5CB8A

Crystal structure of adenosine-5'-phosphosulfate kinase in complex with aps and sulfate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
174
structure length
174
Chain Sequence
QRGVTIWLTGLSGAGKTTITHALEKKLRDSGYRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRIGFVSHLLTRNGVIVLVSAISPYAAIRQEVKHTIGDFLEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRTDLEELDESVGKIWQKLVDLKYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recapitulating the Structural Evolution of Redox Regulation in Adenosine 5'-Phosphosulfate Kinase from Cyanobacteria to Plants.
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Transferase
molecule keywords Probable adenylyl-sulfate kinase
total genus 72
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cb8A00
4P4SB 3IQXA 4Q1EA 4RD0A 1MT0A 3EZ2A 4BGDA 1E99A 1DAFA 4LCBA 3GMTA 2DYKA 4XSHA 2NQ2C 4A0RA 1A2BA 4MUAA 2J7KA 4QJ3A 1DO2A 1G8FA 1S1CA 2QUZA 2AN9A 1PUIA 1XPRA 4KBFA 1ZUHA 5KYKA 5FUWA 2NO7A 2VIIA 2J46A 4FMCB 2EWWA 2HJGA 2QAGA 3UKDA 1FL9A 2VHCA 2UKDA 2FV8A 4LHZA 4ARZA 2AKAB 1U9IC 1R8QA 2X19A 2VH5R 4R2IA 1EXMA 4UQOA 3KXIA 5CITA 1QHGA 4V0ME 1MRNA 4DC9A 1XP8A 2I3BA 5L3QA 4PZLA 1NMZA 3KTAB 1YHNA 3KJHA 1KIMA 1ZP6A 5E7MA 1YU9A 1NLFA 2ZXUA 3I1FA 5JWRA 1S1MA 1W36C 1P75A 3F0TA 2BKEA 2O8EB 3L0SA 1D9ZA 2W0MA 2V54A 4UJ5A 1R0WA 4Q1BA 3VQTA 1XJQA 5AJWA 2OBLA 4JKIA 2OXRA 1HV8A 5C4GB 2H8KA 3FHCB 4EPYA 1F60A 1ZUNB 2AFIE 1IJFA 2QORA 3QKTA 4JVSB 1ZNXA 3B5JA 4QM6A 1Q12A 2QTHA 1OW3B 4PO9A 4MGZR 1RE0A 4N0DA 4OBEA 2A3RA 3B13B 2FSFA 3W8RA 4FMBB 3QKRB 3VR3A 3PEVA 2P0EA 4QHTA 2Z5FA 4PHGA 4ZKEA 4DZZA 3LQQA 1QVAA 1II9A 1VYTA 2PCLA 2GJSA 5KNBA 1VHTA 1D8TA 5JHHB 2REBA 1VYVA 2P3SA 3ZQJA 2R6DA 3QXCA 5FI0B 3BFXA 2ZUBA 1FQJA 4TLDA 2WIBA 1P7CA 2ASEA 1OV4A 2GJ8A 3WYGA 2QSYA 2XZPA 3WMEA 5L3SA 3C16C 3W6OA 2ONJA 1OT3A 1XZQA 1N6HA 4HB0A 2GHIA 2HT6A 4DLTA 3FFAA 4QBGB 5DISB 1W49A 3K0EA 5FUVA 2QMEA 2ZU6A 5TDHA 1FMJA 3FKSD 3QENA 1HQYE 1LS1A 4OK6A 4F4IA 4FWTA 2JLVA 4DCTA 1KI8A 3MCAA 2HXYA 1N5IA 2BDTA 5BYKA 1MV5A 2CLSA 2V55B 4YONB 3CH5A 4S2EA 1TADA 4EDHA 1BH2A 4WXRA 1QHXA 3AM1A 1GTVA 2HJVA 3NWJA 1L8QA 2GNOA 1TUEA 3CPHA 4MGIR 1S9DA 1CULC 3G82C 2X2FA 2C9YA 1K8RA 2LKDA 5E7JA 1CXZA 4BFTA 4EQ6A 1SVKA 5FR1A 4IFBA 5DNYB 3KQUA 1J7KA 4AURA 4DDUA 2ZS9A 3LLMA 4CEIA 3ASZA 2VP0A 3EZFA 1VPLA 1CF4A 1F3OA 2NO1A 4CRWB 3VKHA 4QBIA 4BLQA 2PBRA 3BGWA 4HSEA 2W2VA 1VG1A 4QHYA 4EFNA 3OAAA 1R8SA 1X3SA 2J0QA 1ZNWA 4DUGD 4Q7LA 3B7GA 1XB2A 2ZRLA 4TMVA 2IYVA 2VL7A 4JSYA 4HLDA 1KK3A 1G7SA 2WMNB 2CCGA 3CLVA 5FFMA 3SHFA 4TYQA 1J70A 2MMGA 3MJRA 2ZAMA 3T06B 2HCJB 2PT5A 4PAOA 3BOSA 1E2EA 1OJLA 5G3YA 1E2IA 1H8EA 1W4AA 3A1TA 4D0NA 1GKYA 3FYHA 1Q20A 2ZVPX 2OAQ1 4QC2A 2H17A 4QRHA 1RJ9A 1VHLA 4CYMA 1P4SA 3EC2A 3FTQA 4NYIR 3GLGE 2IA5A 3Q85A 4DDTA 3TUIC 5KOYA 2BBTA 2FGJA 4D25A 1JEEA 1ZNZA 3UG7A 3A1VA 4JLMA 4Q48A 1I2MA 4Q4JA 2BCJQ 1SXJE 3ZGXA 1SVWA 3CRW1 4HZUB 3N5CA 3PG5A 4JT4A 1N6IA 2YWEA 1TAGA 4MRNA 2IUSA 2ZE5A 3QI2A 1FW6A 4JYCA 3MWKA 3X1DA 1TF7A 4OK3A 1OXXK 4DT1B 4FN5A 4PSKA 3GEEA 2ZJZA 2FH5B 1M7HA 2NPIA 2PX0A 4LC1A 4KBGA 5GJWC 1QDEA 2O52A 2Q6TA 3C14C 4URUR 2C2HA 2GEVA 4C2UA 2YWFA 4JVMA 2QG6A 1J8YF 1ELOA 1YZLA 5J4YA 4RKEA 5KSYA 1E0AA 2E87A 1RW4A 1NN5A 5FL7A 1CR2A 1KO1A 2GCNA 3RRYA 4LHXA 2F1JA 4C7OB 1AA9A 3I73A 4A15A 1GUAA 3HP1A 2J0SA 2ORVA 2YNMA 3RWOA 1R7RA 5DLQC 2IWHA 1X8JA 2WVJA 2ATVA 3H84A 1Z8FA 4ZIRA 1NG9A 3FMFA 1OF1A 3RRZA 3LY5A 2ZE8A 1F2TA 5DHFA 1JXMA 1QHSA 3UWKA 4EJSC 4P33A 3V4RA 1XCGB 3ICEA 1TEVA 3ZVRA 3QKSA 1E9DA 1ZCBA 3MD0A 5IDVA 2GEDA 3VTKA 4TL9A 1T3SA 2ZYTX 3A1SA 2NTYC 1KKMA 4PXAA 4Q00A 5HE8A 1S8FA 5J4VA 3IPYA 5CJPA 2QAGC 2DFNA 5CLQA 4QBHA 2AKYA 2PZGA 1WMSA 3GLGA 2ODWA 3KZ1E 1LNZA 4EFLA 2IUTA 4R7ZA 1XF9A 2ZS8A 3L0OA 221PA 2F1IA 4OK5A 1ZIPA 4LJYA 4M2LA 3KKQA 2BWJA 2MMCA 3MSXA 2QM8A 4IHQA 5G3ZA 3R7WA 3TSOA 1GM5A 4JLVA 1UDWA 2A78A 1CS4C 2X8AA 3AF3A 5DIFA 2ZREA 3D31A 1KJWA 1HE8B 1E4YA 4DHEA 4E09A 2V8OA 1U8AA 5A5GA 4C2TA 2R62A 1GFIA 3AEZA 3DDCA 3AVQA 2OCAA 1GZSA 4A4DA 2BM0A 1B0UA 1P2SA 4EIWA 5B30A 4JS0A 1XTIA 3GLFB 3W34A 2F43B 4M9SA 1QHIA 4JLDA 4PC1A 3ZQ6A 1FNMA 2OCBA 6Q21A 1OXVA 1Z0FA 2B92A 4P4TA 1N6RA 1R0YA 4Q1DA 5KHOC 2H1LA 4DVGA 3KXKA 5AWFC 2C9OA 2PZFA 4HDOB 3WP0A 4HI0E 4LPKA 3U7HB 3K9LA 4TL7A 1FQKA 4OJKA 3QIAA 5FUYA 4RFSA 3BXZA 4K81B 2HEIA 5KSPA 3IIMA 4NH0A 2AK3A 1UPTA 2IYZA 2W6JA 5CYOA 3UWOA 4BE7B 1W46A 2H57A 1TQ4A 4ZKDA 5IT5A 5JJLA 2EVWX 2BC9A 4LDJA 1CRQA 1F6BA 1JJ7A 2BM1A 5C18A 4TMZA 2GJKA 3ZIAA 1OFIA 5TXGA 1TQ6A 3L82B 4LBVA 4L15A 3B85A 1WRBA 1Q44A 2XEXA 4BASA 4CT4B 4CEJB 3TKLA 4DCSA 1COWA 1DAMA 3BH7A 2BIFA 2WKQA 4JYBA 4TWZA 2QT0A 4QNMA 2CBZA 2D4HA 1HUQA 1XEFA 4QGGA 2QPAA 1UEIA 3I62A 1GL6A 5CDFE 5L3RA 4NBSA 4O0MA 4RY2A 2EFCB 3OEHA 2ANCA 1E9EA 2KBEA 1X1SA 3FPAA 4OQNA 4Q4HA 3QVUA 4IEIA 1QHYA 1DAGA 1KNXA 2NO6A 5KPDA 2WJVA 3KB1A 2OESA 1A82A 3QXHA 3LW7A 3M0EA 1HQCA 3ZDQA 4NPHA 3ADDA 1GKIA 2IEYA 2AX4A 2GZAA 4KITB 2GRJA 3OIWA 4CF7A 1G5PA 3NBFA 3RWMB 2JATA 2YOGA 3OIUA 2RGNC 2XNDD 4Q4AA 1EWRA 4G5RA 4TMXA 2DWOA 4OI4A 5EXPA 1H8ED 3A36A 3X2SA 5EXSA 1W44A 1UAAA 2IXEA 3MLEA 1YR9A 4UXJA 4DLRA 