5CB8A

Crystal structure of adenosine-5'-phosphosulfate kinase in complex with aps and sulfate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
174
structure length
174
Chain Sequence
b'QRGVTIWLTGLSGAGKTTITHALEKKLRDSGYRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRIGFVSHLLTRNGVIVLVSAISPYAAIRQEVKHTIGDFLEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRTDLEELDESVGKIWQKLVDLKYIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable adenylyl-sulfate kinase
publication title Recapitulating the Structural Evolution of Redox Regulation in Adenosine 5'-Phosphosulfate Kinase from Cyanobacteria to Plants.
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Transferase
total genus 72
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cb8A00
3FKSA 2CCJA 2RGBA 3ICEA 1TX4B 5H8WA 3W3ZB 4CGZA 1T4GA 1VG9B 1YZNA 3M4YA 5CYOA 2X77A 4OQFA 1RPZA 1NSFA 2VSOA 5K8UA 3ZLJA 2GETA 5JRZA 1G291 2VA8A 2Z83A 4LJ7A 1EGAA 4LHXA 2FH5B 1CIPA 1N6PA 2FE4A 1NVWQ 4JL8A 5EE9A 4ZI3A 4TYYA 5KNCA 2GBLA 4JBXA 3FKSD 2FZ4A 3RYTC 1G3UA 4B74A 2NO9A 5AJWA 2NZJA 3EZ9A 3T1QA 2AKAB 2G83A 4Q66C 3MJHA 3RABA 1E4VA 1JEDA 5M04A 1IM2A 2MMGA 1XMVA 2IWHA 4TTPA 1OYWA 4Q9IA 2Y8EA 2XTMA 2X2EA 4Z8XA 2I1VB 1G7TA 1VYVA 3B9PA 4E5UA 1GTVA 3QEOA 1R0ZA 2OXCA 3L2OB 4XVRA 2Z43A 3IPXA 1GKYA 3AVTA 3EC2A 1NLYA 1Q1EA 3SDZA 1TQ4A 2OV2A 3O8RA 4V03A 2CK3A 2ZYUX 3B8HA 4LSGA 2VHUA 4DDWA 3I1FA 3B1WA 2OUKA 2YHSA 2ZJ2A 4KFSA 4HLUA 2IT1A 1KDRA 4A4DA 1N5KA 4Q19A 2HXYA 1YZKA 1E0SA 1I4TD 1WQ1R 3AB3A 1G3MA 1EFCA 4E07A 1PJRA 5HZKA 1KNXA 2CEAA 3CRQA 2PZEA 1HQYE 1VKJA 2VEDA 3KUDA 4NU0A 5TARA 4I4LA 2CK3D 4XWOA 4BRUA 1J99A 3LY5A 2ZR9A 5FTKA 3SJZA 4V0LA 2AKYA 4GL2A 2FPMA 1VCMA 4LRWA 4J0QA 2IXEA 4R2IA 821PA 4JSTA 3KKMA 2G88A 1LV7A 4QBFA 4BZXA 5J40A 5B58C 2J7PA 3D31A 4RY2A 2CHGA 2JLQA 4IDOA 2YNMA 4EFLA 3IDQA 1N25A 4EPYA 1GNPA 4MRSA 4NPHA 4ON9A 5JCZA 1DAKA 1T0HB 1XEWY 4CT5A 4UNQA 4DWJA 4D4KA 1ZIPA 1Z0KA 1A4RA 2WOJA 1YR7A 4IVRA 2C96A 5GJWC 3OF5A 4LBVA 1M6NA 1DAMA 1KDTA 5FL7D 3GLGE 4OBEA 4GNKA 3KB1A 1XF9A 2REOA 2DCUA 1D2NA 3CB4A 4LYHA 2J7PD 2GF0A 2HT1A 1GRQA 3K70D 1XD2A 1EFHA 2GZDA 2KBEA 2OE2A 3B78A 3CWQA 3HWSA 2OFOA 3WBKA 3EIQA 2IEZA 4US0R 3TVTA 3HYTA 1UFQA 2QGZA 1WMSA 1E79A 4LC1A 2QAGB 3QF4B 3S1AB 2PT5A 1R8SA 4B2IA 2J41A 2BVNA 1AGRA 1L2TA 2VSXA 3QOFA 1SKYE 1SXJE 3TAUA 5BN5A 4IFEA 1AJEA 1O87A 4A8JB 1S9DA 4UKDA 4BFXA 3NEYA 2NPIA 3PITA 1G19A 1XEXB 1G7SA 4FMCB 5AUQA 3SYLA 2OBMA 4TQ9A 5L8VA 1RRGA 4GP7A 3QKUA 1FTSA 4BLPA 1ZYUA 4L9SA 1YR6A 2IL1A 3VU9B 3GLFA 1E79D 3SHFA 5L3SA 4OHXA 2XX3A 1S1MA 2RHDA 4OI4A 3PJRA 2ODEA 2GEDA 1I2DA 3G5UA 3P1JA 3NVAA 4XVQA 3ICQB 1NLZA 2F1RA 1DELA 4TL8A 1LB1B 3CPHA 2NTYC 4DC9A 5HE9A 1KKMA 4KAXA 3PCRB 4ESVA 4EJSC 1CBUA 5FOSA 1U0LA 2AL7A 2G6BA 3F0TA 3UK6A 4DDVA 3I32A 4B47A 2JJ1A 4QGAA 5KYKA 2QBYB 3KJIA 4BGDA 1XPUA 3U4QB 2LKDA 3LVRE 1LF0A 2BDTA 1US8A 4F92B 1E9EA 3KKNA 4B48A 2YWHA 3NWJA 5G3YA 4L5BA 3U44A 5B57C 1R0YA 2YC4C 4HDOB 2GBLC 5CITA 4C2UA 2DPXA 2RGEA 3EA5A 4HAXA 1W46A 5L3VA 2JJ1D 2KSQA 5FI1B 3G0HA 3AF4A 1NL3A 4HAYA 3LW7A 3IEVA 4RFSB 2QMEA 1JECA 4WAUA 3W6OA 2RGDA 3ZVNA 4P4TA 3BB3A 3H86A 3AP3A 2DY1A 4M21A 3T34A 4CYMA 1JB1A 1YR9A 5HCNA 3EX7C 1XD8A 3LW8A 3A1TA 4CDGA 1NBME 1PUIA 4S35A 4BLTA 5K8TA 3LX5A 1W0JA 1G3IA 2ANBA 4KLZA 4ARZB 4ZKDA 4O3MA 4AG6A 2JLWA 1MRNA 3TK1A 4DCNA 4US1R 5JHGB 5A0FA 2P6NA 1CJTC 4Q1AA 2XSZA 3UG7A 4B33A 3FGNA 3TUZC 1Z8FA 4GPTA 1W48A 3CNLA 1U99A 3LO5A 4KVGA 2ZSAA 1RVDA 4DCSA 2WAYA 4HLUC 4X8OA 2XITA 1ZINA 3Q3JB 4MRNA 5E7IA 2BKEA 4JLNA 2JLYA 3UANA 2HYIC 1ZM7A 3EA0A 2O8BA 4AI6A 1W0JD 4GOKA 3KTAA 1W7AA 2ZI7A 1KO4A 1VG1A 2JLSA 4Q03A 2C99A 1D5CA 3RHFA 4PQFA 2DFNA 2XSZD 4HDQB 4Q1BA 2FGJA 1VTKA 5CIWA 2FFHA 5CM9C 2VLIA 4URYR 3V00A 1G41A 4DLSA 1KK1A 2B92A 3A1WA 5EP4A 2R8RA 1KI9A 1R4AA 1WDTA 4IOJA 2YOGA 5EE1A 3LA6A 1IOZA 4FIDA 5SZJA 4ZCMA 1G8PA 2QM8A 1IBRA 1JR3E 3ZZUA 1IXZA 2TMKA 3HYRA 3VR1A 1Z0JA 2ZE5A 4HZUA 1P60A 2JIZA 4YDHB 2F55A 2CL0X 3CPJB 4MKHA 2QP3A 4EPWA 1TU4A 4W9MC 2V4ZA 4IOKA 2REXB 1VHTA 3NEJA 4KI0A 1OB2A 1R0XA 4LHZA 3T61A 3K8YA 1MO6A 4F4IA 4B34A 2Z4SA 3AP2A 4LZZA 1Z07A 2H17A 3SYNA 4XIGS 4ZV4A 3AVQA 6Q21A 1TEVA 2WWFA 5KUTA 1N0WA 3KQNA 4XH9B 3IILA 3L0OA 5DHAA 2JIZD 3THXA 5LBIA 5J47A 2G0NA 2ZAMA 4YC7A 1IN6A 4OHWA 4KU4A 3R8CA 2P5SA 4EJSB 3SYKA 3B2EA 4LJ5A 3K9LA 4U7DA 4QNRA 1J8MF 1XXHA 1YVDA 5HPYB 2ZRLA 4FCWA 4JKIA 3PR1A 2YOFA 5GADl 4NDZA 2XAUA 1KOFA 1VCOA 2ZRHA 3FTQA 3IPYA 4ZKEA 1L4YA 1RYFA 2V1UA 2EFDB 1K5DA 2QU8A 4QBGB 2HV8A 3IO3A 4TL9A 3NDPA 2VO1A 2OFWA 3G82C 1UBGA 3OAAA 1G6HA 1KMHA 4MKIA 2D2EA 4GOJA 4IOMA 5B64A 2A5JA 4HB3A 1H8EA 3W6PA 1NJFA 1QF9A 2IC5A 1I2MA 1W1WA 2ECKA 4HAVA 2J59A 3GJ6A 1R7RA 5FPYA 3TKLA 4PSKA 5JS8A 1VG8A 1HE8B 4PO8A 3TIFA 4TMXA 5CB8A 4W5WA 2HYDA 2J9RA 4PZYA 3T5DA 4V0MA 3Q8XB 4DB2A 3JZMA 1Z3IX 4DB4A 2GVDC 3ZD6A 3AF2A 2Q0HA 4NYIQ 3VMFA 1MO3A 4I81A 3A36A 1ZUHA 4LC0A 4D4MA 3E70C 2QEQA 1P9NA 4QHTA 1HH4A 3OAAD 4B3FX 5KOYA 4CVNA 1H8ED 1Q57A 3OEEA 4MYUA 4DLWA 4DT1B 4NYJQ 4OQMA 1V43A 2QSZA 2ZJAA 3SNHA 4QBIA 2W2TA 2DHRA 1YQTA 3B6EA 2PZFA 4MGYR 2QG6A 4ZDWA 2QSYA 5ELXA 2DWPA 3K1JA 