1KO5A

Crystal structure of gluconate kinase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
172
structure length
172
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Gluconate kinase
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 65
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko5A00
1PLKA 3LBNA 1QHXA 3IPXA 3MG9A 3TH5A 3CX7A 3CH4B 1LW7A 1RYFA 1M74A 4OI1A 1KMQA 2IS4A 1J8MF 1S96A 2QRZA 4C4PA 2P5SA 2V4ZA 4D4MA 1OLOA 2OCYC 2D2FA 4CZ2A 4NYJQ 4CDGA 1Z06A 2OCAA 3FFBA 2ZEJA 3TUJC 5CM9C 1VG1A 2CDNA 4JL6A 4BLOA 2PMDA 3EW9A 4URXR 5HR5A 3D7MA 2HT6A 3Q85A 4RZ2A 1T8TA 1K6MA 5KPDA 5DO9A 2KBFA 3QY0A 2R6GA 4M1MA 4QM6A 1OIWA 4NCIA 1EX7A 5KTYA 2I4IA 1YJ5A 1G3RA 3QE0A 2QMEA 2ZROA 1GKYA 2YOHA 2ATVA 4KJZA 2W2VA 1F5NA 2C9CA 3AF3A 4MYUA 1W0KD 1OPXA 2J7PD 1L4UA 3I8SA 4PSKA 1A1VA 5L8VA 1OFHA 1G7TA 1XU4A 1LFDB 2WJHA 4KAXA 3ONWA 1ZC3A 2CCGA 4H1VA 1IY2A 2C98A 1W4RA 3DKVA 2G1KA 4PTLA 1E2NA 3UATA 2ZRAA 2BHRA 3FMIA 1EK0A 3IBYA 1GWNA 5JWOA 4Q4JA 5EXXA 2GCPA 2PCJA 1RKBA 2RGDA 3O8DA 4MRRA 4E03A 3U6BA 2ZRCA 3M0EA 4MYTA 2NO9A 3DKPA 5FL7D 4D4KA 4JLJA 2WWXA 2IX3A 5TB5A 3K9HA 5IRCD 1ZM9A 4EFLA 3NBYC 1RE0A 1VCOA 1XX6A 4D0NA 1OFIA 3VKWA 4PFSA 4NHOA 2IYQA 1KJZA 1G3MA 5IK2A 3EPHA 3DL0A 4Q4AB 1Z6TA 1KDTA 1YZGA 1JAHA 1IAQA 5BYJA 1KO7A 4OHZA 2DFTA 5FOTA 3LVRE 4AD8A 3E5HA 3ADCA 3AKYA 4Q4JB 2P67A 2BKUA 1BYIA 1QHHB 3HP1A 1ZM7A 3GMTA 5FPKA 5F9HA 4Z8XA 4ESVA 3MJRA 1DVRA 3HU3A 4BFTA 2ERXA 1D2MA 3RANA 2RB4A 4DSUA 2DPXA 4CEJB 3PVSA 2HUPA 1ZM3A 2QBYB 3TVDA 5AUNB 2ODWA 3VR5A 2IXGA 5EE1A 4XWAA 2NO0A 4IFEA 3BH6A 4O2LA 5FR2A 4HYYA 2WKRA 2VBCA 3GJ7A 3OIYA 1XTSA 1E0AA 1DE0A 4M2LA 4QXAA 4Q5IA 2AL7A 4PC7A 1Q21A 4ZDKA 2IW3A 1EXMA 4F93B 4O0MA 4CGZA 3BAFA 4FMDF 2GEVA 1ZUIA 2BJVA 5E7MA 421PA 2D62A 1UPTA 4GFDA 3IUYA 4ZIRA 2J3EA 4JL5A 2KB0A 1UADA 2Z43A 3A4NA 4RFSA 4M9QA 2X1VA 3LD9A 4IRUB 4JJKA 5CLLA 4ZI2A 821PA 1DTSA 5CDFE 1Z07A 4DUGA 1NN1A 2BBOA 2F3RA 1SGWA 3ASYA 4Q19A 1E79D 3VAAA 3T1VA 2WZQA 4A1FA 4M1WA 4BFYA 2QP9X 3CW2A 3S1AA 4MKHA 3SYNA 4D26A 4MYCA 2EWWA 1I4DD 1UJ2A 2Q21A 4HUQA 1E32A 2WJYA 3ND9A 5JI2E 3ZZUA 1KIMA 3WNBA 1JB1A 1FZQA 1Q20A 2OXRA 4M21A 1UM8A 1P60A 4G5QA 2NTYC 3TJZA 2J0QA 4A0GA 1VKJA 1OKKD 2FGJA 1XTQA 1U9IA 3SYLA 4DLRA 5C4MA 3CWZA 4CT4B 1Z3IX 4ACBA 5BN4A 1EG7A 3T1OA 2C9OA 1D2NA 4AK9A 3K0AB 4W5JA 3UPUA 1XMVA 4V0MA 5GJBA 2VP4A 3E1SA 4PQRA 3THYA 2ZIAA 1GZSA 3WY9A 2J45A 3B1WA 1Q1ZA 2AFHE 1ZVQA 3GEIA 1F3OA 2IT1A 3I32A 2WSSD 2GKSA 4KV9A 4L16A 2GJKA 4NMMA 4DCTA 3VR4A 2ANCA 2VHTA 3GFPA 4HUQB 4JVLA 1XF9A 3EIHA 2IWRA 1Z6YA 1NN0A 3FPAA 4LV5B 5HKKD 2RGAA 3SR0A 3W9YA 2GVZC 4GMXA 3FMFA 4PC1A 5EZ5A 5JFGA 2EFDB 2JLWA 3CRMA 4A0FA 3X1WA 1N3BA 1SVWA 2MSDB 2REOA 2JLYA 4BWYA 3UANA 4I4LA 2NGRA 4Q47A 4TYNA 4D80A 1IQPA 1E0JA 4V02A 4HAWA 4P4SB 2O8CB 1KMHA 3TE6A 3TKLA 1J7KA 1KI7A 1DEKA 2AD5A 1DO2A 3OFNA 4DLUA 4HDOB 4IVPA 3V9PA 4D4LA 4X8MA 4A15A 4FMCB 2D7CA 2FPMA 4EAQA 1KZ7B 5DHAA 1HURA 3ICEA 1AS2A 3KJIA 2IS1A 1UBGA 5JRZA 3MJHA 3B60A 1Z0AA 3NH6A 2GJ8A 3GPLA 1LB1B 3E2IA 1NJFA 1C1YA 1S8FA 4DLZA 4RD6A 3IIKA 4D0LB 5K8LA 4KBGA 4C0QC 4JVNA 1G6OA 1GP2A 1CJVC 3N5CA 2XZPA 4A0RA 3QEJA 1H8EA 4U02A 3PEWA 1CBUA 2IF0A 4IW3B 3EZ2A 3W5JA 2HYDA 5E4FA 2VLIA 2ZUDA 1WP9A 1FNNA 5KDOA 1JBKA 1G8GA 4B3FX 3K1JA 4V0KA 2R6DA 2CJWA 5ANRB 4BRWA 3K0FB 2AKAB 3SYKA 1R0XA 1EESA 1N6PA 1W49A 4ON9A 2KJQA 2XJ9A 3BERA 1FOEB 1P9WA 1T91A 4F91B 1Z22A 2FSGA 3RWMB 1OYWA 2O0HA 1CIPA 2B6HA 2Z0MA 4B3BA 3LO5A 3N2EA 4LJ9A 1S3SA 2WAXA 1W1WA 1GRRA 2F6RA 2J0UA 2QRNA 4XVRA 5FTMA 1D9XA 3PR1A 4JLOA 2W0MA 1ZCBA 3X1XA 4JVSB 4LOAA 1XEFA 4TLBA 1FTSA 4JBXA 4URYR 2P5TB 3AGQA 1FP6A 5EXTA 4Q7LA 5HE8A 4L8GA 4EKDA 4ZKDA 3GLIE 3X2SA 1ZU4A 2ZRMA 3KKPA 4LHXA 2H57A 1VIYA 5L3VA 2ZR7A 1DG3A 4QOSA 3FDIA 1VIAA 3WHLA 2D4HA 1FW6A 3BK7A 1E94E 3U3RA 4CEIA 4RKFA 1KY3A 2C5LA 1KI3A 1Q1QA 4DXAA 4LJ4A 4QGAA 1XTRA 1J99A 3ZS9A 2VP2A 4NPHA 2ORWA 3I73A 3NIBA 1MKYA 3CX8A 4CVNA 1G4UR 1CR0A 3TSZA 1QBKC 1AS3A 1XEWX 1HYQA 5DISB 5TARA 1P2TA 3PQCA 1WBBA 2QPTA 4NCJA 4UXIA 3A58B 3CRW1 3HJNA 1IJEA 4BLQA 2ZAMA 2ANBA 1GL6A 3A1VA 1M1YE 3B85A 4NCKA 3VKGA 5HPYB 1SKYB 3LWNA 4UQOA 1T4GA 1UBCA 2MSCB 2B8WA 2IA5A 2YC4C 1SVIA 3QXJA 4A2WA 1NVVR 2DFLA 5TVKA 3CRVA 4B2PA 2ZRFA 3C8UA 4MUAA 2V1XA 4CRWB 3PUWA 3AVVA 2IYXA 1S3GA 4D0GA 1OIXA 1SZPA 3FTQA 1JEDA 2GNOA 2PEZA 2EFCB 3AV0B 1H65A 4NE2A 1B23P 1XRJA 3K09C 3FMPB 2AKYA 2ZJOA 1KI4A 1I2DA 3Q7PA 2QZ4A 3BB1A 4TSFD 4XOIA 1AQUA 1T0JB 1XMJA 1ZBDA 3PCRB 3GLFE 1GKUB 5KNBA 2IYTA 2G83A 3LY5A 4K81B 1T0HB 4NZYA 1YR7A 3NEJA 3PUXA 2ZYTX 5KDDA 4QBFA 4E5UA 2W6JA 2XB2A 2NG1A 1KY2A 1P4SA 1DAEA 3MAAC 2CCJA 5HZKA 4ZCLA 2H17A 3QIAA 1KI6B 1SXJB 4PSVA 3AVTA 4LC1A 3IIMA 2XXAA 3B1YA 3P20A 4FI3C 1BYUA 4OQLA 3NC1C 3Q72A 4BGDA 5KYKA 4JKIA 3U3MA 3NHBA 1E1RD 2ZE8A 3NG1A 5KDLA 4LPSA 1XFAA 4C0KA 2PJRA 2Q3FA 3QENA 3TIFA 4Z8YA 4DT1B 2CE2X 2FFHA 3MWKA 1FTNA 2OLKA 3MMPA 4GNKA 4DC9A 4DLWA 2P6RA 2IYZA 3DDCA 2NMVA 3ZS8A 2GBLA 3U6KA 4DSNA 2G77B 4HLDA 2HV8A 4M8NE 1KJWA 2C96A 2QN6A 4MKGA 1UDXA 2LCFA 1UKVY 1P3JA 3CB4A 2DFNA 1HH4A 3BOSA 2FZ4A 1X8JA 4URUR 