5CB8A

Crystal structure of adenosine-5'-phosphosulfate kinase in complex with aps and sulfate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
174
structure length
174
Chain Sequence
QRGVTIWLTGLSGAGKTTITHALEKKLRDSGYRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRIGFVSHLLTRNGVIVLVSAISPYAAIRQEVKHTIGDFLEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRTDLEELDESVGKIWQKLVDLKYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable adenylyl-sulfate kinase
publication title Recapitulating the Structural Evolution of Redox Regulation in Adenosine 5'-Phosphosulfate Kinase from Cyanobacteria to Plants.
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Transferase
total genus 72
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cb8A00
4QG7A 4NYMR 3AUXA 4F92B 5AJYA 5HPYB 4GL2A 5FBWB 3THOA 5LD2C 1LVGA 4L5BA 2ZRKA 3L2OB 5JJIA 2QMOA 2W0MA 4HLQB 1G8PA 4B44A 2QROA 5E95A 1C4OA 2D3WA 1IN4A 4V0ME 5JWOA 3LLUA 2FSGA 4M8NE 4KFSA 5KPJA 2OILA 1TEXA 1W5TA 1G5PA 5J4LA 1SVOA 3GJ5A 4F4JA 3GMTA 2NPIA 2X2EA 2VQSA 1ZD9A 2A7QA 1QDEA 2CVFA 2TMKA 4DLRA 3PQCA 3A58B 2ZJAA 4D0GA 1E9DA 3DMNA 4XVUA 3UMFA 2WOOA 4BRUA 3OESA 2FGKA 2OM2A 1ZD1A 3FKQA 4A82A 1EFUA 2OFXA 4HAVA 2CL7X 1KK2A 4G5OA 1ZCBA 1IJEA 3CB4A 1SXJC 4W5JA 3U5ZB 1ZP6A 3K09C 2ZS9A 3QBTA 1AZSC 3DM9B 3EC1A 3QXCA 1VG8A 4QKQA 2A5DA 1ANKA 1DELA 1Z3IX 3QXJA 1X1RA 3BBPA 2H57A 1KMQA 2QQ0A 5JEDA 3NBXX 2ZJ2A 3GD7A 2C77A 3QKRA 5AUNB 3CWQA 4Q7MB 2QAGC 3AVPA 3A1TA 1RPZA 1F6BA 3Q72A 1R0XA 2WMOB 1VTKA 2QL6A 1VIAA 4PHFA 2C9OA 1CBUA 1W36C 1J90A 4Q1BA 4LC0A 2GETA 4NYJQ 1ZMXA 3FKSD 3RS4A 4EJSA 3CR7A 4YMSA 2BMJA 4HZUB 1KMHA 1SXJD 1BMFD 3GCGA 2ODEA 4TMWA 3ZZUA 3N2EA 2GZDA 4W5HA 3SDZA 2QTVB 1LS6A 1FNMA 3LH5A 3AVXA 1NY5A 3IBGA 4I4LA 4L9SA 1S3SA 1RIFA 3CX7A 3T61A 1X6VA 1G64A 2ZJYA 121PA 5K8LA 2A5FA 2VP5A 3QQ5A 4L15A 3EPLA 2BMEA 2C2HA 4YDSA 2PX3A 1W1WA 4Q4HA 2RGAA 2FA9A 4UQOA 4YQFA 3WNDA 1K5DA 1NI3A 1SHZA 4FD2A 2ANBA 5CDFA 4CEHA 4BEBA 1SVWA 3H0KA 1OJLA 2F1RA 2OXRA 4OJQA 4M1KA 4ARZA 4GBMA 1KYIA 2Z0MA 4ZCIA 3EZ6A 3CLVA 1U94A 3PUYA 2FV8A 1W36D 2DB3A 3I62A 1Q1ZA 2RGNC 3CH4B 3P4YA 4PR0A 1P62B 1Z83A 2EWVA 2QSZA 1U8YA 3D3QA 4KU4A 1QHHB 2DY1A 1IY1A 5EE5B 4HZIA 3HYRA 3EX7C 1SVIA 2J1LA 4Z51A 3U61B 4D0NA 4D82A 4TQAA 4GZLA 2IYUA 3VQTA 3GLIA 1AS0A 3T12A 4KBGA 3PXGA 4AKHA 1MO4A 1WB9A 4M1YA 2R9VA 1DAGA 3AKYA 2J59A 4RD2A 2H17A 1KZ7B 2JJ2A 3AF1A 3FMIA 3H84A 1V5WA 2R6GA 4HAXA 5AJVB 5C18A 3AH8A 4R71A 3VR6A 1W0KA 3SJCA 2IYTA 4Q19A 4L4UA 4LBVA 1JR3D 4F38A 3AV0B 2GBLA 4IJMA 4M21A 1E96A 3VTKA 5FUXA 5CDFE 1U81A 1P2TA 1DBSA 2F3TA 2VPPA 5JZVA 4C30A 4QHTA 1NY6A 2BBOA 2W2XA 5FTMA 2BKUA 1Y63A 4YONB 2PZFA 3ZQJA 2EFHB 3MGCA 2YJTD 2H8KA 1M7BA 5DISB 5KSZA 4WZAE 2FX3A 5FBVB 4DIEA 5KSPA 1LS1A 4JSYA 1U99A 3SC3A 4AKEA 1RW4A 1XX6A 2QPOA 5CITA 2GEDA 3FTQA 3W5IA 2EYQA 5B64A 4IDNA 1KO8A 3GLIE 3GJ8A 2RHDA 2VHQA 1DPFA 5TB5A 4H1UA 3Q5DA 2ZRNA 4LJ6A 4QXAA 5JI2E 2X1VA 2G0TA 4BPBA 1NMZA 3A1VA 1HY3A 3MWYW 3CBQA 1P4SA 5EP4A 1HV8A 3MAAC 2WHXA 3KJIA 2QPTA 1OW3B 2CMKA 4DSUA 2D74A 1VHTA 2OSBA 3EWSA 2G6BA 2C99A 1GNQA 4RVCA 4CF7A 2O8FB 5LB4A 3QF7A 1E2KA 2WJYA 3B1XA 1KK1A 1T0HB 5BYJA 1RJ9B 2VHCA 3BB1A 2JLSA 3TMKA 3GEHA 2BHRA 4IHQA 2OAP1 1RVDA 2O0KA 4A0FA 2JJ1D 1P2UA 4X8OA 4GT1A 4QFMA 1NF3A 2P2LA 1M6NA 2EU8A 1QHYA 4M1TA 3VNVA 2EQBA 2X77A 1M8PA 4DWJA 2XTMA 2N1BA 3REFA 3R9XA 2QTFA 4URUR 2DWQA 2FFQA 2PT7A 4NE2A 4AK9A 2F3RA 2XJ9A 2WV9A 1NN0A 2QBYA 2ZRPA 4II7A 4ZPXA 2X2FA 3KJHA 4JBYA 4B75A 5GJWC 1KGDA 3W3AA 1T3SA 1MT0A 2FEOA 1E3MA 3N70A 4NONA 5FL7D 2CLSA 3C8UA 3BAFA 1M34E 1QHGA 4GP7A 2C98A 3FKSA 1CJUC 4B6EA 4EFLA 1N6KA 4NL4H 1SXJA 4QHYA 4QGFA 2ZSBA 4TTRA 4TMTA 2ONKA 2NZ8A 2ZETA 2C8VA 2GVDC 2ZRCA 3B2EA 3K09A 3NC1C 4MUAA 3MG9A 5K8UA 4LPSA 4ZCLA 1XU4A 1Z0IA 2QP3A 1A82A 4R2IA 4TYNA 4HDCA 3Q7QA 3BH6A 3RRZA 1OH8A 1E69A 1QZXA 2FGJA 3DOFA 4UNNA 1SKQA 3FMPB 3MMPA 3LW7A 4P3YA 5BXQC 2GEVA 2QAGA 4F4CA 2J41A 3F3YA 1L2TA 1FW6A 4TL7A 1WP9A 1AA9A 3GQBA 3AF0A 4BWYA 4PQYA 2ZJBA 3PR1A 1AQUA 2BEJA 1XNJA 4HUQB 3KJGA 4LPKA 1FTSA 4QNRA 2WAXA 1JB1A 3HDTA 1ZM9A 1TU3A 2NIPA 4G5QA 5IK2D 4ZIRB 3SYLA 4HZUA 5JLJA 3DPUA 4KSBA 4TLDA 3NH9A 1VMAA 1SXJE 3CRMA 3DZ8A 3WHKA 1XTSA 2ZR7A 1Z07A 2FZLA 2DR3A 1FUUA 4R98A 1E2NA 4C0QC 3AVYA 3AGQA 4M1MA 3C41J 1A4RA 1FP6A 4HDQB 5KDDA 3O47A 2FPMA 4G0NA 4IOKA 2YOFA 3WBKA 1YZNA 4DDUA 1NP6A 4QBIA 4OQLA 3FDIA 3THWB 4MRRA 5JMTA 3EASA 1NIJA 3CR8A 1AS2A 3FMFA 1NLFA 1E2GA 2FNAA 5E3HA 1IY0A 3AVWA 2FWRA 3I5XA 1PLLA 2EFGA 2ZVQX 4JBWA 2BCJQ 1ESNA 1JR3A 1XD9A 4IVQA 4XOIA 2AFHE 1KO4A 2G1KA 2VP4A 1PUJA 2ZYTX 3IHLA 4HB2A 5KOYA 1KDOA 1VECA 1VCNA 5AUOB 2BBTA 2ZE7A 4LI0A 4X8MA 1WBDA 1HUQA 3UANA 4WVFA 1N6OA 4KFRA 5TXGA 2O8DB 4FINA 1OSNA 2OCPA 4Q1DA 1G7RA 2V4ZA 3TW8B 2GXQA 2QGZA 3SNHA 3ECCA 1QRAA 4G1UC 2FEMA 2PLFA 1YJ5A 5A5GA 5FR1A 3THXB 1G6OA 1ELOA 3SYKA 4CT5A 4URZR 3AVOA 3B1YA 3IPXA 5J4YA 2BJVA 1NL3A 4BFVA 4DT1A 2JLXA 5A0FA 4URYR 2G1JA 2GF0A 2JASA 2BV3A 2K5UA 5CLQA 2F1IA 3KUCA 2ZRIA 2O52A 1N5IA 5K8IA 1PVOA 1BIFA 2XEXA 3QXXA 5DH9A 2B92A 4O2LA 1JR3E 4N1AA 3LBHA 4A8JC 1CR2A 2GCNA 1CU1A 3VR2A 1LB1B 4S2EA 2D2EA 4IOLA 