3I61A

Structure of mss116p bound to ssrna and adp-beryllium fluoride
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
509
structure length
509
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase MSS116
publication title Structure of the Yeast DEAD box protein Mss116p reveals two wedges that crimp RNA
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 197
structure length 509
sequence length 509
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i61A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i61A02
5D3QA 1W46A 3AUYA 1E2QA 1WBBA 1ZM3A 2VHCA 1IN5A 1FUUA 1OKKA 1G8HA 1WQ1R 2EFDB 1E1QA 2OV2A 2G77B 4NYIR 3FKQA 4QJ3A 1ZD8A 5LDDC 3RWOA 2ZRJA 1EK0A 1CS4C 3DMNA 1JR3A 4JL8A 4D80A 1Q21A 2QPOA 1II8A 3I92A 4RCZA 1E2MA 3TLXA 2GAOA 2LCFA 1BKDR 2ZPTX 1SXJB 2DWQA 4US2R 1L7VC 3RS2A 3AGQA 4RFSB 3TR5A 4D2IA 3ND9A 1OE0A 1AQYA 3AUXA 4B6EA 1M2OB 3U7FB 3KJHA 3DVLA 1H65A 4JYCA 1CIPA 2IL1A 3QF7A 4Q4JB 5D3MB 1W2GA 1JEDA 1LTQA 5FI1B 3ZGXA 4DC9A 3OE7A 2IYZA 2OT3B 4TTQA 4PAMA 2HCBA 5DIFA 4KLNA 1NMZA 2Q6TA 1X6VA 1MOZA 2NO9A 4QBIA 2A5JA 1TF5A 4NCIA 1VKJA 2VP0A 3LRPA 2YYZA 4XWOA 4M1OA 4IVPA 3IO5A 4Q01A 1JALA 3WBJA 3MAAC 2OAQ1 4IKEA 4V0LA 5AJVB 4QM7A 4EJSB 1VYVA 1DO0A 1F48A 4HB4A 3AF1A 4M22A 3UWOA 4TMTA 4TYQA 3MMPA 3NG1A 2PH1A 3U7GA 4JT4A 4JJKA 4QJ4A 2WWIA 2ZAOA 4TLEA 3B9QA 2C8VA 5K8LA 2WWFA 4IOLA 3VTKA 4DUGD 1GDDA 3NBXX 2NZJA 1H8HA 1DBSA 4G5OA 1OYYA 4CF7A 1IN8A 2FGKA 4NCKA 1ZU5A 4P4SB 2EFEB 4Q7MB 3H2YA 3GQBA 4L9WA 1ESMA 4B33A 3CIOA 4QHYA 3Q8XB 3CO5A 2G6BA 2E9SA 3LXRA 1TF7A 2JJ1D 5J4VA 4A0FA 2O5VA 1TPZA 2JA1A 5EE1A 3DMDA 1P73A 4HYYA 3ZIAA 5E7JA 5L3QA 1SZPA 3THXB 1E9AA 1Q1ZA 4HATA 4TLDA 3GLGB 1DO2A 5KDDA 4HUTA 1QG2A 4W5WA 2DYKA 2W2VA 4HEJA 1XTJA 1NBMA 4LI0A 3U2QA 3W3ZB 4P4UA 4A0GA 4BLQA 4M1TA 1GZSA 3GLFB 3PR1A 3FMIA 1RZ3A 4LPSA 2OCBA 1HE1C 5JHGB 1VCOA 2V54A 3CX7A 4IDNA 5FPSA 1DAEA 5JWRA 3W5IA 2D74A 1TQ4A 2FDCA 1M7BA 2GBLA 2ZJYA 3ZZUA 3ZVRA 5J47A 4EFLA 2NGRA 1M1YE 3V4RA 1NY5A 2IEZA 4C2TA 5AUOB 3IIMA 1CXZA 2ZSFA 4XTCS 3FMOB 4QM6A 4Q4LA 3B60A 3CUEF 2CL7X 4Q4AA 5TMPA 4JSYA 1E9CA 3IPXA 1X1RA 2C9YA 2GJ8A 4LDJA 4HZUB 1A5TA 5FBRB 4B74A 4KXFB 1CR0A 4JBXA 1NI3A 2HDNB 1H8EA 3RS0A 3IGFA 2VSOA 4W5HA 2JLSA 1EWRA 2GCOB 1E6CA 4BASA 4Q1CA 1MO4A 1VG9B 2XZPA 4TYNA 1T3SA 3CRVA 2FGJA 4IOKA 4PHGA 4TL6A 4RZXA 2C95A 1AM4D 1FUKA 1WRBA 3M4YA 2HXSA 4O2LA 1P5ZB 3BD9A 2B8TA 1NIJA 4HDOB 2QTHA 3TAHA 3MWLA 3SZRA 5FBQB 2BC9A 2IA5A 1A82A 5HZKA 3L82B 3K0SA 5G41A 1ZVQA 5TY0A 2LKCA 1P60A 3DO6A 5CLLA 1VIYA 5CJ2A 3UMSA 1Z28A 5KOYA 5FUXA 2CHQA 3SJZA 3LW7A 2PEYA 3AVWA 3DPUA 1OB2A 1W0JD 1IN6A 2QA5A 3HPQA 4JVLA 2BBOA 1W7AA 1XTIA 3JVUA 3QKRA 2WWYA 4DEXA 3MRSA 2V7QA 4KVGA 1J2JA 4JVSB 2A3RA 4TYYA 3L0IB 4QBGB 5FBWB 2PJRA 1MH1A 3DM9B 1WCV1 1SKQA 3CNOA 3KQUA 1BS1A 5FUWA 1DAGA 2GTPA 3RAPR 5JS7A 3HP1A 2IC5A 3ZD6A 2WPDA 4X8OA 2ZRPA 2WKRA 2FEOA 2ZU0C 3W6OA 4TYPA 4WBSA 5F2EA 1E98A 1YRAA 2QT0A 3HJNA 1W49A 2J46A 1I2MA 3HU2A 3W8RA 1PVOA 1Z6AA 4ZCLA 1Q44A 3V9PA 1G3MA 4A2QA 3D7MA 1CRQA 1Z6GA 4DXAA 5CB8A 5SZKB 4LV6A 2YC4C 2B7CA 2HEIA 4D4KA 4TQ9A 2PL3A 1G291 4QNRA 2DWPA 2HLDA 1AS0A 4LJ4A 4BZQA 1U8ZA 4PSKA 1FNMA 5CIQA 2AFIE 1MV5A 4TZ6A 1DAKA 3LH5A 2OM2A 3QVVA 2H92A 4FMCB 1T0JB 2JCSA 4CT5A 1U94A 3A58B 5CK4A 4EAQA 4RFVA 1KI4A 2WTUA 4KFUA 1JQJC 2BM1A 2F1IA 3TE6A 2CJWB 1E9RA 2YWEA 2J7KA 1SVWA 1XXHE 4MRPA 5FPHA 1W4AA 3K70C 1HV8A 3DOFA 2XOKD 2J9RA 4TT3D 2A5FA 1ZIPA 4OQLA 4QJ5A 2A5GA 2QSZA 5TB5A 2WMNB 4QGFA 3OFND 2OLKA 2D2EA 4A4DA 3E5HA 3SDZA 4RKEA 2GEDA 2IF2A 2Q21A 2ZTSA 4CIDA 1A2KC 4C0AC 3SI7A 1D9ZA 4GZLA 4PPQA 3IPYA 1L4YA 1UEJA 4TTPA 5K8TA 2J59A 4C0KA 2UVQA 1G16A 1T8TA 4KCGA 3T1OA 3Q3JB 2GA8A 1Z2AA 1XEWX 2XTZA 1B0UA 2RMKA 1GL9B 1F5NA 2ANCA 3IO3A 1GUAA 5CK5A 4A8JA 2KJQA 3ADDA 2JASA 4EPXA 2GILA 2G9NA 3NEYA 1GL7A 2FSFA 4KFTA 4YDHB 3TVDA 3NXSA 4B3XA 1G18A 1II9A 4A1FA 4GP7A 3UMRA 1XU4A 4PC3A 1GKYA 3VKHA 3PEWA 2G1JA 2ODNA 1W1WA 2BCGY 4GL2A 2MSEB 1S1MA 2FSGA 5BQ5A 1N0WA 4QNMA 3TW8B 1F2TA 3SE0A 4I1UA 2H17A 4Q5IA 4OHYA 4FMBB 3EASA 1KHTA 4JMPA 2WSSD 1XTKA 2WWWA 4I1VA 2O8FB 1E9FA 3WMEA 1R4AA 1YR7A 3PUWA 3W90A 2ONKA 3BIFA 4U5XA 5CB6A 5JZVA 1QVAA 4GBMA 1QHHB 1UBFA 1U8YA 4Q00A 4UJ3A 3K1JA 3AGPA 1SQ5A 1CJUC 1NVWQ 2JLZA 2WWXA 1RFLA 1YZKA 3CRQA 2QQ0A 1TAGA 2IWHA 2CL0X 5JRZA 5AJZA 2IBMA 3T35A 2GEVA 2PCJA 3N2EA 4DBLC 2CE2X 1ZNWA 2Z5FA 3UG7A 4QHTA 2D06A 3TJZA 2ZYWX 4OK5A 3EZ9A 3QF4A 4DIEA 2H8KA 3G0HA 3HYRA 2BIFA 3M6AA 4B71A 4LHXA 4PO9A 3X1WA 2XZLA 1GITA 3P4XA 3EXAA 3EW9A 1G20E 1Q57A 2OBNA 4A2WA 3GJ5A 1TMKA 1ZCAA 3VHLB 4QKQA 3ZVLA 2JDIA 4ESVA 4JJZA 3RABA 1Z0IA 2HYIC 1P62B 2QRZA 4RSGA 2YVUA 4LWZA 2R6FA 3U3KA 4YC7A 5FR1A 1E0JA 1OHHA 4PQYA 2ZJBA 5BYKA 3U61B 3QKSB 3W3AA 1RYFA 3FFAA 3X1XA 2QTVB 2UZIR 1PLJA 3DM5A 2R6AA 3WNCA 3GLIE 4OI0A 121PA 4JLBA 3I73A 4D25A 4IEIA 3QXCA 1RKBA 3LNCA 5HPYB 1OXTA 4C0LA 1EFUA 3IIKA 1RYHA 1JI0A 2NPFA 4Z51A 5DHFA 3SBEA 1W36D 4AKGA 4V0MA 2DFKB 2VHTA 4AD8A 3HYTA 1X8LA 2QM8A 1UF9A 2FSHA 3A36A 4UXJA 4F4JA 4LHZA 1CJTC 821PA 3SBDA 4DT1B 1F2UA 1Z22A 2RGGA 2ANBA 3EC1A 3GLHA 4FN5A 3WMFA 3FYHA 2ZJ8A 2GDJA 1KSJA 