4O8ZA

Crystal structure of human sirt3 in complex with compound (2-butylbenzofuran-3-yl)(4-(2-(diethylamino)ethoxy)-3,5-diiodophenyl)methanone
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
272
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacetylase sirtuin-3, mitochondrial
publication title Crystal structure of human SIRT3 in complex with compound (2-butylbenzofuran-3-yl)(4-(2-(diethylamino)ethoxy)-3,5-diiodophenyl)methanone
rcsb
source organism Homo sapiens
total genus 94
structure length 272
sequence length 273
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4o8zA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4o8zA01
2QQFA 1T9BA 1M2NA 2Q5OA 1N0HA 1JSCA 1PI3A 4RMHA 3GLSA 4GM4A 4K9NA 4MPRA 1EFVA 4HDAA 5BWOA 4JUFA 1YI0A 5MF6A 4BVGA 4C78A 4GM1A 1M2HA 4MQ5A 1SZDA 2WVAA 2NXWA 4MPJA 1V5FA 1V5EA 4L2IA 2VK8A 3D4BA 3CLTD 3RIYA 4BVFA 5EJMA 4F4UA 1J8FA 3JR3A 2JI7A 4I5IA 2Q27A 4BN5A 1YHZA 4MZXA 1T9AA 4GM0A 1M2KA 1M2JA 4JUBA 1S5PA 2OD7A 4L3OA 1PTJC 1PNQA 4X3OA 2PGOA 5DGDA 1ZPDA 2VK4A 2OD9A 1U31A 4BN4A 3CLSD 4J16C 1PYDA 2VK1A 5K3SA 4D5EA 2FR8C 4GG1A 2C31A 1S7GA 4FVTA 5DEIA 1PT9A 2Q5LA 3PKIA 1T9CA 1U2GC 1YBHA 2JIBA 4HD8A 1MA3A 4RJKA 4KXQA 5EJ5A 4O8ZA 5AHKA 3PKJA 5MFZA 3HWX1 2JI8A 1QPBA 2EZUA 1UPBA 2H2DA 5FYQA 2JLCA 2FSVC 3U31A 4FEGA 4BVHA 4BVEA 2Q5JA 1OZHA 1MCZA 4Q9DA 4C7BA 2OORC 1V5GA 2H4HA 2JI9A 3ZGOA 1YHYA 5DGTA 3IAFA 2WVGA 2EZ8A 1Z8NA 2IHTA 4BV3A 1Q17A 4IF6A 4UU8A 4QQ8A 2JLAA 4UUAA 2A1UA 4KGDA 1U28C 1UPCA 4V1CB 1ICIA 4FZ3A 2OO5C 1YTLA 1DJLA 2A1TR 2AG0A 4UTXA 1Y9DA 2OD2A 2HJHA 2UZ1A 4FEEA 2V3WA 4JUAA 5IMSA 1HZZC 1POXA 3IAEA 5EJ7A 1YNOA 4JT9A 4QELA 1XLTC 4GPEA 4RJIA 1M2GA 2WVHA 2EZTA 4JUDX 4MPPA 3LQ1A 1PNOA 3ZG6A 2NYRA 4V1CI 3GLUA 1O97D 3GLRA 2VBGA 3CF4G 5EJ8A 5EJ4A 3FSJX 2VBFA 4GP9A 1T9DA 1Q14A 4F56A 4G1CA 1O96B 4BUZA 4K9LA 3JWPA 4Y6OA 3RIGA 4ZZIA 4IG9A 5MGNA 1UPAA 5D7NA 4UU7A 5K2OA 5EJ6A 3HWWA 3EY9A 4UTVA 4JU8A 5BWLA 5BWNA 3ZGVA 4JT8A 1OZFA 1OZGA 3CLRD 1YI1A 4K9QA 2Q28A 4JUCA 4RMIA 2H4FA 2PANA 2BRUC 1Q1AA 2B4YA 1E3TA 2QQGA 1BFDA 4BV2A 2W93A 2Q29A 1YC2A 2PGNA 4V1CA 2EZ9A 2H2HA 2H2IA 4UUBA 4J1TC 3FLMA 3EA4A 4ZP1A 2AG1A 1YC5A 4K9MA 3U3DA 2FRDC 4D5GA 2VJYA 1NM5C 3D81A 4JSRA 1OVMA 2DJIA 2FN3A 3PDHA 3GLTA 4RMGA 3FZNA 4COKA 3OE1A 2X7JA 4Y6LA 3F6BX 2H2GA 5MFPA 3K35A 4Y6QA 4JD5A 1SZCA 1PVDA 1EFPA 2H4JA 1D4OA 5K6RA 4QPZA 1U2DC 4IAOA 4TWIA 2VBIA 4UTZA 2UZ1B 5EJAA 5EJ9A 2H59A 1PO7A 2EZ4A 5K6TA 3E9YA 4X3PA 4KPUA 5FEMA 4TWJA 2IHUA 4RJJA 1Q6ZA 3D7KA 2Q5QA 4K9OA 4RMJA 4BVBA 3CLUD 1POWA 2IHVA 2H2FA 4UTRA 3EYAA 4UTNA 4R8MA 2FWNA 4K9KA 4JU9A 3F6EX 4K9PA 2JI6A
chains in the Genus database with same CATH superfamily
3OI7A 4BPRA 1CRLA 1Y9EA 3LC2O 4B74A 5G1OA 2ID9A 2XWJI 3H16A 1JVBA 2RE8A 1RM0A 3NS7A 1ULBA 3ZU4A 2IX3A 5GJCA 2PUFA 1ZOPA 2B8JA 4M6WA 4DVGA 1AXRA 1J99A 1N0WA 2QJOA 4ZWNA 4KPFC 1CS0A 1F6BA 2WPNA 3DWEX 1XZBA 2IEBA 3KJIA 3N7UA 2JZOA 2QAJA 1AZLA 4FDAA 1TJYA 4DV6B 2JCSA 3FTNA 4D45A 4Z6KA 1GM5A 5D3MA 5KI6A 4B4KA 5A06A 4F8EA 3U7HB 1SXJB 5I9TA 1JDVA 2EKQA 2VCHA 3IURA 1CR2A 3DOIA 4FYPA 1OV6A 1Q1ZA 2J4CA 1A8IA 4KN8A 2WIFA 1PBNA 2BFMA 4KAAA 1A5ZA 2XYPA 1GTSA 2YMMA 1RKUA 2HLDD 4RE6A 1USGA 2BCGY 1QO7A 2F8LA 3CNEA 1C3XA 3KLPX 3NDIA 4MKFA 4D44A 3D59A 5BW4A 3BE8A 2ZRFA 4FT4A 1S2LA 1QX4A 3OPXA 2WF8A 3TECE 1KK3A 3SD7A 4NCIA 2H5IA 1FP4A 2F1KA 1PGPA 4BQEA 1N57A 3GA5A 3QLVA 5KU7A 3WJ2A 3WJ1A 2PZ8A 4BNZA 2QJRA 2ETXA 1DEXA 1JXAA 1Z0UA 2GA9A 2O52A 4RWZA 4X65B 3MWEB 1F1BA 4TT3A 1ZH4A 3PLNA 1OTHA 2PRZA 1KYQA 1P2BA 5HFNA 5IUJC 3R7SA 3BE4A 3U7GA 1XN4A 4GZ6A 2X41A 3CUYA 5EHGA 3WJ7A 1LCIA 2DR3A 4PV7A 1K6MA 2GPTA 4G8DA 1TUGA 5KUTA 4DLKA 4ZDJA 1N34B 2ZCVA 4EHBA 3H1FA 1YZQA 3NG1A 1ISFA 1UCFA 3TNFA 3FNIA 1AK2A 4NYMQ 1IEQA 4Y1GA 1BDMA 2A3RA 2OLKA 3PR1A 2H18A 3HEMA 3TW8B 4D3ZA 2JJMA 3QKRB 3TG8A 1P5ZB 2QNRA 5FADA 1ZSVA 5D1NA 2PVCA 5E2IA 3H2YA 3I23A 1KEKA 2WYUA 3N3AC 3BF8A 1IK4A 5AICA 3EISA 3OLYA 4BN5A 3KQSA 5AWFC 3OHMA 1JTFA 5KVCA 1W36B 2EP8A 1XFAA 1SQ6A 1GTG1 3LW8A 4MZXA 3V4PB 3QVUA 1GGHA 5IZ4A 3F9CA 4YC7A 5FPKA 3CX7A 3B7PA 1ADCA 1E77A 1UAGA 2EJCA 4HRVA 4GE3A 3ZCPA 3E4CA 4DR5B 1PSZA 2XYHA 1WWKA 1JEQB 2NSJA 3JQRA 1S5PA 2CL5A 3D02A 4LRWA 4AO8A 1JI3A 1T9HA 1O77A 3HUTA 4Q4DA 3U7QA 2LW7A 2J33A 5GONA 1I3KA 2HD4A 4RFSA 5KTMA 2BE7A 1T6NA 5IC5A 1G3UA 4BE4A 1HRDA 1KPGA 1NVFA 1HDOA 1SA0B 3PFBA 1TM4E 4TV9F 1NNUA 1GQYA 5EXTA 4YMHA 4EJ0A 3F6YA 1DQSA 4QO7A 5TJHA 3U7FB 5EMNA 7MHTA 4RIGA 4A0GA 4EYKA 3KZMA 5L3QB 3ASZA 3UFXB 4TYNA 5AHXA 4UVHA 1IUPA 1D3AA 5IU6A 4A0RA 3DCNA 2PYZA 5H3CA 4ER3A 2A7QA 3I8XA 3RR2A 4J29A 2RFLA 1Z4QA 2PDAA 4CL2A 1AQJA 1KI6B 1STOA 3OUUA 1QJ4A 1B26A 1WHSA 1MAHA 4CKWA 2HTEA 1KAOA 2QU8A 1SU8A 4KG7A 4JKYA 2QQ0A 3S44A 3UJDA 4MVJA 1E6UA 1XXHB 4BATA 3T61A 1A98A 1J22A 3UPDA 4L95C 1S7GA 3OAAD 4GICA 4I8DA 3BJRA 4ER6A 5CTAA 2P9QA 1HDGO 1VRCA 1ZISA 4FX2A 4EO9A 1WKCA 1ZMTA 3IAUA 3N9IA 4MAMA 3TCNA 3TLMA 5HNKA 4RH3A 3EVNA 5HIJA 3O92A 4DQ0A 3VUFA 2EGGA 1XD8A 2PLAA 1MQ9A 4JQSA 2A30A 4LIPD 2GPJA 4Y2TA 3ODPA 4QYIA 5KU1A 4B8WA 4Q7QA 1M5RA 2C59A 4IEIA 3ZVMA 1J5EB 2QB5A 2FEOA 4OO3A 2FZ4A 