N1DA 4QXOA 4YQZA 4E2XA 3DMHA 3SZMA 2X6QA 1K6XA 2G7MC 1ZJ4A 1HYQA 2EATA 2PSJA 2CL0X 1XTTA 4X5OA 1NVFA 1Y82A 5JCOA 3DTVB 1DCTA 2RBGA 2B5OA 3G9XA 4QYIA 1LFDB 4DLPA 1Z8DA 3CEHA 5FORA 2M6RA 3B5EA 2VR1A 1V9LA 2C57A 3V7FA 4M55A 4OLHA 2JLAA 3H3FA 3NNDA 1EFRA 5KPJA 2Q4RA 1DHTA 3FPEA 3AM4A 4Q3OA 1RQPA 4O3FA 5DULA 3SFTA 3G7UA 4BO1A 2VP9A 5HKKA 1OFIA 4HWRA 1CQIA 4M76B 4N5DA 4TMYA 1PJSA 5DOVA 5SZHB 2DHRA 1FXSA 1O6GA 5SZKB 1AUOA 5EJFA 4PHTA 2B8EA 4X6UA 1G21E 3V4RA 2F8LA 4YXWA 3IA2A 3K0FB 1QIMA 2IFTA 5HRUA 5KNBA 1NG9A 1V9CA 1ISRA 4B3SB 4EYSA 4M1ZA 2VYQA 2PWAA 3G8DA 4EA7A 3GLIA 3E22B 4TL7A 3HXKA 1YHZA 3FB4A 3GJXC 3PENA 2AKYA 2I99A 3KJQA 4LC9A 4MVXA 4W5HA 4CMIA 3HYTA 1DCMA 4B48A 1UBEA 3QWFA 1JQAA 1ZJ6A 4YCLA 3GB9A 5GTDA 4RHCA 1V3TA 2RGBA 4QC2A 4QJIA 1N7IA 1PFYA 5EC8A 2B37A 1SH7A 3EN0A 5A9RA 3OX3A 3NTUA 2C4VA 1P4RA 2DKFA 3AWDA 2VNHA 3JAWB 1ZOSA 2D54A 4ZA2A 2BR3A 1ZK4A 1T43A 2X1MA 3GPIA 1CQWA 5DH9A 3G82C 1CZOA 3MWYW 1DC7A 2H1CA 5BSGA 1KZ4A 2PMWB 2R4UA 1GYQA 4QYSA 3E2IA 4URXR 1DI0A 3E4CA 2DUNA 2WM3A 2ZTMA 3I83A 4PR3A 4UM9D 3RVLA 1CS4C 2XMSA 1MFZA 4IM7A 4AJ9A 4EAQA 3VHXA 5KB3A 1Z4IA 3HU3A 4MQBA 5FDFA 1MF7A 3K8OE 1OLOA 2CHUA 4LX8A 1NFRA 2QTAA 4MVJA 3TLGA 1NW5A 1YQ9A 3Q15C 3A3NA 3HPQA 4F5ZA 1N2JA 1RPAA 3K4HA 3J7TA 4L5CA 3UWSA 2KWIA 3ISJA 3CX8A 2NVWA 4C5AA 1JIKA 2QE7D 4E6EA 2WFZA 2V3WA 5KOIA 2C95A 1DE0A 1NQVA 4GVXA 2J3MA 3ANSA 1ISIA 3CW2A 3F5FA 1Z12A 4HS9A 4MQEB 5DLPA 1RI5A 3WIOA 4CW7A 4BNHA 2XA2A 4I1VA 4MRMA 4OXIA 3I05A 3C2QA 3T1TA 2FZWA 2QGFA 3DZFA 1ZGJA 5FRDA 3W9SA 1VBFA 4J03A 4OI2A 3HBMA 4QICA 3UHPA 4FQ7A 2V5AA 2HJWA 3ZPXA 4V1CI 5IJWA 1I1OA 2BJWA 2FLVA 2P62A 5IFLA 1BNCA 3U3DA 4YIHA 4RQUA 2ZRCA 4J4TA 5J3JA 1NURA 3MHPA 4IUCS 4MS3B 1Y48E 1ZGCA 1WZNA 1M34E 3FTNA 2LWIA 4FGUA 4WXPA 5M3BA 1TW3A 3KPVA 4BMOB 5H9WA 5IHXA 3AUTA 3E3MA 2WWVD 5LZ9A 1GZ7A 2IIPA 3CZMA 4X3OA 3DGFC 1FSZA 3HKCB 4HNHA 4K87A 3UYKA 3WB2A 5BMOA 3K70C 1WHTA 3PICA 1KAQA 1Z4KA 3DEJA 3DQPA 1DWUA 4M54A 2AG0A 2FPLA 2XXAA 4D99A 4ZU3A 3K8YA 3PFCA 4Q4AA 4XFDA 