4ETWA

Structure of the enzyme-acp substrate gatekeeper complex required for biotin synthesis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
255
Chain Sequence
b'NIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLGWALGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFISHPAEFCHLLVALKQRVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pimelyl-[acyl-carrier protein] methyl ester esterase
molecule tags Hydrolase
source organism Shigella flexneri
publication title Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis.
pubmed doi rcsb
total genus 91
structure length 255
sequence length 255
chains with identical sequence C
ec nomenclature ec 3.1.1.85: Pimeloyl-[acyl-carrier protein] methyl ester esterase.
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4etwA00
3V1MA 1O6GA 1ZI8A 5D3KA 2C7BA 4KAAA 4UBNA 2IITA 5CT6A 3I2IA 3PFBA 1BCSA 5LLSA 3IVMA 3IDAA 3ZV7A 3MVEA 2JF0A 1QIGA 3I6YA 4RNCA 1EVEA 1U65A 4PV7A 4E15A 4H77A 1F8UA 5CTAA 3R3WA 2C5GA 4UBKA 4CG2A 1UZAA 4HRXA 4IH9A 4AZ0A 5CH8A 4BP9A 5ALFA 1N1MA 1XRRA 4F60A 2OCGA 5A7HA 1JFRA 4Y2JA 5ALQA 3LIIA 2QVBA 5JYCA 3IURA 4JNCA 1Y7IA 3STTA 5C8ZA 1E8NA 5J3JA 3QPDA 3A2MA 1NU6A 3VXKA 5D3ZA 1VKHA 5AI5A 4DTCA 4F5ZA 1Z68A 1CPYA 2RHTA 1U8EA 1JU3A 5AM4A 4AMZA 4I4CA 2XUPA 3DOIA 2CBGA 3SWWA 3V9AA 3O4IA 3UUFA 2VF2A 2OAEA 4MEBA 5ALLA 3FWHA 4EUSA 1ORVA 5KREA 3I2KA 4BTLA 1B41A 1BCRA 3PF9A 4XWGA 3C8DA 1DT3A 2ROQA 5HK9A 3IUNA 1B6GA 5JD4A 5AOAA 3WKAA 1QIIA 4WCVA 3AJAA 4DNFA 1QOZA 5JAPA 2W22A 5CMLA 3IA2A 4I3FA 3V1NA 3HSSA 3ICVA 5E4TA 2I3ZA 2RIPA 5FPPA 3FLEA 4BCCA 1XQWA 3DYIA 1O6FA 3PI6A 4DMCA 1QLWA 4U2EA 3ZPXA 1CIJA 4FOLA 5AKEA 1IUNA 1EI9A 3EF3A 3BF8A 1JU4A 4DGQA 5AIAA 2OGZA 5I7UA 5ALUA 3R41A 1PV1A 5K3BA 3F9CA 4UHBA 2GBFA 1CRLA 4JEIA 3R3VA 4OCZA 2X76A 4H7KA 5ALPA 4MQLA 4PSUA 4BZWA 1HQDA 4UBOA 1EHYA 2W6CX 3WWEA 1VXRA 1GPLA 4C87A 1L7AA 3IUMA 1MAAA 1R9NA 2OCKA 3N0TA 3H1AA 3O95A 4ROTA 5DYWA 4NMWA 3NGMA 4HVTA 4WFIA 2GBGA 3H04A 1D07A 4ZREA 5LZ4A 1KU6A 2VAVA 2XQGA 1BEZA 1CUCA 4BAUA 4NVRA 5AKLA 2DSNA 2WU4A 3I2JA 3WK7A 3IUJA 3GZJA 2R8BA 2QRUA 1USWA 4G8BA 1J06A 1XRQA 1CEXA 3FOBA 3H2GA 3D2AA 3VJMA 5A7GA 2C4HA 1SCQA 3IUQA 2I03A 5AM2A 5CURA 3BWXA 5ALNA 1EH5A 3EQ9A 5JALA 2WIKA 4ARBA 5JD5A 3DKRA 4PNZA 4B84A 4Q34A 5EHXA 1IUPA 2JGMA 2ACEA 3I6ZA 1EDEA 2DQYA 4B9AA 2VJDA 1QIEA 4NZZA 2O7VA 1XROA 2XMGA 2H7CA 3I1IA 1XZKA 2XUJA 4Y2SA 5ALTA 1UOOA 3HLKA 2XB6A 4IH1A 2C0PA 2YYSA 3JYHA 3UMJA 1EDBA 5BV7A 3WKDA 2YXPX 5DYTA 4OUKX 3QITA 4U2BA 3AZOA 4KAFA 2GYWA 2WUGA 1TAHA 4FNMA 2XQKA 4DLNA 3D5EA 1ZIXA 3FCYA 2BUAA 1A8QA 1UK7A 5A62A 1HL7A 2WG2A 2Y6VA 5AI6A 5CT5A 3HRHA 4ETWA 3QBJA 3MGAA 4C89A 4MYSA 3H0CA 4HTAA 1W76A 1A7UA 3H19A 1MO2A 2FJ0A 4BC1A 1MNQA 4M0EA 1G4HA 5ALZA 2AJLI 4ARAA 4DMFA 2HL6A 5AKZA 2OCIA 2VT6A 4MWSA 3D3NA 4MYDA 2V97A 4Y2UA 4KYVA 5HCUA 3QZUA 4EHBA 1VLQA 3O9VA 1A8SA 3I2GA 5KWIA 3QH4A 5AI8A 4LKOA 4Q82A 3DDUA 1GGVA 1H23A 2Z8ZA 3O9MA 1ODTC 4Y2YA 4FBLA 4PW0A 4GLBA 3U1TA 4MQMA 4CIBA 2BGRA 2C58A 2PUJA 3PFCA 3SX4A 4P08A 1KEZA 4EY4A 1QZ3A 3R0VA 2VQ6A 3HJUA 2BUCA 4B0OA 1IZ8A 5DNVA 2WUDA 4H7FA 1EINA 2DHEA 3Q0TA 1C4XA 3R3YA 5CT8A 2ES4A 1YB6A 1X2EA 2PPLA 1XKLA 1XLUA 5HKBA 4B6GA 4BVKA 2VATA 5FOQA 3YASA 4FBMA 3I1YA 1XZIA 2PSJA 5EIAA 4BAZA 4U2GA 3OC0A 2QJRA 3R3ZA 1CLEA 2XUHA 3RLIA 4GI1A 4NS4A 1XQVA 5AK3A 3WWCA 3HZOA 2Y2VA 1ODSA 6YASA 1WB4A 1LZLA 2HRQA 3ESDA 4WDQA 5AI4A 2H7YA 3GELA 1G42A 3FCXA 5D7BA 3G9ZA 4N8EA 4A16A 1IUOA 5YASA 5JZ9A 2PSEA 2Y1KA 4FTWA 3VDXA 5FUMA 2HU8A 2PSDA 1W4LA 3FYTA 3I28A 4IQ4A 4OD0A 1RWQA 5ALOA 4DM7A 3PICA 2BCEA 2XUKA 5SYMA 3VVMA 2HM7A 4C4YA 1J1IA 3W04A 3ZLTA 1DWOA 4UFNA 5ALMA 1M33A 5AKHA 1QJ4A 3QPCA 1JJFA 4X95A 1UT6A 4FFVA 4QEKA 1SCIA 3AFIA 2WFLB 5KWJA 4XVCA 1AMNA 4W1SA 4BB0A 2FUKA 3C70A 2BKLA 4N5HX 1UKBA 1EA5A 3DCNA 3G0BA 4Y9SA 1F6WA 1VA4A 2VSQA 5T4BA 3VJLA 4BE9A 1CUZA 4Y2TA 1CUDA 3ED1A 2WILA 2J3QA 2P8SA 3SK0A 4C01A 3STYA 5JANA 4JYPA 3BIWA 4FDMA 3OOSA 3WWPA 4EBBA 2G4LA 4TGLA 4DNPA 1TCBA 4LYDA 1LNSA 2QOEA 4QWWA 3JWEA 1H22A 3W05A 5EI5A 1BE0A 1DX6A 1GQRA 5JAHA 3ICWA 4KAJA 1GQSA 1CUGA 2XMDA 3W9BA 1R4ZA 5AKYA 3F98A 4JYMA 1IZ7A 2HIHA 4J0IA 4RGYA 3M3DA 2I3DA 1L7RA 3DQZA 1G5FA 1U4NA 5KBYA 5JARA 2OXEA 4X00A 2RGUA 3WJ2A 1MX1A 3F67A 4FKBA 4C88A 1XLWA 2C0QA 4DMKA 1CUYA 1ZD4A 4XIIA 3UUEA 3AIMA 4BE4A 1P0MA 2RONA 3WQHA 4J0HA 4TPKA 5FDFA 4EB0A 3S2ZA 4UHCA 2WHQA 4EZIA 1YCDA 4GBGA 2WJ4A 3WL6A 4H0CA 5LKRA 1L7QA 3W06A 3DKKA 1F0NA 2QR5A 5AM3A 4GECA 2EDCA 3M81A 5AICA 3E0XA 2HDWA 3LIPA 1QIKA 4KACA 1AUOA 3L1JA 4Y2XA 2HHAA 2ORYA 3U0VA 2Z5GA 4UHDA 3QM1A 2BUBA 5JAOA 1JMYA 1LPMA 3O4JA 5AK6A 1DU4A 1YAJA 4ZWNA 4BATA 1QTRA 3QPAA 1S8OA 1ZIYA 5IVKA 4MWTA 4S0XA 3LCRA 1DWPA 3HYSA 3BF7A 2B9VA 4EY5A 3CCCA 2PX6A 2HADA 4J0JA 3WYNA 2WJ3A 5AKKA 2ZYSA 5ALGA 1ORWA 2HU7A 1J2EA 1GZ7A 3LP5A 5EHQA 4QDOA 1VE7A 3R3XA 3AZPA 1EDDA 1YA4A 1ZGBA 3D7RA 2CZQA 4W1QA 5D6OA 3RM3A 3O4HA 5T4HA 3TEJA 3WZMA 2HA3A 4KR0A 2GYVA 7YASA 2UZ0A 1ACJA 3VJKA 4B9EA 5DNWA 3DNMA 2RI6A 2XUFA 1YASA 2R11A 1A8UA 4OB6A 4FLFA 4B85A 4ZXFA 4X6UA 5IH7A 4Y2PA 3OURA 5BWBA 1I6WA 1N8SA 2VJCA 4AN0A 1LPSA 5LZ8A 1ZOIA 