4ETWA

Structure of the enzyme-acp substrate gatekeeper complex required for biotin synthesis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
255
Chain Sequence
NIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLGWALGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFISHPAEFCHLLVALKQRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pimelyl-[acyl-carrier protein] methyl ester esterase
publication title Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis.
pubmed doi rcsb
source organism Shigella flexneri
total genus 91
structure length 255
sequence length 255
chains with identical sequence C
ec nomenclature ec 3.1.1.85: Pimeloyl-[acyl-carrier protein] methyl ester esterase.
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4etwA00
3D3NA 5K3DA 1SFRA 2EEPA 1S8OA 4UFNA 5EGNA 1TK3A 3IB3A 3DKRA 3WL8A 5ALUA 1AMNA 2O2IA 2O7RA 3SC2A 1ZGCA 2V96A 4KACA 3QPCA 3U0VA 3L1HA 1PFQA 3AIOA 4ITVA 4B84A 4QWMA 2VT7A 2PUHA 3QYJA 1WCYA 3MUOA 4M0MA 3MGAA 2QUAA 5AP9A 2HA5A 1GKLA 4DIUA 4UHEA 5CW2A 3BIWA 4ARBA 5K5EA 4AB1A 2XDWA 2ZYHA 2W6CX 4A23A 4KYVA 1E89A 4FDMA 4AN0A 4KAJA 3WWPA 1XZDA 5LZ2A 4GI1A 3VJKA 3IVMA 2Y6VA 1CRLA 5HFAA 4WFIA 4IQ4A 5AKHA 2JGEA 3C45A 4FTWA 3WK4A 1XZMA 4OUKX 4X3CA 1VXRA 3C43A 2G4LA 5IVIA 2QJWA 5E4TA 2QUBA 3G02A 1K4YA 2I3DA 4DMCA 1TCBA 4ZREA 5AKIA 1FJ2A 3AFIA 3D59A 4UBLA 2YASA 2HIHA 1XROA 4IH1A 4EZIA 4X91A 4AMZA 2JIDA 5IVHA 1FFEA 2QTBA 2H7CA 4EA6A 1B41A 2PVSA 1LZLA 4DLNA 2GBGA 3T52A 3DL4A 2OGSA 4E11A 1OCEA 1UKBA 3O0DA 1LPSA 4DMKA 1Z68A 3C5WP 5AKXA 1CPYA 3WKEA 2J3DA 2VATA 3FLEA 1GPKA 4B6GA 1XRPA 3N0TA 3H2JA 4WY8A 4BB0A 3RKSA 3HI4A 3GZJA 4LHEA 1GZ7A 2XMGA 1MX5A 4F0JA 3FBWA 3WJ1A 1ODTC 5DTJA 3LS2A 3FLBA 2PSDA 3DNMA 3WI7A 1UK8A 4KE9A 2YYSA 4K2AA 4X7BA 3IUJA 5HF6A 2JGJA 4Y2QA 4J0IA 4P93A 2HA3A 2QJRA 2Y6UA 4H7KA 2JGLA 5LKAA 5JALA 4N5IX 5LZ9A 4MQLA 5ESRA 1EHYA 3I1YA 1MX9A 2W22A 4ETWA 1WPXA 1BE0A 3RLIA 4BP9A 3W04A 3DS8A 3M81A 3FVTA 3NGMA 3BF7A 2XMQA 1QONA 1CUXA 4QEKA 2C5FA 3WZLA 5LIPA 2HA7A 1FFDA 1EX9A 1H2WA 2RIPA 4G1FA 4KEAA 5K3BA 4ROTA 4BTLA 4G4GA 4CCWA 1EK2A 3M3DA 2XMRA 2RGUA 3S2ZA 2OCLA 1XZAA 5DWDA 5HCUA 5DLPA 1ZI6A 4G4JA 4CG2A 1JT2A 1E66A 3NOXA 1AQLA 4HAIA 2B61A 1QOZA 1WB5A 3VVLA 5BWBA 3K2IA 3WYNA 4PW0A 5JD5A 1HPLA 2XB6A 1JKMA 3NWOA 1ZJ4A 4L0CA 2VA9A 3MUNA 4Q82A 3WJ2A 4FMPA 4UBMA 3DOHA 5IVDA 4CI9A 5ALPA 1CQZA 5JASA 5AJHA 3HYSA 2WUEA 5AOAA 5EFZA 4CCYA 1LPNA 1CUCA 5KBYA 1ZOIA 3O4GA 2XUHA 3ESCA 4AO6A 2PKYX 2G63A 2CBGA 1XLUA 1QE3A 2Z3WA 2PM8A 3KWFA 4IHAA 4W63A 2J4FA 1L7QA 1CUZA 3RM3A 4B9EA 4Y2JA 4INZA 4Q3LA 3F67A 1DU4A 1SCQA 1LPOA 2RHWA 1CUJA 1R9NA 4LIPD 2OCGA 4J0DA 5AI8A 4AZ0A 3CCCA 4X94A 3WWOA 2XUJA 3L1IA 5CRIA 1XZIA 4OYLA 4F5ZA 5AKJA 4FWBA 3WK9A 5AKLA 2XMZA 1LNSA 2VF2A 1QZ3A 1CFJA 4U2DA 4N8DA 1XZKA 1TQHA 5K3FA 4MWSA 2WFMA 1I6WA 5DYTA 4FKBA 2WFLA 4BATA 5AM1A 5ALGA 3QH4A 4UBKA 4BP8A 2AXEA 2RONA 3X3HA 2PSHA 2BFNA 2XUPA 3CCBA 2IX9A 1N8SA 5D6OA 3DJYA 5AKKA 1ZD2P 2QKYA 4U2GA 1FFBA 4OB8A 4OSEA 1ZD4A 2RHTA 4AXBA 1K6EA 4XWGA 1R88A 2CZQA 1THTA 3QZUA 3V48A 3FSGA 3KXPA 3WIOA 3V1MA 1UOOA 5CURA 4J0KA 5EHQA 4C4XA 3DEAA 4X00A 3I2HA 1LPMA 3QBJA 5SYNA 4P08A 1BEZA 2VT6A 1B6GA 2BUBA 4WDRA 5AK6A 4C01A 5I9IA 3R3XA 4C87A 3A2NA 2Z3ZA 4LXGA 1WM1A 1E8MA 4GLBA 3N2ZB 1EA5A 2XMDA 1G4HA 5FDFA 1A8QA 3ED1A 6YASA 5ALZA 4KJXA 4QA9A 5AIAA 1EVQA 3R0VA 4LXHA 5AI0A 3D4LA 3FLAA 1RWQA 2WLSA 5JAUA 3G9ZA 2BCEA 1TCCA 3VXKA 1A8UA 4RE6A 4C4YA 4FFVA 1UOQA 2C58A 1HLGA 3FYUC 3FVRA 1JMYA 1N5MA 4GECA 5FLKA 1QTIA 3EQ8A 1EVEA 2HRQA 2J3QA 5C81A 1XZHA 1CUEA 1BCSA 3TGLA 1LBTA 1LGYA 3IUMA 1CIJA 1PV1A 4HZGA 4ZV7A 1Y7IA 2ACKA 2UZ0A 4BVLA 1Q0ZA 5HF5A 1UK6A 4X97A 5T4BA 4K5QA 3ESDA 5ALTA 3S8YA 1CUHA 3PI6A 3Q8WA 3G0BA 1MAAA 1AKNA 2VJBA 5AK4A 4EY6A 3U1TA 4G8BA 1UK9A 4YASA 2GYWA 3H0CA 2FUKA 4KE8A 2Y2VA 2OQIA 4UUQA 5D3ZA 2HA6A 3AILA 4I3FA 5E4JA 4EY7A 5E2IA 3UUFA 4UPDA 3A70A 3IUNA 5YASA 2OPHA 5CT9A 4Q34A 4LKOA 2HM7A 1DT3A 3B3QA 1CUWA 4EHBA 1YCDA 3O4HA 1XZLA 4DGQA 1XLWA 4BVKA 2I3ZA 2PX6A 3BJRA 1ZICA 5AI5A 4ZRDA 2QVBA 2ZJFA 2WTMA 1BN7A 1BN6A 4O08A 4WY5A 2PPLA 4Y2PA 4AMYA 1GPNA 4IH9A 5J3JA 2V98A 3W9UA 2BJHA 2GYUA 1L7RA 2DHCA 2DSNA 1X2BA 2XMBA 2CUTA 5BV7A 1H2ZA 3A2MA 4B0OA 3R3WA 3WZMA 4J03A 4U2BA 2IIVA 4BDTA 2JGMA 2G5TA 4J0CA 4QNNA 4UHFA 1DT5A 4FOLA 4EB0A 4JEIA 1MTZA 2XI4A 4KE7A 2HDWA 1TAHA 3BDVA 5A2GA 2CKMA 3I2JA 2OCKA 1FFAA 4M0FA 4MQMA 2O2HA 1ISPA 1SCKA 2JGKA 5FP0A 4IO0A 3ICWA 3MVEA 3BIXA 1UKAA 3ZLUA 4FLFA 3JW8A 5HK9A 2WSLA 1MPXA 3AINA 1TCAA 2OXEA 1NU8A 1WOMA 3AUKA 3FYTA 4B9AA 5K3EA 3OG9A 2DR0A 3HLKA 5D7BA 1P0IA 3C6ZA 4DNQA 4UHDA 5A7GA 3FAKA 1CUVA 4GWLA 5H3HA 3I2IA 3GFFA 4NMWA 5FRDA 2ZSHA 3PE6A 3SWWA 3I6ZA 1K63A 1ZI8A 4ZI5A 4AX4A 4PSUA 1MU0A 1ODCA 4Q05A 2AJCA 4QDTA 1XLVA 1DQZA 4NZZA 4BVJA 5DNWA 3FOBA 1D07A 3STVA 1G42A 5AOBA 3C87A 3OC0A 3WA7A 1GT6A 3O4JA 3ILSA 2GZRA 5LZ5A 1U65A 3KSRA 4U2CA 2OAEA 2WILA 2GBIA 2BGRA 1TRHA 5JIBA 3DLTA 4W1SA 3FSGD 3H2GA 3TRDA 1UKCA 3PF9A 4H7HA 3BXPA 1MNAA 5JARA 2C4HA 1ZGBA 5KWIA 5JADA 3RK4A 3CN9A 3D7RA 4OB7A 5JAPA 5JATA 1QJ4A 4W9RA 1YS2X 1KU0A 2WFZA 1DX4A 3QMWA 4G9EA 4DSZA 3GROA 