5CB8A

Crystal structure of adenosine-5'-phosphosulfate kinase in complex with aps and sulfate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
174
structure length
174
Chain Sequence
QRGVTIWLTGLSGAGKTTITHALEKKLRDSGYRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRIGFVSHLLTRNGVIVLVSAISPYAAIRQEVKHTIGDFLEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRTDLEELDESVGKIWQKLVDLKYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recapitulating the Structural Evolution of Redox Regulation in Adenosine 5'-Phosphosulfate Kinase from Cyanobacteria to Plants.
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Transferase
molecule keywords Probable adenylyl-sulfate kinase
total genus 72
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cb8A00
1KK0A 1Z22A 2GDJA 3CBQA 4DRZA 3TUZC 5HZHA 4LJ7A 5DYGA 4M1SA 3PVSA 4XD7A 1XD8A 4JVMA 1H65A 4F7WA 1PVOA 2VLIA 4AC9A 3PXGA 3IGFA 4LWZA 3U3RA 2QUZA 2C03A 4N1AA 1S9DA 1W0KD 4I1OA 4XJXA 3IPYA 2C96A 2A3RA 2ZM5A 1WE2A 1M1YE 2PZGA 3PR1A 2FH5B 3TBKA 1FOEB 1LB1B 1GM5A 1LS6A 3CWZA 3CF0A 5CIQA 3ETLA 3Q9LA 3TAHA 3VX3A 4C7OB 4D0GA 3GQBA 2OHFA 2G77B 2ZSFA 4KLZA 1KI2A 5FBWB 3LW7A 5A4JA 4A4DA 1TAGA 3M6AA 2WWHA 1E1RD 1NLZA 3O8RA 1E2MA 1E2DA 1E9BA 5D3MB 4D4KA 1VCIA 2FFHA 5BN3A 3BH6A 3LX8A 3EX7C 3TJZA 3I62A 5FI1B 5FBLB 3LO5A 1XEWX 4JBYA 1E4VA 3L8YA 3FYHA 2QMOA 2KBFA 3AF4A 3B13B 1ZM3A 1JJVA 2H57A 3TE6A 3ZIAA 3KX2A 3ASZA 4O2LA 3SJCA 5KOYA 2ZRNA 4IDPA 1XEFA 3WNDA 4BEBA 5E7JA 2JGNA 1DELA 1CP2A 4DIDA 4TMXA 1G17A 1O87A 1VPLA 1A7JA 1U8YA 1G16A 1EG7A 4OKSA 1NI3A 5KHOC 2YINC 2GHIA 2XSZD 3RAPR 1SKYE 3N5CA 1ZMXA 2GF0A 3U3KA 4NONA 2ZSAA 4LGMA 3GLFE 4DIEA 1W4RA 1SVKA 3ECCA 1TF2A 2GESA 4RKEA 5H68A 1KDPA 3TW8B 3V4FA 2WAXA 2OZEA 3RSLA 4RZUA 4B74A 2OXRA 1CIPA 2YV5A 4A2WA 1Z28A 2XTZA 3FKSA 2QG6A 2NZJA 4A2QA 1DVRA 2JLSA 3KFVA 2D3WA 2TMKA 1RVDA 3D3QA 2HT6A 3OIYA 4MRRA 1YR6A 1ESMA 1M8PA 3ZGXA 4B2IA 1T5IA 4HEJA 1YR8A 1OKKA 3E1SA 4OHWA 1GTVA 5EP4A 4MKHA 1V5WA 3CB4A 4G3XA 3CKLA 3B7GA 2OV2A 2GXSA 1CJVC 2OBNA 4OJQA 2ATXA 4OQNA 3HDTA 1G6OA 1F2TA 5EP3A 2PJZA 1NJGA 1FX0B 2ZR9A 2ZJ2A 2I1VB 5IRCD 2IF0A 5LD2C 1F2UA 3BFKA 2NO0A 3PG5A 5FTJA 4AIIA 2N1BA 4R9UC 2PH1A 4ZKEA 3AEZA 5CDFA 3B1XA 4GZLA 5CM8B 3EIHA 2D06A 2ERYA 2JDIA 2C9OA 3CX7A 4RD1A 5CYOA 3OE7A 5JSZA 2KWIA 2Z6VA 1SVWA 2VF7A 4E5UA 4QJ3A 4ZCLA 2IXGA 1P61B 3B9QA 2IWHA 1XMVA 4GP6A 4PPQA 1VDZA 1S1MA 4OI1A 2MSCB 4HUTA 3SR0A 4H9GA 1QZXA 1ZUNB 1US8A 1N0WA 1XEXB 4MGKR 1GAJA 4TMKA 3UIEA 1KDTA 2Z43A 4ASUD 3EPLA 2VL7A 2RB4A 4H1UA 4Q66C 4HLCA 3SHWA 4TLDA 2ZJYA 2YWFA 2BMJA 1OYYA 4L5BA 3I1FA 3SFVA 2HT1A 1VYTA 2X2FA 4MGYR 3VX4A 3ZD7A 1D5CA 2XGJA 1CU1A 4JLMA 2ZRCA 4GL2A 3LBNA 1CJUC 4X8LA 2C98A 2QQ0A 2ZSEA 4AK9A 2GNOA 5DI3A 1SVSA 3KZ1E 4B3CA 3ZIAD 3B6EA 1JJ7A 3KL4A 3DKPA 3IEVA 2IUSA 2GK7A 2QN6A 3GLFB 4P4SB 3ZVNA 2OSBA 4HATA 2EFCB 3RRMA 3U61B 5DI3B 1KJWA 2ZE5A 2JIZD 3THWB 5JEEA 1N3BA 1AA9A 3F5FA 2B7BA 2FFBA 5TDHA 5FBRB 4QNRA 4DHEA 2JJ1D 3FHCB 1OT3A 1E2IA 2WJIA 2PX3A 3CRMA 3W8RA 5JCPA 5DH9A 5FBQB 1R5NA 4NH0A 1VTKA 1FQJA 2AKYA 1ZYUA 2EFGA 1G3QA 1Z47A 2ZANA 521PA 1G7CA 5JRJA 3QXSA 2Z0MA 3LBHA 2ZU0C 2WWFA 2CDNA 3CH4B 3SDZA 1R2QA 2NQ2C 1NBMD 2HLDA 4FWIB 3IKJA 4KAXA 3RS3A 4LDJA 2GJKA 1W5TA 3CNNA 2B8WA 3KXKA 4WBSA 1T8UA 4A9AA 2W6JD 3V9PA 3WMFA 2BWJA 1GWNA 3WNCA 3LXXA 4QBHA 4YMWA 3GFPA 4JBXA 5FL7A 1BH2A 5AUNB 1XMJA 1ZM2A 2F9MA 1F2UB 3OEHA 4Q00A 2XEXA 1OYWA 4QL3A 1EFHA 1A2BA 2DHRA 3SFZA 1KJZA 2RHMA 2CVHA 4RD2A 1E2HA 3H4MA 2OXCA 3GJ4A 4LHZA 1YZNA 4FMCF 3T06B 2QI9C 821PA 5A5GA 2GEVA 2BBOA 4JJZA 3UATA 2GAOA 1TEXA 4BRWA 2BKUA 4CEIA 4M1KA 4X8HA 2G9NA 2OM2A 3DEFA 4KV9A 3A4MA 1F60A 2D7DA 4XVRA 1UBEA 1MO6A 5DGXA 5KDOA 3T1TA 3WP0A 2ZRPA 2HDNB 4ZDKA 2REBA 2RGXA 3ZH9B 3T15A 1J90A 4P3YA 5AUQA 1TU3A 4NCJA 2F3RA 5L3QB 3KQHA 3WHKA 2VHCA 3BH0A 4NKRA 5DHFA 3FPAA 4AURA 2IUUA 3EZ7A 1KI9A 1EFRD 2WJJA 3W3AA 3MWLA 1WXQA 2YHSA 5CM9C 1AGRA 2AK3A 4KU4A 4KJZA 1PLJA 2F43B 3MMPA 4DCNA 3K0EA 3NBZC 3UG7A 1C4OA 1CR0A 1SQ5A 3FFAA 2XOKA 5G40A 1U81A 4R7ZA 1GFIA 1JXMA 1XJ0A 4L4UA 3MJHA 2PL3A 4JT4A 1QG2A 4U5XA 4ARZA 3V4RA 1RRPA 2Y8EA 4JLOA 2BBWA 2C77A 1E2FA 1NKSA 3DZDA 5DLQC 4TTRA 2XNDD 4LYJA 2V1UA 2Z83A 2ZS7A 1G20E 5E4FA 1R0WA 3ZYCA 3RC8A 1JAHA 2A5GA 3AH8A 4UJ3A 2LCFA 3KKOA 3U44B 1YJ5A 2J59A 2JEOA 3IQWA 4O3MA 1BO6A 4QM6A 2O8BA 2XAUA 4QJ4A 1GOTA 3PCRB 4CT4B 4BFWA 2WKQA 2HF8A 2YOFA 3GLHB 4M8NE 3U7FB 2O8EB 3GLIA 4DJTA 5TARA 1Q57A 3U44A 2GF9A 4I81A 4QGHA 3BIFA 1KSHA 4PHTA 5HR5A 2WJVA 5KPJA 4A6XA 5IT5A 2XZOA 1H8HD 2J7PA 5LD2B 2XITA 1Q1QA 1HH4A 3WHLA 2AKAB 3Q5EA 4B6EA 4UNRA 1SGWA 4LJ5A 2NPFA 1WB9A 5JMTA 4WZ6A 2W00A 1P73A 1KOFA 3CW2A 2QP3A 3K09A 1LTQA 3GEHA 1IJEA 1B0UA 2WSMA 3QVVA 4HAYA 4DCVA 4B76A 4DDUA 2ZRIA 1ZJ6A 4URVR 2Q9AA 3KXLA 1IXZA 1XTKA 1QBKC 4R2IA 2YVUA 3REGA 3RS7A 1W36D 4Q1AA 3RHFA 2ZSBA 1E2EA 4HB4A 1DAKA 4URZR 3K0SA 3KXIA 4LSGA 2KJQA 1IY2A 4LHWA 2EVWX 4B75A 1P6XA 3H86A 1KMHA 5L3SA 3A58B 2MSDB 1L2TA 1DAGA 2ZAOA 1G8PA 1MOZA 5C46F 2AX4A 5CK5A 2QQEA 4LBZA 5IK2A 3I61A 4LJ8A 2H5EA 4V0MA 4H1VA 4UKDA 5L3VA 1G7RA 3LV8A 1KI6B 1Z0DA 4LC0A 4DLZA 1UAAA 3PEYA 1GRRA 2CLDX 