1QIMA 1LGYA 5BOVA 4V2IA 4WY8A 3TGLA 3WK5A 1CFJA 3WA6A 4DSAA 1ACLA 4L3WA 4LYEA 1XZAA 2ONCA 5AM1A 3B12A 1E5TA 1YR2A 3L1IA 5FLKA 4U2DA 5T4FA 1P0PA 1EK2A 5CXXA 3FAKA 3C6YA 3W2TA 2AJ8A 5IVDA 4X6XA 1XZCA 3DOHA 4A5SA 4UHHA 2VAXA 4HXEB 5HKAA 5I8PA 2JGFA 5AHXA 1K8QA 4J0CA 4DIUA 4KRXA 4J0GA 3DJYA 2E3JA 1CUBA 2FJPA 4GDMA 2QJWA 1VZ3A 1VJ5A 3ZLUA 5JATA 1GPKA 5K3FB 3DL7A 5A71A 4N8SA 3ZI7A 2ZJ6A 2OQVA 4Y2VA 4L72A 1TKRA 1LBSA 1ZD3A 4HS9A 4EY8A 1HKHA 2XQIA 3LLCA 2OG1A 1QIHA 3KWFA 3NWOA 4FFWA 3KD2A 2I78A 2QT9A 1W52X 4X3CA 3A70A 1TCCA 1UOQA 2QKYA 3AIKA 2JGEA 1XZLA 4G8CA 5CRIA 1THGA 3FYUC 3FLAA 3R40A 1LPAB 5LKAA 3X3HA 3H17A 3ESCA 5C7YA 1E3QA 1XQYA 4HRYA 1CQWA 5HFNA 1XZFA 5K3DA 3WL7A 1XRNA 3L1HA 4CCYB 4X7BA 1TK3A 4E14A 3G7NA 4G5XA 1UK6A 4AX4A 2WLSA 2WFZA 4HAIA 3HI4A 4IHAA 4AN1A 3D0KA 2XE4A 1CUFA 1ZI9A 2G5TA 2YH2A 2HA7A 3G02A 3STVA 2WJ6A 1UKCA 2GBCA 3FNBA 4QDZA 3F97A 4LXGA 3K9BA 3WI7A 3E4DA 1GKLA 4AZ3A 1MX5A 4EY7A 3QMWA 2CJPA 2CMFA 1ZD2P 2HA0A 1K6EA 4FHZA 4QWMA 4CG1A 2ZJFA 1H2YA 1CUXA 3I2FA 3FYUA 2HFJA 2PVSA 4O08A 3RKSA 1W6RA 5AK5A 1FFCA 1AZWA 3PF8A 1DX4A 3BJMA 4Q3LA 5C81A 1PJAA 3G0DA 4QDTA 4WDRA 1F0PA 3BDVA 1OCEA 1AKNA 3WLAA 3K2IA 4KE6A 5DYYA 5LZ2A 4UHEA 4BVJA 3DLTA 3N2ZB 2OGSA 4EY6A 4XX1A 3G0CA 3T52A 1BU8A 3MUNA 5AOCA 2CB9A 2GBIA 4GXNA 3FSGA 1XZDA 4C4XA 2XLBA 5ALRA 4L0CA 5ALYA 2QZPA 3WWDA 4IH4A 5CH3A 5AI9A 3CCBA 2PKYX 5AM5A 2XMCA 3C43A 4CG3A 3IBTA 4JUIA 2DFPA 2ZSHA 5HF5A 1UXOA 1CVLA 3M83A 1MAHA 2WTMA 5FPQA 2RHWA 4K2AA 5A2GA 3WKEA 1MJ5A 1UK9A 1CUWA 3F8SA 4Y2QA 4HXGA 3PUIA 1E8MA 3QMMA 2WIJA 3AINA 1YS2X 3B5EA 1IVYA 1XZEA 4E46A 2WHPB 5ALKA 4GW3A 4G4GA 1HLGA 3NOXA 4K6HA 4INZA 2LIPA 1LLFA 4QLAA 1ISPA 4W63A 4ZV9A 4E11A 2AJBA 3H2JA 1U2EA 5FP0A 2DCMA 4P92A 2WUEA 5LIPA 1YSCA 5DJ5A 4DYHA 4N8DA 1UOPA 1VOTA 3ANTA 2J4FA 5BWCA 1EXWA 1WHTA 4D9JA 1H2XA 5JASA 2DQZA 5ALWA 4CFSA 2HFKA 2V98A 4W9RA 5HZGA 4HXFB 1WPRA 5ALSA 4YK7A 1Q84A 2XUOA 2WIDA 4OB8A 4UBIA 2WKWA 4PSCA 5CT4A 5ALVA 2WQZA 1XZGA 2BAGA 3T4UA 4W1PA 1LPBB 4WFKA 1AGYA 2C5FA 2WUFA 4PO3X 2Z8XA 2XUDA 4UFOA 2DHCA 2Y2UA 5AKJA 2QXUA 1E66A 1ETHA 1TRHA 2ZVDA 2XUGA 3GROA 2Z3ZA 1Y37A 1QIJA 3IULA 2YASA 3BJRA 2ACKA 5FXMA 4DNQA 4K6GA 5F4ZA 5IVHA 3FYUB 4BRSA 5AK4A 3LS2A 2ZYIA 1XKTA 3WMRA 2V96A 2JGLA 5I9IA 4LIPD 1JKMA 3FSGD 2Y6UA 5HF8A 1SCKA 4QLOA 5E2IA 4J0KA 5HK8A 5EHZA 5AKGA 2QUAA 4Q3OA 3GA7A 4G4IA 3FVTA 3IB3A 2ZYRA 2X8BA 5DWDA 1ZGCA 3KXPA 4J03A 2V9ZA 2GZRA 2OPHA 5C8VA 1XZHA 4FWBA 4B82A 3AZQA 4AXBA 2XMQA 5EFZA 4H7IA 2QTBA 1H2ZA 2RAUA 5ESRA 3O0DA 1GPNA 4ZGBA 4OYYA 4CIAA 2XI4A 2QUBA 5JADA 5AP9A 3STWA 3WL8A 2XMSA 5ALIA 1QFSA 2ZYHA 1JT2A 5DNUA 3GUUA 1QFMA 3D2CA 3H2KA 2JIDA 3HACA 2X5XA 3D59A 1K4YA 4BCDA 5AH0A 1OILA 1RP1A 3AILA 3ANSA 4H18A 1W75A 4H7DA 5CW2A 1CUVA 3WKCA 4BRZA 1CUAA 2O2IA 3GBSA 2BFNA 1H2WA 1WB5A 3S8YA 3DD5A 4XJVA 4OPMA 1CUIA 2PU7A 2XT0A 3WIOA 2WFMA 3WZLA 4OU5A 1E8DA 1LBTA 2OAGA 2Q0XA 1R9MA 3I6MA 1BS9A 3KSRA 1SOMA 1YA8A 1DWQA 3G8YA 4HZGA 5JIBA 3FVRA 1HDEA 5SYNA 4JH0A 4G9EA 4QNNA 4BCBA 4G1FA 3PE6A 4ZV7A 4TVKA 5LYYA 1ODCA 4CCWA 1GKKA 4Y7DA 1Y7HA 3KDAA 5ALXA 1FSSA 4X97A 1BN7A 4J7AA 3TRDA 1AC5A 4X90A 3AUKA 5HQ3B 3H2HA 2HA5A 5IKXA 3HEAA 3HC7A 4BVLA 1TQHA 1MNAA 3G9TA 3G0IA 4B81A 4U2FA 3VVLA 4B83A 4PSDA 4WJLA 4AO6A 1YB7A 3PDCA 1AQLA 3C87A 4UUQA 4N5IX 3WL5A 4LHEA 1CUEA 5EIEA 4B80A 1TIBA 1XRMA 1XQXA 4CI9A 3RK4A 2VJAA 5HF9A 4LXIA 1VXOA 5AO9A 2D0DA 1ZICA 2QXTA 5HFAA 1WM1A 2JEZA 3V1KA 4BDSA 2FX5A 1TCAA 4H7EA 4RE5A 3KOOA 1K63A 1E89A 1BRTA 1K5PA 1CUUA 4KE7A 4K6KA 4KE8A 4H7JA 1C7JA 1AURA 4AB1A 1LPPA 3C5VA 1DINA 2WG1A 1ZI6A 5IVIA 3F96A 3C45A 5EIHA 2HRRA 3FLBA 4WFJA 1ZJ5A 4P9NA 2GZSA 1XFDA 3EBLA 3O4GA 5JD6A 1MPXA 3CN7A 5JZBA 1A88A 5CXUA 2CUTA 4OB7A 3NUZA 3OM8A 5AJHA 4FNGA 4QDUA 5AKXA 1YS1X 3WJ1A 2AXEA 1VZ2A 3C6XA 5LZ5A 3P2MA 1T4MA 5ALJA 3BXPA 5DLPA 2XUIA 2WU3A 5ALEA 4FMPA 1THTA 4YX9A 4AMYA 2VTVA 2O2HA 4KEAA 1OXMA 1QGED 4I19A 4CCYA 5FV4A 5JZSA 3BE8A 2O7RA 3K6KA 4B7ZA 1T2NA 3QMVA 1P0QA 5T4EA 1CQZA 1N5RA 1J07A 1FFAA 3HXKA 2JGKA 4OYLA 1GXSA 4RPCA 2ECFA 1N5MA 2G63A 3WK8A 4GEGA 4G4JA 2G5PA 1KU0A 4OU4A 1VE6A 2XDWA 4UHFA 4MJ3A 1EK1A 1Q83A 4IO0A 1MU0A 1CUSA 4MXDA 1WHSA 5CT9A 2IIVA 2WTNA 1FFEA 1JJIA 2BJHA 4ITVA 5JAUA 4RE6A 1QIDA 1R3DA 2EDAA 4FLEA 4QZVA 4Q05A 3EQ8A 4U2CA 2OLEA 2VT7A 4A23A 2HA6A 2Z3WA 2H7XA 4F21A 1NU8A 1R50A 1UWCA 1C7IA 1JJBA 2DR0A 4X94A 5C8XA 3OTQA 4QA9A 3WK6A 1BEEA 1MX9A 2HU5A 5AKIA 3BDIA 2H9YA 3D2BA 1WCYA 4P93A 5AIBA 1DTEA 5AOBA 3CXUA 1CUJA 3G9XA 1LPNA 4BBZA 5E4YA 3C8HA 3VISA 1EB8A 5FRDA 1EVQA 4C4ZA 3EIOA 3WKBA 1IMJA 5ALHA 3I2HA 3STXA 3PUHA 2XMRA 5A6VA 1AX9A 1CV2A 1FJ2A 4Z49A 2VJBA 3OG9A 1WPXA 2XUAA 5H3HA 2XLCA 2WFLA 4MEAA 1BROA 2OQIA 2XQJA 4EA6A 5HF6A 2WHPA 1Q0RA 1MT3A 1CUHA 4BC0A 2PBLA 4UBMA 4PQEA 1XZJA 2DHDA 3STUA 3A6ZA 4UBJA 3DS8A 4J0DA 1XRLA 3ZWQA 4H7HA 2OGTA 3IIIA 3V1LA 1VA5A 3G9UA 4QE3A 5ISMA 3GFFA 5AM0A 1XLVA 3EQ7A 4KE9A 3C6BA 1LZKA 2AJCA 3V48A 1DQYA 2B61A 2PSFA 1SC9A 4M0FA 3FBWA 4M0MA 1R1DA 1NX9A 2WIGA 3A2LA 5K3FA 3JW8A 4G8DA 3M82A 4X92A 1FFDA 2QMQA 1MN6A 1EB9A 2GYUA 4YASA 4Y2RA 2K2QB 2PSHA 4DSZA 1Q0ZA 3G0GA 3H18A 2AJDA 1EX9A 2XQFA 5E4JA 1GT6A 