5CB8A

Crystal structure of adenosine-5'-phosphosulfate kinase in complex with aps and sulfate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
174
structure length
174
Chain Sequence
b'QRGVTIWLTGLSGAGKTTITHALEKKLRDSGYRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRIGFVSHLLTRNGVIVLVSAISPYAAIRQEVKHTIGDFLEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYEPPTNPDVECRTDLEELDESVGKIWQKLVDLKYIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable adenylyl-sulfate kinase
molecule tags Transferase
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
publication title Recapitulating the Structural Evolution of Redox Regulation in Adenosine 5'-Phosphosulfate Kinase from Cyanobacteria to Plants.
pubmed doi rcsb
total genus 72
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cb8A00
3CF2A 4LHZA 4OHWA 2QMHA 2GZHA 4YMWA 3I61A 1AS0A 1KZGB 1OIWA 1T8TA 3UWKA 2BHRA 3LQQA 1N0UA 4C3ZA 1XNJA 2X1VA 4ZIRA 3D31A 3BXZA 3EARA 4G5RA 1OFTA 3PVSA 1T8UA 4Q1BA 3PXGA 3KKPA 4JVMA 3U44B 1SZPA 3A4MA 4P4SA 1LS1A 1VYVA 5J4KA 1IN7A 1CLUA 2PX3A 3CRRA 2BV3A 3SHFA 4C0KA 1XTIA 2QN6A 1ONBA 4BZPA 3QF4B 2JLQA 4QJ5A 1T5IA 1NY5A 1E2IA 2QAGB 3QBTA 1SULA 3MGCA 3SU8A 5CDFE 1Z8FA 2DYKA 3Q7QA 4OQNA 5FPHA 4KBGA 1D8TA 1U8ZA 4Z1MA 2DWPA 1FW6A 1GRQA 2F1RA 1ZNWA 2P2LA 3AF2A 1NSFA 4CEJA 1Z06A 5CJPA 2QE7D 4ZDKA 4Q7LA 3P4YA 3Q8XB 5CITA 4AC9A 2Z4SA 2EYUA 1PLKA 2A5JA 1OH7A 3N5CA 2HJVA 2FN4A 2GJSA 3LAWA 1R8SA 3GJ4A 4BUJA 3P27A 3B60A 4A8JB 5BQ5A 2J45A 3B8HA 3T1VA 4GSYA 1XJCA 3P26A 1RZ3A 2WJVA 4IFBA 4E03A 4TTRA 2J7PA 4B33A 4TYNA 4BLSA 2ATXA 3PCRB 4LHWA 2V55B 3SZRA 2ZREA 4EFLA 4PC2A 4WIAA 5FUYA 2O8BA 5FUXA 1DVRA 2VA8A 1GM5A 4OBEA 4G5OA 4IJMA 3MSXA 4OYHA 1EWRA 2JASA 2IYRA 4Q7KA 2IYUA 1DO0A 1SHKA 3Q3JB 4JLBA 4JVLA 4ZCLA 4C0SA 1J70A 1Y63A 1DAFA 3E1SA 2QTHA 3NC0C 4LGMA 2ZXUA 1U99A 3RRMA 4US1R 4GMDA 3R8FA 1CEEA 2IYWA 4B76A 5CM9C 2GF0A 1JXOA 1E94E 3QPWA 1WXQA 2NO7A 1SVLA 2GAAA 3K0AA 4QNRA 3K09A 3U3JA 4W7SA 2WWIA 4B3BA 3AVTA 4FMDB 1G3RA 1ZU4A 3CR8A 1BO6A 3NVAA 4ARZA 4DUGD 2N46A 2ODWA 1T6NA 1IY2A 1KKLA 4MUBA 2A5YB 4TSFA 2D7CA 3U60B 2YC4C 1Z0AA 1Z6AA 3G82C 1FNNA 2Q3FA 1JR3A 4MYCA 2ZR7A 4Q4JA 3A8TA 3CB4A 2C96A 4F93B 3DOFA 3N70A 3PUVA 1UBCA 2ZROA 2HT1A 1JALA 2VP0A 2VTKA 3DVLA 3BIFA 1PV4A 3MLEA 4URUR 4B74A 1KDRA 3H0KA 2FX3A 1AK2A 4L16A 3QG5A 4P31A 2MMCA 4OHVA 1W4BA 4TLAA 2ERYA 1E2FA 5FUWA 2NO1A 4NYJQ 1KSGA 621PA 1RRCA 1KDPA 1M7GA 1QG4A 2ZIAA 1F48A 4BASA 1DAMA 1IJFA 5L8VA 1NVVR 4G5GA 4Z1MD 3FFAA 1G8HA 5IRCD 1T3LA 4HB0A 4DLSA 3EWSA 1TQ6A 2IYYA 3FTQA 1SVOA 1ZM3A 2QP3A 2O8CB 4G0NA 4QNMA 3KJEA 3L43A 3TSWA 1G7TA 4KBFA 2REBA 2WIAA 1UJ2A 2ZS9A 2ZJ8A 1RYHA 4C7OA 3OF5A 2ZRNA 4RFSB 4M1OA 4DEYA 1UAAA 1KNXA 1WBDA 2IS1A 4IKEA 3NKVA 4JSYA 4PO8A 1P5ZB 1S96A 2YV5A 4DHEA 1DG1G 2CE7A 2OE2A 3AUYA 4RKFA 1QZXA 4CZ2A 5D3MB 2QP9X 1VG8A 3FKSD 1KAGA 4EUNA 2ORWA 3NBYC 5FOUA 1UKVY 3EIEA 2QPTA 1VCMA 1OB5A 1Z2CA 1R5BA 4KXFB 3LD9A 5KU1A 1II8A 2QTFA 1YR7A 1OH6A 2D3WA 2R6DA 1E9SA 4Q21A 4QGAA 2R6AA 4R7ZA 3B6EA 4KFRA 3A1UA 1UEIA 1Z29A 3ZGXA 5KUTA 5FOXA 1XPRA 2DHRA 2IF2A 1XTSA 3LVRE 2DCUA 3WRYC 2ODBA 2AHOA 4BE7B 3THYA 3MWLA 3AP1A 1E2PA 3C41J 3LBHA 3NXSA 1O3YA 3RHFA 3GJ5A 2B21A 3VU9A 1H8HA 4NYIR 3BFXA 3AKCA 2I1QA 5DE3A 1G3MA 2F7SA 4TZ0A 1E9FA 3B1XA 3DEFA 4NU0A 4JBWA 5JCZA 4DB2A 2C04A 2GETA 2J1LA 2NQ2C 2ZVPX 5DYGA 1G7CA 4KAXA 3SDZA 4RZUA 5KTYA 4PHFA 1R7RA 3MWJA 3GFTA 5DHFA 2KE5A 2ZYWX 4EQ6A 5FPKA 1SXJE 4MGZR 2EFCB 2A2ZA 2XTZA 3GLHA 4EQ6B 5AUPB 1AKYA 1GZSA 4B3GA 3I8SA 3CONA 3BFKA 4MGIR 2R6GA 4CEJB 4LYAA 1IN5A 2ZJ2A 1YU9A 2B8TA 2ZRPA 2FSGA 4EDHA 3GD7A 2PEZA 1RRGA 1CTQA 5EXPA 2DY1A 5JZVA 3IEUA 3O8DA 1H8ED 2C78A 4V0LA 1YRAA 2HJGA 4WZAE 3JZMA 4LBWA 3KJGA 2QPAA 1CBUA 3M4YA 4KO8A 2KB0A 4NH0A 3I8XA 3MAAC 4D0NA 4LHXA 2GXAA 5JWRA 1U9IC 2ZSDA 3W8NA 3OEED 4M9ZA 5SZHB 2O5VA 1FNMA 4FI3C 4PZZA 2O8EA 3LDAA 3DKVA 1FMJA 1CJKC 2G0TA 1Z5ZA 2NTYC 5ANRB 4Q1CA 4A8JC 4RZXA 3U3MA 5E4FA 1J8YF 3MUFA 5FI0B 3CLVA 1KSJA 5CB6A 4PPGA 3AEZA 1P4SA 1US8B 3B85A 2ZAMA 3KKMA 1ZC3A 3DOEA 3EIQA 4GRAA 5KO2A 2IXGA 2QI9C 1US8A 5IDVA 4XSGA 1GTVA 1B0UA 5J47A 1QDEA 2OFOA 3QEOA 4D6PA 3HP1A 4B2LA 3K0CA 3A1WA 4A2QA 4LSGA 4JL6A 4TL9A 3KQLA 2F1JA 1SXJC 2X2FA 4URZR 4V0KA 3ZZUA 2PLRA 5G41A 4BLOA 1C1YA 1D9ZA 5AK0A 3IBGA 2ATVA 1PLLA 4MQBA 1VMAA 2ZETA 4JL5A 2C77A 3K53A 1KJWA 3QKRA 4LYFA 4NCKA 2HUPA 3UMSA 2J87A 3VHXA 3GLHE 1YZGA 1KI1A 5CB8A 2C2HA 2ZRGA 2ZUBA 1DE0A 4R2HA 1E69A 2WMNB 1N6LA 1RVDA 3QXHA 4Q03A 1JPJA 3WHLA 3OE7D 3QKUA 3OIYA 1RJ9B 4C9BA 5D3QA 1AIPA 4LYJA 1L7VC 2GCPA 2ZRIA 5J4YA 1MO4A 1CR1A 1G21E 1VIYA 3GEIA 2WV9A 1X3SA 4F4JA 1LF0A 3FWYA 2XZPA 1IONA 3G0HA 4ZCIA 1VHLA 4HUTA 5CM8B 4JJZA 2DFLA 3O8CA 3PEYA 1ELOA 1GRRA 4CW7A 2W83A 5AJXA 4DT1B 2IXEA 4QBFA 2J0SA 4D25A 2XEXA 1GVNB 2PBRA 3LNCA 2YWFA 1W0KA 3A1VA 1NIPA 3H4MA 4KCGA 5FPSA 3A6PC 1JPNA 1ZUHA 3IKJA 4DDWA 1W5TA 2CHVA 1MABA 1OXXK 4W5HA 3UMRA 1KO7A 2WKQA 1MH1A 3V4RA 2X8AA 1W5SA 3FGNA 4E5UA 3AF4A 4A2WA 2PT5A 5EXTA 1KIMA 2OCPA 1YE8A 5GADl 1ZM9A 3LBIA 4OQLA 4IDOA 3K0FA 1KO8A 1OXTA 4HZUA 4OI4A 1BYIA 4K81B 5JS8A 1VYUA 2VHUA 4CIDA 4E09A 1JI0A 5LD2C 4U7DA 