2A30A 3SOPA 4B3DA 2B8WA 2C04A 1M7HA 3TAUA 1JAHA 1H8HD 1J99A 2V8OA 4K8OA 2YC4C 4A2PA 4I1OA 3LBNA 5HR5A 4BE7B 1Z29A 2QAJA 2Y8EA 2JJ1A 5CIWA 1ESMA 4M1OA 5B30A 1KTVA 1ZNWA 2IHYA 3AKEA 1HE1C 3QNUA 2V1XA 4CGZA 4G3XA 2ZSAA 2AFIE 4MH0R 5DI3B 3J81k 1OFHA 3TVTA 2VH5R 1WMSA 4BEJA 4HAYA 4LC1A 4EPXA 2F1HA 4M9SA 2E1RA 1KSFX 4Q1CA 4A6XA 3SQWA 2N46A 4NCIA 1KI2A 1TQ6A 2AWOA 3GFPA 5JJLA 3HPRA 1XXHA 1Z6TA 1Q0UA 1QF9A 3C4JA 5FL7A 3KJEA 1YRBA 4XD7D 5CYOA 5KDLA 2AN9A 4OL0A 1QVRA 2ZQ5A 1ONBA 3FFAA 3T34A 2O8FA 5EXPA 3TSOA 2IXGA 3LRPA 1RJ9A 5FBQB 5M04A 2G0NA 4TLBA 1IQPA 3KKOA 2NO7A 4PQFA 4DEXA 3SFZA 1CJVC 2CLDX 5BN3A 1DAEA 3G0HA 2IS2A 1KKMA 2GNOA 4FW9A 1AN0A 2PLRA 5FH9A 2OXCA 3CZQA 3MD0A 1UBEA 5EP1A 1P7CA 4XH9B 2J46A 2BBWA 2ORIA 3Q7PA 3K0AB 5AJXA 3QJYA 3C15C 2ZUBA 4NYIQ 1N6LA 4NH0A 2DWOA 2OG2A 2Q9AA 2REXB 3H4MA 2WM9B 4BFXA 4LHZA 1G8HA 3TK1A 2J7PD 2XGJA 3VX3A 4OK5A 4PZZA 1XXHE 1EESA 4B3FX 3CWZA 4OHWA 1NSTA 1U98A 3UG6A 1XCGB 2CL0X 3M1IA 4LDJA 4E5UA 5FOXA 1J8YF 2OAQ1 3VAAA 4AKIA 3AEZA 5FI0B 3WRXC 1U2RA 4OI0A 2VRWA 4GOKA 1Z2CA 3TH5A 4PZYA 3M0EA 2ZI3A 2ERYA 3X1WA 5EQTA 4M9ZA 1Q1BA 3GLHB 2DPXA 3EA5A 5GADl 1NVXQ 3IDQA 4NCHA 4DBLC 4PAQA 3PUZA 1KK3A 3QKRB 1Z0KA 2CVHA 4RD3A 5G53C 4PXAA 4YLGA 4O3MA 1AKEA 3GFTA 5DIFA 4DVGA 2KWIA 2YINC 3WHLA 3T1TA 4N3NA 4HUQA 5SZHB 1YR9A 4KYUA 3AVVA 1E2JA 1YVDA 3NXSA 4ZIRA 2GCPA 2FF7A 1G1MA 2J0UB 1KMHB 1U0HC 1E2FA 5EJEA 1XMSA 3UG7A 4X8LA 2WKQA 5E4FA 4ZKEA 2WSSD 1Z0JA 3DDCA 2JAQA 1E2EA 5DE3A 1N0UA 2EW1A 2V6JA 4JJZA 3E70C 3WY9A 4PSVA 2IEYA 5IT5A 1DG3A 2LKCA 3VFDA 3OIYA 4BLRA 1UKZA 3CZPA 1UDWA 3R8FA 2V3CC 1YR6A 2QN6A 1G21E 4DB2A 2QP9X 1E2MA 1TQ2A 2ZS7A 3THWA 2OBMA 3CPEA 1QHXA 4Q4HB 1II0A 2W58A 3I73A 3ICEA 4LYHA 2FG5A 3NEJA 1CJKC 2O8EB 4CEHB 2IBMA 3AM1A 4Y0VA 1CJMA 2VO1A 3REGA 3WMGA 4IDOA 4DZZA 1FTNA 2UVQA 1IAQA 2CDNA 1WBBA 1DAFA 4B73A 4ARZB 3MWLA 1RZ3A 3LQQA 2GRJA 3UK6A 4DKXA 3SHFA 1E0JA 1E1RD 1ZM2A 2VSFA 5J47A 2O8DA 4YMWA 4KYIB 2Q21A 1N6PA 2BIFA 2XSZD 4I1SA 1KAOA 4I1VA 2E9SA 1DEKA 2GKSA 3BH7A 5D3QA 4AYWA 4US0R 2F1JA 1NJFA 2NO1A 3BIFA 2NOAA 3THXA 1Q1QA 2GTPA 5ELXA 3NBYC 1R2QA 2AXPA 4MA4A 5HCIA 4DXAA 2HCJB 3MJHA 1UADA 4IW3B 2GESA 3OAAD 4Q21A 3U7FB 4MRPA 3HR8A 3FMOB 2Q3HA 4BRWA 1DARA 5FOUA 1E2QA 5K8TA 3ADKA 2BEKA 5DGXA 3RS3A 3A6PC 1NIPA 3FOZA 2D2FA 1W4CA 2R6CA 3LFUA 4V0KA 2Q3FA 2XNDD 5FUVA 1N6RA 1I4DD 3IILA 3NWJA 4YMTA 2WPDD 1TQ4A 1JXOA 3LW8A 4PTLA 5TVKA 2VP6A 3A1SA 3KZ1E 3BD9A 5LPNA 2F43B 3SS8A 4A8JA 1RE0A 4XD7A 1VCOA 2QE7D 3WYGA 4LJ7A 4CYMA 3GEEA 2ZSFA 4E22A 4C0LA 1KI8A 2ZANA 1HH4A 3CF6R 2O8CB 4ON9A 3ZYCA 3FHOA 4O0MA 2WWWA 1SKYB 2ZXUA 1NLYA 4MKHA 2OE2A 4RD6A 2VF8A 2A9KA 3ZLJA 1U0JA 2J3EA 1N0WA 3AP2A 2ERXA 4JL8A 5AR1A 4MQBA 3CNLA 2JLYA 3HR7A 3QBVA 4LJ4A 1NVVR 4JYBA 2ZSEA 1KI3A 5CJ2A 4BLTA 3VNUA 4KAXA 2ZI7A 2FMXA 5DI3A 3BFKA 4M2LA 1XPRA 5JI3E 3U4QA 1G3UA 5TARA 4F91B 2IS1A 1MABB 5GVRA 1GUAA 4RCYA 1NVWQ 1Z6YA 721PA 3OIVA 2J7PA 3L8ZA 3LA6A 1XMJA 3V00A 3NIBA 3UWKA 5CIQA 2D06A 3NHAA 4B35A 2IYRA 4RCZA 2CK3D 1U9IC 2YZ2A 1UF9A 5KNBA 1W5SA 1E1QD 2QGNA 3EC2A 4KVGA 1JJ7A 4B6FA 1UAAA 5LB2A 4JKIA 5F3WB 4NMMA 2W6ID 1TEVA 1E94E 1XTJA 2BVNA 4JLAA 4LYFA 3K0SA 5LD2B 2GJ8A 5IDVA 4LHXA 3WYFA 4OHVA 5JWHA 1E2LA 1K6MA 4QL3A 3K9HA 4M53A 1FOEB 4QBHA 4HB3A 1LF5A 2YYZA 3K0AA 2IYLD 4GMDA 4DLYA 1RYHA 1ZC4A 2PMDA 4I1UA 3WRYC 1KO1A 1D2NA 1IN5A 1J7KA 1NG9A 2QBYB 2ZR0A 3FHCB 4JYCA 4WIAA 621PA 1R5BA 4DSOA 1DAHA 2ZS8A 3I4LA 3C16C 2SHKA 1DOAA 3GJ7A 3K9NA 4A9AA 2V9PA 1W4RA 2ZAMA 4MGZR 5EZ6B 4CDGA 4KSCA 1D5CA 1Q3HA 3KFVA 3GLFB 4QC2A 3TLXA 1TUIA 1HEIA 2QP4A 1SXJB 1XEWY 1E98A 2QT1A 3GEIA 2Z4RA 3N2IA 4KBFA 4PC1A 1OXVA 1R0WA 1N0VC 4JLKA 2WSSA 5JWRA 5GJBA 4BFTA 1OH5A 4LSGA 2UZ3A 3GLHA 5H1YA 5J4KA 2PCLA 2Q6TA 1OFTA 3KUDA 1NJGA 3OIUA 4QJ5A 1XD2A 4QHSA 4FIDA 2DFLA 4Q9KA 3UXMA 3ZVLA 3QG5A 2W2VA 5L3RA 3I32A 3V4FA 1ZRHA 2QQEA 3TE6A 1P9WA 2QAGB 1HQYE 4X8HA 4OHYA 2QMHA 4WW0A 1OXTA 4ZCMA 3PCRB 3AF3A 3HP1A 5E7IA 1RRPA 3QENA 5H8WA 3M4YA 4QJ3A 1KAGA 2RKOA 1W36B 1CRPA 4DLVA 5IRCD 1Q21A 1W4BA 1E1RA 1ZUHA 221PA 2J0UA 4URXR 1S9DA 3SHWA 4DLXA 3GLGB 3OFND 4JL6A 2EVWX 2HUPA 1E0AA 2XSZA 4UXHA 2CLCX 4LK2A 3GJ6A 3TUIC 1TUEA 1LFDB 2OBNA 4LV5B 3X1XA 3QY0A 3IGFA 5FTNA 3UKDA 1E4VA 1Z08A 1ZINA 3GLHE 5HTKA 1E6CA 2C9CA 2L0XA 3CX8A 1G3RA 3OAAA 4C2TA 1WE2A 2OO7A 3CNOA 3L82B 2ANCA 2GCOA 2QSYA 4YDHB 1LTQA 3W6OA 1HURA 2FFBA 4D4JA 4NYJR 2WJIA 4B71A 2O8EA 1P61B 5CM9C 1UEJA 4M1SA 2XNDA 2FH5B 5EXXA 3GP8A 2WPDA 4DJTA 4CEJB 2GJSA 4IEIA 2O0JA 1CXZA 3LWNA 4TZ6A 2ZVPX 4GMXA 2AD5A 1HE8B 4QGAA 1G16A 2QE7A 4ITRC 4PPQA 4I99A 2ATXA 1Q1EA 2RGEA 2H16A 2RH5A 1ZM4A 3PUXA 4V0LA 4OHZA 3AB3A 3K70C 5KU1A 4KCGA 2H5EA 2CNWD 3SE0A 1OLOA 1WCV1 4Q9LA 5A4JA 4D80A 2WWYA 4BLSA 2NGRA 3T5DA 1E79D 4LX0A 1YZUA 4U02A 5EP3A 5AWFC 4F7WA 2PJRA 1CR4A 3K9GA 1DAKA 2WKRA 4C0KA 4DT1B 1X86B 1IXSB 1G41A 4Q01A 1E9FA 2LKDA 2WIAA 4D2IA 1CJTC 1U8AA 1DS6A 3SZRA 3ZD6A 3IIKA 1IN7A 4HB0A 3I92A 3ZIAD 1MO3A 3WP1B 1CR0A 1TF7A 4Q4AB 1KOFA 4DDVA 4LBWA 2RMKA 1MO5A 2VP0A 2F43A 3KDSE 4LCBA 1JR6A 4Q9IA 1R8QA 1T9HA 3BH0A 3IEVA 2CK3A 1JBKA 2GK6A 1GOTA 3BFXA 3B1WA 1E1QA 4KV9A 3PEUA 1KI6A 1JJVA 2IA5A 