1KO5A

Crystal structure of gluconate kinase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
172
structure length
172
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gluconate kinase
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko5A00
5CLQA 2C03A 3EIEA 3SU8A 1OFUX 1ZNXA 4FW9A 4OJQA 3DZ8A 1NP6A 2C96A 3TNFA 4A8JB 3OAAD 4QHSA 4S2EA 3SE0A 4TLAA 2VO1A 1DAGA 4RFVA 3WHKA 1T91A 2J0SA 1AZTA 2D06A 4D80A 4KFRA 1PVOA 2HXYA 4OHWA 621PA 4TL8A 4LBYA 4XIGS 3U7HB 5FTLA 1BYIA 2IT1A 2XJ4A 3NEJA 3V9PA 1G18A 1KI3A 2IYXA 2ODEA 5JRJA 2GCPA 3LRPA 4YMSA 4JZKA 2ZRMA 3CB4A 1IY1A 3DOEA 3I8XA 2CNWA 5JLJA 3AVYA 3WBKA 3WP1B 4Q4HA 5HZKA 1G8GA 4A36A 4EJSC 4BEBA 4HAXA 5BXQC 5FBVB 4RCYA 1E99A 4DSNA 4WXRA 2A78A 1ZM4A 3QG1A 4Q00A 4Q4HB 4MKFA 2QBYB 2GZDA 1XDBA 2PLRA 2W2VA 3LXXA 3ZQ6A 4M9ZA 4IOMA 3VNVA 1P9WA 3CM0A 1G1MA 5JWRA 2FSFA 2D2FA 1Z5ZA 1A1VA 2WV9A 1WQ1R 2KBEA 2JLSA 4Q4JA 1VTKA 3GFTA 5LD2C 1G17A 2P3SA 3ZIAA 2H92A 1ZW6A 2ZPTX 4QNRA 4Q4JB 1SVSA 4B35A 1Q1EA 3NDBB 3CWZA 1G5PA 3U4QA 4LJ6A 1ETUA 2VA8A 4KYUA 3LAWA 4G3XA 2ZJAA 4NONA 1RRPA 3R9WA 2WJGA 1KJYA 1KHTA 1SHZA 4LJYA 2CHGA 3CX8A 1NLYA 3VR3A 3QPWA 1N6OA 3I92A 3RS4A 4R7ZA 4NZYA 4M2LA 1DG3A 1D5CA 2AXNA 2VP6A 1XWIA 4FN5A 3P20A 4JKYA 3VR1A 4E5UA 5C18A 1KI2A 3SHWA 4UNPA 4RD3A 1NMXA 1QHNA 1OXVA 3AVOA 3EAQA 3CONA 3LLMA 2ZU0C 1ZMXA 3H84A 2OZEA 2AL7A 1XMSA 1NY6A 1MRSA 4JBYA 2IBMA 5AUNB 1EWQA 1QF9A 1RRGA 2NGRA 1CEEA 1UBEA 4DLXA 1LF0A 4BECA 2BKEA 3MRSA 1YQTA 1KDPA 4FCTA 5HE9A 2CE2X 4OHZA 3PFIA 2JLRA 3QBVA 4Q1EA 1IHUA 2QN6A 3T15A 1LVGA 1T5LA 8OHMA 3RDPA 3KKOA 2V9PA 4V0LA 2UZ3A 1HEIA 3L43A 3MJRA 2IXGA 4V0MA 3A36A 5FL7A 2IF2A 2AK2A 4CZ2A 3PJRA 4PHFA 3FKSD 4YDHB 4DWJA 4EIWA 4TQUS 1UKZA 4M1WA 3R8CA 1R2QA 3IIMA 3WYGA 1IOZA 3K0SA 2J3EA 2ZU6A 2QP3A 2D3WA 4JSTA 5EQTA 1W0KA 1CTQA 1U0JA 5KNDA 1WDTA 4M9SA 1XMIA 3GMTA 2XB2A 3AGPA 5CIWA 3MFYA 1MT0A 5AJYA 3AF0A 2ZAOA 2W0SA 5B57C 1KMHB 2ZI4A 2IXFA 1VIYA 3K09A 4US1R 3GLGA 1G8FA 4TSFA 1KJWA 2EVWX 3SDZA 4DLVA 2ZITA 3RANA 2OV2A 2QM8A 3GLGB 3PEWA 4Q9KA 5TV2A 1EXMA 1DS6A 2PCLA 4TLEA 5L3QB 3RS5A 2NO7A 1BKDR 1QVAA 4UJ5A 2I4IA 2N46A 3RWOA 721PA 4OHXA 1OB2A 2QPOA 3KJEA 1YZTA 1XTQA 2W6ID 2ZS9A 4PSAA 3Q7PA 4LSGA 1YU9A 1KKMA 3WNBA 1K6MA 2IYRA 1DBSA 1YR9A 3FDIA 4TMTA 5FPYA 2ODBA 4LJ7A 2C9CA 2GZHA 1RPZA 2IK8A 2J0QA 2NIPA 5FUVA 3QPVA 5KHOC 2QAJA 2PEZA 4AK9A 3BC1A 3B8HA 2QRNA 4L16A 1YRBA 2P6NA 2RGGA 3F0TA 2D2EA 5FTNA 2VP5A 5TDHA 4NU0A 5CIQA 1LV7A 4I1OA 4DCUA 3GLHA 1T5IA 2V8OA 4F4IA 5HTKA 4EFMA 4M9QA 2OBMA 2AXPA 2HLDD 2WWYA 2ANBA 2QZ4A 2J7KA 2ZIAA 2KWIA 2REBA 4JJKA 4OJKA 1JAIA 3NHBA 1VCOA 1US8A 1EFRD 1U99A 4Z8YA 4MKIA 4LBZA 3AM1A 3I73A 1OFTA 2OFOA 2R6AA 1US8B 3QF4A 5B30A 4C7OA 2CL0X 4R9UC 1Z8FA 4LHWA 2IS2A 3GLIA 1L2TA 4URWR 4TL6A 3BH6A 2D4HA 1G6HA 2GJ9A 1VG9B 4C7OB 4RFSA 2PZGA 4NCKA 3SR0A 3WMFA 5JJKA 2XZLA 1R8QA 2O5VA 5JEDA 3GLIB 4YMWA 2Q9AA 1RYFA 3PQCA 1SQ5A 2BIFA 4PAOA 3O8CA 1FUUA 4L8GA 4QGFA 1C1YA 1E2FA 1G4UR 3VR5A 1UPTA 3AVQA 2V6IA 1E9DA 2FA9A 2OBLA 3B6EA 4PPFA 4Q9HA 3KTAA 3ZJYA 1GDDA 1OPXA 2FX3A 2ZSAA 3HP1A 4O0MA 3JZMA 3KFXA 4CEJB 1XCGB 4A82A 1T6NA 4WBSA 2IYSA 2QROA 2ZJYA 2VLIA 3KTAB 1W36D 1B0UA 2GJAA 4OQXA 4Q9LA 2FF7A 1XEWX 3OZXA 3UKDA 4JLAA 1E2EA 4YONB 1KIMA 1IN5A 2VHJA 4Q1CA 3QKTA 4GP7A 3VTKA 4FMCB 1OH5A 3EA5A 4Q7MB 5CB6A 3TSOA 2YNMA 2IX3A 2CNWD 2FSGA 2GA8A 4N3NA 2ZRDA 3NH9A 1DO2A 1TF2A 1CR4A 3OESA 5FUXA 4C0KA 4DIEA 4PTLA 1KDRA 3K9GA 4I1VA 4TMXA 4D82A 4V0ME 2MMGA 2F3RA 3DZDA 2GK6A 2UKDA 4Q02A 4DCNA 1SXJA 1OKKA 1E1RD 4US0R 1DAEA 2PJZA 4TMVA 1IJFA 1YZUA 2KJQA 3CH4B 4GOKA 2PZEA 4AYTA 3KQUA 1Q44A 3KL4A 3REFA 1EX6A 1G6OA 2GCOA 3ICQB 1XEWY 2NG1A 3FHOA 1CXZA 4FMDF 4DVGA 1N6KA 4K46A 2DBYA 2X2EA 1KMQA 2J1LA 2NQ2C 3BAFA 3ZIAD 2GCOB 5B58C 4OI4A 2O8BA 1Q22A 3Q3JB 1NVVR 3C8UA 3EZ7A 4MRRA 3LLUA 3OHMA 5FPTA 3ZVMA 4DCSA 4Q7KA 2VYFA 1ESNA 1XEXA 2O8BB 3LQQA 3GQBA 3QPUA 2E9SA 3EC1A 1FX0A 5DIFA 1BYUA 1U0LA 3U7EB 1KI4A 4OK5A 5JHHB 4ESHA 2BMDA 2GETA 2PLFA 2GF9A 1FX0B 4P32A 4GSYA 1FMJA 1TAGA 3A4MA 1L8QA 2OXRA 3CO5A 4PAMA 3ZD6A 1NIJA 3IPXA 4QJ5A 5BQ5A 3B5JA 1CP2A 3CNOA 2Q0HA 4PX9A 2A2ZA 4WW0A 4DSUA 1P5ZB 1WRBA 2QAGA 2QT0A 1ZNYA 3UMRA 1E9CA 4NE2A 4X8OA 4UQOA 2W2TA 5FUWA 4KBFA 4M1SA 2P6RA 4LY6A 1JQLB 4LYFA 4B47A 1ZIPA 3C41J 5DHAA 5BN5A 4CIDA 4HSEA 3PEVA 4C0BA 4NYJR 4LJ9A 2FMXA 1NNEA 1Z06A 1ZUHA 3GLHE 3K0EA 3KX2A 1RRFA 2AKYA 4J0QA 5TVKA 3WMGA 1NMYA 4G1UC 2WOJA 3FHTA 3VNUA 1FQKA 1PJRA 4Z54A 1ZRHA 1BO6A 5J47A 2IHBA 1W36C 4JVSB 1W0JA 3BFVA 3D31A 4M1TA 5KPDA 1G9XA 2QTVB 3ND8A 1XJCA 3LVQE 2P6UA 5FL7D 3TUJC 1G16A 5IHPA 4X8MA 4EJSA 5AJVB 3AVWA 5D3MB 2IYVA 2OFWA 2PT7A 3N70A 2P2LA 4D4LA 4EJSB 1OH6A 2H8KA 1W0KD 2G77B 3UK6A 2GJSA 2BM1A 2FZLA 2PEYA 4ESVA 2DFKB 1QDEA 4L9WA 2FV8A 3BH0A 1JEEA 3PVSA 3QF7A 3L8YA 2WWHA 3VU9A 4TSFD 2H16A 1G41A 4DSOA 2D74A 4XWOA 4L5BA 3H0KA 4BZPA 4CEHA 1ZU5A 4WIAA 1A7JA 1RKBA 2QMOA 3LVRE 2OLJA 2G0NA 2FSHA 5LD2B 1X3SA 1KO5A 4KO8A 2BKUA 4LV8B 3OFNA 1IXRC 1KK2A 1ZM7A 1NN5A 2O8EB 4RVCA 1JQJC 1LS6A 1LW7A 2A5DA 2ZJ8A 4B34A 1R4AA 2BBTA 3NBXX 3FB4A 4A9AA 2ZQ5A 