2WM9B 4EGQA 5AJZA 4ERNA 1VGQA 2QR5A 5JANA 1YCFA 4DLTA 4DN6A 1JDTA 1YVDA 2XOEA 1SCNE 4LY6A 3S5JA 1A04A 1HEYA 2YUIA 1M2HA 2P4SA 3OM1A 5BYJA 1TTHA 3ZYCA 4NMHA 4ENTA 3NKVA 1AC5A 3HCCA 4OUDB 4X60A 2DBZA 2FMHA 1F8GA 4ECAA 1VIAA 2G82A 1VB3A 3E2PA 1IVSA 2E3JA 2NO4A 4I50F 1YRQA 1M2NA 1T8RA 1U3GA 2AI2A 1KI3A 3MBIA 3OHPA 5TMEA 3SR0A 3V32A 4AJOA 3BAZA 1SXQA 5G0WA 3Q3EA 3T61A 4EATA 3QJ5A 5I9MA 1I3NA 1P4HA 2XCTB 3G5UA 4C4RA 4E09A 3A9CA 5K3FB 3K2IA 4G8JA 2W6ID 2JARA 3R44A 3WYCA 4V2IA 4RPGA 2H4FA 2GZ3A 1T2NA 4E31A 5AM3A 2XVYA 2CLLB 1EUDB 1GPMA 3Q2OA 1Y1LA 2QQGA 4FGWA 5KTNA 1BCRB 5LD2C 4TQUS 2D2VA 3MCZA 3N6RA 5EMJA 4RPCA 4UBIA 3NTXA 4B8WA 4DWVA 4F7DA 4RDXA 5KVCA 4Q82A 1CY4A 1L7DA 2ZYRA 1HZZC 1W52X 1D1SA 2PM8A 3I52A 1DKLA 1U5BB 4URHA 4WLUA 3SF8B 3T1OA 1BRTA 2W83A 2X41A 3BB4A 4P4NA 3FLEA 1DU4A 2H54A 1VE5A 3ACBA 3KSMA 4O08A 2SCUA 3TMAA 3TINA 4DJFC 5ICGA 4URYR 3KB1A 3LYHA 1KI7A 1PJLA 1RS0A 4KR6A 4LF6B 1ZIYA 2C9BA 3AR5A 3IPCA 2R6ZA 3NKFA 2HO5A 3LX6A 1JG3A 2FSFA 3EZGA 4R01A 3UC5A 3DWGA 2Y6UA 1XEWX 3DMGA 4N0EA 5CT8A 1YJAA 3INGA 3P26A 1EHIA 1EVKA 3PFHA 3FMGA 1PWZA 5ITSA 1L5QA 4UU1A 4HFMA 4L8VA 4Y2RA 1XA0A 4R2XA 1M34A 3DAGA 5E1BA 1DAMA 2VQSA 4RA6B 1Y7LA 3OETA 1I5RA 2TECE 5CA0A 2NNWB 2PZBA 5BQXA 4K46A 4WY5A 1WG8A 1W48A 1DWQA 1JIIA 2UXCB 3ZCXA 1NPDA 3GLHB 5IZCA 4HNAA 5GINE 3QA9A 4B3GA 3IR5A 3JQFC 5KQPA 1VKNA 3BVPA 2W2KA 2EX4A 1YI0A 3LWDA 5TVKA 4ND8A 4YJFB 3ZKAA 1IOVA 2DPMA 4BLOA 1JB1A 2C5GA 4OFXA 4FKBA 2IZ5A 2A6PA 3AB3A 2OP0A 3TEJA 2WWXA 3CH7A 4FZRA 5J2UA 3D02A 2NO9A 3T34A 4MW6A 5K0GA 4BVGA 2JI6A 2H29A 1B15A 1DDOA 4LZOA 5CT5A 3IVAA 4WASA 3M83A 5DGTA 4CQNA 5A3RA 5K0JA 4JI4B 2R44A 3U4QA 4B5LA 2IP2A 2ZRAA 3LHSA 3A1WA 1BFKA 3BGWA 2HDWA 1ATIA 3OFSA 3C5EA 4OXKA 2FEOA 3GLUA 2QB5A 4I81A 2X4IA 2FLWA 2HTEA 3ROFA 1PFWA 3MT9A 5FI3A 2BYTA 5HTOA 1SIUA 1JFFB 3Q7QA 4HLDA 4GWLA 4D57A 1N2SA 3IOMA 1IWBB 3HYNA 3IRVA 3OZDA 4U2EA 4IGAA 1ZUWA 3BXZA 3DOIA 1ILWA 4KI7A 1L5HB 4CMJA 2P79A 4QG7A 5SYNA 4B5KA 4V03A 5CJ2A 3AH8A 4FUTA 2IXBA 4QDUA 