5KNBA 4EFMA 1FW6A 3THYB 4W7SA 4ZI3A 3CR8A 5G40A 4BLPA 1BYUA 5FTLA 1CF4A 2IXGA 1IBRA 2ASEA 3BAFA 4EKDA 2A7QA 2G1KA 2W6JA 1AA9A 3EPHA 1K6MA 1RVDA 2RCNA 4AKEA 5A5GA 3K0FA 2VP6A 3WP1B 1P7CA 1KI1A 2IYRA 4Q1BA 1TUEA 4RD6A 3CLVA 2GXAA 4BEBA 1XTRA 4G5RA 5FOXA 3VX4A 3AVUA 4R7ZA 2AK2A 4M9ZA 3CPHA 3CWZA 1UBCA 3AF0A 2QEQA 4Z1MA 3KZ1E 3K0EA 2D3WA 5IK2A 2B8WA 2AWOA 1FX0B 3P27A 4MRNA 3KQNA 2F9LA 4HLCA 3RC3A 4BLRA 3R8FA 2VF7A 3P26A 4LBZA 3OEED 1JEEA 5FTKA 3LY5A 4B3DA 3KKPA 1E4YA 4MUBA 1P9NA 1COWD 1Z0KA 1G5TA 2O0JA 4XVUA 1XMJA 4QXAA 2FA9A 1Z0AA 3QQ5A 3REGA 4EFNA 1U9IA 4TL8A 2O8DA 3VMFA 2HCJB 1Z6TA 1EFRA 1Z08A 2L0XA 4BLOA 2GCPA 4BZPA 2QMOA 3N70A 4NU0A 1XPUA 4G1UC 3AVYA 4HUQA 4ZI2A 5FL7A 1R5OA 3OAAA 4H9GA 2NO6A 1YZNA 1MKYA 3B7GA 1OPXA 4LYJA 1KDRA 2VSXA 3X2SA 721PA 4FXPA 4BFZA 1RJ9B 3ZQ6A 1JJVA 2O0HA 5JJKA 1YHNA 4DRZA 1XNJA 3BB4A 2O52A 5LD2C 4MDFA 5CYPA 3VKGA 5C46F 2MSCB 4ZIRA 3ADKA 2CLSA 4H1VA 2BM0A 3EA5A 1T5LA 1G3RA 1GG2A 2JAQA 2W2TA 3PIRA 4DLYA 3CR7A 4M0LA 2NPIA 2XSZA 2ZJ5A 2FH5B 2IYUA 3DKPA 3FDIA 3KB1A 1YU9A 3N2IA 3BS4A 4R9UC 1BMFA 1QRAA 1TU3A 4HZIA 2IYYA 1UBEA 1TEXA 3UXMA 5H8WA 2GAAA 1XJ0A 1KY3A 4B3GA 1OIXA 2HJVA 2R8RA 3OEHD 2GWHA 2ZRMA 3R9XA 4GZMA 1X8JA 2IUSA 1FNNA 4URZR 4ILEA 3FHOA 2R65A 1G17A 3PUVA 4FMDF 2ZI6A 2ZSDA 1OXSC 1SVOA 1NMXA 4E5UA 4CEHB 2QMEA 1WB9A 1X3SA 3KTAB 5UKDA 4MGZR 4B3BA 2QZ4A 4V0NA 5HE9A 1EXMA 4BGDA 1OH7A 3QG1A 4DIDA 3N5CA 2AD1A 4JS0A 1S3GA 2DFNA 3AKYA 2DR3A 3U6KA 1XBTA 3S1AB 4I4LA 4A2PA 4KV9A 2QI9C 1VPLA 4LK2A 1KJZA 5FTMA 1G3QA 1KK3A 4D6PA 4KLZA 1MO6A 2IS4A 4XWKA 2QTFA 2QENA 2ZVPX 3D8BA 3HU3A 4DLZA 1Z3IX 4IXNA 2OBMA 2OSBA 4ZDWA 4QRHA 4GT1A 3AKEA 1ZU4A 4GOKA 1SXJA 1ZW6A 1OFTA 4PPGA 2EFGA 4RFSA 4KU4A 4B3CA 3Q7PA 3A1TA 1D5CA 3W9YA 2OXRA 4OQNA 4DVGA 4PZYA 4LBWA 2J7PA 4Q4JA 4LCBA 5D3MA 1MR3F 2DCUA 2TMKA 3A1VA 4MA4A 4XOIA 2JLQA 3U60B 2YHSA 3T15A 5JWHA 4XSGA 3A1WA 1U2RA 3LV8A 1QHXA 3SFZA 5BWMA 3VNVA 2QPAA 4YONB 4OK3A 3LA6A 3MG9A 3T06B 3K70D 1ZINA 3SOPA 4DZZA 2JIZA 4TYWA 2JLXA 1P6XA 3PEUA 4IFBA 5JJIA 1XEWY 1KOFA 2IS6A 3U7HB 2C9OA 1PUIA 2R6CA 3BWDD 4GRAA 2V6IA 2RHMA 3IBGA 2PBRA 4EJSA 4XTRA 1E99A 3X1YA 2ERYA 1W5TA 5GVRA 1C1YA 3SYNA 1E2JA 2FOLA 4S2EA 2ZE5A 2DWOA 2X77A 5AJWA 4F91B 1DG3A 5GVSA 5CJPA 1FFHA 2ZI7A 3QPVA 3I5YA 5E3HA 4HI0E 2QP9X 2IF0A 4EDHA 5JHHB 2CXXA 1R6BX 4P4SA 4PAQA 5G53C 2Q3FA 1W48A 3EPKA 5DYGA 5HCNA 4RD1A 4FCVA 5BXQC 4MRRA 3KDSE 2RGXA 2BEKA 1YZTA 2F9MA 1FMLA 3VR5A 2KSQA 5IF9A 1QHIA 1N6OA 3I4LA 3DEFA 2P6UA 4KO8A 3THXA 3MWYW 3WMGA 2GJKA 3GLGA 3AF3A 4U02A 1Z0JA 4B2IA 1AQUA 1XCPA 1YVDA 3B1VA 3KL4A 3ZQJA 4MGKR 2ZUCA 3GMTA 2ZUDA 2QGNA 4KAXA 1RRFA 2IYWA 3K0AB 4IOMA 4TMZA 4B32A 5KSOA 1Z83A 1G64A 2CBZA 2ZAMA 3GLFA 4JLAA 1NN0A 2A2ZA 5DN6D 1JXOA 2RGEA 4TMVA 3W6NA 5JRJA 3NBYC 4B47A 2W6IA 1G21E 2PLRA 2NO1A 1R2QA 1AZSC 2WICA 1JAIA 2FPMA 3MLEA 5EP2A 3P1JA 4FCTA 3T1VA 1JR6A 2QM7A 5FL3A 3RDPA 1JB1A 1EGAA 1OV4A 5DI3B 4CEIB 4OBEA 3C5HA 4X8LA 4B44A 4HZUA 2ZRDA 5KNCA 4HLQB 5JCZA 2X2FA 4Q7KA 3ICQB 1N0UA 4C7OB 3I1FA 3U7EB 3VR6A 4AY2A 2RKOA 4UNPA 2QE7D 4II7A 2G0NA 1XX6A 1GRRA 3F5FA 2AX4A 2J1LA 2CNWA 3KB2A 1E9DA 2GCOA 1Z0DA 4Z8XA 3UKDA 1EFHA 1I2DA 3ASYA 3QUSA 4AYTA 1KK0A 4JLOA 4I99A 2H7VA 3LLUA 2BBWA 3AB3A 3TQCA 4F4CA 3PEYA 2QAGB 4UNSA 2YJTD 3KJIA 4Q1DA 4GOJA 4S35A 1XFAA 2WWGA 4KFRA 3IIJA 4NYIQ 2GZAA 4E07A 3RRMA 1J8YF 2V9PA 5JI2E 4AG5A 1SKYE 1IAQA 3MSXA 4IXMA 2QBYB 4YMVA 1U0HC 1HYQA 3AP3A 2YC2C 5GJCA 1CEEA 3OIUA 5EXTA 4QGGA 2V3CC 2J5XA 3EAQA 4C0BA 4LBYA 2BBTA 3CM0A 3GD7A 4DB4A 3PG5A 4D4JA 2OFOA 1Z6XA 3MWKA 1SGWA 2GZDA 2N46A 1HA3A 3AKDA 4Q1FA 1MT0A 1ZCBA 5A4JA 2VLIA 4ZPXA 1EFTA 1ZM9A 4MYTA 1YR6A 1T8UA 4F38A 1M34E 1P2SA 2WV9A 1M8PA 1OFHA 3SFVA 1RW4A 2EFHB 2QQEA 4I1SA 5TXGA 1W5SA 3I62A 3K0CA 5KSZA 4OQMA 2CLCX 2NMVA 4DKXA 1OLOA 3NTUA 2P5SA 5F98A 1E79D 1KAOA 2GBLC 4ZCIA 4QL3A 1FOEB 2FFQA 1JJ7A 3HR8A 3P20A 1J7KA 4Q19A 3ZJYA 1Z5ZA 2CK3A 4M1MA 4RD3A 3R9WA 2PZGA 4ARZB 1N5IA 2JJ2A 3R7WB 3F8TA 5F9HA 1Q1QA 1QHYA 4CGZA 1OXXK 1IN4A 4MQBA 2ZIAA 4NDZA 5EJEA 2J0QA 4FWIB 4M1WA 3F3YA 3K9GA 3ADBA 3THWB 2WOJA 1N6LA 4YMTA 1QG4A 1B23P 2F7SA 1JR3E 2QNRA 1FZQA 4URVR 1G9XA 1KO8A 1VCIA 1J8MF 2CJWA 4NCNA 2OHFA 2J0UB 1SHKA 2GVZC 4FD2A 4NCHA 4HSEA 2IYSA 4PSAA 3TRFA 4E03A 1W47A 3OHMA 3ND8A 3CH4B 4TSFA 1X1SA 3WNBA 4PO1A 1KSHA 4MYHA 1UFQA 2KB0A 3QI2A 1E1RA 2V8OA 521PA 5KNDA 3FOZA 1Q20A 4A36A 1G3UA 2AK3A 2DFTA 4XH9B 3L0SA 4ZDKA 2IS1A 2ZU6A 1NN1A 1S2MA 2PX0A 3BJIC 3Q9LA 3GPLA 2O8CB 3HPRA 2BDTA 3VAAA 3L8YA 4RKFA 3RSLA 2HV8A 2BMJA 3TVTA 2H16A 3X1DA 5J4LA 3AEZA 4C0JA 1R10A 1XDBA 2RGDA 2ZI4A 5EE5B 1D6JA 1D2NA 2QT1A 4DLTA 2CDNA 2DHRA 2FG5A 3C7KA 2ZJAA 4C3ZA 1G5RA 1P2VA 1AIPA 1M7GA 3AVOA 2AN9A 1R0ZA 2V1XA 1AK2A 2OXCA 1E2LA 3RS5A 3SQWA 1E3MA 2EVWX 2FE4A 1HEIA 3VR1A 1MRSA 2C03A 3GFTA 3ZVMA 3B6EA 1XD2B 3QNUA 5CM8B 5LB4A 1ZMXA 2BMEA 2X1VA 3SN6A 4N0DA 4BFVA 1S4QA 3UG6A 2O8FA 4XJXA 1N6PA 2ODEA 2W0SA 1FP7A 4MKHA 3DOEA 3AVPA 3QENA 4XD7D 2ZRIA 1DADA 1QHHA 3A4MA 1F6BA 3BE4A 4FW9A 3AH8A 1W36B 3L0OA 1Y3AA 4NYJR 1PZNA 1WDTA 3QBTA 1KZ7B 2F43B 2OAP1 3C4JA 1G8FA 4TWZA 3LWNA 3SYKA 1R0YA 2WJGA 3MCAA 3TSWA 