5CB8A

Crystal structure of adenosine-5'-phosphosulfate kinase in complex with aps and sulfate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
174
structure length
174
Chain Sequence
QRGVTIWLTGLSGAGKTTITHALEKKLRDSGYRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRIGFVSHLLTRNGVIVLVSAISPYAAIRQEVKHTIGDFLEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRTDLEELDESVGKIWQKLVDLKYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable adenylyl-sulfate kinase
publication title Recapitulating the Structural Evolution of Redox Regulation in Adenosine 5'-Phosphosulfate Kinase from Cyanobacteria to Plants.
pubmed doi rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
total genus 72
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cb8A00
5J40A 5FOXA 3ONWA 4CRWB 1DAKA 2VF7A 2RGGA 1NF3A 3BORA 1KK0A 1P9RA 2ZI6A 2OM2A 3N70A 4LDJA 1FP6A 2ORVA 2ZSBA 2ZE6A 4YQFA 3I72A 1G6OA 2GK7A 1E2PA 1WCV1 4CEHA 1ZCAA 3BFVA 4JJKA 2PH1A 1OKKA 2FN4A 4EJSA 4KFRA 5B64A 1W4AA 4O0MA 1H65A 2OO7A 4POAA 2FF7A 1W4CA 3VQTA 1L8QA 1WB9A 4JSTA 3RRZA 1BMFA 1WP9A 2HEIA 4JLVA 3QEOA 1OXUA 3L8YA 5TXGA 1YVDA 2F1IA 3PR1A 4OQMA 2ZRKA 1E9FA 4JLNA 3C5CA 3L8ZA 3RS7A 3BK7A 4LBZA 3EW9A 2V6JA 3VX3A 3CB4A 3W3AA 5GJVC 1CEEA 1CJVC 1E99A 4DLUA 1TQDA 5FOSA 1RRCA 2QMEA 1WBDA 4NDZA 3FKSA 2IYTA 3L0PA 3O47A 4MGYR 3U4QB 4I1VA 4KU4A 3Q85A 2NO0A 3THXA 3ASZA 5G3ZA 1SGWA 1WMSA 4DT1B 3K09A 3TQCA 3PV0A 1T3SA 3WP1B 3RC8A 1RRPA 3K1JA 2Q3FA 1I2DA 4ESVA 1VCNA 3UIEA 1ANKA 3RSOA 4DLWA 2FG5A 4LBWA 3R9XA 1XXHE 2KBFA 2HCJB 4PZZA 2P2LA 1JXOA 5E4FA 2FZLA 2JCSA 4RCYA 1SHZA 3JZMA 2CBZA 1OB2A 4TLCA 3FHOA 1D8TA 3LXRA 2RGAA 4QHYA 2I1VB 1KSFX 4YXWA 1RIFA 2WMNB 1ZNZA 1XPRA 1AKEA 4V0NA 1F2TB 2Z5FA 1K8RA 4HZIA 4DCVA 4HLCA 1XCGB 4H1UA 1E9EA 3PEYA 3K0CC 4MKGA 3EPHA 5JLJA 1NMXA 4AYXA 4M1WA 1VIAA 4TMKA 4RKFA 1MABA 1W5SA 1X1SA 4Q9HA 4TN1A 5IF9A 4K46A 1U8YA 4KFSA 4A4DA 3DOEA 1S1CA 1SVIA 3VU9A 4LJ7A 1G8FA 2BBTA 4Q4HB 3O8DA 4A92A 2N42A 4Z8XA 2Q9BA 3KQHA 2FSGA 3NEJA 4E07A 3R7WB 4ARZB 2QY9A 1Q20A 4JSYA 4C2TA 3BFKA 1G18A 1KAGA 1RRFA 4D0NA 3MUFA 4YMVA 4Q1AA 5FR1A 3D6TB 2VQSA 1EFTA 1IXSB 3X1XA 2QBYB 1W0JD 3U44B 1Y3AA 2ZYUX 1HUQA 3I32A 3QF4A 1EWRA 3DMDA 3ZDQA 2PEZA 2P3SA 2I3BA 3V4FA 4MYHA 4Q48A 3TLXA 2V4ZA 4EQ6B 1CIPA 1N6IA 4PO9A 2NMVA 3EIHA 3Q7QA 1R2QA 3NTUA 4O2RA 3WYFA 1C4OA 3UK6A 1BH2A 2R8RA 3AF3A 2AN9A 3NXSA 4Y0AA 3SHFA 2C99A 4DSUA 2PLRA 1A1VA 2C95A 3KJGA 3Q8XB 1TF5A 3MSXA 4WXPA 2GK6A 1LB1B 4GOXA 1BKDR 4DEYA 1LV7A 3BJIC 2OAP1 3UPUA 4NE2A 3H84A 5AJWA 2GXUA 5EE5B 2QTHA 3L0IB 3AF0A 3O8CA 1DS6A 2QI9C 2PMKA 5K8IA 2Q0HA 3UKDA 1YR6A 4NYJR 1SKYB 4Q03A 3W34A 4MUAA 5DN6A 1TTTA 4IOMA 4QJ4A 4A1FA 4B73A 4QRHA 1R5OA 421PA 4Z8YA 1P62B 2O8CA 3HR8A 4JLAA 1G4UR 4B48A 4URXR 3EX7C 1OKKD 2IW3A 2OESA 1UJ2A 4Z1MA 4YMUA 4JYBA 4JBYA 3FYHA 3W3ZB 4JT4A 2VHTA 2DFKB 4W5HA 4CW7A 4D0LB 2A78A 5JWHA 1BMFD 4WOPA 2LKCA 3RVBA 3T06B 2QPTA 1D2NA 4G3XA 3UXMA 1ZUIA 4Q7LA 1GDDA 1KZ7B 2ODNA 2IUUA 3TW4A 4ABYA 3GLIE 3THYA 1P60A 1OH8A 4WVFA 1E1RA 4NMMA 1WQ1R 3DEFA 3AKDA 4QL3A 4TT3A 4AI6A 2XXAA 3WNCA 1KI9A 3B1XA 2VHUA 2ZS8A 2BMFA 4LPSA 3E70C 3BH0A 2V8OA 3UMSA 4PC7A 2R6AA 1JPJA 2C78A 3LWNA 3KJIA 1CJTC 4NYJQ 5DNYB 2Y8EA 2X19A 3K09C 4LHWA 1HQYE 5HZKA 3NDPA 3H2YA 4M1OA 1DAHA 4B2LA 4F4IA 1SXJA 1T3HA 3GEHA 5CIQA 1OW3B 1OYWA 2ZR7A 4DLTA 2VL7A 3HWSA 3QKUA 1AM4D 2HLDA 3VAAA 1UM8A 2GAOA 4QHSA 1L7VC 2F3RA 1XD8A 1YZKA 3C8UA 2BM1A 4XIGS 1RE0A 3B78A 2GCNA 5G40A 3VTKA 4LYHA 1KI2A 4A0HA 2WKRA 1CR4A 1VCMA 3OZXA 3ADCA 3S1AA 2F6RA 1CP2A 2VA8A 5DIFA 1X3SA 1X8JA 5JRJA 1YU9A 2O8BB 4BEJA 4YXWD 1HURA 3AH8A 4BFUA 4FN5A 2GILA 3ZQJA 1E0JA 4EIWA 3UMFA 1N6RA 1IY0A 2JAQA 4M21A 3IPXA 4LJ6A 3VR3A 3KX2A 1W47A 4LV8B 2A3RA 2QTFA 1Q12A 2VYFA 3RS2A 1N0UA 3GLFB 1HYQA 2G6BA 3NWJA 4PANA 1ZUNB 2FZ4A 2WBLC 3CX7A 4C0LA 2ZTSA 3LQQA 1MO6A 3CBQA 4S35A 2REBA 2IS2A 3ZZTA 4US2R 1SVKA 1GKIA 4HB2A 2H7VA 1W1WA 1KI3A 2IF2A 3U3MA 1JI0A 2DHRA 3GEIA 4M1KA 3W5JA 3TJZA 2CE2X 1Z63A 821PA 4HATA 4IDNA 1QDEA 5FI1B 4XWKA 5J5CA 2A7QA 2QQEA 2F9MA 5FTNA 1JECA 4PHFA 4HYYA 2G9NA 2BEJA 5KPJA 3AVYA 1NKTA 2GESA 4LC1A 4UNSA 5FL7A 3T1VA 1K5DA 3WMEA 2O8DB 1JJVA 1UBEA 4YLGA 3IGFA 3OE7A 2ZI3A 1J2JA 4DC9A 5L3SB 3A58B 4B43A 2XITA 3ASYA 4HZUA 4N3NA 2EVWX 4XSHA 1E9AA 2OG2A 4JLKA 3IIMA 4KHZA 1RYHA 3CF0A 2QMOA 1ZC4A 1FPMA 4TTPA 5A5GA 1XZQA 4KVAA 1UBCA 4E03A 2WPDA 2E87A 3AGPA 4LJ4A 2DY1A 3SJBA 4RZXA 5SZKB 3B2EA 1I4DD 1X8LA 1G16A 2BKUA 5JS8A 2D7DA 4QG7A 2ZAOA 1LF0A 1XTSA 2ZI5A 4ILEA 1AJEA 2BJWA 4OHWA 4NH0A 1PLJA 1Z0JA 2H92A 2ZUDA 4EPWA 2H16A 2X8AA 1UKVY 1UADA 4UJ3A 1OIVA 3D8BA 3PITA 3A1TA 1EX7A 1P75A 2ZJZA 4RKEA 1E2EA 4YDHB 1H8HA 3LDAA 3K70C 5SZJA 3HP1A 1R0ZA 3AVTA 1II8A 1OH7A 2ZJBA 5DN6D 2W83A 3GLGA 1TF7A 2FSIA 3K70D 3VFDA 3ZVNA 1SULA 2PCJA 2G88A 5D3MA 1W49A 1AA9A 1E9BA 2B7BA 1Q3TA 3QF7A 4Q1BA 2D7CA 4ZO4A 5L8VA 4PO8A 4TMWA 1JJ7A 2H57A 2OLJA 5JHHB 3MG9A 2NQ2C 2BWJA 3EPLA 3KQNA 2HXYA 4NCHA 3LBNA 3Q3JB 4MH0R 2RGNA 5FUXA 3OIWA 4Z1MD 2PT7A 3B9QA 4UQOA 4IKEA 2IX3A 2F7SA 2YWGA 1QHIA 2BMEA 2FSFA 4W5WA 4DDWA 3HPRA 2R6FA 3VKHA 4KVGA 4OJKA 3DOFA 3R9IA 2O8EB 1ELOA 1NLYA 1XDBA 