4R71A 1KNQA 2DFKB 4EKDA 5C1BA 1E98A 2WAYA 3BRWD 2WAXA 4BFVA 1LF0A 4CEHA 2ZSEA 3N2EA 4WOPA 1G17A 5D3QA 4IW3B 1FP7A 4LBZA 4M4SA 4DKXA 1RRGA 1Z6GA 2WKPA 3HJNA 1N0WA 1GITA 3NC1C 2KWIA 2FFAA 1AS0A 1KMHB 2WICA 1E9RA 2D2EA 1XRJA 2AR7A 1AZTA 4IOMA 4AI6A 1AM4D 1E1RD 4M53A 4NKRA 4PANA 2VF7A 3SNHA 2QE7D 5JRZA 3VAAA 2FFHA 2ZEJA 4YLGA 2CXXA 1N6NA 1E2HA 1W0JA 1Z0DA 2WZQA 4WZAE 1ZBDA 1IY0A 2J1LA 4LYFA 1G8PA 1J90A 3PVSA 3KKMA 1N0VC 2XTNA 4MRSA 3QG1A 1W4CA 2OO7A 4PHFA 1CIPA 3QF4B 4TLEA 3SYLA 3GLIE 2RGNA 1MOZA 3PENA 5FOXA 2ZYWX 1KI6B 1U98A 3V4FA 4BEBA 1ZM7A 2IHBA 3K70C 3GFOA 2JDID 2ZRMA 1OE0A 3PUZA 3MWLA 1LVGA 1R10A 4R9UC 5J5CA 4FW9A 3AUXA 3G5UA 2P6NA 3LW8A 4B3XA 3CX8A 2P5TB 3DZ8A 3NG1A 4DDVA 1N6PA 2XSZD 1UKEA 2REXB 3AKCA 3LA6A 5IRCD 2GCPA 1R2QA 5JWHA 2IYTA 1V43A 2VP4A 2WMOB 5DE3A 1R5NA 3BK7A 3MMPA 4B6EA 4DEYA 4AD8A 3SR0A 5JJIA 3DEFA 4G5SA 1TMKA 3DVLA 2DB3A 1T0HB 2XB4A 4BLSA 4BLRA 1NY6A 2EFEB 2NG1A 1FNNA 5FL3A 2D3WA 2KE5A 1OFTA 4OKSA 4BLPA 4JSTA 4KFUA 4I1SA 4D0GA 4LOAA 3PFIA 4TTRA 3G0HA 1WA5A 2JLUA 3U2QA 2V7QD 2OV2A 3VX3A 1N6KA 3C4JA 4LK2A 5CK4A 2G0NA 1IN8A 1D2MA 2QQEA 2ZRDA 3WP1B 2HDNB 3KQHA 2ZJBA 2ZYUX 4RD3A 3O47A 4UNNA 4YMWA 4DWJA 1NVXQ 5FPKA 3QPWA 2QP4A 4M9QA 3UATA 3I61A 4JVNA 1R0XA 3CO5A 4L5BA 1FFHA 2BEKA 1GRNA 4PTLA 4AYWA 2O5VA 1CR0A 3N70A 1Z2CA 3WBKA 3I3SR 1Q1EA 4E07A 4EPXA 4ZCIA 4DSTA 3VX4A 4D6PA 4PC2A 4IVPA 4X8HA 1Z28A 1N25A 3CWZA 1YR7A 4E5UA 2GK6A 4WVFA 1ZINA 4LV8B 4K8OA 2WSMA 2WWFA 4D4MA 1IXSB 3LH5A 2OCPA 1G3RA 5AUPB 5JRJA 1BMFD 4WAUA 5CYPA 4CEJA 2A30A 4AIIA 2GAOA 2J41A 1COWD 1K5GA 4RD2A 2IHYA 1CJTC 1KYIA 2RHMA 3CR7A 2X2EA 4G3XA 2JCSA 3AV0B 2JLWA 1NLYA 4Q21A 2R6FA 4B73A 1W48A 4KU4A 1NIJA 1IN6A 1CP2A 3DM5A 3GD7A 3W6PA 1OKKD 1YRAA 3LDAA 5EXXA 4BFZA 4LYHA 1EFUA 3EARA 1YR6A 2W2TA 3HYTA 1DAKA 2IYQA 4Q1FA 4HUTA 5L3QB 2HLDA 3I72A 3JVUA 1ZYUA 5FI1B 5BYJA 4TSFA 3H86A 4II7A 1OYYA 1IY1A 1OIVA 1BS1A 4QOSA 1T9HA 3EPHA 4IKEA 3TAHA 1OXTA 4IDOA 2WTUA 1OSNA 2NIPA 4EAQA 1BKDR 2QP3A 4DLVA 5FPYA 3RANA 3AQ4A 1M8PA 4RVCA 3KX2A 3OF5A 4DLZA 1ZC3A 4QM7A 4E03A 1X86B 1KSHA 2ZRNA 3REFA 1IHUA 2IS6A 1XD9A 3LXRA 2VSXA 4TYPA 3EASA 3UANA 4PO8A 4C0QC 3ZZ0A 4EJSA 3I5YA 4L4UA 4JLNA 3P20A 3PIRA 3WYAA 4B34A 4RZXA 4EPWA 1NI3A 2EFHB 2RAPA 3TUJC 2D7DA 3C7KA 1HEIA 4MKHA 4CVNA 1XXHB 4KFRA 1GKUB 4HLUA 3B1ZA 1E69A 4FCVA 4ABYA 2OHFA 5CM9C 1M34E 3FHTA 2LWIA 2PCJA 4LJ5A 5ANRB 2AL7A 3O8DA 5BN3A 3KJIA 3QQ5A 3AVUA 2C96A 1IN7A 3DHWC 2DHRA 3T1QA 1YQTA 1XJ0A 1G64A 3GCGA 4RZUA 2QPOA 3UIEA 2IYWA 3FMPB 1ZMXA 4D81A 1Q0UA 2EFDB 3FE2A 4ESHA 3OHMA 2XXAA 4PC7A 1HA3A 4DCVA 3GPLA 1JALA 2YJTD 2FPMA 2V1UA 2ZR7A 4JLOA 3ONWA 3IO5A 2G0TA 3R8FA 3SFVA 2HT1A 4ZPXA 3BB1A 3PEUA 4ZIRB 3ADKA 2ORIA 3R9XA 4LWZA 2G83A 1F2TB 2MSCB 4D26A 4ASUA 3BFVA 2ZRFA 4RFVA 5CIWA 3EPJA 1ETUA 2O8BB 1UJ2A 3JVVA 4LRWA 1RPZA 3GJ6A 2QRZA 3T1TA 2WJGA 2WJIA 4QL3A 4A8JC 2XJ9A 4O2RA 1DTSA 2CMKA 4HLUC 4ACBA 4B2LA 3SI7A 4DB2A 4V0NA 1IOZA 2CE7A 2GBLC 2ZAOA 4BEJA 5KU1A 2FFBA 3QF7A 4MGKR 1V5WA 3U4QA 1U9IA 4FMDF 5EP2A 4PQFA 3MJHA 4Q5IA 4LJ9A 4BZXA 3CRQA 3OIYA 5DI3A 3UMRA 1BMFA 2V9PA 4MKGA 4JJZA 3ETLA 2REOA 4ARZB 4HYYA 1E9SA 1KK2A 1LTQA 4GP6A 1G6HA 5TVKA 1XNJA 4OI2A 1EFCA 3ADBA 1OH5A 1A7JA 3ECCA 4QGHA 2N42A 3K0FA 1W1WA 3U44A 2YC4C 4LSGA 4GSYA 1GNPA 4M1TA 3U60B 3DKPA 3FMOB 1C9KA 4A0GA 4BPBA 1AGPA 4JBXA 2VSOA 4KI0A 2JLSA 3EZ6A 4PSVA 2OM2A 1RYFA 2NZ8A 1QZXA 4DIDA 5KSOA 1MKYA 1JR3D 4TMTA 5JZVA 2QMHA 2VO1A 4GOXA 1VG9B 5BN5A 3ZVMA 4HZUA 3ZD6A 2Q0HA 1X6VA 1EX7A 1E0SA 5AJXA 1Z6AA 3OESA 4E22A 2VHJA 3GLFA 3WNBA 5LD2B 3AVVA 4G0NA 4GBMA 3B6EA 2F6RA 4DSUA 3MGCA 2XSZA 3RRMA 1NBMD 1LB1B 5FBWB 4B74A 4XWKA 4UJ3A 3TVDA 4HATA 4BLOA 1KI7A 3HWSA 3K9GA 2AXPA 2EU8A 4BLTA 1M1YE 2H16A 3ZJYA 4F93B 1S3SA 2GDJA 3IEVA 2ZSAA 5DSZA 2OFXA 1T5IA 4G5OA 1HH4A 3QBTA 1YVDA 2OUKA 4D0LB 3VHLB 1SVLA 4OQFA 3WNCA 2QGZA 4Q4LA 5HKKA 3DZDA 2SHKA 2W2XA 2YINC 3Q8XB 4KVAA 3VR6A 5GADl 3FFBA 4LPSA 2JJ2D 4URWR 1MABA 4Q18A 3GJ7A 1AZSC 2Z6VA 2ZQ5A 1G7RA 1SKYE 1GL7A 2X1VA 2RHDA 3AF0A 2FFQA 3B1WA 3AVWA 4TSFD 3O8BA 5FOTA 3CR8A 4G5QA 4EQ6B 1RFLA 1BYIA 1VG0B 1VIYA 1Z6TA 2FGKA 2W83A 2WJYA 3L8ZA 4M1SA 4NCJA 4ZCMA 4MKFA 4DLUA 4NZYA 4CEIB 3KFVA 5E4FA 2RGCA 1K6MA 2VP5A 4EPTA 2F1HA 1NVUQ 3ND9A 4IDHA 2IYLD 4LBWA 2CEAA 5CJ2A 3V9PA 2WWYA 4DB4A 3ZD7A 4L8GA 5CK5A 4QHSA 1YZNA 5EZ6B 3DL0A 1X8KA 4W5HA 2A9KA 1CKEA 3IGFA 4BFSA 4CEHB 2ZUDA 5EXTA 3ADCA 4NYJR 3T35A 2QMOA 1OYWA 4BRUA 3QEJA 3LFUA 4QGAA 5LB2A 5FOWA 2Z83A 3UMSA 5H8WA 3UG6A 4LZZA 1F2UB 1UKVY 1ONBA 4Q4AB 2ZJ8A 1TL7C 3TH5A 1DBSA 2F1RA 1L7VC 5AK0A 2O0HA 2DFTA 1ZJ6A 2AXNA 4NCHA 2Q9CA 4V0OA 3X1YA 3GJ4A 1NSFA 3PUXA 1P9NA 1VDZA 1G4UR 2G9NA 1YR8A 3TR0A 2GAAA 1SGWA 3MWYW 5JS7A 3HR8A 3AF4A 5FOVA 4LC0A 1CLUA 2PEYA 4LHVA 1MO6A 4AKGA 3RYTC 5B64A 2EQBA 5G40A 1KY2A 4URVR 4AYXA 2CLCX 1G3UA 2CL7X 4CGZA 2F7SA 2JEOA 1U2RA 3CRVA 3IEUA 1Q57A 1E2QA 3QY0A 4D4KA 1ESNA 4HAVA 1YKSA 1QG4A 2DY1A 4GZLA 4H9GA 5JWOA 4H1UA 5FBVB 2BHRA 4DLSA 3AVTA 1CRPA 1XD2B 3BC1A 1SKYB 1T6NA 4A2QA 3Q7QA 1DG3A 5JEDA 1XEXB 3GJ8A 4MYCA 4YC7A 3M6AA 3CKLA 1ZC4A 5DHAA 4EFMA 3I32A 2WWHA 1HT1E 2CVFA 2ZJ2A 3BBPA 5JEEA 4AYTA 4US0R 4DLYA 3U5ZB 