1TF2A 3T5DA 1MRNA 2ZI4A 3BBPA 4HAVA 4IDQA 4QBIA 1KDOA 4R2IA 4RZ3A 2VLIA 3C14C 2ZI3A 2W6JD 1D6JA 5EUMA 4B3XA 2ZQ5A 5BWMA 1PUJA 3EZ2A 2ZJYA 1KI7A 1S4QA 5TXGA 2BCGY 3ADCA 4HSEA 2KBEA 1CRQA 4NYIQ 4EKDA 1KI9A 4MRRA 2NO6A 1UBEA 4TL7A 4ZO4A 2DB3A 1FX0A 1IN8A 2GJ8A 5FTKA 3IIJA 3CKLA 1UADA 1YR8A 1II0A 5UKDA 4CEIB 4ASUA 3EAQA 1TMKA 1GFIA 5E7MA 2NGRA 2AL7A 2BMJA 1XCGB 3CPEA 3SQWA 3AVYA 1XXHB 4JLAA 1VYTA 3KTAA 4N3NA 1OE0A 4ACBA 1LW7A 4GP6A 4BLPA 1KK2A 2PJRA 4C0QC 3I92A 2OXRA 4EJSB 1RRPA 3QF7A 2AWNA 3C16C 3W5JA 5HZHA 4TYQA 1AS2A 2ZITA 3U6BA 4Q19A 5HCIA 1G5TA 2WOJA 3BD9A 2ORVA 2UZIR 3LV8A 1GP2A 4YDSA 1YKSA 4BFVA 4M1SA 1M34E 4JLKA 1XZQA 1ZVQA 4ITRC 4LV8B 4IDPA 5FI1B 1BKDR 3IEVA 3SNHA 1Z2AA 2ZUCA 3GJXC 4TMWA 1N3BA 4AKGA 4WW0A 3W5IA 3K9LA 1FTSA 1YZTA 3KJIA 2QL6A 3L0IB 3NBXX 4BFYA 5J4VA 4WZ6A 1JJVA 5TB5A 3HJNA 4E22A 1E9EA 3QXSA 4NL4H 1U81A 1CULC 1S8FA 2W58A 2EWVA 3LXRA 3KX2A 4PHHA 2NO0A 3FHOA 3WNDA 1XU4A 2GNOA 2L0XA 3EWAA 3V9PA 4PPFA 1KI2A 3T35A 1GL7A 4DT1A 2QA5A 3D3QA 2DPXA 4HLUC 4UJ5A 1XRJA 2RGNA 3FFBA 3T5GA 1EGAA 4DSTA 1IBRA 2RHDA 3KKQA 3NTUA 3PQCA 5C4GB 3EX7C 3CIOA 1QHHB 2IEYA 121PA 4GOXA 2XJ9A 1U0LA 1XDBA 2F3RA 3TR0A 3B13B 4HYYA 2QQ0A 2OM2A 1E2LA 1FMLA 5GJVC 4AG6A 1SVKA 2RH5A 1G8GA 4V0NA 2ZUDA 3GLGE 2WPDA 1FUUA 4RCZA 2XGJA 4DDVA 1GITA 1XP8A 4Q4JB 3K70D 3DMNA 4WVFA 1ZD8A 1C9KA 3S1AB 1D2NA 1KDTA 3BAFA 1NI3A 2OSBA 4RVCA 2CLDX 5EP1A 4Q1FA 3W8RA 3IUYA 3CO5A 1KO1A 4QGFA 1E9DA 3TIFA 2QQEA 2V1XA 3HU1A 4FIDA 3AUXA 1PLJA 2JEOA 1LS6A 4RD4A 4P33A 3KUDA 5JWOA 2JLZA 2DFNA 5JJIA 4B3DA 2J5XA 1E79D 1W0JD 4M9XA 1HTWA 5LB4A 5DYIA 3LVQE 4JVSB 2W0SA 4GT1A 2C5LA 2ZAOA 4ZV4A 4HB2A 2R65A 3GFOA 3SEAA 4LCBA 5KPJA 3EXAA 3B1ZA 1NLYA 4JYCA 1XEFA 2OXCA 3AGPA 4Q9HA 1GKIA 1T0JB 1U98A 2H18A 1ZAKA 2XOKD 4PPNA 4BZQA 4U02A 3OEHA 5BYJA 2V8OA 1PUIA 1RRFA 2GJKA 1NVWQ 4IOLA 1HA3A 1R0WA 4YDHB 3WHKA 1QHSA 2R6FA 4AYTA 1HE1C 1Z0JA 1V43A 1HEIA 1KI6A 4H1UA 2ORIA 2QORA 4JBYA 2IEZA 2P5SA 2JLVA 2HXSA 3IILA 4Z51A 1KI6B 2OT3B 1SKYE 5KHOC 2CDNA 1CF4A 1EESA 1NN3A 2VF8A 3WP0A 1TEVA 4MKFA 3MWYW 1I2MA 3EZ6A 3AV0B 5EXXA 2OCYC 3K0CC 5SZJA 3OAAA 5E95A 2NG1A 4KVGA 4M1MA 1ESNA 3DZ8A 2WWYA 1VECA 4IOKA 4Q9IA 5KDDA 2OAQ1 2PZGA 2P0EA 3WYFA 1XCPA 1UKYA 4LUCA 4C0BA 1L4YA 4Q01A 4WAUA 5HKKA 5A5GA 4TL8A 5C46F 2OLKA 2QRZA 2TMKA 2WZQA 1G6OA 2V7QD 3SN6A 2XNDA 1KK1A 3BB1A 3WMFA 1T5LA 2O0KA 3LXXA 2CNWA 2YOHA 2ZYUX 1P62B 4Q1EA 4UXJA 4TT3A 2O8BB 2BEKA 3TAHA 4NP6A 2VHTA 3OFND 4YXWA 2VHQA 2FGJA 2IYTA 2QEQA 3IO5A 4L9WA 1XMIA 4HDCA 2HCJB 2FFHA 1P2SA 3RS2A 4QM7A 5B57C 3EPLA 3AKDA 2YWHA 1R5OA 2ZEJA 4ILEA 2IS4A 4OJKA 1OW3B 4UNSA 2WSSA 2FA9A 4LY6A 4UNNA 1HQYE 5BN3A 2Z5FA 4URXR 4PQYA 1NSTA 4NYMR 4IDNA 2Q3HA 1FQJA 3I1FA 4P3YA 1K6MA 2BC9A 4JLOA 4UNRA 4ESVA 2EW1A 2QG6A 2QMEA 3NH6A 1X8KA 2C9OA 3B1VA 4Q4HB 2J0UA 3FMOB 4GL2A 1F2UA 1Q0UA 3UXMA 2ZRHA 2LKCA 4PPQA 1SXJA 4H1VA 4A92A 2A3RA 4RJLA 4YONB 1Z07A 1KI4A 1TPZA 2FZLA 2KJQA 3SJCA 5L3VA 2GKSA 1N5IA 3TBKA 1N6HA 2VQSA 4LV6A 2V6JA 5LPNA 4FMCB 4R98A 3B7GA 2VP9A 2D62A 2FEMA 4IFEA 3UG7A 4EPWA 4W5JA 4TLCA 3DM9B 1X8LA 1E2MA 1XZPA 3PIRA 3U3OA 4C0HA 2IWRA 5B30A 3CRMA 4UQOA 1ZYUA 3QUSA 3WYGA 5CLQA 4R9UC 4ACAA 4GP7A 3BH0A 5FTMA 3LRPA 4DB4A 1XF9A 1E9RA 1OKKA 2DR3A 1UDXA 2JJ1D 2W6ID 2V7QA 3GEEA 3GJ6A 3PUXA 2IYLD 3CF0A 4NHOA 2ZRLA 2ZM5A 4EFMA 3LBNA 5EE9A 2J9RA 1EFCA 3VQTA 5JJKA 3TGPA 3AP3A 1P9RA 4OI2A 2VP6A 3FMIA 3O47A 2H7VA 1GRNA 5K8IA 3HR8A 4NTZA 1JB1A 2OV2A 1XEXB 3OAAD 1R10A 2QM7A 2OILA 3PV0A 1S9DA 3LA6A 1TUEA 2CHGA 2X19A 1IOZA 1G20E 3M1IA 3BB3A 1Z6YA 3QNUA 4JLNA 2Q9BA 3I5YA 2I3BA 1NVXQ 1RE0A 2E1RA 2RAPA 2IK8A 2D4HA 3CZQA 4Z8XA 3ZLJA 2AK3A 3BE4A 3EPHA 1G8YA 1G291 1WE2A 2FMXA 2AXNA 1II8B 4GOKA 2C9CA 4LRWA 4Q9KA 1GIAA 2WICA 2I1VB 3ZVMA 1CU1A 2XOKA 2Z83A 1W2GA 1LTQA 2CL0X 2EQBA 221PA 4URYR 5H1YA 2QBYA 4G01B 4XSHA 5TMPA 2LKDA 1J7KA 2ZI9A 2FG5A 5CIWA 1X6VA 4GFDA 3WBJA 3LWNA 1IJEA 1COWD 2Q0HA 5DSZA 4N0EA 3T1TA 1XFAA 4PSAA 3U7HB 2VSFA 3CWZA 1KMQA 1E2NA 2IYXA 3NDPA 4B34A 1KSHA 4D0LB 3TVTA 2AWOA 1QRAA 5L3QA 1K5DA 4NKRA 4L4UA 1M7BA 2QROA 4LJ7A 4WXRA 2CCGA 2ANCA 4PANA 1ZNXA 3O8BA 2B7CA 4PO1A 4TLBA 4BEJA 2O8DB 2IWHA 2R8RA 4G5SA 2P6UA 1MO3A 2WAYA 2H57A 3GLIB 2V3CC 3REFA 2B92A 2EFEB 1FZQA 3GLGB 1XTKA 2CMKA 4F7WA 2A78A 4DLXA 4PAMA 1R5NA 5FPYA 1MRSA 2ZU6A 4IVPA 2HF9A 1UF9A 3H84A 3NIBA 3QKSB 1GAJA 4M53A 1H8HD 2YYZA 1ZUIA 1HV8A 3DPUA 4JT2A 3FOZA 4PO9A 1TQ4A 1NLZA 2VBCA 1KJYA 1P9WA 2WTUA 1ZM4A 4DSOA 3Q5EA 3PUYA 4TTQA 4L8GA 2ONJA 3MWKA 3SHWA 3DL0A 2JJ2D 2GXUA 2OCAA 4QJ3A 5HR5A 5CYPA 4W5WA 1X1RA 4Q4LA 4MKGA 3FKQA 1FFHA 1ZUNB 3VKWA 1G8PA 4BGDA 5HE8A 3V4FA 2XX3A 4E07A 4TMVA 5G40A 2R62A 4QBHA 5JSZA 2FEOA 3MFYA 4NDZA 1CJUC 5DI3A 5FBLB 1HT2E 3L82B 4OQFA 2YWEA 1TQDA 3CF6R 4DDUA 1WDTA 3UANA 2PT7A 1Z0DA 3GLIE 1E2EA 1W4AA 3KTAB 1OYWA 2HLDD 4GI7A 4V0MA 4DVGA 1JQLB 3WYAA 1XPOA 2VSOA 1DAKA 2ZRBA 5KNBA 1E3MA 3TE6A 3FHTA 4B47A 4JLVA 3GJ3A 3KXKA 4F92B 1IN6A 2IUTA 3D6TB 4D81A 1ZINA 1E0SA 1X1SA 4JBXA 1U0JA 2J59A 1KK0A 2AKYA 4M9QA 5KSOA 3RSLA 1Q12A 1GL9B 2A30A 1ZNZA 3OZXA 4S2EA 3CX8A 2E9SA 4ZI2A 2GBLC 4MGYR 4D80A 2IYSA 2F9LA 2GWHA 4NCHA 3T12A 1XTQA 4HI0E 3QKRB 