2FJPA 4G5XA 2G5PA 1WB6A 2OLEA 2Z8XA 4LYEA 3K6KA 4P92A 3KWJA 1QIHA 1QIKA 5K3CA 2GBCA 4BDSA 4TGLA 4RGYA 2WTNA 2DFPA 1VE6A 4YPVA 1CQWA 5LZ7A 1NU6A 1YA8A 1QTRA 2Z5GA 2O2GA 5AKEA 1J07A 3QPAA 1XRRA 3H1BA 5CT6A 3B12A 1YAJA 3VKFA 3QITA 1QLWA 2WHPB 1EINA 3IUQA 4QE3A 4M0EA 2GZSA 3VJMA 1XZFA 3OTQA 3OURA 1BU8A 4FFWA 2ZYSA 4H77A 2VJAA 1CEXA 1A88A 1M33A 1PJAA 2H1IA 3FNBA 1XZGA 1XQVA 3PFBA 4Y2VA 5A71A 1H23A 3OPMA 4N8EA 2DQZA 1CUAA 3LCRA 3WL6A 1WPRA 4F21A 1IZ7A 2XQIA 2XT0A 1CUYA 3IA2A 2ZYIA 1DX6A 2DHDA 2XMCA 3I6MA 1R9MA 5HF8A 2NW6A 4QDXA 4HRYA 2HL6A 5ALHA 1DQYA 5EIEA 2WIDA 2BUCA 4HTAA 3PICA 5AM3A 1AUOA 1E8NA 2WIJA 2C5GA 3FYUB 4WCVA 1ACLA 4G4IA 1H2XA 3I28A 3EQ7A 3QVMA 3H17A 4XX1A 4CG1A 1C7IA 1U2EA 4ZWNA 4H7JA 1YS1X 3LIIA 5AM5A 3HXKA 5ISMA 4J3JA 5KWJA 1UOPA 2AJDA 4L9AA 4U2EA 3G0CA 5DJ5A 2I78A 1T2NA 2IITA 2WQZA 5T4HA 1Q0RA 2XMSA 2VTVA 3H1AA 4OU4A 4BE9A 4DYHA 3AJAA 5CH8A 3G0DA 4Q3OA 2BUAA 1ZD5A 4YK7A 3QMMA 5FV4A 4ZXFA 4E15A 1AZWA 1X70A 2VAXA 4PSCA 5EHZA 2XUDA 1E5TA 1KU6A 2LIPA 2OGTA 4KR0A 3AZOA 3PUHA 4N8SA 1HBJA 5BWCA 5HQ3B 4QZVA 4AZ3A 3EQ9A 3TEJA 2K2QB 4UFOA 4H18A 3WL7A 3G9UA 4DNOA 4AQDA 3C6XA 4G8DA 1L7AA 2HFJA 1XZJA 5HF9A 2QRUA 5C8VA 1UK7A 1W4LA 3DCNA 2VJDA 2X76A 3KDAA 5EIAA 3HZOA 2JEYA 2QXTA 1YAHA 3DD5A 2XLCA 3HJUA 2WM2A 1ETHA 4B80A 2VAVA 2R11A 4RPCA 3D2BA 4WJLA 1U4NA 3B5EA 1N1MA 3WWDA 5ALSA 5LZ4A 5IKXA 3F96A 1Q83A 1YR2A 4LYDA 5FPPA 1XRNA 2ZSIA 3WLAA 3ZWQA 3WQHA 3F97A 1K8QA 5ALKA 4BC1A 4CIAA 4Y2YA 2J4CA 3ZPXA 3HSSA 1R50A 2I03A 4NS4A 2HADA 2ZJ6A 1C4XA 5AI6A 2C7BA 3VVMA 3CN7A 5JZ9A 4OD0A 4PQEA 1Q84A 3IIIA 4S0XA 1DWOA 3ZV7A 2XUFA 1CV2A 3DKKA 4BAUA 2XUAA 4B85A 2XUOA 1EH5A 4DMHA 3ANTA 4MXDA 3GELA 1MJ5A 4B83A 2WUFA 3G9XA 5AOCA 4PF1A 2WIFA 4E46A 1MAHA 1CUGA 5ALDA 2GBFA 5ALLA 3BL8A 4X71A 4PNZA 4H0CA 1IMJA 3DL7A 5AKYA 1CVLA 1LPAB 2QS9A 3JWEA 1QGED 3DYVA 4BBZA 4FNGA 4AO8A 4PSDA 1MN6A 5AIBA 5HKAA 2DQYA 2C0QA 3E0XA 5CBKA 4JNCA 2HU5A 5ALMA 5EI5A 3IURA 1VJ5A 4W1RA 3BDIA 2OAGA 4KAFA 4UHHA 1GGVA 1VLQA 4I4CA 3D0KA 1DWPA 5ALVA 4UFPA 4X6XA 2V9ZA 3R3VA 2ZVDA 1HDEA 5CXUA 4YX9A 2XUKA 4FLMA 1JJBA 3D2CA 4QLAA 4IH4A 4TVKA 2PSFA 3G7NA 1ACJA 4JH0A 5ALIA 3SK0A 3WMRA 1RYYA 4BCBA 4RE5A 4X95A 3ZLVA 4C89A 5JZSA 4C4ZA 1MO2A 3TJMA 1CUSA 1F0NA 4A16A 1BCRA 1USWA 3F9CA 4DMFA 4EY4A 3EBLA 1QIGA 2OCIA 1H22A 2YXPX 5AM4A 2PUJA 4QDOA 2WJ4A 3OOSA 1XZCA 1KEZA 4Y7DA 5AICA 3AZQA 5AH0A 4B82A 5ALOA 5LZ8A 1WB4A 4J0JA 1UFOA 2H9YA 2ONCA 4QDUA 5AM2A 1BRTA 2RI6A 2EDAA 4A5SA 1DINA 2YH2A 3WYDA 3A2LA 1R3DA 1QIJA 1YA4A 4H7DA 3ANSA 3WKBA 1ZI9A 1H2YA 1SC9A 2E3JA 2HFKA 4AO7A 3V9AA 1EK1A 4AN1A 5ALJA 3STXA 3F98A 4W1PA 3STYA 3VISA 4KRYA 3GUUA 4TPKA 4L3WA 3I2KA 1P0PA 4QLOA 1TIBA 3D5EA 5EHNA 4EBBA 3HEAA 3WIBA 1TKRA 4BZWA 2CMFA 2JF0A 5DNVA 3L1JA 2ES4A 4MEBA 5LKRA 1VXOA 4E14A 3G9TA 1BEEA 5HK8A 4GXNA 1W76A 1G5FA 3R41A 2EDCA 1SOMA 2Z8ZA 3H18A 2AJ8A 3C5VA 5CH5A 5AO9A 3W2TA 4B0PA 4CCYB 1C7JA 3I2GA 3STUA 1EDDA 1OXMA 4ZV9A 3OM8A 2XQJA 5FOQA 1E8DA 3WKAA 3WK6A 1VZ2A 1W1IA 4PV7A 4PO3X 3RARA 4X90A 3ZI7A 1R4ZA 2XUQA 1IUPA 1LPPA 5F4ZA 2ECFA 1VOTA 3PUIA 4X93A 2QOEA 3K9BA 2O7VA 4H35A 3V1LA 1ORWA 1QFMA 1VE7A 1XQXA 5K3FB 3G0IA 4BE4A 2ORYA 2WFLB 1EXWA 5CH3A 5ALEA 2HU7A 3DQZA 1ZIYA 4BZZA 2B20A 2WG1A 5I8PA 4Y2TA 4K6HA 1A8SA 5JD6A 4RNCA 3HABA 5A6VA 2PSEA 3G8YA 1UT6A 4F60A 2H7XA 2RAUA 1X2EA 5AI9A 3ZLTA 1WHSA 1CUUA 2D0DA 4XJVA 3E4DA 2AJLI 2HU8A 2JGIA 4X6YA 1QIFA 4BC0A 3C8DA 3KOOA 4EY8A 3PFCA 4MJ3A 1E3QA 5DYYA 1JI3A 5JYCA 3IBTA 2CJPA 3ESAA 3HC7A 4DNPA 1MNQA 4BCDA 3FCXA 4J0GA 4I19A 4CIBA 4GDMA 1JU4A 3M82A 2R8BA 2WHQA 3IDAA 5DYWA 3KD2A 2HHAA 4FLEA 3WWEA 4EUSA 1QO7A 3Q0TA 4ARAA 2HRRA 1GKKA 3DOIA 1JFRA 3DYIA 2VQ6A 1YSCA 4C88A 1IZ8A 2Q0XA 4OYYA 3BE8A 2P8SA 2DCMA 4Z49A 1JJIA 3WWCA 5D3KA 4XIIA 3W9BA 1YB7A 3IULA 3WKCA 2QR5A 1CR6A 3VJLA 1GQSA 2WU4A 2QMQA 4MEAA 2BAGA 4HVTA 3C6BA 4Q1VA 3I6YA 2JGFA 1EI9A 3I2FA 5HKBA 2PBLA 4UHBA 5CT4A 2HA2A 4DNFA 1F6WA 3WA6A 2BKLA 3FWHA 4MWTA 3WK8A 1DTEA 5EIHA 3M83A 1XZBA 4HRXA 2CEKA 3QMVA 1W6RA 2XQGA 5ALRA 1LLFA 5A7FA 3E1GA 4HXEB 1CLEA 1QFSA 1ZIXA 1G66A 3WK7A 5ALQA 2WUDA 4H7FA 1F0PA 4LXIA 2VJCA 1XRQA 3F8SA 1A7UA 1BROA 4B81A 2C0PA 5LP1A 3LIPA 3ICVA 4C6HA 1AC5A 5JZBA 1XQYA 5CT5A 2XE4A 2QT9A 4H7IA 3BJMA 1JMKC 5C8ZA 3UUEA 4X92A 3VDXA 2V97A 3E3AA 4OPMA 2XQFA 5ALYA 5EHXA 3O9MA 3EF3A 4L72A 5T4FA 3W06A 3C6YA 1ORVA 1QIMA 5JD4A 3A6ZA 4BYMA 4BAZA 4EY5A 1XKTA 2HA4A 5JAHA 4P9NA 1W75A 3PDCA 3C70A 3H2KA 1XKLA 2WJ6A 5AKZA 1XQWA 4FNMA 3QPDA 4BRSA 5BOVA 1U8EA 1UXOA 3WKDA 4HXGA 4JYMA 3R3ZA 5IVKA 4DSAA 3R3UA 1K5PA 3H2HA 1J2EA 3LLCA 4W1QA 1YASA 4HXFB 5K3AA 1P0MA 2QZPA 2B4KA 4BCCA 3D2AA 3R3YA 1QIEA 3LP5A 1XRLA 4GHWA 1ODSA 2Y1KA 1QO9A 1IUOA 1IVYA 5AM0A 2WIKA 4MYDA 4N5HX 5FUMA 1JJFA 1XRMA 2B9VA 1MX1A 2WHRA 2ZJ7A 3H04A 4NVRA 5CTAA 3BF8A 4GEGA 5LLSA 5HFNA 3JYHA 4K6GA 4Y2SA 4BTVA 2HA0A 4CG3A 1IUNA 4Q3KA 5JANA 2VEOA 4KRXA 1N5RA 3UMJA 2BGNA 3R40A 5AK3A 1HQDA 3STTA 1EB9A 5ALFA 5FPQA 2PU7A 3V1KA 5I7UA 3I1IA 5E4YA 3ESBA 4X6UA 2WIGA 2XQKA 5LYYA 5FXMA 3DDUA 4CFSA 3CXUA 1J06A 3BWXA 3EIOA 1QIIA 1GXSA 2GYVA 2ROQA 1GPLA 4Y2XA 1FFCA 1HKHA 3QM1A 1VA5A 4BAGA 3HRHA 2FJ0A 3C8HA 