2NSYA

Crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis in complex with nad-adenylate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
271
structure length
271
Chain Sequence
SMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords PROTEIN (NAD SYNTHETASE)
publication title A novel deamido-NAD+-binding site revealed by the trapped NAD-adenylate intermediate in the NAD+ synthetase structure.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 105
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2nsyA00
1OWPA 1G8HA 4ARIA 1NP7A 3COWA 4K03A 2A1TR 2R5WA 4MVXA 1K4KA 2VTBA 4A91A 2DPLA 1X8XA 4QRDA 4EG7A 1N2IA 4RUKA 3KT8A 4BWVA 2PG3A 4OUDA 4P2BA 3L93A 1M8PA 3Q12A 1EE1A 1GZUA 1T6YA 2QUJA 4TS1A 2YWCA 1F4LA 4AS1A 4JYZA 1KKUA 2CV1A 1P7PA 1KQNA 1XNGA 1PFWA 5J5AA 2VXOA 3PXUA 1KAMA 3SZ3A 4YP6A 4CDMA 1EFVB 1FFYA 3HL4A 1VBMA 3ZXIA 3ZJVA 1GTSA 4U8HA 1LW7A 4KPUB 2Z3VA 3IVGA 1XNHA 3DV2A 1TYCA 3A2KA 4S1OA 3QTTA 5LLTA 1SURA 1QTQA 3FNRA 1PFVA 4CT0A 2IJGX 4X0EA 1M8GA 1EUYA 3INNA 4ZT4A 1UFVA 3N8HA 1K92A 2BYTA 3KFLA 2J4DA 3CLUD 3TNJA 1MRZA 3UK2A 4JXZA 4HPWA 1OWLA 2V0GA 4R2LA 2X1LA 1XJQA 1MB2A 4NATA 3RHSA 4U63A 1M83A 3CA8A 2CFOA 2GM3A 3TS1A 4EG5A 3ZJTA 2J08A 2QJFA 1KR2A 2CV2A 1ZUNA 1QU2A 4DNXA 2Z09A 3HGMA 1Q15A 2PZ8A 4EG6A 2A86A 2NSYA 1JIIA 3P0JA 4MULA 4MW5A 1VBNA 1DNPA 4ZT7A 2A4MA 3LCJA 2PXHA 5J58A 1NI5A 1O94D 4ZT6A 4KR9A 1T9GR 4J76A 2AZXA 3FH0A 4MAFA 3CVXA 2XRYA 4XFJA 1PG2A 3CLUC 3SEZA 1A8HA 1IRXA 1EFVA 3UMVA 4ARCA 3AFHA 2DXIA 3MMXA 1RQGA 3K9WA 4YP5A 1N2GA 4HJRA 1PG0A 1WKBA 1V8FA 1X6VA 1NUSA 3D6VA 3HV0A 4I6GA 1Y42X 4CQNA 1TYAE 4EG8A 1KP3A 3N2YA 3X1KA 1OD6A 4KPUA 2X1MA 4FZJA 1GPMA 3H9BA 4Q93A 3RBAA 3CVVA 2CUZA 3M5WA 1OBHA 1OWMA 1MJHA 1T6XA 4GRIA 1EFPA 4NZPA 3GMIA 3RK0A 1VBKA 1T6ZA 1XNJA 3A4IA 3CLRD 1D2RA 1JEEA 2DERA 4MUNA 3UOWA 3FG9A 2JANA 1KAQA 3CLSD 4G5FA 4UZFA 1O94C 3A05A 4EFKA 1Q11A 3COVA 2GOYA 1BS2A 5DK4A 5H16A 1J1ZA 3AG6A 4Q16A 3RK1A 1M8KA 3MXTA 4JFAA 4JXXA 4ZCPA 1Q19A 2J09A 5IJXA 1KP2A 1M8FA 2AG6A 3ZGZA 3BL5A 1M8JA 1IFXA 2A84A 1ZH0A 2C5SA 1NUQA 1JZQA 1K4MA 1MC1A 2A1UB 3P0IA 5KCMA 1O96B 5K0TA 1PFUA 3P0HA 1MOPA 2WQ6A 4F4HA 2YXNA 2GKSA 3IUEA 5AHWA 1VLHA 1YULA 4DE5A 2QTMA 4MUIA 1TQ8A 1N2HA 4DDHA 3IVCA 4MUKA 2CYCA 3CLRC 1NUUA 1R6UA 2A7XA 5TEWA 3KT0A 4EG1A 3CLSC 5H7XA 5TEVA 4NX2A 3ND7A 2CYAA 1KQPA 4KKVA 1O0CA 3U1VA 2EL7A 1KH1A 1Q77A 3SEQA 3MLAA 1S4MA 2D54A 4MVYA 2WSIA 2YY5A 3AL0C 3F3MA 3ND6A 4I6EA 5J59A 2ZUFA 3FIUA 4ND7A 1O0BA 5LM3A 2D5BA 1N2JA 2HGZA 2Z08A 2IP1A 1J70A 1NZJA 4MWEA 4R2MA 2OV4A 4ZCSA 1N2EA 3H97A 1EUQA 1WJGA 1N1DA 2JAXA 4HJXA 3SP1A 4MW9A 2RD2A 3FDXA 3S3TA 3L92A 1NURA 5F23A 3HZRA 2WQ7A 3FI0A 3H05A 2O5RA 3G6KA 2PZBA 1N78A 3CR8A 3AIIA 4EG4A 3VU8A 3MLBA 1LI5A 2RE8A 1QU3A 1YUMA 3A04A 3KT6A 2ZP1A 3CLTD 2B7LA 1U0BB 3SZGA 4KR6A 3ZIUA 4MWDA 2A1UA 3ZUGA 1O96A 4EG3A 5IHXA 4MW2A 4MQ6A 3IOCA 3FETA 2E0IA 2EJCA 2A1TS 3TQOA 3LOQA 4ND6A 2VTBB 3HMQA 3COZA 3N05A 3PRHA 3E27A 5HG0A 4OJMX 3KT3A 3IUBA 3NBAA 1I6KA 1U3CA 4MUGA 4DLPA 1NUPA 4I6JA 4ZT2A 3TZEA 1J21A 3JXEA 5DASA 4MW6A 5HUHA 3ELBA 1YIAA 3NBKA 3PNBA 2CT8A 4CDNA 1WZ2A 1CT9A 3CLTC 1JILA 2QJOA 4ZCRA 2HMAA 2DUMA 1K97A 3DPIA 5BNZA 1U7DA 5JBNA 2H29A 2X3FA 3ZJUA 4PBRA 4WSOA 2J5BA 4ZT3A 2D13A 2CSXA 2ZUEA 4MWBA 4MUFA 1HYBA 2JA2A 2X0KA 3FHJA 1G59A 1V47A 2CV0A 3N9IA 2QUKA 1TFUA 4G5YA 3X1MA 4DDMA 1TYBE 4YP7A 1ILEA 1MAUA 4YBRA 1LI7A 5DEOA 1OBCA 3GLVA 3OP1A 2WB2A 1WQ3A 3IMEA 4XFDA 4ZCTA 1NYLA 2PZAA 1YUNA 2CYBA 3LE8A 1JGTA 3QE4A 1ZH6A 2XRZA 1R6XA 3H9CA 1GAXA 3CVUA 3D6UA 3G5AA 1WXEA 1KH2A 2QUHA 3DO8A 4MWCA 4NAUA 2PFSA 2E21A 3IOEA 5EKDA 4E1AA 1J1UA 2O8VA 4JZYA 1WXHA 1G8GA 2H2AA 5FO1A 1WXFA 2E18A 3IOBA 4U7JA 1H1TA 3COYA 1O95D 1NUTA 3Q4GA 1JIJA 4DDKA 1EJ2A 3FWKA 1T9GS 4DJAA 2QUIA 3SYTA 1QQTA 1F7VA 4L2IB 4QREA 1COZA 3UY4A 1QJCA 2V0CA 4XSVA 3ILVA 1WY5A 1JZSA 2BTEA 2QTNA 4PBTA 1KORA 1WXGA 2QTRA 3AKZA 2DEUA 3H99A 5FNZA 3QTBA 2QJTA 1I2DA 1ULHA 3FY4A 1MAWA 5KHAA 3IDFA 2DR2A 4F3RA 4MVCA 1O6BA 4G6ZA 4R0NA 4MW0A 1IVSA 3PNYA 3CVYA 2DLCX 1TEZA 1N77A 1H3FA 1EFPB 1FYDA 1YI8A 1I6LA 5K0SA 1IH8A 3X1JA 2YWBA 1O95C 4EF6A 1VL2A 3FOCA 3CVWA 2PIDA 2G36A 3SDBA 3K32A 4MVWA 4KR7A 1IQUA 4NAHA 1WQ4A 3P52A 1IHOA 4K0RA 3PNVA 5KWVA 2E89A 3ISJA 3TQIA 4WNYA 3IH5A 4HK4A 4GU5A 1IQ0A 1IQRA 1JHDA 1R6TA 1QRUA 1OWOA 4EGAA 5DB4A 2IELA 3ND5A 1EXDA 5LFAA 1O97D 2A88A 4OUDB 1QNFA 1U7XA 4QBTA 3RJZA 1JECA 1N2OA 5TS2A 4UZEA 1U3DA 2DETA 2J07A 3I05A 1MB9A 4MLPA 4MUHA 4MUJA 3ZXSA 1J09A 2NZ2A 1KQOA 3TZLA 1J20A 1F7UA 2TS1A 1N3LA 1B6TA 3MUEA 4L2IA 3IMGA 1WOYA 1TYDE 1WXIA 1F9AA 3RFFA 4ZT5A 2AKEA 3DLAA 1PFYA 1GTRA 4MW7A 4RPIA 5HUJA 1GN8A 4MW1A 4H3SA 1NSYA 4MUEA 3VRHA 1M1ZA 1H3EA 1OWNA 1N2BA 1QRTA 3IVXA 3G59A 4J75A 3UC5A 1JIKA 2HZ7A 1I6MA 1H3NA 4AQ7A 1JMVA 1KH3A 1O97C 1YIDA 3Q10A 3NV7A 3C8ZA 4YMIA 3VGJA 1G8FA 4PBSA 3HFJA 1ZJWA 2OQ2A 2I1LA 1N75A 3OTWA 1MBZA 4ZCQA 1GLNA 3AG5A 1QRSA 4NDAA 3GUZA 1JEDA 4PY2A 1O5TA 5TGTA 5FO0A 3IODA 3IMCA 4MW4A
chains in the Genus database with same CATH superfamily