3U44A 3HDTA 1PJRA 4LBWA 2Q3HA 4L15A 1SXJC 4OHWA 4QJ5A 3SFVA 3EX7C 3B1VA 3QKRB 4GPTA 5H70A 4AG5A 2G1JA 4B32A 4O2RA 3BWDD 4NONA 2OESA 1TF5A 1XD8A 4LGMA 1IOZA 5EXPA 2BM0A 1ESMA 3FHCB 1YQTA 3KX2A 2QENA 2YWEA 4IXMA 2AWOA 5EZ6B 2XNDA 3UWKA 1J70A 3GEEA 1G3QA 4XVQA 3BH7A 4IJMA 2EFGA 2ORIA 2WKPA 2ERYA 2F1RA 1LTQA 5G3YA 5BYKA 4ASUD 3GJ0A 2OBNA 1RRGA 2LWIA 3D3QA 2ORVA 2HF8A 1P9RA 2GZHA 2OFOA 2PZGA 5IF9A 4AKHA 4M9ZA 4AI6A 1XPRA 2UZIR 3TAHA 4KHZA 3FWYA 4PO8A 1L4YA 5B57C 3LRPA 3U44B 4JLDA 5E3HA 1NN3A 5ELXA 2ZI4A 4JKYA 1NSFA 5G3ZA 1AGRA 3L0PA 3ZZ0A 4M9SA 4GI7A 4F38A 4IXNA 2N1BA 1Q0UA 4G5GA 1GNPA 1CXZA 4LJ5A 4TMVA 1NY5A 3A1UA 4LJ8A 3O8CA 2CVHA 3Q9LA 4WZAE 2JIZD 2QG6A 2O8DA 3REGA 2FX3A 2IUTA 5FOSA 1AM4D 2OBMA 621PA 1X8KA 4ARZB 4MKIA 4EQ6B 4TTRA 1W0KA 1EGAA 1US8A 2J7PA 3KKOA 4FCTA 4OQNA 4TL6A 1KKLA 1HA3A 3GEHA 3LBHA 2GDJA 5UKDA 1NJGA 1YRBA 5JJLA 1ZUHA 5DH9A 2RGNC 2GJAA 3LQRA 3GLGA 1OSNA 2VYFA 1E2KA 1GILA 4FINA 1T3HA 1Z63A 2DWPA 3T15A 2FJUA 3CX6A 4V0NA 3PITA 2CLCX 1Z47A 4Z54A 1T6NA 2OLJA 4NP6A 4A0HA 3R9XA 4NL4H 1QDEA 4WVFA 4Q9LA 4RD3A 4B3XA 4LHWA 2FG5A 3RVBA 2YOGA 4JT2A 3IQXA 2C9YA 5FL7A 5C18A 3WYGA 1W4BA 4LX0A 3AVPA 1JEEA 4C0LA 3W5IA 4R9UC 3U3OA 1XXHE 4KVGA 1Q44A 3THWB 4LV6A 1G4AE 3T12A 2ZI6A 3CNNA 1DBSA 3VR6A 4S2EA 2ZYUX 1OHHD 3DZ8A 2QPOA 4TMWA 1QHSA 1WRBA 3QXHA 2RGGA 4TL9A 2GK6A 1KI1A 3L82B 4MRSA 1YZLA 1W2GA 4KU4A 1OW3B 1LV7A 3ZVNA 2AX4A 3X1ZA 4W9MC 2ZQ5A 4LHYA 1ZINA 1MO6A 1JJVA 1FX0B 1G8YA 5LPNA 3TMKA 3MFYA 1R0ZA 3AP1A 1KGDA 2WTUA 5AJZA 1ZYUA 2VP0A 1JQLB 3R9WA 4KBFA 3BXZA 3GJ6A 4Q21A 4DLTA 2ZRPA 4M22A 4OJQA 3TSWA 2Q9BA 3ZLJA 4WOPA 4JS0A 1HTWA 1XEXB 3BH0A 5FUVA 3NC0C 4XWKA 4OHVA 3ASZA 4MRPA 5BXQC 1NG9A 5L3QB 4QNMA 4WIAA 3IILA 4Y0AA 3UG7A 4R2HA 2ZSDA 4LZZA 1ZNWA 3C41J 5GADl 5DE3A 5L3SB 5DI3B 1P75A 2QAGB 2QSYA 4Q7JB 4MGYR 3CZPA 2BBTA 3NKVA 3Q7QA 4HB2A 4PAQA 3BS4A 5E7IA 3PEYA 1XZQA 3VX4A 2FF7A 3OE7D 4KSBA 4EPRA 3AVWA 4URZR 3P4XA 5FI0B 1EWQA 4A8JC 2ZJAA 3BORA 3THXB 3REFA 2ZREA 1E79A 2VSXA 4MITA 3AKCA 1SHZA 3C4JA 4LHZA 2PZFA 2EW1A 5FBLB 4HUTA 1KO1A 2IYRA 4MH0R 1UBFA 5EP1A 8OHMA 1GSIA 1Q1BA 3SEAA 4Q1DA 4Q1CA 1HUQA 1R5BA 2G0NA 3AUXA 3DEFA 2QT1A 2D3WA 1U90A 4OI4A 5EUQB 1XPOA 4C3ZA 3QVVA 1E9CA 1MABA 5FTNA 1E0SA 1D5CA 1U0LA 1DO0A 1OKKA 4K46A 2ASEA 2QAGC 5L3RA 1CJMA 3L0IB 1W47A 1G5RA 2F9LA 2KBEA 4DIEA 3KQKA 2CHVA 4RCZA 3GJ8A 3T61A 1YU9A 3UWOA 4LI0A 4G5OA 4OK5A 1N5LA 1NMZA 2ZJ8A 4DLSA 4HDQB 3SHWA 3QG1A 4UNSA 1VDZA 5JS8A 4R71A 1E4YA 1UEJA 2XTNA 4B44A 2WSSA 4A9AA 3C15C 5DI9A 2WOOA 1JPJA 2YKGA 2C8VA 2E87A 5BQ5A 2VTKA 4MDEA 2XAUA 4GDFA 1ANKA 5HKKA 2P6UA 3QKUA 1XPUA 2J87A 2PEYA 3GLIA 4US1R 4E07A 1XCGB 5TMPA 4EPVA 4EPTA 1Z28A 1D2EA 1ETUA 4R7ZA 4F4CA 2ZI5A 3AF0A 4PO1A 4BFZA 1EFHA 2XTZA 3LFUA 2YV5A 5FBVB 2QP4A 3KL4A 2AXPA 3SQWA 3ZVRA 4AKEA 5LD2B 1KDRA 1NNEA 3CNOA 4B3GA 1F2TB 1DARA 4TTPA 2Z83A 3NDBB 5FOVA 5G40A 3RWOA 2WWIA 4GBMA 4GOJA 4EPWA 3U4QA 1II8A 2O52A 3GLHA 4US0R 2ZS7A 5KNDA 5JLJA 4H9GA 1K5DA 3D31A 1CP2A 5FOWA 2ZSEA 4NKRA 2WV9A 3LXRA 2GXAA 3GJ4A 2RKOA 4QL3A 4BFWA 3Q5EA 1F2UB 1Z0DA 2X19A 3G0HA 2OFXA 1OXVA 1TUIA 5HTKA 1I4TD 5C4GB 4L9SA 1IXSB 3LAWA 3VKHA 1T3SA 1UKYA 2DHRA 1E2FA 1YZQA 4M53A 2H8KA 5TDHA 3SBDA 1CTQA 5J4LA 2BOVA 5B58C 5JHHB 1YR6A 2KI5A 1WB9A 2NZ8A 3R8FA 2RCNA 1D8TA 1UFQA 3AVUA 2QY9A 4DDWA 2QGZA 1OF1A 1U81A 1IN8A 2DY1A 1R0WA 2H5EA 2VQSA 2NPIA 4C30A 5JWHA 5CLQA 2R9VA 4R2IA 4PZLA 3SN6A 4QNRA 1G19A 3ZD6A 3B13B 4HB0A 4JLBA 1P61B 3GLFA 2FH5B 3VHLB 1DAGA 3E70C 4NYIR 1II9A 5BWMA 4EDHA 1MV5A 3RLFA 3Q8XB 1CULC 2ZRNA 4TMZA 1JR6A 2IUUA 3QXSA 5FPHA 1EWRA 4WW0A 3UG6A 4D4JA 1S2MA 1TTTA 1ELOA 2QROA 3ICQB 4XSHA 3EPKA 5KSYA 1ZRHA 4IHQA 3W90A 2JLVA 1KSJA 2OHFA 3LDAA 3NDPA 2F9MA 4M1OA 4OQMA 3MLEA 3I72A 2FU5C 3LXXA 1E0KA 1E9EA 1RYHA 1A82A 4A36A 3R7WA 3NTUA 4JSTA 4ZV4A 4GZLA 4A92A 1AGPA 3I62A 4KXFB 4W5HA 1RZ3A 3AVOA 5DNYB 1E99A 3CRRA 2O8EA 1GNQA 3GFTA 3ZZTA 4B35A 1HT2E 4CEHA 1MO4A 3TR0A 3VNVA 5J47A 1COWD 2REBA 3IHWA 1TF2A 2A78A 1NVXQ 1ZCAA 4Q9JA 2WHXA 4UJ3A 5J40A 2K5UA 5DYGA 4JVMA 4AKIA 1IXRC 3EXAA 5FUYA 2ZRHA 5EE9A 1KI8A 1TX4B 2W2TA 4GP6A 3SJCA 1ZNZA 2IYLD 3FE2A 3NHAA 4FMDB 1NVWQ 2IUSA 2A5YB 3GLGE 4BEBA 2IF2A 5LDDC 1H8HD 2HJGA 2FPKA 3SJAA 4Q02A 4YQFA 2REXB 1PUIA 2JGNA 3KTAA 4JJZA 2O0JA 2QNRA 2QSZA 3CIOA 2GZAA 1CR4A 3EIQA 1BO6A 3PEUA 3K70B 2XB4A 5A5GA 4MQBA 5KOYA 1QHNA 1HE1C 3HU1A 1G41A 3W8RA 4ZKEA 2PLRA 3L2OB 3QUSA 3IDQA 1O87A 3SQXA 4TSFA 2HF9A 1J90A 4QBIA 3FB4A 4YDHB 2WVJA 4YMTA 4F4IA 2PMKA 1K5GA 4NH0A 4QHYA 4TWZA 2QA5A 4QJ3A 1DAIA 4TN1A 3UK6A 5JS7A 3VFDA 2GXQA 1N5KA 1WMSA 2GRJA 3TK1A 4LYHA 4CIDA 3X1DA 4L5BA 4C7OA 1NBMD 4M1KA 2XEXA 2HLDD 4TYPA 2GILA 4DEYA 4GSYA 3KJEA 4KODA 4ZIRB 4IDQA 2ATXA 1D9ZA 4RFSB 4ERNA 1Z5ZA 1E1RA 1SVOA 4LJAA 5B30A 4HZUA 1G1MA 721PA 2OM2A 3TBKA 2Q3MA 3A36A 1U8AA 1E2DA 2VL7A 1TUEA 4PZZA 3S1AB 3V00A 1M34E 3C7KA 4U5XA 1FUKA 4JT4A 2C77A 3VHXA 2J41A 4AC9A 3VTKA 4NYMR 2BEJA 3A4LA 3ECCA 2ZVQX 4WAUA 4XWOA 4RD1A 1AJEA 3CF0A 1JNYA 3L8ZA 3TW8B 1YR9A 2F1JA 4Q9KA 3TR5A 3MUFA 4BUJA 1PV4A 1X6VA 2ZRIA 3DO6A 5JCZA 4PPGA 3CR8A 3BD9A 