3EX7C 2XTMA 2ZJOA 2HYDA 3Q3JB 2O8FB 1Z6XA 2CJWB 4ASUD 4XVUA 2IS1A 2PLRA 2QL6A 3WNDA 1DO0A 3CF2A 4C30A 4JMPA 3SN6A 2ATXA 2BBOA 2IEZA 5SZHB 2R2AA 2O0KA 1RRPA 1US8A 3QSYA 1AQYA 2QP9X 1NRJB 4JKYA 3VNVA 5FTKA 4QJ5A 3THWB 1DARA 4OL0A 1ZD8A 4A6PA 4IOLA 4D2IA 3SC3A 3I5XA 4HEJA 2WWGA 2QE7A 4IEEA 4XH9B 1SHZA 1D9XA 2VHQA 1T5LA 5DYIA 2P67A 1G1MA 4IXNA 4LUCA 2JGNA 2G88A 2X77A 5CB8A 4L9WA 1PZNA 3C5HA 4KYUA 1A5TA 2VQSA 3TBKA 3EIEA 4ZDKA 1RYHA 5JSZA 1NG1A 5HCNA 1EESA 1ZIOA 4MRRA 2RGAA 4RD1A 5KPJA 3LWNA 4MH0R 2IXGA 4Z8XA 1Z63A 3WRYC 1D6JA 3AP3A 4NYMR 3AGPA 4A8JA 2C77A 4FCWA 1Q3TA 1D2NA 3AVPA 3I92A 4UNQA 4TYWA 5K8LA 1KI1A 3FKSA 5H70A 3JZAA 3B9PA 1EFHA 1FUKA 1G5RA 3EC1A 2KI5A 1JAIA 2UZIR 4WZBE 1R4AA 1XTSA 3AP1A 1G3QA 2WOJA 2IYXA 1DPFA 4ZI3A 3DO6A 5J4LA 1OB5A 1KK0A 1U8ZA 2C98A 2DWPA 2F3RA 3D6TB 1X8LA 4N0EA 3I4LA 1KKLA 4MRVA 2IS4A 2OCYC 3SE0A 4GL2A 2FE4A 3SYNA 3QKUA 1NY5A 3L2OB 2B6HA 1VKJA 2BJWA 3BS4A 2CL6X 3E1SA 3LVRE 4JZKA 3TK1A 2ZTSA 2JLRA 1UBCA 4KYIB 4HAXA 5EP4A 4YMVA 621PA 3LX8A 2Q3FA 1W36B 1US8B 4PC3A 4PPGA 2O8DB 2G6BA 3K09C 5DH9A 1OFHA 1WBBA 4AKIA 4IDNA 1XEWY 3D7MA 3QJYA 2RGDA 2OE2A 1E6CA 4AKEA 1MRSA 4Z8YA 5B2ZA 2ZM5A 3KKOA 2Q9BA 2GILA 2AHOA 4G01B 3T15A 4ACAA 3SJBA 4JLPA 1II0A 2QN6A 5SZJA 1W7AA 3ZVNA 3FMIA 5FUXA 4IVQA 1RZ3A 4U7DA 2ORWA 1NSTA 5J47A 1JXOA 4IXMA 4AY2A 1TPZA 3VR2A 4BFXA 1G21E 4WIAA 4DSNA 3UXMA 1JPJA 4GDFA 1E9BA 3VU9B 2YVUA 4M9XA 4RSGA 5A0FA 3SEAA 4NMMA 4US1R 1ZCAA 1H65A 3U7EB 2J45A 2IUUA 2QAGB 4D82A 1QVRA 2JASA 1G8GA 1XWIA 2OFOA 2ZU0C 1FPMA 1SQ5A 2Z4RA 4RFSB 3WRXC 3V00A 3B1VA 1NBMA 1T3LA 5KO2A 5DI9A 2OBNA 1TX4B 1PLJA 1JQLB 5HCIA 3ASYA 4Q9IA 3K09A 2B7CA 3W9YA 3PEWA 4M22A 1Z22A 4QNRA 1E3MA 2FOLA 5UKDA 3FB4A 4AG5A 3CX6A 3LRPA 4I4LA 3P4XA 4A2PA 5L8VA 1GL9B 5EE5B 3MAAC 1BIFA 2ZITA 2J0VA 2V7QA 3PXGA 4KXFB 1JQJC 4O25A 2JJ1A 4JVLA 2YV5A 4IDPA 4UNPA 1U0JA 4S35A 4M1OA 3Q5EA 3U3JA 3H4MA 5DGXA 5E3HA 2ECKA 3DMDA 4M0LA 3E2IA 4ZDWA 3TSWA 2CLDX 2QQ0A 2A5GA 4PZYA 4DSOA 3RS2A 5GJVC 3R20A 3RABA 3F8TA 1JR6A 4CDGA 4ZDJA 4Q4JB 4Q4HB 4LJAA 4BQSA 1MO3A 5KTYA 2W0SA 2ZI4A 4DDWA 1YRBA 1IONA 3FKQA 2JDIA 3LX5A 1NJFA 1GWNA 3TAUA 1GP2A 2V4ZA 1JB1A 4PPFA 3L8YA 3I8SA 4A1FA 1ODFA 1R5BA 2IW3A 1QHHA 1KO8A 3VNUA 2PLFA 1XZPA 3T5DA 1Z0AA 4G5GA 5KDOA 4FI3C 4M9ZA 1JBKA 3KUCA 2BMEA 1TF2A 1Q21A 4Z1MA 4QJ4A 2EYQA 5KNCA 1YZTA 4PPQA 2QTFA 4FMCF 1NNEA 1EFTA 5EUMA 2IK8A 2FA9A 4LYAA 1EGAA 1W5SA 4US2R 2VP2A 1KI9A 2CK3D 2EFGA 1P9WA 1A2KC 4YMTA 2Q3HA 3FWYA 4XTCS 4DJTA 4TZ0A 1N0UA 2IYUA 1DS6A 1Z83A 3ZZUA 5JBQA 2XJ4A 4PX9A 3LBIA 2GF9A 4N3NA 3ICQB 3SBDA 5FL7D 2RH5A 2VP6A 5FBQB 2I1QA 2GESA 4I1OA 1LS6A 3IO3A 5DN6D 3RLFA 3LVQE 4B2IA 1G7CA 2F43A 2YKGA 2YZ2A 4I1VA 3O8CA 2J0UB 5GJCA 1WF3A 2J87A 4Q1AA 3CNOA 2RGGA 3T1OA 4B76A 3N2IA 2ZIAA 3THYB 3IHLA 4A2WA 1N3BA 4XVQA 1QRAA 3CNLA 1PVOA 4JLBA 1FTSA 2JLYA 4TLBA 4OHYA 2CDNA 4GT1A 4C0AC 5G53C 3KQNA 3EZ9A 1AGRA 1PV4A 4GPTA 1E2GA 2GK7A 4Q7MB 3Q72A 3ZLJA 2ZRJA 1FUUA 2J7PD 4DRZA 4AKHA 2J9RA 3AKYA 5CLLA 1KZGB 4NONA 4LI0A 4V03A 4TL8A 4Q19A 1I4LD 2QA5A 5JSZB 2K5UA 2B7BA 1II8A 1OHHD 3QNUA 1YJ5A 4ZV4A 2ONKA 4LV5B 3ZH9B 1K5DA 3K1JA 2G3YA 3RRNA 2ZRKA 1Z0JA 4NCNA 3RS4A 4NTZA 4QKQA 2ZSFA 2BJVA 5TY0A 3RS5A 1BYUA 1UBEA 1CR1A 3CONA 4PAMA 2O8CA 1Z6YA 1MO4A 2I4IA 1XTJA 4HZIA 3QKRA 4I1UA 2HLDD 2A5JA 1VIAA 2J0UA 4C0SA 2ZR0A 4BZQA 1P6XA 1NKSA 2GZHA 2HYIC 2V1XA 4PZZA 3GFPA 3LXXA 3NIBA 4KCGA 4Q66C 2PMDA 1DEKA 2IS2A 2VRWA 3EPLA 1GRQA 2FG5A 2D06A 2IYYA 2ZVQX 4PQYA 1U99A 1AS3A 2OLJA 2QM7A 1N5LA 3HR7A 5AJVB 2AFHE 3B1XA 1DADA 1AJEA 4RCYA 3IPXA 3RNLA 4I99A 4M1KA 2ZRIA 1I2DA 3U44B 5LBIA 4HUQB 1XMSA 4DLWA 4LX0A 3SJCA 1KSJA 3KL4A 1YE8A 2W6JD 4W5WA 5D3MA 5JS8A 1XTKA 1IN5A 4NCKA 2VEDA 1O87A 3K0CC 3TR5A 3EAQA 4AG6A 3L0PA 1KZ7B 2QI9C 1JECA 4JL8A 4LBYA 5DI3B 3THXA 3ZS9A 1E9FA 5M04A 4HAZA 4D80A 5FTJA 4PO1A 1E1QA 1R0ZA 1UFQA 3WYFA 3CF0A 1G16A 2XB2A 1XBTA 2ZPTX 2FEOA 3GJXC 4DXAA 4ESVA 4EJSB 1VCMA 1NMXA 4JIMA 1Z47A 1Z0KA 4OYHA 3A58B 2GTPA 3QXJA 1Q1BA 3KKPA 2ZYVX 3LBNA 1U0LA 3GLHE 1TU4A 4PHTA 5FOSA 1KI2A 2IWRA 1XXHA 2NGRA 3SJAA 4M1WA 5IF9A 2UZ3A 1S0UA 4BUJA 2QBYB 4PR0A 4FIDA 1E2FA 2ZJYA 3CZQA 3SS8A 2XNDA 4OHVA 4CT5A 3IBGA 4RD4A 1WE2A 3QVVA 1G291 1Q3HA 3TMKA 3SQXA 3F3YA 4F92B 1NN1A 2C78A 2EW1A 4TZ6A 4UXHA 2QY9A 3GP8A 4TQ9A 4DLXA 3LLUA 3UMFA 3VKWA 4ZCLA 1KDTA 3CB4A 4Q7KA 1WB9A 1O3YA 4HUQA 3TUZC 4Z1MD 3AVXA 1ZRHA 2FSIA 1OFUX 3GLHB 3L43A 3OEHD 4XVRA 4HAUA 1XTQA 4V0LA 1I4TD 4L9SA 4JBWA 5IHPA 5SZIA 1NP6A 4KSCA 3AUYA 5FPTA 2QRNA 3BERA 4IOJA 1NMYA 1AN0A 2R6GA 3NHBA 3MWJA 3EZ7A 1KTVA 1XCPA 3B78A 3U3KA 3THWA 2RGEA 4TL6A 4WW0A 1ZU5A 4V02A 5TARA 4TQUS 2P65A 3BIFA 2ZSDA 3Q7PA 1KGDA 3A1WA 5BXQC 2OILA 3IIKA 5KDDA 1U81A 4RKFA 3SJZA 2Q9AA 4NP6A 4LJ7A 3KUDA 4V0KA 2PJRA 1E1RA 2ZJ5A 4URYR 1NN3A 4C9BA 3PV0A 1YZUA 2ERYA 121PA 3OZXA 5L3VA 2ZJAA 4CW7A 3KQKA 3R9IA 5F3WB 2ODNA 2IBMA 3IHWA 4CIDA 3UPUA 3SU8A 3TNFA 2WHXA 4UNRA 5AJZA 3T61A 1ZM4A 1W0KD 1NVWQ 2GXQA 3HPRA 2BV3A 4EUNA 1E9AA 1C4OA 2DBYA 1IBRA 3NXSA 5FR2A 4ZDIA 4UKDA 2B8TA 4Q9KA 2YOHA 1AK2A 3HPQA 3U6KA 2FDCA 2XZLA 4YXWD 4IJMA 3K70B 1T91A 4B44A 1OB2A 4EPVA 5LDDC 2RKOA 3EWSA 2R6CA 