4XSGA 1XPOA 2O8CA 4RZXA 1T5IA 3E2IA 2IS4A 3L0OA 1KJZA 1KJWA 1GKIA 2W6IA 4UKDA 4B47A 4XWKA 2XX3A 2WZQA 3LO5A 4JLMA 3W34A 3MFYA 3K8YA 5LBIA 2IYQA 4B76A 2VSOA 2R2AA 3LX8A 4HLUC 4IFBA 4Z8YA 5DO9A 5HE9A 4GOJA 1KI9A 3AP1A 5HCNA 2H18A 2D4HA 1VDZA 3K1JA 2NTYC 3VU9B 2ZEJA 3RRNA 4V0NA 2C95A 1L4UA 2AD1A 3PIRA 1MABA 5FOTA 1D9ZA 3VHXA 1DG1G 3K0CC 4XTRA 5H68A 3IQXA 2PEYA 4PANA 3U3MA 2J0VA 1XXHB 2C96A 3QPVA 4P32A 1IONA 2ORWA 2QORA 3N5CA 4GI7A 3TSZA 3U7HB 2AX4A 1NSFA 2KSQA 4LJ9A 3U6BA 4K46A 2ZIAA 1AZTA 4JLPA 1MRSA 3KTAB 2CCKA 2IC5A 3F8TA 1EG7A 1OXUA 3KKNA 1SKYE 2NQ2C 4ILEA 1M74A 4C0JA 1E99A 1EFCA 1IM2A 1IHUA 2AK3A 3BFVA 3BB3A 4UJ5A 3JZMA 4FMDB 5B2ZA 1CKEA 4Q4JA 1COWD 2RGXA 4ZDIA 3PUVA 2OCBA 2QZ4A 2J0SA 1G8YA 1EX6A 2R62A 1HYQA 2HJGA 1L7VC 1XEFA 2QG6A 5FI1B 4IVRA 4ZDWA 1E9CA 4EPYA 8OHMA 3K0FB 3EG5A 4CEIB 2DWPA 4M9XA 1S4QA 3DZDA 4HEJA 1GP2A 5BN4A 4C0AC 2ZJZA 3QIAA 1QHIA 2C03A 2DCUA 2GDJA 4HB4A 4XWAA 3GLFA 1BMFA 1W4AA 3OFNA 1UDXA 1XEWX 3L0IB 3R9IA 4XWOA 4JVSB 4D6PA 1SULA 1KY2A 4RZ2A 4U00A 4EIWA 2OBLA 2P6RA 4B3XA 1GZSA 1RRFA 2O8BB 1MR3F 3WP0A 3TR5A 1S9HA 3QUSA 1IN6A 4RD4A 3HU1A 4IFEA 3B78A 5JBQA 2F9LA 4A0RA 2AXNA 1W2HA 1G8GA 1E2IA 1K5GA 2R44A 5FPTA 4TTPA 3SBDA 4QRHA 1ZUIA 1WXQA 1EFRD 2YWHA 2WOJA 2IUUA 4TL6A 4JVMA 4IEEA 3SJZA 5IHPA 2X19A 4Q1FA 3V9PA 2HF9A 3L43A 2OT3B 1JALA 1E2PA 2KI5A 3LXXA 3MUFA 1I2DA 3ZVMA 3A37A 3ZDQA 4RY2A 1ZM7A 3T1OA 4RZ3A 1VHLA 4GNKA 1TTTA 4RKFA 1F5NA 5LDDC 3JVUA 4R2HA 5FPSA 2ZPTX 2XXAB 1PLJA 2BKEA 4EFMA 1XJQA 3GLFE 1B23P 3GLGA 1Z6XA 5JHHB 1U8ZA 1NBMD 3RNLA 3TUZC 3PG5A 4BLPA 2CNWA 2ZR9A 1S0UA 5JCPA 3ZS9A 1C1YA 1N6NA 3K0EA 2ZSDA 2X8AA 1SVMA 3DM5A 4ZO4A 2FE4A 1SGWA 2B7BA 4PO8A 2ZROA 3DKVA 5SZIA 1OH6A 3CM0A 1CS4C 1L4YA 2NO9A 1KKLA 4KLNA 5KPDA 3RS2A 1BYUA 3U7EB 4FMDF 2OESA 3TW4A 1U0LA 3VKWA 3ZIAA 4Z54A 2HT1A 4LV6A 4CEJA 2VSXA 2V6IA 1N6HA 1XTIA 3IUYA 4JLDA 3FHTA 2NMVA 5EUQB 4YC7A 2CHVA 4PPNA 4Q7KA 3OHMA 1US8B 5FR2A 4PX9A 4RZUA 1Q22A 1W46A 3EZ9A 2R8RA 2RGNA 4JSTA 1OB2A 2XOKD 4EQ6A 1X3SA 3I72A 1DADA 4N0DA 3GLGE 2IL1A 1I4LD 5AUPB 3SQXA 1UKYA 3CH5A 3ZD7A 3QE0A 3EWAA 4PC3A 1R4AA 4B74A 1ZNZA 2D62A 3TGPA 4KFTA 421PA 1Q20A 4PC6A 1I2MA 1FZQA 1FX0B 2B6HA 4PC2A 2RAPA 3CKLA 1NMXA 3CPHA 4JMPA 4PHGA 821PA 6Q21A 1IJFA 1KI1A 4ESHA 1R0YA 4RFVA 3RWMB 2B21A 5FBLB 2H92A 3X1YA 3AKDA 2MSEB 5DHFA 2VHUA 2V55B 3B8HA 3GJ0A 2JJ8A 2GXUA 4TN1A 1G8FA 1Z0FA 4KFUA 4LOAA 4Q4AA 1Q12A 1FQJA 4OK3A 2QENA 1Z28A 3W5JA 4P33A 3T15A 2F6RA 4A8JB 2UKDA 1KHTA 2XZPA 4IDQA 4K81B 4EPRA 5C2JB 4EPWA 1R5NA 1H65A 4D4MA 5KO2A 1NN3A 3ADBA 3NKVA 3DL0A 4JJKA 1ZBDA 1GRQA 2YV5A 4L16A 1DO2A 1N5KA 5HZKA 3KL4A 2QRZA 1YZGA 4NCJA 2IYWA 2CE7A 3W90A 3CRQA 1T3LA 3P26A 1CLUA 4Y0AA 4JLJA 2ZE5A 4PSAA 4B3GA 3AGPA 2ZRAA 3W8NA 4DCNA 1COWA 1GKUB 1RC8A 1XBTA 4HLUA 3TNFA 5DHAA 3GFOA 1MH1A 2O0HA 2BMFA 5FUYA 1E9AA 4TQUS 4JLVA 1OFUX 4NP6A 3VU9A 4XIGS 2C5LA 3RC3A 3U4QB 3P1JA 3ASYA 3UPUA 2F55A 4JS0A 2H1LA 3QVUA 1TAGA 2A5YB 2CEAA 3NTUA 4EKDA 1T0JB 3U6KA 2OV2A 4ZI2A 2JATA 5DSZA 5KSYA 5L3VA 1W49A 1G7TA 4YXWD 1FUKA 1NNEA 1QVAA 2QT0A 3CX6A 3RHFA 4LJ5A 2P6NA 3RABA 3RS0A 4M0LA 2XAUA 2G88A 3KTAA 2G83A 4MYTA 3VX4A 4TZ0A 1T5LA 1GL9B 4JIMA 4MRNA 2AKYA 1CIPA 3KKPA 3MLEA 3SN6A 1KI4A 2B8TA 2MMGA 3W3ZB 1Z8FA 3VR1A 3NDBB 3EPHA 2P5SA 1V43A 1H8ED 4URWR 1T3HA 2ZUDA 1EFTA 4DCTA 4OBEA 4D4LA 1ZU5A 3E5HA 4A92A 2VEDA 4GDFA 3DHWC 3B7GA 5AUQA 1CULC 3K0FA 4MYHA 4US1R 1YKSA 4NBSA 3WNBA 3ZS8A 1EFRA 3B1VA 4C2UA 4CEIA 5AJWA 3P27A 4PO9A 1KDRA 2ZI9A 2LWIA 3AP3A 4RKEA 5D3MB 2OLJA 4P31A 1UBGA 1IXZA 4OJKA 1S2MA 3CNNA 2XZLA 1R5OA 5IK2A 4GPTA 2ZRJA 4DDTA 4FN5A 1J2JA 2I4IA 5JS8A 1G4UR 2GHIA 5JECA 2J0QA 1XTQA 5DLQC 1NBMA 2IF0A 3EIQA 1SVLA 3KFXA 4NYIR 2FPLA 2IK8A 2XJ4A 2O8BA 3AUYA 1VG9B 3FFBA 3EARA 3D6TB 5UKDA 3O8BA 3WNCA 1XD2B 2NO0A 5FOVA 3TAHA 3ETLA 4B43A 3KQUA 3AVQA 4MDEA 2EFCB 4Q66C 1LNZA 1PLKA 2HXYA 1OV4A 2AR7A 4LJYA 4B3BA 1UBFA 4BFZA 4Q1EA 3PEVA 4NDZA 2EYUA 2MSDB 4AD8A 2WWIA 1NRJB 3K9LA 3ADCA 4KI0A 5DN6D 1WA5A 1HA3A 2D7CA 2VF7A 3BERA 5FTKA 4AC9A 1PUIA 3U2QA 3NDPA 2ZRGA 4IXMA 2XXAA 4DB4A 3O8RA 4TLEA 4ZI3A 1TF5A 2QNRA 1UKVY 4JLNA 2XOKA 1P73A 3OEHD 1QG2A 1KNXA 3IQWA 1NBME 1OKKD 3RRMA 3MSXA 4BFUA 1LY1A 4UNSA 5TV2A 2WMNB 3BGWA 2IUTA 3EAQA 4NCNA 2E87A 1XJ0A 1XJCA 1GNPA 1R8SA 1PV4A 1A2BA 2YC2C 4EJSC 1XRJA 3IIJA 3KQHA 4Q02A 3TSWA 4OHXA 4BFWA 1ZJ6A 4C7OB 1OIWA 2GCOB 5AK0A 4DCUA 1YRAA 1TNDA 1GKYA 4GP6A 3LLMA 4DLTA 5E7MA 4IDPA 4CIDA 1Z2AA 1G3QA 3TVDA 2QEQA 1AKYA 2PT5A 3QKSB 4MYUA 2VHTA 2GZAA 2D7DA 4W9MC 3CRRA 4J0QA 4B2IA 3S1AA 1EFHA 3IEUA 1JQLB 5P21A 1TMKA 1US8A 4DSNA 2BC9A 3ZZ0A 3KQLA 1JNYA 3D8BA 4TYPA 1H8HA 2RHMA 4CRWB 4H9GA 1VIYA 1Z0AA 4KLZA 4TMKA 2IW3A 5JSZA 4P4TA 5BN5A 1TX4B 2J9RA 3SBEA 4DLUA 4QGGA 3FYHA 2JA1A 1N3BA 1FX0A 1E9EA 4FCTA 3TQCA 4ASUD 2FZ4A 2G9NA 1OHHD 5SZJA 2HCBA 2PMKA 4DRZA 5CB8A 5JCZA 2J45A 1IXRC 3GJ4A 5TDHA 4POAA 5GJCA 1DO0A 4PZLA 1G7CA 4MRVA 4UJ3A 3NEYA 2ZTSA 3BS4A 1MKYA 1SQ5A 3R9WA 3U60B 1BOFA 3QOFA 3MJRA 4C0BA 1XFAA 4HDOB 4YXWA 1T6NA 5EE3A 1D9XA 4PAOA 1C9KA 3U3JA 4URVR 3LV8A 1AS3A 5L3QB 2BWJA 2DYKA 1YU9A 3NBFA 3PV0A 3BJIC 4XTCS 3U44B 4YMVA 4G5GA 1KI6B 2QA5A 