3IKJA 2SKEA 3FOBA 1DGQA 2RMKA 2O14A 1FZTA 2L42A 1Q2UA 1NXQA 1O9BA 3GO4A 1L1QA 4IX1A 5CP8A 1OYYA 2AMVA 2NVUA 2X9QA 1EDOA 3EOAI 5JH7B 1WMEA 4HMPA 4AM8A 5J2UF 1BX1A 2WF7A 1QG4A 1NRJB 2WWFA 3GT4A 3NBYC 1HNZB 1PE0A 2H5LA 1RT9A 3DDCA 4BKRA 2BYTA 4FHEA 2HJRA 4C04A 5IH7A 5EJ5A 1G59A 5CB4F 4DB4A 1VL8A 4N7BA 4M88A 3LBIA 3TR0A 4C4XA 2PX5A 2X4IA 1ZY2A 1PVVA 3AHGA 4X71A 2OCKA 2FFBA 3RRJA 4CN8A 4HC4A 4JYBA 9ABPA 3Q8MA 4KXMA 1YQDA 4YAKA 2J8ZA 4IUCS 2NMVA 5F7JA 1MX9A 4KFUA 1E9BA 1W1WA 3CE6A 4M8IA 1SKYE 2ZGVA 3FIUA 4XX0A 5EQJB 3NPAA 1IOLA 5IABA 2G0TA 5ES3A 1NLYA 2IXTA 3VISA 1WB5A 3ZS8A 1YV9A 4CDMA 1ZX1A 1LKZA 3NI2A 1QLWA 3I04M 2DFPA 1EUZA 3N28A 3S28A 1P6UA 1Z0KA 3HDJA 4UHDA 2J0SA 1ANKA 2NAPA 1TVKA 4WCFA 4EI8A 1DTWA 5EVJA 3EF3A 1OPRA 4AROA 3IT3A 3KT6A 3PGMA 4TL6A 4NTZA 4EB3A 2IE0A 1RAHA 2HEIA 3NR2A 1JFSA 4C21A 4ZC1A 3EGCA 4YV2A 1RIFA 3FOEC 3NJRA 4DR7B 2WWGA 4D25A 4L7VA 2EWWA 4M4SA 4GZ5A 1UP4A 1NXTA 5A2GA 3ORRA 4NBRA 2JGIA 1LPMA 4WW0A 3CZ9A 3TTWA 5JZ9A 4JI6B 1BYUA 1E2QA 4U9HS 4FU0A 2X5OA 2HREA 2BWJA 1IXRC 1C3LA 2YVLA 3KTOA 1CNFA 2CMKA 1H23A 3F47A 3KSRA 4MW6A 6PFKA 1HDCA 2GRUA 2VUHB 4BMSA 3KQLA 1IN4A 3PVZA 1UBRS 3NUZA 3WGGA 3T8YA 4QQ8A 5EE5B 4NBSA 4Y2YA 1XQXA 2ENUA 3R7DA 3RUAA 1KJJA 3SQXA 1PYOA 2A1UA 2IYAA 4DNXA 1GTJ1 1RE0A 3OPYA 4GBGA 4NMHA 5F51A 5HBRA 2Q2OA 4JN6B 5JVDB 5AVKA 3OX4A 3PWTA 3FRJA 3MCUA 4ZZ2A 1FRQA 5DEOA 3N2KA 3SF8A 3KHTA 4O2AF 2AG5A 4IDQA 1N2OA 2K6GA 3IOBA 4RF5A 3QBDA 4U5XA 3RLFA 3UB3A 3OQNA 3ND5A 1K9VF 1SUBA 3Q8WA 4HWGA 1LVGA 1PJTA 2OQRA 2UZ1A 1N7HA 4FEEA 1E1QD 2ZPAA 3RFXA 3GEBA 1KI2A 4P3YA 1SHJA 1CPYA 1A3CA 2FSGA 4R3NA 4Z0TA 3G8AA 5JPCA 1E6MA 3WMGA 4X7PA 3CWZA 2COUA 2FMUA 2QVYX 4YCNA 2IS4A 4ZT2A 3NQ41 3LBFA 1E3LA 2XZTA 4OFBA 4RCYA 4UM8B 3D1VA 5DX8A 3V2UA 4E07A 4F3RA 1TCUA 3EXEB 4YGXB 2KB0A 1TKAA 4GPBA 1Q44A 1EHYA 1K3TA 2IWHA 4X94A 5DSZA 1N2CE 2Q07A 4B4WA 4BNXA 3FX2A 5C4MA 2WM8A 3ZQ4A 4OQYA 5FPSA 1S2IA 2A3NA 4H60A 5B7PA 5L40A 1JFRA 1I9CA 4DT1B 3CCBA 2P9BA 3I4LA 4KQ1A 4GOOD 4ND3A 2Z83A 1RBMA 4HDNB 4J2TA 1NUHA 3QI7A 4TRMA 3KYCA 3VPGA 3NIFB 2YDYA 3U3MA 4GX5A 1SOMA 3V7FA 5BP7A 3STXA 1ULHA 1RYZA 3AW9A 4WFKA 3TLKA 4P4SB 3UJNA 1J8MF 1N5DA 1XKXA 4N41A 4A0HA 2QXYA 4LF6B 3WIEA 1UADA 3DUFB 2ZU0C 3V4ZA 2FWIA 2J45A 5A5FA 3L84A 1HG0A 2DWCA 5C35A 5D87A 5KYUA 5CYPA 2CNKA 3HP7A 5ISMA 4RVHA 3OLZA 2X9VA 4TN5A 5CVDA 1FNMA 4NJEA 1YBAA 5F5XA 3SSMA 4ENTA 3E3NA 3OTHA 4QOGA 4ZAXA 1Z0AA 3OFJA 4ENQA 3I5AA 1Z5ZA 4XWGA 2GD6A 2Z58A 4QGAA 3GUYA 4Z4IA 1PDOA 2RGGA 2W6CX 3HH8A 1RWWA 5DCYA 1YS6A 4ESOA 5H3LA 4OFWA 3S2ZA 3NJ4A 4Z1MA 2DPYA 5CBPA 2WP8J 4PQGA 4NXMB 3WLEA 4Y6GB 1KQGA 5K20A 1P7WA 1LJLA 5IT0A 4F5YA 3H11B 3H5VA 4ZEOA 3DOUA 3VNSA 2EFYA 3U9LA 2XYGA 5AKLA 1IQRA 3F4KA 1T9ZA 5DTRA 3SEFA 3QMWA 3TVYA 2XTJA 1WEHA 2JAWA 2V7XA 3LUKA 4NEQA 2QK4A 5GINE 3GFVA 4ZO8A 3SQWA 1ZGAA 2YFKA 1BSVA 1GLNA 5JJ5A 3HWWA 4REQA 1HNWB 4ZU1X 1Y0BA 2HU2A 4PRZA 1L8XA 4UAVA 1CZKA 4EW6A 2FP4A 2H7VA 1VSUA 3R5KA 1D04A 1HE5A 4FUTA 4ZICA 3OHSX 2DFNA 2IZ1A 3REOA 4RNCA 3OIDA 2BM0A 1Z26A 2HMUA 4MROA 4DM4A 1TJNA 3PWSA 3EUEA 4ZVLA 2Q28A 5L4SA 1R6BX 1QAOA 2ILVA 3TNJA 4CF7A 4YRTA 4EF5A 4LHVA 2R4TA 2H52A 3JAKA 1WS6A 3FTPA 2R6AA 2H4FA 2C2YA 3EYWA 4I14A 3TCXB 1RC8A 5SICE 5HCUA 3RYIB 1Y34E 2AE1A 3IVCA 1T6XA 2IH2A 2RHOA 1QR2A 2QQGA 3L7YA 5KBYA 2QRQA 1MBZA 3QYPA 1PV2A 2ICAA 3FPEA 2H2WA 3Q88A 5EWMA 3TIXB 3UAWA 3U2QA 1D2EA 2ODAA 3P0FA 3JARB 5KYYA 3MUNA 2ZRCA 1V7PC 2F8TA 1L5FA 2PL3A 2M6KA 1I4EB 4HRXA 4OMDA 3LW7A 4W6QA 5EIOA 4G9BA 3QMMA 2J6BA 4UUBA 4B17A 1RYBA 1NLZA 2GT1A 1W46A 2HSDA 1OXVA 3VR5A 3COYA 3JQPA 3RQSA 2IA5A 4AKGA 3D4PA 2QSUA 1QGDA 3UAZA 1OJ7A 1ZC3A 2C5HA 2I3ZA 4DKJA 2QENA 3DCIA 1M0SA 3T3DA 3FOAA 3T0GA 1VL1A 1Z75A 1N75A 3O4VA 1KSGA 5IZCA 3TLJA 3NTVA 3ZK8A 1CRPA 3AI1A 2YASA 3IUEA 3HVRA 1CIPA 2JBAA 5K99A 1SQ5A 3AF3A 1M2EA 3DNPA 4BO3A 4OHRA 1JJAA 4NOLA 4AYXA 2JGFA 2AD1A 2ZBPA 4Q1VA 4Z53A 4Y0AA 2C61A 4YV0A 1HEYA 3TTVA 3F9RA 1Y63A 1C2YA 2X8JB 3EZYA 4HN2A 4E70A 4CI9A 4LXGA 4D3FA 5LA6A 4F38A 2AC7A 1AUOA 1BRMA 1VDMA 2PVPA 4OYLA 3BD7A 1G1AA 4JD5A 4ZEMA 1CX9B 1SZCA 3AESA 3J7AC 1XNGA 5C8YF 2I54A 1KS9A 2J3JA 4YROA 5IVIA 1SVWA 1RKXA 2GCPA 1DB3A 1MX5A 2HUNA 3A2NA 3HB0A 5IAEA 4BBAA 3AFNA 4MK4A 4NE9A 3BBPA 2L82A 4QAQA 4TX1A 4B09A 1WB9A 1B14A 3F67A 1GPBA 4FGSA 3K6SB 4YRSA 4NFSA 3IR6A 1U2DC 4JEUA 4PTZA 5A6VA 4IAOA 1XRQA 3NVMB 5DNAA 5FPQA 1Y8QA 3ZXYA 3CSSA 4MMXB 4NMLA 3SZLA 1XZJA 5LP1A 4ASUA 1FTGA 2YHSA 5HS6A 3GFGA 4LRQA 4XVCA 4DYHA 3GP5A 4O0LA 4OB8A 4PPGA 4W1QA 5E7JA 2G0NA 1G5FA 4ARZA 1QO9A 2ZTSA 3O4FA 5K2MA 3GLIB 3IALA 1M1NB 1T2NA 3WGUA 1Z5PA 4JEHA 4D92A 3IKTA 2D1TA 3CW2A 4JKOA 5L3RA 4Q6BA 4D46A 1RAGA 1YZFA 4BAGA 4MW5A 3G9QA 2XUDA 1PZMA 1WZEA 3SBOA 3GJXC 3GJ6A 2KWIA 2QYSA 4RVFA 4ZHQF 4O4JB 4KUHA 3MPUA 2G5GX 2VJNA 4RGQA 4B9EA 3JWJA 4E6PA 4CN9A 2RKOA 3D7KA 2XB4A 1UZUA 1G17A 1G1MA 5K8VA 3OC6A 1AVTA 1NYLA 2IYUA 4G26A 2RGDA 3T3EA 1C9DB 3AHEA 4Q4JA 2PM8A 2H2FA 1CLUA 1OLOA 3DONA 3GQVA 3IUNA 3CF6R 2FB9A 1J0AA 3KYJB 4Z8XA 4PLGA 1RHQA 1O95C 3VHRA 2WMOB 1GTRA 1U2GA 3LV8A 5JFGA 3B51X 1CBUA 3DD5A 2OEPA 4G37A 3ANLA 1W4CA 1UP6A 4MVXA 4PX5A 2JI6A 