1W44A 1W1WA 3N70A 2WOJA 3RABA 4QBIA 1OIVA 2JLUA 4JYBA 1G3RA 4X8OA 1IM2A 1PZNA 4EFNA 3VU9A 2VRWA 4JZKA 3R9XA 3SJBA 1AZTA 5J5CA 4GI7A 3UPUA 3IILA 2XOKD 2FWRA 1YQTA 4FN5A 3QSYA 1EK0A 2YWGA 3OF5A 4BZPA 2VP2A 3UK6A 1J7KA 1OF1A 1SHZA 2GCPA 2HV8A 2ZYWX 3QUSA 4QHYA 3T5GA 3DO6A 2KB0A 4BUJA 1T0HB 2P5TB 3GD7A 3I8SA 4MKIA 1M34E 2ZRKA 4IKEA 1II8B 1ZRHA 2BJVA 5DHAA 2FG5A 5DISB 5KSPA 3P26A 2IWRA 2NZ8A 4Q4HB 2IYYA 2QSZA 4HAUA 4YDHB 3LRPA 4D4MA 5LPNA 1QHNA 5DO9A 2FFAA 1N2CE 1P60A 2H16A 1W36B 1WMSA 1XRJA 2IX3A 5G3YA 5KDLA 3SOPA 4DDTA 4V0NA 1AIPA 3C41J 2UZ3A 4DLXA 1P9NA 2QNRA 5HKKD 5J4LA 4MRPA 3BJIC 3BFXA 1OSNA 1DAMA 1E79D 1XP8A 2AL7A 2H7VA 5GJBA 2B6HA 3SC3A 5FI0B 1OKKD 1YE8A 2CBZA 5GADl 2QTFA 2GCOA 4LRWA 2EFEB 3C5CA 2OCBA 2ZXUA 5K8IA 1BOFA 1TNDA 2F1JA 2RGBA 3KTAB 3Q3JB 2KBEA 2DWPA 5J4VA 3PUYA 1P2SA 1I4TD 2CVFA 1YVDA 4M21A 3AKCA 3WYGA 2OBMA 3CPHA 1J70A 4FXPA 4YMVA 4M53A 2AXNA 4QRHA 1R6BX 1E2GA 5TY0A 2F7SA 1R0ZA 3T34A 2FDCA 4QJ5A 2ZETA 4LV6A 3TLXA 1E2JA 4BWYA 3FGNA 4DCUA 3C16C 4Q9KA 4Z8XA 1G3MA 1H8ED 3ADDA 2J41A 2ZU6A 5UKDA 2D2EA 1NVUQ 3E2IA 4KVGA 2QM7A 2DB3A 1E1QA 4YMSA 4B3FX 2ODBA 3ADCA 3H0KA 1JAIA 1NBMA 2HLDD 2NOAA 1SKYB 1CLUA 1E69A 2D62A 5IK2D 2VP0A 1KYIA 3EIEA 4FMDF 5HCIA 1NJFA 2UKDA 3QQ5A 4XD7D 1E9EA 4HAWA 4US0R 4A0HA 1QVRA 3QF4A 1D2MA 1JR3A 5H70A 1YZGA 6Q21A 1ODFA 3M1IA 1K8RA 1W0KA 3OEHD 1HE8B 3UXMA 3FB4A 4RD3A 4TYYA 3GLHE 2G88A 4JLAA 4ARZB 3CR7A 1J8YF 5IHPA 1UKZA 3OIUA 4D80A 5J47A 1EESA 4L8GA 3UWOA 4M9XA 4PSKA 1Z2CA 2HYIC 1L4YA 2WJYA 4ZCIA 3CF6R 2UVQA 5BN4A 2FU5C 5CB6A 1YZUA 1KZGB 5CIWA 1RRFA 1NN0A 1W47A 4RFSB 3HYTA 4O2RA 3EPJA 2WBLC 1OH6A 2EYQA 4Z1MD 2PT5A 3CRW1 2OT3B 1Q21A 3QY0A 3AVOA 3DMNA 4UNPA 1NVVQ 1Q3HA 2FSHA 3GFTA 3CM0A 4W5JA 4WZBE 1MABA 2RGAA 1HURA 2I3BA 1IN4A 3QBTA 1VHLA 3HJNA 3KB2A 3RNLA 3I92A 5HZKA 5LB4A 3SS8A 1F5NA 2WJHA 4AG6A 3B1ZA 4FMCB 1N6HA 2JLYA 1GKYA 3KJEA 1MABB 5EE5B 4EPXA 2RMKA 4Q9LA 4KYUA 4Q9HA 1GNRA 3UG6A 2IYSA 1D8TA 2ZVQX 2VH5R 1W46A 2DY1A 2C9CA 5F98A 1Q22A 1X3SA 2BV3A 5JJLA 2GJ8A 4DSOA 2B21A 2JASA 2VQSA 3I32A 4BLSA 4GDFA 1R7RA 4V0ME 4DEYA 4PO1A 2R8RA 4IDNA 3R9IA 2ORIA 3R9WA 1OFIA 5FBVB 3K70B 2FFQA 2QEQA 3ICQB 1GG2A 3K1JA 2ZTSA 2O8FA 4I1VA 3CNOA 4PO9A 4TL8A 3PUVA 3P1JA 5C2JB 3LVRE 3P4XA 2C8VA 3ZZTA 1NVVR 2R6GA 1XBTA 4KODA 1ZU5A 2A5DA 2JA1A 2ZEJA 3W34A 4PHFA 3U2QA 1AS0A 3IIMA 3QENA 2OO7A 4J0QA 3ND9A 4P4UA 5LDDC 1M7GA 3HYRA 1ZUHA 4PO8A 3TVTA 3O8CA 3DKVA 1T9HA 3QF4B 1KK3A 3K70C 4LV5B 2FGKA 4TQAA 1DPFA 3R8CA 3H84A 5CJ2A 2CCKA 4XOIA 3QKUA 4GT1A 1X1SA 3VR6A 4B35A 4Z51A 5DI9A 3THWA 4TLEA 4FCVA 4B6FA 1XTIA 3N2EA 3NHAA 4HZUA 1S96A 4ZIRA 1T3HA 4PAMA 3IUYA 3CRVA 3LXRA 3UANA 1GZSA 4GP7A 4KBGA 4HB3A 4O25A 5EE3A 3ZZ0A 5J4YA 3RWMB 3LD9A 2PMDA 3X1YA 4KBFA 4M1TA 2J46A 2RAPA 4LOAA 3GJ0A 1LVGA 2PEZA 1I2DA 3VHLB 5FPKA 2BCGY 1G8YA 1Z0KA 1NIPA 1N0UA 2WPDD 2ZRFA 1NY5A 1T6NA 4RD4A 4F4CA 1G4UR 1N6OA 2KE5A 2W2TA 1NLYA 5DN6A 3RS0A 2EWWA 2WIBA 4HZUB 3RVBA 1SXJE 3U7EB 3R8FA 4B44A 1GKIA 3QOFA 4A8JB 4Q02A 1KKMA 2JCSA 3LBIA 2ZQ5A 4FMDB 4ZPXA 4D82A 2O8CB 1NMYA 1YHNA 3TGPA 3KKMA 5HTKA 2WVJA 4PC1A 4NYJR 1OH8A 4M1YA 3X1DA 3QKRB 1PLKA 5JECA 5E7MA 4BLOA 4IEEA 4LYAA 2BBSA 2V7QA 2YYZA 3CPEA 4X8MA 3QE0A 3SJZA 4B71A 1Z8FA 5EE0A 5KYKA 5IDVA 4TZ0A 5HE8A 1KI3A 4ZI3A 3GLGE 1FMJA 4Q4AA 5H1YA 3GJ3A 4US1R 4A0RA 1N6RA 2B8TA 1TADA 3W6OA 1N25A 4JBWA 2YZ2A 1E2KA 2NGRA 1E1RA 2CE7A 2JIZA 4NYMR 1R8SA 2KSQA 4HLDA 1FP7A 1BMFA 2BHRA 1FUKA 2BIFA 5AJYA 2L0XA 5FPHA 3K0CC 4NDZA 3REFA 5GVRA 2LKDA 4CEHA 4KLNA 4QC2A 3RS5A 4AKGA 3THYB 3U3JA 3C8UA 4IW3B 4OHYA 4F93B 5JJIA 2BBTA 4NHOA 4QM7A 1XZQA 1I4DD 2YNMA 2QRNA 1S3GA 4GMDA 2QAGC 2XXAA 1MR3F 1RIFA 2XX3A 2J5XA 2NO6A 5KNCA 1TUEA 4QXAA 4W5WA 1JR3E 4CRWB 2ZJAA 4D2IA 3ZVMA 4A36A 4AY2A 2W2XA 1G5PA 2VF8A 2QZ4A 3HU3A 4JVSB 2BOVA 2IBMA 4PSAA 1XTJA 4UQOA 5EUMA 3MWKA 4NPHA 5GJVC 4GPTA 4A8JA 1JR6A 3AF0A 2P6NA 2VHJA 5F2EA 3A4LA 2GVZC 2H8KA 1E0JA 5FL7D 3W6PA 4LY6A 3LLUA 2Q21A 4C4PA 4MDEA 4JLKA 3BB3A 3NKVA 5E7IA 1R5BA 4ZKDA 1CJMA 4IOKA 1A82A 2VSFA 2XJ9A 1S2MA 1XZPA 3LA6A 3VR5A 4C2UA 2AXPA 2J45A 1TQ4A 3JZMA 4D0LB 3L0PA 4XTCS 3RRNA 1ZU4A 2JJ8A 1CJKC 3IHLA 1GILA 4LJAA 2BDTA 1VG0B 2DWQA 4AYTA 2ZR0A 4E07A 2FOLA 1RRGA 3AGPA 4ZIRB 4PQRA 2W6IA 4NCIA 4W7SA 3GP8A 1E96A 1G4AE 3AF3A 3K9GA 3TKLA 1WF3A 2C78A 4EFLA 1T5LA 2IF2A 4N0DA 3SJAA 1OJLA 5DE3A 3W5IA 5L8VA 4Q5IA 3K70D 1S4QA 1DADA 2VTKA 1NP6A 4QHTA 3R7WA 5ELXA 5B57C 4D4LA 4XWOA 4IOMA 4CT5A 1E6CA 1ZNYA 4Q1DA 3FE2A 3THOA 4CF7A 3HPRA 4JIMA 4LPKA 2P2LA 1OV4A 3HWSA 1XTRA 4DSNA 4LBWA 2ANCA 2DWOA 4LCBA 2QRZA 4EUNA 1GUAA 1QHGA 2R6CA 2G1JA 4HB2A 3SN6A 4B33A 2X1VA 1ETUA 2FEOA 3DVLA 2G0TA 4B3XA 5CYPA 2PCLA 4KO8A 1VCMA 3U4QB 1GIAA 3J81k 1EXMA 1XEWY 4AYWA 3N2IA 1IY1A 1COWD 3CZQA 1RPZA 1JQLB 1KY2A 3EC1A 5AR1A 3KJHA 5JWOA 4Q21A 4WIAA 4HUQA 4U7DA 1PUIA 4NYIQ 1GL7A 1R5OA 4FCWA 2Q3FA 2WV9A 4A2PA 4CYMA 1MO3A 3S1AA 2IS4A 5JSZB 3TSOA 3VQTA 4RVCA 2H17A 3HU1A 1KSGA 1NSFA 4EKDA 4HZIA 1NSTA 4DT1A 3EWSA 2JJ2A 3LDAA 4TYPA 3KB1A 1R8QA 2NO1A 2J0VA 3LQQA 1SULA 1UKVY 5CK4A 2IHBA 4IOLA 3IIKA 3EZ9A 1IN5A 1Z6TA 4FW9A 4OK5A 3WBJA 1LFDB 2JJ1A 3GEIA 3EIQA 2BCJQ 2H18A 4RFSA 