4O8ZA

Crystal structure of human sirt3 in complex with compound (2-butylbenzofuran-3-yl)(4-(2-(diethylamino)ethoxy)-3,5-diiodophenyl)methanone
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
272
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human SIRT3 in complex with compound (2-butylbenzofuran-3-yl)(4-(2-(diethylamino)ethoxy)-3,5-diiodophenyl)methanone
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacetylase sirtuin-3, mitochondrial
total genus 94
structure length 272
sequence length 273
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4o8zA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4o8zA01
3EA4A 1EFVA 4JT9A 3EY9A 5MFZA 4C7BA 4JT8A 4K9MA 4KPUA 1QPBA 3IAEA 2Q27A 1O97D 4UU7A 4Y6OA 2OO5C 1DJLA 2FWNA 2UZ1B 4K9PA 1MA3A 3PKIA 1EFPA 4FEGA 2IHUA 4JSRA 2Q5LA 1U28C 4FZ3A 2EZTA 2Q29A 4JD5A 5DEIA 1V5GA 4JUAA 1U2GC 2H4FA 4MPRA 2HJHA 1HZZC 2EZ4A 3FSJX 2IHVA 3FLMA 1D4OA 2WVGA 2H2FA 2H2GA 3GLUA 4ZZIA 2VBFA 4KXQA 4D5GA 4RJKA 2A1TR 1PNOA 4F4UA 1XLTC 2W93A 4BV2A 3D7KA 4BN5A 1O96B 4K9NA 2H2IA 3D4BA 2OD7A 1T9BA 2JLAA 3CF4G 4KGDA 3HWWA 4MQ5A 1UPAA 1PO7A 4GG1A 4RJIA 1YHZA 5BWLA 3JR3A 2PANA 4UTRA 4IG9A 2Q5JA 4J1TC 5DGDA 4UU8A 4QPZA 1Y9DA 1M2JA 3ZGOA 4JU9A 2BRUC 2Q5QA 4RMJA 1YC5A 4HD8A 3GLSA 4UUBA 2PGOA 2FR8C 2H59A 1YHYA 3CLRD 4C78A 3CLSD 5BWNA 4GP9A 4QELA 1U2DC 5AHKA 2V3WA 2FN3A 2X7JA 4GM1A 2H4JA 3GLRA 1YTLA 2AG1A 4ZP1A 4V1CA 1POXA 5EJ9A 2PGNA 5MGNA 1PYDA 5K3SA 4UTVA 1Q6ZA 2Q28A 3CLUD 4O8ZA 1E3TA 1T9CA 3ZG6A 1Z8NA 4GM4A 4V1CI 5EJ5A 4FVTA 4D5EA 4IF6A 2JLCA 1PI3A 5EJ7A 1M2KA 1T9AA 1PT9A 4HDAA 4RMHA 5BWOA 2VBGA 4Y6QA 4BV3A 5D7NA 4K9LA 2H2HA 5FEMA 3PKJA 5EJ8A 1BFDA 5DGTA 4Y6LA 4X3OA 4UUAA 2VK8A 2WVAA 4I5IA 2C31A 4MZXA 2UZ1A 3F6BX 4J16C 5IMSA 3LQ1A 4RJJA 4COKA 4BVFA 4R8MA 2FSVC 4UTXA 2H2DA 4UTNA 2OD9A 2OD2A 1JSCA 2EZ8A 3RIYA 4RMIA 2NXWA 5EJ6A 3CLTD 1U31A 1Q14A 1NM5C 3PDHA 4JUDX 2EZ9A 4BUZA 4BVHA 3EYAA 4JUCA 2A1UA 1YC2A 1V5EA 4MPPA 3K35A 2VK1A 5MFPA 4UTZA 1OZGA 1PVDA 1OVMA 1J8FA 1SZDA 4BVEA 4F56A 1OZHA 1S7GA 2JIBA 1YNOA 2VJYA 4BN4A 1M2NA 2OORC 1UPBA 2EZUA 4JU8A 3RIGA 4GPEA 4IAOA 4QQ8A 3FZNA 5EJ4A 1YI1A 2B4YA 2QQGA 2JI7A 3U3DA 4RMGA 1OZFA 1ICIA 1PNQA 1V5FA 3E9YA 4Q9DA 5EJMA 4TWJA 4JUFA 4L2IA 1MCZA 4K9KA 4K9OA 3OE1A 5K2OA 1S5PA 5FYQA 4V1CB 2JI6A 1YI0A 2WVHA 5K6RA 3GLTA 3JWPA 3D81A 4FEEA 4L3OA 4BVBA 1ZPDA 4G1CA 4X3PA 4TWIA 1N0HA 1T9DA 5K6TA 2JI8A 3F6EX 1UPCA 1M2HA 1POWA 4K9QA 5MF6A 2AG0A 2H4HA 1SZCA 2IHTA 3ZGVA 2QQFA 2Q5OA 2VK4A 4JUBA 2DJIA 3HWX1 1PTJC 2JI9A 3IAFA 2FRDC 4BVGA 1Q1AA 3U31A 1YBHA 4GM0A 4MPJA 5EJAA 1Q17A 2VBIA 2NYRA 1M2GA
chains in the Genus database with same CATH superfamily
3SFZA 3F5FA 2E6UX 2XNCA 5EQDA 1TM4E 4JBLA 3B20A 4LY0A 4GBMA 1XQ9A 1N3LA 1GT6A 5DBIA 5LP6A 3JTMA 2RH8A 4NF2A 5B1SA 3CNBA 5F2OA 2IEGA 3WDKA 1VCOA 3X44A 5BW5A 2ZJ8A 4PLHA 5CJJA 4YUXA 1QRUA 1VLZA 2JZCA 4C3UA 3IH5A 3JAMA 4EENA 5LIRA 1Q83A 1D4ZA 5DSZA 4EBFA 4IRMA 2G82A 2OEPA 2PKCA 4XVHA 2I1WA 2V7EA 4ZAWA 3S81A 3V9PA 2QUHA 3LKDA 3REQA 5KQMA 5KCZA 2R5NA 4IDGA 2IW3A 4G9BA 1JFFA 3ZGOA 1A71A 3E0XA 4WUVA 3JATA 4EGJA 3EZXA 3PI7A 2WWGA 1DC8A 3KOUA 4ENQA 2GGSA 1W75A 3IA7A 1NLFA 3EF1A 4QHYA 5AOCA 3T7SA 2W0SA 2Y6VA 4UASA 4DLRA 1NNI1 2VG8A 4DIKA 1XN1A 2CUKA 3CVXA 4KR0A 1KI8A 3N2KB 2C57A 2VYFA 1U0HC 3UMGA 4U2GA 3MF4A 3FRHA 2JCXA 1JA9A 4PPGA 3Q5DA 3P0FA 2MOKA 5CW1A 1HQDA 4ATNA 4D79A 3LH5A 2GZ3A 4O2BA 1A9RA 1DXQA 2C4HA 2J0EA 3LKZA 2IV7A 4D2IA 5DX1A 4G1BA 2LZ0A 2JGNA 1NVFA 4Q15A 3TQFA 4XD2A 1TFUA 1TO1E 2AE2A 2C99A 4KFUA 4YDHB 1PX0A 2X77A 3IV6A 4OSEA 2AK3A 3CLUC 3H05A 3WJ7A 1I1HA 4QQNA 1UFVA 1A3CA 3WRYC 2FLKA 1FFGA 5IWAB 3HA5A 1EBBA 4KRFA 2UZAA 1FDRA 1IEXA 3MWDB 2D0OB 1U9IC 3AJEA 3DZFA 4AZ0B 3PCTA 5JSZA 1A9SA 1LH0A 2YN2A 2ZJ3A 4AJ1A 3LCJA 5JTUA 3ASUA 3OOSA 4GF5A 4MPTA 2ZK7A 2FLVA 3C3YA 3NBAA 1JQLB 3O4VA 3V7NA 4EPYA 1GV0A 4J3NA 1R37A 4DKJA 4XM1A 2ZYVX 1U4OA 3KG2A 3I04A 5C5DA 2CXHA 2VQFB 3AV0B 3QYAA 3UWSA 2QW1A 3T9CA 4KI7A 1VTKA 2NSYA 4HGQA 3TM4A 3MT0A 1G4AE 2O7VA 4DLAA 3OCCA 2P4EA 1C3JA 1UBHS 3KPYA 3N7AA 3IUPA 1LZLA 1JHYA 2PFGA 3S7TA 1QJCA 3SZMA 1ZUD1 5EZYA 4F96A 2MSWA 1PJZA 3PHHA 2QTGA 3O7WA 4N4AA 1UXKA 1RI1A 3HDVA 3ISTA 1L9KA 3H3JA 5B58C 1BJRE 3BXGA 3D2AA 1F51E 2V7GA 2X4IA 3INTA 4OUDB 3KBBA 3TDNA 4QEKA 1KXZA 2DSTA 4YJFB 1NJ5A 4GQAA 2J7KA 3LOQA 1GQSA 1KSJA 5T3YA 3RGWS 2R44A 3RT7A 2UUCB 3C3KA 3JQAB 3BFKA 1QE0A 1T5OA 3O4IA 1UKZA 3KFVA 3KQQA 4L6AA 4PQYA 4D9JA 4H77A 4FGLA 5BPHA 2H11A 1OWNA 2PAAA 3IJEB 5E2IA 3AUXA 5AM1A 3G79A 4REQA 2R00A 4OLHA 3LO5A 1YJQA 1Z5NA 2PQMA 4BKOA 2JFGA 3LTNC 4FEGA 5F9HA 4DUPA 1MTZA 5COQA 1DELA 4GRAA 3FMOB 3LF2A 1MAVA 1NUAA 2WWHA 3TZKA 3GLFE 1ZM3A 3MD0A 4B74A 4DR4B 3W5SA 3AHJA 3CX3A 4PAWA 5FUXA 3UGTA 3VKWA 1P60A 2E48A 5FX2A 3IBTA 3K1YA 3PVSA 5JANA 5LP6F 4IOJA 4Z1OA 4I9GA 3GC6A 4CTJA 4B3SB 3HGMA 4ENVA 2VF4X 4PLVA 4YJ2B 3K70B 1M2FA 4HZGA 2HF2A 1DX6A 4GBJA 4OV6B 2JCBA 3TZCA 4W6QA 3LY8A 4AU1A 3B1ZA 3QPBA 2OCLA 1MP0A 3VR5H 3MT7A 2P7HA 2BKEA 1EUCA 3P9KA 4IZHA 2JK1A 1FZQA 5K8TA 2I1QA 4DZZA 5DYIA 4KR3A 1J5PA 3I9NA 3AM5A 4NU0A 4JI3B 5DM70 3PC6A 4QXQA 4IHQA 1J0XO 