5FR1A 4EI9A 1I1QB 5I7RA 3I37X 3BDIA 1J0DA 2I1WA 1ENYA 1V2GA 1N9GA 2BZ1A 2X42A 3GRAA 5DCUA 3UHJA 2CFRA 4TZ0A 3WLAA 4M87A 4UZFA 3UK1A 4C9BA 4Q24A 5F9FA 4COOA 1AS3A 2JI4A 1OV4A 1V9SA 4ZVPA 4YLEA 4R71A 1RWVA 1D4ZA 2W0MA 2IC5A 3M81A 1J0XO 4D80A 4XLZA 4D9MA 5TT1A 5IKOA 4DLLA 1L6RA 1L9XA 1QUEA 2R7MA 3L1HA 4DM7A 4A6DA 4EGAA 2B99A 5B3KA 3KTAA 1HTWA 5F5NA 3U44B 2QTMA 2CDNA 3VV3A 3MJRA 4FI3F 4DMHA 1FXUA 1D2AA 5CLJA 2XA1A 4M0PA 4ZO8A 1WZ2A 4LV6A 2YRXA 3G2KA 3DHEA 2CJYA 3V9AA 4D3ZA 5I7OA 1LV7A 2J67A 4N3GA 1W36C 2ZZMA 3NWJA 3N1UA 4D4MA 2REQB 2V3CC 4C7OB 2C94A 2BL4A 1PDWA 2O0KA 3EBOA 4P80A 4X1YB 3QX7A 4G0PA 4U3JB 3T41A 1T0JB 5FUQA 4FBMA 4W5JA 2QM8A 4J94A 2QP9X 5GGYA 3IDFA 4RLQA 3PS9A 2A9OA 1ECGA 1AXRA 1FVHA 2X13A 3EDCA 5JALA 4MS1A 2IYAA 5WRFA 2GPSA 3GV0A 4LDQA 1GIAA 1E7WA 3V8MA 2Z9CA 4K03A 2MMGA 3AEUB 4EYOA 5KMGA 2AYXA 3CNLA 4LHYA 3L84A 2HH9A 2ZJ2A 1IXKA 2DZDA 3WGQA 3QMVA 2PX4A 2GJ8A 1I2ZA 1KKLA 2VAMA 3L6BA 2VQFB 3I76A 3FDJA 5FAXA 2B2CA 2WJIA 3AFNA 1WD5A 4BO7A 3VOSA 1DB3A 5DHSA 3NB0A 2QLBA 4G1VA 1DIRA 1C29B 1YFKA 1N2BA 2E6KA 4ZV9A 4ZVSA 2KS6A 4HZUA 6ADHA 3MM4A 3OX2A 1J8FA 3O0DA 1FFGA 4UOQA 1GKUB 2AGVA 2F1HA 5JAQA 3NBQA 3SBOA 3D5TA 4ALLA 2RC6A 3RTAA 2B7BA 4JDPA 1J06A 1IBSA 4KJXA 4Q3DA 3UJNA 3HVRA 3EIFA 5A4MS 2CFIA 2R6CA 2VRWA 3WYGA 3ESQA 3LUBA 4KXLA 1E1QA 3N0WA 3LCJA 2HUPA 3KT6A 4L50A 1CRLA 4FLMA 3B12A 2QTNA 2Z6VA 3ASUA 3L4EA 2R25B 3KEMA 5JATA 4KVFA 1SKUA 1P62B 3BQMB 4X66B 3LO8A 3R9KA 5C3MA 1XJCA 1ADCA 1P2DA 4HDNA 2P90A 1M7GA 1HA3A 3ESZA 3BGOS 4RVFA 2HQ1A 2Z5GA 3BRQA 2EZ8A 3L7JA 2Z8ZA 4WAUA 4DQUA 2EW8A 3SHQA 5IF9A 4B4OA 3KQLA 4HPXB 1E20A 1K7YA 1X7HA 2GF2A 2XB2A 1WW8A 2XTNA 2GEVA 4PWZA 4ZI7F 3OZUA 2WV7A 4EL0A 5H81A 4ZZIA 2OUKA 1KMMA 2V5UA 5ES3A 4D2IA 2WLTA 4NH4A 5FUWA 3TTTA 1ZI6A 3DSRA 4UCWA 3JWPA 2IBSA 3GUYA 5AMXA 3U7HB 1U9YA 3NWBA 1LTQA 2WTXA 3BGSA 4G09A 3EJWA 4KQMA 4N5IX 4XYEA 1M1YB 2QRHA 1NDHA 1QZUA 3ZWMA 3HYLA 4NABA 3T3MB 1Z6ZA 5B58C 1CUUA 1FVOA 3A32A 2DWOA 3X1MA 4ZCLA 4D9NA 2V4MA 3COZA 1JV2B 1KVSA 3K1AA 