5SZKB 2HJGA 1F48A 2QGZA 3NTUA 4MRVA 4V0OA 1NVWQ 1SXJA 3MAAC 4JYCA 4B3GA 1VYUA 1YZLA 1N5IA 3D31A 3RS2A 3NC0C 3HR7A 3ASYA 1N6LA 4DXAA 4NYMQ 1O3YA 1HT1E 1GNQA 2CNWD 2A2ZA 4G5GA 4GOJA 1L7VC 3MJRA 3S1AB 1DARA 2VYFA 2BJWA 3P32A 1X8JA 1Z08A 4P4TA 1QHSA 4QBFA 2QBYA 4Q9IA 2XZPA 3BXZA 4ITRC 3THXA 5JS7A 2GCNA 1E2QA 2W2VA 4YONB 4JKYA 3VKWA 1E0SA 2GKSA 1OH5A 4DLVA 1G3IA 2GBLC 2WJGA 4AKEA 4XSGA 3U4QA 3KUCA 1S1CA 1M2OB 3E70C 1M6NA 2CL7X 2OFXA 3PEUA 3QKSB 1G8FA 4QKQA 5F9FA 2HUPA 5FTMA 1BIFA 1E9CA 1AGPA 3OFNA 5LB2A 2IC5A 1UKEA 1VYVA 4MGZR 3NH6A 3VR4A 5L3SB 4B3DA 5JS8A 5C18A 1A1VA 4DLTA 1KAGA 1KO5A 4KITB 1G9XA 1KKLA 4JLVA 4IVRA 1V43A 2P67A 2YWEA 3GFOA 4TT3A 3U7GA 1JPJA 3EW9A 1XF9A 4C2TA 2XTMA 4PTLA 1IN7A 4P0TA 2IT1A 2IYRA 4QHSA 1LF5A 2EFDB 1TF5A 2BKEA 5EP1A 2EWVA 2KI5A 4IVPA 1P5ZB 4K8OA 2C2HA 5GJWC 1RFLA 4Q1EA 4JT2A 2VP9A 3VHXA 1Z63A 1GSIA 1UFQA 4LYHA 1G7SA 1ZM9A 1IAQA 4OQFA 4OQLA 1NN1A 2Q0HA 4G01B 4F92B 1TU4A 3AVQA 1IN6A 3NBFA 2E1RA 4C7OA 3NH9A 1VMAA 2QORA 3DDCA 4M0LA 1N5JA 2C95A 2QTVB 2CLSA 1RW4A 4JJKA 1G3UA 1U0LA 3A1TA 4KFSA 4LPSA 3A6PC 3T1QA 1DG1G 1KDOA 1MT0A 4GMXA 1AS2A 5BW8A 2ZRJA 3GLIB 2QU8A 1T91A 4RZ2A 4PQYA 2FN4A 3LQRA 5J4KA 5AWFC 4TSFD 1B23P 5C4MA 2N46A 2IS2A 3NBYC 1U9IA 1QHYA 1VKJA 4C30A 5KDDA 3FWYA 2PLRA 1US8B 2OCYC 3QPUA 4B34A 1ZC4A 4P31A 1FW6A 1BMFD 4AKHA 3FKSD 4AD8A 2R2AA 2CLCX 4IFBA 1P75A 4JKIA 3AM1A 2YOGA 1AS3A 4V0LA 3GJ7A 1DOAA 4HDOB 3WYFA 4W9MC 3QPVA 2OEPA 4OJKA 1Z0JA 3EZFA 4MYUA 3UMSA 2HYDA 2JLVA 4I99A 5SZIA 3T61A 1P2VA 3AVYA 2WM9B 1A4RA 1GP2A 2P6UA 5JRZA 2O8DB 1H8EA 5EQTA 1H8HA 1YRAA 2J7PD 1ZCBA 4A0FA 1W36C 1KY3A 2OBLA 5F3WB 4BRUA 2NO9A 2OFOA 1G291 4BLTA 3BB1A 4LK2A 3VR3A 2NO7A 3SQWA 2RCNA 1Z07A 1YKSA 3AKDA 3C15C 4Q9JA 2WSSD 5BXQC 1ZC3A 2CCJA 3B85A 4GOKA 4NP6A 2IHYA 2GBLA 4LHXA 2J0UB 2ZIAA 4N3NA 3WMEA 1S0UA 2QAJA 1QHHB 3B9PA 2G83A 5JHGB 4V02A 5EXPA 1KO8A 1PLLA 1N0VC 4RJLA 4DB4A 3BK7A 3C5HA 2P0EA 4MYCA 2X2EA 1KI7A 1LY1A 3NEJA 4JL8A 4ACBA 4FD2A 4XVUA 2P5SA 1G1MA 2ZUCA 4UNSA 5TB5A 5FOXA 1ZUIA 3PQCA 1GVNB 1BS1A 2ODNA 2RGGA 3O47A 4MGIR 1YRBA 4TL9A 5K8UA 2A7QA 2ZREA 4MITA 4C0AC 1T4GA 2ZUBA 2C9YA 4US2R 2O8CA 2OE2A 5EP2A 5FUXA 3EG5A 4LUCA 1XPUA 3AVPA 1KI4A 4E09A 2W6ID 2QGNA 3ZDQA 5JWHA 1OFHA 3TRFA 3T1VA 4A0GA 4LYFA 4QGGA 3RYTC 2IW3A 4LBVA 5EJEA 1DS6A 1GL6A 4C3ZA 1I2MA 3KKNA 4B43A 3RRZA 4ZCMA 1FTSA 1EX7A 3EARA 4O0MA 1TX4B 1HT2E 4GNKA 5JBQA 4ZDJA 4PZLA 2WOOA 4C0KA 1SVMA 4G5OA 2NIPA 1XJCA 4ESVA 2IS6A 1QG4A 3I72A 4YMUA 1UBFA 1XB2A 1IY0A 1LW7A 2GXUA 5P21A 3W9YA 3K0FB 8OHMA 4TTQA 2O8DA 221PA 2J9RA 3I73A 4BEJA 1TUIA 2IYUA 2ORWA 3CPJB 4NCKA 1AKYA 4MRNA 3MCAA 1W5SA 3QEJA 4UXHA 2HEIA 4QBGB 4IFEA 5CITA 2VP5A 3B78A 2YKGA 3W3ZB 2QP4A 3VMFA 5KTYA 3OEEA 2AD5A 4RD6A 4BE7B 1PUJA 5E95A 3GJXC 4TL6A 1W0JD 1AKEA 4CVNA 2B7CA 1GRNA 5CLQA 1OH7A 1P9RA 2QP9X 4UXJA 5AUOB 4E03A 4DB2A 1WQ1R 2PCJA 1AQYA 1Y3AA 2IUTA 4FMBB 1TQDA 4OQXA 4XWKA 3KQKA 2F6RA 3CLVA 3NBXX 5F9HA 2QT1A 2QE7D 1R4AA 4BASA 2BEJA 2VSOA 3FMOB 1UDXA 1SVLA 3F0TA 4DZZA 1TQ2A 4BFUA 3CWQA 3VKGA 4JS0A 4EDHA 1TMKA 4F4IA 4A1FA 1G18A 2FMXA 3GJ5A 1CKEA 1JNYA 4IEIA 3RS4A 3UKDA 4EJSB 2FPLA 2N42A 3C14C 5B30A 5BN5A 5FOUA 1ZD8A 4DWJA 1P7CA 4PX9A 3L0SA 5FUVA 2QPTA 2FPMA 4MQBA 4WZAE 5FOWA 2ZSDA 5JFGA 5LBIA 2ZI4A 4Q7JB 3U6KA 2GETA 2XTNA 2ZS8A 4R2HA 4OHZA 4CEIB 4EPYA 1U8AA 5KNDA 3QJYA 4WXPA 3LFUA 2X19A 1VG1A 4NZYA 3KKPA 2BC9A 1NG9A 2V3CC 1XWIA 2O0KA 2WPDA 4TMZA 4NCNA 3CNLA 2GTPA 4EJSC 2HXSA 3VU9B 4Q4JB 1CTQA 3K09C 1Y63A 3THXB 4PANA 1NY6A 4CEJB 1XXHB 2VA8A 1FX0A 4CEHB 4MUBA 4DLWA 4NBSA 1XCGB 4A8JC 3OAAA 4K46A 1F2TB 2R6DA 3ZVRA 2VO1A 4EQ6A 1OXSC 1JB1A 1KI6A 1KSFX 1YZTA 2ZRGA 1KNQA 5K8TA 4CGZA 4MKFA 1W4BA 2F1HA 2V54A 2ZPTX 121PA 4RD0A 4TLAA 3SBEA 4RCZA 5CJPA 1KJYA 1KO1A 3RC3A 1IBRA 1SXJB 4BFYA 2WZQA 1KNXA 1IONA 4LHYA 3RLFA 5C1BA 3HPQA 5C4GB 1R0XA 1HTWA 2B92A 1E4YA 2CL0X 2VSXA 4Q1CA 3W8NA 2OG2A 5J4HA 3PFIA 3AB3A 4MH0R 3I5YA 2GXAA 2ERXA 1UEIA 1Z0FA 3LAWA 5FPSA 3X1XA 2G3YA 3LLMA 4PHHA 1UDWA 4JLJA 1NNEA 1KI8A 4OBEA 4IXMA 3QXCA 1G6HA 4RZXA 4S2EA 3TQCA 5JI2E 4MUAA 1LF0A 3FOZA 3FDIA 2WWWA 3BC1A 1GITA 2BMDA 4YDSA 4BLRA 1Z6GA 3BH7A 5FR2A 1C9KA 5FOSA 3K0AA 3ADBA 2GJ9A 1ELOA 3KJGA 4W5HA 1W2HA 3AVUA 4ZV4A 2WAYA 3L8ZA 3T12A 3JVVA 5KSOA 2JAQA 3K0FA 2GA8A 1ZNWA 3GLHA 3TR5A 4C0JA 2CHGA 1UM8A 2ASEA 3TNFA 1J99A 4KFRA 1OW3B 2FV8A 4IDOA 2V8OA 1SXJC 4DLRA 5EE1A 2D2FA 2GZAA 3V00A 1HYQA 3KQNA 4AYXA 4OHXA 5FH9A 4B2LA 3JVUA 3AUXA 3VKHA 3MWYW 3QNUA 2QPAA 2QENA 2W0MA 4MA4A 1GNPA 1P4SA 2RH5A 2FSGA 2CCGA 4G5RA 3SYNA 2PLFA 1XXHE 1YU9A 3NEYA 4Y0AA 3WXMA 2GEDA 3DL0A 1DAEA 3MG9A 1FNNA 3BD9A 1Q20A 1Z5ZA 3SYKA 4TYWA 2Q3MA 1JEDA 1CBUA 2I1QA 4Q03A 4Q7LA 1FPMA 2WWGA 3B60A 2QAGB 4QOSA 3B5JA 4URYR 3EPKA 2ODEA 3PUZA 2R6AA 5HPYB 2F1RA 5IF9A 4B2PA 1M7BA 4UJ5A 1P2UA 2CEAA 3W5JA 3ZZUA 1Z29A 1TEVA 1OFTA 3ONWA 3LNCA 4ASUA 2WSSA 1DTSA 4BQSA 2ZITA 3OAAD 3Q7QA 4FINA 4DC9A 3TUIC 2ZRAA 4BZXA 4JVNA 1TQ6A 4OQMA 2NPIA 5E3HA 5DNYB 1FL9A 1QHHA 4FCTA 2ZR7A 5EE9A 5AUPB 1W48A 1G21E 2VHUA 4R98A 4DCTA 3I5XA 1YZQA 1Z6XA 4OI4A 4PQFA 3TAUA 3BAFA 4E22A 2FF7A 3EXAA 3X1ZA 3GJ6A 3SZRA 4FI3C 5M04A 3AVXA 3QI2A 