2J45A 3H86A 1E1RD 4JVNA 3AF4A 3PUYA 3CPHA 4ZDWA 4LI0A 2UZIR 4RZUA 4TT3D 1E2HA 4LX0A 3AVWA 1J8MF 4QBFA 2JLQA 5F9HA 3LLMA 3CF2A 3P1JA 4LBYA 1V5WA 5E95A 3QBVA 4DEXA 4JVLA 1XD2A 1OB5A 1PUIA 2N1BA 1SXJC 3U4QA 3F0TA 2CE7A 2RGCA 3NBFA 5K8UA 3BGWA 2OE2A 1NI3A 1SXJD 2F1RA 1DBSA 1P2VA 1K5GA 2VLIA 3BS4A 4W7SA 4Q9LA 3Q5DA 2NZJA 3FPAA 4DT1A 4DXAA 4NU0A 2FSHA 2JATA 2WWXA 3TIFA 1U0HC 4QOSA 5DHFA 4C9BA 4ASUD 2WWYA 3OIVA 1FMLA 1E0SA 2AD5A 2BVNA 1IONA 3MFYA 4HB4A 3SYKA 3MD0A 2ZM5A 4B34A 3ZLJA 2V7QA 3NIBA 1P6XA 2C98A 4PC1A 3QENA 5B30A 4DCNA 5EE3A 4B3BA 4KI0A 2G0NA 3W6PA 5ANRB 1E79A 1KSHA 1N2CE 1SHKA 2RMKA 4HLQB 3IPYA 3QXJA 4II7A 2WSMA 2EYQA 2V3CC 2DFNA 2ZAMA 3H1TA 5EXXA 3HU1A 1W36C 3EWSA 1F3OA 1Z29A 2GXSA 3M1IA 1N5IA 1XJCA 5FBVB 4GL2A 5JJKA 1F2TA 1CR0A 1CR2A 2ZR0A 4TMXA 4EFLA 2A5JA 2YINC 4G5RA 4C0AC 521PA 2WHXA 4CYMA 3SU8A 2ZRJA 3QKRB 3NC0C 3T1OA 2QGNA 4D4MA 3PUVA 3WHKA 1GG2A 2AKAB 1YE8A 2QAGB 4QBHA 2AXPA 4BFZA 5EUQB 2IS1A 1DAFA 3K53A 1VMAA 1Z08A 3OFNA 3P20A 3LD9A 121PA 3ZVLA 5KDDA 3A4LA 4OBEA 3IHWA 2CMKA 3LX5A 4PQRA 4JL8A 4Q4HA 3RS0A 2D4HA 1JPNA 4LBVA 3TBKA 4P0TA 3QPVA 1EG7A 4TTQA 3T1QA 3R7WA 4ARZA 4DBLC 1NY5A 1I4TD 3EA0A 4DHEA 3TVTA 3TH5A 1GWNA 1U0LA 2A2ZA 4B76A 4TMVA 5HR5A 4R9UC 1IN7A 3PFIA 5FL7D 4EAQA 2QBYA 4JLOA 1QZXA 1IJFA 1QHHB 1WA5A 2FU5C 3U44A 1E96A 3EXAA 1YR9A 1BS1A 4D2IA 5C1BA 5FUWA 2WKPA 3LA6A 2F43B 4P31A 3BBPA 4EPVA 3M0EA 5EQTA 3ZJYA 3DDCA 3M4YA 2BDTA 1XRJA 2GJ9A 2R6GA 4WIAA 2VHQA 1TEVA 1W36B 2H18A 4UXHA 1P3JA 1GOTA 4Q4AB 5JSZB 1AS0A 1X86B 3EZFA 4IDOA 4RD1A 1GTVA 3ZD7A 3A6PC 1ZM7A 4DKXA 4DLSA 3X1ZA 1G64A 3KQKA 2RHMA 5CDFE 3CZPA 4NYMR 2ZEJA 1OF1A 1E2KA 1JR3A 2WAYA 3B8HA 2FMXA 5E7JA 3K0CA 4LY6A 1TNDA 2AFIE 3IKJA 3N2IA 4FCWA 3R8FA 1YZNA 1PLLA 2ZSFA 4GP7A 3GP8A 3EA5A 1Z07A 4TL7A 3CZQA 2CLCX 5CYPA 3VHXA 1L4UA 5JRZA 3T61A 2CCJA 4NP6A 4RJLA 1T8TA 2X77A 4NCJA 4U02A 4AYTA 1GL7A 1XEWY 3E5HA 4PR0A 2OCAA 4B71A 3EAQA 4KFTA 3H4MA 4I1OA 2W58A 1KMQA 4TQAA 2NPFA 1VHLA 2IYSA 2PZFA 2RGNC 3FE2A 4BFWA 1W0JA 4DJTA 1KSJA 3GJ3A 5J4VA 2FX3A 2O0KA 1M34E 2ZRIA 1KGDA 1Z6YA 2YZ2A 2OCBA 3UG7A 3ADBA 1EESA 2C03A 1PZNA 2B8TA 3B1WA 3P4YA 4KLZA 4X8LA 3RC3A 1W46A 2IC5A 1ZC3A 2L0XA 2W6JA 4FIDA 3W5IA 4DRZA 3HPQA 2G0TA 3LQRA 3CPJB 4TWZA 1HTWA 1ZP6A 1LFDB 5CK4A 1FX0B 4LJ8A 4NYMQ 2R9VA 1E9CA 2A5YB 1G8PA 3GLIB 1MRSA 2AWOA 3CNOA 3WRYC 3FMPB 2O0HA 1VPLA 5LB2A 2QP4A 3K0FB 1UDWA 1PV4A 1KK1A 1HEIA 3UANA 1JAHA 3KZ1E 2Z4SA 5JHGB 2FDCA 1GRRA 2V1XA 5KDOA 4LCBA 1R4AA 2REXB 3JZAA 3CF6R 2ODBA 2NGRA 3TR5A 4JKYA 1KKMA 3B5JA 2QN6A 5GVRA 1SKQA 1U90A 1M8PA 4DSTA 1KY3A 4B74A 5KYKA 1G9XA 1CBUA 2XEXA 3CH4B 2J0SA 1P61B 2R6CA 4UKDA 3A4NA 3MWYW 2P65A 1LW7A 4C0HA 3SQWA 2QMHA 5G41A 1CULC 1XX6A 4GT1A 1M7HA 2C8VA 1HY3A 1VTKA 4D6PA 1N6KA 4DIEA 3CNLA 4OQFA 2V7QD 1VYUA 4HB0A 3KXKA 1K6MA 5JI3E 2EFCB 4A0GA 3THWB 1ZNXA 4OI4A 4QGFA 1CJUC 1E79D 1GFIA 1VIYA 3KTAB 3LBIA 3AKCA 4FMBB 3VX4A 4A6PA 5IRCD 1G3MA 1EFCA 2IYWA 4D25A 2BIFA 1PUJA 2XTMA 2ZE5A 3NBZC 4Z54A 1U81A 2O8BA 4H1VA 2XTNA 1YRBA 2GZAA 1E2IA 4JLBA 4KAXA 3ZD6A 3J81k 2NIPA 4B33A 1CRQA 2BOVA 1Z47A 1Z83A 3DM9B 4DLRA 1GRNA 2ZU6A 2YWHA 1U2RA 1VCOA 3RABA 4DB4A 4JKIA 4Q02A 1CR1A 3MGCA 2ZRNA 1N0WA 2ZU0C 4PXAA 4Q1CA 2I1QA 4QGAA 1P7CA 4RFSB 3GLFA 3OFND 5TMPA 2ZSDA 4B35A 3RYTC 1R0WA 2QORA 4ESHA 2XZOA 3I8XA 1JQLB 4V02A 1NN1A 3PG5A 3CRRA 3VR2A 2ANCA 4KCGA 3PXGA 3BC1A 2HT6A 1R10A 4IHQA 1YZLA 4HDOB 3C7KA 1E6CA 3PENA 4PX9A 1AS3A 3NDBB 2C2HA 5FOVA 4ZIRB 2YOFA 2X2EA 1Q3HA 3FB4A 1XB2A 4JMPA 4AKGA 4QM7A 3SE0A 2KB0A 1KIMA 1E3MA 3SNHA 3O8RA 4EUNA 4DVGA 5H1YA 3HYRA 1G21E 4L5BA 3UWOA 1NVWQ 1R8QA 3CWZA 8OHMA 3QVVA 2QQ0A 4ACBA 1NVUQ 3PIRA 4C0QC 3AVXA 2ZRGA 5JWOA 4BRWA 5KTYA 5L3SA 1GNRA 2ZQ5A 4GMDA 5E7MA 3L43A 5J4YA 1I4LD 2O5VA 2XX3A 2ORWA 4C30A 2J0UB 1HE8B 4JLPA 4KXFB 1OFHA 4DB2A 2QT0A 4RZ3A 3QEJA 1KDOA 1DEKA 1ZBDA 1JR3D 4DWJA 1GM5A 3SR0A 1KK2A 3MMPA 4QJ3A 2EU8A 2OBLA 2JDIA 2FJUA 3KJEA 3LX8A 4IVPA 1N5KA 2IS6A 1RRGA 2GA8A 4RFVA 3AP2A 4ZCIA 1NBMA 4RD2A 1AZSC 4V0KA 1EXMA 4LJYA 2R2AA 4PO1A 1OH5A 1IAQA 2HF9A 4NBSA 1OFTA 4M1YA 2QRNA 3G82C 1P9NA 4UNNA 1SVMA 4BASA 1ZD9A 3IHLA 4GZLA 1NKSA 3VNUA 2ODWA 3LAWA 1FMJA 2IYVA 1OE0A 1SZPA 3C41J 4DCUA 1DE0A 2IXEA 1KJWA 1XCPA 5DI3B 1FW6A 5KSOA 1ZD1A 3WXMA 5KU1A 1Z0AA 2NTYC 1KDTA 3OAAA 2P6RA 1PVOA 3BIFA 1OJLA 3QKSB 2Q6TA 5DI9A 2W6JD 4D4LA 3QI2A 4RZ2A 3AGQA 4BZXA 5AR1A 2F1HA 1FL9A 1KI6B 3HDTA 2GZDA 2BHRA 5GJCA 1XTRA 1YRAA 1IXZA 2AL7A 2QNRA 3TSWA 5J47A 3GCGA 1G20E 1R7RA 3DZDA 4Q66C 3ZQ6A 1EFRA 2B7CA 3K0AB 4MQBA 3IIKA 5P21A 3FFAA 2ZXUA 3NBYC 1P2TA 3BB4A 1KY2A 4O3MA 5A0FA 1CKEA 5DH9A 3I1FA 2ZI4A 3RWOA 2FPKA 2WAXA 5EE0A 3MWLA 4XVQA 2BC9A 4TLDA 3UMRA 4DZZA 5BN3A 3CX6A 2YOGA 2CLSA 1IBRA 4X8MA 2QE7D 3DZ8A 4GRAA 1AZTA 1IY1A 4V0OA 1FUUA 2F3TA 4WBSA 1KNXA 2ONJA 3ICQB 2HYIC 1DAEA 3TSOA 4C2UA 5K8LA 3IQWA 1NP6A 3WBKA 4DLVA 4IOJA 1R5NA 3GLHE 4TSFD 3A4MA 4F92B 5J4LA 3LVRE 4ZKEA 3PEVA 1UF9A 2MMCA 1XXHA 1NL3A 1Z28A 3VR1A 1N3BA 3SN6A 2HXSA 2UZ3A 4EPRA 5FOUA 4FCTA 621PA 2OUKA 2OILA 5TDHA 5FTMA 3KKQA 3M6AA 5CM8B 3WY9A 4M8NE 3RLFA 3GJ7A 2IYLD 4BLOA 2WWHA 4FD2A 4XWAA 4YMTA 4PFSA 1AK2A 2XNDA 3LXXA 