3LC0A 3EVEA 1NQUA 4Q1EA 4EKGA 4LY3A 1T0IA 3TQQA 1ISPA 1MDBA 5JLJA 1TTQB 4MV0A 1JQKA 10MHA 1YF3A 3ICCA 4M1TA 1DQNA 4NYMR 4PG6A 4KAJA 3SG0A 3GLSA 2FQ1A 1L4EA 2BEVB 2W98A 1FFEA 3QPCA 3D7NA 4F60A 1XO1A 3C4VA 4PX2A 1RNLA 5DYWA 4LVOA 1F7VA 1HWYA 1IZ8A 3LM8A 4KSCA 1R0KA 1GQSA 1YHNA 5ICEA 2CZCA 1EFCA 1YMVA 2R8RA 4D6YA 5KTOA 4MKIA 4R2IA 1PEKE 2I6FA 4EEKA 4PHGA 1G5RA 4HVLA 5B4VA 4RKRA 1XZHA 1OT3A 2P1DA 2VDRB 5CHYA 4NZZA 5KTPA 3K0KA 4CDGA 2GM3A 4P3XA 3QMPA 1RLMA 2VJBA 5J4LA 2XADA 2JVJA 3KKOA 3FPJA 3JSXA 4QNNA 3ADOA 3PPWA 3KM0A 3ZV4A 4E5UA 4RC9A 2G3YA 5K51A 3P0IA 3UG6A 1BHSA 3TPCA 3BD9A 2N75A 3Q0IA 1JG2A 1E2GA 3JD0A 2CHVA 3NM6B 3IRUA 2H65A 3OFND 3OT1A 3RBXA 3VU9A 4D0GA 5DTIA 1R8XA 4GM1A 4U2BA 4V0LA 4GMFA 1XF1A 4F0JA 1Y8CA 3PFGA 4TMFA 4HZUA 1WUIS 1UBHS 2YL2A 5K8LA 4I0WB 3T7JA 1GXSA 3ZDDA 4EBFA 2F3PA 1ZK0A 1B41A 2ZB2A 4XSGA 2YV2A 4IIEA 1O6ZA 2J09A 2A2ZA 3NHKA 4OKIA 3DVSX 4L3WA 3KQOA 4WJLA 3FZYA 3LOQA 4HGRA 5AIAA 4N0DA 4D8UA 4F2HA 3K70C 1US8A 3H84A 1XU9A 1NR7A 3CX4A 4GPD1 1TAGA 1ZQ1A 5F2OA 4C29A 1J33A 2ZATA 4ZMRA 4OIFA 2RAFA 4Z9BA 3KFXA 3WNCA 3DKIA 1I4LD 2G04A 4KMOA 3K9CA 1G8JA 3L0PA 4GX0A 5FUQA 1QG6A 2YRFA 3K9HA 1BMFA 1FSSA 1MJFA 1YULA 5J58A 1E9CA 4QSHA 4KYTA 4F2GA 2O3QA 4E2WA 3PT9A 1VB3A 2V7VA 1VE1A 1VLVA 2YBDA 3BF7A 1X7GA 4QA9A 2G08A 4WASA 5THQA 4JJ8A 1TC2A 4GM0A 4IHKA 3O8NA 4I4TA 4LISA 5CX1A 4IHJB 3AR2A 3QUSA 1EM6A 4P53A 4ZAYA 4I1YA 1ULTA 3JV7A 5CVTA 1E7SA 4L4UA 1G5PA 4X45A 3WL8A 4C03A 3UV7A 3SKVA 3S8MA 4AI6A 3HU3A 2GAIA 2P9FA 4G63A 4YMWA 1JKJA 1WSWA 2AX4A 3LXMA 4HYTA 5T8KA 3DDOA 5C46F 2RGYA 3ZZ1A 1GAQA 4KU4A 4YIKA 5T8KC 2H8KA 1IN8A 4RFLA 5EPEA 3DB2A 5JFOA 1R8QA 2LNDA 5FUMA 3AIOA 3ADBA 3IEKA 4MNTA 3CLSD 4J16C 3FGZA 1DDOA 2X2OA 4HX9A 2HA7A 2ODBA 3HA3A 1APBA 1QKIA 4DNQA 4H7DA 2AJCA 3RU7A 2PQ0A 3ANMA 1G5HA 2X9GA 1B6SA 3Q0EA 3UWKA 4O2BA 3BPSA 4D8XA 4H7EA 3LQQA 3HJHA 3GDHA 4KVGA 2Z8YA 2RCYA 2MR5A 1E3SA 4H6VA 1B0PA 1X77A 3QKSA 4BAUA 2VHXA 4ND8B 2EJUA 1WTCA 2OXFA 3UOGA 1A4XA 1CJKC 3HV2A 4FCWA 1VIMA 4UNQA 4P83A 1EE2A 4BEVA 1YRAA 2PQ6A 4FVTA 1PG5A 3JATB 4X1YB 4F4JA 4DEXA 1XHEA 4TLEA 3JQAB 2EBWA 2DJ5A 3NBMA 1UFOA 1DBSA 3PZBA 4PLTA 1AHIA 4FGZA 4WBXC 5JH7F 1IOWA 4TSRA 5FORA 5JYDA 5K8IA 3KQNA 2P35A 2VDOB 1G18A 3FI0A 1S3FA 3O0DA 2ZFUA 2Q2WA 3CJQA 2MTBA 1QIEA 3SY8A 2FXIA 3PNLA 3QRWA 4UAGA 5G41A 2R8EA 3PYLA 3REQB 3H7IA 4G1VA 4MR9A 4V0RA 1SC6A 3DEIA 2XGOA 1KI1A 1Z7YA 2B34A 4IVPA 1SQ0A 4JUIA 1YU6A 3Q15C 4KQFA 1U0LA 4Z1OA 4AZ3B 16PKA 1BJKA 1RYHA 1QANA 2CSUA 2QA5A 3LUGA 3EAGA 3NH6A 5CT9A 3CCCA 1Q74A 4LYJA 5AUQA 4HH4A 5EUQB 2XGMA 3TPZA 2ZU6A 4EJSA 3EC2A 4F4HA 3HKCA 3OZFA 4LTDA 2B4QA 1FYDA 4NS1A 1VGVA 2D5AA 2O8EB 3SLGA 4DWVA 4P81A 5FL7D 3B1JA 3PHLA 2IV7A 2I67A 3O21A 3ZGLA 2R7KA 4L5YA 1UWVA 2D13A 4FSDA 3EXHB 2PKRA 3VKHA 1G20A 2PLRA 1OJLA 4AVYA 1QPBA 3WX0A 5CNIA 5K0SA 3NOVA 3L77A 2PQMA 4H3KB 5CVUA 1Y3DE 4XCXA 4UNNA 4KE9A 1AZSC 3PA8A 5FWYA 3OD1A 1FX0A 1SHTX 1ZSYA 1XPRA 4R41A 2BM8A 2H57A 2Q3MA 3OZIA 5B1EA 4I1IA 3BXZA 2Z56A 2XQKA 2BFBB 3PU6A 3K6JA 4MQBA 2WF5A 1QH8A 3CZ5A 2ZRAA 3DJYA 4V03A 2GF9A 1KSFX 2PAAA 3WNDA 3ZGNA 1ZOIA 1A04A 4AN1A 1O97C 1FL9A 1T36B 3QHQA 4UHJA 3SJAA 4OUKX 2Q1TA 1WZCA 4G23A 4D9CA 2A58A 1U5BB 3OZVA 1Q95A 1QTRA 2XT0A 3JVVA 2H4HA 3PFKA 1QS0B 1NDQA 1RCFA 4ZC8A 3TR5A 2ZB8A 2G06A 5A5VA 1NBEA 4IMJB 3K5WA 3LWDA 2O1WA 3ABQB 5F9FA 2QZJA 1AO3A 1FBNA 1W94A 3O5AA 1HXHA 5JVDF 4JLAA 2JGEA 3MJTA 5T5QA 4N76A 1X9IA 3N0VA 4MYSA 2VVTA 1TRHA 1VCMA 3L6CA 1NVAA 2QRMA 4TWAA 4BV3A 1KIFA 3EFEA 4PLHA 5B1HA 1ONOA 4CMIB 3U6KA 3O26A 5TPZA 3WBFA 1QU2A 1MABB 1KPHA 3CLUC 4WY5A 1OI2A 3UAYA 2GDZA 3UXYA 5CFRA 3R9XB 1KZ4A 1U28A 2E9SA 3CO5A 4V3CA 2ZTUA 5KZMB 1RXCA 1IH8A 4KJXA 4Z5XA 2Z08A 4MRSA 2QRUA 3DR3A 4FIZA 1U28C 3KPVA 1GD1O 2NU6B 4II7A 1BG6A 3B1XA 4RF4A 5FBLB 1I2ZA 3TDNA 3IQEA 1JHQA 4F9FA 3HJFA 3ICOA 1GA4A 1KKMA 4K87A 5DO9A 1M5TA 4OH7A 1IULA 4MP8A 4X6YA 3M8KA 3M1LA 1ZD8A 4ZA2A 4ZT6A 4UZEA 2Z4SA 5H7XA 3ZHXA 2X4LA 1XALA 1EIZA 5C81A 1YA6A 4QYMA 3B70A 3HK2A 5BQOA 1MVNA 3G0BA 5T4HA 1JL3A 3NWOA 4ZMSA 4QXAA 1KTIA 2YYAA 4L2IB 4ENWA 1W52X 1DI0A 4MJ7A 5DNEA 1QCCA 4WH0A 4TV9A 5JE8A 2UKDA 2EF0A 3O31A 1ESMA 1ZVJA 3RWOA 4P86A 5FTLA 2Q5CA 1XMPA 1KK2A 3AJ9A 1ZMXA 1WQ3A 3INGA 5AI8A 2W6ID 2ZSIA 3NYWA 3W7BA 1Z35A 4J3FA 2XGSA 3W5VA 2JBWA 2RHCA 2GZ3A 4LJ6A 4A6EA 4LAFA 3Q5DA 4GMXA 4DBLC 1VPTA 2BKXA 4C0BA 5TGDA 1N5JA 1ZIPA 4WX2B 3WLAA 1Q0HA 4BNDA 4QATA 2Y4OA 1V1RA 3GG9A 4URFA 5KPDA 2FCRA 2AFHA 1ID8A 5KQRA 2P5SA 3ECAA 3LNTA 1SBZA 2WP0A 5A9RA 3B9RA 2EZTA 2NO9A 2H48A 2XDAA 3OOJA 4BC1A 4F9EA 3RYHB 4KBYA 5JEDA 3RSLA 1XZGA 4AQYB 5DM1A 4GBMA 4PHFA 4AURA 4LJYA 3W78A 4BO9A 2V1XA 4P82A 1HF3A 2JCYA 1VMIA 4XB1A 5JS7A 4JVSB 2W22A 1VIVA 1NPYA 1RQGA 3ECCA 2ES4A 1ZDMA 1WMAA 3FVQA 3NATA 2FU5C 3VBEA 5C8DA 4N48A 1QAMA 3KWFA 5C53B 3CQ9A 3BIWA 4OYHA 2O57A 1TO2E 5KHLB 3EPKA 4WSOA 1YT5A 4EPVA 3H2IA 4HDMA 3TQSA 1M75A 2PFSA 3WICA 3NHPA 3QYJA 1J42A 4QWWA 4F56A 3PC4A 4B6OA 3UG7A 2BGWA 1J20A 1JTVA 4K9LA 1OXBB 3U37A 1SVLA 5LC1A 4EI9A 5AOAA 5M34A 3VH3A 1QVZA 1TRKA 4BP3A 4BEWA 2ZUUA 1PG0A 4MV1A 5J2UA 2FWJA 4ZYZA 3HYNA 3ZDQA 4OHCA 4MHSA 1KMHB 