1E3MA 2QROA 1RZ3A 3OHMA 4IHQA 4LHVA 4LV8B 4WW0A 1CR4A 1T8TA 4TSFA 2CXXA 2OFWA 2WICA 3IHWA 1XMIA 1GRQA 1XCPA 3PUWA 2FGJA 3EPHA 4DBLC 3CF2A 1S9HA 1MRNA 3NWJA 2DCUA 4PSVA 5BQ5A 2ZYUX 3B2EA 2A5JA 3DZ8A 2CL6X 3U7HB 1E9DA 5KSYA 4KFUA 3RRYA 4PPGA 3PUXA 4LJ4A 5FFMA 4TMVA 4JVLA 3TUJC 3NVAA 4D4JA 1QRAA 2VBCA 2FNAA 1KHTA 3Q85A 1XU4A 2NG1A 2LKCA 2PX0A 4DSTA 5HCNA 1VIAA 3VNVA 4FWTA 2IYVA 2FJUA 1FQKA 2Q9BA 3EWAA 3DM9B 4PAOA 4FIDA 2F3TA 3VFDA 4R71A 2Z5FA 3I8XA 5CLLA 4Q4LA 2XXAB 2DBYA 2OCPA 2W83A 1FZQA 2ATVA 3L0IB 3MSXA 4DKXA 3U5ZB 4TTPA 3EASA 3EZ6A 1D6JA 1NG1A 1SXJD 3VTKA 1DG3A 4D81A 2PZFA 4HDQB 1U0JA 1WP9A 2PMKA 3BWDD 4OI0A 3A1UA 2YOHA 3WP1B 1P72A 5KO2A 1E2PA 5GJCA 2IYXA 1CEEA 2QM8A 1SVOA 3QG1A 2PZEA 2RGNA 1E0KA 2BEKA 4I4LA 3FFBA 1XPOA 1ZP6A 4TQUS 1JBKA 3RSOA 3ND8A 3WYAA 2BM0A 5SZHB 1OFUX 3ZVLA 3PEVA 4Q01A 5FOVA 4WOPA 4DEXA 1MRSA 4C0LA 1WBDA 3VNUA 3AVWA 2G6BA 4HAXA 3BB4A 3K9HA 4TYNA 2JATA 4TL7A 4TZ6A 5FUWA 2R6FA 1ZCAA 2WHXA 2IXFA 4DSUA 4LJ9A 1VHTA 2ZVPX 4CIDA 4D6PA 1AJEA 4MDFA 2OILA 4HSEA 5J40A 4KFTA 1XD2A 5BWMA 1XD2B 4M1MA 3T35A 2FZLA 4Q47A 4YQFA 2VHTA 2GRJA 1XPRA 2ONJA 1FTNA 2Q9CA 2FPKA 4YLGA 4TT3D 3CR8A 1DAHA 3QXJA 4TMTA 3T5DA 2OLJA 2RKOA 2QMUA 5G53C 4NYIR 4KVAA 2QPOA 2WTUA 2ZJ8A 2QBYB 4Z1MA 1CRPA 3M0EA 2WKRA 4IDHA 1CXZA 4TLCA 3QXHA 2QT0A 4F91B 1II8A 2J0QA 5SZJA 1HE1C 2PBRA 4BFSA 2QMHA 2J0SA 3TK1A 3K0AB 1OXXK 3IEUA 3MLEA 3QG5A 2O8FB 3BERA 2FSIA 2ZUDA 1J2JA 5FOTA 1WBBA 4G5QA 5FTKA 5AJZA 1CR1A 3CX8A 2DFTA 1CJTC 3FMPB 5FTNA 2IYLD 4JLBA 3SHFA 5JEDA 5B64A 5ANRB 2HCJB 1WA5A 3QPWA 4DDWA 1OPXA 2EQBA 1NLFA 4M1OA 4KXFB 4B3BA 3A36A 1S8FA 3RDPA 1LS1A 1OIWA 1XD9A 1XXHA 3G82C 2ZI9A 2IEYA 4M9QA 1R10A 3TVDA 4B47A 1IXSB 3FKQA 1MO5A 1JEEA 4QGFA 721PA 3BS4A 5JHHB 1N6NA 4MRSA 3ZJYA 1N6PA 2HF9A 1COWA 2ZJOA 2CJWB 3H2YA 1ZW6A 4ESHA 2OAQ1 3U3OA 4YXWD 2ZE7A 1VECA 4L15A 4RY2A 5DYIA 5CB8A 2ZRMA 1E98A 2EU8A 3OIWA 2X77A 3NDPA 4M4SA 1Q1ZA 4N0EA 3G5UA 5A0FA 1CRQA 1DE0A 2CK3D 3EA0A 4URXR 1KMHB 2GAAA 4JL5A 1Z6YA 1FFHA 2DFKB 3DMDA 2XZLA 1SZPA 5EZ5A 3GMTA 2A30A 1C1YA 2G1KA 2AR7A 2OUKA 3IBYA 2ZJ5A 3L82B 3QVUA 4DVGA 4PR0A 2FZ4A 4Q4JA 3L43A 4NCHA 1F3OA 1ZBDA 4L9WA 2ZI7A 4LX0A 2IYZA 1ZNZA 3TQFA 2QL6A 1D9ZA 3AP2A 2IXEA 2PT7A 4G1UC 5D3QA 1VCOA 2NTYC 2W6JA 2OAP1 2FSFA 2R9VA 4Z8YA 4CDGA 4JLPA 2V55B 2QA5A 3FTQA 4PPNA 1QHIA 3L2OB 4A6PA 3MFYA 1I4LD 4JLDA 4RCYA 4HAVA 2JLWA 1OXTA 1U8ZA 2P3SA 1OB5A 4EJSA 2IS1A 1XDBA 3AV0B 3U60B 3KKQA 3PIRA 1PV4A 2WIAA 1OHHD 2REXB 1CR2A 3JZAA 1XMSA 3BFVA 3IDQA 3Q8XB 4I1SA 4L9SA 3D6TB 5BYJA 1EFUA 5KUTA 3AP1A 2Z4SA 2QMEA 4GRAA 1NF3A 4BFXA 3EA5A 3LWNA 1OLOA 2EW1A 2ODWA 4A92A 1T0JB 2WMOB 3EAQA 1N6KA 4BFZA 4ERNA 1FP6A 2O5VA 3WY9A 3AF1A 4UNQA 1SHKA 1II9A 4C9BA 1HQCA 1WDTA 3ZD6A 2VP6A 3KFXA 2ZI5A 1F6BA 1VCNA 3TSWA 2R62A 2ZJZA 2ZRLA 4AKIA 3RWOA 1K5GA 2V7QD 5KPDA 2FX3A 4HUQB 5EUQB 5L3RA 4DUGD 1NMXA 4F38A 1RC8A 1DO0A 1Q1EA 3B1WA 5DIFA 2AFHE 4KSBA 3NXSA 3X2SA 3T1OA 4HLUC 1W7AA 1X8KA 2CHQA 2DYKA 1K6MA 3GCGA 1Q0UA 3WRXC 1JPNA 2AK2A 2GILA 1XX6A 3KTAA 1ZAKA 1XTQA 4OK3A 3LW8A 1ZD1A 4OYHA 2YJTD 1QF9A 2GCOB 5JI3E 2WKPA 421PA 3AP3A 3QF7A 2K5UA 1ANKA 1OIXA 2H92A 1TPZA 2O52A 2V6IA 2WMNB 3TSZA 5JWRA 1NVXQ 2A5YB 1G5TA 5L3QA 4IOJA 2WWXA 5B58C 4GFDA 4MYTA 2MMGA 3UMRA 3IQXA 3AKEA 1ZM4A 4PAQA 3R7WB 1FUUA 1KDRA 1W0JA 2VPPA 3EC2A 3QIAA 4YXWA 3SYLA 1UJ2A 3DPUA 2J0UA 2E87A 3CO5A 2ZE6A 2ZRBA 3CX6A 1U0HC 5FTLA 2YWHA 4YMTA 2A5FA 1IOZA 1VG9B 3QKTA 4BLQA 5EXTA 2PEYA 2ZAMA 4PZYA 5K8LA 1XFAA 2QE7A 1DAIA 5EXSA 1JALA 1NMZA 4RKFA 1JQJC 1KO4A 2ZYVX 4WVFA 4M2LA 3A4NA 1ONBA 4KYIB 3CRQA 1KIMA 4C0HA 2A9KA 3MUFA 2GVDC 4XWAA 4G0NA 4HI0E 3I4LA 4TMWA 4EPWA 3GLIE 4Z54A 4OHVA 3OFND 1X6VA 1U99A 1U9IC 2FEMA 4JSTA 1EFTA 1JXOA 1NKTA 5TXGA 4BLPA 4XTRA 1ESNA 3UMFA 1G7TA 3GJ8A 3K9LA 1Q1BA 4KHZA 4Q4HA 1E9RA 2CMKA 5AJVB 5TVKA 1RJ9A 1E9AA 3NC1C 3Q5DA 2ZI3A 4LI0A 1EFCA 2AN9A 3CONA 3AVTA 2V9PA 1L8QA 1W49A 2REOA 4BGDA 3GPLA 4JSYA 4GBMA 2R44A 1RYHA 2VIIA 1KK1A 1S3SA 4B48A 2Q3HA 1OE0A 2XNDA 4XH9B 5G41A 2X8AA 3HR8A 2F1IA 1A5TA 2CJWA 1Q3TA 1E9FA 3BGWA 5D3MA 4ZI2A 1KMQA 1IJFA 4NTZA 3ZQJA 1WCV1 4JL6A 1N5LA 1VG8A 1LNZA 3IBGA 2IYTA 4CEJA 3D8BA 1X86B 2J87A 1SVIA 1DBSA 3THYA 3MGCA 4URWR 4LBYA 2H1LA 2MMCA 2O0JA 4WA7A 1ZIOA 1YR7A 4MKGA 3R20A 4M22A 2WWIA 4XIGS 2JLQA 4HAZA 1LV7A 3OZXA 4U00A 5JCZA 4V03A 5KU1A 3G0HA 1UEJA 2QAGA 3AKYA 4PC2A 1ZM7A 2IYWA 4C0QC 1NN3A 5B2ZA 4RSGA 4Q48A 4V0KA 1KZ7B 3BBPA 2CHVA 1L4UA 2OESA 4RFVA 5FPYA 1BKDR 3AF2A 1MV5A 4NE2A 4PC6A 3VAAA 4EAQA 4Q4AB 1RE0A 3KJIA 1SKQA 3TIFA 2HXYA 3TR0A 2NMVA 5AJXA 1UBGA 3QXXA 1RKBA 1UADA 3Q72A 4D26A 4ZDWA 1TL7C 1MO4A 2ZROA 2ECKA 3A1WA 3FHOA 2J3EA 3LVQE 1R0YA 4I1UA 2R65A 4S35A 3SQXA 1ZNXA 2ZRHA 5H8WA 3QKSA 1Z2AA 2V4ZA 1W4CA 1W4AA 1P62B 1W2GA 3B82A 3TMKA 2XB4A 4EPVA 4Q1FA 2VHQA 4LJ6A 4ABYA 4TLBA 3CIOA 4EPTA 1HY3A 2V1XA 3X1WA 1NL3A 2RHDA 2JJ2D 2ORVA 1G5RA 4G5SA 3GLGB 1JI0A 4NU0A 4ACAA 5GVSA 3IIJA 3MWJA 2GJSA 3OIVA 1UF9A 4DLYA 1RRCA 1E9SA 2DFNA 1U94A 3M4YA 3KDSE 3ZLJA 1Z6AA 4OL0A 5EZ6B 2I4IA 4NL4H 4F4JA 5AK0A 1G19A 4WAUA 4M1WA 2O8EA 4ZDIA 2Z4RA 2C99A 1P2TA 2OCAA 2D7CA 2F43A 1X8LA 3CH5A 4DCSA 1XTSA 4HB0A 