4UBNA 2XUIA 1LZKA 2WG2A 2WJ3A 4V2IA 2QXUA 3GBSA 4X85A 4G9GA 1R1DA 1FSSA 4QDZA 4UBIA 1NX9A 1LPBB 4J7AA 3FCYA 1CUIA 3PF8A 4UHCA 3G0GA 4JUIA 3P2MA 2ACEA 5FKJA 4HS9A 4B7ZA 1W52X 4H7EA 3AZPA 1XFDA 1AGYA 5ALWA 4OCZA 1WHTA 2WHPA 5DNUA 1ZD3A 4XVCA 5ALNA 1AX9A 1Y7HA 5ALXA 1CUFA 5CMLA 2ZYRA 3YASA 2X8BA 5AKGA 3H2IA 4DTCA 5A7HA 2FX5A 3WK5A 4K6KA 2WUGA 1O6FA 2X5XA 2QM0A 5IH7A 2VSQA 3V1NA 2WG0A 1DWQA 1UWCA 4UBJA 2Y2UA 1HL7A 4FBMA 1CUBA 3O4IA 1RP1A 4WFJA 3O95A 2DHEA 1VZ3A 5AI4A 4Y2UA 1VKHA 1GQRA 1MT3A 4WDQA 2H7YA 1Y37A 4JYPA 4Y2RA 3FYUA 4G8CA 1SCIA 3H19A 3WL5A 2JBWA 1THGA 1F8UA 5C8XA 2PL5A 3O9VA 4Y9SA 4D9JA 2WKWA 1EB8A 4FBLA 5DTIA 1EDBA 4KAAA 5CXXA 4MYSA 1XZEA 5HZGA 5CT8A 4GW3A 3T4UA 4FHZA 4WFKA 1EDEA 4ZGBA 1AURA 1BS9A 1P0QA 4J0HA 5SYMA 3STWA 2XUGA 4UBOA 2PSJA 3AIMA 5T4EA 5AK5A 1QIDA 4QWWA 2XLBA 5A62A 3NUZA 3W05A 4OU5A 2AJBA 4OB6A 1OILA 3SX4A 1UZAA 2OQVA 1LBSA 5AHXA 4KE6A 3AIKA 4U2FA 5JAOA 2OG1A 1T4MA 5HQ3A 1ZJ5A 2CB9A 7YASA 4BRZA 1VA4A 3HACA 3GA7A 1O6GA 4DM7A 1YB6A 2WU3A 2D5LA 2OGZA 2JEZA 1CUDA 1J1IA 4GBGA 1JU3A 5KREA 5C7YA 2PU5A
chains in the Genus database with same CATH superfamily
3D3NA 4BVGA 4DLAA 1POXA 1SCNE 1RQXA 1IM2A 1U0LA 2RGEA 4RKQA 1DP4A 4ATNA 1U6IA 3HLYA 1KTIA 3WSTA 5BNIA 2C2ZA 3D6TB 3NX4A 3RC9A 4WPGA 1S8OA 4N9QA 3TAXA 5EGNA 5F5XA 3WMGA 3DFUA 2AR0A 4MVXA 5FTJA 3PUWA 1HYBA 2IXGA 1E3DA 3ZKWA 2BI4A 2FSUA 2F9MA 1C1HA 1PNQA 1YU9A 2BKEA 2FVXA 3QG1A 1QZTA 1T91A 2KPOA 3NYIA 3QWAA 4H6XA 2EFHB 4NNJA 1N3IA 2FF7A 2YWFA 3L7JA 1O6CA 3NEPX 4J76A 2PRSA 1OBVA 2CE2X 1F8GA 2O5RA 3VUEA 4EMBA 2HMYB 3H7AA 4B4KA 1Z62A 2QXYA 1XN4A 2ZSDA 1RE1A 3QPCA 2CF6A 3R0IA 4IFIA 4JDUA 3TS1A 1RC8A 4ITVA 3UTCA 1JQ3A 1ZK4A 4DVGA 4P58A 3X1DA 2B82A 4ZU6X 1LSUA 4KNYA 2WZBA 2PUHA 2EKPA 4Y9TA 5GJCA 3FPLA 2IW1A 1DAGA 4DTIA 3K0BA 1XHEA 5CX1A 2C94A 3FY4A 1YULA 4JY7A 3SN6A 4OIFA 4DCCA 3LCJA 3HG7A 4M0MA 1Y5RA 3RG8A 2C2WA 3KQSA 4NK4A 3MJTA 3T7SA 1PLLA 5C8DA 1XAHA 2W6JD 5EG5A 1IWBB 5JMPA 4NKRA 5ABPA 3G5MA 1ZGAA 4PPYA 4UULA 3E1KA 5CW2A 1SCUB 4F9FA 4DR4B 3DW1X 4KO1S 4J9VA 2EFJA 4G3XA 2J1LA 3E8SA 3HU3A 4S12A 5TLSA 1ZAYA 5KI6A 1D1TA 4Q21A 3JVDA 2QLTA 4F97A 3S8EA 2DFLA 5J5CA 3CRW1 1V8ZA 5K8VA 3ZGZA 4YAGA 4GMKA 5ADUS 1DV1A 2J9GA 4DLRA 2GEFA 2H1WA 1QE0A 2BFAA 1GQ2A 1E69A 2V5VA 4Z4CA 1FJXA 2JJ1D 4TYPA 1TECE 1POWA 3CX4A 2VRWA 3REGA 1WXIA 3W79A 4U7FA 4ONEA 5BSTA 4Y0VA 5I48A 2YC4C 3BULA 5KVCA 1NVUQ 2VEDA 3RRBA 1RRPA 3UWMA 3EN0A 5ESDA 5A5DA 5CXQA 4M38A 3OFJA 1PVVA 3PEEA 1KXJA 2Q4EA 3FYHA 4B6QA 4FGLA 3E4CA 1S3IA 5EZYA 1U5CA 2RI0A 3M2PA 4RELA 1XZDA 2D7JA 2DHRA 5DSTA 3JD4A 1Z16A 2RK4A 2VXCA 2R87A 4EHIA 1EVLA 5LP6F 4O29A 3RIGA 5FR2A 1ULHA 1WUKS 3HYTA 1BH6A 1X0VA 3CLRC 3OVMA 3PXDA 4JLAA 2X0KA 3W34A 2VDKB 2YV1A 3ZU2A 3N2NA 2PL3A 3KVRA 1XMVA 3IDSA 4OUKX 1FSGA 1OV4A 2V7QA 3ABIA 1JQBA 4EPRA 5HRUA 4G0PA 1VXRA 3BAFA 3QY9A 2FPOA 5C46F 3C43A 3DE0X 2G4LA 5IVIA 4J0EA 5E4TA 3J7TA 3T5CA 2FZEA 3T0FA 4ARUA 1NP7A 1FXSA 2Q4DA 1K4YA 2IDKA 1E2PA 1Q7CA 1KI9A 4HTFA 4KVGA 3MWLA 4HN2A 3ZWMA 1SBCA 2HB6A 2WMNB 4B2IA 1ZYUA 2A14A 3VTFA 1X1RA 4Z4EA 1V4BA 4U2KA 1BX3A 1XU4A 2YASA 4IJ5A 3UCEA 1D2MA 3GAAA 4DIFA 3CZ9A 2WJZB 4ND6A 3FTQA 4F2GA 5CJ2A 2JDIA 2GARA 5JCOC 2DUMA 1J9EA 5CCXA 1I2AA 5UKDA 1ZY2A 2FWMX 5BNFA 5CHEA 4Q24A 3S99A 3N8KA 4IF4A 3QOXA 5CCBA 3RC2A 4KWEA 4TRJA 4PEVA 4GL4A 1TQDA 2PVSA 4DLNA 3M5CA 1JSRA 3VZQA 1QHFA 3R5KA 5DN9A 1ZWLA 4JODA 4EL5A 1FNDA 2R86A 2I87A 1CY6A 2Z2KA 4HNAA 1YI0A 3GO4A 4Q7MB 4QRHA 4NXNB 2XZLA 3ER6A 3SP1A 5KQGA 1C30A 2EKQA 4FEGA 2PFSA 3T52A 2E5FA 3DL4A 1HWYA 1II8B 1XTVA 2ZUVA 1XVVA 1JKIA 2GJSA 1UKBA 4OLHA 3ZE1B 1LPSA 1YBFA 3U4QA 1A71A 2WQ6A 3JRXA 3LUGA 2P1DA 4MUIA 3ER8A 2G8LA 2IA5A 1YZ3A 3IUBA 4CV0A 4ND1A 2PUAA 1KI1A 3WKEA 2ZT7A 5B64A 1TKAA 2PY6A 4R9UC 4HJXA 1XRPA 4ZP1A 5KTKA 3N0TA 5TGTA 1J22A 5L40A 1BC5A 2Z98A 3EDYA 4BB0A 2B78A 4I4TA 3JQ7A 5H68A 4AD8A 4ZV4A 3GLHA 4I1VA 5BV8A 4OLAA 1AKRA 1L5RA 1DSSG 1KEEB 1TM7E 4LHEA 2DRIA 3I4LA 4EJSB 4PLHA 4NBWA 5THKA 3L6DA 4ZO8A 1USKA 4PSAA 5F23A 1UZLA 4IIHA 1KEEA 2HCBA 1E2QA 3PX7A 2BI7A 2EX4A 2PSDA 3H8VA 1RYBA 3DNMA 4ZZIA 3WI7A 3LWZA 5FI1B 1AV6A 2B5WA 1T1JA 3ID6C 4R81A 5JDIC 3FB4A 4XDZA 1D6MA 4HQFA 4KE9A 3BMCB 1HDIA 5COAA 4BVEA 1BCRB 1HSZA 4QM7A 2YVAA 1AHPA 3TQHA 5F35A 3R1IA 1TZJA 4J0IA 1J21A 4P93A 3KXIA 1QWSA 2QJRA 2Y6UA 2JGLA 3AV3A 4M0CA 4PPFA 3VC7A 5JALA 3JD3A 3A9TA 1J99A 1XPRA 1YACA 2I2XB 3AL3A 3DVAA 3G5AA 5BWLA 3I5MA 3EIWA 1ZK2A 4RNDB 4PNEA 1IBKB 2OFPA 2OZLB 1U63A 1EGAA 4ETWA 3WQBA 5LOVA 1O4VA 2E4ZA 2PV7A 1BE0A 4X1KA 1ORTA 3TTYA 5KOIA 5K3OA 1VYTA 3CZCA 4DA9A 2C3OA 2V74B 2VS1A 4QAQA 5M29A 4W5OA 3ZDFA 3A6GA 1JEEA 2JCSA 2SCUB 2WF8A 3F71A 3HA2A 1TVKA 3AHGA 4M0DA 4PU0A 3RGWS 2HA7A 4QQRA 3I12A 1FFDA 2BEUB 3ABZA 3EE6A 3OQJA 2A9JA 1EX9A 1H2WA 1DMRA 3COSA 1VFPA 4UZSA 2DKNA 2FWNA 3K0SA 3IDOA 1MB0A 3A6LA 1XYGA 3C14C 4A2PA 4TZTA 2VDPB 4CCWA 3EY9A 4JBWA 1EK2A 3VR4D 2HK9A 2XMRA 3PDIB 3M3DA 1SCDA 2BR3A 2JFGA 5AW2A 2RGUA 4IQFA 3CW9A 2ENUA 4RC9A 3HCBA 3DWFA 1I36A 2H1FA 4DOMA 1U9IA 3LVRE 3MF4A 3EFOB 2NXWA 1NXQA 4G26A 3X1WA 2N0SA 5AVVA 1ENZA 3MMXA 3WLLA 2G72A 2YW2A 4G4SP 3EIUA 4CMCA 4CG2A 8MHTA 2O0MA 