3KQNA 2G77B 2IYZA 1UKEA 2ZRDA 1W0JD 5C46F 1N6IA 3SJBA 2R65A 3MRSA 1AQYA 2CJWA 4B2PA 1J70A 2IXFA 1NKTA 2W83A 4P0TA 4MRSA 4KITB 1FL9A 2HJVA 2Q9CA 3DO6A 1G20E 5B57C 3A36A 1H8EA 3X2SA 3AVTA 1FP7A 2IYXA 1GDDA 3FVQA 2GAOA 4A4DA 1KO7A 1BO6A 3IHWA 4DC9A 3I61A 2AWNA 4LHYA 2CL6X 4GRAA 4Q7LA 4Q03A 3TR0A 1S3GA 4XVQA 2JLQA 4G5RA 3EPJA 1G3MA 4U7DA 4KO8A 3EXAA 3R20A 2ODBA 4B32A 3T1VA 3KKMA 4AY2A 1II9A 4NYMQ 2DFTA 5FPHA 3PEYA 4JZKA 1XB2A 2AKAB 2AL7A 4B48A 5L3SB 4UXIA 3TKLA 3KB1A 4E03A 1NVUQ 3F5FA 2IF2A 2JLRA 4G01B 3IIMA 3R7WB 1GG2A 3QF4B 1M2OB 1WRBA 2JGNA 1SZPA 2IWHA 1NKSA 4Q7JB 5FPYA 5HE8A 3JVVA 3EW9A 2OFWA 4Q4JB 4F93B 2DFNA 4OKSA 4ZDJA 1Z6GA 2W00A 2ZJ8A 3P20A 2CHQA 3W8RA 3P32A 4RD0A 2YWFA 5CJPA 3RDPA 2RGBA 1NN1A 3RSLA 4TTQA 1XCMA 1OYYA 4Q1AA 4QM7A 2GXAA 1OH7A 1X8KA 3DEFA 2PEZA 1OFIA 4E07A 2BM1A 3C5HA 5D3MA 2WSMA 2ZREA 3GJXC 4FI3C 5DN6A 2Z4SA 3W6NA 2WWHA 3L0SA 2G3YA 4IDHA 1KY3A 1QHNA 3D31A 4EDHA 1VYVA 3B6EA 1DE0A 2WKPA 4NKRA 4QOSA 1F2UB 1BS1A 3OEHA 1P9NA 3AVUA 3Q9LA 2JCSA 1QG4A 1N25A 1T91A 1OKKA 4WAUA 2FJUA 1ZIPA 4IRUB 4WOPA 4B34A 3UWOA 3FGNA 4DUGD 1BYIA 4GOXA 2VL7A 3Q5EA 4A0HA 1D2MA 3B9PA 4D0LB 4Q48A 1WDTA 1EX7A 3EZFA 1O87A 3LY5A 4UNRA 4R7ZA 5FTJA 3G82C 2FFHA 2IYSA 3MCAA 2MSCB 1ETUA 4TMZA 2MMCA 2VP9A 3CONA 1P5ZB 2V7QD 3C7KA 4B3CA 4TYQA 1G5RA 1UM8A 4LYAA 1KI7A 2AHOA 3ASZA 4US2R 2GF9A 1F2TB 3DMDA 2ECKA 4A15A 1VYTA 3V4RA 4U5XA 5KSOA 1YE8A 4JLOA 3B5JA 4KODA 3WXMA 2WWFA 2W0SA 2GJ9A 2WJGA 4HAZA 4PO1A 1ZIOA 3BC1A 2A3RA 3NHBA 1GNRA 4LJ8A 1Z6AA 3QPUA 4Q5IA 4UNPA 2FSHA 5GJVC 3RS7A 2XB4A 1DAIA 4Z1MD 3TRFA 4ASUA 2A5GA 2JDID 1KSHA 4QGHA 1FMJA 1CEEA 3T06B 5E7JA 1OHHA 1UJ2A 4FWTA 4NTZA 3T5GA 4C7OA 4P4UA 4LJAA 4E09A 5JHGB 3CF0A 3IBYA 1II8A 2FU5C 3R8CA 2NG1A 4LRWA 3T35A 3QKSA 1OYWA 1JEEA 1EGAA 3H1TA 1JEDA 2YOGA 2YWGA 3THYB 3RRYA 1ZCAA 2RB4A 4V03A 4MGIR 3ZQ6A 2FPKA 3Q8XB 4WXPA 4JKYA 2ZI4A 3TIFA 3BRWD 1DVRA 1X1SA 2QTHA 4ACBA 4F4IA 4P4SA 4EQ6B 2WJHA 3SI7A 1VPLA 2EFDB 1W0JA 3QEJA 4DLWA 3K70B 2VHJA 4BFYA 3NH6A 1VG1A 2IWRA 1Z5ZA 2ZRFA 1CF4A 4NPHA 2HV8A 5EUMA 1IN8A 1XEXA 4PHTA 3SR0A 4BZQA 2PCJA 1W44A 3NG1A 4CVNA 2QM8A 1AGRA 3VR5A 4MUBA 3QEOA 1KZGB 2V54A 2IXEA 5KNCA 1WF3A 1Q3TA 3ICQB 3HU3A 1VYUA 2Q3MA 1GFIA 1X8LA 3W6PA 1R10A 1XWIA 4JBXA 4TQ9A 3QI2A 1TF2A 1LF0A 4AKGA 1PJRA 2IHBA 1RKBA 5L3QA 4RJLA 3GJ3A 3AQ4A 5FBRB 3U44A 1AJEA 4PHHA 4PFSA 5FOSA 3B1ZA 2ONJA 2OUKA 2DHRA 2WICA 2QM7A 1CTQA 3P4XA 3K70D 1L8QA 1IY2A 2HF8A 2XTNA 1PZNA 5JRZA 1GRRA 2FSIA 2HDNB 2YKGA 3W9YA 1N5JA 2PH1A 3K53A 3O8CA 5IF9A 3LVQE 5KNDA 2GVZC 2HLDD 1Z47A 5J40A 5C4GB 1SVSA 2ODNA 2WTUA 2V1UA 3FB4A 3DOEA 4DCVA 2ZJOA 1GL6A 2KBFA 3M6AA 1TU4A 3WMFA 1A1VA 5HZHA 4D26A 1FNNA 1F48A 4GSYA 2GZHA 1KJYA 1NN5A 1SVKA 2QRNA 4M1WA 521PA 1BH2A 3H2YA 2CHGA 5BQ5A 4JT4A 3QVVA 4RFSA 2WIBA 1ZD8A 2A5JA 2REOA 3FPAA 3KX2A 4ZV4A 2J5XA 1U9IA 5L3SA 3KXIA 1ZC3A 1RRCA 4KVAA 4PQRA 4MKFA 4BQSA 2HEIA 4PPFA 2VYFA 5G3YA 1HTWA 4BASA 4L8GA 3R7WA 3LD9A 3QF4A 1J8MF 2I3BA 4B33A 2BMDA 2ZUCA 4TL8A 3LX5A 4C3ZA 4DUGA 4BLQA 1JXMA 2C9YA 1BKDR 1ZW6A 5FOWA 4JL5A 4KHZA 1KO5A 2R6DA 4Q00A 2PBRA 3FWYA 4HLDA 4WZBE 4M9QA 4TLAA 1D6JA 5GVSA 2V7QA 1F60A 4TLCA 2GILA 3IKJA 2RGGA 3KKQA 2ASEA 4N0EA 5HKKD 1TQDA 3B60A 3UMSA 2KE5A 5C1BA 3SU8A 2GJAA 3TUJC 1OXXK 3B9QA 1P75A 1G9XA 3KB2A 4LHWA 3CRW1 4D25A 3OZXA 4OK6A 1F2UA 3B85A 1GIAA 1Z22A 1Z63A 3H86A 1XMVA 3G5UA 5KHOC 1T4GA 3RYTC 2VP2A 4CZ2A 4MITA 4Z1MA 3EZ2A 5JRJA 2JDIA 5CM8B 1I4TD 1UFQA 4TYWA 1G5TA 1GM5A 1E9RA 2BOVA 4OQXA 4R9UC 2UZIR 3U3RA 5KTYA 4BZXA 1GRNA 5L8VA 2I1VB 1JPNA 3TQFA 4LWZA 3FE2A 1KDPA 3IO3A 1F3OA 1E2DA 4MKGA 1S96A 3VMFA 3DVLA 4AURA 4OQNA 4XSHA 5FTLA 4JT2A 2JLVA 1OB5A 4EUNA 2DFKB 1F2TA 1YZKA 1XTRA 3LAWA 2GJKA 1E9BA 1KNQA 4ZKDA 3RSOA 2PX0A 2ZI5A 3A4NA 3A8TA 3B82A 1A7JA 5EP2A 3I8XA 2OFOA 4OQFA 3DKPA 3CPJB 4NCKA 1G4AE 3UATA 1JECA 4LGMA 4XJXA 5KDOA 3HWSA 2WJJA 1T8TA 2HXSA 4OI4A 4BFSA 4QM6A 1E79A 5JEEA 3RLFA 4WZ6A 2ZE8A 3T1QA 2ODWA 3U3OA 3OIWA 2AK2A 1QHSA 1G3IA 4TSFD 5BWMA 4UNQA 1YR7A 2JLZA 1KDTA 2IT1A 2R6FA 1XD8A 2P3SA 5SZKB 2F7SA 2GXSA 2JEOA 5J5CA 4TT3D 3ZH9B 3HYTA 2VBCA 1R0ZA 1VKJA 1W48A 3THYA 1EWRA 3S1AB 1Y3AA 3B13B 4KXFB 3OEED 3LBIA 4AG6A 1YZTA 1RFLA 4S35A 4DEYA 1YZQA 1OF1A 4DCSA 3RC8A 2Z83A 4YMUA 1FMLA 2O5VA 5FPKA 3I1FA 4XVRA 1VCMA 4LV8B 5F2EA 1G291 2BM0A 2XTZA 2GAAA 1ZAKA 5JSZB 4DHEA 2W6JD 3SJAA 4HAUA 3BWDD 1N2CE 2P0EA 1Q57A 2PJZA 1HT2E 1ZYUA 2OCYC 3EA0A 2Q0HA 3KXLA 4LHVA 4IOMA 3WYAA 2HLDA 3IPYA 4FMCB 5EZ5A 3LDAA 2ZE6A 2ZJ5A 3NC0C 1OIXA 2NPFA 3VR4A 5CLLA 2IYVA 1TADA 4MDFA 3UIEA 1QHHA 2GWHA 5G3ZA 1B0UA 1E4YA 5EE0A 1UPTA 2VIIA 2WBLC 2N42A 3RWOA 1YHNA 4JVNA 3OF5A 3SYNA 4AG5A 2QI9C 2OHFA 4QBGB 2LCFA 2FSFA 3HPQA 1G18A 3A1UA 4LZZA 5DYGA 1O3YA 1P6XA 1XDBA 4LUCA 5ANRB 1UEIA 2A78A 2P6UA 4RSGA 5CK5A 1NG1A 3TJZA 5DI9A 4EPVA 4A6PA 2ZYWX 1P72A 1Z0DA 2OEPA 4EPTA 2BCGY 1GSIA 2CJWB 1ZNYA 3BORA 1Z06A 1KSGA 2IYYA 4WXRA 1KIMA 2YHSA 1YZLA 5F98A 1S8FA 4TL9A 2VLIA 4NHOA 1P3JA 2IUSA 3X1DA 2XZOA 2ZM5A 3WBJA 2ZU0C 4NZYA 4DDWA 4FWIB 3ZGXA 5JJKA 2WWGA 1DAMA 4HLCA 4JVLA 5TMPA 2GEUA 5EE9A 4Q18A 4DLSA 5FL3A 3K0CA 1P60A 4HAWA 4NU0A 5C4MA 5HKKA 3EZ7A 3ZZTA 