1RRFA 1IY1A 2AN9A 1LS6A 3RS5A 1N5IA 3FFAA 3TLXA 3AUYA 3BGWA 2P65A 1XXHA 3THYB 1N6IA 1HQYE 1IN7A 2ZI3A 4FCWA 2V7QD 1CF4A 1MRSA 1OXXK 4TT3D 2DWQA 1CJUC 4JIMA 2ZS8A 4IFBA 1X1RA 1RVDA 2CLDX 4IOJA 1FNMA 1KYIA 2AHOA 2A3RA 3KUDA 3LLUA 4WA7A 4DDTA 3CPHA 3U5ZB 4XD7D 2X2FA 4JSYA 4IEIA 3EA5A 1IM2A 1XNJA 1E9RA 4G0NA 3BB4A 3EZ9A 4YXWD 4ASUA 2ZYWX 1XTJA 3CPEA 4PSAA 4PXAA 1L8QA 2IS2A 2VHCA 2V8OA 3DVLA 4B73A 1JXOA 5GJWC 2CNWD 1ZIPA 2A5DA 3K53A 4PHFA 3F3YA 4XSGA 2C78A 2V1UA 1VCMA 5DYIA 4DSOA 121PA 3K0EA 3RSOA 3T5DA 1S1CA 1CEEA 4HZIA 2N46A 4XIGS 2XZOA 3OEED 2WSMA 3LVQE 1Z0JA 3W3AA 5CK5A 1VG8A 2FFAA 3NBXX 1TL7C 3HU2A 1U94A 4FMCF 2I1QA 4PR0A 4LBZA 2NZJA 2VHUA 2F55A 1KMHB 1GRQA 2JIZA 3PG5A 1I4LD 1LY1A 2XZLA 1YKSA 3F5FA 2KWIA 4TLCA 1N6HA 4TMTA 4BZQA 4D81A 1GRNA 1MO3A 1Z2CA 4UXHA 3DMNA 3VR1A 1A4RA 2A5GA 2FN4A 1FUUA 3C5HA 1OB5A 3U7FB 3HPRA 4URWR 2W6ID 1QF9A 2R2AA 4NCHA 1OFUX 3GCGA 5J4VA 4KFSA 4DEXA 4RY2A 4MRNA 4DDUA 5TY0A 2ZE6A 3NVAA 3AEZA 1U99A 1V5WA 5D3MA 3TW4A 1P7CA 2ODNA 4IVQA 4G5RA 1JR3D 1S1MA 2ZU0C 1OXTA 2OCBA 1W5SA 2CVFA 1XMSA 2ZRGA 4ESHA 4D2IA 2B7CA 3SJZA 1XD2A 2CJWB 1FP7A 3SZRA 3TVTA 3PIRA 4Q03A 1NMXA 4AG6A 3GLHE 4CF7A 1W36B 3AVYA 3TSOA 3SNHA 2Q6TA 4MA4A 4EUNA 3WBKA 2MMCA 2JAQA 2YWGA 2PH1A 1OHHA 3W8NA 3CBQA 1U0HC 3RDPA 4LK2A 3BB3A 3RNLA 5EE5B 2J0UB 4G01B 3AVQA 3B1XA 1QVRA 2JDID 2ZSBA 4B76A 5FH9A 3BJIC 3RS0A 5GVSA 2P2LA 2F1IA 3L0OA 1NF3A 3ZD7A 1GG2A 2WMNB 3ADKA 1GKIA 2JLRA 4I1SA 2YJTD 1C9KA 1XWIA 2GK7A 3L43A 4XJXA 2VP6A 3IKJA 1KO5A 4RSGA 3RS4A 4CEIB 1YZNA 3PJRA 1KO4A 4CT5A 3K0SA 1A2KC 3ZQJA 2BEKA 1WDTA 1E4VA 4JLAA 1NVUQ 2EYUA 4AURA 2OFWA 3FYHA 1XP8A 1W2HA 4C9BA 4KFUA 2WJGA 1CR2A 1N25A 2GAOA 3CM0A 5JSZA 1ZD9A 3MCAA 3UXMA 5A4JA 3QEOA 4EIWA 1A2BA 1AZTA 3U7GA 2PX3A 2GETA 2OAP1 4LWZA 3RABA 1Z6GA 4UNQA 4AY2A 4KFTA 4RJLA 1KKMA 1OIVA 1CR1A 2FZLA 3H84A 3IPYA 4KSCA 2ZR9A 3RRYA 5KHOC 3TAUA 1VYUA 2IK8A 4FW9A 3GFOA 3OE7A 1YHNA 3EPLA 2B21A 4OHXA 3MSXA 4NYJR 3PFIA 1TADA 4JYCA 2G88A 2VP9A 1XJCA 4PX9A 3TQCA 4ZCIA 1YZUA 3IEVA 1JR3E 2H18A 3K9LA 4M4SA 4GMDA 4WZ6A 4B33A 4M0LA 2AD1A 1VMAA 2IYVA 3A1WA 4BLRA 1ZJ6A 2O8BA 3VU9A 3ADDA 2FSFA 4W7SA 2IYWA 4PAMA 1R5OA 3DPUA 1QZXA 4OK3A 1G7SA 3RS2A 3CKLA 2SHKA 4DBLC 5GVRA 3EA0A 2O8FA 2GXUA 3I8XA 5JMTA 1UKZA 2I3BA 2OO7A 3HWSA 4Q7MB 3U61B 2OG2A 2XITA 4LYFA 2ZJBA 3CRQA 4B2IA 4OI2A 3KKNA 4R98A 1QVAA 2ZRJA 4I1OA 4I99A 2QQ0A 3LX8A 4M1TA 4LCBA 1RJ9A 4BE7B 1FQJA 3TUZC 4KLZA 4QBHA 3PUZA 1YZKA 2XXAB 2A5FA 1L2TA 1R7RA 2FEOA 3DOEA 2J9RA 2QL6A 2FDCA 3ADBA 1VHTA 1NKSA 4L9WA 2QQEA 5EQTA 1GFIA 1SKQA 1GVNB 3PUYA 3H2YA 3W6PA 2WWHA 4IKEA 4JYBA 1KDOA 1OXUA 3Q5DA 2C2HA 3I5YA 2ZRBA 1WBDA 2HCBA 2BCJQ 2A7QA 3SC3A 3QSYA 2QMOA 3QPUA 4Q18A 3EARA 1RRCA 3LNCA 2AFIE 2P0EA 1F48A 1Z8FA 3B78A 2BMEA 4Q1BA 2RH5A 2IHYA 1KK0A 2GVDC 2HT1A 5H68A 4HLUC 1L7VC 4MDFA 3OIWA 1M6NA 4DB4A 2PLFA 4JL8A 2GWHA 1VHLA 1W4CA 4N0EA 4YMWA 5J5CA 3UMRA 2PJZA 2Z4RA 4IDPA 4TQAA 4F4JA 3U7HB 4IVRA 4U7DA 5BW8A 3RHFA 5FPSA 4ZPXA 1DS6A 1ZAKA 2EU8A 2OUKA 1BIFA 4LDJA 2CHGA 3QF7A 2UZ3A 2IBMA 1ODFA 4ITRC 3WRYC 3JZMA 2Q9AA 1WQ1R 4LBYA 2NPFA 1QRAA 2FMXA 4UNNA 2WWFA 5G41A 1HEIA 3QG5A 3KDSE 4QHSA 5AWFC 5JEEA 1TNDA 1G291 4ABYA 2VHJA 1G17A 3WNCA 4JBWA 4WBSA 1U2RA 3DMDA 5IHPA 4MGIR 3UMFA 1BH2A 2A9KA 2KE5A 2RAPA 2ZJYA 2DCUA 4UXJA 5AK0A 2VSFA 4BECA 3T5GA 1KK1A 4UNRA 4PZYA 1NN5A 1KAGA 4UNPA 2YWFA 3RSLA 3AF4A 5J4YA 2CK3D 3WHKA 1ZNYA 4RKEA 1OXSC 4FWTA 1IJFA 2Q9CA 1KSFX 1FMLA 1UBEA 2ZRLA 1XCPA 3NBZC 4NYMQ 1NLZA 2BMFA 3CF6R 1E2EA 1F60A 3AGPA 2X2EA 3QKSA 5JI3E 5DN6D 2O8DB 2OSBA 1CRPA 2ODBA 2OZEA 2BC9A 4TYWA 1M7BA 2F43A 3IGFA 4I1UA 1IBRA 1ESNA 4HAVA 3SOPA 4HAYA 1G9XA 1TQDA 1US8B 1GNRA 4DLXA 5FI1B 2PZEA 2JLUA 2QTHA 5M04A 4QBGB 3GLGB 2GJ9A 2VEDA 1E2HA 3P32A 3MWYW 3OEHD 1ZUNB 1SVMA 4HAZA 1WCV1 4B75A 1W0JD 4A8JA 4NTZA 3O8BA 3I61A 4DIDA 4Z51A 1QHYA 4O3MA 4GP7A 4Q01A 3C5CA 4DCUA 1EFTA 4BFXA 2NQ2C 3CO5A 4PHGA 3SS8A 3ND8A 4Q00A 3HR8A 3A6PC 4D82A 4FXPA 5EUMA 1R8QA 2CCKA 3WRXC 3J81k 1G8FA 5H1YA 1COWA 4A6PA 1IN4A 3M4YA 4PC2A 2CL7X 1E69A 4KO8A 1RW4A 3IBGA 2O0KA 4RFVA 1E9AA 2A2ZA 2AK2A 5EP4A 4B34A 2IYSA 3GP8A 1XJ0A 3QXCA 4LUCA 2F7SA 1ZU5A 4HB3A 2QORA 1SXJD 2J7KA 4RZXA 4Q1EA 3KJHA 3GD7A 3K0CC 3MRSA 1KI9A 4EJSA 2ZXUA 1RIFA 1H8HA 4B71A 2ZR0A 2AWNA 2IXEA 3BFXA 1P62B 2FPLA 2RMKA 2R6CA 2P3SA 1SVSA 1VYVA 1XTIA 2VA8A 5LB4A 1S0UA 3I4LA 4HDCA 4TLEA 3EPJA 4IDNA 3WBJA 5AJYA 4E09A 2ZSFA 2VF8A 3LV8A 1E1QD 1MOZA 3I5XA 1FPMA 4FD2A 3ZVLA 1MT0A 2ZANA 3NBFA 3OHMA 2ZJ2A 5P21A 4EFMA 3GQBA 4Q4HA 1PVOA 1G5PA 2FOLA 4QKQA 5H8WA 3KJGA 3RRMA 2V9PA 3OAAD 1AK2A 3ZYCA 4RZUA 1KK2A 1KSGA 2AR7A 2BWJA 3QF4A 5FTKA 2W2XA 5FPTA 5SZHB 2BMDA 2Z6VA 4RD0A 2QMUA 2ZS9A 3AP2A 1NBMA 4KVAA 1G3IA 1ZC4A 2HLDA 5C1BA 1NG1A 4MRVA 3PXGA 5CM8B 5CIWA 1BS1A 1S4QA 3B6EA 4P33A 3ZQ6A 1TQ4A 3FGNA 4US2R 5EE3A 3ZIAD 4WZBE 2KSQA 1R5NA 2YYZA 5EE0A 1RC8A 3K9NA 3AVXA 3V4FA 1GL7A 2GESA 1NVVQ 1N6RA 1JPNA 3IEUA 2UKDA 3H86A 1Z83A 4TQUS 4XTRA 3VMFA 2TMKA 1CRQA 2BBSA 3LW8A 2HJVA 2V6JA 4I81A 4MYHA 2HEIA 3I3SR 1M2OB 1P72A 3WP0A 4ZCMA 1MABB 3TGPA 2AK3A 2FNAA 4P4UA 