5FUWA 5E95A 2J87A 5CJ2A 3FMIA 4Z54A 1GILA 1UEJA 5FL3A 4QM6A 1FL9A 4V0NA 3C16C 5P21A 4DVGA 2RKOA 5DISB 1QHSA 2BBWA 4TTRA 5EZ5A 3PXGA 4GDFA 2RGGA 3OEED 3U7GA 1E1RA 1Z08A 2P67A 1G4AE 5JI3E 2H18A 4PPNA 2PJZA 4FWIB 4D80A 4KO8A 2ODBA 1JJVA 1L7VC 3IHLA 4TLAA 4WBSA 1NNEA 2G1JA 2QT1A 1CJKC 2FWRA 3FHOA 5SZKB 3WBJA 1JXMA 3LWNA 3UATA 3EPLA 2OHFA 3Q7QA 2SHKA 5F9FA 1S0UA 3K70B 1E96A 3MWJA 1BMFA 5L3RA 3NC1C 4GOXA 4Q4AA 3GEEA 3WHLA 4YMSA 5FH9A 5C4GB 1E1RD 4BQSA 1E0KA 3GEHA 4HLCA 5IDVA 5KDDA 3PEVA 2FEMA 2V7QA 1WCV1 4TLCA 3C5CA 4IKEA 4DLZA 3I73A 3H2YA 1F5NA 1W5SA 3PFIA 4TLEA 4YXWA 1E2HA 3T1VA 3VR5A 1NY5A 2WJJA 1TPZA 2QQ0A 4GP6A 4JBWA 2IS2A 1EFTA 2JAQA 2FOLA 5HR5A 4B3BA 1XD2B 2OCBA 3FMFA 4HUQA 1BMFD 1XMIA 2A5DA 5EZ6B 3GP8A 2V3CC 3NDBB 1NG9A 2QAJA 2ZUDA 2RB4A 3T5GA 1J90A 1YZTA 4Y0AA 4DCVA 3I5XA 4DLUA 3AF3A 2QZ4A 2ZAOA 3AVYA 2IUUA 2V7QD 1YZLA 3N2IA 2AWOA 4G5SA 1XD9A 2ZYTX 3Q9LA 1P73A 3IEUA 3FYHA 4LYAA 4DEXA 2FA9A 2OM2A 2QQEA 3L0SA 4W5JA 1KI4A 1X6VA 4YXWD 4IDQA 2IYSA 4QBHA 1GL7A 2CNWA 2QPTA 5EP1A 4B76A 5G41A 4Z51A 3CX7A 1FX0A 3QKSA 5AJXA 1AQYA 4IJMA 1GOTA 1UPTA 3QXJA 2OCPA 4US2R 3GLFB 5L3SB 1CXZA 3V9PA 1QHYA 5KDLA 4LBWA 4C0SA 3OIUA 4RFVA 4BUJA 5BN3A 1T6NA 2AK2A 4LJ9A 1W0KA 3QXSA 2BHRA 5CLQA 3GJ5A 4Z1MA 3SE0A 1L8QA 3MUFA 4AK9A 3LFUA 3WMGA 5C4MA 1G21E 3HR7A 2CL6X 4DHEA 2CNWD 3X1YA 1CKEA 4PC2A 2X8AA 4QJ3A 2PL3A 4WXPA 4PC7A 3B7GA 2IYQA 3RS5A 2A30A 3KXKA 1X3SA 4AD8A 1I4LD 1TL7C 1Y63A 5FTMA 1SQ5A 1KI1A 3TH5A 1US8B 1Q1QA 2FN4A 1W0KD 4L16A 4D0NA 1ZIOA 3WY9A 3GLIA 4F4CA 3U44B 3DOFA 3TUJC 3B82A 1T3SA 2NO6A 2J0UA 4LJYA 3VKHA 2GAOA 2L0XA 2C9OA 5FPSA 2QM7A 1IY2A 1UKVY 1AZTA 2WPDA 1TADA 3T06B 2JLVA 4MRPA 1KSJA 3BH7A 3F8TA 1U9IA 2PLFA 4URVR 1YZQA 1M1YE 3KDSE 1MOZA 4UNPA 5IHPA 2HEIA 4KFRA 4DBLC 4CRWB 4AKGA 2FEOA 3BH6A 3AVXA 2ZI6A 1OH6A 1N6NA 4A0HA 5DLQC 4DLXA 2VSFA 4IXNA 4OK5A 4P4UA 2NPFA 3ECCA 2IX3A 3WNCA 5CK4A 2WPDD 3AV0B 3DHWC 3X1WA 1LY1A 4OI2A 4A1FA 2QI9C 4KXFB 4XSGA 3VQTA 1JPJA 1XJ0A 4C9BA 3BIFA 3FFBA 1P6XA 1FMLA 2RCNA 3HJNA 3DOEA 4OYHA 2O8BB 2FSGA 3X1ZA 5FOWA 4HUTA 1TUEA 3KTAB 1X8LA 4AYTA 3TQFA 1IAQA 4EUNA 4LBYA 2ZSFA 3O8BA 4AKIA 4OJQA 1G16A 5ANRB 5IRCD 2J46A 3VX4A 1G7CA 1XBTA 1ZP6A 2WZQA 4CEIA 3MWLA 3IHWA 4TSFA 1F2UA 3EWSA 2H57A 3UWOA 2JASA 2ODNA 3X1XA 2PBRA 3W9YA 5D3QA 1OPXA 1GM5A 4JLAA 3OEHA 1JR6A 2MSCB 2YKGA 2BM1A 4JLMA 1CRQA 1W2GA 5FUYA 5D3MA 3U3OA 3MCAA 2PEYA 4ZPXA 1D8TA 3E5HA 2IYXA 1AGPA 5KO2A 4KJZA 4HZUB 4M4SA 1IONA 3DVLA 1OYYA 3NH9A 4A82A 5JMTA 1N6KA 3DEFA 3UKDA 2BJWA 2CE7A 3RAPR 1DAHA 4OHZA 3REFA 2VHTA 4Q48A 3IUYA 4TSFD 5K8LA 2XOKA 3BGWA 421PA 4JVSB 2VP6A 4V02A 3X2SA 3RC3A 3SBDA 5C18A 3ZS8A 3A1SA 3OEHD 1TU3A 2WHXA 3LLMA 3VHXA 3TQCA 2ATXA 1G9XA 1R2QA 1TEXA 4HAUA 3E1SA 4FMCF 2EVWX 3THXB 1FP7A 2IYRA 4OL0A 4CF7A 4RD0A 3U3RA 2ZJ8A 4JLDA 2YWGA 4U00A 3N5CA 2IA5A 4Q7JB 5KPJA 2O0HA 4CEHA 4HEJA 2XOKD 1ZNWA 3JVUA 1Z2AA 4JVLA 4TMKA 2XNSA 4GRAA 2ZE7A 4M9SA 1TF2A 1WB9A 2A5YB 1XXHB 2GILA 4DDUA 1ZM9A 5GVRA 2OO7A 5J4YA 1KI3A 1TF7A 2XXAA 1E3MA 4JLOA 4YMTA 4LHWA 1X8KA 1UDWA 2NZ8A 5KU1A 3B60A 1W4BA 2YZ2A 5FPKA 3LXRA 2D7DA 2CVFA 1E94E 4OHYA 2IS1A 2R65A 3K53A 2JJ8A 2QN6A 4HB2A 4G5QA 3QY0A 2XZPA 2BKUA 5GJVC 1KMHB 1RRPA 2VHCA 1GNRA 2OSBA 4PQYA 3U3MA 1TTTA 3E2IA 1TQ2A 4RZ3A 3GEIA 1KI2A 1T91A 3AKEA 3WNDA 1DEKA 2E9SA 3KJGA 3WYGA 2HLDD 5AJZA 3CRMA 3PUYA 2GEUA 1NIJA 2Q3HA 3RC8A 3SFVA 1XCGB 4RCYA 4V0OA 3BAFA 4UXIA 4X8HA 1SHZA 2KBFA 3RANA 3ZQJA 5KSZA 2ZSEA 1VIYA 1XNJA 4QGHA 4NE2A 2CXXA 1XTIA 3UXMA 1UEIA 1KO5A 5FR1A 3RSLA 2WKQA 4N0EA 2FGKA 3DO6A 2WSSA 4NYIR 2ZETA 1KAOA 2F9LA 4NMMA 4DT1A 1LNZA 3ZH9B 4O2RA 5AK0A 2WIAA 3CRVA 1S96A 1OIVA 1BO6A 1QDEA 3IIKA 3BRWD 1BIFA 4DIDA 1J2JA 2BMDA 2GHIA 1NI3A 4QM7A 5KHOC 4I1UA 2NO7A 1U9IC 3LRPA 1DAGA 3NH6A 4KSBA 4QHSA 3SC3A 1GKIA 2NG1A 3GMTA 5KSYA 5E7MA 4KHZA 2WSSD 4E22A 1ZD1A 2BEJA 4MDEA 2O5VA 5DE3A 4LPSA 3A1UA 5HTKA 4PPQA 3T35A 2R6CA 4DLTA 3C14C 3PUXA 1E9FA 4QXAA 3QJYA 1VG0B 3K9HA 4Q4LA 4D26A 1GDDA 1HT1E 3I4LA 4IEIA 2GAAA 2B7CA 2VP2A 1D9ZA 4G01B 1E98A 1FNNA 2WWYA 1COWA 3WRYC 5FL7A 3U3KA 1E1QA 1T5IA 2ZVQX 3BXZA 3SHWA 2XJ4A 3RWOA 4CW7A 3AF0A 1E99A 2VQSA 4Q4AB 3AKCA 3SU8A 3EZ6A 2ZE6A 2QY9A 5FOVA 3THWA 2GJ8A 2IS6A 3ZJYA 4BFZA 4PQRA 2IYUA 1M34E 2PEZA 4AG5A 1OH5A 2Z0MA 1E9CA 3DKVA 4Q7MB 5HCIA 3VR4A 4BZQA 5J4KA 2D7CA 3NKVA 4JLPA 4PX9A 5J4VA 3W8RA 5E7JA 5J4HA 3THYA 3U61B 1F6BA 2IHBA 4TL6A 4EAQA 3HR8A 1C1YA 1COWD 1S3GA 4PHHA 4EFMA 5IT5A 1E1QD 3AQ4A 3NBFA 3TNFA 4AYXA 3MSXA 3MWYW 4I1VA 4ACAA 4HUQB 2E1RA 4FCTA 4N1AA 3HDTA 5FBLB 4UJ5A 4MUBA 5DO9A 3CLVA 3K0AA 1WBDA 3AUYA 2OFXA 4QRHA 1OXUA 3ZDQA 4BWYA 4B75A 1FQKA 3X1DA 2JJ2A 4ZDJA 4IEEA 1GVNB 3GLHE 4Q9LA 1ZAKA 4TQUS 2JDIA 2ZI4A 2GF9A 4JSYA 5DHFA 4BZPA 5JWHA 1VPLA 1E2JA 1LW7A 2C95A 5KDOA 1X86B 1XTRA 2PMKA 3QXHA 4AKEA 4PHFA 2O8DA 3BBPA 1MO4A 2WIBA 2ZYVX 4Y0VA 2GKSA 3K0SA 1AK2A 1SVLA 4BPBA 5EXXA 4ZI2A 3R9XA 3VNVA 2XZLA 2GJ9A 4L4UA 1X8JA 4WZBE 3U7EB 1AIPA 3KFVA 3QKRA 1FX0B 3QKSB 3GPLA 4AC9A 4JKYA 4R71A 3UPUA 2UKDA 2JJ2D 1Z0DA 1U8ZA 3RS3A 1S4QA 4OHVA 4MGZR 4P0TA 1VMAA 1C4OA 2AFIE 4D6PA 3GD7A 3ND8A 2JDID 1CS4C 1UF9A 1YZUA 5AUNB 3C7KA 3P26A 4RD1A 