2YHSA 2OESA 2RH5A 4HAYA 2G3YA 1ZC4A 4DSTA 3GJ8A 3V4RA 4TZ6A 3P32A 4DLWA 4LPSA 1FP6A 4PHTA 2O0KA 3K9HA 4Q7LA 3LX5A 1J2JA 3VMFA 1OIXA 3A1UA 5DHFA 2AX4A 1EESA 2BDTA 2F1JA 2GKSA 3KKQA 4RZXA 1SXJE 4XSHA 3WNDA 1P6XA 3X1YA 4AYXA 4UNRA 3UXMA 5C46F 2CCJA 5H70A 1IY0A 2NPIA 521PA 2GEVA 2VQSA 4R98A 1KSJA 1VIAA 2NO6A 1E2LA 4ZO4A 1DAIA 3HU1A 4IDQA 3AQ4A 5J5CA 2IS6A 5DI3B 5FBQB 1TU4A 2A5FA 4C9BA 3RNLA 4JL6A 1LFDB 3SEAA 1CLUA 3R20A 3FYHA 1FL9A 3PG5A 1OYYA 1FW6A 3AKCA 1JPJA 4C0SA 2H1LA 1KO7A 2G6BA 3HR8A 5KNBA 4CYMA 3C15C 1SVOA 3SZRA 4ERNA 4Q7JB 3IDQA 2KBFA 2WKRA 5E7MA 1DTSA 2FPMA 2C98A 4MRNA 1FZQA 2ZS7A 3SJCA 5G41A 1YE8A 3SFVA 1UBGA 2J87A 1VCMA 5E4FA 1CR0A 2AR7A 5FH9A 3ZZUA 3IQXA 4UNQA 3L0SA 1DELA 3CRQA 3B85A 1IJEA 3TVDA 5BW8A 3UWOA 1XP8A 5DN6A 3VHXA 1MO6A 4HDQB 3FTQA 5EXTA 3IGFA 3NBFA 1ZCAA 1SVKA 5FI0B 1F5NA 4DRZA 4AKGA 2ORWA 4M0LA 4D81A 4FCVA 1VMAA 1XD8A 1F2TA 1XBTA 2OEPA 3PV0A 5FBWB 1E2DA 2Z4RA 4OK3A 5EZ6B 821PA 2FE4A 3N2EA 4Q9JA 2ZUBA 5TXGA 4GMXA 2IYLD 1YR8A 2RGBA 4JS0A 3CPHA 2CLSA 4ZI3A 1F60A 5DNYB 2ZRLA 4IVPA 4UXJA 1SXJD 5GADl 1OKKD 1VHLA 421PA 4NMMA 3SYKA 2RGNA 2Z4SA 4EAQA 4HEJA 4BFSA 3GJ0A 1E2QA 3CX6A 4POAA 4CF7A 1RRCA 1ESMA 4TL7A 1COWA 1W48A 2FG5A 2VP4A 4AI6A 1XEFA 2QE7A 2EFDB 4LGMA 1UDWA 1ZINA 1WP9A 4IEEA 3A8TA 4JLKA 3KJIA 1G3QA 3MD0A 3QEJA 2C77A 4JT2A 2X2FA 4YMUA 2F6RA 3E70C 4E07A 3GJXC 1AA9A 3D7MA 1AS2A 4MUBA 3EIHA 3GJ7A 2J5XA 3RRZA 5KSYA 4LHYA 1ODFA 1W5TA 4WZ6A 1YZKA 2YWHA 5FOWA 2WKQA 2R9VA 4M1KA 5C4MA 1TF7A 4NCJA 3FGNA 2JA1A 4M9XA 1Q1ZA 1AKEA 1GRRA 1XX6A 1R7RA 2GJ8A 3O8RA 3GEIA 4HLUC 1G3UA 1HQCA 4ZDJA 3ZLJA 3AVVA 4XWKA 1GKUB 2C9OA 3ZD7A 3LBHA 2BBWA 1P72A 1Z0AA 3AKYA 2FSIA 3BWDD 3VX3A 2HJGA 3T1TA 3SJBA 2B92A 4A2PA 4W5HA 1G21E 1N0WA 2BMEA 2DR3A 4PAQA 4AC9A 3U6BA 5DSZA 2GESA 1G5RA 2F9LA 1GVNB 2P5SA 5GJWC 2QNRA 4Q47A 4DT1A 1OE0A 2HCBA 1M8PA 2GK7A 3LQRA 3GJ3A 5AUPB 1VYUA 3W8RA 4A0GA 3WMEA 2J59A 2YZ2A 3G82C 4DT1B 5EUQB 4XWAA 1JXOA 1T3SA 3B1ZA 1ANKA 3PR1A 2YWEA 5EP1A 4WZBE 5KU1A 3KB1A 1GL6A 1BMFA 2GXQA 1W0JD 1XTRA 4HAVA 2PX3A 3PITA 5JHGB 4JJZA 4HYYA 1QHHB 2HJVA 1L4YA 1EFCA 1R0XA 3BIFA 3E1SA 2XGJA 1JNYA 1GTVA 221PA 5F3WB 1IQPA 3ONWA 2WWWA 1F2UA 1I4DD 1A82A 5SZHB 4IXMA 2C99A 4C0LA 1CRQA 2FZ4A 3IO5A 4AYWA 1IAQA 1F2UB 1L7VC 1XU4A 2Q3FA 2GZAA 1Z0KA 1HURA 1KJZA 2JIZA 4N0DA 2Q9BA 1SXJC 4LDJA 4ILEA 2ZRHA 5EE9A 5EUMA 1GRNA 2R8RA 2ZUCA 2REOA 3ECCA 4PANA 3MCAA 2MSDB 3QE0A 1SHKA 1X8JA 2DB3A 3T1OA 4KYIB 3R7WB 3RC3A 4MGYR 3H4MA 4JL8A 2ASEA 4P33A 4Q4LA 2OM2A 5E7IA 1CKEA 3LX8A 3OFND 1W46A 3FFAA 4AKEA 2D7DA 1D6JA 4B33A 121PA 1J99A 3B9PA 1KY2A 1NKSA 1LY1A 4MKHA 3K70B 4GOJA 1Q0UA 2R6DA 4W5JA 5C2JB 3I4LA 4BZQA 2OCPA 1T8TA 4C3ZA 4BFUA 4G5OA 1E0AA 1JALA 3LFUA 3TSWA 1OIWA 3FMPB 3U5ZB 2IYUA 1OXTA 2QT1A 3AF4A 4I4LA 3TAHA 1WF3A 2QAGC 3KKMA 2A5GA 1N5JA 1V43A 1E2IA 3CRMA 4RKEA 1N25A 5KNCA 1W4RA 4IFBA 1D2MA 3UG7A 3MJHA 1IXZA 2V7QA 4BQSA 1BS1A 3BB3A 4HZUA 4BFZA 1QHXA 1R5BA 3QI2A 4G0NA 4YC7A 1LNZA 1YVDA 3Q5EA 3OEED 3P4XA 3K9LA 3UWKA 1ONBA 1U8YA 4RZ2A 1I4LD 1CULC 1GZSA 2A5YB 2DFLA 2IC5A 3L0OA 5LB2A 3K0CC 3FMFA 1W36B 4D0LB 1SZPA 2XTNA 4HATA 2A5JA 4NYIQ 3BBPA 1EFTA 4M22A 2I3BA 2ATVA 4YMTA 3J81k 1RZ3A 4JL5A 3PUXA 5KYKA 4B75A 2OXCA 3PEUA 4KBGA 3GP8A 4IXNA 4Q9IA 2JLVA 4DLUA 4JVNA 1S2MA 4NYMR 5JS7A 3K53A 4JVLA 5F9FA 1G3RA 1IN4A 1VKJA 4ZDWA 3LV8A 5DN6D 3GLFA 1QHSA 2VBCA 1N6NA 2ZR0A 3A1SA 4UJ3A 5JWOA 2GAOA 3ZZTA 3I5XA 3GJ6A 3RVBA 4QJ3A 4EUNA 1ZM9A 5TB5A 2GF0A 1R10A 3VR2A 1VPLA 3W9YA 4IOLA 3UIEA 2LKCA 1KY3A 2ORVA 2AK3A 3K1JA 2CCGA 2DPXA 4A2WA 1UAAA 4OI0A 1NKTA 2ZE5A 3A1WA 4HLQB 2JJ2A 3ZDQA 4EPTA 2CDNA 2JJ8A 3A4LA 1N0VC 4A6XA 2Z0MA 4V03A 4A1FA 4QBIA 1WXQA 2P5TB 4NTZA 3M4YA 1LF5A 4B32A 3U4QB 1J90A 4O2LA 3T34A 2EFEB 5H68A 3EG5A 5L3SA 1PZNA 2B7CA 2O0JA 2EYUA 2QGNA 3TAUA 3QIAA 1GNRA 1LTQA 2KB0A 1W5SA 1S3SA 1S9DA 4JSYA 5L3SB 1COWD 5SZIA 1N6PA 3CBQA 3BS4A 1HH4A 2QE7D 3AF3A 2NO9A 4D4MA 3D3QA 2REXB 2K5UA 2WSSA 4UXIA 2GWHA 3IIJA 1RE0A 1ZM2A 2ZRJA 1RYHA 4C0JA 2PZFA 2QM7A 5AUQA 3OIUA 2JAQA 4OQFA 2BEJA 1JBKA 1GITA 3T06B 1DVRA 1MO3A 5BYJA 5H8WA 3AVPA 4HAWA 4N1AA 6Q21A 2LCFA 2ZYTX 2WJIA 4PPGA 4U02A 4TZ0A 4DEYA 1JR6A 1TL7C 2LWIA 5FPKA 1Y3AA 3KKNA 4ZI2A 1C4OA 2ZM5A 3QXSA 2PBRA 4P4TA 2ZS8A 4M1MA 5KSOA 3NDPA 3DKPA 3Q72A 1G4AE 2IWHA 3ASYA 2HCJB 2RGAA 1RW4A 1ZNWA 2VF7A 2IYWA 4DIDA 3BXZA 5FOSA 2H17A 3CZPA 1M2OB 4FINA 3AP3A 5L3RA 4NPHA 1M7GA 1P75A 4GMDA 4AG5A 4AURA 1N6LA 4DB4A 1UM8A 1E94E 5CM8B 4P4SA 4JLBA 1G20E 5GJCA 4TMKA 3RS2A 1X86B 3DMDA 1Q1BA 1GILA 2V54A 4P4SB 2A3RA 3AEZA 2ZXUA 1Z08A 1PUIA 3DL0A 3IO3A 2IUUA 3QBTA 1YJ5A 2RHMA 4LHVA 2QMUA 4LJAA 2CL7X 2IS1A 3RS7A 4II7A 4TQAA 3PENA 2F1RA 2AD1A 3BORA 4V02A 3THWA 2YVUA 4CT5A 4NDZA 2ZSBA 3GFPA 4IDPA 2ZYWX 4MITA 4QGHA 1MO5A 3FMOB 2ZE6A 2WICA 3THWB 4BEJA 3TW8B 2JIZD 5JFGA 3AUYA 1GIAA 2WZQA 1MABA 1Q57A 1TQDA 1ZD9A 2GHIA 2EYQA 2IA5A 4Q01A 2RGNC 3IHWA 4ZCMA 1QZXA 2CVFA 2XZPA 2OFXA 2X19A 3UPUA 2G83A 3FOZA 3EC2A 1J7KA 4LV5B 3C5HA 3RSOA 4QC2A 3TKLA 1XD2A 3UMFA 1Z6TA 1BH2A 3GLFE 2ZR9A 3GLHB 3KZ1E 5GVRA 1XD2B 1XMVA 4GT1A 3RHFA 