1GR1A 1M33A 1YB6A 2NV2B 5EWMA 1QGED 3G0GA 4K03A 3DQZA 1O6CA 4UDXX 1DFIA 1JAXA 3KQWA 4UC0A 1NYQA 4Z3KA 3GLIB 4KX5A 1MXFA 3EFOB 3IDSA 1KFCB 3E61A 2Z0MA 1UBEA 3KJXA 1DG9A 3OKAA 5CFQA 5EJ4A 5IT5A 2BMDA 3TB4A 4RNCA 3NYQA 3ZNQA 1EGVB 4P2BA 1CY0A 1OZGA 2I62A 2VQ6A 4K9LA 1MT3A 1L7AA 1LW6E 1BDMA 1OLSA 2X1VA 3OT4A 4HNAB 4Z9BA 1R8QA 1EGHA 1PT9A 1UKCA 5KAPA 4CM7A 1QP7A 4YJ2B 5A0FA 5J1TB 3QJYA 1ZMTA 1XUOA 3K2EA 3O3MB 3WTCA 1KKUA 4R3UC 1W2GA 2DYKA 3AC0A 1R15A 3SR3A 2VRNA 3T4XA 1PV4A 1DEOA 5DLYA 1XR3A 2J46A 1CBUA 2WYHA 3LK7A 4TROA 3U0BA 3PXUA 4M89A 4DJDC 1UDXA 3LL4A 3QEJA 3A1VA 2JAQA 3G2KA 3AVXA 4RGBA 2GTIA 4OXXA 5EXXA 1GTSA 3ZD8A 2C2HA 1NSFA 2ZANA 3VKHA 4DSUA 2CJWB 3W04A 1LS6A 2HSZA 3R0IA 4G36A 1EFCA 4LHXA 2G06A 1CUUA 1U2GA 2WYWA 1SZCA 2I87A 1M2KA 4OLJA 3EJ6A 2GVZC 1E6WA 3R5TA 1EWYA 1AKMA 3WGTA 4QHSA 1L1FA 1Z0SA 2P6PA 3TI7A 1YS9A 3JWEA 3KR2A 1EKXA 2NXEA 1ZGGA 3IP7A 4XD7A 3E3LA 4EUFA 3JQCA 4LF7B 3ZCPA 1VPLA 3P4XA 3ZX5A 5B58C 2C04A 1D2MA 4AURA 2P3OA 1IVNA 1OXXK 4DG8A 4E2FA 2CCKA 4EA6A 4OK3A 4OBBA 4CM9A 1PU2A 4AQDA 1FX0A 3DUWA 2DQ4A 2I7VA 5C37A 2YINC 4GKJB 2D8AA 3IXMA 4CV0A 4ZIRA 1SBHA 2KQUA 3VSCA 2UUAB 2CLSA 1IN6A 2PNJA 2WMNB 3DULA 5E2IA 5A6SA 1RVV1 2D4AA 2HU7A 2WLTA 3JR7A 4Q1FA 3S40A 5CXSA 1WSWA 3P32A 5EMKA 5AVXA 2W6OA 4Y2QA 3JWHA 1C9KA 2AN3A 4FGJA 2BFWA 2W6CX 3PQCA 3D7MA 1C4OA 1HRKA 3DFMA 1LPAB 3C6BA 3W5SA 3BDVA 4MHSA 3V7UA 3WRYA 3VZRA 3I58A 4G5RA 3PITA 1L8XA 1OXVA 2VCHA 4ZQFA 3WRXA 2Y9MB 4CKXA 3K05A 4HB3A 3EOZA 2EWWA 1DNPA 1A69A 3UKDA 4LF9B 3O82A 5IJWA 3I9V6 5FQNA 4FEGA 4ETWA 4BEJA 3COJA 1GTMA 3QXHA 3O8OB 4ZREA 1UWCA 2XSZA 3K1ZA 4P8RA 4ZC1A 3DHVA 4NZZA 1GILA 2GD0A 3JSXA 2MWMA 3B3QA 1ONBA 4B7UA 5KB3A 1LJUA 1NR1A 2ZJ8A 2AE1A 4DNFA 3GZTB 3OPQA 4BWFB 2IPXA 3IBGA 1HNWB 1HZJA 4CTNA 3KS9A 4A0SA 4R8VA 3N2YA 1NRIA 1A4RA 4G85A 4MMYB 2WLSA 1MU0A 3LC2O 2FUCA 5F4ZA 4DIKA 2HMYB 3BWBA 4HWSA 4P35A 3ZPXA 3B60A 1EM6A 3EDMA 3STTA 3WJAA 4AY5A 4FOTA 1EUCA 1OWMA 1Z0UA 4OAPA 4WKBA 1KC3A 2LXNA 3PC6A 4C1BA 4CKWA 1OT3A 1UMCA 1GPJA 3WO0A 5SZHB 5BSGA 2PUHA 3M5CA 1ACJA 4HMOA 1W5BA 2Q3EA 1XVLA 2ZBPA 2IXBA 2DERA 1S1CA 3BBPA 4N3GA 3WGGA 2J8ZA 4NE9A 1BA2A 3N5KA 3RS7A 4G0OA 3VPHA 3ZIAA 1PSWA 5KJ1A 4RA6A 2F9FA 1EP2B 4IH1A 4RGVA 5DLQC 2OOKA 1C80A 2R7MA 1JSCA 2XUJA 4JHLA 4LKOA 3UB3A 2P9BA 3ZK8A 3ZDQA 4R16A 2ONCA 4NMMA 2Q4TA 5HBGA 2K2QB 3GVXA 1BN7A 1ZL2A 2O0KA 3B53X 4G0YA 3WDSA 4XWOA 1Q19A 2BGRA 3FSJX 1NJGA 3MHPA 3G7UA 3O4HA 4RLSA 4HAIA 3RREA 3ZHVA 2PT7A 2Y1CA 3BL5A 5JAPA 2WJYA 2Y1KA 3LRXA 1BCSB 5L95A 5AICA 1O6GA 2V65A 1H9BA 1U11A 2OCAA 3LXUX 1OC4A 4MV0A 1Z06A 3PRYA 1NVXQ 3LQ2A 4HDMA 3AKEA 4F3YA 1YB4A 1SKQA 3ZBPA 3BHMA 1NBIA 1QANA 1FDRA 4LWQA 4AS2A 1F38A 2NO6A 1SQ6A 3KUXA 1BXGB 2XQVA 3Q88A 4MUIA 1N2HA 1E1CA 2VAPA 1WB9A 1N36B 2R8ZA 1Q7TA 1N3YA 3IVCA 4RTKA 1RXWA 2WM2A 3HUUA 4MR8B 1GZ4A 4QVKA 2CCJA 2XD4A 4HAOA 5JS6A 2PRJA 4EMTA 1UK8A 2QX6A 3KT0A 3PKZA 4JBGA 2AKAB 3Q1LA 4M1WA 5G1PA 5H9WA 1NX6A 1N1GA 1NF3A 2E4AA 3G17A 4CQLB 2OCIA 2IWRA 5KINB 2X6TA 4BO4A 3NHBA 3FDFA 4K28A 4P4GA 5COQA 4AMBA 2VH5R 2YXPX 4BE4A 3UMYA 3IAHA 1MH9A 1RKVA 2RIPA 2Z2KA 2F6RA 3WADA 4A8JC 3HWWA 1M66A 3MLAA 4G5SA 2X19A 4D3DA 1Q0LA 1NVMB 3WSTA 1T2CA 3F5SA 3H19A 4F9FA 5LD2B 4II7A 1VSQA 4MRMA 3RG2A 3U62A 2VUIB 2OL4A 2C8JA 1Y98A 1Y4UA 4ND7A 2IT1A 1VJTA 1PWHA 3AFMA 3GFRA 1Y6JA 4LECA 4BQPA 3DMYA 1BDIA 1PJ4A 3D6HA 1DKRA 1S2MA 1SHTX 2GCPA 1CIJA 1K6IA 2EX1A 2IL1A 3SU8A 3QBVA 1QIEA 1II8B 3WMRA 4ENWA 4BVKA 1GGVA 1VFNA 2F62A 4O1HA 2QPAA 2Q41A 3CR8A 5CA1B 2F8TA 3FOEC 3CWZA 1R0KA 1LI5A 2FK7A 2AD5A 3QZUA 2HJ9A 4ND4A 5T41A 4G5HA 1M1UA 4PNPA 3U7QB 4HH0A 4YT5A 2KBFA 1SOUA 4LHVA 1N5KA 1X0XA 221PA 4J1QA 4HYTA 2I5PO 2JC3A 4UULA 3TRJA 3UBMA 2GILA 3NYWA 1B43A 3TGWA 1VXOA 1RRKA 2ZIGA 2C7OA 5FPSA 3W2FA 1U7OA 2A5YB 4PYRA 4TV9F 5JE8A 3M3DA 5DX0A 4NCAA 1CDDA 4Q48A 1K6MA 3RAJA 3TQOA 2E0IA 1JDUA 1GGFA 1Z4OA 2ZYRA 5EVCA 2CDBA 4CRWB 5T7BA 4MYDA 1R0CA 3GJXC 4G09A 4ER6A 3N0VA 1UBJS 2XR1A 5IC6A 3LG2A 3FWZA 1L7BA 5KDDA 3DH0A 1QQBA 3EEQA 4PZPA 2AQIA 2Y6VA 4E0BA 4ZVKA 4YHBA 2EZ9A 5GPBA 5EYPB 5DNCA 1DLJA 4IY1A 1OLSB 3K1JA 4IM7A 2QYTA 4DAEA 5AESA 4DM4A 5IBPA 3RIGA 4CFZA 1V4VA 4MPTA 3DGEC 4X94A 5DASA 3G8DA 2ZBQA 1NN1A 4V0SA 3C3AA 5CG2A 2AX4A 1KZ1A 3U16A 1IY1A 2G63A 3CEAA 1GZ5A 3HYLA 4HH4A 4MS4B 4C0XA 3GEHA 4PGFA 1P0MA 2O2IA 1E1DA 5FT9A 3PE3A 1JE0A 4R41A 5LBUA 2HRRA 4L5JA 1F20A 4PO8A 4BZXA 5EUQB 4UBKA 6YASA 4EP1A 2P41A 2UYCA 1MGPA 2IQ5A 1OCEA 3IQGX 1U7DA 1RPAA 3USES 4J91A 3HBNA 5BYKA 3TOZA 3ADBA 2RGUA 1UXOA 2W2KA 3RS2A 6ABPA 3LUHA 1TZJA 3FGOA 4U7HA 3BD6A 3VO2A 4MUFA 1FQJA 2Z95A 3V4LA 3V7NA 2EZ8A 1T5IA 1FDUA 2ZJ5A 4I9GA 4X45A 2VQEB 4KNYA 1IL0A 2DC1A 1N8NA 2Q0SA 3I9FA 3AIOA 4G07A 5DTJA 2YNMA 2Q28A 1F6WA 1FPQA 1LNSA 1QCDA 3EMKA 2YHBA 4OHBA 5EP1A 2BRUA 3X1MA 4BNWA 1JHXA 3AUYA 3Q1KA 4DR2B 3MHTA 2QTBA 1RWQA 1TYZA 1LF0A 1S4QA 1Y6RA 2HK9A 5DHQA 3RU2A 1FX0B 5TT1A 3VI4B 4A5OA 4Y1FA 4AN4A 4ZZ0A 1RWXA 1FQWA 3JATA 1MVNA 4GGMX 4UQOA 2IODA 4WE3A 4ZIRB 1QONA 4PLYA 2QLBA 3WLSA 3C3BA 2AEJA 3S1AA 3W3AD 3GRKA 1R8XA 4I3FA 1Z0JA 3DTVD 1XLTC 3JAWB 3PWKA 5FUWA 5A6SB 2FMTA 1TZ2A 2ZSUA 1KK3A 4U6QA 4MVJE 5GIOE 5CDYA 1PVDA 1YKGA 3O47A 