3E1GA 3QVMA 5AI0A 3ILSA 3WIBA 1WOMA 3CN9A 4KJXA 3A2NA 3WWOA 2JBWA 1DQZA 1PFQA 1RYYA 5K3EA 1JMKC 2JGIA 2PL5A 1R88A 2JEYA 3W9UA 2CEKA 2B4KA 2WIFA 4Q1VA 1UKAA 4YPVA 4L9AA 1CR6A 5A7FA 3RARA 1P0IA 1XRPA 1X70A 1QTIA 4ZRDA 2VEOA 2O2GA 3BIXA 4QDXA 3C5WP 3SC2A 2JGJA 5LP1A 4GWLA 3MUOA 3B3QA 3ESAA 2ZJ7A 2XUQA 2H1IA 5FKJA 2HA2A 2PU5A 2EEPA 3OPMA 1YAHA 4AO8A 2QS9A 4BAGA 3E3AA 2CKMA 1LPOA 4K5QA 3D4LA 4UBLA 4F0JA 4BZZA 5LZ7A 2XMBA 4UPDA 4LXHA 1QIFA 5CH5A 4X85A 3R3UA 5K3CA 2BGNA 4BDTA 5LZ9A 3C6ZA 1DT5A 2XMZA 2QM0A 4DNOA 1QO7A 3QYJA 4X93A 1HBJA 1MTZA 2WHRA 5ALDA 2B20A 4J3JA 3DL4A 4GHWA 3Q8WA 2WM2A 2VA9A 3WA7A 2WSLA 1QE3A 1W1IA 3H1BA 4AQDA 4X91A 2NW6A 2J3DA 4PF1A 4BP8A 3KWJA 2PM8A 5DTIA 4DMHA 2WG0A 1QO9A 1WB6A 4KRYA 5K5EA 1XZMA 5EGNA 4OSEA 3ESBA 4BYMA 4X6YA 3DEAA 1HPLA 1ZJ4A 4AO7A 1UFOA 1X2BA 1G66A 5EHNA 4G9GA 1JI3A 2D5LA 3VKFA 3ZLVA 1UK8A 3WYDA 3TJMA 4BTVA 4B0PA 2OCLA 3HABA 3AIOA 5K3AA 2J4CA 5DTJA 4ZI5A 4C6HA 3BL8A 4FLMA 4X71A 5CBKA 1BN6A 4H35A 3DYVA 2IX9A 1SFRA 1ZD5A 4W1RA 3WK4A 1QONA 2PUHA 1XZBA 1FFBA 2ZSIA 3WK9A 4Q3KA 2HA4A 5HQ3A 4UFPA 3H2IA 4WY5A
chains in the Genus database with same CATH superfamily
1D6MA 3V1MA 1JV2B 1K3FA 1O6GA 3M4XA 4QBHA 2Q45A 3UXMA 2ZIXB 2PRIA 1KO5A 3LECA 4KAAA 2PD6A 2P7IA 4MUXA 4PG4A 4ZI7F 1EM8A 3O74A 4DVGA 3I2IA 1MQ9A 4P7GA 2FLKA 2FB9A 1QF9A 3CUWA 1BDHA 1BCSA 3QVGA 2BEUA 3KFVA 1GPUA 5LLSA 3U31A 1NRXA 3V8PA 3DO5A 1YUNA 1G0NA 2LBPA 3WLTA 3TNLA 4D26A 3ITDA 1M0WA 1VG9B 2DAPA 3JQCA 3H3XA 1FXSA 3F8WA 4P1ZA 3LBAA 2E18A 3MWLA 5D84A 4YAIA 1K6MA 2XRMA 2FDRA 3I6YA 1H6CA 1EUCA 4S35A 4V0OA 2XCIA 1GP2A 2JDIA 4L7VA 1UP6A 4N49A 5T5QA 4EVSA 3LP8A 4D42A 1LH0A 1QG0A 2PR7A 1X77A 1KSHA 1IEXA 1U65A 3NIBA 4NU6A 1L1QA 1XIVA 3NVAA 3RRNA 4E15A 1T6BY 1PR2A 1IATA 4GWGA 4CMIB 5CTAA 4XAQA 1I10A 4ZAVA 2D3WA 2C5GA 3UIEA 3WQSB 1ZW1A 1TL7C 2BFPA 4CG2A 3M4YA 2CLOB 1UZAA 2Y4NA 3I12A 3MINA 4C7VA 2OB2A 2QQFA 3KM0A 5FORA 4KMRA 4BPBA 3V7WA 2I91A 3QRWA 5E2BA 1U0HC 2ZULA 3TMKA 4CBVA 4P0QB 1UM9A 3ECSA 4AZ0A 2FEWB 2R1TA 4ERNA 5CH8A 4I2NA 2EYUA 1QP0A 4M8LA 4RD0A 3Q7QA 4J1TA 1J0EA 1YDGA 4PZUA 2VUIB 1U8TA 5ALFA 1N1MA 4LRUA 5DBIA 2OCGA 1P6QA 2FGJA 5FOXA 5G0TA 5JARA 3P9QA 3K4QA 4Y2JA 1V11B 1GOTA 3AKEA 3PNYA 2C1XA 4JNCA 3FOAA 2WJAA 4BX9A 5TVGA 1JKJB 2W2VA 5L3SA 2AHOA 3DMHA 4WLFA 5AJWA 1TNDA 4NE2A 4P31A 5HCNA 5DN6A 5LSAA 3JALB 2UYYA 5CM8B 3UT6A 3VXKA 1AMUA 4AQYB 3DXFA 3FF1A 4AICA 2HV8A 1W7AA 5D3ZA 2QP4A 2IYYA 4NCHA 4F5ZA 2WWWA 1Z6TA 1Z68A 2GO1A 1U5BB 2RHTA 1TI7A 4GMXA 1UFVA 4GNKA 3GT3A 4C0WA 2QQEA 3JZFA 1GPJA 2O3JA 4K9KA 1YDFA 4B4VA 4QJBA 5KC9A 1B93A 5ILOA 1GRQA 1IBCA 1QR6A 3CZMA 4YWHA 1JU3A 1KP3A 2XEDA 3IAM6 3K9FC 1GNLA 1AKRA 2VZ8A 3UANA 2XUPA 3DOIA 5J9FA 2CBGA 1GJRA 1PG5A 1W5SA 2QENA 3GGSA 3VBCA 2GAAA 1RYMA 4CR8A 1XCGB 3LX8A 4JWKA 5JISA 2JFYA 3ESQA 3UUFA 4ZCSA 2MT9A 5B36A 1SOWA 2OAEA 1D9ZA 4QELA 5ALLA 3HFRA 4JNKA 4EUSA 4YMHA 4OJMX 1R6TA 2GAOA 2I65A 4OBXA 3ZGVA 3NHYA 2QP9X 3EMKA 1NBMA 3IEMA 4YMTA 5EIWA 3EZXA 3AI7A 2PKEA 2ROQA 5B7GA 5DT9A 3R8CA 5HK9A 4OX9Y 1N2XA 5TY0A 2I33A 3EWNA 4B3BA 4H1WA 3SKYA 5J23A 2Y1XA 2ZPAA 1XAGA 2RGCA 3WKAA 3O0TA 1P45A 4ZMRA 3TCXB 1JA0A 2HLDA 3AG6A 3GA0A 5AYVA 4D96A 4QYIA 4EKIA 4QLBA 3P97A 3IEPA 1QOZA 1E63A 3LUFA 1IULA 3N6VA 4DZRA 2BCGY 4GSYA 3T5TA 1FFGA 3ZCTA 2ZWOA 3QXJA 3R3JA 1T8RA 4UCQA 2H5JA 3G1TA 1ZN7A 3HSSA 3PQ6A 1X1EA 2Z09A 3PGVA 4MV1A 4MHSA 5E4TA 1YRQA 5L8VA 1KQFA 4G5RA 4K40A 2HXYA 3JQ8A 2CLIB 3IDZA 4HWRA 4MYRA 2YXNA 2P77A 3COYA 5FH9A 1KNQA 3TR5A 4MEJA 5L7TA 5KYKA 2FETA 4D9GA 2C4NA 3FLEA 4OGKA 1RFLA 5EP1A 3RASA 4NCBA 2NNLD 1SIBE 2HJVA 2A7QA 5M3BA 4BCCA 5BWNA 3UFXB 3ADCA 4LI3X 5GJVC 1XQWA 4WOCA 3R5SA 4NULA 3TUZC 1NW8A 1AZTA 5KYNA 4HX9A 3OPYB 2WVHA 4RKEA 4GO1A 1MO6A 5E1OA 3C3BA 3M34A 3EZLA 4JMPA 5COQA 4LAFA 3SEZA 3EXAA 3VPXA 1C1XA 2HZBA 4G4SP 2DUWA 2XZOA 3ZPXA 1JFVA 3D3WA 5KTOA 1IUNA 1EI9A 1XNGA 5BW4A 3BGIA 1PL7A 5GZ6A 1C7FA 3OZEA 2GPJA 4XYLA 4JJ4A 3ZS9A 4G07A 5DRTA 4Q66C 5H0IA 3VAZA 1EK0A 2H9AA 1CF2O 2B1RA 3L0ZA 4PQFA 5TQ2A 2FGKA 5AIAA 7MDHA 1FNNA 2J3JA 2BYTA 2VHUA 2A5JA 3ZTTA 1PGNA 2OGZA 5I7UA 1OIXA 3F90A 1Z29A 3GUHA 1NPTO 5ALUA 1E5VA 3GJTA 3R41A 2CUNA 2ZBRA 3P0FA 4IS3A 4OTZA 3F9CA 4K8OA 1FS5A 4IIFA 1E0KA 1S89A 1ZSNA 2JI9A 5F51A 1EP9A 4DR1B 3KSDO 1EFVB 3DZHA 4R40A 3T9DA 1TVCA 4FYXA 2L0XA 4OXYA 1UDWA 3KSUA 3Q3HA 5T6BA 4QPJC 4P84A 3SZUA 4B8WA 5AW4A 1BKYA 5DGTA 3W6UA 5DYNA 5TX7A 1L4GA 1FFXB 1HT1E 4LNUB 4M8KA 5B2ZA 3KZKA 3OMWA 4IIYA 3WWEA 1GPLA 1TLFA 4HMQA 4EITA 4ITRC 1K66A 3GJQA 1ZISA 5EP2A 5A02A 1IH8A 4UDNA 1QLHA 1L7AA 3EGWA 1WBDA 4C0XA 4MB2A 4EYQA 3N0TA 5AUOB 1MGOA 3U7EB 1NPYA 2VH2A 4OKNA 4AJNA 5EOVA 3ZNOA 2QY6A 1UT5A 3H1AA 2Q9UA 3O95A 3U7JA 4ROTA 4DIKA 1RYFA 4IHJB 5GIPE 1P2VA 3B6EA 1XTJA 3K94A 1EUDA 4TSFD 4FYHA 4W4TA 4U9UA 1DAMA 2Y99A 3N87A 4NMWA 1P31A 3G79A 1F4PA 1NA5A 3QELB 3NORA 5REQA 3W9SA 2Q5OA 5EE5B 2J5QA 2CCKA 3A2KA 1RMQA 1LJ8A 4E07A 2IVZA 2VJKA 3KQUA 4YVFA 3HWSA 4HVTA 4M1SA 5EZ6B 3T7IA 2GWRA 3M0EA 3H2ZA 4WFIA 4D8VA 1YL5A 3ZI0A 1J25A 3AUTA 5TGZA 1J9GA 5EIBC 1J20A 1D07A 2IYAA 5A4FS 4TQAA 3AP1A 4NJEB 4DQ0A 2X58A 3TLBA 2JZNA 3S1LA 1UAAA 1GTG1 1CUCA 2VNHA 