1NSFA 3KJGA 4RZUA 3TIFA 4HLUA 1MO4A 1U8ZA 4M53A 2IHYA 3K70D 1DADA 4JT4A 4O2RA 4EQ6A 3MWJA 1KI1A 2QI9C 4B3DA 3A6PC 3I61A 4DJTA 4EFLA 1FOEB 3QF4B 5CDFA 1DAFA 3VFDA 4EQ6B 4RD0A 5EP4A 3QXHA 2WMNB 5JRZA 4AWXA 5IRCD 2YOHA 1JI0A 1Z0IA 2F1IA 4RFSB 4DXAA 4KU4A 3ADKA 1NVXQ 3AKEA 3QVVA 4B3GA 2XJ9A 2HYIC 2VP9A 5HPYB 3SN6A 4P0TA 4WOPA 3F3YA 1GWNA 1HUQA 1I2MA 5FPHA 1ZIOA 1FNMA 2V7QD 5IDVA 5L3VA 1VECA 1E1QA 4FCWA 4ZCLA 4LYAA 1TNDA 4NYJQ 1KO4A 5AK0A 3REGA 2ZI6A 1XTKA 2PH1A 3I72A 1P2VA 5E3HA 4F93B 2ZUDA 1DEKA 1RFLA 4Q4AA 4FMCF 3NKVA 5E7JA 1W4CA 2XX3A 4F38A 1JAHA 3SOPA 4MQBA 4TYQA 5J4KA 3NIBA 2XNDA 1SVLA 1R5NA 1S8FA 1XXHA 2J41A 1W2HA 4TN1A 4OHVA 1OSNA 3R9IA 4MYHA 1KKLA 1S3GA 3NC0C 3EZ6A 1XZQA 2OE2A 1WBDA 3BRWD 4PFSA 4Q1DA 4EFNA 3M0EA 2V55B 1KDOA 3KKPA 2ECKA 1CF4A 3D8BA 4JLDA 1XNJA 1N5KA 1TQ2A 5F2EA 2QP9X 1SXJB 2H18A 1GRQA 4B2PA 2QEQA 3NC1C 3SFZA 1IN6A 1NF3A 1NBME 5DGXA 4AY2A 4OBEA 4PXAA 4URVR 3C4JA 3OIVA 4H1UA 1QHGA 2JJ2D 2YWGA 4H1VA 1OH8A 2AHOA 5DI9A 4ZDKA 3TLXA 4DDUA 4HB0A 5G3YA 4BLRA 3TR5A 4OI1A 1S0UA 1VYVA 1XEXB 1M7HA 1P62B 3JVVA 3WBJA 3K70C 3FE2A 1HT2E 5SZKB 2JJ1A 4PHHA 4MYUA 3H86A 4KSBA 5CJ2A 1FP7A 4FMDB 2FDCA 3HDTA 2L0XA 2WSSD 2DHRA 3ND9A 4GFDA 2JEOA 2ZJBA 2AN9A 4PC6A 4G5SA 1HTWA 2DYKA 4JLOA 4CEIA 3AF2A 5GJVC 1IM2A 1XTSA 3FWYA 1TMKA 2QAGB 5JBQA 2IW3A 2W2XA 5IK2A 4CEIB 1P9RA 3NBYC 1JR3E 5KTYA 4LX0A 4KCGA 2O8DA 4ASUA 2P67A 2WJHA 1C9KA 4M1YA 4BLQA 3K0CA 3PUYA 1GL7A 3PEYA 1YZGA 3NVAA 4BFXA 3IIKA 5EP3A 3UMSA 1P2SA 4E03A 4UKDA 4DZZA 2ZRFA 4PO9A 3SS8A 4IRUB 3PXGA 4ABYA 5TMPA 1TADA 2B7BA 3AV0B 3CRRA 4DKXA 4TTPA 4NCHA 3TVTA 4GBMA 4A92A 1YZNA 5CB8A 2WIAA 5CDFE 3C14C 4L15A 1XMJA 1KGDA 4EPYA 5KDDA 2B21A 4EPWA 4GL2A 2DWQA 1Z2AA 2CBZA 2HT1A 4G5GA 1JJ7A 4GRAA 4FI3C 4GNKA 3FPAA 2W83A 3KJHA 3X1WA 1E79A 3VU9B 1MV5A 4ON9A 4PC3A 2AFIE 3BOSA 4ACBA 4QL3A 5F9HA 1CJTC 3A58B 4RD1A 4WXPA 2YV5A 4M8NE 4CEHB 4B48A 5DYGA 3EPKA 3JZAA 4MGIR 4URXR 1ZYUA 4OKSA 2A9KA 1ELOA 2VHCA 1HQYE 3W5JA 3HR7A 5CLLA 3OIYA 2Q6TA 5FR1A 3V00A 1CRPA 3TE6A 3LBIA 3SBDA 2HV8A 1XXHE 3SC3A 1KZ7B 2BWJA 1OIVA 4FXPA 4QHTA 4WZAE 1N6RA 2QQEA 2BBSA 2ZETA 4KSCA 1Z63A 1AJEA 1YHNA 2D62A 2XSZA 4Q18A 1P7CA 3K8YA 2BJVA 3U3KA 4LRWA 4ARZA 3TUZC 4S35A 2KSQA 3IBYA 4G5QA 4IVRA 3RC8A 4ARZB 4B2LA 4W7SA 1CJMA 3FVQA 5HCNA 3A1TA 3ZGXA 5EXPA 4F7WA 2P65A 2CLCX 3SJAA 4D4JA 5K8IA 3H2YA 4OQMA 2JLWA 2WIBA 4ZIRA 1GKYA 2N42A 2HYDA 3LO5A 3IEUA 2F3TA 2I1QA 3VHLB 2NO0A 1W4AA 3KUDA 1XJQA 3CF6R 4HLDA 3TBKA 4ZIRB 3QSYA 1ZC3A 3MMPA 3NG1A 4JKIA 4MRVA 2GEDA 1SKQA 4CRWB 5HR5A 3U61B 1UF9A 3SQWA 1FUKA 4F4CA 2BV3A 3ZS9A 4B43A 4TYNA 2IYTA 1X6VA 4QNMA 2JLZA 2BHRA 5DLQC 1JEDA 1XF9A 2CCKA 1VG0B 4V0KA 3Q5DA 4B6FA 5CM9C 2B8WA 1GSIA 4DLYA 1QHYA 5SZJA 1NIPA 1T3HA 2W6JA 4AKHA 4NL4H 2PMKA 3X1DA 1E1QD 3CR8A 3ICEA 2WKPA 2VHTA 1G64A 4N0EA 5DH9A 5FUYA 2ZI9A 3S1AA 1KI9A 4JIMA 4LUCA 4RKFA 4JLMA 4TYYA 2QG6A 3IEVA 2FFBA 3RAPR 2XB4A 2QTFA 2KE5A 3PUVA 1AZSC 1J70A 2OLKA 4F91B 1E2NA 1E98A 2XNDD 3TSZA 3ASZA 4QHYA 1X1RA 5ELXA 4IDHA 1GL9B 3BB1A 3SNHA 4LBWA 3ZVLA 2H7VA 2RKOA 1F2TB 4JYBA 2ZRPA 5BN3A 3HWSA 3RSLA 1U9IA 5BWMA 2VSOA 3O8BA 1K5DA 3B82A 3M1IA 2ZYUX 4AIIA 1HA3A 2WWGA 4QFMA 1XPUA 2WWXA 1HT1E 3EA0A 5FTKA 4QJ4A 3OE7A 1UEJA 1DAKA 2WMOB 4UNNA 4BLOA 3NHAA 3HPQA 2R6GA 1F48A 1EFHA 1TEXA 2BEKA 1KK0A 2VP0A 2BCJQ 3MG9A 2IXEA 2QU8A 5JCZA 4D6PA 5EXXA 1TX4B 1Z47A 3WP0A 1V5WA 1B23P 2QRZA 3UATA 4I1SA 3QUSA 3LDAA 5J4YA 2H57A 4JMPA 2IWRA 5FOXA 4DCVA 1KSHA 1N2CE 4A15A 4HB4A 4Z51A 3BERA 4QM6A 3KUCA 4GPTA 1U0HC 4B44A 3HU2A 3L0IB 1H8HA 4M21A 2ZJOA 4NCNA 5G3ZA 3SQXA 2PCJA 3QVUA 2EQBA 4KVGA 1W1WA 4XSGA 2JJ1D 1S96A 3BFKA 1CS4C 1MKYA 2E1RA 2QENA 2C8VA 1Z6AA 3QJYA 4KAXA 1W44A 4IOJA 1ZU4A 2ZAMA 4NH0A 2FN4A 1GG2A 2Q21A 2YOFA 1E2PA 3CNLA 4PQRA 5KDOA 4MYCA 3D6TB 2YYZA 1UDXA 3EWAA 4QBHA 2NMVA 1P73A 1HV8A 2A7QA 2WAYA 4IHQA 4PQYA 3IILA 5IK2D 1A2KC 4PPNA 4KLNA 4GZMA 4BRWA 1KZGB 3LH5A 1EFUA 5E95A 1Q1QA 2JATA 2YC2C 4OYHA 4ASUD 3B2EA 3QENA 1E69A 1ZAKA 2QY9A 3THXA 4IDOA 3UG6A 4QXAA 3B9QA 2ZSDA 3QQ5A 2NPFA 1Z28A 4ZV4A 1AGRA 2QTHA 4KVAA 3E5HA 4PSKA 5EE3A 3NXSA 2FOLA 3THXB 5LBIA 4B71A 3DM9B 2V3CC 3C16C 3I1FA 2IEYA 1JXMA 4M4SA 4EPVA 1G8HA 4TMWA 4TTRA 2FGKA 4A0RA 4Q1BA 2VEDA 3OF5A 2ZE8A 2D7CA 4Q5IA 1R6BX 1VCNA 4QKQA 2WWIA 3KXLA 3P4YA 4DLSA 3FMIA 2LKDA 2GXUA 1OF1A 1Q3HA 1WE2A 2Z6VA 3EWSA 4LV6A 1OV4A 4RD4A 2BC9A 3EASA 4PZYA 4DLRA 3B78A 1E2HA 4YQFA 5K8TA 1DO0A 1E79D 2ZJZA 2FWRA 2F7SA 1QHIA 4ACAA 2EWWA 1II9A 3B60A 3EZ9A 2VSXA 3O47A 4C0HA 3KFVA 4ZKDA 1IBRA 3RLFA 4B76A 4LI0A 1BOFA 3QXXA 4MRSA 5CITA 1E9BA 3AB3A 1IN8A 3QOFA 4MYTA 5KUTA 5JSZA 1SKYE 1OYWA 2CXXA 3CH5A 2NO1A 1GNQA 4PPQA 1T0JB 3DMNA 1RC8A 3WRYC 3CPEA 3P1JA 2XZOA 3W90A 5BN4A 5GVSA 2Z83A 3RRYA 2J46A 1ZVQA 2FU5C 2XSZD 3R8FA 1Q12A 1E4YA 4D0GA 1GOTA 1Z6GA 4BLSA 3ADDA 4Z8XA 2PX0A 2R65A 4YDSA 1Z0DA 4BASA 1MOZA 2RGXA 2ZTSA 3BJIC 1TTTA 2QORA 4XVQA 4PC7A 3T12A 3T35A 1H65A 1TEVA 1E96A 2W58A 1T3LA 5A5GA 4B3BA 3BE4A 4B3XA 1AK2A 3PUZA 4OHYA 3TMKA 1OXUA 3EPLA 2ODNA 5FL3A 3RRNA 1OB5A 5KDLA 5FBRB 1NN3A 4D4KA 4LYHA 5AJXA 1PLJA 