1VG9B 4IOLA 2PBRA 3P1JA 1SXJE 2YWHA 6Q21A 5HCNA 5AUQA 2OILA 2FGKA 2ZI7A 1G8HA 5DIFA 1IN5A 2ODEA 4PPNA 4DDVA 2YOFA 4OBEA 3OIUA 4LV8B 2IEZA 2BJWA 2Z4SA 1QHIA 4BFUA 1GIAA 1XD9A 2V7QA 4RD4A 4TT3A 3K9GA 1KNQA 2QGNA 2Y8EA 4HLCA 4C2TA 1T9HA 2H1LA 2V54A 2X8AA 3VX3A 3PV0A 2V6IA 3QJYA 2G6BA 3VQTA 4XD7A 2ZU6A 4X8HA 3RYTC 4YXWA 4LJYA 2JATA 4B2LA 4LPKA 5CITA 2DB3A 4YONB 3A37A 1OYYA 4A6XA 1P2UA 4LSGA 3RRNA 4Q48A 2LKDA 3GLIB 2PT7A 2CNWA 1P9NA 1XZPA 3T1TA 1UAAA 4PHTA 4LRWA 4BLTA 1Y63A 4AWXA 1UEIA 3NEYA 1OE0A 5FTJA 4GRAA 4PHHA 4O25A 2H16A 1KZGB 2JJ2D 1X3SA 4KCGA 2WWYA 5LD2C 2WPDD 3OEEA 3B7GA 3U4QB 1II8B 2EQBA 3GLHB 5FR1A 4TYYA 2QU8A 2J0VA 3QI2A 2PL3A 4FN5A 4P3YA 2D06A 1IY0A 3DM9B 4OYHA 1CLUA 2GTPA 2WAYA 1N6KA 4Q4AA 1CJTC 2BBWA 4QM7A 1NKTA 2GJSA 4BQSA 1N0VC 3AH8A 3EWSA 2OEPA 5DSZA 1OH8A 1N2CE 4EFNA 2W6IA 1N0WA 3P26A 4OKSA 1LVGA 1LS1A 4F7WA 1QHHA 3QPVA 1Z29A 3JVVA 2ZRKA 1P2SA 3A4MA 4BPBA 1BMFD 4A2QA 1E2MA 2W83A 1TQ2A 3R20A 3LH5A 4CEJA 2P6NA 3OF5A 5FL3A 1TAGA 1JI0A 2QM8A 1JR3A 1N5JA 3KQHA 4KFRA 2QBYA 3F0TA 3U2QA 1VTKA 1MO5A 3FKQA 3MD0A 2G9NA 5C2JB 3SJBA 1JALA 5CYPA 4W5WA 2OXCA 1VPLA 4GT1A 5E95A 1EFRD 4LYJA 5JZVA 1KI2A 4YDSA 1GDDA 3GLFB 1CU1A 4NCNA 1D6JA 2EFEB 3PUVA 2WIBA 3KB2A 1HQCA 1OB2A 4MKFA 2J46A 3DOFA 3FKSD 1SVLA 3IIJA 2J0SA 1G7RA 2JJ1D 1ZP6A 2X77A 3CLVA 2HXYA 2QE7D 2ZETA 4OJKA 2JDIA 2VO1A 3KFVA 3NH9A 4JMPA 4KYUA 4Z1MD 4QGFA 3Q3JB 1UKEA 2QAJA 5KSOA 1TPZA 4LJ6A 5FUWA 4HEJA 4OQFA 4EPXA 3EC2A 3W3ZB 5FBRB 3A8TA 3R7WB 2HCJB 2B7BA 2O8EB 4DHEA 2C03A 1Q3HA 3WMEA 3SE0A 4CEHB 1GL9B 2GZDA 1KNXA 2ZE5A 3A1SA 1KTVA 5K8IA 1U98A 2WWGA 1GOTA 4IOKA 3ZGXA 2JCSA 2O5VA 1ZW6A 2ECKA 3KKQA 2QTFA 3AP3A 3CF2A 5JECA 1SVKA 2VSOA 2VH5R 4TLDA 3VNUA 4KITB 2QP3A 2YZ2A 4HSEA 1NY6A 3N2IA 1XB2A 1TU4A 3K0AA 2BIFA 4OI0A 3EG5A 4PQYA 4JBYA 4M1SA 3L0SA 3MWJA 3P4YA 3UMSA 5BN3A 2OAQ1 5JRJA 4PPFA 4QFMA 2JASA 1TMKA 4IDOA 4YC7A 4TZ0A 1JAIA 4OL0A 3KTAB 1GITA 1E2LA 1FQKA 4Q1FA 1KK3A 2FFBA 1W48A 3D6TB 3AM1A 1DAFA 4F92B 2PT5A 1NIJA 5JJKA 2MSEB 2HYIC 4PPQA 4U00A 5JHGB 3K70C 1BKDR 3VR3A 1T5LA 4LHVA 4E22A 1Q22A 1Z0FA 1LF0A 1QHGA 4DZZA 3LLMA 2BKEA 1DPFA 2CLSA 5F98A 2VP5A 1AZSC 2ZAOA 3KB1A 3WP1B 4XVUA 3BFVA 5KSZA 2XOKD 1V43A 3CNLA 1PLJA 2IS6A 5SZKB 1OV4A 2QM7A 3EIEA 1T8UA 3QVUA 5CYOA 4PANA 4POAA 5EJEA 4FIDA 4P4SA 1TU3A 5K8UA 4IDHA 2O8CA 1N6OA 1E2JA 4KI0A 4C7OB 5F9FA 2E9SA 1E9BA 4DRZA 2A30A 1ZM4A 5GJCA 2XSZD 3B5JA 2IL1A 3GJ5A 1RRPA 4HAUA 3G82C 3CUEF 4DSTA 1W7AA 2DFKB 2FWRA 2YC2C 4K8OA 1ZM2A 3RS7A 4HI0E 4HZUB 1R4AA 5EXSA 5CIQA 2WICA 1NLFA 5C46F 2VPPA 2GCOA 2J5XA 1NSTA 5EP2A 5TV2A 3ZH9B 3PEVA 3QKTA 1J2JA 4UJ5A 5DLQC 5AJXA 5KUTA 3X1YA 1IXZA 1A7JA 1CS4C 4JLVA 5B64A 521PA 2E1RA 4V0OA 3LX5A 4P0TA 3KXLA 4G1UC 5F2EA 1AKEA 1DG1G 1U9IC 1XDBA 3M1IA 3ZDQA 2V3CC 2CL6X 5AJVB 3K0FA 4P4TA 3P27A 4OQXA 5CB8A 4FCVA 1OH5A 4DLVA 1S9DA 3B9PA 3W34A 4DCVA 1B0UA 4EPYA 3LW7A 5GJVC 4CYMA 1XXHB 4Q1AA 1NBME 2ONJA 1C4OA 2R6AA 2J59A 4D6PA 5IT5A 3MWLA 5FOXA 3EAQA 2CHQA 4FWIB 2GCOB 2R65A 2JA1A 4RVCA 3SU8A 1AQYA 1NP6A 2WJIA 1EFUA 4LYAA 4NDZA 4UKDA 1G64A 5KO2A 3OZXA 4LJ7A 4JLNA 1YVDA 4C2UA 4X8OA 1OJLA 3IHLA 3WNDA 1GM5A 1ONBA 1BOFA 2IEYA 1Z0IA 3R9IA 3V4RA 1OH6A 1AS0A 2CK3A 2XGJA 4S35A 3K09A 1SHKA 2VIIA 2FE4A 3K8YA 1HT1E 2W0SA 3OESA 3WYFA 1JXMA 3B9QA 1SQ5A 2NOAA 1ZMXA 3CONA 1II0A 4ACAA 4HATA 5E7JA 4HB4A 3T06B 5K8TA 2IYYA 3KZ1E 3IO3A 2ZTSA 4QRHA 5DN6A 5IK2D 2BV3A 1Z0KA 1X86B 2JJ8A 4TQ9A 5J4HA 1G18A 4BFVA 1R0YA 1KO8A 4RCYA 4II7A 4DVGA 2C99A 4ILEA 1Q3TA 1X8LA 1AIPA 3O47A 3QQ5A 1IONA 4A2PA 2GXSA 4B3CA 1WF3A 3OEHA 221PA 2ZVPX 1W0JA 2NO1A 1FL9A 2ZYVX 4H1UA 3EASA 4GOKA 3N70A 3B8HA 4D25A 1I2MA 2B8TA 1TEVA 1TF7A 1PUJA 3K70D 2QT0A 5D3MB 5D3QA 3FHOA 1EX6A 3CZQA 2L0XA 1E9SA 2IWHA 1T3LA 3I92A 1UDWA 3RC8A 2HXSA 2IC5A 4JLMA 4AIIA 1VCIA 1XD2B 2Z5FA 1U8ZA 2RHMA 2XX3A 1FFHA 2WWWA 2MMGA 2WIAA 4PO9A 2JLXA 3SHFA 1W36C 2WMOB 2YINC 3UKDA 1GAJA 1WE2A 1NI3A 3TQFA 3JZAA 4BEJA 1VECA 3R8CA 5LB2A 2ZM5A 4B47A 2FFQA 1KI6A 1SXJA 2XNSA 5FUXA 2BVNA 4N3NA 4DKXA 3FHTA 4WXRA 2VRWA 4P32A 3DZDA 3SI7A 1Z6AA 5IDVA 1E2IA 3KFXA 5CB6A 2OBLA 1MRNA 2BMJA 3RAPR 1R8SA 4NYIQ 2JLZA 3AF2A 4DUGD 1CKEA 5FOUA 1A5TA 3SFZA 2A5JA 3TRFA 4M9XA 1RPZA 4DT1A 1IHUA 1Q57A 4YLGA 3ZVMA 2ONKA 3FOZA 3FVQA 4QHTA 4BFSA 4DJTA 3WXMA 1KOFA 3L8YA 3MGCA 4Q9IA 1DADA 1M7GA 1N6NA 4I1VA 1P5ZB 1XBTA 3O8RA 4XH9B 2D74A 1G16A 4HLUA 3SBEA 1E1QA 5HZHA 4RZ3A 4G5SA 1NRJB 5A0FA 2YVUA 3U7EB 5AUOB 5JSZB 2RGBA 4B74A 3KQNA 2LKCA 4YMVA 3OAAA 4TL7A 4Q7KA 1W44A 1HY3A 4ZI3A 4TMXA 1P2VA 2BM1A 2CXXA 3CR7A 4OK6A 4TL8A 4C0BA 1EFCA 3QKRA 2J1LA 3KUCA 4DCNA 1X1SA 1QG2A 3H0KA 3THOA 5SZIA 2ZPTX 1W46A 2GCNA 1NL3A 1XTKA 1G20E 5SZJA 1E98A 4AYXA 1WXQA 1VCNA 4X8LA 4ZO4A 3KXKA 4IEEA 3CWQA 3ZIAA 3AQ4A 1LF5A 2EFHB 3CPJB 3WMGA 3TNFA 5FBWB 2RGNA 1W4AA 1P73A 4A4DA 2RHDA 2O8BB 3VU9B 1N0UA 1YZTA 1S9HA 4URVR 5KNCA 1YRAA 3CH5A 5CJ2A 4RD2A 1Z08A 1ZD8A 5B2ZA 1P6XA 2EVWX 4ZDIA 4YMUA 2O8FB 2PX0A 3EZ7A 3U3JA 4N0DA 2JEOA 5AR1A 1M8PA 4TYQA 1U0JA 3FMOB 2DYKA 3OIVA 2OT3B 4IOMA 1DAHA 1TQ6A 3AF1A 1KSHA 2R62A 1RJ9B 3T34A 4CW7A 1CJKC 