3WDSA 3ZBQA 1X1EA 4XWYA 1Q7BA 4XH9B 3R4VA 2GN4A 4OSPA 3OQ6A 2P0YA 3O9VA 4A8JA 3QWHA 4XIGS 1YZYA 2P67A 1Q16A 2CZGA 3U3RA 1CULC 1NJ6A 1U80A 3IJEB 4LOKA 3W5JA 1U02A 4U6NA 4BLTA 3CX6A 1PV1A 1DVRA 2AOTA 3GRYA 1ZCAA 3EZXA 4NH0A 2HJSA 1V8BA 1D6SA 2IITA 1YGYA 2VNIA 2ZQ5A 3BQMB 2VP6A 3FCOA 1YIOA 1M72A 2IPLA 3FFTA 3GJRA 3G2HA 3NAQA 5EG5A 2YRXA 4Q1CA 5GVSA 3ZWDA 3D6HA 3HA5A 3HXLA 4PGAA 4IJKA 4JUCA 2WT4A 2WQ6A 2IHNA 1MO5A 1ZM2A 3N8HA 3B8HA 3KZKA 4C4ZA 2CY0A 2EG9A 4BKMA 3CZ4A 2YJTD 3C6ZA 4KXLA 3L0OA 4S1NA 4TYYA 5MN5A 2BH9A 2XDQA 3LGAA 1CUXA 2G8NA 5EXPA 2JFOA 4JBLA 4BNNA 3D4LA 3IVAA 3MMZA 1AMOA 2GNOA 2XUKA 3D8UA 4IQ0A 4EHAA 4F4IA 1KVUA 5KC8A 3R8FA 3AF4A 3I9JA 5KAPA 1DAIA 1Z0ZA 2F3TA 4NAUA 2O8CA 1LLQA 1UWKA 3GGCA 4QULA 4F6LA 4M0DA 4NPCA 1XTUA 1VPWA 2X19A 1ADGA 4C88A 4X1KB 1Y98A 3IAS1 4F93B 1ZA1A 5C5EA 2REQB 5JJLA 4ZQEA 1ABFA 3NTXA 4F85A 3VMMA 4KITB 5AVWA 3CUVA 4QQKA 3EFOB 2LP4Y 1B6RA 1R6AA 2SCUB 1IVSA 2UXBB 4GPZA 2IU4A 3EPPA 1FMFA 2ZPUA 1LNZA 1Q83A 3BXPA 4WESB 3QKIA 1TEVA 2DKNA 1RWBA 3M6XA 4ER7A 5LNK1 1G21A 1KP2A 4CM9A 4LMPA 3B3AA 4J0GA 2V7EA 2NPOA 1H0HA 4F97A 1EWVA 1VTKA 2HLNA 3L7MA 3ZI4A 4CWAA 1XDWA 4QLOA 4DQUA 4CTKA 5FAKA 3TMKA 2QOEA 3W3AH 4RZSA 3N7AA 4NFYA 3IPRA 3PX3A 1JG1A 2CNWD 4GEGA 4O2AA 4PAMA 4OV6B 3SR4A 3UB2A 4CW7A 1N6KA 3ZWOA 3R0XA 1FJGB 3HDYA 2ZRMA 5GONB 3H5WA 2QZSA 4GVLA 4IKEA 3IPLA 1EYZA 3LK7A 3WL4A 4BGDA 2ARKA 4DM7A 4NQZA 4MYRA 5A4JA 3V32A 3VC1A 1MKYA 3CSDA 4WCVA 4X1OA 3FHTA 1L7RA 5KNBH 3T54A 3QU9A 2Q4TA 4K2AA 1U3UA 4TWBA 1RYNA 1OT5A 5E4FA 4BNGA 5L4LA 5EHXA 3GH3A 3E9EA 4XQCA 2HA5A 3WR5A 4Y6QA 1DIAA 1W0CA 7REQA 1NQAO 5FDFA 2ZWOA 3VZCA 2B0CA 3PHJA 3TCKA 3LPNA 1PTJA 4Q3KA 3WGNA 3TLGB 2WWRA 4RKFA 1U7PA 1VL5A 4QJBA 1SNYA 3ZE0B 4G0XA 1ZEMA 4BNYA 5C4IA 3KXKA 2F48A 3RS4A 3AT1A 4TKUA 2OHVA 5L3VA 3SLKA 5B36A 4QTYA 1INLA 2ZI3A 2RK6A 3OM8A 3IQZA 1QHHB 4R31A 3V4RA 1XNRB 3IEVA 2VBIA 1Z5NA 4KVAA 1RQ7A 4OHBA 4X90A 3UKOA 2DUMA 4YQEA 4HNTA 2HA2A 2GCOB 1E2FA 3AI2A 1V71A 1H8HA 4CE6A 2VP2A 1LFAA 4PLZA 4UFPA 2PUHA 3I34X 5EJIA 3O8OB 3O8LA 1YDFA 3KTFA 4MYDA 4D8WA 1IM8A 3ZU5A 3HNRA 1L3BA 4H17A 4S2EA 3A06A 4WL0A 5LJIA 3GPBA 3ESXA 3TOXA 4IEFB 4JLSA 4MP6A 3ENZA 4PIPA 5AKIA 4BZPA 4MS1B 3IEIA 5DNYB 2WKRA 4N3AA 4GP6A 2O3UA 3I5UA 5IHPA 3AETB 4F84A 4YJ3B 3N2NA 4NCKA 1XZMA 1T4CB 1CVLA 2MSNA 4GLOA 4K9OA 1WLSA 3ZWPA 1CY7A 1TQ4A 1NJ8A 1YFJA 4BLSA 1IB0A 2WG0A 3T52A 3QMVA 1L7MA 2BGKA 2X3FA 3A0RB 1MAWA 2ANCA 1KVTA 3DF9A 4UTRA 3A9CA 4AMZA 3DBHA 3KSBC 2ONKA 4RTSA 4XB6B 2XJ9A 4CUJA 4QT4A 2AV6A 1JDPA 5TPWA 3OZAA 4K9PA 4E1VA 4A0QA 4JL5A 4MB6A 2AKAB 2FFAA 1E62A 1JHZA 2RIPA 1Q20A 2D4HA 3GVIA 1Q21A 2PWPA 4B3JA 1Z9BA 4F4CA 4M9CA 1KYXA 2R86A 3H5AA 4OFZA 4RVCA 2ZYIA 1E1YA 1DXYA 1NJ2A 3HBLA 3RS2A 3GOHA 4RVSA 2H08A 2VHTA 3SSOA 2HW8A 4L57A 3QX8A 4G8JA 4WZBE 4DRXB 2CJPA 2DZDA 4EKYA 1LX7A 3KBOA 2AZ4A 4CIVA 1XJQA 1GYQA 1L8AA 1Q1QA 1U0HC 3PDCA 5CDTA 3UCXA 3OFVA 1P5RA 4C0AC 2BEWB 1A7JA 1L4LA 3CH5A 1LBTA 4FFRA 1X9HA 3TE7A 2O59A 2GLXA 2IUFA 5H3HA 4DA7A 2AD5A 4L9SA 1GFWA 3G49A 2PTHA 1EJ2A 5ENVA 1JXQA 1DJNA 1NFRA 2Y1CA 1F1JA 3IH5A 3SHWA 2WJPA 1JQEA 4BCBA 1JR3A 4ZEWA 4D98A 2Q5EA 1RXVA 5LDDC 1R4NA 3GI1A 5I7EA 1XQWA 1B0AA 1AK1A 1M6VA 1WVIA 1ODIA 2YCBA 3E9MA 4CLOB 4AO6A 4PYOA 1PS0A 3SNHA 2LVBA 2NXWA 4KO3S 2WIDA 3AF5A 3I5MA 1KFKB 2QYHA 4GWLA 4MYCA 4ZMBA 1WXEA 3EDOA 1DEOA 4JNKA 4HFNA 1E5XA 4L78A 3NEYA 4Y6SA 3UNXA 2FN7A 2X0EA 3UA4A 4N5MA 3X44A 3N53A 3CZCA 1B00A 1GU0A 4L3VA 2BDTA 3HGMA 2G36A 1FP1D 2XECA 4DXDA 5C1PA 5CH3A 5KYXB 4DLPA 1E6KA 3A4LA 3WBJA 4C07A 1RM4A 2WD7B 3QW2A 3F73A 2NV2B 1P1FA 4B79A 1NY5A 4IHJF 3BQNB 3VHXB 2X13A 3H8VA 1XVTA 4NLLA 1E2PA 1CWUA 4ZK6A 5B1YA 4CLDA 4HS4A 3W5UA 3FDZA 1VHDA 2MJLA 3GLFA 1AK9A 4Z3DA 1H2ZA 1I3LA 1OW3B 3VOBA 1GKYA 1DELA 2J6HA 4GC9A 2H7YA 1YS7A 1Z15A 4J6EA 3HC7A 4IFBA 1GPLA 3RC9A 4AY4A 4BVKA 2Y99A 2YV5A 3WNZA 3CW8X 4M55A 5FLYA 5DPMA 1YS4A 4ENSA 3L5KA 2ZJ0A 4QRHA 3SFZA 2YVQA 3WRXA 1OC4A 3MK31 2X4DA 4KN9S 4KRYA 3RJMA 3B1WA 4F2WA 5B55A 1SG6A 1JIVA 3SVLA 3BMQB 2UUBB 3OE7D 2CLHB 3EFBA 1AF7A 2BM1A 2YFYA 3KJEA 1Q5PA 2PRJA 4M98A 4PPNA 4R9VA 3P2YA 5I7RA 1CE8B 5REQA 1RWMA 2JJ1D 3U16A 3ZDAA 3U39A 5JECA 4RL4A 1XRSB 3I01A 2WSLA 1TPYA 1BHJA 2OZLB 3O4IA 1ISJA 1GGKA 4WZ6A 1L5RA 3O8CA 3K05A 3WWCA 2IXGA 5HM6A 4TQUS 4GUAA 4F96A 3HBNA 2J7PD 2GB4A 4WXMA 1ULAA 3H5TA 1NJSA 2YRWA 5AJVB 1H8ED 3UWOA 5CCDA 3LVFO 4L72A 3DQZA 5E8JA 4A8HA 4EG0A 3GUVA 2HXYA 1PSDA 3W05A 1WF3A 4P92A 5K3SA 4EKNB 3G0GA 5AW7A 3B38A 4CQNA 3DZGA 4W8HA 4Q7JB 4NG4A 4PLVA 4PLCA 1LDYA 2WQZA 1KGSA 4MARA 2EIXA 4ZT4A 1AKWA 2IP4A 3A3OA 2PX8A 4F5ZA 1TMYA 1P0FA 1Y6GA 4DLBA 1LNSA 2BEJA 1A97A 3SX0A 1LD3A 3E6AA 2QAGA 2BJWA 2YDXA 4C0WA 1W49A 4JA0A 4LA4A 4KDFA 4OQEA 5ALOA 3H65A 3PKIA 1E2LA 3K92A 3W8NA 1CETA 1XCMA 1MXFA 2HXGA 4HFRA 2Y0BA 2QAGC 1UM9B 4MJLA 4Q3LA 3ZD6A 5AR1A 5G0WA 1EGMB 1UMDA 1BW9B 3RYFB 2Q6IA 4J3JA 1XPOA 2W42A 4JC8A 4I2NA 1T25A 4EARA 2JH9A 2Q3LA 3RHFA 5EE1A 3TM5A 1G64A 3IVMA 2FJPA 5JZOA 4CV0A 4HD8A 2Q3FA 1SXJA 3BSFA 2RH4A 4QXQA 2BI4A 3DW1X 1RQPA 5AOBA 2WU3A 5HBGA 2VSYA 1KYZA 4ZYWA 2HY7A 3VGJA 1UJ2A 1P72A 1SXJC 1RSZA 5IJWA 1PKXA 