4HAYA 1XTQA 3UK6A 1GAJA 1OXVA 1V43A 3VR4A 3UPUA 4LV5B 1OH8A 1NVVR 2VYFA 1CR4A 5EXXA 5GJVC 1EX7A 3LD9A 2RH5A 3EZ2A 3ZLJA 6Q21A 4BRWA 4JZKA 4LV8B 4DWJA 1UDXA 1LS1A 1R0WA 4PPNA 2BBSA 4Q9IA 2XNDD 1ZRHA 5EP1A 2AL7A 2P67A 3EZFA 3AVVA 3CF0A 3SEAA 1OYWA 2ZRAA 4DSUA 4Q47A 5AUNB 2BCJQ 3QKSA 1KKMA 3VU9B 3I8SA 3LQRA 5CYOA 4IOJA 3EWSA 3ECCA 5TV2A 4OKSA 1JECA 1ZNXA 4NYJQ 1HURA 4BFXA 3LX8A 4KBFA 1HUQA 2QGZA 2NOAA 4D0NA 2R9VA 2MMGA 3RS4A 4A8JC 1CR2A 2VHJA 1W0KD 4DSNA 4BZXA 1E0AA 2RB4A 2XX3A 3LBNA 1WBDA 3O8RA 1KAGA 5HKKD 2GXUA 3WY9A 2QROA 3DKVA 4KBGA 3KUCA 1XXHB 2A30A 2ZE6A 3P32A 1KMHB 4M4SA 1QBKC 3JZMA 1VG1A 4CDGA 3T1QA 2JJ8A 2NO0A 3C16C 2AR7A 4ZKEA 3WRYC 3I5XA 3FB4A 3QXXA 4JBYA 2JLUA 4LJ6A 2ODBA 4DT1A 3CH5A 4ASUA 3MFYA 1U81A 1M6NA 1QVRA 3TUJC 1CRPA 1WP9A 2YINC 4W5JA 3RRZA 1W2HA 3P4YA 4G5QA 4NPHA 2J45A 4R2IA 1E2EA 3C5CA 4EQ6B 2EW1A 3THYA 2QU8A 1YJ5A 4FCWA 2G88A 4PQRA 1I4LD 5H68A 3FTQA 4D82A 1LFDB 4QHSA 3THOA 3J81k 3O8CA 1NRJB 4NP6A 3DDCA 2VP4A 4MKFA 4YXWA 5IT5A 5CM9C 4Q4HB 2PCLA 1CULC 1G6OA 2NG1A 3OESA 2FWRA 1YZUA 2ZS7A 4JLNA 1S96A 5FBLB 2WAYA 5FUVA 2ZRBA 1JXMA 1NKTA 4DCTA 4B2LA 1OKKD 4BQSA 4ZDJA 1E1QD 3BH7A 3QXSA 4DLUA 1LS6A 2ZI3A 2R2AA 1JR3D 4NCJA 2BWJA 4LYFA 1N25A 1FX0A 1HT1E 4OHXA 2C99A 1PLLA 1FMJA 4L15A 2BMFA 1WMSA 4YMWA 3FPAA 3NIBA 1E9EA 1IOZA 3FKSA 1TU4A 4TL7A 3SHWA 4Y0VA 4UXIA 3NKVA 3GJ8A 3OE7D 2BMDA 4HAXA 3RVBA 3PUXA 2JLWA 4BECA 4V03A 5JI3E 2I1VB 4OHWA 3CX6A 1KI8A 1M74A 2YZ2A 4B2PA 4DSTA 4BPBA 1P9WA 2NIPA 2ZE7A 5AUQA 4KVAA 2HT6A 2ATVA 2BV3A 3QJYA 1TX4B 4XVQA 2BKEA 5KTYA 3AP2A 1RJ9A 1XPOA 4BFTA 5EUQB 5JFGA 2J0SA 2PEZA 3G82C 2CHGA 4FMDB 2ZYUX 3KXKA 4Q9HA 5DHAA 4GMXA 1A4RA 1L8QA 2VHUA 3AVQA 2Q9CA 4LX0A 1U0LA 1KO5A 2CVFA 3QXJA 2BVNA 4GSYA 3RRNA 4MRVA 2ZRFA 1G19A 3IEUA 5E95A 4A0RA 3C14C 2WKPA 1OFUX 4B34A 1DAMA 3GLIB 1U99A 1H8HD 1ZM7A 3QG5A 1DVRA 4IEEA 2WKQA 4OYHA 4FIDA 2O8BB 2SHKA 4IVRA 5ELXA 2CL6X 3NDBB 3A1UA 1VYTA 3EPLA 2OO7A 4JKIA 4JVNA 4EPVA 5CITA 4CEHA 4PX9A 5JSZB 3KTAA 3UMFA 3ZIAD 1GP2A 3K70B 2WAXA 3KKQA 2Z0MA 5B2ZA 4D81A 1KI9A 3TNFA 2XB4A 1TUIA 3RNLA 4NHOA 1NSFA 3IHLA 4X8HA 3O8DA 3K9NA 1N6HA 1NN3A 5AWFC 1EFCA 3V00A 1NBMD 2VF8A 4HAZA 3A6PC 1E4VA 4MDEA 2OBLA 1CJKC 2REBA 5EE0A 2VL7A 2ERXA 1N6NA 4UNNA 2ZM5A 5K8IA 2J0VA 3IKJA 2A9KA 3S1AA 5LPNA 4A6XA 1GRQA 4RD4A 3GFPA 4PR0A 3A8TA 3T61A 3EZ6A 4B43A 2NQ2C 4JL6A 4MH0R 2YOGA 4RCYA 4DCUA 4P0TA 3KJGA 2J87A 3E1SA 4DUGA 2IHYA 2ZQ5A 4GFDA 1VHLA 3M1IA 1KO4A 1U9IC 3NBFA 4BRUA 1MABB 3ZD7A 3L8ZA 5CDFA 4GDFA 4B35A 2QAJA 1OSNA 4K8OA 4JSTA 1PJRA 1GRNA 1TF2A 4P4TA 5KDLA 3NC0C 4M1SA 4WZBE 3CPEA 2JJ1A 4RY2A 2W2XA 4QBFA 1TL7C 4TMWA 1H8ED 3BB3A 4WOPA 1NF3A 2V4ZA 2HYDA 4M8NE 4N1AA 4TSFD 1LW7A 4ZCMA 2HT1A 4OQXA 5JWOA 2ZSEA 3EWAA 1TQ6A 4P31A 4QGHA 4ACBA 1SULA 4UKDA 3ZZTA 2WIBA 5L3SB 4ON9A 2WHXA 2ZS8A 1QZXA 4JLVA 1VCNA 4ZKDA 4KJZA 4AYWA 2I1QA 2ZXUA 2VTKA 1KJWA 1PLKA 1EG7A 5L3VA 3BGWA 2JLVA 1Z29A 2IWRA 2OESA 4XIGS 2EYUA 3EZ7A 1K5GA 1IM2A 1NLZA 3MUFA 2PZEA 1G8YA 3JZAA 2BJVA 1E94E 2GJSA 3FGNA 1ESNA 1ZD1A 3LDAA 4AKHA 1OH5A 3GJ6A 2E1RA 2OE2A 1XRJA 3VQTA 4G3XA 1VIAA 5EXSA 1ZC3A 2REXB 1G7RA 3NC1C 4LJYA 3GJ3A 4V0ME 1GL6A 2EQBA 2D62A 2BEJA 4MGIR 3SNHA 2V7QD 1XPRA 4NTZA 3U44B 3H0KA 2FV8A 4EPTA 3LFUA 4IDOA 3SU8A 1NY6A 3A4LA 3GLHE 3TAUA 3T5DA 3L2OB 5DI9A 2G3YA 4ZV4A 2GCNA 2HJGA 4LUCA 4PHFA 4BE7B 1UKZA 2D7CA 4K46A 4G5GA 2WPDD 1A7JA 4URYR 3DHWC 1TQDA 2YNMA 2P5TB 1I4DD 1NLYA 3LVRE 5TARA 5JEEA 4LYHA 4TLBA 4OI2A 3K0AA 4C4PA 2OUKA 5FUYA 3WYAA 4PZLA 2WBLC 1EESA 4PC2A 4FINA 5KYKA 1E96A 1FQJA 4PFSA 3PCRB 4D26A 4G01B 2IYXA 3AVXA 1SXJC 4WZ6A 2AKYA 2HLDD 3EC2A 2C96A 5JMTA 1ZP6A 2P6RA 3AM1A 1VHTA 1W0JA 1HY3A 2VHQA 1XZPA 4KHZA 3NBZC 4CZ2A 4O3MA 3EIQA 2KI5A 2XTMA 1W4RA 4QC2A 5DI3A 2IXEA 3WYGA 4CEIA 1YE8A 2B92A 4YMSA 1E0KA 3T1TA 3VHXA 5ANRB 2Q9BA 2X8AA 4CEJB 1CTQA 3NWJA 3KXLA 4LHVA 2ZVQX 1NIPA 4C7OA 1ODFA 3VFDA 1V5WA 2QAGC 3IBYA 2OFXA 1XEXB 3K9HA 2ZRGA 1IN7A 3OIYA 4BUJA 1J99A 1R5NA 4QG7A 4YLGA 5AUPB 3AP1A 4OHVA 5SZIA 1RRGA 1N6RA 4IJMA 5P21A 2PMKA 4EJSC 3IQWA 1T6NA 2AD5A 2X2EA 1DAFA 3MGCA 3VNUA 2C98A 5E7IA 4IFEA 4B75A 2QAGA 4L5BA 3U5ZB 3O8BA 4DDWA 1G8GA 3WP0A 5DH9A 5EP4A 3RS3A 4F93B 2R62A 2GZHA 2KWIA 2ZRLA 4R2HA 3GEIA 1US8B 3T12A 4JL5A 4Q1AA 5SZHB 1GM5A 3LVQE 2P65A 1UKEA 2QBYA 4UJ5A 1Z63A 1ZC4A 4R98A 3HR7A 3V4FA 5HR5A 4GMDA 2GJ9A 2QP3A 621PA 3TGPA 2XXAB 1ZUIA 3LBIA 1OFIA 2RGNA 1NVUQ 4WVFA 4ERNA 1KO7A 2FX3A 2F3TA 3CPJB 3I32A 2WVJA 1LVGA 1YRBA 2IYQA 4WXPA 1Z2CA 2XOKA 1YQTA 4TT3A 3EX7C 1N0VC 4PZZA 1HT2E 4HLUA 4BEJA 3RHFA 3AF2A 4BLTA 1T5IA 3OFNA 4Q48A 2XB2A 5CLQA 3AF4A 3ICEA 4Q9KA 3TR0A 3TUIC 4HLDA 1Z6YA 2Z4SA 2GJAA 3SHFA 1E2IA 2JEOA 2IHBA 4PSVA 5DLQC 1RRPA 1KSGA 1IJFA 1KDOA 5IRCD 2Q9AA 4M9XA 1Q12A 3FVQA 2CCGA 3AQ4A 5LD2B 3T34A 2ZJOA 2BHRA 3PJRA 3GJXC 4JKYA 1C9KA 1ZD9A 3ZH9B 1N5KA 3PQCA 3UWKA 3PVSA 4EPYA 3RRYA 1QHSA 2C9CA 3W8NA 4ARZA 4LJ7A 3R7WA 1E9BA 2G0TA 2IX3A 4POAA 5FOSA 4EUNA 1LY1A 1T4GA 4Q7LA 2ZSAA 3BBPA 2A5YB 3BRWD 3THWA 2DPXA 1KNQA 3QKTA 2JDID 1KMQA 3PENA 3ZZ0A 4PANA 4PAOA 1HTWA 2GF0A 2WSSA 1A2BA 421PA 1OHHD 4V0OA 1T9HA 3R9IA 1GVNB 5JCPA 