4ETWA

Structure of the enzyme-acp substrate gatekeeper complex required for biotin synthesis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
255
Chain Sequence
NIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLGWALGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFISHPAEFCHLLVALKQRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Hydrolase
molecule keywords Pimelyl-[acyl-carrier protein] methyl ester esterase
total genus 91
structure length 255
sequence length 255
chains with identical sequence C
ec nomenclature ec 3.1.1.85: Pimeloyl-[acyl-carrier protein] methyl ester esterase.
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4etwA00
2GYVA 2OCLA 5ALQA 4B82A 3DLTA 2G5PA 2XMCA 4DSAA 1QIFA 1XZHA 3A2NA 1IUNA 1VA4A 3E1GA 1BS9A 1PJAA 4MQMA 5JALA 5CRIA 5ALZA 5CH5A 3YASA 1J06A 5CMLA 5AKXA 4WY5A 4ZGBA 1QIGA 1U4NA 4U2BA 3F8SA 2GYUA 2WSLA 2WG0A 4I3FA 5A2GA 1O6GA 2H1IA 2WHPB 2XUAA 3LIPA 3RLIA 5JASA 5JAOA 1XZMA 4A23A 4X85A 4DIUA 4ETWA 2WTMA 2HA7A 1MX9A 3FVTA 1WHSA 2WKWA 4QWMA 2PVSA 3I2JA 2DR0A 3FSGD 4X91A 3HI4A 2Y2UA 3PF8A 5DWDA 1AMNA 2ACKA 2CKMA 2QR5A 2JGJA 4EY4A 1K4YA 3QPAA 1JU3A 1EDBA 4AMYA 4N8DA 4FKBA 1ZI9A 3QZUA 3AZOA 4B83A 3G0CA 1LPNA 4D9JA 3V9AA 2IIVA 2CZQA 2ROQA 3G0GA 4H18A 3W04A 3SC2A 1O6FA 2X5XA 4UFPA 3W05A 5C8ZA 1BRTA 1SCIA 1FFDA 3F98A 3L1HA 3G9ZA 2DHCA 3D7RA 4GI1A 5AI8A 2QUBA 2VJBA 4MJ3A 5A7GA 4B9EA 2FJPA 4Z49A 2HADA 4A5SA 2DFPA 1ZGCA 5ALUA 5I7UA 3O4GA 3B3QA 4XWGA 3T52A 1FFEA 4E14A 1B6GA 1JI3A 5JIBA 4CCYA 3PDCA 2PSDA 4WY8A 3E0XA 2Z8XA 5JADA 3G9XA 3C70A 4I4CA 3STUA 3V1LA 2XMRA 1GPKA 3GA7A 2CBGA 3BF7A 3ZLVA 2WM2A 5C81A 3OPMA 4Y2VA 5ALWA 5KREA 2WHPA 4TGLA 1X2EA 4J0KA 1E8MA 3DL4A 5AM5A 5KWIA 1R88A 5K3BA 1ZIXA 3FYUA 1BE0A 3I2IA 1L7RA 4CCWA 5CT4A 1CUCA 2JGIA 5LLSA 3W9UA 1P0QA 2JGKA 3K2IA 2ZSIA 4OU4A 1IUPA 3OC0A 3VISA 5ALDA 1DWOA 4RGYA 3PFBA 3STYA 4KACA 2WFLA 3M82A 2I03A 4FHZA 5JZSA 5K3FA 3WWPA 3O4HA 4S0XA 1T4MA 4IH1A 5JAPA 3V1KA 4ZI5A 4C6HA 2XUGA 4BCDA 3EIOA 5LZ5A 3OOSA 4KRYA 2BJHA 2HA3A 1CUFA 3HYSA 1E5TA 5LZ2A 4M0MA 5AOBA 2XUOA 4MYSA 4BAZA 4CIBA 4P93A 3NOXA 3VXKA 1H2ZA 2OAGA 1XFDA 1B41A 4BYMA 3DOHA 5A7FA 1LPAB 1P0IA 1T2NA 3EBLA 4H7KA 5CXXA 3VVLA 1FFBA 1CUVA 1UOQA 5AOCA 1OCEA 1CUJA 1XZGA 4ZRDA 4Q1VA 1CUUA 1IUOA 3O4IA 4LYDA 5EHNA 4BC0A 1EK1A 3C5VA 4ZXFA 3AUKA 5AO9A 3X3HA 5CT8A 3IUMA 4Q34A 1EVQA 4CIAA 1HPLA 5BOVA 5JYCA 3R3UA 2XQKA 5AI6A 2WFZA 1MAHA 2VSQA 3HZOA 3R3ZA 3RKSA 1LZKA 1N8SA 1QIEA 2CB9A 4HRXA 3DKKA 2OLEA 5ALSA 5JZ9A 3WKDA 4BVLA 3C6BA 4OCZA 4G8BA 5BV7A 5SYNA 4CG1A 3B5EA 4Y9SA 2BUAA 1E8DA 3WK9A 1LGYA 3FBWA 4KE6A 2HA5A 3ICWA 3IB3A 1MJ5A 1A7UA 2WUDA 4ITVA 1MX5A 3IUQA 3LLCA 4C4ZA 3G7NA 4YASA 1G42A 1QO9A 1YAHA 1TCCA 4W1SA 5ESRA 1LPPA 2ES4A 1D07A 3DYVA 2WG2A 1ZGBA 1C4XA 4WJLA 2PM8A 3UMJA 2OG1A 2NW6A 1G4HA 1XZKA 3L1IA 5DLPA 3EQ8A 4X6XA 1VKHA 4Q82A 4N8SA 4GWLA 2QKYA 3D3NA 4Y2UA 3TRDA 3H1AA 4ZREA 1RYYA 4W1RA 1FJ2A 5JD4A 3DDUA 4BZZA 1ODSA 5AICA 3ESBA 3R3VA 2O2GA 1XZIA 4EY7A 2HL6A 4H7IA 4W1QA 5AIBA 1VZ3A 2X8BA 3MUNA 3LIIA 4Y2TA 2RAUA 4H7HA 2QMQA 2BKLA 4AXBA 1Q84A 4IH9A 3WKCA 4HS9A 1WCYA 1JT2A 1CPYA 2CEKA 3AZQA 3WKEA 2C5GA 2BUCA 4P9NA 1WM1A 4N5IX 4FLEA 5EIHA 2XMSA 3H1BA 1PV1A 1P0PA 1WPRA 2PBLA 5K3DA 2ACEA 4J0CA 3C87A 4PSCA 3D2CA 2IX9A 4W63A 2OXEA 4XJVA 3UUFA 1LZLA 3H2IA 1QE3A 3D2BA 2HFJA 2BGNA 5FRDA 2WIKA 5IVIA 2ONCA 1DWPA 4Y2JA 1BCRA 5KWJA 5I9IA 1ZI6A 1USWA 3DYIA 3U0VA 4QDZA 3V1NA 1SFRA 3DEAA 2QT9A 3N0TA 1JJFA 2Y6VA 1DINA 2K2QB 2I78A 2WUEA 2B9VA 4OU5A 3H2JA 2VAXA 3NUZA 3H2KA 3IULA 4HRYA 1XKTA 1YASA 5AKKA 2Z8ZA 2XLBA 2WJ3A 4E46A 2WIDA 1MO2A 4DLNA 4FBMA 5YASA 5LIPA 5HCUA 1EA5A 4UBLA 3IA2A 1GPLA 1LPSA 5HKBA 5HF9A 3DL7A 4JYPA 3D2AA 1IZ7A 5A6VA 5IVKA 2WHQA 4I19A 5FP0A 2OCKA 3ANTA 3HXKA 5F4ZA 3STTA 4DGQA 2I3ZA 3KSRA 3HEAA 4CCYB 1YB6A 3CCCA 4F21A 3O0DA 1CUDA 1BU8A 4K6KA 2Z5GA 5C8XA 4BCBA 5ALRA 1GXSA 3I6ZA 3S2ZA 4IHAA 1XRRA 4H77A 1XQVA 2C0QA 1ZJ5A 4EY5A 5EHZA 1DQYA 1QIKA 1LPBB 4FDMA 2O2IA 3F96A 1EHYA 4O08A 3GROA 5FUMA 4UHFA 4QLAA 1CIJA 2P8SA 1ZD3A 4HXGA 2QRUA 3FLBA 5JD5A 3PICA 3CCBA 4LYEA 2ORYA 4G1FA 2C5FA 4U2GA 1XZLA 3CN9A 5ALLA 3ESAA 3ZV7A 4YK7A 1JFRA 5HK8A 2GYWA 2R8BA 2X76A 3LS2A 4DNQA 1SOMA 4AO7A 2Y1KA 4FMPA 4RPCA 3WK6A 5K3CA 1EX9A 4UPDA 1CQWA 3QMVA 1JMYA 4PQEA 1F8UA 2CMFA 2E3JA 2HHAA 5BWBA 1R4ZA 1A88A 3RARA 3WA7A 1LBTA 5EGNA 1MN6A 4MWSA 3BL8A 4QDUA 1WHTA 3PF9A 2XMQA 4G4IA 4H7FA 2V9ZA 4K6HA 4F5ZA 2XUFA 2D0DA 2VJCA 5AK6A 4BRSA 1CFJA 2PL5A 1UOOA 3TGLA 3T4UA 3IDAA 3VVMA 4B80A 5FXMA 1H2WA 2QJWA 2PKYX 5AM3A 4KEAA 4B81A 1CUAA 2AJ8A 2G5TA 5AKGA 5HFNA 4FNGA 4K5QA 4X7BA 1UFOA 1BCSA 3GELA 1XZAA 2J3QA 1H2XA 3I2FA 1KU6A 3FYUC 2QTBA 2ZVDA 4ROTA 3DQZA 3BIWA 4HXFB 3ZLTA 4GHWA 1HKHA 3KOOA 5FPQA 3H2GA 5LZ4A 5AH0A 5EFZA 3DJYA 1E8NA 3FWHA 5AKIA 5ALNA 1YB7A 1R9MA 2B20A 2WU3A 2H9YA 2GBFA 4BBZA 5H3HA 5LKRA 4INZA 2OPHA 3EQ9A 5AKYA 3AFIA 1TKRA 2AJBA 2VATA 5T4FA 3GBSA 2PU5A 2PSEA 1XRMA 1UZAA 5CT9A 4B7ZA 2XB6A 1H22A 2XQIA 1QIDA 2EDAA 5AK5A 2UZ0A 1LBSA 3D59A 5ALVA 2XLCA 1IMJA 4DTCA 2WJ6A 3H18A 2YXPX 5T4BA 2C0PA 2HM7A 4BTLA 1ORWA 1X2BA 4UFOA 2JGMA 4OB6A 5ALGA 