1OT3A 3R5JA 2ZUSA 3LGSA 3NXSA 4MVJF 5ALDA 4D79A 1FRNA 1TCBA 3DTVD 4YV0A 3MMNA 2C9CA 3R0JA 3K7EA 1ORWA 2ZKLA 4I1SA 1EZ4A 1WKBA 1XMPA 2OZEA 3GJZA 1BQ4A 1PS9A 2ZDQA 3IS3A 4IJQA 4ZMRA 2G28A 1TA9A 4LQ4A 4ISCA 4MWGA 3VR5D 3NHYA 1CJSA 4K5QA 3ZQ6A 4RD0A 1JJFA 4NMLA 3DDCA 4TV9A 4EW1A 4MVCA 5DNUA 3PTZA 5LCXA 1Q83A 1AV6A 2VF7A 4IJ6A 3RC2A 3REQB 5EMHA 3AT1A 4EA6A 1JGTA 2BFEB 3D3WB 2BOVA 3U7EB 3EVCA 3RVSA 1QYRA 2NQ2C 1YZNA 4WPGA 1P2SA 4X1IA 5KC9A 2VT6A 4EA9A 2V7EA 2DHCA 1QQBA 2ACWA 3CUSA 3DUFB 1UADA 1ZJZA 2GO7A 3R7SA 2JGMA 1T5BA 2EBUA 3ITNA 3L4BA 3GGPA 4NONA 1JHXA 4G26A 1JWBB 4TLEA 4YAKA 1UXGA 2Q4EA 4MV8A 3M4ZA 3PEVA 3PYLA 1NBEA 1PZNA 3HM2A 4FMPA 4R9SA 4XGKA 3ZY5A 3QW2A 1IZ0A 1UPCA 4DBVO 4EFDA 2TYSB 1QH1A 3CB2A 3GRCA 1PL0A 2EG9A 2H2IA 1IJKA 5I3ZA 4WKCA 4LPSA 1TA0A 3E3NA 3UY4A 3F4KA 3OO1A 3KLMX 2QZSA 4L9AA 4FBGA 5DNAA 2ZE8A 2G4LA 2YMLA 4C7MA 1YT5A 1AE1A 4Z0TA 1U02A 2DMRA 2NO0A 2VBGA 3BSFA 5JR3A 4NCHA 5BYBA 2ZB7A 2ZTHA 3JVVA 4KBFA 4UFNA 4N5LA 1OV6A 3C6ZA 5AJUA 2Z09A 4Z9FA 4P3PA 5JD3A 3NWEA 4NE2A 1Q92A 2RGUA 1Z68A 1NVKA 4K81B 4RGQA 3ZWYA 3RU9A 4FDTA 2ZSBA 4OQXA 3IPRA 3IC5A 4P0QB 4P81A 1PDVA 4RZSA 2C59A 3OCCA 5CBPA 1RTKA 1B0AA 4YX9A 4AY3A 1PP4A 2ZW9A 3IDAA 4L4UA 5GZ1A 3KQOA 1OBFO 2CHGA 5EJIA 1OAOA 3KKZA 3A28A 1VMAA 3K0CC 4ZV7A 3TLMA 2HIAA 3JTEA 1PNRA 5GJBA 2YWEA 1XVAA 3G0OA 3TB6A 2AOVA 1TLLA 2GCGA 2EFHB 3MQFA 3QM1A 4RMGA 1KZ6A 4E4RA 1Y3AA 2FMUA 4GPD1 1UOOA 5ARCA 4AX8A 2HGZA 3AEYA 3JD1A 1YB6A 2FZEA 3BA1A 4J4BA 1L5HA 4DTIA 4FZ3A 4ZCTA 1KQGA 2V1UA 3LQQA 3NT2A 4XUDA 4B4VA 3OTOB 1DWPA 2ACEA 3ONVA 1C7FA 3G0BA 4MDYA 4BUJA 1PVVA 4NMWA 3EVTA 2AR7A 2EXXA 4R41A 2X2OA 3SLGA 5BWOA 2R47A 4IDNA 2QRVB 3IJPA 4ZAWA 5C0OE 1OUMA 3W6ZA 3L8YA 3W2IA 1N2CE 4NJEB 3ODGA 2OD9A 3AL2A 4QGHA 3MMXA 3RVDA 2VN8A 2OO7A 4P4TA 1FFBA 5GP1A 1ZH4A 3QU4A 1XTUA 3V42A 2ZUFA 1U7PA 1NLFA 2IXEA 1LS1A 4C4XA 4DJDC 1QP8A 2PVSA 1XVIA 1TZJA 5KWVA 3I3OA 1L3IA 3E7DA 3NBZC 5FWAA 3ZW8A 3MQ2A 1RLMA 2F3PA 4I19A 1SBNE 3CMMA 5B3JC 3IIMA 1R3DA 3RFXA 3AI7A 1ZM7A 