1N6LA 3MCAA 5KNCA 2LWIA 2QG6A 2VP2A 2ZRHA 2QP9X 4GP6A 1T0HB 4F38A 1W4BA 1P5ZB 1CS4C 4DSNA 3T12A 1GNQA 2BBWA 3WP0A 2FPMA 1F2UB 4X8OA 2EQBA 2W00A 1I2MA 3T5GA 4D81A 2REOA 1GNPA 1T4GA 1E32A 1Q1EA 1ZU4A 3QKRA 4P4TA 721PA 1DG3A 2FGJA 3QOFA 5AUPB 2YV5A 4NZYA 4HSEA 3CRW1 5AJVB 2YHSA 4L16A 1T0JB 2J7KA 2RB4A 2FEOA 1Z2CA 2F55A 1OXTA 1SVLA 2RGEA 5BQ5A 1FUKA 2BM0A 1IHUA 4PAMA 1T91A 2X2FA 2Z6VA 1N25A 1OFUX 4AY2A 3F8TA 1S9DA 4XVRA 2J59A 3HU2A 1VCIA 3VHLB 2IWHA 4ASUA 2PZGA 2GRJA 2GWHA 2ZJ8A 4F93B 3R20A 1KDPA 3BE4A 3SBEA 2OZEA 5EJEA 2R6DA 2DWPA 2VF8A 1EK0A 4N1AA 1QHHA 2H17A 2ZRFA 3I5XA 2D06A 3B13B 3U6BA 1ZMXA 2CK3A 2ZRMA 3SC3A 3W9YA 5FI0B 2F43A 1W7AA 5EXPA 2OCYC 1IN5A 2BCJQ 1DAGA 4M9SA 1XZPA 3TUJC 2O8FA 2VBCA 4P4SB 4R98A 4Q4JA 1OT3A 2XTZA 4HAYA 2G77B 3VR6A 1M2OB 1XMVA 4Q4AA 5JSZA 2FPLA 3NHBA 1ZJ6A 3IQXA 4EPYA 3U60B 2ZREA 4OL0A 1KSGA 4U7DA 5BYKA 1G5TA 1E4YA 4BWYA 2JDID 2ZANA 4UJ5A 1KMHB 2P0EA 2Z43A 3FMFA 1OHHA 3Q5EA 4G5GA 4MGZR 2GVDC 4NHOA 1S8FA 1DAIA 3TGPA 1NBMD 5DLQC 1AS2A 1KDRA 5M04A 2JLRA 4LHVA 1OXSC 4QM6A 2B8WA 2HDNB 1F5NA 2WOJA 2WJVA 3W6NA 5JBQA 3CWQA 3OIYA 4JVMA 3EZ6A 3QPUA 4JL5A 2IBMA 3BH7A 4LYFA 2Q9AA 2CHQA 2JLWA 1Z06A 2MMGA 4HLDA 4Q21A 4JBWA 5LD2B 2HT1A 4BE7B 3R9WA 2QTVB 2H5EA 2J41A 2NO1A 1OIXA 5KNBA 4XTCS 4L4UA 3KJHA 3U7GA 1E2QA 2ZSAA 3OAAD 1WXQA 2ATVA 4CEIA 5BN5A 1TU3A 4Q4LA 2GEUA 4GSYA 3WNBA 4URZR 2CDNA 2IYRA 3QNUA 4NL4H 4PZLA 4PHTA 5KOYA 3WYGA 4BLQA 1W4RA 3E1SA 2VO1A 4MA4A 4QNMA 1AQYA 1G19A 4I99A 2QM7A 3RRYA 2ZRBA 3T35A 1LS6A 2PCLA 1U0JA 1MR3F 1F60A 3QXHA 4GBMA 5FTLA 3LFUA 2P5SA 2ZE8A 1YZTA 4M9XA 3OEEA 3IILA 1EFRD 1Z5ZA 1FX0A 3WYAA 2CVFA 3AQ4A 2XZLA 1CRPA 3B1VA 1GIAA 1BYIA 1Z0FA 3OEHA 4URYR 4FMCF 5IT5A 3EC1A 5CJ2A 1QG2A 5FOTA 3RDPA 1S2MA 3AM1A 1HV8A 2QENA 4HUQB 1W0KD 3ETLA 5EUMA 1XEFA 4JL6A 1Q22A 5GVSA 4BLTA 2QROA 5HCNA 1XTJA 4TYQA 1NNEA 1M7GA 1M1YE 2V9PA 2QZ4A 2ZRLA 3U7HB 1Z22A 4LJ9A 5CB6A 5LDDC 1DELA 1TL7C 1JAIA 2ZRAA 1A2BA 3T15A 3CUEF 1E2DA 3DO6A 1A5TA 4FI3C 4OHYA 3BH6A 4A0RA 3LNCA 4QNRA 5CJPA 4XOIA 1J90A 2WIAA 4OQLA 4PPNA 4MGKR 3GFOA 3ZVRA 4CIDA 5JI2E 2JEOA 1XJ0A 4CZ2A 4AD8A 4DCSA 2D2EA 5E3HA 1OXXK 2JLUA 2IHBA 2JLVA 3AUXA 3KXLA 4LYAA 1UKEA 1T8UA 3THWA 2YJTD 2HCBA 4A15A 4LYJA 1KI8A 4PHGA 3RHFA 3KTAA 3KFXA 2XNDD 2VH5R 2ZRPA 4NYIR 4UNQA 2YVUA 2BMDA 5IK2A 3B9PA 1V43A 1NG1A 3TW8B 2B21A 1ZVQA 2IXFA 3TMKA 2WOOA 5EP4A 3ZS8A 5E7IA 4Q7KA 4DIDA 2GJSA 2VSOA 2ECKA 3KFVA 2VP5A 2YKGA 4G1UC 3KKPA 3C14C 1E98A 2QAGC 1DG1G 1U94A 1Z0IA 4NCKA 3SJZA 3QPWA 1LY1A 2FE4A 5AK0A 2IF0A 4TL6A 3D7MA 3KB2A 4RFSA 1Q44A 3ZIAA 1EFUA 1RW4A 4HEJA 2ZVPX 4UNPA 3CO5A 1RZ3A 2CVHA 4L15A 4LOAA 4A82A 3GJ8A 1DADA 1KAOA 3IEVA 1MT0A 3LV8A 1VYTA 2AR7A 1II0A 1R0XA 1C9KA 2DFLA 3VR5A 3RNLA 2XSZA 2VRWA 4ZIRA 1CXZA 4OYHA 1E94E 3IEUA 4LUCA 4D26A 4HLUA 4KFUA 1UEIA 4KJZA 2HV8A 1N0VC 3OHMA 4MGIR 4MKHA 3MJHA 1GAJA 1F6BA 2OFWA 3AKEA 3LY5A 1Z0KA 2CK3D 1XEXB 4NYIQ 1T5LA 4B6FA 2QSZA 1VG0B 4D80A 4C4PA 3SFZA 3KL4A 1KJYA 4CEJB 3PCRB 4F7WA 3HYTA 3SZRA 3PQCA 1YKSA 1PJRA 2GHIA 5EE1A 5AUNB 1IN8A 2RH5A 4UXIA 1W36D 1NN3A 1Q21A 3JVUA 2VP0A 4QKQA 2J0UA 1U98A 4ZPXA 1M74A 4A2WA 1L4YA 5FR2A 1OHHD 2JA1A 4O25A 5FFMA 2A5FA 4URWR 1N6PA 5F2EA 2MSCB 4LC0A 4Q7JB 3B7GA 4QGHA 3RANA 5FUVA 1ZW6A 3FHCB 4I1SA 4P4UA 2CCKA 4PC6A 4PSKA 5LPNA 2XXAB 4GZMA 3N2EA 1W2HA 3G0HA 1TPZA 4A8JC 2W2TA 3D3QA 2OCPA 5CLLA 3DM5A 5KSZA 4H9GA 1MKYA 4RY2A 2RHDA 2GJAA 2XB4A 4DDUA 4EKDA 4WZAE 1FZQA 3GEEA 2YWFA 4E5UA 3LRPA 4EPTA 3EZ2A 1N5LA 3MRSA 5AJXA 5L3RA 2V54A 2AX4A 4M0LA 1XTQA 2QA5A 3QG5A 1QG4A 4AURA 2EW1A 4V0ME 4XWOA 2UKDA 2EFHB 4M2LA 1Y63A 2P6UA 3PVSA 5DI3A 4AC9A 1G7CA 1U8AA 2BMJA 1E2LA 2EFEB 4FWTA 3IBYA 3SJAA 1ZD8A 2OBMA 1KK3A 3MJRA 1IOZA 2CL0X 2ORIA 4EQ6A 4A36A 1Z8FA 3ND8A 3CRVA 4WZ6A 2WVJA 3GJ0A 1FOEB 3NEYA 1NVXQ 1XEWX 2GTPA 1ZRHA 2J46A 4GPTA 2W2VA 1KZGB 5EZ5A 1KI6A 4L9SA 3U2QA 3KDSE 3OEED 2CLDX 1PLKA 1AIPA 2GBLC 4YONB 1HH4A 5DISB 1RPZA 4OI0A 3OEHD 4B44A 2BKEA 2VHCA 1A2KC 1UBGA 3BERA 3CRMA 3K0AA 1LVGA 4Q9JA 2C9CA 4P33A 3CONA 1XF9A 4PSAA 4HDCA 4LSGA 4FMCB 4Q7MB 5ELXA 1Z6GA 4AWXA 1HQCA 2OEPA 2DFTA 2CJWB 4GFDA 4A8JB 5FPSA 4BECA 3BD9A 3CRQA 4A2QA 5CB8A 1LTQA 4C7OB 1NG9A 1JR6A 1S1MA 2VIIA 4PSVA 4BZQA 5JJIA 2KSQA 2QSYA 4XJXA 2A5GA 3AF2A 5EE9A 2GEDA 1M6NA 1COWA 1R5BA 1E0AA 1KO4A 3GMTA 5CITA 1KOFA 2MSDB 3SDZA 1IY2A 3GPLA 4GMXA 2G83A 2GAAA 2ZUCA 3GLHB 2DWQA 1XTIA 4BLRA 4B47A 1UBFA 5FBWB 2ZJ2A 4ACAA 2QGZA 1ZAKA 4JJZA 3THOA 4IXNA 1Z3IX 2V55B 1A4RA 4LV6A 5H68A 4G01B 221PA 2YWEA 4JYCA 4Q9KA 4KYUA 3R8CA 4DUGA 2VSFA 2Q3HA 3CNNA 1NLZA 1R6BX 4I1UA 4IEEA 2IXGA 1OPXA 4KODA 4BLSA 3RSLA 1S4QA 5IK2D 1B0UA 1D6JA 1RJ9B 4TYYA 2W6ID 3O8BA 5CK5A 4W5JA 4OJQA 4PHHA 2WWIA 2V1UA 3QBTA 3AP3A 4B3DA 4U00A 4I81A 4OHZA 2DCUA 3I4LA 1YJ5A 2WJHA 3EZ7A 3KKOA 2OFXA 4Q1FA 1QHXA 3SQXA 1OFIA 2FOLA 2RGXA 5TY0A 4V03A 3OIUA 1F2UA 1OLOA 2JJ2D 3EIEA 5LB4A 3ZIAD 3ZYCA 2KE5A 1ZM4A 2QE7A 2ZI7A 5F98A 4M22A 1CJKC 3CLVA 1UDXA 3RS3A 3UG6A 2GF9A 4PAQA 2OLKA 4BFXA 2ODEA 1KO8A 1GSIA 1VG8A 3I8SA 4B3FX 2ANBA 3U7FB 4HLUC 4YMWA 4M1MA 2DWOA 1SVOA 2OV2A 2XSZD 5JJLA 4BZPA 3L0SA 4TSFA 2YOHA 1D9XA 1ZCBA 3MWKA 1YZQA 2PL3A 