4WDRA 1IVYA 4C88A 3IUNA 4AX4A 1AGYA 1GT6A 2GBIA 1QO7A 4LXGA 3G0DA 4BVKA 4ZV9A 1CRLA 1JKMA 2DSNA 2BAGA 3WZMA 4EY8A 2ZYHA 3DNMA 4MWTA 2CUTA 2ZJ7A 5D7BA 4X97A 1E66A 1YA4A 3WL8A 4Y2SA 2VF2A 5IH7A 2XQGA 4DMHA 4DMKA 4OSEA 3QH4A 4WFKA 2WU4A 1N5MA 1CUBA 4XVCA 5HQ3B 4TVKA 2XUJA 2HA2A 5AP9A 3W9BA 4AZ0A 4B6GA 4QWWA 2JGFA 2C4HA 1AX9A 5JD6A 3HRHA 2HA0A 1ACJA 1K63A 2XUPA 5CURA 4BP9A 3OURA 1X70A 1K8QA 1OXMA 3L1JA 5CH8A 4DMCA 1EXWA 2RONA 4HZGA 3K9BA 3SWWA 3CN7A 3FCYA 4QDXA 4KYVA 5JARA 1QLWA 3W2TA 3G8YA 2XMDA 1XRNA 3QM1A 5E4JA 1GGVA 4Q3OA 1W75A 1XRPA 1N5RA 2JIDA 2PX6A 3AJAA 5LZ9A 4EY6A 4KAAA 4WCVA 2OCGA 1ORVA 5HFAA 5ALPA 5AM4A 4KR0A 4NVRA 1QFMA 3K6KA 3IIIA 1XLWA 5CXUA 2HDWA 2VQ6A 4OD0A 3M3DA 4F0JA 1J07A 2I3DA 3WQHA 2HRQA 1EDDA 1DQZA 3PE6A 3ESCA 4Q3KA 4QZVA 1GKKA 3OG9A 2GZRA 4UBOA 4RE6A 4X3CA 5C8VA 2H7CA 5LZ8A 3ESDA 1U2EA 3IUJA 2DQZA 3C6ZA 4J0HA 1I6WA 4C89A 5I8PA 2PPLA 5ALOA 3WL7A 2XMZA 5FOQA 2HU5A 4KE8A 1R50A 1YS2X 3BF8A 2V96A 1EH5A 5IVDA 4GDMA 4N5HX 3I6MA 4CG2A 1OILA 3WA6A 1N1MA 2VTVA 4HXEB 1CUGA 1F0PA 4OYYA 4BB0A 4OB7A 1U65A 4B0PA 1J2EA 2WUFA 3IBTA 1CEXA 2QM0A 1YSCA 2HU8A 1UOPA 4Y2RA 1ZOIA 5ALJA 4EBBA 5EHXA 1GPNA 2FJ0A 1HLGA 2VJAA 5FKJA 2WIJA 3CXUA 1TCBA 1EDEA 4UBIA 3VJKA 5HKAA 4UBJA 4DNOA 1IZ8A 2Q0XA 4PSDA 4J7AA 2PU7A 4RE5A 1PFQA 5CH3A 3IURA 3AILA 4AB1A 1CUSA 1Y37A 1UKCA 4AQDA 1BN6A 5BWCA 4HVTA 5AM1A 1EK2A 4BATA 2WQZA 4BTVA 4FFWA 3JW8A 3C8DA 3I28A 5AOAA 1MAAA 4Y2YA 3H0CA 1ZD4A 4E15A 4QDOA 4Y7DA 5IKXA 3VKFA 5T4HA 1XZJA 5CT5A 4GW3A 1G5FA 4X90A 4C4YA 1UKAA 4G8CA 1EINA 2DCMA 3GFFA 4PO3X 1DT3A 1FSSA 1ZIYA 5T4EA 5AI4A 4Y2PA 3FYTA 4FOLA 1CR6A 5JZBA 2G63A 4BZWA 1K5PA 1J1IA 5E4YA 4GBGA 5ALIA 3QMWA 3F97A 4G5XA 3I6YA 2OQVA 2D5LA 4PW0A 5AHXA 1XZFA 3WK8A 4DM7A 2ECFA 4BRZA 2RI6A 2BGRA 5CBKA 4J0GA 1CUZA 4XX1A 1THTA 1NU8A 4H7JA 3BIXA 4BDSA 3AZPA 4AO8A 5DJ5A 1XLVA 1XZDA 1M33A 1XZBA 5ALEA 4DNPA 1TRHA 1UK8A 2QS9A 5JAUA 4QNNA 4BDTA 1TAHA 1LNSA 1QIMA 4X95A 3JYHA 3BE8A 4GLBA 4Y2QA 3WKAA 5JANA 1LPOA 1CQZA 3P2MA 5E2IA 4NS4A 5FV4A 2RGUA 5AIAA 1BEZA 1YAJA 5AI9A 4PSUA 4JYMA 5CW2A 3KWFA 1WPXA 4UHHA 3H17A 1CV2A 4KAJA 2JGLA 3WYDA 1E89A 1QIIA 1TIBA 4EA6A 4U2DA 3WK5A 1MT3A 5A62A 2AJCA 2GBGA 1QGED 4G4JA 2WFLB 4IO0A 2HIHA 3N2ZB 4GXNA 4AN0A 4J0IA 4UHEA 4XIIA 2XUDA 3I2HA 3FAKA 5AK4A 2Y2VA 4ARBA 3VJMA 4UBKA 3NGMA 1L7AA 5HF5A 1CVLA 3WL5A 5DYTA 3HC7A 4K2AA 1ETHA 2VT7A 1AZWA 3O9VA 3Q0TA 2J4CA 4FWBA 1ZD2P 1EB9A 3R0VA 2JEZA 4C01A 4H35A 3C45A 1RP1A 1WB6A 2J4FA 5D6OA 4FLFA 1XQXA 1A8QA 5HF6A 4HTAA 5AM0A 2QXUA 1JMKC 4Q05A 1QTRA 1UT6A 2WTNA 3BXPA 1Y7HA 4H7DA 1ACLA 3C5WP 4OB8A 1HBJA 1KU0A 4PNZA 3LP5A 1XQYA 3OM8A 4MXDA 1EB8A 4AO6A 1QFSA 3WWCA 2LIPA 1W76A 3WL6A 4B85A 3HLKA 1ZD5A 4FTWA 4EB0A 1XROA 2OAEA 3WYNA 4IQ4A 3I2GA 2B4KA 3MUOA 3WIOA 2JGEA 4EUSA 3D4LA 1W1IA 2QOEA 3PFCA 4GEGA 1JJBA 1XZEA 4PF1A 4UHDA 3D5EA 3WLAA 4KE7A 1F6WA 3STWA 1WB4A 3BDVA 3MVEA 5A7HA 2AXEA 3DOIA 4AN1A 2VEOA 4X71A 1Q0ZA 4QDTA 3EQ7A 3S8YA 2H7YA 3KXPA 4BAGA 3RK4A 5EIAA 1MU0A 4H7EA 1R3DA 4LXIA 3A2MA 1W4LA 2XE4A 1WOMA 3M83A 5DNVA 2GBCA 4G9EA 5ALXA 3VDXA 1CUIA 5CT6A 4BAUA 4U2FA 1MX1A 1Z68A 2XUQA 1H23A 4G4GA 5JATA 1UKBA 3C6YA 2WIGA 3FCXA 2ZYRA 3WI7A 5FLKA 2WIFA 1C7JA 3ZI7A 3G02A 3ANSA 5LZ7A 1BN7A 3V1MA 3F67A 4FFVA 2VJDA 2EDCA 3WWOA 4A16A 3I2KA 1VJ5A 2YYSA 3F9CA 1VOTA 4X6YA 4EHBA 1EI9A 5DYYA 1GQSA 3I1YA 1G66A 4OPMA 1A8SA 5E4TA 5DNWA 2ZJFA 4U2EA 1UWCA 1RWQA 4F60A 3AIMA 2XMGA 2R11A 3R3YA 2RHWA 2PSJA 2IITA 3QITA 3BJMA 1ISPA 4YPVA 3G9UA 1VE6A 3G0IA 1TK3A 2WLSA 3FVRA 2JF0A 4CFSA 5ALKA 3HACA 1UXOA 1HL7A 2XDWA 1MNQA 2WFMA 2HA6A 3H19A 2O7VA 5CTAA 4X93A 1GZ7A 1UK7A 4K6GA 2EEPA 4P08A 1YA8A 5DYWA 1KEZA 1VXRA 1MPXA 1BROA 2BFNA 2PSHA 2Y6UA 2YH2A 1CLEA 4J0DA 3OTQA 4DNFA 2H7XA 4KE9A 5EHQA 1VLQA 3R3XA 3FLAA 4WFJA 3TEJA 1FFCA 3DS8A 5LYYA 1CUEA 3AIOA 2ZJ6A 1S8OA 1XRQA 4JNCA 3ZWQA 2XQFA 4BCCA 4NMWA 4X92A 2WG1A 4PV7A 2GZSA 4G9GA 4AZ3A 2W6CX 1VXOA 3B12A 4LHEA 3W06A 4DYHA 1K6EA 2PUHA 1CUWA 4B0OA 1F0NA 1AKNA 4ZV7A 4LIPD 2BUBA 5DTIA 3EF3A 1YS1X 5HF8A 3DD5A 1VE7A 4L72A 3STXA 4M0EA 4B84A 3H2HA 4B9AA 4GECA 3MGAA 4JUIA 4W9RA 3LCRA 1C7IA 2DHEA 4C4XA 3DKRA 3G0BA 5FPPA 3FOBA 4QE3A 5DNUA 1THGA 1XQWA 3JWEA 7YASA 2PUJA 3HSSA 5AKZA 4CI9A 1JU4A 4J3JA 1H2YA 3Q8WA 5J3JA 1AC5A 3HABA 3V48A 4X00A 4FLMA 1CUXA 5AI0A 4WFIA 5AJHA 4TPKA 4H0CA 4UHCA 4L9AA 4M0FA 1AUOA 2CJPA 3O4JA 1WB5A 3BDIA 4P92A 2O2HA 1AQLA 4MEBA 4YX9A 4UFNA 5HQ3A 2OQIA 1BEEA 1QJ4A 4N8EA 5KBYA 1XKLA 3PI6A 1UK9A 1QZ3A 1TCAA 4DMFA 4ZWNA 1U8EA 4FNMA 1W6RA 2Z3WA 2WUGA 4JEIA 2VAVA 3QPCA 3WWEA 1QIHA 5ISMA 2V97A 4CG3A 5LKAA 5SYMA 1YR2A 5AI5A 4NZZA 1CUHA 4UHBA 3U1TA 4UBMA 4IH4A 1SCQA 2O7RA 3R40A 1DWQA 2BCEA 3KD2A 3SX4A 3RM3A 1DTEA 3KDAA 1QONA 3M81A 3WWDA 1Y7IA 2OGZA 3STVA 3O9MA 5AKEA 5ALHA 3WK4A 4X6UA 2YASA 1DU4A 1UK6A 1JJIA 1R9NA 5ALTA 2FUKA 4BVJA 3G9TA 1VZ2A 2VA9A 3FNBA 5A71A 1DT5A 5AKJA 2VT6A 4EZIA 2G4LA 1QOZA 5DTJA 4UBNA 2QXTA 3ED1A 3NWOA 4U2CA 4W1PA 1MNAA 2Z3ZA 4E11A 5EI5A 2ZYIA 3WKBA 1YCDA 3FLEA 3ICVA 3ZPXA 2HRRA 2HU7A 2J3DA 2WHRA 1QIJA 4RNCA 2OCIA 3ZLUA 2RIPA 4LKOA 3HJUA 4X94A 2ZYSA 4BC1A 2OGSA 5FDFA 1ZICA 3C43A 1GKLA 