3C5CA 3IBYA 1CJMA 1E2MA 2ZRCA 3DM9B 3C41J 3NBXX 5CM8B 1Q1ZA 2ZRPA 2ZANA 3SYKA 3SQWA 2YWGA 3IKJA 2ZRAA 2NOAA 2DWQA 3C8UA 2KBFA 4YQFA 3THOA 5JFGA 2C8VA 2Q21A 2CL0X 4A92A 3SOPA 1W0KA 4P4UA 2BVNA 1LY1A 3OFNA 4QGFA 1W4BA 1T8TA 5LD2C 2C99A 4DUGA 4TT3D 4TMWA 2A5YB 4JL5A 1KO7A 3EPKA 3T5GA 3U6BA 2GXUA 3BB4A 2CCKA 2IF2A 3DOEA 2B8WA 1EG7A 3AH8A 5A4JA 4P0TA 2UVQA 3ZS8A 2GZDA 3JZMA 3K0AA 5FH9A 3GEIA 2CJWA 4HB3A 1XTRA 3EIQA 2C9CA 2PJZA 3BJIC 3CM0A 4HDQB 4KO8A 1KJYA 1DE0A 3W3ZB 4KAXA 1OPXA 3X1WA 1OH8A 3W3AA 1UM8A 5FTNA 1UKYA 2XAUA 5K8UA 3OAAD 1E2LA 3VU9A 2FX3A 1W36D 1RIFA 1ZM9A 3MUFA 1KI4A 5CDFA 1XEXA 4U5XA 1CJKC 3H2YA 5FOUA 1GNQA 3IILA 4Z51A 2DCUA 2R65A 3LQRA 3U61B 1X1RA 1KMHA 4NL4H 1S96A 1EFRA 2VTKA 1PJRA 4LJ6A 4B47A 3GLFE 2WPDA 3WMGA 3HU3A 1E2KA 1BO6A 4GI7A 1AKYA 1OKKA 3GJ5A 1KOFA 5AR1A 1CJVC 5FTMA 1KJZA 4TLAA 1TEXA 4DEXA 1SXJD 1VYUA 2ZE7A 3TE6A 3NEYA 2NPFA 1Z06A 1S9HA 3A1UA 1AS2A 2VP9A 4BRWA 4XD7A 4YDSA 2FSGA 5JECA 3LNCA 4MKIA 1KDOA 1RVDA 1MH1A 1UBGA 5HE9A 2CHQA 2GJ9A 2F3TA 2PT7A 4YDHB 4O2LA 2F55A 4MUBA 2P2LA 4A6XA 4XTRA 3K0SA 3QBVA 1SVOA 3TW8B 3HDTA 5HR5A 1E0KA 5JJKA 4TYNA 1BOFA 1CBUA 1IXRC 2PL3A 4M21A 1E1QD 3THXB 2BOVA 5EP3A 3AGQA 5EZ5A 1W2GA 4IDQA 4KFTA 4BZPA 3NBYC 4Y0AA 4DT1A 1HTWA 4KJZA 2YOFA 2H18A 1SXJA 2D2FA 2QTVB 1RC8A 1W2HA 3TLXA 3LO5A 2R9VA 3CPEA 1CTQA 3KDSE 1TTTA 1GRRA 721PA 2JLXA 2QGNA 1E4VA 3VR4A 4AK9A 3PUYA 1G7TA 4A36A 3GJ0A 4LV6A 2CNWA 3HU2A 2TMKA 4NCIA 1DELA 5GJBA 4Z54A 2A5FA 1ZUIA 3K0CA 1GOTA 2ZR9A 5J4HA 4ERNA 3PR1A 1XPUA 1IJEA 1ZM3A 2HCBA 2MSDB 3GQBA 1S2MA 2BMDA 4URZR 5H1YA 2GBLA 2J3EA 1FP6A 4F7WA 4QG7A 1WDTA 1XMJA 1ZNYA 4HB2A 4BWYA 4QXAA 3GEHA 2GEUA 4MQBA 3PJRA 2W58A 4A0FA 1Q1QA 2QBYA 2JLQA 2ZRHA 5DO9A 3ND8A 5AUOB 3CX7A 5HZKA 4OQLA 1E2DA 3WXMA 1R5OA 1IAQA 2GVDC 3DPUA 3I8XA 4ITRC 1KSGA 4C3ZA 5C46F 2O8BA 1M74A 2FU5C 2ZRGA 1YZQA 1VMAA 4W5JA 1ZM2A 1KK1A 2A5DA 2MSEB 1Y3AA 4JL6A 5TMPA 3H1TA 2QPTA 1UBFA 1P9RA 4OHXA 4FD2A 1VECA 4X8LA 4OHZA 3TRFA 1D2EA 1WP9A 2ERXA 4XWAA 3SDZA 4B2PA 4ZI2A 4F91B 3GLHA 3KQLA 1PLLA 1KAGA 1M6NA 2PX3A 2P6RA 2ZUCA 2PH1A 4KV9A 3DKVA 4HDCA 1ZD1A 4RZ2A 4IFEA 1NKTA 1G8YA 5GVRA 3TQFA 2ZS7A 5IK2D 2V3CC 3AKDA 2B21A 3W90A 5J40A 3CBQA 1GDDA 3KJGA 3QUSA 3CF6R 3K0FB 3PQCA 1UF9A 1PLKA 2OFWA 2IL1A 4LJ8A 3RDPA 2OT3B 1M2OB 2F9MA 1XX6A 4NYMQ 3HU1A 2YC2C 3REGA 3D8BA 4B43A 2JAQA 5C4MA 4GRAA 2FF7A 2CHVA 3R7WB 4P31A 2V6IA 3WMFA 2Z4SA 4B3CA 1P62B 5AUNB 3P32A 1Q22A 1Z3IX 3IIJA 5EP1A 4B3GA 2GA8A 2BBSA 1F48A 2LCFA 2AD1A 2GCOB 3AP2A 8OHMA 4U02A 4UNSA 2JJ8A 2AWOA 3QXSA 3OE7A 4FINA 2RGBA 1GVNB 2CHGA 2ZROA 2WPDD 1ZVQA 3U7GA 2FWRA 4XIGS 3NH9A 2PMKA 4NHOA 3PUWA 5FBLB 4GMDA 5D3MB 1HT2E 3BORA 1IM2A 2WJJA 2OBMA 2FPLA 4EPRA 4A0HA 1G19A 2YWHA 2KJQA 2WWWA 4TYYA 3F5FA 4MA4A 3PCRB 4RJLA 3S1AA 1SKQA 1NF3A 2AWNA 2JJ2A 4V0MA 5HTKA 4B32A 1N5JA 2DPXA 4URXR 2C5LA 1E0JA 2W6ID 4IOKA 4KVGA 1QHHB 4C0BA 4LJ4A 3MFYA 5CIQA 3VR1A 1I4DD 2GCOA 1J2JA 1DAHA 3KKNA 3RS3A 1W47A 5C2JB 3K0AB 2C03A 1CEEA 3DMNA 2GWHA 4POAA 2OSBA 4PFSA 2VYFA 2D74A 1XMVA 421PA 1OXUA 4TT3A 2OEPA 2ZI3A 1KAOA 4W7SA 1F2UA 3BD9A 2QEQA 2JLZA 1SZPA 1DAEA 2FNAA 3QPUA 1B23P 4MYTA 1GILA 1OLOA 4Q9HA 3T34A 1S3GA 5K8IA 4P32A 4YMUA 1FX0B 5JI3E 2WV9A 4XWOA 4B71A 1OIWA 2RMKA 1HE1C 4QFMA 4Q1CA 4O3MA 1IQPA 2L0XA 5L3SB 3QOFA 1Z07A 3BH0A 3CPJB 3P26A 2A2ZA 2RCNA 4RCZA 1NN0A 1NJGA 3SFZA 3NVAA 1JPNA 3EA5A 1J8MF 5AUQA 1G6OA 3W5JA 3K9HA 4OJQA 5ELXA 1KSFX 1NL3A 4WZ6A 5F9HA 2GKSA 1KO5A 2DFLA 1W4RA 4MYUA 2WBLC 3NEJA 1JR3A 2ZI9A 4J0QA 5FTLA 3CH4B 3R9WA 1T3HA 3GLIA 2LKCA 3IUYA 5H68A 2IXFA 4TTQA 1E94E 3WHLA 4DBLC 4RZ3A 3BE4A 4Q47A 4WXPA 2DR3A 4WA7A 3AVYA 1UDXA 1SHKA 1YZGA 2IF0A 1KDRA 1UEJA 2EWVA 3E70C 5EE3A 4X8OA 3FVQA 1C1YA 2R6AA 5SZKB 4AC9A 1P3JA 1NVVQ 5E95A 3IDQA 4PAQA 4PSAA 3TVTA 1AQUA 1HY3A 2IYRA 1MR3F 3E5HA 3K8YA 1KHTA 3J81k 1II8B 2W6IA 3A37A 2Z43A 2H92A 4DIEA 3ZYCA 3GLGB 3CIOA 2A7QA 2XOKD 5FBRB 3VR5A 1WBDA 4KSBA 5K8TA 2KSQA 1G8HA 1FMLA 2CK3A 2EYUA 2WIAA 4G1UC 4D4LA 1OH7A 3LD9A 5B58C 1A4RA 1XJCA 2R44A 3ZZTA 1FZQA 2Y8EA 3PITA 4PC6A 4AWXA 4I81A 2H5EA 3BH6A 4LYJA 5JCPA 3HYRA 1U0HC 3GFTA 1CR4A 3KFXA 3OE7D 2I1VB 4R98A 4NE2A 4Q9JA 1WQ1R 1UADA 1W5TA 2WSSA 3A4MA 2ZI6A 2CCJA 3LV8A 2BMFA 5HKKD 1SVSA 2QNRA 1XEWX 3W8NA 2VA8A 2VPPA 4OQXA 3FHOA 3QF4A 1CU1A 3NKVA 1W0JD 1Y63A 2GETA 1L4YA 3NDBB 4F38A 4GZMA 2QROA 1GNRA 3KB2A 2XITA 1SVMA 2FJUA 3EIHA 3VKGA 1EWQA 1P2VA 1HURA 3QXXA 4B35A 3NH6A 5EE1A 1XU4A 4GFDA 3KTAA 1T0JB 2KB0A 4TN1A 3QPVA 4Q01A 2J5XA 3PUVA 3K53A 4GNKA 3RSOA 2AK2A 4IRUB 1JAHA 4KFSA 3CZPA 1GG2A 2FPKA 1SULA 2IX3A 2HF9A 3TQCA 2IYSA 4XJXA 5HZHA 4LHYA 5JI2E 3B82A 3U3OA 3CNNA 2WJHA 1NVVR 1ANKA 3QG5A 1IN4A 4HB4A 1UKZA 5BWMA 4K46A 1DOAA 4A8JB 3KJEA 1LV7A 1WXQA 1NIPA 4ILEA 3WHKA 2H7VA 4Q03A 3C15C 4M1MA 1JJVA 1DAIA 4MYHA 1HYQA 2WOOA 1KY3A 3K70D 2NZJA 2VLIA 1EFRD 3T12A 4B33A 3THYA 4OI1A 1FOEB 2QMUA 1G5TA 1Z0IA 4KODA 2XNSA 5TV2A 5KUTA 1E32A 3FGNA 1P5ZB 3S1AB 3BWDD 1U8YA 4PPNA 4UXIA 3B1YA 3P27A 2BMJA 2ANBA 3CWQA 1FTNA 1QF9A 4KLZA 5BQ5A 1M7BA 2XGJA 1E9CA 1OIXA 2WKRA 4CZ2A 3QE0A 4GMXA 3QKSB 3EG5A 3CRMA 2PZEA 4C7OA 3VFDA 3X1XA 4MRPA 4BFYA 1XDBA 2ZETA 