4EIWA 1AM4D 3SNHA 2O8BB 1IQPA 4IXNA 1XJQA 2JLRA 1CULC 4Q7MB 1HUQA 1QHXA 4P33A 3AQ4A 3BORA 1RJ9B 2RGCA 2GZHA 4II7A 2ZS9A 3WBKA 5HE9A 4QG7A 2QY9A 4NYJQ 4UXIA 4DLSA 2LWIA 4PZZA 2GZDA 1EWQA 3DHWC 2AHOA 2XNSA 1E1QD 3KUDA 3E5HA 5EXXA 1BYIA 1AZSC 2BVNA 2ONKA 3LX5A 4IJMA 5DN6D 2BMEA 3TH5A 1E94E 1K5DA 2V6JA 4L16A 4IVQA 4P32A 3SEAA 3A1SA 4HYYA 3P27A 1DO2A 1EFRA 5TV2A 3QEOA 1KI1A 1T3LA 1DEKA 1E2LA 4C0SA 2RGDA 3RANA 1G8HA 3AUYA 4A15A 2JDID 2W0SA 1JR3D 3P4YA 5DSZA 4BPBA 3OE7D 4IDQA 1NBME 4TYQA 5JZVA 4BECA 2Q6TA 1Z83A 1Z0IA 1G8GA 3VR1A 5JLJA 2XSZA 4DT1B 1E79A 3W90A 4LC1A 1MH1A 1AN0A 1VIYA 1BYUA 4KCGA 2GWHA 3B8HA 1NN5A 4Q7KA 4YC7A 3H1TA 4PFSA 4U02A 4DLUA 2O0HA 1ZD9A 1A2KC 3SE0A 3EZ2A 3D7MA 3OEED 4LZZA 4GSYA 3C7KA 4EFMA 1KK2A 2DPXA 3DM5A 3FVQA 4ILEA 4M9ZA 3NG1A 1UBCA 4DUGA 2OLKA 1N6IA 4PXAA 2GK6A 1EGAA 1YR9A 4QGAA 1OXUA 3W6NA 5KNBA 1IXRC 2JLZA 1Q44A 3ZS8A 1N5KA 4TQ9A 2J1LA 1AK2A 2HJVA 5FL3A 3ADKA 2DR3A 1FNMA 3U6BA 2AD1A 4Q1BA 1E32A 1HA3A 2EYUA 4MYHA 4Q19A 4PPFA 3K8YA 1MKYA 4D0NA 1UKYA 4TN1A 4Q18A 3L0OA 3SU8A 3F3YA 3Q7PA 5FUYA 3ZQ6A 3PJRA 3HU2A 2SHKA 4NMMA 1GDDA 3DOFA 4EPRA 2E9SA 2GJAA 2WWYA 1U2RA 3WMGA 1D2NA 3TW4A 4CW7A 1EWRA 1OHHA 3O8DA 4GOXA 2QSYA 3B1VA 3IO5A 4P4SA 1E2NA 3NHBA 1XNJA 3K9NA 1Z0AA 3VR2A 3GLFA 2P6RA 1HEIA 1YZKA 2FA9A 4ON9A 1PJRA 3BOSA 1ZIPA 2XJ4A 5BYKA 2JLXA 4B73A 4POAA 1IN8A 1EX6A 4Y0VA 3OESA 3HP1A 3SBDA 2F9LA 4HLUA 1HQYE 4BFTA 2ZI6A 4JLNA 2UZIR 1HV8A 2IEZA 3WRYC 1ZINA 2IK8A 3CZPA 4C0BA 4M9SA 3NIBA 2W58A 1WRBA 3BE4A 3KQLA 1U98A 4XSHA 1T3SA 3NDBB 1GKUB 1KSJA 4CZ2A 2HCBA 2YC2C 1XEXA 4IRUB 4XVQA 2PJRA 2IA5A 1TF7A 3QBVA 5KSZA 2YC4C 1D9XA 2GEUA 4KI0A 2F55A 1KTVA 1X1RA 2C5LA 3A8TA 4BZQA 2AWNA 2G0NA 2P65A 5AJWA 3IO3A 4JMPA 3ZS9A 4AI6A 2AFIE 4URUR 3DOEA 3F8TA 1TTTA 1II0A 4HDCA 1P3JA 3AGQA 4TWZA 3O8BA 5CDFE 1JECA 2ANBA 1E0AA 2BMFA 1Q12A 1KO7A 3CUEF 2CE2X 2D4HA 1DAFA 1GL9B 5JJKA 2BM1A 3A37A 3QKRA 1P9WA 1FMLA 2A78A 4PHGA 3AVVA 1M74A 2C04A 3MD0A 2RGNC 2MSEB 3I3SR 4OK6A 3FHTA 1ZVQA 2VP4A 3LY5A 2GXQA 4BFVA 3GEEA 2VEDA 3PITA 3A1VA 4HLQB 4PC3A 2ZE8A 4PC7A 5HKKA 2ZJBA 1J8MF 2ZYTX 4DDVA 1IHUA 4UNNA 1CS4C 2IYQA 2QTHA 2FE4A 4GZMA 4A82A 1CF4A 3ICEA 1E99A 3LH5A 5FR1A 1OXVA 3U3MA 4EQ6B 1KGDA 5TMPA 1UPTA 3K0CA 3PEWA 1D2EA 2EFHB 4RZ3A 3B1YA 3SI7A 1KAOA 3P20A 1G41A 2IL1A 4AG5A 1RYFA 1AQUA 3CRRA 3UWKA 2DFLA 621PA 3PENA 3WNBA 2RGEA 3FMFA 3KQUA 4D25A 3GLGA 1G64A 3FMIA 2J7KA 2AWOA 4WXRA 4QFMA 4AWXA 1QVAA 4OI2A 4KSCA 1QDEA 4B32A 2CK3A 3MRSA 1M7HA 1NRJB 4LJYA 2CNWA 4QNMA 3BRWD 4ZO4A 5FPTA 5G3ZA 2XB2A 1U90A 4K81B 1OB2A 2ZRDA 1Z3IX 3PV0A 2D74A 1XCMA 3K53A 1NIJA 3IPXA 3C4JA 1Z06A
chains in the Genus database with same CATH superfamily
1KK0A 2PWZA 2Y0EA 4JOCA 1Z4MA 4I5FA 1Z22A 5SY9A 3R3WA 1Q84A 1YMQA 4NU6A 4PGHA 3ND6A 5DYGA 4I1IA 3P2YA 1BN6A 2Y27A 4R7TA 4XD7A 2AJ8A 4DHWA 3QWIA 1LQ2A 1F4VA 1ZG3A 1SCJA 2VLIA 5A7HA 3PJFA 1YGYA 1PR1A 3U3RA 1UBSB 4R1MA 2YR0A 4K88A 4N1AA 2NU7A 1Y8QA 1ZUD1 3FI0A 3GXOA 3NBMA 4REQB 2QZ9A 4K9PA 4D44A 3IAXA 3QLUA 1L8AA 3V8BA 3ZIUA 2PZGA 4DE5A 3PR1A 5AI9A 2VJAA 2LCIA 2PXHA 1YNOA 4GZ6A 4B2YA 4YAGA 2L69A 2MIIA 2R60A 2AOUA 3HBJA 4BN0A 2J5QA 4ITUA 2BEWA 2HQBA 4D0GA 1QIIA 3IAS6 2OHFA 4NBWA 5CH3A 5CFQA 1KI2A 1OX6A 1KEEB 2CXOA 2OECA 3HADA 3OHSX 4KJXA 1Q83A 4O59O 4EI2A 2C4HA 4A4DA 5A4JA 1TAGA 1R16A 4XQCA 3FIUA 1E1LA 2WWHA 2PVPA 4EMBA 1NLZA 1YUBA 3K8QA 1E2MA 3G2OA 3U62A 4E15A 4KREA 1WCIA 5D3MB 1FC0A 3PNLA 1QIJA 1U11A 2PGIA 2OWDA 4K7JA 1E20A 2IW1A 2XRMA 2FFHA 3ABRB 3NUZA 4KH0A 2WHRA 5FRDA 5T7BA 2OBBA 4N5HX 3EX7C 2FPPA 4A0QA 5FI1B 4DBVO 5TR9A 3I62A 4XVHA 1XZMA 5HM6A 1XEWX 4XDYA 1AQ6A 1KMNA 3M34A 2QMOA 2WB4A 3K15A 1ZM3A 1JJVA 2O1XA 2UUPA 1E3TA 1Y4UA 4JUBA 4A03A 2Z2YA 3ZIAA 1SG9A 3UMBA 1Y7PA 3ASZA 3H8VA 4OHBA 1UXIA 1MW9X 3JWGA 4CG3A 4DM3A 3GPDG 1VC2A 1XEFA 3GT4A 3DW3X 4BQIA 3PIIA 4EL0A 1UDRA 1FBNA 1JJFA 3CKYA 3WNDA 4II2A 5E7JA 4TMXA 4PIVA 1U8YA 1MG0A 2Y1DA 3IQZA 4QE3A 4BV8A 5KHOC 9GPBA 2E89A 2XSZD 3PKZA 1QJ4A 1XDUA 4P2GA 1ZMXA 2WHYA 5HDQA 3C45A 3H9GA 3JSXA 4DIEA 2KMLA 4CTJA 1QQ7A 2H1HA 2X0NA 3DFIA 1U1EA 5CXQA 2OZEA 3RSLA 1C7RA 1KJNA 3H1PA 4RZUA 5LA6B 1U3TA 2ECFA 2YV5A 4IJQA 5G4KB 4A2WA 2XTZA 3H2KA 2IXTA 1D2AA 2QZJA 3B3FA 4WBNB 4BMOB 1J9ZA 2JLSA 1FLNA 1H4VB 1Y1KE 2TYSB 5IJ0A 5CLGA 4B6JA 3D3QA 2HMTA 1DC7A 1BVRA 1Y5MA 1M8PA 1BQ3A 2HT6A 4MRRA 5GONB 3W9UA 5L7WA 1G20A 2BTEA 4MEBA 1DHTA 1RSZA 1GTVA 4OHWA 5F2OA 5JMPA 3JRWA 4PE5B 2FP3A 1F0KA 1IUOA 2HTEA 3B7GA 3OY7A 4KPFC 4QGBA 2DCMA 4Q1FA 1ZJ5A 1T35A 1CJVC 3KC2A 1ODTC 2FDXA 1D7OA 2H8GA 4LI3X 1EWTA 2VF5X 1YFJA 5EP3A 4UEQA 1B42A 1MEOA 4MA5A 3AJEA 1NJGA 2FLKA 5I3CA 1PJ3A 2L82A 3LY7A 2W6QA 4NV3A 5F9MA 4GOND 2E2WA 3BFKA 1H9CA 1JJIA 4AIIA 2N1BA 1X92A 3AUUA 2YY6A 3ECAA 3C48A 1ARZA 3B1XA 4G1VA 4GZLA 2Q7XA 1M1UA 1MAUA 5CM8B 1VRCA 2BMAA 2ERYA 2JDIA 4I55B 4EGQA 1SXIA 3DAFA 4YJFA 4KIGA 3OE7A 3MGBA 5CYOA 3T3DA 4EG0A 4MS4A 1GPJA 2VF7A 1W9MA 1P61B 1AGXA 3B9QA 1KQFA 4KNYA 1V9CA 2CXHA 2FSVA 2XYVA 5EJIA 1WDLA 4OI1A 1LDYA 1NATA 3HFGA 3CYFA 1ZUNB 1US8A 2WJ6A 2XMBA 1XEXB 4MGKR 1YQXA 4X91A 2CFOA 2GPTA 1YB4A 3VR6H 2P2SA 3CZMA 3WDMA 5BPFA 5CA1B 3ZDBA 1BWQA 2IIBA 