2RGCA 2FDCA 4O2RA 2F9MA 2RCNA 2ZRMA 2QMUA 4CW7A 4V0OA 3WMEA 1CRQA 2PL3A 1A5TA 3I8SA 2FOLA 5G40A 1R6BX 1GTVA 1CR1A 2ORVA 5KUTA 2ZYVX 5G41A 1K8RA 2I1QA 2ZITA 3AF4A 3KQKA 1P2VA 2KB0A 3EIEA 3ND8A 1VG0B 4LBZA 5DNYB 1OXSC 4BZPA 1SHKA 3NBZC 4G5SA 3L8YA 4L9WA 3TBKA 1XP8A 1HQCA 4TMXA 2ZRHA 1UBCA 2PZGA 1EWQA 1AM4D 1G19A 4FMCF 1TL7C 3F0TA 4W5WA 1G6HA 5FFMA 4ACAA 1YR8A 4A1FA 3HU2A 3BE4A 4LYJA 2XB2A 4OI2A 1S1MA 2GK7A 2BBSA 1ZNXA 2VTKA 3QXHA 1R7RA 2Z5FA 4C9BA 2YNMA 3OE7D 2ZYUX 2W2TA 2P65A 3VKGA 2YWEA 1GL7A 2JIZD 5J4VA 3C5CA 1XZQA 1Q44A 3NVAA 4GZMA 3UMRA 4QJ4A 5JS7A 1EK0A 1MRNA 1G7SA 3BK7A 3VKHA 2P67A 4V02A 2FN4A 3QPWA 4PSKA 4Z8XA 4D81A 1MV5A 2QPAA 4AYTA 4TSFA 1E0KA 4FXPA 5TY0A 1OT3A 2IEZA 1XPUA 4TT3A 2VA8A 3PUWA 5BYKA 5B58C 1E0SA 2OCAA 1W7AA 5CB6A 4HSEA 1P2SA 4BECA 5AJZA 4PAMA 4HUTA 3OEEA 5EXSA 3Q3JB 3AKCA 5F9FA 2Q9BA 3QXSA 2YOHA 4I81A 1M1YE 4PPGA 4HI0E 3BOSA 3IO5A 1AIPA 4Q47A 5CK4A 2JLUA 1OE0A 4B2LA 4A36A 1ZM3A 3PENA 2FFAA 4AWXA 5F9HA 5EXTA 2HYDA 2XITA 1JPJA 2W6JA 4FCVA 4EAQA 5JFGA 3D7MA 4MKIA 1U90A 3QKUA 4A2WA 4TMVA 2IX3A 1GAJA 2QU8A 4FCWA 4RD1A 5CYPA 1OIVA 1ZU4A 2A2ZA 3CUEF 1HT1E 3VR3A 5J4HA 1RRGA 2R6AA 1ZVQA 4Q9JA 1E32A 3X1ZA 4KJZA 4PC7A 3L0PA 1IOZA 4EJSB 1XCPA 3I5YA 2B7CA 3PJRA 2NO6A 3EIHA 3Q85A 3CO5A 1LV7A 3LVRE 1GVNB 1II8B 3MWJA 3SFVA 2NZJA 4LBYA 3HJNA 2JLWA 2IS6A 3RVBA 2CCJA 4WA7A 3BB4A 4HATA 3LNCA 1XMIA 1OPXA 1VCIA 1XTKA 3ZJYA 4C0SA 3QG1A 2KJQA 4FMBB 4P4SB 2QY9A 4CT4B 5H70A 3AF2A 4MGYR 5EE1A 1IBRA 3CF2A 4ERNA 4IKEA 2HT6A 4Q4LA 2XNSA 3CW2A 1S1CA 2ZAOA 2Z43A 2CCGA 1YQTA 1M7GA 3RANA 1NLZA 2PZEA 3I3SR 1XEXB 2CBZA 4OYHA 5BW8A 3PEWA 4UXJA 4W7SA 4ABYA 2QMEA 4QBFA 1AGPA 4IVPA 4OQMA 4DLZA 1GITA 2BDTA 4DIDA 3U3KA 2KBEA 2WAYA 4ESVA 5FUWA 2RGDA 4LY6A 4AI6A 1MO6A 1E2HA 4HYYA 1QBKC 2P5TB 2J87A 4MYCA 2WJVA 2QUZA 3GLIB 1JI0A 3BXZA 1JQJC 1W47A 1EXMA 1XZPA 1X8JA 4D4KA 4BLOA 1FQKA 1P9RA 1ODFA 4C4PA 1XF9A 2OLKA 5DYIA 1GILA 2C78A 2GBLC 1E9SA 4A2QA 2ZRBA 4Q9HA 2YVUA 1NVVQ 3E1SA 4BUJA 1MOZA 4IXNA 1ZUNB 3QKTA 2CXXA 2DBYA 3MWKA 3CIOA 4C0HA 4O25A 4A0GA 1RYFA 2EFEB 1A2KC 3U7GA 3RAPR 2WVJA 1FFHA 3JZAA 2CE2X 1DTSA 3PFIA 2J7KA 4H1VA 1T8UA 2ZRLA 4IOJA 1N5LA 3ONWA 4ZDKA 4JLBA 2GA8A 4AYXA 1G17A 2H7VA 2ZU6A 3EPKA 1KSJA 2ZI6A 4V0MA 1CP2A 3LXRA 2BJWA 4EFNA 4GFDA 2WWXA 4RFSB 4WBSA 3ND9A 3QSYA 1FPMA 3SEAA 3ZVRA 2HYIC 2REBA 1NMYA 2Z6VA 4AIIA 2JJ2D 1D2EA 4OI1A 1TPZA 3CRVA 2OZEA 4M22A 1W2GA 3OE7A 3C14C 1W0KD 4M4SA 1LW7A 2JIZA 3RS5A 3VHLB 3A1WA 4BGDA 5KYKA 1WQ1R 3ADDA 4DSTA 1KK0A 4QNMA 3GPLA 1GWNA 2ATVA 3A4MA 3A4LA 3O8DA 4TYYA 3PVSA 3ZVNA 1AK2A 3LQRA 3PITA 3KXKA 4MGKR 1JAIA 2EWWA 1D8TA 4TWZA
chains in the Genus database with same CATH superfamily
3AT1A 3QBEA 4NYMR 4QG7A 4L8FA 4RV9A 4BN4A 4KQIA 4FMPA 4CT0A 4F92B 5AJYA 3KOOA 4OFWA 3PJEA 4NZNA 5FRDA 1DWOA 4X1OA 3THOA 3ZNPA 1LVGA 1FBTA 2F90A 2Y77A 1R3UA 1RWQA 1GQSA 3L02A 4BMPB 4ZJPA 2XCRB 4MMZB 3VSCA 4L78A 3EW7A 1C4OA 1O96A 3JR3A 4L4SA 2FLVA 5FD8A 4V0ME 5JDCA 1O89A 2A4KA 3EFHA 3OZIA 4I4IA 1ZOPA 3M49A 4XB6B 4XRRA 3HZRA 4XGQA 5DYYA 1YOVB 4N0QA 3GLSA 5DASA 1QIJA 2VQSA 1QDEA 3K96A 2ZJAA 5FUBA 3FCEA 2IY8A 5KQPA 4RDIA 4CL3A 2YJGA 1NYRA 1YH3A 3U81A 2R97A 3ZUPA 3O1LA 1E9DA 3IUNA 3E3AA 1HL7A 2JCGA 1M75A 3AF5A 3LTEA 5REQA 3UMFA 1U0EA 4D5EA 4Q3DA 1Q5PA 4BRUA 3OESA 3PU6A 5CAEB 1NU8A 2VRCA 3KWLA 4G5OA 2VDPB 3FZQA 4Z49A 2W71A 3V55A 4YCCA 3LUGA 3ABQB 3TW6A 3OE1A 4J7UA 4W5JA 2ZBQA 3PXEA 5BNWA 3KJFA 2ASVA 1PGJA 4TKUA 2BFBA 2MINA 1N1GA 4QSMA 1AZSC 5GMOA 4G4SP 4MKZA 3HSYA 1TEZA 4D9MA 1P0PA 4CMEC 2G09A 2XHZA 3DOJA 1EINA 3BMNB 3L7DA 1KMQA 4QDUA 1NU6A 5KMGA 3D2AA 1V6CA 4QICA 4UUNA 2PNFA 3S70A 4P22A 1E5QA 3F4LA 1ML3A 3GD7A 3UC9A 3VZCA 2HC9A 3CWQA 3ZTTA 1I51A 2QAGC 3C3CA 4BKRA 1LSUA 1CK4A 4DMRA 3WNQA 1G2PA 2XVAA 3Q72A 1E5TA 2CF6A 3WGKA 2EZ9A 1JTFA 3KBOA 4NFHA 3R6WA 4HRYA 2NVWA 3HY6A 1CVLA 3V46A 1OWOA 4KIWA 4LC9A 3G2QA 4RA6B 5DBFA 3JWPA 4P0QB 3KAPA 2ZUSA 3CR7A 5J59A 2MTBA 3OZUA 4HZUB 1R0RE 1THMA 1KMHA 1SXJD 3BCSA 5A5DA 3GCGA 1HEUA 2ODEA 2I7TA 4JP5A 4DAOA 3ZZUA 1WCXA 5IBCA 1PVVA 5ITZB 2Q6OA 1TLLA 3REQA 3K8QA 2QTVB 1KJQA 4F9TA 5GM2A 1FC0A 1Y8QA 3IBGA 5AQ1A 5AW0A 1NUSA 1RRMA 1X7YB 3BVPA 4I4LA 4PWZA 1EIWA 3LBYA 4ZV9A 4QO8A 1E3DA 5LVAA 2ZJYA 2ET6A 4I8DA 2OHJA 1QFXA 4OQYA 1D4FA 3BPSA 3EPLA 1UPBA 4AM8A 4BMZA 4C5AA 2FPPA 5CJJA 1W1WA 3GBSA 4KVZA 2RGAA 4RDXA 1C30A 5IBRA 4YQFA 1JU3A 1UL1X 4QWWA 1K5DA 1NI3A 1W0CA 4X60A 4ZQIA 4E5PA 4W7IA 2ANBA 4EB3A 4UUPA 4AUEA 3H0KA 3QW2A 2OXRA 2W4MA 2I1LA 3PRKE 4J6FA 4OJQA 3ANTA 3DT6A 4WBNB 1R6AA 3T9FA 2GZ3A 1LPNA 3HFGA 4EHAA 1NRIA 1XHLA 4TS9A 4ARZA 4GBMA 3K6SB 1Y7HA 1AKNA 3EZ6A 3PF9A 5IM4A 3Q9SA 3WFZA 2DB3A 4AP6A 3I62A 4NECA 1RU3A 2R87A 2RGNC 1OI2A 2WE8A 4YBZA 3P4YA 4G8DA 1P62B 1Y0BA 4ZI7F 1Z83A 3RIYA 1CS0A 3IAEA 4MS3B 2QSZA 3IJEB 4WZAA 5CVUA 4ILKA 2QLMA 1PSDA 2AHRA 3A2NA 4F2WA 2W2PA 1IY1A 1RPAA 3TBFA 4HZIA 3ANXA 3EXIB 4FOTA 1K63A 4YAEA 4AZ0A 6GPBA 2DFVA 2A6PA 2RIPA 1BROA 1QB7A 3T94A 3U61B 4LF7B 1RWBA 2IYUA 3VQTA 4X20B 4KBGA 1AHPA 4UBMA 2QR3A 4XYEA 3SLKA 2UXBB 4JJEA 2R8BA 4M1YA 3I2KA 1DAGA 1ZD4A 1ZGCA 2JIPA 3AKYA 1NI5A 3AERA 2H17A 1KZ7B 2JJ2A 3AW9A 3I9FA 