4YJFA 1MNAA 1CF2O 3F4LA 1TIBA 2ISSD 2O2HA 3I2HA 1HOXA 1F9EA 1TF5A 3I01M 2WAYA 4IVPA 1WXHA 3VISA 2YH2A 5DBFA 3VNUA 3KRTA 1SOVA 3R09A 3GGDA 3Q7TA 1GPH1 1R0ZA 3S6JA 1CDZA 1HDCA 2PH5A 4H3HB 3ED1A 2PUFA 5EIFA 3QMMA 2R6ZA 3ZK7A 2MYNA 4E88A 2P6RA 4OO3A 4NEGA 4DLZA 2VFAA 4QXRA 3ZVMA 3E5HA 4CFYA 3B6KA 3QY0A 4TV9A 5ALQA 2NV6A 2BR5A 2JA1A 3FZGA 2ZIAA 4KVZA 4YAIA 3W6PA 2YMLA 3UY4A 4K9OA 2UVPB 1KY4A 2EEPA 3CZCA 2WTXA 3QPWA 1I4OA 2RMKA 4AIRA 1XRQA 3WWDA 1ULUA 2GM5A 3F1KA 1BNCA 3TVDA 4PZLA 5H8WA 1JDBB 4X8HA 5LWHA 1W36D 1KMQA 1ENZA 3TSCA 3GVPA 3OZXA 2H2WA 1EZ4A 3DE4X 4I3HA 2P68A 3QELB 3CBQA 3KB8A 2QLNA 2CXQA 3W6ZA 3BMQA 2HL6A 421PA 1A82A 5HMLA 2X5XA 1BHO1 2I33A 2ZAIA 4MVCA 1LD3A 4ILKA 4O02B 1ICIA 1IEQA 3GEEA 5CYPA 4E5SA 4EYKA 2F4VB 4CKWB 5GWXA 4MS3A 3U44B 1TEZA 4P84A 2VZ8A 4PG6A 4XQCA 1XB2A 3KZCA 1YI8A 4KN5A 3NHJA 5FI5A 4XQ0A 2P2LA 1C3OB 4LTDA 2VPYA 2ZVDA 3VZQA 5HVNA 5JCJA 3OLZA 3ZDXB 5FAXA 5K3FA 1XA3A 4BC0A 4UXJA 2Q4BA 3RASA 2OCXA 5IZCA 2X4GA 2BFEA 1QSGA 4D96A 4K9KA 4IKOA 4RA6B 3BT7A 3BC1A 3PDWA 4WZAA 1D1QA 3AW9A 4MUXA 1D6JA 1JYSA 3W77A 1UIRA 1DKOA 1AKQA 3OMXA 1PK8A 4D81A 4L7VA 1DBRA 4XIGS 2QTHA 2B1RA 3MNFA 1HE2A 1R6TA 1YCDA 4JU9A 5T4EA 3K2IA 1Z2PX 5DB4A 5FOWA 2GEDA 3LDHA 1NOKA 4RZXA 3CZRA 3NYRA 1TA9A 1Y7LA 3HYRA 2R62A 1IBRA 1XTJA 3EPPA 4RTOA 3VYTB 5LQKA 3CX8A 1NJSA 1H8HA 4JOBA 2J6HA 1DQRA 5JVDB 3SFVA 3THYB 2PLRA 1ZIYA 3F71A 1Y8AA 2PZKA 3KC2A 3DEIA 3RBZA 1Q6YA 4MNTA 5JC1A 4BOYA 2CLKB 4OKIA 2C9ZA 1KQOA 1U9JA 4IP0A 1L5FA 4LE0A 5FFMA 3LUPA 1N6IA 1XCMA 4G1EB 5KYUB 4C4OA 1XVAA 1QTRA 1T36B 1TJYA 3WISA 4II2A 1X94A 1XYVA 2CXOA 2PKEA 1GR0A 2WOOA 4JKIA 4PLTA 3A7EA 4EZEA 4IINA 4PXYA 5TMDA 2SCUA 3B6ZA 3KAQA 4RPIA 2GBGA 4GBJA 1PVVA 3R6TA 4Z9XA 1SIWA 5DM70 5ALTA 4X71A 2WRZA 5A2GA 3S7TA 1NQTA 5KHOC 1SXJC 1XFAA 5CXXA 3HB9A 4BFXA 4CJXA 1ZHHA 1OAOC 3T12A 2PUDA 3EW9A 3FMPB 2Y0PA 1UH5A 2DQZA 3IVXA 3OH8A 2LPMA 2IEBA 2PSHA 1RDFA 4HNTA 5IFKA 1PJTA 2BZGA 4KYTA 4MRMB 3O8DA 4CQMA 4CV3A 4TS9A 1AXEA 3KAJA 4Z4FA 3PVSA 4YMIA 5EHQA 4QPJC 2Q9CA 4K26A 3P2EA 5IH7A 1VCOA 4RF3A 1XXHE 1VSUA 3SZLA 1GLNA 1RI3A 2G76A 2XTNA 3B78A 1TJ5A 1NF9A 4RK1A 1JHYA 3VOTA 1PT6A 2RAPA 5IVDA 5A3RA 4GP7A 4I9HA 5TGTA 5G41A 3QE2A 3JQBA 2FSUA 3K9BA 1KE2A 4IVNA 1N5IA 1PR6A 5D51S 3FAZA 1GPAA 4MQEA 1JDVA 3COWA 3LHIA 3GCGA 5FTJA 1PP4A 3NAGA 4TTAA 3IHWA 4MV4A 4ZD6A 2ZRNA 3CC8A 4D3SA 1EXNA 2C2MA 2Q46A 2HBYA 3N2NA 1YZQA 3FZNA 4TXMA 3N2KA 4Q00A 4BLSA 4YK7A 2EP5A 3CF2A 3D2CA 4JB8A 4NF2A 4Q3KA 3C97A 1Y3IA 5IAKA 3ZDRA 4CIVA 4FOLA 1ZNYA 5CFOA 1L4NA 3CISA 2EBHX 3TJMA 1CULC 1KHHA 1SO8A 4QVGA 4TS1A 5FJJA 1T26A 2HCBA 3F78A 1DWPA 1U1DA 1ISHA 5E6SB 3BJMA 4DYHA 2G9RA 2R8EA 3ZJ4A 4FMCF 5L3SA 3HVUA 1A9ZA 1E1RD 1Q7GA 2NAPA 4BO2A 2BJHA 3LT0A 5E9JA 5AO9A 1JQ3A 1G17A 1FEZA 1FXWF 1G3UA 3W8RA 1JSLA 3IT0A 5FYQA 2HU5A 3EEYA 4HN9A 3P9IA 4ER3A 4F4UA 4BPBA 5JG7A 2ATVA 3KQSA 3H1FA 4K9SA 5JO9A 4BNVA 4BO7A 2VQDA 2QTVB 1E32A 5LOVF 2D1YA 3NTVA 4NYIR 1M1YA 2QL9A 4F4IA 3GFTA 1Q7RA 3UXEA 4KPUB 1Z35A 2OO5C 3R7LA 4RTQA 1XWIA 1NP6A 3L8CA 4PXSA 3UG7A 1F17A 4MUAA 3LW8A 4OHMA 1P2TA 2AJCA 3ILHA 2XDYA 3O4FA 1KZHA 4JASB 5BN3A 1YL5A 1OSNA 1OVMA 2FR8C 3TD2A 4ERXA 5K6AC 1TT5A 4D6XA 3FNRA 2QSJA 1JEYA 1G4HA 4C29A 3G8AA 3IB3A 1BG6A 1M34B 2V4UA 3EWSA 3INNA 1YQGA 3NH9A 4JODA 4EUEA 5JUWA 3KTOA 5K8TA 1P17A 4BMYA 5EXEA 4DWWA 2MSDB 3T5GA 2EJTA 2AN4A 3O1LA 3AVYA 1OWLA 3I0NA 2EJWA 2O7NA 4QOFA 4JROA 4U2EA 3BJEA 2AL7A 5LVAA 2JK0A 1IXKA 4MXDA 4J0KA 1ZKMA 5E9WA 1LH0A 3KQLA 3HO8A 2XTAA 4J1SA 3ZN2A 3PPXA 2CEAA 3BPSA 2I9KA 4JT8A 5FPQA 4E22A 2GJ4A 4EG5A 5JFTA 1OIVA 3A0RB 2CV2A 4Z3DA 1YMVA 3GRCA 3TQHA 2J3EA 3B1KA 1D1TA 3I0ZA 3I1FA 3ESZA 5JJLA 4UFOA 3ABIA 3ZHXA 3TRKA 4YS6A 3FKJA 2W2NA 5FLEX 2ZSKA 1GUYA 1QH8B 1M2EA 3WJ7A 3AF3A 3KELA 3SFTA 1HTBA 2IPAB 4LS3A 3CSDA 3G1TA 3LUJA 4XVHA 1NVUQ 5E8RA 4FCTA 2PXHA 3NEJA 4XYEA 1O94D 3IP1A 3KLMX 1MJGA 3DBLB 3ENNA 4H6PA 5EGSA 4HT3B 1AO3A 3T1TA 3TNFA 3IESA 4NENA 1OLXB 1TM3E 4KK4A 3LBYA 1W48A 2DT8A 3L01A 3I4FA 1EH5A 2OGZA 3DEAA 1PG2A 3CLUC 4CM3A 9GPBA 1SXPA 1DC8A 2UYGA 2YXLA 1E1QA 2VH1A 1IUPA 2I7TA 1B6GA 1RLMA 2H52A 3D8RA 2BI4A 1F6DA 3Q11A 2KYRA 2XVXA 2UYQA 4NVRA 1P33A 5BN4B 1PAUA 1AA9A 2AJDA 1H5QA 3OBIA 4QPPA 1FY2A 4EJ6A 3DLTA 1T9CA 1A2QA 3A4LA 3C1AA 1OYWA 2XMBA 4JEIA 4OQDA 1V3QE 1JXQA 3V48A 5AI6A 1U99A 1ZVJA 4CGZA 3G0IA 3M49A 1NVDA 4Q93A 4TRJA 4TXNA 4WNIA 4ZI2A 3CVVA 2X0RA 2IFTA 3U6BA 2Q4OA 3EGDA 4LJ4A 5BV7A 1XXLA 1PNTA 2Y4OA 3C43A 4I1IA 3A6LA 1IJEA 1FXWA 3NVMB 3GMIA 4ZEXA 2Z6VA 1MV5A 4B74A 3FCXA 4QBIA 2OFWA 4BJHB 2FMFA 1D2RA 3PEVA 5GMOA 3ZTWA 5LOVA 4E5DA 1QHHA 3EN0A 2JANA 1K75A 1FYWA 4GXQA 3KYIB 4ETNA 1WLYA 4C4YA 1DTSA 3LX6A 2BJVA 2ESRA 1FYVA 5A5EA 2PZEA 3N6XA 2PV7A 1GAQA 2AUNA 2QENA 4J3JA 1A2OA 4IZ6A 3SVTA 1G6Q1 1O08A 4B3SB 1BE1A 1M6NA 2D0OB 1LJLA 1Z6ZA 3OY7A 2J45A 2L18A 4JSYA 3UJDA 3EQZA 5FOXA 2DBRA 3DCJA 1SWWA 1K63A 5IW8A 1XCBA 4WKOA 1IFXA 2DFNA 1EG7A 1WUTA 1Z2CA 2XBUA 1NUQA 1OLUB 1JR4A 1QIKA 4KZKA 4M9SA 5HCIA 1G5QA 1K4MA 2PAAA 2YC4C 2FHSA 3DWIA 2A1UB 3PQ3A 4KWEA 4WNCA 4DV1B 3KEGA 3RSHA 5EC8A 4QXAA 1ADYA 1ZJZA 2FWRA 2DMRA 3QWHA 