3VNSA 5K03A 4Q7JB 4LTNA 3H2JA 4EHLA 3TECE 3PK0A 1J70A 2XR1A 3AEZA 3DP7A 3MA0A 2C82A 4AY3A 1VIYA 1ZA1A 2G1KA 3N2GA 2X0RA 1BO6A 3DPSA 1VPLA 4YFYA 4MR7A 3IJPA 5KYKA 3ZXSA 2ZJOA 1IJKA 4RYLA 3J80A 5D5PA 4P82A 4BDTA 2V9PA 1MJNA 4KLCA 1TA9A 3EUEA 4M0KA 5DX0A 1PSDA 4OLFA 1R2QA 2IITA 2CMHA 3B7WA 4LYYA 3HJFA 4U5QA 1KI7A 3WK8A 4AF6A 1ZGHA 3F49S 3OVMA 4G4SP 1HE2A 1X2EA 3RIHA 1EJBA 3ZV5A 4AXXA 2QGZA 1TO2E 4HN4B 3LPLA 4OB7A 4O2BF 4X0EA 3VA7A 1U6JA 2MINA 3F2VA 1KH3A 4LJLA 4PC7A 4YRPA 1W73A 4RABA 1LQ2A 2J5RA 1D0VA 2VPWA 2AT1A 1V8PA 2NXJA 4YAUA 1A98A 2C5BA 3NYQA 4PAGA 4DY4A 1M7GA 3R5HA 3UQZA 5CM9C 1Q14A 3TEMA 2NU7A 2FF5A 2ATIA 1W1WA 2Q6VA 4P4UA 3M4YA 1IZ9A 1MQ9A 4QUDA 1XDGA 2VTBB 3LC0A 1PQPA 1XLWA 3VU3A 4AJOA 5AOAA 1IY0A 2L17A 4QARA 2CFIA 1IIRA 1RKVA 1X7WB 3DL2A 3LBYA 5FI0B 3ZIDA 1RWBA 2X3YA 1HM5A 1R0BA 3L7JA 5KU1A 3L0BA 1I32A 1WBBA 1UFRA 4LV6A 4XJSA 1IAVA 4OQPA 4QYSA 2VWHA 3A04A 1J8YF 3PJGA 1F7VA 3FWZA 3H99A 2IXBA 2G8LA 5EWLB 3JQ8A 4PIVA 3T5AA 1D2CA 4MKHA 2IZOA 5EUQB 3UKDA 1H4QA 1NF3A 1I3CA 4JLNA 2O0KA 3H2SA 2B4TO 5JQGA 5HMLA 1N5OX 1P18A 1U7OA 5CCXA 4DW8A 3B82A 1C9YA 1JUDA 1QF7A 4H7IA 3RVBA 3DMFA 3RS4A 1VCNA 1IXSB 4Q1DA 2ZUFA 3KO8A 1RWOA 4IDPA 4IQFA 1FJHA 2O8EA 2ECKA 4NV0A 4PSUA 2ZIXB 3HBFA 3ZJTA 1OGJA 2BT4A 4FFLA 2Z30A 1II8A 4RZQA 4C4SA 2VHCA 2TMDA 3O84A 3QE4A 5BO5A 4U3JB 2XE8A 1QTIA 1KSGA 3ZY2A 8OHMA 1VI5A 3AR4A 5E2AA 1SXGA 2O2GA 4MARA 4RESA 5MHTA 3CVOA 1SBYA 4FCCA 1CYEA 1NYTA 2DULA 4URHA 3DE1X 3ODGA 4MVJM 2SCUA 4FHFA 1OC4A 3Q5GA 3WIEA 3BEDA 3LDHA 1ADBA 4EX6A 1HGXA 4GX0A 2B8EA 2P9TA 4FSDA 4KFCA 1EYZA 3HB7A 5CGZA 1M6WA 3MSXA 4ZVLA 3JQGA 3CKLA 4LI3X 1C3XA 2QMUA 3DDUA 3U19A 4LJ8A 8ABPA 1E2BA 4BMYA 4EPVA 3KUDA 4EG6A 3CYFA 4ZHQB 4K9NA 1CS4C 4JYMA 2F3RA 5CEJA 2IS2A 4TXJA 1QC5B 1L5WA 1V1RB 1IOLA 1NQUA 3PTZA 4Q5IA 4G24A 3NYWA 1NLUA 4XIIA 3AY3A 4Y6SA 5I9IA 2D2VA 4N5DA 4M0FA 1FTWA 3LXRA 2EGHA 2XB4A 1ZSVA 3KSRA 3LXMA 4G67A 4C08A 1YZNA 3EZ6A 3RVLA 1SQ5A 4U2BA 5F1KA 2D7JA 3OU7A 1J2TA 4ZU6X 4BNHA 4CV3A 5B7PA 4UJ5A 2GN8A 4X8LA 2VLBA 4NFYA 3B13B 1TJ5A 3MGAA 1CLEA 3LFUA 2YRWA 1ENOA 2FW7A 1WB5A 1KMCA 2BFFB 1MB9A 2GDJA 3OZIA 3QQPA 3NIFB 1V3QE 1U0JA 4O4HB 4I4CA 1ZY2A 5G0UA 1ISRA 4BZQA 3EVDA 5BWOA 3BH0A 3HCEA 1KC1A 3PQEA 4RY0A 5DHSA 1SD5A 4BUJA 2K2QB 3KOWA 4CIDA 1OLUA 1AA9A 2CD9A 3ESCA 3WL3A 4DYDA 2C31A 4HX2A 4XGIA 3W5HA 2X5JO 4Q9HA 3SOZA 1AHIA 4ZV7A 3UFBA 4G6ZA 2QMYA 4PTLA 4TXMA 4C01A 1XDDA 5I7HA 4L5JA 4G1UC 3OMWA 2VC2B 4J0IA 1LBTA 1TF2A 1EE1A 1AK9A 3P2EA 1KZ1A 3CNLA 3N0WA 3NX4A 2XMSA 4I46A 4QYIA 2WF5A 4Y7CA 2QLBA 4KX5A 1E4VA 1YOVA 4BUZA 3BMOA 1LLUA 2AFRA 1OFUX 2ZU6A 3TZEA 2GD0A 4NE7A 3UJ3X 2Q2WA 1GSHA 1ZW1A 1HDZA 3A36A 2RH9B 1O6FA 1ORIA 4CR7A 1NBME 1YQXA 2O3TA 1IN4A 2XUFA 4S1TA 4X93A 4ETMA 5JD5A 16PKA 1TF7A 2VQ6A 3Q8WA 3WKCA 4WE3A 2VP5A 5LBUA 4A6DA 4ZPXA 5A4AA 5IVHA 2HT6A 4I8XA 2NU7B 1E1CB 1UMBA 1JQDA 1Z62A 4P3XA 4EI9A 1DIGA 3JVVA 1JPJA 4P22A 3CJQA 5DBOA 2RKOA 3EMVA 4QVKA 1UK7A 2F8MA 1GU1A 1QS0A 2G72A 2UZIR 2JCSA 2ZB2A 3D8HA 3ENKA 4R40A 3DC7A 2QR3A 4S12A 1JWLA 1MX3A 3FDZB 2YYAA 2J6CA 3A1WA 3UK1A 4EGSA 2WJYA 2A67A 2Y67A 1LNZA 2OL4A 4K6FA 4PWYA 5B1YA 1KPIA 3GP5A 1LDMA 1OWOA 3I76A 4FNAA 1TW3A 4DR2B 3IUBA 1K98A 1TAHA 2P9ZA 3E53A 3TLGB 1CB0A 4BO9A 1M75A 3KCQA 4P1ZA 1QGDA 1JU3A 1P2FA 1AGNA 1GXSB 2PPVA 2X2OA 2VZ8A 2XOXA 3IIJA 3FUXA 3MJDA 3ESYA 4HTAA 5K3BA 3I0NA 1J22A 4PC6A 5ALVA 3E8XA 2ZS8A 1J2JA 2WW8A 1PV2A 1D2RA 3BYZA 3R7AA 3CQ9A 4EFNA 5U9CA 2RGWA 4MWDA 3MBOA 4EL5A 3FCCA 4CIWA 1VA5A 3BL5A 1TCVA 2VJOA 3G0OA 4H2DA 4CEJB 4TS4A 4AN4A 2BKLA 5AOVA 1X39A 4HWGA 1Z38A 3T3HA 4YP0A 5BMOA 5LDDC 1I2CA 5F35A 5A2QA 6AT1A 1M0SA 1ENPA 3IEXA 2ZSFA 3IFSA 5KUTA 1RR6A 2NOAA 1RMYA 1U2ZA 3UAZA 3TO5A 2VHVA 4WZBE 2A5LA 4BU1A 3EULA 2G08A 2KSQA 2WC1A 4Q82A 3JZAA 3BMXA 3DZHA 4NFHA 5KQRA 2HQ1A 2WHQA 1NR1A 2O2DA 2XYVA 1V43A 4US1R 4I9FA 2OUIA 1EWRA 2YV5A 3I01M 2B20A 3OLZA 4ZANA 4PQGA 1H0HA 2ABWA 3TLJA 2GXQA 3HHPA 3IURA 4YT5A 1YRYE 2I67A 1YA8A 2IEYA 2ZJ5A 3L6OO 2HO4A 1Q44A 1AKNA 3WHKA 3IAXA 4L9AA 2AD1A 3NORA 5MN4A 3ZHBA 2J6HA 3MXOA 1NW3A 2AX4A 3G9TA 3HNRA 3QIVA 4MUFA 4MYHA 1KC3A 5AVJA 5JECA 3PFNA 2Y0BA 3DVAB 3PJDA 3QU4A 4LMRA 1OUMA 2A84A 4YJHA 5FCDA 4OXKA 5JJ5A 3CLSC 1P5HA 1PT9A 5EKDA 5HF5A 1KYXA 3NM4A 4QNRA 5E7MA 3IR6A 1JZSA 2WZQA 3ONNA 2GM5A 4R6WA 4DLYA 3HJCA 4KWEA 4ML3A 3I9MA 4A15A 3MTBA 3U26A 3OQPA 5FORA 1MEEA 2IP1A 2QTRA 3FOBA 5HKLA 4A27A 2VHXA 5I7VA 3AWDA 4YYEA 1YULA 5CDSA 3CLTD 3E7DA 3MWGA 2OFOA 1JQ3A 4KI0A 2HNAA 3FYSA 5LYJB 1A2OA 2R8ZA 2W2XA 4R4JA 3K0FB 4ZVOA 1CUAA 4HQFA 1MJGA 1BGWA 4F9EA 3HI6A 2BLLA 5I4BA 2QG4A 1PZHA 1XZDA 3R24A 1X38A 4KKXB 2AZMA 3R7DA 3I61A 1KSFX 2DKOA 4IRXA 4O2LA 4DXDA 1Y1LA 1D09A 1O9GA 1YZVA 1ZA2A 1P5JA 2O1WA 4A5OA 4JCOA 4Q18A 2QX9A 1TX4B 2X23A 4U8GA 2WYWA 3I6MA 1BN7A 1YR6A 2NO4A 2ZJ6A 3RTBA 1SXIA 3ZU4A 1GGEA 1UDCA 1VG1A 1B76A 4MVYA 3AYZB 2HLDA 3E8MA 4EY7A 4KRGA 3I12A 1HT1E 2F48A 4H59A 5IBQA 4YN3A 4PGFA 2IYZA 2ZQYA 1YS9A 3AR7A 5HKAA 4YRBA 1SZCA 1AUPA 2W6JD 1XQ6A 3BEOA 2PVCA 4Q7LA 2BE7A 2H7CA 4ESEA 2QX4A 2JIPA 2QNBA 4QDZA 3QTLA 2IV2X 4AJJA 1QVVA 4Z86A 5EWLA 3ICPA 4AS2A 1UJ6A 