4PC1A 2RHDA 4Q21A 3Q85A 1SXJE 2HXYA 4NKRA 1IHUA 1G7CA 2J0UA 2QMHA 5FPKA 1BOFA 1JPJA 2RGAA 3CW2A 3RSOA 5J40A 3M0EA 1O87A 1WA5A 2VPPA 1KI6B 4E09A 2W83A 1IXZA 3NVAA 4CT4B 3NH9A 4IHQA 3B78A 1E32A 3CKLA 3KKMA 1KY2A 4B48A 2BJWA 3OF5A 1UAAA 1Z07A 1FTNA 3WBKA 1DARA 5FFMA 2QRNA 2D4HA 2O8CA 3FFBA 2FNAA 3I8XA 4HDQB 2FSIA 2ZR7A 1DTSA 2FN4A 3ONWA 3U4QB 3L0PA 3BB1A 3CRMA 4F7WA 1RIFA 3I72A 5C4MA 4HDCA 3BH6A 3VX3A 3PUZA 1GFIA 5FPYA 4A82A 1R7RA 4LOAA 2IEYA 2ATXA 2IS2A 2F6RA 3UIEA 2WJHA 1CJVC 5CIWA 5LBIA 2F1RA 5DNYB 3B8HA 1KK1A 4U7DA 4LBVA 1Q1BA 1XD2A 2W6JD 2ZITA 2H18A 5GJBA 3ZDQA 1UJ2A 2AXPA 1W36C 4LSGA 3K0CC 1Y63A 1P4SA 1SKYB 1S9DA 1AZTA 3KQHA 5E7MA 1G3IA 5EE3A 1T3LA 3ETLA 2CE7A 3BH0A 2ZJZA 4XVRA 3SC3A 2ORWA 4L8GA 1XEFA 1E69A 1Z8FA 2VH5R 3IHWA 5F3WB 4DDUA 2F1HA 3NH6A 1Z0FA 1P75A 2BKUA 1XD9A 4B76A 3K09C 2GK6A 4Z1MD 1P72A 1U98A 2RGBA 3GEEA 2C5LA 4ZO4A 3RWMB 5LB2A 1BO6A 2F43A 3RYTC 5IK2D 3GLGE 1G5PA 4UQOA 1SHZA 2AHOA 2PZFA 1XTSA 2VQSA 4LC1A 1U8AA 2O8EB 1ANKA 2NTYC 2WWHA 3KJEA 1CBUA 1HH4A 2Q3MA 3EIHA 2O0KA 4M9QA 2Q3HA 1HQYE 1ZUHA 4Q66C 3GLFE 1BIFA 3K09A 1G8PA 1NG9A 1DELA 2VP9A 3QBVA 2YKGA 2CLDX 1D2EA 3QPUA 5KSPA 1BH2A 4MRSA 4URWR 4OL0A 4LHWA 5J5CA 5AR1A 2IUUA 4P3YA 1EFRD 4DLRA 2ZI5A 4B6FA 3SS8A 4ACAA 1NNEA 2FFBA 3QIAA 5FL7D 1TEVA 2WOOA 3TBKA 4EIWA 3OAAD 2OCYC 3TSOA 3U3MA 1KI3A 3BORA 4DCVA 3VU9A 2VA8A 2W58A 4Z54A 5DGXA 1GKUB 1XB2A 4WW0A 1MRNA 2GHIA 4WAUA 5HZHA 2ONJA 2PMDA 5C2JB 2ZETA 2CCKA 1II8B 3IILA 1KYIA 2OZEA 2ZRCA 4MGYR 3B1YA 5DE3A 2XSZD 2ZRKA 2XGJA 1XXHA 3PUYA 1KMHA 5FTNA 1BMFD 3OEEA 2GKSA 1VG0B 5AK0A 3CBQA 4OHZA 2I4IA 5KDOA 4KITB 1COWA 3VR2A 2XNSA 5EZ6B 1YZGA 1IY0A 3GJ7A 2DB3A 1FPMA 2P0EA 4C0QC 1R8QA 1N5JA 3CRRA 2OEPA 1JQLB 3DZDA 3LAWA 4HAUA 2KBEA 4EQ6A 4L16A 1GIAA 3LBHA 2XJ9A 2YWGA 5M04A 4GI7A 4WIAA 5KSYA 1YR9A 3B1WA 4TLAA 5GJWC 3FE2A 1W44A 4IDHA 3B13B 4TZ0A 2FPKA 1KJYA 3CRW1 3D3QA 4PTLA 4EPRA 2FZLA 2IXFA 3LO5A 1P61B 2EFCB 4M1KA 4TN1A 5A0FA 3WXMA 4Q4HA 4D0GA 2IT1A 4C0SA 2EU8A 1KSFX 4QFMA 2IK8A 3TMKA 4A6PA 1PV4A 3FWYA 1KZGB 4ABYA 1NSTA 2B21A 2C04A 1LNZA 3ZYCA 2XITA 3EPJA 2GEUA 2ZANA 4AIIA 2AWNA 1KNXA 2PX3A 4C30A 5E4FA 3SYLA 4HAWA 4K81B 4Q18A 4IVQA 2RAPA 3R20A 1ZM4A 4AI6A 1NG1A 3CF2A 3AV0B 3A37A 221PA 3OEHA 1AS2A 1SXJD 2N42A 1NBME 2YWFA 4I1OA 4Q7JB 4BLSA 3B9PA 1J90A 5EUMA 4DLXA 1OH6A 2DFLA 1D2MA 1G1MA 4DSOA 1N3BA 2J7PD 1RPZA 1IQPA 3G5UA 5L3QB 2OCAA 2IYTA 1HE8B 2ZEJA 2HUPA 1K5DA 2CCJA 1D9XA 4RD2A 5FOVA 4KSBA 1E9SA 1G4AE 2OG2A 2P6NA 2V6JA 5KO2A 3L43A 1Q0UA 4CYMA 4JT2A 4RZ3A 2GXQA 1JAHA 2JIZD 3ZS9A 3ZVNA 3TUZC 1P2UA 2DBYA 2ORIA 2ZE8A 4DEYA 1E2NA 1IJEA 5JBQA 4RZUA 3W6PA 5BW8A 3QXHA 5JECA 1KTVA 3OIVA 4BFSA 1ETUA 5FTJA 4OQFA 5KUTA 4DDVA 5F9FA 4LJAA 4M53A 3QSYA 1A1VA 1AJEA 4Q4AB 2WJJA 1JPNA 3RS7A 3WYFA 1S3SA 3PEVA 1XCMA 1VYUA 3EIEA 1IY1A 3GLIA 5EP3A 1YR8A 1DPFA 4R71A 1NVVQ 5KHOC 3RC8A 5J4KA 3H84A 2AXNA 4OI1A 2BOVA 3LLMA 2O8BA 1OF1A 4A0HA 1UPTA 2YWHA 2ZRHA 3PITA 4JBWA 4JLMA 3UANA 3ADCA 3EA0A 4RVCA 4AURA 5J4YA 5JSZA 2JLYA 3ASZA 3GCGA 3CF6R 3H86A 2FZ4A 4URUR 3CONA 2XTNA 1E0SA 4N3NA 1OB5A 3NEJA 3GJ0A 3A4NA 1IXRC 4FWTA 4IDQA 1LB1B 2H57A 2DY1A 2VSFA 2GETA 3HU1A 3FHTA 1OIWA 3IEVA 3MD0A 1W4BA 1ZIOA 2P3SA 2XJ4A 5L3RA 5FBVB 1ZYUA 3SQXA 1OXUA 2PT7A 2ZRNA 4F4IA 3QKUA 1VECA 4TTRA 2W6ID 3CNLA 4JYBA 2HF9A 4HAVA 4MKGA 4BFWA 3TQFA 3D31A 3U3JA 4DDTA 1P9RA 2IW3A 3QKRB 4C9BA 1SVLA 1IONA 5HTKA 1DOAA 1MABA 3NHAA 4OJQA 1WF3A 3UATA 3GJ4A 3GEHA 4TMKA 4XWAA 4LJ5A 2JLRA 3I61A 1ZBDA 3BFVA 2A5DA 3NHBA 4L4UA 3RLFA 5BN4A 1KK2A 4PXAA 1XMIA 4P32A 2N1BA 1KIMA 4LJ8A 1NVXQ 1VDZA 1G7TA 2OFWA 2PJZA 4QGAA 5FOTA 2D7DA 2YOHA 3H1TA 1E2DA 1L4UA 2CNWD 4WXRA 2D2FA 1XJQA 3OZXA 3KXIA 2ZROA 4MYUA 5L3SA 1G6HA 2YOFA 1AS3A 1S8FA 3FMFA 1ZUNB 2UZ3A 5JLJA 2EYQA 2VEDA 2K5UA 2LKDA 4NZYA 4TQAA 5DN6A 1UEIA 1O3YA 2V55B 2ZYTX 4BFUA 2NZ8A 5BYJA 4MYCA 1Q3TA 2FFHA 1QDEA 2J3EA 4X8MA 2KBFA 3WHLA 1C4OA 1ZJ6A 1N5LA 4RJLA 3B1ZA 4KSCA 3Q7QA 4C2UA 2QUZA 2ZSBA 2C78A 4NH0A 3PFIA 3CZPA 3QEOA 4B3FX 5IHPA 1M7HA 1UKVY 4Q03A 2GVDC 5FH9A 3D6TB 4ZDIA 4PHTA 2JATA 4Y0AA 4IDPA 5C18A 1GKIA 3CZQA 4LRWA 3U3OA 4DLSA 2A78A 1U90A 1E2HA 1TTTA 1NL3A 4W9MC 3AVTA 4Q1EA 2PT5A 4D4LA 1UKYA 3Q5DA 2QE7A 3U44A 1N6KA 4TQUS 4NMMA 2R6DA 1GWNA 1UDWA 1PUJA 4AYXA 3PV0A 5EQTA 1UM8A 1GNRA 2Z43A 3SR0A 4MUAA 2QPTA 2B7BA 1KO1A 1R8SA 1NP6A 3BERA 2EWVA 4MITA 4AC9A 4CVNA 3IQXA 4DLWA 2W00A 4PPFA 2FU5C 2AFHE 2JGNA 3BK7A 4OK6A 4IRUB 4FMCF 4U00A 1LF0A 4NYMR 2W0MA 2WJYA 3OIWA 3U3RA 5DYIA 3TK1A 2QMUA 4GNKA 1DEKA 1EX6A 5FOUA 3LW8A 2YV5A 1TQ2A 4A8JB 1UBGA 2QORA 2GK7A 1DG1G 1QHGA 2HF8A 4KYUA 4GPTA 2CK3D 4LZZA 4JLJA 5AJYA 2JJ2D 1XF9A 5KU1A 5SZJA 5GADl 4DHEA 2IUTA 4US0R 1SVKA 4EPWA 2ZR9A 4DLVA 4V02A 1DS6A 4NL4H 1Q1EA 2OLJA 3C15C 3CNNA 4RZ2A 5DISB 4JLKA 1TNDA 1F2TB 5J4HA 4B73A 4HB2A 1G7SA 2G83A 4D0LB 1S9HA 1IXSB 1ZNZA 3QVUA 2WM9B 3B82A 5FPTA 4LJ9A 5C1BA 1MO3A 3CB4A 3Q5EA 2MSDB 1Q22A 3B85A 5DSZA 4CEJA 1XMVA 1NMYA 4DCSA 1NKSA 1DAHA 3Q72A 2GESA 4PO8A 4AK9A 2ODWA 4JIMA 4NYMQ 1KDTA 3K8YA 1NJGA 1QHNA 4HB0A 5EXPA 3SJBA 3WHKA 4URXR 1XEXA 2ZJ2A 3U6BA 3R8CA 1ZAKA 4DCNA 5C4GB 3W5JA 1E1RD 