1GFIA 1XDBA 3L82B 3NBYC 1ZC3A 2QPOA 1OIWA 2F1JA 2H5EA 1BH2A 3KUCA 1P3JA 4JL5A 3AGQA 4L9WA 4LJ8A 1XPRA 4XOIA 1GL9B 3RRNA 4BEBA 1DTSA 3OESA 3VTKA 1KDOA 4Q9HA 2WJGA 5DSZA 3A58B 3PIRA 1W44A 3AVUA 1E2GA 1RC8A 1OF1A 4BFSA 1R5OA 2I1QA 1TNDA 2ZRFA 1Q12A 1JPNA 1G4UR 4WZAE 4RSGA 3GLIB 5CDFE 4JYCA 3R7WA 1N6HA 2WICA 2QGNA 4PAMA 2J0UB 1MV5A 2R6DA 3FOZA 4FCVA 1KZ7B 1LFDB 2WV9A 4OQNA 2WWGA 3EAQA 4C30A 2GCOA 5CLLA 1HQCA 1EFUA 2BBSA 2QTFA 2WAXA 3UMRA 1SVIA 2B21A 5FTLA 3CR7A 1XJCA 1NN0A 1KGDA 4DEYA 2AWNA 1E2DA 1QVAA 3N70A 4XTCS 1MABA 2X19A 3EPHA 2F43A 1BYUA 4TMVA 3GQBA 2D06A 1GNQA 1W5TA 2ZROA 4DZZA 3IIMA 3EARA 3JZAA 1IY1A 1ZRHA 4M1OA 2AXPA 1HUQA 5AJYA 1E9DA 5CM8B 1KDPA 3FKQA 2BEKA 4Q00A 3OFNA 3DMDA 2HF9A 3GJ7A 1U0JA 4XSHA 3EIEA 1Z6AA 1OXVA 1GSIA 3KJHA 1CR2A 2R6GA 3AH8A 4PHTA 4NCNA 4B6FA 2P6RA 4A0RA 1W4AA 1H65A 4MKGA 4QKQA 3GLGA 3FPAA 2X2FA 4WZ6A 5AUOB 3NG1A 3UIEA 3BH0A 2J0QA 1XTQA 1B23P 4G5OA 2ZEJA 1DG1G 1DAFA 1N0UA 4C0JA 2A2ZA 1SHKA 2F1HA 1XZQA 3OFND 4BLQA 1DAEA 2YWFA 2VH5R 3A8TA 2ORWA 1Q22A 3ADKA 1FP6A 1SXJA 4CEIB 1F2UB 1ETUA 2AN9A 2BCJQ 1WA5A 3QBVA 4JT2A 4ACBA 4GBMA 2D74A 4DSUA 2LKCA 3B9QA 1NVVR 3LBNA 2WKRA 2C2HA 5D3MB 3DM9B 2W00A 5EJEA 3BORA 3K70C 2XTNA 2Q9BA 3CH5A 2CCGA 3K0FA 3RSOA 4TN1A 2XB2A 1YKSA 1HT2E 5JEDA 2VL7A 3KX2A 3GCGA 1JALA 1G7RA 4JMPA 1SXJD 1XRJA 3B5JA 4C7OA 4QJ5A 3RWMB 2NGRA 4F91B 221PA 1ZM3A 1Q3HA 3U60B 4Q1CA 2KE5A 4PO1A 2ZUBA 3Q85A 4NYMQ 4ZIRA 4JJZA 3Q7PA 4RCZA 4NCHA 3EPKA 5JJIA 5JHHB 1CRPA 1XX6A 4OQXA 3AF1A 2NOAA 3BB1A 1XEWX 1K6MA 4Q7KA 2IXGA 2FV8A 1UAAA 2OAP1 5CDFA 1OLOA 1W2HA 3LQQA 4OQLA 4CEHB 1ZMXA 4MYHA 1E2QA 2GRJA 4LUCA 4P31A 3CBQA 1RIFA 3B13B 4Q02A 4BLOA 4OI1A 3DMNA 4MH0R 2XXAB 1CP2A 2IEYA 1RE0A 4K8OA 4A92A 4OKSA 3ZIAA 8OHMA 2QRNA 2X1VA 3BD9A 1IN7A 3C8UA 1AA9A 1XB2A 4Q1DA 1NBMA 4IDHA 1F60A 2DB3A 4TZ0A 3D6TB 1KIMA 2C8VA 1ODFA 1VDZA 4HI0E 1ZCAA 2GNOA 2IF0A 4Q47A 4A2WA 2D3WA 3DKPA 3K9NA 4Q4JA 5JWRA 3K9GA 4P3YA 3R20A 4Q9KA 2ZRIA 2WWHA 1FUKA 3IIJA 3U7HB 3FDIA 3OIVA 1G6OA 4D4LA 4L8GA 4LV6A 1CLUA 1OFIA 3GJ3A 3ZIAD 2BMEA 1ZD9A 4II7A 4DLVA 2ASEA 2CE2X 2HJVA 1IJEA 3BOSA 1TQ6A 3QXCA 1NBMD 1NN3A 4NL4H 621PA 3MLEA 4GFDA 3AKYA 1W47A 2CHQA 3CX8A 1E2IA 2ZU0C 4IOLA 2PZGA 5EQTA 5EUMA 1VCIA 3FB4A 1J70A 2G0TA 5DN6A 1SVWA 2ONJA 1LS6A 4C0KA 1LF5A 2BBOA 3CZQA 3F5FA 1SVKA 4HLDA 2GXUA 3QENA 2YINC 2DWQA 2PCJA 1QG2A 4DDTA 1EWRA 1P9RA 4TMZA 2IUTA 4LV5B 2A7QA 1P62B 1XU4A 2QROA 5DI9A 1OXXK 4IVPA 1KI6A 1JR3A 1Z2CA 4NTZA 3T12A 1GWNA 1OKKA 4WA7A 3PUZA 3LNCA 1ZCBA 1LS1A 5H1YA 2ZJZA 5DN6D 2FSIA 4PC1A 1GG2A 2J7KA 4PC6A 4A36A 2ZRJA 4NCIA 4DSTA 2ZS9A 1FZQA 2OLKA 2QA5A 1NSTA 3MGCA 3SR0A 3RS4A 5H70A 5FR2A 3DZ8A 4C0LA 2CJWA 1QHXA 2O8EA 2B8TA 3AUXA 5JFGA 5JZVA 2JATA 4TLDA 5IF9A 3D8BA 2D2FA 1JR3D 3THWB 1N6RA 1PLKA 1E6CA 3D7MA 4G5RA 3KQUA 2ZJOA 3ZVLA 2HXSA 2VBCA 1RRFA 3GJXC 1OKKD 2ZR7A 5FBWB 2JLXA 3WHKA 2IW3A 1WE2A 3H0KA 2K5UA 3PEYA 1W49A 5EUQB 1GUAA 2QMUA 2CL7X 3RNLA 3THYB 2P65A 4PPFA 1SXJC 2F6RA 4RKEA 4KYIB 1U8AA 3TVDA 3LXXA 2BV3A 1HY3A 2N46A 2W83A 2V9PA 2BOVA 3QE0A 1E2KA 3K0AB 1K5GA 1G8GA 2GJAA 2FJUA 2RHMA 3B1XA 1Z47A 4I99A 3C5HA 3KXIA 1N5JA 1DE0A 2OXRA 4B6EA 5F3WB 4JLKA 2JGNA 4FMBB 4LDJA 2WMOB 3QEJA 2ORVA 5EE3A 3KKQA 2O8DB 2ZR0A 1U0HC 2GJKA 4H1UA 2ZITA 1PVOA 3H84A 2C98A 4FN5A 1P61B 5GJCA 2ZRNA 3QKRB 3ZZTA 4JJKA 2B8WA 1KO7A 1RYHA 2VF8A 3FMOB 3OIYA 3HU1A 4B3CA 3SI7A 2IHYA 1PV4A 1CR4A 3BFVA 1DAIA 1M7GA 3B1VA 2OESA 3I92A 2Q3FA 1X1SA 2IK8A 4NBSA 1A2KC 4CEJA 4B2PA 4B43A 5F9HA 1E9RA 1G17A 5TV2A 3CR8A 2EU8A 2UVQA 4JVMA 2EFGA 1FTNA 1AS2A 1II9A 1OIXA 2O8FB 5JBQA 3KJEA 2H92A 2HDNB 5EXTA 3K0EA 4LJ4A 3VR6A 4C0HA 3CIOA 4TMTA 2BMJA 4KSCA 5HKKA 1RRCA 1ZNZA 2IXFA 3CNOA 3Q5DA 1G18A 4I1SA 3LVQE 4LHYA 4LWZA 1KAGA 3NC0C 1MRSA 4G1UC 3AVOA 2IBMA 1T5LA 2OLJA 2OT3B 2ZPTX 4WOPA 1T0JB 2OCYC 5LDDC 1QG4A 4KFTA 4TMWA 3R7WB 5JEEA 4JLVA 3THOA 1OB5A 4M22A 1CR0A 2EW1A 3CO5A 4JZKA 4MA4A 5HKKD 2GCOB 1AN0A 4CT4B 3HU2A 1DARA 5FPHA 1E32A 3ZZ0A 2VPPA 2GXAA 2FZLA 3U7FB 4TTQA 4EPXA 1MABB 2XZOA 2F43B 1E69A 1CJVC 2FFQA 4R2HA 1XTJA 4Q9JA 1P4SA 4QGGA 2WJVA 4RD2A 5EXPA 1QHNA 5FBQB 4A2QA 4ERNA 2OILA 1OHHD 2FG5A 1TF5A 4LJAA 1A82A 1QVRA 3TUIC 4S2EA 3LBIA 3MRSA 3CWZA 1DADA 1QZXA 3NHAA 4IHQA 3AM1A 3HP1A 4A0FA 1KI8A 3GLGB 1TQDA 2LWIA 1KSGA 1ZBDA 5BYJA 1J7KA 3K0CA 4DXAA 3O8DA 4FMDB 4MYCA 1RKBA 5JI2E 4B3GA 4C0AC 3CX6A 3RLFA 3FWYA 3A4NA 3QNUA 1HURA 2XB4A 1G20E 2V54A 5EP3A 2ZJBA 4BFWA 1SKYB 1SXJB 2CLDX 4IDPA 4Q01A 4QJ4A 5BXQC 4MGIR 2O52A 1U2RA 4KYUA 1G1MA 4LOAA 3T15A 2ZRGA 5JSZA 1ZM2A 1NKSA 4Q1EA 3TAHA 5DH9A 1E0JA 4ZCLA 4B73A 5DYIA 1UJ2A 1UBFA 2H16A 4LBZA 1R5BA 3K0FB 4M1YA 1OW3B 3BFKA 2DFTA 4KODA 1HA3A 1W36D 3MMPA 3K09A 2CMKA 4C7OB 2VP0A 4P33A 2GESA 1OH7A 3DM5A 3EG5A 1Q1ZA 2I3BA 2ZUCA 1E9AA 2DFLA 5G53C 2FPLA 3LBHA 2FDCA 3VHLB 1R6BX 3CF2A 4ZIRB 1YE8A 3CUEF 3P4XA 5TMPA 1UDXA 4WW0A 2GDJA 3PV0A 2WWWA 4JLJA 4AWXA 1NF3A 3AP1A 1XMJA 4Q7LA 2F7SA 4QG7A 4HAWA 1KKLA 4PPGA 4BRWA 1T9HA 4KVAA 1OFUX 3AVVA 4D25A 1WF3A 1ZNYA 4W7SA 1XFAA 3D3QA 3OHMA 4YDSA 2O8FA 3EPJA 2CLSA 2OBLA 1VHLA 1A7JA 1OJLA 2ZE8A 4YLGA 4DCUA 1U90A 2VTKA 1RZ3A 3FVQA 3TR5A 1ZU4A 2ZS7A 