4TLDA 3UATA 1LVGA 3KB1A 2FNAA 1QBKC 1FX0B 4LBVA 5JEEA 2O8FA 3MMPA 3ONWA 1Z83A 4LBYA 4PZLA 3THYB 2J3EA 4RD1A 3NBZC 3QQ5A 4CRWB 1GUAA 1KO4A 1RJ9A 5J4HA 3TJZA 4LHVA 3WXMA 2IX3A 1VTKA 4TLEA 3IO3A 2B8WA 2RB4A 3V00A 2AX4A 5IK2D 4DIEA 2OLJA 3BH7A 4TYPA 2VP2A 5H68A 3BGWA 3IGFA 3AKEA 3TK1A 1TQ2A 3UKDA 3PFIA 2FV8A 4C30A 4MITA 4RSGA 1QVAA 3TSOA 3OESA 1Q3HA 5CJ2A 1Q1QA 2QU8A 1GNRA 3SR0A 3CNNA 5FOVA 4Q5IA 2RGGA 1N6NA 3WY9A 3RNLA 5JI3E 3HR7A 1XB2A 1MABB 2EU8A 2O0JA 4NYMQ 5KNDA 1S0UA 3ZH9B 2GF9A 1PJRA 5EZ5A 3L8YA 1OH5A 1SKYB 5KDLA 5B58C 1DELA 2IUUA 4R71A 2OFWA 5CYOA 1GNQA 3TLXA 4MH0R 3THXA 4I1SA 1HQCA 4RD3A 1Z63A 1M2OB 2D2FA 3BFVA 4RFVA 1W4CA 1XTJA 3QXJA 3KKNA 3F8TA 3I73A 4A1FA 3DM5A 4B75A 1HE8B 2R6CA 4HAXA 5DN6D 2ZANA 1L4UA 1ANKA 4D4JA 3GLFE 5DHAA 3ETLA 1IXZA 1IY1A 1E2DA 2A5GA 3NH9A 1SVIA 3KB2A 4YLGA 4AYXA 4KFUA 3WP1B 5DI3B 4OHYA 2XXAA 2WKRA 2ECKA 1QF9A 2QUZA 1UFQA 1Z6GA 1IXRC 3CM0A 3FPAA 4DLVA 4O2RA 2C8VA 1W47A 1W48A 2DFKB 2JDID 1QHHA 3OEHD 5IHPA 1TF5A 2XTMA 4KODA 2BCJQ 2N42A 3ASZA 4FW9A 1G3IA 2WJJA 4JSTA 4P32A 3ZQJA 2RGXA 2CJWB 2A5DA 1G8FA 5HCNA 2ZJAA 2HYDA 3LY5A 3R7WB 3THOA 1ZIOA 1E79A 1W0JA 2WWFA 4QC2A 4JLJA 3LQRA 2AFIE 1IY0A 5HTKA 3FDIA 4KLZA 3LX5A 4CT4B 2JATA 5F3WB 1FQKA 5AWFC 3MG9A 5KSYA 4CYMA 3MJHA 1KI8A 1SGWA 2EWWA 2ZJOA 3SJZA 3QVVA 5AR1A 3CNLA 2OO7A 1KO5A 3X2SA 4WBSA 2C98A 1GG2A 3E70C 5HPYB 3P32A 3NEYA 5G3YA 4RY2A 1K5GA 1NP6A 1Q1BA 2ZI7A 5BW8A 2BIFA 4AURA 1M7HA 4PAOA 1LB1B 4DSUA 4A15A 2J0QA 4MYTA 2FU5C 5AUOB 1MOZA 4A0GA 3CW2A 4RCYA 2NIPA 2QZ4A 2REOA 2R9VA 3BWDD 4HEJA 2VO1A 5DGXA 4DLYA 4M0LA 1DO2A 1UBGA 1MO5A 4TN1A 1G41A 1NY6A 2Q21A 4EPVA 2GCOB 4M2LA 4TMTA 3D8BA 1KTVA 1E99A 1PVOA 4G1UC 2GJAA 1NL3A 821PA 5JJLA 4M8NE 2WJGA 2YVUA 4DLUA 3BK7A 3EA5A 4KFSA 2G3YA 2BOVA 3B78A 4Q47A 5FBWB 3CRQA 4FCVA 5JI2E 1YZLA 3EASA 4OHZA 4JZKA 2FH5B 4CEHB 3L0PA 4EPTA 2BJVA 3ZYCA 3KXIA 1Z6XA 3ZVRA 1I4DD 4F4IA 2HEIA 2W2XA 4IW3B 4Q4AB 4DLWA 4CF7A 1A1VA 1Z28A 1XMJA 1R4AA 1L8QA 5B64A 4A8JA 1N25A 3CX7A 3PEUA 1OYYA 2Z6VA 4POAA 2PH1A 3PENA 2C99A 1C4OA 1DAHA 2DWOA 4OQMA 4BLTA 2J7PD 5J5CA 4BRUA 2OHFA 1VG1A 2ZYTX 2PJZA 1T0HB 2IL1A 4LJ9A 3LW7A 3VU9B 1G7RA 1ZJ6A 2GXSA 3CUEF 5GJBA 1Q21A 3QJYA 3W90A 3Q5DA 1N0WA 1WA5A 2WSMA 2ZE7A 4Q48A 2OBNA 2RGDA 2WVJA 4JL8A 1EFUA 3X1XA 2GDJA 1DADA 2CBZA 1Z0KA 4MRPA 5LDDC 2D7DA 3AGQA 4TQAA 3P1JA 3QENA 3AVOA 1YR9A 4ESHA 5LBIA 1Z08A 4U5XA 3BERA 1NMYA 5TVKA 4EJSA 2QAJA 4D4KA 3KDSE 5P21A 4BFSA 2WJHA 3ZJYA 1RFLA 3A58B 3KQUA 4GNKA 2ZYVX 5GVRA 4IOJA 5DN6A 2GVDC 1XD2B 4AWXA 3GPLA 5HZKA 2B6HA 4TYYA 4HZIA 2CLSA 1KKMA 1A82A 3CH4B 4I99A 2GHIA 4B2PA 3U4QB 3RS5A 4DC9A 4QJ4A 1F5NA 3CWQA 4LOAA 3B9QA 3PEVA 4UXHA 4DXAA 1G3UA 2JDIA 2OCBA 4A9AA 1W36B 4DBLC 1BMFD 5DI9A 3SS8A 1GDDA 3RC8A 2FSIA 1NBME 1NBMD 1DBSA 2MSEB 4C0JA 2WJYA 1KHTA 4I1VA 2ONKA 5JS7A 1NKSA 3Q85A 3TRFA 4PXAA 1U2RA 521PA 4JS0A 2RGAA 1SXJD 3JVVA 2X77A 1N5KA 1OV4A 2Q3MA 1TU3A 2XB4A 3B1YA 3DMDA 3MCAA 4DKXA 5KOYA 5J4LA 1GILA 1S3SA 4GOJA 5KYKA 1Z6TA 1VG9B 4TQ9A 3ICQB 4OQXA 1OH8A 1AZTA 3QIAA 4XJXA 4B6EA 2JJ8A 2P5TB 3BS4A 4XWOA 4XH9B 1RPZA 1B23P 1XXHE 2CHQA 3QF4A 1R0ZA 4Z8YA 5TY0A 2G83A 3SJAA 2QAGA 1Q3TA 2IHYA 2VL7A 2CL7X 2RGBA 3AQ4A 4WA7A 3F5FA 5JMTA 5K8LA 1Q1ZA 6Q21A 1F2UB 2FPLA 4OK3A 1P72A 2BM0A 1EXMA 3EG5A 1Z22A 1NJGA 3S1AA 3LLUA 1KZ7B 1IAQA 4NCIA 2VPPA 3U3RA 3R9XA 5IK2A 2YOGA 1U8AA 3RSOA 1YR6A 1DEKA 1NMXA 1N6RA 2ZJBA 4HB3A 1ETUA 2PCJA 3LLMA 2MSDB 4RKEA 3KFXA 4Q1DA 5JRJA 1WRBA 1XCMA 2JA1A 5F9HA 1SKQA 2BMFA 2GEVA 3C5HA 3B9PA 3K70C 2OZEA 4F91B 2HLDA 2A9KA 2ZR0A 1SHZA 2PZEA 4OK5A 3OHMA 4M4SA 3VAAA 1ZBDA 4PR0A 1OT3A 2ZE5A 3VR4A 3GLIA 1YZQA 4HUQA 3NC1C 2GZDA 4HUQB 1AS3A 1VCOA 2IBMA 1M1YE 4ZDJA 2JGNA 2CK3D 5LB2A 3KUCA 4L15A 4Q02A 4DLTA 2WWWA 2RGEA 2FPKA 5KSZA 3RS7A 5AJVB 3K0FB 2ZE6A 5K8UA 1P6XA 3K8YA 2OUKA 4BLRA 1CR4A 1S9HA 2OG2A 3AM1A 3UK6A 2A5FA 4MRNA 1JECA 4KVAA 1G17A 3T61A 1YHNA 1ODFA 3K9HA 1NVVQ 4Q4AA 421PA 4LJ8A 4TMXA 5GVSA 2YHSA 3DHWC 4OK6A 3RRYA 2JLSA 1KK3A 1QHGA 1J90A 1II9A 4EPXA 3ZIAA 1GNPA 4Q9JA 4XOIA 4YC7A 2QMUA 5AJWA 3HYTA 1FPMA 1GSIA 2O8EB 2XZLA 1UKEA 3GLFA 3TKLA 3KFVA 1NN1A 3K70B 2NPFA 1N6KA 3IIMA 3AVXA 1D9XA 2ZS7A 5FBRB 2NPIA 3AP2A 2CCKA 3CNOA 1FTNA 1R0YA 2AN9A 3QY0A 1G19A 4IHQA 4RZ2A 3R9WA 2O8DA 2RCNA 4PFSA 4A6XA 1U90A 2ZSAA 5H70A 2WBLC 4GMXA 3AVVA 1U94A 3ICEA 1EFRD 1L2TA 3HWSA 2J0UB 4QKQA 3SBEA 3IHWA 2C03A 4Z54A 4V02A 1VKJA 3HDTA 3THWA 1G9XA 3TQFA 1W36C 2OAP1 1EWQA 2QSYA 2UKDA 3CRVA 4C2TA 1SVWA 4KSCA 4TWZA 4KV9A 4ZKEA 5IF9A 2LWIA 1TL7C 3AF1A 3CH5A 4O0MA 2GZAA 3HPRA 3L8ZA 3QPVA 4LZZA 1EX6A 1KY2A 1CP2A 1M8PA 2G77B 2PX0A 1JBKA 4D82A 4Q7JB 3TR5A 2V9PA 2OEPA 3QVUA 2CE2X 2ERXA 4C2UA 2UZ3A 2RGNC 4LC1A 1NNEA 1LF5A 3DO6A 1N6OA 4HATA 1E9BA 3KJHA 5GJWC 3RLFA 2Z43A 4C0AC 2RGCA 3RVBA 1QG2A 3IPYA 1NBMA 5DO9A 4BFWA 4UXIA 1N5LA 3VR5A 1I2DA 3RRNA 4FWTA 2ZE8A 5IT5A 1R8QA 1GL6A 3QG1A 4B43A 2XB2A 2C9YA 3ND9A 4CEIA 3RYTC 1KMHB 1ZP6A 3FKSA 4DRZA 3Q9LA 4M1WA 4A0FA 4AG5A 2GEUA 5B2ZA 3W9YA 3SYKA 1W44A 1YRBA 5EE3A 4MKIA 1P9NA 1CJTC 3WMGA 2YWGA 5G3ZA 3ZQ6A 2G1JA 4URVR 4B3FX 3SJBA 1OSNA 4FMDF 1D2EA 4DIDA 4BECA 3TAUA 3B5JA 4HLQB 4US0R 1W36D 