3WYAA 1GTVA 3WMFA 1KAOA 5JEDA 4V0LA 5JWRA 4C0AC 3OFND 4ARZA 4QGGA 4GZMA 4EQ6A 2WM9B 1AKYA 3HR7A 4AKGA 2CBZA 2QTVB 2ZJ5A 1Z6XA 3QBVA 4B48A 2JLQA 4G3XA 4BRUA 2VF7A 3EC1A 2FV8A 2UVQA 2WBLC 2ZUBA 2QI9C 5KPJA 4GOXA 2C04A 1XCMA 2G3YA 2GAAA 4OHYA 3B82A 3HPQA 3H1TA 1MR3F 2ZITA 2OE2A 1O3YA 2IXFA 1VYTA 5G53C 4MGZR 1E2PA 3B1ZA 2GBLC 3NXSA 3QBTA 1JQJC 3BBPA 3C16C 2H92A 4L4UA 5HCIA 5TXGA 3RRZA 4DLYA 1H8ED 1U8YA 2R6FA 2ZJZA 4C0SA 2D2EA 2DBYA 1G8PA 2ZSAA 2NO6A 4BLSA 1Z2AA 1Y3AA 1PZNA 1IN6A 4TLAA 1G21E 1JJ7A 1AN0A 4XTCS 1T5IA 1G5TA 2JJ2A 5HE9A 1E3MA 4B6EA 2CEAA 4V0ME 2WPDA 2GEDA 1DAKA 4ZDJA 3KQLA 1HV8A 2BCGY 1W36D 5BN5A 1XEWY 4NBSA 3THWA 4BZXA 1J8YF 2FSIA 2NIPA 1Q1EA 1UF9A 1JECA 1WA5A 1QG4A 4FMBB 4C0JA 1HE8B 2DWOA 3K0CA 4N1AA 5KSPA 3KQUA 3T35A 1DOAA 2F3TA 3BC1A 4NU0A 2GF0A 3ETLA 1E2GA 3PENA 4WXPA 3KXIA 5CDFA 2YHSA 3IQWA 4LC0A 1ZIOA 3DM5A 4QG7A 4DWJA 2RGEA 3M6AA 1FX0A 3JVUA 1BMFA 4DCSA 1R6BX 1R2QA 3TUIC 1OFTA 4Y0VA 5AJWA 2R44A 5DGXA 2ZE7A 4B6FA 3LQQA 2G0TA 3QPWA 2V55B 5LBIA 4JLPA 1F6BA 3G5UA 1G6HA 4B43A 3AKEA 1VG0B 3W6OA 1YE8A 1XEXA 1GUAA 3HYTA 3H4MA 3A1TA 2BDTA 4BLPA 3EWAA 5L3QA 1EFRA 3QKSB 4HAXA 2IHBA 2RGXA 4AYWA 5FFMA 1RFLA 2AXNA 2F43B 3ZJYA 2GF9A 3BIFA 4LY6A 2EWVA 3SDZA 5DI3A 3B2EA 4YMSA 5L3SA 2H7VA 3LA6A 2QAGA 2PCLA 3D8BA 4AYTA 3AB3A 3FKSA 3GJ3A 4PC6A 1FMJA 1XMIA 1NLYA 4DB2A 2JJ1A 1MH1A 1K8RA 3BE4A 2QE7A 2QPAA 5JBQA 4QJ4A 4A8JB 2XTMA 4QGHA 2CMKA 4Z1MA 2FSHA 2C95A 3EZFA 1R10A 3BFKA 5DHFA 3VR2A 4KYIB 1NIPA 4TMKA 3THXA 4MUBA 4V03A 1TEXA 2CE7A 2HDNB 4Q9HA 1Q12A 1E6CA 3EZ6A 3C14C 3KKMA 3QNUA 2B92A 2EYQA 3W6NA 1SULA 1G3UA 5CK4A 1G7CA 4BZPA 3UIEA 1DAMA 5FPYA 1E2QA 4M1YA 5AUPB 3IO5A 4JZKA 3GJXC 5EP3A 2OV2A 1W5TA 1KJYA 4MGKR 1PLLA 2ZRDA 1M7HA 1KDPA 2W6JD 3LBIA 1AA9A 3QXXA 2GA8A 2FEMA 2YNMA 2QUZA 4P31A 1LNZA 1SKYE 2WJVA 4GL2A 4PC3A 4EJSB 3BRWD 3HYRA 2VHQA 5CJPA 4HLQB 4Q66C 5FTLA 2XJ4A 2CL0X 1XJQA 3NWJA 4PQFA 1E9FA 2WJJA 3F8TA 2W58A 1YR8A 1ZNXA 4TTQA 2D7DA 5J4KA 1OT3A 1DELA 4A82A 2R8RA 2WOJA 2DR3A 4BASA 3U3KA 3T1QA 5JJIA 1ZD1A 2GHIA 2WKQA 2QMHA 4Q4LA 4JLKA 5FBQB 4C0HA 1KHTA 3AKDA 1OH7A 4Q4HB 1E96A 3RS3A 2XOKA 5F3WB 2ZI9A 4TZ6A 1NMYA 2N42A 2W00A 2QEQA 5JCPA 3DHWC 4QC2A 1F2TA 2IYUA 3QF4B 2NO7A 4PAOA 4LBVA 4EJSC 2FA9A 2F1HA 2Q0HA 4J0QA 2JLSA 3U60B 1E9DA 2GEUA 2RGCA 1N6LA 2I1VB 2XSZA 2OCPA 3I1FA 4ZDWA 4KLNA 2XNDD 4B3DA 3QOFA 5KU1A 3RC3A 2ZUCA 1F2UA
chains in the Genus database with same CATH superfamily
3W05A 3GCWA 1SG0A 5CA0A 3CX7A 2G71A 1LW7A 3CH4B 2VA9A 5LQCA 1SKAA 3PHCA 3FDZA 2PMBA 1VE7A 3LPNA 2IS4A 1J8MF 2CXUA 1S96A 1O95A 4G81A 1A8SA 2H29A 3F7TA 2V4ZA 4RLFA 3ZV7A 2QR3A 2PKYX 4CDGA 2OCAA 5FUQA 4LSWA 4OQZA 3DC2A 5CM9C 3V8VA 4H17A 4HN4B 5KJFA 1QIKA 2CDNA 5T3YA 3W5UA 4BIMA 4CLHA 2HFKA 1RZUA 3OICA 3H5VA 1U3WA 2ZKLA 1K4YA 4RZ2A 4NQRA 5KTRA 3QY0A 2R6GA 2PGLA 4QU8A 3J80A 5DB4A 4YCMA 4X20B 2NZYA 4CCYB 3QRWA 3QE0A 1Z4IA 2DKOA 2QMEA 2ZROA 4WKBA 2RJ3A 3JQBA 2YOHA 2QX7A 5FHQA 2RIRA 3ZI7A 1EVLA 3DEHA 2W2VA 3T1NA 4DQVA 2VEOA 2WVGA 1VJGA 1IVYA 1OPXA 2RAFA 3I8SA 4P6VF 3HO8A 4K5QA 4Q7EA 4NABA 5DW0A 5C8YF 1OFHA 1XU4A 1B76A 2ODPA 1U5CA 4IO0A 4O2BB 1G66A 5U9CA 3ETNA 2AE1A 1B7GO 3ONWA 3QTBA 2X7XA 4MV3A 1BC5A 3S8MA 5HK9A 5KX5F 1W4RA 2Z2IA 3IQZA 1ISFA 4HYQA 2UVPB 2HF7A 2I4LA 3PE4A 4HC4A 5EJ2A 5KYVA 1A9RA 3PGVA 5CU7A 1QBGA 1DC3A 4HD8A 4Q4JA 2B8NA 4L5IA 4O4JA 2ATIA 1RKBA 2PCJA 2Z8YM 4E03A 4MR7A 5DNAA 3FPBA 1AN9A 3RYIB 4G0WA 1CY4A 3SZOA 1PW5A 2ZRCA 4W7IA 1WUYA 1AK1A 5KMGB 2VKQA 4HVAA 1VKOA 4OLBA 4AJ2A 2Q1UA 4JLJA 1M9NA 2WWXA 4BNZA 2PD6A 4AJHA 5H3HA 3R0QA 3S2UA 1LSUA 2E49A 1J0BA 3DVQX 3K9HA 4GRDA 5IRCD 2OPHA 3NBYC 5K3CA 5LQSA 4ER3A 1GKLA 4UUNA 2RHTA 2RHOA 4PFSA 4H6VA 3WQHA 3D2AA 3CUTA 3LE8A 2QD4A 3VR6D 5CB0A 5EHZA 1DQZA 2IYQA 3BXFA 1OPRA 1WM1A 5HGJA 1QU3A 4WSOA 3DPSA 4B9EA 2OHJA 5EIBD 2JGLA 1JAHA 1JIIA 1Z17A 5BWOA 1IY8A 1IAQA 2F1KA 2H07A 5BUSA 3DZKA 3BAZA 3Q0TA 4OAOA 3W2HA 3KSBC 1KO7A 2REQA 2DFTA 3OSUA 5DASA 4DMLA 4G67A 3FDXA 1NHGA 5JH7B 4N39A 3E5HA 5DWVA 4Z4HA 5KNBH 5MN5A 3C39A 4Q4JB 4ABTA 2BKUA 1BRMA 1NZFA 2J3QA 2W11A 4PSDA 1ZM7A 4C4XA 2Y27A 5B3JC 1CF2O 3D59A 1X94A 1U7XA 4R3NA 2ERXA 5LQRA 3NRBA 2ZIWB 3VOTA 3ZXUB 3SM3A 4EUEA 4K28A 5TE9A 1JIQA 3PVSA 3L6OO 2OGZA 2HGZA 2FKAA 2HK6A 4ZTZB 4BVHA 3TYXA 7ABPA 4FSXA 5AUNB 4UATA 2ODWA 2QY6A 4WXMA 4FGWA 4DQUA 4OB7A 4YHBA 2LV8A 3JTMA 3UUWA 4HRAA 2NO0A 1Q2UA 2NXNA 4IWYA 2JD2A 3QGMA 1C3OA 1ZX1A 4EOGA 5M3BA 1TAUA 2VBCA 3GJ7A 5MN6A 4U6SA 1ZXLA 1AV7A 4HN2A 3V1UA 3FUXA 5K0NA 3LT2A 3OPVA 3Q2IA 4CL3A 1DE0A 2BFBA 2J6CA 1OJ7A 1UPBA 5DXJA 1JDBC 1R4NA 4Q5IA 4PC7A 3R0VA 1Q21A 4ZDKA 4TSKA 2IW3A 1PR2A 1LX7A 1NDQA 4ND1A 3FYTA 4WEQA 5B1IA 3W4KA 3H1FA 1ZUIA 3DV0A 2XUZA 3FNIA 1X9IA 3MWGA 2D62A 4MIEA 4X90A 4JI2B 2I78A 4HQOA 4PZCA 4L4XA 2FPPB 3IUYA 2ZTHA 2H2FA 2KB0A 1UADA 3A4NA 4RFSA 4ZI2A 4IRUB 3LD9A 3WR5A 1QXSA 1GUDA 3LKBA 1DTSA 4EX7A 821PA 2FWPA 2C7RA 2HHHB 1MQAA 2RH9B 4CM6A 3RVDA 3IPRA 5EKDA 3BJEA 1T2EA 3HJFA 4Q19A 2YASA 5AIAA 1H2RS 5BVGB 2ZUVA 2Q49A 3AUTA 3K71B 3MT0A 4A1FA 4GKKB 5DFAA 1GEEA 4GWLA 2UAGA 4DREA 3SYNA 4ARCA 