3TBHA 5AVYA 3MCWA 3IESA 5AJVB 2Y1CA 3AH8A 4R71A 1KU0A 1P4JA 4LMPA 4OAOA 1A0OA 1HWYA 3Q0EA 3JD3A 3KSBC 2XD9A 2GFQA 3TIVA 3R23A 4NF2A 2WYIA 4TMFA 3VTKA 3KPWA 4M21A 3OCXA 3RVOA 1TZ2A 3DG9A 3NYRA 2XOXA 1YULA 3WSTA 4BEVA 1DBSA 3NWOA 3P19A 3RIXA 1GAEO 5JZVA 4YREA 5NLLA 2H9AA 2I55A 1DBPA 4HYTA 2H4YA 2W2XA 4EPRA 5SY4A 1JLSA 2BKUA 5ECDA 4BB9A 1Y63A 3E1KA 2EFHB 2JLXA 3O93A 1VGRA 2Q5CA 4D6XA 4WZAE 4OJNA 4V0RA 5FBVB 2K7FA 1T0BA 3D64A 5KSPA 4GXNA 3W5SA 2RFLA 3UT0A 3AXSA 5HFJA 4DV1B 1OAOA 3D54D 1U8UA 1RW4A 3R6LA 3T7JA 3CLRC 1VJRA 3TXYA 3FTQA 3ILSA 3W5IA 1VC2A 2ZKIA 4IDNA 4ZOLA 3VZRA 2RHDA 3V1UA 1DPFA 1K7SN 3HYSA 4KPGA 5TB5A 3H3FA 4YPVA 4LW8A 4YCNA 4MDYA 4LF6B 3AEUA 4OA5A 1WPRA 4QXAA 5EVJA 4MEJA 4TKMA 4FDTA 3HYCA 1YC5A 2RSLA 4BPBA 4ADSG 1SOAA 3QYFA 2HJWA 3WLNA 4LJRA 3JALA 1HY3A 2WU0A 3MWYW 2I7XA 4XEHA 2X2PA 1P4SA 4OXYA 4RXUA 5EP4A 3JAMA 3KJIA 1ORIA 1V9SA 2QPTA 3I1IA 4XI9A 4ZCSA 4DSUA 1XQ9A 2CLOB 4IL5A 5EJAA 4BWFB 1P77A 1VZ2A 5EJ5A 1V8OA 5AK6A 2G6BA 1GNQA 3GFBA 1W5EA 4JJGA 4CF7A 3OLQA 5JZ9A 3QF7A 5CT9A 1JVBA 2ZJ0A 5SYAA 3ZC3A 1TM4E 3B1XA 4BP9A 3GWGA 2ORYA 3BB1A 2VHCA 4KQWA 2JLSA 3COVA 2Z5GA 4EK9A 2OAP1 4HDNA 3IA7A 1ZH0A 4QFMA 1NF3A 1JTVA 3I64A 1VJTA 4ZMSA 2Y99A 5E1BA 2QJTA 1BRMA 2J9FB 4I5IA 2O2DA 4F4DA 1EM8A 1YOVA 1VJCA 3G7UA 5TEWA 4DWJA 2N1BA 2E4YA 4EEXA 4KHPB 3A9WA 5FV4A 4URUR 3U4MA 2OFFA 1I3OA 3VNRA 2O2HA 2W8ZA 2P79A 4MW4A 3HLKA 4A6EA 4JJ6A 1BVRA 2YWXA 2QBYA 2ZRPA 4UFPA 1ZI9A 1KEKA 1W581 3ZIDA 5AQEA 2VAVA 4ENRA 5J2TF 3EC7A 3QVSA 4CL8A 3W3AA 3WL8A 2C3YA 1KP9A 2FPSA 4O8CA 4D45A 2FG6C 5A03A 2Y0BA 3EWNA 1NW5A 1D1SA 2P5YA 4NONA 5FL7D 3DEKA 5CAEA 1QHGA 5U4XA 3G89A 2JJYA 5HKAA 5EWLB 3UMCA 2Q27A 3VZQA 1U9YA 5BWBA 2V5AA 4EFLA 4TMTA 1S8OA 1ORDA 3B2EA 4WXYB 1MQAA 2OV6A 3SC2A 5CCEA 2FWAA 4YUAA 3MG9A 4E30A 3LPCA 3UTDA 2RHCA 3FOBA 3VH3A 4ZQGA 3BMNA 5IMBA 2FEAA 2BP7B 4M54A 4PG4A 5FWYB 1EZ1A 3GB9A 4FILA 3KBBA 4NS4A 5JCJA 4BNJA 1QZXA 4RVSA 3DOFA 5DCUA 2QL9A 3G9ZA 5LUAA 1RAIA 2X3FA 4FBLA 3HB5X 1PW5A 3MMPA 3LW7A 4P3YA 2UUCB 2XE6A 4U7GA 3UW1A 1KE2A 4YUVA 1KYWA 4N9WA 3F3YA 4B4OA 3BE6A 2QVZX 2GBGA 5CU7A 3FCXA 3C6QA 1A04A 1WXIA 2ZJBA 3OFJA 4PQYA 2DTXA 1AQUA 1YS2X 1XNJA 4HUQB 4RA6A 3ZWNA 4OQ4A 5DLEA 1FTSA 3OOYA 1TCAA 4CMIB 4F1KA 2WAXA 1CDZA 2IIBA 1JB1A 3HDTA 3IYLW 3F7TA 3PYXA 4PG5A 4WMLA 4G5QA 1LQTA 1CY4A 4PLGA 3S40A 4HZUA 1AB6A 3DLIA 2NYVA 4M0EA 3DZ8A 4RIGA 5ITZA 3A04A 1XTSA 5LU9A 2QTVA 4L08A 3KELA 1BDMA 3MGKA 3AGQA 4O4HF 3BWMA 3C41J 3JRNA 1X7YA 4PLYA 1A3CA 1Q77A 2ZIEA 4GU5A 3P9IA 4GLBA 3BGDA 1NBEA 3VJRA 3UJHA 3UYLA 1RQPA 4G0NA 3UGQA 1WSAA 1MQSA 4YCMA 4ESEA 1H94A 4EHHA 3THWB 2C7BA 4X7PA 4LXUA 2SBTA 5ESWA 2AOVA 4REQB 4BPRA 4G1CA 1L3CA 2DQZA 1V1JA 2GCIA 2VYVA 4JUCA 5JUWA 4JBWA 2M6LA 3G49A 4C5BA 1ZONA 2BCJQ 4PTZA 2P27A 1W6UA 4K2AA 4WBNA 2X0KA 3DUFA 1SCJA 2RBEA 1LJLA 3TRJA 4HBGA 3U49A 2WJ4A 1KO4A 2SKDA 4CL0A 4FONA 3K6SA 1H2EA 1V9CA 2VP4A 1CYEA 2IYPA 3QOYA 5KOYA 1KDOA 1T25A 5B3JC 3OFKA 4UD2A 5AUOB 4LI0A 5FJJA 3VBEA 3RUPA 5CCBA 3UANA 3II6X 3VVCA 1N6OA 2NPOA 5TXGA 2OHXA 1OSNA 2VJYA 1NI4B 1YGYA 2Y0EA 4MV6A 4Q1DA 3VO1A 3S2SA 1HDXA 4CWAA 4OJTA 1OVGA 2GXQA 4JBGA 5DGTA 2JBHA 3R44A 3EXIA 1PR6A 4O2AF 4BJ1A 1QRAA 1XE3A 1EVLA 1A76A 3V7NA 5T6BA 1VL1A 1JKXA 2ZIZA 4JXZA 4JT8A 4QOFA 3AVOA 1MG5A 4G41A 4NE9A 2G28A 2P1DA 3U37A 1F7VA 5JD5A 3LP6A 4Y2XA 3R3SA 3AUAA 3KD3A 4HNQA 5A0FA 4BFVA 2G1JA 1QHFA 1X0XA 4LTNA 1ZRMA 3EIFA 5CLQA 1QRSA 3KUCA 1LLFA 1QH1B 2ERCA 2QD5A 1TGVA 2O52A 3AYXB 5K8IA 1PVOA 2C2YA 1YQXA 1RDFA 3QVLA 3QXXA 1SUWA 4U6NA 5DH9A 3X1MA 2R79A 3I0ZA 4N1AA 1BDIA 3LBHA 1CR2A 4W8HA 3CW9A 1NJ5A 3BCHA 4RQTA 1SCDA 1PT9A 1XZ8A 2D2EA 3SOPA 5EQDA 5GZ6A 3UCFA 5KNDH 5LQSA 4KDRA 4MMYB 2C04A 5CFLA 3ZOKA 3TAUA 5BQOA 4TWRA 2V8OA 1L8XA 1TT5B 3TLZA 2HA4A 4CDGA 4A2PA 3ED1A 2OTCA 2HOQA 5HR5A 4BE7B 1HTTA 1T24A 5BVGB 3GGPA 5GV7A 5EMMA 2QAJA 2C00A 5B30A 2WUFA 1CQIB 2ZWMA 1BWRA 3QUQA 4X93A 1TVKA 3C3YA 3GHHA 4G5YA 1HE1C 5BNFA 1JS1X 4IV8A 1WOYA 1UODA 4G3XA 3LBFA 3HNRA 2JLYA 2BSQA 4BATA 1WMSA 4LC1A 2TECE 2F1HA 4M9SA 1H2ZA 4OU5A 4RGBA 1GGHA 4D3YA 2QE6A 1AXEA 2GFIA 4IKOA 1PEKE 1ZN8A 4UHDA 1KYYA 1EDBA 3HZOA 4NCIA 3W06A 5JJLA 3HPRA 1Z6TA 4IBOA 2R47A 3FOCA 1T0IA 1TFUA 1YRBA 3R3YA 3F7MA 3H83A 2F1KA 4OL0A 2CYCA 4PAWA 1QVRA 3QEBZ 1ONBA 3FFAA 3DDNA 2P30A 3FPEA 3OF3A 1EJ0A 3ESAA 1FRZA 1TKBA 1YR2A 4H7JA 5AKJA 3RU7A 5ALVA 1Y7LA 3TSOA 1H22A 5B2FA 3DVQX 3B53X 4IILA 2G0NA 1L5LA 4DZRA 3FAKA 4FC7A 2VA9A 2KW5A 2NO7A 2ADMA 3SFZA 1CJVC 2CLDX 3ELBA 2G07A 5BN3A 1DAEA 3KQSA 1AN0A 2J9FA 5EUCA 1H23A 1IEXA 1OAAA 2VFAA 5DTMA 3SS9X 5LP1A 5AI5A 1UBEA 5CM2Z 2NYUA 3M6LA 4XH9B 5AJXA 1OX4A 4JJIA 2OBYA 3ZV4A 3DKKA 1DBQA 2ZUBA 4W8GA 4NYIQ 3WNVA 2ZIXB 3UB2A 2V7GA 4NH0A 2DWOA 4DA7A 2QI9F 3H18A 4KZKA 1BHJA 4GYKA 4QSHA 1NOKA 1XVUA 1K9VF 3TK1A 3FW1A 5FB3A 3V8MA 1DJPA 5TMDA 1T9CA 2PZKA 5AOCA 4CCSA 3H3JA 2KYRA 3VX3A 4NBVA 1VIMA 1VI2A 3DEYX 3G2KA 5H82A 1XELA 3T7AA 4IEFB 4B3FX 4YRKA 5IZ4A 3B3JA 3IP8A 3CLKA 1SR8A 2BL4A 3A6LA 1N9GB 2B83A 5EWLA 3OWOA 1HI9A 1YIAA 3M1IA 1EK5A 2Y1EA 3OUTA 1V5GA 4S1OA 5CX1B 1VJDA 3KPVA 4C6TB 1E59A 4OQEA 3VAAA 5DP2A 2GD6A 3AEZA 5FI0B 1WXGA 3D1VA 4OI0A 