3RRMA 3TR0A 3B6EA 2AFHE 2XZPA 2C9OA 3KQUA 4U5XA 1SVSA 3A37A 3GFPA 3B1ZA 4PC3A 3T5DA 1DAMA 1WBBA 1US8B 3AVPA 4JVSB 4OQNA 1ONBA 3REGA 1YR7A 3UWKA 3U3KA 4B2IA 3E2IA 1KJZA 2GEVA 1G8HA 1X1RA 2GZHA 4IVQA 4B3XA 3DHWC 2YYZA 4AK9A 3NKVA 4S2EA 1DO0A 2VTKA 2ZYTX 4M53A 4P4SA 5FBRB 1T9HA 3ICEA 4LHYA 3NC1C 2EYUA 4IDQA 1Q1ZA 3I73A 4K81B 1XPUA 1XMJA 5CDFA 4R71A 1JB1A 4DLYA 2AD1A 3PEUA 1KMHA 4C0KA 1EFHA 1MH1A 3TUZC 4XVUA 3ZVMA 1X6VA 2IYQA 2WMOB 5CYOA 1E2MA 1G5PA 2H1LA 4WAUA 3KB1A 2GCOB 3D31A 3TAUA 5L3QB 2Q21A 3C5HA 1G6HA 1G41A 1S96A 1XD2B 3AB3A 5BN4A 2JLSA 4C0BA 2YC4C 2JIZA 3PUWA 1KO7A 4ZDIA 2DB3A 4TMTA 3GJ6A 4LJ5A 1UFQA 3QY0A 5HE9A 2ZJOA 3NH6A 2IUSA 2O8DA 2JGNA 4M1TA 1SVWA 1ZM9A 3NH9A 4AG6A 2ZRCA 3DKVA 5DYGA 1OIWA 3NG1A 1VKJA 3SYNA 2ZRDA 3QVUA 5EP3A 4B6EA 4JT2A 4MYTA 5BYJA 2ZPTX 3QSYA 3BB3A 3H0KA 2FA9A 1G1MA 2NG1A 5FPTA 3X1DA 2C77A 1RKBA 2ZIAA 1VHTA 4GI7A 1UKZA 4KV9A 2WWWA 1D5CA 3QXCA 3U3OA 4D4KA 3I62A 1IN6A 1G3QA 3U3JA 2FH5B 2PJZA 1P4SA 4LHZA 2B6HA 1L2TA 3KKNA 2QAJA 4RVCA 1U8ZA 1ZINA 3QJYA 4KITB 5HCIA 2AXNA 1ZYUA 1G3RA 1U99A 2BBOA 1ZNWA 1KI1A 2PX3A 1RFLA 1QRAA 3W6OA 4Q9IA 2J87A 4HUQA 4RD0A 1D2EA 1F48A 4EFNA 5FOWA 1FNMA 3MWJA 1B23P 1NIJA 5DSZA 1OSNA 1CTQA 3ZZUA 5H8WA 1COWD 5AUQA 2XGJA 2O0JA 4C3ZA 4DSOA 1GKUB 3DVLA 2QT1A 1SXJE 2XNSA 2J7PA 1WF3A 3PUZA 4BFSA 4EFMA 3TVDA 3ADKA 2VPPA 4GNKA 2AWNA 4JS0A 3ZZ0A 4CT5A 1YHNA 2G3YA 3LW8A 1FQJA 5G3YA 2QEQA 2WICA 1S3SA 2GF0A 4TLAA 4IRUB 3T1TA 2WTUA 1CF4A 4AKIA 1W48A 5EXTA 4G5SA 2FV8A 2X1VA 4DUGD 1YZGA 3AV0B 4BQSA 1HE1C 5FPHA 1KI7A 4BRUA 2O8EA 3FVQA 1FTNA 1GITA 1T6NA 3CW2A 2Z0MA 3KKMA 1WRBA 5FH9A 4CGZA 4MUBA 3VNVA 3ZS9A 3SYLA 4O2LA 1QHGA 1SQ5A 3GFTA 1DTSA 1D2MA 3OF5A 3L2OB 3EPJA 1R8SA 2CCGA 1ZIOA 4Q01A 3A1UA 1RC8A 3TNFA 4IFEA 1P9WA 4IVRA 3Q9LA 2CHGA 1ZUHA 1W0KA 1G8GA 2GETA 4HAZA 4XD7A 2XJ4A 3SEAA 5JZVA 4C0SA 1E2GA 1JEDA 2KWIA 3LBHA 4HAUA 1OH6A 1GILA 4GDFA 1U9IC 2IYUA 2WV9A 2W2XA 4OK5A 3LW7A 2HYDA 1FP7A 1XU4A 2A9KA 3QG1A 3AF1A 1XPOA 2OT3B 2HF8A 2AKYA 2XAUA 2ZR9A 3EARA 4TLEA 1OXVA 1GL6A 3U6KA 1H8ED 4J0QA 2ZETA 3WBJA 5HTKA 4Q5IA 2GJ8A 2XOKA 4URUR 3DMNA 4OI1A 2ZSEA 2JASA 1E1QA 4F4CA 2FEMA 3QKTA 1A82A 3CM0A 5G53C 1O87A 2D2FA 2QP3A 3C15C 1Z6XA 2PZEA 3W8RA 3MLEA 2VP4A 1TU4A 3W90A 2WIBA 2BCGY 1XEXA 4TL9A 4TYPA 3KXIA 4CEJA 4EJSC 1MRNA 1TUIA 2XB2A 5FL3A 2IK8A 2WWGA 4HI0E 3QQ5A 2GXQA 4BFTA 1BO6A 5KDLA 5C2JB 3OESA 2D3WA 3PJRA 2D74A 1G7SA 4OK6A 2QRZA 4FCVA 1G3UA 2GJKA 4NCNA 5CLQA 5F3WB 2J9RA 1Q57A 4MKFA 2BEKA 5HPYB 3A1WA 2P6NA 2LCFA 4DLZA 3VKWA 3BOSA 4EPXA 4TQ9A 2DYKA 1CJMA 2CEAA 2J3EA 5IHPA 2QAGA 3PUXA 5BWMA 1GKYA 1JNYA 2JJ8A 3SS8A 4ZDJA 2NO9A 1XMIA 2WJIA 4X8HA 1N5JA 1NN5A 4IXMA 2F1JA 3SJCA 5FPYA 4CVNA 3FKSD 5D3QA 1IN4A 1FFHA 1Q0UA 3DKPA 2JIZD 4FWIB 5LD2C 3GLGE 2RGBA 4ZV4A 5JEDA 1O3YA 2OFOA 5C18A 1E9DA 2IT1A 4G0NA 4JBXA 1KTVA 5FTKA 2V6IA 1S0UA 1YZUA 4MYUA 2Q9CA 4MRNA 2C96A 2EWWA 1QBKC 4LPKA 1N6HA 5AJYA 4TMZA 3HJNA 4QBIA 3FTQA 4PPFA 2J5XA 1IM2A 2KBEA 4MRRA 1RYFA 4BFYA 4E09A 2K5UA 5KPDA 3X2SA 4TYWA 3IO3A 4D4JA 3PEWA 3SI7A 4CEHB 4RD3A 3T34A 4EJSB 1A7JA 3AUYA 3TAHA 4HAWA 5DHAA 2PT5A 5EZ6B 1QHNA 5DYIA 1P2SA 5TVKA 3BRWD 2ATXA 2ZROA 2MSEB 1ESMA 2ZS9A 1GZSA 2HJGA 3QIAA 2GCPA 3TKLA 3REFA 3WMFA 1Q1QA 3IDQA 3HR7A 4Q1DA 2OXRA 3I61A 2G1JA 3A1SA 1E69A 2FGKA 2NOAA 2P67A 1AQUA 2NO6A 4OI2A 1DO2A 2I4IA 3FHTA 1JEEA 1GUAA 2CJWA 4HDQB 4A8JA 2H8KA 3I92A 4Q47A 4QGGA 1NIPA 2FFAA 3THXB 5EXSA 4C7OA 4BEBA 2J7PD 3WHLA 2GNOA 5DO9A 4PTLA 1W44A 4E22A 1E0KA 1Z6TA 4RD4A 2PX0A 2QUZA 2YC2C 4JIMA 2IEZA 4LK2A 2RKOA 2WSSA 1NRJB 1E2JA 1TMKA 3P32A 4YDSA 3SOPA 5FBLB 3ZH9B 2ZVQX 4DDVA 4F91B 2GXAA 3U61B 2FFQA 1XJQA 3GJXC 3EWAA 3GLHA 4JLMA 5AJZA 1EGAA 4TQUS 3AP1A 1VECA 3CKLA 3FMIA 2JLYA 4AIIA 3IO5A 4KYIB 5JCZA 3BB1A 1NN0A 2JJ1A 1MO4A 1X8KA 4W9MC 1BOFA 2AK2A 2EWVA 2C9YA 3IUYA 4IW3B 3BFXA 3GLIA 2OXCA 4WXRA 4JLDA 5KSPA 2GBLA 1TQ6A 2ZI9A 3P4XA 4R7ZA 1RJ9A 3LO5A 4MRPA 1TUEA 2NZ8A 4R2IA 3SBDA 1LS1A 3K0FA 3TQFA 1GP2A 5JS7A 5KSYA 1JALA 4B3GA 1KNQA 1EX6A 2BV3A 2QMUA 3AKYA 4R2HA 3TRFA 1AGPA 2Z83A 5GJBA 3AVVA 5CIWA 4XD7D 1Z6AA 3CIOA 2R65A 1GVNB 2AK3A 4LJAA 3K9LA 4PZYA 5B58C 4BGDA 2KJQA 1MABB 3AVOA 3K9NA 4URVR 1MO3A 4ZI2A 1LF5A 3RAPR 4LZZA 4D0GA 1NSTA 4IOKA 3ND9A 5C4GB 4WZBE 3VU9B 4YMSA 5HKKA 1J70A 1HT2E 3CPEA 5DE3A 1TEXA 3L0OA 1NSFA 2ZYVX 3TK1A 2O52A 2WZQA 2VSXA 3I3SR 2XOKD 4FMDF 2ERXA 3U7EB 3F3YA 2ZJ5A 4QC2A 2WJGA 2JLZA 4MKIA 2ZJAA 4ON9A 5BXQC 1E1QD 1UAAA 4BPBA 2GDJA 3NVAA 5AWFC 5TB5A 3EASA 4IEIA 1S9HA 1CU1A 3B1YA 3GJ4A 4KSCA 3ADDA 4IOLA 2D62A 2NPIA 5C4MA 4TLBA 1NMYA 1Z2AA 5BW8A 3QF4B 4G5QA 1G7TA 5A4JA 2ERYA 4P32A 4US0R 3AVUA 2LKDA 1US8A 2C04A 2HJVA 4XSGA 5FUYA 3VKGA 1IJEA 3UATA 4LGMA 4I4LA 3FMOB 1NVVR 2W6IA 3P27A 4PC2A 4B75A 4IDHA 4Q00A 3K0SA 2N46A 2WJJA 1AGRA 1XMSA 2FWRA 1XD9A 2R62A 3IBGA 1QF9A 1WDTA 1LNZA 4BLPA 2IYZA 3IIJA 2QPAA 1JR3E 5FTJA 3RWMB 2CNWA 2WKQA 2OSBA 1ZU5A 2RAPA 4FXPA 4NTZA 1E2FA 4ZDKA 2JJ2A 1TAGA 3CR8A 5UKDA 4M9ZA 2J0VA 1W2GA 4RSGA 4DLXA 1XTKA 2G1KA 4XTRA 6Q21A 3RS4A 5AUOB 1QHYA 1ZM3A 2QPOA 4PPGA 2GCOA 2HUPA 4ERNA 1C1YA 4KSBA 4QFMA 2WM9B 5L3QA 1G3IA 4MRVA 4NONA 2VEDA 1M7BA 1SKYE 