3A2LA 4J0JA 3A6ZA 3QMMA 1XRLA 1ODTC 4DSZA 2XUHA 5HZGA 2WJ4A 5K5EA 3BJRA 1A8UA 2XMBA 3UUEA 3KWJA 3SK0A 4KAFA 4L3WA 2JEYA 5HK9A 1SC9A 2QZPA 2XT0A 5C7YA 1NX9A 4ARAA 1XZCA 2V98A 2JBWA 4C87A 4MYDA 2WILA 3WJ1A 4UUQA 6YASA 2HA4A 4BE4A 1ZJ4A 1GQRA 2DQYA 1QTIA 4G8DA 4Q3LA 5IVHA 4BE9A 3PUIA 1DX6A 4BP8A 3D0KA 4L0CA 5K3AA 4J03A 4LXHA 5ALMA 2QJRA 3QBJA 4Y2XA 2RHTA 1Q0RA 2DHDA 4WDQA 2PSFA 3PUHA 3E4DA 3BWXA 1W52X 3WIBA 3C8HA 1ZI8A 1L7QA 4JH0A 5AKLA 1TQHA 1HQDA 3IVMA 3WJ2A 4QA9A 3H04A 2XUKA 5K3FB 3R3WA 1SCKA 2AJDA 4MEAA 2W22A 1P0MA 3A70A 3QYJA 3QPDA 3ILSA 1FFAA 2AJLI 2ZSHA 5JAHA 1XLUA 4FBLA 2XI4A 3C6XA 2C7BA 5K3EA 4KJXA 5AM2A 5D3KA 3WZLA 3DCNA 3E3AA 2B61A 5ALFA 1AURA 2XUIA 4HAIA 3AINA 5LP1A 2QUAA 2XQJA 3GZJA 1MTZA 4QEKA 3FYUB 1EVEA 2C58A 3QVMA 1LLFA 1LPMA 3GUUA 2OGTA 4OYLA 3TJMA 2FX5A 3VJLA 3WK7A 1NU6A 3R41A 1CUYA 4AMZA 1VA5A 1R1DA 3WMRA 4QLOA 3FSGA 4MQLA 1HDEA 5ALYA 1Q83A 5AK3A 2HFKA 4OUKX 3AIKA 1DX4A 3I1IA 2QVBA 5AKHA 1ODCA 5D3ZA 1E3QA 3O95A 4V2IA 5EIEA 4KRXA
chains in the Genus database with same CATH superfamily
2ATXA 3LUDA 5B3LA 2DE0X 5FA6A 5F5LA 2OCLA 2R68A 3L1VA 3EXEA 4B82A 4YWJA 1KR5A 5A0VA 1NM5A 2BE7A 5KKNB 1Y1PA 2P0EA 3HDTA 4DSAA 1KHHA 2G9QA 2PGNA 5L4LA 3AVOA 1T6YA 1VA4A 4M9ZA 1EP1B 2QX4A 4HK4A 1SXJE 5JALA 2B99A 1GSAA 5KNCA 5F7XA 3FRHA 3R3HA 4LRYA 4IXNA 3OZGA 3SDSA 4E7PA 1XHFA 4W5QA 1SPXA 1JVSA 4LG1A 5EJIA 3YASA 2OBXA 3LC2O 1USIA 3ZE9A 1L3CA 5DM4A 4RKEA 3HL0A 5HRUA 3A58B 3NETA 4WY5A 3OY7A 4G8JA 3SCZA 3MA0A 2KW5A 4DQUA 4ZGWA 4D8VA 1U4NA 1CJSA 1YULA 4KUHA 5F5NA 1V3UA 3F8SA 3NHRA 2BEJA 2QG6A 3M2TA 3N8DA 5LBIA 5JHHB 4MWEA 1UXJA 1QG6A 1C7QA 3EXFB 4O4LB 1E59A 5AXBA 2RGEA 5M3BA 1KAEA 2FF5A 3KJIA 4BKOA 2BI4A 2EJUA 3RQIA 5MGNA 1B8PA 2AD5A 2CFIA 1F1BA 4YS6A 5AW8A 5JASA 1JWLA 5F5XA 1E0DA 1B6TA 2PYIA 1AHPA 2AZTA 1VYUA 1XN1A 2REQB 1GRRA 4BO8A 1WEHA 3ID6C 4YAIA 1D6MA 2JFGA 2EQ5A 1NF2A 2H57A 2UAGA 3FPEA 2HA7A 1GAJA 4YECA 1E1QD 1ISSA 1QZZA 1E58A 3ZHSA 1NVFA 4K81B 1ORTA 5JAMA 1WHSA 4TYWA 2XDAA 3PENA 4G65A 4RSHA 5KJ1A 3ON5A 5EZYB 2G8LA 2J48A 1PNVA 2QW1A 3TB4A 1BX3A 4QWMA 3TLAA 4AWAA 1KPIA 4B32A 1C7RA 3I2JA 3QY9A 2BFBA 3W1VA 1G9SA 4KG7A 2GB4A 5GMOA 4C0WA 3R7WB 3BWMA 3FPSA 5HRAA 2PMFA 4TOIA 1C8LA 3ZI4A 4LXXA 3ABZA 2P2YA 5B3JA 2MHCA 4JKOA 4UTNA 3O2NA 5DYIA 5K0SA 3SVTA 2GZ2A 5AW5A 1SCUA 3I52A 2FUNB 3KJXA 2CKMA 3L6RA 3L8DA 4L5AA 3RIYA 1F17A 1ZN9A 3PA6A 3X1DA 3AM5A 4C7BA 2DVMA 2QN9A 1VP3A 2I6SA 2QL9A 4JJ6A 4XARA 4YC7A 4R8KA 4EY4A 3QBTA 4TYYA 3NXSA 2BKAA 4TWBA 5LQJA 3DNFA 2Z0MA 4D79A 4GR9A 2JLYA 3UA4A 1LDEA 2E7ZA 4RTMA 1RKVA 4N8DA 5BNZA 2SCUB 2X1VA 2HUPA 3KE8A 3AZOA 1WMAA 4RVGA 4B83A 4JXKA 2AYXA 3FG9A 5LD2C 5JCZA 3B3FA 3N7TA 4D9JA 1MLDA 3AR4A 3H7IA 4OMFG 5E0KB 4F3CA 1FLAA 2HJRA 1KMCA 3G0GA 4H18A 1QX4A 13PKA 3H1PA 2ZBFA 4D98A 3MGCA 1NFFA 3UM9A 4BWYA 4RTNA 2BSQA 3SM3A 4BMCA 1V4BA 3DZFA 4RHUA 5C8ZA 1O95A 1HK7A 1PJZA 3DZKA 3EOZA 3HCAA 3K31A 4M8NE 4R5HA 1P18A 3T0GA 4C0XA 3TXXA 1G3QA 2ZVPX 3KJZA 2VDJA 3KEFA 1C1DA 1I2CA 1T2DA 1DCTA 4H31A 4RK5A 3Q6IA 2EVWX 3OJOA 2QUBA 4P7FA 4MJ3A 4CLEA 4EI2A 4B9EA 3R7LA 2HADA 1A4RA 4A5SA 4GX2A 1O0CA 1KL7A 5GTDA 1AS3A 3PHLA 1JDSA 4B4DA 2Z6AA 2FP4A 2ERXA 2REBA 4HWRA 2CLOB 3NOXA 3O4GA 2AFIA 4GLOA 1Y5MA 1GUZA 1YUNA 1WX1A 3K9HA 3QVJA 4XWGA 4BP1A 4U7DA 2B1IA 1V3QE 1D1SA 5JIBA 1WLYA 1EVIA 1YFKA 3PDCA 3QU5A 2PSDA 5TS2A 3T7JA 1ES9A 3ZUGA 3ZWPA 1ZH6A 1K8ZB 1UXHA 2QENA 2ZRHA 3FNHA 1P3JA 5JADA 1Y5RA 5KOYA 1KO8A 2YZ7A 4NNPA 3Q3GE 3G9XA 1L8LA 2OUKA 2FZVA 3C70A 1JXMA 3T5BA 4DWVA 4X66B 1H1TA 4DV6B 2KQUA 3DZIA 2JASA 4NWIA 2XMRA 2JH9A 3QKSB 4LS3A 1F4LA 1PK7A 1BFUA 4UUNA 4DA9A 5B58T 4EW6A 5AJYA 3O47A 3HUDA 3X1YA 3ZLVA 2BTEA 4ZEVA 2WSIA 2R44A 1MPTA 1Z6QA 4N0EA 1K3FA 3AJ9A 2WM2A 1IXYA 4Z2AA 5FPYA 2XYPA 3NW9A 1WQ4A 4GOJA 5C81A 1AK9A 5ALWA 4DIKA 3MWDA 3Q11A 5ADVA 3ND5A 2WSSA 3PFKA 1DXQA 1G41A 4PSAA 3WJAA 2PXXA 3IEUA 2Q6LA 1LDYA 2ZYVX 2J3JA 2XV1A 3NHSA 2DWUA 4BBPA 3FX2A 5I8ZA 4DCTA 2QJTA 4TZ6A 4ZCQA 1W2WB 1QYXA 1IIRA 4E07A 5REQB 4O4HB 2ZATA 3IPAA 2PZJA 4LI0A 5FHRA 5JLJA 2JGIA 3DHYA 5AVSA 4FXOA 5LLSA 2JIZA 2M32A 1V96A 1IN4A 3W9UA 4BLUA 5I4KA 3P9CA 4DC9A 2JGKA 4KPYA 4I4TB 1N32B 4AP5A 3W5VA 2CLDX 1C0KA 2FAXA 1K89A 4QHSA 5L9AA 3L8HA 2E85A 3K2IA 4A1FA 4OU4A 4EPYA 1L5HB 1WJGA 1FQWA 3R5XA 2ZTUA 1E4EA 4YI3A 3TAUA 3VISA 5ALDA 3W6NA 2QQ5A 1DWOA 2QAGA 1U0FA 4OQ4A 3V7UA 3ZYCA 1FUKA 5LOVF 2XB9A 1EX7A 1U3FA 1T2UA 2Y0BA 3FCAA 3G5AA 3KKQA 2QPLA 2IHBA 4KACA 4XGRA 4YRLA 3V1YA 4DBVO 4EKDA 4QBKA 1PNRA 1TM2A 3M82A 4S2UA 3CLHA 121PA 3GDGA 1G9XA 2YV1A 3LT0A 5F3RA 3TTYA 1F0KA 2FW8A 1FMTA 2VSFA 3HCCA 5CYPA 4U0JA 1CJMA 1HFWA 4OKIA 1Q7CA 3CRW1 3BIOA 1R64A 4RYLA 3SDZA 1F2TA 1WHTB 4GSYA 4Q6BA 3BHJA 4V0KA 3LKZA 1SCUB 1OLOA 2IYPA 1EG7A 4GMDA 4ZI5A 4KDCA 2ZI4A 2EWWA 2GUWA 4YMIA 1TEXA 3GJ5A 3Q9LA 3LT2A 3SOPA 4BCDA 4C5AA 3OOSA 4KRYA 1ESZA 4CQMB 1AQNA 2Z2ZA 4ZT6A 2BJHA 1TECE 5GV8A 5A5FA 3D6HA 4KWEA 4EJFA 3O7MA 2RCNA 3HYSA 3Q5DA 1Y4DE 4PYRA 2UYOA 5LZ2A 4M0MA 4UJ3A 4MYSA 3W5IA 4BAZA 2AN5A 4KW7A 4Y1FA 5JT1A 4LRWA 1FE8A 1T5IA 2HKIA 1DLIA 1ZK1A 3A6DA 2ZT5A 3DE5X 4KFCA 2G6BA 3HVUA 5AVWA 5E1MA 1OI3A 3AEUA 1EGAA 