3UEOA 4ESOA 5KYXB 1P62B 1XAJA 4ODIA 3VZBA 1AQLA 1FX0B 2QAJA 5JSFA 3ELWA 3U37A 3AMVA 1HDGO 1MRNA 4LRSB 4BKQA 3UT0A 3K20A 4NQZA 2FP4B 4MVJE 2VO1A 3AR3A 1GD1O 3FNRA 1O6BA 2OHJA 1W4BA 3SKXA 3K2IA 3WXMA 4C6SA 3MZ0A 5BWBA 2C4WA 1EDZA 2JH3A 3N2YA 4GM4A 1JPUA 3AY0A 4PW0A 1JNXX 3U4DA 3L8YA 2H2FA 1ULZA 4FYIA 2CT8A 1SG9A 2CLEB 1AQUA 2AOVA 2XA2A 3AP2A 5NLLA 4Z4QA 4IF6A 4GSLA 3UWSA 4OL9A 4Q82A 1TYBE 1AE1A 4HWPA 3WJ2A 4L73A 4BPRA 3DOHA 4RHFA 3LHDA 1ZWKA 4URXR 3AUTA 2WFAA 3FWNA 3CRZA 2WSYB 4CI9A 1K97A 3SJUA 2JATA 5F1PA 3VHQA 5J4YA 1HEUA 1FMTA 4H17A 4I1YA 4O5OA 3PI7A 2TMKA 3OQIB 1R6DA 2H1VA 3G5TA 4P81A 3RUIA 1A4IA 1O9BA 3FXAA 4I9FA 5ENZA 1VKRA 1IN6A 2XUHA 4HFNA 1NLYA 3IXQA 3SYLA 4WXMA 4Z9FA 2PKYX 4QTZA 3DBOB 4R16A 5DSZA 1F3LA 2QP9X 5DHTA 5B3AA 2FWAA 5L3SB 1RI2A 2RG7A 3OF5A 4X3PA 1KDVA 2PM8A 1I80A 4G1VA 3SYKA 2FEKA 2N75A 1XVTA 4RSGA 1KPIA 1KSHA 2QU7A 5FLXA 4IHAA 3MQ4A 3CW2A 4IG9A 1UC8A 1CUZA 3OA2A 4B9EA 5KSYA 3BGWA 1JIIA 3PKZA 3O2NA 3ABRB 1XLTC 2Q2NA 4ETNA 3F6RA 3CTMA 3I1FA 4EZEA 2NIPA 2O8EB 4XOUA 3WBBA 3VVBA 1E0JA 2RHWA 1YHYA 5CFMA 3KSZO 1GRVA 4C0BA 1R9NA 4LIPD 4HP8A 4UU1A 1IQUA 2OCGA 4TOIA 1JEQB 1STOA 5BXYA 1KNQA 2O07A 5AI8A 2E4UA 1JG3A 3CCCA 3M49A 3WWOA 4AZ0A 4F84A 4ZZ3A 4AURA 1GTRA 3AVOA 4TV8F 4C0JA 1BJKA 4WZBE 5IF9A 5CRIA 2A5YB 5KPDA 1LVGA 2YRWA 2KE5A 2O9JA 1QGDA 3CBGA 3N2GA 4WEQA 3WK9A 3WLTA 4N6GA 4DBLE 3CVWA 1Z0ZA 5AJVB 2UU9B 2XNCA 4O0LA 3GRUA 5FUQA 1LNSA 4DCPA 3TMYA 2VF2A 3UUGA 1NR5A 3PNOA 4R3UC 3TGWA 3QVVA 3SFTA 4WKOA 4CLOA 2YVKA 2CNWA 3COYA 2NACA 1TM4E 4DUGD 3HBNA 1IXKA 4KVAA 3B51X 3OLYA 5JBIA 5JQGB 2RFLA 1NQAO 1P9NA 3RO7A 1QHNA 4MWSA 1C9EA 4MWZA 1CJBA 2JAQA 3V55A 3VPSA 3I76A 4O4IF 5DYTA 3DNPA 3Q0EA 2WFLA 3QLEA 2GAOA 1YR1A 2C5LA 3JQAB 2PRZA 4NRDA 4LDQA 3TYXA 2YRXA 1N2CA 4OKNA 3ANYB 5ALGA 5AM1A 2ZE7A 3RTCA 4RPLA 3W1VA 2NOAA 5E38A 4NZOA 3HR4A 4Q3NA 4PAQA 3AH8A 3DP7A 5EZ5A 2C2GA 3Q6IA 2RONA 5BYBA 2FFAA 4GE3A 5KYGA 1BO6A 3FFXA 3DMNA 4FDVA 4ENUA 1RQLA 1XKQA 3ND6A 1ZK1A 5CCEA 2YDXA 4FGZA 3NJ8A 1Q19A 1RLOA 1UDWA 4Z9AA 2HNAA 3MS4A 4DEVA 4DV0B 3M4YA 1J0BA 4R6XA 3IKJA 4AXBA 3I05A 1F5NA 2QTZA 1R88A 4PZPA 3RSZA 4F71A 3QZUA 3V48A 2SBTA 2W90A 3FSGA 1QJCA 2EWMA 2ZAGA 2UVPB 1KDPA 1L5YA 2YYZA 3KD3A 1ZZGA 3LXMA 1XA3A 3V1MA 1MCZA 3BWBA 2OM2A 2PYDA 4EAQA 4JJKA 4TL6A 4ZI7A 4ESVA 3UQZA 4KGDA 3PNPA 3DEAA 4GBED 2M6RA 4IHQA 5JSZA 1QH0A 3SZUA 5SYNA 3M33A 5CM8B 5JI3E 4FMCB 5G1PA 1NW8A 5F3RA 4IO1A 4KDRA 1BEZA 1UJBA 3KHKA 4KQXA 5E7IA 3WLOA 4ENQA 2OBFA 1B6GA 5AVOA 4WDRA 5EYPA 5DE3A 3TL3A 2YJ4A 3FG9A 3RWOA 4C01A 3R0ZA 2H4WA 4HYQA 1W4AA 5AD1A 4RVNA 2OV4A 4FN5A 4IPTA 4HB0A 1V5EA 4LXGA 1JDUA 4TLAA 3LSTA 1M1XB 3L8ZA 4GLBA 3IEMA 4LISA 1RRGA 2P30A 3N2ZB 2I7XA 3B3FA 3HBAA 2YFYA 2XGSA 5BQXA 1OYWA 2WKQA 1JZQA 4RO0A 2CUKA 2EKBA 2HF8A 2A7XA 2R4UA 3ACDA 2BBTA 4HDNB 5I9TA 2CL0X 1GTVA 4FYVA 4K81B 2W2VA 1UXKA 5AIAA 1VI5A 3F6BX 4ZVLA 1ECPA 3OF2A 2QQFA 2WLSA 3MBOA 4P32A 4C4AA 5MDHA 2WT8A 4MA5A 4NECA 3CQ9A 3PLAE 2ODBA 3WO1A 3M6IA 5BPFA 2Q2WA 2H4FA 1XTKA 5TQVA 2UAGA 2H85A 4TROA 2GK7A 2GPBA 5BMVA 1EWYA 2R5WA 1UOQA 4F9TA 4TYYA 3DDHA 1V4VA 3FYUC 3EXIB 1JMYA 2Q3FA 3F49S 1SXJD 3MUFA 3WLEA 3THWA 1W2WB 4CMEC 2PMKA 1YZQA 3KQUA 3EQ8A 3OCWA 3GGCA 1Q3TA 3NTVA 3JCZA 5C81A 5M2QA 2P9HA 2YYAA 4HUQB 2PYIA 4J1SA 2CL6X 4EI2A 1NRWA 4B3GA 3G2HA 5JJBA 4HQ6A 1CIJA 1PV1A 1UDRA 3N6VA 3T5PA 1PVDA 1Y5MA 4OH7A 1X74A 2BCGY 3B82A 1NPTO 1WV0A 1EYZA 2GBLC 2BH9A 2HPZA 2Q28A 4E22A 1F2UB 4E70A 5MF6A 3U60B 2UZ0A 1E5LA 1T6XA 2ZDHA 4KSCA 2FEAA 1RYMA 5FULA 1W85A 2WU0A 4DARA 3PDWA 5HF5A 2OFFA 1Z8DA 5JHHB 4EF4A 3AM4A 5EXEA 2JIBA 3KOWA 4II7A 5BN1A 4JB3A 4K5QA 4KP7A 1NLMA 3ESDA 3QQPA 3AP3A 1CUHA 3CKLA 4NY1A 5ALTA 4UNNA 4UAJA 5I7HA 5DM70 3I30X 1TJ5A 2PJDA 2WU8A 5DLDA 3V8RA 2EERA 4BO4A 2G0AA 1MAAA 4YIKA 4EHNA 5MN5A 4Y9UA 3MOGA 2HO4A 5T6MA 4C9BA 4JN6B 3U1TA 3G17A 3H2YA 4NOLA 4W99A 4IP0A 4YASA 4D4JA 1RKUA 4BLPA 3LLVA 1JKJA 2O2DA 1Z5UA 4IS3A 4MVJG 4UUQA 4N5DA 4RXTA 1Z0JA 4WZAB 1XDSA 1HO3A 2WJYA 4FE7A 2Q3DA 3OZEA 1Z28A 1X3LA 5D3ZA 1N3YA 1W7AA 3SYMA 1AZLA 4MS4B 3B1ZA 1RTKA 3OETA 3EPHA 1RS0A 4OGKA 3C7DB 3EZ2A 3GFPA 1IXYA 3K8YA 4DG5A 5HWSA 3F5MA 5KTRA 2KM1A 3ET5A 5B1DA 4IVQA 2CDAA 5AW7A 3E5RA 2NO0A 3P4UA 3RE1A 2CK3D 4F06A 4DL9A 3L41A 4MLPA 4HDSA 4D9BA 5AVJA 1GPMA 4J94A 3N0WA 5AW4A 4H3KB 5HTKA 3RJMA 4A1OA 1GQFA 3KZ1E 4MKXA 1P7CA 3PEFA 4RH1A 1R4MB 3FIUA 1EFRA 2IBMA 4B43A 1IZ0A 1JMVA 4G0OA 4JOCA 4XCXA 2DYKA 421PA 4CQMB 4X1OA 2VQFB 4JJIA 1SUEA 5ER9A 2C7OA 1DAKA 2IHKA 1NQ5A 2WTMA 3JPYA 1FTNA 3QFCA 4JZKA 1QUEA 4PBRA 4DWOA 1ENOA 4KNVA 2CL7X 3B3JA 4BQFA 1WW3A 4WY5A 5P8WA 1ZGHA 5FTLA 5DGCA 2BW0A 4Y2PA 2P3QA 4DV6B 4XCVA 3FAZA 4AMYA 1TPYA 3AEUB 4CEJB 1U0NA 1YZYA 4C4OA 3KKPA 4MKFA 4P22A 3QPVA 3VR2A 2Z0MA 4OXIA 1DPFA 3RD5A 4CYMA 3CZAA 3RVNA 4B87A 1QV9A 3NDPA 5HMMA 4Y0NA 3ETLA 2DSNA 1CS0B 4ZK2A 1PZMA 4TN1A 1N9KA 1RPNA 3OOJA 4ERNA 1QRRA 3WICA 3EDCA 1HDOA 1YB2A 3EWIA 1YCFA 1VSTA 5BV7A 3NMUF 3O4VA 2JIMA 2BHRA 3A2MA 1RJEA 1SC3A 3I6IA 4XEHA 5BW6B 1L4HA 1U9ZA 4M3NA 4B17A 1F7UA 5B12A 3ZWKA 1SUIA 3HHEA 3ROMA 1NDQA 3DCYA 3DXYA 3MCWA 5IDVA 4AKSA 2ZSJA 4BLVA 3TLGA 1SUBA 3ZXIA 1AA6A 