2HMAA 3RM3A 1RZVA 3L8EA 2XDAA 2ZI3A 2ERYA 1WUYA 5CTJA 2SICE 1FMTA 4CF3A 4Y2YA 2BP7A 3EA5A 5GADl 3H0EA 3D81A 4R9RA 1KFKB 4MWEA 4DBLC 2B37A 4Z4IA 3WWDA 5HDQA 1WXWA 4EZEA 1MNQA 3AU9A 2G1AA 3I1JA 3OM1A 4PXAA 3TNDA 4DRXA 3DV0B 3NCHA 5BSHA 4M3NA 3TB4A 3FLBA 5H9VA 3DEIA 1C3JA 1SUFA 4R2MA 4ARUA 2UVPA 4GMKA 1EGVB 4BNWA 3TOSA 1HFJA 3F74A 2C2WA 1ZJ5A 5DIFA 4DVGA 3T1TA 3OP1A 4H7EA 4HUQA 1K86A 2VF5X 4O2BF 4CMIA 4HNVA 5B7GA 2GEKA 5LLDA 4BGEA 4XQ0A 3N8NA 1E2JA 1WB4A 4G4JA 4RH1A 3PUIA 3U26A 1ENPA 3N87A 3SVTA 3O95A 1LDMA 3AUTA 4QLBA 1NNI1 1L8OA 1GUZA 3WLFA 2CDBA 5HMMA 4Z4CA 3W78A 4DJAA 3PC3A 2E49A 1UWKA 3CG4A 4X8LA 3UG7A 4CMKA 2V7BA 1S7GA 1U5AA 2RKWA 3I2YX 2JAQA 3N0VA 3I6ZA 2ZIFA 4Y6PA 4B9EA 4N48A 4IDFA 1VKOA 1A5AB 3KZXA 2D0IA 1O6FA 4YN3A 1WJGA 2IEYA 5GP1A 1SQ6A 1WZIA 2X6QA 3FB1A 3OIYA 3UJ8A 3VFDA 5H5JA 1KFJB 1E2MA 4K9NA 4K6OA 3THWA 2FCRA 4KNYA 3CPEA 4GYYA 1QHXA 4REQA 4CQMB 1II0A 3E7XA 4DARA 3G2MA 3C1TA 5ULLA 1CJKC 4CEHB 2IEGA 4ANFA 2G76A 2FEKA 2PWAA 4X3CA 1JFFB 3E9MA 4AZ3B 3PGLA 3NHFA 1UPXA 3A3PA 3KLMX 4XYBA 4B73A 3KETA 4TWBA 2BR4A 2COKA 1RZ3A 2PMBA 4G5XA 5TT1A 3UK6A 4NAUA 1QFJA 4DKXA 3F6SA 1EUZA 5DSTA 1X7GA 1DKPA 1ZM2A 2H5JA 5AH0A 5JLAA 4DLNA 4WXEA 1N5MA 1ENOA 1NI4A 2ZB8A 3BJZA 3PC6A 3A6HA 4HEA6 2XSZD 4OHCA 4IS3A 1W4ZA 1V7PC 4EI9A 2AJLI 3UW3A 2E9SA 3KS9A 5EESA 2GKSA 4E0BA 4PZDA 1P6UA 2ZTVA 2J3DA 1XK7A 4J7AA 4EMTA 1Z5GA 4JQSA 4KDFA 2BKLA 1R2QA 3KYDA 1BZYA 1Y4SA 3MJHA 1G6KA 3OPYB 3W6ZA 4R31A 1IIBA 3OAAD 3U7FB 2VSNA 1EDZA 2A9PA 2GSDA 2Q3HA 1DARA 3GVPA 3VPHA 4IGIA 1ISHA 3EVDA 3FOZA 2D2FA 1W4CA 2R6CA 3LFUA 3QBDA 2Q3FA 2XNDD 4NG5A 4ZO8A 3NWJA 1UANA 2PBLA 4LDPA 2W2NA 2J08A 5LPNA 3D3WB 3KZ1E 4Q34A 5L53A 1USVA 3UHJA 4CM6A 5JVDF 4XW2A 4UM5A 1D09A 5CFPA 2V4MA 4L3OA 1VCOA 5LOVB 1T6BY 1TW3A 1EI9A 1VLQA 2P9CA 4NQZA 4BO0A 5JALA 1CUDA 1TT5A 3IV9A 4CYMA 4E22A 1TUBA 3IC5A 1O5IA 2LTAA 4GM1A 3CF6R 1TTQB 3ZYCA 3L7JA 5BVGA 1NLYA 4PLFA 4JSRA 1ADFA 5CGQB 3VYTB 5E7QA 1QTIA 2A9KA 4OLAA 3KT0A 2B61A 1N0WA 1P74A 2J3EA 3AP2A 1PT6A 3V4LA 3CNLA 4CV1A 2ZQYA 3HR7A 3QUAA 1N2IA 5CJ2A 1THZA 4KQ9A 4BQRA 4DIBA 1XU9A 1ZQ1A 2P9GA 3LC7O 2JH3A 2D59A 3PSHA 4UDYX 5AVVA 2CUTA 3PK0A 1XPRA 3RYIA 5IEJA 3PE4A 5BVHB 1I3LA 4H6WA 5JI3E 1I7SB 2IS1A 1A1SA 1IBCA 4DBVO 2V65A 5K9ZA 1MU0A 2X23A 1ECPA 5C3UA 1AV6A 3HWRA 3DT9A 1MC8A 3OO0A 4LMBA 1DXOA 4AUKA 3TINA 1XL0A 3V33A 1V2GA 3K4QA 4EW1A 5AXCA 1U9IC 1XJ5A 4WXHA 4Y2QA 1QCDA 1X92A 5D86A 1KZHA 3K4HA 1E1QD 1A9YA 2FSUA 2G5GX 2X76A 4B6FA 2GARA 5LB2A 3RIEA 4B2YA 1O0SA 3MD9A 1V8FA 1NF2A 4NMMA 3AEKB 2FWNA 4ZO7A 4BO2A 2QX9A 1NLMA 4NAVA 5FLKA 1XTJA 3ND6A 3HYNA 4NARA 2YR0A 2IITA 2GJ8A 2K2QB 4DWWA 4DIOA 2F8MA 1UBOS 2ZBGA 4LHXA 2XWQA 3KQTA 4DM3A 4BCDA 1ZMOA 5B36A 4B8ZA 2A4MA 5EGNA 4G97A 1LF5A 2YYZA 4Y9TA 1P5RA 4GMDA 5IASA 2PMDA 3QMPA 1VE3A 4G0UA 2ZIXA 4I1UA 1EDOA 1IN5A 4GQIA 4NBUA 3NEAA 3V97A 2DP4E 1BC5A 2O07A 4JYCA 1NW3A 4WIAA 1MXHA 3PXDA 3OA2A 4DSOA 2Y6VA 4HNUA 3I4LA 3G79A 2H1FA 4CLEA 2QUKA 3GC6A 3GJ7A 1NVMB 4HEA1 3D5TA 2NUTB 1I24A 1W4RA 2ZAMA 3K5WA 5BSFA 5CDYA 1T3ZA 2BH9A 1N9GA 4QC2A 1N2GA 5CX1A 1E9VA 3TLXA 3FPSA 4XGIA 1IOLA 5GV8A 2Z3ZA 1DCKA 4KBFA 4C6TA 4MROA 1Y9DA 4J1SA 1OXVA 3WMWA 1R0WA 4RL4A 1YK1A 4N8EA 3IOCA 5KI6A 3PX7A 1USWA 5GJBA 5LR6A 2FR1A 3ST7A 1QO7A 3BTSA 2HI0A 2NYAA 1ULUA 3KE9A 2UZ3A 4OH1A 2HK8A 5ICGA 4CGYA 5J4KA 1ZQ9A 2M1XA 4QJ5A 4OHRA 3R5KA 2QUAA 2C20A 4ZA2A 3L6CA 5ELMA 5C7IO 1C0KA 5AM5A 4I1IA 2D1FA 1AKTA 1DWUA 3RAJA 4W5QA 3SS7X 2QQEA 4Q9AA 3TE6A 2QAGB 2Q6IA 2AQIA 3EIXA 4ND5A 4OHYA 3MIZA 3DQQA 3CLSC 1E60A 3NV9A 4M8LA 3OZGA 4MV9A 4TS4A 2G04A 5COQA 1FRFS 4QU9A 1PVDA 4I5DA 3I05A 2C7VA 1NVTA 4CKWB 3TG8A 1Q83A 3PEEA 2D5IA 4BXOB 3QENA 3DL7A 5D7BA 2VWHA 1TD1A 2V03A 2Q4DA 3N6VA 4K2HA 3TPCA 2P9TA 1XZFA 3PUKA 1CRPA 3B6JA 4NBLA 3DV9A 2PBFA 1GYPA 2VUSA 3NR2A 2JGKA 2A1TS 3GLGB 1CF2O 4IJWA 3BGVA 4YA6A 4E2WA 2EVWX 3K9FC 2HUPA 1X1DA 1JHUA 1IZ0A 4UXHA 3GCDA 3GJ6A 4R7TA 4TRRA 4CF5A 3A6KA 1TUEA 1LFDB 2EATA 2CT8A 4HVCA 3G2IA 4LV5B 4HXYA 3X1XA 2ACKA 4Y8VA 1ZINA 3DMYA 3R5FA 1E6CA 1LZKA 1GTZA 1JZSA 2OQRA 5T4EA 3V8VA 1QQAA 4MHOA 4C2TA 1EK6A 5AK3A 5IUJC 4ME6A 4GS5A 1LQ2A 5EIBC 1LU9A 2ANCA 2GCOA 2WFMA 4DNXA 2FFBA 2EJCA 4D4JA 3DAYA 4NYJR 5GGYA 3K9WA 2DR2A 1T10A 3IELA 1FS4A 4ALJA 1JH9A 2B4RO 5DM60 1L5HA 3U40A 4K0RA 1I13A 2BYTA 1JFFA 3G8BA 3GP8A 3QMWA 2AUTA 3RS9A 1GL3A 3CTMA 2GJSA 2GAIA 1ZGJA 4XDHA 2AOWA 1JKFA 4FR0A 4IEIA 2AD5A 5IDXA 3QXGA 4N18A 1QZUA 3TXAA 2QE7A 3AWIA 2ATXA 4PYNA 2RGEA 3S29A 1ZM4A 2E1PA 1MOSA 4YJHB 4OHZA 3DYVA 1X38A 3AB3A 4BNKA 1GPJA 5KU1A 3C24A 4WKCA 4YRNA 4AP5A 2QD2A 1WCV1 1H4TA 5DNAA 1NUAA 2WWYA 5DYNA 4QBTA 4R1SA 3ZHYA 1TO6A 1Z34A 3OPYA 4JB2A 4U02A 5AWFC 2PJRA 2WKRA 1TA4A 3O9VA 4QPCA 4DT1B 2JIOA 4IX9A 4Q01A 5BSUA 4XPIB 3HKCB 1OI7A 3UFBA 3KIPA 2WIAA 4D2IA 3IRVA 3DTVB 1DS6A 2JFQA 3PWSA 5K0EA 2HHHB 1MG0A 1MJFA 1SEVA 2QHXA 1CR0A 3WP1B 1V41E 3GGGA 3KFLA 2QTCA 4CUJA 5K6AA 3T3NA 4LJSA 4MUEA 4X9XA 3D3WA 3KTOA 4LBWA 5F3DA 1DC4A 3SQLA 2VP0A 3U4CA 3KDSE 4LCBA 1YBVA 1RZRA 1OBVA 1PKXA 4BNYA 1S3IA 5LOVA 2J67A 3SXPA 5KBYA 3KR2A 4WKBA 3EFEA 4YDQA 3UJPA 2Y4NA 3B1WA 3HVUA 5IULC 4KV9A 3JQGB 4XSGA 