1XFAA 1J2UA 1N5JA 4HNRA 4BYMA 2J1LA 5IEBA 4LDPA 3I30X 3R24A 1ND6A 3L0YA 1LPAB 3QE4A 1P0IA 4S2EA 1FMJA 1W2GA 3EBLA 3F46A 4TMTA 5JNLA 1IHPA 4H7KA 3TECE 3KKMA 2M6KA 1I36A 5ADHA 3LNTA 4CTKA 3W78A 4LEIA 2PUCA 1VG0B 4LZNA 2CXHA 2X9GA 4FK8A 5ICGA 1FFBA 1HH4A 1QE5A 3QPVA 4TT3A 4CV0A 4DEXA 1CUJA 5ITSA 2EJTA 4GMFA 3F4LA 4IX9A 2PMWB 2IYZA 2QTWB 1XZGA 2GFQA 4ZRDA 4GX1A 4TKVB 3MQ2A 4IEIA 1CUUA 5EHNA 5CA0A 5LL6P 4WCFC 1M6EX 2F9MA 3C5VA 1I4EB 2QSYA 2Q7OE 2XXJA 1DAOA 3E9QA 3AUKA 3IXLA 1HOTA 4ENUA 4YMHA 4YJ3B 1EZ4A 2MDTA 2OQ2A 3O0TA 3N8GA 2YVQA 5I51A 1ZGAA 2Q5OA 2CJFA 3EASA 2RBGA 4TMVA 1DTWA 1RKBA 1OSNA 1RAHA 5C80A 3AETB 1E2NA 4Z0TA 2BEWA 5FLYA 3VHQA 5BORA 1U2GC 2GA8A 1Z73A 1J1UA 2J6CA 4WOKA 2NZ8A 2A9VA 4HDAA 1T6BY 1PE0A 1HPLA 1U28A 3DZCA 3S2GA 1IB6A 3SS9X 5I9TA 1GR1A 2C7VA 3QFFA 1B0AA 1V39A 2UZAA 3NEPX 3PP8A 3QNMA 4FPXA 4HLCA 2XQKA 3AOEA 2WFZA 2VSQA 2ZYUX 4XEUA 3UAGA 3W3AD 2HB6A 3ZU3A 4YT8A 3ZDYB 4TTSA 4Y1RA 2K7FA 4GDFA 4FDLA 5E6UA 3K4QA 3WGQA 1MV8A 1PFKA 1RZRA 1LZKA 1N8SA 3GJSA 3T99A 3EQ2A 1X1DA 3DKKA 1CJUC 4E5VA 4UM7A 2GN8A 5DVZA 1L5SA 3CRNA 4L02A 4RK1A 3C6BA 3TSAA 5CDHA 4ND6A 2VP3A 3SS8A 4RVDA 2XA2A 3JD0A 4G8BA 5HXAA 5KWSA 4EGSA 1U9IA 1R4NA 2YZ2A 1II0A 1PRYA 3VU9B 2FFJA 1FLVA 4JL5A 4P3PA 3R23A 1F6BA 2A35A 3JVDA 3JPYA 1UEJA 1CF4A 2IYQA 2ZBVA 4R1TA 3ROFA 2ZITA 4D46A 1P8JA 4LOJA 5DBIA 1EBFA 4WOCA 2IGTA 4EY3A 1S01A 4HDKA 4EP1A 3L4BC 4WXEA 1I14A 3ICWA 5E6UB 3P32A 4YDRA 1N3YA 4ZCTA 5EJEA 4WKBA 4FM9A 3F1LA 4HUQA 3EOBI 2CEAA 4R1UA 3HNOA 5DGHA 5F33A 2R8ZA 2Q4RA 1E2QA 4BO6A 1QGDA 1U2PA 2CXNA 1T13A 2W4MA 4TMXA 2P78A 2YFKA 2WHEA 5J2TA 4ITVA 3N3BC 1BMFA 3IUQA 1M2OB 3FMGA 4C4ZA 1ABEA 2A1TS 4LJ7A 1X1QA 1GU7A 3Q1LA 4RCYA 3GLFB 1HDZA 3MNFA 2IXGA 3PRJA 4R98A 2VI5A 3DP9A 4PX5A 4RFVA 4RSGA 4R16A 4DV3B 2WHXA 4Z0PA 1Z2EA 3O7WA 3HCFA 4Y9TA 2YUIA 1WUHS 2BFDA 4PNPA 3ZQJA 4B33A 4C14A 1ITZA 2IHNA 2IUTA 1JPJA 3VTAA 1JKJA 2HMAA 4IF6A 4ASUD 4KIFA 3DTVB 3N0RA 3QPUA 4RZSA 3FHCB 4WY2A 4NJEB 3WBKA 4UNSA 3SF0A 4E31A 1ZGBA 2A5LA 2IZOA 2X5KO 3JU3A 2ALJA 1GO2A 1N4DA 3PR3A 1ULHA 2PM8A 4MUHA 4WN3A 4AKTA 4OFBA 4XEHA 2O5VA 1BVRA 2WWHA 3NYWA 3O94A 4RF3A 3DL0A 2OG1A 1L4KA 2ODBA 2CLFB 3O93A 1ZU5A 3AJDA 2X2EA 1VGRA 1XZKA 3EG9B 4OTZA 3DXYA 4QYWA 3TYXA 5DLPA 4L7VA 1WUIS 4WGFA 2NV2B 4KLZA 3BT7A 3LK6A 1VI6A 1S02A 2NU8A 4BWFB 5B2FA 3EZGA 3TXYA 1MOPA 3L0CA 4O0MA 1VHDA 4Y2UA 1ZN2A 3J7TA 4IS3A 5HE8A 3ZH9B 4AROA 5FI3A 2LP4Y 3D7LA 2UUCB 3JQEA 2JHFA 3AU9A 3NTLA 4JX9A 3WLKX 2PE5A 2AC7A 2BI8A 5LUBA 1Y8QB 3KX2A 5G0WA 5H81A 4CUJA 4UMVA 3LYLA 4Q02A 2NUPB 5J43A 1ZO8A 4E5PA 2ZPUA 3ORHA 1Z2OX 3KHTA 3LV8A 2R25B 1N7JA 1PFUA 3MMNA 2XT6A 2J59A 4CWAA 1K6XA 1G8MA 1LS1A 5AICA 2FW9A 5EERA 3CEJA 2O2GA 3M3PA 4RL4A 1LJUA 2AG8A 1NLUA 1PLJA 2BGIA 3FNQA 4BVGA 4BJ5A 4EW1A 4TWJA 4GPD1 3C3EA 3I01A 4H7IA 4EKEA 3G68A 5AIBA 4BNZA 3URKA 3K70D 2LWIA 3OHSX 1EBBA 4V24A 4LZPA 2X8BA 3E3NA 2NVUA 4RYDA 1KNQA 1PFGA 2PBZA 3LQ4A 4LVUA 1CTQA 1DC8A 3FF4A 1PLKA 3R7NA 1RYHA 1QF7A 3O1HB 2AOUA 4K40A 5SV2A 3W7AA 1Z15A 2BKLA 3FSJX 4RLHA 1OWMA 5KTOA 4F84A 1EUQA 1U2DA 4BMYA 3C1TA 3PQDA 1Q84A 2AS0A 2C97A 1P4RA 2PZGA 2ZYTX 3BKXA 4JCCA 4F4UA 1JT2A 1CPYA 1H2RS 3A36A 4M7WA 2YXNA 1MG0A 4TKUA 5KVCA 1ZVVA 3RSQA 3P9XA 3EEQA 1A95A 1KAMA 4MDEA 1RRFA 3U3KA 2R7AA 1TM7E 3U4HA 1VKRA 3BK7A 4J16A 2TECE 2VDNB 4JBYA 4AJOA 2XCQA 2FSGA 2VR1A 4ZVSA 1HNZB 4NPAA 3EMDA 2XMSA 1OTXA 1U7DA 3INGA 4N6NA 1WXWA 1Y9JA 3GEHA 2Q0SA 3HCPA 1P0PA 3BZUA 1M0TA 1XTVA 2PBLA 5JC1A 3U9SA 1A5BB 1I4DD 3GOHA 4TVBA 4JMLA 5ED0A 3C97A 1F14A 4W5HA 4CR7A 3ZE7A 4M7PA 1H5QA 4FJ0A 2CDNA 3K0FB 4JK3A 1D8AA 3RREA 1VFPA 2GD6A 2VT3A 5K7SA 4ND7A 3A7EA 1L5KA 3VOAA 5FX2A 4KHPB 3E5NA 3TR6A 2OXEA 4QX6A 4XJVA 5JNRA 4C4TA 4N65A 3SEZA 3UUFA 3CUTA 1BXRA 3VHXA 4AJLA 1LZLA 2VF7A 3E27A 4HH4A 4IKEA 4JB3A 4ZI2A 2UVQA 1EBUA 2I2AA 3F6PA 4LJYA 4QBFA 1QE3A 2JD0A 4TV8F 3ADPA 3GLGA 1MXFA 2FX2A 4G0PA 2Y1WA 3WE7A 4YJ2A 2P69A 4MKGA 3GX1A 1QE0A 1Z75A 2XH8A 3U3ZA 3MMSA 2ONCA 4JJAA 1TF2A 4PCUA 1OREA 5IWCA 2ZZNA 5B7GA 2J32A 1SQ6A 1Z5PA 3IQGX 3LKBA 4HAOA 4NZ9A 4B5LA 4DT1B 1MOZA 4MV5A 4GUDA 4EFDA 2J9FA 1ZMBA 1ECCA 5EJMA 5I9IA 3R76A 1ONNA 2ZRBA 4QJBA 2FK7A 1UFQA 4FYWA 2O59A 3GHHA 3FNEA 1VL2A 5LQSA 1AZSC 4DFDA 5JS8A 1MJFA 3DOEA 1OLUB 1SFRA 2H2IA 3DEAA 3GL9A 4BLVA 1L8AA 1O96B 2R6ZA 3U6BA 5E1OA 2XKKA 2Y6VA 4RZUA 1OFUX 3OJEA 4ITUA 4Z9XA 4Q7KA 3OT1B 2K2QB 1ZLXA 2I78A 2GLUA 2VHTA 4OU5A 2A57A 3IVRA 5EJ5A 1VJCA 3OIFA 5KYVA 5CEEA 2VAXA 2XYVA 5B7QA 4XX0A 3OCVA 3CH7A 3H2KA 4ZOLF 5HCIA 3GT4A 4Z7JA 4X7PA 5ICMA 4CI0B 5BRJA 5IUJC 2V4MA 4U7GA 3IHTA 3X1WA 3JQCA 4E46A 3U31A 3QVUA 3WOHA 4J9VA 1DC3A 1ZA2A 1ZK4A 2WIDA 3E3OA 3IV7A 4GP7A 3V8BA 2B1JA 2W2NA 4J1TC 1FSGA 1ZHOA 1SD2A 3Q6NA 1JFFA 4LVCA 2CYBA 3B52X 3IAHA 1WO8A 4Q16A 1C9YA 2IIBA 3GFSA 1Z82A 4B6QA 4PHTA 2JVIA 3K2EA 1JJ7A 4A0RA 2C3PA 1RZRD 4U8GA 2P67A 1S8NA 2GM5A 4LMAA 5HKBA 3CF2A 3FFXA 4IHJF 1IZ7A 1OWOA 5FULA 5BR8B 1NW8A 5FTLA 4D43A 4W9MC 3L4SO 5IVKA 3PE3A 1GPJA 1OOEA 1G55A 2ZRCA 4MA5A 3NVAA 2ESRA 2B1RA 5FLEX 1BW9A 3ANTA 1O03A 4RKWA 5F3DA 4BMNA 1UMKA 4NXMB 3SZMA 3TDKA 1XQ6A 4R0MA 3PIRA 3TRFA 1SKAA 4P4UA 1PNQA 