2IGBA 3HN2A 3ZBUA 4CMGA 4D57A 4NZ9A 2AN1A 4BTEA 4YCCA 4G07A 1JA1A 1IH8A 3K35A 1I30A 3DHNA 4Y7CA 1O94D 2I4LA 2LDXA 4RHEA 1N2ZA 3ZCXA 4EB0A 5LMZA 1VBKA 2WA2A 4RGVA 1RCFA 3OFND 4A6XA 5DGDA 1Z3CA 2IYAA 2EARA 4C7JA 1BA2A 1CBUA 1C5KA 1UXGA 1XIVA 2TYSB 2YXDA 2ZRKA 2OGWA 3QFRA 1KMMA 3R24A 5ILQA 3BDVA 2R2AA 3USES 4ZI2A 4WSOA 2CKMA 1A1SA 1Q11A 3OM9A 4QREA 3V8VA 1XMXA 4UPVA 4WCFA 5H3CA 3EVNA 2BZ0A 3FMFA 1XALA 3DTVD 4FCTA 4KYIB 4NATA 2P7IA 3O8DA 3DG9A 4MQMA 2VWHA 1H85A 1U1EA 1VPLA 4NCIA 4MQFB 5LQMA 2O2HA 3GHYA 2QLMA 4WADA 1GPH1 1ISPA 2QSUA 4GI3A 5TQ0A 2FPLA 3PCTA 3NM5A 3VFDA 1SCKA 1AO3A 2QGNA 2JLZA 3A26A 3M5DA 2VJLA 4JOSA 3C74A 4WVLA 4EVSA 3ICWA 1P6UA 2JJ8A 3U7RA 1JXOA 3PHIA 1HZZA 2P6RA 2GEDA 1JEAA 4B4OA 3O6VA 3ZLUA 1P9LA 1EFDN 3JW8A 4WGFA 1TTTA 1S3GA 1IXSB 4X66B 1D1PA 1VMKA 2Y68A 3QE9Y 4ENWA 1AF7A 1RHQA 3E8MA 2PRYA 4V0OA 1MPTA 3EDMA 1OIVA 3TKLA 4HK4A 3S81A 4UDXX 2FMIA 2QLBA 4AT1A 3FVQA 1P1IA 4WESB 3C4QA 4UE2A 1T0UA 3T5TA 3G49A 1L1QA 2JRLA 2GFIA 3WMWA 3WR5A 1ICIA 2A6PA 3UAZA 3R4VA 4DMLA 4QUBA 4ZODA 5KNBH 1GUYA 4LZOA 1UM9B 4FFLA 4UHDA 3FAKA 4OBEA 1F5SA 3UAYA 2CB0A 1CUVA 1HY3A 3WIUA 1WAMA 1Z5PA 2OQRA 3RFCA 4P3XA 1P7PA 5H3HA 3P0IA 1T4BA 1UEJA 3I9LA 3R6WA 4N39A 4EPXA 2PZKA 1A9PA 2JIQA 4V0RA 3ZW9A 3E05A 1IJKA 3USCS 2YY6A 4E88A 4DUPA 3KQLA 3HK2A 4ZVNA 1GA1A 1T6YA 1ORDA 5K4GA 2VTDA 1YQXA 3KV1A 4YCDA 5E9AA 5HSGA 1KVRA 1QANA 5LNK6 1ZI8A 3GLVA 4HDMB 4TWRA 3RYHB 3DDCA 4ZI5A 3BTUA 4E3WA 3HP4A 1OA1A 5E3HA 2IU4A 4I36A 4DSUA 2IU6A 3JYOA 4CM9A 1G2OA 1MU0A 1PK9A 2Q0QA 4YBZA 1ODCA 2D5BA 4XSVA 4NULA 2QD3A 3FHOA 4PC2A 4A8HA 3OE4A 1WEKA 3BHMA 5KJ1A 4P7JA 4ACBA 2RHLA 4QDTA 1U3GA 4UMFA 1G16A 1DQZA 2EJWA 2FK7A 2MSDB 3BD9A 3EEFA 4NZZA 3W3ZB 5DNWA 3RIMA 3WL4A 4BVHA 2D2IA 1BIFA 2C97A 2MINA 4G6ZA 1D07A 4OKIA 2F90A 4OVKA 4NH0A 1EWQA 1CTQA 4PVDA 3TZ6A 4CKWB 3ODGA 4J4HA 4NE9A 5AOBA 5A6SA 5AQ1A 3C87A 2WABA 1HE2A 2AHOA 1LSSA 3L49A 1GT6A 2QL7A 3O4JA 3RR2A 4UOQA 3DEKA 3PQ7A 4D9CA 5LZ5A 4AY2A 3LA8A 4PVCA 2QAGC 1U65A 3KSRA 2GHIA 4MUHA 2AJTA 4U2CA 4F11A 3I3SR 3PIDA 4QGGA 2CYAA 4UEWA 4AW9A 1T1GA 1D6JA 2HBQA 1XXHB 4UVGA 2I7TA 2E5WA 1M5UA 4EK9A 1TF7A 1EM8A 4L78A 2WP0A 1FPMA 2KWIA 1KQ3A 3B5JA 4JYCA 4KQKA 1OFUA 2Z2YA 3EVEA 4IJUA 4PNHA 3KKMA 3TMKA 5KSZA 2C29D 4X62B 1W1WA 2QTLA 2CFSA 3G82C 3KX2A 1MABA 4R1QA 2ONYA 5EE3A 4V1CI 1UKCA 3PF9A 3BXPA 1JFFA 2XBLA 3MFQA 4XX0A 1E6UA 4D6XA 3Q2OA 1PN3A 2B98A 2W6QA 3VYSB 3VYRB 2CXRA 3ZJYA 1E59A 2ORIA 2OT3B 1ZFNA 5ERXA 3LT0A 4UNRA 3IT0A 2AB0A 3CN9A 1BDHA 1RVDA 3FYDA 3D0RA 5JAPA 5JDCC 5JATA 4P4UA 4BUZA 4W9RA 3ORSA 1YS2X 1KTVA 1ZN9A 3JQGA 4D46A 1Z5OA 3CNEA 1NYQA 2WINI 2ZKLA 3L6EA 2Z09A 2G40A 2V6BA 4RTLA 3BRQA 2IU0A 1DX4A 1UL1X 1W44A 3GROA 4HDRB 3IHTA 4RIEA 3DAOA 1H3FA 3VNSA 3L0DA 5D2CA 1V35A 3L0IB 1ZQ9A 1WB6A 5HFJA 3WFJA 5IYZB 1A97A 1KJZA 4LYEA 4P92A 4LECA 4J4BA 1SXGA 2PXXA 3OC6A 1JHZA 1T2FA 3C3CA 1JTEA 4LRQA 1WS6A 3OLVA 3KZXA 4O2BA 1X1TA 1N92A 3OJEA 2VPXA 5ANRB 1OLSB 1HURA 2ODNA 1NBMA 621PA 3GGDA 3NHRA 5KJ6A 1EKXA 3KU4A 1NU6A 2B36A 2VK4A 4FR2A 1JPVA 1R5NA 2VP2A 4GAEA 2Z5GA 1KVTA 2Z4RA 3QXSA 4M1MA 3GQVA 4H1VA 4HZUB 1J07A 3LQQA 3QPAA 1PUJA 3SAJA 1YAJA 5TF0A 3BE5A 3LFTA 1T8WA 1XCJA 2ZJ4A 2Q7DA 2C1ZA 1Y5NA 3IUQA 5JT1A 3BA6A 5D6NA 4DLUA 1E2DA 3FUVA 3KZOA 3L7BA 5AVWA 1VI2A 2DY0A 3LHSA 4YQFA 3NHWA 1WJGA 4MRMB 4KCGA 2K5UA 6ADHA 1XZFA 5I47A 4US0R 5IHPA 5E6RA 1Z5WA 4PYNA 3CUWA 1EFCA 4DA6A 5FX2A 2WWWA 1D1QA 1P8AA 2WJVA 3U7QA 2ZSBA 1YFLA 2ZYSA 2VJAA 1M33A 1PJAA 3UJ3X 1ZMBA 1ULTA 3DHYA 1CQJA 2P4EA 5EZQA 3MMNA 2C9YA 3K5HA 3L6CA 1IHYA 5AHOA 2FWRA 2PFGA 4U6QA 3ZHYA 1XP8A 3SJ7A 3W5UA 1JAHA 3OPMA 4N8EA 4R8VA 4XWAA 4L7QA 5DXFA 2C54A 5IVPA 1GUFA 5K0LA 2I7VA 4H1HA 1WXWA 2QI9F 4JJEA 3WL6A 3RWMB 4ARVA 5GIOE 1CG6A 4R3NA 4EENA 1ZH6A 2V6MA 2ZRAA 2ZW9A 1HOXA 1V0JA 3UZUA 1ZNXA 1PU2A 2FDXA 1Y80A 4YWHA 2BEWB 2NQ8A 2ZRGA 1CUYA 3IA2A 1LLDA 5K03A 4FW9A 1ELOA 2CDNA 3FUWA 1NBEA 2DHDA 2CJWB 3MWFA 5F2OA 4KR9A 5JOQA 3FPAA 3HCDA 5KOHB 4Q1EA 3GXOA 2HJSA 2IL1A 3P0HA 2Q8QA 3L82B 2VLIA 2BFDA 5KX5F 4HRYA 3RAPR 3R7SA 1KY5A 2YV4A 5IN5A 5JHGB 4CF5A 5AFSA 1M2NA 2QENA 4CKZA 4LNHA 4MGZR 4BFVA 1IFXA 4B7XA 1Q7EA 3QOYA 3ZS9A 2PRJA 3ZD6A 4GR9A 3PICA 1XF1A 2ZYAA 1QYIA 2N3ZA 1WY7A 2PR2A 1CKEA 1PJ4A 5EZYF 4DABA 2XY4A 4GS5A 1E8NA 2REOA 5C1PA 4GRIA 2VH2A 1A5SB 2KLHA 2WIJA 3K73O 3M5WA 4YAFA 5CR9A 4IHJB 1L5GB 2C5GA 4FIZA 3FYUB 5TVGA 3HTXA 1KY2A 1ACLA 2QWXA 1AK1A 1ZS9A 1S02A 4JAVC 4B75A 4Y8VA 3BMQA 1VECA 3QVMA 1E2BA 5IWAB 2VFAA 4MV1A 4RTSA 1M76A 2B30A 4QVGA 4N47A 1G18A 2QLLA 4HQNA 1I9CA 1XL0A 2I29A 3O1IC 4HVCA 1KO1A 1NQXA 3LX6A 4X20A 1F8YA 1J8FA 3LUHA 1C7IA 4CG1A 1U2EA 5I7RA 2BP7B 1K27A 1GR0A 4L6IA 4X45A 1GZ3A 4MR7A 4DG9A 2Q1UA 2XQVA 1JN0A 1L0BA 2Z6QA 4TMZA 2R47A 2JLAA 1KAOA 4JQCA 1DGQA 5KWJA 7AT1A 4L9AA 3OFVA 2B7LA 4FFBB 5DJ5A 1RFLA 4XFKA 4XSGA 2AI2A 4JX9A 3TB6A 3ESXA 1VE9A 1MKYA 2L0XA 3NIDB 3Q11A 4MP3A 3CA8A 5DGIA 2GCEA 3QVGA 2Z4TA 3AB7A 4H0FA 1Z4NA 1QP8A 3H1AA 2P90A 3R5TA 1ZA1A 2X6TA 4OAPA 5EUQB 2XYHA 4M86A 4S1NA 5EXSA 3IAM6 1PR1A 4I50A 4OK3A 1ORHA 3CUTA 5FUYA 1CZHA 1EUDB 1VRCA 3G0DA 2WPNA 3WV5A 2PE5A 2P68A 1JHPA 1IEXA 4LE1A 4O4LF 