3CPEA 1KNQA 2HLDA 1E2FA 1JEEA 2ZU6A 2P2LA 5UKDA 2A3RA 1F2TA 1QHGA 1XMSA 2JLUA 4R7ZA 1HE1C 1CF4A 1P2UA 1FPMA 4MQBA 1UM8A 3LD9A 3EW9A 4XJXA 4LYFA 3KQHA 4P32A 3PEUA 4QGFA 1E2MA 4IDNA 1KYIA 4IW3B 2BIFA 5G40A 521PA 2V1XA 1UKZA 1CU1A 5SZHB 3W90A 2OCAA 4A6XA 3KQKA 2WKPA 2YV5A 1JXOA 2Z5FA 3T1OA 4YQFA 5FI0B 4Q4JB 3O47A 1Z6XA 2JEOA 2H1LA 4M0LA 1CR1A 2QP9X 4GI7A 4BEJA 3L0IB 2GTPA 5TDHA 2O0JA 4M1WA 4TQAA 2J1LA 3A4MA 3M0EA 4BLSA 4BFYA 4EPRA 2B6HA 4XD7A 2VP9A 1SULA 2O8CA 2ATVA 1BYIA 1G5PA 4BFTA 4NKRA 2C5LA 2HT6A 1N6OA 2QTVB 3TW4A 2YVUA 3RRZA 2WM9B 2V6JA 4PHGA 3Q72A 4LK2A 3SN6A 2YC2C 3I61A 2AR7A 3EWAA 5HZHA 4RVCA 2LCFA 4OK6A 1E2NA 2OG2A 4ZCIA 5FOTA 3LH5A 2O0KA 2R2AA 2W0SA 3ETLA 2VHQA 2P6UA 3ZVMA 1R8QA 1YRAA 1A5TA 4XD7D 3SQXA 4NYJR 4D4JA 5DI3A 2ANCA 2XGJA 3RS7A 4CIDA 4A6PA 2FSFA 1G8FA 3GLFE 2CHVA 3SOPA 1VECA 4U5XA 5HE8A 1DBSA 4HB4A 1E4YA 4HSEA 3TBKA 5EE0A 1KI6B 1OFHA 3QPVA 3PUWA 1PUJA 3WNBA 3EC1A 2GK7A 2FFBA 3UWKA 4FINA 3PEWA 2YOHA 2FFAA 3KKOA 2D4HA 4G3XA 2F1IA 1U81A 4Q4HB 2W6IA 1ZJ6A 3CF0A 1ESMA 2C03A 4TLBA 2ZRPA 5A5GA 1OXSC 1RW4A 3GFPA 5JCPA 2WTUA 4D0LB 1OXTA 3B1YA 2AHOA 3I3SR 4LX0A 2AX4A 2IYVA 2MSEB 1Y3AA 2O8EB 1OT3A 2CJWB 4TWZA 2QL6A 4UQOA 1NMXA 2DYKA 3K0CC 1NG1A 1P2VA 5CJPA 4JIMA 3ZVRA 4ZDKA 1M7BA 3CW2A 5FTJA 4LJ6A 3SS8A 5GJBA 1N5LA 4M9ZA 2W6ID 3DDCA 1EFRA 4URUR 1UBEA 1W36C 2ERXA 4P4SA 4L15A 5AR1A 3CH4B 3SEAA 1E0AA 2FU5C 3FHCB 2EWVA 2IWRA 1MR3F 3FE2A 4ZO4A 1WP9A 4PFSA 1T8TA 1S1CA 4D0GA 4ABYA 5CK5A 5JS7A 5LD2C 2GJSA 1II8A 4FI3C 2HJGA 4PAQA 2CCKA 4HATA 3KQLA 1S3SA 3W5IA 2W2VA 3MWKA 1KI7A 4K81B 3WYAA 3QKTA 3LX8A 2F3RA 3TSZA 1OV4A 1NMYA 2XEXA 1DO0A 1KSFX 1EFRD 4UXJA 1KO8A 1JQJC 1VIAA 4GZMA 1UADA 3K09C 3TJZA 1XTKA 3BC1A 4DSNA 2WJHA 2BMFA 1IN8A 3QIAA 2C9YA 1EG7A 2P0EA 3QVUA 4LCBA 4FD2A 2NIPA 1AM4D 2QNRA 4DJTA 1NVUQ 4O2LA 1ZM4A 1N5IA 4WXRA 1KJZA 1MH1A 4QL3A 4CEJB 1FNMA 2GZHA 4A15A 3KZ1E 3AEZA 2RGAA 1EX7A 4WIAA 1FUUA 1MT0A 2VP4A 1KO1A 1Z28A 4F4JA 2H8KA 4O25A 1NP6A 3B1ZA 3MG9A 4U02A 4BFUA 2J0SA 3VKWA 1PLLA 4G0NA 4PANA 1ZC4A 4LGMA 5JJLA 1R5NA 2IYTA 3L43A 2V6IA 2CLCX 3GJ0A 4PSAA 1Z22A 4W5HA 5EP2A 4JL6A 1FQJA 3EIHA 1NLFA 3FFAA 4PZLA 4E03A 2VRWA 4DRZA 2F9MA 2DWOA 1EESA 3BK7A 4TZ6A 5C46F 4GT1A 1AS3A 4OJKA 3VAAA 1JI0A 5K8IA 2ZRMA 3QUSA 2G3YA 2RGCA 3PQCA 4C2TA 4TYNA 5DGXA 5JLJA 1EXMA 2AK3A 2FMXA 2W58A 4RD3A 1NY6A 4D2IA 4Q21A 4X8LA 1ZVQA 2AXNA 4DKXA 4KFUA 2HF8A 2QMOA 1A1VA 1CEEA 2QENA 3TLXA 3FHTA 1DPFA 1XCMA 4EPVA 4PTLA 4EFNA 5TB5A 3ADDA 4UJ3A 1ZW6A 2Q3MA 4F38A 3ZGXA 3LAWA 4C3ZA 3EZFA 4YMUA 4EDHA 4B32A 2VHJA 1G8HA 4POAA 2V8OA 3QG5A 1XXHE 4IXMA 4MYTA 3UMFA 1DG3A 2ZANA 5F98A 5FBRB 1GRRA 3FMPB 4LPKA 1Q20A 3QVVA 1BS1A 4HLQB 2I4IA 3RDPA 3WXMA 3U5ZB 2GEVA 1D2EA 3SQWA 3BS4A 3C41J 4EQ6A 5C1BA 4RZ2A 3BE4A 2EFCB 1P7CA 1RJ9A 3A1VA 2PX3A 4JT4A 3CRRA 5KSOA 5A4JA 2ZXUA 2QT0A 3VFDA 2AD1A 3IQXA 3GLHA 2ZSBA 2J3EA 4ESHA 4NH0A 4UNRA 3GFOA 1W36B 1J8YF 4M9XA 1H8HA 2WWIA 1W4CA 2Q9AA 4PZZA 3PENA 3H1TA 2ZIAA 4V0ME 1E9BA 1M74A 3SFZA 2RGNA 4I1OA 2NQ2C 3WMFA 4BE7B 5JSZB 3DL0A 4QFMA 1N6IA 3ASZA 3EASA 5LD2B 3IO5A 4XTRA 2HCJB 3QPUA 2IF2A 4B44A 5SZIA 2V55B 5KNDA 3R8FA 2A5GA 4R98A 1ZD8A 4LY6A 3BWDD 4BECA 1IXRC 2HCBA 1QRAA 3ZS9A 2RGXA 2ORIA 3EZ7A 4LYJA 3PG5A 2W0MA 1H8HD 1U8YA 3AGPA 3O8CA 1IQPA 3VR3A 1D9XA 5KSPA 2KJQA 1WRBA 1HV8A 2J5XA 3VKGA 1KTVA 2ZVPX 1OE0A 1XP8A 2N42A 4XWKA 1BKDR 1U94A 1II0A 1QHHA 1GITA 2R44A 4ILEA 2B7BA 1Z06A 4EKDA 3PUVA 2DBYA 3QG1A 4NONA 4TL7A 3UMSA 1P2TA 2H7VA 1CJMA 4TT3A 5L3QA 4AY2A 3ONWA 1Q21A 3W5JA 3GJ8A 2G1KA 2XNDA 5KPDA 4KBFA 1NN1A 2AFHE 3W34A 1NJGA 3V4RA 1YU9A 3C15C 3RVBA 3N2EA 4PXAA 2QORA 1SVOA 1CJUC 4PSVA 2YWEA 1I4DD 3KL4A 3EXAA 5B30A 1DVRA 1IN4A 2JCSA 4MUAA 4NZYA 2ERYA 2EYQA 3KFXA 1KZGB 3BERA 3KKPA 2W2XA 5EE5B 3OIWA 3QBTA 4FW9A 1F2TB 1R10A 1UBCA 4TT3D 3I62A 1AS0A 4ITRC 1N2CE 4X8MA 1XPOA 1JQLB 2GCNA 2C78A 2XNDD 2HUPA 3IKJA 1OFTA 3NTUA 4DIEA 1YZGA 1Q3TA 4B3DA 4UXHA 2JLZA 4K46A 3HU3A 4RZUA 1UKEA 4M1TA 3SJAA 1Q0UA 3U2QA 1NKTA 4MRRA 1P9WA 1G3QA 5TVKA 4FXPA 1E2LA 4M2LA 1Z0FA 3DZDA 3CNNA 1K8RA 3WYFA 2RMKA 4M8NE 5CYPA 1KY3A 2BC9A 4ZDIA 3Q5EA 3HPRA 4PAOA 4M1KA 2Q6TA 1TUIA 2O8CB 1S8FA 4Q1FA 4QOSA 1FFHA 2Q9CA 4KCGA 1W4RA 1NVXQ 2W6JA 4LI0A 4OI0A 4WVFA 1VYUA 3TMKA 4D82A 5LB4A 2E87A 3LDAA 5CIQA 2G9NA 4DCTA 2ONKA 1ZUIA 4YMWA 4V0KA 1XEFA 4M9QA 1Z83A 4GZLA 1M7HA 2KB0A 2Z4RA 4AKHA 5DI3B 1KK0A 1DO2A 2DR3A 2XJ9A 3OZXA 1AZSC 1U98A 2W6JD 4ASUA 5IK2A 4H1VA 2QUZA 3OE7A 4AYWA 5J5CA 1IY0A 4M53A 3C4JA 4R9UC 3R9WA 2IYWA 4FMDF 4HYYA 4Q4HA 5AUPB 3IBGA 2EFHB 2GCPA 3WMEA 4DLYA 4YMVA 1GIAA 2A5FA 5KTYA 4PR0A 1G5TA 1XJQA 3TSOA 3ND9A 1G8YA 1TMKA 1ZUNB 3NBXX 2FX3A 3M1IA 1IJFA 1IN5A 1C9KA 5AJVB 5JWOA 3TW8B 1Z6TA 4PO9A 3IGFA 1GP2A 1IXSB 1XTSA 1EX6A 2IS4A 4ASUD 5IK2D 1Z5ZA 3GJ4A 3OE7D 2F3TA 1DS6A 2A78A 4QC2A 3GFTA 4MITA 1ZU5A 5E4FA 2OZEA 3GLIE 4HB0A 4UNSA 2JLRA 2WWXA 3QPWA 3I8SA 3W8NA 3BFXA 4N0DA 1HYQA 3HPQA 4UNNA 2BM0A 3RRYA 3BJIC 1A2BA 2D62A 2ZM5A 5DIFA 2P5TB 5BWMA 4DLRA 2IYYA 1ZNXA 4P4SB 2C77A 2OEPA 1GRNA 3VX3A 3VNUA 2WOOA 1VCNA 5LB2A 4B71A 1O3YA 2QPAA 1GZSA 3CONA 3SJCA 4XVUA 2RGNC 5FPTA 5FUVA 1JAHA 3I5YA 3R9IA 2ZREA 