4NYJQ 3ZVLA 4D4JA 3PEYA 4IVRA 1R6BX 2XTZA 1L4UA 4C0JA 4JLAA 3CUEF 3ZIAD 4C0KA 5KDLA 1EX6A 3TJZA 4RD6A 1CJUC 5EQTA 3AB3A 2ZSBA 1ESMA 5TB5A 3KXLA 1WCV1 1OHHA 2CVHA 4HAWA 3SZRA 4A9AA 2IT1A 2Z0MA 1NLZA 3TSZA 1F5NA 1YZKA 2FZLA 1E96A 2N1BA 1ZD9A 2YHSA 4NU0A 2F9LA 3W5IA 1A1VA 3VHXA 1KI3A 5JLJA 2CNWD 3A4LA 3IQWA 1P60A 3NTUA 4M1YA 3CW2A 2QT1A 1XD8A 2C95A 1N2CE 1LW7A 2C04A 2GJAA 4B3BA 2JJ1D 2GXSA 2XX3A 3BAFA 3U3MA 3Q9LA 2BEJA 3P4YA 2RGXA 4P4SA 1ZU4A 2E1RA 2VF8A 4B48A 3L0IB 1RRCA 3GJ3A 2WWXA 4LHWA 1SXJB 4PHHA 3EW9A 4JBYA 4JLJA 4KLNA 2FN4A 3AVOA 1E2JA 821PA 1TQ2A 2WWIA 2NO0A 3BFKA 4N1AA 1U94A 2ZI7A 3FDIA 1FX0A 2OLKA 1N6LA 4GP7A 4ZO4A 1LFDB 2BKUA 2PEZA 3AF2A 1KI6A 4XD7D 3RHFA 1QG2A 5KSZA 1JNYA 1EK0A 1E2PA 3LAWA 3NHAA 4LGMA 4BFUA 1DVRA 2WSSD 5FPSA 2ODEA 4XOIA 4XSGA 521PA 5LPNA 1M7GA 1H8HA 3X1ZA 4HLQB 3WBJA 2W00A 3B9QA 5BN4A 1TUIA 2D62A 5CB6A 3OEEA 3D3QA 4Q9LA 2OAP1 2OXCA 3O8RA 1Z2AA 1E2NA 5LB4A 2VHTA 5EUQB 5HPYB 2HV8A 3UK6A 3SHWA 1QHNA 1XCMA 1VCIA 4QBFA 2XOKA 4P3YA 4ON9A 3TIFA 1Z29A 1SVIA 1Z5ZA 2CE2X 3EA0A 3K9NA 2RB4A 2VHUA 5EE9A 2HUPA 2XZOA 2GXAA 1JI0A 4BECA 2NO9A 3OEED 1T8UA 1VTKA 4OQMA 3RS0A 2XXAB 2IC5A 2VBCA 3BB3A 3NC0C 2R8RA 3OFND 5EJEA 1N6OA 4DCNA 1MO5A 1IXZA 2O8DA 5EE0A 1H8HD 1OXSC 1TF5A 4MDFA 1RKBA 2OG2A 4FXPA 5F2EA 5JMTA 1XD2A 3RC3A 2BBWA 2Q3MA 2QENA 5G41A 2QAJA 3U4QB 1G3MA 4C4PA 3NDPA 2AD5A 1E79A 3AKEA 1P2UA 1VCOA 2HXSA 2FEMA 4C0LA 1XFAA 3RS7A 3M4YA 3VMFA 4NDZA 1TU3A 3U7FB 3MRSA 4R2HA 3LBHA 4WBSA 1S4QA 3Q5DA 4MITA 3EXAA 4GOKA 1AIPA 2YYZA 5AJYA 1ZW6A 4HLCA 3A6PC 4JJKA 3W6NA 3R8CA 1GIAA 3TW4A 1GSIA 1G18A 5IK2A 1KMQA 3B2EA 3WY9A 3A4NA 2OZEA 1U90A 2BCGY 5E7IA 4BFWA 4B3FX 4L16A 1AKEA 4HAYA 1VG8A 4YXWA 4FCTA 5F98A 3B8HA 2ZI5A 2G1KA 1Z08A 1J99A 2JIZD 2G1JA 1E79D 2O8FA 3M1IA 4Q02A 3EWAA 2HF8A 1MABB 1XXHE 1ZAKA 2J59A 1JEDA 5FPHA 1SXJC 1P72A 1IY2A 3OIVA 4U00A 1XMIA 3DOFA 3H0KA 4OHWA 4C0HA 3CRRA 5P21A 1L2TA 1G20E 3QEOA 1RRFA 4X8MA 1G9XA 2GVZC 5DN6A 5DYGA 5JHGB 1P61B 2FMXA 4TLCA 4LY6A 1LF5A 3RSLA 2GF0A 4KHZA 3RAPR 4MGYR 1KO4A 3RC8A 2P5SA 2ZE6A 5B57C 1G4AE 2QSZA 1N5KA 4YMSA 2O8CB 1D5CA 2D7CA 4B6FA 1G3IA 4FMDB 2ZRBA 2JA1A 4JLKA 2FSHA 1TNDA 2G77B 1XPOA 1T4GA 4FWIB 2O0JA 4GOJA 2NMVA 3AF1A 3TGPA 1VCNA 2E9SA 4PQRA 4F4JA 5BW8A 3MG9A 4W9MC 2V6JA 2WM9B 3B60A 4Q7JB 1P2TA 3P1JA 2QZ4A 3GLIB 3RVBA 4NYIQ 4H1VA 4TTPA 4B3DA 2ODBA 1RJ9B 2J7PA 5KNDA 5GVSA 1GAJA 5F9FA 1DG1G 3FOZA 1G41A 1JR3E 2FZ4A 3SBEA 4MDEA 3NBZC 1TQDA 2P6UA 2QU8A 4DCUA 5J4KA 2O8EA 4M8NE 4TMKA 2N46A 3A8TA 4Y0VA 4F4CA 1P73A 1OH6A 5JCZA 1PUJA 3T1VA 1NBME 3U3RA 4TQAA 1QBKC 2JIZA 4A82A 4B75A 4OI0A 4JT2A 1KDPA 2VSFA
chains in the Genus database with same CATH superfamily
3TL6A 4P4SB 3EUEA 4ZTZB 3ANYB 3EZ2A 1S4MA 1WZNA 2FSUA 1NRIA 1RM3A 3A11A 3DZCA 5GQSA 3OLQA 1YFJA 1CUUA 3R2JA 3ZHQA 1U3CA 2BAGA 3H3XA 4AXXA 2C57A 2AYZA 4GPIB 2HPHA 3ZK9A 4KPFC 1K92A 3E9YA 3LYHA 2R1UA 3R5XA 4HV4A 1G8FA 4MW7A 1C0LA 2QUZA 5KINB 1PUIA 1U0SY 2ZCVA 4GXQA 5HQ3A 2LPMA 5KQSA 2GPJA 4P1ZA 3O38A 5ALZA 1PGOA 2VIIA 4Q3AA 4RKWA 4DGQA 4HNHA 4YY3B 3UKDA 1XK6A 1FL9A 1Z0SA 2PGJA 2VHCA 3DCNA 3MNFA 3RFVA 1BU5A 3KT6A 4DDHA 4FYIA 3MJVA 4QRDA 4OXXA 3H87A 1E7QA 1MJHA 1WHSA 1MA3A 2P2SA 3AOEA 3K6KA 2VH5R 1KKUA 4R2IA 4X7PA 4DNPA 1VSUA 3P5SA 1F12A 5H0IA 1XP8A 4LNHA 3EBOA 1FFBA 2G9ZA 4MUNA 3ER8A 1KIMA 4XSVA 5HF6A 5ALFA 2V6FA 3G5AA 3RIYA 1S1MA 3LHIA 4JIGA 4H3HB 2PKWA 4EY5A 1QIFA 1D9ZA 1R0WA 2VXBA 1R16A 4Q1BA 2D1TA 4KQ1A 5HRAA 3P2OA 4QJBA 2QPLA 3WP0A 4N5MA 4YT4A 3O0TA 5C4GB 5J3JA 3P2MA 1F60A 1QOZA 2RC6A 2QLMA 1IJFA 2WPNA 4TS1A 1D07A 1JLMA 2FZEA 3GT7A 3DAFA 4K9SA 3PP8A 4EQZA 4K6MA 5C5IA 5KEIA 4XKJA 3B5JA 3L4SO 4FHEA 2D13A 3NM4A 2AI2A 4BJ6A 1UWVA 4ZZ3A 3DNMA 2A3RA 1GPYA 2FSFA 3BULA 5FADA 4YP9A 2AYXA 3OBIA 1WWKA 3G0BA 1KC1A 2P0EA 3CKMA 4PINA 3X43A 1NT4A 4B17A 2Z5FA 4EOGA 4ZKEA 4DZZA 5LKRA 1TT5B 3DOIA 4ZYTA 1QVAA 1SCKA 1II9A 4EY6A 4Q3EA 3PXXA 3I5AA 1D8TA 2XMPA 5TPZD 3PQ7A 1VYVA 2P3SA 5U1PA 2X0FA 2XCUA 2R6DA 1OX6A 3QXCA 3VGPA 2GB4A 4EHHA 4YP5A 3R3HA 5AOCA 1TUGA 4TLDA 1KFJB 1RKQA 1WETA 1UFKA 2IZZA 2PFKA 3GUUA 4BNZA 5I7UA 1TE2A 2HEGA 1OFUA 2OWEA 3PDIA 1YQWA 2HBYA 3WMEA 1GU7A 3W6OA 4YCLA 1DRVA 3GAZA 5FKJA 4V3BA 1C7JA 1N6HA 1ZZEA 1NFRA 4DLTA 1H69A 1IG0A 2DH6A 4QBGB 5DISB 3EVZA 4YAIA 2F62A 1W49A 2NZYA 4QDJA 3TQRA 3W5CA 1V6AA 3NOOA 1FMJA 4BMYA 4OLHA 1JE0A 5T4EA 2ZYAA 4Q3CA 1HQYE 4Y6QA 4OK6A 2E4AA 5AKEA 1R4NB 2IEDA 4L4RA 1T25A 1TT5A 3ISTA 2BDTA 4WCFB 4DCTA 4E4YA 3CUKA 1IH8A 3ORSA 1YJCA 3LZCA 3MGKA 3KP1A 1U8UA 4XVCA 4YONB 2C5EA 2VDWB 2F64A 1OBHA 3SIWA 1TADA 5KJEA 4YAUA 2WSBA 4W5OA 3F6EX 3DV2A 4IFTA 5CNMA 2XQJA 2ODPA 4JT8A 4O4IF 3VRHA 3QEBZ 3NWJA 1L8QA 5FWYA 1O4VA 1JZQA 1K8XB 1TZ2A 3IKVA 4MGIR 1VB3A 2XA1A 3QGMA 5HIJA 5IBQA 1XN1A 2VQ6A 3D0OA 4TPKA 4KRFA 3H9JA 2X2FA 1TLFA 4R0NA 1K8RA 2LKDA 4RA9B 5LC1A 3QLEA 2WTXA 3PE4A 1FXUA 4EQ6A 2XZTA 3T9CA 1QE5A 3TEJA 5DNYB 1N34B 1JKMA 3O2JA 3KQUA 1J7KA 2C4NA 3FNQA 4BWVA 2AW3A 1A8UA 2ZS9A 1HETA 3PXEA 3SKYA 1A5BB 4M9UA 4AP6A 2WM2A 1GN9A 3W6ZA 4BEVA 2AV6A 3FAKA 1VPLA 3G0GA 4W9RA 1F3OA 2WSYB 3AIKA 4CRWB 3CLHA 5L7TA 3IKMB 2CF6A 2JIBA 5ALPA 3UH1A 1VRWA 3STXA 