1E79A 3C70A 1JS1X 2XEDA 4KHPB 2G72A 1KY5A 2GXQA 5A5VA 5L6MB 2CXNA 1W7AA 5DDIP 3A3PA 1SUAA 4QUHA 3V97A 3HWSA 1PT8A 4KP7A 2WWWA 1E9CA 2YTZA 3RSLA 4NBRA 1B8PA 3AEZA 1GOTA 1FNDA 1QOPB 3M3PA 3AR9A 1G5RA 1L4UA 2IYXA 3BJIC 3ZGLA 2PS0A 3AUTA 1DAFA 3TMYA 4TX1A 1SVNA 3AU9A 4FMDF 1DBIA 3HFGA 4BU0A 2FN3A 2I3ZA 4RJLA 4EVQA 3CPEA 3AONB 1U9YA 4R8MA 4LV5B 4Q4DA 1I2CA 1ORWA 2PV0A 2PWBA 1PWYE 4RLFA 4FNAA 5K1ZA 4OEHA 3CF0A 2EARA 3V9AA 1NXSA 1WXDA 3G0DA 5JPIA 2YY5A 2GPJA 4OYYA 2MT9A 3MJEA 4J0EA 1M7BA 3DFUA 3X1XA 1GG9A 1JKJB 1HDYA 2SCUB 3D6NB 4BZQA 1W96A 4FYPA 1XKXA 3KZKA 2VBFA 3H17A 2V6FA 2D5BA 3JZIA 4R9VA 2H7CA 1NXVA 1ADJA 5LSAA 1YACA 3I6QA 4EQ6B 5C81A 2AFIA 2VT3A 3OIGA 1BC5A 2JI9A 1DT3A 2PGNA 4W1QA 3OU6A 1SCUA 5ED0A 4AJIA 1OA0A 2P5UA 2TSYB 4ZU6X 3TW8B 1T5HX 1YCFA 3HZRA 3F98A 1RBYA 3EQ9A 3JYQA 1FP7A 3QVWA 2NLOA 4H6XA 3D1VA 3WHLA 2D00A 4FSDA 2JPDA 1TKRA 2L69A 5G53C 2ZE7A 3FNHA 4ALIA 2D4HA 1OA1A 2XCUA 4Y2UA 3K15A 4TT8A 4TVBA 1SHLA 4QSHA 2MU1A 4DBZA 5CU7A 3QEOA 3QKSA 1KRHA 3R77A 2WWTA 1H0RA 2HOQA 3V5NA 1Z4JA 2AC4A 4L3VA 2EP7A 4QDKA 2H51A 3QXJA 5F1OA 4Q39A 3HXLA 4D8WA 1JKIA 3OPXA 3O83A 2GZRA 3ROFA 2WY2D 1CB7A 5HZMA 4AKIA 1QIMA 2CXRA 2PHZA 1KSFX 4B3IA 1NFRA 3KNZA 2ZIVB 1EA5A 1I14A 2XA9A 5GJWC 2FMUA 4ND6A 1XU4A 1D8AA 3C5CA 1ZD5A 1MG5A 1JHZA 5FWNA 3ROMA 1IRIA 1U1GA 2I1WA 3F6CA 2ROQA 1VL8A 2H00A 2XUHA 3AR3A 1T5OA 2H9IA 2PSJA 1V7PC 3C15C 1RTTA 3A25A 3JQFA 1DKQA 1BMDA 4DIOA 5E9QA 1R50A 2JAWA 2CVZA 2GS9A 4TMTA 4C20A 1GGJA 2OSVA 3FPFA 1JHRA 4UDNA 5EHGA 3PD7A 4LXIA 2YOFA 3E81A 4JWKA 1MO3A 2CHFA 4K6HA 5CEEA 4PAQA 1NLYA 1SULA 2D5LA 2VF8A 4RY0A 4U7TB 2JJ1A 1U3VA 3FHOA 4ZXPA 4DHWA 2QRUA 3LUAA 3GPCA 1NXOA 4M4SA 2W8BA 3X0DA 1HQCA 1YDMA 2WZBA 3O94A 5EZ5A 4GGOA 4WZBE 5LUAA 3DPIA 2OQIA 5B2ZA 4BNGA 2IOYA 3LJKA 4I0WB 4K7JA 1RKUA 3OPYI 4DM3A 2X3FA 1ZCZA 1Z2NX 4YCNA 4H7FA 2JLWA 1YS6A 3AM5A 3IPLA 3RARA 3BH0A 2JA2A 3PDUA 1G59A 1KS9A 2FOXA 2I34A 3QTLA 3ZBQA 2IDKA 1LZLA 4D8TA 4GP6A 5KMGA 1RWPA 1T1EA 3E9NA 4QTTB 1MOZA 1RQXA 5E0OA 4A2CA 3HB0A 2I67A 1PR3A 2OV1A 3R3UA 2WJWA 5KNBH 5K2OA 3FHCB 3FROA 5JD3A 2WA1A 4DV7B 1OVGA 3RSCA 1ELOA 4YUYA 2PWYA 2DKNA 4HNSA 3DSRA 3GQBA 1K9VF 1XO1A 1ZBDA 3DFFA 2M6SA 3EVEA 3C8UA 1AKRA 1GNPA 1U5CA 3F3YA 4KDEA 4KAFA 3GLVA 3G23A 3OIUA 2X2OA 4IMPA 5CHEA 4YB8A 4BUZA 1KRXA 1AG9A 4BO6A 5KTMA 2PZAA 1I13A 2VNJA 5DE3A 3AT1A 3RHFA 3EZNA 1U4OA 2KS6A 1X3SA 1ADFA 3N0WA 5HZHA 1GAXA 1CSEE 1JH8A 4L78A 2H85A 1U0TA 1ISRA 2JH3A 2X0DA 3R9XB 3DO8A 4O8ZA 2NT4A 2B21A 3CNLA 5A2QA 3REQA 2E21A 3HI6A 4MYCA 5JD6A 2GRAA 1MQSA 1ABBA 2J9RA 1U9IC 2WUVA 1X13A 3EXAA 3OESA 4JY7A 4P7KA 2QTFA 3M1IA 4CCYA 4JJ6A 1WHTA 4IQ0A 2A9FA 5AM4A 3UENA 1FUYB 4HLUC 4MRVA 2Q7DA 2OECA 1DIAA 3EXFA 2FG5A 5HIKA 5JNVA 2ZWMA 4BVHA 4WLEA 3QMWA 1Y7PA 4MDHA 4COKA 4N01A 2AYYA 4G0ZA 1GFIA 5FWAA 3LBNA 2QN6A 1YS7A 3OG9A 4I99A 1PK7A 4NENB 4LGVA 3PPYA 2PSEA 4C2TA 5DX8A 4MTCA 3SIPA 2YWRA 2YKGA 1RI4A 1J0AA 3HUFA 1UJBA 1P1HA 1T9KA 5AXAA 1AKYA 1E64A 4LUCA 1E69A 1NXXA 1RQLA 1UDBA 1KORA 1YHZA 2GNOA 3MD9A 3QU9A 1KEWA 4X3CA 2QLTA 3RAGA 3L0DA 1OE0A 3ABQB 3RRNA 3ICCA 2UVQA 1JI0A 1JBQA 1ULZA 1V35A 4L15A 1OYVA 3N0TA 4YALA 2YC2C 5FBHA 3H6HA 1O6BA 2FEKA 4G67A 4G6ZA 3K9FC 3Q8WA 1C14A 3EGDB 2WHPB 3CVYA 3MMZA 2IYEA 2WKRA 3MSCA 5FWDA 2UUCB 5JJKA 2DFKB 4WKGA 3BIFA 3D8SA 3WLMA 5K20A 3HACA 2C4UA 5SY9A 5B58T 2REQB 2DHEA 4QUJA 4DQXA 2XDAA 1TM7E 1AGPA 2C78A 3EVDA 4TMXA 3ZLVA 2RGNA 3UWPA 4QQNA 5KYKA 1QHHB 4F6RA 4BLRA 4KL8S 2BTQB 2I80A 2O0LA 3Q0EA 4BRUA 1BDHA 5BR7A 4UAGA 5CLIA 2JFWA 2RG1A 3H3FA 5CT8A 3MJ4A 2BSXA 4LXHA 3C7KA 3WMEA 3VVMA 5KSZA 5IT0A 3CW9A 4FYIA 4GFDA 4UASA 4GOMD 2VHWA 1ZMXA 2FUKA 2PSSA 2EW8A 5FI3A 1SVIA 3OZCA 1CF4A 3HEMA 1S2LA 4J6FA 2G1JA 1FSGA 2LVBA 4ZWNA 1O6ZA 3C4QA 3HYTA 1FQOA 1RJ9A 2X77A 1G5PA 1U7XA 4D3FA 2BV3A 2ANBA 5CXQA 2I8LA 4MA5A 1I7SB 3Q98A 1BAPA 2OCYC 3DR5A 4X8MA 5DYGA 1JALA 2PTHA 1MABB 3RIMA 2D0IA 3U56A 1BW9A 1A9SA 4BASA 3KHTA 4PNHA 5G02A 3LCUA 2NZ2A 1WSBA 5K0CA 2IYLD 2ZUSA 1F7UA 3W2HA 4G84A 3E03A 1CUWA 1JFFA 1A8SA 2ZCJA 1P1IA 4R7ZA 2GZ3A 1OFIA 2QTGA 2RAUA 5KJ6A 3QOWA 1C9NA 1CTQA 1C0PA 1QG2A 3L6EA 1A9QA 1ESEA 1V96A 2AF3C 4KBFA 4M76B 3NOVA 1XI2A 5AK5A 5FADA 4QZVA 2QZSA 1Y0BA 2RC5A 3ICWA 1JHOA 3HJBA 3IP3A 3NHRA 4H3SA 3D1JA 4AZ0A 4I55B 1H5UA 1W581 2ECFA 2GVNA 1DL5A 1X3LA 4JJ4A 1T8TA 1N1EA 2FPXA 1EWTA 1YR7A 1H3EA 2DRIA 3BFJA 3CRNA 2JRLA 4IIEA 4P5DA 4P3YA 5IT9A 5DYTA 3T3HA 4ALMA 2PMWB 1O5OA 4TVOA 3ZJ5A 5I7FA 1OX4B 3BK1A 3FDIA 5JNLA 2C2BA 1A4IA 1KAOA 2DQYA 1FF9A 1PV2A 1NBWB 4WT7A 2B0CA 3CIOA 1G8FA 3MT0A 1PJBA 1IB6A 4OQMA 1IUOA 1NJ2A 1U1FA 2NSDA 3GRZA 2W4QA 3NBFA 2NZ8A 2VOJA 2R11A 3D5EA 4OYRA 4QYWA 1I10A 5ARDA 3RVPA 5CFLA 4KCGA 4KR2A 4DCSA 3PQFA 1BXRA 2I29A 3PEEA 4IIJF 2G0AA 1SCUB 1T3LA 2XOXA 5K0ZA 1ISSA 1JQKA 3B6IA 4BVJA 3KPWA 2H6EA 4X9XA 1R9GA 1NRXA 2ZDQA 2FOIA 2XKKA 2VAWA 5KNDA 2A1TR 2A7QA 2X5KO 3TRFA 2QRNA 1E0KA 4P58A 1KI7A 3H18A 4MH0R 4NU8X 5DXAA 4LJSA 3P2JA 3VO1A 4X64B 4HDKA 2F90A 3PTZA 2FX5A 3R7WA 1G9XA 4CHTA 4C0LA 2V45A 1QK5A 3QVJA 4DXDA 5EHZA 1WRBA 1HA3A 3NZEA 3ODGA 4F5YA 2CFSA 3VR5A 1KOLA 3IT3A 3PNKA 1HK7A 1ML3A 