2CD9A 3BM5A 3JVUA 4CNQA 2Z9BA 2E4WA 5KNDH 2YYZA 3PQCA 3M6UA 1WCIB 3CVWA 2E89A 1FX1A 1KFBB 4UDNA 3VAYA 2WFAA 1O9GA 3EDRA 3JTMA 4YREA 3KD2A 1SIOA 4UMDA 1LLUA 1ZW1A 1T5TA 4U0KA 1WCYA 5T3YA 2ZROA 1BX3A 4BAZA 3BJEA 1KMMA 1U2SA 4BKOA 2ZS7A 1M54A 3TLAA 3LZ6A 4RK1A 1X3SA 3M1IA 3RRBA 2IYWA 3C3JA 5FI1B 3MWEA 2XOKD 2GK6A 1LLDA 3E18A 2X42A 4U6SA 3KR2A 3KJGA 3KLNA 4Z4CA 1CP2A 2HA3A 2ZBFA 2B78A 1MC8A 2XMCA 3DA8A 3JQGB 5EQDA 1GKUB 1LQUA 2NUAB 3UN1A 2V7QA 4X20B 3S3TA 2OP0A 1Z45A 4R40A 4C5CA 4B3IA 4I55F 2WLTA 1EJBA 3SP1A 1P4RA 3BXGA 2Y77A 1A7AA 4X63A 3FZGA 2NW6A 2FKNA 4M1WA 3P9IA 4Q4AB 3CRZA 3ZXUB 1T24A 1R0LA 4F8JA 1T2EA 3U3XA 3OZEA 3G7NA 4URYR 1HYHA 5K4AA 1PJQA 4FHZA 2FPUA 1RU3A 1LPPA 1XRLA 3HVHA 4EGQA 1QIJA 1X8JA 2SNIE 2XMRA 3E05A 2W8ZA 1PT6A 3LY9A 4AULA 1CRQA 1VJ5A 1W581 1Z8NA 2IPMA 2NO5A 2Q3HA 2YX1A 1IPFA 1Z82A 5CW1A 7AT1A 3I2KA 4HR7A 1X8KA 3W2TA 5DMXA 4A16A 5ALYA 3BS4A 1P9OA 1VL2A 1MV8A 1JEQA 2JLAA 3DEJA 2YIDA 4TLMB 4FOOA 3GGPA 2XQVA 4TMYA 5LXTF 3E9CA 1JAIA 3X1MA 1GP2A 2AW3A 4I66A 1O94C 2G25A 1JIXA 2GETA 1P8JA 2OR3A 2FWBA 3QVGB 4BWGA 1SA0A 5GVRA 5BVHB 1DIBA 3G82C 4IEEA 2Z2IA 3RTDA 5ERYA 2SICE 4QRIA 3SE0A 5KCMA 4ZGBA 1PLJA 1F06A 3AU9A 4J2OA 3VKWA 5DBOA 3HS3A 3HJNA 1IM2A 1SFRA 2EL7A 2FPOA 3AIMA 2XA2A 4JR0A 4QREA 1ML3A 1FXUA 3V7YA 3PYXA 2QMUA 5FLEX 1H93A 1Z7GA 1JKXA 2FE4A 1FTQA 1KORA 1OC2A 3GGOA 3CEPB 3L6OO 5DHFA 5J9FA 3WV4A 4N3CA 2AXNA 3NM4A 3R7WA 1KI6A 2FPWA 4Y9UA 5HFAA 4DIMA 1XVUA 1GEEA 4H1VA 3ZLBA 4CIYA 1HBJA 4FFNA 2PH1A 4HX5A 5JOQA 2IVZA 3Q9UA 4MGIR 4JBWA 1XXHA 2EEPA 3F98A 1OASA 4NFLA 3AUFA 121PA 2QX7A 4FMCF 4FOLA 5EIXA 1YVPA 1AS2A 3THYB 4S1TA 2FW6A 3NFYA 1G7TA 1M6YA 1FYFA 1A2KC 1JU3A 2JASA 2B30A 3KG2A 1C1DB 3MAJA 2HQ1A 3EGEA 4O4LF 5AKZA 5FP0A 3I9FA 3OKFA 4RH0A 5SZIA 4CEHB 3FAKA 1BHQ1 3TVDA 4CF3A 2PUAA 4W8OA 2P2GA 4PQRA 1ZUHA 4ZV7A 3TNDA 1SUAA 4DSOA 2W2LD 2W2OA 3NH9A 1M8FA 2RBGA 5CHEA 1H2FA 5EQFA 5KNCA 5F2KA 3PVSA 4OXRA 4PO1A 3PTAA 2DR0A 4KFSA 2VIIA 3ELWA 1GZ5A 3DEKA 4WBSA 5EINA 3ZXSA 5JH7A 1VG0B 5K0FA 2ZJ4A 5E38A 3OZTA 4ZO6A 3WK7A 2C4MA 1Z4OA 1M8JA 1HLDA 5JZSA 4E7PA 1OBVA 4X95A 2Y1DA 3VNUA 2PUCA 2KE5A 4EJ2A 4RD6A 4C1NA 1KIAA 4PN3A 4FDMA 2YS7A 1HQKA 2ANBA 1WIWA 3GLHE 1BIFA 3AG6A 5FA6A 2C7RA 1E4OA 4DMCA 3KYDB 4HFMA 4JJEA 4E12A 4ZV4A 2B4KA 2D1SA 5LR6A 1MT3A 1Z2OX 3NGXA 1BN6A 3WRYC 4GS5A 3UMRA 4P84A 5EWJA 1HO3A 1UPAA 4K6MA 1R6VA 1ESDA 1MQSA 3HB5X 4RZXA 1ZN7A 4D8TA 1I6KA 3ZDYB 3F96A 1EB9A 4EY6A 2XA1A 2V59A 4YRBA 2O8DB 4OOEA 5A1TA 1KSHA 4B3CA 4E46A 2G4VA 3A9UA 1OU0A 3GJ5A 3PL5A 1E9AA 1V9CA 2ZBGA 3KQMA 3HYRA 3OQPA 2QMOA 2FJUA 2F8MA 2WJZB 5F5LA 3WB0A 4A8JC 4LGYA 1BGWA 1YI1A 1L5LA 5TY0A 1WUJS 3QX7A 2POCA 1FBTA 4B45A 4WV3A 1F14A 3Q41A 2C77A 2ECKA 4R1QA 3TB6A 3TQHA 5K7SA 4OP3A 2BSAA 1QK4A 1Y1KE 3WVNA 4TMZA 4R05A 1L4UA 1LC3A 5KTKA 1AV6A 3E3AA 1CY4A 1LW6E 4OQFA 1QQ7A 4ZI5A 1XPUA 4KCGA 3DEZA 1SHUX 1E58A 4P0QB 3C3BA 3DPIA 4OL0A 4B5LA 3B1FA 3OKPA 2DWOA 3DBIA 3GC6A 4JLKA 3UJAA 2R85A 1WDWB 3R44A 3RYTC 3LMKA 4RZUA 1GR1A 1U0EA 1XD2A 1Z0IA 2XYVA 5CMLA 1ZAYA 5JVDA 4XCVA 3WZ2A 1ADJA 1THMA 1WCV1 3NUGA 2XMPA 1GR0A 2A4MA 2OKCA 4HK4A 3HVIA 1KJQA 2OVFA 1Y1LA 5J4KA 4F91B 5L3SB 1BD4A 4J1TC 2I8LA 1KMNA 3EA4A 3Q5GA 3SXUB 3DQQA 3SYMA 4Z8YA 5A6SB 5GONF 4LI3X 1CDEA 4YDHB 3NAZA 4QNRA 1YC5A 3VHLB 4HEQA 1D2HA 1FRFS 2BFCA 2B92A 5LUAA 4FDUA 2FFHA 3GLIE 3L7DA 1LY1A 1QBGA 1VPEA 2HL6A 3RVMA 4DSZA 3KQYA 3FPCA 4MDHA 3VSAA 8ABPA 1TVEA 2PK3A 5ELLA 4UM9D 1NWHA 2BDUA 3UYKA 1CHNA 2GRJA 2DJIA 4OLBA 3FNGA 4H4EA 4YDRA 1N1EA 2GEBA 1TU4A 1YK0A 1H42A 1HZJA 3FZNA 3L6EA 5DX1A 4HLUC 4DJFC 2CHEA 2QRVB 1WP9A 5ALGA 4DT1A 1DO8A 2NQTA 1SKAA 3FR8A 2W8BB 5WRFA 2AMLA 3QLUA 2JEZA 1ONSA 3NHWA 4FCTA 2EV9A 4HDNA 2XSZD 1WDKA 3TZCA 3VC3A 1AA6A 3OZGA 1N9ZA 1EFRA 2X9NA 3PE6A 3CEMA 2C5LA 5A62A 3F49S 1UINA 1VLJA 2APJA 3PUHA 1UXOA 1E7WA 5DWDA 4WLUA 2ATXA 2IELA 1NNEA 2PXXA 2BJHA 2G83A 2IZOA 3P2KA 1EB8A 2JHPA 4IMPA 5JSZB 5J2TB 2Q5FA 4EG7A 3V8EA 3MOGA 3NKLA 3D6TB 3H2GA 2KLBA 1O1YA 2PEYA 3JQ8B 1D8TA 1WL8A 3DUFA 1XDUA 3EUFA 3QM1A 2CUNA 4OAQA 4QPPA 3W8DA 3D31A 1KU6A 4MUXA 3Q9LA 3QUBA 4MCJA 4TV8F 4YT5A 1U7WA 5KHOC 4GLJA 2IIBA 2PSJA 1V43A 4YUZA 3AONB 3TW4A 2OCBA 1NNI1 3R24A 3PHHA 3H9EO 3FJ1A 1GQOA 4TMKA 3H05A 3K4HA 3ESQA 4C01A 1YR1A 3QJYA 5GOTA 5JCJA 4XUGB 3H5OA 5CA1F 1P5JA 5J40A 5D5QA 4ARAA 4TLAA 4QTTB 2C54A 1WETA 1C8KA 2HA6A 3MINA 3UAGA 3W5BA 5EWLB 4OI2A 1MAVA 2R6DA 4IW3B 1A1SA 1QDUA 5UKDA 3RV3A 5DHRA 2JJ2A 1OWMA 1IZ0A 2LD4A 3H11A 4CVNA 1QRSA 1UODA 1XAJA 1V5IA 2IHUA 1ODTC 4J3NA 3ADKA 4NCXA 1ML4A 5CK5A 1JHAA 1GITA 3D54D 1Q50A 3TZBA 5JDIC 5FOTA 4JX8A 4M36A 1ORHA 1THZA 1OQAA 4UULA 5A03A 1BWSA 1QOZA 1W9HA 1J8DA 2B5VA 4P36A 4MWZA 4WFJA 4XJTA 3WDKA 4AMUA 3ZTWA 1QMGA 5K3FB 1Z4LA 2GPWA 3FI9A 1J2RA 2BFDB 3OU7A 5AVXA 2P7HA 2IYPA 3ZWWA 1OR8A 2P4SA 4L8LA 1G8KA 1NTRA 3HHPA 4JKIA 5KHAA 2F17A 1VPDA 1R66A 2DUUA 3T7CA 3ZCSA 1KDTA 2ZAYA 2VYND 3JU3A 4LNAA 3SDSA 4C87A 2YVKA 1P9WA 4K5QA 3NONA 4EFMA 3FGPA 2PUVA 3AY6A 3NWEA 5GJVC 3RYIA 4E30A 2ZI6A 4PAOA 1SOAA 3BC1A 3KPJA 3QX9A 4F4DA 2R11A 1GCAA 4FZJA 4FJ1A 3KQUA 4BPBA 4E5YA 1IZ9A 5J59A 1HYBA 2HYDA 4Y6RA 