3GJ0A 1CJMA 4JVNA 4XVQA 4CVNA 3T1OA 2Y8EA 1FUKA 5H8WA 4PSKA 3ADDA 2WKPA 1NLFA 5AUQA 1LV7A 4MRVA 3EZFA 4MKHA 3U44A 4FWIB 2JLRA 1AGRA 1Q44A 4EPYA 1KYIA 1QVRA 3OEEA 3MJRA 3TUJC 1E1QA 1K8RA 2FFAA 4IEEA 2CL6X 2FFQA 3LFUA 4PQRA 3GFPA 3X1ZA 1ZCAA 4NYJR 5JECA 1IHUA 3KKOA 2PL3A 4NBSA 4X8HA 3ZD6A 1JXMA 2QRNA 1P75A 4HAWA 2BKEA 2QENA 3RWMB 4DZZA 4FMCF 2Q6TA 2XSZD 3PR1A 2WSSD 4C0LA 5C18A 3W3ZB 3T1QA 3VNUA 2VH5R 2FFBA 3RC3A 4A0RA 4IRUB 3R9IA 4AI6A 4HAYA 2XJ4A 4PC7A 2ZJZA 3CRW1 1E1RD 3WNBA 3U5ZB 2C95A 1A2KC 1Q22A 2AK2A 3RWOA 2FWRA 4IDHA 3MRSA 3IQXA 4LV5B 4MYHA 4G5QA 4NZYA 5TDHA 2IYVA 4TT3D 4BLQA 5AJZA 1AGPA 2PMKA 3VX4A 3ZZ0A 2G88A 1E2GA 4QGGA 3VFDA 2IF0A 2GK6A 1IN4A 2XZOA 3QSYA 3JZAA 3AVWA 1MR3F 2VHJA 2ZRMA 1NN5A 5CDFA 5EUQB 1JEEA 4QFMA 3NWJA 1JNYA 3P4XA 5FL3A 1PZNA 1ZM7A 3A4NA 4FCTA 2W0MA 1P7CA 2CVHA 3KZ1E 3K0EA 1JEDA 1KNQA 2F9MA 3DZDA 4PC3A 4OJQA 1G64A 1BH2A 3VR3A 2NO9A 3EC1A 3SYNA 2AR7A 2H92A 1EG7A 2JIZD 2KI5A 4W9MC 1G4UR 3RDPA 1Z47A 2X2EA 3QBVA 4LYHA 1VDZA 3QI2A 1AN0A 2BMEA 4S35A 4MGKR 2H16A 3N2EA 1XMVA 1WB9A 1G1MA 1DAGA 4I1UA 1NKTA 3RS3A 3RAPR 1WCV1 1VIAA 3ZVNA 4GZLA 1TUIA 2ZRFA 3Q7PA 3TSZA 5FBQB 4WZBE 2ZSFA 4CGZA 1IM2A 3F0TA 4LBZA 1ESMA 1H65A 5K8TA 4O25A 4XTRA 5FUVA 1FL9A 4AYWA 4AD8A 1D2MA 2IT1A 1F2TB 2F43B 5EXSA 4EAQA 4RD0A 5JCPA 4NCJA 1JAHA 2CK3A 2SHKA 1KSFX 1NIJA 2BKUA 4P0TA 2WWHA 4KSBA 4TTPA 1RIFA 1Z3IX 2P6RA 1XD2A 1ZMXA 1LY1A 4K8OA 1QHIA 1XJQA 4FCWA 3GLHB 3C4JA 2ODNA 2GESA 2QM8A 1DAEA 1E0JA 2QGNA 3REGA 1FP6A 4X8LA 4P4SB 2BMDA 1T4GA 2H8KA 1KY3A 5G53C 1A5TA 4JMPA 3QOFA 3TW8B 1F60A 3HU2A 4BRWA 2B7BA 3JVUA 3T06B 3KXLA 1P60A 3B1WA 2JIZA 5C4MA 3EA0A 1S1CA 3PEWA 2J46A 4D4LA 2Z0MA 3VR2A 2BJWA 1YZUA 3F3YA 2CEAA 3C7KA 1OHHA 1TX4B 4IVRA 4LJAA 1CR2A 3T34A 1ZD9A 4YQFA 1OIXA 3QPUA 3OIWA 4P4UA 4XD7D 2DBYA 3TQCA 1YQTA 3W34A 2QMOA 2F55A 2J0VA 3CR7A 4AIIA 3TNFA 2F6RA 4TMKA 4A4DA 4JYBA 1COWA 2GEDA 1E0KA 2R44A 5EE0A 1OXSC 3SFVA 4TSFD 3FHCB 3KQHA 4M22A 2UVQA 1UPTA 4XD7A 1F2TA 2F43A 4Q4HA 3SBDA 1TEXA 2RHMA 4Q66C 2YJTD 3VR1A 1UM8A 4KITB 2FE4A 1EFRA 3A37A 1EX7A 1EK0A 1VPLA 4RD2A 2WAXA 3X1YA 1NG9A 4NPHA 4URWR 1OLOA 2WWXA 4FD2A 5E7IA 4HDQB 3NBFA 2QNRA 2VRWA 4BEBA 4EPRA 1BOFA 5JHHB 2MMGA 1E2HA 2XSZA 2EFDB 4XWAA 4ZDWA 3Q72A 4LJ6A 4V03A 4EIWA 4AK9A 5L3QB 2FJUA 2BBTA 2ZRKA 3OIVA 3RABA 2ASEA 2AD5A 4FMBB 4BFXA 3RS0A 2QE7A 4HB4A 2GK7A 4BWYA 1E1QD 2VP4A 5C2JB 1N6IA 4YMUA 4TZ6A 1AJEA 2RKOA 1YJ5A 5KPDA 1I4TD 2DWQA 1GWNA 5GJCA 2EFHB 4B2IA 2KWIA 2PCLA 2YC2C 4IEIA 1S3GA 3E2IA 3UPUA 1HURA 3THWB 2JJ1A 3GP8A 3C15C 3IBYA 1WMSA 3B82A 1SXJB 4OL0A 2I4IA 4I1OA 1I4LD 1ZCBA 3EIHA 4XVUA 4RD6A 1P3JA 3BRWD 2HXYA 3HYRA 4UNPA 1CIPA 1TNDA 4LPSA 2W6JA 1E2KA 2WMOB 3U4QA 4F38A 1G16A 1P73A 2Q9AA 4UNQA 3TUZC 3X1WA 2JAQA 4BQSA 3WMEA 2HF8A 4A36A 4NCNA 4DCNA 4MDFA 2QT0A 4Q9LA 5F98A 1OFHA 4KHZA 2ANBA 1CRPA 1W1WA 3PG5A 4P4TA 1VCNA 4K46A 3UG6A 2BDTA 2HT6A 4DSNA 4ASUD 1OF1A 4ZDIA 1X86B 2N1BA 4L9SA 3I3SR 3E5HA 3EPKA 3NHBA 2FSHA 3SFZA 5CK4A 5CK5A 2GILA 2EYQA 4HLCA 3VKGA 5C1BA 2WJIA 4IXMA 1W0KD 1TF7A 1E96A 1WF3A 1ZU5A 5FL7D 3GLFB 3PUWA 5A0FA 2H5EA 4BPBA 3UWOA 1LNZA 2Q9CA 1SVMA 4N0DA 3VMFA 2NMVA 1AQUA 3N2IA 3NEJA 4MUAA 1OXUA 4LJ5A 3A1SA 2FF7A 4JKYA 2AFHE 2WOOA 4OI1A 3K1JA 2ZR9A 3BORA 4M1TA 2XITA 4B32A 2KSQA 4AKIA 3GQBA 3CBQA 3L0SA 1Z0FA 2QT1A 3TUIC 2HDNB 2PMDA 3SE0A 2CVFA 3EZ7A 3R8CA 2JLWA 4LK2A 1CXZA 2O0HA 1XTRA 4QG7A 4QL3A 3IQWA 5EZ6B 3EPJA 1NVUQ 3CPJB 3PJRA 3QKSA 2V6IA 1UBFA 4M21A 4ZPXA 3U2QA 1P2TA 3ZDQA 1N2CE 1AZSC 3H1TA 4QHYA 3OFNA 1MV5A 1A2BA 1GKYA 4IVQA 2P67A 1VCIA 1E2QA 4LJYA 3VHLB 5FL7A 1BS1A 3AKYA 5FR1A 5SZIA 5FOWA 4I4LA 1JR6A 2RMKA 5FTLA 2QTVB 3BC1A 2CLCX 2W2VA 4LWZA 4D0GA 2NOAA 3OE7A 4QHSA 2G6BA 2ZPTX 5DH9A 1FOEB 1Q57A 3U3KA 4B6FA 3FYHA 3I72A 3RRZA 4GZMA 3AF0A 4BFUA 4Y0AA 3G5UA 1VHTA 5JSZB 4QOSA 1N6PA 1AA9A 1DTSA 2NZJA 2GJ9A 2JLXA 4XVRA 1YZNA 1T9HA 3ZS9A 1EFHA 3AF3A 2F3TA 2O52A 4JLDA 5BXQC 3GCGA 2GCNA 2P6NA 3X1DA 4B48A 2YNMA 5EE5B 4B44A 4PC6A 1RYFA 3U6KA 2GCOA 2H17A 3U7GA 4YMSA 1X8JA 5AJYA 2W2TA 1P2VA 2XNSA 4FXPA 3VTKA 1E9AA 2GTPA 3L0OA 3ZVLA 4LC0A 1OB2A 2IA5A 1J2JA 2K5UA 3C5CA 2ZRJA 3K0AB 1DAIA 2GVZC 4PTLA 2D06A 2IUSA 4Q7MB 2ZSEA 4ARZB 2NZ8A 2JCSA 3M6AA 4V0ME 5JBQA 2BVNA 1KJZA 2G0NA 1KI3A 3EZ9A 2W00A 1WQ1R 4FINA 2ZVQX 1OJLA 1LFDB 1S1MA 4L5BA 2BBOA 4DDTA 1JQJC 1E98A 1UDWA 5FBVB 2WPDD 4DWJA 4IXNA 1DARA 4KU4A 4PZYA 3TMKA 3ADKA 2ZRCA 3KL4A 1JJ7A 3SYLA 1MKYA 1W49A 1Z0IA 2IC5A 2QPOA 3I32A 1QHXA 1OPXA 1G3QA 2JJ2A 1UKZA 1XBTA 1G4AE 2BBSA 2VIIA 2CXXA 2ZI5A 4GPTA 5L3SA 3ADBA 4PAQA 2EFGA 4AKEA 2ZJ5A 3QEJA 1YZKA 3EC2A 2IXFA 2YZ2A 4LJ4A 3R20A 4AY2A 1G5RA 2VHCA 1U0HC 4TMZA 2LCFA 4DCTA 2WHXA 1D5CA 5E7JA 2F1HA 1J99A 3H86A 1V5WA 4DUGA 2VSXA 2ZRAA 3AVUA 3P20A 4N1AA 4M1KA 3VX3A 2YOFA 3D7MA 1OFUX 1UEJA 5EQTA 5A4JA 1E1RA 3A36A 3ZZTA 5JEDA 1P61B 4OHXA 4B3CA 2BEJA 4Q00A 1OFIA 3LW8A 1XEWY 4G3XA 5ELXA 1HT1E 4ZI3A 4QGHA 5SZKB 2XAUA 5FH9A 2BBWA 1S2MA 2V54A 4KJZA 4U00A 4Y0VA 2ZTSA 1CJVC 3ND8A 5KNCA 1NG1A 1E0AA 3K09C 4XIGS 3ZD7A 5FR2A 1BYUA 3W6NA 4PC1A 1CKEA 1T91A 3RANA 2F1IA 3EW9A 2FDCA 1GOTA 2FSFA 1QHNA 3ZIAD 1G6HA 4TL6A 1IQPA 2OESA 4KLNA 3VR6A 