1T36A 4CCYB 2RK4A 5JQGB 1WDLA 3VDMA 4AKGA 2ZRMA 1ZH8A 2MR6A 4Y98A 1R8SA 1XNGA 2A33A 2J3KA 2QY9A 4RBNA 1V7ZA 2IHKA 4Y3UA 5EFOA 1SKYE 5B7PA 1YL7A 1SHUX 1GZ4A 4K6KA 4E21A 1E6EA 1C50A 3WGNA 3AF1A 4L0DA 3OQNA 4DV1B 1GPMA 3WSVA 2D3TA 2RK6A 3ZHYA 4KZPA 5IAOA 5CG2A 3CVVA 2XITA 1L5RA 3QMPA 2IZ7A 1ZH4A 2HCRA 4IHAA 5H7XA 3RUEA 2P5TB 4L8WB 4TS3A 4CEHA 3JQ6A 1VSTA 1KP9A 4H77A 4HEHA 1O4VA 5DLEA 1FP4A 2LCIA 1OYWA 3PC6A 4G86A 1ZUNA 1PQ4A 2E1PA 4EY5A 1QIKA 1MAVA 1IXSB 3ISTA 2WVHA 3FI0A 3QEJA 4O08A 3W8FA 2OLJA 5B6IA 4DLWA 4OQNA 5J2UF 5CDYA 1RXUA 3S1AB 5BPFA 4ZVQA 3VC2A 1UP6A 4UHFA 1WR8A 3RFVA 3SR0A 4KTVE 3DV2A 3QVTA 2M1XA 4PBRA 1T8RA 1CIJA 3ZGZA 3AERB 3SHOA 1ZD3A 1JEAA 1T1GA 4RF5A 3E7FA 4RZHA 3SJCA 2XNDD 2QRUA 3UFBA 1X7YA 1WMFA 3Q3VA 4S12A 5JD5A 5TT1A 3CCBA 4P31A 4J4HA 1RAFA 5TPZA 2Q1TA 4BJHB 2HCTA 1YE3A 1GADO 1NVKA 1HZZA 3AR7A 1XZLA 4LQ4A 3Q8LA 2VYND 5G4LA 3CUEF 1MCZA 4G0QA 4CIYA 2VWPA 2DPYA 2VP9A 3CHYA 3ESAA 2M6LA 4EJSB 1UZMA 1DJQA 1U0JA 1KBZA 1A4IA 1LY1A 2GYWA 2EFGA 1YR6A 3ESZA 1YKSA 3NAZA 2PA3A 4TXJA 4XR9A 2B8WA 3QXGA 1RWXA 4DDHA 2C03A 4YUAA 3UK6A 1Y8ZA 4OM8A 4Q9IA 3A31A 4FMPA 4IY1A 4ZIRB 1L8QA 3JVIA 4MRAA 4ZEXA 1H05A 3ZDCA 4FW8A 3CINA 4IV5A 4CM9A 2BEWB 3VSCA 2ZAGA 3H83A 2VXBA 1L5FA 1ZM9A 3QMVA 4LZZA 1FL9A 1KO4A 2HJVA 2WPNA 2ODQA 5KQSA 5DK4A 2UZ4A 1XJQA 2CMFA 4P4SB 1KQGA 1SVOA 2XVXA 2C3YA 2HZ7A 5IJAA 2E3JA 3QTTA 5I9MA 4JI2B 3OX2A 1IZZA 1CZRA 2YXDA 3IBFA 1OKKA 3I42A 1J4AA 1LBTA 4HFMA 2WQ7A 1IEWA 1M73E 2DUUA 1P1CA 2AC4A 1UFVA 1DC6A 2LCFA 2PV7A 1T9DA 2JFWA 3AHJA 3BL8A 3NBFA 1UBGA 3N2KA 1UMDB 1RZUA 4NR0A 2ZVJA 4O2RA 4D6YA 1BS1A 5INTA 3PQ3A 5IC6A 1ONOA 2Q1UA 3BE6A 2XB4A 5DV9A 4OVKA 2CSUA 4RKYA 4TLMB 5DT2A 1KDZA 4RZIA 5AK6A 2ZWPA 2H18A 4RLSA 2QLMA 5AHKA 3TKLA 2APJA 4G6ZA 3V4VB 4CKEB 1RD4A 2PMKA 2QL7A 5AUOB 5HM6A 2G72A 3GT7A 5EWJB 4B3XA 4V03A 3IDAA 1C0IA 3P4XA 1U9YA 3FTPA 3FPKA 3GCZA 3KFXA 4WBSA 2ZRLA 3H87A 3PR1A 4B80A 5CB4F 3FMPB 1V26A 1Y3FE 2H29A 5T8KC 4ZYUA 4ANFA 3CPJB 2IYVA 1BDMA 4AAYA 3HG7A 2JARA 4XH9B 3DT8A 1E18A 2B34A 3P0JA 4G67A 2R1UA 4XJSA 1E7WA 1NN0A 4ZQIA 5G0SA 4LFCB 5AKGA 5HFNA 4E2FA 4X5OA 4FNGA 3ANYB 2HWUA 4P3NA 1J97A 1UFOA 4FGZA 4MZDA 1P17A 4J1QA 1BCSA 1V5WA 3NRBA 4KK4A 4O4IF 3B9PA 5JNWA 2FW7A 1OXSC 2VHQA 3BA6A 1H2XA 1U3GA 1EFTA 5A3SA 3RF7A 5C1BA 1PN3A 1A96A 2VLIA 3I2FA 2J0EA 4AYWA 4NY1A 2BTQB 4Z9BA 3L18A 5GPBA 2QP3A 3T3GA 1ESEA 3FYUC 2QTBA 5JU6A 4GSKA 2VJNA 1WU8A 2EYQA 3DQZA 3S5JA 1UJ2A 5JCOA 5K0EA 4FKMA 4UNNA 3KKOA 2P2ZA 3OOJA 1HKUA 2FSUA 4C29A 5JYBA 4F1JA 1J8FA 4IQGA 3ZZ0A 4YUXA 3UMBA 4C20A 3ZZNA 2GF2A 4IDBA 4UE2A 5ALNA 3IKTA 1H3NA 1OGYA 4MTCA 1E7MA 3OHMA 1BGVA 3NKVA 5H4HA 1BXKA 3MW8A 3EULA 3M5WA 4K3VA 4YQYA 5FUBA 4U6SA 5LKRA 2LCQA 3HY6A 1IDOA 1NBHA 1P1IA 3AM3A 3EQ9A 4NMLA 1CD5A 1O89A 1KFJB 4GRAA 4EHJA 2OFOA 1Y6GA 2RDMA 2X0JA 2UVDA 3AFIA 3FIUA 4MRPA 2P65A 3RS3A 3SFTA 1W36C 2AFIB 4H4CA 3MOIA 1NBWB 2J08A 3GBSA 2H4JA 3DKVA 3CLSC 3PK0A 1HDOA 2XTJA 4GFDA 1X7HA 5H02A 4BFVA 1VFNA 4AY4A 2PU5A 3BH0A 4TTAA 1NVXQ 2UZ1B 4G0YA 4IYJA 3UAYA 3UBTA 3HU2A 4V39A 3VMMA 4K7JA 4KDEA 1NJ2A 1M8FA 3RJ5A 1XRMA 4I1VA 1E64A 4DSOA 3O9ZA 1UZAA 5CT9A 1BDBA 1YU6A 2XQIA 2AZDA 5HGJA 3EA0A 1OWLA 3GARA 1PZHA 1YXMA 5AK5A 3FUWA 3OECA 4JSTA 2UZ0A 5HFJA 2YZGA 1KNXA 3MXOA 5JSYA 1B74A 2XLCA 1IMJA 2H9AA 3PBKA 4JU9A 3RYFB 3S6JA 3TRJA 9LDTA 4DCMA 1X15A 4QU8A 2YXPX 1JQJC 4DLYA 1DSSG 2NYUA 3EUFA 5T4BA 2C0PA 2HM7A 1NHWA 3DL2A 1NPDA 4TWAA 3WL3A 2I1WA 4RPLA 1ORWA 4GPBA 2GHIA 4IZHA 3WWYA 4FYPA 5M29A 1NZJA 2ZE6A 4LJ6A 1KC3A 2O7SA 5CA0B 2OSBA 1IVYA 1Y98A 4WKCA 4YT4A 1W4ZA 3AR5A 4KQXA 1PT5A 4TZ0A 1U28C 3HM2A 3B1YA 4PY2A 4BO0A 1UBOS 1J22A 1QZXA 1RWPA 1AGYA 3FPCA 3I4FA 1QO7A 2GPJA 4I5GA 1D4OA 1N0WA 1VQ1A 3GLVA 3NT4A 4TMFA 1KOLA 1VKNA 4BVKA 5KOJB 3H1EA 3FBTA 4ZV9A 1OH7A 4XGQA 1RSZA 2QUIA 3H65A 1JEQB 3AR9A 3FFWA 1C1DB 3U17A 1AUQA 2K5UA 2WAAA 4FOTA 4V0ME 1RZVA 4EY8A 3L1KA 3R0QA 3TINA 1E69A 2C2BA 4NZOA 2ZYHA 3DNMA 4MWTA 5L3SB 1ZK0A 1FVHA 1P75A 3VAZA 4N5LA 2REXB 4MWCA 2NZXA 3G9QA 4RJKA 1LQTA 1O97D 4E5KA 3ZVMA 4JOCA 1SUPA 2R4UA 3EVGA 4PAWA 3FPJA 1HM5A 2O1SA 3MCVA 2ONJA 1TL7C 1ZESA 1MEOA 3OQMA 1SPBS 3DOFA 3PR2B 1JQEA 2SCUA 4DMKA 1SBZA 4BNJA 1T0BA 5FBRB 1C8KA 1U3DA 4PPGA 4R9NA 2I66A 4E1AA 3ZZUA 3G2LA 5A5VA 4WVLA 1GTL1 1BWRA 4MUBA 1AK1A 2WU4A 4ZQHA 1C1XB 2OKCA 4IOJA 1QV9A 1CUBA 2O2DA 2WP8J 3EIQA 5HZKA 3HBAA 3LCCA 1UC4B 2ETXA 4JQOA 2XUJA 2HA2A 3UHOA 4BVHA 1BZYA 2QU8A 5F3WB 4CTNA 4Q5IA 1QP4A 1GWNA 4HFRA 1GTRA 1BYIA 1ISMA 4OQQA 1S0UA 2GJ8A 3E81A 3FN4A 1A9ZA 4Z2YA 1AKMA 1M34E 2C4HA 3TR0A 4N5MA 2FFHA 4BVFA 1G5IA 1BXGB 3CEHA 4IIVA 3RBZA 1IHOA 3MFYA 5E8RA 1M0EA 1RC8A 3RHTA 4BP9A 4QXPA 1MA3A 1ZOLA 4Q7EA 5KYYA 2ZUDA 1VHQA 1C29B 3BH7A 1M0SA 5NULA 5HS4A 3X1MA 3LRPA 1Z17A 3LO5A 1GDHA 1D2GA 3A3OA 1K3TA 4O8ZA 3WG9A 7REQB 1C5KA 2YOFA 2BP7B 1PUIA 3E9YA 3WV4A 3ZJYA 4MUYA 2F4VB 4PC3A 4GXTA 3H2YA 1DEKA 4LY0A 1TAUA 2IHZA 1PTJA 2QD3A 4HH0A 3D0RA 5CH8A 4R81A 4C03A 2HMYB 3CIFA 4C9BA 1TLTA 1YS9A 4ECAA 1DGQA 4E30A 2WU8A 3NPAA 1EXWA 3DWEX 1T1EA 4YRMA 4WBNB 4MGYR 4EHLA 2O8BA 1PEDA 3H05A 2G28A 4QDXA 3T5PA 2GCOA 5JARA 4QXOA 1KJ9A 3PHJA 