3MWKA 3QXCA 2FH5B 5JECA 1E6CA 2JLQA 3CRVA 3EXAA 4HZUB 2ZEJA 4OL0A 5FOTA 3WXMA 3SJZA 4UNSA 3F5FA 2XEXA 1AIPA 1IY2A 2GXAA 1UEIA 1XCMA 4FWIB 1E3MA 2ZRGA 4Z1MA 5EJEA 4QM7A 2G1KA 1DARA 2OAP1 3VQTA 4BUJA 5FI1B 2R6CA 1G3IA 4KFTA 1NRJB 2ZJ5A 4JYCA 5GJBA 4G5RA 3EX7C 3BFXA 4NKRA 2W6JD 4V0OA 2ZVQX 1WA5A 4DBLC 3CWQA 4ZKEA 1A4RA 1AS3A 3A4NA 4EKDA 1G5TA 2ZJ2A 5FOUA 3U2QA 1D8TA 1OJLA 1W2GA 3CUEF 2Y8EA 2VIIA 1OXSC 1KNQA 3Q9LA 4RSGA 1ZUNB 2WSMA 4RZ3A 2IYZA 2ZVPX 3QG5A 2ERYA 4YXWA 2QBYA 4DLTA 3GLFB 3A1VA 5CJPA 4D2IA 4DB2A 2GDJA 1G7RA 3MUFA 2WJJA 3N5CA 1PUJA 2XOKA 2ZI3A 5TARA 1E9RA 1EWRA 2RGDA 2DCUA 1UBFA 4L4UA 4DEXA 3SI7A 1AQUA 3OEHA 4Q21A 4NBSA 1E1RA 3B1YA 3CKLA 3U3MA 4JBWA 1OFIA 1TPZA 5EP2A 1W4BA 4RJLA 5C4GB 3OIWA 1E9AA 2H5EA 2B8TA 3NEYA 4IW3B 4TMZA 1CR2A 3DVLA 3W6OA 2GVZC 2ODWA 1UKEA 1XZPA 2ZRIA 1E0JA 1JPNA 3L82B 3OE7D 4HUQA 1AN0A 4TLCA 1YRAA 5KO2A 1WBBA 2C95A 3I8SA 1OXXK 1QRAA 5CYOA 4BFTA 5K8UA 5AR1A 3I62A 4HUQB 1DOAA 2NZJA 2XTMA 2FPKA 3MGCA 2G1JA 4CDGA 1NJGA 2X77A 3ZS8A 3HPRA 2JLYA 1DAMA 3TGPA 1NJFA 4MGZR 3QXJA 2GXSA 3CX7A 2W0MA 3GPLA 1D9XA 1EX7A 1T0HB 4TYWA 1Z2CA 1CJUC 2WAXA 4JVMA 1HY3A 1H8HD 5IF9A 1MH1A 2CHQA 4P31A 1GNPA 3VR6A 3I32A 4UXHA 4JLJA 1U94A 4B3FX 1FTSA 2BOVA 1KAOA 1OT3A 2CL6X 2QPTA 2R2AA 2WWFA 4X8HA 2XTZA 2ONJA 3AH8A 1FTNA 4C30A 3B13B 3NTUA 2EFCB 1CR1A 2EWVA 4DCTA 1P2UA 3VAAA 2R44A 1KK1A 3AVTA 1F3OA 2VTKA 3VR4A 2NOAA 1OLOA 5J4HA 4URZR 2HUPA 4LBVA 3W34A 2V1UA 4X8LA 2GNOA 2FNAA 4QBFA 1N6IA 2IYYA 2IEZA 3X1XA 1EG7A 1TUEA 3X2SA 3EPHA 3GJ4A 4LPKA 3BK7A 3EPJA 4BWYA 5L8VA 1NBMA 4A2QA 3TQCA 2RGCA 4QRHA 3W3ZB 4MDFA 1D2EA 3K9NA 4NYIR 3WY9A 4F4JA 2ZANA 4DDWA 4QGGA 2QP4A 4P3YA 1BMFD 1OW3B 1OHHA 3QKRA 3QNUA 4MKGA 1VDZA 4PO8A 1LB1B 1G291 4LK2A 4KV9A 3DM5A 1KMHA 2WOOA 1KAGA 2OT3B 2PMDA 1L4UA 2J7PA 3QKRB 4R71A 1Q20A 4DUGA 1NVUQ 4DDTA 2C78A 2MSEB 4W9MC 4HAUA 1N5IA 1N6HA 2E87A 4Q1AA 4NHOA 2NZ8A 1U9IC 5L3QA 5EXSA 4LHZA 4JLVA 5FFMA 1SVMA 2Z5FA 4A4DA 3U7FB 3W5IA 1E9SA 1NG1A 3SHFA 1MABB 1D2NA 4E22A 5EE0A 2G9NA 1JR3A 3QY0A 2WJVA 2XXAA 1YZLA 1GM5A 1T4GA 2AWOA 1H8EA 4MRPA 4F92B 5LPNA 4URYR 3U6KA 3KQHA 3NH6A 2XXAB 1U8AA 4RY2A 1T9HA 1NVVQ 4TT3A 1TUIA 5JI3E 1GAJA 4HUTA 2C5LA 1IONA 2J9RA 1NL3A 2BCGY 1FNNA 4P4UA 1TF5A 3QEOA 2GBLA 2V1XA 4B3CA 3ADCA 2MMCA 1ZCBA 1HYQA 1SULA 2OG2A 2PL3A 1FFHA 1M74A 1II0A 2HT6A 4KFUA 2CE7A 1WMSA 1R5OA 2QQ0A 1HE1C 2AKAB 5FBLB 5IT5A 2KI5A 1AKYA 2OHFA 2PT5A 1CBUA 1JECA 3SBEA 2ZSFA 4KITB 5CK5A 2YWFA 4IFEA 2VHUA 1M7BA 3P27A 4TYPA 3ZZ0A 1WB9A 2AWNA 3BGWA 4PZLA 2FFAA 1E2MA 5CK4A 2BVNA 4CVNA 4IOKA 4EPRA 1P3JA 3LNCA 1UFQA 3G5UA 2GEUA 2O8FA 4MA4A 3LD9A 1P61B 4OQLA 4PSVA 3ADBA 2FEOA 2O8FB 3T61A 1KI6A 1G8PA 1FQJA 3LWNA 3GD7A 4Q19A 3MWLA 3TQFA 3DEFA 2RCNA 2GTPA 5F98A 4Q4AB 1D9ZA 2EU8A 3IKJA 1I4TD 4KLZA 5B2ZA 1KI6B 4CEJA 2J0VA 2ORIA 1KO8A 1YR6A 2V4ZA 3AP2A 2YINC 3FKQA 3CF2A 4Z1MD 5KOYA 4B6EA 2WJYA 3LY5A 3KQLA 1O87A 4K8OA 5AJZA 4WVFA 1XXHB 1NY5A 1R0ZA 1DE0A 3LW7A 1G3MA 4PO1A 3K0AA 3WHLA 3LXRA 3P26A 1KNXA 2ZE7A 1Z83A 3ETLA 3TUIC 2VL7A 4XJXA 4FWTA 3MLEA 3CF0A 1VCIA 5JJLA 3GJ5A 3K0AB 2OSBA 4BLPA 2GAAA 1U98A 5HZHA 2UZIR 3BH7A 2JLUA 3KB2A 1PV4A 2CLDX 2GCNA 1FPMA 1ZM3A 4YXWD 4KJZA 2F43A 2N1BA 3QKSA 4JBXA 4RCZA 4MH0R 5CYPA 4GOXA 5FOVA 1QG2A 4HDOB 1G7CA 2SHKA 3I3SR 1UBCA 2EFGA 2XOKD 4KFSA 1AQYA 2Z43A 3LW8A 4TWZA 2F43B 4PR0A 3QKSB 2ZRAA 3AVUA 1ZNZA 3OEHD 3HJNA 1GKIA 1MR3F 3Q85A 1XFAA 4HB3A 4CT4B 1M1YE 2RMKA 2XNSA 2IS4A 3M6AA 4KXFB 4DDVA 1XCPA 2OCYC 1S1MA 4O3MA 1Z29A 2YJTD 1YR7A 3AKDA 2YOGA 3B1XA 4ZCIA 4CGZA 2OCBA 3GLGE 2ANCA 3WYFA 4LJ5A 3CIOA 4CW7A 4KHZA 4XOIA 1LS1A 1P4SA 2QSZA 2ZYVX 1SVWA 5BYKA 4ZDIA 3NBZC 2VP2A 4YLGA 1NN1A 5JJIA 2C2HA 2RHDA 4TQ9A 1Z22A 2ZI7A 5DISB 2JLXA 1XTJA 1S4QA 1G7TA 2VSFA 5HE8A 1W7AA 4DC9A 1RVDA 4XTRA 5K8LA 2GILA 2R62A 3B1WA 4B73A 3BD9A 5FR2A 1U2RA 2HF8A 2VH5R 4HAZA 1W49A 4C2UA 2F1HA 1XRJA 3B1VA 1CJVC 2YC4C 5J4LA 3U7GA 2J45A 2FJUA 3Q8XB 2AD5A 5DYIA 4A8JC 1II8A 2EW1A 2WPDA 3L2OB 1YZQA 5AUOB 2YKGA 5JWHA 2O8DB 2FFQA 3U3JA 2EFHB 3N2IA 5KPJA 2ZRKA 1R0WA 2NTYC 2XAUA 4LC1A 4GZLA 1GP2A 1II8B 5HCIA 2GRJA 2JDIA 2C04A 2RAPA 5JCPA 1IXSB 4LWZA 3TJZA 1P9NA 5FTJA 3GFOA 2CVHA 4JLNA 1XB2A 3GEEA 5HKKA 4C0QC 2CK3A 3IQWA 2ZROA 2WHXA 1NBMD 4BPBA 1N5LA 1GUAA 2JCSA 5D3MA 4U5XA 1N3BA 3MSXA 3C7KA 1CIPA 2OUKA 5JMTA 1AGPA 2OAQ1 4BE7B 4L9SA 3RS0A 1NLFA 3GEHA 4I81A 2WTUA 4NCIA 5DO9A 4R2HA 1XPRA 4XD7A 1OHHD 4WAUA 3GLIE 4DLZA 1VHTA 1G7SA 3E2IA 4D0NA 3X1ZA 1MRNA 3QKUA 1E4VA 2OBNA 3RWMB 3EZFA 2PJRA 4H9GA 3RYTC 2ONKA 3UANA 2OILA 2J7PD 4BZXA 4DUGD 1Z6XA 3RABA 4M1OA 3U60B 4FIDA 4BRUA 4Y0AA 1G19A 1CU1A 4IVQA 1KOFA 3HYTA 4FD2A 3K0FA 4BFVA 1NN0A 4RD2A 3TR0A 4XVUA 2IUTA 4US2R 4K81B 4V0NA 4AKIA 1IN7A 5TY0A 1RJ9A 3EW9A 4RD6A 3T1QA 4BFYA 4IDNA 2O8EA 3K0FB 3KXIA 4IJMA 1E2JA 4OQNA 1JR3D 1RJ9B 4LCBA 2DFNA 3AF1A 1H8ED 3THOA 4A0FA 3RRMA 1P2TA 2F9MA 4HLCA 2ERXA 5FPSA 4TT3D 2R6FA 4TTQA 4IKEA 3WNCA 1AM4D 2BBOA 3T1VA 2DFTA 3PCRB 2FGJA 2ZR7A 1PLLA 3PUWA 1TQ6A 3IUYA 4MGKR 5EE5B 4BFWA 2G88A 5FTMA 3DO6A 1NSTA 2FEMA 1Z0JA 3OAAA 2A30A 3TH5A 4C2TA 