2HYIC 2QP4A 3DDCA 1G7SA 2XNDD 3K9GA 2GRJA 3AH8A 4F4CA 3ECCA 5CLLA 1ZM2A 1DS6A 3DKPA 3QXCA 4CT5A 1BMFA 1OIVA 1A4RA 1E6CA 3SI7A 4JJKA 5TV2A 1R2QA 3W6OA 4II7A 4DCVA 4B35A 1OXVA 3LX8A 1KMHA 5BN4A 1AM4D 3BH6A 1E4YA 3L2OB 2GAOA 2DFTA 1XMSA 3FVQA 1HH4A 5AUNB 1TTTA 5EP4A 4MRSA 3TW4A 3AB3A 3M0EA 2CJWA 4Q18A 5D3MA 4OKSA 2CCJA 3R7WA 3W6PA 1O87A 2YKGA 4LI0A 3SOPA 1NRJB 2D2EA 1YVDA 1J8MF 3LH5A 4DJTA 4MYUA 2ODEA 2OBMA 2PZFA 4PQFA 1DG3A 1JAIA 1HUQA 5EE1A 3LO5A 4I81A 2JLUA 3VNVA 5F9FA 4ABYA 2QAGC 3AVPA 1W2HA 2J7KA 5F2EA 2XTNA 5FFMA 1N5JA 3GMTA 5JLJA 1R6BX 3SC3A 2YINC 1NJFA 3FB4A 2GA8A 4EFNA 4JT4A 2FGKA 5TARA 4ERNA 2IS6A 3B2EA 5BYKA 5JWHA 1E2JA 5JHGB 3I62A 4M9SA 1U9IA 2Z4RA 5J40A 4ZKDA 2V4ZA 4DEXA 1ZRHA 2IS2A 4ON9A 5DLQC 4NONA 3SQXA 1Q1EA 4KI0A 721PA 2ZS8A 5CIQA 3U7EB 1N0VC 1DOAA 4HLDA 1KAOA 1W4RA 4PSVA 5EP3A 1MO6A 4DLZA 4V0OA 3GEHA 4QM6A 3PITA 2BWJA 2IYZA 4A82A 2MSCB 3TH5A 4DCSA 3J81k 1XD9A 2EVWX 4UKDA 4A2PA 1F6BA 1OHHD 4TQUS 4A6PA 3GLGA 2OBLA 1G18A 2E87A 3VKHA 4C4PA 2VYFA 1XX6A 4C7OB 4PX9A 4DCUA 4X8OA 1XEXA 4IOMA 4D4MA 1IXSB 1AKEA 4CEHA 1R0XA 2FZ4A 3BB4A 5FOTA 5FPTA 4B71A 5E3HA 3A4LA 4YXWD 3HPQA 4A0HA 1Q20A 2AXPA 4UJ3A 2GBLA 3GJ8A 3PUZA 3QKTA 2FPMA 3THXB 4QHTA 3I5XA 3W3AA 2ZSBA 4HAZA 2V1UA 3AVQA 1ZC4A 4LDJA 3HU3A 4OI0A 1ZIPA 1ZNYA 2OFXA 3K9NA 4TYWA 2REXB 2G9NA 3WBKA 4JKIA 1SQ5A 1T3SA 5HKKD 1QHYA 4XWKA 3CZPA 4QXAA 1WBBA 4CDGA 4HAUA 3WRXC 1HYQA 2QBYB 3FMFA 4NE2A 1TAGA 1E9CA 3OIUA 5EP2A 1NF3A 4B73A 4MDEA 3RS4A 1A7JA 2R2AA 5EJEA 3A1TA 3QE0A 4KFTA 4NMMA 1GKUB 1CS4C 3NDBB 4WXPA 2A7QA 1EFTA 1VG0B 1W46A 2J41A 1F3OA 4J0QA 4Q1AA 4LHYA 1AQYA 4HDOB 5L3SB 5BN5A 4LX0A 2QGZA 4AKHA 3O8RA 3C8UA 4X8MA 4M1YA 3U61B 1XD8A 4BFZA 4DLRA 2WM9B 5HE9A 4MA4A 2H1LA 2QSZA 5M04A 2IHBA 1TADA 2PEYA 1CR0A 4H9GA 3CPHA 5DNYB 3T15A 1XWIA 3NHAA 4LPKA 3BOSA 3IPXA 2VP5A 5FTJA 5L3RA 5LD2B 4JIMA 4FN5A 4EJSC 5JFGA 1E32A 2IW3A 3NG1A 4JLMA 1P2UA 2FOLA 2ZRDA 3BJIC 1TU4A 3QXXA 2D74A 4XTCS 4GBMA 1OKKD 2W6IA 4ZIRB 5JRZA 4D26A 3FMPB 3I4LA 1HY3A 4ZCMA 3TVDA 4YMVA 1MT0A 4HZUB 4BFTA 2BM1A 4KYIB 2O8FB 2KBFA 4JLPA 1DPFA 1H8EA 1XPUA 3K0SA 4D2IA 4YMTA 1ZW6A 2P65A 4O3MA 3CX6A 3IHLA 2O8CA 3UIEA 4HLUA 2IYQA 2ZU0C 1NN0A 3KQKA 1W7AA 3UMFA 3H2YA 1M6NA 4KYUA 4O2LA 1Y3AA 8OHMA 1XJ0A 1G5PA 2HV8A 5KDOA 2VF7A 1RC8A 2ZI6A 2AD1A 1SVSA 1KOFA 4RFSA 3U7FB 2P3SA 3ASYA 2HCBA 1BIFA 4GDFA 1NMZA 1T3HA 5DISB 4US2R 2QY9A 2XXAB 2G1KA 2JLYA 2VEDA 2WIBA 5KSPA 3WNCA 4WOPA 3KQNA 1FP7A 1JR3D 3IIKA 1JR3E 1WP9A 4PHGA 3ZS8A 1XXHA 5FOSA 5FTNA 1ZD1A 5DIFA 2CNWD 1U8YA 1XEWX 4QBGB 2GXQA 3GJ7A 3MD0A 4BZXA 1KGDA 1M74A 1E4VA 4QRHA 2AKAB 1RW4A 3IDQA 1RKBA 3FE2A 2WWGA 4PHTA 2PLFA
chains in the Genus database with same CATH superfamily
2YXBA 4LHZA 4LWPA 1IJKA 1GZ7A 1EVZA 2V4UA 3QFCA 2PNJA 2QMHA 2GZHA 4YMWA 5JYCA 2UU9B 3JZIA 3BCUA 4M0CA 3B5EA 4X92A 4KQXA 3K2BA 5BVGB 3VNQA 1P7VA 4K9RA 1KYWA 1XNJA 2X1VA 4N4AA 1I2ZA 3D31A 3WJ2A 1PJBA 2HSDA 3BXZA 3EARA 3M7IA 4PQEA 1ODIA 3EXG1 1T8UA 3SXUA 4JVMA 3U44B 4P4SA 1LS1A 1VYVA 2WIKA 1BJRE 1ENZA 4K9DA 5J4KA 3V46A 1OI3A 2P8SA 4PZCA 4UZSA 5LQRA 3KKLA 3CRRA 4RZIA 4AZ3B 5EKSA 4LFCB 3SIRA 1PQPA 1GL3A 1M72A 5GONF 2QUAA 1JMVA 3KJFA 2BJHA 1YJBA 2NYRA 1C30B 1WCIA 2IZOA 4N40A 3IBFA 4W7HA 5CYFA 2JLQA 5TT1A 4BMDA 5AW3A 4DR6B 3QBTA 2CNBA 4O4IF 1QDUA 4K9NA 1SULA 3TJRA 5IG2A 4OQNA 5FPHA 3MINB 3CLSD 4TV8A 4Z1MA 1D8TA 1U8ZA 4BDTA 2Q3DA 2OR3A 3K1AB 3LCMA 4PG5A 2XNHA 2VDVE 1IOLA 4FWBA 1GRQA 1VP9A 2P4HX 1ZNWA 3K5IA 1FW6A 4R5MA 1PAUA 3PWSA 4YRNA 1Z06A 4WLOA 2QF7A 3KT0A 2O2GA 3D3NA 1EK6A 1KY5A 2XHZA 4G9BA 5CBKA 4BQNA 5CITA 1ZZEA 1XHLA 2Z4SA 1PLKA 3NOVA 1AQLA 2A5JA 4R05A 3CN7A 5BR8B 1BDBA 2XCRB 3PFGA 5DCUA 1QQTA 4BVFA 2R4QA 4H0FA 2E6KA 4NK4A 4BNZA 3P27A 3IOEA 2MINB 2QL5A 2PRSA 3B60A 4JXJA 4N01A 4BKQA 3FETA 5CDGA 4MWBA 4ZCRA 2Q3LA 1TM1E 4WOCA 5FJJA 3C85A 3DHNA 3T1VA 2Q6LA 5DK4A 4E03A 1M2OA 4TTRA 4BO2A 4B33A 4K6OA 3U26A 4A03A 2EF1A 1ZHHA 1TZBA 3PKJA 5EIHA 2C3YA 3LOQA 1EJBA 2ZREA 3R41A 3PQ5A 3SIWA 3R3SA 3ZCXA 2HA6A 3HLTA 4WIAA 2XQJA 3ZOKA 3IR6A 2BISA 2VA8A 2ZTVA 3JYHA 3G7SA 1Y6RA 1A3CA 1RZUA 3NTQA 2Z8ZA 4CQNA 2VLBA 1EWRA 2RH8A 3HRHA 4ES6A 2IYRA 2YUTA 2MR6A 4RMIA 5JPDA 1DAFA 3NC0C 1GNSA 2ZXUA 1H1LB 1N2IA 3RRMA 3RG2A 3HLYA 4NJEB 1TIBA 3R5KA 4HQLA 2OQVA 1SU7A 1QV9A 2GF0A 3SEZA 3VJKA 8MHTA 3K0AA 4FOTA 3AINA 4IS3A 3RUHA 1WVIA 4Q47A 4W7SA 3ZJVA 4EY4A 1G3RA 3L0BA 4DUGD 4E13A 3T1HB 2CMFA 2D8AA 2HCRA 4ZRDA 1KS9A 3OJWA 3QYJA 1KKLA 2Q3EA 3P2OA 4MUBA 5DNUA 1I4EB 5FI3A 5C51B 1TAHA 1SCAA 1Z39A 1TVKB 3DYBA 2FXVA 3S2ZA 4WN9A 3A8TA 2C96A 4F93B 4XOUA 3C6KA 3DOFA 4KVZA 5B6IA 2X42A 1AD2A 2RHOA 2ZROA 3PUVA 1I2CA 1JALA 2ACEA 1Y5NA 2VP0A 3FDJA 4IV0A 1PV4A 1LDBA 3RGGA 4IQ4A 2O5EA 1KIAA 1NW5A 2GRAA 2XYHA 4KQWA 3ET4A 1GEEA 3DV0B 3VC7A 5JSFA 4E5DA 3TAXA 4QA9A 2WR8A 4OHVA 4TLAA 2O0LA 1A5BB 5FUWA 621PA 4PG7A 3D2CA 1M7GA 1PR0A 4MV1A 2ZB4A 1F48A 1JH8A 5K3CA 4G5GA 2DM6A 4DFDA 3I1YA 1G8HA 1UBOS 3IRUA 4DLSA 3S8EA 3FTQA 4ZD6A 1SVOA 1OBOA 1XCOA 1YS2X 4Q82A 2O8CB 1B93A 3Q2IA 4I50A 3HDYA 1QYIA 3L43A 4QNMA 4L51A 2AG0A 4YJGB 4AS3A 3Q2OA 4KBFA 4C7BA 1VRVA 4KFCA 4GXNA 3ZE7A 3D6FA 1QE0A 1YBVA 2ZS9A 1RYHA 