2CL7X 1KO1A 1N6OA 3P26A 4D82A 3VMFA 3X1YA 4C0JA 1YQTA 3K70B 3HU3A 3FGNA 5F9FA 1NJGA 1ZM2A 3A1VA 3BAFA 1Q1BA 2YNMA 3U5ZB 5JWRA 4KBFA 1E9RA 1TQ2A 2OBNA 3B82A 2BJVA 3RS5A 1GL9B 2IUTA 3QE0A 2HLDD 2O8CB 4QXAA 3K0EA 4F4JA 3ZGXA 1NVVQ 3EG5A 5GJWC 1VG9B 1E4VA 2QU8A 2OAQ1 1ETUA 1FNNA 1XXHB 5KO2A 4GOKA 2GKSA 2FNAA 2FFBA 4PQYA 4XH9B 5CM9C 3V00A 1N6NA 3QXSA 4KBGA 1ESNA 2PLFA 4HUTA 1QHSA 1KYIA 3LVQE 1IQPA 2ZS7A 5SZHB 1XBTA 1VG1A 3SFVA 3W8NA 1TX4B 5L3VA 4MDEA 2EFGA 3B60A 1ZIPA 1MOZA 3Q7PA 3KQLA 3THYB 1YR8A 1UKYA 4RD6A 2J1LA 4M1SA 5B57C 4Z51A 1ZNYA 4P3YA 1Z0DA 2OHFA 1T3LA 3N5CA 1UPTA 3GQBA 1G8YA 1UEJA 3FKQA 1NMZA 4HAVA 2KI5A 4TTRA 1W5TA 4KLNA 2IYXA 5C46F 4CT4B 4PAOA 5DGXA 2CHVA 2RGDA 4FINA 3SHWA 1EWQA 5HE8A 1RVDA 1NLFA 3EIQA 3FWYA 2IWRA 3MAAC 1AN0A 2TMKA 3KUDA 1BYUA 1KHTA 5J4KA 2DBYA 3Q72A 1SXJB 2WSSD 4QHTA 1XWIA 3GD7A 1XCMA 1TADA 5B2ZA 5JFGA 4CDGA 3TSZA 4IDPA 2EFDB 2FFHA 4QJ5A 3KUCA 5LBIA 4AKEA 1HT1E 4AG5A 2RCNA 4Q18A 4Q19A 2VP9A 4IJMA 1XNJA 1KI4A 3GJ5A 3QKSA 2IL1A 3WNDA 4ZCLA 5TV2A 4BFVA 2JJ1D 3RRNA 4LHXA 4A6XA 2A5DA 2GVZC 1G7RA 4ITRC 3S1AB 1J8YF 3TE6A 5GADl 1JQJC 1AKYA 4NKRA 3A36A 3OE7D 2F9LA 4IFBA 5TARA 4DCTA 5J4HA 3I5YA 3K9GA 5JECA 4TZ6A 1ODFA 2UVQA 1J99A 4UXJA 1OV4A 2W0SA 3FDIA 2PBRA 2O8FB 4AKHA 1CLUA 5FPKA 2IYYA 4HAXA 3G5UA 3A8TA 3AEZA 4M9QA 3FFBA 2P5TB 4G5OA 1DARA 3F5FA 1WE2A 2CL6X 2WPDD 3QUSA 4Q4JB 3WRXC 5JEEA 1TF2A 2C5LA 1IXRC 4Q1EA 1G291 3QXXA 1DPFA 2VHJA 2Q3MA 4NPHA 1DVRA 3DPUA 1FTSA 3EZ9A 4WW0A 5SZIA 4ZKDA 1XFAA 2QM8A 3CX8A 3GLFE 2PJRA 5IDVA 5HKKD 1QVAA 1T5IA 1JXMA 4K8OA 1NY6A 5H70A 4CF7A 4TL8A 4ZCMA 1P73A 2ZUBA 4B3CA 2J0QA 1HA3A 1VYVA 4ZI3A 2Z4RA 2ASEA 1NJFA 2A30A 2SHKA 2DPXA 5KNDA 4US1R 1H8HD 4RCZA 2XJ9A 4M4SA 5EP2A 4HB3A 5KUTA 4MYCA 4QBGB 4KO8A 4LV5B 3LLUA 3DL0A 4TZ0A 2ONKA 4FMDB 4N0DA 3WMGA 3LH5A 4L8GA 2ZYWX 2B92A 4NCIA 2IHYA 1VDZA 3NBXX 4WA7A 4MDFA 3EC2A 5FBQB 4TYNA 4OQXA 3X1WA 4CEIB 3C4JA 4A2PA 2QL6A 1G5RA 4PPQA 1GRQA 2DR3A 1BIFA 2NO7A 2E1RA 3AVQA 3K9HA 4HZUB 3ECCA 1FQKA 1S3GA 5JCPA 3FOZA 5JMTA 1KKLA 1DOAA 4V0LA 1MV5A 2WJYA 1TQ4A 1XP8A 3U3RA 3NHAA 3BWDD 3V9PA 3L82B 4FW9A 4OHVA 1KO5A 2CNWD 1G4AE 1P72A 2IEYA 3TUIC 2JLXA 2ZE7A 3EPKA 4JZKA 3C16C 4A0FA 4JLJA 5EP1A 4AYWA 1P2UA 2PMDA 2E9SA 1QVRA 2BBSA 3BXZA 1R0YA 1NBME 1E9SA 3VR4A 4UNRA 4OHXA 1U9IA 3JVVA 2PEYA 5HZHA 5K8TA 1E2NA 1II9A 2AHOA 2CXXA 4PQFA 1MO5A 1II8B 2W0MA 2WWFA 1H8EA 4Y0VA 1J7KA 3K8YA 3GLGB 3CR7A 4BUJA 1G17A 3V4RA 2ZJYA 3CH5A 4A9AA 4GOJA 4MRSA 4LWZA 4EDHA 5D3MB 4DDTA 5KHOC 2IA5A 4OK3A 1D9ZA 2R44A 4YC7A 4N0EA 2VP6A 1JBKA 4B32A 1OYYA 4OKSA 4B2PA 3B85A 2IS4A 4LRWA 4L9WA 4V0MA 2ZITA 4MITA
chains in the Genus database with same CATH superfamily
1XVAA 1KBQA 2JI6A 5PNTA 3ZE7A 1TT7A 2X5JO 2RGGA 2VAMA 3PUJA 4HDRB 1XQ6A 4MR9A 1JG7A 1P9RA 2OM2A 4LDJA 1XDWA 2ORVA 2P8JA 2W48A 4I19A 2GK7A 1JBEA 3PRYA 3BFVA 1Y6JA 3UCXA 1T4DA 3N2GB 5B64A 4B3IA 1JBQA 1YOVB 1OV6A 3VQTA 4POAA 1W4CA 3U9TA 4KR3A 3F73A 1BHJA 2EJVA 3OOEA 4DZRA 3TRHA 3IP8A 1C3OB 4WCFA 4YP5A 2ONCA 5HRCA 1OXUA 3L6EA 3TZ6A 1MW8X 3I01M 2V7TA 3R44A 4UU7A 3PR1A 1P5FA 1Q6YA 1P1HA 4RABA 2X2OA 4WEOA 4CMCA 3RS7A 4G26A 1TCCA 1UKBA 1VB3A 3HBAA 5DMHA 2E7ZA 3EQ9A 3GROA 2ZTUA 3CVOA 1Y3IA 4RZIA 5ALEA 4DCJA 3W3AA 5AVSA 2ZIEA 3IPLA 1CEEA 1JWBB 3EA4A 3HCFA 1CY6A 1TQDA 3T3PB 3D8TA 2BFDB 4Q3CA 4S1WA 4NDZA 3FKSA 1OU4A 3O47A 2B4AA 2NNLD 4YBZA 3RRBA 3L7MA 2R48A 3IBTA 4EUFA 4YT4A 4KU4A 2AN5A 3FMGA 3ZHXA 2EQ5A 1PJQA 5KCZA 1FX1A 4RELA 3THXA 4LY3A 2HZBA 1CEQA 3UAGA 1WMSA 3FZQA 1PR1A 3NWOA 4UATA 3ZV4A 1ZD3A 3Q7IA 3K9CA 4F3RA 4UU0A 2EP8A 2XUPA 1TTHA 4IXDA 4MWBA 4J9UE 4E4YA 4MVJD 4C4TA 5K45A 3RC8A 3D9QX 3K1JA 1XAJA 3UIEA 1YJXA 2P90A 3RSOA 3TZQA 2FG5A 2V4UA 3HO6A 2Q5QA 1HI9A 1XXHE 2GFHA 2UZ1A 3IUEA 4DRXB 2QJOA 1JXOA 3AHFA 3I2JA 2PMCA 3MLBA 5EJ4A 5BUZA 4RCYA 3RIGA 1SHZA 4HNRA 3CLTC 1MC5A 4J94A 3MXTA 1YUBA 4X6YA 3A6HA 3UUFA 4M8LA 4BKUA 1ECPA 1XUOA 4GM0A 4YMHA 1WZEA 1SOWA 4QHYA 3FRJA 1O5TA 5I7WA 5L9AA 4A8PA 1U2GA 4DOMA 2PD4A 3OE4A 2QTAA 1XPRA 1K7YA 2IE0A 4P81A 1JDBC 3FDFA 3HM2A 3MWDB 3UNXA 5EZYF 4IL5A 5AXAA 5TGZA 1WKBA 1KBZA 1MMFB 4DCVA 4FHCA 1DC6A 1SA0B 1XCGB 3C3BA 4H1UA 3K0CC 1LD3A 4HLCA 3UTDA 4RTLA 5JLJA 2BM9A 1VIAA 5J2UA 2H2WA 2CMHA 3C4QA 2NU6B 4PZUA 4N47A 4F8JA 3JQBC 3LSTA 2G40A 4GPEA 4MW7A 4KFSA 4WZBB 1DMRA 3M7IA 2I9PA 1LSSA 4TPKA 1J21A 1CZHA 3KXPA 1K8QA 4Q4HB 3UM9A 2N42A 1N2OA 4L1KA 2P1RA 4C5AA 3O73A 1IN1A 2FSGA 3NEJA 3N2KA 3P97A 1FJXA 3UA3A 1P1CA 4Q3DA 4QO7A 2W7TA 1WETA 5C31A 1YQGA 2FAXA 1I3MA 3MHPA 1Q20A 3DTVD 1J0BA 3DGEC 3LQ1A 3BFKA 2QOEA 2C5FA 1RRFA 3UH1A 1BVUA 3FYTA 3MUFA 1R12A 4N5DA 5TSDA 3D6TB 2VQSA 1EFTA 1VPVA 4Z3DA 5BSGA 2FE1A 2AFHA 2WFZA 2XRYA 3M3HA 4J8PA 2QBYB 1FIUA 1BTOA 3KK0A 5IABA 3MT7A 3VRHA 1HUQA 2IPNA 3QF4A 2V0GA 3TDMA 1Q1AA 1Z7WA 2PEZA 2EXXA 3OLWA 2PGNA 2PS0A 2VF2A 1UC8A 3DMHA 3PS9A 2J5QA 4MWSA 5JADA 1ADJA 1IU9A 1CIPA 2REQB 1EP3B 3PC7A 3UKJA 2RK4A 1ESZA 3NTLA 4J49A 3EIHA 3MILA 2H4ZA 4PO9A 3QJ5A 4TV9B 3T3EA 3UMVA 3JRXA 3V7UA 2FR8C 2PKYX 1RKXA 2O7NA 2PX5A 1BH2A 2R8RA 3AEQB 1HKHA 1N5DA 1TK2A 5LP6F 5CT6A 1A1VA 4Q15A 2C95A 5KJEA 3GEGA 3Q8XB 1E3WB 4N41A 2I2XB 4GVXA 