2JFUA 1ONNA 2ZJ6A 5F35A 2CZQA 4EWLA 3DE1X 1T5IA 3WQQA 2A94A 2W6IA 4M9RA 4UKDA 3PFNA 3JQ6A 5L7YA 3W2EA 3FIUA 4A0QA 3M6MD 4FFVA 5C34B 2WZQA 3WLJA 1UK9A 5LBIA 1GPDG 1BMDA 5JO9A 5HE9A 4Z8YA 5KKNB 5JAOA 5KOHB 1HLDA 2ZPAA 1A88A 1Y1LA 2X15A 3AP1A 3Q8MA 5HCNA 2H18A 5LZ5A 3JPWA 4X7MA 3FNFA 4MP8A 2JG3A 5BVHA 4V0NA 1QF6A 2IDKA 2C57A 1D9ZA 2R60A 2W2MA 2UYOA 2Y93A 2W6QA 4BAUA 4XTRA 2PEYA 4GX0A 1GRCA 4PZ9A 2PA3A 2NVOA 2ZB7A 5HIAA 2RG1A 1WZ2A 2P9FA 3JARA 3N5CA 4K6GA 1XNGA 5A5VA 4DKJA 2A88A 3W2TA 1CNMA 3KB6A 4LJ9A 1PJZA 4K46A 4WECA 1OLSB 1ZZGA 4BZWA 1MRSA 4ZVQA 1FU8A 2WJZB 2IGBA 2WAMA 2DT8A 3F8TA 2XT0A 4PZCA 4HO1X 4V0QA 5LKRA 1C4WA 1EG7A 1M8GA 5IVPA 2C59A 4KG7A 4FYHA 2NQ2C 5E2IA 3UWPA 4ILEA 3URMA 1EFCA 2VAMA 1IHUA 2YZ7A 3BFVA 1YJAA 3BB3A 4N41A 4BFCA 5B2ZA 2NTJA 1QKJA 1COWD 3QM1A 3CXRA 1MBZA 4KXVA 3W1VA 2QM0A 4UAUA 4O4LB 3OQ1A 3C4VA 1G8YA 2R62A 2YJ3A 5EPOA 2HJGA 2PRZA 1PL0A 5FI1B 7ABPA 4IVRA 1R64A 4DQVA 4M1EA 1UP4A 2IYEA 4JENA 3EG5A 3DEJA 2JIRA 1SUDA 1JILA 3GCWA 5ALPA 2HWUA 3SKYA 5GAJA 1QIHA 1SU6A 4PE5B 3OD1A 4C0AC 1U0OC 4BQNA 1YRHA 2FWIA 2OA0A 2FSVA 1TFRA 2DCUA 2GERA 1EE9A 2GDJA 2J4CA 4QOJA 4RC9A 2ZDHA 4XWAA 4RK6A 5CCXA 3JSXA 3PE3A 1W8DA 4EW6A 1UDXA 3GLUA 2OAEA 4H7IA 1NR1A 4D9GA 2ONZA 4IJQA 1SELA 4EIWA 1GPAA 4PEVA 1EBFA 5IYZB 3EB9A 3EBLA 1RRFA 1R9NA 1XQVA 3TR5A 3A6FA 3GNLA 4CMEA 1EFVB 1JQBA 3ECSA 5DGHA 1RC1A 3V4OA 2F9LA 2H3EA 2Q9UA 1JIIA 1G21B 4KR7A 5FF9A 2O1WA 2HO4A 4X6YA 1W2HA 1L4NA 1JDNA 3D7KA 3MLBA 1XZIA 2GT1A 2FMKA 5EI5A 3H4TA 3DFZA 3H2GA 1U2SA 2D4AA 3GT7A 3SBDA 3R3VA 3C45A 4QRHA 3ZHCA 1R50A 1WXQA 2HCFA 2I22A 4Z9XA 1LQUA 2JHPA 2FEWB 3V9PA 2FVXA 1ENYA 2HF9A 1B14A 4WY8A 5KTMA 4U7TB 4MS1B 2X0RA 3A37A 3ZDQA 3T3OA 1U7WA 5KVCA 1AV7A 2ILTA 4RZ3A 2X0DA 1VHLA 3C5VA 4N3AA 2JS7A 1F5NA 4RHUA 3JVUA 1YZYA 4ZODA 3WRWA 2BKEA 2J5KA 1B23P 1XJQA 5JNLA 4FFBB 4FEGA 4QPPA 5I8WA 3LK7A 4QPDA 3GLGA 4EY6A 2GA9A 3CVXA 1RJGA 5JHHB 2R7MA 2GLUA 3DZIA 4QVKA 2AN1A 3RW9A 4I66A 2ZR9A 5KIAA 3T9EA 4XWGA 5ECYA 1YRYE 2HRCA 5KAMA 2ATCA 2CNKA 1FUEA 2JGAA 2ZSDA 1SVMA 3DM5A 5C8YB 1QGUB 1L1EA 5EJMA 2X0NA 5JNRA 1LA2A 4MZXA 1FEZA 3P2KA 1ZR4A 5SZIA 2GN2A 5L4SA 4QQKA 1L4YA 1OH6A 1B73A 3IT0A 2NO9A 4HXEB 4OA8A 5KPDA 1M8JA 3HXTA 2EL7A 3RS2A 1M1UA 2ZIWB 1N3LA 2WNSA 4EHBA 1IQUA 3VKWA 1EEXB 5JS6A 2H1VA 2HT1A 4OGWA 2ESRA 1QB8A 3CEJA 4MR8B 4MYRA 2H9YA 4KWTA 1L7XA 2AC2A 2VSXA 2V6IA 3EGVA 4PXYA 1FNDA 1N1MA 1CQWA 3HB7A 3ZW9A 4LYGA 5AW2A 4YRDA 3SIPA 1RAGA 2I62A 4G5HA 4W5RA 4Q7KA 4OGKA 2C8KA 3PSAA 2IU6A 1QIGA 1AQLA 3HN2A 1UMKA 1O1YA 2R8RA 2RGNA 1M2GA 1PP4A 3TL3A 1P1HA 2NACA 3EGWA 3AQIA 3L4JA 1GDHA 1DADA 2PKYX 3CHYA 1SCAA 3FLAA 4WOBA 3GLGE 3DL4A 3SQXA 1UKYA 1WXDA 5F76A 1O0BA 2FN9A 1R4AA 5I4IA 1ZNZA 2D62A 5DPMA 1FMCA 4WY5A 5TMEA 3TGPA 4PC6A 1I2MA 2VQ6A 2R85A 4CI0B 3FCUB 4Z4FA 3LKBA 2AZ4A 1YMQA 4A8HA 4JMPA 3L0DA 3FYSA 4PFQA 5ELLA 4LMAA 3VR0A 1YVPA 3M4JA 2X58A 6Q21A 4BJ5A 1MA0A 5I9MA 2P2NA 4XPIA 3HKCA 4J2HA 1XN1A 4FYKA 1R0YA 4N54A 1ADBA 1AKWA 2VPIA 4FDAA 1RRVA 4MTLA 5BW6B 3AKDA 4QEKA 3GJ0A 2V55B 1WZCA 3F6RA 2IFTA 2JJ8A 3RVNA 3VR6H 4D56A 4DDHA 1G8FA 4A7PA 4YHHB 4DJJA 1LLUA 1FQJA 2P3QA 1E3TA 5EZSA 1U1FA 1NQXA 4Y6OA 3W5JA 1QMGA 5CA0B 1U1GA 1C14A 3AIIA 3DB1A 3P52A 3L01A 1RHJA 3E3OA 4K3UA 4JBHA 3T15A 3WGYA 4AMBA 2HDHA 4DA6A 4CTMA 2JB9A 1A96A 2J3QA 3H6HA 3G1UA 3HXOA 2B5VA 1CZLA 1FYXA 1R5NA 2R00C 3FDXA 1MX5A 2AC7A 2V9ZA 3JQGA 2A0UA 3LT0A 3MTEA 1ZEJA 4KOAA 4RKWA 1T13A 4FBGA 4H4DA 4JJKA 1GRQA 4FFDA 1LWNA 4H2DA 5LZ8A 3R3UA 1C3OA 1Y8AA 3T9DA 3AU8A 3VYRB 2IYWA 3CX3A 2CE7A 4EF6A 4IDCA 2GVNA 2H63A 4X3PA 3BDVA 3CRQA 3F5MA 1T3LA 3P26A 3W90A 1ABFA 4HFMA 5BMVF 1F4VA 2ZE5A 1VLLA 3W8NA 3K9BA 4DCNA 5KOHA 1GKUB 4IDAA 4HLUA 1RC8A 2Z9BA 4X66B 5C3MA 4QGBA 1E9AA 4TQUS 1KE1A 4AMUA 4JLVA 3PC7A 1A4XA 1T3GA 4GR4A 3R7BA 3UPUA 4KQGA 1NW6A 1N7IA 3E8XA 4JS0A 3VYUB 1NF8A 3QVUA 1BNCA 4EW2A 1EBBA 1T0JB 4G63A 4Q05A 5CFZA 1UC4B 5DSZA 1LI5A 5L3VA 1E92A 1NNEA 3V8PA 5A9TA 4YCAA 4LFCB 4JDPA 3V4PB 2PXXA 4ZTZB 3NAZA 4DCGA 2F64A 5J2UB 1J4AA 3VJKA 1CY8A 1J0EA 1OLSA 2P6NA 2ZWOA 3G8AA 3LOUA 3N1UA 1FNSA 1I4EB 5CH8A 4M0LA 5KQRA 5CUQA 4MYTA 4J3FA 4JB3A 5IFLA 2J33A 4KACA 4TZ0A 3S3TA 4JIMA 5CA1F 3FR8A 4UBKA 3G9QA 4YIHA 2XB6A 1CIPA 3ETGA 3F5DA 5IDQA 2XMPA 2NZYA 2AMYA 4GOMD 4BMXA 2C7QA 2L69A 3HUUA 3RKUA 3VR1A 5M2QA 1M9NA 1L5WA 2F2TA 2ZXFA 2P5SA 4BNTA 5D5HA 4DHWA 4I6GA 5LQKA 2ZUDA 1SUAA 4RHEA 4XCQA 4O4LA 4YRIA 2Q1SA 4D4LA 3N0TA 4DV2B 1ZU5A 2VEDA 1ID1A 3E5RA 4QFDA 2JEYA 3FKJA 1GGVA 3VH1A 4PS0A 3DFKA 3I53A 4W5TA 2GPBA 2PGXA 4NBSA 4C2UA 3U4HA 3AFOA 4LZPA 1K8ZB 3TLGB 1QG6A 3GRCA 3N2NA 2WFAA 2NXWA 1UEXC 3AP3A 5D3MB 2FQYA 4GR9A 4P31A 3R7LA 1WNFA 3NHPA 2UAGA 5DEOA 2ZSKA 2CNBA 2WF6A 1ZHHA 2XQIA 3RPEA 2BFEB 2ZRJA 4FN5A 1O5OA 1TLFA 2PFGA 5JS8A 3DP9A 2WAAA 4CIYA 3FETA 1XTQA 2OKCA 3L4EA 1NBMA 4BUCA 3VU0A 1SVLA 2Z2ZA 1Y8RB 4AMVA 5IVHA 1UBJS 4MQEB 4LCEA 2RK3A 3AR8A 3SLRA 5IYZA 4EMUA 1V45E 2X4GA 3BXPA 4A23A 5C81A 5KC9A 4MARA 3PNBA 3RBVA 1TCUA 3GUZA 1Y4UA 4X6XA 2HO5A 5ALFA 2XD4A 1XD2B 3UC5A 5K45A 2ISCA 3LQ1A 3T9CA 1NVKA 4DMHA 3FVVA 3MT9A 3U56A 1YRQA 3AVQA 1OI3A 3KR1A 1YAHA 4IH4A 2X8WA 4Q66C 4E08A<