3VYSB 3ZJVA 2ODEA 3NKVA 2WE8A 2ZTUA 4JNCA 3D1VA 4KW7A 1OKKA 2VEOA 4MVCA 3RT1A 4BMOB 4DG8A 3HU1A 4HUQB 1X70A 4HH1A 3S5UA 5KNDA 2P6MA 5HVNA 4QICA 4ES6A 1M6EX 2ATXA 2Q0XA 3MT9A 2ZE7A 1G1AA 2QZSA 4LSZA 1QG6A 3BJRA 1MRZA 4MOWA 4U6NA 5FULA 4MMXB 4ZRDA 3VMMA 2PT7A 1Z0SA 4MWTA 1LI4A 1WDLA 1V5GA 4JUAA 4XFKA 3UHFA 3IP5A 4UZFA 1JTEA 1F9EA 2C2MA 2X9QA 2XE4A 4OB6A 2A92A 1E3DA 1N2EA 3P71T 3TOXA 1FXUA 1NE2A 1E1MA 1VL5A 2Q5FA 2WIJA 4CCSA 3LQFA 1J2YA 2EF1A 2WZDA 4IXNA 4P38A 3CX7A 4IV0A 1IG0A 4QU5A 4WT7A 1KQ3A 3WMEA 3UKJA 1PUXA 4Q0MA 1QOPB 4GFDA 2XNKA 4Q9IA 1QAMA 3TN7A 1L5QA 3E3MA 5FLEX 4KXWA 1W30A 1ZIXA 2J07A 2POQX 1NAHA 2WHYA 3AUKA 3IAM1 3K31A 2H6EA 1OLOA 2XKJE 1JIXA 2CUZA 4MQ4A 3GO4A 3HCCA 1E6LA 2DGDA 3EPLA 1YR3A 2B6HA 3K1AA 2FK7A 2YHAA 3ETJA 5ALYA 5FUBA 2UVDA 1T3ZA 2PZMA 4FHEA 1XL0A 2JGDB 1I10A 1KVQA 2HJSA 1A82A 1PIWA 2ZI9A 5CDFE 3JQBA 3I2KA 2P2GA 4HN2A 4QGSA 1SCJA 4R1LA 2OHFA 2XJ4A 5EXTA 3EHEA 3N05A 5E7JA 3WNZA 1GUFA 3EXIB 4UBKA 4HGYA 3MJEA 2CLOB 1JXMA 3MQ2A 4Q4AB 1NMSA 3AR9A 4ZMSA 2YHUA 3HWSA 3MFYA 1Z8HA 1U0TA 2P6UA 3O73A 2QM8A 3UJAA 1NRIA 3CE9A 4HX9A 5AKYA 4R3UC 3ZHVA 5TPZA 1JS1X 1JPUA 3NWBA 4F7DA 1AZWA 4J0FA 1KYZA 4YP9A 4C7JA 5DHPA 4BVFA 1L8QA 3EEIA 1QWSA 1NGSA 1ZMRA 1TB4A 3GLHE 3H83A 4A2QA 1EFRA 3T7IA 1KS9A 3U7GA 4BMDA 5ENVA 1W0KD 5CFLA 4DC1A 3OE4A 5DLYA 2C1EA 3ORFA 3BTSA 5LU9A 3SMQA 1SVKA 1ILWA 1DTSA 1W76A 2W00A 2OZLB 5ECDA 4G0VA 2Q2NA 2QYOA 1OR8A 3V7UA 3UG7A 4FSHA 2XBLA 4Z51A 1R4MB 3H9CA 3QELA 3S1SA 2D0IA 3WAJA 4HWPA 3B2EA 4BGDA 3TS1A 2EC5A 1TLFA 3HYTA 4TX1A 1PNQA 3RD5A 1KRWA 1DC7A 4RH1A 4S1WA 3JASB 3TLXA 4KLRA 3LQYA 4UCQA 1COZA 1F8XA 4PG6A 3AI1A 1VPEA 1Z56C 2XT9A 4DFDA 4HVLA 3THRA 1GQOA 1JPNA 1BCRB 2HCRA 1W34A 4B7CA 3UWMA 4C2UA 3EGVA 2VP0A 3V33A 1JFTA 1J99A 2AEMA 4AY4A 4YRQA 5KYUA 4A4DA 1LSOA 4IVRA 3M0EA 3H87A 3D6HA 2CVHA 4ROSA 4UOZA 3NEAA 3N6VA 2X4DA 4MJLA 5ENZA 2R84A 1HEIA 4YRIA 1JJAA 1W96A 2OV8A 1M76A 4Q05A 2BMVA 3DZDA 2J32A 2DAPA 3LECA 3F98A 5AM3A 1T8SA 1T4GA 3T95A 1NL3A 3E22A 4FKBA 4HLNA 4IX1A 1E0JA 1XZGA 2IOYA 2BDEA 3ABZA 3IPCA 3ZWQA 2XVMA 3T9AA 4FZ3A 4U7PB 3W6OA 1QE3A 2AFIB 4FK8A 5TMDA 4DKXA 4WESB 2D06A 4R0MA 4OBXA 2IYVA 5BSEA 2JEYA 3DHNA 2XGJA 3FGOA 4QUHA 1HE1C 1AQ6A 2FPPA 2QUJA 5KOJA 3JWEA 3ASYA 4QOHA 4PYKA 2OB2A 4IIGA 4GO1A 4C3VA 2YWHA 4L78A 1YE3A 4H4CA 4TKLA 1AUOA 1GUBA 4QBIA 2XMQA 4UHFA 3K4QA 4K3UA 4J03A 3BDIA 2JATA 1H6DA 1WD7A 2QYHA 4IG9A 3A1FA 1LF5A 3QHQA 4OA5A 2YIMA 3QUBA 3ZNOA 2XRMA 2FEMA 4H7DA 3T3MB 3RSZA 1W44A 5AD1A 3R7SA 2RAUA 4RGYA 4GP9A 4LOJA 3AETB 3NHYA 3B1XA 4QOEA 3TX6A 3W3AH 4QAQA 4DMMA 5HDBB 3GLRA 1JHMA 3EXG2 4KAJA 4JT2A 1ECPA 3KAPA 5DTRA 1CUWA 5I9TA 1VL0A 3OZSA 4PO9A 4R1QA 4BE9A 2IBSA 1RWPA 1YH3A 3DOFA 3PSAA 4RCZA 5IVDA 3SP1A 3SR0A 3ORYA 2ZT8A 2ISCA 1BRMA 1SUBA 3DEHA 2YIJA 5LMCA 1U7UA 1T9AA 1OTXA 2OBNA 4QL3A 4J0CA 1G8JA 1W8DA 4N41A 2ZJ1A 1XXLA 3HDJA 1W5BA 4HI0E 3QJGA 3EQ2A 2C9YA 1YV9A 3OICA 2WFLA 3MD9A 4WOBA 5B30A 3EXEA 3OAAA 4BN0A 4BQPA 3PDJA 4NXMB 3DFIA 3DWGA 3UAOA 3FNBA 1PS0A 1N6KA 5K1ZA 4XWTA 3KXLA 3SYKA 3WZMA 4A6PA 4MWEA 3IBCA 2PM8A 5TVGA 4FYIA 3NV9A 4Y9SA 3RG2A 3B70A 4FINA 4GHWA 2ZYDA 2KBFA 1NV9A 1PJTA 3MGGA 1F60A 2P3QA 2XZDA 4F72A 4O5OA 3HU5A 1QQ7A 4MPPA 5A02A 5KYUB 2HA7A 1XLUA 4M8IA 3S7ZA 1JJVA 1AHPA 3HDQA 1SXJE 3X2FA 2XHEA 3COVA 3X2SA 1U8CB 3ICOA 4N76A 4C76A 2YXEA 4CT4B 2EFYA 1P3JA 4PZLA 4J0EA 3TGLA 3X0DA 4MIEA 4G5GA 1T5HX 3UFXA 3L77A 1R18A 3R09A 4Y6RA 5DTJA 4YR7A 4NBWA 1JEYA 1J0EA 1JFLA 3M2TA 3WBKA 3NHKA 1AV7A 2B21A 3Q5EA 3DMTC 1YQTA 5H4HA 1XJCA 5HUHA 3J7AC 5A3VA 1CUXA 1NAIA 3KJQA 4R01A 3RRMA 3SF0A 1UJ5A 4EDHA 1KJ9A 2ATVA 1TK3A 4AJIA 2QT9A 5KYWB 2W6QA 3EJWA 1AU9A 1WB6A 4RBNA 1HDOA 1JMVA 4LXTA 5F2KA 2G83A 4XPIB 3RV4A 1XZEA 3D8TA 5E9AA 2ZUSA 2RHBA 4CL8A 4F97A 1B42A 4J7AA 3CRQA 3P9IA 4DR5B 3A06A 2ID7A 4ZDIA 3KTFA 2GRAA 2FB9A 3FVRA 1YRAA 2UZ1B 4C5AA 4F45A 3OSZA 3PF8A 3JZMA 2XZLA 1EPUA 2I0FA 5AJHA 3ZK8A 1F2UB 2PLWA 3BSFA 3U60B 2HYDA 3RAPR 2IZ6A 1DCFA 3L04A 4JC0A 4IIUA 2UVPB 3O4HA 5AMXA 3OZEA 2F62A 2VBFA 3V8RA 1GPBA 1HTTA 2MT9A 4NBNA 1DDOA 5ANRB 1N2HA 3FNQA 4BL5A 4QLAA 1TU4A 2SCUB 3KZNA 5DGXA 4XX1A 5JNWA 1KETA 2AMLA 4KO3S 4N39A 5LB2A 1Q1ZA 4MO9A 5ULLA 3E2MA 2C4WA 2CW5A 3EF0A 1F4PA 2CC2A 3A1SA 3ME5A 2FJ0A 2PX5A 3EA5A 5HX7A 2YYZA 4NAVA 1PL6A 3EAQA 3DOHA 1K0UA 1CEYA 1Y3DE 1WVIA 3DE2X 2C7PA 1A1SA 3NT5A 1GTMA 1H2EA 2GHTA 4OGLA 2HSWA 2ZR8A 3L8MA 4IUCS 5TPWA 4CLHA 5IUNC 4LIPD 3T7RA 5JQGB 1C80A 1UOOA 1S9DA 5FOVA 4CRWB 3U4QA 1L7OA 3VC1A 3V00A 2BHTA 5FR1A 4TSRA 2FP4A 1FFDA 5LVAA 2FP3A 3QPVA 3ZBTA 2DWQA 3ADPA 4NJOA 3EXHA 1T26A 3FWPA 1DRJA 1XEFA 2RJ3A 2PYIA 1CZKA 4OHBA 2P68A 3BCUA 4OJMX 4WJZA 3CVWA 1G2IA 1B8VA 2VSYA 4DUYB 5EP3A 2HRZA 3D3WB 1HURA 2LKDA 3KJZA 2NP7A 1LFAA 1OFHA 4MA4A 4QJ3A 3IBGA 3FTDA 3X1KA 2HMVA 3M83A 2H1LA 4MYDA 5A4KA 3OZWA 2O5VA 5G3YA 1XKLA 5H70A 3SSOA 5H9WA 3TW8A 1R3DA 4QGFA 3II6X 4HEA1 3THXB 1TCBA 4U6QA 5SYAA 3IQDB 3M82A 2Q6TA 3EPRA 4D9NA 5IDVA 3LQRA 3HYLA 4OJNA 3FKJA 2YWEA 4LE2A 5A3JA 1V5EA 3P8ZA 5C1BA 3GLFA 4Q34A 1J06A 3L4SO 2A5DA 2Q62A 2R1UA 1QF9A 2CFSA 3GCZA 5LR6A 5KKAA 1IDOA 1L5RA 3L7MA 4CL0A 1ID8A 4GP7A 