3M6AA 3REGA 2Q21A 1N6LA 2UZ3A 1II8B 4EIWA 4KV9A 2CDNA 4O0MA 2PJRA 1P5ZB 3ZD7A 1M8PA 1X1RA 4M1SA 2PT7A 1S9HA 1KY2A 2REBA 3NBZC 4IRUB 1YRBA 5F2EA 4BFVA 5LPNA 1JJ7A 3U3JA 2EQBA 1XZPA 2PMDA 4E09A 2N1BA 4URWR 3CM0A 3NIBA 1WXQA 4Q18A 2AD5A 2GWHA 2GZAA 3H4MA 4GMXA 4A2PA 4AURA 5H68A 1KHTA 1ANKA 3QSYA 4FWTA 1PLJA 3QQ5A 1KSHA 1JNYA 3VR2A 2NO1A 1FW6A 4NCJA 3F3YA 3QXXA 2DFKB 4B2LA 2OBNA 3RS0A 3JVVA 2ODWA 1KJYA 1P75A 4M1MA 4TYPA 2NMVA 121PA 5FOXA 2ZI3A 4C4PA 4HAZA 2QAGA 3QF4A 3S1AA 2WVJA 1KK2A 1T3HA 5BQ5A 3CZPA 3WRXC 1YJ5A 2EFEB 5FTNA 4A8JA 4A9AA 3NXSA 1JAIA 2PX0A 1LTQA 1XEXA 3QI2A 3TE6A 1Q44A 2NO0A 1Z0IA 2KI5A 2R6AA 4JVNA 5TY0A 1SGWA 5BYKA 5JRJA 5J4LA 2ZTSA 1M2OB 2QTHA 3U6BA 1NIPA 1Z29A 3TRFA 1NRJB 3SZRA 4QNMA 1OSNA 1N3BA 3ASYA 3VU9A 5TXGA 4NCKA 2ZSDA 1KMQA 1UKYA 3P27A 1G5RA 4N3NA 3TSWA 4C0QC 1GKUB 3W6NA 1RFLA 3P4YA 4YONB 1AKEA 2BWJA 1OHHA 1E2PA 5GVSA 4MRVA 2ZRDA 4HZIA 1QBKC 2ZRAA 1MKYA 5BW8A 1KJWA 5CB6A 1ELOA 3CF6R 3LQRA 1GAJA 2MMCA 3I72A 3NHBA 2BCGY 2QBYA 2XTZA 1SKQA 1FOEB 4JYBA 2GK6A 1L4UA 5JECA 3U4QA 2WJIA 2J45A 3SJBA 1B0UA 1S2MA 3IQWA 3A37A 4Z1MD 4MDFA 2R62A 3T1TA 1YHNA 1IHUA 2ZQ5A 2FF7A 5FUXA 2RH5A 3QF7A 4DUGA 1KK3A 5B2ZA 5KNBA 2VYFA 2A9KA 4RD4A 3RS2A 4TYWA 2GXQA 5FBVB 3L8YA 4RFSA 5FOUA 4EQ6B 2WJYA 2WBLC 4RZXA 5DNYB 4PC3A 1F48A 5G3ZA 1SVSA 4H9GA 1RJ9B 1N0VC 1LVGA 3DPUA 4GMDA 4IFBA 3W3AA 2QE7A 1CTQA 2RAPA 2EYUA 2C04A 1E9SA 3ZQ6A 4RJLA 1ONBA 3GLHB 3PVSA 1EK0A 4ARZA 1CULC 2EWWA 4DUGD 2Z6VA 4A0GA 1P2SA 3LLUA 5AWFC 4JLBA 3U6KA 3L0PA 4F7WA 3AVPA 2VP5A 1XWIA 1R0WA 1G64A 2ZJYA 3L8ZA 1NN5A 4MKFA 1BOFA 4DSOA 4F93B 3IBYA 2WSMA 4B35A 3TGPA 2ZI5A 4NP6A 1MO5A 1HTWA 2QP4A 3P32A 2BBTA 2PLRA 4TYQA 3ADCA 4URXR 3ADBA 721PA 2QE7D 2ZRKA 3P20A 1OH8A 5BN4A 1G3RA 2R6FA 4BLRA 2MSDB 4RKFA 1T8UA 3CKLA 4MGKR 2CVHA 1ESNA 4D81A 2C9CA 2FNAA 2IYZA 1QHIA 2GA8A 1NVVQ 2BJVA 2IUSA 2OAQ1 1Z6YA 2YJTD 1DOAA 2PH1A 5E3HA 2VIIA 3KB2A 2ZRCA 4JS0A 4IVQA 1QHHB 2FSHA 4KLNA 3RRMA 3TR0A 3V4FA 1TAGA 1PZNA 4Z8YA 1FMJA 4HDCA 4XWAA 1Z6GA 1AKYA 4JBYA 5L3QB 2VF7A 1JBKA 1XCPA 3MFYA 4KITB 1SVMA 4QHYA 4B3XA 4RD6A 5FFMA 3WP1B 1P72A 4KBGA 2PCLA 4AIIA 4NYMR 3MAAC 2KWIA 3AKDA 4OK3A 4Q5IA 3MD0A 1Q1BA 3LV8A 2ZJ5A 2ZYWX 1D6JA 1E2EA 2JA1A 1Z63A 4EPTA 4LHVA 1D2MA 1VYTA 2P3SA 2UZIR 2GXSA 2YYZA 4NHOA 1T3LA 1EWQA 3UG6A 4G5GA 3A6PC 2CBZA 4URZR 4LV8B 4BASA 2QRZA 1SZPA 2R9VA 3ZYCA 1WBBA 2ZI9A 3A4LA 3B85A 2WMNB 3EZ2A 3SBEA 3MJRA 3WP0A 2ZS8A 2ZRBA 5C2JB 4GSYA 3I8XA 5DYGA 3CRW1 1V5WA 1F3OA 1Z0AA 2FPKA 2IYLD 3J81k 2QMHA 3KXLA 5JJKA 2G77B 2GVZC 3AVWA 2QAGC 4C0BA 1HEIA 2J0VA 3BB4A 1GL6A 1AQUA 4CZ2A 5EXSA 4A8JC 4EJSA 1YR8A 1NMZA
chains in the Genus database with same CATH superfamily
3FKSA 2J3JA 4WGGA 1TX4B 4WT7A 5TLSA 1GZVA 1V4VA 4NE9A 1XJ5A 1NOJA 2VBFA 3W3ZB 5JCOC 2X77A 4OQFA 5HKOA 3GXBA 4CE6A 4YXFA 3DNMA 4Y6OA 5FIUA 4GU5A 4HVTA 3ZHBA 2VA8A 2VDRB 2DECA 2QD3A 1QFSA 1EKXA 3UJDA 4LJ7A 1EGAA 2FH5B 1CIPA 2IHUA 4MMZB 4B5LA 5EE9A 4DOMA 4TYYA 2OGTA 4YV7A 1Y6ZA 2LVBA 2VCEA 3OJOA 3IP5A 3QUQA 3SEQA 3KSBC 5JSUA 2FZ4A 3VJMA 1T3TA 4B74A 4MEJA 4BVAA 1Y4UA 2NZJA 1IJKA 2ZSHA 4LE2A 4Q3DA 1MEJA 2G83A 3ZW7A 1XNGA 1E77A 1G2OA 4Q66C 4YAFA 4KPUB 3MJHA 4UEQA 1E4VA 1JEDA 2XDWA 4HQ0A 5G0VA 1DOHA 2MMGA 1XMVA 4RKQA 3SHQA 5M04A 2C0QA 1RRVA 5J59A 2Y8EA 4G0YA 2YVKA 2I1VB 4X6XA 4FX5A 1G2QA 3B9PA 1F0YA 1RYZA 3CF4G 3L04A 4V2UA 4YAOA 1L9KA 2UYQA 1ZXXA 5JNUA 3QEOA 5TIIA 2IVZA 4ZAGA 3UN1A 4PBTA 4XVRA 4O4LB 2AEMA 1GGHA 1OA1A 4OBBA 5BSGA 1FP1D 3CEPB 5B6JA 1GPKA 2A3NA 2PX8A 3SDZA 2OV2A 3O8RA 2JHGA 1KQGA 2D0OB 4PWYA 3GVXA 2P4UA 3EVTA 3L6OO 3Q0IA 2VZ0A 4DDWA 5JAQA 2YHSA 1C1XA 2ZJ2A 3OKFA 4Q3CA 3A7DA 1ZPDA 2WE7A 2EZTA 5EPEA 4TPKA 2PMBA 4YJKA 3T3MB 3ND5A 4CMGA 4DR3B 5L45A 1E0SA 4WASA 1LPSA 2JZCA 1RQ7A 2QN7A 2ZG6A 1TI7A 2G5PA 1VKOA 2IHKA 2XXJA 3QWHA 2B1JA 1XT6A 4CMHA 5C1OA 2YHAA 1KNXA 1EFKA 3TZLA 4RS3A 3EEFA 3KUDA 1UOQA 3DWFA 3ULKA 1OGYA 5TF4A 4LOJA 2WD8A 4M0FA 1J99A 4KXQA 1POXA 4BRUA 1JKXA 1PDWA 2ZR9A 3NBMA 5DBGA 1CZNA 2AEEA 4BLVA 4BNUA 5KJFA 4DNXA 4GL2A 3IVGA 4LRWA 4J0QA 2K2WA 2HRRA 3ZCVA 4QU0A 4RPHA 4JSTA 2H2GA 2CLEB 5L7YA 2DFDA 4DRXA 1K3UB 3K16A 4V3CA 4BZXA 4MPRA 1RM0A 3FM9A 1VL1A 1T35A 2CHGA 4J0HA 2DE0X 2YNMA 5D1NA 4Q3BA 5I45A 1DQPA 3CLTC 2C2XA 1ZA1A 3WL4A 2H4HA 1T3ZA 2AI1A 2OCIA 4JCOA 4H08A 4YRQA 3LPLA 4NPHA 5KAPA 3WVNA 4DWOA 4EMSA 3RR2A 3ZN2A 1XEWY 3HCFA 2AZTA 3IULA 3NOVA 3ZY5A 3PGXA 3BWMA 3WLKX 1R12A 1Z0KA 4D4KA 3WYNA 3T0GA 1Z6QA 3TZHA 3DEIA 2ZAYA 3GWZA 3EBOA 3MINB 1XJWA 4IZOA 4H7HA 2NUBA 4U7GA 5FL7D 3GLGE 3HDHA 4L57A 3WQSB 1ZWLA 3GP5A 5EKDA 2ZCUA 4LYHA 2HC9A 2DAPA 4P34A 2PRJA 2GF0A 4G26A 4XDZA 2F00A 4BNTA 1XD2A 2GZDA 3L1VA 4IEFB 3VDNB 3HWSA 3SVLA 5ALJA 4YRBA 3GGSA 4JI7B 4J7CA 2ZWMA 2IPLA 3ROKA 2QZ9A 2RHLA 3GR6A 1TC1A 5A4DA 1XMOB 4PX2A 4IJWA 2C5FA 4I46A 3JTMA 4AWBA 1OU0A 4QECA 2QAGB 2PT5A 3GT3A 2QJWA 2NT4A 3QOFA 4EW2A 4EY7A 5BN5A 2PH3A 5DU2A 4NJMA 2PL5A 3OWHA 3ZQUA 3B20A 2ZLBA 2AOUA 5EMKA 1XEXB 2W8BB 4BY9E 2FWNA 3WAKA 3WK5A 2OBMA 4JB0A 4RVSA 5DULA 2OQ2A 5I5EA 4ETMA 3FBGA 2NAPA 5L8VA 3QKUA 2JARA 3OPYB 4BLPA 3KC2A 1NMQA 4Q16A 3TX6A 1U2DA 2VKQA 1YR6A 5FUMA 2IL1A 4LMBA 3WWEA 