2PKQP 2VQ3A 4HFJA 1ADGA 4Q66C 4TKVB 2QX6A 3F8SA 4N54A 3RTCA 1J09A 1PT5A 1UT8A 2YWFA 3KSMA 1CQIB 1OYYA 4PLFA 2HT1A 4QTXA 1VYTA 2VHYA 2X2FA 3VX4A 4OQYA 1D5CA 1EP9A 3ZD7A 1Z62A 1JE0A 3QVXA 3PCXA 1TYDE 1ADFA 1FMCA 3AXTA 4DGSA 1AHPA 5CCDA 1LNQA 3ILSA 2QQ0A 4OGWA 4EATA 4AK9A 2FZCA 4E2ZA 1U0FA 5JVDB 2KYRA 3GDHA 4G4SO 1NJ5A 4WCDA 2H4ZA 1TPYA 3GFQA 4YPVA 1NRIA 2JHAA 5KUTA 4XYGA 3KL4A 3H83A 1ODJA 2WILA 2WSIA 3GLFB 4L8WB 5DOZA 3U61B 3RRMA 1XZNA 3GOQA 1CFJA 4MUGA 1KJWA 1PF7E 3U7JA 1RLTA 2O0LA 2ZE5A 3M6XA 4MB2A 1N3BA 4WA8A 5JEEA 2FFBA 4DR5B 3THWB 2BD0A 2VXBA 1ZD4A 2M32A 2WWTA 2C84A 3AIOA 3I0ZA 4QVIA 4RO0A 1ZJ4A 3FHCB 5T8KA 1ZIXA 4CTKA 4IICA 4TN5A 1JDBC 2GCEA 1R5NA 1VTKA 2AKYA 2EFGA 1A88A 2PYDA 2PZLA 1G3QA 5TSDA 1NHWA 3V80A 1R0RE 4HAOA 1QIEA 1EB8A 4EBBA 3LBHA 1DXYA 3ETCA 1GL3A 1ULBA 3CH4B 4UE2A 1KWKA 4F5DA 2IY8A 3O4FA 3SC4A 5C5EA 2NQ2C 4Z4HA 1SU7A 4ZAVA 3F7TA 2ORED 2O2SA 1Z38A 4QICA 1NRXA 4YFYA 3ZNNA 4KAXA 5FOQA 1CDOA 1W5TA 3CNNA 5B55A 2B8WA 1G21B 2RB5A 4FYJA 4TWAA 1H6DA 4I5GA 1JL3A 1D6NA 4FX2A 3N6XA 2W6JD 3VBCA 4IRMA 2BWJA 1V1JA 1GWNA 4N3AA 2HCTA 3LXXA 2QRMA 4TGLA 1E4OA 1L1FA 3RTEA 3ZC3A 1CJBA 2BFCA 3N74A 4JBXA 3TB4A 7REQB 4U7JA 5FL7A 3NCTA 3OMLA 1NF2A 4UD2A 3TX2A 3PU6A 4DRYA 3N3AC 2PH5A 5C53B 3PNMA 1XMPA 3H17A 3HMQA 3PR2B 2CVHA 3K6SA 3H4MA 3JQ8B 2JFFA 2OXCA 4LHZA 1QE5A 4LWOA 3RYHA 5FKJA 1K4YA 4CM5A 5LN1A 1P4HA 821PA 2BBOA 3MRTA 3UATA 3FNIA 4PYNA 3B6ZA 3BRCA 3D4NA 1RQGA 4BRWA 4ECAA 2BKUA 1U0GA 1F4PA 2QD3A 2CLIB 2QX8A 4MUJA 2OM2A 4KV9A 4ZRDA 1KE2A 4J8PA 2C92A 1F60A 1YQQA 3G49A 3P5BA 2D7DA 1VGVA 2DXIA 5KDOA 4V2IA 5EERA 3AWDA 1VGQA 3T1TA 1USWA 1JZQA 1GSOA 2RK6A 5D8DA 2XUIA 1K06A 1RCUA 1VL1A 1F9AA 1ZI8A 1DOHA 2RGXA 1J90A 3ZH9B 3BZUA 1OASA 4ZYWA 1TU3A 4NCJA 5BVHA 4X6YA 1FE8A 4EM6A 1C0EA 3WLOA 1F8FA 1ZXLA 2Q5LA 3BE8A 3WHKA 2IX9A 1L4GA 3BEDA 3BH0A 3H7AA 3B89A 3FPAA 4NG5A 4Z49A 2BEUA 1U1CA 3IPAA 3W3AA 5G4KA 1L7NA 3L4BA 4XWTA 1NNSA 1XSEA 2I0FA 4Y3UA 3WK8A 4EEKA 1PLJA 2F43B 5KTOA 5ENDA 2HQOA 2XOKA 2H07A 4R7ZA 3RUHA 1Z2OX 5B3LA 3GJSA 2CY0A 4L4UA 2HJHA 1QGUA 3MJHA 1RP1A 3HN2A 4ARZA 1V39A 3HVKA 3R74A 2P7IA 4B3HA 2V7UA 4B45A 1LUAA 3OCYA 3T7TA 3WIEA 2C77A 1E2FA 1IEVA 1NKSA 4RENA 5DLQC 3QYFA 4TTRA 3RSZA 3E8MA 3CLSC 3SKVA 5IKEA 3KXDA 2V1UA 5TMDA 4BMCA 3HGTA 4GOMD 2CMGA 2QZZA 1QRRA 4X20B 4BMYA 1JEYA 3LXMA 3ZYCA 3UH1A 4RXTA 1G8SA 1VMIA 1S2OA 4UTPA 4YJ2F 3B6MA 4O02B 3WA6A 3VPDA 3H0CA 5COQA 2CXUA 5C81A 3CWCA 4E4YA 3DBOB 4IDGA 3P9QA 1GOTA 1V0JA 1YL6A 2AT1A 4IJUA 3ISJA 4AY4A 4BFWA 1JSXA 4CT4B 2YHBA 1LI7A 2HF8A 1T9CA 1XFDA 4PPYA 4JJEA 5TARA 3UMCA 5LNK6 1WBJB 4G5XA 4QGHA 2DQSA 2G9UA 1JMVA 2VWGA 2HHCA 5HF6A 2OYSA 3WC4A 5IJ9B 4ND8A 1A9TA 3D0OA 2DEUA 2VCYA 1GGMA 5ABPA 2TMDA 3M4JA 3VDQA 5KPJA 4LY9A 3KVNA 1RM0A 3BRWA 3OZBA 1D0VA 2XZOA 5LD2B 2OMKA 3A06A 1Q1QA 1SGWA 5B3JC 4LKRA 2WLSA 5IG2A 1WB9A 3P0JA 2CT8A 5DBEX 1RHMA 1ST3A 3PXBA 1KOFA 3SSOA 1P45A 2QP3A 2EIHA 2QYOA 1HQKA 3LRXA 3GEHA 1ZSNA 1IJEA 2NO4A 3K6RA 4HAYA 1AUOA 4FS8A 1U9ZA 3DDSA 3JQPA 3CQ9A 1NFQA 1BAPA 2Q9AA 2YFYA 1KBZA 1QBKC 1JSLA 3KXLA 3O9VA 4FFDA 3CCFA 4AG3A 2BEUB 3PQ8A 5KNCD 1HG0A 3KXIA 2KJQA 4LSGA 1W76A 1GRCA 3AEKA 1MV8A 4B75A 1RLMA 2V7GA 3PJEA 5KTPA 4XR4A 4MMZB 3E6AA 3AW8A 4IDAA 2XWPA 3PFKA 1L4EA 5HX7A 5TJHA 4PICA 4EUFA 1MOZA 3WXBA 4PBSA 4TZKA 1D1QA 4CV3A 4OUDA 4YAJA 5J5AA 3WZMA 4ENRA 4DUYB 1MZVA 2H5EA 1V8BA 4UC0A 4AY5A 5HJ2A 5L3VA 3TZCA 1G7RA 2HNBA 1KI6B 1H2YA 1Z0DA 5ECGC 4ZTZB 1MD9A 3MS2A 3WGHA 3P9NA 1X7ZA 1W1WA 1GZ4A 3JRXA 2WOJA 2A4KA 4QBIA 5A3JA 5DM1A 4JBIA 3HNOA 4K9RA 1XQ9A 3HKEB 4JYBA 4LZJA 3Q5GA 3O2QB 1IM2A 2Q2WA 3LKDA 1CF9A 2I80A 2HKIA 4K2AA 4MWZA 2VRWA 2VDMB 4JZKA 2JHPA 2B99A 4DNPA 2Q2OA 2IH4A 1GCUA 3L18A 4GI7A 1SG6A 2X22A 5H81A 3ZCRA 1L7DA 2RDMA 4LOJA 3OFVA 1YQTA 1GGVA 2R1UA 1I6MA 4FN5A 4GR4A 2ADFA 4NV0A 1WCXA 3V42A 1S3IA 4DRXB 3UK2A 1J7KA 3L4EA 1R1DA 3DWFA 4Y6GB 1DKRA 3QUSA 4M55A 4QHYA 1RMYA 2KB0A 3T5GA 2QTNA 1T0HB 3VYSB 3T5AA 3S8YA 1XHEA 3BUSA 4IKEA 4XX1A 1ZRHA 5DHAA 2VHZA 1LPSA 5ELLA 5B1EA 5KSPA 3DHEA 1T8YA 1AHNA 4AJLA 1QO9A 2QSZA 4YDHB 4U3JA 3KZCA 4UU8A 2HRZA 1SCQA 1B93A 4IJKA 4Z9YA 4YO8A 1W36B 1WMSA 4R1TA 2JAHA 5GOZA 1OX4B 3FCSB 3B20A 3H9QA 1JDSA 2ACKA 2OFFA 1BE6A 4ZAZA 5ADUS 1AIPA 4GVPA 3BSYA 4X90A 4JN6B 1M1NA 1UKCA 2P68A 2R1TA 1JSZA 4HGYA 4JUCA 3BMOB 4R2JA 1NOIA 4DLXA 4JXZA 4MRPA 3BJIC 3BFXA 4DN6A 1OSNA 3C0KA 4YCCA 1E79D 1OC2A 3TLMA 3VO8A 3RU2A 2ZT6A 4L5CA 1PS0A 3LA8A 5T64A 1W88A 2OCBA 4YMUA 1NT2A 2ZXUA 3SC2A 1RQ7A 4DEVA 3VDXA 1P1BA 2F1JA 1TNDA 3KTAB 3SEQA 4IH4A 4DV2B 5TS3A 1O6ZA 2KBEA 6PFKA 2ADMA 4XFDA 1PL8A 4V3CA 3SOZA 5J4VA 4OHKA 1I4TD 2POQX 4UBKA 1DT3A 4WK4B 4EG7A 4EI7A 3OOSA 2BUCA 4H59A 5JNTA 1UJ4A 1SU8A 2J48A 1P17A 1XNRB 2OBMA 4PAWA 3F67A 4C2AA 5EKXA 4M53A 3WTBA 5TY0A 2XQFA 4MVJG 2EXXA 5A05A 3TLXA 2VH2A 4BQEA 3FPSA 1ZW1A 3DP9A 4RKRA 4Q9KA 2P9BA 2QTWB 1VGRA 1HOXA 3DOUA 4M7WA 2BFEB 2PSEA 1H6AA 1J2RA 3PFNA 5FFFA 5DM0A 4PN7A 1YULA 3ABSB 1ONNA 2J41A 2X0RA 2ZU6A 3F6SA 2D2EA 3PFCA 3KR9A 3JQAD 1NVUQ 4RVSA 2J9FA 1V8OA 2QM7A 4CCWA 3FDFA 5I7SA 1E1QA 4Z4EA 3HQ4O 1WZEA 1IZZA 3OLWA 1JAIA 1NP3A 4H7EA 2JBAB 1OBVA 2P30A 1SKYB 