5F33A 3D3NA 1Y81A 1XFDA 1Y5IA 2XBUA 2XOKA 4KN9S 1PV1A 2HLNA 4CODB 2Y2VA 2UV8A 3L0SA 3WLLA 1U2QA 4IKOA 4MINA 4Q37A 3KLOA 4B80A 2Q8PA 3TAHA 5JADA 2ZR0A 4QUBA 4P36A 4Y3UA 1SC1A 2J3QA 2IV3A 4QXRA 4M1EA 2WZBA 3LPDA 3S1LA 3ZTWA 4TMVA 4NG4A 2GZAA 4G5OA 2I5PO 1P72A 1BJKA 3KEQA 3QYPA 3GJTA 4AG3A 1U81A 2XTAA 3U3JA 2IPAB 3ER8A 1RYHA 1G6OA 2AQHA 4D3DA 1R0ZA 3C7KA 4FIZA 3SXUB 2OA0A 3VXKA 1L3CA 3K0KA 1B73A 5FFNA 4WKGA 1CDDA 4WNAB 4XJVA 3RSFA 4NZPA 2W9XA 3ANYB 5D6NA 5FTLA 4UU7A 4PYIA 2NTNA 1G63A 1ZD9A 1NJ1A 2B83A 4B4OA 5KPDA 1ADGA 3UT6A 5K3FA 1SBZA 1ZN9A 4RPKA 1L4FA 1U28C 1FW6A 4TLBA 2HRDA 3W1VA 2FEAA 2HJHA 4LYHA 1NXOA 2C78A 3WMWA 4AZSA 2FPGB 3L8YA 2P6OA 3HR4A 5BW8A 3O75A 1J8MF 2XWBF 3OE7A 4TKUA 3BRWA 4LJKA 2HGZA 2PSJA 2Y1KA 2C2XA 2GNOA 4MUGA 3BGDA 1ZH0A 1K8QA 3ITDA 3LL7A 1EJ0A 1OBCA 1PO7A 4UD2A 3WIUA 1IVSA 4JBYA 1MF7A 1WDMA 2ZI7A 3MINA 4EB6B 2XQFA 3MUFA 3LRXA 4LMPA 2PG3A 4E13A 4ZMRA 1IZ0A 3C3CA 2VDWA 4UUBA 4IDOA 5ALUA 4HNSA 2FG6C 4C05A 5IDWA 1ISMA 1AKYA 4HB2A 4C0XA 4FEYA 4JXKA 721PA 2EG9A 2NSLA 4WY5A 3SBOA 2X6RA 4X9XA 1L1QA 1C4WA 4YAIA 2F59A 2RK4A 3BPSA 3H16A 5A04A 3AM1A 1Z4JA 2EKBA 3KYIB 4GP6A 2WPDD 4HMOA 1KVRA 1W2HA 2GCGA 2VTEA 3N2LA 4FXOA 3V97A 1T9CA 2Z4RA 2XDYA 3VU0A 2VTDA 1E9VA 1Y8QB 3G8CA 2B1IA 1RHRA 2IEZA 1RKQA 4KN6A 7REQB 5AKLA 2IU0A 5JSHA 1USVA 1W2GA 3FOAA 4RACA 2I03A 1Z33A 4PSAA 4LKOA 5A6VA 3C3WA 3ZDDA 1JSZA 3QVKA 5E4YA 3TSYA 3LUGA 3MOGA 1NUQA 1M34A 4OK6A 3WS7A 5IC4A 3Q8MA 5K0ZA 5F2NA 2VNIA 4HDSB 1KKMA 1Y1SA 3B6IA 3ESAA 1DIOB 3MJCA 5BV8A 3H5OA 1YQDA 3IVGA 3SLRA 2L18A 1OTHA 2YIDA 3SBXA 3X1JA 5KDDA 4AKGA 3VVLA 1DBPA 4JMLA 1Y4SA 3GBSA 4UQOA 5THKA 2PT9A 5JAUA 1NUTA 3W6ZA 3TF5A 4DLKA 2FSVC 2AK2A 1XVVA 3IBSA 4IIHA 1ZSYA 1BHSA 4RPLA 3ZCUA 4MR9A 2ADFA 5EJ6A 3CS3A 2AZXA 2NPFA 1A7UA 2HQSA 2AEFA 1EEXB 3ETLA 3E1SA 1ZQ1A 3VR2D 1Y6RA 1Y82A 3BZUA 1KVUA 3BF7A 3FAZA 4RKWA 4EZBA 1ODFA 4WLFA 3W7AA 1QYVA 3KZ1E 5CURA 2UZ0A 4PHTA 1RC1A 4QPNA 5HZGA 1EFHA 2QJOA 4N3CA 2ZAOA 1KY2A 2ZP1A 4NBUA 4MX8A 5IJXA 5J4HA 1COWD 2RB4A 3QIAA 5DYTA 4ZAGA 4DC0A 4KIWA 4ZJZA 2XA1A 2QBYA 5JEDA 2QENA 5KI6A 1AKRA 2YWCA 3ASZA 3I28A 3GCDA 3PGKA 4ZC8A 5H5JA 4HDCA 4YC7A 3ZDXB 3GLIB 4DV0B 3G82C 1B6TA 5JPDA 4TUYB 4UCWA 5K3DA 3ZDQA 3IP3A 4UM7A 1CE8A 4L9WA 3TPCA 1NBAA 3FJ1A 4ED9A 3OCUA 3VAYA 4YCMA 3GJSA 2ZR9A 5CCEA 2AW3A 4LF6B 2J6BA 3I62A 1A9QA 4KIUA 2OP0A 4V39A 4OAPA 1S2GA 2JHGA 2HN9A 4RHCA 1XDUA 4FCVA 1ZU5A 4FOPA 1Q1AA 1AK1A 3RVRA 3BFJA 3A1NA 5CA0A 5REQA 4KVAA 3J7TA 5AKGA 2YHSA 1YDEA 4WD3A 1XTZA 4OM8A 2G67A 3QVOA 3E22B 4AQ7A 5AVKA 4LRYA 5FHQA 3GAAA 3V48A 3ZV4A 3FOZA 1D7AA 4X97A 3RFTA 4DG9A 5C81A 1FB5A 4RHTA 5C4MA 3LBAA 3DL7A 3S68A 5HSGA 3QOFA 1HZZC 1HWYA 4FDMA 2EEPA 3IDSA 4S1NA 4AECA 2R6FA 2XB6A 5CDUA 1WF6A 2A14A 2P65A 6NULA 1PNOA 3JARA 3OT1A 5C8YF 3WV5A 3FI0A 4IGFA 3VSDA 3MVEA 1XT6A 2DP4E 4GX1A 1QRAA 2CVZA 2E5FA 2ZBFA 3ZZTA 1YHZA 1WKCA 1NW6A 1XF1A 1QH8A 4CDNA 3MYRA 2CGEA 1CUFA 3TB6A 5BUQA 3F6CA 2CDNA 3KQHA 3GBVA 3HK2A 1AMNA 3SOPA 1K89A 4AIIA 4QRIA 4Y9UA 3ZW9A 4Z3KA 1CJKC 3Q40A 3KD2A 1A7KA 5E7QA 4WNCA 1YWGO 2DUNA 4MUMA 4YWJA 4B6GA 1FLDA 3OIGA 4LCBA 1JJIA 1SHZA 1XEWX 1G8FA 3O03A 3B53X 3EBLA 1EWYA 3PITA 3RC1A 4LMBA 5L40A 4P32A 5DHUA 2D13A 4N8DA 3K70C 3PA6A 4BQNA 4DIBA 1HLDA 2CMKA 1V25A 4L5BA 4N54A 1O96A 1Q0LA 1RXCA 2UKDA 5CA1B 1SPXA 4PZEA 2VUUA 4K9RA 4IIJF 3CW9A 3DTVB 4JOCA 1RFLA 4Z8XA 3UXMA 4EG3A 1MLDA 2CFRA 1KEEA 4H6PA 1B41A 1VE1A 3OI7A 3FX2A 2HMUA 3THYA 3UH0A 2RGAA 1UWKA 1G3IA 4QU8A 1ESMA 4B6RA 3MC1A 1VKNA 4D4MA 5IXSA 1F2VA 3OETA 1QLHA 1OT3A 1Y37A 3B2QA 2O7RA 1TYZA 1NLYA 3ZW7A 5TS3A 1KHHA 1BQEA 5JPIA 4UBLA 2C7QA 3BHJA 1BXRA 1M5RA 1JHUA 5IK2A 2LD4A 2NO0A 1JYEA 3FUWA 1FU8A 2VKTA 4ZZ0A 1ISPA 5A4IS 3FHLA 4GKJB 5HA5A 4ECEA 1WUHS 1PR9A 4GZMA 2EGUA 5DU2A 3ZE1B 2N0SA 1SUAA 3BTUA 4WW0A 4HTFA 4OHWA 3H4IA 3R3WA 4ZVTA 4N5HX 4C14A 2JI4A 3ZE0B 5JV5A 1E2KA 3ETHA 4RY9A 5D3MB 2GEUA 3ZWBA 1BW9A 2UVQA 4MUYA 3OOJA 1CJMA 4D9BA 5FWAA 1N6NA 1JBEA 2XUDA 1BHQ1 4HFMA 2F90A 2YVQA 2GN2A 4EO7A 3DULA 1H9CA 1JR3D 2PRJA 4YMUA 1W5FA 1BE6A 3AI7A 4MGHA 4CLXA 3F1KA 3TXYA 1CS0B 4FMCB 4YUZA 2P8JA 1SBIA 3WLNA 3N28A 2MR5A 1FJXA 2AWOA 4LXHA 1O03A 3A70A 2HQOA 5HGJA 1VDMA 2IEBA 1CZUA 1AF7A 1MQSA 2OMEA 2WTNA 1C7QA 3SSNA 2HSZA 2FV8A 2WMNB 1YKGA 4BFZA 4CFSA 1QGUB 5CUQA 3R7LA 3F7MA 3PPYA 1I6WA 3MMSA 4UHEA 5IT9A 1RLIA 1PG2A 4DCJA 4IEEA 3A4VA 3PGA1 5MGBA 2GZHA 4LY3A 1JPVA 1V1MB 4EHJA 2BFDA 1L3IA 2ZIGA 2P77A 1YZLA 3TMKA 3SLGA 4ETIA 5JQGF 4PRYA 4GYJA 4FYWA 3EGIA 1Q7EA 3V1KA 1XWWA 1ZWKA 4LFAB 1NW4A 3FFWA 4X65B 3QA9A 4BN5A 3W78A 1QVRA 4IINA 2RAPA 4YRCA 5ICCA 1CJVC 3KVNA 1L1RA 2VH5R 3MUNA 4HX5A 4Z0PA 1VMEA 3ICWA 1TYEB 1SOWA 3HSSA 4R2HA 3MM4A 2RHLA 1I2AA 1ZIOA 4A0FA 4B6SA 4AJNA 2HDOA 3N39C 1MW9X 1XVLA 3OLXA 1EVKA 2C1XA 4LPKA 5IC5A 3SZUA 5KZMB 1ZI9A 4IIJB 5KTTA 1X8KA 2V6GA 1FSGA 3F8TA 3SQMA 5B4VA 4CE6A 1M0TA 1WMFA 1GEGA 1I14A 2QSUA 4HGNA 1OC2A 3GVPA 3R2JA 4R5HA 2QVZX 3TQIA 5CYGA 4HDSA 2K7FA 2CL5A 1G0OA 2QY6A 4GM4A 4AQDA 5ECYA 3R0ZA 3GLHA 3Q9SA 5KNCD 4FONA 5KJCA 3F7NA 3ZE2B 3LOUA 2ZVJA 5BQPA 1KYTA 5E3IA 4ILKA 3TQSA 5JC1A 5C1IA 1N6HA 3T9FA 4E09A 3MQFA 