2PWYA 2IFTA 4CUZA 1UJ2A 2IZ7A 2NTEA 2GPSA 2Q21A 3F8WA 1QH8B 3HRKA 3II6X 4HUQA 5JI2E 2OWEA 2K7ZA 3N2KB 2VF2A 2ZBUA 1UP4A 2C84A 1FDSA 1KZYC 4U2FA 3SBOA 4IZIA 5JASA 4N0MA 2IDKA 3RJZA 3N3AC 3ZBPA 1SEVA 4L2IA 3OCUA 4OLFA 4HQ6A 1M8KA 1N9GA 4ETNA 3BG5A 4PE5B 3TAXA 1GRCA 3ORHA 2LW7A 2Q28A 1EFVA 2EKLA 2JIQA 3K0AB 3WB2A 4MV9A 1UAGA 3KTFA 3AIMA 4MRMA 5GJBA 1TTPB 4A26A 1XZGA 2O3QA 2QF7A 4Z53A 1F0KA 1O9GA 4H77A 1YQ9A 5F76A 3FNQA 3ZHQA 2QN3A 2F62A 4DF3A 2FE1A 2EDCA 1G60A 2GKSA 4IFIA 4G4JA 2VJDA 2GJKA 4NMMA 1EQAA 5CNKA 2OAEA 5B4VA 10MHA 4HUQB 4WJZA 3RKUA 3EIHA 3WMWA 1DHTA 2IWRA 3JQ9C 3M4XA 2FP4B 4LXGA 3SR0A 2GVZC 3FMFA 3SQNA 2O1XA 5EZ5A 5HM6A 5AD1A 1C4XA 1U02A 4RA6B 2FG7C 1CG6A 2PUAA 4W1SA 3WAKA 3EQ6A 3NIWA 5F4ZA 4D98A 3K1AB 5K6AC 1RFGE 1DRUA 1ODTC 2KLBA 2BSAA 2YUIA 3IAAA 3HKDA 3LYLA 1YRQA 5KTKA 4D80A 2YZGA 4NR0A 4X6LA 4V02A 1K89A 1A9QA 4HAWA 4MVJF 3T38A 2O8CB 3B3FA 4EYOA 1NX6A 2XLBA 3NXKA 5I6DA 5KNDD 1KMHA 1J7KA 4G1BA 1PG2A 1H23A 3BRCA 5CVJA 2HMYB 4HDOB 1MORA 4C6RA 1P7PA 3V9PA 1ZA1A 1G4HA 2D7CA 3E2PA 4WADA 2QJOA 2YWRA 3UENA 3W5SA 5JBIA 3UT6A 2JVKA 3JWPA 5L7YA 1HURA 1Z38A 2C3MA 3ICEA 2HQBA 3SGLA 4ES6A 3AUFA 1UBGA 5AVKA 3SEZA 3FB1A 1WOYA 5A7FA 1GGKA 3ABQB 2VJYA 2GJ8A 4N9QA 1Q5PA 1LB1B 3E2IA 1NJFA 4DLZA 2XIJA 1R8JA 4D0LB 2Y1CA 1Q0LA 9LDTA 1G8AA 2HSZA 3KR1A 1WULS 4UMFA 1EDEA 2FQWA 1IBCA 2XZPA 4KE7A 4S1VA 3S40A 3UK0A 4U02A 1CBUA 2IPAB 1YB6A 2VJNA 2C57A 3OY7A 3Q40A 4IW3B 5C34B 3AHFA 2XCOA 5JVDF 5C53B 1EGMB 5F1PA 2NQ8A 4L08A 3WX0A 2I9PA 1SHUX 2XGGA 5KDOA 5BR4A 1JBKA 3FYSA 3W9UA 4V0KA 2PVCA 3RJ5A 4UDNA 4EMTA 2VT2A 4K6HA 5HNKA 3GFQA 3FBWA 1EESA 3OU6A 4Q3CA 1L7EA 2PAAA 3BERA 4J1SA 4KXNA 2XDWA 4R7GA 5JAOA 4A91A 2OZLB 2WAXA 1W1WA 3DT6A 1RWBA 2IE8A 2QRNA 2F6RA 5FTMA 1EEXB 1I13A 3AETA 2W0MA 1ZCBA 3LZDA 3OT1B 4G0XA 5COAA 1XTBA 1R8XA 1Y8RA 5TJHA 4POOA 2KM1A 4TLBA 4D8WA 1CYEA 2WP8J 4JBXA 4O4HF 3AGQA 3O8OA 1Z9BA 5EXTA 1JFSA 4L8GA 4AY6A 2LPMA 3O84A 1RM5A 1WLYA 5HIAA 1TAQA 2ZR7A 4QOSA 2R8PA 3S8EA 2D4AA 2W2KA 3FDIA 3PFBA 4BVAA 4CE6A 3IT1A 3M5PA 5K3DA 9MHTA 1GGNA 1NUUA 1MPXA 1KEWA 2BEWB 3LC2O 3P7MA 1Q1QA 3ZUPA 2IZ6A 1Z15A 2WNHA 3QVLA 1MVLA 3ZIUA 4N5IX 1XRPA 3MJDA 1G63A 3HHEA 3WC4A 4YASA 4OP1A 3W2FA 4C5AA 1MKYA 3CX8A 3RUDA 4HDSB 1CYDA 3JQFA 1VRCA 1F8YA 2I4OA 1FFWA 3ENKA 4CU2A 4ICIA 1SA0A 1HYQA 4LW8A 4BQQA 5TARA 3PQCA 3HXQA 4Z3OA 1WBBA 1OBFO 2QPTA 1ZMOA 4UXIA 4WWHA 5JAIA 2Z6UA 3CRW1 3HJNA 2FR8C 1IJEA 1J0DA 1E5QA 2ZAMA 4JP3A 3F3MA 4CLEA 3NAQA 1NM5C 1GL6A 2OGUA 3A9CA 4UPDA 2V7WA 5EKTA 2F9FA 5IT9A 2B8WA 3VDMA 1IXKA 1UDBA 2YC4C 5BSKA 3JWEA 2F17A 1N4DA 1VE3A 4R1LA 5FD8A 5TVKA 3GD5A 1WMFA 4B2PA 1Q7TA 3C8UA 2ODQA 2V1XA 4MINA 5FRDA 3RM3A 1XHEA 4WJKB 4B8ZA 4CLXA 2FSVA 2IYXA 4CRWB 4YLGA 3U9LA 4D0GA 1SZPA 4PRZA 1I7QB 1JEDA 2GNOA 4IPTA 5LJIA 3FUVA 4KQMA 2WJWA 2NO4A 3TSYA 1G2OA 1H65A 4NU8X 4R54A 1JDSA 5EKXA 3E3MA 4WZBB 4H4EA 1XRJA 3PXCX 1IQRA 3WGUA 3K09C 4L6IA 2ZJOA 1KI4A 2HB6A 4CIWA 2BGLA 2QZ4A 1C7FA 3AZPA 3AC0A 4S1OA 3UV7A 1ZSVA 1P74A 4XOIA 4BWFB 3DAPA 2H1VA 2HPHA 3B48A 3GLFE 1PRYA 1I6KA 4DV1B 2IYTA 3AOEA 1U6JA 3LY5A 3TI9A 1L5ZA 3AI2A 5KVAA 4RWEA 1FXWA 1ZJZA 2VBGA 2VHEA 3NWOA 2AG6A 4NZYA 2ZYTX 4Y0NA 5KDDA 2HA4A 4NCBA 4L3OA 4QBFA 3ZDBA 2JFZA 4F6CA 5ED0A 2AKEA 2VAMA 1DAEA 2AYYA 2CCJA 4QDKA 3CVXA 4BMCA 1LCIA 1A9XB 2CNLA 4ZYVA 3OQ1A 3U3ZA 3IIMA 1JG1A 1VE9A 3WLAA 3ZQUA 4MVJD 4OQLA 2GTIA 1UBSB 2R00C 5KYKA 3NTQA 4JKIA 2OPBA 1E1RD 2BFOA 3OE5A 2HRDA 2ZE8A 4ITVA 4UBNA 4XGRA 3EVZA 4LPSA 4OFBA 3UYLA 4IV5A 1T35A 5C3UA 4D74A 3TIFA 4J7CA 1IZ8A 3VPXA 4DC9A 1YWGO 4GNKA 2P6RA 1PGJA 1N8SA 2IYZA 3DDCA 2NMVA 3V46A 2GBLA 4CQNA 3P2KA 2JAUA 4HWPA 4LOIA 4Z0NA 1V2HE 4MWEA 4PIMA 1KEEA 3U31A 1MEOA 4IG9A 3RSSA 5JSUA 3GH3A 3I39X 3D3JA 3SP1A 3T6KA 1K5HA 1Y6QA 2AG5A 3EFOB 1KS2A 1B0PA 1UXIA 4UVIA 5D3KA 5IW8A 1TM7E 3AIOA 1HH4A 4UASA 4D43A 5KNCA 1HDCA 1KYXA 2X2PA 4BV8A 2XA2A 1SIWA 2C2BA 2Q3HA 2NXEA 2PGAA 1QZZA 3PQ4A 5JYEA 4PEVA 2FPUA 5DX1A 3HVRA 3EX7C 1RR6A 4DV0B 4OM7A 5G1NA 1U0GA 1JMYA 2V0CA 1BE6A 5HP4A 2VZ0A 4O2RA 5TT1A 1BKYA 2PZ8A 1XD8A 3F5DA 4LGMA 1IOZA 3VSDA 2IQ5A 4IXMA 1QYRA 2AWOA 1JHZA 1Y7HA 2K4MA 5SY6A 1UDCA 1QONA 5LQJA 5EWMA 3R3XA 4CM4B 1GAWA 4JUBA 2AR0A 3K20A 5EQFA 2PBFA 2EFGA 5BSUA 3ZV3A 2ERYA 4D3SA 1LTQA 5BYKA 5DRTA 3X0DA 4ASUD 2QZJA 3GJ0A 2DG2A 4E5MA 2JGFA 3D3QA 3HUUA 1Y6RA 4AI6A 3VPHA 1N9ZA 4J8PA 4MV1A 4RBNA 1QRUA 4UFNA 2UZIR 5LOVF 5C32A 1ZGBA 2QRPA 4I3GA 3FZNA 4PO8A 3TFWA 5GM2A 4JLDA 1ADCA 1JVBA 1HE5A 1NN3A 2VRCD 5E3HA 1SCJA 4G8CA 4WK0B 2GKGA 5ENDA 1C9NA 3U7JA 4ZHSA 3OG9A 1OFGA 5AKKA 5J5AA 4GI7A 4F38A 4ZHQB 2WIJA 5IKEA 1Q0UA 3IKMB 5JSFA 1ZMBA 3TZEA 5GV7A 4UBIA 3K9CA 4EZEA 2WHYA 5IDXA 3R8XA 1KQOA 3NKLA 4MVJE 1LSJA 3HCDA 3Q9LA 1LNSA 2IUTA 3WLLA 1EHCA 2GI4A 2OBMA 4XDZA 4EFDA 2I8AA 3FA2A 2YS6A 3OQMA 3IDOA 3CLUC 3UK2A 1W5FA 1JFFA 1VMEA 1W0KA 1EGAA 2VCHA 2ZB4A 3BTSA 4NSNA 4TL6A 2XRYA 3VOBA 3DW3X 3LBHA 1RWMA 1EM8A 1YRBA 2FI1A 2OO5C 5AI6A 1JF8A 1NQXA 5ALKA 3ZHXA 1O57A 3D43A 2BGKA 2C0CA 2GH1A 4FINA 3K16A 2NV2B 3DE0X 1J4AA 4RVDA 3LC0A 3V1LA 5HHTA 1JHRA 2OB1A 2CLCX 3IYLW 3DLAA 