2ZAMA 2ZI3A 2DWQA 4R3NA 5JRZA 1PWEA 3OQ1A 2R79A 3UKOA 3ENVA 2NXJA 2WJJA 2XI4A 3QE4A 4EX7A 1QMPA 3ZV5A 3U7GA 3QEBZ 3PFWO 5DW0A 5FOTA 4LYJA 4DA0A 2AD5A 3P9ZA 3CX6A 5BOSA 2VT3A 1K0UA 2VHZA 4KPGA 3ZD8A 2PBLA 3ZJYA 2O3TA 1RRGA 2WU8A 3UTDA 3I6QA 5LZ2A 1IXYA 1MC4A 3K2QA 4X93A 1A5TA 1N8SA 2AVDA 3U5ZB 2V4ZA 4RACA 4DPKA 5AJTA 4LK2A 1RI1A 1VCIA 3H0CA 1CPYA 1PZXA 4IP0A 3BHNA 3VISA 5I9NA 3KCNA 4I14A 5K8IA 4G4SO 2C8JA 3EOBI 3FTPA 3GPCA 3HDQA 2R00A 3OWHA 3ZQ4A 4F97A 3PX7A 1O87A 4BVKA 1WHSA 3F7MA 2Q0XA 1QR2A 3E8MA 1DP4A 3VKGA 3KOOA 4REMA 2Q8PA 5DV9A 1SZDA 2C78A 2OCPA 3ZDEA 2HL6A 2AJDA 4DV0B 2ZUVA 3FSJX 4MZXA 4R3UC 3ZY3A 1BS9A 1T9BA 2J5BA 4G5SA 4Y1GA 1GPDG 4BMXA 3R0IA 3VDQA 2PKRA 1GGMA 3DAOA 1E1CA 3DCYA 1FRQA 1UK9A 4FGJA 3DTYA 1T4GA 3L6DA 1FFHA 3O90A 1CEQA 2OHXA 4HAOA 4UC0A 5BWCA 1H2EA 2PUCA 4R9NA 4U8GA 1D6SA 4YK7A 4DC9A 3PXUA 5BNIA 3AR3A 3L8MA 4KRYA 4EJ0A 3K5WA 3MWEB 1IIBA 3EIXA 2ZJ1A 3USES 2Z58A 5KOHB 4JLAA 1OKKD 3OF3A 5HKAA 3CFYA 3GRRA 3IMCA 1OTHA 3OURA 5HZGA 4JP3A 3D2BA 3AEKB 3CSUA 1SIBE 3GYBA 4L5BA 3ZLUA 4YRDA 3NDBB 4MWDA 3QOWA 1A9XB 1P3JA 2E4AA 4A3SA 1UKAA 3NV9A 3TAHA 2EZTA 1OF1A 2Q3FA 5A3QA 3T5CA 3ND6A 3W78A 5LIRA 3WMGA 4CTKA 1AO0A 4S24A 1H4QA 1CUFA 3ZLBA 1ZZEA 2E37A 1GCOA 4NJOA 1QRDA 3HO8A 4JLBA 2WG1A 2WUEA 5JROA 5LP6B 4II3A 5DNWA 2RAVA 2OO3A 3OLWA 5EUBA 4R7TA 3FFWA 3QPWA 4F0JA 1XMXA 1RJGA 1PTJC 3KUKA 4EHJA 5ANRB 3CX3A 3EBLA 1FUKA 4WNCA 4CEHA 7GPBA 1CUYA 3UXYA 5K0TA 2PT6A 2W6JD 4Q0MA 2ZYAA 3AUSA 4CIBA 3DDWA 3KZKA 4QU8A 4QDKA 3WK7A 3A6DA 2R3SA 2IELA 1ECPA 3V1YA 3ZU3A 4E2ZA 1I7NA 1T6BY 3RSGA 3GPBA 2GCNA 4S0XA 5EKSA 3I04A 5CMLA 4ZGWA 4JASB 1PR5A 3NG1A 1NXVA 3HXPA 4PSCA 3Q8MA 3QZUA 2EU8A 2ET6A 3AY7A 5DIZA 2JI8A 2W2VA 2B4QA 2FN7A 2QQFA 3DMTA 3NV7A 1N8NA 2B8JA 1C7QA 4DLVA 1QP0A 2YVAA 1QNFA 3CMCO 3EZ7A 4AO7A 5A9SB 2WI8A 5CHEA 3E9YA 3QIAA 4L07A 1M9NA 3AP3A 3U6KA 4K6OA 2BCEA 1BOFA 4K6FA 4IOKA 1F5NA 1IBRA 4MCHA 2H31A 3DLAA 1VJ5A 4YT8A 1JR4A 1XNRB 1JZTA 1GVHA 2CDRA 3FCYA 4J8PA 4IDQA 4PQEA 4CTNA 3KLPX 2R8PA 