2ZR0A 1E79A 2VP5A 4ITRC 2GF9A 1ZNYA 3QF4B 1F3OA 1T3HA 2ZI9A 1OIVA 3I3SR 2GNOA 4UNRA 2NO7A 2R6GA 4A15A 1R5BA 1XJCA 1UADA 3C41J 1RE0A 1DAIA 2CMKA 2VRWA 3BC1A 2IYLD 3KX2A 4IW3B 1QF9A 1US8A 4N0EA 4AG6A 4M21A 1GOTA 1IY2A 1SVSA 2WSMA 4A92A 4O0MA 4LY6A 1E2FA 5FI0B 3K53A 5DO9A 2ECKA 4CW7A 3IDQA 3W34A 1N6IA 1CJMA 1VMAA 2QY9A 2FPLA 4GP6A 1OT3A 5HCIA 5TDHA 3DL0A 2XXAA 2F1JA 1EWQA 4UXHA 2E87A 3PXGA 1AKYA 3TKLA 5B58C 1YZQA 4G5SA 3KFVA 3EARA 5G3ZA 4L9SA 5H70A 2H1LA 4JVMA 1E2KA 2ZYVX 3KQKA 4J0QA 2QSYA 4A9AA 1JBKA 4US1R 3QOFA 1R0XA 1LV7A 2FEMA 4KYIB 2C77A 4V0KA 2CEAA 3B2EA 1U0JA 2QP4A 4Q02A 3SJCA 1WE2A 4RD0A 1E2PA 2C2HA 1S1CA 3CX8A 3ZS8A 5BN3A 2CVHA 1RC8A 1MO5A 1F60A 1CU1A 3VKWA 4YMUA 1T91A 3JVVA 4LYAA 1NLFA 3BFXA 2WJVA 1F2UB 3KKOA 4LC0A 1X8KA 3GLHB 1KDPA 1J70A 5KPJA 1GTVA 1E2GA 1Z06A 1KKLA 4H1UA 5K8UA 1CLUA 8OHMA 1XCGB 1S0UA 1Z47A 4HB3A 4Q9JA 4GOXA 4LHYA 1K8RA 4JLDA 2QN6A 2F3RA 4JLPA 2Q0HA 1VCMA 3A1SA 3FHCB 4DB2A 2WZQA 3MJHA 1FTSA 1NJFA 3BFKA 2H5EA 2FF7A 1AGRA 3K0FB 3KFXA 2B6HA 1NN5A 4LGMA 4PC7A 2VIIA 4PQFA 3WRXC 2RGCA 3X1ZA 1VG8A 1LF5A 4XD7A 3QY0A 5CDFE 1ONBA 3LQQA 4OI4A 2QL6A 4BWYA 4KODA 1YKSA 2V1UA 2REOA 3B5JA 3FMPB 2XZOA 1N2CE 4AWXA 1D8TA 4NE2A 2ZREA 1XD8A 3LX5A 1KI6A 2I3BA 4QBHA 1T0HB 4Q9LA 3E70C 4F92B 5B30A 1W4CA 5HE8A 1GNPA 1XP8A 4O2RA 3GP8A 4QOSA 3LXXA 5FOWA 1XMSA 4P33A 5B64A 1CKEA 5IDVA 1GNQA 1Q3HA 1JNYA 4YDSA 1OW3B 4M1YA 1AN0A 5H1YA 1I4TD 3H4MA 3U4QA 2GRJA 5G3YA 2RGNC 2ZUBA 4KFSA 5TVKA 4ASUD 4MKIA 1CP2A 1GILA 4TMXA 3EG5A 2O8DB 1ZM2A 2R44A 4YQFA 3DZ8A 3GFOA 2QG6A 5B57C 2XAUA 2GXSA 1FP6A 2UKDA 1SVIA 2X19A 2Z6VA 1DE0A 4HLUC 2FFAA 3K9LA 2XNDA 3KUDA 4HUQB 4NONA 4C0HA 4E22A 3VR3A 4NBSA 3BXZA 4LPKA 1GSIA 1CR1A 4PC6A 5BN5A 2WJIA 4KI0A 1WXQA 3KQLA 3AKCA 3WNDA 1XWIA 2AKAB 1L2TA 4WZAE 4Z8YA 3O47A 2J41A 1BYIA 4FI3C 2IYVA 1YZLA 1HQCA 2F55A 4YXWD 2WIAA 2XEXA 4WA7A 3HDTA 3T5GA 1AKEA 3HWSA 4ZIRB 5EZ5A 1W0KA 1KI2A 4DJTA 1II0A 1SVMA 3SJAA 5HKKA 4XSHA 3TSZA 2P2LA 2Z83A 1FQKA 5FR2A 2Z4RA 4ESHA 3QPWA 4TL9A 4PHHA 3MWJA 4CRWB 2FMXA 4OJKA 4O25A 2VP2A 1TADA 2WMOB 3B1XA 1XZQA 4TLCA 1ELOA 2KE5A 3MJRA 4G0NA 1P2TA 2ZS9A 4M9SA 2O8EA 3C8UA 2FJUA 2VBCA 1P3JA 2VO1A 3NDPA 1RRCA 3TIFA 4M2LA 5JS8A 1FL9A 4D4MA 3E2IA 5EE9A 1AGPA 5JJLA 3FKSD 3TH5A 5L8VA 1KGDA 2PLFA 1G41A 2OCPA 2EWWA 3QE0A 5AJXA 4BFYA 2OILA 1G4UR 1OJLA 3KKNA 4UNQA 3IUYA 1KI7A 5JEDA 2Y8EA 1X86B 3QEJA 2MMCA 2LWIA 2ORVA 3CWQA 1VTKA 2CHVA 4AKIA 5KPDA 4I81A 3F0TA 3TW4A 3REFA 3BOSA 3RANA
chains in the Genus database with same CATH superfamily
1G42A 4DL9A 3AUYA 4MVJD 5AOBA 3FNFA 1XG5A 2VHCA 1FUUA 5C3MA 2G77B 5LDDC 1ZD8A 4UBIA 4RVOA 5JAHA 4G89A 4U9UA 1UBSB 2E5FA 1JR3A 3DMNA 4LZLA 3H42B 2B1QA 1XO1A 1YQ9A 2G5TA 1EKXA 4E5PA 3PNOA 4US2R 2DWQA 1DPGA 4R16A 3M3HA 1L7VC 3RS2A 1WHTB 4G9BA 3AEKB 4H6XA 1UDBA 4QFBA 4I50F 1C9YA 1AQYA 1M2OB 4UOQA 3U7FB 2K2QB 2P0YA 3KJHA 4N5HX 3L4KA 4JYCA 3QF7A 3FY4A 5FI1B 3G1UA 5D3MB 1DEAA 1JEDA 1LTQA 2FW8A 4Y6GB 2JBAB 5AXDA 1FJGB 3H5IA 2EKLA 2V96A 2QYOA 1PZGA 1DOZA 1KMIY 5DIFA 4CQLA 4KLNA 3H9EO 3RJ5A 4NJMA 1MOZA 5KVCA 3BF7A 4O4JA 4PGHA 2A5JA 3MXTA 1OAOC 4JDUA 3SC6A 2FN9A 2PBZA 4ZEMA 2ZWAA 2X22A 3S2GA 1AE1A 1B93A 1JR2A 1QIFA 4IVPA 2W6NA 1NUUA 3AZPA 1RHMA 1JALA 1XCBA 3DE4X 3E81A 3LUCA 1YS4A 3BE8A 3MAAC 4I4IA 2F62A 4IKEA 5SY6A 3UBTA 1IJKA 5DYWA 7YASA 3GP8A 1Z4QA 1ZKDA 1ZO8A 3ESZA 3FB1A 1AD2A 2O59A 3N6VA 3VTAA 1RJFA 1VLJA 1M2GA 2EGUA 1HYGA 2AMFA 1QCZA 1B8PA 2WWIA 1NW3A 5IXJA 4DLAA 3IUSA 5K8LA 3CTMA 4LYEA 2MT9A 2YDXA 4IOLA 4KE9A 5EJAA 1VGVA 1P2DA 3MYYA 3IQGX 4K1LA 5I3CA 3I2HA 1X1AA 1JQBA 3DFZA 4G5OA 4HRXA 1W9MA 1U0SY 1BHSA 1ZU5A 1A4XA 2H7CA 4NU5A 1RYBA 3A14A 5CA1F 1CZKA 1MW9X 4JJFA 1GGKA 4Q7MB 5TGTA 4MWSA 1ESMA 5DBHX 5IUKC 1QZUA 3S70A 1WY5A 3TRIA 2VHXA 5BSFA 1JA0A 2E9SA 3D6NB 2Y6UA 3R0IA 3ZI0A 1CUUA 1P3Y1 2C0QA 4AO8A 1EVLA 2QLJA 1PCXA 3DMDA 1FFWA 5EVJA 2VNHA 2EATA 5DN9A 1OQAA 1E6EA 5E7JA 1L7NA 2IFTA 3ESXA 4MR9A 1E9AA 1KS2A 3QWAA 4MW9A 3IBFA 4TLDA 3FKJA 4YAFA 3CINA 5KDDA 4AMYA 1V39A 2DYKA 4HEJA 3BWEA 5K20A 1KQ3A 1N2IA 4FC7A 1PR1A 2GI4A 1V5GA 3KOZA 3QNWA 3TZKA 3AB7A 3E3NA 5DFAA 1JVBA 4N5LA 2X9NA 4AT1A 1CUGA 4IDNA 2V54A 4CIWA 3PTAA 4EB6A 1XLWA 3W5IA 1MEOA 3E6AA 5LA6F 1TQ4A 1E92A 2HH9A 1M7BA 2YVAA 3ZZUA 1Q91A 2Q7DA 3VNBA 1JGTA 2DE0X 1NY5A 4MRMB 4C2TA 1E4OA 1CZLA 5CP8A 4G07A 4PYIA 1CXZA 1DRVA 2G9VA 2V4UA 3EXFA 4QM6A 4XDGA 1J0AA 3B60A 4R6XA 1MDBA 2ZUWA 4XUCA 1X1CA 3LQ4A 4Q4AA 5TMPA 1E9CA 3N58A 4EHJA 2GJ8A 4LDJA 4TRJA 1A5TA 1W5EA 3BD8A 3GUCA 3OHSX 2XVYA 1E3JA 5AI0A 4GOMD 3IEMA 1NI3A 1QGOA 2DT5A 4IR7A 1MORA 2GYWA 5K4GA 3M6LA 5T5QA 4KAAA 5BT9A 2VUTA 4W1RA 2PANA 4KREA 4C78A 1M54A 1MO4A 5ARBA 2XZPA 5JAOA 2FGJA 3QE2A 4C6RA 3A3YA 5F21A 1GAQA 3A9SA 2XEDA 4MS4B 2C95A 1XLTA 1AM4D 4O0LA 1FTWA 4QEKA 2JFPA 3EVNA 2VJMB 4R8VA 5AESA 1NF9A 4O2LA 2XDWA 3TKYA 1C9NA 1NIJA 4HGOA 4HDOB 4CUZA 3L1UA 4OU5A 5FBQB 2BC9A 3WWCA 2WNSA 1K88A 2M9MA 3BREA 4TS1A 3EEYA 3R7BA 1Z4JA 3M6FA 3ELWA 3GH1A 3KR0A 4YV1A 3QV1A 3ZD7A 3I39X 3KT0A 1LDNA 1PZHA 5TY0A 5B7NA 3AT1A 3R7LA 3KE8A 3ENWA 2QTAA 2WD7A 5CNIA 1WZ2A 1Z28A 8ADHA 5KOYA 1AXGA 1IHXA 2CHQA 