3CPJB 4BLTA 2FFHA 5B64A 2IUSA 1TU3A 1F6BA 1S9HA 4D26A 5DI3A 2AFHE 2B6HA 1NG9A 3T5DA 5P21A 3ZVRA 3GCGA 2O52A 5JEEA 3V4FA 2QUZA 5KSZA 3I5YA 2GVDC 3L0PA 1KTVA 3TRFA 3OEEA 1S1CA 2XITA 3CRW1 1E2GA 2RGEA 3FHCB 4AD8A 1UKYA 3CR7A 3DDCA 4I99A 1EK0A 4PC1A 1UJ2A 1R8SA 1RIFA 5UKDA 2HXSA 4U00A 1CJKC 3W8NA 2QPAA 2VF8A 4EPXA 3S1AB 1XJ0A 2JGNA 2Q3HA 2X1VA 1Z0FA 1ZP6A 1JB1A 3LA6A 2V6JA 4QGAA 1ZD1A 4URUR 5EZ5A 2ZRNA 4BGDA 2ATXA 1Z6YA 1SKYB 3KXKA 2O8CA 4Q03A 4Q1FA 3B7GA 3PIRA 3THYA 1X8KA 1M34E 1VYTA 2IL1A 4PZZA 2RB4A 5M04A 5JS8A 2O8CB 3W6PA 1QG4A 3K09C 4E09A 3THYB 1X1SA 2Q9CA 2X8AA 4D25A 3DPUA 1A2BA 2QL6A 3CZQA 3JVUA 2ZRCA 1M6NA 4LOAA 4PHGA 1KYIA 4TLBA 2J0UA 4KI0A 2CHVA 5JI2E 1K8RA 1E9FA 4LC0A 4R2IA 5EE1A 5A4JA 1QVRA 4IEIA 3T5GA 2QMHA 2J0UB 2W00A 4KODA 3TK1A 4ITRC 3DOFA 1Y63A 4PC2A 2O0HA 2GJKA 4WA7A 4DHEA 2P0EA 1KI7A 3HU3A 3VKWA 1NVWQ 1KSGA 5ANRB 1E9EA 1ZUIA 2JASA 1VG1A 1UADA 4LJ8A 1XPOA 1VG8A 2MSCB 2GBLC 1N0UA 1A5TA 3MAAC 4YMVA 3ZVNA 4B74A 3VX4A 1XTIA 1NLZA 4MUAA 5LDDC 3W6NA 4AG6A 2VPPA 3FFBA 4HZIA 4LHXA 3O8DA 4TLDA 4GI7A 2F55A 3IHLA 3SYLA 1XD9A 3HYRA 3Q7QA 1I2DA 1E32A 1WCV1 3U44A 2WBLC 3IBGA 2BM0A 1J8YF 3EZ2A 5KSPA 4C0AC 3F8TA 3DHWC 4Q48A 4HDCA 4GDFA 2CMKA 5AJWA 4G01B 3TW4A 3U44B 3VKHA 1YKSA 3EARA 3MWYW 2QMEA 3FKSA 2DWOA 3AP1A 2WPDD 2TMKA 3KDSE 3NWJA 1G8YA 3H1TA 3LBNA 1P60A 5C1BA 2CEAA 2HEIA 3ZH9B 2BMJA 2QA5A 3DKVA 4FMBB 2JDID 4HB2A 1X8LA 4A0HA 1BIFA 1DPFA 1TQ4A 5D3QA 5DE3A 2HDNB 2WM9B 4MDEA 1E2KA 1E0KA 1Z07A 4O25A 1SVIA 4U7DA 2QGZA 1EGAA 3ZYCA 5HKKD 2IYQA 2HF9A 2CK3D 2OO7A 1PLKA 2ZREA 1KK3A 2DWPA 1KDTA 5AWFC 4C4PA 1QHHA 1HE8B 2IF0A 4PQFA 4NYMQ 3C5CA 1SGWA 1NI3A 1DG1G 3AUXA 2W6IA 2BMFA 4XD7D 4JLPA 3AVXA 1E0SA 1GFIA 2CJWA 1Q3TA 2OCAA 3VKGA 1R0YA 1ZBDA 1UKVY 3BB4A 4ZPXA 3ZQJA 2G0TA 4W5WA 3WRXC 4XVRA 2CJWB 5J40A 5LB4A 1KO1A 4Q66C 3IPYA 2ZI5A 1Q21A 2UVQA 5A0FA 3R9XA 2FPLA 1Z3IX 3R7WA 3CNNA 3G0HA 4A6PA 5H1YA 1FMLA 4OK6A 2Q3MA 5JSZB 1W47A 1OH7A 3KQNA 1KSFX 4QG7A 3SYNA 1J8MF 1K5GA 3CW2A 1AS0A 4B2IA 3U3OA 5J4VA 3WYAA 2QSYA 5G53C 5JZVA 3EIQA 4XH9B 2ZRBA 1NMZA 2HLDA 4I1UA 4EDHA 2DY1A 4Y0VA 1T8UA 2C9YA 1EFRA 3AGQA 4QBGB 2VRWA 3A37A 4TL9A 4GP6A 4LZZA 1OFHA 1QBKC 1JJVA 1U81A 3L8ZA 1U90A 2ZSEA 3W3AA 4QOSA 1DAHA 3RS3A 3U3RA 3CLVA 5G40A 2I1VB 4NP6A 2BJWA 4LYJA 4XTCS 4LJ4A 3KQKA 2WVJA 4A8JA 2VHQA 4OI2A 1KI8A 1O3YA 4HI0E 1ZD8A 1ZJ6A
chains in the Genus database with same CATH superfamily
5MHTA 3SU8A 4AS1A 5TQ2B 2C96A 4QHSA 3SE0A 1P5FA 4DZRA 4TLAA 3F97A 4OJNA 1IOLA 1RHJA 4J0CA 4RFVA 3RFXA 3SQDA 2A84A 4B7ZA 1RYDA 1JQEA 1AZTA 3K9WA 1W87A 4HMOA 3JQ8A 4R40A 3VV3A 1YGYA 4D80A 1J23A 4ECAA 1PVVA 2PQMA 4F1WA 3II6X 2HXYA 5EJ2A 4OHWA 1A8HA 1JI3A 1D4FA 3AW9A 1UFOA 4E5NA 2CF6A 4GOMD 1BYIA 1PQPA 3NWEA 3UUWA 5BWLA 3OZTA 4WTOA 1HDGO 1RXEA 1G18A 3V9PA 1KI3A 3KSUA 3P9ZA 4N0MA 3UICA 3CVJA 1KEEB 3MUEA 5GONA 1DLJA 2ZBPA 3VZDA 1OZ0A 1T2FA 3OLWA 4P4GA 5C5DA 4DR7B 5TS3A 1IHYA 3W77A 4KDCA 3T9CA 4CIXA 4A36A 4EJSC 2VWHA 2HLHA 4O1IA 2ZUTA 5C4IA 1ZXXA 2YRXA 3HM2A 4HAXA 2PXXA 4CMAA 1XN4A 4FYHA 5L53A 3BRSA 3QG1A 4Q00A 1OA0A 3VKVA 2QBYB 2F00A 3JCZA 3UGKA 3LXXA 3ND7A 1TCAA 3MGKA 4IOMA 4KEAA 4MIYA 2FVYA 4U2KA 4PX3A 3ZQ6A 1Y48E 1PL0A 4YFYA 3WNZA 2FSFA 1TMYA 1SUEA 3H8JA 3ZV4A 4J6EA 1XHLA 4ZZ1A 5EJAA 5FBKA 5KQGA 3GCZA 4LZNA 4AJKA 1WDKA 2DQZA 1HE3A 5K3AA 1P33A 5HEKA 2WF8A 3HH8A 3GFTA 4HP8A 4YTEA 1G17A 3N75A 2DPGA 3RFCA 3TTYA 1TM4E 2MYUA 1SVSA 4CNQA 3NDBB 1HLDA 4ZEOA 4YWJA 4KQWA 4NONA 3KPUA 2PD4A 4ZT5A 3RU7A 3GK3A 4BNUA 2F17A 3VXKA 4ZWNA 1W85A 4DANA 2JRLA 3L79A 3QNMA 4UBKA 4BAZA 5ITWA 2M32A 4BX0A 3LTNC 4NOJA 1TZBA 4LJYA 3DWFA 3LKBA 3HB1A 1R16A 4K6FA 3CX8A 1W85B 3MTEA 4L72A 5BSEA 1DJPA 4U63A 2RBKA 3MB8A 2AVDA 1DG3A 1XVTA 1I9GA 1IG3A 1CQPA 2AXNA 4EI9A 4Q34A 1XWIA 4FN5A 1LDBA 3PHCA 4JKYA 5C18A 4TS1A 2HHHB 1KI2A 4BU1A 4UNPA 4RD3A 1A8IA 4J76A 4NJMA 3BL5A 1T0BA 3WLKX 2HM7A 1FBNA 2VWGA 2Q9UA 5CYFA 4CV1A 4EY3A 1WSBA 5FAKA 2CLKB 5BSWA 5IJ0A 2EJVA 2GA9A 2GN9A 8ADHA 4LE1A 3DZKA 4NJMB 1JV2B 1E8NA 1MRSA 1H2ZA 1Z2NX 5IJ0B 2NGRA 1LPAB 1IEXA 2Y92A 3G89A 3FYSA 3WO0A 3RH0A 1D09A 4KQ6A 4NDAA 4BMSA 5LQDA 1KDPA 3FPSA 4HWPA 1D2CA 5T41A 4OHZA 2JLRA 1XUOA 1YE5A 3NYIA 3QBVA 3IHTA 2C3PA 4G1FA 5AOCA 2OGTA 5CTJA 4MUMA 3U31A 4EW1A 2M1XA 4QARA 2I6XA 1YB4A 3ZKWB 5KWVA 1PKEA 5AT1A 4AJ2A 5K8VA 2IXGA 4V0MA 2IF2A 2AK2A 4DUYB 2FRXA 4DWJA 3ZCXA 4M54A 1TVCA 4LDRA 1TM3E 3R8CA 1R2QA 1Q6ZA 1IOZA 2BT4A 3KR2A 2WNHA 2G25A 1EP2B 2D3WA 5EQTA 1W0KA 1SEVA 4BATA 2HRDA 2JI4A 3EDCA 1KDYA 3RUDA 1KZYC 3P2MA 3MFYA 1M1YB 1MHPA 1MT0A 2VPYA 5AOBA 4BRZA 4Z7JA 3AF0A 2VSQA 2ZAOA 2W0SA 3RVNA 5CB4B 1UPUA 3HCOA 1RKVA 2IXFA 2ZI4A 5FDFA 4XPIA 1G8FA 4TSFA 1KJWA 2EVWX 3FRHA 3GGDA 3DLIA 3E61A 3Q40A 2QM8A 3MTBA 1IC6A 3WC4A 4PLPA 5KJEA 4XPIB 5CVCA 2AZXA 2FSPA 1U9YA 3M8KA 5L3QB 2JGEA 1A04A 1BKDR 1DJOA 1FRNA 1D2HA 3I9V1 4FHEA 5ADUS 3D5QA 1TFRA 2PZMA 3ZU2A 1KBQA 1OB2A 5IYZF 1J8VA 3FAZA 1H4TA 4PSAA 4O4IA 1P2BA 2OOKA 5BWOA 1R6AA 3TW8A 3IUPA 1Q16A 3N7TA 3FDIA 4TMTA 2IH4A 2KLBA 4RK6A 2C9CA 3SM9A 5M34A 2QX4A 3NAMA 4IIEA 5CCXA 3SJUA 1RPZA 5FUVA 