3CUKA 2E18A 2YJ3A 5M2QA 1AV7A 2HREA 1WOMA 2OY0A 2NVUA 1RWQA 3JVIA 1GL9B 3FMVA 2KJQA 3MIIA 3NUZA 4MB0A 4YCMA 1FPQA 3QU9A 3UK7A 1IQ0A 3ESXA 3W8NA 3BX1A 2W2LA 3EPHA 2CWDA 2Z2XA 2QJOA 2G63A 3ICPA 4JMPA 4CF6A 3RS2A 2NZ8A 2YFHA 1Y7HA 1NU6A 1ZQ1A 1K8ZB 2P65A 3OT4A 5AM4A 3RM3A 4B6JA 4FDMA 1XDWA 3WX0A 1ZSYA 2AQIA 2BF7A 4JT9A 5LUBA 3IUQA 5CVDA 3ROMA 1JDBC 3VHLB 3RK0A 2XYPA 3EIOA 3K0BA 5EQFA 3IXLA 1X7WA 3HYRA 2WB2A 3G2PA 4JUAA 4Y7CA 2GASA 1SNYA 3S27A 4J16C 4UDOA 3NHJA 2G5PA 1E2PA 1O97C 3BREA 3LGXA 4N41A 4G23A 3NDRA 4G1FA 2HU8A 4KDCA 2ZZKA 4DL9A 3CR7A 4NCIA 3U19A 3DPUA 1UIMA 5KAPA 2D7DA 5AVOA 1A76A 1QVVA 5IVHA 3KFLA 1QXSA 2ZPUA 3A2NA 2C7GA 2FFJA 1KEEA 2OLKA 1CFJA 1OH8A 1IU9A 3W90A 4U7PB 3D9QX 4CMKA 2JC3A 4XQCA 1QRAA 1KU0A 1YR3A 3IYLW 3SIXA 2VDPB 3LT0A 2YIMA 3BA6A 1FFAA 1X13A 2I03A 4WLFA 5GZ3A 4NS1A 2IUSA 3T7CA 1EQAA 1JW9B 2IJGX 1K5GA 1SWVA 2QNBA 3ORSA 3C4VA 4MDHA 3RWOA 5IUJC 4MSUA 1E9VA 2HPZA 2QIPA 1C9MA 1NYLA 1SKYB 1CVIA 2DR3A 4RK0A 1Q6YA 4YI5A 3CJRA 4ILKA 1K4YA 3EDYA 3GK3A 1B0UA 1ZAKA 2XUJA 2ZSDA 4KYVA 5IW8A 4U7JA 3PNKA 4B85A 3BXEA 5JAOA 4QNRA 2E6UX 3THWA 3JQ6A 2HIGA 4WDRA 4GU5A 1RJWA 4IIEA 5DF1A 5H9VA 4EZEA 4F46A 5FBRB 2XRZA 1TYDE 3FH0A 4WACA 3V55A 2HYIC 1GT6A 3B2EA 4IGFA 3WK5A 2FQWA 1PO7A 3FGPA 1CR1A 3FOWA 3TM4A 1NR7A 4IIDA 3IKJA 4AK9A 3LPAA 4PTYA 1G7SA 4PYMA 1SVMA 2XDYA 3AY3A 1ESZA 2H2AA 3RS5A 1KYQA 2VSNA 4V0RA 3C41J 4JP2A 3LL7A 2VQDA 4E5UA 3A4VA 3PDIA 3UAZA 4AP9A 2FG7C 4NYJQ 2YY6A 4Z53A 5GY7A 4FYIA 2MYNA 3MMSA 1LV8A 3PJGA 2XTMA 5E9JA 1Q7BA 3RYIA 4JITA 5CT4A 3A6FA 4CUKA 1P75A 2ZT7A 2NSHA 4GR5A 5EN4A 1SG6A 2HSJA 3ZQJA 2VG8A 4EW3A 2G8NA 2FSHA 3L8GA 2B25A 4J76A 4X85A 3FPGA 2OFFA 1X3LA 5B6IA 1F6WA 5MN6A 3KSZO 5LQUA 4CVNA 2O7SA 3LV8A 4JKIA 3OJWA 4WTOA 4WE3A 5JSQA 4MQFA 5HF8A 1YJBA 1PG0A 3WNCA 5IEBA 3N2GB 5JH7A 2BGWA 4YJDA 3ANLA 3IVXA 3MTJA 4ZOEA 1HE8B 3QV2A 3EZ6A 3VQTA 1XQ6A 4Y2HA 3HJRA 2G9ZA 4B8YA 1COWA 3I01A 5EHQA 2J9XB 3PWTA 3Q0EA 3I5AA 3KAQA 2VK2A 4BVEA 1UEIA 4KQCA 1NXTA 1ISPA 1VCMA 4NOLA 4UHHA 1DKMA 