1OX6A 3BK2A 2JFGA 1LFDB 1XVVA 1YGPA 2A9OA 4JQZA 1C2YA 4ENRA 2YWCA 1XWFA 2IY7A 3LC7O 2FQQA 3HDYA 4MR9B 1JLSA 2D2VA 1TCVA 4ZVTA 1ZYUA 5BSEA 3TG8A 3RADC 2CV1A 1TECE 4QDOA 5D5PA 3H16A 4X7RA 4M6WA 3WLTA 2FPWA 4A8HA 4URXR 3WIUA 2PO7A 3AHGA 1PZEA 2VXOA 2C54A 1KAMA 5JMWA 2XA2A 4KO2S 4CDMA 3IP6A 4JA2A 1R9NA 1T8PA 3IUYA 4IMRA 4XX0B 5FRDA 3GDOA 5D01A 5A62A 3KHUA 2YN2A 1BZYA 1TU3A 1NX9A 3GFPA 3TEFA 3N5CA 2AEEA 1G55A 2OV3A 3H11A 4NYIQ 4QFMA 4AF8A 2IIPA 3LDUA 2XGJA 2IS4A 3K1AB 5DXFA 2BUCA 1GN9A 2G0NA 2Z43A 2PO5A 5EERA 4IKPA 2ZIXA 2NPFA 4YQYA 4YLYA 5K8VA 4BFZA 3F5DA 1XCJA 3I6BA 1RI5A 1C1XA 4MI9A 4ZCMA 5C8VA 4HFNA 4UMEA 4QBFA 3UMSA 3BXFA 5T4FA 3S0JA 2H59A 3VYSB 2C96A 2GM4A 1TKBA 1A5ZA 1UFVA 1QHYA 1YOBA 2NZVG 3HU3A 1F0NA 1AUOA 2CXSA 5FP0A 1XP8A 2JBHA 2PM8A 3T4EA 1EX7A 1OXSC 3LMKA 4TLMB 2JF0A 2X0NA 3HVJA 3KFLA 3RUAA 3Q8MA 2M32A 2X2EA 2A35A 4G4GA 2HHHB 3FR7A 4UE3S 4R83A 3A6JA 2EGUA 2IHUA 2N47A 2RI6A 3TL6A 1LLFA 4G81A 2YYSA 4NQRA 3MFQA 3PUWA 2NMVA 1XELA 5JTUA 1XJQA 5AJYA 5C1DA 4JS0A 1GTL1 4KPFC 4TSFA 4CKYA 5KMGB 2DHCA 1HV8A 3U9LA 3HE3A 1YK0A 4LSZA 4DQUA 8LDHA 1AHHA 3EXG2 4OJNA 1ZGCA 4XH9B 3MVEA 1U2RA 3V1MA 4AJKA 1DBVO 5JRDS 4C0BA 2R97A 3LY9A 1SCAA 2I9PA 1X1AA 3CZ4A 3GQBB 4EG6A 5EZYF 3HG7A 5LU9A 1MLDA 2O05A 4YO7A 3HZHA 1E6CA 3JVEA 2ZYAA 3NO4A 4C30A 4IIJA 5CVVA 4L07A 5ITWA 4FB4A 1P1FA 3N8NA 4KB5A 2I03A 2C3YA 4J16C 2FSGA 4G37A 4GNRA 4D3XA 3HDQA 5FR2A 3EPHA 3SSAA 4OAOA 4L5IA 5F9HA 4ZJUA 3F9CA 5REQA 4JBWA 1ESZA 1W44A 4PVDA 4LC0A 3SC6A 4LISA 2PGJA 3EF0A 3GNQA 3M4NA 2XRYA 1XLUA 4KMOA 5L3QA 4G4IA 1D5CA 5EWJB 1WHTB 3SEZA 4CCYB 4MK4A 1XQXA 5KTOA 1IIBA 1VL0A 1EFVA 2UZ1B 1FS6A 3EC2A 4GW3A 3IXLA 2WFLA 4HQRA 1X6VA 1WKBA 2C9CA 2VH2A 1QRDA 3NHMA 1JDTA 4IOJA 4WOKA 3KFXA 5FWXA 3UAOA 1R4NB 3OBBA 4JT2A 3N7AA 4RIHA 3GO4A 4XB2A 4B84A 2WSBA 1R0RE 2MMCA 3HS3A 3VNBA 1WMDA 1OBHA 3O4IA 4YAOA 2AMVA 4F8YA 1C81A 2JD2A 3MMPA 2CHQA 4X1YA 4O63O 5EMLA 1VBKA 3OOYA 1GITA 1GHTA 1W2WB 2B7CA 2FRVA 2KB0A 5FEMA 1WQ1R 2OFOA 5AOAA 2E1RA 4GG1A 4JI6B 3PXXA 3ZLJA 4P31A 1A71A 4BUJA 2IDZA 2CVPA 1ECBA 1Q7EA 5LIRA 4FD2A 1ISMA 1CQXA 3UJ8A 2YW9A 2GAJA 2TRSB 3QOYA 3LCVB 3R7SA 1MHTA 4MKHA 1L5WA 1H22A 4QO7A 3PUIA 4UNNA 4JLWA 3O8CA 2CKDA 3SBEA 3V8NA 4DHEA 4ZMSA 3EIUA 2EKZA 4W5HA 4WK2B 4FKZA 3SG0A 2VJYA 1G21A 3ME5A 5IK2D 1P5RA 3B6EA 1Y7HA 1MQ8B 1IWBB 4L4UA 3K35A 5AP9A 1R5NA 1CUCA 3I83A 1K5HA 1KI1A 2IUSA 2AR7A 1RYHA 2Z8ZA 4JN6B 3HUEA 5EEHA 5FOTA 3NMUF 1LGYA 5DN9A 5WRFA 3WWCA 1DS6A 2CVQA 3UJNA 1A5AB 5AVUA 1ZK1A 2R1TB 2QZJA 4EVIA 4Q1CA 1KDZA 4DE5A 1VA4A 4YJ3B 1BYUA 4DCNA 3I9MA 3M33A 1PJ2A 1RJ9B 4KE6A 4D9BA 2JJ2D 1R4MA 4Y6RA 4B3JA 3EXIA 2QYHA 1NUUA 1V6CA 3FLBA 3H7IA 3EAFA 4GI5A 5EZYA 5YASA 1FA9A 3H2HA 4QJ4A 2C58A 5EINA 4CW7A 4IEFB 1VI2A 1YR2A 3LVRE 1TDJA 4I19A 1VZ3A 3SOPA 3PJRA 3IR6A 1S3FA 2G28A 1DAIA 3IQFA 2OAEA 1E66A 2I4NA 2ETVA 3IAM6 4KQJA 4OXIA 5FOSA 3VYWA 2FSHA 4OM7A 4Z7NB 5JTTA 1JFFB 2LNDA 1XMJA 3MWJA 3OFNA 4FR2A 4L0QA 1ISFA 4DL9A 5TPZD 1O87A 13PKA 1X14A 3IEIA 1QR2A 3ML1A 1MX5A 5ICCA 1I2AA 3AESA 3OCUA 2Q1YA 4MTLA 2XB4A 3CKMA 1BEEA 4Z0PA 4KXFB 2ZXEA 2ORWA 3CUVA 4P38A 3HUDA 4AZ0B 2GHIA 3P1JA 1EFTA 3BXZA 2IZ5A 3E5NA 1YUBA 1NW9B 2NO9A 4C0JA 1N2EA 4BLQA 1E5QA 1P2SA 4XVRA 3NHPA 5TJHA 3Q9UA 3DOFA 2DBZA 3NM4A 3ZWWA 4UZSA 4RVSA 1NURA 3HV2A 1VOTA 4KPYA 2M6KA 1RM5A 4PHCA 4EKGA 1KU6A 4U7WA 3VU8A 4BB5A 2WWGA 2WHQA 4GLLA 5TQVA 4YMVA 4O5AA 3LT2A 4AY4A 3OCWA 5H9VA 2Z30A 3P9YA 4QUEA 4EJSC 2VHJA 3RIXA 1AQIA 2PKQP 3ETGA 3N3BC 1F0KA 1QZ3A 3SC3A 1EMDA 4EBBA 5HA5A 2QVXX 2P3SA 1PHRA 4A3SA 3ZIUA 1E9AA 3RYHA 3NIWA 2JI7A 2VNAA 3AJDA 3WC4A 1ZIOA 2JZCA 4I5DA 4JB3A 1XTZA 1V71A 1YJAA 4XB6B 2RARA 5CK5A 3T5PA 3IO5A 3O2SB 4E70A 3BE8A 1DG1G 2ODAA 3DTNA 2FOLA 1Z2OX 1LC0A 1PIWA 3QQPA 1LEHA 3MA0A 4KIUA 3FYUA 4CZ2A 4RK7A 2QA5A 4HDKB 5PNTA 5TLSA 3R7WB 3QOFA 2HCTA 2IZOA 2JHPA 1LY1A 5HKOA 1J97A 1FYEA 2JGDB 3OLVA 4WECA 1L5VA 2OSBA 3ZCRA 4N6OA 4C3OB 3I42A 4OXNA 1QRRA 1JQEA 4BAZA 2Q6IA 4KMSA 5DPMA 4WBNF 4I6JA 5JZSA 3WLNA 2J3QA 4N41A 3UB4A 1FVFA 1Q14A 3NP7A 1WG8A 1RBQA 1T3HA 3TBHA 4KWIA 2MJLA 3F6RA 1MAHA 1Q92A 1ZU5A 4GXTA 4M6WB 1QYVA 3ASYA 3H4VA 3SDSA 1THMA 1XYYA 2HY7A 2FI1A 3JRNA 3JYOA 3Q5DA 3IP5A 2ORVA 5BSKA 5IWCA 1KEUA 4HQ6A 2DSTA 2I6SA 4GI3A 3N59A 4OL0A 3N75A 2VPZA 3KOZA 3LC0A 5TC4A 3WLJA 4HTFA 3N2IA 3H11B 4FDVA 5KOHB 3R3JA 4INZA 4N8DA 3ICQB 3B5EA 3B52X 1AK9A 1NC1A 2LUOA 3L2OB 4ZT3A 3I9NA 2LWIA 5DW3A 4MWBA 2HLPA 1UJ5A 3DEYX 1OH6A 3D8TA 5B1HA 1C1XB 4CM1A 1RT9A 3AI7A 3I45A 5J1SB 5HM6A 3BGIA 4NBKA 3EOBI 2BKLA 3ADKA 4QOHA 1ATIA 1U2TA 3FVTA 4IQ8A 2I76A 3WDKA 3I30X 1TVKB 3CYFA 4X91A 3V4VB 2IBTA 2EATA 2PZFA 1JQLB 3DXFA 2VP4A 3K09C 3FOFC 3B9BA 4C7OB 1Q0QA 2C4WA 3RC7A 4DDMA 2OENG 3AEXA 4YP7A 4ZI7B 4PZCA 4TWIA 1JIVA 2R86A 1WCIA 4O59O 2ICAA 3VUFA 4KK3A 2PIAA 3UAWA 2WTUA 2GTPA 1WQ3A 4FCCA 1XQYA 3RC9A 4JLPA 2OMEA 2CYBA 3TAHA 3VX4A 4FWIB 3HVKA 4WGGA 4JKYA 1OX5A 4ND8A 4ZGGA 4MMZB 2VYND 2YV3A 4HAYA 2HT6A 1NKVA 5KNLA 2IPMA 4UM5A 1YDEA 4QBHA 1K3TA 3LUDA 3IOEA 3UNXA 1TVMA 5EP3A 1UBNA 4HCJA 3PUYA 3NAMA 4LPSA 3FNEA 5A4AA 3DOHA 3IQDB 3LQFA 3WHIA 1ZIDA 1BXZA 