2PEZA 1UPUA 1BE8A 1IK6A 2PO5A 3AR5A 3L4BA 3DAYA 3BWVA 3O8DA 4GOJA 5G2OA 1IB6A 1KFEB 3RBZA 4TMFA 4C7VA 3R7NA 4AMBA 4YUAA 1LS1A 1AHNA 3LP6A 4J7UA 2OAEA 2A0YA 3GAFA 2K5UA 5KHLB 1YJBA 1U90A 1YS6A 2V0NA 2ZJ7A 5FFMA 1HL3A 2VUIB 5EP4A 3S2EA 1EUZA 1DCMA 2ZSIA 3SE0A 4C0AC 3H1FA 1HMPA 2F8LA 3DMTA 5HUQA 4MV1A 4X8OA 3VSBA 3MHTA 2YZ7A 3LX8A 4XRGA 3UHPA 3QEJA 6PFKA 3JQCA 1K08A 4LRUA 4MA5A 1R8YA 3BRCA 1D04A 3MB8A 4MI6A 1R6XA 3NZEA 4LDQA 4C0BA 5ADWA 1C50A 1JALA 3DQQA 4LDNA 3PD1A 2J3DA 2GAAA 2BGRA 3D5EA 1EVLA 3O21A 4MQFA 4FGUA 3VH1A 4BNXA 5I4IA 1MAHA 4JU8A 1CY0A 1SC6A 2HW8A 2P78A 5DK6A 4TWZA 3UO8B 3BS4A 2GS9A 5H3HA 1Z0FA 4ZD6A 1KDTA 3ZXIA 1JEYB 1Y3BE 1WU8A 2V7QD 3MRSA 5JVDF 2PX2A 2XB8A 3TNDA 1M3SA 1HL7A 1WU7A 1A5ZA 3CF4A 1U4SA 4JJEA 1L4GA 3NB0A 2ZB4A 2HEIA 1V1JA 2XA2A 3LX6A 1FIUA 4XASA 4YCDA 2Q3EA 3WWZA 1ZD3A 2BCGY 4FNMA 3RYFB 1U98A 2VK4A 1WUYA 3P96A 4FI3F 1RE1A 4Q3NA 5CDFA 5IT0A 2C29D 2GZ1A 4J0GA 5BR4A 2QVXX 2IHYA 3BG5A 2IUYA 3ND7A 3MCUA 5FI1B 5K0GA 4INJA 2BHLA 3LPMA 1PT7A 1FU4A 2YX1A 3OQHA 4JKIA 1N6OA 4RKQA 5REQB 1NTRA 4JT8A 3DBLB 4ZU3A 2BUCA 3DM9B 3G7NA 2SNIE 4CWAA 2P9CA 2IL1A 1CQIB 3BXZA 1JB9A 3A7DA 1WSDA 5DP2A 3OECA 2QTTA 4J9UE 5DEIA 1TI7A 1JQEA 3E61A 4G0MA 4MWGA 4RPGA 2RHCA 4DLSA 4EYOA 4LXXA 4D9CA 4G56A 4MUXA 1JG4A 4B6EA 4ZI5A 1RWNA 3RAEC 4P7GA 4PGAA 4QUJA 1VLQA 3EQ7A 4CPDA 5JSQA 5KAMA 4J8PA 2FDRA 3RUHA 4OFZA 3ST7A 1QP7A 4IUYA 3UJHA 4LE0A 5GVRA 4DJAA 2V3VA 2QTVB 4B6QA 5LU8A 4W8OA 2IZZA 3F46A 2WD9A 5GIPE 2GASA 3DMPA 3QVXA 1RS0A 2F1RA 2NVUA 1NNSA 1KDOA 3HKEB 5LQMA 4GEGA 3SC3A 1RXSA 2HI0A 3BK7A 3STTA 4CM1A 3U4IA 4R81A 4M1QA 5E1OA 4ZCPA 4NYJQ 2XX3A 1W4ZA 1P1JA 2EJTA 4IFEA 3VTAA 3H5NA 4AFNA 5CT4A 4WJKB 1G3QA 4B2LA 4RJTA 2D2EA 2PDAA 3D3WA 2QGFA 3LWBA 4DQVA 2HIMA 4KDEA 2IS6A 3HS3A 5CD9A 2XQIA 1RBZA 3QUAA 2FRVA 4HC4A 2VSOA 4CHTA 5JCPA 3EFEA 1GTSA 3A3OA 1QSGA 5CYPA 3LOPA 3WDSA 4GGPA 4R1MA 2DBZA 1SHLA 4MRMB 4CT0A 2HTFA 1W4LA 2ICAA 3W9BA 3O82A 1BVRA 4KIGA 2RI1A 4OMUA 4R9UC 4EB3A 1IMOA 2H0AA 4IFBA 4YAEA 1XNGA 5JAIA 1MDBA 2VZ9A 3BQMB 3T4PA 1G3MA 1QHNA 4QG7A 3QPWA 5LP6B 3QZUA 2A9RA 4OK5A 4GSLA 1U9ZA 5LUAA 2SKEA 5EE0A 4PGMA 1IN6A 1SCNE 2C9MA 4YJ2F 4CMBA 1DZIA 2ZYTX 3I9V1 5JBQA 2GWRA 1GNVA 1RRFA 1GU0A 2B99A 2X22A 4MQ6A 9LDBA 2F43B 3MS4A 4DWOA 2WAXA 3K35A 1ISSA 3ZNNA 1GVHA 1YONA 3EGWA 3G85A 4WRRA 5D00A 3AXSA 1O0CA 3VDMA 2HWUA 3O3OB 4L7QA 4A03A 2VF7A 4MGYR 5EHQA 1WLYA 2P30A 4R0NA 2ECQA 2UVPA 1DAPA 3JD2A 3BFVA 5HFJA 4KMMA 4DCPA 1IJEA 1H2XA 1MDFA 5EJGA 4DAEA 4AT1A 4JOBA 2GTIA 2GVDC 2PZKA 3KKOA 2X19A 2X0EA 4AMYA 2DQKA 4UHKA 1ZC3A 2IYLD 4I55F 1E9FA 4JJZA 2QRKA 4CMIB 1NRJB 2PZFA 3G0HA 5JW6A 5KO2A 1IB0A 4AG5A 3P9QA 4EJMA 3CZMA 3U6KA 2BGGA 4AKEA 4NARA 1VSQA 3C0KA 1EDEA 3DMGA 2ACKA 1IBLB 1XCGB 3QXHA 1J0AA 4JUBA 4MMZB 2YKGA 4HQOA 5CFQA 1IHYA 4EW2A 3RFXA 4E94A 2RBEA 5EJAA 3F73A 3MTGA 2LW7A 4IGIA 3VTKA 4JVNA 4D6XA 1JILA 2IXAA 2KB0A 1WMEA 1KZ9A 1L6IA 1Z3CA 4G2TA 4KK3A 2VJMA 1UP6A 3ZXUB 1RAAA 4QFDA 1N2GA 3U4AA 1VI6A 1OREA 1F0NA 4RGQA 3TXXA 4JP8A 2O5RA 3QNMA 5GZ6A 2HKIA 3GEHA 5AWFC 1IBRA 1GCOA 1FS4A 4RSRA 1N5KA 4ZYXA 1XZKA 2ID9A 2FVYA 3WNDA 1U11A 3ILXA 4IGEA 4ZK2A 2CYAA 1CNMA 1O97C 1RWKA 2JIQA 3NOVA 4AD8A 1L7BA 1S89A 3G2MA 5D3ZA 4N0MA 2I1LA 1N8KA 4MRMA 2A88A 4H3SA 3RVMA 3WV4A 4ZDWA 4HKTA 5DCUA 4OKNA 5ES4B 5JS6A 3DBVO 2ZXEA 2Q46A 1HEUA 2LGJA 1KE2A 1AX9A 1XHFA 3ZZMA 1U1CA 3X1XA 1N7GA 4LZNA 1DUIA 1CY8A 1IY8A 1ZYUA 3IA2A 5TIIA 1JAHA 2XNHA 2ZPUA 4WK6A 3TLCA 2CUTA 4PSDA 3A4IA 4P4SA 2Q21A 3H1BA 2C8LA 3I9JA 4IJQA 3INYA 4KP7A 5FT9A 4DUGA 5EJ5A 1KWGA 4EWLA 4XTCS 1EZ4A 1LJ8A 4TRNA 1ZICA 3SR4A 2IHBA 5EJ7A 1A8IA 2MCFA 4XWWA 1NN0A 1RVDA 3M3PA 1V5IA 2FDCA 4I0WB 3DAHA 3WSVA 3U9TA 3VDXA 2ZTVA 2IUEA 5J2UA 1L7RA 4B47A 2NUAA 1RBQA 3A05A 1XRLA 4YMHA 4LWOA 4F1KA 2PKWA 2X1LA 1B2LA 3A3NA 3F47A 3H5IA 1X7YA 1UKYA 1A9YA 3GUYA 3VC7A 3KX2A 3EVTA 4RSMA 4TLDA 4BFTA 3E9RA 4KQWA 3AKEA 4UUPA 2GK4A 1AGPA 2MSKA 3K1TA 4GL2A 1P73A 1K8YB 3BGVA 3UHOA 4DLLA 1KQGA 4E70A 4FBMA 1YJ8A 3ECAA 3LDGA 4L72A 1R66A 1EXWA 1QAQA 1O08A 4EJSC 2ZRCA 4WZAE 4DS3A 1XALA 4ZCRA 1RKUA 3FM9A 4QXMA 5FOUA 5JVDB 1DIAA 1ZH2A 2CDCA 2ZWAA 3ETCA 3HJGA 1PDOA 3PNLA 3TZBA 2CLEB 1M2NA 2BHNA 3AUTA 4EW6A 1PBNA 3AR3A 2CL7X 2RI6A 1Q3TA 2SKDA 4PV7A 1XNQB 1WCXA 2FPPB 4PBRA 3VR4D 4CQMB 1C7FA 4E6PA 5KOJB 2VT7A 3RYFA 2XE7A 2WA1A 4TKZA 4HH0A 4MW2A 4OQQA 4R68A 4C4YA 2GZSA 5JZVA 3AHFA 5K6RA 3HCFA 2CCJA 2JCGA 4NEQA 2Q4OA 5AXBA 5GJCA 2WF6A 4ER6A 5HJ5A 1XZIA 4ZXPA 3KQPA 1VBFA 1XTJA 2JJ1D 3ANMA 3PD7A 5JCJD 4HNAA 5GADl 1WZEA 1ZSNA 2PYDA 3LL4A 4MI1A 1GAJA 2ZIZA 5DMXA 3U7QA 4ALIA 4EFLA 4HMPA 5JALA 4CM8A 5JXJA 1GCIA 1C7JA 2QY9A 4OMFG 5K0CA 1EK1A 4D82A 3B8HA 1H0RA 3QX7A 3HUEA 3E7WA 1YO6A 3CH7A 2VJCA 1MO5A 3E7PA 3IQFA 4RY2A 4WBNA 1YR8A 3THSA 4FW8A 2ZCUA 3WGIA 1VYHA 4ALNA 4RK5A 3SKYA 1BWQA 2CMGA 1JR4A 4NV1A 2XXAB 4GGOA 2JGFA 5H82A 4BBPA 2CJFA 1VSUA 2YFQA 3A6GA 3GPIA 3DSRA 4MQUA 4OREX 4PLWA 4XD7A 4AMVA 4DAOA 2OZVA 4KITB 2ZCJA 3PE6A 2YUIA 1W5AA 3D31A 4MPDA 4L07A 4DNQA 1TGYA 1VKRA 1THMA 2YOGA 2G04A 1VLJA 4Z6KA 4LVOA 3AEKA 3M9XA 1VIMA 4KQ2A 4BVKA 2XWSA 3C87A 4L4ZA 5LXTB 4CQNA 2H2IA 