4J9UE 4A27A 3AVWA 1S4MA 1W0JD 2QA5A 3E7FA 5C35A 2BBOA 4RZQA 1JHRA 4BKMA 4P3XA 5KVSA 1XTIA 3JVUA 5CBKA 4FNMA 4KVGA 3P2JA 4IHKA 4C4TA 1LPBB 4TYYA 1DKNA 1ZEMA 2D1QA 3U7IA 1RLOA 3VVLA 1I7QB 1MHPA 1E1NA 1WCV1 5KTMA 1SKQA 3BIXA 3L4BC 1AHPA 3G6WA 1O6GA 2A4KA 3HP1A 4LXXA 3K4HA 4ZEOA 5K4HA 3W6OA 2A67A 4ZAWA 4GOOD 5F2EA 3EZYA 1RC0A 4U2BA 2G07A 4R8KA 1MZVA 1ZCZA 2HL6A 1YRAA 4TUYB 2QT0A 1Y82A 3I2JA 3NAQA 3HJNA 1VMKA 1W49A 1E20A 1UMDB 3HH8A 3O91A 4IZHA 5JIBA 1E62A 1JQDA 1PVOA 4GVLA 4Z9YA 2J9ZB 4ZAXA 1Z6AA 3UOGA 1O57A 1THGA 2E1PA 1CRQA 2X13A 3D7MA 4C5AA 4E5SA 1C3OB 3FRIA 5DK4A 5JJBA 5AVQA 5SZKB 2V59A 4HWGA 2YC4C 1KH2A 1PR9A 1V26A 4NULA 2OK8A 5DGCA 1QKJA 3OURA 3RSSA 3JD1A 4QNRA 2HLDA 3R0VA 3MCUA 2WIDA 1Y7TA 3V8QA 4RK4A 3ODPA 3V46A 3WDMA 4RE6A 2H2FA 1USVA 4YJFA 4JU8A 4DLBA 2P69A 3BSYA 5C32A 3A58B 1MX5A 4LWOA 3T1NA 4EAQA 4UTVA 5ICSA 2P2DA 1H0SA 1JQJC 5AYVA 2X9LA 4M3NA 2VNIA 3SG0A 2VNAA 5L7TA 3KJQA 3NUQA 3TOCA 1HV8A 2J9RA 4O4IF 4TT3D 4QJ5A 1RWKA 2A5GA 5EJ8A 2AW5A 3OFND 4HFRA 3DMGA 3MLAA 1HO3A 4BBJA 3CGWA 3E5HA 2O3QA 5KJ6A 4JV5B 2GEDA 4JHXA 4CM9A 1EEXB 2G5GX 2Q21A 1P0QA 3NATA 4DKJA 2VYND 2KS6A 2Q6OA 2SKEA 3STUA 2H2IA 4RTSA 2O07A 2A84A 1QPBA 4HPXB 4M60A 2VNKA 3ESBA 1C3EA 2UVQA 1G16A 4KDCA 2O2ZA 2CV2A 2IPXA 1VZ3A 1BX0A 3W05A 3IO3A 1B41A 1JI3A 1GL9B 1W34A 2PPLA 1OCEA 2X0IA 2KJQA 3D4IA 3DTTA 3ETNA 3SR4A 1PSZA 4NENA 2B4TO 2IUEA 2RGWA 2XQKA 1GL7A 4QXOA 3O3MB 4RVHA 3VVBA 1RLUA 4ZALA 1II9A 1O94D 4GP7A 2AG0A 1O89A 1FXUA 4FFOA 4ND8A 3JARB 5CX1A 1GGVA 3UMVA 3WGTA 3EVTA 4UOEA 5FQOA 2BCGY 5H83A 1E64A 1ST3A 3OIDA 4ALKA 1QYRA 1S1MA 1RBMA 3A6EA 5BQ5A 4J75A 4EL0A 4HDNA 4MB2A 1R27A 1IB0A 2Q8PA 1VIMA 3KQPA 4Q5IA 5KX5B 3D0RA 2MR6A 1KHTA 3NHRA 2DRIA 2HNKA 2WSSD 4I1VA 2G82A 4B45A 2O8FB 1E9FA 1R16A 2EBFX 3FTNA 3UWMA 4Y2HA 3UH1A 1QR6A 5KTTA 1YR7A 3W90A 5I9IA 2PHZA 3E9MA 3I04A 3JQBA 5BY2A 3T1HB 3CMCO 4GBMA 1Q1AA 1UBFA 5IVDA 5DNWA 2H9AA 4LE0A 3UH0A 2GERA 3WLJA 2ETXA 1OZHA 3FDJA 2JLZA 2WWXA 1ODCA 4FVTA 4E6EA 3W5VA 3EXIA 3IMEA 3CGGA 2ONZA 4P7GA 1DC4A 5ALVA 5EVCA 3KNZA 1SEVA 3DNPA 2CE2X 1G0OA 4KN8A 2UXBB 2ZTHA 4HEA1 2E4ZA 2CBGA 4WY2A 2D06A 1WDLA 1MTZA 3H7IA 1O6CA 4JR1A 3M6AA 2HK6A 1P0CA 2G17A 3WMWA 4B71A 4ZU1X 4PO9A 3X1WA 4AWBA 2E4UA 4FHEA 4L6IA 2XZLA 2QVGA 3L02A 2ZT5A 2WNIA 3EW9A 4ZT2A 5ALIA 3RG8A 4KQ9A 4L2IB 1GZ5A 1Q57A 2H4WA 5K0CA 1W4ZA 3GJ5A 4NJEB 4QKQA 2FJPA 5L9AA 2NTJA 5CT5A 1E1CA 4JJZA 3H9GA 5F9MA 1Z0IA 2RHCA 2BGUA 2QRZA 5HUQA 2R6FA 3G5MA 4B3MB 4KO1S 3DVQX 3QKSB 4RVGA 4EF5A 3UVEA 3DP7A 2TMYA 2XUZA 1Q7RA 1C8VB 4DEVA 2Z9CA 5B6PA 3FPEA 2A1UB 2VYCA 4Y2XA 4LTNA 1C7EA 3OKPA 2CMDA 1HZZA 3G7SA 1CJBA 121PA 4C3VA 4IEIA 1J06A 4MS3A 4R3UC 3QXCA 1RKBA 3NW9A 2HI0A 1A8HA 2MYTA 5JSKA 5T4HA 5CW2A 5TPWA 4C0LA 3FDFA 1JFFB 4K0RA 1DQPA 3QBDA 2RK4A 1JI0A 1JNXX 3R6TA 5DCYA 3ICPA 3MT7A 2GPWA 4H2DA 4W8HA 1RYZA 4V0MA 4AD8A 4ZTUB 3HYTA 3ZY3A 4ZTZB 1X8LA 1SD2A 4WXYB 3S29A 4I4TF 1EDOA 4A5SA 4Y8VA 1DDIA 4GKKB 1X70A 1WKVA 1DLIA 3UJAA 2RGGA 5KKNB 3WMFA 2FP4B 2RAUA 4KVZA 3CH7A 4RK6A 2HADA 5FA8A 4QXPA 4J3NA 1HX7A 1DB3A 4INPA 2AFHB 1PJBA 2JH9A 4W7SA 4JQYA 2P6PA 3O93A 1FQOA 1BYUA 1IBRA 2ASEA 4CM8B 1JQKA 3ZV6A 2A7QA 2G1KA 1L8AA 2PO7A 3EFOA 5AVUA 2E37A 1AA9A 3ZX4A 1OU0A 2FPWA 3KQVA 4DQXA 4GPBA 2ZUSA 4Y0NA 4S04A 5CH3A 2VP6A 1I14A 2JGEA 4MAMA 3VZDA 4BNDA 2B8JA 2MINB 3AQIA 4YHBA 1Z0SA 3V4SA 4ZHSA 3UPDA 3ZZMA 1CNFA 5FWDA 5C51B 4N6NA 4IZOA 2QN3A 4X1YA 1NXXA 1ZOIA 2XBLA 4V24A 4ZARA 1LKZA 4PSUA 5EKUA 2XIQA 3VU0A 5B5SA 4H0FA 2DUUA 4QTYA 2WZCA 3MWEB 3F6RA 2C5EA 4H6WA 4DCOA 2IVFA 3BD6A 1N5MA 1A2QA 4IKPA 5DYNA 5IK2A 3FPLA 4AP9A 1J0XO 2AWOA 3P27A 1QG6A 3RVDA 4EMUA 3KZCA 3ASVA 4Z4CA 1PJ4A 3ZCUA 4K0KB 1JEEA 3IA7A 1Y5IA 2OO5A 4ZZIA 2ADOA 1P9NA 3OTQA 3VR2D 5ITWA 3TLBA 4AAYA 1G5TA 2J3LA 5H4HA 3TEMA 3ZD8A 4XVUA 1LI5A 4QOFA 1ZOPA 1UQTA 1ECBA 3GLSA 5JQGF 3TX6A 1U9IA 1M2VA 3U4IA 2HCJB 4P84A 2ZVDA 3FOAA 4DYHA 3E7XA 4HMOA 1RAEA 1F8UA 1SKAA 1NJSA 2QDKA 4XA8A 4NU0A 1V9SA 5CGZA 4G1UC 4ZI2A 4LDAA 4QPCA 4H9GA 3I34X 5ALJA 1MKYA 1OPXA 2VYVD 5EJFA 3FBWA 2PV7A 2E89A 2O2EA 3JATB 4L8FA 1LZKA 4BFZA 3ZPXA 3ZQ6A 1W75A 2G0AA 2ZAYA 4GMKA 3TTTA 4DRZA 1XNJA 4B6OA 2YS7A 4KWEA 1DINA 4YCAA 5TSDA 3DE3X 5CYPA 4ZCRA 3WICA 4Y9SA 4ZIRA 3OY7A 2BM0A 1X7HA 4YP9A 1GG2A 3DBHA 1LVHA 3HB5X 1KERA 1F3LA 3H5TA 3DDZX 2ZJ5A 2G70A 4YCBA 3KB1A 5HMMA 3KQMA 1J8VA 3K1YA 5LQUA 4R9UC 1BMFA 1QRAA 4WCFC 1JX6A 1UBEA 2H4YA 2H3EA 3ZE0B 1C4WA 4ZAVA 2VC2B 2J33A 4KMMA 4ZEWA 4LWPA 1KY3A 1BD4A 1FIUA 4BNHA 4REOA 3BWVA 3GB9A 1TKRA 3OT4A 3PX7A 2GWHA 2ZRMA 3D7SA 4ECEA 3R9XA 5EZSA 4EG6A 2QLNA 2VJOA 4ILEA 4URZR 4RL4A 6PFKA 2R65A 3DNFA 3PUVA 4R0NA 3C85A 4OB7A 2ZSDA 3WNZA 4CEHB 5HK9A 2FMFA 3ZV5A 5UKDA 4RHXA 1OREA 2CD9A 4ZOLA 4YJKA 1YUNA 3OZSA 2QZ4A 4V0NA 4FGZA 1T9GR 2P2YA 1QAMA 1X77A 4E1VA 5ARCA 3ZDZB 1NASA 5KTKA 4P3PA 1ZRSA 5KIAA 4WASA 4RENA 3N5CA 3CZAA 4TKMA 3KU1A 5EWJA 4FR5A 2EZUA 2OQ2A 2XMQA 3FX2A 4JS0A 4QEDA 4XIYA 3AKYA 4AECA 2D8MA 3S1AB 4I4LA 3MTDA 3GRRA 4BV3A 1P1HA 3BL5A 1VJ0A 2QI9C 1PF7E 3M6UA 1QIGA 3KEFA 4ITVA 1KK3A 1MJHA 1JTVA 2YRXA 1MO6A 4YCJA 3FLAA 3TFQA 1WB6A 5IT0A 4R8MA 1ZWLA 3D8BA 