1JJFA 2D5LA 1BXRB 1EA7A 4DUGA 3CU5A 1G4HA 2O20A 1WXIA 3EHDA 1G7CA 1GJRA 1R6TA 4JR2A 1H2HA 3EBLA 5DRYA 2YWDA 1GQRA 3I6MA 2GXSA 3BJIC 4L07A 4TRRA 2XDYA 3K0BA 3HPQA 4I1UA 5HF6A 4ACAA 4DA6A 4X92A 1U3VA 3VYUB 1UPTA 1CJVC 1NU6A 1MH9A 1ZGBA 2A4KA 1QG2A 4ECAA 3VVBA 2WBLC 1UZNA 3T6KA 4NDZA 3AEXA 1RC0A 2Q4OA 2VWGA 3ELUA 2Y0CA 3IKMB 1DC4A 4YN3A 3E23A 3S2FA 4ZVNA 5KVSA 2E5WA 2Q2VA 1NV8A 3BDVA 1VECA 1YQTA 1ZFNA 2C92A 2DQZA 2WU8A 1LPNA 3I0ZA 3KTAB 3LTEA 2GLTA 3Q3JB 3R6WA 4JYPA 4MTLA 3Q3GE 2NZYA 1XA0A 1XX6A 1KI3A 1ULSA 4XIJA 3ROGA 4NG5A 1DRVA 4G2TA 2GFQA 5EIWA 1P9RA 4AAYA 5IJXA 1ZZGA 2J3QA 3W2FA 1BVUA 4Q19A 3L6BA 5GY7A 4CM6A 3HY6A 1JLHA 2X8JA 4GPIB 4MRVA 1N4AA 1CF9A 4OHZA 3O6VA 1A2BA 2JVKA 4MVYA 1CJBA 3L4JA 1DDIA 2Q1SA 1H9AA 2GF0A 2ODTX 5DYIA 2J30A 1GYPA 4S1WA 1FFYA 3BJMA 3ORQA 3HB9A 4KYUA 3OPVA 4ZT3A 3GEEA 2OFFA 4I5IA 2H1VA 3S99A 1WA5A 3G0IA 4GGPA 3D4OA 4LEIA 4NHEA 1OWPA 1MH1A 1X7ZA 4PHHA 4OJMX 2JH3A 1C29B 1FQWA 4B3XA 4JNCA 5I4IA 1U1GA 2G1KA 1PHPA 1WD5A 3LRTA 2QAIA 2ZVDA 2JIZD 2VPIA 3WBKA 1UBEA 3DT6A 1B43A 4RE5A 2A7XA 4UBNA 1ZD1A 3ZTYA 3NNNA 3RNOA 2PR2A 3TSAA 3V34A 2PGOA 2RBKA 4JOQA 2JGRA 1M1NA 3TXYA 2Y9MB 2DT8A 1QO0A 1LQ2A 2GLUA 1MC5A 2CHUA 2IJGX 2QNIA 1UJ4A 3DKKA 2AFIB 4EF6A 4KPEC 4OH1A 3WNQA 5JNLA 2A84A 5JSHA 1MF7A 3UCEA 4EEXA 1Y4SA 1IQ0A 4RHCA 3UPTA 3GRCA 3ESYA 4P33A 3Q7QA 1TUBA 1PR2A 3PC8C 1SWWA 3W1WA 3RJTA 4TLDA 5ILOA 1A2QA 2C7PA 1PGNA 4RBNA 1SKBA 3R77A 4LZPA 3I0NA 1MJHA 4YT2A 3DZIA 1CR4A 3ANYB 4NAHA 3RAJA 3SICE 1SCJA 4FD2A 1YRBA 3KU4A 3OPMA 1MGOA 1TJ5A 3KB1A 2HJVA 3IESA 3MCZA 3OIUA 3QY0A 4JX9A 4US0R 3RS0A 1L7NA 4IIXA 3SZUA 1UEIA 1V5WA 2P4HX 3MTGA 4OVKA 2XCUA 2YFHA 3Q2KA 5HMMA 5M3BA 2PXAA 1FS6A 1VLZA 3RG2A 3BZWA 5AVYA 2DTXA 1ZONA 3BXXA 5AOCA 1P74A 4O2LA 2ZUFA 2XGJA 3P2MA 2VHVA 1FFCA 4EG8A 3KYBA 1DEHA 2IS1A 2C3MA 4CFSA 3C6YA 3ZZMA 2GJAA 2FOXA 2XUGA 4GL4A 3VTKA 5CB0A 2R62A 3BK7A 1T9CA 3FG9A 3TUJC 5DKFA 2BEVA 4DA8A 4XEHA 2C8JA 4MEAA 4YMTA 3IFSA 3ND7A 1HQCA 1TLLA 3OT4A 5EVCA 1XK7A 3MELA 5JD4A 3DE5X 1NAHA 2VRCA 4WHMA 4K86A 3WL5A 1C3EA 1A72A 1W2HA 3LWNA 4UPDA 4JJFA 1VIAA 4FP9A 721PA 2GAJA 4E33A 3V42A 6REQB 3JALB 2FZ5A 1J2YA 4S1PA 2YQZA 2NTEA 2ZJOA 4Q0MA 5KINB 1WQ1R 2BTEA 1ZQ9A 3URMA 2O6LA 1VE7A 2FWMX 1QCYA 1GVHA 5E6UB 2G5CA 5YASA 2YC2C 1JVNA 1EWTA 2FEAA 5EN4A 2PUJA 1DRJA 3LU1A 3JQEA 3K5HA 3K6KA 1WXXA 3LKDA 4GHWA 5EPUA 3X2FA 3U44A 3M6AA 1E3WA 2D5BA 5T41A 4AWXA 4C05A 3NIGB 1PWYE 1F12A 4MVJG 3P9NA 5CFPA 1AUQA 2CE2X 3E7XA 2JBHA 5FRDA 4PQFA 2V97A 3DKVA 2XZLA 5ARCA 1A0OA 1PJZA 4CLEA 4KDCA 2HLHA 2QVXX 3IR5A 5DM2A 1W1IA 2X1MA 3JWHA 4R1TA 4XQEA 3VPAA 4B1FA 2WRZA 2CFIA 2QJTA 3PJFA 2XQIA 4RS4A 1U3TA 3O75A 5HIMA 4YMIA 2G67A 1EDDA 3QNUA 1TQHA 1CZUA 3IKLA 2YV4A 4KTTE 3CONA 3OWOA 4L5IA 1T4GA 4G67A 4JR1A 3TUIC 4K7JA 4WLFA 4Y98A 1GSHA 2PZEA 1U8FO 4H08A 3G9TA 1OD6A 5KYNA 3SYKA 4HTFB 4RTNA 2WKQA 3LO8A 3K9GA 1DMSA 3PRJA 4W4TA 4E3WA 3CR8A 2C7GA 1G4AE 3FN4A 2G80A 1ZHHA 4QUAA 4R1LA 3LT2A 1MP0A 3NHAA 1U7HA 4IHJA 1M83A 2X14A 1YRWA 3LUFA 1ZJWA 4N03A 3HY3A 3BICA 2OV2A 1YL6A 5P8WA 1LGYA 4IVQA 3IIKA 1UPCA 2PMKA 4LE1A 5CG1A 1YA4A 3CF4A 3EUWA 4D9EA 1X8LA 1N2SA 1Y8ZA 5AW5A 3T5BA 3TZEA 1JQ5A 3LVBA 1XZFA 1V1MB 4RZIA 4XQ9A 5I7FA 4RNDB 5IS2A 2CLEB 1VB5A 3THRA 4H31A 3GYBA 3W6NA 2MSKA 3QX3A 5FB3A 5A4IS 4JELA 3OMXA 1FYWA 1XNHA 2YWGA 4PO9A 2HRDA 3HJCA 1XEWX 2VA8A 2YNMA 3SE7A 3KQWA 1JQ3A 5FUYA 3A1WA 3CLRC 1K4YA 4FX5A 3JSAA 1ISSA 4JH0A 5ALMA 3VDMA 2C82A 3HY4A 2POQX 2YNMC 4XE5A 3HFSA 4TGLA 1GT91 3GROA 4V02A 1C7IA 1EM8B 3KDPA 5IM5A 1M7HA 3HADA 4ND8A 1P77A 3CFYA 2E6UX 2IGTA 3CPEA 2WSIA 3JATA 4L5BA 3D7RA 5I9SA 4EYSA 3I04A 2PNJA 5LOVF 2EHJA 1R8SA 2FF7A 3DZCA 1X70A 2WHPB 3JQAA 3LVRE 4YNBA 2P1ZA 3OZRA 4JIGA 2B7LA 1M2GA 2H1RA 1YRYE 3IULA 2ZI9A 1Z8HA 3TGWA 1VYHA 4A2PA 2JLZA 4K81B 1SC3A 1QQAA 3LT5A 4U2FA 1PNOA 4QKQA 5BQ5A 2A5FA 2NYRA 4I1OA 5BN3B 2IY7A 5ECDA 3UKDA 3G0CA 1RWVA 2VNJA 4Y8VA 4A10A 3S2IA 3W9YA 3REQA 3PDUA 1NRIA 1Z6YA 2VYVA 3QYFA 2G4LA 3IEXA 4GEKA 4B7AA 4KMSA 2OBFA 3WYNA 2VQFB 5CGQB 3B6EA 4AZ3A 1F5SA 3FSJX 3RTCA 4WDRA 4ZCIA 1H9CA 1RRPA 1FFBA 2HIHA 1UKVY 4BDTA 2O0LA 4G0VA 4LY9A 4XYMA 3UT6A 3ONWA 2Z2ZA 5AI9A 2RJ3A 3A14A 4FDVA 4OB6A 3N3BC 3MS2A 4YJFB 2Z9CA 1Z2EA 2FY8A 3MD9A 4FIDA 5AT1A 3RFCA 3S2YA 3IMFA 1LLFA 1ZJ4A 4G5OA 2QIOA 1JTEA 1QKJA 2ADMA 3IMEA 1FU8A 3KUUA 4Y0NA 3ZNOA 4P7KA 1PJ2A 3V7WA 1PS8A 1UJBA 1Y1TA 3EOZA 3EXHA 3JYHA 4BWFB 3I1FA 2F7SA 3AIKA 1EWYA 1G5QA 1JPUA 5CCEA 1OB5A 1YE3A 3KDAA 4CIXA 2Z2KA 3GFSA 2OBYA 4RHYA 4U0JA 2E87A 5TB5A 2P6UA 2VWQA 1L5VA 1BDHA 4RK6A 4UEQA 2FUG1 4HY3A 3QYAA 1JB1A 2WIBA 4R2KA 2BFBA 4S35A 1OKKA 5T4BA 2YN0A 3TTTA 4IILA 3WTCA 1BNCA 4GDMA 1L7AA 4ZAGA 1E2JA 1P60A 4AJJA 3ASUA 1T36A 4MW0A 2FG6C 5D01A 2AOWA 1D2MA 3A3YA 4PM4A 3BWDD 3NB0A 2NQ2C 2FKAA 5H16A 3CH7A 2M6SA 1NZJA 4WN9B 1JFVA 4UM9B 2NP7A 1U5BA 1QHFA 1KQOA 1QS0A 2GTIA 3B53X 3N8KA 3HGTA 1PEDA 2GD2A 4LV5B 4GFDA 1IXYA 4QOJA 3VSDA 3C48A 4H6WA 2H4ZA 4JSTA 2YJZA 5EE3A 1B1CA 3DP7A 2AH5A 4I55A 2FVYA 2SKCA 4NCBA 1QE3A 1UBFA 2EFCB 4ONEA 4CMIA 5A7FA 2AHOA 1MO4A 3QLJA 3WO1A 1MABA 1YR8A 2Q2NA 4D3DA 3PEVA 2Y27A 1N8NA 3D0RA 3D4IA 5BRJA 