1DB3A 2R1VA 3VH2A 2G8NA 2YICA 4FOLA 4GOOD 2P91A 5DNDA 5SY4A 4F12A 4ILEA 3B60A 4O4IB 3THWA 1L4EA 3WXBA 2WF7A 3K9WA 4OX9Y 1EAMA 1DUSA 4H4DA 2NXCA 3AX6A 4EYQA 2P90A 2C8VA 4XIJA 4YJFA 3KRTA 3RASA 4V0NA 1EUDA 3G1TA 4BGIA 1WL8A 5ABPA 2GB4A 2QJTA 1IEQA 1UIRA 3HLTA 4C7XA 2C3UA 5FQOA 3L6EA 4S0XA 4RK6A 4Y8VA 2ID8A 3TTYA 5FTNA 1AN9A 2VL7A 4D4GA 4E11A 3IIIA 1XR3A 3I2FA 4HQ6A 4MUIA 4EB0A 4HNAB 4BMSA 4EMUA 1B6SA 4J0JA 2WY2D 3C16C 1GLGA 5KSPA 5J43A 4GWGA 1DFGA 2PIDA 3IHKA 3M5CA 3PE3A 3RUFA 2PBZA 3G23A 4Y9RA 5DNVA 3UTCA 1USGA 4EKDA 3EXIA 2CSUA 4IHAA 2ZIXA 3OQVA 1TKBA 2FCAA 3OBBA 5H9VA 4ARIA 1X9IA 4EQ6A 3ONVA 4U0JA 5KNDD 3UAGA 1QIEA 4LI0A 5MGNA 4PO8A 3NWJA 4UHDA 3EZFA 1EXNA 2B9VA 4GMFA 3UWDA 4I3FA 4XUEA 4MW0A 1DOAA 2AVNA 1IHOA 3EY4A 1VBNA 5C8ZA 1TKCA 4PZZA 4X8HA 3DBRB 3DM5A 4R2XA 2F1OA 4R1NA 3RS9A 3FSEA 4YJ3A 4ENPA 2NUAB 3TNJA 5HM8A 5KVAA 2FGJA 4GRDA 4MYTA 2WM3A 4YIHA 2VK1A 2XGSA 4TQ9A 1NHWA 1QMGA 3BA6A 1PVDA 4HVTA 4RSHA 3ROXA 1AV6A 2AD5A 1K66A 2HBYA 2I6XA 3PQ7A 3STXA 2QP4A 2Z57A 3NEPX 3C3AA 1RZRA 4GPEA 3O1HB 5BMVF 1W7AA 2HWYA 4GWKA 1MVLA 1CNEA 2PWPA 2QQ5A 3B3GA 1EI9A 3LNCA 2AC2A 1DXOA 3GDHA 4GMXA 3JYPA 2E18A 1MQAA 1VHTA 1UC9A 3BM5A 3GROA 4G9GA 4LQ4A 1ZH8A 3I6ZA 4WI1A 4OGFA 3RK0A 4D7AA 2DETA 2GSDA 2HRCA 3TL3A 4IJMA 3JY6A 4LHZA 5L8VA 4ZZ2A 3TRJA 4QDOA 2HM7A 1XRMA 4PBTA 3NC4A 5LWQA 1YS4A 2BL4A 3T7CA 5JJKA 2P9FA 2I9KA 3DBHA 2G3YA 3UT5B 4YJGA 1CS0A 4YPFA 2O2ZA 5D3MA 1QGED 1KMHA 3LW7A 4DCCA 4YDQA 4J3FA 2NXEA 3CUVA 2I7DA 3FNRA 3PX2A 3IT0A 1KI4A 5ICSA 2A35A 1TLTA 1HDIA 2OKCA 3HKBB 1IRIA 1H2WA 4I1PA 4P2GA 2DWCA 3Q9UA 2HTEA 2IH5A 4W9NA 3ACCA 3E8SA 4CW7A 1LBEA 1TXGA 4I4TA 4NVRA 1A95A 2JB9A 2P27A 3OLWA 1P80A 4DWWA 1NWCA 1WXXA 3HCOA 4H0NA 4KLZA 2PX6A 4OD0A 1RACA 1H2AS 2FSGA 2BM0A 2HUNA 3CRRA 1KPGA 4NCIA 5JY1A 1F0PA 3KDAA 3AKCA 1F8GA 3KFLA 3FOFC 1YVDA 2ZI3A 2B1JA 1S3FA 2G9VA 4RMNA 1G18A 1HR0B 3R9XA 2G4LA 3RUCA 4D8TA 1QJ4A 1JL3A 3RW9A 3GARA 3CHYA 2DR3A 2XNDA 3F3YA 3C85A 2WHXA 2C3OA 4FZVA 3EGDA 1YGPA 5LBTA 4F5YA 5KYYB 2I1VB 3TH5A 3CUWA 3PLRA 2I4TA 3TZQA 1KRHA 2Q5JA 3KKZA 4UTRA 2FDXA 2C94A 1IMJA 1Y98A 2ZSHA 3I0ZA 3IULA 4UU8A 4RKEA 2OBBA 5I8ZA 3VO9A 4DF3A 5CEFA 3GFBA 2QN3A 5T5QA 3RADC 4RL4A 1D2MA 3IAAA 1FL9A 3TX2A 1YT5A 3OEHD 4KN5A 3KVOA 4EY4A 2GKOA 4I1OA 2QE7A 1UJCA 3O8OA 2ECFA 4YRDA 3TQTA 1O94C 3KWFA 2CHUA 2GN0A 1ZUHA 1EZZA 4DREA 5KVVA 3CH5A 3U1BA 5A3SA 1Z8NA 3FF4A 3SKXA 1TAQA 5EXPA 3OZTA 3OTQA 1XXHA 3D6MA 1EQUA 5HRCA 5KX5B 4ZHQA 3LZCA 1EXMA 3Q2OA 4JJ6A 3E5NA 2GILA 3L4BC 1LZKA 1LPAB 3Q88A 1AKVA 5FRDA 1GDDA 5B6PA 1E1LA 2O2SA 3O9ZA 2H4YA 1H5NA 4FYKA 1O6BA 2G6BA 1JAZA 2C96A 4FN4A 4O4LB 3NT4A 1ZI8A 1TMYA 3JYQA 4I1YA 4U7GA 5I7AA 5J59A 3RLFA 3ZHYA 4CKBA 3E03A 2O8FB 4HLDA 3SDSA 4EJSA 4ZEXA 1RWQA 3QLVA 2BGNA 5BQXA 3KKLA 4L8VA 4P8RA 4DCUA 3CH4B 5H83A 2JGDA 2VRCD 4H08A 5AHOA 5J1TB 1XQYA 4ZJPA 1YMQA 4D8VA 5DM0A 3WB0A 1Z29A 4B3BA 4PQFA 2CL6X 4IIFA 3PGLA 5HK8A 1K5GA 3SX2A 3SJBA 2WKPA 1DXYA 1KMHB 1Q3HA 2BUBA 4CR8A 4PO1A 4OHZA 5CFRA 1AUQA 1KFJB 1T0BA 4K8RB 1DAOA 1EH5A 1S4QA 4L4RA 5I4CA 3NIWA 1HOTA 2YWFA 4Q39A 4F06A 4CLRA 1YF3A 4LF5B 2F4VB 2JGRA 2EF0A 3AUSA 3O38A 4PINA 2MYPA 3DOJA 3B1JA 4PLZA 4UTOA 5T3UA 4PG8A 1SH7A 3EGXA 2ZUTA 5CB8A 3F71A 1D2EA 3AF0A 4MEAA 1Z0JA 5ALSA 4ZAFA 2ZITA 5TLSA 2UYCA 1NT4A 3LLSA 3M6LA 4UEWA 3HE3A 1KQPA 2MSDB 1PZMA 1NUPA 1WCIB 2WJJA 4L57A 4DLVA 1RAEA 1Z2CA 4V0MA 3NWOA 4NYIQ 3AEQA 3U9SA 4COOA 2NU9B 5AW1A 2JEOA 4LA4A 5BSFA 4BBZA 1XTVA 2FZ4A 4TOIA 3TJMA 3CA8A 3TWOA 1LVUA 2DPGA 3ORQA 4AI6A 3KVYA 5K3EA 1KP3A 1S2MA 2D0PB 2FMFA 1UK9A 2FPWA 2YJ6A 4GSYA 4PZDA 4N48A 3E2PA 3K6RA 1Z18A 3FUTA 1USKA 2G80A 2HSJA 2AMJA 3DBRA 3U17A 2KJQA 2O8NA 3LZ6A 4C04A 2R8YA 2ZB8A 2PGJA 5D2CA 1WM1A 3UCFA 2Q07A 3E9QA 3QX8A 4K9PA 5A1JA 2Y99A 3T1YB 4KQXA 4LOHA 5F73A 2ERCA 4ZVUA 3DTNA 3KHTA 4K87A 5DHAA 1KJ8A 3KZCA 1U9YA 3D6JA 1I1OA 3F3MA 5ALQA 3JX9A 4EECA 4FS3A 3KVRA 4ZYLA 1TK2A 4CEIA 1LBSA 3ZCTA 1T5SA 1YR7A 4UDOA 4PCAA 3HRKA 4XYGA 3DBLA 3GLUA 4R71A 1GCAA 1RAGA 4KXQA 5CK5A 3WGMA 1ZKDA 3IT2A 4JT4A 2XLCA 2QTWB 4PG5A 3OMLA 5A7FA 1SZJG 4LCEA 2P8SA 2W2TA 1KORA 1L4NA 2V6MA 2YINC 4XRRA 5DB4A 3F96A 5EWMB 5IN4A 4KDRA 3C2QA 2AYXA 3TCXB 3VZDA 3WADA 1C30B 2N47A 4PX5A 5KQPA 3QMMA 2UXCB 2DVMA 3C7AA 3P4UA 1JECA 3ZI0A 4C78A 1BE1A 3MPOA 4AJLA 2AJBA 1BD4A 1RPAA 4FBGA 1M2OA 3IMKA 3KTAB 3I45A 4BLWA 3EWSA 2LIPA 1POXA 2IS1A 4A0RA 4OJQA 2GTPA 4RD4A 5TY0A 5L3QA 2XGMA 1UEIA 1UBKS 1CR6A 1A69A 5EQJB 1H0SA 3ZU3A 1HH4A 1G6HA 4DQLA 1WZNA 1O1YA 3R3UA 3TRDA 3TW6A 1URPA 1HT0A 4QQFA 1T9HA 1ULBA 3BSSA 3O92A 3HFJA 2C2WA 4LNHA 5GV8A 1YCDA 2H5IA 1CZNA 1NW5A 2H4ZA 3K8QA 3Q10A 4L50A 1LDNA 3HJHA 4QYMA 1BFDA 5WRFA 2RE8A 2NU6B 2VK8A 3DCNA 4D6YA 2H06A 1Z7YA 3KAQA 3C5WP 2WB2A 3FNIA 3T5TA 1R4NB 3F6RA 3IDOA 3SHQA 2APJA 2XEDA 1KK3A 4BTLA 2A5FA 4UNSA 5AW8A 3PC7A 4GMDA 1IOVA 4UTNA 2VXOA 4L08A 5AW6A 4B3TB 3GGOA 3WLRA 4LHSA 1WMBA 3MIZA 4MV9A 1JU9A 4CXMA 5LJLA 3TNYA 4C4ZA 3QMPA 2R86A 4AIRA 4LOLA 2BLNA 1DG1G 2GF9A 3B6MA 2B34A 3AOEA 2YXLA 3G89A 3GUUA 1J42A 3JS5A 4FFRA 2F4NA 1GRVA 2W83A 4Z2YA 3VPDA 1K3UB 3P19A 4PC3A 4XARA 4ZN6A 1RXYA 1PLLA 4QQ8A 