2EZ4A 1FCJA 3QPVA 1QS0A 3OZBA 2HIHA 4GI2A 4PGFA 3PGLA 4LOLA 5E0OA 2PEZA 2DFPA 1KYTA 1Y6JA 4IF4A 5DLDA 1JLLA 3PP8A 3QPDA 1YRBA 4L16A 2RGGA 5B5SA 3F0TA 4N0QA 4HFJA 4RY0A 1U6KA 1I14A 1QFXA 2O2ZA 4RWEA 4ZVVA 3A3KA 4HEQA 1T2AA 2XKBA 3ON5A 3OZAA 5TDHA 2DHCA 4BMDA 4E5DA 3GLHA 3C43A 2QR3A 1T5IA 1ZEMA 4AX8A 4DARA 4DR4B 4EFMA 2HSWA 4GDMA 2FZKA 4ZOBA 1A7AA 5JYBA 1ZL2A 5CFOA 3LL7A 2WWYA 5JR3A 3RGWS 2REBA 4HDRB 4CKXA 2A9QA 1D4AA 1TJPB 1JAIA 3PSAA 4R1SA 4R8RA 1VCOA 1OOEA 3P2KA 5HJEA 4LMAA 1P19A 4Z8YA 4YHHB 1I1OA 2V5UA 1CUGA 3AM1A 4B6PA 1TTQB 4YUVA 4HQRA 4C7OA 2PUTA 3W3AD 4MUFA 4R9UC 4Y2YA 3ICWA 2UUBB 3ED5A 1HG0A 3GLIA 4H6XA 1E1NA 3HEAA 3LL4A 1YRHA 3H5AA 3IR5A 3BH6A 3OZDA 4NPAA 1G6HA 4C7OB 4P5DA 3FTCA 4MPDA 2QLMA 1CRZA 1PL6A 3SR0A 1N7HA 4XM1A 6ABPA 3GLIB 4L9RA 3WZLA 4F9EA 5U1PA 3KCQA 1PL8A 1MNQA 4MW1A 2YJNA 1FJXA 4E31A 2IW1A 1E60A 3O8CA 2P1ZA 3ROKA 5LXTA 3H11A 4QGFA 1C1YA 1E2FA 1G4UR 3H6HA 2J3MA 3TZBA 4GSLA 3WLPA 3VR5A 5BOSA 4I7EA 2PZ8A 3B6IA 2OQVA 4RVUA 1Y3IA 4P5PA 4Q9HA 4BRSA 3H11B 3KTAA 2FX3A 1OPXA 3IP1A 3LLCA 4R8MA 5TQ0A 5CD9A 1IL0A 2Y0PA 2P9HA 3B1FA 4WLOA 4L4XA 2ZJYA 3KDPA 3KTAB 4MVJA 1BGWA 2P9CA 3NRJA 4Q9LA 1W36D 4TM7A 5TQ0B 2WI8A 3QXGA 4F3KA 2JIBA 4JLAA 3HBFA 4OY3A 1U3DA 1JU3A 4RW0A 1LLCA 4FCCA 4OX9B 2WK1A 2GYVA 2P9TA 3BXPA 4HTFB 5I7OA 1EQ2A 4DBZA 5CB6A 2IX3A 2OR3A 4AW9A 4U6SA 3USZA 4EB3A 1I0IA 5H9VA 1NNSA 4Z0NA 3NH9A 5A03A 2Z5VA 3GOQA 1WB6A 3SAJA 2WRZA 4YRTA 4BB6A 2AE2A 5E6SA 1DO2A 1E1YA 1Q5PA 1SB8A 1YVRA 3T38A 4C0KA 1PE0A 3DJYA 5FUXA 4DIEA 4TMXA 4D82A 2MR6A 5GGYA 3O2NA 4IGKA 4MQFA 4OAQA 3R7BA 4DCNA 1WMAA 1SXJA 1UBTS 3ENNA 1V5GA 2FP3A 1E1RD 3QKWA 4MQMA 5DOZA 2HJHA 2RFLA 3PI7A 3VU8A 5K4GA 1RHQA 3L5OA 2HW8A 1X7WA 2KJQA 5BSVA 1OREA 2Y4OA 5PNTA 4OB6A 4ZYLA 1WOYA 3L92A 3KL4A 2HK9A 1EX6A 4OYRA 2ADMA 1GRCA 3RT1A 3UB3A 3WFIA 1X7WB 3EZLA 3MXTA 1H9CA 5LWQA 4EG7A 4WBNF 1N6KA 2J1LA 2NQ2C 5TNXA 5CCDA 3ZIAD 1AKUA 4YFVA 4OI4A 3HUTA 4Q05A 1XOIA 1KJQA 1ITZA 1NVVR 4KE9A 2J48A 2HRRA 1GPNA 1K89A 4RE5A 1X80A 2BFNA 4KDRA 1KZ6A 2FI1A 1N36B 1I2BA 2VYFA 1FPQA 4RTNA 1T8RA 2PWYA 3GQBA 3CSSA 4L6CA 3DBIA 2HA3A 3CLTC 2XQFA 4GVPA 2J31A 3JD0A 1IU9A 1T2VA 4RGQA 3K3PA 1KH3A 1I1QB 2PLFA 4JU8A 4O2AF 3UAZA 1JVBA 3IAM6 3DEKA 3VR3D 5JJCA 1P1JA 4D44A 1S02A 3WRWA 1EUCA 1VJCA 1Z8NA 4OFWA 2OXRA 3CO5A 4FFDA 4X24A 1WXIA 3IPXA 3JQFC 4F1JA 5BQ5A 3LUJA 2YY5A 3R6LA 3KC2A 1EUCB 1R88A 2QAGA 4RTKA 3WIUA 1WVMA 2WYOA 4X8OA 4G4SP 3JYQA 3PWSA 3T4XA 2XCTB 4LY6A 4LYFA 4XWYA 1ZIPA 1HL7A 3X3HA 2PO7A 5BN5A 2RB5A 1NXTA 4JUDX 2WJPA 3PEVA 4KXYA 4PRYA 4NYJR 3OWOA 1W581 1YR2A 1ZOPA 4XCQA 2FMXA 1YASA 5CNIA 1ZUHA 3V2UA 3K0EA 1NYQA 2AZ4A 3SC6A 1DC3A 1GSOA 2C07A 2HDOA 4HX2A 3W4JA 3WMGA 1A2OA 4NEGA 5C7LO 1L8LA 1FQKA 1UJ4A 1UK8A 3HLTA 3AFHA 1Z6PA 3OHPA 5LMZA 1MAVA 4L57A 1ZO8A 2C4NA 1W36C 1Y7TA 2NYAA 5CIYA 5KPDA 1XJCA 2XUKA 3IE0A 1WPGA 2YR0A 3D4OA 2DSTA 1XZIA 1QPGA 4DADA 5AJVB 5BWNA 1N0HA 2JHGA 2BPOA 5EPOA 1SOVA 5B7GA 2PT7A 3G1UA 3N70A 5AQEA 2QTMA 4OXXA 3HBAA 4C08A 4E1VA 4F97A 1ZVVA 1K6EA 1EVJA 2P2LA 2W4MA 3IEMA 5CA1A 4FKBA 3UK6A 5KNDD 2FZLA 2R25B 1K7SN 1BRTA 2QN9A 4QLAA 7AT1A 1JF8A 1JKXA 1XZEA 1FVFA 3GF4A 3WA6A 3BH0A 3QF7A 5CA1B 3Q8LA 1C9YA 1XYVA 2IGBA 2PQ0A 2OWDA 3L8EA 3MT0A 4V0QA 2G7MC 2WWHA 3LK6A 4L0MA 5TJ9A 1G8JA 3OQIB 3VPGA 1LDNA 1C9MA 2D74A 4DSOA 4XWOA 4OTZA 3LJKA 1PJ3A 3AXSA 4B7AA 4BZPA 3WMXA 1ZU5A 3TIVA 2OKGA 3ESAA 4BKOA 5A3QA 1U28A 1UMCA 2PY6A 1EP1B 3A9UA 3BMQB 3N7UA 5ITSA 1EXNA 1HL3A 2P6OA 2ECOA 3R77A 3KHUA 3AYXB 3PDWA 4DV0B 5LD2B 2JGAA 3H1EA 3ETCA 3ZY4A 4KHPB 2PMCA 2B5WA 5CVEA 3EQ8A 1PQWA 1JDZA 4IQ8A 4PVCA 1ZM7A 3C1UA 4W63A 5H80A 3H5NA 3IUSA 4EJFA 2C5AA 3VO9A 4EO4A 1U5BA 4U7HA 4UMFA 4QVKA 1P5JA 2BDEA 1PZXA 3EPRA 2A5DA 1L5WA 1H3NA 3TZKA 4HDSA 4TS4A 2Q49A 2ZQ5A 2JAWA 2BZ0A 3QVWA 2VJAA 4WI1A 3ZE0B 5DB4A 4Z7QB 1QCDA 1QYRA 1LK0A 3H1PA 4DLWA 4ZI7B 1FP6A 2O0KA 3K1TA 3WI7A 3PEFA 3NORA 2YASA 4HPWA 3U19A 3LX5A 1J2JA 1U3GA 4J91A 3CRNA 4OQQA 5CVDA 1CJBA 2Q41A 5DHFA 1IZ0A 2BLNA 1V3QE 4A5OA 1EESA 1BU5A 2F3UA 4AYXA 5DM1A 1C1XA 1S2IA 3H5VA 2E5FA 3UW1A 1ENOA 3VSAA 4Y2SA 5JTTA 3GXOA 1QR6A 3O92A 2CCJA 5H70A 4DNXA 2MHCA 4PAGA 4IFTA 1G5HA 521PA 5LBTA 2VQSA 1C1XB 4NPCA 1ZSNA 4PLWA 2R4TA 3TKAA 1P8JA 4BMOB 4IDQA 3O1LA 5ESWA 1YRLA 4JR2A 1QIFA 5DI3B 3T3OA 4CL3A 3ZWNA 2NZXA 3SVZA 3S2FA 1HQKA 1LFDB 4AAYA 1CLUA 3R20A 1Z17A 1FF9A 4CMEA 1FL9A 4N82A 4JJ7A 2G04A 4TN5A 4K86A 4KUHA 3LPNA 3LP8A 4C0SA 2H1LA 1KO7A 5DLYA 1U1FA 5GPBA 5KNBA 3C15C 1XTUA 1YJXA 4Z5XA 4ERNA 4YALA 1XVIA 4WCDA 2UUPA 5CCBA 1EDEA 2P91A 4M98A 5AW1A 3VPFA 3OCCA 5IM5A 3P0EA 1N2IA 5J2UF 3DTVB 2FMHA 5BXYA 4YACA 3W5AA 2I78A 4IHJA 5G41A 2Z2IA 3S2SA 3ZY2A 5SICE 1UBGA 5E4FA 1DPGA 1Z0SA 4G23A 3L0SA 5CT6A 2O3TA 1Z33A 3CRQA 4HGRA 1RYZA 3GQVA 4IHJB 3RC2A 4TTAA 3TL2A 3TVDA 5BW8A 1VL1A 3UWOA 1U0SY 3R0XA 5DN6A 3PJDA 3VHXA 1E1DA 5ISMA 1QF7A 2WWVD 1SCUA 1L4KA 3NBFA 4PG7A 1ZCAA 1SVKA 3DOUA 1DRKA 1PAUA 1XCOA 1JP7A 2ZUEA 1BQ4A 2JVIA 2ZBUA 1SCUB 1XD8A 2OEPA 4CFZA 3DKRA 2RHRA 5AM0A 3OF3A 4LZLA 3VHQA 3N2EA 2ZUBA 3OLYA 5CPBA 2NM0A 3O9VA 2IXTA 