3HTXA 3AR6A 1Z6ZA 2CSXA 4DEYA 1UAAA 2WM8A 3FVTA 3LGAA 3ZWQA 1KNXA 4B85A 1GAQA 4IKEA 1NQOA 1Q0QA 3NKVA 4MW2A 2J3MA 4JP2A 3FCXA 4NAHA 3NVDA 1BRTA 4NV0A 4UUBA 1P4JA 4CKCA 4F9FA 5DGTA 4ZCPA 1G6Q1 5I7OA 5D3MB 5IULC 2DPMA 2QP9X 3IEIA 1LX6A 4JI0B 4BKUA 5IJ9A 4BQQA 1JEYB 1TKCA 3N3BC 3EIEA 2CKDA 1SKBA 4NEQA 3LM8A 4B3MB 3S70A 3UB4A 5DXFA 3DNMA 2Y71A 1AHNA 4GLJA 1ESZA 4XJVA 4WRRA 2BFFB 3QY9A 1OH6A 2F64A 2JFVA 1YOBA 4H77A 2X4LA 1OC4A 3P97A 4JT8A 3ZJ5A 3BSYA 1U3VA 2YASA 5BP7A 4QUGA 1O96A 3F6YA 4IJUA 1DT3A 2P9HA 4AVYA 5KUTA 1W85B 1RHJA 3SXJA 1CZLA 3Q8LA 2LR0A 4K9MA 4MB2A 3GJRA 5B6PA 3KXDA 5M5BA 2JIPA 1C2TA 4LC9A 3BGSA 1M33A 3F4LA 4I9HA 1OLXA 5KKAA 4JOBA 4F3TA 3MWLA 4R51A 2C4NA 4LRTB 3LBHA 4X3CA 3E7WA 1GNVA 4J7UA 1H8HA 3HSYA 4NYIR 2ZIFA 2Z8YM 2D6FA 1JMYA 3AKCA 4NU6A 2I1QA 3HRKA 4OREX 1T2EA 1XRLA 1JKJA 1G3MA 2G07A 2H06A 2J5QA 2MU1A 2NTEA 2XMSA 4KQIA 5C5CA 5JTTA 3B1XA 2G0AA 2O8VA 3DEFA 4EF5A 4NBUA 4F4FA 4QUKA 4YASA 2C04A 1CUIA 4JI1B 3HCFA 5LLSA 5DYGA 1L5GB 5A62A 5H3LA 4ZZ0A 4PHFA 3SLRA 3GFTA 3KTDA 1LCIA 1X3LA 2KE5A 4NULA 1E59A 2YN4A 2M2IA 4QDZA 4J0HA 5AUPB 3R3VA 3BULA 2NVBA 1ISFA 4HQKA 3R5HA 5DW3A 4AUKA 1DG9A 3MGBA 3JAKA 2G04A 3O21A 1IN5A 4K28A 1M1NB 3HC7A 1TJNA 3H18A 3CZMA 2RIRA 4KH0A 2BEVB 5KJFA 1RTTA 2CKMA 1MAVA 1CJBA 4F2PA 3R3XA 3QU5A 4FU0A 4U8GA 3W9BA 1U0OC 4KXNA 1DBQA 3ASVA 3IEUA 4MDHA 1O6GA 4XM0A 2HJ9A 1TA9A 3U4IA 4CF3A 1QOZA 4LBWA 3I01A 1MTZA 1RZRD 4D5GA 1B0AA 1U7ZA 2C2OA 2QPAA 2XA9A 1C1DB 3EDRA 3HKDA 2Z98A 3M4YA 1O77A 4NH0A 4ZVSA 4WKPA 4AROA 1UDRA 2GXAA 5LVAA 4PY2A 4EGJA 2WB2A 2B2CA 5JSHA 1U9IC 2ZSDA 3KVOA 3STHA 5SZHB 2O5VA 4KUEA 3IMFA 1FNMA 3MS7A 1SBCA 3WWEA 1H3EA 3LDAA 4HXEB 4K3VA 3DDOA 4RPKA 2XYPA 1FMJA 1TJ5A 5D86A 1VI2A 4AP5A 2G0TA 3W7AA 2BELA 4AJEA 3H3XA 1NRWA 5E4FA 2PO5A 1J8YF 3MUFA 5FI0B 2ZBFA 1L7RA 3Q11A 4J03A 4RKRA 5GM2A 1AV6A 4IJVA 4PPGA 3AEZA 4GRAA 1FYFA 1QX3A 3VPXA 3DOEA 1RXCA 1XRPA 2A14A 4XZ3A 2IXGA 5CX1A 3UT5B 2QI9C 2X3FA 5CTJA 3ZE1B 2H1OA 1US8A 4RYDA 3OJEA 5IDVA 4AF6A 3FPCA 3ZI0A 4I6EA 5J47A 2J3HA 3QVTA 4ME6A 4EJ6A 4MWTA 4LVNA 1YFKA 1QTQA 2VPYA 2ONCA 1UR5A 3ZCTA 3KEQA 4QREA 4BNMA 3SAJA 1CUCA 3RUCA 3T0FA 2I4RA 4W99A 3KQLA 5CA1A 3RADC 2F1JA 5I5EA 3LCJA 1SXJC 3LXUX 3L6EA 5HP4A 5D5PA 2EHDA 3E9RA 3W7BA 1C1YA 2E5FA 1QRUA 1XEAA 1PLLA 4EABA 4ZHQF 2ZETA 3L0YA 4NCKA 4ZVVA 2AOXA 2VQDA 1XVLA 4J91A 4YT4A 2XVAA 3ANXA 1K9VF 2NP6A 1R8YA 3PFWO 4CWAA 4D9EA 1DE0A 4EKIA 2HW8A 1N6LA 4ZO7A 1LPMA 3QXHA 3UNXA 4Q03A 1JPJA 1EBBA 3DE5X 3KL2A 3KNZA 4KO4S 4P7BA 5A04A 3OIYA 1RJ9B 1YDGA 3B7PA 3DBRB 4C9BA 2R8ZA 2X5OA 1FDWA 1KHHA 2YJZA 2HK9A 2Z1DA 5J4YA 1KR2A 3DEYX 2WAAA 4DBVO 4LJRA 3O3NB 1K3TA 3WMRA 5LYJB 1LF0A 4EWLA 3FWYA 1TU0A 2XVMA 3FLBA 4H7EA 3R6LA 3IBSA 4LRXA 3EVZA 4BWVA 2B35A 3KAJA 4EOGA 3GUYA 1ZOLA 1SUEA 2G6TA 1PJTA 4U0JA 1PR1A 2J4CA 5AJXA 2FW9A 2QW0X 4FEYA 4AG3A 4CV3A 4P81A 2J0SA 2F8SA 4CMEA 4NDAA 3LNCA 3QKWA 1IG3A 4A2CA 1UC9A 5JPIA 5AVZA 1RE1A 4MW7A 3IKJA 2M1XA 3L1UA 1EAYA 2NZVG 4DDWA 1W5TA 2CHVA 4XVHA 2X1LA 3V4RA 4W5HA 2WKQA 3KWJA 1MH1A 3E2MA 1PV1A 2X8AA 3O8OB 2AKEA 4XJTA 3O73A 1ZVVA 3BIOA 3AF4A 1DL5A 5IUJC 3LDUA 3UT5A 1BVHA 1ZM9A 1P5RA 1EYZA 4MJ3A 4L75A 4MVJA 5DTMA 4L8YA 5I7AA 4P0QB 1TVCA 2ATEA 3ONFA 4FVTA 4R54A 3WSTA 3RR2A 1BYIA 4E46A 1U3FA 3H2KA 1Y6GA 3GCWA 4QULA 4U7DA 3T5DA 4HYEA 3X0DA 4BVHA 4HAVA 4IDQA 3PFHA 3SSMA 2PZJA 2JRLA 4RZ3A 2PR7A 1PJAA 2ZI3A 5KREA 2PZ8A 2O2XA 2ZJYA 1KI7A 3O75A 1RQLA 5TXGA 1CK4A 4KR3A 5KYUA 4YT2A 3C8DA 1DRJA 2KBEA 1D2RA 3C45A 3REQA 1ES9A 1D2GA 4MRRA 1UBEA 3ZWYA 1C9NA 2JI8A 1FX0A 1IN8A 1ZHFA 5FTKA 3IIJA 3SOZA 5GGXA 1EQUA 3CNBA 2OGUA 4ASUA 1JL3A 2NXEA 2VT6A 1NR1A 4HP8A 1GFIA 4G26A 4RL6A 4URFA 5E7MA 4EJ2A 4MPRA 4MMXB 2QRVB 1CQZA 4R31A 5EJ6A 4N3NA 3P8ZA 1OE0A 3EULA 3FWNA 4W9NA 2FW6A 2GDZA 4L27A 5T7BA 4AMYA 1A4XA 4BQEA 4C0QC 3I92A 1EA5A 3LSYA 1JFFB 3I04M 1NDQA 1EWTA 4UTXA 2BN4A 5BY2A 3U6BA 4NMXB 3N1UA 4JJIA 1LLCA 4JHLA 4KQGA 3LV8A 3CLRD 2UZIR 4QQKA 4RWZA 4UDXX 4IM7A 3ZUPA 4E4RA 3K0BA 4J07A 3R6DA 3CNHA 3O2SB 5IAJA 3VKFA 1Q2XA 2YJNA 1XZQA 3D4PA 3N0TA 3FWKA 3WO0A 1JYEA 5JE8A 2LPMA 4MJLA 1CQXA 3ZXXA 4BV9A 3AEXA 3IVMA 3VJLA 3ELDA 1ZMRA 4MAMA 1Z2AA 3VR4D 1RIIA 1WPRA 3BL6A 1BE8A 2H59A 3GJXC 1N3BA 3ENQA 4EY5A 3W5IA 3C43A 3WIOA 3E05A 2YMMA 3HJFA 1OPRA 1TC2A 1PEKE 1QRDA 1YZTA 1ODJA 2WMDA 5BSMA 4JI4B 2HI0A 4BFYA 2JZCA 5FA8A 4B45A 1A8IA 3BXXA 4YN3A 4HS9A 4ETMA 3KUKA 4DC1A 3A1FA 1E5LA 3IQFA 1GQRA 2ZVJA 1WS6A 3H05A 3ZJTA 3JV7A 4E22A 2ISCA 1GAXA 1CULC 3G0OA 1FMCA 2XKAA 1WHSB 2EWVA 1NULA 5I3ZA 2OMEA 3EIOA 1N2JA 3ZD8A 1ODLA 2L0XA 3EWAA 4BCBA 1M6YA 4FSDA 1NE2A 3OTQA 1KI2A 4R1QA 4ECAA 2BR4A 4DT1A 3D3QA 3TTSA 3OU2A 2BFNA 1XWWA 3LQKA 4FQ5A 4F5YA 3FFBA 1EGAA 1JA0A 1EBUA 2HU8A 3K35A 1RCUA 5LIRA 2ZB3A 1JSZA 3EX7C 3AMVA 4BKPA 4GMHA 1SU4A 2IEYA 121PA 4GOXA 4LOHA 4O3FA 2F3RA 3PR2B 3GG9A 2GR9A 3B13B 2BH9A 2QQ0A 3LKZA 3R3HA 3GC6A 2DQ4A 3FR7A 4JKOA 4COOA 2HOQA 1SVKA 1WF6A 2JIQA 3L4BC 3P45A 3OP4A 4RZHA 2WPDA 2YWXA 1P0MA 2QRJA 4QVKA 2FFJA 4DYVA 2FG7C 5D6NA 3PJFA 4BX0A 4RLSA 4PX3A 4EGQA 5L95A 4WN9B 3K70D 2XGJA 3DMNA 3R0IA 4N5HX 1VB3A 3DPSA 3CZ4A 2MJLA 4QUEA 1KDTA 3S1AB 2VDNB 1ZD2P 