2GASA 4R8KA 2X8AA 3K8YA 1CR6A 2GPYA 1XDUA 1Z74A 1NUTA 3AUSA 3GGCA 2WJVA 4FUQA 3CRQA 3UAGA 4DDKA 5KOJA 4OLBA 2EJUA 2PRIA 4QXOA 1PJAA 2P2NA 4R2KA 4WDQA 5DI3A 2GCNA 2EFDB 2XRFA 4ZAVA 1EJ2A 3WAJA 1RC1A 2DTDA 5EMMA 1YZNA 2O0MA 3HY3A 1RD4A 1SAYA 4UUMA 2GB4A 4AJ4A 4DJAA 2V8OA 1QQTA 3EVAA 3OJWA 3IR5A 1N0UA 1YRAA 2EU8A 1CZUA 4WN9B 4YDSA 1IUNA 1COZA 4LVOA 3ZBUA 2EFHB 3VPAA 1N6KA 5L3QB 3L0ZA 3QEAZ 3B1WA 2DJIA 1VB5A 4GQBA 1DEHA 4P33A 1NW8A 4FZ5A 2BMAA 2HD4A 5F76A 1KZ4A 3T7AA 3T95A 2P5YA 3HUTA 4UUOA 4S0ZA 5IDVA 4U3JA 4RORA 1FRNA 3FPEA 4CDRA 4X8LA 1Y3CE 3ESYA 4O33A 5D84A 1HE5A 2TMKA 3O3CA 4WBNA 1UOPA 4KXWA 1KI8A 1AGYA 2Q0XA 1C7QA 2ILVA 2YRWA 2NTVA 3QU2A 2HSDA 4B6SA 1FDIA 2FF7A 1U3UA 2DR2A 1GV1A 1N5OX 1C7RA 3EZ2A 1EU1A 3HKEA 2LIPA 1VTKA 3CZPA 1MVOA 4YVFA 4I46A 4CV2A 1FUEA 4TTQA 4OFWA 4X1YB 4B2IA 3CMCO 3UT5A 1P0IA 3FJYA 3FPGA 3N8IA 3JQPA 4OSOA 4D92A 2PMBA 1GCGA 2P69A 2PFKA 2P9JA 2ZTMA 2VG8A 3K5HA 2XD9A 2OAQ1 3I5YA 2PPLA 5CAEA 1MTZA 2ARKA 2IBMA 4YCDA 2YJ3A 2E4VA 2X5OA 2W42A 1XEWX 3DDHA 1WQ4A 3UJ7A 1PN3A 1MDBA 4Q24A 1DRKA 2FVXA 2J6BA 4H3VA 5C7OO 2ETXA 4C5CA 5HJ2A 2RGXA 2I4RA 1HXHA 3C7CB 1DDIA 2JB9A 3LKVA 1PNRA 1VHDA 4X66B 3CNQS 3BE4A 2X0JA 1EVIA 3PNQA 2HRBA 2OCDA 2R60A 4UTZA 4EGAA 1NLUA 3NOOA 3RYIB 1L7DA 1E2GA 1HEYA 2OEPA 5LBIA 5FWYB 3W78A 3WIDA 1ZWKA 2R6FA 1Q57A 3AUFA 2RHRA 4OYHA 1Z16A 3HI4A 1Y3FE 3AL2A 2IHJA 3EW7A 3OE5A 2AUMA 3DW3X 2IWHA 3VR1A 3VZPA 1K6XA 3MG9A 7YASA 4BXOA 2ZZMA 3V4OA 3V4FA 5E3HA 2AMJA 2WAXA 5A06A 1T13A 3JZFA 3R0VA 5DRYA 5A0VA 1VSBA 5DT9A 1YMUA 4I1SA 3RD5A 2P62A 3GJ4A 2NXNA 4HTAA 3HABA 2RHLA 1S01A 3DBHA 1YC2A 4L72A 2FEMA 1WW8A 2JGMA 1MA3A 2RGDA 2VCYA 4IDFA 2GWHA 3E9QA 2DPXA 1J90A 2ONKA 5IUJC 4Y0AA 1E3TA 3G8YA 5EZYB 5A5DA 1ZQ9A 1M1YE 1XZEA 1Z4PX 1J0XO 3AR2A 2D06A 4R1UA 5CCEA 4W5RA 2L42A 2V7EA 3EZGA 5F23A 1RXVA 2HJGA 4S0XA 4HQ0A 2C9MA 1L1EA 1S2NA 1TKAA 1K3UB 1KI6A 5KSYA 1A95A 1BFKA 1XD9A 5LDGA 1Q20A 1NC3A 1OWNA 1UXGA 1M6HA 5HNKA 1ZUIA 4L08A 4OLFA 2ZS9A 1RYFA 2DBYA 5TMPA 3DF7A 3HM2A 3UC5A 1JDZA 4AX8A 2H4ZA 3WL8A 3AIMA 3UN1A 1KH3A 4UHBA 1NY6A 5SZJA 5A4FS 3C98A 3G88A 3BEOA 2UUOA 1PZHA 1QYDA 3LHKA 4FN4A 5JS1A 5FD8A 2NXWA 2WUDA 4G9GA 4PBSA 3HRKA 3M89A 3VTKA 2HLDD 3PRJA 3AVOA 1XAHA 1YVRA 5BVHB 3GJZA 2PWPA 4FXPA 2BKEA 2GAIA 3C1TA 3HRHA 3KALA 5AJTA 3TOXA 1BU8A 3MSXA 4MIYA 2LRHA 3GLSA 2DWCA 2HSWA 3FJOA 2JDID 4ZOBA 1X1CA 2G77B 4PQGA 4Z0NA 2ZUWA 1KEKA 1Z7BA 4OHPA 1KZYC 3IELA 1AZSC 1BE6A 3VAZA 4BX0A 3LSTA 4QARA 4DQVA 1FSSA 1NFQA 3INYA 1N5RA 2PXXA 5FL3A 2ZBRA 3OFKA 4BNIA 5ICEA 1MW8X 1R4ZA 4QRDA 3WLPA 3ZDFA 1YZTA 3W9UA 4PWZA 4FZ3A 3JQEA 1R0WA 4FYXA 4AWAA 1RXYA 1T3TA 3WZLA 4PAOA 3ZOZA 1BWRA 3JQGB 1DQZA 5LBTA 1ZGHA 4WCFB 1T6YA 1ZI8A 3CF6R 3ZDAA 4C4SA 1XEXA 2F7SA 1WMEA 4D5GA 1T3SA 2ZJ3A 4D0NA 2B34A 3X3HA 1OXKB 1F8UA 3IO3A 3GMDA 4WOPA 1NBME 2FP4A 2O1XA 1ORDA 3IKTA 4NONA 2J59A 1FDOA 1JR6A 1AGRA 2C1XA 4ZYXA 3BFPA 3BICA 4BRSA 5LJIA 4H6VA 4OI4A 3A06A 1ZY2A 1N4AA 4IIFA 2A0FA 3TAXA 1ND5A 5E6UB 3RROA 1ID1A 1QHEA 1JDPA 4IJMA 5AM1A 3WR5A 4YRPA 3RVJA 1EAMA 3I2JA 3PX3A 3WGUA 1WCXA 5IYZB 3Q7RA 3UJAA 1KK1A 5D3ZA 3GJRA 3FIJA 4Q01A 1VG8A 4Z9YA 2PR7A 4I9FA 2Q6TA 1L5SA 1YRBA 2YRXA 2ZJAA 3V6LA 2VL7A 4HGZA 2VHQA 4I5GA 3GF4A 3C16C 3LUGA 4HD8A 2I71A 1YZFA 5DBHX 4EL5A 2FPSA 1SPXA 2FFQA 1JNXX 3L9WA 3OF5A 1E2FA 4I9UA 4K8OA 5L3RA 2X0FA 4REQA 1JEOA 5AXBA 3ZE8A 4ZQCB 3PQEA 2QRMA 4GM0A 2D6FA 2IS2A 1W4LA 2FPGB 1R00A 2ZI9A 4INJA 4CE6A 2VQFB 2UUPA 3CA8A 3AI1A 3REOA 1VG9B 2B4QA 3TS1A 2FJUA 3K8ZA 3P2KA 3L0BA 2WV7A 5ICGA 3BFVA 4NMLA 1CD5A 3COSA 4GQIA 1U8CB 3C3PA 2HCRA 5HGXA 5KOYA 1ENOA 1VPEA 6CHYA 2GXAA 1JIIA 3PXCX 3QJGA 5G0VA 4BVGA 1WCIB 1ZUD1 3EXHA 5C1PA 2IUYA 1WEHA 1TMKA 2H48A 4O2RA 1ZD1A 2OCBA 1B00A 1ZEMA 2XYGA 3EHEA 3OE4A 1UOQA 5H02A 1KFJB 2IIQA 2P7IA 1EBBA 3MQ4A 4FUTA 4IX9A 5IKPA 1E77A 4E08A 2VWPA 2RB4A 3HP4A 4TLDA 2NNWB 4KR9A 4QXQA 3VC3A 4S24A 4LYHA 1NBAA 1M7HA 1N2CA 2V59A 3GW8A 4L6CA 4FI3F 4RPCA 4XWYA 4DIBA 3R3SA 2IYAA 3JALA 1NHWA 1RXSA 1IHYA 1WUYA 3KK0A 1UJ4A 4IL5A 4JBNA 1LPPA 2XZLA 2XMRA 3UIEA 1S8NA 4CEHB 1QYIA 3W3AA 2GPTA 3DTVA 1Z68A 4ECAA 2XVZA 3EG5A 2Z04A 1GEGA 4AX4A 1YVUA 3O8RA 1VP9A 2BFOA 4UTVA 1L4FA 4D2IA 4HQKA 4PQFA 5EIXA 1UWVA 5ED4A 4TYWA 3TL2A 2JFHA 5EXSA 3WS7A 1M67A 2OXEA 1Y8CA 5JASA 1MRSA 2OHGA 4UHEA 2AMYA 2BKXA 4OU5A 5L7WA 3AR5A 2XBMA 4IDEA 2ZWPA 1I2MA 4PVCA 4DSTA 1E96A 1DJPA 3R6GA 5B3LA 1U28A 2R8PA 3INTA 3WY9A 4LHYA 2ZJOA 2AFIE 3ZKWA 1KRWA 4OQXA 1XNJA 1GRCA 3A4IA 4DG9A 1C7FA 3N76A 1TPZA 1E5TA 4DCOA 3UW3A 1FU7A 3W0LB 4UBJA 1I1NA 2R8XA 1WXXA 3FG9A 5FULA 2WOJA 2QAGC 1GGEA 4ARSA 1I5OA 1N6RA 1YDHA 3CCCA 3LUBA 1F8YA 3P2IA 1XNRB 4HX9A 3F2IA 1XIVA 1YJQA 1DVRA 2IYQA 4RSGA 4BVAA 4CMEA 1DINA 1S8OA 2BPOA 3DLPX 3OP4A 4CKBB 4EFKA 5JNTA 3EHDA 4C6TA 1N2SA 2PZGA 3NHZA 2RK6A 4IYJA 2PUEA 4LFAB 5FTKA 4H16A 3UT5B 2FZGA 3RK1A 3TWOA 5AKKA 4EENA 2O06A 5IT4A 3ZE0B 1PUXA 2ODQA 3K30A 3LL7A 2B9VA 1KJ8A 1N8TA 2B8NA 3QX8A 3T9AA 3MS2A 2X9NA 4HFRA 4QLBA 2CXUA 4DR4B 3OUUA 3FMIA 2HDHA 4R0VA 1J2EA 1N9KA 4F5WA 3PFKA 5P21A 2IF2A 2JARA 4UUAA 1ODTC 2IXDA 1E2EA 4JJ7A 3UUFA 3H5OA 3CH6A 1I5EA 