5J5VA 4GD3Q 3FCSB 1MVLA 4DLZA 3N0TA 5AHXA 5DBEX 3UT5A 2Z6UA 3KQQA 4CFYA 3QVGA 1Y1TA 1DGQA 3PQ3A 3LUKA 4ML3A 1YQWA 2DHQA 1QAQA 1SXJA 2B4AA 2Q45A 3HADA 3I01M 2W2OA 1BE8A 3PIDA 4LMBA 2V9CA 3B52X 3ET5A 3YASA 5JNTA 1OC4A 1SEPA 4B3CA 1OC2A 1JWAB 1RZRD 1D5CA 1NHWA 2HLPA 5GTDA 2QU7A 4OQNA 4G67A 5K3SA 4KDEA 5JU6A 3R3HA 2J7PA 1CQZA 3OD5A 2TMKA 4XOIA 3A1CA 4J03A 1X19A 3T38A 4PV7A 3T15A 3LZDA 3NIFB 4MS1A 2WK1A 4XOUA 5JWHA 3A1WA 3ZWQA 5C8YF 1XZHA 2WT8A 2O2SA 4HS9A 4FGWA 3U3XA 3VNVA 3R3YA 2ZWOA 3L1VA 2QQ5A 3A6LA 3LA6A 3P9SA 5B1YA 5BV0A 4PX2A 2PGIA 5BWCA 2JLXA 2VPTA 4KRFA 3ILHA 2IITA 3H1BA 3I6IA 4G1MB 4IFBA 5CGQB 5JJIA 3HRKA 5LYYA 2ZSHA 3BTSA 3DMTA 4UTZA 1UPXA 5EQJB 4ZT6A 3ICVA 1GG8A 3FWKA 4D7AA 2HU5A 2ZUEA 3G2JA 3IBGA 1XQ9A 2K4MA 1WDWB 2CXSA 2NAFA 5YASA 3UGKA 1BVUA 2ERYA 1CUHA 3X1YA 3DDNA 5HKOA 4PNZA 1UBMS 3TJRA 3TXXA 2M6KA 3FR7A 3EF0A 2VDNB 2DWOA 2ZE5A 4DUYB 1V47A 3LC1O 4WZAB 2G1PA 2B34A 3E15A 3DHYA 4HP8A 4XPZA 5BNWA 3VNRA 2BKXA 4L0MA 3R3SA 1JHMA 2AJLI 2HJRA 3K9CA 5G0VA 1DHTA 3FYUA 2WYIA 3UUEA 1DQYA 4EEKA 4HOYA 2IF0A 2JK1A 3D8TA 3ZCXA 4BKOA 5JHHB 5L6MB 4N0QA 4P4SA 1EP3B 1VKHA 1WZEA 4NOJA 2V97A 5CFMA 1P31A 2W22A 4MVJF 2OVBA 2D5LA 4FCVA 4GI2A 1PHPA 3AHEA 4WKNA 4DWVA 1O95A 2YWRA 2ZJ1A 4MRRA 3KDSE 4ARUA 2RGXA 4NBLA 5K8JB 1YZTA 4Z4EA 1FMLA 3K35A 4FYHA 1ZSNA 2QX6A 3OI7A 1QHIA 1N6OA 1CYDA 1FEZA 3DEFA 3EHDA 1GN8A 2D1TA 3I45A 3WMGA 5JZBA 6REQB 4OKNA 4B2IA 1W1IA 2IYPA 4DCPA 3PNKA 1YVDA 4G1EB 3WRWA 2ZUCA 3FDZA 1ZRMA 1DTWA 3GMTA 1RQGA 1SC9A 3MTEA 3PFCA 3W2EA 2FPXA 4B32A 2CBZA 1YZHA 3KQWA 3QWIA 4MUHA 4AJ1A 3GLFA 3GZ4A 2A2ZA 4CG1A 5DN6D 2RGEA 2XWJI 4LQCA 1MIOB 2WTXA 4CLRB 4AX4A 1JG2A 3LK6A 1Y8QB 3EWIA 3L1KA 3NBYC 2W6IA 1G21E 1Q0SA 4R81A 1ZJ4A 1AZSC 3AK4A 3WJAA 1JAIA 2FPMA 2X4IA 1DEHA 2OBBA 5EP2A 1BWQA 2P9GA 2Q41A 2V7TA 3P1JA 3TZBA 3ODGA 4FONA 1JR6A 3RDPA 2I4RA 1JB1A 1EGAA 1OV4A 1C30A 1UKCA 1VE1A 1WU8A 2QD5A 3C5HA 3GWZA 4MUJA 3GUVA 4B44A 5A1JA 4V3CA 4BNIA 1QUFA 4GX0A 4LAFA 1UJ6A 2G09A 4KX5A 3SIRA 1L5YA 5JCZA 4AQYB 2IHZA 2DUNA 4W9RA 1JZQA 3WBFA 4CQNA 1GTZA 4FZJA 4UNPA 1WTAA 4Z7NB 1CUJA 3G0DA 1KYYA 3WAKA 4BQOA 2SCUB 2AX4A 3DXYA 4FW8A 4GWLA 1MDFA 5TS3A 3FPBA 4Z8XA 3EIUA 4JT8A 1EXDA 1EFHA 3QUSA 3CG4A 1W94A 3BZUA 3DVAA 5BW6B 5A1TA 2VHVA 4BU0A 4OFBA 4ENTA 4UMEA 4GUDA 3WLIA 2FWPA 2H7VA 3RYHA 8ABPA 3AB3A 4F4CA 3RHZA 3PEYA 4S2UA 2PSDA 2QAGB 5JG7A 1Z13A 4R01A 1Q74A 1WZIA 1DMRA 1L5ZA 1XFAA 2WWGA 3DXFA 4PPYA 1ONOA 3L0YA 5E4YA 3IIJA 5A04A 5BUCA 8ATCA 3IT3A 5B37A 3G89A 4NYIQ 4EY3A 2C7QA 1ADYA 3ISVA 2EP8A 3VSEA 4KJXA 3RRMA 1HKHA 2AZ4A 4MI1A 4EO4A 1U0FA 2V9PA 5JI2E 1X7WA 4AG5A 4DCCA 4ZCQA 4IXMA 5HGXA 4LZPA 3DXXA 1QE5A 1VBFA 5EHXA 1ACJA 3AX6A 1DL5A 2WUVA 3AP3A 4ZQCB 1KYQA 2GPYA 5HMLA 4Y2JA 3WK8A 1GGNA 3CZ9A 4R5HA 1CEEA 4WESB 1WQ3A 1Y3FE 4MV1A 1BX1A 2OZLA 5I7SA 1A76A 2J5XA 1W25A 3FPGA 4DB4A 3GD7A 1A9ZA 2WFZA 3PG5A 4ICIA 2JI7A 2OFOA 1CHDA 4D4JA 1LK5A 5FYDA 3LTNC 3AJ9A 1Y4UA 4RVSA 1DRJA 2C5FA 3AKDA 3F7MA 4Q1FA 1S6YA 1ZCBA 1Z45A 5A4JA 3SF8B 2IYOA 4FR2A 2VLIA 3KEQA 2QW8A 4OJMX 3ZLVA 4MYTA 4BQFA 4D42A 4BVGA 1GGHA 4F5DA 2WV9A 1OFHA 1PS8A 3VAYA 1AOXA 3D8HA 4IWXA 3VZPA 3FFWA 3P9KA 5KVVA 1U4OA 3CC8A 5BSUA 4QYXA 3IBSA 2P75A 4AUKA 5CG2A 4E13A 2YWBA 1FFSA 5K6TA 2IGBA 3NWOA 3WIEA 1OLOA 3NTUA 2P5SA 5L3ZA 3A04A 1E1YA 1KAOA 2ZYDA 1SHJA 4PNPA 3W5HA 1IZ7A 4ZCIA 4DIOA 1A27A 2V45A 4LRXA 2QL5A 3K1AA 1J7KA 2HDWA 1FYDA 1UM9B 2CK3A 2HB6A 3HCCA 3OOYA 3GMDA 3VBEA 4ARZB 1N5IA 1FSFA 2I1LA 4ESOA 1G5HA 4DIFA 1Q1QA 1Y7IA 4IDAA 5LQDA 1OXXK 4CODB 1ACMA 1Y1SA 3OZWA 2C9ZA 1EHYA 2ZIAA 3KK0A 3MBKA 4NDZA 4UVGA 4BIIA 4CMEA 5EJEA 2W71A 2YASA 1GG9A 2CHFA 2GD0A 3E9DA 1XLVA 1A9SA 3IDAA 3R76A 3HNPA 3K9GA 1HYHA 4DPMA 3EXG2 3TRKA 1M5TA 5IBPA 1QG4A 3JVEA 3DZGA 5EA2A 1MOPA 2GRAA 1B23P 3P0FA 2AZTA 5DZSA 1JR3E 4HYEA 5HQ3A 1VJCA 2F3SA 2P40A 4P82A 1JW9B 2BM9A 1G9XA 1I9CA 3WL4A 2JIBA 4HJRA 4D3FA 3QVSA 2HJ9A 2D0PB 5IVPA 1GEEA 2XUFA 5IAGA 1JA1A 1Z5NA 3G2HA 1XLTC 2QYTA 1OLXA 1RQPA 1M1YB 1W47A 2F3PA 4X54A 5AK3A 4Z6KA 2NUPB 5E6UB 4D9HA 2WU0A 4JUAA 1R66A 3W6UA 2H0RA 3WO1A 2HRDA 3HCRA 2H5JA 5JCXA 1YRQA 2V8OA 5BSGA 5KNDA 4FZVA 1Q20A 3IRVA 4RIHA 1CF9A 3M1AA 4BVEA 4U2KA 3F3KA 4K6GA 4ZDKA 1JT9A 3L0SA 1QFXA 1UXIA 1OUMA 1S2MA 4P6VF 1PZFA 1BAPA 4RKFA 1RJEA 3K9FC 5C9ZA 1BXGB 4H3SA 5J4LA 3AEZA 1NGSA 4FDTA 4IHJB 5AVXA 1XDBA 2VTDA 3PPWA 1I32A 3VPXA 3V4VB 1NNI1 2ZI4A 5D85A 4B31A 2R8ZA 1D2NA 2AJCA 3L46A 1YSCA 2ZJAA 4RHFA 4A91A 2O7VA 2I4OA 2A0KA 2JA2A 3WIUA 1G5RA 1P2VA 3N6XA 5FLXA 5HRUA 2IOYA 3NVDA 3LGXA 4WK2B 4AS2A 5AK5A 4UTNA 1AK2A 4CNBA 1EIZA 1DJLA 3RTAA 5CLJA 5CD1A 1A04A 1YAHA 1HEIA 1NP3A 3IP8A 3VR1A 1RAGA 2QR5A 4YALA 4ZK2A 4WD3A 5JJCA 4FR0A 2E4AA 4A8HA 5CM8B 3C6YA 1XAIA 3ENKA 4H4EA 1RTKA 2BMEA 3Q7IA 4QG3A 2J48A 4MK4A 3SN6A 3BM5A 1YUBA 3L4SO 3TEFA 4YYEA 3JQFA 3KD2A 4BFVA 1U63A 1EFDN 4FGSA 5K03A 1IH8A 4XJXA 4RF2A 1FUIA 1WM1A 2KM1A 4ZCPA 3ZXIA 4ARAA 5CBPA 5DCLA 4ZU3A 1V6CA 3AZQA 3EEFA 1QHHA 1RNLA 2G7MC 2GBPA 1MAAA 2I0FA 3MQFA 2I2FA 4NK4A 2FUG6 3D6MA 1J00A 3HYCA 3PJEA 3RSGA 3AH8A 2QB5A 4Z49A 4RTRA 3L0OA 1Y3AA 3M5PA 3IL2A 5ELLA 1EM8A 4LVNA 3PQ8A 