5D3QA 4X91A 3S27A 3P0HA 3DUWA 1H5QA 2IYUA 2A94A 2Q8NA 4YMTA 4MWSA 4ESOA 4CL2A 4QT0A 2X0IA 2XADA 1QFJA 3C43A 4J1QA 5K6AC 3GA5A 4IIJA 2COUA 2V98A 3BMCA 2JA2A 5EPUA 5T6BA 2BFEB 5G1NA 3FPGA 3D8RA 3IT1A 3JQ9A 2GNAA 2ZDQA 5DT2A 4RXUA 4YCNA 5EYPB 2AJCA 3OIWA 4OH7A 1PFKA 4US0R 3UWOA 2QVBA 2R66A 5ITZB 1RZ3A 2QMHA 1PNVA 4NCJA 4H7KA 5K0EA 2CBXA 2FHSA 2PRIA 1SBNE 1V6AA 1XWFA 4IOKA 3QEBZ 1M67A 4U7TB 2WJIA 1ZVVA 1RQGA 1V9SA 3RU9A 1Z25A 1CEXA 5B1HA 3S55A 3IKVA 4F5EA 4JCCA 4B7AA 3K9QO 5EUMA 1O97D 2VSNA 4B3RB 3OY7A 4N8SA 1DMSA 2O4CA 3FYUA 3I8SA 3LZDA 5JLJA 2VYVD 2UYHA 2EJBA 3H1AA 2A7XA 5C18A 1P74A 3OEYA 3PLNA 4MKZA 5GINE 3ZLVA 3PVZA 3AFNA 3SHFA 2VT6A 3NYRA 4HAYA 1DFIA 1PP4A 4LWQA 4YECA 5G0SA 4I4IA 5COAA 1MHTA 1DAFA 2FEOA 1CQXA 1U0FA 2MJLA 1KJJA 3KB6A 3D7KA 4P80A 4QJ4A 2IDJA 1Y5LA 4JXXA 3LU1A 1NKVA 3FVTA 4O63O 2REQB 3H17A 4YQYA 2NUTA 4OI2A 4KPGA 1KO7A 2JLYA 5ESRA 1CFJA 4NEGA 1IXKA 1IHDA 1Q6YA 1HSOA 1OXXK 2BZ1A 2CBGA 2YXDA 3JATB 4AAYA 1QE5A 4IDEA 2OBYA 3V7WA 3DGFC 2PZJA 2JCVA 3ANXA 5CP8A 4DA7A 3A6KA 1OCEA 4HNUA 1N5MA 2R79A 1PGQA 3CN7A 1JDBB 3K20A 5G1OA 4L6CA 3C1TA 3OTOB 3VKHA 5KVSA 2GDZA 2Y1EA 4UCXA 5K5EA 4KKVA 3C7CB 1ULZA 1Y8AA 2ZAYA 4FYMA 1S2DA 4HDNA 4XFJA 2LDXA 3KJXA 3D3QA 4PYNA 5DBEX 4C29A 4XIGS 1AB5A 2J9FB 2QA5A 4ZU1X 1ODLA 2ATEA 3BGWA 4MUKA 4D5EA 3O8RA 3JQDA 2CNNA 5KWSA 3PQCA 2WKQA 3W5DA 2H08A 1E1DA 3GRRA 3Q6MA 4MR8A 4OH1A 3WOHA 4LV8B 4F0JA 2X3FA 3CXRA 5C5CA 3IQWA 3URMA 4MGZR 2N9UA 1VJCA 5B7QA 3T3GA 4Z4FA 4Y6LA 2R85A 1MZPA 1KK2A 2FI1A 4KODA 3ZHRA 2GM3A 4Q1FA 1RXVA 3O3NB 1PEDA 4DQUA 3L8EA 1CUGA 1DO2A 4WKOA 3KZKA 2O52A 4QPJC 3LUDA 2B4RO 1S8AA 3GT4A 3QOYA 5CPFA 2GZRA 1YBFA 1NF2A 1Y89A 3T7EA 1DKQA 1PR0A 3SZLA 1TM1E 1TEXA 4B4UA 5PNTA 3EIFA 1OLSB 5KQGA 2YVAA 1HDRA 4R54A 2GRJA 3KE9A 4H7EA 1GGMA 4D9FA 2ZYSA 4A0QA 5FA5A 3WBJA 2AOXA 2JAQA 1I9GA 3F2IA 5LJIA 5HYVA 4NMLA 4XJTA 3C4JA 3GJYA 1LKZA 4HB4A 5T64A 3W34A 3NVAA 1UAAA 4TL6A 1UAGA 1JBKA 2X8JA 1EX1A 2V97A 4KWTA 5DBFA 3VZBA 4M99A 5D86A 1NONA 3GCWA 4YMVA 2Z6AA 4D0GA 4M0EA 3O94A 5G53C 3DOEA 1MCZA 3EH2A 1A72A 2H51A 2YC4C 5K3FB 2ZB7A 4E5NA 2G28A 2AN5A 3NBUA 4FP9A 3DT9A 1UIMA 1R0SA 3K2BA 5C51B 1D2GA 1LF0A 2JC3A 2QN9A 2TMYA 3QBEA 3UC9A 4DCGA 4L5YA 1N7HA 4X3CA 1R4NA 1VJGA 3E3AA 4J7XA 4KYIB 3KHUA 2V74B 2XCOA 4R0VA 3BK2A 1L9XA 3HGQA 4RKFA 2F3TA 3IAFA 3V2IA 1GZ6A 4RS3A 3RVSA 1NWHA 1UP7A 1A77A 4HQNA 1TU0A 4DPKA 3VR5A 3LNTA 2JFBA 4NOLA 3DUFA 4AS3A 2C83A 4HQKA 1PR5A 1YNSA 4BWVA 3PEWA 3QKTA 4PHHA 4PSVA 4ZOBA 4C0QC 3UV7A 1FFCA 2VOEA 3HB1A 4X20A 1PLKA 4BNKA 4MJXA 2KM1A 1QUFA 1LGYA 1XQVA 1BGVA 1Z83A 1ZOPA 2ZU0C 5EHXA 1NJ8A 4HF7A 3FTEA 1WBJB 1RRMA 4WN9A 1NJ6A 1XAJA 2NZWA 4BE4A 5KX5F 1XCPA 4DMKA 1JXOA 3AESB 3AL3A 3L84A 4K8OA 1CR1A 4WADA 1R8QA 4XWAA 5DYGA 1CY4A 1IHPA 3TK1A 5HDQA 2HK9A 3CZCA 4CEJA 2R11A 4OMCA 2H4XA 4PLYA 5E1BA 5CGQB 3M4XA 1FLNA 4PG7A 4R2LA 3SS7X 4EG7A 2CYBA 4LBYA 1YR9A 4JJKA 4EHAA 3TD2A 2AA3A 4FFWA 1N33B 1TUEA 4XYLA 3TTXA 3MBIA 4IM7A 4RELA 4XX0A 2HU2A 4HNHA 1I8TA 4I3GA 2BM8A 3T7AA 1DADA 4UCFA 3FWKA 1WRBA 4UJ3A 3PNVA 4U9HS 4GH5A 5E2BA 5EHIA 4RTOA 3C98A 3RBVA 1PJ3A 1R0WA 1TCUA 2VHTA 3VX4A 3BL6A 3K0SA 4N3AA 4FFSA 4ARVA 2OT3B 4DUGD 1R9JA 3UMBA 1TYBE 1WXIA 3CUKA 1BDIA 4UDYX 3ZQ4A 4YT2A 4V3CA 4NCXA 5BNZA 2JAPA 2PCLA 1X2BA 3K5IA 3PFIA 1NQXA 3JWGA 1P2DA 2E7ZA 1USWA 3G6KA 1FU7A 5CW2A 4DMLA 1NTOA 5KMGA 4KDCA 2V59A 3CR7A 1E8NA 1OGYA 4MR7B 4RIIA 3B8EA 5EE3A 3ROKA 5I7EA 4NC9A 2VNSA 4PF1A 4NATA 1C0PA 1PWEA 1U9CA 1G2QA 1LK0A 2HEGA 2R5FA 2FWIA 2VDNB 2H7VA 4XDYA 3G59A 5FL3A 5IBPA 3A11A 2PH3A 3T8YA 1LX7A 5KOYA 4KMRA 3ITNA 4P86A 3W06A 3CTPA 3I2JA 3W5BA 3UK7A 4XQEA 2FWRA 1H85A 2JA1A 4QXAA 1U94A 4CF3A 3PGXA 3UYLA 2Z6QA 2Z2YA 2BRUA 3GY0A 3ZJ5A 1XCMA 3QFTA 5ALJA 3PB3A 1K75A 5EI5A 4R2KA 3NR2A 3U1VA 4Q01A 3W4IA 4ER0A 3A0UA 4JV5B 1XP8A 1SKYE 2GJKA 2UYYA 4EF6A 4BQQA 2ZZNA 3LY7A 1DKMA 2O8BB 1GKKA 4MLPA 4I2NA 1AOXA 2C2ZA 4LN1A 4Q3DA 1H6AA 4IDAA 5BY2A 1DJMA 5E8JA 2A1UB 4UBOA 1GYPA 4I4NA 5TVKA 4JI7B 3SZGA 1YI0A 2QW0X 3W7VA 4JI6B 5EVCA 4JOQA 4F4CA 5GTDA 1IBKB 4JMPA 1V7PC 1W49A 3BWDD 3RK1A 3VO8A 4OQLA 1V11B 4CKWB 3TI7A 3STVA 2JI8A 3ICCA 3RYHB 3V4ZA 5COBA 3QEOA 4HRXA 1XQXA 1B0AA 1T2AA 2O8CB 1G20A 3W5AA 2Q45A 1YE8A 1NG1A 1TQHA 1GN9A 3OESA 4QXOA 3SS9X 4C5BA 3WA6A 4B3XA 4H6VA 1W6RA 1RRKA 3B85A 2RGNA 3VR3D 2FZLA 1EFVA 1NVUQ 4XOUA 3TQHA 1UBOS 4FR0A 5A0FA 3RM3A 2W2KB 1R8SA 1ADCA 1QONA 4KQGA 2C2HA 4Y6OA 5CMLA 1RP1A 3F5SA 2C5SA 4WFJA 5EG5A 3IPLA 4M6WB 5ERYA 2LP4Y 4AB1A 5KDOA 1B8UA 2CE7A 5IW8A 5JSKA 3L0YA 5SZIA 4K28A 3HEBA 2XQVA 1PT8A 3DV0A 2ZIEA 3HR7A 1IDN1 1HC7A 3PENA 2W11A 3V7YA 4D9IA 3LXUX 3ND9A 1NXSA 4PTYA 4FIDA 3GEGA 5KCMA 4G8JA 4Y67A 4CCAA 4CMEA 5IU6A 3H9QA 3DLTA 4LISA 1CQZA 2ATCA 4JWKA 2QE7D 1DE0A 3M89A 4MK4A 2V54A 1DJNA 1Q1NA 4HXGA 1EESA 1EFKA 5B6JA 5HFAA 2O5CA 3IC5A 1BROA 4MUAA 2WJWA 2QRJA 2PU7A 2VVTA 4I3HA 1E66A 5JASA 2QAIA 4NCNA 1QAOA 2VYNA 4NDNE 4PYRA 4RTPA 5AVYA 1T43A 2NIPA 1WZCA 1S3SA 3ISVA 2W58A 1B43A 1RTKA 3CT6A 3OPVA 1I5OA 4TMTA 1W52X 3SY8A 3RVDA 4C6SA 2Q1UA 1NC3A 4HN9A 1WZIA 3BXHA 2E4ZA 3A4MA 1Q7GA 4W5HA 2Z1NA 1JHAA 2Q3JA 3EW7A 3UWKA 3T3OA 