4FDUA 4L73A 5ALFA 3UUEA 2HRCA 4Y6QA 4NMXB 4P93A 4JJ8A 1OILA 2YZNA 1YGYA 2GO1A 1C8KA 3H5VA 1RRGA 3MGCA 4P9NA 5E2AA 3ROQA 5L3ZA 4E4RA 2FH5B 2FXVA 2WHRA 3AEKA 1YULA 2VP2A 1YE3A 2E4ZA 2JVKA 1TQ8A 3EUFA 3OTHA 3ZU5A 4F91B 5K99A 3ZD7A 1D2CA 2AXEA 1AN9A 2O8CB 1UOOA 1VQ1A 1AUQA 2H0QA 3OAAD 4IYRA 3T8YA 2O5CA 2GXUA 3K0HA 4QBKA 3LX4A 1A98A 3IEXA 2FB9A 2REOA 2R6AA 3PC8A 1Q91A 4WV3A 4CPDA 4C06A 4F3CA 1GGHA 5H7XA 5CB4F 3R3HA 1TK9A 4LRYA 4NU5A 3TLEA 2QE7D 3ETEA 1AM4D 3O7MA 3DZCA 3JPYA 4W9NC 1FMCA 5HBRA 2GO7A 3OPVA 4LDJA 5T6BA 4BP3A 3B3FA 3OJEA 3EPLA 4UUPA 3DBHB 2HTFA 3LGAA 5J5VA 3TKYA 4D9FA 2IVZA 5JARA 2QEQA 2ODWA 4NZYA 4MV6A 4EYQA 2NTEA 5CB8A 4HB0A 1U0FA 2XCSB 3CNEA 5AIBA 3Q85A 3EYAA 3K53A 4QAQA 2B94A 3BE5A 3GYGA 5ESWA 1LVGA 2R5NA 2Q5FA 3PPIA 4NBTA 1NGSA 2OVBA 2QOEA 2AUTA 2V6JA 3ZZTA 5GZ3A 3A1WA 3EG9B 3E2MA 3PC2A 1WHSA 5HUQA 4XUEA 4KQHA 3H1BA 4WPGA 3SHOA 1G2OA 3B13B 3EGXA 3WNZA 2ZRFA 5TARA 2A8YA 2FUNB 2ONZA 4GZMA 4DTCA 1CP3A 1QAOA 3FWHA 1LK7A 3EIFA 4KQFA 3AIIA 5DYNA 4ZTBA 4Z0TA 4EG4A 4YDRA 5JZMA 1Y1SA 3LQ4A 1QU3A 1WVGA 1E2JA 3W90A 5LKRA 3V8MA 1NUHA 3BB3A 3OEWA 3BHNA 1IOZA 1EFKA 3IULA 1K2WA 3NEAA 1PS9A 1A7JA 1V25A 3CJTA 1AV6A 3OHMA 3WBFA 2OORA 1P1KA 4KVGA 4OH1A 5JSZA 4TMFA 4AZ3A 1YASA 2DCUA 1EIZA 3CR3C 4YUWA 3W5BA 1PJQA 4MW2A 3ZY4A 2J1LA 3P4YA 1YZKA 2Q99A 2BMWA 2VHTA 3A27A 2Q3DA 4DWJA 4XIIA 1Y4AE 3THOA 1J2YA 4QUAA 4W63A 2OZLB 3VVLA 4AY3A 5KNCH 2W00A 3VOAA 1GT6A 1MUUA 2DUJA 4GMKA 3QEBZ 1HMPA 2APJA 5T3UA 4PNEA 1W88A 4NC9A 3V7FA 3RS3A 3OUTA 4F1KA 5NLLA 3FTFA 1P0FA 1HH4A 2YZMA 3MAGA 4QWWA 2VA9A 3HHEA 3ZS9A 5J2UF 3AEYA 2I1VB 4LXQA 4LZJA 1HKHA 2HK8A 4TKVA 1VYVA 2WU1A 3PVCA 3RBXA 5EJFA 3KBBA 1XEXB 4RWEA 4JNCA 1DQSA 2IHYA 2VXCA 4R01A 3ZV3A 4HI0E 3EDOA 3BIOA 3MTBA 2RK4A 3EFHA 3EFBA 2K7FA 5HF9A 2HAEA 2FEOA 1S3GA 3TNYA 1U1IA 1YFKA 4MO2A 2FP4B 1XD2A 2JGNA 1BSVA 2FN4A 3NONA 4JB0A 4Z0HO 1GEEA 4X6XA 1RCFA 2ZRQA 1CDOA 3BA1A 2HBQA 2GZ2A 2QF7A 3UPTA 3U61B 1E9VA 3AP2A 1HE8B 5CB4A 1E1RA 2GX6A 3MIIA 4IJ6A 4OF4A 5JSQA 4EVRA 4ZFNA 3T1HB 3KM0A 2G17A 1BGXT 4GE3A 1NOIA 3QWFA 4DLSA 2D13A 2CSXA 2NUPA 4RJ2A 4ATNA 3GX1A 1PSZA 4BRWA 5B37A 1NW7A 4TZKA 1FFGA 1BEUB 3QBDA 4LY6A 3TZKA 1J24A 1HYHA 4QC2A 2OHJA 4H9GA 3JPWA 1LLUA 4MPPA 5D3KA 3TKAA 3ZBTA 2VT2A 3O4GA 2GK7A 2NN3C 4LZZA 4REQB 4YBRA 2FCRA 3TR0A 3UK1A 3E7WA 4CMGA 5TIIA 5EFZA 5HK9A 1TK3A 2DWOA 3PCTA 1V5GA 4LNHA 3ESRA 1NYLA 4DY6A 2PGAA 5KSOA 3NBYC 3S1SA 4FDTA 3VQTA 2YS6A 1RMTA 4RFLA 4EARA 2DP4E 3GD5A 1PZMA 3QGMA 4B4OA 1IJFA 2NQ8A 4MWCA 4S04A 4KBYA 2XXAB 3JQ7B 1BHQ1 1QXSA 4UFNA 1MO6A 1NAIA 2AF4C 1W6RA 3ET4A 4P5PA 4XVCA 3NKVA 4W8OA 3DOOA 3EXHB 5EJ5A 4P5EA 4IJVA 2ZT8A 4RPKA 1H1TA 2QNRA 3DA8A 3COYA 1NV8A 3AUXA 4ACAA 1VCNA 3SQLA 4BAUA 1SQFA 2OD2A 2IYWA 4EPVA 1ODLA 2RKOA 1TM2A 1X38A 4YDQA 5DM1A 4P32A 1THTA 3L8EA 1T4MA 3DUFB 1XZDA 4YYZA 1Q6ZA 2N1MA 4MROA 1V41E 3VR4H 2J9FB 2BFDB 2FLWA 3OWXA 4JDPA 1Y82A 4UATA 5LMCA 1JNYA 3P9SA 4INPA 5JRJA 2O8FA 1VJ1A 2W83A 2ZUVA 3TDNA 3UMBA 5J4VA 4L75A 3W7VA 1VLLA 3CRMA 1FPMA 4A1FA 3OO1A 1BKDR 3SWWA 3MC1A 3DTVB 3M3HA 3WGKA 5C7LO 1O94A 1X9HA 4HYEA 4OBEA 4RBNA 1OB2A 3OZSA 4G0NA 4JIGA 4XARA 5J2UA 5BMVB 1EK1A 2F59A 3G13A 3H99A 2H92A 2ZR8A 3KKOA 3PFWO 3E9ZA 3OKPA 1OFHA 4TLEA 3TD6A 4RTJA 2PPVA 1Y3HA 1FFSA 4AW9A 3JD0A 5ENDA 1MP0A 3KYCA 4RZUA 2AJLI 4H4EA 3T9DA 2VDRB 4BJ1A 2HPAA 4F92B 5HXAA 1GM5A 1EGMB 5DV9A 2V7UA 1L7MA 2O57A 4IUYA 3UA3A 5DLDA 3JTEA 1RWBA 5LYYA 4F60A 3BZBA 1TA4A 1LC3A 1RCTE 1HYQA 5KVSA 1M9NA 3VNSA 4JITA 5FI0B 3I8OA 3RS9A 3CVWA 4LWPA 3AHFA 2ZZNA 4WKCA 2VCEA 3GIDA 4LDPA 3MTIA 4DV4B 1RLJA 1ILWA 2JIQA 1T2DA 4QO8A 4D9MA 4RVNA 1P4AA 4Q15A 4GECA 3LRPA 3C8DA 2CVOA 2EC5A 3TLKA 2QL7A 5EIOA 3TYXA 3PWZA 2XYRA 3CB2A 3LKDA 4WNYA 2AXQA 1W1WA 4DLUA 2WZCA 3E5RA 4C4TA 2C4NA 4Z4EA 1YJCA 1Q0HA 3G7SA 5GONF 3K72B 1JG6A 3G0CA 3WG9A 3TF5A 2G80A 2J87A 4WVFA 4DBVO 4GMHA 1B6RA 1VSVA 5G0TA 4HZUB 1G0OA 3B2NA 4UZEA 4GD3Q 4QM6A 4XQEA 2WR8A 1GSAA 3DFIA 3I05A 1ND6A 2AQ8A 4KODA 1X1TA 2HCJB 1TTHA 3MWEB 2WNSA 5AOVA 4E4TA 3JAKA 3U3JA 1J20A 2CWWA 4X63A 1DO8A 4G8DA 3ZWNA 1GA4A 3GFBA 3IJ5A 5HTOA 3ESXA 4LWOA 3OKFA 1IDN1 4D02A 3BMCA 5KX5B 3KWMA 2CMHA 1HORA 1OQAA 1DQNA 3SEAA 5JHGB 1E0JA 2AG5A 3C6MA 3KYJB 3NHSA 1TOAA 4N5HX 3RO7A 5IDXA 2JASA 4MGHA 3BRWD 5CNMA 3QNMA 1ZD8A 5JATA 3O03A 3IA7A 3KPYA 1K2VN 4GE0A 2RH8A 4HX2A 1IAVA 4JD5A 1QRTA 4N49A 1R7RA 5KTYA 4OMUA 1PE0A 1RJDA 1YQTA 1VECA 1I6MA 3CUWA 4NKRA 1QCZA 2EFJA 1XZQA 4PS0A 3WL4A 1NQOA 1K7FB 3N39C 4TMYA 2H31A 5JNRA 3R5JA 1H9CA 1ES9A 4D43A 5HGJA 1LQTA 1UKBA 3AJEA 1JU9A 3SI7A 4MRSA 3ENQA 1PD0A 2B1IA 2OQ2A 3IP9A 3BTUA 4H35A 4ZO9A 2QD5A 5JWHA 1N75A 4LV8B 1SA0A 4CKEA 1FSPA 3AG5A 2DOKA 2PKCA 2JRCA 3F3SA 4OGFA 2I78A 3TLYA 2GUWA 1LPNA 1NBEA 3G2HA 4DLLA 1P6XA 1RHRA 2VDUE 3RSSA 4JYCA 1NDQA 2DPYA 3OZRA 3EGXB 4GT1A 1MG0A 1OWPA 2O3JA 2C2YA 4ARIA 3TLGB 1Q0ZA 4U39A 3SZOA 4YRNA 4IDGA 1VLZA 5EE5B 3WGHA 5BUZA 4MHTA 5DOZA 3BAZA 4LVCA 2FPKA 1O7JA 3OF3A 4CLDA 4AP5A 3C5HA 4EUNA 1W1IA 1DIGA 4HZIA 5FUYA 3U1BA 1E92A 3QMPA 5BW6B 3L4KA 2RI1A 3G5LA 3KQQA 2VUSA 4G2NA 4HEJA 1WZUA 4OB6A 5KHLB 2OA0A 4D9IA 3BF7A 3EGVA 