4BV2A 2LIVA 4GOXA 1EHYA 1LV7A 3MTBA 2PR2A 4CQMB 1T8RA 3NUZA 4MUFA 3O1LA 3WQQA 4ONEA 5IAAA 2OAP1 3UPUA 2BLNA 3A25A 3FBTA 3L7JA 1EB8A 1UXJA 3BRQA 4FFLA 4FQ5A 3OSUA 3VHXB 4BQNA 4ABTA 5I01A 4KNYA 3RNOA 1SWVA 3E5NA 4WKOA 2C5SA 1DZIA 1LBEA 3QITA 1YL6A 3RTGA 1DS6A 1PRYA 2HQOA 4CCAA 3EGVA 1NXXA 4AP5A 4D0RA 4WA8A 1ID8A 2PGIA 3GFVA 1C0LA 4C3OB 2PMKA 1WDMA 4BTEA 4K05A 4CPDA 3CURA 3LUHA 5A5FA 3DOOA 5ALVA 3CKMA 3MS7A 4UM7A 4DXDA 2A35A 4MUAA 2D8MA 5EMKA 2A9PA 3MCVA 1P44A 2ADMA 4UVEA 4B73A 4P3OA 3AEUB 4E4TA 1JIJA 2DGDA 1R5OA 4FT2A 4JBGA 2EG9A 421PA 1U4SA 3Q3CA 3OJEA 3G6KA 3OE1A 3EXIB 1YFKA 4I4TA 4OXXA 4Y9UA 5COQA 3R3ZA 3EX7C 5KMGA 4PZPA 4WN3A 3KOXA 2IW3A 1F8GA 1V3VA 4JYBA 4JBYA 4Q82A 5K8VA 3L79A 2PO5A 1JSZA 2VHTA 4JEIA 4EF4A 3IAM6 1RWBA 4YMGA 3KWLA 1EE9A 2EJCA 2LKCA 3IAS6 3A9RA 3RVBA 5H59A 3PNQA 1FRZA 1IPEA 3EOBI 1KZ7B 3KELA 1O0BA 3WLJA 1JDVA 4UAUA 3NPMA 1P60A 4K9OA 1YRYE 2IHNA 1O57A 1E1RA 3AU8A 3LX6A 4P3NA 3DCYA 3I76A 3ROGA 5I7OA 4JITA 3DEFA 4R16A 3BIOA 4TT3A 4AI6A 2J5RA 2QZ9A 4KDFA 1DJNA 2Y1CA 2A1TS 5DK6A 2ZS8A 3ONDA 3QMWA 2Z30A 1TO1E 1CYDA 1I4OA 5ED0A 3E70C 1OLSA 1VJ1A 1U3DA 3ECAA 3PUKA 2A9FA 4QVGA 2RARA 2ISSD 4KX3A 1JKJB 1JPJA 1JL3A 2ZIWB 2IQ5A 1Z7YA 4IQ4A 4NYJQ 5DTIA 2NZ2A 3PNBA 2Y8EA 3IP7A 5GQSA 3RTBA 1UXOA 1KYZA 3IQEA 3VKVA 5ALUA 5AI4A 2HA3A 1M8JA 2Y1WA 4M1OA 1PBNA 3UMJA 2GCEA 4MJLA 1DLIA 2Z95A 1WUIS 4FFBA 4PLFA 1SXJA 3GEHA 3UJCA 5L7TA 4DWWA 4TTAA 2ZR7A 1KMNA 1NONA 3V7YA 5F78A 2HLDA 2OO5A 3VAAA 3ZQUA 4GXQA 3CQ9A 4HAOA 3KXDA 3DE1X 5K0LA 3ESXA 4RVUA 2FMHA 1HEYA 1XD8A 1DRKA 1YZKA 5TF4A 4MUMA 1CZLA 2QLTA 3C8UA 4XIGS 4XKJA 1XNQB 1KJJA 2GCNA 3BN3A 1KI2A 1Z4JA 1GR1A 1VCMA 3NHSA 1JKXA 3DCNA 3I04M 1U2GC 3OUUA 1O6ZA 1X8JA 2AZMA 4K9RA 4TQGA 2WU4A 3QU7A 5JDCC 1YU9A 2BFBA 1I7QB 4YXWD 3AH8A 4FN5A 5LOVA 4IWNA 1IZ9A 4KWIA 1E0JA 4NZNA 1GN8A 2XBLA 4MAAA 1RHRA 2YVLA 3UMFA 2H1VA 4IO0A 3T0GA 4EDFA 4GZ6A 5LNK1 2PSEA 2HBZA 3D8RA 3A1DA 4DQKA 3VR3A 5THQA 3KX2A 3VI4B 4EG5A 5EZYB 2VZ9A 1JIQA 1W93A 2XXJA 2X0KA 2QLMA 4MQ5A 1T2EA 3UW3A 3F98A 4BUCA 1ZBQA 1AGNA 2PSDA 2ZTSA 3BCRA 2OUIA 3LQQA 1QIHA 2A67A 1IZ7A 2WW8A 3CBQA 3Q9UA 2AGVA 4S35A 4CM4B 1B0AA 4Y1EA 4TXJA 4BMPB 3ET4A 3I6ZA 1M67A 1A9RA 2H06A 1YULA 2IF2A 1P77A 5H3LA 4LF9B 4FVTA 2BEVA 2VJCA 2DHRA 3PWTA 5K6AA 4L6IA 4CJXA 3G8AA 1DKNA 3FJYA 1M6EX 4HATA 4Q9AA 2F64A 4CV1A 5C7IO 1GSAA 1J24A 5DXJA 5JBIA 5AXCA 5J5CA 2PNJA 1ZK2A 2QQEA 3HRIA 3OA0A 3SLRA 4LISA 3DD5A 1JECA 3OOSA 2V3VA 4HYYA 3WKEA 2G9NA 2WG2A 1E4EB 4FC6A 4LDQA 2DKFA 2BEJA 1B2LA 3CVUA 5E1BA 1Y7IA 5LJIA 3AVYA 1BKYA 4O2BB 4LC1A 4UNSA 1WUKS 2Y1DA 3KYCA 5ER6A 1PZXA 3NNDA 1JJVA 4YLGA 5LCXA 4XYEA 3U1VA 3OE7A 3LTNC 1S4MA 3A58B 1E1MA 2QXUA 5C8YF 4OQQA 4XSHA 1E9AA 2PXHA 2ZIXB 3GF4A 4JLKA 5DVZA 4L5JA 1S2DA 3AU9A 4M36A 4V0RA 4QQ8A 5C34B 4INAA 4HEQA 1NZDA 1ZC4A 4BQRA 3DBHA 3GP5A 4MS4B 4I9UA 5CM2Z 3GVXA 1UBCA 4N65A 3AGPA 2E87A 3NEPX 1Q17A 3NTQA 4LJ4A 3PQ3A 1UJ4A 3T4XA 4AJ4A 5FA6A 1QRDA 5BVHB 5SZKB 1QF7A 4YV7A 1COZA 5LP6B 4J1QA 4KMSA 5TPWA 4C1NA 4BX3A 4E08A 2ZI5A 4ILEA 4DZTA 3KQSA 3J7AC 4LXTA 4EA9A 1LLCA 4LJKA 2ZUDA 3TYXA 4EPWA 2X8AA 4ZK2A 3AI2A 1YI8A 1U7DA 1QZ3A 4OB7A 5ALWA 2BFEA 1PQYA 3D8BA 1MB9A 2BFMA 3E1KA 1EEXB 1N8TA 3PITA 4YDHB 2WYHA 2FOXA 2XGGA 3LDAA 3LY8A 4HDNB 3BTOA 1R0ZA 3I2FA 2GZRA 4DMHA 5C5DA 1OH7A 1OWMA 2ZJBA 4QDXA 2W83A 5DN6D 1TF7A 3RVSA 3GLGA 5CHYA 1SULA 1CS0A 1VE9A 2G88A 4HADA 1AA9A 5D3MA 4Q1BA 5L8VA 1MGOA 3RHSA 4LF7B 5FA5A 2Q2NA 4R01A 2NQ2C 1VRCA 2HXYA 3LBNA 4WEQA 3Q3JB 4MH0R 2KMLA 4W7IA 5GGXA 1KEEB 5BR4A 1PK7A 4IXTA 2OCGA 2VJOA 4EJ6A 4F85A 1FSPA 3E3OA 4HDRA 4TS1A 4UQOA 5K6TA 4LNAA 1TM1E 2DPHA 4QA9A 4R68A 1XZBA 2YMLA 5CLIA 5EWMA 4BMZA 1WOYA 2BMEA 2YVQA 5HJ2A 5E8RA 4KQCA 4FD3A 5CNMA 5B1YA 5M29A 5MFZA 4P7FA 2GKOA 1I01A 1DBPA 3N2GA 3WLIA 4BEVA 1KBOA 1YOVA 2QTWB 2C94A 2FN7A 3IQIX 4JQOA 3IUMA 4BNTA 1FVHA 1C3OA 1NVKA 4JVNA 5CTAA 4QASA 3LYAA 5EC8A 2Y1XA 4LI0A 3CZRA 4WY2A 3UZUA 4LX0A 3MRXA 5CDHA 4M37A 5AJHA 4URFA 4HOYA 5BV8A 2FUCA 5TJHA 5T5QA 4QVIA 4Q7QA 4NH4A 1U0SY 1CETA 1L4FA 1XROA 4JVLA 1OZGA 2DR0A 4NESA 4QYWA 1ISGA 1FUYB 1XD2A 2GZ2A 2HWXA 4OP3A 4AJJA 5B6PA 1PUIA 1QPGA 2OCKA 1SXJC 2QVBA 2Y2UA 3HB5X 2O50A 3OWHA 5CVCA 4QLBA 3JAKA 2D0IA 3TLKA 1TLLA 3FSEA 3BGWA 3FFTA 2OE2A 2PGOA 4XASA 4RF5A 3VU3A 1T2FA 1K5GA 2VLIA 5IT5A 1L7EA 1Y8CA 1XMQB 2FPSA 4RLFA 3P9PA 1BEZA 4H7IA 3IIEA 3C3MA 1AURA 1G5IA 3VR4H 1Z37A 2WWXA 3DA8A 5C32A 1U0HC 2JZOA 4QOSA 1AQIA 1EI9A 2OR3A 4ASUD 1HYGA 4HVAA 3K2EA 3OIVA 3DTNA 2WWYA 1CQPA 5AOCA 3MFYA 4HB4A 4YRLA 3FRHA 1YKFA 4B34A 3R5FA 4TTJA 4DRXA 1A8QA 3CRNA 3IT0A 4RY0A 2C98A 1S3FA 1ECLA 3A3PA 3ZPXA 4DCNA 4H4DA 5HQJA 4GX0A 2ACKA 3NHRA 5IH7A 1ISSA 3W6PA 4QULA 2RMKA 3PQ4A 4HLQB 4KQXA 3RRFA 4ZALA 3QXJA 4PYJA 2WSMA 2CNNA 2EYQA 1XG5A 4RSHA 3JR3A 3R2JA 3VOTA 3H1TA 2A5LA 3W04A 3LVBA 3ERCA 4OKNA 3FHLA 2X3UA 3DMRA 4I08A 4R69A 3M1IA 1O97C 1N5IA 1E3QA 4LKOA 5TQ0B 4ALJA 4E1AA 3INTA 2B1RA 4GL2A 2VI5A 1NE7A 1BVYF 1NVFA 4TKLA 4X66B 3KZCA 3OPXA 3MWDA 2YBEA 2A5JA 2YINC 4C0AC 3PQFA 4KH1A 4LJLA 3RU3A 2HN9A 4M7PA 2ZRJA 2ECFA 1SA0A 3NC0C 4J07A 4D4MA 3ADPA 4KIFA 1O77A 2PYDA 5JDIC 3W9SA 4TKZA 4QBHA 