1X9IA 3K7EA 3W2TA 3G8YA 5T67A 1CBUA 2A78A 3NEYA 4RTPA 3K5PA 2ORIA 4F71A 1NIJA 5J4YA 4XVHA 4QYIB 5LLDA 2IHUA 3WFJA 5E4JA 4EB6B 4M38A 1GGVA 3T1OA 3VUEA 2Y0CA 1Y7PA 3KSBC 5FNVF 2TMGA 4Q3OA 3MRVA 3VH2A 1W75A 2YVKA 1OTHA 4JUBA 5BV2P 4TLDA 3AJAA 4KUGA 4L8LA 4EY6A 1L1EA 4KAAA 4EYSA 1C80A 2PKWA 5D1HA 2OL4A 5ALPA 5EC8A 2NNWB 5GOZA 1NUTA 1RTKA 1JWAB 1GEEA 1JYFA 4MUJA 3NHPA 5E9WA 1G1AA 1EIZA 3CZQA 3EXEB 3SSOA 3TDNA 2W4QA 3LDHA 2R6GA 4A0SA 2BDTA 2HDWA 4MGHA 2ZUCA 1KYWA 1O4WA 2PG3A 2QROA 4IIBA 3WQHA 4PIMA 4C7VA 1KIFA 2I7VA 1DQZA 4CN9A 2PK3A 3O4RA 2AZXA 4ACBA 3GPDG 1GKKA 4I8IA 4DLRA 4RE6A 3HJHA 1HORA 3H4MA 4QJ4A 4GKVA 3NOOA 4HMOA 4QJ5A 2ZUSA 3PIDA 2FR1A 4HR7A 4NE9A 2HSWA 1I0IA 4UEWA 3A7DA 2QX8A 3G2PA 1Q14A 3WYAA 1PJCA 3IODA 5CK4A 3MWYW 1L7OA 3LQKA 5EE9A 1KSFX 2FWPA 3IUJA 4F06A 1U6JA 5HIJA 5H80A 4JLUA 5EP4A 1VE1A 2Z5VA 4BL5A 4BIMA 2A0XA 3V2UA 3I4CA 4YQEA 3DDNA 1I5OA 4YRJA 4HUQB 1S7CA 1YZLA 1K4MA 5LJLA 4HP8A 5JCOC 2RAVA 3KPJA 5FOQA 2P4HX 4WXMA 2X3FA 4KFSA 2J9YB 3G2IA 2IOQA 4N5HX 3V9PA 1ZZGA 3PUYA 4N41A 4WNIA 1OILA 1UFKA 1V8BA 1R18A 2C31A 1O95D 2RKWA 3IP9A 4LCJA 2B21A 4QQFA 4LGMA 1CKEA 2GX6A 2PLWA 4FZRA 3MC1A 3TTUA 1JFFB 2QAJA 4KGVA 3B51X 1CUGA 2IU3A 4XPIB 5IKMA 5B55A 1F0PA 2DTXA 1LDGA 2ZIZA 1FZQA 1Z0DA 3CRZA 5AXAA 1M2KA 4OB7A 1KK3A 5TJHA 2C7PA 3R5FA 3BL5A 3QWIA 2OHJA 3CR7A 4DIFA 5FBVB 2OZEA 3K4HA 5L3QA 4Q3DA 2Q6TA 2YWFA 4OI1A 1VGQA 4FN5A 1K66A 3L5OA 4NMHA 1I6LA 4D25A 4YP5A 4DHEA 4HF7A 5GINE 2C4NA 1C9JA 2HU8A 4MOWA 3BQNB 5DBFA 1UOPA 1ZRSA 4GD3Q 3JQBA 2G4CA 3M8KA 3IL2A 2FPPB 2NUBA 4Y2RA 1HDIA 2XBUA 3VU8A 2OG2A 3QFCA 2I9KA 3L3BA 3EQ6A 1ENOA 2PZBA 1FUUA 4P5PA 2ZRKA 1H6DA 2GH1A 3F6SA 4R68A 1IU9A 1EZZA 2HK8A 2HF2A 2HGSA 2YHIA 2XAAA 2BT4A 1I94B 2HBRA 1SEPA 3N75A 4WQMA 3B1KA 1VJRA 4QPCA 3TBHA 3MIIA 2JLQA 1MOSA 1KF0A 1T4BA 2F90A 2QN7A 1HLPA 4JLWA 1A7JA 5GONA 3T3HA 1BAPA 3UN1A 3AVXA 1IY2A 2A5GA 3DBVO 4UZEA 5A6SB 4DB2A 3JS5A 4KMSA 4XIYA 5HKAA 4LNHA 1P9LA 2HSDA 3AUSA 3LK7A 4MAMA 3RGWS 3TRHA 1XZQA 3WB0A 2CV2A 2Q46A 1SOAA 3V4SA 4UBJA 1B42A 1QH9A 4DNOA 4I99A 1IZ8A 1QCCA 1UMCB 1AKYA 2VO1A 3E8XA 3LBFA 3KP1A 3O03A 5GVRA 3IALA 4ALNA 4YR9A 2Q0XA 3FDXA 4W4TA 1CY6A 3QBEA 2VXYA 3GLSA 4RJLA 1U7XA 2VH1A 4K46A 1KAOA 4HFJA 2BKVA 3KV3O 3L77A 3W5CA 2R4QA 5B6JA 1SXQA 3P97A 3CZCA 1OV4A 2FWJA 2VSNA 5KWVA 1RR6A 3T4XA 5B1DA 1KI6B 4X54A 1J9GA 5TGZA 3E48A 1XI2A 3IURA 1RHMA 1XWIA 1RCFA 1NBIA 1WXEA 4KUEA 1J5PA 1PZGA 1TFRA 1VJTA 3GNQA 4F9GA 4JSRA 1RXWA 2QW8A 3TG2A 3D3QA 2J33A 2V4UA 5I8WA 3DZJA 1NVTA 2IT1A 3KOMA 4FHEA 5CX4A 5BWCA 4DR3B 4GF5A 4PO9A 5AM1A 3GGOA 2UXDB 3PQFA 4NECA 1TGVA 5HTKA 4BATA 1PGJA 1RXCA 3IPCA 3CBGA 2WQZA 3GAFA 5FNVB 1NN1A 2FSPA 3V7WA 1FU4A 2UYYA 1A3CA 4WN9A 2W58A 4Q00A 3MUEA 4F46A 1TJ5A 3P27A 1NY5A 1Z6XA 2LW7A 4HRAA 3I28A 3G85A 4DCCA 3I01M 3L9WA 2BOVA 1MAAA 2YYAA 5F2EA 3QIVA 4LXTA 1R8XA 1JJVA 1MB4A 1H66A 4QUGA 4QDOA 2Q0HA 4RZ2A 5EJGA 3TLKA 4CR8A 4O4JA 1L7EA 5IJZA 1N6KA 2B92A 1RJFA 5DSXA 4CNQA 1P5FA 4JZYA 2PGJA 3VKFA 2YIDA 1DIRA 4M1OA 3GLFE 2J09A 5ELMA 3RS2A 2PR2A 3P71T 1EQAA 3OOEA 2O2JA 4ASUA 2FY8A 3E9NA 3VA7A 1ULUA 1CDZA 1UKAA 3NHZA 1I0ZA 2X9QA 4D45A 2J5KA 4J91A 2L18A 3RBXA 4G24A 1DT3A 1I2MA 4RAOA 2IOHA 1RRVA 2WYIA 5T4EA 3WB9A 4B3FX 2ADOA 5DO9A 4Z7QB 1JILA 1M6WA 2Q41A 3ESYA 4Y2PA 1NVMB 3E5MA 3FYTA 1KMMA 1C1YA 4M1QA 4RVNA 1G6HA 1Y1LA 2ODAA 4JJFA 3VU9A 5CDFA 2P4QA 3ZI0A 4MWOA 3VZSA 4G63A 4RORA 3EYWA 1RIFA 3ANNA 4PXAA 3WLOA 5CDGA 4C6TA 5EOVA 1JHUA 2I4TA 2EP8A 2XHEA 5FPSA 3T4EA 3AO0B 3EZ2A 4NAVA 1AN9A 4QNRA 3WIUA 4GKJB 4RTSA 1XZPA 2VEDA 2ZAOA 3M33A 2IZ6A 3QMWA 1HYBA 4MQEB 2GVDC 4HNGA 1ECPA 2OQVA 3NYIA 2FE1A 1QOQB 1QGUA 5DTMA 5FD8A 1NVUQ 2WTAA 2JCBA 3N8HA 4DMRA 3CKMA 1N2EA 1U4SA 2HUNA 2X19A 4FMBB 1TQ4A 1I33A 3L5KA 1JR3A 3LHFA 3DXXA 3ORQA 4Q4LA 4QG3A 2VDRB 3LQ1A 1XK6A 2PNFA 5CBKA 4KGZA 5CEFA 3H1FA 1CUZA 3ENWA 3JZFA 4NZMA 2G9NA 1NU8A 3K70B 2AMJA 3L4JA 2OFFA 1GITA 3BIXA 3ODGA 1G5RA 3GUHA 3PD1A 4GEKA 1S8AA 1ELOA 4AG5A 3N28A 4F45A 1ZGJA 5DXFA 2C2XA 1XLVA 5IUNC 5KNDH 1N25A 1VRVA 1KDYA 4Z7NB 3DC2A 4MQEA 3R0XA 1CR4A 1AM4D 5T8KA 1FVFA 5FQOA 2X22A 1O54A 5ALEA 3WYCA 2H4YA 2I67A 3IO3A 3NGLA 1TRHA 3BH6A 1KYYA 1W0CA 3CWQA 1UK8A 1DFHA 4MVJM 2R6AA 3TTSA 2JBHA 1LNQA 1Y89A 4BDTA 3PNYA 1Z2DA 4U3JA 3PE4A 2B36A 4FQ8A 4F6RA 3G1UA 1OHHD 1NV9A 2NSDA 3N2GB 1LF0A 4C7XA 2OBLA 1OX5A 1SUSA 3QVLA 3JYHA 4TTQA 4X95A 3TVYA 4FGJA 3CVXA 1TM5E 4O4JF 4GLBA 1W4RA 2DUWA 1DPGA 3NXKA 4HADA 4ML3A 3WKAA 3ZW9A 3F4BA 2G77B 3ROPA 2WB4A 3MCAA 1N92A 4TKMA 1CQZA 1QF9A 1QMPA 4JUAA 3MGBA 4M9CA 2D5CA 2HZBA 2VNKA 3A4LA 3ANLA 5ICSA 2LGJA 3AEKB 1U7PA 3LD9A 3PFHA 2J0SA 4I50B 1PVOA 1I7LA 1P4HA 5FORA 4ND4A 1B93A 2PX4A 4ZI7B 2DLNA 3VFDA 5BMVB 5KYNA 4ZEWA 1SN7A 1YAJA 5AI9A 4JI1B 3ZIAA 2IH5A 1ISFA 4C22A 1TDJA 4MK4A 3LUBA 3JAKB 4YAEA 3GLIA 3QBDA 3PTZA 2XRZA 2DULA 1CRWG 5B12A 2W7TA 4HX2A 2F64A 2NO1A 3G2QA 2QD4A 4FOSA 4KAJA 2HC9A 4NDZA 2WJWA 3O38A 4QASA 3RJZA 3WYDA 4CIVA 2Z1MA 3K96A 1NVAA 2D7JA 5IM4A 2AL7A 4EA6A 2ZDHA 3SC3A 4JB2A 1R0WA 2COKA 1W36D 1BE8A 3A6HA 2VUIB 1MT3A 4ZN6A 3ZIUA 4I5IA 2AJCA 1Z2NX 4FNAA 1QGED 2G9ZA 4WLFA 1XEFA 3WYGA 1WPGA 4G4JA 