1GDDA 2NVUB 1RKBA 3RVMA 3QMMA 1T3GA 5K0NA 4F6LA 2IH4A 3Q1LA 3K2BA 4A0RA 4N48A 3M89A 2GFHA 3E82A 2C57A 1Z15A 2VAXA 3C8UA 3LBNA 4HDAA 1F2VA 4LJ7A 4LEIA 4IOKA 1QQBA 1PUXA 4U8GA 4CDNA 1S3SA 2NO4A 5FPHA 4NK5A 4KR0A 1V9SA 2R7MA 4ZQHA 3AZOA 4YRSA 4YCLA 2A59A 1AMUA 1JXMA 1U7TA 3FNFA 4RK6A 1GNRA 2QR2A 2B4TO 3ORRA 1WCV1 4QZVA 1FS4A 1VL8A 4PLYA 4AZ3A 2BSQA 1Q1ZA 3TEJA 2B2XA 4OHBA 4AJHA 3PC3A 2CXHA 5JS1A 1C7QA 1S9HA 3WDSA 2G9UA 4MKIA 4QXRA 1T34A 4EUKA 3C24A 4I4TF 3G9UA 4MW9A 4FX5A 4YCSA 2IV2X 3SHVA 5CEJA 4DNOA 3OJLA 4AQDA 4PAOA 1MW8X 2W42A 1C29B 4G8DA 3AFOA 5L9AA 1AKYA 2C78A 1DUSA 3BGOS 3LCUA 4GZ3A 4IIUA 4IFEA 3ROPA 5HHTA 2ZJ5A 1FJHA 1OZFA 2R6JA 1WSBA 3IDQA 4RM3A 5T64A 1KJQA 4RLHA 4Y67A 3L2OB 3VR6H 3K6SB 3GRFA 5IKPA 3B7GA 1JX6A 3KVNA 3QJGA 2Z43A 2NYAA 4CDMA 4DQXA 4JROA 4LZPA 4XUCA 2JEYA 3E48A 1M5RA 2VDJA 1CY8A 4JEMA 1QFXA 1FVFA 3TOZA 1ILEA 3DD5A 2I6SA 4Q9NA 4CM8B 1HFEL 1BNCA 3GF4A 4XM2A 1WXFA 2WM2A 4U1RA 1AXRA 1KAMA 4IG4A 1A5ZA 4ZAGA 1TU0A 4C76A 1Q5PA 3DVLA 5JZOA 5FOSA 2VAVA 5KNDH 3E7PA 3PC6A 1B6RA 2FEPA 2XCTB 1B76A 4Q18A 2C84A 1GFWA 1TZBA 1H5NA 4RACA 4Q1CA 4BO3A 3T7DA 2CNOA 3SC2B 3RRYA 1N1MA 1UJ4A 5TJ9A 4WJLA 4HNSA 4TXNA 1Q2UA 1SC1A 3TLEA 3HJTA 2EJVA 5ALSA 1IBSA 2G3YA 1F4PA 3F96A 3NTRA 5GONB 4RQUA 1WD5A 1KZ4A 4IDOA 1RQPA 3EAGA 4J0FA 1Z36A 4NHOA 4XAQA 5H02A 3HGTA 4GOXA 5EJIA 3Q7SA 1UWLA 4OK5A 2GCIA 4TKZA 3I5XA 2WWHA 1Y1RA 2ZTSA 4N4AA 2R6DA 1NJSA 4DCMA 3F73A 2NP6A 1XRNA 2FDRA 4CEIB 2AD5A 3GGSA 2QG6A 4G63A 2H4HA 4PLWA 2QRNA 4LOLA 1VYUA 3ZWQA 4BNJA 4BV8A 5LQAA 3OQMA 2ZVQX 3WQHA 1X3SA 3ZVMA 1SCUA 2I99A 3TSWA 2WZCA 2IC5A 1DHTA 3GG2A 4HEA1 3HCCA 5I8ZA 2NSLA 3ZPXA 3KB8A 3WJAA 2NYUA 4ZCRA 1SUCA 4CZ2A 4RV9A 1NAHA 1Z38A 2G9NA 1U2RA 1NC1A 1ISRA 1YU6A 2HDHA 2W9XA 3AC0A 2HADA 2PBZA 4G84A 4L15A 4R54A 1KSGA 3UHOA 1Z83A 2XZOA 1UBTS 3D7MA 2GK6A 1B3RA 2ZSKA 4DDMA 3D31A 2C7BA 4FSHA 4PG8A 1YO6A 1N2XA 1ZSVA 5DCLA 3RUEA 3WGYA 4BFCA 1QH1A 2HMWA 4K6OA 3VVMA 4MSUA 2Y67A 2XRZA 5C51B 3DE6X 3DMHA 4MJ7A 4IQGA 3WTCA 3F3MA 4OQZA 3RFXA 3RU3A 1OE0A 3ZU4A 4PQEA 1DL5A 1TCUA 2Y1DA 3GRPA 4R1OA 4WAUA 1HFJA 1GNPA 1UPAA 2EQAA 2WAOA 4V3CA 5IEJA 2BDEA 1S2MA 3BIJA 4HLNA 4DIDA 3VC1A 2GAIA 3SHTA 2XUFA 1CV2A 4EKDA 3DKKA 4B85A 1AQJA 3IHLA 3JQCA 3N2IA 3OQOA 3ANTA 1U9YA 5DM4A 3IAHA 3D8UA 2Q6KA 4QUJA 3HA5A 5A9TA 4D7AA 4B83A 3O0TA 2WUFA 2ORED 2I2AA 2GRUA 4LMPA 1U2GC 4R3WA 5TPZD 2H48A 3G9XA 4FDLA 4BJ5A 3W3AA 5BT9A 5JECA 3OJWA 3SLRA 2KLBA 5A0VA 3NDJA 1N34B 2JCYA 1JHAA 1NVBA 1TX4B 2JCGA 2V6JA 5ALDA 3UGKA 5BYKA 1DBSA 3D4NA 4J1NA 5IN4A 1ZIDA 4YQYA 2OBNA 3HPRA 2YVLA 3OICA 4X71A 4EGJA 5AVUA 1NV8A 4H0CA 1E4OA 4ENRA 1DDIA 3DL7A 4OG2A 3THSA 2IX3A 1N36B 1YHZA 3OEWA 1SVKA 3TW8B 3WLJA 1FA9A 5JSKA 3WGIA 1QGED 2GN2A 4BNLA 4W9MC 3UVEA 1AOXA 1VKNA 4BO0A 2I3AA 3WMRA 3ZU3A 1DFIA 2VUIB 5KUTA 3DLIA 5EWLB 3U1VA 3NHJA 2WSBA 4LS3A 4EHDA 3TNFA 1IB6A 2PGAA 5T57A 4TX1A 3C1AA 1SHLA 4N3AA 3JYQA 3L7DA 3AR9A 3VOTA 4MINA 4DLPA 3NJRA 4IIYA 5HKAA 3TSYA 1Z29A 5TMPA 5LYJB 4MV3A 3E2MA 5ALMA 4RWEA 5U4XA 5AOVA 5EI5A 1ESZA 4G5SA 1YBHA 1LBIA 1UZNA 1GU0A 3K0KA 4RCVA 5DNEA 3VU8A 4EI7A 1CETA 3QBEA 4LY0A 4W1RA 5LA6B 1DJNA 4FZVA 3BDIA 5BXQC 1M6WA 2P9EA 4KBGA 4I1UA 1II8A 1U94A 4AYXA 3GRZA 1EFKA 1M2OB 4HUJA 2YC2C 5AVQA 3VYVA 3CO0S 2JLWA 4TS1A 1GVNB 2ZS8A 3AY7A 3CR7A 1RWVA 3CR8A 4Q7EA 5I9MA 5IASA 3QKUA 3L18A 4R2WA 3IQEA 3RKUA 3LQ2A 2JHCA 4I4CA 3TXXA 1DWPA 5ALVA 1RTTA 1SWVA 3EQ2A 3L1UA 3A6FA 3SFVA 2XTZA 3PL5A 4L5CA 2V9ZA 2ANCA 1HDEA 2HIAA 1GQQA 2O0JA 3IPXA 4S2EA 4IIFA 3DEIA 4URHA 5B4UA 2X2OA 3LUJA 1O7JA 3BCHA 1PKXA 3NYWA 1GZ6A 2J0EA 2XUKA 4FLMA 4I1SA 3NIBA 3G2KA 3EDQA 1XZNA 5E9QA 3ZH2A 2B4QA 3D2CA 5DPMA 4DEYA 1K88A 2PSFA 2BHTA 3G2JA 4EPVA 4RJ2A 2HSEA 4TTTS 3T12A 2L19A 2P35A 2WJIA 1RYYA 4EJSA 4G0VA 5KYUB 4I9GA 4G1BA 2WIAA 4NFYA 2VTBA 4X95A 3ZLVA 1ZJZA 3R20A 1OX4B 3ZGXA 3DKIA 3HDGA 2A94A 2ZAMA 3FZGA 3KOUA 3A58B 4NAVA 2DJIA 3E3NA 2IYTA 1KYXA 3HUUA 3HZRA 1FLVA 3AHIA 2IW3A 2GT1A 2N42A 4LV6A 3TJMA 1I9GA 4KQGA 3BMCA 3LRXA 2WPDA 3GT7A 3OLXA 4XVRA 5C8YF 2O6HA 3KJZA 3I5UA 4TV9B 5JY6A 4ICIA 1BCRA 2NU6B 5FL7D 4EIWA 3IJEB 3B8EA 5LP6C 1RYZA 3D4IA 4AJ9A 1TMOA 4F3YA 5I3CA 2X15A 3GDOA 4E1VA 3Q9NA 4F3CA 4EYKA 1H22A 3FPKA 4ZI7F 2Q3EA 3AVPA 1F9AA 3IEVA 4RMGA 2B7CA 1U2ZA 1ABFA 2O48X 2F17A 1WTCA 2DT8A 2PUJA 3OOSA 4XGIA 4CKYA 4UHKA 1DCTA 3GLFE 4EWLA 5AICA 4ZEVA 5AH0A 1B73A 2OZLA 3MJDA 2ZDGA 1AK2A 3SBXA 2IH2A 4FZ5A 3GU3A 3KKKA 1FL9A 4J0JA 4K9QA 3AHFA 5DTRA 3GLGB 3TI7A 2XNDA 3MGBA 4E5NA 2YMLA 5K4HA 4UAVA 1GKYA 1N2BA 2SCUA 3BGDA 1U8AA 2W48A 4TT3A 1HE5A 1XTJA 2BEUA 3WQSB 5ADVA 1XQ9A 5A5FA 4AIRA 1Z0KA 1Q1NA 3VA7A 4MYRA 3O8CA 3F8TA 5DRTA 2VJYA 3SNHA 1YDMA 1ZI9A 4TM8A 3PDIA 1SC9A 5CA0F 2E3JA 4CJXA 3N28A 5KJFA 1S6YA 1V96A 1ODLA 1RQ2A 3GRCA 4RTQA 3EFOA 4HNQA 4QBKA 4W1PA 3STYA 4Z99A 4GGPA 3DPIA 1A9SA 5CGZA 3VISA 4BFWA 3CUYA 3IAXA 4OP3A 1P44A 4IDGA 3TQIA 2XTAA 4A27A 4RPKA 5KYXA 5EHNA 1II0A 1FX0A 4EBBA 5IJXA 3F7MA 1CRQA 2W8BB 3LI2A 4P1ZA 4YMWA 3ADDA 4LJ9A 1E9SA 1YS9A 2BI8A 4BZWA 5D87A 2FP4A 1XBTA 1G6Q1 3COPA 4BJ6A 4HS4A 4EUNA 3LC7O 4HQKA 3LUBA 5AJZA 3BA1A 1L3BA 4E14A 4L28A 1BMTA 3VNVA 2YV3A 1P61B 1ULBA 