1E69A 2WMYA 4YEDA 1DXQA 4YRKA 2D62A 1YS1X 4FJ0A 1V16B 1KYIA 5B2FA 1WMBA 5IK2D 1JZSA 3OFKA 3GG2A 1F1BA 1UFRA 4FBMA 4UUOA 3QQ5A 4XD7D 1Z8DA 3V97A 4HAWA 5H83A 2WR8A 2FWIA 4Q9NA 4M3NA 3RASA 5K8JB 1OI3A 2JCXA 1EMDA 1D2MA 1JR3A 2W2MA 1YZGA 4A0SA 3JXEA 2V9CA 3DQPA 2Y4OA 1IH8A 1K8RA 2H48A 5HUHA 5AVRA 1L1EA 1DIGA 1ZXXA 2Q3CA 4IQ8A 1V45E 4RD3A 4JLAA 3CR7A 3OLQA 1RRKA 2IDJA 1O1YA 1IHDA 1Z17A 1J8YF 5G02A 3A6EA 4U7WA 1TLLA 1Y4AE 2IY9A 4JNKA 5CDGA 1UCFA 3O3MB 4FDVA 4ZVPA 5BQPA 1TI7A 2FQXA 1DEXA 4CF4A 5A2GA 3BHJA 4M9XA 4PSKA 4OXXA 4IHAA 5JZ9A 4CIAA 1N2GA 3CF6R 4EO9A 3H16A 2FU5C 3Q0TA 4XASA 3NUGA 1QTQA 2W93A 2PRZA 1VE7A 1SUCA 1W47A 1GXSB 5TLSA 4WLEA 4MQ4A 2Q3JA 3ZGYA 1EWVA 2WBLC 4D3SA 3EPJA 4YMIA 2EYQA 4Z1MD 4LY0A 4C22A 3CRW1 3ACDA 1DRVA 2GPAA 5DOVA 4EHAA 1ZMOA 1U3VA 3UHFA 1NVVQ 5LA6A 3H1AA 1EJ0A 4JI3B 2OCIA 3HTXA 1R3UA 3KB2A 1S2LA 4L8FA 4CV0A 3LUJA 3I92A 1JHDA 2WU4A 1WXWA 4KK4A 4XX0B 5E6RA 2ETXA 2D59A 1N6HA 4MGEA 4O4LB 4C4SA 2JLYA 1Z26A 2XA2A 3FX2A 2I2AA 2VBFA 5ER9A 2G71A 2RHRA 1L8XA 4LDRA 2ZVQX 3KAPA 1Q22A 3N0TA 5KC8A 5H3LA 4EOGA 4DQDA 1X3SA 3T7AA 5B37A 5JJLA 4DYVA 1GXSA 1QZ3A 3SNKA 2OC9A 2B21A 3IEKA 4BLSA 3I32A 2X4IA 2EP5A 3D6UA 3JD1A 4D9JA 1Y1SA 4V0ME 5EHZA 1GQ2A 1KXZA 1U9YA 2R8RA 4TWIA 5D51S 3U4CA 4L8LA 3R9IA 2ORIA 2F67A 2Q4EA 3K70B 2FFQA 2QEQA 2WE8A 1H4QA 3NDRA 1GYQA 1YXMA 4JQOA 5G2OA 4AIRA 3EXIA 3LG2A 1RTTA 4I1VA 1O0CA 2AG5A 4TL8A 3PUVA 2GZ1A 5C2JB 2DUJA 3LVRE 3L7BA 4G09A 1PZHA 4AZWA 4QYSA 1WXFA 4BO3A 4JODA 1NR5A 1XBTA 2C1XA 1YE3A 3I6IA 4KODA 3AERB 2JA1A 3ZHQA 1VPTA 1PFQA 2EBFX 1AS0A 2GBPA 1SXQA 4EEXA 4DLKA 5ERGB 1FFWA 2N0SA 1U7WA 2F64A 3SE7A 1T9HA 3TG8A 4NK4A 1K3UB 2HIHA 4LV5B 1QRTA 4QQNA 1V6AA 3EY9A 4EF6A 1KARA 1SWWA 2HDWA 1J9EA 1JDPA 4NMXB 4Y2HA 2VK8A 1T2UA 3THWA 3MJVA 1ISHA 4FCVA 3QFRA 4LOKA 3WQHA 4B6FA 3C3WA 3KB6A 3N2EA 1FFDA 2Z8ZA 1K5HA 2A4MA 3E1KA 3IUYA 4PAMA 3U5TA 3UANA 5F76A 1PWZA 4GP7A 4KBGA 4NFSA 2Y9MB 3W5DA 2YIJA 1JVNA 4C1BA 4C0XA 4R01A 4BKPA 1SQSA 2PMDA 3ESXA 4P7KA 5IM4F 1EVKA 5SYMA 3AHDA 2ZUVA 5EG5A 1O6CA 3K1YA 4HBZA 3J7AC 4XPIA 4NDNE 2NXJA 3G0IA 2PEZA 2WAOA 3ED5A 3V48A 1RYDA 4GKBA 2WPDD 4QD3A 4F4CA 1N8SA 2W71A 1T6NA 3HKCA 1GGJA 4NMLA 4RD4A 1JS1X 1TM1E 4UCWA 5EYPA 2R3SA 3VKVA 3ZWCA 5KOJB 2EHDA 4H4DA 1TW3A 4FUQA 1Z5OA 2I03A 4LEIA 3BXHA 2HMVA 4ZD6A 5I7OA 4RAQA 4M9UA 1KKMA 3B9RA 5JDCC 2H1IA 4D82A 2R7AA 1O97D 2Q46A 4MMXB 1NMYA 1OFGA 1YHNA 4P7JA 4EHFA 5CAEA 2ZYHA 3KETA 1I7NA 1OH8A 1RWMA 3GHYA 1E1YA 2YVLA 2XZTA 1NXOA 3URMA 1B6GA 2A0WA 1Y6FA 3RJTA 2NLOA 2IYAA 2C2WA 2BBSA 2OXEA 2V7QA 3MMNA 3CPEA 3PRJA 4JLUA 3TLGA 1EJ2A 3TXXA 3QE0A 3ZQ4A 5B1YA 1Z8FA 5KYKA 3PQ5A 3NPAA 3QEMA 3H5RA 5HE8A 1CUZA 2Z2XA 3LZDA 3W6UA 4WHMA 4FNMA 1C2YA 1FMJA 3PVCA 4CM8B 3AHCA 3HACA 4F6CA 2ACVA 4KIJA 2UYCA 1KFKB 1LDMA 2AJTA 2XVYA 2JZNA 3WS7A 1XDDA 1FVFA 5JY1A 2FSSA 3GVHA 3TLAA 1A7UA 2B8TA 3H9CA 4BVLA 5FCDA 3W6OA 4B3RB 3TIIA 1X7XA 5E4TA 4YBRA 1A95A 2NGRA 5LBTA 2KSQA 1IHOA 1FP7A 2FMUA 1ZMRA 2YXDA 5B1HA 1FUKA 4LX8A 4YK7A 2C5BA 2L0XA 2O9JA 2O2XA 4NDZA 5FPHA 2W6ZA 3N6VA 2EC5A 2LKDA 4UPDA 1RZRA 1B23P 1H94A 3I1IA 4AP9A 4D41A 2LNDA 1P77A 5AKZA 3BJRA 3MMZA 4QC2A 5HF8A 2I91A 2YWCA 3IEPA 4IW3B 3U3JA 4OHYA 1H2RS 4D3YA 4F93B 4QTYA 5JJIA 1KFBB 5K0GA 2YNMA 3ICOA 7REQA 3RTGA 2QUAA 2B4RO 4PLVA 4BJ6A 1MR3F 1W9HA 2NO6A 1KZ4A 3QK7A 2ZDQA 3RIXA 1V71A 3EZLA 1DTWB 1UQTA 1LH0A 1VBFA 4CRWB 4D3DA 5B6PA 1KRWA 1T10A 2FK7A 4JI1B 4S0ZA 1G9TA 4E13A 3KEGA 3ZHZA 2Q5HA 5ALPA 5KMGB 5JQGB 3LS2A 3AHFA 2DR2A 3O2JA 3HU3A 4EKYA 4D9HA 1IVNA 3MXTA 3TIGA 2YTZA 1PZEA 3AHHA 3RH0A 1P4RA 1GPYA 2VHJA 5F2EA 3V1KA 3A4LA 5EEHA 1ZAYA 1E0JA 4EH1A 3REOA 1Z4KA 5MN5A 4F9GA 1UWCA 1YB2A 4JLKA 5E1MA 2X0FA 2JIDA 4Y9SA 3W2IA 3PGMA 2BFBB 1R5BA 2Q2NA 2FF5A 5AI8A 3BE5A 3SSMA 4NCAA 1PT7A 1S2MA 5DGCA 3EQ7A 2BUAA 3BK1A 4Y6QA 2R7LA 4KR2A 4RZHA 1AUVA 2R0QC 4WZBA 4OCZA 3NWBA 3WFJA 4XTCS 3MELA 3OZAA 1RYNA 3DL7A 2YQZA 3UAXA 4LJAA 5ICFA 3OJFA 2ZBEA 1RZUA 4D99A 5DHQA 4B79A 5JYEA 4UEJA 1EFDN 1V1MA 3AGPA 4NDAA 3X1JA 3VA7A 2C7RA 5EQDA 1D2HA 1E96A 2Y1XA 4PG5A 3TKLA 4WXYB 1T9DA 4R9VA 5F5NA 2J3MA 4ZHQB 2IBSA 2IIVA 1UM9A 3ZZMA 4R5HA 4C4TA 3WL7A 4EENA 2VQFB 2IBTA 1U2QA 5CD1A 1OJLA 4U39A 4HVTA 1CZNA 1S4QA 3O31A 3NIFB 2VI5A 5DM2A 1DADA 5ECDA 3C3CA 5EJFA 5K3BA 4LGCA 5B57C 3NHRA 3NRBA 2I1LA 3FFXA 4NS4A 1MF7A 2YMLA 2I3ZA 1SRQA 1RHKA 3PFGA 4Q1DA 5IJ9A 2QL7A 3W5HA 3AERA 5JPIA 1QIDA 4Z53A 4EUHA 1SURA 1T1RA 3KYCA 2Q3LA 3UJ7A 2VHWA 2AOWA 2WYWA 3I04M 3HWSA 3RIGA 3SF0A 4DIMA 3KNZA 4EO7A 2DWOA 4EW2A 4LCBA 1YS4A 4RMJA 1Q14A 4LYGA 4LECA 1XZ8A 2D1FA 4ENUA 5MFZA 4Q4DA 1L6RA 3DVLA 5DASA 1XU7A 4QO7A 3UHAA 2YUTA 5DYNA 3MZ0A 4Z0HO 3ENVA 1T5HX 3EGEA 4DAOA 3D4LA 1JV2B 4F9TA 4GLBA 1GQFA 1XEWY 4CLHA 2H11A 3C5VA 1IY1A 3HUFA 2DKFA 2I87A 4G4GA 3CZQA 3B1JA 4QYTA 4AECA 4F97A 1RPZA 5DSXA 5AR1A 3KJHA 1PL6A 5JWOA 2JRCA 2CDCA 2I3AA 4CL2A 4U7DA 3M6WA 2BAGA 4EZEA 4NYIQ 4PG8A 1GL7A 2J3IA 1R5OA 4K9MA 3UHOA 4A8TA 2HIMA 1KZHA 5C0OE 4JI6B 2OPHA 2WV9A 3AZPA 2HHLA 4BO1A 4CYMA 4XRGA 1VKHA 5JSZB 4LS3A 4JA2A 1OD6A 2I4RA 4M76B 4HNTA 2GTIA 1E7QA 1F06A 3E9QA 3TBFA 3VC7A 4MCIA 4FYYA 1VBMA 5F3RA 1YCGA 1QX4A 4MS1A 3KB1A 