4HYQA 3WNVA 5I8PA 4QBIA 3BGWA 4HSEA 4E11A 4WZAB 1T43A 1V8BA 1HGXA 2YIJA 3FM9A 1K3UB 1VC2A 4IDAA 2DRIA 5FWYB 1MX1A 3NPAA 4EFNA 3OAAA 4UOZA 1JDSA 2P6RA 3G6WA 1F0PA 4WINA 5BRNA 3D3KA 3ELBA 4MUEA 3NTQA 4QTYA 2QZJA 3WGIA 3HFGA 3KUUA 2IYVA 1TO6A 1CUCA 2OHHA 3WL5A 4DV4B 3VDMA 1KK3A 4YRQA 3EVCA 1RKVA 1ENOA 2JJYA 2VAMA 4M0CA 2WMNB 4E2ZA 1E20A 4NOMA 2Q0XA 2CCGA 3ASUA 3CLVA 3X2EA 1TJNA 2MMGA 1HG1A 3T8YA 1BWQA 3T06B 2PT5A 1RU3A 4PAOA 1FZTA 3SHOA 1YCGA 1EXNA 1NI5A 1OJLA 5G3YA 1XKQA 2V74B 3HLKA 1FYVA 1H8EA 1W4AA 1SUEA 1JXAA 1I3LA 1Q20A 3K4PA 4WXYB 1NUPA 3ZY2A 1D04A 4LJRA 1J00A 3EH1A 3EE6A 1P4SA 4XCVA 4NYIR 2ALJA 3Q85A 4BNHA 4X5OA 3TUIC 4D9HA 1QRDA 1YO6A 5LXTB 1ZNZA 1ZICA 3A1VA 1ZA2A 4DQ0A 3V34A 4UAUA 1QS0B 1RHJA 2WA1A 1Q11A 3HZZA 4H2DA 1DJLA 1Q7BA 2V7XA 3NHJA 1JFFA 1TMYA 5KOJB 4HZUB 3N5CA 3PG5A 4QE3A 2G8LA 1N6IA 3FHLA 1NXWA 1TAGA 4ARSA 5DLEA 1VGQA 4IXDA 2B2CA 3GRPA 1CUZA 4K9RA 4JYCA 3MWKA 3X1DA 1TF7A 4OK3A 4DMGA 1M2FA 1T6XA 2D2XA 2X7XA 3ROPA 3A4VA 1NW6A 3C39A 2FX5A 2FH5B 1A8PA 1XC7A 1A4IA 2PX0A 2ZJZA 3CT4A 3PHGA 2Q6TA 4KBGA 5BO5A 1O6FA 3SX2A 3U9TA 2GEVA 1NUSA 3CVOA 3NXKA 4LFAB 5BWOA 1J8YF 1YZLA 4RTMA 4RWZA 4AJJA 1XDSA 1ZG3A 2E87A 5CX1B 1RW4A 4W9NA 1CR2A 1KO1A 2R68A 1JSCA 2E18A 2F1JA 3K92A 3I73A 4GVPA 4DNFA 3H16A 1QIJA 2XV1A 2XVXA 5DGIA 1X9IA 3HP1A 4CKWA 2J0SA 5D6NA 2VDVE 3E53A 3SX0A 3UFXB 1EPUA 2HA6A 4R1UA 1WW2A 3O26A 4TWAA 5B1YA 4CN8A 1CJCA 1P5HA 1X7XB 3FTCA 5DNVA 2XMCA 1FDSA 1K3FA 3LY5A 4J7UA 1F2TA 3NTOA 1SUPA 1RQGA 1QHSA 4KPUA 3UWKA 3UUWA 3AL0C 3K9BA 1N4DA 4HC4A 1TVKB 1TEVA 4ROTA 1RJWA 1E9DA 2CXQA 2PD4A 2PX4A 1MC5A 2CFTA 2GLTA 4KO1S 4EBFA 2DVMA 3PC8C 1GJRA 2OMEA 3MJDA 5HS4A 1GRCA 1Q6YA 1Y1QA 3A1SA 4HDMB 2OAEA 3LLVA 5EKUA 3LBFA 5BSUA 4Q00A 4R4JA 4EX6A 3VVMA 3PL5A 1S8FA 1WNFA 4FEYA 4WMLA 3ZNOA 1ZSNA 2NXWA 4LNUA 4MVJI 5C5DA 2QAGC 1FK8A 3AERA 3G68A 2DUMA 5CLQA 5A1TA 2PZGA 2M6SA 4M76B 3GLGA 4JD5A 4J3FA 3VH2A 4X6UA 1ZITA 4EFLA 3DV0B 4K6CA 4LJSA 1OA0A 2CFIA 1BKSB 3RAJA 2Q28A 4LHEA 1DRJA 3A2KA 3UJ3X 4U4AA 4LFBB 1ZDMA 4LNAA 4N40A 1G6KA 4OK5A 3WV5A 3OICA 2BWJA 3Q7EA 2MMCA 3L1JA 2QM8A 3R7WA 3UWPA 1T35A 2ATEA 1CUDA 2AG1A 4K6HA 3T4PA 5C1DA 3NGLA 2QD3A 2ZREA 3D31A 3LKDA 3DVSX 3N28A 3W9BA 2GX6A 1XKXA 2M6KA 3WJ7A 3GG2A 4BDSA 4PVCA 1DCTA 4G63A 4KWTA 1U1EA 2HRCA 2R62A 3DEKA 3GK3A 4R8RA 3UMGA 2YBEA 3DDCA 3AVQA 2OCAA 1GZSA 2W90A 3IXQA 4G1VA 4LDQA 4DG8A 1JTVA 3STWA 5F2OA 4EIWA 2GERA 1X1QA 3UGJA 1I9GA 1EUCA 4JS0A 4HY3A 3IDOA 3M3HA 4EO4A 9ATCA 4RAQA 3L1VA 2PPVA 5ALGA 3TZEA 1NF2A 4PC1A 3OY7A 1SG6A 1OXVA 1IZ0A 3KZOA 4K0KB 2B92A 3QV2A 3TLEA 2Q3EA 2RE8A 1LUAA 1ODSA 3DA8A 1PV1A 1R0YA 4HH3C 5KHOC 3H75A 4DMRA 4XUGB 3H8WA 5IUKC 1KL7A 5IM5A 5GAJA 4FSXA 4GSKA 2JH8A 3GNLA 1WO8A 4IV0A 5A4KA 2F67A 4OJKA 4RFSA 5JSYA 3UAZA 5B4TA 4K81B 1T10A 4HNVA 2RHTA 4N12A 2IYZA 4NH0A 2W6JA 5BN5B 5CYOA 3V1YA 4Q05A 2DBVO 4J49A 5IT5A 1CRQA 3U7QB 1XRPA 1FCJA 1V2HE 3JARB 3T7TA 3ZLUA 3L82B 4MA5A 4B82A 2P77A 3B85A 1HEUA 1I2AA 3N86A 2ECFA 2FWBA 1XVAA 3Q98A 4HWOA 2DMRA 2WFLA 2I4LA 1T6BY 4KXQA 4RH0A 4UEWA 3TKLA 3LT1A 4DCSA 5AW2A 4PZUA 3KJZA 3BH7A 2R11A 2UAGA 2CLFB 1H42A 1ACJA 3S99A 4F86A 5AVSA 1OBFO 1UPFA 3ANXA 4ZQIA 2DG2A 2CBZA 2D4HA 1HUQA 2ZIWB 3B7PA 3GCDA 4QGGA 2QPAA 3T6KA 4I9GA 3CYFA 1UEIA 2Q4RA 4XX1A 5BVGB 1M1XB 1Z73A 2O3TA 3EHEA 2I03A 3R5SA 4NBSA 1OAKA 1YDWA 4BTLA 3OEHA 2V7VA 1BWPA 4P3OA 2WJZB 3FPAA 1NVFA 1NOIA 1YS2X 3PPIA 4N7MA 4IEIA 3C4VA 4BS9A 4RTSA 1MW8X 3GGJA 2NO6A 5KPDA 4EELA 4CM7A 2OESA 1A82A 4G56A 5T5QA 4JR2A 5BOSA 3M0EA 3G2LA 4COKA 1R6XA 2XVAA 3EDYA 4NPHA 1C7IA 3HJFA 2WF6A 1ENZA 5G1NA 3GGOA 4RVSA 1Z12A 2BEUA 1IWBB 1RM0A 1K3TA 4PF1A 2X5NA 3ZE9A 4KITB 4RYDA 3L8GA 4C0XA 1K6IA 3OIWA 2C7RA 1W2WB 2GPTA 4G5RA 2DWOA 3GAMA 4OD0A 4B45A 1CIJA 1CFJA 2CVOA 5EUCA 2JCVA 3PZRA 3ENVA 1W44A 5FNVA 1SQ0A 4IL5A 1MGPA 5AQ1A 1QG6A 1XMQB 1KNQA 4EKDA 1KE2A 4WLNA 1A9PA 5LWQA 1E98A 5JXHA 5JXIA 3S8EA 4Z0TA 2QLFA 2ZB7A 2QN7A 3QM1A 2ZSEA 4WOPA 4DC1A 5KTNA 1M1YA 3FMGA 1FP7A 3M49A 4G85A 4BAGA 2G04A 4DKXA 3HXMA 3W1WA 5A2GA 1JS1X 1WSWA 3L07A 4CMIB 3WNZA 4QUBA 1O8CA 3ZW9A 1AS0A 2CN1A 5K0SA 1E9RA 1POXA 5LL6P 3KYBA 2JBHA 3UW1A 3FWHA 2HMAA 2RG7A 4QUJA 2AR7A 1AZTA 5FLEX 4Z53A 1Y98A 3SNHA 3KUKA 2QE7D 2ZBFA 1N92A 3VAAA 1ISRA 3O6VA 2FFHA 2ZEJA 4BU0A 3G13A 3EISA 4LGCA 4YLGA 2ZJFA 2CXXA 1ICEA 1E2HA 1LNQA 1SZDA 1VRVA 4D42A 2Z2ZA 4JH0A 1L4EA 3DZGA 3IUJA 1WP4A 2GBGA 2GFIA 3AR2A 3R3WA 1RM5A 1KYZA 3HUDA 5LCXA 4RELA 4BRZA 4CLRB 1QZUA 3RQSA 4KW7A 1E6EA 1L7PA 1UJCA 1XLUA 2F3SA 1YB4A 4X1KB 2EXXA 2BUCA 2E48A 5CP8A 4B9EA 5JFTA 4IXWA 6LDHA 3W79A 3PENA 4GF5A 3RIGA 4BV8A 3EN0A 5I01A 3OTIA 1KI6B 3L1HA 1WKVA 3UMCA 2Y1GA 4UMVA 4M60A 2Z8YM 1RQPA 1GA4A 2HIMA 3V4FA 3K70C 3IE1A 4ZCRA 5DHSA 5H81A 2JDID 3JSAA 1OE0A 1R6TA 4R9UC 1XZ8A 2OQIA 3M5DA 3OKAA 3SGLA 1F0KA 4PFJA 3AUXA 2C4KA 2W2QA 1KTIA 1Y9ZA 1PVVA 4OMCA 1JBQA 4DDVA 5ALYA 1XQ9A 4YJ2F 4A5SA 1N6PA 5G4KB 1UKEA 4E5MA 1VSQA 4AWAA 1VPWA 2A0FA 4EKEA 5ITVA 3FOAA 4JFAA 1I24A 3PC2A 5JWHA 1MENA 2OORC 4GUDA 4CTJA 3ESAA 1B41A 1R9NA 5EQDA 1JPVA 2JIMA 3CLRD 3JPYA 2XF8A 3C45A 2O6HA 3DE1X 4DEYA 1WCYA 4DIUA 5AM4A 5JJIA 4G5SA 2R7KA 2HN9A 