2C88A 1VJ0A 2WFLB 1FRQA 4O2AB 4QG7A 4C78A 5A3RA 3VSEA 4B43A 5L6LB 2HIHA 3MPOA 3QOYA 4GXNA 1V4NA 4B45A 1FEZA 3FYSA 1XQ1A 4YMGA 2XTAA 3OZRA 2HO4A 5K8TA 3ND9A 3AHGA 4YH1A 1CHDA 3I2HA 2OWDA 4JQZA 2Z2YA 2EKPA 5KNCH 2GD1O 4PYJA 3FFBA 1Y34E 4IOKA 4RDXA 2Z6QA 3HL4A 4FYXA 4OL0A 4UBKA 1YOVB 1VIAA 3P45A 1DFGA 3QUSA 3CF4A 4MMZB 4LWOA 5HF5A 1L7AA 3CZAA 1CVLA 2ZG6A 3BFVA 3K72B 4FGWA 4F4DA 2Q8QA 2X2FA 1AKQA 1T2VA 2QLFA 3CX7A 3PNVA 4H16A 5H82A 1ETHA 2VT7A 3E7PA 4X44A 3I39X 4F4JA 3NFRA 1STOA 1COZA 3GA0A 3Q0TA 1HQCA 2GN0A 4OMCA 4M0PA 2OGWA 4RQTA 2AIRA 2ZJ3A 3CPSA 3HWSA 4E5MA 5KINB 3OPYA 2ZAMA 1NT4A 5KMGB 1YVRA 3QBVA 2Y3IA 4YMUA 1ZX1A 4OEHA 3WC4A 1IN7A 4NMMA 5BYJA 1JPVA 1QV6A 2VNAA 1QPBA 1VPDA 2JEZA 4RFSA 5M5BA 4KSCA 4H35A 3OT1A 2N1BA 3PJDA 5H9VA 4K3UA 4LGVA 4KQIA 3OQHA 2BR3A 2J4FA 3TMYA 4PE5B 1JHDA 4HDRB 1HLDA 1A8QA 1ORDA 1XQXA 2IHYA 2WRZA 5BRNA 4IXWA 4KO3S 2EWVA 5IABA 4RVHA 4H27A 2X23A 4OXRA 1WCV1 5AM0A 1VDMA 2E37A 4GRDA 2RGAA 3T7AA 4RX1A 5JZMA 3FWNA 4D6PA 2WR8A 3JAMA 2DTDA 3AW9A 4M86A 3JWPA 2ZRNA 4NYIR 4F5WA 2C94A 2AN3A 1QTRA 2D2IA 4NJEA 4YAJA 4BQEA 1QHYA 5A05A 2EP5A 2AEMA 1YZUA 2V58A 3I58A 4G3XA 2WP0A 3HFGA 1YKFA 5FOWA 3TSWA 3ENZA 1VM6A 3EW7A 3FCEA 2NN3C 1ACLA 1FP4B 1SCAA 3CWZA 3NJ8A 1JAIA 4H7DA 4HB0A 1L0BA 4OB8A 3HCDA 1T1RA 3OTGA 4KVZA 3AL0C 5EXDA 4JFAA 3U7QA 2GEBA 1HF3A 2Y76A 5G1NA 5AW7A 1T35A 3C0KA 4BZQA 1GZHB 5TT0A 3UWMA 4CNBA 5AVUA 2A9QA 3PQ8A 4FTWA 4E2WA 1GD1O 1AHIA 2FEWB 4MV7A 3B53X 1YZGA 1A9QA 1G7CA 1XROA 2GA9A 4MV6A 3Q7TA 4KTTE 1IBLB 4IQ4A 3T1QA 4BJ1A 5IULC 4G0MA 5LDDC 3O8QB 4C0JA 1P73A 5BUZA 1PQPA 3WIOA 5DCLA 1SC3A 4RZQA 2JKYA 3EIWA 1QYCA 5TLSA 1DRVA 1NUQA 2QW0X 4PZ0A 5EP1A 4EUSA 3H9BA 2A3NA 1EFPA 1H42A 1MIOA 2JAWA 5BXQC 4EIWA 2D4HA 4ENSA 1KDRA 2ZSKA 1XO1A 4GPAA 3PRYA 4W7IA 1JJBA 3M34A 4PF1A 4UHDA 3ICPA 5DXAA 2GVZC 3E18A 4PZPA 1YI1A 4YV1A 4RMGA 1BNCA 1BCSB 3TSZA 3D5EA 4PRYA 2WYOA 5TQ0B 4MVJF 3T5CA 4WEOA 3S99A 1F6WA 2QTLA 1X94A 4OHCA 1NHGA 2VA8A 4L9SA 1UWKA 2GO1A 2IYOA 2QR2A 3BDVA 2ZUTA 3ZQUA 1EPUA 2VJQA 3LECA 2J3MA 3LMKA 2O1WA 1PNOA 5BMVF 2AXEA 3OQJA 4DQLA 3SLRA 3KEMA 4C7MA 3G8DA 2VEOA 4I1PA 1GPAA 4X71A 2H3HA 4OHPA 5LBUA 4RCZA 3GC6A 4P5EA 4GOMD 1X14A 1YC2A 1OI4A 2IW3A 2QG4A 3IESA 1JLKA 5JAQA 3ZDEA 5DTEA 5CA0F 3VPSA 3GJZA 4N0PA 1RAAA 2GK6A 4DN6A 2FEPA 5A6SA 4BAGA 3HCNA 4LYYA 3PNKA 1DMSA 2HK7A 4PHHA 4XUEA 5I7WA 3K92A 3GFPA 5G0UA 1T0PA 1L5QA 1OA1A 3HB1A 3BCUA 3DMNA 4OLFA 3SFVA 3VTZA 2J0VA 1E99A 4EEZA 5JCPA 4EYOA 3ET4A 4AY3A 1QH8A 3MJHA 5DNVA 1NQXA 4YHBA 5KMGA 2X0NA 1ZNWA 1JG6A 3EY4A 1GG9A 1NBMA 3G82C 2P41A 4J4BA 3OU2A 4HY3A 2AG5A 4RV5A 3QELB 4INOA 4U2FA 1MX1A 2H08A 4M9RA 1KVTA 1KO1A 1W5TA 2PXHA 1V4VA 3O2SB 4R2HA 4RFSB 5H5JA 2BEUB 1HXHA 3VRHA 5CW1A 1OVMA 4H1TA 4O33A 5FBHA 2IEYA 5IDYA 1UMCA 3KKPA 1WETA 1ORHA 4C7OA 3NHJA 1W30A 2Q9UA 1C7JA 1EZ1A 4XCXA 2G40A 1QRDA 4P7JA 3BHIA 4MRNA 2G1UA 3MTQA 1KDOA 4RV4A 3EJWA 2ZTSA 2QV0A 3EVBA 1RLIA 3CM0A 4M0DA 3T3EA 2VJDA 2EW2A 5CDTA 2DBZA 4TSFD 3GFOA 3M6MD 1Q1ZA 1QAQA 3OZTA 3I9V6 4XQ0A 1UT8A 2D06A 4LJSA 3CE9A 3NONA 4LDJA 5CVUA 1RI5A 5T5QA 1JVBA 3PFWO 1FRNA 3HU5A 3MTDA 5KJ6A 1YR3A 3LRXA 5BXYA 3QLTA 1NC1A 2FZWA 5FTMA 1A2BA 1QLHA 3KKLA 2BH2A 2OILA 4M8LA 4YJKA 1RM4A 5JEDA 1N2XA 2FCRA 3KB6A 3ZZ1A 2J4DA 4C0SA 4EX7A 2DX7A 1CQJB 1Z3IX 4RANA 1K6JA 3C7CB 3D0OA 3LL4A 2FR8C 4UM5A 3NHAA 5KNBA 2Q49A 3LPAA 2C8LA 4ND3A 1TU3A 3WJ7A 3LDUA 5KTMA 2BE9A 3C3MA 3CUYA 3I09A 4MKXA 3TAXA 3WLJA 4I6EA 2C4WA 1O97C 3N5CA 1XP5A 3HDVA 3R3YA 4WBXC 4XWKA 1AU9A 5ICFA 3TLYA 4HLQB 3SEQA 1YB4A 5KNDD 1ZD9A 3BJMA 2BMVA 4NEGA 3EIEA 2P2CA 3EZLA 1X80A 1M5UA 2ZR8A 4LHSA 5EQDA 4RDCA 3KRTA 1OB2A 1JPNA 3G49A 3RG8A 4OLHA 5FYDA 4YMWA 3I3OA 5JR3A 1USVA 5L3ZA 2WLSA 3T8YA 2H31A 1HT0A 3PITA 3NHFA 4DR5B 2GHTA 4Q9KA 4XQGA 1KGSA 1Z6GA 3F6CA 4U7TB 2J67A 2ZGVA 3HCRA 4BLTA 4DBLC 1QB8A 1GSIA 1Y9AA 1FP7A 3D8SA 5CNMA 4DEVA 1UXOA 3W4KA 2HA6A 3WYEA 4RXTA 1U0HC 4NESA 2B83A 1YS4A 2ZIFA 5JWRA 4HVCA 5CTAA 1TJYA 1RKXA 4Z4FA 1UK7A 4D2IA 1JE0A 2Q6VA 4XXHA 2PTGA 1J5EB 2I2FA 1LTKA 1SXHA 2P30A 2NU7B 2WYWA 3BC1A 4NQZA 5DYWA 4ESEA 1KEWA 3F6BX 1RLMA 2ARKA 1VTKA 4WKOA 1HC7A 4X1OA 5TV2A 3RFFA 4IIHA 4TV8B 2PSHA 2XNCA 3IB6A 2QSZA 3TEFA 5HS6A 1IPHA 3DQPA 3CUWA 4HZIA 4OHKA 1CLEA 4OXXA 1EYZA 3K1ZA 3BE5A 4EUFA 3A1UA 4Y0NA 1P1KA 4DNFA 2OO7A 4KLAA 4KE9A 3SPXA 3GWGA 4X61A 1T36B 1J0BA 4UULA 3ADDA 1N8NA 1GYQA 4C2AA 4WFJA 2IX3A 4UXJA 3P4YA 4DCNA 1FFCA 1GYPA 2QYHA 4QUIA 4FE3A 4DANA 4ALIA 3AKZA 5F4BA 3Q8MA 1LRJA 1K7EB 1NTOA 1OQAA 1BQEA 3NBZC 2H1CA 5GZ6A 4NIMA 5LVAA 1S8OA 3DMFA 3N0VA 4JNCA 1SVNA 2XQFA 3S29A 3ZWQA 4BCCA 1TYDE 2P5SA 1KS9A 3CLRD 4J94A 2JJ8A 2YKGA 5ECDA 4JLAA 1RM5A 3KQHA 1WEKA 4UOEA 2UZ1A 2DFTA 4PV7A 4YCAA 1JX6A 1DZIA 2VK8A 5H83A 2J9FB 1PHRA 4JDUA 1K6EA 1L3IA 3TM5A 1XMVA 1CUWA 1CY4A 4ZDKA 3AY7A 3EIXA 4HQKA 2XA1A 4HG2A 5JPCA 4ZYLA 2AKYA 3HY3A 1Q0LA 3WL4A 2IF0A 1YQUA 2CUKA 4OBWA 7REQA 1NKTA 1S96A 4HTFB 3IFSA 1J09A 4B4WA 1UBKS 1KDVA 3ZU5A 1I13A 1TLLA 2YHIB 1TM4E 2G0NA 3EVFA 3DEIA 2WV9A 4D02A 3AB8A 2I2CA 2W6NA 4KGDA 2QYOA 3KXLA 1YIAA 5FADA 4JUIA 3I53A 4W9RA 1XJWA 3KXDA 3M6IA 1H85A 3IP1A 5IDXA 1TK9A 