4H6WA 4YMSA 4HNVA 1IG0A 3HADA 1I0LA 4AIRA 3DOHA 1YB5A 3LK6A 4EECA 1K97A 4R68A 4G0MA 4DZZA 1A9TA 4DJAA 1MQ9A 2VKTA 3CRVA 3L7MA 4FI3C 2HCBA 1TX4B 4A2QA 1CRQA 4PC6A 2CUZA 2LKCA 5G4KB 1YS4A 4A8JB 5KYNA 1AB5A 1J2TA 1W0KD 1RADA 1YFJA 3LMKA 1Q7CA 4TRJA 1WXIA 4CM3A 5FWNA 5DP2A 1BE1A 2IIQA 2FWBA 1EVLA 1EFVB 1YI8A 2QUKA 3CZ5A 4RSMA 2OWDA 3AFOA 4G0XA 3FPLA 3WK6A 2VSXA 2VNIA 3SYKA 3TN7A 2O2HA 4RD1A 4MARA 3N74A 4YCDA 5LN1A 3E1SA 5EGSA 2H85A 4A8TA 2QZJA 1DZIA 2JAOA 3B9PA 3DLTA 3DA8A 5LYJA 2BH2A 3TDKA 1MO4A 3EPPA 1FUYB 1N0IA 3LZCA 2ZQ5A 4LV8B 3WGOA 2DUWA 1KPHA 3OFNA 4QOIA 4AT1A 5BV7A 2H3EA 3TBFA 1XKXA 5JYDA 5E2BA 3AVUA 4IDHA 4TL6A 3IL2A 1AD2A 1XF9A 4HN9A 2F55A 4Z4QA 2HV8A 1LA2A 5J2TF 1WXDA 1P4GA 4P82A 3L6OO 4H7FA 4BWFB 2EQBA 1CNEA 3BL8A 3W9YA 3EVGA 3DW3X 5BN1A 1QG4A 1W6UA 1WUTA 2O2DA 1G20E 2ZYVX 2A7XA 4PPYA 4QPDA 2D5BA 3SEAA 4GR9A 1H66A 2WT8A 3LQYA 5BW6B 5ENDA 1KDTA 1U3VA 2GTPA 4L72A 2VFAA 3VV2A 4EPVA 2C04A 3L8DA 4XRGA 5A9SA 1VLMA 1LFAA 1P7ZA 2Q1SA 3DTVA 4ZWNA 2JLZA 1UWKA 2DPXA 2XJ4A 4TZKA 3W5CA 1KY4A 1Q95A 5JYCA 5JDIA 4MRNA 2E4YA 4PGAA 1Z13A 5EG5A 1IHOA 2DFPA 2YIJA 3AERB 4LJKA 4PM4A 3OAAA 1NNSA 2FTKE 2YNMD 4JYCA 4JX9A 3OPQA 4B4WA 2PRKA 2FYTA 1WUYA 2Z9DA 2JRCA 1TUGA 4R1UA 4X6YA 5DRTA 5FPPA 3CCBA 4MVJP 4NK5A 3I61A 2XF2A 2V55B 4P58A 1P45A 1U2PA 4X91A 1H1LB 1XYGA 2Y1OA 4G9BA 2JBAA 4CCYA 3GFFA 4RMIA 4G37A 1YVPA 4PBSA 2ANBA 1EB9A 3IKTA 3S5UA 5AUQA 1WMDA 3FYTA 2HZBA 1E2DA 1U7OA 2XV1A 1SBIA 4DNFA 2C97A 3H18A 2A9JA 3H5LA 3VNSA 3AFIA 1OXUA 2R11A 3BHMA 4ZOAA 2ODAA 4DY4A 2LUOA 4LTNA 2XUKA 4KWTA 4WCFA 3TRIA 1OROA 3GLIB 4EPWA 1Z6YA 3KKNA 2GAFA 2I4TA 4K6HA 4OLJA 4EKEA 3L8EA 3E9QA 1ZESA 4J0JA 3VU9A 1ZU5A 4R54A 1CYEA 2ZE7A 3F74A 1BJTA 2R48A 3ZE9A 3QE3A 2Q1XA 4J0CA 4YO8A 3WAJA 1X1DA 5H82A 3ZBPA 3K0AB 4I8IA 4IQ0A 2PFSA 1CS0B 2QQ5A 1OAAA 5EOVA 4B47A 3P2MA 1N5DA 5CR9A 4DLAA 4YTEA 2BPOA 2G36A 1K5DA 2C0PA 2CGEA 1RT9A 5IC5A 3RASA 5I8ZA 4BVLA 3OI7A 3C3XA 3DHWC 4LJ6A 5EAIA 3VR1A 3TSZA 2W2NA 3WWPA 1Y4SA 3P9YA 4CM9D 1S2LA 2XMDA 