3T3HA 4JBIA 3ZE1B 3ELYA 3JAMA 1CJSA 3UA3A 3PFHA 4XI9A 4E5PA 2OM2A 1WX1A 3PR3A 3TO5A 4LVNA 4DLUA 1PDWA 1G6Q1 1Z2PX 1RJFA 2NU6A 4C0JA 5EGNA 1N4DA 2G71A 2WWHA 1M6HA 4MVJD 1W7AA 4AKIA 2HM7A 2PBLA 3RC1A 2BE9A 2X6TA 1GT6A 3HCAA 4WAUA 3WKEA 2Z4RA 5HFJA 2AMFA 4NV1A 6LDHA 2J9FA 3R6LA 3FLEA 2BLNA 1DXQA 5LMUB 4PZ0A 1U65A 1XBTA 2BTOA 3K7EA 4WJZA 4UDYX 5HQ3B 1VE3A 2QJFA 3PC7A 3F74A 4X97A 3W6OA 3WIUA 5LXTA 4M22A 3UXHA 4TXJA 3OTGA 4AG6A 1XA4A 1VE6A 1AB6A 3O3NB 4A6PA 4BMNA 4C76A 4CKCB 4W9MC 2I1QA 2PZFA 3ZU3A 4JSRA 3MF4A 3LT1A 4LNHA 4MR7A 4YO8A 2I65A 2XHEA 3U4DA 1F9AA 5TT1A 2O2XA 1WCXA 1NR1A 2HHHB 4RMGA 1K8XB 1L4YA 3MB5A 1QDLB 2FRVA 2OCPA 3A6EA 1YIDA 2FR0A 4X54A 3WB9A 1K6EA 1GNVA 1VKOA 2QG9A 4XGIA 1CUWA 4WTOA 3I72A 4D57A 4B87A 3W5AA 2OZKA 2E85A 1JJBA 1K7CA 1MB9A 2XQGA 1JR4A 5H81A 3ZIAA 2R47A 5AW4A 4I1PA 4Y18A 2YCLA 3D3WA 4KH0A 5A71A 1YDWA 4RLQA 3T41A 4OHUA 2CMHA 2CVOA 2XVZA 1DOZA 3TQRA 4C3OB 1AO0A 4P22A 3DE3X 3DB1A 3V6LA 1SXGA 1XUOA 5LZ5A 3RYHA 3LSYA 3WSWA 4LOAA 1TT5B 4GX2A 3AIIA 4QODA 1Q1NA 5L6LB 3WLHA 2FQQA 2PYIA 2XUZA 3QTTA 1N25A 1SRQA 3LRPA 3HACA 4LQDA 5F52A 1NHGA 4J76A 3W79A 2ZSHA 2RGAA 4H7IA 1A9RA 2ZIUB 3N58A 4RPGA 4LWQA 3Q3CA 1OV4A 3L04A 2E4YA 1DKUA 4IFTA 5CM9C 1JHPA 3WLIA 4L4XA 3HCBA 2JJYA 3CXUA 1YACA 4RIFA 4YJKA 1N5MA 2OQ2A 4I5GA 3ZHTA 3AVUA 4MWDA 4M0CA 4JYAB 1L9KA 2ISQA 2J59A 5EJ2A 3BK2A 1LZLA 1VI2A 3M1AA 4WOPA 1WE2A 2ZT6A 1ZCBA 1KMHA 3UAOA 4WZAE 1UFVA 3O47A 4YV1A 3IPXA 4A03A 1JHMA 1ZLXA 4I9HA 5DSXA 3RSSA 1WULS 3L0ZA 4N39A 4BASA 1OVGA 4Y67A 2R1VB 2CXSA 2HFJA 3T35A 4XR9A 4HNAB 4P0TA 4OQMA 4L4ZA 1PLKA 1O6CA 2BHTA 5FNVB 4CKBA 1ZWKA 4LF8B 3M3PA 5E0KB 1ZMBA 2RHHA 5CBKA 2W83A 2KM1A 3NU1A 4O4IB 3GA0A 2X8WA 3D1JA 3GJ3A 3T3OA 3J81A 4JCOA 4A26A 2CV1A 2IUTA 2XF2A 3D2BA 3GCDA 4QU5A 3WK4A 2XE4A 4TKMA 2WUFA 3WZLA 5IF3A 1XZQA 2HMWA 3A6KA 1NW8A 2Q5OA 3L8GA 1U9CA 5HTKA 5LIRA 5NULA 2UVDA 4MB0A 1BTOA 1FDWA 5G0UA 5BSTA 4WNAB 4DS3A 3RAEC 4FI3C 4BLVA 5EYPB 4U7TB 2ZZKA 4DCUA 4EY8A 2IDMA 4FT2A 2YJ5A 3JYQA 4JCCA 4KIUA 2I6GA 3WGQA 2BGNA 3RSQA 4I9GA 4M8KA 1J1UA 3TR6A 2A8YA 1P1HA 1E9VA 4X1KA 4KXXA 4QGHA 4EIWA 1AU9A 2REQA 2C8VA 2JFZA 4JYZA 1J0DA 1XMSA 1NA5A 3OZCA 1YGPA 2KMLA 3EFOA 4YP0A 4A6XA 4C3VA 1YASA 4UQOA 4AJNA 4RTLA 2CV2A 5ALIA 1GL6A 1RI4A 3QEJA 1K6XA 1T4BA 1ATIA 2ECQA 1ZD2P 3IMGA 5EUBA 4JBYA 1JX6A 2O05A 2YN4A 1ZU4A 5LU8A 2ONCA 3GAZA 5CW2A 4FD3A 5I4CA 2ZUDA 4HLCA 1UJ6A 1KKUA 2E55A 2D6FA 1UDXA 3CVOA 3PGKA 1L5YA 5T4EA 1DWUA 1R9MA 4WBNB 3LUHA 5G02A 4ETMA 2NSDA 4IMRA 4KRXA 3H2KA 2OL4A 3IILA 1GZ3A 2FZWA 1DKOA 1E1RA 1QV7A 1RKQA 1U0FA 1K6JA 3EHEA 4JQCA 1OMOA 4D3SA 3E82A 4IS3A 5ILGA 4XM2A 3LTNC 2HQSA 2DHEA 3EARA 4C9BA 5LQSA 4LECA 2Z8ZA 1N6RA 1NYQA 2VZEA 4U6QA 4G01B 1RWXA 3MGBA 4W9NC 1EX1A 1T5HX 2DU8A 2UVPA 4IM7A 2CNOA 2ZJZA 3CMMA 3W5HA 4P58A 3MEQA 1ZCZA 2IYTA 3PUKA 4JVOA 4PG5A 4RU1A 4TTJA 4BNJA 4UD2A 2XH8A 4Z1MD 1B8PA 3HA2A 2A88A 5TX7A 3TLGA 1NDHA 1OFGA 2Q6OA 4DV4B 5F1KA 2VP3A 3I30X 3GVCA 4US1R 3U40A 1YHZA 3E8MA 2WKSA 2MOKA 3JQBC 3W8FA 1N5RA 1CJMA 5H0IA 5JCXA 1OGJA 2BR3A 1JFLA 3JS5A 1T0JB 3U26A 5LP6B 2PWAA 4KL8S 5EXXA 5T4FA 4EITA 4GD3Q 1I01A 1QHHA 3UWPA 3KKZA 2F67A 3ABOB 5KSOA 1Y9JA 3E9NA 2GCOA 3TJRA 2PZGA 4K6KA 4YY3B 1HZZA 3I6IA 3FBWA 3RV4A 1DTSA 2NNWB 5C8ZA 1SVMA 4FYIA 4LG1A 2IZ5A 3M4ZA 4IDAA 3FYUC 2JAHA 3UBTA 1EUQA 3JPWA 4JJZA 1SBQA 3SKYA 4R6WA 5AKJA 4O0MA 1EFDN 1JLLB 1OILA 3BWYA 1XE3A 1AS0A 4RA9B 5FTKA 3IV6A 1NQOA 2PXHA 1L5NA 3ONDA 2ZWIA 1NF2A 3NVKI 4N3GA 4B34A 5EKDA 1N5OX 3JQ9A 1QYCA 1Z74A 3I6ZA 3A4VA 2VH1A 2DBVO 3AETA 2DFDA 2V0NA 1NP6A 4YJ3A 3SHQA 3JQ9C 4RPCA 3LH5A 5G2OA 1T4CA 3G2OA 1B6GA 4LHEA 4ZODA 3RTEA 5CA1A 4EKIA 3CBQA 4FWBA 1M10A 1KBQA 4N5NA 4AXXA 5HDQA 3HXQA 3NTQA 3H9CA 3C97A 1N6PA 3LDHA 3IXLA 3ZQJA 5AK3A 1RHUA 3HCDA 4I81A 4LY0A 5ALUA 2WZBA 2UYQA 1G9SA 4RO0A 4XB2A 5GOZA 3RU2A 3CRQA 5C80A 1QH1A 2FUNB 2V74B 2XTNA 3OX3A 4IIBA 1T1EA 2Y76A 3QVSA 1A5SB 3T99A 1EFPB 4E1BA 8MHTA 1QP0A 3RF6A 4M7RA 1K4MA 1I4WA 3AJ8A 4R4JA 3NHFA 5BPHA 4PCUA 5BYJA 5M2QA 1BU5A 1WDLA 3MTBA 4PSUA 1P19A 3TQTA 4ZV9A 2P9HA 2J0UB 1Y3FE 3UB4A 4HLDA 5A4AA 1FXSA 1CSEE 4I2VA 1WJGA 4LCBA 5JWHA 4B82A 3VR5D 2J9RA 4LYGA 5CRIA 2YBEA 4FZRA 1YKFA 4QG7A 2BGMA 3C3DA 3TJMA 2FX3A 1AUXA 1CNMA 2VXCA 1HMYA 5FR1A 1V3UA 5I9LA 2OVBA 4MW4A 3S68A 4DRXA 3ZWMA 4GWGA 2CJWB 1K27A 3L7JA 3RGWS 3RF7A 3HG7A 2GOYA 3ZKWB 1MA3A 4KRGA 4MUNA 1YZLA 2BHRA 2X7HA 4RJKA 1JR2A 2WAXA 5JG7A 2PZMA 3COVA 2BEWA 3N5KA 4D82A 3AOEA 2LGJA 2QR2A 3OWHA 4GMHA 4WVLA 1B4DA 1UKYA 2BZ0A 3VH1A 1V95A 4BS9A 3Q8XB 3DSRA 1KZ7B 3AOEC 5C5DA 1PZHA 2EIHA 3KKQA 5CLLA 3EGXA 4FEYA 4KK3A 3ZZUA 1VLQA 3WIOA 2V4MA 3VYWA 5ALNA 8GPBA 3HWX1 5GJBA 5HJ7A 4F6RA 2PJUA 1LK0A 4BFVA 1BH6A 1ZXXA 2J3KA 2IUYA 8AT1A 3ADCA 4CLOA 2H2DA 1M33A 3IP6A 2E49A 2ORED 2GJ9A 4DILA 3KBBA 4TS4A 4I9NA 2GZ1A 4JVLA 3U31A 2Y93A 3W9UA 1MNAA 4AFNA 5DULA 4RTMA 1IWPB 2R00C 4EK9A 4DA0A 2VPWA 1XLWA 5H80A 2QY6A 2O8NA 4FBGA 3VC2A 3WOVA 1E9RA 1JHRA 4BEJA 3LKBA 2XPCA 4ACBA 2Y1EA 4E09A 1C4WA 3CWCA 1PU2A 3HUFA 4GKAA 4WLNA 5KYXA 5JJIA 1AXGA 1FNDA 4ASUD 2WD7A 3T7EA 3GA7A 4PWYA 1E1LA 1ZXBA 1CS0B 1UBKS 4PIMA 5KNLA 1V5GA 