2WI8A 3OLQA 1C4KA 3U3DA 4DIBA 1KFCB 2BH2A 1C7ZA 3AR7A 4LN1A 1BDIA 1B8NA 3A9WA 3ZEAA 4LMRA 1VL6A 3BC1A 2CDCA 3MWKA 1W34A 3PJGA 4KGZA 3GEDA 3HJGA 4WLNA 3RVJA 5BUSA 3QXXA 5AJTA 1IY0A 1C50A 1PK8A 4MUMA 1KZHA 2J6BA 4BWYA 4U8HA 4J2OA 3VR4H 3ZK9A 4CETA 4B0PA 3RYCB 4DKJA 3HBLA 2BPOA 4DR3B 5K09A 1PNRA 3OQIA 4IX9A 4QHSA 5AW1A 3MOSA 3ICQB 1ZHFA 2EFCB 3STUA 2OHGA 4PXAA 2VBCA 4MKHA 2XZPA 4ZOLB 5FI0B 2SNIE 4ZV9A 4DFDA 2ZBDA 2V1XA 3I6QA 1G9XA 3L4BC 4EQ6B 2E82A 5CDGA 2NO6A 2AE2A 1K3UB 2BFOA 3L0ZA 3FBTA 4P31A 5A9RA 5KS2A 2GEKA 5LDDC 5L3SA 3PWTA 3DZKA 5A5GA 5J1SB 2CZGA 3ASZA 3SICE 3B6IA 3I32A 1E1DA 1SCBA 2X58A 1U2SA 2ARKA 3TE6A 1E8DA 1YS7A 3AWIA 2W7TA 1K9VF 2V6IA 3UB2A 2I54A 2GGSA 4EKEA 3RHTA 1DKLA 3WK6A 1X14A 4RJLA 3MGCA 3Q88A 2O8EA 2OHOA 4BX3A 1W1IA 1PGOA 3HCOA 2X86A 4LSWA 3FETA 4QRDA 2DPHA 1XHLA 4W5WA 3TQFA 3GEPA 1JEQA 1JZSA 4PO3X 1R2QA 5C2JB 1MHPA 4JXXA 4PFSA 3ZI7A 4DT1A 3JU3A 2G67A 1ZVVA 2XUQA 1LPPA 2L42A 3E18A 3C3EA 5EXXA 3NHMA 2ECFA 3WLNA 3PUIA 3ESQA 2E37A 3ZE0B 1IBCA 1M72A 5CK4A 3PBKA 2V5UA 3KBBA 3ZQUA 5HTOA 1QFMA 4F04A 3GLRA 3K09C 1GCGA 4G41A 3FMOB 3RSQA 1KYIA 4FJ2A 4PZYA 1I4LD 4I99A 2OO5A 2H59A 3QVOA 1QHXA 3MFYA 2CMGA 3BORA 5GM1A 1GAXA 5JQGA 1DC4A 1Q20A 2CN1A 1DHRA 3BRWD 4CQJA 1YOVB 3UJ6A 4BE4A 4ECEA 2ORYA 2R85A 3B3AA 2FSIA 5JROA 3WMEA 1E32A 1L7MA 3VZCA 3JQAA 4OHUA 2LKDA 2OD9A 1Z6AA 3D0QA 3GT3A 4OHKA 3RSGA 4HT3B 3T1YB 1MQAA 4MPDA 2L69A 2HU7A 5A03A 4YCJA 3DQZA 2VSXA 3LY7A 3UK1A 5F1KA 5HKOA 3Q8LA 1QAQA 4DC0A 3EODA 3LKZA 3VSAA 3ZWOA 4KR6A 3CURA 1P9WA 4DB2A 2G9RA 2DKFA 4F3KA 1X86B 1MTOA 2OEPA 4J0QA 3PC4A 4X44A 4Y2TA 4FXOA 5AUNB 1Z6XA 3BQNB 4JLPA 1CR2A 2I0FA 2R79A 1JR3E 1VLVA 1YMVA 2GCNA 3FD8A 3QEBZ 4ZFNA 3R44A 2W6NA 3I04M 4LOIA 3HABA 4C30A 3R75A 2VQEB 1H1LB 1K6XA 1WUJS 5HOQA 1PP4A 3JAWB 3K6RA 4FIDA 4PHFA 2UVPA 4Q3CA 1I1NA 2Q7XA 3B2NA 3LJKA 3W8DA 2FP3A 3O2QB 3WLIA 3G8YA 1CQPA 2OXFA 3IQXA 5AW3A 1PT8A 1VHWA 3EC7A 2XKBA 2ZWMA 3L4EA 4CTOA 3R0JA 5HX7A 2H7XA 2ZBFA 4EABA 1GTL1 2A33A 4HWTA 2FG5A 3GGGA 2IVZA 4HSEA 1KRXA 1TYZA 4MV7A 4PC7A 1QVWA 4DY6A 2YW9A 4KX3A 4IVRA 1VGQA 3IKVA 1D9ZA 4J7UA 4XR4A 4WASA 2PLAA 4OV6B 4XJVA 2G1JA 4IJKA 3ZVNA 2LIVA 4R40A 3C3XA 1R9JA 4QYXA 3UHAA 2OK8A 4DUGA 1CDOA 1HT1E 5A9SB 2MU1A 4Q6BA 3L84A 1SXQA 1V8DA 1VIDA 1SC4A 2V7WA 3WLPA 2M1XA 2FR1A 5C1DA 2V5AA 2YNMA 3AF2A 2RB5A 3U9LA 4FB5A 1D4ZA 4PPNA 1MIOB 1YZGA 2NTNA 4NAUA 4QSHA 3GJXC 3GDWA 4JHXA 4BKMA 4F5YA 3NS7A 1EVKA 5EJ6A 1TMGE 2EZ9A 2FW8A 1V7ZA 2XTNA 2A9RA 3OX4A 5LMCA 3F7TA 4HDNA 3G8CA 1NF2A 1W0JD 4H6PA 4ML3A 3AFNA 4UATA 1E3QA 4DSTA 2C8LA 4S3MA 2OD2A 4FMDF 3ITEA 4KXWA 2VWQA 4MLDA 4LRYA 3N05A 4LCEA 1GHTA 1CP3A 5CW1A 3ESAA 1ZX1A 2NSDA 4DT1B 3HC7A 1Z8FA 2IZOA 3LA6A 5DYNA 2FFRA 1I10A 3HA7A 3MW8A 3HVRA 1HG0A 2KMLA 3AUUA 3S0JA 3C5CA 3EWSA 4WW0A 4CIBA 1GQOA 1K5DA 4JD5A 5I7FA 2EGHA 3EXIA 4CL2A 3FMGA 3EUEA 2VQSA 3PD0A 2LV8A 2ZATA 4YRCA 3CNHA 3EVCA 3OQBA 3COWA 4KQCA 5A3QA 1SELA 3KQQA 2BBWA 2M1ZA 5INTA 4HUQA 4AKGA 1WKVA 1E60A 1MMFB 2XYRA 2XYGA 5AVZA 4RV4A 3D7KA 1MAWA 5DNCA 5TDHA 4JLUA 4P4NA 4UTXA 4F9GA 1GKKA 3LPDA 1ZXBA 2YV5A 4MWCA 1U0HC 3L1KA 4DV5B 1F2UA 3DYIA 2Z1MA 3HB0A 3W7BA 521PA 1YSCA 2B0CA 4C88A 1Z06A 5TMBA 2PUGA 1DJOA 2Q0XA 2WAYA 5EVJA 3D3WB 2EGGA 2CNDA 2P8SA 1E92A 1M73E 3PGLA 4EFKA 5K8CA 4EO7A 3IXLA 2YXEA 5HUJA 1UJ6A 3Q9UA 5LWHA 2QN6A 2FZKA 2H9AA 2Y27A 3IV6A 4OFZA 2E0IA 4RKFA 1AUQA 4CL3A 1T5IA 3W9BA 2NU9A 3AWDA 3OUTA 4DMGA 2R3SA 1YB7A 3H1TA 4YMSA 3IULA 5CGQB 1SN7A 4WECA 1J1UA 2WQ7A 4WBNB 2G9ZA 3VJLA 1DG9A 1GQSA 1WLYA 4M2LA 4NU5A 3T95A 3KEQA 2K6GA 2VI5A 3IMEA 1NKSA 2B99A 2V65A 4HVTA 4JKYA 4WINA 3VR5A 1VPEA 4DSZA 4FR5A 1SWWA 1XCLA 5C1IA 3QA3E 2ERCA 3RT9A 3ZY3A 1AVTA 1NBOA 1GA6A 1EI9A 4WZAA 5DMXA 4DKXA 3AVXA 3O75A 5JG7A 1WV1A 1JUDA 5CDYA 1T26A 1SXHA 3M3HA 4IW3B 1YC5A 2OK7A 4JDPA 4MS4A 4ZOAA 3V8PA 1M0WA 2YZ2A 4M8LA 1VPDA 4AQYB 1D8AA 2HA2A 1CRWG 4LQDA 2C5SA 4YJHB 4OGGA 3ZCUA 1V6SA 2Q1XA 1KEWA 4UTPA 4DSNA 5I4KA 1ZRHA 2RE8A 3UW3A 1GZ4A 2IDJA 5IW8A 4DLSA 3O94A 3KJNA 4A6EA 5EIHA 8ATCA 1C8BA 2LXNA 2Z2ZA 3FX2A 3L0OA 3V8BA 2CFTA 1GY8A 1CE8B 2R751 1A7JA 3NP9A 2HXSA 2QPLA 3C1UA 4G23A 1YJ8A 4PQRA 3U6BA 2WWVD 4Q9KA 3IJPA 1R4MA 4JCCA 4CN9A 1LLFA 5FAKA 1LD3A 1WMAA 1PJQA 4IYJA 5E8JA 5FLYA 4BJHB 1QH9A 2X1LA 3MHTA 3S40A 4UEJA 4CQMA 4E5MA 2GLUA 1CLEA 1J8QA 5EIBC 1ZIXA 2Y0PA 4PG4A 5EP2A 5F7OA 2CFCA 5JCOA 2QTRA 2WUDA 4OYHA 3MA0A 4BVBA 4CBVA 4G0NA 3B9BA 1F0YA 3GEGA 2GF2A 3R9IA 2PGNA 1I3CA 2YZ7A 4F46A 2D7DA 4ZHQF 3AEUA 4CEJA 2X9GA 3X2SA 4R8SA 3ZCQA 1BROA 1CJTC 1EK6A 3K4QA 1NQVA 4B81A 2W4QA 5LP1A 1SQ5A 1Z18A 1Q7GA 2CXXA 2CUNA 2W2XA 1YR3A 2WT9A 2NZ8A 3A7DA 3ICVA 4KXYA 4XCQA 4G67A 3WLSA 3LYUA 1ZXXA 2XXBA 1CS0A 4PWYA 3AKEA 3MILA 1HLFA 5CT5A 1W59A 1OXKB 1PZXA 4H7IA 4QVIA 1U2PA 1ZU5A 2BT4A 5D01A 3ZJ5A 4OSOA 4P0QB 4X92A 2PDAA 2NV6A 3RYTC 1P29A 1X8JA 2HV8A 3WGNA 1UDXA 1W93A 2DWPA 3AEYA 4Z1OA 4RKWA 5ALYA 2H1CA 1UBUS 2CNKA 1KRWA 1O95A 4O2BF 4FVTA 3VPFA 4BXOB 4AUNA 3KK0A 2DT5A 2WOOA 2GNOA 2NO1A 4G5QA 1OXBB 3UKJA 2XH8A 4IIBA 4N3NA 5CLIA 3GJ4A 3LY9A 4KMSA 2J85A 4EA7A 4CMKA 5T4FA 2FGJA 3E7DA 5T3UA 5HJ5A 2XCSB 3M0EA 1Z6PA 1M54A 4LI3X 4BYMA 