2V0NA 1M1UA 2W6JD 4KH0A 2PVCA 4PNEA 2YJ5A 3FH0A 3IUJA 2JL1A 2DTDA 4MWZA 2ZROA 3TZEA 3SVLA 4GFDA 1EXVA 1H6DA 3OOHA 2QRUA 5IKEA 2CLCX 4ZC8A 3S44A 4EGAA 3DDCA 1J06A 3OWXA 4G63A 3LH5A 2ZB3A 5EPEA 3DOOA 2WPDA 2ZI6A 2BFEA 3L04A 3IT1A 3MQ4A 2OBLA 2QRVA 3QWBA 5C5CA 4MROA 2ACWA 1NJ5A 2FMHA 2YWFA 3AH8A 2XVYA 5A7GA 1ZC3A 1HEUA 3IDOA 4I7EA 3EXG1 2IU6A 1SCQA 4TZTA 5BN5B 1FF9A 4YQYA 2Z9DA 1T2UA 2AI3A 5KTMA 2Q6TA 3UH0A 4QGSA 1KZ1A 4LK3A 1XEWX 5CURA 2A1UA 3JQFC 1YVEI 5F5NA 1XMPA 2OQ2A 3H9QA 1MZPA 5KQLA 2TMKA 3MAGA 3EB9A 3E7PA 3LT0A 3DKRA 1SXQA 1GU7A 3MCTA 1VJRA 4B84A 4N9WA 5NLLA 1IUPA 4M2LA 1N78A 1PI3A 2OKCA 4LN1A 3I1JA 4K6FA 4Y1RA 5FTKA 3VBEA 1N6IA 2O2CA 1W4BA 4M9ZA 2O7VA 2BGIA 1EXNA 3SNHA 3TX2A 3IAS6 4R0VA 2H5LA 3NM6B 4UEKA 4Q4HA 3AWIA 1ADYA 1E1RD 3WYAA 3K6JA 4YT8A 1QU3A 1EBBA 3DEJA 4II2A 3QLUA 4OAOA 1ZD1A 3F5DA 2C2KA 2JIMA 5CCXA 1J49A 1PS8A 3SN6A 3COJA 2V9PA 4JR2A 4V03A 5ECYA 3L18A 3WGTA 3I01M 5FWAA 2QJTA 4TTJA 5BNTA 4LECA 4YV1A 3NKVA 4CQMB 2QL9A 3JYHA 1KXZA 3O3NB 2G1UA 4NYMQ 2Q9AA 2AQIA 4N3AA 4CMAA 4YUXA 5B12A 2Y68A 2RK3A 4JLUA 2RMKA 3WKDA 2QUKA 2YXPX 4AP5A 4OUKX 1UL1X 2VRNA 2Y1WA 3VX3A 1BKSB 4RKFA 1LLUA 1NXVA 3HO8A 4L73A 2GYWA 2WUGA 1TAHA 1W44A 2FR8C 4NOKA 4TUYB 4AM8A 1A7AA 2GF0A 2ORED 4N12A 5J4YA 1ID8A 3HCNA 4DLVA 1DFIA 1SZDA 3FCYA 3TCKA 1X94A 1P4JA 3QX9A 1BJRE 1OR8A 5E8RA 1QFJA 1TC1A 4ZHQF 5A9SB 2FN8A 4C7KA 4TL8A 4ER0A 2E21A 3LYAA 1EWVA 1ZWKA 3ENQA 2Y6VA 3ABSB 4R68A 4XUEA 1EWRA 4IRXA 5CT5A 3HRHA 2LVBA 1TF5A 3QBJA 5DLDA 3WGQA 1VHDA 5BT9A 4MYSA 4Y1EA 2JLYA 3KLBA 1FUIA 1X8JA 2R6GA 3SHVA 4NCAA 1SOVA 3B6ZA 1KNXA 4HTAA 4QIHA 1G3UA 1UKYA 4R05A 4GGMX 2XBUA 2HHLA 4OFWA 1Q6YA 1VLMA 4IIJB 4R1PA 1MO2A 2FJ0A 3EPJA 2ZBGA 4ER5A 2R1TB 2NU6B 1C0IA 4C3UA 1UEIA 1SIWA 1H4TA 4DLTA 1V96A 5BVHB 4US2R 3E2IA 3H87A 5ALZA 3FHTA 1VG0B 4DMFA 4KQFA 1NXTA 4NECA 2OCIA 3K1ZA 2A7XA 4W8HA 3ZCUA 4UM9B 3C74A 1KEUA 2PPVA 1KH1A 3KYCA 4EW6A 1SQGA 2X23A 3WJAA 4A0RA 3KFXA 2QRHA 1XKQA 2X4LA 3FDZB 2F7SA 4FDUA 4TZ6A 4MPRA 1BE1A 2GNPA 4JBXA 4MCAA 4Y2UA 5DI3A 5E95A 3ROZA 1IXRC 3NPAA 4ZI2A 4ZCLA 4EHBA 5KMGA 1IJFA 1VLQA 3O9VA 1YQUA 1NRWA 1RAFA 3FMGA 3I2GA 3PXAA 3WB9A 3JZMA 4ALJA 1I6KA 5KWIA 1NVTA 2PS9A 4LXQA 4IIGA 3GZNA 1W96A 4HK4A 3PZRA 5ANRB 1VECA 4L15A 1CFZA 1R4NB 3IP3A 4LKOA 1APBA 3ORRA 4Q82A 2ZJYA 3QEJA 2GD6A 5CDFE 5KVCA 3UJ7A 3O9MA 1TRKA 2PGDA 2BHSA 1W85A 4PC1A 4Y2YA 3Q88A 5T67A 3QF4A 4DUGA 4GLBA 3JRNA 1LEHA 1UBGA 4FQ7A 3PTLA 4MQMA 3HU2A 5DVZA 1P3DA 1QMPA 1ARZA 1QE0A 5UKDA 1RCTE 1I30A 2ZUUA 1J90A 2VBGA 3JQRA 1TO6A 2IWRA 3A9VA 2W6IA 4IMPA 1C0LA 3QW2A 4PG7A 3HDYA 1PJ2A 1QPBA 1WDMA 4P08A 4JLJA 4IL5A 3L4JA 1QZ3A 2JFVA 4RQTA 1RR6A 1SQFA 2ETVA 1OYVA 3G88A 3HJUA 5CLLA 4A92A 2P9GA 2PGNA 1NI3A 5EP4A 2YHUA 3JYOA 1TAGA 4OK5A 1ZJZA 3EASA 4F93B 3M4ZA 2EIXA 1IB6A 3PCTA 2CXUA 2OV2A 1AM4D 3AV3A 1RQXA 3Q0TA 4XWAA 3CRZA 3R3YA 4B3SB 3TFWA 1JKXA 5F2OA 3RPEA 2QJOA 4OMFG 3H0KA 3ZW8A 5EIXA 1DADA 1RSZA 4PXYA 1MORA 1P9NA 1YO6A 2RHDA 2BH9A 5D3MB 4C2AA 3IBSA 3QE4A 1ENZA 3NBUA 4PAWA 5CHYA 2PPLA 1XJ5A 5EJ6A 1XLUA 1UBHS 3TQQA 4F6RB 3ZH9B 1E1MA 4KB5A 5TDHA 3O93A 1I7QB 4BFSA 2GN1A 4BVKA 3DLAA 2VATA 4HPXB 1CRZA 2PMKA 1N9GB 2C8VA 2X6TA 3HWWA 4G01B 5IW8A 2Z4SA 3YASA 4GOMD 4EQ6A 3I0NA 2W8ZA 4JVNA 5EIAA 4KU4A 4DLWA 5FWNA 2ZXUA 1RZRD 3RKUA 3DW3X 3R3ZA 3M4JA 4S24A 2UDPA 4IIEA 2B36A 4EIWA 1GAWA 1R7RA 3C1TA 2ZSAA 3MRSA 3O8NA 4GI1A 4RD3A 5H02A 5AK3A 4I14A 3I34X 1Y3HA 3LRPA 2Q4DA 2X1MA 2Y2VA 1M72A 4NC9A 1GFIA 5E6SB 1NE2A 3AUFA 5JDCC 1Q1GA 3LYLA 2NACA 3BWMA 3EMBA 2R1VA 3HMQA 2IL1A 3JWPA 2BI7A 2SECE 4KQXA 4WDQA 4IV5A 5AI4A 4AK9A 3MMXA 4B6RA 1NVKA 3GELA 3GG9A 1U8UA 1G42A 1G6HA 2YXDA 3FCXA 3IAFA 4FOOA 1NOJA 5ERXA 3ZDEA 1E7YA 1XF1A 3MOSA 2MSDB 1KYXA 1P4GA 4N8EA 3QENA 2LCIA 4QPZA 4TN1A 1IUOA 3ZY4A 1FY2A 1M2WA 3OKAA 3LLMA 2AIRA 4ZIRB 4Z53A 4FTWA 2EGHA 1DC7A 1QM5A 2AV6A 3ETLA 3JQGB 1S3IA 2F8SA 2IZ5A 1VCNA 4MR8B 1NI4B 4OQEA 3AL2A 1EXMA 2HWYA 1W4LA 2PSDA 4IKOA 2EVWX 1U2PA 1PNVA 3PI7A 3R6TA 3HQ4O 1QB8A 2NOAA 5GTDA 3A7DA 1JQ3A 3ILXA 5ALOA 2A92A 1FP4B 2AD5A 2PH3A 3ONNA 1H4SA 3DD1A 3PE3A 2X3UA 4IVRA 4ZZ3A 1TE2A 2XW6A 1GCIA 9LDTA 1GVNB 4MS3B 3WB2A 5KOYA 2FMIA 1JE0A 1A2BA 3IPLA 4IM7A 3OJWA 1J1IA 2O3SA 1VL1A 3WYCA 2P35A 1E64A 4YPOA 5SY9A 4QGGA 4LRTB 5ALMA 5BSTA 2AI1A 3VMMA 5JNRA 4EJ6A 2EAUA 3THSA 1LQUA 4IX1A 2HI0A 3HKEB 4D6YA 4A0FA 2DMRA 1QPZA 1XD2A 2OORA 1Z4KA 2JI4A 4OY3A 4J94A 3K6RA 4KN6A 3U37A 2BT4A 2ZQZA 1YZ3A 1R66A 4ZA2A 4KXNA 3LK6A 3UPDA 5BSKA 1KEEB 1YU9A 1X39A 1JPNA 3M2PA 2AMYA 3MJFA 3MLEA 4ZT5A 3ADPA 3VPAA 4DBZA 3VNAA 2AYZA 4CKBA 1JEEA 1L5YA 2GOYA 5BNWA 5JRJA 3RGWS 2JLXA 3UPUA 1ULBA 1FXWA 2CZCA 3A9TA 4Z99A 2UZ1B 2LZ0A 3WRVA 5B4UA 3C98A 2AYYA 1XB2A 3G85A 3EGVA 4L75A 3KAKA 2I4OA 4WESB 1IBMB 1Q0UA 1OYOA 1UJBA 4W1SA 4KTTE 5FQOA 1RI2A 4PR3A 5EE0A 1M34A 4ZOLF 4HGNA 2RBKA 2FEMA 1E2JA 5LXTF 5IEBA 1O97C 3C70A 4XA8A 5A04A 1WR8A 4DCVA 2GXUA 4US1R 1ZNXA 3KYDA 4N5HX 4Z1OA 1UKBA 1Z2PX 1JLRA 5IAEA 4B4KA 2D0IA 3E61A 4R9NA 3UAGA 3W5BA 3T7EA 3FPCA 4HFRA 4C6TB 1AF7A 4R81A 4TLLB 1V5FA 1W85B 1XNHA 3EOZA 3CINA 2IHTA 4Y9SA 5EUBA 3D6UA 1F5SA 1YDHA 3DCIA 3EGIA 1NN1A 3KXDA 3ONFA 3QLUC 