5EP1A 2CLDX 5KYXB 3IUYA 2DT5A 4QGFA 1VL8A 4ZOEA 2BAGA 2CYAA 2FZGA 3LC0A 1QTNA 2IYAA 2QDXA 4H3KB 4C3OB 4NS1A 1LS6A 4RD4A 5CH3A 3KUDA 4LRQA 5BNTA 3SDSA 1OLUB 4DXHA 3SBXA 4B6RA 1QCZA 1ZO8A 3VO9A 4DJEC 1MC4A 4E1BA 1W0JD 2Y1WA 1EDDA 3ECSA 4N7JA 1HTWA 4O2AF 4PYNA 5DYIA 4JVSB 2W0SA 1Q84A 3T9EA 1FJ2A 5C1PA 2C9DA 2ZAOA 1RM5A 3CMCO 3RHZA 4AY5A 3GFOA 3SEAA 2OGSA 4EYSA 3D7KA 2YHIA 3DV2A 3CSDA 4OLAA 5K7SA 4LKOA 4X3OA 3N8NA 1QTRA 3PT9A 4HYQA 4Q9HA 1GKIA 3DH0A 1GPLA 3U4CA 3LL7A 1LGYA 5I7VA 4JBHA 3ZCVA 4IOLA 4RY9A 1R0WA 3I52A 4AYTA 2DG2A 1YS7A 2R68A 5ERXA 3G2IA 1PUXA 2POCA 5LP6C 4Q3OA 1PS8A 4I3GA 3WGYA 1HEIA 1K08A 1QLWA 2C31A 3ESAA 3HCRA 1KI6A 1WXHA 1AX9A 2A0FA 4L78A 4YGYA 2GD0A 4E5VA 4CCYB 1FSSA 5K8VA 1O4VA 1E0DA 3BXGA 1NVTA 4Q93A 5IJAA 3T0IA 2VF8A 2WYHA 2ZVDA 4Z9BA 1I2MA 3EZ6A 3AV0B 1E7WA 1VLVA 2OCYC 3KK0A 3MAJA 5IBPA 5SZJA 4A23A 1P9OA 1U9YA 2XR1A 3KLMX 1UMCB 4NV3A 1QE5A 2JNWA 2REQA 4JQSA 4KK3A 1VECA 1YDHA 2P3QA 4HTAA 4JU9A 4NBNA 1A7AA 3C8HA 1K86A 3EUFA 2W93A 3O74A 4GSKA 2O23A 4NOMA 2W70A 1UKYA 4I5DA 4BVJA 3PFFA 1L4YA 1P2BA 2P6OA 1USUA 3CRZA 5KB3A 3JQ8A 1LJLA 5AW7A 3B5IA 2NTNA 2WT9A 3W04A 2GEFA 3VI4B 4RGQA 2EHJA 1CVRA 3PPXA 4P54A 2X0KA 3E58A 5EMLA 1T5LA 5SY4A 3JWGA 5A02A 3ZGZA 1P62B 1T9GS 3FSGA 4TT3A 3RAGA 3TAHA 2VHTA 4IMIB 4AUNA 1ZMOA 5A6VA 5JDCA 1EHYA 3ZC3A 4D92A 4IUDS 4DQLA 4MO2A 5DASA 2E4XA 4OBWA 3SLGA 1N2SA 2W6ZA 3KWLA 4FR2A 4LQCA 1VGRA 2BR3A 3Q7SA 1A9PA 4HDCA 1CHNA 1YHYA 4MWGA 4RTSA 4HUJA 5HYVA 5B57C 4JBGA 3C8MA 3FI9A 4OJKA 4ITUA 4IF4A 4UNNA 2FA9A 2WJZB 1EI9A 1VL5A 3TL6A 3ZHRA 1HQYE 4CKCB 2DVMA 4JITA 1E1NA 1PSWA 1H2BA 1NSTA 1TJPB 3IAM6 4PQYA 4Y18A 4G1MB 3B1KA 4G0QA 3ZLBA 5FLEX 1CJSA 3OZCA 1T3GA 1IFXA 2QMEA 3NH6A 2DPHA 4OXQA 3CNQS 3HFGA 3UBTA 1E61A 1JQAA 4U7FA 3E03A 5AH0A 1ADCA 1SXJA 1Q17A 4YR9A 3ZJUA 2P2SA 1Z07A 4W82A 2KJQA 1Z88A 1FDTA 5K3OA 4PLFA 2GKSA 5CT6A 1Z0UA 3BJRA 5J23A 1VE3A 3NGXA 3JAKB 4ND8A 4EG8A 1BJKA 2Q2QA 4H1HA 3LP5A 4LV6A 1XVAA 2NUTA 4CMBA 4R98A 1Y7LA 4JB8A 2IQIA 2FEMA 3OFJA 4IFEA 5DTRA 3UG7A 3VAZA 2VJLA 4EPWA 3BFPA 5IM5A 3VOSA 2EXXA 4DR4B 3AC0A 1RXWA 3FW1A 1U6KA 1M66A 1XZPA 3VV3A 4HPXB 1BKSB 2DH5A 5IARA 3WYGA 1CUYA 1F06A 5CLQA 3AJ8A 2LTAA 4X71A 3RJTA 5LN1A 4BP9A 4MB0A 3BH0A 4G9GA 3GWGA 5FTMA 3GEEA 3PUXA 1UDXA 3AFMA 1GTSA 3OMWA 4GL2A 3CF0A 2ZM5A 4DLBA 2H9YA 3LBNA 5AVQA 5GIPE 2AG1A 2BZ1A 3VQTA 2EL9A 4OQYA 5CNJA 4WEQA 1JHYA 1QU2A 1TTQB 4HFRA 4EG6A 2B4QA 5IVPA 1E3WB 3SBOA 3PE3A 1J20A 3HR8A 3GROA 4QVGA 3C5WP 1JB1A 3NCHA 4MUJA 2QDKA 1F4LA 2PIAA 5D5HA 1EDOA 3AHHA 3S68A 2XCUA 3LY9A 1SQSA 5AW4A 2QM3A 1JSLA 3TZ6A 4ZAYA 3K9QO 2BLLA 3IE1A 2WJ3A 1CEXA 1Z6YA 1BCRA 3BB3A 3PVZA 1PWXA 3NW9A 4JFRA 4ZI5A 2VWQA 3N07A 5AVYA 1IH8A 1NVXQ 4M3NA 1HT0A 2E1RA 2G1UA 2IK8A 1N5OX 2QLBA 2Y66A 3OOYA 1S02A 4XKJA 3V4PB 2AK3A 1V5IA 2D5IA 2PLNA 1WE2A 3OLVA 1J0CA 2V5AA 2V8BA 4IJ5A 1EA7A 2AXNA 5BMVB 3PF8A 1SUBA 1YB7A 4OQDA 2ZPUA 3H2HA 4ZYXA 4ER0A 4G1VA 1R27A 1GIAA 2I1VB 3C4VA 4B46A 3ZVMA 2H4HA 3GMIA 5EIBC 3KS9A 2CL0X 2EQBA 2BY4A 3MLAA 1A98A 4OVKA 4MEBA 2C61A 4U6SA 4WXEA 4XSHA 3L04A 1GO2A 1Q0LA 3BMOA 4KWTA 5JQGF 2LKDA 2SBTA 5TMPA 3BK2A 1M1UA 1ZVKA 4PVDA 3O1JC 1X39A 1JU9A 4MV7A 5CFLA 5GV8A 3EY9A 1IM8A 4UTPA 1IJEA 5AK5A 3GLRA 2Z9DA 4JEMA 4OMUA 3O92A 4PSAA 1FTWA 4DM3A 2VSFA 5DU2A 1P0PA 2HCFA 2GLXA 3NDPA 1H4QA 1WNFA 1CZNA 3TVTA 5L3QA 3TRKA 4TM7A 3BD7A 1FVXA 1TLTA 1Y7TA 4R2MA 3UUWA 3BE6A 1PYDA 3IEXA 4LZOA 2Y6UA 3FPSA 2FG6C 2A35A 3QELB 4ZVPA 4QUIA 4HCJA 2OHXA 1DDOA 1G20B 4TLBA 4F45A 3K6RA 3OJOA 1YU6A 1IOVA 2R8RA 2P6UA 2RK6A 1EFPA 4QYTA 2H57A 5DXJA 5FPQA 3SVZA 1N8KA 1YZHA 3DOOA 3GLIB 1EEHA 4C08A 3NHWA 4IIJF 4D45A 1ZI9A 1XTKA 2CMKA 4YVFA 1YI8A 5FF9A 3JQAA 3T3PB 1I94B 1EFLA 4PAMA 2NZ2A 5E6SA 5JV5A 3DP9A 2ZUFA 4H7HA 5L51A 2HF9A 1ORTA 2ZDGA 4LXGA 3COZA 3A10A 4X66B 4NSNA 4C6SA 4N41A 3T3HA 3H84A 3IOCA 1L5VA 4AS1A 1VE5A 4E1AA 4IP0A 1ZUIA 1HV8A 2R1ZA 4JT2A 3MPOA 4K9OA 1WTCA 4WOJA 2ZJ4A 3A3PA 4PO9A 1TQ4A 4OXIA 1LLQA 2H1RA 2QI9F 3UYLA 4BVLA 2C8KA 1J25A 1EE9A 2B4AA 3CCCA 1KJJA 1DTWA 1G1AA 1XRMA 3Q5EA 2QR5A 5NLLA 2C7GA 4UHDA 1X7XB 4WCFC 3SHWA 5KQPA 1DP4A 2GXUA 1BA3A 2JJ2D 2OCAA 2XYGA 4U2GA 4EK9A 4HSGA 5CYPA 7ADHA 4RVDA 4CIAA 2C4MA 3S55A 4Q4LA 4ZT3A 2I34A 4MKGA 1O1YA 3EEYA 4TRNA 5K3DA 3VKWA 3UMYA 4NEGA 1SK8A 3OLYA 4ZV7A 4EY3A 4IIDA 1YGPA 4YP9A 3REQB 3D6UA 4FN4A 3AR2A 2XX3A 1B6SA 1BNCA 1OZAA 4KLAA 4QBHA 3I6QA 4TMVA 4XWGA 4D9BA 5JSZA 3SC2B 1N3LA 3AWIA 3W4JA 1X7HA 4HVTA 3CYFA 2EJTA 5DI3A 5FBLB 1K6XA 5L4NA 1C3OB 2PKQO 4OQFA 2YWEA 1V37A 1AHIA 1EGMB 1U5BB 1U1CA 3HBMA 5T8KC 4C7JA 2QVYX 3USZA 2PBLA 4DUYB 3GD5A 1MIHA 2F9FA 1UQUA 1S4MA 3PC8C 3QE3A 4G2TA 1E2EA 1E1YA 3WQSB 1CEYA 4NBKA 1OYWA 2D5LA 2GOYA 3QK7A 5AOAA 3WLHA 4DVGA 3WYAA 1XPOA 3TX2A 2O07A 1SCKA 4QDKA 1WVGA 3TE6A 1E3MA 2EERA 1EZ1A 2WLTA 3SHQA 1G20A 4FBLA 1JPVA 1BX0A 1WW3A 2AMJA 2J30A 2OO5C 4ARCA 4F92B 4GU5A 2XQKA 2PG3A 3O8QA 3QU4A 1H2ZA 2HH9A 3I9NA 3MF4A 4FHCA 2J59A 2AKYA 3QWIA 1M2KA 4U2BA 5K0FA 1Q12A 2R2GA 4CPDA 1GV1A 1JEOA 2QLNA 1MAAA 4E1VA 4ZI2A 4O8CA 5B1SA 4JU8A 4NC9A 4HNRA 4RGBA 1PYOA 1E1MA 3OQVA 4LYYA 4OJNA 5EQJB 3BIWA 3EFHA 3T12A 4KC0A 4ARIA 3DEKA 1ICIA 