1G4UR 1U1EA 4ZQFA 3FYSA 1URPA 4QYSA 1N6LA 3H99A 1ZMRA 2O2HA 5AM1A 3SI7A 3VHXA 3C3EA 3IL2A 5DP2A 2P5YA 1YHYA 4B6EA 4M7WA 5DGTA 1KARA 2Q8QA 3IAFA 3EZFA 2IQ5A 1J0BA 5K3AA 1CR0A 3LQFA 4M0FA 3KYIB 1LS1A 1RQNA 3HO8A 3GDFA 5DYNA 1AMNA 4G0QA 3COSA 5CM8B 5ALFA 1OYVA 2GEUA 4BB9A 2HA4A 4PZCA 1ACLA 4U2CA 1AIPA 1CYDA 4GW3A 3MGKA 3P5SA 1QGYA 2NWQA 3MFYA 4P35A 2C1ZA 4L0DA 5E9WA 4V3BA 1KC1A 4E08A 1EP3B 3BMQA 3J80A 2HMTA 3RADC 1F2UB 4DPMA 2DUNA 2HX1A 2J08A 4L15A 4N5DA 4A82A 3A4MA 5ALXA 1CE8A 1ZBDA 2O3SA 4J0EA 1RZ3A 2OO5C 1NM5A 3FUCA 4DEVA 3PNQA 3JZMA 4ZVTA 2OZLA 3QPAA 1DJLA 1PCXA 2AJBA 2QWXA 3II6X 4ENVA 4ZVMA 1XK6A 5IM4F 4QXPA 2RI0A 4QHSA 1O6FA 1ECCA 5ADHA 2V3WA 4U7PB 3HCWA 4P98A 4Y2HA 4WNYA 4YA6A 5BYBA 4N1AA 3HN2A 4PX3A 3IR7A 1JFFA 3NORA 2OAP1 4AZTA 2C99A 2FV8A 2PFKA 1X1DA 2HSZA 2CLFB 2DXIA 3UHPA 4BY9E 1N2ZA 4KR3A 3ABRB 4LJ9A 3H8WA 3TNLA 3FUTA 1A9XB 4I99A 3GJ4A 1PBTA 4R2HA 3SQLA 1IY0A 2ZPTX 4CM5A 2NV6A 5DX0A 3C5EA 3DWFA 2HHJA 4ROTA 4OU4A 5GM2A 1GAEO 3IIJA 2PKEA 5FI3A 4ARCA 4U8HA 3LYLA 1T8PA 2CLIB 1K6IA 1YRHA 3LP6A 1JLRA 2RKWA 4IGFA 4U2GA 5AW1A 4LXYA 3SGLA 1JDTA 4JB8A 1XLTC 4GPEA 4W7HA 4DABA 1FJ2A 1X2BA 4R2MA 4J0FA 3NLLA 4Y2PA 1NYRA 4POOA 5JATA 2VOJA 3EA0A 4P4NA 3QG1A 1Y81A 1UM9A 3U7QB 4K05A 4FFVA 1N0VC 2VRWA 3MWJA 1LTQA 3BXEA 3RYFA 4DCVA 1NL3A 1E59A 1Q22A 3BL8A 4ZT7A 3TNYA 1GFSA 1AN0A 3RFTA 1OHHA 2HV8A 4ZDIA 1TW3A 1QB8A 2QX4A 4TXLA 4FFOA 3L0CA 1HEIA 3PE4A 4LGMA 4BJ5A 5FFNA 4B80A 3TE6A 3FNQA 4R9NA 1XRJA 2H1OA 4YMVA 1MVLA 1Z08A 1ZL0A 1KK0A 2OSBA 1RI5A 4IIVA 1I13A 5CB8A 4XGNA 5KIAA 1AUVA 1Q7CA 3H04A 2BMWA 3GT7A 1WCIA 2Y1KA 3KWMA 4UZSA 3OUZA 4ENRA 2V7BA 3OF5A 1EK5A 1G42A 3I1IA 5E6SB 1N8TA 1QYVA 3BD8A 3AZQA 3OCCA 4GI5A 3RVQA 3FPAA 1CEYA 3VR6H 2W6QA 2W4QA 3HEBA 2P4UA 5F78A 1H66A 3F8WA 3KDSE 3KVVA 1PNTA 1EVZA 3GXOA 3ML1A 5FUXA 3O38A 4K0KB 3L4BC 4A7PA 3PEFA 2BGJA 4TVKA 1KMCA 1P2DA 2V9ZA 2HU8A 4IJUA 1GQQA 4MUJA 3WK5A 2IPXA 3H5NA 1XEXA 2PAFA 2WJGA 2NUAA 2B7CA 3JQGA 4UTVA 1UQUA 1AKEA 1N5LA 4ERNA 1XQ1A 4QPJC 1LVHA 5BWLA 3JQDA 4X20A 3RHSA 4L0MA 4YCLA 3CVUA 4ESEA 1N3YA 2QP9X 3BCHA 4GPAA 1DFHA 3BOSA 2R2AA 5COQA 2AXPA 4CG3A 4B33A 1YCHA 2WZQA 3BGIA 3DOHA 3EY4A 2FEKA 1O4WA 3LBYA 1C9JA 4GOLD 1NJFA 3L0IB 4LXIA 4Q4AA 2GN2A 4AUEA 3MOSA 4RK0A 3TLYA 4D9GA 4LVCA 1BHO1 1J1IA 1VKRA 1XROA 2ASVA 2GM9A 4MLCA 2HRBA 2G9NA 4RMIA 1DAFA 2ZR9A 4HNGA 3QEMB 1ZOSA 3HE3A 4TTQA 5IAJA 3WLFA 2C96A 4GMKA 4R0VA 4ITVA 2ZYGA 4RAQA 2QT9A 3ZTTA 3QBVA 2Y67A 4L5CA 4D9MA 4X1IB 4TTPA 1WDTA 2W6JA 1JWAB 2IXBA 3KR1A 3QFRA 3QV1A 3TAHA 5CDFA 3UQZA 2RHRA 3AEUA 4EG1A 2PN1A 3DMNA 5B3LA 4IYRA 1QGAA 2Q7XA 4N0MA 5IXYA 1EHCA 4IV0A 3HFJA 1L4GA 3DO6A 3F1LA 4H18A 3QVGA 1NUUA 1VPLA 2GGSA 3L8ZA 4RDIA 3FYHA 2O2IA 4MVJI 3S1LA 2GXAA 2HSWA 2C7VA 4XX0B 5T6MA 2Z1DA 2Y6VA 3WHIA 3IIMA 3EZ7A 2VPPA 1E7QA 2ID8A 3ZNPA 1N6HA 2A0YA 1J2UA 1JI0A 1W2WB 4RVUA 5LDHA 2EC5A 3NXSA 2I1LA 4Y2VA 3W77A 4EWLA 2DEUA 1GL9B 4EX7A 1TVKB 1M34E 1Q84A 4HADA 2ZI5A 4B47A 4L9WA 5G1NA 5K45A 4OQXA 5KVQA 3V9PA 5ERXA 4WE3A 3GEIA 1C7FA 4ETWA 1EXVA 3Q1LA 5E9AA 4HN9A 4R9UC 5K05A 5IVDA 3QE2A 4RV4A 4XLLA 4R1MA 5EKSA 4MGEA 2C3UA 3OZWA 4FFBB 1CQXA 5BSHA 4GR9A 5FH9A 3RAFC 3QKTA 1PDVA 4CQLB 2JATA 5G0TA 4ND5A 4DCPA 3RKUA 3O4JA 3LLUA 1MQAA 1GG2A 4BMPB 1AGPA 3G0OA 5B1IA 2I2BA 3PC6A 3GHYA 4A73A 3F6BX 1C1DA 5I9IA 2JH8A 3UJ3X 2DSTA 5BY2A 4DR4B 4CEHA 5MFPA 3ZBUA 1GWNA 1Z06A 4OI1A 1XTKA 2BONA 5DNDA 2CUKA 3PHGA 4D3YA 5A9SB 3KJXA 5B58C 1Y5RA 3GCGA 3NO4A 2H4JA 4PRYA 4RHTA 1BEEA 3ROMA 4B31A 4B43A 4EJFA 1YB4A 4PQYA 4WACA 5LOVA 2E7ZA 2J4DA 4F8YA 3DUWA 5FQOA 1JG3A 5K3DA 3GV0A 5IMBA 1M2OB 2DQYA 3LKZA 2H1HA 2VCEA 2Q4RA 4X3CA 3AJRA 3E3LA 5DIZA 5HZMA 2VHYA 3KZCA 3CZAA 3H4TA 2UZ1B 4TQGA 5DLDA 3UH1A 4YRZA 2F8SA 3ZC3A 1W93A 2M6RA 3P4YA 4LVUA 4M8LA 2V6FA 3DYVA 1P2FA 3T38A 4CF4A 2J07A 4DIKA 1MORA 2AKYA 3JD3A 3RBVA 5DGCA 3N07A 3I9NA 4UVEA 3E9YA 4S3MA 2ATEA 4MDYA 1ORWA 4IR7A 3FWNA 4MR8A 3KYDA 4BQFA 3AVVA 1NATA 3MJSA 3ZDZB 3QVXA 2FLWA 5FEMA 1R9JA 2X2EA 1TCAA 1DZIA 2VZLA 1JG7A 4N18A 4CXMA 3B9PA 2NYAA 4O4IF 4PYQA 2I3GA 3QFFA 4BECA 1CF2O 3JAWB 3AQIA 3CLUD 1KFCB 1POWA 3FPHA 2Y1LA 1SG0A 1A88A 1JZTA 4BO2A 5D3ZA 5IC4A 1MZPA 1QYXA 3LF1A 2Z09A 5D7BA 5TPZD 4PYJA 3A2KA 4V24A 3ESDA 1O4VA 5T6BA 2ZT7A 1IWBB 3IIEA 1FUEA 4K3UA 2ZSFA 4MQEB 3ZDEA 1D03A 1TK3A 2B7BA 4L08A 2ZSEA 4YPOA 3GT3A 5HPYB 2P65A 3K32A 4JC4A 1X92A 4OAOA 1GDHA 3H4VA 1TI7A 5SYMA 1I7SB 3BKXA 5K6AC 5EIBC 3LG2A 1QTQA 3R5SA 1KH1A 5KYUB 3G2MA 1TMGE 1NP3A 3AFIA 2OB1A 3W04A 2DFTA 4IY1A 4RD4A 5EQTA 2E1RA 1N5KA 4Q9AA 1EFTA 2VYQA 1VL6A 2O2CA 2QGFA 4HAXA 1H2YA 2R8BA 2UYOA 4X24A 5ALEA 3U3OA 4ARVA 4WJKB 3F4LA 4K9NA 1ZM9A 1MUUA 4B73A 4C06A 2GVZC 2OBMA 1EGHA 3OPNA 2ZCJA 1JQJC 4MS4A 4CMGA 4MUBA 2EFHB 1KEEA 3N7TA 3QUQA 5F12A 1RR6A 4N9QA 4ZCQA 1JEOA 3PP8A 4JJIA 3STTA 2XMZA 4PRLA 5F64A 1B23P 1AE1A 3PD0A 1K89A 3HSYA 1SOVA 4NVRA 2HIAA 4CL0A 1UZAA 1FDOA 1YI0A 5A6SA 3FKSD 1TEZA 4KWIA 4C78A 4Q1BA 2QXTA 1W85B 3EVFA 3AUTA 3W6UA 4QDKA 4RESA 5CLQA 1I5EA 3UIEA 2JL1A 5LB4A 1K06A 5IEBA 3H0CA 2PBZA 3QP9A 4ZYXA 5KYWA 3HYSA 3T06B 2OG1A 2CBGA 3SZMA 2KHZA 4I46A 2UZ4A 2AFIE 3F8TA 3OIVA