4QFDA 3VJLA 3Q11A 3VR6D 4F3NA 5GP1A 2H4YA 1X74A 4RFVA 5FJJA 1I5EA 3AFGA 5JROA 2G08A 2MYUA 1E32A 2J3QA 2WILA 1WXQA 2GARA 3SK0A 1HOXA 1PF7E 2NV0A 2R7MA 4J2HA 4I9HA 4RIHA 5EG5A 1EGAA 4IY1A 3ZQKA 5BP7A 3VVCA 1IK6A 4DWOA 1IQUA 3T1HB 3NBFA 2RIRA 4MJLA 5HK8A 4G5GA 1G8AA 4WXMA 4XPIA 4D8WA 1ZRNA 4A8JB 4OI1A 1UBNA 3DJFA 4WXYB 3N8KA 4IHJF 4KBYA 4YP5A 1RMTA 2OGWA 3DAPA 4QECA 4G5OA 1S01A 4JLWA 4RY0A 1FUYB 4B3DA 4R6WA 2CXTA 2GPBA 4UKDA 4ZI3A 4DB2A 1W46A 2NVUA 3KJQA 1DX6A 5E6UB 1CD5A 1YR3A 1BS1A 1TKCA 2PS1A 2Z0MA 3ICWA 4WZAE 1QKJA 4DW8A 4Z4HA 3KT8A 1AT1A 4Z9FA 2R8EA 3JASB 1OIVA 3PA8A 2R6CA 3SE7A 4FN4A 5LQSA 1N1GA 4WA7A 3H2YA 1R4ZA 4JJKA 3W9BA 1KE1A 1HFWA 2KM1A 4CFYA 1NOIA 3KETA 4NNOA 1F2TA 4J0IA 4FOPA 1HMPA 3K9HA 1E7RA 2HBRA 2P9FA 1E2QA 2GXAA 1NVMB 1NR7A 1T9KA 5KBYA 1NSFA 2D00A 1KSFX 5E8JA 3IESA 5EJAA 4AUMA 1GXSB 2ZWVA 2I29A 4BNYA 1OZHA 4X00A 2SKDA 1B7GO 3AEQB 4MS4A 1CDEA 2NYUA 2FSSA 2ZR9A 2BKUA 3SXPA 1AZLA 5KVAA 3F67A 4LF7B 4URUR 4FKBA 3B3AA 4RJTA 3N2YA 3NYQA 1DEOA 1NW5A 4KQ6A 4RK6A 4U3JB 5EZYB 3SG0A 2RB4A 1UBTS 3AX6A 3PGJA 3ITEA 5ERYA 1TQ8A 3HXLA 3UUEA 3TBHA 2H4WA 2RONA 2WSSD 3AP3A 4TL7A 4J8PA 4XTCS 1KSJA 2I66A 4UATA 4S0ZA 2CMHA 2C2ZA 5FDFA 3EA0A 2QU8A 5MN5A 3QVLA 1DC6A 2X9VA 4EO4A 1N1EA 4QAQA 1Z5NA 4EZIA 4EVIA 5IUJC 1OWMA 1A82A 1U3WA 1L4FA 3RS7A 1EE1A 3CUYA 1D1SA 2R8XA 1FYFA 4BE7B 2HJRA 2NTEA 2OMEA 3KR1A 1PJQA 1Q21A 3A3KA 4JUFA 1MBZA 1WIWA 5K9ZA 3M49A 4JT8A 1X87A 3PQ8A 1NLZA 1NLMA 2B8WA 1PFKA 1PYGA 2GZAA 2WTEA 4RUKA 2GZHA 3JTEA 4ASUD 4AJ2A 2Y92A 2VTEA 1YZQA 2A5FA 5JAZA 3E0XA 2HTEA 3HUFA 5D5HA 5H9WA 2CDAA 1VIYA 5EWJA 4EHAA 3L5KA 4KACA 2PUGA 2P75A 1FRQA 3ZJVA 1XTBA 3DV2A 1KDVA 4JQYA 3WHLA 2JGDB 1WW2A 3DE7X 1L6IA 5D5PA 3K92A 3ZZTA 4ZHQA 1EU1A 2WHYA 4MV0A 3FPFA 2R97A 1TUIA 3OCVA 4G24A 3U0VA 4BZPA 2Z5GA 4NG4A 3E5NA 2PT7A 4NZPA 2NXCA 4BRUA 4DV7B 2SHKA 1RZRA 1KR5A 3IA7A 3VPDA 4D9CA 3WNVA 1XCLA 1LPMA 2C78A 1DV2A 1U9ZA 1D4FA 1B8UA 4BATA 4WCDA 5IBRA 1M1ZA 4D3XA 3K70D 2QQ0A 3NKLA 4B45A 3FR8A 3KL2A 3CNBA 4O3FA 5IVKA 4MS1B 2UUCB 1PFWA 2GD0A 2H3HA 1XG5A 4JVLA 4ZOAA 2H29A 1AK9A 5IRCD 2X0DA 4E4YA 3KJHA 2BELA 4BUCA 2FH5B 1Q3HA 1XMJA 2FPUA 1AGPA 1QFXA 2XNSA 3HCPA 4GXTA 4HSGA 3GT0A 3JYPA 4RPJA 3UT5A 2P9BA 3LUBA 2OBXA 2AYXA 4HLQB 1PFGA 2EG5A 5EZQA 4EA7A 3ROGA 4PFQA 3H2SA 4QUIA 4DRXA 3FCCA 4JC0A 4WZAB 3FNHA 3IKLA 4YRDA 5KX5A 1HV8A 3QVTA 4A15A 2HADA 3AM5A 4J0JA 4R1UA 5TMDA 1T9DA 2MMGA 3AF1A 4JHLA 5AKKA 2B8TA 3WFIA 4DWJA 3ELDA 3L82B 4YPFA 1KK3A 1FTQA 2C1EA 4REMA 2CLKB 3TKYA 4IJKA 3P71T 2JI8A 4AMYA 4E5VA 4TTRA 2RFLA 2WTXA 2X3FA 3EPKA 4FHFA 1MP0A 4L3VA 3LP5A 2EOAA 1KI4A 4KK3A 1ZC4A 4JJ7A 1G7TA 3P94A 3OKCA 1Z7EA 2VRBA 4BO9A 2IBSA 3KC2A 4MO2A 2ID7A 2OOKA 4RELA 2DUMA 4GS5A 2R84A 1FRFS 1L2TA 2CZQA 2OPBA 4K88A 4IIHA 4PANA 4W1QA 5HGJA 4RZQA 3WGLA 3FIUA 1STOA 5KNCH 2YOHA 3C7DB 3U7QB 3TEJA 1GZHB 2H57A 1Z2DA 4NFYA 3WZMA 2VI5A 4MVCA 4DJEC 3UFBA 2BKEA 2GYVA 5CA1F 2AA3A 1ONNA 7YASA 2HCJB 4N3BA 1ACJA 4GGOA 3BTSA 1XA3A 4I3GA 2EBUA 3DNMA 2A0XA 2RI6A 3RKRA 2YVKA 4B9EA 3KSAC 2JAOA 3OD5A 2BJWA 4RX1A 3U9LA 3K6SB 1R8JA 1U31A 3G5AA 5ITZB 2X0FA 3LWNA 4IDOA 2DUNA 1XPUA 4Y2PA 2KLBA 4GNRA 1B0PA 1J4AA 1HE4A 2IHBA 4ZQCB 2VJCA 2B1IA 5BUZA 3PC7A 4PFJA 4UE6A 5LZ8A 1FLAA 1QR2A 2VDWB 3FOFC 4HV4A 5DNYB 1CQJB 4BNKA 4TN5A 1I4WA 3S40A 3HLTA 3OZGA 4V2IA 4C3VA 3DLBA 4RMHA 1OWLA 3TGLA 1W36B 1J2YA 3D7LA 3WK5A 2ADMA 3FRHA 3HU1A 3S99A 2O8FB 1WF6A 1SUPA 3B9PA 3QKUA 4AAYA 4DSAA 4MGKR 4JASB 3ADOA 3CKKA 3U81A 1XYYA 2ONCA 3LT4A 4BQPA 2J0UB 4DUZB 1DUSA 3H7IA 3B12A 4RLHA 4X63A 1ZLYA 2JCGA 2JLBA 1I1NA 2PZLA 1FFXA 1N0WA 1QZTA 1VBKA 2AFVA 1AKTA 3KEQA 4LNUA 4RZ2A 1MZVA 4TQUS 2YZ7A 4LF4B 1P0PA 3IEUA 1EK2A 5CXXA 3E18A 3N59A 5ICFA 1GAQA 1WD7A 1EFTA 4BNIA 3ER6A 3KOWA 4RVGA 5IJXA 3RC2A 3QFSA 1XD9A 1IBSA 4R1SA 3TXXA 4GI5A 1JHXA 1AO3A 1E7MA 3SIRA 4C08A 4CODB 1C1DA 4RPHA 2DBZA 4QG3A 3JVDA 2GPNA 3DOHA 1EG7A 3JARB 2ZBFA 3HADA 2MSNA 5ENDA 4I0WB 3AC0A 2QTMA 3KEOA 2FN7A 2VAXA 5FNVB 5IC4A 4LHZA 4A1FA 4DQUA 3EIEA 3BL5A 3G68A 5AHWA 1ADCA 1PLLA 2C4WA 1S96A 1K8QA 4C7OA 3A6DA 3QNWA 1FFHA 4K1LA 2ID9A 3F46A 4MWCA 2Q2QA 4DIUA 1OTYA 4KRXA 2R87A 4YAGA 3DJYA 2YKGA 1QCYA 1EFHA 3ZDBA 1YR8A 1RYNA 2GWHA 2XNKA 2KB0A 1KJQA 3NYRA 3RU2A 4XYGA 2HK8A 4FOSA 4BUZA 1I4OA 4OJYA 4Q4LA 4GDMA 5E3JA 3DWEX 1QUFA 1HQCA 2QJWA 3BQMB 3CEJA 9MHTA 3B82A 3DE5X 3GMTA 2VHEA 3JS5A 3K8QA 1GPKA 4Q4JB 1DG1G 3L79A 3DL7A 3KQSA 4YJ2B 3CZ9A 3PCXA 5KUTA 3K6SA 1WUJS 2X0JA 3T4PA 4FFNA 3TUIC 1URPA 3K53A 1FC0A 1KGDA 2KWIA 1RKQA 2IY7A 4ARSA 3PFGA 4XM1A 2X7XA 2OQVA 4Y2VA 4B3GA 1LBSA 1ZD3A 2Q7XA 4I9FA 4RPKA 3RRYA 2VQDA 2HQBA 5JS8A 5MFZA 3SXUB 4UCWA 3U09A 1OX5A 2W83A 3Q0EA 3TMYA 3OFJA 2YHSA 4E30A 2ON6A 4DWVA 4RMNA 3QBDA 5DSTA 4Z3KA 1D4ZA 1GPAA 1ZG3A 3ZY5A 4R2WA 1RQGA 2QQGA 3KWFA 5KNDH 4ABTA 3KD2A 3NM5A 3SX2A 4TV8A 5JYDA 4WERA 2I78A 4MMXB 2QT9A 4XRGA 3IJPA 1Q44A 3A70A 4BO2A 3CUSA 1ZNZA 3G5UA 1UOQA 1JDBC 2YC4C 3BWVA 1XQ9A 1ZOPA 3DPIA 4JU9A 1W5BA 2C2XA 2I4MA 1W36D 2QKYA 3AIKA 2JGEA 3UMRA 3E9YA 3HBJA 4FB5A 3T35A 1Q7RA 1THGA 3O8DA 4PGAA 3EF0A 4PGMA 4CLXA 1W88B 2Y9PB 4RS4A 2QF7A 1NYQA 4RCZA 1ZNWA 4MRVA 3OOEA 2Q3BA 4B4OA 