3CUKA 3TEJA 2BGKA 2FX5A 2NU6A 4IMIB 2PZJA 1YBFA 2HC9A 4UMFA 4B0OA 5AW8A 1JDJA 1Y5LA 1NUTA 2FQQA 1JSRA 2VN8A 3ZVLA 3DXXA 5FLEX 5KDDA 4Q3OA 4Q4HA 1SKUA 1W2WB 2BZSA 2YRWA 3PFHA 4NDAA 4XUGB 3TBKA 4TTQA 3C5VA 4DSZA 5BQ3A 3ELWA 3VTAA 5ADHA 3ASVA 3BT7A 3ZY2A 1C9DB 2WY2D 3D1JA 1NY5A 3FI9A 2H1SA 2GS9A 5FEUA 4J2TA 1I6LA 1L7PA 1NSYA 5DLEA 3TH5A 5AM4A 1GWNA 1O0SA 1OWPA 2A2ZA 2IEIA 2Y1EA 3LDHA 5HR5A 1VSUA 3OY2A 1IN7A 1ZOPA 1NXVA 2OLEA 4R9UC 4B81A 4I4NA 4EAQA 2QBYA 2OB2A 1QZXA 5FHRA 4BIMA 3TPFA 2Q99A 3CMMA 1BS1A 3FNGA 1IVSA 3GJRA 5FUWA 4JOQA 1NQTA 3KOUA 4HR7A 1MFZA 3LL4A 2C4HA 3UT0A 4ZZ3A 2EZ8A 4OH7A 1ZHHA 3VGPA 4M9UA 1AVTA 2REQA 1XRJA 2GJ9A 2R6GA 5HEKA 5C8YB 4JFRA 4TV9A 2VHQA 2VWHA 5KREA 4UW9A 2FPRA 1LV8A 1R9MA 3G5LA 3K35A 3QE4A 1AS0A 5DGCA 4GI1A 1VL8A 3EPRA 4J16A 1YQ9A 3AEQA 4E13A 3ZD7A 2Z1MA 4J0CA 5CB4F 3FPEA 1NAHA 4U7FA 3KQKA 2RHMA 4I6EA 1LBIA 5JISA 4YRFA 1E3WA 3B8HA 2FMXA 3BQMB 1JYFA 3ZLBA 3IKJA 2F2TA 1Y98A 4IWYA 3ST7A 4BN0A 4CQMA 1AX9A 1I2CA 4A03A 4F9EA 1T9DA 2YXEA 4TL7A 4UAGA 5F9MA 4PEVA 3VHXA 5JRZA 3ABOB 5HUJA 2JH8A 1QE0A 4DEVA 2X77A 2Z4TA 5LWQA 2L18A 1XQYA 3GN2A 4PR0A 1UFKA 1T5SA 3ZU4A 4KFTA 2ZYHA 4PBRA 5C51B 5BSHA 1JU3A 5HYVA 4PG5A 3VGJA 3EFOB 5ED4A 10MHA 5ECGC 4DDKA 4KYTA 4TQAA 3TPZA 3WE7A 1VHLA 4UBMA 4WWHA 3WGUA 5J4VA 2FX3A 1M34E 3ILYA 5FWAA 4RTKA 3EN0A 1D09A 2Z8YA 1Z6YA 3GQVA 4OH1A 5ABPA 3K6SB 1HDRA 5GV7A 3UG7A 1SC6A 4A6EA 4E1BA 1PZFA 4FYHA 1IK4A 4YT5A 2B8TA 4H0CA 4MIOA 3B1WA 4X8LA 4BVEA 4R2JA 2VDMB 1W46A 2R8ZA 3DHEA 4OG2A 4F3KA 1KTIA 3C3CA 2O54A 2CBGA 1BU5A 5BV7A 3W9UA 1P18A 4QXMA 1CQXA 4R9VA 4X7MA 3LQRA 4DW8A 2ZP1A 1HQKA 3NCTA 4DR7B 1LFDB 1I30A 1YRWA 3X3HA 5C8DA 5IDWA 4NYMQ 2TMDA 2Q4TA 1TGVA 3ES9A 1G8PA 3BMCB 2JD1A 3GLIB 4GKKB 4UMEA 5K0ZA 3BJZA 3FMPB 1SJ9A 4RIHA 3IYLW 4ZV9A 3RIYA 4AZSA 1JVSA 1QH1B 2OCXA 2NUPA 3EW7A 2M98A 3MFQA 1G5QA 5LB2A 3QV2A 1VSQA 3QUCA 4JEUA 1QV9A 2IY8A 1IY8A 4UUMA 5JHGB 4DR4B 3ZKAA 1GRRA 2BDUA 2PZ8A 2EL7A 2V1XA 1R4AA 2X1MA 3H04A 4LCBA 3CNQS 1P1KA 2HU2A 4KGXA 1PR3A 4P58A 4YR9A 5A4FS 5B55A 4JKYA 5CEFA 3B5JA 2OHVA 1ZNQO 2CMFA 2JCBA 2QN6A 1JKJA 4XFDA 3R7SA 3ZV7A 3GZJA 1SKQA 5LMCA 3CXRA 1GTSA 1KY3A 1UBSB 1YMQA 5IPFA 1KVQA 5CX4A 3PWSA 3K2BA 4N03A 1RLMA 2J0SA 1Y3DE 3ORHA 3A4NA 2WYWA 3WB2A 3CINA 4BVKA 4LDRA 4ZODA 1JMKC 3WWOA 2KPOA 4BX2A 5GY7A 3SXUA 2H1RA 3WA7A 1CULC 4R51A 3KUUA 1M7HA 1GGFA 4PYIA 1HY3A 1SK8A 1N6KA 3FCAA 3CNLA 3WNVA 4OQFA 5HX7A 5DGDA 1I6KA 2WNHA 3L4EA 2P9QA 2ALJA 1YF3A 4UDYX 2R6ZA 3HJGA 2EFCB 3NP9A 5ALDA 5KWSA 1TJPB 1ZNXA 2XUGA 4OI4A 1HYBA 1IDN1 2GD2A 1GFIA 1E79D 4GO1A 3JWIA 3LBIA 4FMBB 1SC1A 1JAXA 3AKCA 4JQYA 2WT8A 3FUVA 4DCOA 1G3MA 4L3WA 3GDOA 5BPFA 5E3IA 4ALNA 1C7RA 4ZRDA 4B31A 2JARA 3IV7A 5SY6A 4L4YA 3DNFA 1PUJA 2ZE5A 4CLDA 3GDFA 2FUEA 1ZHOA 1DWUA 4IH1A 4DY4A 3RUPA 4EKNB 1IG3A 4H1VA 4M49A 2NZYA 2QKYA 1KQPA 2XTNA 4JLBA 3S44A 4KAXA 5JMPA 3ZD6A 3RUDA 3OHSX 4B33A 1ONSA 1Z47A 1EAYA 4DLRA 3DM9B 2OV1A 3K1YA 4LS3A 4U8GA 3RABA 4JKIA 5B7PA 1NQXA 6ABPA 4OX9Y 3MGCA 1KAMA 1MORA 2ZRNA 5EZYA 1N0WA 1OWOA 4Q1CA 1CQJB 1NVMB 4NEGA 1P7CA 3U4DA 3TRJA 2HGZA 5TMPA 1IMJA 3JZIA 1YI0A 1LPNA 3UGKA 5KTPA 1ONPA 2G07A 3PWZA 4IIEA 1IXKA 3A3YA 1AO0A 4CM4A 1L5MA 3TFOA 2ANCA 3TQSA 5BWBA 4X85A 1IFXA 3PA6A 4IHQA 2VYQA 2WLTA 1YZLA 3M89A 2ACVA 4HDOB 3VHRA 2PQ6A 3C45A 3D7RA 4XDZA 1LJUA 2GN6A 1XA4A 2B3DA 13PKA 3LK6A 3NAZA 4G9BA 4HXFB 4J0HA 2YOFA 3MJ4A 2YZKA 5IFLA 3TECE 1Q3HA 1M1UA 1XB2A 3FB4A 4JMPA 2JFZA 3G17A 4ZP1A 4CMHA 1J0AA 1KL7A 1QKJA 3O2SB 4RK5A 2FEKA 4G25A 4K9DA 2D6FA 1I36A 1J5PA 1NUUA 1Q7CA 3DBRA 1E4EA 1T34A 4GRDA 3H1AA 4EL0A 3KQWA 2YH2A 2QXTA 3DMGA 5DCWA 2OV4A 1VI2A 3UWOA 3SC4A 4O2BA 4ZOEA 2R00C 4D9HA 1O6FA 5BN1A 4FJ1A 4DL9A 8OHMA 4MP3A 2QQ0A 1U7OA 4JNCA 4C0QC 2I4TA 2ZRGA 5JWOA 1PX2A 5EYPB 4GMDA 4J16C 2P1ZA 3WG9A 3IOMA 3N74A 2P9CA 2EV9A 4FHZA 1J5XA 2ZIXA 3KDAA 2QR2A 2ZAGA 1A5AB 2ORWA 2RHCA 4YACA 1HE8B 2VPWA 2VBFA 3AUSA 4MS4A 4JLPA 1FJGB 1NQVA 1NOJA 4DB2A 3G2HA 2I2FA 5GZ1A 3OX4A 2Y3IA 1DEKA 3HVJA 4G89A 2BGGA 1JR3D 1NW9B 4K87A 3C3WA 1I7SB 5BVHA 4MHSA 3RV4A 3EDOA 3L8EA 5CB4B 1GAWA 3D02A 5LP6A 3HBNA 1BU8A 4MRAA 1TQ8A 3B3QA 2I0FA 2NW6A 3T3HA 4DLKA 2HCFA 3DPIA 3EQ7A 3F8SA 3O2NA 5EJ6A 4ZCIA 2XUFA 3FOFC 2X9VA 3HHPA 4BYGA 2JAUA 2LDBA 4E14A 4OGFA 1EGHA 2R2AA 2ZPUA 1IZYA 3E03A 4IS2A 3IQZA 4PO1A 3OM9A 4LMAA 4I3GA 2QYHA 4PG6A 4ZVPA 1LLQA 2I7TA 3KLPX 4M1YA 2XCTB 3K73O 1P9NA 4UNNA 1ML3A 2WUFA 2ZQZA 3HZRA 4HDNA 2C2MA 2UVDA 2QZZA 2VHEA 5M2QA 2ZBPA 5D1NA 1GCUA 2ODWA 2GUGA 2OA0A 3UBMA 3L7DA 1SZPA 4DCUA 3E9NA 1RLOA 3HHEA 2PUVA 4UFNA 2HTFA 4OB8A 2AMLA 1ID1A 5IZCA 1FS4A 5KSOA 2YWXA 5KU1A 3ZWDA 4WKBA 1KDZA 4BN5A 3T7KA 1KDTA 3OAAA 4CETA 5I9IA 3QKSB 4B8YA 1KEEA 1VLHA 1VFPA 2HLNA 3RFVA 4F1WA 3WLEA 1NYQA 3KSBC 5JNSA 1PE0A 1KI6B 1LLUA 2IX9A 1LWOA 3N0VA 2IFTA 4N3BA 4OHBA 4D92A 1Q0TA 1JEYA 4H77A 1XYGA 4KMRA 5EN4A 3K9FC 3WLLA 5GJCA 2VHXA 3D8NA 1YRAA 2AL7A 2XQGA 3ILSA 2QNRA 5GTDA 5A03A 1PJ8A 1B3BA 3TSWA 1EXNA 5J47A 2IGBA 4TT8A 3V5NA 1Y7TA 3K0AB 5P21A 3KLBA 1ZXLA 2BR3A 1Z36A 1HRKA 2B36A 2FSSA 3E3LA 1N3IA 4NOKA 1P2TA 3VSDA 4O3MA 4Z9AA 1CKEA 4E2FA 5KQMA 4K0RA 1UANA 1J22A 4Y8VA 1WB5A 