5TS3A 4J4TA 4A0HA 1GPNA 4KXMA 1LWNA 5DBEX 1FPQA 4B3XA 1TT5B 2CUZA 4BNGA 1NASA 1KJJA 4WK4B 3IQXA 1JYFA 3EXIB 4J3FA 1R9NA 5FL7A 2PYIA 1U7DA 3I2KA 5K99A 2GEFA 5C18A 2IHJA 5DTMA 5AKGA 3UAZA 1YI8A 3AVPA 2DSNA 3KSDO 3PRJA 3LI2A 2P9FA 1PX0A 1HWYA 4J1NA 5BN5B 1E8DA 4LV6A 2WA2A 3DWIA 3UMBA 4DR2B 3UWMA 1S7GA 5LUAA 2AV6A 5H81A 4DBZA 1AG9A 1G6Q1 2VQFB 1NW5A 4B4WA 3C6XA 5K3OA 4TMWA 3CINA 4OH1A 5DWDA 3WQRA 1K98A 4L85A 3M5CA 1R15A 4JIGA 3O82A 2GRUA 1BMTA 3HDYA 5A3JA 2IBSA 2RGGA 4TL9A 2GK6A 2C3YA 5D7NA 3L82B 1YZLA 3QQPA 1W2GA 2JFFA 3IDSA 4GS5A 1W8IA 4NBVA 4B40A 4DQ0A 2HIHA 4BJ1A 4C4OA 4PYOA 4ZN6A 4J0GA 4G23A 1MO6A 1X9GA 5EXDA 3BIXA 2EBHX 2GD0A 2IHUA 3H2SA 2G6TA 4L02A 1PT8A 1NQUA 2KMLA 3DDOA 2ZM6B 2FAXA 5I7HA 2O2JA 4M83A 4NJEA 1VPWA 3J7AC 3WLHA 3HZRA 4H3SA 3ETEA 3BXZA 4CQMB 3GJ6A 2PMCA 1E59A 1LWOA 3PDIA 1GTL1 2HCFA 3TSWA 3KCNA 2R1TA 1U2DA 1WD7A 1LBSA 1NP3A 1PQPA 3BEOA 4LDRA 4OJQA 5HRCA 5A5EA 5CA1A 5EFZA 1XEXB 5FUVA 1V9LA 3PI7A 4DRXA 3ASZA 1VSUA 5CNMA 5JSHA 4FFWA 5L3QB 1F7UA 5FWYB 1RABA 3L7BA 4Y0AA 4WBNA 1SQ0A 2IZ1A 4YQYA 3HBNA 3IODA 2WJPA 4DSAA 2GLUA 3ZE6A 1JLHA 1MB3A 1IHDA 3F90A 2LGJA 2QSYA 4HJRA 1T9ZA 4MGYR 4Q7JB 5FP0A 3SC2B 4CTJA 4J2TA 3A4YA 4RXTA 1ONSA 1UOOA 2WHRA 4E2WA 3V1TC 4WOKA 4AQDA 1YTUA 1XFDA 2B30A 4H35A 4TXLA 1UBHS 2PH7A 2AFHB 3KB8A 3P4XA 1YBFA 3LCCA 5FI0B 1HRKA 1NF9A 2P4SA 3A1EA 4EZIA 1YL5A 3EWIA 4E2YA 3TF5A 3THXB 2Y6UA 3IP9A 2IDJA 2Q5OA 1RWNA 2ZREA 4ZTBA 1E79A 4JR1A 4MITA 3AKCA 1BVRA 4TTJA 1HGXA 4KMSA 4NZOA 4UDOA 3QHPA 3C70A 3GP5A 4LHZA 3G9ZA 2A35A 3N59A 2EW1A 1AHHA 1X80B 2QQGA 2GGSA 2J5RA 2P9YA 2XKJE 3EW7A 4MH0R 5EP1A 4QODA 3ZCXA 5JC1A 4CF5A 5D1HA 1EFAA 1YRYE 3QVWA 2QT1A 1U90A 3ESCA 2IXBA 4OI4A 4F2GA 2ZCVA 1WXDA 1E9CA 4IRXA 1MABA 4NBNA 1SRRA 5K0GA 2WJ3A 4RTPA 1OKKA 3MGBA 1TK2A 1ZD4A 4YP1A 3T3EA 3VZDA 2DEUA 1CJMA 1KQ3A 3AFIA 3L0IB 2Z9BA 4N12A 4R1NA 4DC0A 4DIEA 1V1JA 5K45A 4FK8A 3DZBA 3C3XA 2VKTA 4N8EA 4QFCA 4CM1A 3OOSA 1I3LA 1LLUA 3HJAA 4QJIA 5JJBA 2JI7A 5HDBB 1SCDA 1I2BA 2HADA 3KXPA 3KR0A 3O90A 4G5OA 5EEHA 3TQRA 4ZXFA 5LR6A 2FCRA 2XMZA 3HBMA 2UUBB 2B4QA 1NMZA 2IYAA 2VQ3A 1TTQB 3HWWA 4GGOA 4CMAA 4DLSA 1E4EA 5DNCA 3QG1A 4HDNA 1VDZA 4UNSA 4R71A 2QD1A 1F4PA 5JS8A 1XROA 1B4DA 2WFMA 3B3AA 1HG1A 1UEJA 4X6UA 1XL0A 2WSSA 4MJXA 3K1TA 3GFSA 3H11B 5JE8A 1DCFA 3PTLA 1LLCA 2HOQA 3WIVA 2E87A 5BQ5A 1PQUA 2E55A 3EY4A 5A3RA 2D8MA 4N7MA 1FFGA 4JB3A 5JSKA 4KW7A 3NO4A 2P6UA 1GCAA 3WLQA 4AXXA 4GDFA 1XPUA 2PEYA 1I94B 1EDBA 5TMPA 1L4BA 1XCGB 3ZBUA 4EPVA 1Z7EA 4EPTA 3QX8A 4QPJC 2ZCUA 1J56A 2XKAA 1QYDA 3W77A 4ALLA 1CEYA 4RAQA 4K9LA 4QA9A 2NZUG 1FVFA 4ZZ2A 2MINA 5DHUA 4ZD6A 1QGYA 1Y8QA 4EJFA 1XZEA 3GCXA 1QFXA 2AC2A 4TTPA 2Y1WA 4B3GA 1N36B 1ISSA 3F6BX 4GOJA 4GBMA 5CVEA 4EPWA 5ICEA 3WL8A 1TE2A 1V25A 3DE7X 5D2CA 2P35A 3JXEA 4XWWA 5JLJA 4H9GA 3NAZA 2WQZA 1MW9X 3AR9A 4P9NA 3MYYA 1XKTA 4I50F 5EINA 2Q4EA 4L5JA 5DLEA 4ESEA 2RKOA 4D8XA 4Z6KA 3Q5EA 4REMA 2A58A 4M46A 3FAKA 4B87A 1KAHA 3ETCA 3G0HA 2OFXA 2LVBA 1A9TA 1M1YA 3IV6A 5ALOA 1T1GA 4QUJA 4WUVA 2Q5JA 3KWMA 1EB8A 3I2HA 3GAMA 3KOOA 4LC9A 2X5NA 4GR4A 4UHDA 2YMQA 3R2JA 3TKAA 4PU0A 3YASA 4C1NA 5ADHA 3WLJA 2DHRA 3VKHA 3BULA 1E2FA 3ZU6A 2WYOA 5I51A 1VLMA 2ZK7A 3CH6A 2H8KA 2IIBA 2WF6A 1KXZA 3PC6A 4YV1A 2BOVA 4RF3A 5B58C 5CVVA 2BLLA 2E18A 2PHZA 4FHZA 4XRRA 2Y66A 5BQOA 3R8FA 2RCNA 3O94A 3AVUA 3OTQA 4PNHA 4DDWA 1D0IA 2B1JA 2IU4A 4C30A 5BVHA 2CFOA 2PBLA 5DBHX 1XDGA 3U39A 3WHPA 3CF4G 3W9BA 5C52B 3SN6A 1MD9A 4B8WA 4D9EA 4QNNA 4QXMA 1YFLA 4PFJA 5AJHA 3S27A 4HRYA 4JLBA 4RJKA 2PWPA 1TZKA 1MMFB 2FW8A 2PNFA 2Q6IA 4NYIR 4O2BF 3HZHA 3OLWA 4TS9A 2AMVA 3UUGA 4AAYA 1XVIA 2C7QA 4BO1A 4EDHA 5GZ3A 4TRNA 3RLFA 3Q8XB 2VBFA 2IUUA 5FPHA 4LF8B 1NAHA 3LSTA 4D4JA 4RK0A 3RT1A 1TTTA 2QROA 2D7JA 5CXSA 1Q74A 4NV3A 4A23A 4ZVVA 1EKXA 4IGIA 4FLFA 1XDZA 1XVLA 3NOVA 1VC2A 1C8LA 1PS9A 2F9MA 2CNKA 3EXHB 4C6TA 1WD5A 3SIWA 3I72A 2CV1A 2JBAB 2PGXA 4P83A 1E9EA 1M8GA 1RYHA 3TD2A 4A36A 3PD0A 3REOA 3GIDA 3I62A 4GBGA 1A8HA 2WWTA 4BVBA 1LBQA 3HSSA 3AVOA 5ERYA 5BVHB 3ZJ4A 4N0PA 1I1NA 3EZXA 5K5EA 3TR0A 1GPH1 4M49A 3T5PA 1H2EA 3V8PA 4FE4A 2A0XA 3WE7A 1GQYA 2Z57A 1ST3A 3QKIA 5A62A 3BL5A 1M67A 1XALA 4MQ4A 2BI8A 2X23A 2A78A 2AZ4A 4R2XA 3HDVA 1YVRA 4Q9JA 1V6AA 3FCUB 2K5UA 1CQPA 4OP2A 5DYGA 2BSXA 1YI1A 5FLYA 2AJTA 2VSYA 1CQJB 2GRAA 3EXAA 5JH7F 5FA6A 1CUJA 3L0CA 1BHO1 4LF4B 2O3TA 3SJCA 1MX9A 1JDNA 1ZNZA 2HWYA 4UD6A 4YIKA 2QUKA 3LG2A 4WUTA 2IUSA 3RFFA 1V45E 2IF2A 1GUZA 4KH1A 1PYOA 2RH4A 1KC1A 5JCXA 1XK6A 4QUKA 3L7YA 4CR8A 4U0KA 1PUIA 1OI4A 4I55B 3WB1A 2KLHA 3KTAA 2W6MA 4FHCA 4JJZA 4EY4A 7ADHA 5EIEA 1GG9A 3E05A 1P0FA 3LHFA 1WZCA 1XNGA 3JWHA 1CR4A 5HRAA 1Z45A 3ZLJA 3Q9NA 3K70B 2FUNB 4ZOBA 1N1EA 2V97A 4LX8A 4NICA 5AXAA 1M2GA 2WUWE 1QHNA 1XLTA 1VSTA 2RBKA 4ZVRA 4ZKEA 1UT6A 5JFTA 1C2TA 3VO8A 1Q6ZA 1J90A 2Q1WA 2QU7A 4QBIA 2YHAA 3HFSA 2WVJA 4RPGA 5E6SA 3R7NA 4F4IA 3IMFA 4K0KB 2KHZA 4NH0A 1QJ4A 2WFLB 5ALGA 2B5OA 1WUTA 4QHYA 4R01A 4TWZA 3EGXA 5AI0A 5FF9A 3IL2A 1DAIA 4FX2A 1DUVG 4CL2A 5JS7A 3VFDA 1BX3A 4C5BA 5ITSA 4TKUB 1WMSA 2DPYA 4KE6A 1K27A 4MS4B 3ZHBA 