5GY7A 3L4BA 5A3JA 4DQUA 5TQ0A 4L6AA 3L9WA 3A06A 5E8JA 1LVHA 1FW8A 4LBVA 3U0VA 4B4UA 5CG2A 2GEKA 4W1PA 4V1CI 3MMPA 3CE6A 1JG6A 3IQGX 5H82A 4XARA 2GD1O 3SYTA 3Q1KA 3QQ5A 1N0IA 1BU8A 3I6IA 4RV9A 3UTCA 1RJ9A 4EP1A 1OAAA 3ZHYA 1RXUA 3IO3A 4TLEA 2DTEA 2GTHA 3PGA1 4NIMA 1C3XA 4C07A 3WQRA 3WK6A 2NVWA 1Z15A 3TXYA 2TSYB 1H2HA 2PWAA 3ANTA 1M6VA 1XV5A 4PLZA 4D4IA 2OLJA 4ZGBA 3IE2A 3BH7A 4YV2A 1SWVA 3AKEA 3TK1A 4B7AA 2V98A 4GWGA 1TQ2A 3UKDA 4HRAA 2W22A 3I9V1 3PFIA 4M1QA 5CPFA 4MITA 1QVAA 5CJ2A 4YAIA 1GNRA 3SR0A 2GS9A 2RGGA 1VMEA 2A6PA 4L0CA 4YT5A 4E0BA 4P7KA 2IDKA 1FUIA 5EHXA 1MABB 2EU8A 3F74A 1KP9A 4NYMQ 3UUFA 3KTOA 3OSZA 4RHUA 3UYKA 4E7PA 3IDOA 1G8MA 1U63A 2Z95A 1OH5A 2WVAA 1QRTA 4FFDA 1YFZA 2IUUA 2OFWA 3MJEA 1Z8NA 3M33A 3R4CA 1UOPA 3GVPA 2G40A 2RG7A 2D2FA 5U4XA 2GA9A 5L4LA 1NW4A 2XQFA 2OK7A 1JG4A 1LKZA 4IDBA 4A1FA 3WX0A 1CHDA 1V8DA 3EG9B 1HE8B 1WXDA 1VLMA 2I6GA 4OLBA 3BEDA 1ANKA 4RSMA 3DL4A 4FZ5A 4KMRA 5HDBB 3MCZA 5DXAA 4RQTA 3K73O 4YV7A 5ALLA 1SPBS 1AE1A 1IY1A 1PR4A 1UFVA 1G5HA 2WUEA 2YDXA 3IV9A 3MUEA 3O9MA 4CMIA 1L7OA 5TX7A 5JATA 1NNSA 2PUEA 3QMVA 4HYTA 4KFUA 4AYXA 4KGVA 2GYYA 4AQDA 3CM0A 1ZESA 2QUZA 1ZD3A 1Z6GA 1IXRC 3MWEA 3NAMA 3ZHCA 4MIKA 2ZPAA 4A6DA 1QWSA 1W47A 5IHPA 3AHJA 1C1XA 3NWPA 4C88A 3D3WB 1MPTA 1X7WA 2N42A 3ASZA 3FOCA 2Y2VA 5CEFA 2VAXA 4JSTA 2X5NA 2RGXA 5L4SA 1QO0A 4ZT2A 2A5DA 1VGVA 4MQ4A 1SOAA 5FAXA 2ZJAA 4RF2A 1QH1A 3LY5A 3WBFA 1JDJA 1ZIOA 5AI9A 1RC0A 4YAKA 2MSNA 3D7NA 4Z49A 4JLJA 1U7UA 4OB7A 4G5HA 2Q3JA 4PRLA 1KZ4A 3T99A 3GZNA 2GCGA 4OJTA 2HA3A 3RVQA 2H08A 2X9LA 4KX5A 2MT9A 2NPOA 2AI1A 4IGKA 4LFBB 2C98A 2FUNB 4PGGA 2J31A 3IT3A 4D02A 1TMYA 2WYOA 2VJPA 4ER7A 2A1TR 2HF2A 1XRQA 1ZW1A 2GN8A 5DBFA 3WKCA 5BW8A 1P1FA 1S2IA 2DHDA 1M7HA 3SFTA 2DJ5A 2VJBA 1BXGB 2J3KA 1LB1B 4Q6BA 1EM6A 4DSUA 3IBCA 1ADJA 3F47A 3ORFA 4L5JA 3FDXA 1Z68A 2ZIGA 2QZ4A 4Q3KA 4FQ7A 5DGXA 2SCUA 4O2BF 3QNWA 3E5RA 1TJYA 3IXQA 3JD4A 4HDSB 4H4CA 3EVDA 2ZCVA 4M0LA 4G36A 1BG6A 4BNKA 3GLGA 1DO2A 1NR7A 5FEUA 4TN1A 1CUHA 1NY6A 2FPIA 2GCOB 3HGQA 2I8CA 1T2VA 4MQUA 4NBWA 4N3CA 3AQIA 2IOFK 1PVOA 1DUSA 1NL3A 2NV6A 1JEAA 1VLJA 3KOWA 3SC2A 4DLUA 821PA 4NZPA 3RYIB 1GN9A 1M10A 1DX4A 3E7XA 3NZEA 2ZIXB 4LNUB 1QPZA 1K5PA 1YZLA 2IDMA 1X77A 2IIPA 3EASA 4KO2S 5AXAA 2I3GA 4OHZA 3TX6A 4EZBA 3A9TA 1O0CA 1DC8A 5HK9A 4O4LA 4PV7A 3OFVA 3L0PA 1NPYA 4QWWA 3WHPA 3LO8A 2Q7DA 1TEHA 3G9XA 4FE4A 3T7RA 3ZVRA 4F4IA 1U04A 1K7EB 3GBPA 3D5TA 2W2XA 1YBMA 4DLWA 3RK0A 1RHMA 1U8TA 4BQRA 4A8JA 1N25A 3CX7A 5J1SB 2P1RA 3JQ8B 3PEUA 4BU0A 2EP5A 4AJIA 4NENA 4TUYB 4WFQA 1LD3A 1NJSA 4M76B 2OECA 4JI5B 2C99A 1ZCJA 1GYPA 1T6BY 2PSEA 1UPFA 5IKPA 2G09A 4PZPA 1L4NA 1Q14A 4OEHA 1XN1A 5ESXA 4F2DA 1L8XA 5DLPA 2P3LA 4BLTA 3G2NA 1Q0PA 4QGSA 2D4AA 1VG1A 4W63A 2WU4A 2FK8A 2PJZA 3D6VA 5DNVA 4ZVQA 2W43A 3TD2A 5B2FA 4LVOA 2IL1A 3TQOA 3VHXB 3VU9B 5JTUA 1ZJ6A 1QVVA 1JH9A 4I4TF 4FGKA 1AK9A 3Q5DA 1N0WA 1WA5A 2X7XA 1TCCA 5JXWA 1AXEA 3HKCB 1FTGA 4B6PA 1YQQA 5GM1A 4EHHA 2Y3IA 4HBZA 2F00A 1N77A 4O1IA 3QVOA 4HPWA 2I8AA 3ZE9A 4B7ZA 1YVPA 1V3QE 4IHJF 3U4HA 2GFIA 4MRPA 3VPAA 1WCIB 1V3UA 3P1JA 4TQAA 1DC4A 3E82A 1C0PA 2DQKA 4CQLB 4KN8A 1PJCA 1E3LA 4U5XA 3BERA 2YFKA 1U9ZA 4RCVA 3IA7A 5KWSA 2QAJA 1OUMA 1SC9A 3KDSE 1UWCA 3BD8A 4HEHA 3QU9A 2WJHA 4IDEA 5P21A 2VDWB 3ZJYA 5CFPA 4YY3B 2WM3A 3QP9A 1MZPA 3HM2A 5EESA 3UGJA 2R60A 2ZYVX 3C3KA 5EVJA 4DV1B 3TI7A 1ZHOA 3RSGA 4GPBA 1KDVA 4ND8B 1SJ9A 4BLVA 5G0TA 2B6HA 1V47A 5ALVA 3JY6A 5CXSA 4B2PA 3SD7A 4GVLA 3G9UA 3RS5A 4I9NA 1F5NA 3FPKA 3C1OA 4RK4A 1TW2A 3B9QA 3NM6B 3PEVA 1A9RA 1UBUS 1VFNA 3UENA 3UMBA 2BP7A 1I36A 4KO3S 4L5CA 1H05A 4TS1A 3ZDXB 5DI9A 1CRWG 1GDDA 2QMYA 4HG2A 4IGEA 4MV5A 2IV3A 3SS8A 4NENB 4BNYA 1N33B 1N78A 5HWSA 2I33A 1YRLA 3L01A 3KYIB 1NBMD 1QC5B 1NFQA 3WFIA 2IHZA 3QLTA 4XDGA 2YJ5A 4BO0A 2WJYA 1TJ3A 1GT91 4BPRA 1HDZA 4AQYB 3T54A 4JI2B 3Q85A 1UBTS 4PXAA 2FP4A 1Z5PA 2I7TA 2RGAA 1SXJD 3GIDA 3TCXB 1OV4A 3FSJX 1ODKA 2JGFA 3JZFA 3ENVA 4MS3A 1T8PA 2I99A 4FP9A 3NNSA 2XB4A 3B1YA 3MCAA 3WB0A 2OD9A 1GILA 3TRDA 3LIPA 5LDHA 4L4ZA 1IXYA 4UPDA 5I8PA 5JRDS 1RLOA 1M2WA 2IZ0A 3SS7X 4MWDA 3OJCA 3RBZA 1ORHA 4JX9A 2ZCJA 4GE0A 1T2NA 2P5TB 1QGOA 1GPUA 2QUBA 1XXHE 2CHQA 4RBNA 4C4YA 3GL9A 2QAGA 3OU7A 1PW7A 2AG5A 1TOAA 2VT7A 4Y2RA 2CL7X 3C3AA 1UT6A 3U48A 5IBCA 1M2FA 2ZXFA 4NARA 3ZDYB 4LOIA 3WGJA 3VRHA 5K8LA 1XQ9A 2BM8A 2ZYIA 3DR5A 3KVVA 4ZJUA 5G2OA 2FPLA 2K7ZA 1RM0A 1GCGA 3OQHA 3RQIA 1P72A 3G5LA 4C6RA 2LBPA 5ARDA 1FFEA 2V6GA 3QMMA 1NJGA 4G0MA 1REQA 3E7PA 5JPCA 2IIQA 4X7MA 3UV3A 4I3FA 4NCIA 3EJWA 4NNPA 1AUXA 1J7JA 1DDGA 2J48A 3BXFA 2YOGA 1PQUA 3SSAA 3WAGA 3KHUA 3RSOA 4OX9B 3CSUA 3RHTA 1DEKA 2QVZX 2PCJA 3LLMA 2IXDA 3PGVA 3P7MA 3ANMA 4ZFNA 2LCQA 3KFXA 3D8TA 3E61A 3OIDA 4QXRA 5JRJA 4XGRA 2JA1A 2GEVA 2WUDA 3C5HA 4RABA 5JZSA 4F91B 3Q5GA 3GGJA 5JZ9A 1ULZA 3NHUA 3TZCA 1TFRA 1XZKA 1R0BA 2ZR0A 5BSEA 4A8HA 2CUZA 3I0ZA 1E62A 3PQ3A 4RPLA 4ZAZA 1JXAA 4M4SA 3VAAA 3NGLA 4K5QA 4MS1B 5LWQA 1R12A 4DQVA 1SD2A 2J09A 2VSQA 4BMNA 4FFSA 1KVTA 1L9XA 4RELA 3R0XA 2I3AA 4HUQB 5EJ4A 1NUQA 1VCOA 4XUDA 1K8XB 2VYND 1UP4A 3EFEA 2JGNA 3V1KA 4BJ3A 4DCPA 2VTBB 4YCBA 3COPA 1RM4A 4UBNA 4C