3I1FA 5IT9A 2J48A 3UT5B 5JNRA 1QNFA 2BC9A 3IOEA 1YGPA 5IX8A 2DSNA 4QU0A 1W8IA 3UMRA 4F04A 2QD3A 3T95A 5BQFA 2CLSA 3L8GA 3JQRA 1HE3A 2H2AA 1UJBA 2C8LA 1JPUA 3ELUA 3ORSA 1D1QA 1L4HA 1U0TA 4RBNA 5KC8A 4C89A 2C31A 3D3WB 3N0TA 4V0OA 3I4FA 3ICQB 1KNXA 1XQVA 3CO0S 1PN3A 1DAEA 4O6VA 2Q7OE 1GCIA 7AT1A 2ZUTA 1A8SA 5F64A 2NV6A 3IEPA 4LXIA 3GLHE 3N8NA 2R87A 2EOAA 2M6RA 3KOZA 2GI4A 3GR6A 2FSPA 5JXIA 2QYSA 5JJBA 1PG0A 3HH8A 1N3BA 5K0NA 4ZICA 1ZUD1 2WABA 2W6NA 1YCHA 2R96A 3P8ZA 5FOUA 1SCKA 3QV1A 1WXDA 5DM60 1CUXA 1GADO 4PLZA 1N2CB 4UM8B 3UWDA 4E5SA 5I45A 4YMIA 1YK0A 4FD2A 1N34B 1CUYA 2GM3A 5T7BA 2O5EA 2J5KA 5FEMA 1T2VA 3ENKA 1EWKA 5LXTF 1KE1A 3CW9A 2AE2A 2ZRHA 4DM3A 1F8FA 4F38A 1W4BA 3RJMA 5TQ0A 4HX9A 1PU2A 2JI7A 5TRTA 2D0DA 2I71A 3N05A 3SC6A 4PZAA 4AU1A 2P5YA 1DQSA 2XYRA 3LC0A 3WGIA 2A8YA 3LHKA 4F5DA 3F4KA 7YASA 2VDUE 2DQYA 5EWLB 1CJCA 1PNRA 1BXGB 2ZTHA 1E77A 3BXFA 1E32A 3ZTYA 5B7NA 2HH9A 2YV5A 1QDUA 1J9ZA 3CRW1 3NIFB 4M8SA 2G17A 3UF0A 5CH3A 1T0JB 2JPDA 3QUBA 1MF7A 2I6SA 1BN7A 1EFPB 1PV1A 4OREX 4MQMA 5AW1A 2P2ZA 3I6QA 1EP1B 2QX9A 3F74A 2PBFA 3O4HA 4K6MA 5E9JA 5HG0A 1IHUA 4PAMA 4DYVA 1QFJA 1N25A 1OFUX 2H1HA 2VT6A 3H2JA 3H2IA 3F8TA 4CNBA 5SYAA 3O2QB 2HHAA 4HWTA 3KPWA 5THKA 3TMYA 2GWHA 2ZJ8A 2V7BA 4F93B 4DA8A 1KDPA 3AFHA 3SBEA 4N3AA 4E6EA 2WUEA 5TS3A 2OOSA 4ZT2A 1V96A 5ALOA 5KJ1A 2VF8A 1ATZA 1EK0A 1SUPA 2NSJA 2XCOA 5H80A 4OBBA 2D06A 3A3OA 3N0RA 4M54A 4XRRA 5CXSA 2CK3A 4ZV7A 4TS4A 5CXUA 3SC3A 3RBXA 5GZ3A 3V7WA 2IOQA 2Z3WA 2WP0A 4M9SA 1XZPA 2P9JA 1Y6FA 4E4RA 5C5CA 5C8YA 1RBYA 3FGZA 2D5LA 3F49S 4Z4FA 4DKJA 2DBVO 3PJDA 1L5GB 1XMVA 4F5WA 3MUOA 1JA9A 2PX8A 1E60A 2EZ4A 5K0BA 4P98A 3BCSA 3U60B 1TFRA 3H2HA 4U7DA 5BYKA 3AINA 3B1JA 2ZANA 2P0EA 3FMFA 1OHHA 4G5GA 1ABBA 1K7EB 4HVLA 1AK1A 3V7FA 3B52X 1DAIA 2HX1A 4G5HA 3TGPA 1AS2A 1WUYA 4MPPA 4Y2XA 3SOZA 4X7PA 2EFYA 1PL0A 1OXSC 3ZOKA 3BSFA 2OFPA 4OLBA 3BD7A 2HDNB 1FDRA 5HBRA 2YDYA 5BRJA 3LKVA 3OPQA 3EZ6A 3QPUA 5F7ZA 3N8KA 3CHYA 4Z49A 3H9JA 2HAEA 3BWBA 1TM2A 5BN4B 2CT8A 3KTDA 1X7YB 3O9ZA 4IZ6A 3K71B 3J81A 5IZCC 1JYSA 2JD0A 5LD2B 1VOTA 4F1JA 4EY7A 2JFBA 1CQZA 1FS5A 2H5EA 3ECSA 3EFOA 3IJ5A 2J41A 1SG0A 3OURA 1HE2A 5H4GA 3GCWA 5KNBA 2VKTA 3U7GA 4C78A 1E2QA 4TV8F 1YR3A 2VDPB 6LDHA 4IUYA 4CEIA 3AY3A 4ZAXA 5LQRA 5HILA 4Q4LA 2GEUA 2C92A 3WNBA 3OTQA 3K6SA 1A71A 4KWCA 1GA6A 3NHLA 2WU0A 3O4GA 3PGJA 4YVFA 5HIJA 3MS2A 4JR1A 3T52A 2W2LA 2C2OA 1KU6A 3WYGA 2X4DA 1AQYA 1G19A 1PCXA 2C9ZA 3I1IA 4R31A 3RAGA 3T7CA 4ZU1X 3PGKA 4ZO6A 2PCLA 3IA2A 1J56A 1L7QA 1N7HA 3LFUA 3E82A 2P5SA 4DJEC 1FUEA 3TDKA 1C7ZA 4JZYA 1QUEA 3WQBA 2UDPA 3P9YA 2XD9A 3WYAA 5JSHA 1SC3A 3GLKA 4UFOA 3S5UA 2XZLA 1BHO1 1GN9A 3EXG1 1PIWA 4IIJF 1BYIA 5BV0A 4JC4A 4D46A 4KR6A 3AHJA 1SD2A 4I8IA 4N0QA 4URYR 3ZDXB 1NDQA 1BGVA 5G2OA 4ZOBA 1QH1A 1QTNA 2E4WA 3UQYS 3W79A 2VLBA 3UVEA 4WOCA 4DLLA 1GZVA 2QN8A 4P5EA 1F0PA 4KQHA 4IDEA 3CVWA 1L1EA 2CKMA 1E6WA 1RAHA 2JIPA 2R1TA 5EUMA 3VH3A 1UBRS 2VQ3A 4FKZA 1C0IA 1IQUA 4N7RA 4MI1A 2ZR8A 4CCWA 2X8JB 2I3AA 2C5BA 3GRCA 3C1TA 1NNEA 4HSGA 1HZZA 4UPVA 2XCQA 2V9PA 4DABA 1J1ZA 1LQ2A 2GRAA 4RIEA 3PPWA 4YJDA 1AUPA 4HDKB 2HGSA 2MOKA 4GZ5A 5B7GA 3Q2KA 1FUIA 1G42A 1DELA 3PTZA 4NIMA 4NZMA 4DMFA 3HE3A 4NBWA 1PWHA 5LQJA 3I12A 1E2DA 1TAHA 2O2IA 3FSGA 2IOHA 3KYJB 4H08A 4IPTA 3VC7A 6NULA 2CXHA 1WTCA 5CVJA 5GOTA 5SYNA 3PK0A 4CIDA 2XE4A 1ZVVA 4XIJA 2WM8A 4E5YA 4CZ2A 2VNSA 2PL5A 3KZMA 4AD8A 1G2PA 4M1EA 4DCSA 1J4AA 1OXXK 1ZN9A 1HYHA 2JLUA 1DQPA 1KY4A 2JLVA 3HXQA 4G0PA 1P9LA 1UKEA 4LYAA 4MZDA 5AVZA 2VHVA 4K6HA 1AN9A 2BI4A 3AZOA 1KI8A 1LSOA 1TD1A 1CVRA 5KYYA 1GPMA 3IKVA 5P8WA 1V71A 3LE8A 4Q4DA 1DBIA 3OP4A 1POXA 1P80A 4EKYA 3ZWVA 1VMDA 1NG1A 3HEMA 2XNCA 2FCRA 3BVPA 3V4VB 5IMSA 3RHTA 2IXFA 3N8HA 4XQEA 1USGA 1WZCA 1T9GR 3QYPA 5F21A 5E7IA 3WRYA 4LSZA 4DR6B 4EVSA 5GM2A 2YKGA 5LXTB 4DIMA 3GGJA 3L05A 3QX9A 3K4QA 4G1UC 5WRFA 3KLMX 3EIFA 1CNFA 3TTXA 2AJBA 1DG1G 1U94A 1UPBA 1YA4A 2W2NA 3FJ1A 3MTJA 3QPWA 3R6TA 4NCKA 1JIUA 4PYRA 1LVHA 4LWOA 2O4CA 5ULLA 4XXHA 3ZCTA 2IF0A 4FS3A 5T4BA 1CQJA 3D7MA 3TCNA 2HA7A 1SCAA 3DLAA 3KB2A 1UK9A 5IP5A 1Q44A 1EFUA 2EJUA 2MSLA 4UNPA 3AL0C 1Z16A 3S2FA 1CHNA 1ISHA 4DQDA 2FI1A 3QWAA 5JYBA 1Z17A 1ZMRA 1DOZA 2VJYA 2PUWA 1NVGA 3FW1A 1KAOA 4L8VA 3IEVA 3GJTA 1ADGA 3LV8A 1IPHA 2AR7A 1FDTA 1PQ4A 4XGRA 4EHJA 3K2IA 3KJXA 3R5SA 3RNLA 3VR5A 2VRWA 4CR6A 1CXZA 4F2WA 1KH2A 5CCXA 5ENZA 4LUCA 1P2GA 4F2GA 4D26A 4WX2B 5AHRA 2Y05A 5JO9A 3DL7A 1N0VC 1XA0A 3DDHA 3OHMA 3R75A 2C3YA 3EIWA 1PO7A 1X14A 3HKCB 4YFYA 3GX1A 5LQDA 1MC1A 3LCJA 3PL1A 3LM8A 3LY5A 5JZMA 1GFSA 5K20A 3OKAA 4FOOA 1N3LA 1XEXB 4NYIQ 1T5LA 1VJTA 5F7JA 4BVAA 1CJSA 3KL4A 4R9RA 4EO4A 4F7WA 1NFFA 4FYMA 1J8FA 3D6VA 2GAFA 3ZC3A 2GHIA 4L8WB 4KMMA 5EYPA 5AUNB 1IN8A 1V7ZA 2RH5A 4FEEA 1NN3A 4R5HA 1PD0A 2TMGA 4UXIA 2Y99A 3RI3A 3RJZA 2CWWA 4YUZA 1ITZA 2B82A 1YRQA 1Z6ZA 2FZEA 2GH1A 4O08A 4J0GA 4GP9A 1U98A 4BO1A 1PUXA 4EMBA 1BGXT 3EUAA 3UXYA 4BNMA 1CZUA 4J2OA 2JA1A 1QRUA 4O25A 3STYA 3CZ4A 2C1EA 4RMIA 5CFOA 4PX5A 5CB4A 4P08A 2R6JA 3B7GA 4QGHA 3RANA 5FUVA 3FHCB 1RZRD 3MSCA 5IKPA 2CCKA 3G9UA 1SU4A 1JG2A 3PR3A 4CLRB 3PQ5A 5LDGA 2RC6A 4QGBA <