1LBIA 1L5VA 2AG8A 3K05A 1V1RA 3EZGA 2A0UA 3GLFA 4B17A 5B7QA 1GNVA 2XX3A 1YFLA 2BP7A 3PJRA 2NV2B 3G5UA 1RR6A 1UDAA 3MOGA 3P1JA 4FOPA 1T8YA 1XAJA 1OD6A 4KRXA 3BHMA 3BD8A 2F1RA 3GVIA 1DELA 3PHGA 4YJGB 4YROA 5A1TA 1RZRD 1F7VA 2KX7A 2P2DA 5C5EA 4DC9A 4Z86A 1WLSA 3DYBA 4H77A 2AR0A 1I0IA 1KKMA 1PNTA 4R1PA 2OGSA 2Q4EA 3E23A 3U16A 4W5OA 2L82A 1CBUA 3F9CA 1WU7A 4TOIA 2C92A 1AVTA 2EKDA 3LI2A 4UBNA 3I32A 3K5PA 5CG2A 5KYKA 3KJIA 4A03A 1VLVA 4OMFG 4WXHA 5COQA 3VSBA 3ESDA 2NUPB 2IZZA 4BGDA 1XPUA 4KKXB 5DBEX 4RPJA 3OZTA 2FF5A 1FLDA 1U1DA 1KAHA 1VDMA 4RZIA 3OZBA 4MHSA 3VPDA 2VAMA 2TMGA 2JG3A 4D3YA 5B57C 4Y2XA 3IQEA 3IVAA 1UDCA 3CF4A 1ND6A 4C2UA 2DPXA 5E4TA 1FXSA 3WDKA 4G41A 4BBPA 5LP1A 4EO9A 1KMCA 3I53A 4BVLA 5IDYA 1WPRA 3UJ7A 3AF4A 1NDHA 2J9XB 1E1LA 1Y7PA 4HAYA 4P8RA 1RAIA 5J2TF 5ABPA 3IEVA 1MH9A 4BMPB 1N8SA 1PW5A 3CW8X 4W8OA 4UE6A 4M21A 3T34A 1PHRA 4YDRA 3DZCA 4NECA 5HCNA 3EX7C 1NWHA 2RK4A 3LW8A 1TCCA 3A1TA 3HKBB 3MT7A 3PPVA 4KW7A 3T9AA 1H6AA 5JISA 3CLRD 4GEKA 2AZDA 4BLTA 1GHTA 2C8JA 3C3WA 3PC8A 1W0JA 1G3IA 3WI7A 4BO0A 3HY4A 3PFHA 4WOBA 3BE8A 2JLWA 5KJEA 3TK1A 5FNVF 1NAIA 2WK1A 3H18A 4JJAA 4OLJA 1NM5A 4DPKA 1PV1A 1BOOA 3BULA 4XVHA 5TEWA 9ABPA 1T0PA 4B33A 4V1CB 5IKEA 2WPNA 2ZBVA 3G0BA 4JGBA 1I3LA 1TM2A 5IPFA 3GRKA 4MW9A 16PKA 1ORIA 1Y6RA 4L22A 1BHSA 3BTUA 4DBZA 4I4TF 1B0AA 5ERGB 5CDHA 3MBOA 4FK8A 5L4NA 3KOWA 3U4CA 5E7IA 4WOJA 1S8OA 3DE2X 3LKDA 2JS7A 3NAQA 4FLFA 4PQEA 3RS8A 4CFZA 5LFAA 1ZM7A 2JLYA 3HXTA 1LA2A 2DXIA 1L8AA 4OV6B 3SZLA 1TVEA 1RM3A 4QPPA 1QANA 1W7AA 4QYWA 1DFHA 5E6SA 1I6MA 4C20A 2HSDA 1AT1A 1KS2A 1PFUA 2C99A 1D5CA 1DCKA 4LWPA 1B6RA 1ZCZA 1KEEB 5TJHA 2DFNA 4PIMA 4OMCA 4KIUA 4RTSA 2HK8A 3GN1A 3V4SA 5CBPB 3DFIA 1Z2DA 1P81A 3AEXA 2Z1NA 1DEOA 2ZYRA 3HZHA 3CCCA 4Q93A 1QRDA 4CIWA 5AJHA 2Y1WA 3A1WA 4ZV7A 3UB2A 3U48A 1R4AA 1P19A 1WDTA 2GD1O 1WZIA 3DE6X 4IOJA 1J0XO 1NULA 4LOIA 5EE1A 3V8RA 1TW2A 1IOZA 1GAXA 4GC5A 1G8PA 5HGXA 2QVLA 3G13A 3OCWA 2PSDA 1DQRA 5EGSA 2YNMC 4TVSA 1IXZA 1P4GA 2PYDA 2TMKA 3HYRA 1J23A 4HWTA 5CU7A 3JR3A 2ZE5A 1FFXB 4YQZA 1MPXA 3D5EA 3LECA 3H5AA 3UGQA 3L1KA 2QLTA 2E82A 1QO7A 2BGRA 2HGZA 4OKIA 2GEKA 4B6RA 4BRSA 4EVSA 1V45E 4MKHA 3RTBA 5FWNA 1A98A 1HDXA 1TU4A 2VJYA 4IDGA 1Q14A 4RBNA 2EKLA 2REXB 4AW9A 3DL2A 3BIOA 3O1JC 5E9JA 3O2QB 1M2VB 4X6LA 1R0SA 1FW8A 3ZZNA 1QYXA 4NBNA 4IMJB 4CKEA 2CF5A 1VXRA 1G38A 3GUCA 3DAPA 5SYAA 2A1UA 4E51A 1ML3A 2BGNA 3Q10A 6Q21A 3KQNA 1BMDA 1ZUD1 2I65A 1G60A 4PNPA 3HN2A 3I5MA 2VJCA 3IAS1 3K0BA 4CI9A 2ZZNA 3V1TC 4EMTA 1IN6A 4EJFA 4A10A 4X6YA 1Z2PX 4Y6PA 4KU4A 3OOEA 3R8CA 4BNIA 2JCGA 2QL7A 2P5SA 1PSWA 4EJSB 2CLKB 2IHTA 2PGLA 3AI2A 4F9EA 1CUEA 1MTOA 2VYVA 4QNRA 3A2KA 1XXHA 3KPYA 4MAAA 1MX1A 2B5WA 4CLOA 1QFXA 3GCWA 1ORTA 2R7MA 2D2IA 4NDZA 4C1NA 5K4GA 4DLBA 1OWLA 4WDRA 1ECJA 3QMMA 3MT8A 4ZKEA 2ZRHA 2F4VB 4GKVA 1L4YA 1U2DC 1MENA 1XZAA 3LFHA 3GJTA 2Q49A 2EFDB 4G81A 4NPAA 2QU8A 4WJZA 4D9HA 2HV8A 4Z4IA 1Y0BA 1RBZA 2A84A 3RUCA 4AN1A 1Y3DE 2XXBA 2OHOA 2ZR8A 1RM4A 4O4JB 3O9ZA 5F7OA 3OY2A 4IFTA 3WKDA 4N48A 1KMHA 2DTXA 4MKIA 4GOJA 4IOMA 1ZD2P 1VSQA 2P35A 4Y2VA 2OVFA 1G20B 3U62A 1I2MA 2J59A 3TKLA 1R7RA 1MJ5A 4FEAA 1AV7A 1D0IA 3FPLA 1TZCA 5JS8A 1EQ2A 4UTPA 5HRUA 3LUDA 3BG5A 1XRLA 1UXJA 2R85A 5CB8A 4BC1A 2G7ZA 2E4ZA 4I0WB 4J3JA 5LYYA 1Z3IX 3ZD6A 1U2QA 2ZTVA 3W2GA 4NYIQ 5ULLA 4BS9A 1ZUHA 2BJHA 2C2ZA 1P9NA 3A25A 1HH4A 4G9BA 3WKAA 5H4GA 5HFAA 3OP1A 2R8PA 2PO7A 3OAAD 3UXEA 4AMVA 1J49A 1Q57A 2J09A 5KQLA 3NM6B 2R1ZA 2HK6A 2G04A 4FFDA 1V43A 2ZJAA 3OCYA 4OQMA 2W9XA 3RV4A 4MPDA 1GNTA 4U7HA 5JNVA 2DHRA 2DPMA 4P7KA 2BFEB 3B6EA 1EWTA 4R83A 4DDHA 3BMNA 4CLRB 1S7GA 4D3ZA 2AQIA 2X2OA 1C0IA 3QFFA 4LNUA 2QSYA 2CDAA 3T5TA 3SSMA 2XVAA 5CT9A 2JH9A 3HGQA 3KBOA 5BSFA 2GZ3A 2Z3WA 1U2SA 1VBNA 5DX8A 5G1OA 1MIHA 4UVGA 5CAEA 4Z54A 2DPYA 3S55A 3ZK9A 3UWSA 2GNAA 4YPVA 4QM6A 4BHTA 1HOXA 1XZNA 4V0NA 4ZOLA 5DISB 5B3AA 3VU3A 5K0FA 4LF7B 4IBOA 1NXWA 2RGGA 2AOTA 3OEED 3PXGA 2X6QA 3PC8C 1RWPA 2WG0A 5JI3E 5CPFA 3WQRA 3MNFA 1WW3A 2P0AA 1NW3A 1RPNA 1U0NA 2JIMA 2ODBA 2ZBFA 1JJVA 1J33A 1NM5C 2IU3A 1UJNA 2P69A 4FGZA 4KXXA 3ZCTA 1W8IA 1SCUA 3N0TA 1BXGA 1NNEA 4S3MA 4LZNA 1WETA 4DLPA 4BVBA 2ENUA 3LWNA 5F9FA 1S0UA 1QDLB 3OZAA 4KTTE 4X9XA 1BMFA 1QYIA 1IHYA 4R0VA 3NC1C 4TWIA 5DMHA 5TMBA 3WDMA 4MQ5A 2GZ2A 4YMSA 2NNLD 2IY7A 3WHLA 2C57A 5EQFA 1O95C 1RWNA 1OWMA 1E0KA 5KDDA 2JRLA 3W8DA 5DNYB 3WWDA 1N36B 1ZGJA 2A1TS 1SMKA 3F6RA 3L6CA 3L7LA 3Q7IA 3M8KA 4DLZA 4K0RA 3KZCA 3U1VA 3NTOA 2I7VA 1F5NA 1W5SA 2B6NA 3PFIA 3VR5A 5GOTA 4G07A 1EP3B 2QQ0A 3VNRA 1W4ZA 2JFYA 3IEXA 4CTOA 4ZICA 3E2MA 5AW0A 2GFIA 3IPAA 1AO3A 2ACWA 2FOLA 2XF2A 2AJ8A 2QSJA 4B3BA 1VA4A 1PNQA 2YQ5A 4NU8X 5JD6A 4MP3A 2VTBA 4MDHA 3IAAA 4IH9A 5FWXA 2RB4A 4YAKA 3T5GA 4Y0AA 4AB1A 1N7HA 5DASA 3AF3A 2QZ4A 4BFLA 2ONZA 4P53A 4QOGA 5B3KA 2W2LD 3EJ6A 2PWAA 3PSAA 3AJAA 1LWNA 1Y1QA 4KN5A 3U40A 2WF9A 3Q9LA 3ZCUA 3IEUA 3QFTA 3I9V1 3B8EA 2EZ4A 3EDOA 1X6VA 3M6WA 4C7XA 1EXDA 3AESB 4F3TA 3HBLA 1FLVA 4AY4A 3ZDBA 3GRAA 3LRTA 4AULA 4B76A 5GPBA 2R4TA 5C1DA 1PS0A 1AQYA 3GUZA 4RTMA 1GOTA 1JP7A 2Q0SA 3FI0A 1PRYA 1ODSA 2W8ZA 1N2XA 1DAOA 1QV7A 2A14A 5L3SB 1CXZA 