1QC5A 2AQKA 2V6FA 3AKCA 3GOQA 2IV7A 5U9CA 1ZIDA 2FSGA 2JBHA 4PPGA 1E2LA 4L73A 4C7VA 5IN5A 1DV2A 1B1AA 2VPZA 3LCCA 2P6OA 1DQNA 4N6GA 4QO7A 3NCTA 2QM7A 3DL0A 5TLSA 3SC2A 1HFEL 3FE2A 4D3DA 4U39A 2O8EB 4DR7B 1NXSA 1GA4A 2XY4A 2FSUA 3AEKA 3SFZA 4GLFA 5EMNA 2H11A 1XVVA 1GP2A 4DDUA 5KYTA 5MN5A 2AHRA 1XZJA 2ZDHA 1U6JA 2J3JA 3NGMA 1Z33A 3BE6A 3QEJA 2AJBA 4LQCA 4MS4B 4AJLA 2OZVA 3GIDA 3KYCB 4UCQA 4YCBA 4EDHA 2QPLA 2XA9A 2M6KA 4LBYA 1NN0A 4Z8YA 1EQUA 4JJAA 5EQJB 3H9GA 3PDJA 3NBAA 2AZDA 3ICWA 1ZOOA 1NVVQ 5CEFA 3C5HA 1CTQA 5DISB 3BMOB 4ARAA 2EYQA 1HNNA 1QK5A 3PYXA 4JU9A 4TPKA 4G0ZA 3OA0A 4GF5A 2I87A 2PMDA 1BCSB 1I6LA 1U7DA 4IOJA 1LBSA 3AETA 2XSZA 1VL2A 3ZW9A 3W1EA 4XSHA 2JLSA 4LWOA 1HTTA 3TL2A 1Y6RA 2ZB2A 4BV8A 1ACMA 4PIVA 2NO1A 4C4AA 2ZXEA 2OKGA 3X1XA 1SXPA 4GBJA 4CL0A 9LDTA 2QP4A 3CVOA 3GHYA 3BMCA 4I1RA 2C88A 4MVJM 1HUQA 2BM1A 2EERA 2PX3A 4L85A 5E0OA 3V7NA 3HTXA 2OBBA 8GPBA 5LP6F 1QLJA 3KO8A 4L9SA 1RKQA 3V33A 3IUEA 4KKXB 1YA4A 1U8AA 4AKGA 2QD3A 1JDSA 2Q3DA 1PGJA 2WNHA 2RIPA 2DHDA 1BJKA 2RK3A 3DPSA 3H9EO 1RI2A 1UBMS 2AG6A 3PV0A 4KUEA 6Q21A 1HDYA 1Z2OX 4IF4A 2DQYA 2R8RA 1VKHA 4YR7A 2WJAA 1SVSA 4R5HA 4TV8A 1YZKA 4CR8A 2R8BA 3WLQA 4H08A 2XCSB 5IJ0A 3QLUA 1MJGA 1V96A 3TZHA 3VPFA 3DE0X 4BNWA 2BTEA 1FFXA 3G2OA 3H97A 1P7YA 1QKIA 4QUDA 3SU8A 5IZ4A 1UL1X 3NBMA 1VCOA 1AXGA 2NTNA 3WO0A 4F2GA 3CLUD 5EWMA 2CL5A 2H4XA 3KUUA 4EG5A 1JSXA 2OFWA 4AF7A 2V03A 2PG3A 1IN7A 1A98A 2YY7A 4BNJA 5ITWA 4QJ5A 3RARA 3NIBA 1JEAA 4HEA6 1NN5A 3H9QA 5KJCA 2QV7A 2QLNA 3ETLA 3ORFA 3IXMA 4Q1CA 2QL6A 1JPUA 4Y9RA 3RRBA 3T6KA 3AOEC 1C1YA 2EHJA 3J81k 2CK3D 2CDCA 2LCIA 3SHTA 4ENUA 1OWMA 2C77A 2CKDA 2XUDA 3RYFA 1ENPA 1QYCA 1Y3FE 2Q1YA 3D8UA 1PBTA 4UASA 1AKRA 1VLJA 2YVLA 3W0LB 3BMQA 2J6BA 1PWYE 2R751 1I4EB 2O3QA 2XKBA 2N47A 3PU6A 3H5WA 2DBRA 2FGJA 1U1GA 4XM1A 2VJYA 1SKQA 1NXXA 1VLHA 3K9CA 5JU6A 1YCGA 2FEXA 5DBOA 3EEYA 4UMDA 3IUJA 3HJHA 4DR5B 2I3AA 4UXJA 2WF7A 3WRXC 1B3BA 2XUIA 3HNRA 5H59A 5IN4A 4HAXA 4WVLA 4YUAA 3FDZA 1DC8A 4PYRA 2IUUA 1X1BA 1CJCA