2HWXA 4DOMA 4AZ3B 5JSZB 1AQJA 1KJJA 1W4CA 2D3WA 3H9GA 1IBLB 2ZVQX 4N7JA 2C7QA 4Q1EA 1U65A 4PPGA 3DHWC 1CLEA 3HJUA 5BQ5A 2IEGA 3QSYA 3TTVA 1ZITA 5ITSA 4MKIA 2C4KA 2W2MA 3DG9A 4Z54A 5FNVB 1XROA 1GGKA 3B51X 3GCDA 1PFKA 3IIJA 5GONA 5J5AA 1QHXA 1G8MA 3QXCA 4PPFA 1W88B 1WSDA 4HH1A 4ZJYA 5I45A 4OX9Y 3IE0A 3HSYA 2VOEA 4LBZA 1N0HA 1EHIA 3GLGA 2O8NA 3ACDA 1EAYA 2XQGA 3ND8A 5D1HA 2OGUA 1PO7A 1DWOA 2PZJA 1AOXA 4U8HA 4TZ0A 4Q0MA 4RHFA 3R3XA 2OKCA 3NRJA 4HRVA 3LQ1A 5AJXA 3I01A 3UZUA 5BQOA 2DKFA 5ALZA 2XVYA 1YT5A 1W36B 2O8EA 4PSDA 3O21A 5JSFA 2WT8A 4HWPA 4PF1A 4ENVA 2JCXA 2WKQA 4HNVA 5JD4A 2C61A 5DP1A 3TUIC 5CB4B 4LRSB 1XZFA 2QORA 4Y2YA 5KVQA 3ERCA 3ZNNA 3WZMA 1DJMA 3ZXYA 2CL5A 2JFPA 4KYVA 4EI9A 1TAUA 2IHKA 2NUPB 2OAGA 2YV4A 2PQ2A 4Q18A 4PZUA 4M55A 3Q0TA 1QS0B 2DBVO 3SQNA 3S2EA 1SHZA 4HEA6 4YRCA 5KC9A 5ILGA 3UPUA 3K9HA 5EXPA 5K2MA 4GXRA 5K7SA 1LBTA 1Z15A 4EELA 4WY5A 2HMUA 4YRZA 2NAFA 2JFFA 1X1BA 4BMVA 4D4LA 1FB5A 2NSYA 4MULA 2WIGA 1JFSA 1G6OA 3FVWA 4JC5A 2ZTLA 2WT4A 4HDSB 3NLLA 1DKUA 3W34A 4YRMA 4E94A 3V7YA 4B6EA 4MSUA 3HA3A 3DMFA 3H4MA 3A2NA 4KZPA 1DUIA 4KUHA 3TCKA 2XB6A 5ELMA 2W98A 1T9GR 2ZM5A 1TUBA 3BMNB 4TSKA 3QPVA 3R23A 3EY4A 4L8LA 1M76A 4EGCB 2AZXA 3DXZA 2ZROA 3B5IA 3MUOA 4QQFA 1L7QA 1N5DA 1O57A 4YRLA 1KXJA 5DYWA 5DTEA 3G9ZA 4BWYA 1UKYA 4LBYA 2H7VA 2XLBA 4JHXA 1M1NA 1R2QA 3R6LA 3TQRA 2XGOA 5KIAA 1UDAA 4RQAA 3ZVNA 3N87A 3S81A 5JXWA 3IHLA 4ABYA 3EGIA 4C89A 1NE2A 1WSAA 2E37A 4FHZA 2PAFA 1JT9A 9LDBA 1DBSA 4KQ1A 3FRJA 4RABA 1XL1A 2R44A 1JDSA 4E5MA 2XYVA 3PJFA 4KSBA 4NEQA 3OZTA 4IIVA 4LRQA 2B4YA 2YJ4A 4ZMRA 4TS3A 4YBZA 3CLRD 3ICPA 3RUCA 2QYOA 3PNLA 1XT6A 2IC5A 1KO1A 4AKTA 1GPWB 4NRDA 1QP4A 1KAQA 1E2KA 1EHCA 1MO2A 4TXHA 4G2TA 1BE0A 3WB2A 1OROA 3I53A 5SV2A 4A0QA 3F7MA 5AI0A 4DLRA 3IC5A 4XWWA 5K3DA 1W5SA 3NETA 2VP5A 4B45A 4BDTA 2QT0A 5AVJA 4CT4B 10MHA 4KQXA 4Q16A 1FNCA 1M8KA 2WZQA 1G20E 4A92A 1TIKA 5AW4A 4HF7A 2HKIA 1WBDA 1O8CA 3PHCA 4J03A 1MQ9A 4MI3A 5AI9A 4DYVA 4M87A 2ZRCA 4RANA 1M8JA 3ORFA 3DO5A 2V4MA 3UW1A 4DCVA 1AMUA 2CXPA 3HBLA 4DKJA 1KBOA 4LDQA 1O8BA 3MTDA 4JIMA 4S35A 2G08A 1J49A 4MGYR 4YX9A 4NNOA 2B1JA 1IIRA 2JFYA 3GRUA 2ZTHA 4RWZA 3A9SA 4BPRA 3DBRA 3D0KA 2XNDD 1A1SA 2CL7X 1VLHA 2M1XA 1OFUX 3GJSA 4CG1A 2QRGA 3V46A 1WULS 3EXEA 1E62A 1I8TA 3QK7A 3QLUC 1QG6A 1HNXB 4PPNA 1E3SA 1XQ6A 2A3RA 4D4MA 4B2YA 1BOOA 1CR1A 2PMDA 4LGMA 4EYOA 4DA9A 4L16A 3OQ1A 1M2WA 4JVNA 4EG1A 4GKVA 4ESEA 5LP6C 5AR1A 2Y1GA 2CLMB 2OC4A 4QEDA 3GROA 4KKVA 5GIPE 4GC5A 4OREX 4F97A 4L22A 4UTOA 1EDOA 4A8TA 2DQSA 2IHVA 5JCXA 4TOIA 5DNYB 3KEFA 1U98A 2D1FA 4B5LA 5B64A 2C5BA 3GARA 1ZGAA 3ICVA 3SNHA 4BZWA 2QV7A 3DVAA 3GLQA 5H4GA 5CJ2A 2RG7A 1TT7A 2NUAB 2Q8PA 5KU7A 3ER6A 2A4KA 1WMBA 2PXAA 1JG2A 2WJPA 2ZQZA 1O9GA 1D7OA 3HY4A 1HO3A 3QXGA 4K40A 4NJMA 4RHYA 3RBVA 1XLTA 2Z08A 4R2MA 4KUEA 2GVDC 3RIHA 1UQTA 4YWHA 1RP7A 2NW6A 3FUVA 2GK4A 4MYSA 4NXNB 3R3WA 1Y3DE 2C9YA 2O2EA 2Q5OA 2WBLC 1HY3A 4FHGA 4MW9A 4RHCA 5ER6A 1GYRA 1UM9A 2E49A 2D5AA 2VBGA 1KIAA 2YFHA 1H2FA 4UBMA 4YAGA 1Y7TA 2K5UA 3H2YA 5BUSA 2F3TA 2OUKA 3ZCQA 3I6YA 4JJEA 5FEUA 3UFXB 4EY7A 2A2ZA 2LP4Y 1SG9A 2BONA 5CDHA 1TGYA 3A04A 1ZH8A 4P3XA 5BY2A 5ICMA 1EGQA 1M0EA 2JBAA 1C1DB 2QD2A 4NYJQ 1U0JA 2LCFA 1X39A 2GHQA 4FE4A 3CLTD 5MGBA 3D3KA 4C0SA 4DV5B 2HU2A 1ORVA 3IQXA 4QECA 2D62A 2IDMA 2QMQA 2WT9A 4NV3A 3SXUB 2BF7A 4ARAA 4KR6A 3QBJA 4EUSA 4YHHB 3K1TA 4GMXA 1TO1E 1J2UA 1U9CA 2QW1A 3TCNA 2CMKA 3FUCA 5IARA 4BO8A 3DOIA 5FTLA 1ZMOA 3MJRA 4US2R 1QMGA 3PB3A 5E3JA 3PXAA 2A30A 3F5QA 3CXUA 4RKRA 5EZ6B 5EAIA 3E27A 1ID8A 3QKIA 4IV5A 4ISBA 5LA6F 2HMSA 4D8UA 2F1HA 4YC7A 1OI2A 4CIYA 4CQLA 2TMDA 1T5DX 3EGWA 1TJ4A 3PIRA 1UCFA 2IHBA 5FHQA 4F4CA 3DR3A 5CCBA 1QCYA 1A7UA 4JMPA 4L8GA 4PX2A 3JXEA 3W5VA 4KQGA 3VPSA 3U17A 1VKZA 2UU9B 3JY6A 4TKLA 4FW8A 4P81A 1GA6A 3V55A 1WKVA 1I6WA 1UAGA 1VFPA 2G5TA 3C7DB 2LZ0A 1QZZA 4MR7A 3FUWA 4WVLA 1XAJA 2BKVA 4MVJH 2VDQB 4FGWA 4RETA 2HMAA 5C4MA 4XSHA 1L1QA 1NVWQ 1Y6ZA 2ENWA 5H83A 5I4CA 4MO9A 4EKNB 2BAGA 1M75A 1UPAA 2QZ4A 3RCBA 2ZDGA 7REQA 1A9PA 1LB1B 3AXTA 4WZZA 1TLTA 1EG2A 3I6IA 3PC7A 4BFVA 1V9CA 3W1VA 3AQIA 1G1MA 4C6RA 1QH9A 1RE1A 3G82C 1H05A 2OYSA 1II0A 1G6KA 3FHJA 4P3PA 4HYYA 4G23A 1QHIA 3OJOA 2XECA 4P4NA 4KYUA 4D9NA 4D9GA 2R3SA 2QUKA 2DH5A 2B61A 2FZ5A 2XOKD 4IZHA 1W8DA 4PRZA 1LWOA 3SXJA 1T4GA 3VH2A 1F51E 4FPXA 4B3RB 1N2XA 1TMYA 3IVRA 3KJGA 2JJ8A 2EJVA 5AVTA 1Y4DE 2FCAA 4RM3A 5A3JA 2PLNA 3HN2A 5JPCA 3OP1A 4RAOA 1SOMA 1FK8A 3RTBA 2W93A 3L8DA 3NCHA 1U3WA 2WWFA 4XWTA 3P5SA 5TT0A 1ZP6A 4LSMA 3VTZA 3CT6A 1IULA 4ROTA 4UHJA 5KSPA 4EK9A 2WFMA 2JFNA 1ZOLA 5ADUS 3SY8A 3QRWA 1PR4A 3HXKA 2QUHA 5IN5A 5A5GA 2XJ9A 3QE0A 3ZI4A 3C4JA 2Q1WA 3RJTA 4ZN6A 4JLVA 4ESVA 4TT3D 1P29A 2C0QA 1ISIA 3AJAA 2R2AA 3ANSA 1I4DD 3NFRA 4HYQA 2W2XA 4HSEA 4N9WA 3L8ZA 3QQ5A 1NR5A 2FZLA 2FW7A 3HR7A 4TYQA 1IWOA 4V0NA 5DM60 1L3IA 4A8JB 1DRVA 3HDTA 2CDRA 1PKEA 1XTIA 4O2LA 1JXAA 2XUFA 4CT5A 3QLVC 1ZINA 3PEYA 1AKVA 3FPKA 1P2UA 4YLEA 4L5YA 3RF6A 2JGKA 3ZVRA 2R25B 1XN4A 1AQNA 5DHFA 3U3RA 2XJ4A 3PGVA 2PJZA 1CRWG 1T3ZA 4J2OA 2LBPA 1D5WA 3DZIA 2PS1A 3LP8A 4H08A 1Z8NA