5EXEA 1C7RA 4B17A 2CL0X 4N6GA 5FTWA 1YZGA 1JSRA 3PEUA 3OHPA 2PH5A 5IHPA 2R7MA 2JEZA 5CHEA 4I5GA 1UEJA 4W7HA 1HMYA 2F9LA 2Q3DA 1GUAA 5BW6B 4RLHA 2JJMA 3EUWA 1NVBA 4AO6A 1HNWB 3FTNA 4KACA 4NBTA 2XYHA 1AMOA 2QX6A 3QF4B 4BNDB 2GJ9A 3BXEA 2HDNB 3RF6A 2WVAA 5BURA 1M0EA 1UKCA 2FKAA 5EA2A 4PS1A 3VMFA 1WULS 3UN1A 1QHSA 2PL9A 1JDZA 3MK31 1JLKA 4RPIA 3KB2A 2O59A 1XEXA 1IXRC 3WYNA 2W4MA 2PHZA 2G07A 2G36A 4KE7A 4TLEA 4ZT5A 1Z22A 1A5AB 1GA6A 1UDAA 3QYJA 1A5SB 3FMIA 1Q22A 1SVWA 2QJFA 1MNQA 3DLHA 5AVSA 2G4VA 4F6CA 4MH0R 1SKAA 1MPXA 2PSHA 1A9XA 3CPJB 4IJ5A 1Z47A 1GILA 3DP9A 3HJRA 2NXNA 3NPAA 3SIRA 1LRJA 2IVFA 2NU9A 1IZZA 1T1GA 2ID4A 1R0RE 2HCFA 1WS6A 1B6RA 4G25A 4IIXA 4JJ7A 4LHYA 2Z5VA 4W7IA 4Y0VA 3UB4A 1JHZA 1M1YE 4R2JA 5NLLA 5TQ0B 3UKOA 5B5SA 5BSUA 3IEMA 1XJQA 3DL0A 3VUFA 2QZZA 3EZNA 5AO9A 3GLIA 1A4RA 3RS8A 1JIKA 1KI2A 2Y1DA 5AKEA 1I5RA 5J2UF 1PNTA 4UOEA 5B7NA 3QKUA 1U2RA 3JCZA 4ZODA 4AUNA 4YO7A 4DNXA 1PFYA 2QTZA 3OF3A 4WBSA 3SZRA 1Z4OA 4QGHA 1NVWQ 3RYIB 2X1VA 3WHPA 4AC9A 1MO6A 4YRFA 4MICA 2C20A 2DUWA 1EG2A 2ZRDA 3NM5A 4OHUA 3ZEAA 3U4GA 4DQ0A 4PZ0A 4DYHA 1H1LB 1FW8A 3TDKA 4GXTA 1TVKB 5T67A 4F8JA 1K86A 1SUCA 3N74A 4IIYA 4BC1A 4Z4IA 1SVLA 4PNPA 4G65A 3P2YA 3QP9A 2YN4A 1JIQA 1QYDA 3JQFC 2FPOA 2IJGX 4NX2A 1WY5A 3DZKA 4PNZA 1N4AA 4DNFA 4CQJA 1QOZA 1VMKA 5FNVF 2AN3A 1G38A 5A9RA 5J58A 4AJEA 3S2GA 3OPYA 4N9WA 1ST2A 2VDMB 4XR4A 4DMRA 5ITWA 3S44A 3L7KA 2RCNA 2QI9F 5SZKB 3FIUA 2W8BA 4I1RA 2VP2A 1ZN7A 3FHOA 3SX4A 1CULC 1T0HB 5AUQA 1P9WA 3LDAA 1ADYA 4E1BA 4S2UA 4EW1A 2JIRA 3LHDA 1ZO8A 2HXGA 3Q3JB 3RRFA 4YJ3F 2RC5A 4M0DA 4BKQA 1E7SA 1W25A 3OIVA 1G55A 4B75A 1XF9A 1XG5A 4O2AB 3Q3HA 2IDZA 2AG1A 2R6AA 4GR9A 4PPNA 3RAFC 2C54A 3MRVA 1CNFA 3K8OE 2Q99A 2YDXA 2YJ3A 1EFVB 4KBYA 5J4LA 1H3FA 4TS1A 1PFGA 5GONB 1MZVA 1ESDA 4QOIA 3JQAA 4R51A 1NOKA 4EHHA 4CNQA 2WD8A 4AS1A 3A25A 1P7WA 4FYYA 1NBOA 2PKXA 1H23A 3A58B 4G0PA 1QV6A 1E4EB 3FW1A 4UVHA 3WQQA 3ZIAD 1R6TA 4AP5A 4ISCA 2JD0A 1EINA 5BV1A 5EHZA 1GEEA 1MU0A 8LDHA 4H17A 5JZOA 1P9RA 1L5NA 1JT9A 4BAGA 5BSWA 1HXHA 3QI2A 4K26A 1DP4A 3BJZA 2X9NA 4AK9A 1TIKA 3K1AB 3JQBC 4P54A 4PPFA 4F85A 4IVQA 2C0QA 4I99A 4J75A 3U5TA 1F0KA 1TMKA 1GPH1 2VSXA 4X64B 2O8BA 1E0AA 1SQGA 3E6AA 3ENWA 1A88A 2NG1A 2I3BA 4LXIA 3A9CA 5AK0A 4I9UA 4PX9A 3ET4A 5DXFA 5A06A 4JHXA 1RQRA 1BDMA 5EVJA 3E3LA 4GMHA 5EE9A 1ECLA 2ZRHA 3L5KA 1OW3B 2JLUA 1XI2A 3MS2A 2ZJBA 5TQ2A 4NCBA 1SB9A 4L0CA 4E2ZA 1JHXA 2B4YA 2QR5A 4LYAA 4D9KA 4G1MB 2JLVA 4Q9DA 1JJFA 3TFWA 1SNYA 2B4KA 4WLVA 2XUGA 3ROGA 2COEA 2DHQA 1QH1A 1N6LA 1QHHA 4BNUA 2XB2A 1A5TA 2J31A 1SCUB 2PVSA 3MERA 4IZ6A 1YZHA 2OO5A 4BFSA 2M6RA 4NBSA 4H1HA 5LM3A 5I7RA 4FHZA 1MMFB 4D4HA 1KAHA 2ZYWX 5BYBA 1QU2A 2QUKA 5DMHA 4DQDA 5GOTA 1RRCA 1WHTB 3TUZC 3TZ6A 3GRZA 3WYDA 1E9SA 3UXYA 4RFSA 4WVFA 5I9BA 2RGXA 5EUCA 3ZQKA 3ERCA 3CWCA 5DX8A 3DDOA 1UT8A 2Y27A 4PICA 3D6AA 4XR9A 3NXSA 4WKCA 5TE9A 4X66B 2NSDA 3NDRA 2OBFA 1UL1X 3PUYA 3S8YA 4E5YA 1GTJ1 3NUZA 3EEBA 1QTRA 1B16A 2PGDA 5A4FS 1P1FA 1G9SA 2C59A 2ZVDA 1V26A 3A10A 1EA7A 3M6FA 4P4LA 2JLBA 2ZYUX 3Q7RA 4K9DA 3EUAA 2DT8A 4ZQEA 3N86A 3GOQA 1S0UA 4D5GA 2R96A 1G7RA 2DBQA 3B9RA 3FFBA 3SQDA 4JI1B 3SX0A 1T6ZA 3U9LA 4E1AA 3SQXA 3NHAA 1JGTA 1RQ2A 2BEVB 3AI2A 4B3JA 3GRCA 2BGUA 2OHIA 2X1HA 4PZCA 1DX4A 4KRXA 4K0KB 5AI4A 3CZAA 3U3ZA 1RQPA 2IXGA 1K06A 4OXRA 1N77A 4AZVA 4B2PA 1QFMA 2HYIC 4DY6A 3GGGA 4AL4A 1EGHA 1QDUA 5JJBA 3GWGA 5LLSA 2Y0CA 2CD7A 3OPYI 1Z39A 5SV2A 5ED4A 4YAWA 5T7BA 3K94A 3H9EO 1P0PA 4AO7A 4ZGWA 3OD5A 4MVJH 3LCVB 3FG9A 2HA3A 2II6A 4TQGA 1V7ZA 2HPAA 4EVQA 1Z4PX 5TMBA 2X5XA 3ZS9A 4OQDA 1W29A 2GBFA 3COYA 1V4NA 4FE3A 5SY6A 1X13A 2BVNA 1ZNZA 1JMKC 2QLJA 2GESA 2NN3C 5K3CA 1DBSA 2EKLA 3PUZA 5G0VA 3TD9A 1RPJA 2CNWA 2OV4A 4M37A 1O95C 2XYRA 1SC9A 4L6IA 1R00A 5EKSA 3GJ8A 2YJGA 2ZM6B 4FGWA 3LT0A 2GAJA 4ASUA 1L5SA 2J3HA 4ZO4A 2JBWA 1DC4A 2CXRA 1EZ1A 4A8JB 2RAVA 3VM6A 2FZEA 5KYGA 1BMQA 5LOVA 1N7JA 1SM4A 3F6BX 5KS2A 4B3HA 2HDWA 3CZPA 1ZEMA 2B7LA 3FCEA 5BN3B 4D9HA 4LE1A 3BMNA 2OD2A 1VGVA 1VRVA 1IN8A 4RMIA 4GXNA 4FFNA 3SXUA 4ZOQI 4M7OA 4D45A 1NVMB 3F9RA 1BMFD 1ZJJA 4UHJA 4ZV9A 2V0CA 3K8YA 1Q0HA 2WLTA 3QTTA 4Z7QB 1F8FA 3OOEA 1SG6A 4LQLA 3AFGA 3WLEA 3ZHZA 1UBCA 4X90A 1R0KA 3UYKA 3NHFA 1XC7A 1M1NA 7MDHA 1YBVA 3WB9A 3A7EA 1BVUA 3GEPA 3HYSA 1VA4A 1EJ2A 3P20A 4QO8A 2V6BA 5ENDA 3VAZA 2NVBA 5C1OA 1VPTA 1N3YA 2OGUA 1UDXA 3BXPA 4WKBA 1WB4A 2HJWA 1YB1A 4GVXA 2IYXA 1G6Q1 5HBRA 2ZUCA 3D9QX 2VZEA 3GRYA 5FPYA 3D3KA 5SY9A 2FQ1A 1DC3A 1E9CA 4PYJA 2Z3VA 5AP9A 3ZU5A 4X62B 1DEHA 1RHJA 2WHPB 2VT3A 3TM5A 3G49A 1XU7A 2YVLA 4G37A 2WQ7A 3GW8A 1X8JA 1VJ1A 2YV2A 1Y80A 1Q2UA 3U39A 2YY5A 1C1XA 3JQ6A 3PPVA 4BYGA 4YRNA 1KYVA 3TLZA 2V1UA 5GJBA 1DXHA 2R47A 3DE3X 4L28A 3AY6A 1U5BA 1XAGA 1Z45A 3DEAA 5KWVA 4A9AA 4PN3A 3PQDA 3GLFB 1VIDA 3ZWYA 5ADUS 2YVUA 2R1ZA 1SEPA 1I4WA 1MENA 4QBHA 2CKDA 1RI5A 3QVVA 4U00A 2OXCA 4ALKA 2BP7A 4C2TA 1PUJA 2EDAA 2H65A 1RYMA 2OG2A 3NYIA 3L01A 3UCEA 4OVKA 2B3DA 4F3NA 3E5HA 1ZBDA 2JLXA 4B85A 2WWTA 2C7RA 2VDJA 4EI7A 1K88A 2F8TA 1I7NA 1GPMA 5K05A 3IIEA 1YACA 2A1TR 3BZBA 5AW9A 3SR3A 5BV7A 1U2TA 4FDAA 5ARDA 4C3ZA 2OP1A 4TSFD