1VE1A 3L7LA 3OLYA 1Y5IA 4OQDA 4Q7MB 4GVPA 4QJ4A 4C4TA 1AJEA 3QA3E 1LTKA 5GONF 4Q9IA 1XCBA 3H17A 3ESCA 2NTJA 1O5TA 4QEDA 4WECA 3SYTA 1XQYA 3ZE9A 4X62B 5ELLA 2B4YA 1G1AA 1O87A 2DBRA 5FLEX 4YO8A 1Q1NA 3JZDA 2N42A 3SC4A 3RUDA 1XRNA 4MIOA 4UE3S 3L1HA 3EIUA 2H1RA 1B74A 3ZE7A 1W0JD 3NCHA 1MW8X 2Q6OA 1C8KA 1XI2A 2EEZA 2Y0CA 4G8JA 4OQZA 5IABA 2WHXA 5BRNA 1YJQA 4R2KA 3PRKE 1N7GA 3LU1A 1OD6A 4OUDA 2M6LA 4G5XA 4BMVA 2FW9A 5HKLA 1JP7A 3RAJA 3EG5A 4GZMA 5I4IA 3AGPA 5CFMA 3DZIA 1VKJA 2EATA 4MKHA 3N8NA 3U49A 4KLCA 4CKEB 1CUFA 2CW5A 1KI1A 1RWXA 2HN9A 1PT7A 4U9HS 4YXWA 3RHFA 5G40A 4B7XA 4EL0A 3OJXA 1AO0A 2G5TA 1SZPA 3OA2A 1WETA 3A3OA 3STVA 1P5FA 2GRUA 1OLUA 1UKCA 2P2SA 3QQ5A 3TD2A 4FFOA 1G21E 4HDKA 4AZWA 4NYIQ 4XYMA 4DV0B 5IAOA 2HT1A 4BZXA 4YO7A 1UC8A 3AOEC 2G71A 3PPXA 3G2JA 3K9BA 2JEOA 3TW8B 3W8RA 2VG8A 2PKQP 3K5HA 4PTYA 3HGTA 3IVAA 3H86A 2I7CA 4J1NA 4N0QA 5EMJA 3LX4A 1E3JA 2G0NA 2JKZA 3ZHOA 1GL3A 1T4CB 5JCOC 3QMWA 4JJZA 3ZEAA 2JD0A 4ZJPA 1KAQA 3AY3A 1NE7A 3NC4A 3OU7A 3PHJA 4WCFC 5FULA 3TL6A 2O1EA 1E3WA 4WKBA 1AXGA 4R3WA 3AY0A 1XN4A 3S29A 1A4UA 3Q8LA 2WWYA 1O97D 2FFRA 4C06A 2GI4A 3I2FA 1TU4A 5JMTA 5CGQB 2IYSA 1X13A 1RHUA 3JVUA 2HFJA 2QPTA 2YJ4A 3A6HA 5BV0A 2EZUA 1IPEA 1TW3A 3DV9A 3L8MA 3EGXA 3QLTA 4PBTA 4WUTA 3RKSA 1W6RA 3QKSA 4RTNA 3QYPA 3OEWA 4J90A 4IZHA 2FAXA 4N7JA 2XZTA 4N48A 3NG1A 4MQEB 5IC6A 1NUUA 2F17A 1TGVA 1Q15A 2EWVA 2R79A 2H2AA 1S7CA 3RNOA 5JAQA 3CLSC 1Y9ZA 4DLLA 1EDZA 4M36A 4D3DA 2XB8A 4HEQA 5KQMA 3DQQA 3NZEA 5LJIA 2I4TA 1VKZA 5B3LA 2GAFA 3FFBA 1HYHA 1AS3A 4MVXA 1LTQA 521PA 3WRWA 1MIHA 1FYEA 2PD4A 2AOWA 2RGNA 3HNPA 4RJLA 4JB3A 1HT0A 3GLGA 5DYYA 4LWZA 5LZ2A 3R5HA 3R7NA 4P0PB 2CT8A 1W4AA 5I3ZA 1ORHA 4YJKA 1MH1A 1KEWA 1EAYA 4B47A 5JBQA 5KCMA 5TR9A 3QFTA 4XX1A 3LY8A 3G0CA 4L76A 5BSUA 3T52A 1KQ3A 4NNPA 3N1UA 2QE6A 3MIZA 3A31A 1Y6FA 3HVHA 1D6JA 4ZOCA 1X8LA 2OAP1 3OICA 2REQA 1EFUA 4KPYA 2CMDA 1MAWA 1V41E 2CB9A 2REOA 3T7JA 4AI6A 1ABBA 3HZHA 1GAJA 5EESA 1XTIA 4MPJA 4C4XA 2BH2A 5K3SA 1PX2A 5ALYA 1UDCA 1JEDA 1GQFA 3DOEA 3CCBA 3KNZA 2G17A 1X9GA 2PKYX 4EG8A 4XWWA 1X7HA 1NQWA 1Y0BA 2XMCA 4UVGA 2I2XB 1WUIS 3B36A 2BZ0A 3JVIA 2AXNA 3RJTA 1CEEA 2Q3FA 2A88A 3IKMB 2V7GA 1X6VA 3C5HA 5LYJA 2C83A 4MOWA 4ZANA 1TUEA 3SZRA 5FR1A 3ZHXA 3OMLA 1PSWA 1KPHA 2DFPA 1Q57A 2ZBPA 1KZ6A 3E2PA 3R74A 3UV7A 4DN6A 5KTNA 4XR9A 4UCFA 4ZFNA 3G13A 4DJDC 3QEMA 2VAPA 1JPVA 4WACA 2EF1A 5FPQA 1E2BA 2ADOA 4D8XA 2XNHA 1MJ5A 3KQOA 4IO1A 3KB6A 5A2GA 3CVUA 1UK9A 1QHYA 1CUWA 2LD4A 4HAVA 4UEJA 1UMDA 5KOJA 2XZDA 2I76A 2XJ4A 2IHKA 3CT6A 3GRAA 3NPMA 4G1EB 2EP5A 3O8QB 1J0BA 4HLUC 4YRQA 4E5DA 3BD8A 4CM8B 1C9EA 1DSSG 1ZSYA 2GN0A 3AUSA 1XR3A 4BNTA 4PYLA 1H0KA 4RTJA 1KKMA 5EKDA 2WD8A 2ZSKA 3AINA 1WEKA 3ZTYA 1YS2X 2CNDA 3CLSD 2QPLA 4LJKA 3G5MA 4NV0A 1GUYA 3MTDA 2PMFA 3QHQA 1QG4A 5ALKA 2ESRA 3R0IA 4ASUA 4R1TA 5FAKA 4Q1DA 2I9KA 2C92A 1JEJA 1R6BX 1HLGA 2A8YA 1LD3A 4LMBA 1RKVA 1NLUA 1MTOA 2CDBA 4KCGA 1XJCA 1IOVA 2ANCA 2VYNA 1CNMA 3HYCA 3UAZA 3SDBA 3MJVA 4ND6A 1LLFA 1HDOA 1OFUX 1WSDA 1RLTA 1K8YB 1UJ5A 4MV8A 3SHTA 2XDQA 5KI6A 2EGGA 5TRTA 4YUZA 2JARA 4C3ZA 4R4JA 2MSLA 1GSHA 3CX7A 4KI7A 5DYWA 5DW0A 3WB1A 3LP6A 5FP0A 3MWKA 4HQOA 1Z83A 1KO7A 3AY7A 2Z98A 4P92A 4TX1A 1IHPA 1QH8A 1SKYE 2BONA 4OLFA 3ADKA 3H4MA 5AW6A 2DLNA 5HOEA 5LIPA 4NWIA 3CLRC 1WDKA 5CIQA 2IOHA 3CX3A 4OYRA 1RAIA 3KXLA 3QEKA 1YSCA 2G40A 2XAAA 3R23A 2JRLA 2CYCA 4CKCB 1WXIA 4Q48A 2FOIA 3L07A 3MLAA 4OK3A 1FQWA 3P0HA 3VR4D 3PQDA 3EGDB 3WGZA 5JQWA 1D2GA 2JFNA 3DLPX 5HBRA 4HR7A 5CDGA 5M7EA 3A1UA 1FYDA 1M0TA 2H17A 2Y3IA 1WU8A 3P5SA 3OWOA 5BWCA 3I5UA 2I3AA 4HEA1 3SYRA 1H2EA 3IB6A 4D9JA 1RM5A 5ALWA 4KR3A 2XGMA 2R6JA 1Z0DA 1WHSB 1AKMA 3WWYA 1K3TA 1UT8A 3GZNB 4TV8F 8AT1A 5GJWC 3A1EA 1CP3A 4L5AA 2ZUVA 1UAYA 1JHOA 3P45A 3U4MA 2E5LB 1WPRA 2FA9A 3A10A 4MV9A 3M6MD 4NBNA 1MLDA 1UWKA 4H1TA 1RAAA 2P90A 4B3MB 2XUOA 1NC3A 4QT0A 2I6QA 2VXYA 3JQBC 4TLCA 1F51E 1LVUA 5AW3A 2W98A 3KQPA 1GRNA 4LRSB 5ALVA 4JT2A 5CG1A 1P6XA 3ZDAA 2AI2A 4I1SA 5DTEA 3UK1A 5EXPA 4FYIA 3A1CA 3MCZA 3MT0A 1X92A 2BAGA 1Y1TA 2WAAA 5HFJA 5KHAA 1I4LD 3QX8A 4RZHA 4PRZA 2GK6A 4LYGA 4UW9A 1L1RA 3Q85A 3IH5A 3HCDA 4KNWA 1U0RA 2XODA 2GM5A 1OJ7A 2XRZA 4PO3X 3UCEA 4HNRA 2YZMA 4M7OA 2Z9CA 2DHCA 1II0A 2TMYA 2Y2UA 1V37A 3L7JA 2UV8A 1CY6A 1ETHA 1N2CA 2QLTA 3THWB 5IT9A 3K0EA 2R1VB 3UAWA 5JNLA 1AH2A 4PZ9A 5ECGC 1V16B 2B37A 3ZKAA 2JANA 5BMVA 4KHPB 3GROA 4IPTA 2CYAA 1T1EA 2XKBA 3C6KA 2RB5A 3OEHA 4CL8A 1XELA 1RFGE 2XE7A 2B7BA 3FYHA 2ACKA 4C2UA 5JPCA 3NBQA 4J4TA 4K6GA 1ZPDA 3HS3A 3CLTD 1OBCA 2YQ5A 1G63A 1Z4PX 2F3UA 4IHQA 1ZRMA 5AK4A 3VC1A 4DCGA 1NHGA 5CDFA 3KK0A 4WKGA 1J9ZA 1XKTA 5J4KA 1ISFA 2OFWA 2G88A 4OHXA 1R0KA 3NNNA 4RMGA 2BMAA 2JGLA 4FW9A 2ZP1A 3D1LA 3L7AA 4L2IB 4WE3A 5KQSA 2QAGB 3PKJA 4E94A 3F49S 2BEJA 1OBVA 3ZIAA 1VJ1A 4E7PA 3MGKA 2HWXA 3L92A 5HF8A 3UY4A 5HRUA 4M8NE 4XPZA 5E2IA 3TX6A 2HQOA 1Y3DE 2JGNA 1NBHA 2GQ0A 2Q6KA 2ZYTX 3HEBA 3I5AA 1RAGA 3PUJA 4JVSB 4NP6A 4PY2A 4DLYA 2QUAA 3KJGA 3W6PA 4LGMA 2WUWE 4PCUA 3T5BA 4LJ5A 1RBQA 3UMYA 3MTIA 4G4IA 5KHOC 4DB4A 1P72A 3E8MA 1E77A 3A1VA 4YQFA 5MN4A 4TYNA 2ZYRA 1FNCA 1DC5A 2X8BA 1S8FA 4NMHA 