2O1SA 3H5VA 3OJWA 5GONA 3GAZA 3IIKA 1AC5A 1SA0B 3EMDA 2BP7A 4FW9A 1BMTA 1CUSA 4CMGA 3BQMB 2JJ1A 1J33A 1MJHA 3NAZA 5HG0A 2H18A 1D09A 2NUTB 1EVEA 5F5XA 3SF8A 3SIRA 4YJ2A 4QPDA 2QGZA 4D8XA 3F9IA 5ECWA 4JY7A 4MRVA 3AL0C 3KJNA 4BVKA 1PR6A 2JI6A 1GR0A 1XNHA 5ILGA 4B3GA 1YZLA 3QU9A 3RS2A 3ED1A 3NC0C 1VXOA 1CS0B 3WLMA 3C74A 2GB4A 4NYMQ 3FYUA 2ZUFA 2CNWD 1VE9A 1WU8A 2A2ZA 1GKLA 3DTTA 4GOJA 1L7VC 4OV6B 5IM4A 3A6DA 4GI1A 4EY3A 1Z08A 1RJDA 4EMUA 3B2QA 3JQ8A 1KU0A 1ZJZA 4GX5A 2BR3A 1ZH8A 2M9MA 4Q9IA 4B81A 2XZPA 3BXZA 4RGBA 4XLLA 5JS7A 4DPMA 3NVDA 1E2QA 4JKYA 4E11A 3RVSA 1QRUA 3RUCA 4OD0A 3HLKA 4C6SA 3H3FA 3C87A 5B7GA 4CIWA 2WJGA 5BT8A 2WHQA 4RF5A 2ENUA 3S81A 1JB9A 4CMEA 4G67A 2Q0XA 1S1CA 1VJCA 4D9FA 4AMBA 3G0DA 1CZLA 3EXHC 4QKQA 5I9NA 3QKSB 1G8FA 4BO9A 4CUJA 1NF9A 3NB0A 3I2IA 5B1SA 4AF8A 2XWSA 3L6BA 1E9CA 3OFNA 1W30A 1W25A 3W3AH 4V39A 2OZLB 3HY6A 2X4GA 1V7QA 2HV9A 3WK7A 1P0MA 1V7CA 3QTLA 2J3JA 4OB8A 4C06A 3EBLA 5L3SB 2LXNA 3J81A 2CMHA 1A1VA 1EB9A 1KO5A 1VL5A 1G59A 4OQPA 5CH8A 3T7RA 4PGMA 1NX9A 4I3FA 1VYHA 3E61A 4H15A 3EJ6A 4FNOA 3WJ7A 3AI1A 1NUTA 1QE3A 4TT3A 1TXGA 2X9VA 3EW9A 4Y1RA 4BNTA 4C2TA 4PTLA 3GH3A 1IN7A 3QNMA 5D1HA 2RBKA 5EFZA 2IYRA 3LYLA 4MVJM 1PX0A 2ZBGA 4WKBA 2BKEA 5IAJA 1K75A 2EWVA 4WNIA 4X7BA 2NACA 5DHRA 1JLHA 4O2BF 2O07A 3GRCA 4BC1A 2WUGA 3F6EX 3WZLA 3ZWOA 3WIVA 2FPIB 3LUAA 2PU7A 4JT2A 4COOA 3D4PA 1O7JA 3GJQA 3G23A 5CFZA 2VT2A 2WTXA 3DWEX 1D4AA 2C1ZA 4LF4B 1IAQA 1M2FA 3EUEA 4G2TA 2WTMA 1IZ9A 3GVPA 4H3KB 2FB9A 3F97A 2QORA 4M0LA 4O6VA 1IEQA 2C95A 4A27A 3HZHA 3HR4A 1NJ2A 4PZAA 4BVAA 2F1OA 4KR9A 3MBIA 5IXYA 4EQZA 1WD5A 4GMXA 2A1TS 3GLIB 5HMLA 4BPRA 4BGUA 2QU8A 3LKVA 5AXBA 1QKKA 5GGYA 1Z4JA 2XKKA 1Y7IA 3MTEA 4MVXA 3UV3A 3G1UA 4MP6A 4TSFD 4AUNA 1U6JA 2N46A 5CW2A 3NBYC 3BSWA 1U9IA 1QHYA 1DKQA 2AQKA 1W5AA 1BHJA 1TE2A 2Q6OA 4U2BA 4II3A 2AI3A 1ZC4A 1BMFD 1F2VA 4E5YA 4AD8A 3DL2A 1BQ4A 1HNNA 1X42A 2N75A 2E7ZA 1X1AA 4Y18A 4RADA 4I3GA 3HWRA 4YBZA 1FFXB 3GJ7A 3WQQA 4W9MC 2IELA 5E6SA 5C1OA 5HGXA 3PWSA 4TKUA 1Z0JA 3EZFA 3H5TA 3IRVA 5JZBA 2HYDA 3DBRA 4I99A 4TRNA 1EUDA 1PSZA 3D59A 5EVCA 1PDVA 5SZIA 1UH5A 1PFWA 1TK3A 9ATCA 4D9CA 1F7UA 5L3ZA 4PYJA 4Q12A 2HMUA 3FUWA 4M8LA 4B09A 3KLNA 5IVPA 2CUTA 1QYWA 1Q95A 2IUFA 1N4DA 3EIWA 5JRZA 2O8DB 1H8HA 1M2VB 1YRAA 3KOWA 5AKHA 1PQYA 2GBFA 5IP5A 2OY0A 4DKJA 3HKEA 3O84A 4GX0A 3KQQA 3UENA 1KOGA 4R4JA 1H93A 2CL5A 2BH9A 3OPVA 2PSSA 4E5VA 2BF4A 5LR6A 1J49A 1KE1A 4UZSA 1NOKA 5C7YA 2CCJA 3B85A 1Z2EA 4FIZA 2ZTLA 4KMOA 1Q6YA 2NUPA 3VZRA 2JC3A 1IK6A 1VE6A 5P8WA 1NAIA 5TNXA 1C0PA 5D85A 2ZIAA 5LMUB 4FR5A 3TXYA 1I94B 1QHHB 3B9PA 3ESAA 3MB5A 1JIVA 1WNTA 4IL5A 4V02A 3QYPA 5DGTA 1Q92A 1CJCA 3PGLA 5JHGB 4YALA 2QTCA 1A4UA 3SYRA 4RJLA 3CVUA 1TW2A 5I51A 4BYGA 4Z7OB 2DM6A 2X2EA 3SSNA 1TZ2A 3IAFA 3QX8A 4UAJA 4ACBA 4FD2A 3T5BA 3QA3E 5HDBB 1SH7A 3B12A 2FDCA 1PT6A 4LE0A 1CY6A 1RZVA 4UNSA 1ZK4A 5TB5A 6AT1A 4KXNA 3ZI0A 1S2IA 3JCZA 1BS1A 4HAIA 4KQ1A 4MGIR 2O59A 2CF6A 2OHOA 4FK8A 1YRBA 1HO3A 1W34A 5DX8A 3RFVA 2ZREA 3KTOA 5L4NA 3CRZA 1IJBA 2FMIA 3GUZA 1X7GA 4US2R 3A6LA 3I58A 4QU0A 4RFLA 3E2PA 1LX6A 3QLJA 4LUCA 4HGPA 5FUXA 2WD7A 3PWTA 3T7CA 1XPUA 2W6ID 1K7YA 1C8BA 4MWEA 1W581 2OK8A 1WAMA 3DBVO 1POXA 1CQZA 2HOQA 1D0SA 1GD1O 3HEAA 3AILA 3JTMA 4E33A 1J56A 4MUKA 3K4QA 4LYFA 1DIAA 1L6IA 2IW3A 2EBHX 4QGGA 3ZI4A 3DO8A 1GL6A 1YH3A 5LLSA 4CNBA 5EJEA 3SWWA 3RKUA 5JAOA 4RTNA 3KKNA 3RBXA 4B43A 2BKLA 1BX3A 3VC2A 4ALMA 1WULS 2AS0A 1FTSA 1EX7A 3UJDA 1MNQA 4DMRA 1OR8A 3COYA 5IFLA 3M70A 3UJ8A 5CX1B 1SZDA 3DWIA 5FWXB 2WTAA 4PSCA 4D46A 1DAOA 1W35A 2WYOA 3I5UA 2X0JA 4C0KA 1EZ1A 4H0FA 1Y8ZA 2OAGA 1Z7BA 5ALUA 4ESVA 3OJEA 1Y8RA 3KWMA 1UBKS 1QG4A 4JQZA 5BR4A 8OHMA 1URPA 1IY0A 4P53A 4UDOA 2QLTA 4UATA 1E7WA 3PGVA 221PA 3K7EA 4TTQA 4TWBA 2P2NA 4EI8A 1C1HA 2IYUA 1HKUA 2BFAA 3EH1A 3V1LA 4BVHA 4LZAA 3UBMA 1AV7A 1LPAB 4QLAA 4URHA 4BP9A 3IQIX 3NBUA 5JH7F 5K0CA 3E22A 1X77A 1Z5UA 3GWGA 3OEEA 2JIQA 1O94C 4DCMA 3KEFA 1E3WB 4TL6A 2B7CA 9MHTA 2PX8A 4PS0A 2VQEB 1P9RA 4BNVA 2Q41A 2YDYA 3I6ZA 4YV2A 3K94A 1CYEA 1ONSA 2P9HA 3CZCA 1X39A 4KUGA 1WQ1R 6ADHA 2NU7B 1I4OA 4K2HA 3YASA 4DB2A 4FMBB 3KQKA 3CLVA 3NBXX 5GP1A 3T54A 5F9HA 1HL3A 2BR5A 2A7XA 4XSVA 4HRVA 5FWDA 2R8PA 3SQMA 1VJDA 4Z2AA 3PHLA 3VPXA 3PDIA 3I1JA 4IH1A 1UDXA 3U9TA 3UT0A 4DZZA 4ZOQI 4TTJA 5B12A 3CNQS 5JT1A 1V1RB 5AP9A 4ZHSA 2E21A 4D5GA 2Q2QA 1H4SA 2HZ7A 1WPGA 1FTGA 2PGOA 3BQ9A 3C14C 2FX2A 2R2GA 2DTXA 5EJ2A 1N0HA 2R6HA 1OXMA 1P7CA 1C3XA 3L0SA 4WNCA 5FUVA 1O95D 1XA0A 3LZ6A 4WZAE 2ZSDA 5LBIA 4Q7JB 1DEHA 3QEKA 3BICA 4F04A 3VPBA 2XTNA 4EK9A 2P0AA 2XBUA 4EPYA 1U65A 3SQLA 2GJ4A 2NPOA 3ID6C 3L3BA 3QSGA 5ULLA 4YHBA 2ILVA 3JVEA 4C05A 5LOVB 2AN5A 2V3CC 2O0KA 4MW9A 2HXSA 3VU9B 1KXJA 2W2LA 1P6QA 3TOSA 3ELWA 1AH2A 1RYZA 1V3QE 1Y63A 2B7LA 2C3YA 4UEKA 4CEJB 5ARCA 1HR0B 4EVSA 3DDNA 1UJ6A 4MUBA 4DLWA 5IWAB 4Z4CA 4CEHB 1HL7A 3EHEA 3UMGA 5IT4A 2GN1A 4K46A 1F2TB 1ST2A 4WN9A 3ZVRA 2VO1A 1OXSC 1KSFX 2ZRGA 1YL7A 2BGUA 2JFZA 3IAEA 1U80A 2ZWMA 5BRJA 4BB5A 3ML1A 1F0NA 3T1YB 2F1HA 1MQ9A 3W2EA 121PA 1J8VA 3EXG1 4TLAA 1KO1A 4EGFA 1JW9B 1XKXA 4LRXA 3RC3A 1TM4E 3V1UA 1RWXA 3EQZA