5B1DA 1FFBA 2HEGA 5ITSA 3T3NA 3H5LA 1XALA 1KZ7B 4O4HA 4M86A 1D7AA 3W9UA 2VHZA 5CB0A 1RRKA 1R0YA 2X8JB 3MCAA 4JYPA 4QUKA 1A7UA 2DH5A 4J43A 3TB6A 3SXUB 1Y1LA 1RKQA 3BSFA 1SBZA 3IPLA 2AZXA 4CKEB 4HRVA 5TEWA 5FLEX 1SUSA 4MI6A 4TZ0A 4FGJA 1OASA 1U3UA 3HKEB 1XDUA 2VYFA 1CR4A 5ESRA 5GJVC 3O1LA 2BFEA 1F8XA 2RH5A 3KLNA 3ZLJA 1R6UA 4LV8B 5AVKA 3TPZA 1QCCA 2AG6A 1F14A 1JG7A 1N92A 2DOKA 4R2WA 5AIAA 3F73A 2UUBB 2Z8XA 3HCFA 2AL7A 3HY3A 3VR3D 5LIRA 2P67A 1Z2PX 3GGDA 1EX1A 3E7DA 2YFHA 3FAZA 3AVVA 3RW9A 2ZRAA 4Q47A 1BXZA 3HL0A 2PLNA 1E3EA 3RCBA 1G20A 2V5VA 5E1DA 1F0NA 1X94A 1E5LA 3SICE 1ZNXA 2CUNA 3OIGA 2VXOA 2W9XA 5ALMA 3ZE2B 2H07A 2CC2A 5KAMA 3LT2A 3RS4A 2MMGA 1JVNA 2JI8A 2VHJA 3MNFA 2ZTVA 2VDLB 1WBDA 2XX3A 4ER6A 3PX2A 1XRPA 5HKKD 5JFTA 3WY9A 1TI7A 2QROA 4LWQA 1JG3A 3IBCA 4CMCA 1HFKA 1JB9A 1VG1A 1OGJA 2IXTA 4NE7A 2G1UA 4DBVO 4U2CA 3CYFA 4GGOA 1H05A 2O48X 2AR7A 2BY4A 2I78A 2QNBA 3QXXA 3SLRA 4B5KA 1BWPA 5AW3A 3I5XA 2XUGA 1EFPA 4WWHA 3VO2A 2K87A 4IH9A 4ARIA 3CH5A 4ASUA 1VOTA 3V32A 4RWEA 3F9RA 5I4BA 2VAVA 5AI5A 2W6PA 5BW4A 2YINC 1H6BA 2NVOA 2VUSA 5J1SB 1LA2A 5AKEA 3PHIA 3OWOA 2NXNA 3KYIB 4GRIA 3L5KA 3OU2A 4O2AB 2EW1A 5KNBH 1GU0A 2IP2A 1T1GA 3MN1A 2QU8A 1YJ5A 3VU8A 3THYA 3GLQA 2FK8A 2OTCA 3JQBC 4EB8A 2VBGA 1D1TA 2G88A 2DWCA 1QRUA 5AW2A 1AKVA 1QNLA 2HZBA 4IMRA 4M6WB 1GKKA 2V9ZA 3NASA 4IG4A 4QHSA 4KRYA 4WBNF 1RRMA 5LP6A 4I9GA 4K03A 5L4SA 3L6CA 4MUXA 4UFOA 4YXWA 1KPHA 3QFHA 3LQFA 5CM9C 4P3OA 3AG6A 2PCLA 1CULC 1G6OA 2NG1A 4V3BA 5KYNA 1C8KA 3OQIA 2BSQA 2FZKA 5CDYA 3J81A 3FSJX 3OESA 4JLNA 1BXRA 1PFKA 1SUDA 2WAYA 3DBIA 4GECA 5FBLB 5FUVA 4FZRA 3Q4GA 2IYEA 2ZRBA 1JXMA 1C3VA 1L4HA 3BH7A 1SCUA 3ECSA 3OJEA 1LS6A 2VATA 3H5AA 2R2AA 2XQGA 3HABA 3OFKA 1JR3D 1ZKMA 2BFCB 1W85A 1CQJB 4LYFA 2XNJA 2C07A 1NSYA 4IS2A 1V48A 1PLLA 2C2MA 5BV1A 5KNLA 3KALA 4YY3B 4IUBS 3AERB 2EZ8A 4K9SA 4L5YA 4UEQA 1TLLA 2BMFA 4NMHA 1EGQA 3KWJA 3SX0A 2OYSA 3FPAA 3K8OE 3K0BA 2RGYA 1E9EA 2DQSA 5FYQA 4IWYA 1NF2A 1JG1A 3GJ8A 3NKVA 1GCUA 1YASA 1JHVA 1WKBA 4MVJI 4I4CA 3UJ8A 4UPDA 1OXBB 1P74A 3K30A 1L1RA 3FSEA 3HNRA 4TXMA 1HZZC 3CJTA 4WI1A 4ZOQI 1EGVB 3Q8KA 3IJRA 5MFZA 2P6MA 3NM6B 1GUYA 1V7CA 1M74A 2FPIA 3I1JA 4XJVA 1P8JA 5T64A 4GQBA 1Q0PA 1SCAA 4HQLA 4BPBA 2ZE7A 2FDRA 4KVAA 4FKMA 2HT6A 3SZUA 2ILVA 1CVRA 4YQZA 4UEJA 3WNVA 4EG7A 2I2CA 2IZZA 4UMFA 3UJ3X 4F5YA 4BFTA 3FROA 5JFGA 3S1LA 2PEZA 3G82C 4FMDB 4F7DA 3OCXA 1EK2A 2ZYUX 3KXKA 4DJEC 1I80A 2C1EA 3L7BA 5KYYB 2VHUA 4I3GA 3AVQA 1CY0A 1NDHA 3KEGA 2ACWA 3O8QB 5AW5A 4DXDA 2PRZA 4N5IX 3OZUA 4FOLA 2XUHA 1GZUA 2I66A 3QXJA 4GSYA 4B7UA 1U0BB 3EQ9A 1JEQA 3NHPA 2HHHB 4QLBA 2H08A 4TXNA 4AJIA 1GQYA 1ZY2A 5E95A 4ZJYA 1UMKA 2BDEA 3C14C 2ACVA 4FJ0A 1U99A 1NATA 4C4RA 3QG5A 2QUKA 4IEEA 2OECA 1YZFA 4TQGA 1RFGE 4NABA 1H6CA 1PWZA 2XF2A 2CL6X 4M0UA 4M1QA 4IMPA 1B42A 3DFIA 1TVKB 2ACEA 1QO7A 2JCVA 4TTVA 4WKCA 1IVYA 3Q8WA 2OGUA 5BWBA 3RVRA 5CITA 4OXRA 4Y9TA 3K70B 1CY4A 4HVAA 2R751 5B2ZA 2OA0A 4BFLA 4D81A 4RDHA 3RNLA 1QLHA 3PQFA 4DV7B 2NU7A 1WXHA 3O8DA 3ZE7A 3K9NA 2GPNA 1NN3A 5AWFC 1CNMA 2XV1A 4R1QA 2DHEA 4HAZA 3V00A 3JQRA 3WJ1A 5AVSA 5LL6P 1L5HB 1WB5A 2OB2A 4RMNA 4BNFA 4MDEA 1EB8A 3TM5A 1CJKC 3KYBA 4LDPA 2VL7A 5EE0A 1SB8A 2AYYA 3REQA 5CXQA 3GV0A 3L01A 1IWPB 3F6BX 3L6BA 4Y6OA 5C80A 5M2QA 4QVIA 4CL0A 1THTA 4FZ5A 1NKVA 2Y27A 4A6XA 1GRQA 3GLRA 3GFPA 4RD4A 2I91A 2P0AA 3LWZA 2C3YA 3C8MA 2OO5C 4MH0R 3KSZO 3E7PA 3FJYA 3CTPA 3PPIA 4P0TA 1VKOA 1GLNA 1U2DC 3AXSA 3EIFA 1KGSA 4KQMA 4JI7B 1JLLA 1VHLA 1N2BA 2PSSA 3HFSA 3M1IA 2GB4A 1U9IC 2H51A 4O4LB 4D44A 3THSA 3MCTA 4JQCA 5CDFA 4YHHB 1Y6ZA 5EYPA 1YVPA 2F3QA 3W5DA 1OSNA 1SMKA 4JSTA 4EX7A 4JQOA 5KDLA 4WZBE 4QLAA 3RBXA 2VKQA 1ZK4A 3K20A 1WLYA 4J7AA 4JVOA 4ALLA 3H3FA 4B85A 3BB3A 4UCWA 1J49A 2J9GA 2QM0A 2P78A 4QGHA 2ZULA 4X97A 2ZCVA 1V6SA 3FUXA 4FS3A 2YXLA 4UKDA 2RGUA 2WIBA 3O7WA 4YP5A 3PS9A 4J6FA 1OWNA 2PKWA 3HQ4O 3OJXA 1U11A 4YS6A 3OZTA 4I2VA 4BO6A 3AESA 3U40A 1YOVB 2VTKA 4UDNA 5E0OA 3TZQA 3ZU3A 4DMFA 3KCNA 1ZVKA 1INLA 1VP9A 3HXKA 2JAHA 2HIMA 3GX1A 3D02A 3O4VA 2NPOA 4KQEA 4P08A 2XWQA 3VV2A 2QN1A 1TU0A 3I04M 3MA0A 4R40A 2PZLA 4XIGS 2DFVA 3IOCA 1IULA 5FD8A 2VXCA 2QLLA 4JI5B 1LTHR 3IA2A 4PYNA 3UC5A 2H5IA 2PZJA 3JQ9A 3T3IA 2C2GA 1CS0B 1OBOA 4RFLA 5ILQA 1G8YA 1TK2A 2BJVA 4AUNA 1E94E 2D8AA 4WJKB 4ZMBA 5JH7F 4F21A 1CY7A 4AKHA 3EHEA 1OH5A 3EY4A 5E7QA 2OE2A 4I5EA 3NJ4A 4G3XA 5EXSA 4KV7A 3NC1C 4FYWA 3AY6A 4V0ME 3GJ3A 5JD5A 2PL1A 3DW3X 2D62A 3CXRA 1ZIYA 3H11B 3A10A 2NXWA 2XQVA 2AE2A 2FV8A 4WERA 5B1SA 4IF4A 3LFUA 1KZYC 4XQEA 1OR8A 2PVCA 4HD8A 3TAUA 3A4LA 3ID6C 3L2OB 5AI8A 1SK9A 3N86A 2GCNA 3CEJA 3QX8A 1YS7A 1OV6A 1M1NA 1MTOA 1XE3A 1OVGA 5F3RA 2G9QA 5LKRA 4XPIB 4CG3A 1GQOA 2YXNA 4TZKA 4FEGA 1TQDA 2WUFA 4KIGA 2CBXA 4HDKB 2J0EA 4Z53A 1Z7GA 2J85A 4P98A 3LVRE 4RA9A 2Y0PA 2FPRA 4A7PA 1EZ1A 5REQB 2EX4A 3D6FA 4BVKA 1GSAA 1O58A 3K0AA 1Z4IA 2PT9A 2OUKA 2FPGB 3NR2A 5FUYA 4CCSA 4PZLA 1XDDA 3RVQA 4FINA 4OO3A 2JFOA 1CLEA 5CMLA 1JSCA 5LU9A 5KYGA 2IYXA 3AVXA 1SXJC 4WZ6A 5SYNA 4D9CA 2HLDD 2C96A 1F0YA 5JMTA 2P6RA 1P7PA 1OVMA 1KYTA 4RPLA 1TW2A 4EI7A 1WXDA 4KIUA 4HGQA 3C3EA 1HY3A