1ZNQO 3NIDB 4JI0B 2IYEA 3GGCA 4YRRA 5F78A 5BR8B 4ZT4A 1F8FA 5AQ1A 4UVDA 2X5NA 4TROA 3CUKA 3CR8A 3KLPX 2OTCA 3BMQB 2GZRA 5C34B 5G02A 2OPHA 1HKUA 4NQZA 5C8VA 1XU9A 4XFKA 2V4ZA 3PXBA 5F2KA 4B82A 4JFAA 4UC0A 4IMRA 2QG4A 3H5IA 3VX4A 4ZYTA 4Z7NB 1IG0A 3ZN2A 1JILA 1TAUA 3EISA 3SIPA 3L4EA 2XMQA 2OUIA 2PGAA 2QTBA 4NJOA 2RAUA 3LXMA 5L95A 3QFCA 3L0YA 3VSCA 3GUCA 2AC2A 1YIDA 2XWSA 3AI1A 4NBVA 2BRUA 5K0NA 2FMTA 4OYYA 4DARA 4U9IS 2FVYA 1NAHA 1U7PA 1BXRA 2QUBA 1TMKA 3H8JA 2WU1A 4LGYA 3STWA 3V3KA 1M3SA 1AA6A 3VTZA 3GVPA 3PYMA 1SEVA 4UXHA 2DH5A 1M2FA 4BIMA 3GP8A 3PX7A 4PG5A 3CNLA 3D2CA 1I24A 2BHTA 1XVVA 4CL3A 1C29B 3BRWA 3A32A 1H8HD 4WBNB 1U2GA 5DXJA 4WVLA 4KV7A 4M3NA 3BMNA 5LQNA 3WBKA 2VJMB 2RKWA 4AD8A 4QRIA 1QP7A 1NPDA 4E33A 4BCDA 1WZ2A 2VK8A 1RW4A 1J00A 3PUWA 2NN3C 1X7DA 4HSEA 1HZJA 1RP1A 2FV8A 3LKZA 4OHPA 1QWSA 5DM1A 1WEHA 5JVDB 1JHPA 5GONB 3RVRA 4KVGA 3ANSA 2IIQA 1DL5A 3IUBA 4Z0PA 2UXDB 1NTOA 2A0UA 2QRGA 2IEZA 4YRJA 4BLWA 3JTMA 5B58T 4CKEA 1U8CB 1U0TA 1VI5A 4N6NA 4BRZA 4EQ6B 5KSOA 2FXVA 4JSYA 4ZRMA 3K9CA 4EUEA 1SQ5A 1CF4A 2BFNA 1E3IA 1H2WA 2DY0A 3S8YA 3E0QA 3DD5A 3N8HA 5THKA 5GM1A 3FTCA 1ZMBA 4P83A 4XJVA 4X5OA 1QH9A 4M0LA 4MGHA 1DJLA 3VYRB 1A3CA 2Q5LA 1DJQA 2D5IA 3M6WA 4P4SB 5IF9A 3KYBA 5JSQA 4DDTA 2VO1A 3KSBC 1YQGA 1RI4A 4FS8A 1UMBA 1EMDA 1MXHA 2H5EA 2M98A 4L5IA 1AKWA 3G2QA 2WFMA 4O1HA 4Z3DA 3TPZA 3WIOA 4ALIA 4B44A 1E8DA 3HM9A 3KQKA 1LBTA 1PEAA 4MW1A 2J85A 2ZAIA 3I6MA 3ND5A 3EEYA 1R9GA 3WLSA 2L17A 3UMCA 3B6JA 4YJGB 4DV6B 1ZCAA 3CF6R 1H6AA 2F3QA 3JQAD 4MWOA 4CLRA 5F35A 4G9BA 1P5RA 3C24A 3GCGA 4QICA 5EIOA 1DWQA 1ZOOA 1UQRA 4HZGA 4HWSA 2EZ8A 4C21A 2PKCA 1A1VA 3RWOA 4CEHB 2XA1A 4JH0A 5J47A 1MV8A 2XYRA 3QFFA 3GR6A 2O0LA 2V0CA 4IDFA 2P3LA 1Y8QB 2VT2A 3PE6A 3IEVA 1AQJA 3EDQA 2HHCA 4HLNA 3ZS8A 3ZTWA 4CCWA 1GKKA 4KXXA 1FLVA 3PGMA 1E96A 1MC1A 2O2DA 3AT1A 4TOIA 5EMNA 3C3KA 4YRCA 2J0SA 1RXWA 2TRSB 1FFSA 4YXWD 3VZQA 4IGEA 4M0CA 5C4IA 2EBFX 1NVFA 4QGBA 3KR2A 3DH0A 3TRDA 1OFGA 4PCVA 1RWVA 4HT3B 4M1ZA 3FJYA 2BIFA 4R9VA 2BGJA 3FKSA 1PJ3A 2UUOA 2DT8A 2W2TA 1EBUA 3AUKA 3KEGA 5LP6C 3VKUA 5K4GA 1MEOA 3H2HA 2ZOSA 3L43A 4QUHA 4OP2A 5D6NA 5CLGA 4AMUA 3UHJA 5IKXA 4C7XA 1QSGA 1WVMA 4M7PA 2FUEA 721PA 2OCBA 3WB0A 2IDMA 1W0JA 1VIDA 4M37A 4B81A 4BVAA 3VVLA 5DM70 2PRSA 1UJ6A 3B1VA 3L8GA 2E48A 2BFMA 3HDTA 2IPAB 4AO6A 4EELA 2H65A 5TARA 4N65A 4FHGA 4ZEWA 3PDCA 4U1RA 3F73A 5HHTA 4WH0A 1QQBA 1ZGAA 2O3TA 4N5IX 5EWMA 5CTJA 4GKJB 1PCXA 1QKKA 2FSPA 3DVAA 3B6MA 2WFAA 1X7XA 3OT4A 1TIBA 1YI0A 4B80A 1OLOA 5EIEA 3VUFA 2HU2A 1KVQA 1TZKA 3OQIA 1PWEA 5GV8A 4KREA 4LDQA 2VJAA 2C8KA 2PYIA 5HF9A 1N5OX 1P2FA 3G2NA 4RD2A 1MAVA 3D4BA 2O8EB 1DX9A 2FI1A 3D3QA 3MCAA 1QGOA 3AUXA 1ZICA 4OHKA 3HDVA 3TNFA 4MDEA 2OKGA 3T95A 5JJLA 4B3HA 4EG6A 5AXCA 2QTFA 2VDVE 5E6RA 3PPWA 1K5DA 4IG9A 3UKDA 2QVYX 1NSYA 4LKRA 4WLUA 5A3JA 1RWWA 3GEPA 1RJGA 2GERA 2YN2A 1YU6A 4FYJA 2CV0A 2DFDA 1O8BA 3OTIA 1SUWA 3IBFA 3PC4A 3VR6A 5IX8A 1FIUA 4CEHA 1BRTA 1X1DA 3GLFA 1K5PA 2EC5A 3LL4A 3SC6A 3THXB 1HE5A 1HLDA 4KE7A 5JQGA 1JR6A 1ADJA 3GRFA 2ZAGA 1Z08A 4Z8YA 4CFZA 2BSQA 1DC8A 3ZGXA 3LNCA 2AUNA 2VPZA 1ZZGA 1LPPA 2VDPB 3D43A 4UULA 4DAEA 4CV0A 1QHFA 1E98A 1ZI6A 2WG1A 3ICEA 4BQFA 3GWZA 4DQVA 3DE6X 3F96A 4AW9A 5FBWB 1ZAYA 4TUYF 3CUEF 3M6LA 3OF2A 4NBLA 4E1BA 2ZUBA 2OHFA 4E4TA 4IUDS 1OFUA 5D2CA 4CQMD 5CIWA 3VQTA 3WO0A 3GT7A 1TYEB 4FQ5A 4WWHA 5JEEA 8OHMA 2ENUA 5FUXA 4YUVA 5J2TA 2P7HA 5C5EA 3O4GA 2OR3A 3RRJA 3DBLB 2IXFA 2C20A 3CN7A 3FUXA 3LDHA 4LJ6A 4P82A 1YZTA 4HN4B 2WVAA 5JSFA 3IAUA 4OB7A 1T34A 4JOQA 2FP4B 1XL0A 3GB9A 1SHJA 3OM8A 5CNJA 4G86A 4QO7A 4QDUA 3KO8A 1NVBA 3M1IA 2FDCA 1B73A 1UIRA 2WC1A 3P4UA 3D8HA 3RS8A 3EHEA 3LX5A 4IDPA 2AOXA 5H1YA 1BE6A 5LZ5A 5AW5A 3L7CA 3SC2B 1PR3A 2XR1A 2V03A 3IJRA 2KHZA 2BP7B 4U63A 1EGQA 1Y3CE 3TOVA 5THXA 3CT4A 1PQWA 1SEPA 1AN9A 2CNWA 1NV9A 3MT7A 4HJXA 3EG9A 1J2JA 4IIVA 1L5WA 4JOSA 4NCXA 4PINA 2O8EA 1XT6A 3WIVA 5D86A 3UJPA 1SKBA 3BB1A 4JLSA 3DFZA 1E3EA 4X44A 2FKNA 4HDOB 2PQ0A 3N5KA 2CXOA 1NUAA 3GNSA 2DBQA 2G1JA 2HKIA 4I19A 4RADA 4ZN6A 4CCYA 4D0SA 4D25A 4YGXB 2W4QA 2G9VA 3WNDA 2NZXA 1VL8A 1FTSA 1U3GA 4FGSA 3OIUA 1BDJA 3WADA 4YDQA 5JZSA 2FJUA 2PZEA 5FHRA 1ESZA 1NVVR 1UMKA 4FC6A 4PPGA 1YH3A 1JSXA 2Y1OA 3GEEA 3LC2O 1AG9A 3LGXA 2A58A 3FCAA 4X41A 5FYDA 4Z4FA 4JENA 1CEYA 5IM4F 4ZYWA 2O54A 1UADA 2R6HA 1KEVA 2PMBA 2NU8A 4X1OA 3W4KA 3H0EA 3HJFA 1CRPA 1FL9A 1M7BA 2ICAA 4KDRA 5CM9C 3UJ8A 1P0QA 1G1MA 1MQSA 4MWEA 4QBKA 4M9UA 3ZHYA 3I52A 5F7JA 1CYEA 3A1DA 1R5BA 1VL5A 4O2BA 4XM2A 4INPA 1E5QA 1N0VC 2WF5A 4ZVLA 5J63A 4J3NA 3R7FA 3IR5A 2ZK7A 3ZBQA 1AHNA 5CDHA 4BJ5A 1M76A 3E9QA 1AUVA 2IQ5A 2JGKA 4OGWA 3TIGA 3U44B 2ZB4A 3MNFA 4WK2B 2D5AA 4QOEA 3OIYA 3PLNA 4MVJH 1N3BA 3DE3X 2DECA 3H99A 3OCCA 3W2IA 1I2MA 1EK5A 1KYTA 5JJ5A 2DPXA 1CJVC 4R8KA 2V3WA 3UHOA 1FJGB 1R0XA 2CL7X 1LDMA 1S9HA 4FEEA 3VO8A 1E2UA 5LQMA 2ZIEA 4OU4A 3NTOA 3P9XA 4Z0NA 4DV1B 1VE6A 2ZU6A 3TMAA 4UHFA 4MJ3A 1A5AB 1Q83A 4IO0A 1MU0A 4GBMA 1UMCA 3DBVO 4MXDA 3PJFA 4WZBE 1V9CA 1QK4A 5G0WA 2WTNA 3AU9A 3ZHCA 4KBFA 2QE7A 4ITVA 4P3YA 3SE0A 5JAUA 1NVXQ 5JDCA 1QIDA 1T8PA 2HJWA 1FTYA 4FLEA 4U2CA 4WT7A 3V9PA 