2K2QB 3G1WA 4KQXA 4KX3A 2EFEB 2DOKA 1KP2A 1RKXA 1JHAA 3IPCA 4FXOA 5KOHB 1EEXB 1T36B 2DLDA 1K86A 4L7QA 3KSZO 5FL3A 1JT2A 1JAXA 2D3WA 3E2MA 3MSCA 3O7MA 3O91A 2JEZA 4DCJA 2E5LB 1U1CA 1W4LA 1AXEA 4KFUA 3COYA 4WKOA 2I3AA 4E33A 1KGSA 1Z45A 2JHGA 3AC0A 4U6QA 3G0HA 5CEJA 3U2QA 2V7QD 2OV2A 5LP6F 5EG5A 5H9VA 1IN8A 2HDNB 1RE1A 1GSOA 4YFYA 1RP7A 4DWJA 1ZD3A 1NVXQ 5ESRA 3RT1A 3UATA 3I61A 1OUMA 1R0XA 3CO5A 5A06A 2C2OA 4PTLA 4BNGA 3PWSA 1JYEA 2Z6UA 2O5VA 3MBOA 5JADA 3I3SR 2VH1A 3P9KA 4DSTA 2CYCA 1V7CA 5FDFA 2NU9A 1Z28A 4IIHA 1A8QA 5KOHA 2GK6A 4I08A 3MCVA 1ZINA 5ALKA 4FUQA 4HN4B 4K8OA 1B26A 2C4MA 5LYJF 1Y3BE 3W2FA 5BSVA 3MPOA 1JN0A 1G3RA 2EARA 2PRIA 5G2OA 3HK2A 1YRHA 4WAUA 1ORVA 4NHEA 2A30A 3AR6A 4AZ0A 3CW8X 2QDKA 1HSZA 2J41A 4C14A 2IHYA 2O4UX 1P1KA 4ED9A 4YASA 4OXQA 5AVRA 1FTYA 1ODIA 3QPDA 1EVYA 1RXWA 2X2EA 2ZCUA 5JQGB 4UEKA 5FF9A 5K0BA 1W48A 2W48A 3GD7A 2RK4A 4MVYA 2EIHA 1X2EA 1IQRA 5H7XA 4H60A 5EXXA 3IUBA 5CDUA 4KXLA 2RBEA 3HYTA 3LDGA 2YXNA 2B7LA 2GK3A 4OSEA 3SG0A 4KZPA 2WZCA 5FI1B 5KQPA 4OA5A 4TSFA 3H86A 1RWKA 5LJIA 4LYGA 1YKFA 2OUIA 5BORA 1NW7A 3HCCA 5ELLA 4IKEA 2J3IA 1ECPA 2HWYA 5TPWB 3O8QB 3A4TA 2BFBB 4IDOA 3E23A 2WYOA 3IHTA 1OSNA 1YQQA 3HYNA 5AI5A 3LGAA 2OHOA 1EHIA 4W6QA 4R8VA 3PFNA 5FPYA 1FMFA 4HJXA 4QO8A 2G5PA 5D5HA 4MV4A 1BJTA 3KX2A 2O2SA 3EVEA 1V1MA 1QYCA 3NIDB 1W1IA 1NUTA 3KEQA 5BYBA 4E03A 1KSHA 3D6FA 2X41A 1XD9A 3LXRA 1Z25A 1HDCA 4MW4A 1P9OA 2O6LA 4TYPA 4PLGA 5EHXA 3BXGA 3VPDA 4QATA 4FDTA 4WLOA 3TQIA 1C30A 4UTZA 3TUJC 3GOHA 4HS4A 3B2NA 1Q84A 4XLZA 4IGKA 4NRDA 3Q4GA 4CF3A 1AN9A 4GOOD 4R5HA 1KZ1A 1TKAA 2FK8A 1XELA 5EMHA 1EWKA 3RYFA 3U9SA 4AROA 2NACA 3UICA 3CEMA 2R0QC 2WT9A 3COPA 2OHFA 5CM9C 1I33A 2LWIA 3EXHB 2PXXA 4LJ5A 4N8DA 4Z49A 1DUVG 3RSQA 3P7MA 2VJMA 3CEJA 1IN7A 2WUWE 1G64A 2GN0A 4XLLA 4C78A 2CJPA 1K06A 3H5VA 1IBMB 1U7UA 2P8SA 1EYZA 1XL1A 2IYWA 2J9GA 3H5OA 3RARA 3UPDA 4C6SA 2FUNB 3AJ9A 1NBHA 1UMCA 2HTFA 4LDAA 4NBWA 4RJTA 5L4LA 4X54A 3VZPA 1DO8A 2PS9A 2QN9A 2XUQA 3FPCA 1JALA 2YJTD 4X1YA 4X44A 1NULA 2QNBA 1WTCA 3KYCA 4JLOA 4EW1A 4FQ5A 4TN5A 3WKCA 4V39A 2PLNA 1SOVA 2XYRA 4LF8B 4PTZA 3BHJA 3L0DA 4R51A 1W75A 1KF0A 2H85A 3ADKA 3R9XA 3OFVA 4M0EA 3KTFA 1V3TA 3VNRA 3BFVA 3WB9A 4KN8A 1PFKA 1USUA 2ZRFA 1C81A 4PG6A 2JAPA 3QFFA 4RFVA 3FDZA 2O8BB 1SUIA 3A4YA 1AZLA 4C4AA 2QK4A 5FQOA 3NWEA 3T1TA 3LCUA 4MS1B 1FFCA 3VV3A 4YV2A 4HLUC 4ZYLA 3EG9A 3PFBA 2CWWA 2EP5A 4LOJA 3BKWA 1IOZA 2ZT7A 3QF7A 3AZPA 4MGKR 1JG4A 3VYVA 1SIUA 1V5WA 1C9DB 3GT0A 4MJ3A 1O5TA 3HB4X 4TS4A 4O33A 2FJ0A 2W2NA 4OSPA 4BIMA 4YRGA 1R0LA 4FZRA 1JFLA 4OXKA 1UJMA 4BZXA 4EH1A 1CRWG 3CRQA 4FOLA 5HXAA 3C3KA 3ETLA 5C4IA 2ZKIA 4ARZB 3R9XB 4HYYA 4MJ7A 2H1VA 1E9SA 1ZK1A 3OLYA 4GP6A 2XXAA 3O4GA 5ED0A 1RHUA 3A6GA 1ZCFA 3ABOB 3H2BA 3OZVA 4RK6A 5EZQA 5C1PA 3GCWA 3ECCA 4UU8A 3Q1KA 1WNTA 1OZ0A 2FWNA 2PS3A 3C6QA 3FPEA 1EKXA 1C9KA 4A0GA 4BPBA 1AGPA 4JBXA 1FFSA 2VSOA 2JLSA 4PSVA 2MCFA 4C6RA 2FY8A 4DIDA 1LD3A 3VUEA 5AFSA 5KSOA 1MKYA 4TMTA 5JZVA 4I1RA 2NXNA 1T24A 3RFCA 3WAKA 3L7KA 1L7OA 4D98A 3ZD6A 3D59A 3V4PB 1FRQA 1OXMA 2P7HA 3A70A 1MVLA 5JMWA 2A1TR 3P9PA 4FYHA 3OESA 4MI1A 3RUDA 1ADCA 5DCYA 2VHJA 2GUGA 3I01A 3WNBA 3GLFA 5CCEA 5LD2B 3AVVA 1JVNA 2A7XA 3B6EA 4OV6B 3OMLA 1I0IA 3DHVA 3OZUA 5ALOA 2XSZA 3DOOA 1UIMA 3TB6A 1I3CA 1NBMD 4LWQA 1LB1B 5FBWB 3VHXB 5HW0A 2VRCA 4XWKA 3EXIB 3DFUA 3OZBA 4UJ3A 3D7KA 1VBMA 3HWSA 3MOIA 3TM5A 2EU8A 2GWRA 5INTA 4ENVA 3DTVD 4NNOA 5J2TA 5ILQA 2DCMA 3EOAI 4NG5A 1CQJB 2AN3A 5C8YB 3H4TA 3N2GB 4GI3A 4DV6B 4M3NA 3OZGA 1EEHA 1YQDA 3D2BA 2J0EA 2CFOA 3FXAA 1YVDA 2VFAA 4NENA 1XG5A 5J58A 1E63A 4ZOCA 4PGFA 5DK6A 3KJFA 3QITA 4Y3UA 5IJXA 3F9IA 3MS2A 3O31A 1B6RA 1NW4A 4Q4LA 2YINC 4KVAA 4L0DA 4NFHA 5GADl 4LPSA 2JJ2D 5JCXA 1J2UA 1QHFA 4MMZB 4YUXA 3DFIA 2BHTA 4A73A 1ZKMA 1KAEA 1G7RA 1SKYE 2F59A 2P11A 1V6CA 2FFQA 3N39C 3TXAA 1NATA 3U5TA 4KR3A 4RA9A 3O8BA 3DPIA 2FUG6 3SQOA 1CD5A 4MVJA 3U1BA 1D7AA 1R0BA 4EQ6B 1BYIA 3L8ZA 3Q2OA 4ZCMA 3K73O 4BP3A 3MN1A 1OJ7A 2IHNA 3FYSA 1IM5A 2Q2QA 1T0UA 1T2UA 3AY6A 3IUPA 2ZUVA 3S2EA 5T3UA 2R4QA 4HDKA 1K6MA 4EPTA 1GXSA 2Q8PA 4YRZA 1NVUQ 5DTQA 4XFDA 1XALA 5KIAA 3WQBA 5CJ2A 1SQGA 1Z2PX 2CEAA 3WYBA 3V9PA 5KOIA 2E4VA 2WWYA 2E5FA 2W71A 3B48A 3IAM6 3IAS1 3ENNA 3MUNA 5G0SA 5K8JB 4CKCB 2BFDB 1JU9A 1T1RA 4ZO7A 3F4KA 1I5OA 5DHUA 3DL0A 5EZ6B 5H02A 1RXIA 3IGFA 4CEHB 5EXTA 2RIPA 4IIJF 3WGYA 4WLFA 1G5QA 1OYWA 1Y5LA 2AUTA 2BGJA 2Y2UA 3IJPA 5LLDA 1T3ZA 4M98A 4OHUA 1PE0A 4QGAA 4AUKA 1KVUA 2UYGA 2AOTB 4EKIA 1HKHA 1GLGA 1U3DA 4U6SA 3WISA 1N5RA 1GY8A 5T7BA 3OQVA 3UO8B 1THGA 2F1RA 2W2LD 5LYJA 4GGPA 5JFOA 1EDZA 5AK0A 3VSBA 2O0HA 4BX9A 1M1UA 5AW1A 2Q9CA 3X1YA 3KUXA 2P4UA 4G65A 3U40A 2XTJA 4F21A 2RBGA 2GSWA 3SEQA 2B0CA 3PNLA 5FFNA 1G4UR 1TD9A 1PX2A 4ID9A 3MWYW 4L2IA 1UXOA 1TQHA 1X42A 3HR8A 3H1BA 1RLJA 1E6KA 1X1CA 2PKXA 2UZAA 1W6UA 3C8ZA 3QVGB 3CPSA 4LC0A 9LDBA 4Z9YA 2ZXFA 1IJKA 4XRRA 2P41A 1MO6A 1L3IA 1OR8A 4Z2YA 1EFDN 4JQCA 3RYTC 5HFAA 4CBVA 1VSTA 2A0YA 1OU0A 2VPQA 2Y4NA 5DW0A 2FCRA 4AYXA 4BB6A 3E9EA 5E8JA 1AUPA 3DOCA 3HSYA 5K20A 3IB6A 1DJOA 3QNWA 1PSZA 3H97A 16PKA 2FDXA 3ISVA 3C4QA 5CAEA 4IGIA 1M6VB 1Q57A 1R4MB 