5BP7A 1R27A 5DI3B 1T5HX 4XGIA 3NDIA 2VG8A 1XHLA 4RHTA 3E7WA 4BKMA 4C4XA 1ZXXA 4GBJA 5TVKA 4CHTA 1ZK3A 1OC4A 5BQ3A 2XZLA 4YP1A 3H9CA 3MWJA 3VKGA 2RGNA 5C35A 1RYEA 2ZEJA 3N2NA 1GSHA 1XQWA 3H5IA 2Z4RA 3JWEA 4QUDA 1BEUB 2HSJA 1XXHB 2G08A 2PSSA 4G97A 2PT5A 3EGIA 3G5UA 1AHHA 3WRXC 1VCIA 4A6EA 3REOA 2BMEA 2IDJA 2PUJA 3I9LA 3OA0A 5BQFA 1ZVJA 1PV2A 1N0HA 1HZJA 2C98A 1JU4A 1KRHA 2H92A 3FVVA 1W73A 3JASA 1AS0A 5BN5A 1FFSA 1C3LA 1J8QA 4OLAA 4CM8B 1FZTA 1AC5A 1AUPA 4OHUA 1OR8A 3T41A 4R3WA 5FWXB 2HD4A 3BGWA 3M1LA 5KPDA 5G3YA 4QGSA 4AT1A 3HABA 5ILGA 4G5QA 3N6VA 2O06A 2WU1A 5LQKA 3K6RA 3HJNA 3QNUA 2Q3FA 3T1HB 1ODIA 2F1IA 3A1VA 2OHOA 4JZKA 1KAGA 4OFZA 2PJDA 2R6DA 1P80A 4U8HA 1BE6A 2AOTB 4TPKA 4WFIA 4YMSA 4H0CA 1AUOA 2E49A 1RFGE 2QX9A 3O4JA 3BDIA 4E08A 3IOEA 2NU7A 4P92A 3ASZA 7MDHA 3S27A 1M6YA 1N2JA 2GF0A 2YJGA 3AX6A 1AQLA 3FI9A 3GEGA 3PT5A 4FFLA 2HNAA 4H2DA 1X7XB 1Z4JA 4J0EA 4XVRA 4EFNA 1T6NA 1KTIA 2O8FA 3Q6MA 3RBAA 1QBGA 3W79A 1OFHA 4HX5A 5IK2D 4E88A 2A84A 2AVNA 1QJ4A 1Y3IA 2H48A 2YWDA 4MNTA 3DEYX 1U2ZA 3UOAB 1RQNA 2RGDA 2ZIXB 5ULLA 3ETGA 3PI6A 4WE3A 3RNOA 1U5BA 1YRWA 5K6TA 4AMBA 2WMNB 5IBQA 3NALA 3EIUA 3T5MA 1ACMA 3FOWA 4G81A 4P84A 1TCAA 2J8ZA 2ODTX 1N2CB 4K86A 4PHGA 1JEOA 2Q4EA 2QRHA 1ZZEA 2ZB8A 3WTCA 5A9SA 3JQPA 3JY6A 2HR1A 1E3LA 5J58A 3Q41A 2C77A 1YF3A 1GYRA 2Q21A 1W35A 4I1OA 1WABA 4X41A 3QU4A 8ADHA 2RK3A 2BFBB 4NULA 4UCWA 3D5QA 4LTDA 3E3MA 3JQ9C 2V03A 3R1IA 3KTOA 3NBAA 3QKUA 4JB8A 5AOVA 3ZD7A 2VNJA 2HJWA 2H1FA 2GHRA 1XTPA 2CV0A 3GP8A 3UMMA 1T5OA 1GFZA 2D2FA 3NR2A 1NW6A 4NCJA 4ZANA 2QMUA 2QTHA 3DOUA 1SB8A 1PX2A 4GO1A 1XDSA 5KCMA 3AVYA 3OT4A 1N2CA 3TF5A 2NO9A 4MO9A 1CUHA 4EMBA 2QTNA 4YRNA 2IXTA 5HKLA 4CUZA 4JKYA 4XRGA 1M8PA 5JSQA 1I4WA 4MWSA 4B3JA 3E03A 4QICA 4QTZA 1KFCB 4PX3A 3DE2X 5E9JA 1UJ5A 1Z5OA 4J3NA 2QQ0A 1SCQA 2I6GA 2O7RA 2ZM5A 3EHEA 1N5OX 2PLRA 2PS3A 3KB8A 4ARZA 4D9IA 1YR9A 1SQSA 2D7DA 2B4YA 1JHRA 3KD2A 3AIIA 1CEQA 2QRNA 4XD7D 3IMFA 3X2SA 4BJ3A 4GC9A 4JYAB 3LF2A 4BUZA 4YJ3A 1YONA 3OY2A 4AY2A 1Q22A 3I62A 1XTTA 1I8TA 3HBNA 2EW1A 4G09A 1DBQA 4LOAA 4B3DA 3RVRA 1IAVA 2PD4A 5BSHA 5JE8A 1JJIA 4UVHA 2FUKA 3ZY2A 5T41A 2R1TB 1P31A 1GNTA 3H9GA 4JR2A 3UJ6A 3ZCQA 4B6EA 5J2UA 2B8NA 1JHOA 3G9TA 1TPZA 3DCIA 4RS3A 4WESB 3IDSA 5E6SA 5A71A 1NXOA 1J8MF 1FDTA 2QIPA 5AKJA 4LF9B 4CEIB 4DR4B 1GU1A 2VT6A 1ZRHA 3RJ9A 1EVYA 5B1IA 5HSGA 5JPIA 3EIHA 5ARCA 1NXSA 2PZLA 3FDIA 5DTJA 4YYEA 3LQQA 1PL7A 5E6RA 5KAMA 2QXTA 3IEMA 3ED1A 5A0FA 2ZSUA 4J7XA 4JJ7A 5B2EA 2Z3ZA 3KB2A 2GKSA 1E0SA 5EI5A 4H3SA 4O2LA 3WKBA 1W94A 3L04A 1JZQA 3AI3A 2ZI9A 4ZODA 2R8PA 1XAGA 1LSOA 1DRWA 2HJGA 3LKVA 3R4VA 1T0IA 3RJMA 4YPOA 4X3PA 1U81A 5FNVA 2YXBA 3BBPA 3WOVA 3ZG6A 3NB0A 3NT2A 2G0TA 2J3DA 2O0LA 2BHNA 5EQFA 4EGQA 1N7HA 2OCIA 1Y82A 3ZLUA 1PDVA 4CDRA 3L7OA 5AQ1A 4PIVA 3HJUA 4BC1A 5FDFA 1P2FA 1ZICA 2PEZA 1VBKA 4QOIA 1VIDA 3CIOA 2L2QA 3JWJA 3RIEA 4QBIA 1DOAA 3OD1A 3TRKA 3VPGA 3N07A 3LBAA 2GCEA 1C3EA 1XRLA 3BJIC 3IJPA 4IIDA 4WLOA 1NP6A 2WWFA 5H4GA 4RMNA 1Q6YA 5I3ZA 3T7TA 4U39A 5K5EA 4FIZA 4ZCMA 4NMXB 3B8EA 3BJRA 4ZU6X 3MHTA 3JX9A 2P6UA 3UUEA 2AE1A 1NVVR 3MS7A 5HDQA 1RIIA 3I61A 3JCZA 1IBKB 5B5SA 3CBQA 2LPMA 1JLLB 3PVZA 4BQFA 2JEYA 2XGMA 3V7NA 1FFWA 2CLKB 2XVMA 5BOSA 3HN7A 2XT0A 1C4KA 4FD2A 4DIEA 1N1GA 3ZTTA 2XNSA 1KVUA 2GPAA 3L84A 1F8FA 4V0RA 4KQFA 1SZPA 1ZCZA 2QMEA 4PS1A 1NXVA 3MPUA 2JBWA 3FWKA 3GU3A 4FFBB 4ZU3A 1JDUA 3W7VA 3RU2A 3EPPA 1E2DA 1OE0A 2WILA 4IP0A 6YASA 2I3AA 3LXRA 1LTQA 1ZCBA 2O8VA 2BBSA 3QYAA 2VHXA 2QA5A 2PUWA 2GK7A 2NZYA 3SYLA 2EFJA 2XXBA 4W5RA 4G9BA 1VLJA 1E7RA 2XYRA 2ZJ5A 1GQOA 3FPLA 4KXUA 1MB2A 2DQYA 4ZZIA 1NG1A 2P27A 1N3LA 2WJGA 4I1YA 4AICA 3WGUA 5IVHA 4XOUA 3LYUA 2A1UB 4LJ5A 1KPGA 3ST7A 1MDFA 1OFTA 1WCWA 3AG6A 4UHJA 1I1OA 3E23A 3PUIA 1UAAA 4JENA 4JLVA 1WZCA 4BV2A 2H2AA 1MC4A 2OBYA 1TC2A 2JCXA 3BRWA 4M76B 4CL2A 4M88A 5FPHA 4NENA 5C34B 3K3PA 3BGDA 1FSPA 4ZVMA 2QJRA 5C31A 5I5EA 4MB0A 3ZBPA 3KK0A 1KFEB 1Q2UA 1KAHA 2DHDA 3ET5A 2G25A 4WDQA 3ZW7A 1R2QA 2PLAA 2JZOA 4L9WA 4Y6RA 1E3JA 4YRQA 2BKEA 5EPUA 2YXLA 4MR9B 3VHXB 5J4VA 4WASA 5THKA 2JHAA 4MYTA 1PS8A 5I9BA 1H1LA 1DTSA 2CXOA 4QHTA 5AR1A 3HBJA 2FA9A 2NTVA 3IAS1 3H2SA 4JVNA 4MGEA 5IG2A 3EAGA 1I5EA 1O3YA 3OF3A 2GD0A 4CLRB 3GLIB 4RXMA 2ECKA 3FDZA 4MO2A 5D7NA 3OQBA 5CM9C 3ZWWA 4CLOA 2O4CA 2RSLA 3UAXA 3KLPX 3QVKA 3VPCA 1HYGA 4FDUA 1TQHA 4LJKA 4DUZB 4JASB 3PX3A 1SMKA 4XGNA 1YHZA 3IVMA 2I8AA 1GCOA 2QVGA 3WJ2A 4QA9A 4BNWA 4FZJA 3L0DA 2NU6A 1CHNA 3G6KA 4QVKA 2IPMA 4RD4A 2QTTA 2OXFA 3FVWA 1IK6A 4HDMB 1UUFA 3PLNA 3PUXA 1Z29A 3GBVA 1EAYA 3EODA 4RO0A 3BL6A 4QU5A 1DI0A 2B1QA 1P0MA 2G7MC 3A70A 5AVOA 2YVAA 2CVOA 3LVBA 3F3YA 4O4LA 1WWKA 2B98A 1N5KA 3OF2A 3UCEA 1OWNA 4J6EA 3A0RB 5TDHA 1QQAA 2OB1A 1QRAA 1SQGA 3VR1A 5L7TA 2IOFK 4FVTA 4WRRA 2H2WA 1T8TA 4PC7A 1Q0PA 2YDXA 4M89A 4EYEA 3JZIA 3B85A 3LH5A 1LLDA 3IDZA 4KWHA 5GJWC 2VFAA 2G4VA 3GEDA 4KJXA 2WI8A 1KI6A 2PEYA 5D3KA 1GEGA 1Q50A 7MHTA 3DCNA 4OI4A 1W7AA 2F59A 1QP7A 3VKHA 5ALFA 2B61A 1RCUA 1XRSB 1I1QB 1UBLS 3AB3A 4DJFC 5B30A 1LVGA 3NLLA 4J2HA 1U80A 3WDLA 2QUAA 2EJWA 2D59A 1D5WA 3GA5A 4DQDA 2ZLBA 3KUCA 2LR0A 4J07A