3BX1A 2JC3A 4BAZA 5K20A 3TG2A 4KR3A 2ETVA 2HA4A 4YAIA 5JDIA 1U5BA 3GB9A 3UPUA 4TLBA 4AICA 3HKCB 3M1LA 2XHZA 4YP0A 4V0NA 4P9NA 2ZE6A 3HEMA 3OTOB 4UAUA 1BWSA 1W75A 5TMDA 3W8NA 3H2KA 4RMJA 2DGDA 3DMFA 1R9GA 4BGIA 1IHDA 1Z2CA 3VKGA 1VJ1A 2WJ6A 5AKZA 2QTCA 4BEBA 1WW8A 1XQWA 4H08A 4MQFA 5IF3A 1YFJA 1YJCA 3IQFA 3QPDA 1XR3A 2XKAA 3N74A 5AHKA 1YC2A 4PGMA 3TGPA 3T9EA 5TIIA 1UXOA 1ZOLA 2MSLA 2ZJ3A 3NRBA 4W5QA 2IYXA 4KR7A 3SEFA 1QBKC 3W9SA 4JYMA 3E7FA 2FLKA 4CN8A 5IVKA 1GUZA 1P4RA 2J48A 3KL4A 1Q17A 2G25A 5E8RA 3W2GA 4YHHB 3K70C 1OKKD 1J2EA 3HUDA 2V1UA 4BMNA 1JIXA 1L5HB 3WGTA 1MRZA 2ZJ1A 1SMKA 3EC2A 4FBGA 4DJ5X 5JCZA 1USIA 5KTPA 4A03A 3EW9A 3S1LA 1LTHR 4QHYA 4YO7A 4Y6QA 3TE7A 2E49A 4LE0A 3VR3D 3TOSA 1SEVA 3I5AA 3FFWA 2OV2A 1SZPA 3KKOA 4RY0A 1Q0TA 3F5DA 4MVJF 2B4KA 2O2YA 4BFXA 1UP7A 4WNIA 1B15A 3RHFA 4AF7A 1A72A 3HCEA 1E63A 1AUVA 1Q0LA 3LP6A 4GXQA 4RVGA 2G4CA 4WESA 4EH1A 4HVLA 4W8OA 3G88A 2EW8A 1YZTA 1KVSA 4RADA 2GEVA 2GD1O 4GT1A 4Y6LA 3RUCA 3WB1A 4YMTA 5JFGA 1XRLA 3TPCA 5IAJA 4OMUA 4W5TA 1QO9A 3J7AC 1IVYA 2J59A 3HDTA 2WIKA 4HAUA 4MYDA 4YAKA 5EGSA 2IYRA 5EMKA 3T4EA 3ZZUA 3JQEA 4I5GA 3F90A 2ODEA 3SZGA 3L43A 5J4LA 1ZCBA 3TIFA 4BEJA 1XRMA 2B9VA 2DU8A 1XT6A 1MX1A 3EXAA 2UUBB 1NUQA 2VP3A 5HNKA 1QHIA 1XMOB 1JG4A 3WOHA 4PYJA 5DO9A 3F3KA 3SZOA 3PTAA 5BV1A 5EXTA 4RDXA 2V45A 1XDDA 4NF2A 4XWOA 3OBIA 2V3WA 3PZBA 2ZCJA 4MCHA 4XDYA 1DBQA 1I3LA 2QVXX 2VF7A 2ZRMA 2QPTA 2V7EA 2Q8NA 4HDMA 4QPDA 3RYHA 4Y2SA 3SI7A 4BTVA 4TTAA 3BWMA 3IYLW 1CFZA 2DUUA 3AUAA 5HPYB 1NW7A 4LY6A 1V1JA 3UICA 3FWYA 2RJ3A 1RAIA 3MLEA 2O50A 1RPJA 1PJ8A 2GB4A 4GX2A 4KRXA 4MWGA 5FFMA 3UUWA 1WRBA 3Q87B 1T0IA 1P5RA 4J16A 1TM5E 2BGNA 2GN1A 2ABWA 3ACBA 2IEIA 3GOQA 5B6JA 2IHTA 4RIIA 4C3OB 4YT4A 3KQTA 3RBZA 4CKWA 1QZXA 1RXCA 1TK2A 4OJYA 5FOWA 2QP4A 3IODA 1IVSA 2V8OA 1ZC3A 1B8OA 2OXCA 4NBTA 3JTEA 4D0SA 3JXEA 2YWXA 4I50F 4ZVOA 1VG0B 3JZAA 3KDSE 2IP4A 1HSOA 3P45A 3RAJA 4MO2A 5DHRA 5P21A 1XXHA 5KNLA 4I7EA 3W6PA 4IWXA 1EJ0A 3QXJA 4D4IA 5BSKA 3DDUA 2PZMA 3CXUA 2B34A 1G4UR 3NHUA 4U9UA 3T5BA 1XLTA 3WNQA 2MSNA 5CXSA 1IQ0A 2XCOA 3CLKA 1SU8A 1BQ4A 1HMYA 3N76A 1PJTA 2NSYA 5AJUA 5FWYB 2ZE5A 3RSLA 1ZITA 4Z7NB 4Y9DA 5EP1A 4NYJQ 1HV8A 3IPYA 4PQYA 4RJTA 3ZWYA 5CA0B 3RASA 3U80A 4QJ5A 4BAGA 5FNVF 1TZKA 2JI8A 3KM0A 3QE2A 2ECKA 4QYWA 3MD0A 3OF3A 2AA3A 2C9BA 2L18A 4RK4A 1AGRA 1LFAA 1T8PA 4OHZA 1JIJA 3K7EA 4M21A 3W5VA 1B8PA 2W37A 1E2KA 3D4PA 3O31A 3ST7A 1G38A 1LZKA 4N9WA 1IXZA 1M74A 2PNFA 4WZBA 2C8JA 5HCNA 2JH8A 1Z45A 1TEXA 1UJ2A 2KX7A 2FPPB 2JFZA 2DBRA 3EY4A 4EDHA 4AQ7A 5ITSA 3VH2A 4HDRA 1YS6A 5F9MA 1J0AA 1KYQA 1RWNA 4NYIR 5IYZA 5TX7A 2I67A 1RLUA 3P2OA 4HMOA 4MH0R 1KR5A 3KYJB 4TMYA 1NX9A 4UOEA 1CC1S 2VYVA 2BMAA 1T24A 4JA2A 3FCYA 1CUIA 3MB5A 4JEHA 3U9TA 3ECCA 2DPLA 4EA9A 1ZCAA 1UPFA 4ZEWA 5FO0A 1VJTA 1OLSA 5DH9A 3ZWVA 2ACEA 1NULA 2YWHA 3G8AA 2OCPA 1YOBA 5LPNA 3AVYA 1TL7C 4KAXA 2WK1A 3HADA 4Y1FA 2AGVA 1W52X 2XDAA 3PT9A 4WTOA 4LPKA 2UUAB 2ZRQA 3E58A 3W9YA 3H5AA 1UMDB 4HZUA 4BX0A 4BUJA 5JFTA 1XDGA 4JI8B 3IAUA 3FF4A 1MV8A 3ZDQA 4EF5A 721PA 4M8SA 5H4HA 4HEJA 4QBTA 4DN6A 2Y1XA 4C0QC 2YHUA 4HUTA 4DREA 4KQ9A 2EYUA 4MRMA 4EL0A 1OLXB 4NCBA 4HFJA 4LTMA 1NOIA 1YQGA 2LVBA 4G2NA 1KZYC 2FMXA 2ZIVB 3UA3A 3WLRA 2ECQA 2X4IA 4NEHB 5C31A 9LDBA 3QWBA 4ZU1X 2X4GA 3PFWO 3Q3HA 3QFTA 3H13A 1D0VA 1MEOA 2WHEA 4K9RA 3WK5A 4F72A 2PZAA 1UAGA 5CDUA 3TJZA 1ZUIA 1N77A 3S1AB 3AOEC 1Z2AA 1AS3A 1LBHA 1SO8A 5J1TB 4LOKA 2WG0A 1DWQA 1UWCA 1Z6YA 2AEEA 3CZRA 3PA6A 5DW3A 4Z1MD 4F2DA 1EUQA 2Y2UA 4KZKA 1XNGA 2VSNA 5F7XA 4IICA 2GZMA 4ZAZA 5BNWA 2C04A 1IG3A 1PAUA 2Q3JA 4RVDA 1LH0A 2BEWA 4RTRA 1IN7A 4OI1A 2H0AA 4X9XA 3PYXA 3NAQA 4ZZ1A 3LD9A 2CJWA 5TEWA 5GINE 1M2HA 5I7AA 2DPXA 5KOHA 2QTVA 2AN9A 2FQYA 3AF0A 1N7JA 5EZ6B 5G3ZA 1QHYA 3ZBTA 1Q6ZA 3O95A 4D4LA 1XRJA 4JC8A 4LY3A 1GG5A 1AO0A 5J5AA 1L5QA 3BYZA 3P4YA 4E6PA 4WT7A 4C04A 4HPXB 4Q9DA 4DDVA 3Q41A 3NOOA 5BWNA 1AKVA 4GNRA 4PZLA 2HWWA 1UAYA 2YN0A 4M99A 4Y2UA 4LF5B 4D99A 4YMIA 1SJ9A 4YGYA 3ZV5A 4CIVA 1LNZA 2JFWA 4BVAA 1GQRA 5A4AA 2FMFA 1IMOA 4AULA 2HHJA 1D6SA 4N0EA 2B8TA 1N78A 3UV7A 1PUIA 3HZZA 1TPZA 2VAWA 4ZCPA 4IHJA 1Y37A 3HNRA 4J29A 4EG4A 1S5PA 3FYUA 3GN2A 4EM6A 5HIAA 5JNUA 3MUEA 1SCIA 3WL5A 1LQTA 2C3YA 4CMEA 3H5IA 1EESA 3TNLA 1C1YA 4B6OA 2WEKA 4B8ZA 2XITA 2XAAA 4FFNA 1CHDA 1A9ZA 2ZTMA 4O4IB 4P2BA 1NMZA 2P65A 4D9JA 2BF7A 2W6OA 2P77A 1TIKA 3ZGOA 2C4TA 2DUNA 3VYWA 3RAFC 1N6RA 1B8UA 2WKWA 2BP7A 1EB8A 1JDSA 4MIOA 2BM1A 3OZUA 2E4YA 1TJYA 4Z4IA 2GBLA 4H3VA 4AY3A 2DWCA 1EDBA 2FZ5A 4KAAA 1KMIY 2WVJA 3LXUX 3KUCA 1DIRA 4MYSA 1ZM2A 2F6RA 2FZ4A 2OP0A 1Y8ZA 3PX3A 3T1NA 3BKWA 1A98A 4WOBA 5HZGA 4FFBA 5DEIA 4CM3A 1G2PA 3RK1A 4F85A 4FYYA 5KQRA 3RANA 3JWPA 3UMGA 1Q0SA 2GEBA 1GN8A 4H1UA 3SJAA 4U5XA 5B6PA 3OQNA 3KUDA 1PJLA 4K7JA 2J9RA 1GSIA 3BZBA 4AJOA 5AXDA 1NASA 4GI7A 3MTDA 4N5LA 4LF4B 4BBJA 2PKRA 1RM4A 4Q37A 1QIDA 1M66A 3B5IA 1NNSA 1XD8A 3AONB 2PL9A 3CVYA 3QE3A 1Q21A 5A62A 3PITA 1EUDA 2W00A 4UD6A 2HF9A 2FMKA 3GWZA 4IDFA 4OU5A 3VR0A 5IT0A 2AJBA 2NVUA 3T4PA 1JEDA 3SX4A 3GPIA 4DQUA 4MVYA 2FWBA 4IKPA 1NLZA 2REQB 5JEEA 3DL0A 5CM2Z 4B3XA 4CGZA 2I4RA 3EWNA 3OUZA