5CEJA 4BKRA 3I1YA 4MPRA 2OAGA 4Z9BA 3STYA 5CDSA 2Y0DA 3C3AA 3L0DA 2ATXA 3F1LA 1V96A 1ZONA 1T1SA 3CEHA 3HR4A 4KPUA 4Q12A 5ESXA 3OQ6A 4XARA 5EYPB 4YV0A 1SVOA 3KTOA 4O1HA 1L5KA 2YUTA 1SKBA 3Q7RA 1G1MA 2IELA 3JAWA 4L27A 3TBKA 2Q3MA 1U8AA 3ICPA 5KWVA 1KBOA 4AKTA 2YXLA 2ZYAA 4MJ7A 2IU6A 1Y5RA 3C7KA 3QLUC 5K0ZA 4UUPA 3PYMA 3DCNA 3ZWDA 3F98A 3VHXA 1LQ2A 3A4LA 4H60A 1L5WA 4XWOA 1XAHA 3P9NA 4RD1A 1JEYA 1AJEA 1GTG1 1YB7A 3V5NA 2HQRA 4MA0A 1IU9A 4CUKA 4BC0A 3WIUA 1W6RA 2BFFB 4TTAA 1X6VA 2ZRIA 5SYNA 5MN4A 2GX6A 1ORDA 2GEKA 3L7CA 4RH1A 1U1DA 5BN4B 1ZR4A 2GBGA 1CUFA 1TVKA 2HHCA 2XDAA 1L7NA 3CR3C 3BD9A 4PPGA 2AN9A 5LLTA 3DVAB 5IYZB 1GCOA 3PRHA 3FFAA 4DOMA 1ULTA 3HY6A 2NV0A 2CT8A 3P45A 3THYB 1LDBA 1HQYE 3SLRA 4EUHA 2V7QD 3G5TA 1MRSA 2FK7A 3U5TA 1CJUC 3HXPA 3PPWA 3MT9A 2YXPX 2WHPB 1MFZA 2JGEA 4ZO7A 3LXMA 1FNMA 4KDCA 2A3RA 1NYTA 4QQRA 2Q29A 3ENWA 3T7KA 3TZ6A 1MJGM 4EG4A 3BB4A 1UMCB 4YXWD 4YROA 3IUSA 2UZ4A 1TA0A 5CXUA 4RY9A 2BR5A 2XRMA 4G0VA 3DVLA 1FY2A 1L4LA 5TVGA 3OOYA 2A6PA 3I6YA 5AFSA 1OFUA 2CNWD 4KE9A 4RZSA 5JV5A 4RDXA 1TDJA 1Z7YA 1VCMA 3NHUA 1L5RA 3A2NA 5DYIA 3RBZA 4AN4A 5KC8A 3KRTA 121PA 3PT5A 2GN8A 5C7LO 3RSOA 1S1CA 1WPRA 4JQCA 5CHEA 3X2EA 2HNBA 3R5KA 4RADA 5JUWA 4WQMA 3VYVA 3J81A 3C6ZA 1J22A 4PCAA 1CEEA 1U0EA 1WW8A 3OA0A 4XIGS 1RXEA 2PV7A 2XZOA 3OEED 1JA1A 2WSMA 3LVQE 1Z0JA 3W3AA 1Z18A 5CK5A 4RV5A 1QYXA 2FFAA 4LWOA 5CFOA 1TL7C 3HU2A 4BFCA 5FXMA 2I1QA 3UT0A 4LBZA 1WDWB 2VHUA 3BRSA 1RAAA 3PA8A 3ZTTA 3S1SA 1P4JA 4ZOLA 1I4LD 2YZMA 2XZLA 2FZVA 3I09A 1Q19A 4KB5A 1N6HA 4TTSA 5T6BA 4EH1A 1FP4A 4F60A 3EIOA 2P79A 4EMUA 2HDWA 5KVCA 3U4DA 5KYTA 4I1PA 1MDFA 4EMSA 1V7QA 2XE7A 3RUPA 3LXUX 1DIRA 4R51A 1OGJA 4FXOA 5IH7A 1H2BA 1JHUA 2A5GA 3TL6A 1Z36A 1RHJA 3HPRA 4QXRA 5DYWA 5B6IA 4OHKA 5HF8A 2AN4A 2ZYHA 5I8PA 2W90A 3ICVA 2R2AA 1RBMA 4Z49A 4C6SA 1QLHA 3TSCA 3E53A 2UZ1B 3I52A 4KFSA 4DEXA 3UY4A 3FUCA 2ET6A 4WN3A 3CLRC 3H2ZA 3AEZA 1KRHA 1NJ5A 1AUXA 5K2OA 3NYQA 3TW4A 1GPUA 2YBDA 2CSXA 3A1DA 1SJ9A 2CWWA 2GA9A 3BMQB 3BYZA 1N7IA 5AW3A 5KYUA 3SX0A 3QUCA 1XMSA 4D2IA 2J6BA 1JBEA 4H0FA 5CTAA 4L6CA 4CMCA 3SZRA 1JKIA 5A4DA 2HNKA 4Q03A 3OTOB 3KV1A 1JAYA 1O94C 3WV4A 3A6DA 3AX6A 1ZJWA 1GV0A 1NNSA 3DXFA 4XLLA 3SJ7A 1U1IA 2Q6TA 3NBMA 4BMDA 4EUNA 1OD6A 3QMPA 3I2GA 3T5AA 2MMCA 2JAQA 5IAJA 3SXJA 1ML4A 1IWOA 1KYTA 3GT3A 4FE3A 4P92A 2Y1EA 1YZVA 3O4FA 4ZANA 2OXTA 3RNLA 5BW5A 1EEHA 1X77A 2J0UB 3N2LA 4J7AA 2W6CX 4ERXA 5DM60 3N0RA 4G37A 1Q11A 1NV9A 3RS0A 5GVSA 1OI3A 4EB6B 4DWWA 4YJFA 3PX7A 3SKYA 5KWJA 5BURA 4MIOA 4AS2A 4LZWA 1R66A 1N2IA 1R6AA 2FQXA 2C2YA 1IB6A 2UDPA 1K8QA 3HEMA 5T4FA 4ETIA 4CEIB 3RS4A 2ZZNA 2NXCA 4C4SA 4NNJA 1Q7CA 1TZMA 1YOVA 1LRLA 3N74A 3ZQJA 4GPZA 2BEKA 3AESB 2O7QA 1J1IA 4BNLA 1UPXA 1NVUQ 2QYSA 4L0MA 5HFJA 5IEBA 1FVXA 1E5LA 1WVMA 3DA8A 5TQ0A 4CF6A 2XY4A 1C80A 2B4KA 1MAWA 1P39A 4YT8A 1SCIA 4KJXA 2O2SA 2GAOA 1XMPA 4EIWA 1AZTA 4GEKA 3P9RA 2PZAA 2PX3A 4NZZA 4QAQA 4BNMA 5DGDA 5FI5A 3OCVA 1N7GA 3OWHA 1Z7GA 4KFTA 5HQJA 2CVPA 4Y1FA 4PN3A 4R41A 3U4AA 5ITZA 3H84A 2EHJA 4C4AA 1XU9A 4BQEA 4Q1VA 2AC4A 2IK8A 3OE7A 3E82A 3KB6A 4OM8A 1TADA 2EZ9A 3IVMA 3U1TA 3WL7A 1Z0SA 1Y6JA 4TS1A 4EHJA 5A5FA 4EARA 4MV0A 5IBRA 2Q62A 3K9LA 4M4SA 4X63A 2EKDA 2IW1A 4GMDA 1MP0A 3N39C 4HWTA 1TFRA 1J8DA 4MQLA 3T4PA 4A5SA 2AD1A 3RYCB 3A1WA 2O8BA 3WZLA 2GPNA 3QW2A 5LKRA 3ADDA 2FSFA 1NTRA 3ISVA 4LTNA 3STHA 5I4CA 1CEQA 3OURA 4PAMA 2YJ6A 2R5NA 1PL8A 3M83A 2NVUB 4YJGA 5E8RA 1R5OA 3RVMA 1QZXA 3RV4A 2WINI 1ZGGA 5B7PA 4P1ZA 3M2TA 3SOZA 1KH2A 1JFRA 2UUCB 2GXUA 4KGDA 3I8XA 2HFJA 3PFHA 3HWSA 4PXSA 2A9QA 3G7UA 4ADSG 4MDHA 1WXWA 3U61B 4AS1A 3D1VA 5LMUB 1P33A 1TA4A 2P2CA 4OI2A 2CXPA 5TC4A 1H2XA 1QVAA 2ZRJA 3ANLA 3B7PA 4YCCA 1SXPA 2VWPA 3CX4A 4EABA 1Q84A 1DJNA 1RXSA 1XTPA 3CEMA 3FFXA 3OC6A 4MQMA 5DOVA 3COZA 1ZA2A 4KLZA 4ZT2A 1FIUA 4JBNA 4K1LA 1XN4A 3DLIA 4TTIA 2XXAB 2P2NA 4P4LA 3NNDA 2FEOA 3JRWA 2Q1TA 1ZD5A 2QL6A 5FWAA 1HSZA 3E22B 1LBEA 4LNAA 3FNHA 2ZIXA 4GWGA 1TFUA 2QQEA 4L9WA 1Q0QA 2A84A 4IKEA 1NR1A 1M6VA 2G5CA 1OXUA 1GYQA 2C2HA 4KVZA 1QV9A 2HCBA 2BCJQ 2I29A 4H16A 4EHDA 2QMOA 4Q18A 4FUQA 1VPVA 1W85B 3EARA 5D85A 3RODA 3JTEA 3GZNA 4X00A 3UN1A 4QQNA 4CN8A 1ZEJA 2A1UA 4PBTA 4QE3A 4BB9A 1Z8FA 2EIHA 5IC4A 2VJAA 2Q3LA 1JHAA 2VTBB 1T9GS 2HT1A 2GVDC 4GPEA 4OHFA 2NUAA 3OIWA 1M6NA 1N2OA 1HL3A 4PLCA 3RC7A 4EJMA 4DB4A 2GWHA 3Q6MA 4N0EA 1L7RA 1SCUB 1Y1RA 3O4IA 4IDPA 4S3MA 5CBKA 3U7HB 3LPAA 3SPXA 4IVRA 3P5SA 4EKEA 2QV0A 3AM3A 5BW8A 3A9UA 5FPSA 2EU8A 4V39A 2E0IA 3ZZ1A 3BX1A 4G63A 5IAAA 5JEEA 3G2JA 3UV3A 1JIJA 2OHXA 3KPJA 1ODFA 3VZBA 2QX8A 3GZTB 4RPIA 4O02B 4JI6B 3UV6A 2Y77A 5AXCA 4D0RA 1T8YA 1BHJA 3VISA 1V3TA 1KF0A 4QHSA 1P7ZA 1IZ0A 4J6EA 3FZYA 2CNBA 1Y1TA 2PD4A 3AEKA 4XR9A 5JD3A 4DLKA 3NM4A 4TWRA 4JBWA 1L7PA 1NMSA 1U2RA 2CF5A 1F3LA 1U3VA 4UZFA 5IHPA 2DCUA 4JA2A 2JCVA 3FJ1A 3C6MA 3SSOA 1P18A 4DLAA 3RHTA 1NN5A 1MV8A 1KAGA 1PAUA 2FZEA 1MOQA 3LPLA 3ORSA 4LVCA 3RVOA 3ZU5A 3RSLA 4BMNA 5AQ1A 1PR4A 4ZHQF 1ZNYA 3C43A 3VU8A 1L3CA 1M2NA 4A8PA 4RKEA 2Q9CA 3LF2A 1RM3A 1MXHA 1TPYA 2ZT8A 3NBZC 4MAMA 1FJHA 1DHRA 3GPIA