4EQZA 2NTNA 2OLEA 2WAOA 2PIAA 2P79A 1T4DA 5FI3A 1EZZA 4FE4A 2QDKA 4JT9A 2H4HA 3OBBA 3K0AA 3VR4A 2IYPA 1N5IA 3ZW7A 4A23A 4RM2A 4FMCF 1KAGA 1EEHA 2H7XA 4R2LA 3IUPA 4LOKA 3AFNA 4G25A 4JYCA 4TWBA 3RUPA 1JJBA 3WJ7A 2QUIA 5FYQA 2OILA 3I3OA 4PRLA 1XDSA 4LJAA 4CCSA 2FR1A 1L5QA 2QRZA 1O9BA 3WK6A 4H4EA 4TRRA 3GUYA 2EW1A 1QGAA 2PXHA 3BWYA 2F1HA 1IY1A 5EJ7A 4DJFC 5KX5B 2C2MA 4PHHA 1NBMD 4K28A 1WKBA 4REQB 4BNLA 3WGNA 1Y4SA 1I7LA 3D2BA 4HNTA 2AZDA 4I1PA 4TTIA 2NU8B 1RRMA 3AUAA 4C1BA 2GBLC 3EDCA 1M7HA 3NLLA 1NXWA 4QL3A 2ZFUA 3H8SA 4WLVA 1UBFA 3HNOA 2XWPA 4OA5A 4RJIA 3I9OA 3PGA1 4BMOB 3O83A 4EKDA 2ZTMA 1Y3AA 5F5XA 2WJIA 3EWSA 1J0AA 1G21A 4EUFA 5G1OA 3QKSB 4D9HA 3ZU3A 2CFIA 2V54A 1ZXBA 3D7KA 4TYYA 3A26A 1NBEA 1XBTA 4A2CA 3OLZA 2OUKA 5TMBA 1L5OA 3DFMA 4HCJA 5CX1A 4OSOA 3EIOA 5ARCA 3EGOA 4C4ZA 4EG4A 4FZ3A 1TTTA 3T7DA 5JNWA 1DBVO 3ER9A 2DHQA 4G5SA 2W58A 1MFZA 4IMIB 3IBGA 4J2TA 4Y9TA 3LC0A 4GRDA 3TF5A 4C6SA 4F9EA 2PFSA 2E82A 5EPUA 1XWFA 2V7VA 2QTZA 2YVQA 2IS1A 1CV2A 4Q9JA 2PV7A 1I9GA 2ILVA 4LTDA 3CH7A 4ZDKA 1U94A 4D8YA 3QBVA 1US8A 2JH9A 1B1CA 2CCJA 4MKRA 4OUDB 4UTZA 1OROA 3INTA 2XUAA 4IINA 4NBSA 4TWZA 1UODA 1RPJA 3I01A 4NPCA 1L4LA 4ZU1X 1BGVA 4YI5A 4OLJA 2XLCA 1SXHA 1MABA 1F0YA 2PZKA 2WFLA 3MXOA 1M6YA 1BROA 1SULA 3VU1A 3Q98A 5I51A 5A6SB 3GC6A 3KTAA 5HF6A 1TCUA 2QTRA 3BD9A 3C7CB 3OY2A 2QR3A 4R2HA 2XZPA 1Q0RA 2ZIZA 2O1XA 4RSMA 4ZVUA 5LN1A 1YCGA 1ANKA 2W0SA 5L3VA 5EQFA 4E5MA 1X7WB 4D41A 5KYGA 2AOTB 4MW2A 5BORA 2FX2A 5E9WA 1W49A 1UQTA 4H60A 4A0GA 1T0PA 2DHDA 4WBNF 2E1PA 5FI5A 2HF9A 3MRTA 4XDZA 3QSGA 1DNPA 1N8NA 4X3PA 5LYJB 4BWFB 1ZR4A 4HBZA 4H7HA 3NASA 2OXRA 3T7KA 3H5VA 1G2OA 1TUBA 1GITA 1XD8A 3AB8A 1ZOSA 3AR4A 3M6FA 3PRYA 3PK0A 3R5FA 3V1LA 1EFCA 1VA5A 4L08A 4QE3A 1E2FA 4QJIA 4TTVA 4AF7A 5IJ0B 1F8YA 16PKA 2CHGA 5AM0A 5HKKD 1JQJC 1YQTA 2I5PO 3EQ7A 4V0QA 2CBXA 4XGIA 5DK4A 4DNXA 2ZT8A 3AYZB 2HSEA 4B79A 4EJFA 2POCA 2VC2B 3MOIA 4TMYA 2R3SA 3SEFA 5DCLA 4DMLA 1NF2A 4PX3A 4W8GA 5F7ZA 4YI3A 3OPQA 4RSRA 2XCUA 3EGXB 4IDEA 1OB5A 2ZWMA 1UZUA 3NP9A 3DE1X 2CWDA 5JBIA 1XLTA 2GCOB 1SC9A 4OAPA 4Q39A 3W3ZB 3PNKA 3FBWA 4QXPA 4K6OA 3ZDCA 2NX2A 4M0MA 2XDAA 3N0WA 2WIGA 3ORYA 3PC2A 4YJ2A 3T15A 1OLXA 1USKA 5G2OA 3JW8A 3RT7A 4BEWA 5BSWA 3M82A 1L7PA 1PJSA 4X92A 1UBKS 2ISCA 5C1PA 2OD9A 4AKIA 4F11A 2IEGA 2WYVA 1Y9JA 1FFDA 3G6WA 2DFKB 1J97A 4TTQA 3R9WA 3TTYA 1H6BA 5F21A 4F91B 5F2NA 3FHJA 5ELMA 1MN6A 4Z9YA 1ISHA 3HU3A 4YAWA 3PX3A 4BX2A 4PX5A 3TLZA 2X8LA 2NAFA 4H2DA 5FPSA 1XPRA 1EB9A 5ADHA 4F4FA 4YMLA 3VTFA 3WNQA 2GYUA 4LK2A 4YAFA 1NVWQ 1VHTA 4NLLA 1GNSA 2PSHA 4RF3A 2C99A 1LI4A 2A14A 4QJ3A 1XCPA 2EFDB 8GPBA 1SOUA 4L02A 2F8LA 3HB5X 4C0LA 5IYZF 2J67A 1LF0A 2ODQA 4U7GA 4RZIA 5CFQA 4K9QA 1HYBA 5JFOA 3QUTA 1IRIA 2OC4A 2OXCA 3E1GA 2AEFA 4YN3A 2WZBA 4PM4A 1LA2A 2ZRIA 2IDJA 3OAAA 4RWZA 4CZ2A 5TF4A 3ILSA 2OESA 4Q02A 3ZWPA 4DVJA 1HYGA 2ASEA 4L5YA 3CN9A 3GRPA 1NP6A 2GYYA 5CA0F 2PL9A 4OLBA 2E85A 3AVWA 2H4XA 4M4SA 3LF2A 2JBWA 2DF8A 4NCIA 1PSZA 1XKXA 4P98A 1RYYA 2IEYA 5DW3A 3FDZA 1JMKC 4MITA 1VMIA 2JGIA 3BORA 1JECA 3IPCA 3WLMA 1GLNA 3W9UA 3QNMA 2P2ZA 3JCZA 2RGNC 1AKUA 2Y0PA 5AJVB 3PEEA 1PJCA 5DN9A 3N3BC 4N0MA 3HKEA 4AJ9A 4LOJA 2DH6A 3AVQA 3LKVA 4XARA 1FK8A 1KY5A 1G19A 4L9AA 4ETNA 2W6PA 3QYFA 5EKXA 2GEFA 1K4MA 1QV9A 3IPYA 4CF4A 1FP7A 2X2PA 4AZTA 4ILKA 4ZRDA 3OE7D 3S7ZA 1RWNA 1XGKA 2O2GA 2NUPA 3HB1A 1HTBA 2LP4Y 3BIXA 4D6XA 4L8LA 3C5WP 5HJ7A 3SC2A 1SJ9A 1K88A 3OWHA 2DY1A 3AONB 3BX1A 3I05A 3IXLA 5LP1A 1JHQA 3V97A 3MUOA 3A9RA 3B3QA 5D01A 4PO9A 3T0FA 2QVXX 2HQ1A 1LXCA 1ZVKA 2ZJ7A 3OKPA 1M54A 3RAEC 1E2NA 5J58A 4H27A 1FX1A 1UH5A 2JBAA 3OMXA 4KFUA 3ENZA 4HAUA 3BGOS 4QBFA 4CTKA 3NV9A 1OY1A 3X2EA 4AMGA 2VSFA 4KITB 1JJ7A 4J9VA 3UB3A 4PIVA 4ZCIA 3HXMA 3OPMA 1YAHA 2EZ4A 3H97A 2NZWA 1QRDA 3AKDA 4NESA 4W7IA 4WCFA 2EKPA 4FBGA 1VCMA 4EZEA 3KT3A 1DWUA 3T3GA 2R6FA 5K3OA 1RXEA 1GFWA 2H1WA 4KWCA 4Q3NA 4K5QA 3NHMA 4UBLA 2OHIA 4GX1A 2ZUDA 1K5HA 1LC3A 1U2RA 1JTVA 4RD4A 4TXMA 3RBXA 4BZZA 3RYCA 2HXGA 2VJYA 3Q5GA 4RS3A 4C0JA 1ATIA 3RIHA 2PG3A 4Y9RA 2V3VA 4LXHA 4Z0TA 5K8UA 1OXSC 5J2TF 1T36B 1T5SA 3T3PB 3Q72A 4EHNA 4LZNA 2GT1A 1E58A 4R9UC 2BGNA 2GBLA 2WV7A 2ZGVA 2C96A 1H8EA 2R4UA 1N2ZA 3DBRB 4H6VA 2P6MA 3FZGA 5DFAA 2WSMA 4GP6A 4BJ3A 3OZDA 3ONVA 2INGX 3TOZA 3ZG6A 2OO5C 3UOWA 5IHPA 2WTUA 3PG5A 5GVRA 4X93A 1WPGA 2EBWA 1MTZA 4W99A 2WWIA 2YS6A 3TQIA 2CHVA 1KOLA 4LDZA 4MMYB 3ELWA 3RAGA 3TLAA 2Z95A 3DZGA 1MOSA 1QE3A 3FSEA 1XXLA 2OWDA 4RNDB 3VO1A 2H48A 1ODKA 3DOJA 2PKRA 5ED0A 2NW6A 2C5EA 3GLVA 5FA6A 4BMSA 4BU0A 2OZVA 4UJ5A 2VHZA 3ZZ0A 2ZT7A 3QX7A 4IWNA 2I1LA 1R12A 2CLDX 4ESVA 2BGUA 1W5AA 4CN9A 2XDQB 5HBGA 4B48A 1MO3A 3G3EA 4DDWA 3CISA 2VZ0A 4KRYA 5LNK1 3QPVA 4FGUA 3ZQ6A 3SEQA 4BYMA 3UT5B 1CR1A 4C0QC 2OLKA 4MR7A 4X6YA 1ZVQA 3NEAA 2FZVA 1YR6A 2IGBA 2FHSA 4D9EA 2F4VB 3RH0A 4ZVNA 3JQGA 2FQYA 1E99A 2EKLA 2GCGA 2IODA 3DSRA 1MKYA 4EM6A 2BFCA 3L6EA 4G9GA 3B7WA 2ZR8A 1JI3A 2A9JA 3TFOA 3TIFA 1WU7A 4DBVO 3ADDA 4WCFB 3KZVA 1A7KA 4GYYA 4Z7OB 1BFKA 4AL4A 3JYNA 4OG2A 3ZCXA 2VPXA 1ID1A 2BMJA 1AD2A 3CZ4A 3HP1A 4GOLD 2AFHB 4L4RA 4XI9A 1SCBA 3AM1A 3JPWA 4MB0A 3TJMA 2EW8A 1PUJA 4KGXA