3KT3A 1EP9A 4OOFA 1IVSA 4WASA 1DIRA 4INJA 1X7DA 1D03A 3D3WA 1C80A 2HZBA 3LPNA 1QUFA 1UXJA 1QG4A 2H3EA 3ZDYB 4AO7A 4H1UA 2BHRA 2R8EA 2QD4A 4DLSA 2YW2A 3PDCA 2CF5A 2ZBUA 3BC1A 3JWIA 3O82A 3FR8A 1DG3A 1ECFA 5CXXA 2ECQA 3W5BA 4QQNA 5EL0A 5JPCA 4EFMA 3KTDA 5K8VA 3ESYA 2ZJ2A 3GLTA 1DCFA 3DAHA 3M6IA 4MS3A 3RKRA 5BPFA 4DLYA 5KQRA 5CT8A 3EX7C 3GNTA 4H27A 1GGFA 4N6GA 5KHAA 1SCDA 1TJYA 1H2YA 1SHTX 2ZJOA 2HYDA 3DMTA 3LWZA 1ESZA 5DXFA 3GBSA 4E6PA 3TECE 4ASUD 4XVUA 1U65A 3EUWA 2V7GA 4KJXA 4II2A 4J4BA 3ITNA 1K7XB 1P1IA 5EWMA 2GT1A 1QB7A 2BBOA 2IEZA 3KHKA 1EBUA 3PNBA 5SZHB 3VOAA 4AMVA 3RYCA 1EE1A 1AQYA 1NTOA 2QP9X 3KSDO 5CLJA 3VNVA 2Y77A 3D3WB 4INOA 5FTKA 3THWB 3VYWA 1X13A 2Y1DA 4R2KA 4D2IA 2HHHB 1EWTA 1I14A 2CUNA 4HEJA 2PSDA 4RLFA 4HNTA 2PZLA 5K3EA 4CDMA 5KWSA 4IO0A 2XCTB 2P6MA 1Z4LA 4ENTA 1R6DA 4CIYA 1T5LA 4WJLA 4LUCA 2X77A 2C82A 4YA6A 2HQOA 1DBQA 5CB8A 3K1ZA 4L9WA 2IQ5A 3C5HA 3M6UA 4R68A 3HO6A 4ZK2A 5MF6A 3ZUGA 2AN4A 2C29D 2BLNA 2GCIA 1J0DA 1N0IA 1NG1A 1Z6QA 2C3OA 2P69A 2FPPB 1T2NA 3DBLA 1EESA 1PR2A 1VL2A 4JP5A 4MRRA 5EA2A 1T6YA 5TF4A 1NYTA 3RE1A 1ZRSA 4RX1A 1YGPA 2IXGA 2H4WA 3HH8A 3HKCB 3AP3A 3AGPA 4GNRA 4FCWA 3FVRA 3UNXA 3AVPA 4DXHA 4JDPA 2EGGA 3OLWA 4KNVA 1PT8A 4B80A 2K7FA 4UDYX 3BN3A 1G5RA 1FUKA 1K6XA 3KC2A 1JAIA 2UZIR 1D1SA 2I55A 1XTSA 3FKJA 4WZBE 2G9VA 3WDSA 3KSBC 5H3CA 1THMA 4B85A 1EIZA 2BHLA 3DZKA 4CMHA 3GJTA 8AT1A 1OB5A 1X8LA 3PWKA 4N0EA 1KKLA 3CXRA 4AKSA 4GL2A 4A7PA 3E1SA 5EJ2A 4JZKA 1HR0B 2CL6X 1V95A 1SRQA 4MV6A 3B6MA 2BGTA 4KYIB 4P3NA 4JROA 4U3JB 3E0XA 3NIWA 2WNIA 4TV9A 2BGGA 4PC3A 4XYGA 2YWJA 2Q4OA 4PPGA 2O8DB 1FQOA 4LZJA 3K5PA 4H08A 4FJ2A 4QO7A 5LMZA 1RWQA 3ZV5A 5IT0A 5E0KB 5U9CA 3SXUA 1KAMA 5B2ZA 3ZHBA 2ZYSA 2C0PA 2HSDA 3ZBTA 1PUXA 2HKIA 2AHOA 2J3DA 2X42A 1JLRA 1FYWA 1SPXA 3DJYA 1TPYA 5CNJA 1Z4QA 2OA0A 2H65A 3CV3A 4UBNA 1II0A 3W4IA 2UVPB 5B7QA 3PHBE 5SZJA 3T54A 5C3MA 5FUQA 2CUTA 2XR1A 1QDLB 3OHPA 5JSKA 3LQ2A 2ORWA 3IVRA 1GFWA 1NSTA 1P0FA 3AHJA 3HBLA 1LRKA 1ADGA 2WAOA 3UKOA 4C6HA 5KKNB 1J24A 3V4OA 4Z6KA 1ZCAA 1N2JA 3IP7A 1M66A 2VQDA 1JA0A 1JRLA 5KVSA 1PJCA 2NTEA 3U7EB 3GA7A 2FQQA 1QVRA 2JASA 5JXGA 4C5AA 1DX4A 1QR2A 4PGAA 4B4KA 5JBIA 1XNQB 1LRJA 1XWIA 2OFOA 1QIKA 2Z4RA 4HFJA 4EHBA 3I0ZA 3ROEA 2DSNA 1ULAA 2VK4A 4I55B 3QUCA 5KQGA 5LDGA 1TX4B 4KDCA 4JHLA 5HCIA 5K6TA 5A6SB 3IUEA 3F49S 1PFQA 3C2QA 3PEWA 1D4ZA 1UXGA 2H7CA 2YHBA 2YXDA 3G5LA 4Y6SA 4BQOA 1QS0A 2ZWIA 3E3AA 3LRPA 5L8VA 2GJ4A 3FI9A 3L1UA 4RPGA 3COSA 3RYIB 3QBJA 4O63O 1C1XA 1JQJC 2QGFA 1N5DA 4IYRA 2JJ1A 3DW1X 2EG9A 3LM8A 4IDPA 2X13A 3IR5A 4JVLA 2H1IA 3INTA 4HX2A 4DA7A 5TQVA 1J2EA 4O6VA 4MEJA 2C4TA 2QRVA 2YQ4A 3MLBA 3Q5EA 2QS9A 2CZGA 4LWPA 3S5JA 2FQ1A 5DGXA 3DMDA 5FO0A 4M0LA 4XXHA 5CVVA 5EMNA 4EWLA 3E2IA 2CLDX 2QQ0A 2RIRA 4AXBA 1ISSA 1F3LA 3BPSA 2N47A 3QXGA 1YXMA 3DNPA 3ETNA 4RHTA 1ONNA 4EJFA 1UBJS 3G23A 3GLVA 3NDRA 1M5TA 5JMOA 4Q4JB 4G6ZA 4LJAA 4Q4HB 4ODIA 3HXLA 2C7PA 3KYJB 1WAMA 1YULA 2ZGVA 1QYRA 3UBMA 2CJFA 1YRBA 3KKLA 3TTXA 3FPFA 1S5PA 2BFFA 2HUNA 3LX5A 5JT1A 2E82A 5C81A 1TRHA 3OU7A 3L8YA 3QVXA 2ZYIA 4QWWA 2VNKA 4GBED 2D3TA 2ZZKA 2DBZA 5AVWA 1PFGA 3VNUA 3D8NA 3L7JA 1XHEA 1Z0AA 2PAFA 5AVQA 3QU2A 4TMFA 1Z7WA 4ZVTA 2C3UA 2P6PA 1MPXA 3G2KA 1DXOA 4KXMA 1RRKA 4BX2A 3U49A 4Z9XA 3ZGLA 4Z1MA 4MWTA 1MC4A 3GZJA 4FSHA 4PPQA 2PUDA 3PNOA 1E1CA 5F12A 1EFPB 2FA9A 2AOVA 2VP2A 1EZ1A 8ABPA 5E9AA 2TECE 3BA6A 2O0LA 2Q4DA 1PR5A 2CK3D 1A2KC 1O0SA 4BO0A 4DWVA 2Q3HA 3FWYA 3TQSA 5ES4B 3OKCA 3CR3C 1CFZA 3C3BA 2IYUA 1U0EA 3NHSA 5HKBA 4ZGWA 2XY4A 3AF5A 3L1KA 2J48A 2JK1A 3RVQA 2Z3WA 1U0FA 2YV1A 2JAUA 2YYAA 1GTZA 4LRXA 5FBQB 3LOUA 5K3AA 5D86A 3NHMA 2EW2A 3IO3A 5BN4B 3RLFA 3JZFA 4MR8A 3CURA 3GDOA 3IDFA 1SWVA 4H7FA 2OQRA 3J80A 2YZ2A 3A7EA 4WFIA 2J0UB 3KEFA 5GJCA 2J87A 4G8CA 4KUGA 1WUTA 2RGGA 5IARA 1JKIA 3THYB 1X94A 5KWJA 3IHLA 4Q93A 4R84A 3E9QA 4WLVA 4U2KA 5BUQA 3IAEA 1M5RA 2C5BA 2LIVA 3CNLA 4UREA 3EZNA 4E0BA 1PVOA 1FTSA 1C7EA 4ZVPA 4JGGA 2OCDA 2YH2A 1A5SB 1H2BA 2C3PA 3KQNA 2YW9A 1KFBB 4CCYA 1ZR4A 3ENZA 4P6VF 4K7JA 5IJ9B 4CGYA 3FSEA 4PNPA 5BNZA 4DV0B 1AV7A 4Q7MB 5DMXA 1T8WA 4YMIA 3C3DA 2AN5A 1FUUA 2J7PD 2PBZA 4EB3A 2J9RA 1WSAA 1L1RA 3AWIA 4MR7A 4RDHA 5CLLA 5FJIA 1KZGB 4NONA 3E9NA 4P7GA 5AK3A 4WERA 1J0XO 3SLKA 4Q19A 2TMDA 1ZH0A 5JSZB 4TS3A 4A27A 1II8A 2JIRA 1HFKA 3G79A 3S7ZA 3DH0A 1ISIA 3UEOA 4CL8A 2ONKA 1E7RA 3SQMA 2BGMA 4U2DA 7MDHA 5TQ0B 5F35A 1MOQA 4MMXB 3WIOA 3RRNA 5K3OA 2YVAA 4ZVLA 1QWSA 3IA7A 4NBTA 2PUGA 2BZ0A 2XE6A 1PFVA 1YS6A 1I01A 2AG5A 1FJ2A 3QOXA 2Y27A 5KYWB 2HLNA 3UOAB 5I5EA 1Z6YA 5BNTA 1O1YA 2JPDA 3L7BA 3MTQA 4UBOA 3G7SA 5EJFA 1PR4A 2CXHA 4BZQA 1L8XA 1NKSA 4PLVA 5G0TA 5REQB 3AR3A 5BT9A 4QLBA 4PZDA 3EIFA 4B83A 4PIVA 4PZZA 2GI4A 1E2UA 3W2GA 1ODJA 2AYYA 1K8YB 2ERCA 2FG5A 1FFXB 2D06A 2IYYA 3TPFA 5LQUA 1AS3A 1RHMA 1OFVA 2V58A 2VHEA 1N5LA 3I6BA 1X3LA 2X5JO 2AFHE 3B1XA 5E2BA 5F5XA 4RCYA 3RNLA 4ZJYA 5AVXA 7MHTA 4I99A 2CNKA 1I2DA 4HD8A 3T9EA 1ZIYA 1KJQA 2F1OA 2QXYA 4HUQB 3TJMA 2J5KA 3TOSA 3DJFA 4DLWA 4DRXA 3U44B 1NJ2A 4ZVSA 4QELA 1G59A 5GIOE 2BEUB 4IDCA 3SLGA 4GE0A 1PWXA 1UBOS 1Y6RA 5LQJA 2P78A 3QA3E 1XTKA 3LT0A 4F5EA 2C83A