4PZUA 3V9PA 1QHYA 3FUTA 1LBHA 5DW0A 5KDLA 3E61A 4BUJA 3OIUA 4BNXA 5BN3A 4F56A 1TT5B 1UDBA 4M86A 1W0KA 3LYHA 2BHRA 3CZRA 3QXSA 4Z1MA 3RVQA 4YQEA 3H4TA 3ILYA 3FYCA 3EEBA 4U3JA 4AK9A 3I23A 5C4MA 1EJ0A 1NX6A 2D54A 9GPBA 3LDGA 1D2CA 2XT9A 4AQDA 3LKZA 1NURA 2AYXA 3HC7A 4Z7QB 1UP7A 1E58A 3X1YA 1QWSA 1CKEA 1F6WA 4CM8A 4PC2A 1TVMA 1Z4PX 4GZ3A 1QAMA 4WXPA 1PVVA 4PC7A 1PJLA 5H5JA 1ZY2A 1JKIA 1S8NA 1J8VA 1K7YA 3DOUA 1QCDA 3KXKA 4KWTA 5EKUA 1DHRA 1I4LD 1TL7C 4FFWA 4HN4B 2WJZB 4ZVUA 3TH5A 4DG8A 3AUUA 5ALUA 4O4HA 3AXSA 4RK0A 3CJRA 3AETA 3E0QA 4I5GA 1ZIOA 1VJGA 2RKWA 4D0NA 5JCXA 1TKAA 1O0SA 4XOUA 3R5TA 4F4CA 3DOFA 5AP9A 1J39A 2DQZA 2I6TA 1Y4DE 2J0UA 4YCSA 3HXQA 1SXQA 2GAOA 2L0XA 4I19A 3UY4A 3GNQA 3VR5H 1YC2A 2NVUA 1MB0A 2R79A 3S2FA 3ZX5A 1BX3A 2WYWA 4INZA 1BXKA 3T06B 4EAAA 4FNOA 1VMEA 3TB4A 3BH7A 4MVJP 3ESAA 4WLNA 1JFVA 1U31A 1U9IA 2ISSD 1YZQA 3KT3A 3TL6A 1MUUA 1O5OA 1YBFA 1Z0SA 2PX6A 3UMRA 5IHPA 3SZOA 4KFRA 4JYPA 4BP3A 3SXUA 5CT5A 2PGXA 1DC4A 3H11A 3BH6A 3AVXA 2QRHA 1N6NA 3B1FA 4IF4A 3EIFA 1K86A 1C0LA 1RI2A 5DLQC 5K0GA 5CFQA 2PA0A 5EJFA 4Z3OA 4GXQA 1HGXA 2XE7A 5CFOA 2O1SA 2BI7A 3WNCA 4ZVNA 1YZHA 1RXVA 3D3JA 3QFCA 2PUGA 3OJFA 4ETNA 2OCLA 5GZ6A 1LY1A 2VC2B 6REQA 4OG2A 3HA2A 4IIJA 1NF2A 4HVAA 5TSDA 1NPYA 2PIDA 5FLYA 3VQTA 3Q8WA 5KTOA 4CG2A 2FWMX 3FFBA 1P6XA 3TNJA 4B83A 3DOEA 4O5AA 3FWNA 4HG2A 2GZMA 2QVYX 1KS9A 5C4IA 4L07A 4RQUA 5B4VA 3AFIA 1QB7A 4XGIA 4HUTA 4LRTB 1TUEA 1RACA 2HJ9A 2OA0A 2QUAA 4QFDA 1FP4B 3MLBA 1V5IA 3VOBA 3LRXA 3P19A 5IYZB 3G9TA 2J33A 1KBOA 3ODGA 4JA0A 3ZTTA 1VP9A 4EUNA 2O5RA 2ZSFA 4UU8A 1G16A 3M9WA 3KLNA 5ANRB 4F4HA 4KPFC 1CY8A 3VX4A 1Z0ZA 1QQ6A 1DIAA 1J21A 2H8GA 3C3EA 1F0NA 3MWLA 5K3CA 2H57A 4C21A 5KBYA 3W5BA 1UOPA 4ND1A 4XQ0A 3G02A 4ESEA 1Q7CA 3OEHA 1JR6A 2MSCB 1MOQA 1Z13A 3G2KA 2FZVA 1K8XB 1QJ4A 2BZSA 1A8UA 3TIXB 1D8TA 4B3TB 2IYXA 1Z4KA 5MFZA 1AK9A 1U8TA 1IONA 3DVLA 4ZGBA 4GRIA 4J75A 4D8XA 4ECAA 1N6KA 3RAPR 3HYNA 1JTEA 3QRWA 3QK7A 5LQCA 3U5TA 2VEOA 5LMNB 3SQLA 4BO1A 2AF3C 4U6NA 5KTNA 5L4LA 2BSQA 4HMPA 3MS7A 3NUGA 5CD9A 5CT6A 3SBDA 3L06A 1J7JA 3ZS8A 3A1SA 1TU3A 3EIUA 3LLMA 1UMDB 5D2CA 2Y0DA 1E64A 2YUTA 3LLSA 4DQKA 3TQCA 1G9XA 4M76B 4UCXA 4F6LA 3T7DA 1L4NA 2ERCA 3PL1A 4I3FA 1NTOA 1KQOA 3MLAA 5HX7A 1A8QA 4RD0A 3TQIA 3WWOA 4XUEA 4M36A 3K6SB 3N5CA 3JWHA 3LL7A 4QDOA 2C7VA 5KPJA 2UXBB 3G9QA 3G0IA 3JVUA 3KKKA 1LK7A 2XNSA 3JYLA 1HRDA 3H9GA 2A5YB 1BDHA 2GILA 5K03A 3GGPA 3FZEA 4YWHA 1NBAA 4CMIA 3LU1A 4BC0A 2OO7A 4YMIA 5J4YA 3F3KA 3HHEA 4L02A 4M6WA 1E3MA 5ALTA 4AQYB 2B3DA 1M1YA 2IS1A 3UWDA 2CVFA 3G1WA 4B7CA 3MMXA 1N78A 4BQRA 1YS6A 4M8KA 4RMHA 2IV3A 2I1LA 4G5QA 2WNHA 3MT9A 5LYJA 4E4TA 5LOVA 1ECCA 1RRPA 5SY6A 3M5CA 1NVBA 3DMFA 2OGUA 3I1YA 3AHDA 4X93A 1NJ8A 4CN9A 1E1KA 1TTTA 2W6CX 3FYTA 4IX1A 3GFQA 4RNCA 4RZ3A 1VLLA 3MGAA 2E0IA 4YJ2A 1DEKA 3QMPA 3KJGA 5AJZA 3ZY6A 3PUYA 4ZT5A 3CN7A 1ZONA 3H9CA 4IICA 4BRZA 4TXMA 5CA0F 3AC0A 3W4KA 4OPMA 2RIPA 4X8HA 1T2NA 3BREA 1E66A 1XI2A 3RANA 5B2EA 1RRKA 3GROA 2VT2A 1GA1A 3M6UA 4F96A 5KSZA 5LLDA 4KO2S 5A06A 1Q7EA 1UT8A 4HQOA 4NE2A 3ZCXA 4ZGGA 1PSDA 5BUZA 2FGKA 1H6CA 4QOFA 3OQPA 5DNUA 1XN1A 1OI3A 1CVLA 2WB2A 4POOA 4B6JA 4O2RA 1AX9A 2Q1XA 2TMYA 4KXVA 1U80A 4CV3A 2QD2A 3CRVA 1JSXA 2ZIVB 3F71A 3V4ZA 5JPCA 3FRJA 2PMFA 3NV7A 1Q0QA 4WK0B 5JG7A 2BMDA 3PJEA 1JW9B 3AR9A 1L7BA 4AJIA 5FBHA 4Y6GB 1MORA 2BFBB 2FI1A 1U9IC 2JK1A 1PGQA 2XVZA 3LRPA 3R8XA 2OR3A 1DAGA 1P5RA 4QHSA 2DT5A 1GKIA 3VV3A 3RRBA 3OX1A 1YCDA 2IQIA 2RHJA 3GMTA 2YTZA 4CWAA 5KSYA 3HUUA 5DKFA 1FMFA 2WM3A 4B81A 2WSSD 3F7MA 4L4SA 1GAQA 1Z26A 2BEJA 3DVAA 3ZLVA 4MDEA 3A1UA 2HXGA 4GOND 3RYHA 3VPHA 4WN9B 3WGTA 4FFPA 4LIPD 3RVRA 4N7BA 4TS9A 4TRRA 1DTEA 2GPAA 4N8EA 2PE5A 1GDDA 1R4NA 3GH3A 1LQUA 3I4LA 3ZTYA 1J2YA 1BEZA 2VP2A 4Z9AA 2WT9A 4ZV9A 4G01B 3WLQA 4KREA 1FNNA 3VZPA 3NVDA 1Y8QA 1KYQA 3ZHSA 1GL3A 4MHTA 2XH8A 3AYZB 2PPVA 3QE2A 4LSMA 4ZCTA 3HCBA 1GSOA 2VBGA 5LL6P 3AKCA 5K3BA 3EZ6A 1BW9B 5J4VA 3UFBA 2C42A 3Q3HA 3MBIA 2IYUA 3UT5B 1X94A 2BONA 2WJWA 1ISHA 4BOYA 5FBZA 4AG5A 5J4KA 3VR4A 1CX9B 4G0WA 2D7CA 2OB2A 4F46A 3PT5A 2X13A 2AN5A 5J4HA 1T2UA 4HDRB 2I67A 1BNCA 2UV8A 3AJ9A 2XI4A 4YCCA 2PMWB 3L7DA 2YL2A 3GFFA 4MR9A 1C1YA 1COWD 2MSKA 3EVDA 4L27A 4PHHA 4ERXA 1E1QD 2IHNA 5HFNA 1JMYA 1V6CA 1SVUA 3TNFA 4CTKA 3UB3A 1JB9A 2XB6A 2R1TB 4HUQB 2OM6A 4LVCA 1L5GB 3BKXA 2OFXA 5H83A 2BKAA 2NSYA 2JJ2A 5JAMA 4OFBA 4IEEA 1GVNB 4IUCS 4JLSA 4Q9LA 4RORA 2NSDA 1I8TA 1HKHA 3H2BA 5JWHA 3QXHA 2B5VA 2PMKA 4MWGA 4AKEA 3SHOA 4YYZA 4YV1A 2HY7A 2O8DA 1PX2A 4F7DA 5LCXA 3SDBA 4BPBA 4QEDA 1W5AA 2X1LA 3H2SA 1SUIA 3KFVA 2OP1A 1Z5UA 3EQZA 3FNGA 4EUSA 5C7LO 4UEJA 4R71A 3UPUA 3D7NA 4LZPA 1DNPA 2FW9A 1G66A 1U8ZA 3KM0A 1MA0A 1BWRA 4MGZR 4P0TA 3SX0A 5F2NA 2Y1DA 1BJTA 1MB9A 4V0SA 2C5HA 3C5VA 1F8XA 3GD7A 2GKOA 1CS4C 1JMKC 4HDAA 4QX6A 2QRMA 2WUGA 3I6IA 3IYLW 1GFIA 3F4LA 3NBYC 4M60A 2BM8A 4NBWA 4KX3A 2I9PA 4RD1A 4LGYA 2F1JA 3D4IA 4L9WA 5FUBA 3C74A 3UHAA 4EM6A 3K5WA 3SNKA 2FPUA 2H1VA 4EHFA 2BUBA 2MCFA 3FGOA 4MKZA 1FIUA 4KNVA 3EVGA 1KL7A 1KDOA 4Q9HA 5DSZA 3QVJA 1LBSA 1V25A 4GI5A 3A58B 4CKCA 3PIRA 4EG6A 3ZXUB 2QYTA 1VCHA 4EITA 3QJ5A 3WLAA 