4ZJUA 1PV2A 4ZI3A 5DNYB 3HK2A 2JGJA 2AB0A 2O2JA 1Z12A 4DXHA 1TW3A 4ENSA 3WK4A 3QX8A 2QIOA 1SG9A 2R6ZA 2CY0A 2BHLA 3BK1A 1VMDA 3AHGA 3DHVA 3OMXA 4MI3A 4QUHA 5DVZA 2IDJA 4AU1A 4GKKB 3E8MA 4R2WA 1VGRA 1TMOA 2RGNA 4EAQA 1K5PA 1E2QA 4G1VA 4MIKA 1RQLA 5CFMA 3LA8A 4P4NA 4D8XA 4TL7A 2XQIA 1W48A 2VP4A 1QOZA 3ZNOA 3FOBA 4AI6A 2VHEA 3L41A 4WK2B 4PRKA 1ZINA 1WP9A 1F1BA 2Y1OA 4GO1A 3IIIA 4XB6B 3QEJA 1HX7A 5KQPA 4DMHA 3SVLA 2ZBRA 3FBWA 3FUVA 1ZY2A 2F6RA 3E70C 4UU8A 4YMUA 5ARBA 1AA9A 5IH7A 3PI6A 3RQIA 1NR7A 3OUTA 2HQRA 3GJ7A 3RRZA 5KSYA 1WDLA 1YZKA 2CSUA 4XPZA 3RJZA 3NHYA 1P5RA 3VPCA 5EGNA 1BWRA 3BSYA 1FU4A 3AIKA 2GJ8A 1ZXLA 3GJZA 3HVJA 2FQXA 4DMRA 4JJIA 1KGSA 4NBNA 3T7SA 4Z9BA 4BNTA 3OX2A 1P72A 3AKYA 3BWDD 2FSIA 3MINA 4YBZA 4R1MA 4YH1A 4MV9A 4W5HA 4DWVA 3S68A 5JAOA 1P2GA 3U6BA 5DSZA 3HA7A 3N0RA 3MINB 4EI2A 1NM5C 4R7GA 3HJFA 4DYDA 5F1PA 2V9CA 5GJWC 5IDXA 3ELDA 2XWPA 2YDXA 5AW6A 4RL6A 2GK7A 3ZNPA 4MV8A 3W8RA 2G67A 4GG1A 1RI4A 2WVHA 4PYJA 2J59A 1Z34A 1E3IA 2BGLA 2PFGA 3CH7A 3G82C 3H87A 5EUQB 4XWAA 5K0EA 3HSSA 2QLTA 4JJ4A 2V8BA 4PLTA 1MF7A 2HMUA 3PXCX 3E0QA 1YA6A 2QT9A 1CY6A 1YC2A 3GW8A 3PQ2A 3GL9A 1ANKA 4GX5A 4FFLA 4PLCA 2YWEA 4U2CA 4WZBE 1ZSVA 3WGHA 1PK7A 4CM1A 5KU1A 2C2WA 5BQPA 1ZFNA 4OJTA 5AHRA 1ZITA 4HJRA 1G4HA 3C24A 1BMFA 4R69A 5BW4A 2GXQA 4PTYA 4Y2QA 4YR9A 1UR5A 1TYBE 1WUHS 2G5GX 1AQ6A 1J49A 2GDZA 2W6PA 1M2HA 4AQDA 1QHHB 2ASVA 1R0XA 2J3QA 3E1SA 2XGJA 3VVCA 5KYVA 4DJ5X 3KQTA 2X7JA 2ZUWA 1IQPA 3MQFA 2GCGA 3ONWA 5F3WB 3QLUA 1XZCA 1TCUA 4MRMA 1W2WB 3AY7A 1IMOA 4AS3A 1CRQA 3V1TC 3ISVA 3QWHA 4AYWA 2JHFA 2Q3FA 3KELA 5ADWA 1Z0KA 1H94A 1HURA 2FPWA 4MRMB 1EXDA 3ESRA 1X14A 3TZ6A 3H7AA 4C43A 4LDJA 3ZXIA 3MMNA 4ILEA 1CNEA 2NQTA 5F23A 5JE8A 2ZUCA 3TEFA 2REOA 3TL3A 3L0ZA 2WB4A 1BW9A 3R0VA 4R84A 2MSDB 5F64A 4HN9A 4HWOA 1NPYA 5KYXA 2PYDA 1T2UA 1BG6A 1P1HA 1XNHA 2CB0A 3LIPA 4IUYA 4TV8A 5HK8A 3SZUA 4Z2AA 2OM2A 2PVSA 4H35A 5J1TB 1RWOA 3CT4A 2I67A 1R9MA 2CJXA 1PS8A 3FFAA 2OCGA 4DTIA 1UM9B 3NVDA 4NOKA 2IZ5A 3DYBA 4ER7A 4O1HA 1I1NA 4TV8B 1ML3A 1OC4A 1JHQA 4NZPA 3ZD9A 4C89A 1GPDG 4RTPA 2K7FA 2D7DA 1IJBA 4CE6A 4QT0A 2VTVA 1SIBE 3BRQA 3FR7A 3BAZA 3NCHA 3B9PA 2AI3A 4OJYA 1ZMBA 1TB4A 3TRJA 3VUFA 1ND5A 2V0CA 1HFJA 4I6EA 1MC1A 4PLGA 2NVOA 4MKHA 2MYPA 2ZYHA 2V7PA 2R6DA 4GOJA 2Z5LA 5K3CA 5C2JB 3I4LA 3O82A 2WA1A 1N8KA 3NYRA 2JFQA 3AJAA 4NJOA 3RHTA 5AKKA 1QGDA 2DMRA 1I36A 2VBGA 3JWJA 3E0XA 2MTBA 4ALKA 1OIWA 3DTNA 1WTAA 1DFIA 4JA0A 1WF3A 4U7JA 3VNSA 2PZJA 5JH7F 1N5JA 1V43A 4OAPA 3K9FC 2X3UA 4NS1A 3IAUA 4KIUA 5DHSA 4D3SA 3UG7A 4RXTA 3MJHA 1X94A 3AF5A 2DUWA 1ZWLA 1BS1A 3DZFA 3BB3A 3UOGA 1DEXA 4BFZA 1KQGA 2Q3DA 1BTOA 1D4ZA 2R8PA 2P4SA 2Y76A 4HXEB 4IR7A 4YC7A 2C7GA 1DKNA 1OGIA 1LNZA 1Z38A 4LXTA 4E2WA 2BSXA 4OSOA 1XZBA 4E6EA 1JDPA 3ND6A 2ACWA 4N3BA 4RZ2A 4UZEA 5H02A 4ZV7A 2IYEA 3G8YA 3UMCA 1CUCA 4FDMA 3W5VA 1CULC 2A5YB 2DFLA 5LQSA 3K0CC 4H27A 3VPAA 3DAFA 3VOTA 1DKMA 4XGQA 4Q4DA 4UHJA 3CWCA 3LHFA 3EZNA 4NYIQ 2KPOA 3E1KA 4BNKA 3AESA 3BBPA 3A1NA 4QLOA 3GIWA 4M22A 1J1ZA 2EKZA 2I3BA 4YJ3A 1EFVB 4O4LA 2DR2A 3HCAA 2AOWA 2VSNA 3PX7A 5FQNA 1RZ3A 4DY6A 3J81k 2Q45A 2FR8C 3AESB 1RAIA 2OCDA 4UZFA 3Q8MA 3NGMA 4YJ3B 1KWKA 4O4LB 1QO9A 4PFKA 4H7DA 1QFMA 4PXSA 3L8CA 4TRMA 3WLAA 3ZZNA 4YQYA 3OZVA 4ZGGA 1LC0A 1NUUA 4XLZA 1PTJA 5JNRA 1B0ZA 1EVYA 2QAIA 1G3RA 3GMDA 4HT3B 5F9FA 3M6WA 2EBUA 4DIKA 5FO1A 1QHSA 3WWDA 1N6NA 1ZRSA 2AMVA 3LCRA 4B9AA 1NYLA 3DV0B 2DWUA 3FOEC 3P9KA 5HIJA 2AMJA 4QJ3A 3F46A 2OD2A 4FHZA 4WFQA 1MDFA 3VR2A 1EBFA 1VPLA 3CXRA 4L5AA 2P30A 3JQDA 2LKCA 1KY3A 3K1JA 1VL8A 2AK3A 4LRTB 1I7PA 1Q7BA 5IVHA 1JZTA 3A1WA 1C8VB 2Y9MB 2JJ2A 5C3UA 4IXWA 7REQA 2ID8A 2XY4A 2DPMA 2Z0MA 2DLNA 1EAMA 3JARA 3Q9UA 3VTFA 1QKIA 3U4QB 3ROPA 3E03A 1U2ZA 4O2LA 1IBMB 3AHIA 1TT7A 4MUXA 5T6BA 3JARB 3QITA 1HDRA 3C1OA 3HCDA 2OORA 3R40A 2XRZA 4F3TA 1XDSA 1F0NA 3GAZA 3JY6A 1OI4A 4JJFA 5HA5A 3GZ4A 3V4VB 5JAHA 5HFJA 1S9DA 5SZIA 1N6PA 2HHJA 4QPDA 4AT1A 1HH4A 2C92A 3OA0A 2NO9A 4KLAA 3IP5A 4D4MA 2K5UA 2CUNA 4JFAA 1HZJA 4UXIA 2NPOA 1SUSA 3IIJA 3UCXA 4GNRA 2FFJA 3UEOA 3ISTA 1X7ZA 3TXYA 4ACAA 1EAYA 1RYHA 1U4OA 2X5OA 4RGBA 2QM7A 5AUQA 4TX1A 2J9FA 4AJHA 3G9QA 1T3ZA 1Q7RA 2JKVA 4KNWA 1SUIA 3V2GA 1GITA 2J9FB 2QW0X 1UK9A 4JP8A 3NHUA 1IIRA 5BYJA 1QDLB 4HAWA 6Q21A 1GQYA 1N7JA 1YZFA 2CD7A 2LCFA 2PSDA 3PL1A 4UM8B 1U0OC 4L73A 4R54A 2NVWA 2LWIA 3W5SA 3V6LA 5DM60 3KLMX 1NAHA 1ZGAA 4S1OA 4EFKA 3NRBA 4Q1VA 3VDNB 5AVQA 4F3NA 4DLBA 1PL7A 3E53A 3PDUA 2HO5A 3QEBZ 2IPNA 3D6VA 4OCZA 4P4TA 3S4YA 3IKTA 1SBYA 3I0MA 3NDPA 4M1MA 3BE5A 1UOQA 5JSKA 3V46A 3ANSA 4EJ0A 2CFIA 2J08A 2EG5A 3MF4A 2IWHA 4EYGA 1IM8A 3LYHA 1MX5A 3JWHA 1T6XA 1WLSA 1QZUA 2ZJ7A 3KSZO 4QTUB 4OD0A 3BXZA 4BZZA 2H2FA 3AX6A 3S6JA 3CZPA 4K9RA 1JXQA 4M87A 2ZDHA 1M2OB 4KO2S 4UEKA 3AP3A 4P7GA 3NIDB 2JL1A 5IANA 3EGWA 5L3RA 4DA7A 1GPBA 5EHIA 4KAFA 1SY7A 1YVUA 1LD3A 1LBIA 1WXHA 5DLPA 2SCUB 4ZVRA 2OM6A 1I9CA 2VN8A 5CM8B 3ZDBA 2VP3A 4JLBA 3NW9A 1A8PA 3A31A 2PPVA 5KHLB 2QTAA 1JVSA 2VTEA 1TJ4A 3N28A 1X86B 1H1DA 1Q1BA 2H52A 2A3RA 1DJQA 5LP1A 2ZXUA 2W43A 3DL0A 2IUUA 5HM6A 1LI4A 2EKQA 1C14A 2FEWB 4CIYA 3KT8A 4LJAA 3ZUPA 1TVEA 1UEXC 2IS1A 1OWMA 2YVLA 2IOQA 3EF1A 3LQFA 1YJCA 4TQAA 1TLTA 3QOWA 3C70A 2ONZA 1FMCA 3HXMA 3ORQA 2GUGA 5K99A 4CT5A 2AR0A 2EJWA 2P9JA 2QIPA 2CFCA 3RS8A 5K8CA 3NANA 2WVGA 4RK4A 3FMOB 3P8ZA 4G67A 3WDLA 2CV0A 2D00A 2WHRA 3RC9A 1GIAA 4FJ1A 4C3OB 3QX3A 3KJNA 5ER6A 1TQDA 1ZD9A 2JD0A 2IA5A 4IO0A 4JASB 5DK6A 1CEYA 4ZCMA 4NU8X 1APBA 2GZRA 4EY8A 3EC2A 2OXIA 5K03A 3CVWA 2A9PA 2F1OA 4RESA 4B83A 3KSDO 4RPCA 3FWNA 4KRGA 3GFSA 4LOJA 4RL4A 2A0UA 5GVRA 1OILA 1L4GA 3UAXA 4BQIA 1P4HA 4FGZA 2UYQA 4QODA 3W1EA 5CTAA 1PU2A 2Y2VA 3LHDA 3OEWA 2I8LA 1RPNA 2PWPA 2XNKA 4EITA 3WIBA 4HLUA 1MO4A 1U8ZA 2RIPA 4MR7A 3K70D 1KIAA 4YHBA 3TECE 1M8KA 3LPLA 3CNEA 4MW6A 4OOEA 3MWJA 5CDYA 4B3DA 4PNEA 2A94A 5ALDA 3NM6B 4G09A 4MR7B 1MORA 2Q2NA 3GLVA 4EFLA 4UTVA 1KS2A 3DZGA 4GBED 3RYFB 4RD0A 2O8VA 3ZQUA 5K01A 4GPEA 3QXHA 2WMNB 2DKFA 3FH0A 2O19A 1DKQA 1TVKB 2A35A 2JFYA 2H48A 1ZHHA 1D6MA 1JI0A 1R18A 2F1IA 3DQPA 4RFSB 3AKEA 4QA9A 2XE6A 4MYDA 2GHQA 3NTVA 4D42A 3EQ7A 4OHCA 1YULA 1NF8A 3F3YA 1XRRA 5BT9A 2VRCA 4G89A 2YN2A 5IDVA 3AHDA 1LDYA 1OZGA 3EGDA 3B7WA 1VBMA 1W59A 3GRCA 4RTOA 2PS0A 1WPXA 1KO4A 1KZ1A 5AK0A 3REGA 3GC6A 5E3HA 1P2VA 3K4QA 3L4SO 2YMPA 4HQFA 4WN3A 3EOAI 4PLVA 4FMCF 2SECE 4AJLA 2ZAYA 1IE3A 1BVRA 1I0ZA 2XX3A 4LZPA 4MKRA 3HI4A 4F38A 1NBWB 1UXKA 2VHZA 4QOFA 3IXQA 4WMLA 2FCAA 4LF4B 2XVXA 2PKQP 3NIBA 3PC4A 2E0IA 4FFWA 5CDUA 2FRDC 2YRWA 4EW3A 4GF5A 2J41A 1I7DA 3K05A 3RVRA 2Y1EA 1S3GA 1TAQA 1DJMA 2B2CA 5C80A 3IL2A 1SQGA 5DWQA 2YCBA 4ETIA 4PFSA 3G8CA 4G24A 2EXXA 1SH7A 1Y8CA 1H23A 5AI8A 2XCSB 1WKCA 4JLDA 2E85A 3KEQA 5A4KA 1GRQA 4XVCA 4B2PA 3OMLA 1IZZA 4I14A 1FU7A 1DKUA 4DDHA 4X6YA 1ZSYA 3KV1A 4EGSA 1Z5WA 1C0PA 3GEMA 4CIAA 3EEBA 3MAGA 4QDOA 5AKHA 2AFHB 1JFSA 2QJRA 3H9EO 4TRJA 2BGGA 2POCA 3AHCA 1U7TA 5EMLA 3L7CA 4MUKA 4H1VA 3KE9A 3PUIA 3E9YA 5IUNC 1H69A 3EYWA 3C3KA 3O2SB 1U0RA 2AUMA 1Y5MA 1W52X 1C5KA 1ARZA 4EB6A 5IXJA 4HD8A 3TR5A 2R4QA 1VYVA 1XEXB 2GN6A 1P62B 1T6BY 4OHKA 3K70C 1SKMA 5HGXA 2ZGVA 2HMWA 5SZKB 2JJ1A 1B8OA 2I6UA 4PM4A 4U3JA 4YASA 4B0OA 4XWWA 1K0UA 4IO1A 1Y5IA 2XEDA 4HFNA 4YREA 3LBFA 3SOZA 1HSOA 2AOVA 4MXDA 4EW6A 2FDCA 2DHRA 4U3JB 4WZZA 2KM1A 4ZXPA 2EP8A 1JG7A 1E1LA 3EF0A 5JLAA 4IY1A 2DYKA 3AF2A 5GJVC 1Z0ZA 4WY8A 4B8ZA 3UA4A 3AR4A 1NU6A 4B7UA 2OGWA 1YTLA 2W2XA 2YBEA 3EQ9A 5E0KB 2DPYA 1JIUA 2BGMA 3T7AA 1JR3E 3KUKA 1ENYA 4KCGA 3AZPA 1LUAA 1VL2A 3FVVA 3ICCA 3GUCA 3LY9A 4JNKA 4XQEA 4NXMB 2P67A 5KOJA 1K7YA 3PQ3A 4I9GA 4DCGA 3KR1A 4HNQA 2G9QA 1JFLA 1I2CA 4FYPA 3KUUA 2P79A 3RFUA 2P4EA 2PYIA 5C53B 1GL7A 1IVSA 3BSSA 3RS9A 1PNTA 1SHJA 4F8JA 1LBHA 1XDUA 1YZGA 4XKJA 3UB4A 5KOJB 5M5BA 3IVAA 1CF9A 3IIKA 4GZ5A 1B26A 1T2EA 4XYGA 3TI9A 1NVKA 4BKMA 1N5OX 3A9WA 4E03A 1RAEA 4IRUB 3H3FA 3G1WA 2GLXA 4ABYA 1NHGA 1TADA 2VAPA 2X86A 3AV0B 3I0ZA 1QDUA 3JD1A 3ABOB 3HB7A 4GR4A 1U3TA 3OPQA 1TEHA 4MPJA 3RREA 4C06A 5KX5A 2OECA 5CB8A 5KVCA 4WK4B 4IIGA 4HS4A 3O4IA 3O21A 4EBFA 3RODA 4HGZA 1AGYA 2H07A 4ER3A 1MIOA 5B7NA 2FUNB 1WXWA 2E4XA 4MB6A 2B21A 2QQFA 2DWQA 4RADA 1L5NA 4MQ4A 3P45A 1VIMA 3L4BC 4O02B 1TE2A 3PF9A 4GRAA 1MIOB 2Y6VA 4AO7A 2V7BA 4EHBA 4AVYA 3HXTA 3K7EA 1NXPA 3X1WA 2ILTA 4G0UA 1LV8A 3HRIA 1CJTC 1RJDA 4E2XA 1M72A 3DXFA 4BDSA 2IBTA 4Q3CA 2JIOA 5DYGA 5BR4A 1PDWA 2J3IA 1KS9A 2BFBA 1Z37A 3ORHA 1FFAA 4R05A 5LP6A 2G0AA 4OKSA 2Z6QA 2LPMA 4UHEA 2H4FA 4OO3A 2WF9A 1HQYE 1PR5A 2BFBB 4LMRA 2O5EA 4EG3A 5IM4F 3HZZA 4K9QA 3ENKA 3JQ7A 1ORDA 4EENA 5LP6B 5A5VA 1NRIA 2O50A 3TE6A 3LBIA 3SBDA 1Q0HA 3VPDA 4S2UA 3RYCA 1OIVA 4WZAE 2HNBA 3JQ7B 2ZETA 5C8ZA 4KSCA 1AJEA 5FP0A 1YHNA 1A5ZA 3U7IA 3M6MD 4NENA 2Q4DA 3TUZC 5E7QA 3RYCB 3WK9A 1CCWA 1W6RA 2LIVA 2G08A 3W05A 1FRZA 1QX4A 1V9LA 3HABA 4R8VA 2JGLA 1B43A 2QYTA 4RKQA 3EY4A 4NENB 1NVBA 4QYMA 5E6RA 4W7SA 4NBTA 2W48A 1G9TA 3ZE2B 1JJFA 4W99A 4EUHA 4ZCSA 3ZGXA 1GEGA 4OHRA 3O95A 3MELA 4MHOA 5IMSA 4WZBB 4E5PA 3C3WA 3GMIA 3I9KA 2FPSA 4OQMA 4COOA 3NBUA 2OPHA 3WIDA 4JLUA 1QH1B 3K92A 3L1KA 4FP9A 5CH5A 4YRBA 3KZNA 1ZJZA 2G76A 5FV4A 1UKAA 1X7YA 3VOSA 5BPHA 1AF7A 2R4UA 5BNFA 2GARA 3EBPA 3SZGA 4LMBA 3NG1A 5HR5A 4W9NC 1SKQA 2UUCB 1JKMA 1AK9A 1X7YB 3C6BA 3FPKA 1KEKA 4XFJA 1KMIY 4ZAFA 3EZYA 1NJ5A 3LPDA 1X6VA 2O9JA 3QLVC 1XF9A 2VT6A 2ZVJA 3O7MA 2PX6A 4X66B 2QR2A 3OQHA 4BQQA 4LOIA 4ZMBA 3EHEA 3MLAA 3H1FA 3N0WA 3IC5A 5I9BA 3E7DA 5SZJA 1L5ZA 2HMAA 4AKHA 2DSNA 5F73A 4WESA 2GLUA 3X1DA 3R5JA 3CR8A 2BY4A 1NXQA 2VHTA 1G64A 4D2IA 4OFXA 4CM8B 1QFJA 3E2MA 4P8RA 5FUYA 3FPEA 5DEOA 3FIUA 1KI9A 5E4YA 4AJEA 2X0EA 3A2LA 2O1SA 3IEVA 1VBNA 3I8OA 4BHTA 1NBAA 1EFPA 2CNKA 2FW7A 3O75A 4ECEA 4QDJA 3OJFA 1N1GA 1AZSC 1BMQA 1SPBS 3RAJA 2R00A 3ASZA 2OYCA 1FFEA 1KFJB 3CX3A 1EFPB 1GL9B 3BB1A 2HWKA 1JA0A 2SKDA 4I19A 3ZVLA 2RKOA 4HVCA 5JO9A 4J8PA 4GWLA 5JT1A 4JYBA 3RIGA 1JIQA 4UAJA 1SU8A 3SYRA 2NSHA 3GZTB 5BWMA 4EYOA 2YXNA 4ZQBA 2R47A 2O2YA 1K5DA 2VPTA 5HF6A 3UMGA 5EG5A 4AIIA 1Z75A 1HA3A 3MTQA 3INRA 3VZSA 4CTJA 4YRDA 3CR3C 4J3NA 1QQBA 4TV9F 3IXMA 3L04A 4NOLA 3HYSA 1LCIA 2D2XA 1T1EA 2WMOB 3I6QA 4WFKA 4YRFA 4ZO9A 4DBLE 3DE3X