1FRNA 1UBTS 1C4KA 2M6SA 2O6LA 1IPEA 1R5OA 2I1QA 1JPNA 3DT6A 4IDCA 1G4UR 1QV9A 2WHPA 4BB5A 4HGNA 1SWWA 1O0BA 3VKUA 2MYPA 3RCBA 3R7WA 1N6HA 4QOEA 2QGNA 4KO1S 4PAMA 1MV5A 3MMNA 4M89A 3ZUGA 4EHHA 3D6VA 1TCBA 2VTDA 2WLSA 1B2RA 5FFNA 3I76A 1XTZA 4OQNA 4C30A 4JEHA 4MA0A 5ENZA 1T2VA 2CJFA 2YV3A 3IEIA 3CR7A 3N8IA 2L69A 2VSQA 3HFGA 4DUYB 3CXUA 4LTDA 1H9AA 1PJ2A 4HGZA 4W8HA 2F3UA 4TVBA 2RDMA 3ESBA 4QG3A 4FT4A 1B3RA 1MABA 5AKZA 2F43A 2ZVDA 4FC7A 2Q0QA 2GLTA 5LXTA 1S2IA 3GQBA 4TMVA 1YAHA 5EJ6A 1JHXA 4QUKA 1W5TA 5K0BA 1UMBB 1DV1A 2YW2A 3QBEA 1QC5B 2AXPA 2QN8A 2FRDC 5ER6A 1ONOA 2XLBA 3FDZA 1KDPA 3FKQA 2BEKA 2P27A 3OZ7A 4JLUA 1L1EA 4Q00A 6PFKA 3DMDA 3GJ7A 4XSHA 3EIEA 1WUHS 1OXVA 4QGSA 3D3WB 4Y1RB 4JHXA 1Q92A 3KJHA 3R7SA 2P6RA 3DQQA 4NCNA 3U4HA 4KNYA 3QVSA 1Y1PA 4U9UA 4D46A 1LV8A 2V7GA 1W9HA 1XK7A 3PGJA 1OC2A 4WZ6A 2VF4X 3TQHA 3ICVA 3VH4A 1F3LA 2O3JA 4JBLA 4JQOA 3BH0A 2ZT6A 1I3OA 1JPVA 3D8UA 4PGFA 4QUDA 5IKMA 4QXQA 1UWVA 2P0YA 2P9GA 5JXJA 2ZEJA 4M99A 1MZPA 1P4HA 1L4EA 1DAFA 1N0UA 3E7XA 4YCNA 4JQCA 3WIOA 2A2ZA 4D8TA 1TIBA 1SHKA 1N32B 1LW6E 2QE6A 1GA4A 3GFRA 4B0OA 1DAEA 4IYRA 5G4KA 4R1SA 3ADKA 1VKRA 2C5SA 4LA4A 1SXJA 1Z17A 3VYSB 1RIIA 1PZMA 3FUCA 1RI1A 4TS4A 4CT0A 3OQMA 1DRWA 1O6FA 2C7GA 2D74A 3CA8A 4FDMA 3U7QB 4DIOA 2I2XB 3D6JA 5F3RA 3VDQA 1TEHA 1THGA 4X41A 2OPBA 1QU3A 1SB8A 2YMMA 1J0AA 3RFUA 1Z33A 5EWMA 1SFRA 3E9RA 4MXDA 1EUDA 4QDXA 3T7IA 3IKMB 3OCJA 2XTNA 3F8SA 2Q9BA 3K0FA 4RH3A 3IT1A 1O94A 2X0NA 3ZCSA 5B7GA 1JEQA 1I9GA 1N5OX 1ZN8A 2OORA 4L8LA 4RA6A 4RHUA 3FR8A 3SLGA 4HKTA 5KYXA 3UUGA 1JALA 1PQWA 4MUMA 1N9ZA 1OX5A 4RACA 4BGVA 1SG9A 4I7EA 1U3GA 3IKLA 4QJ5A 1JDUA 1OLSB 3VJKA 5DZSA 4P3OA 1Z73A 4Q1CA 1PFWA 4K3VA 2KE5A 4AZ3B 1D2HA 1E9VA 4UW9A 1TTHA 4OGLA 3WIVA 3Q7PA 3C7DB 3HA5A 2A1TR 4PYKA 4L28A 4EBFA 4GKJB 3G2JA 3PQFA 5JHHB 4BNYA 2PNFA 3O2SB 1XX6A 1OJ7A 4OQXA 3HCOA 1ARZA 3IAM1 1CE8A 2HMWA 4COOA 3GARA 3MC1A 1SU6A 4B8ZA 2OFPA 4K9PA 4Z9XA 3C8ZA 3WL3A 4XYMA 2XAAA 3MTJA 3NM5A 3SX2A 2IXGA 4A7PA 1IZ8A 3CWCA 3NALA 1T4BA 2OAP1 5CDFA 1EMDA 1W2HA 1ZMXA 5JNSA 3ZNNA 3O8OB 1MD9A 5T3UA 1E2QA 4LUCA 4LSWA 4Z9YA 3ZGZA 3CBQA 3O8NA 1RIFA 3C1OA 1GPDG 2ZM6B 3HXMA 4ILKA 2PSFA 4Q02A 1HK7A 2DRIA 2VAXA 3D6FA 1XU9A 3DMNA 4K28A 4M3NA 4MH0R 3VGJA 2XXAB 1P74A 2BHNA 3MTQA 4KSYA 1CP2A 2CFRA 2IEYA 1RQ2A 1RE0A 2X7HA 2Z2JA 2Z8YM 3AZOA 3GF4A 2XQJA 2B2XA 3NB0A 3VGPA 5AW4A 2RH8A 4CLHA 1CUIA 2QV7A 3BD9A 1R27A 1R74A 1T26A 3AB7A 4O4IF 4UU1A 4Z3DA 2XHEA 3U17A 3CH7A 1XB2A 1SM4A 5DMXA 3WV4A 2RHOA 4IDHA 2IU6A 1KMIY 1F60A 1M8GA 1PEYA 4UAGA 4X3PA 1Q84A 1VDZA 3I4CA 5DHAA 1YB5A 4GI3A 3I6MA 1M73E 1KHHA 1OX4A 1VL6A 2VAVA 4RK7A 3DTYA 2WG1A 5JVDF 3FDIA 4INOA 3V1KA 1EUQA 1ZGGA 4R9RA 2O1EA 1M1XB 4NBLA 5L6LB 3HDYA 3TCNA 3AOEA 2O7QA 4HDKB 4LV6A 1CLUA 2JCYA 2BMEA 2V96A 1ZD9A 4O2BA 4II7A 2CSXA 2CHUA 3GFVA 3HA7A 5MN6A 1TM4E 3BOSA 3U26A 1C0KA 2FWIA 3C3AA 4GQIA 3QXCA 5FCDA 2JI4A 3O2JA 4UMFA 4WV3A 3ZGLA 1NP3A 4QUAA 3RK0A 1JG2A 3HZOA 5U9CA 3GNSA 5AHXA 5D5QA 3A9VA 4EARA 2SKDA 2ZDQA 2ZU0C 1PX0A 2PZGA 3LSYA 3BF7A 1USGA 1B16A 5DN6A 3TQQA 4C4OA 1SVWA 5LQKA 1JXAA 4ZJPA 3C4VA 3LQKA 3M6XA 4FLMA 3CZQA 5FF9A 2W90A 4JB2A 3GWGA 2K6GA 5J2UF 3MJ4A 3FB1A 3CVWA 4RJIA 3ZHCA 5IAOA 1EWRA 3ZHVA 2ZZMA 3TGLA 1TDJA 1BMQA 4LV5B 5DI9A 2W6PA 1SBYA 3EW7A 2XA9A 4TTTS 1KI6A 5G1NA 4FMPA 2SICE 3HJCA 3LPAA 3RUDA 3T12A 5KTRA 1H3FA 3SGLA 2IEBA 1DDGA 3N8KA 2PUDA 3A14A 1Z8HA 3KB8A 3LP5A 5BWOA 1UIRA 4N5LA 2KLHA 1JG7A 1A7KA 4PC1A 4ZANA 1GG2A 2B2CA 2J7KA 1Y3HA 4OXYA 4AJNA 3CG0A 4RWEA 2O8FA 2AEJA 4AL4A 4CQMA 1WHSA 4RGVA 4DSTA 1KH3A 1U3VA 2QA5A 4JOBA 5GV8A 5EHNA 3TSYA 1DHTA 3ZBTA 4OAOA 5H70A 3W7VA 1W4LA 2AJDA 4EJ6A 4ALJA 4F4DA 3R3XA 4I5IA 1TXGA 2IXTA 2CJWA 2H52A 4C0LA 1OR8A 5JZVA 2JATA 3TTYA 2B35A 3ELWA 2D2FA 4AICA 4FUQA 3ZDCA 1JR3D 1N6RA 1PLKA 3NGXA 4RVNA 3LWDA 3NTVA 4UTOA 3OFJA 3ICOA 1X9HA 3VYUB 3ZVLA 2C7RA 4MLDA 1OKKD 3IP3A 4U63A 2BFDA 3WHKA 5M7EA 3N2NA 1L5ZA 1WE2A 3H0KA 3O1IC 5I9NA 1IZZA 2K5UA 1XE3A 1WKCA 2WKSA 5DWDA 4ZYYA 3PEYA 1WDWB 2CL7X 3S70A 2P65A 1SXJC 1T5HX 3RWBA 4OM8A 1H93A 1QIKA 2HADA 5EFOA 3HTXA 4B4WA 4ZT2A 4LZLA 1QOZA 5BY2A 1ULZA 1KRWA 3NWEA 4DYHA 1ST3A 4YFVA 3P9XA 3QTLA 1UOEA 1B93A 5GGYA 3V7NA 2F1KA 4I99A 1KC1A 2C2BA 2YHIB 3Q9NA 5FX2A 1LDNA 2TYSB 1EGHA 2WW8A 4NS1A 1IYZA 1O94C 3C5HA 2Q7XA 4ZEMA 2R751 4RVHA 2OORC 2OV3A 3LF1A 4WNYA 4TUYA 3COSA 3T5MA 3ZUPA 4LDJA 2XZTA 4DL9A 2WMOB 3EXIB 4HL6A 1T9DA 4XDHA 5HYVA 2X0KA 3PXDA 4F9FA 5EERA 2GJKA 4II3A 2JGRA 3F97A 4D4IA 1PVOA 2C98A 3OPQA 4R54A 1PBNA 4W6QA 4M55A 4JP8A 3G7UA 2B8WA 3GJQA 3RC2A 4B3CA 3FMOB 2CNBA 2WAAA 4J0GA 3SI7A 1CR4A 1EAMA 2BISA 1XMQB 3W4JA 5EZYA 1M7GA 1I33A 3OQNA 4JI2B 1C9JA 2Q3FA 5NLLA 3A6FA 1A2KC 4B43A 1K0FA 2IZ6A 5E3JA 3G2LA 4MARA 3OC6A 1G17A 2I7DA 1F8FA 2PKEA 2UVQA 4YAJA 2B34A 3N7AA 3K72B 3VXKA 2LBPA 2JF0A 2CDBA 2O8FB 3ZDXB 5AKEA 2CFOA 2H92A 2HDNB 3I09A 3KE9A 1HMPA 3VR6A 1EXNA 2X4DA 5BR4A 5HKKA 3EJWA 4TVKA 2Q3DA 5TQJA 4DYVA 3CNOA 2YVLA 3Q5DA 1G18A 3FTDA 4LEIA 3P9YA 3AFGA 2D6FA 2Y4OA 3ZDZB 4KQHA 3NOQA 2IBMA 1Z39A 1WVGA 5JRDS 1LRLA 3KQOA 2Z5GA 5C8VA 4D44A 4ER7A 2CYBA 3F5SA 3M7IA 1QIDA 1VA5A 2FSUA 4TMWA 4O