2NSYA

Crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis in complex with nad-adenylate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
271
structure length
271
Chain Sequence
SMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NAD SYNTHETASE)
publication title A novel deamido-NAD+-binding site revealed by the trapped NAD-adenylate intermediate in the NAD+ synthetase structure.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 105
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2nsyA00
3KT6A 4WSOA 2WQ6A 3MLAA 3AG6A 3TZLA 4MUHA 2YWBA 3H05A 2J08A 4U7JA 2PFSA 5H7XA 1WXGA 4ZCRA 3ELBA 4YP5A 4DDMA 5DASA 4G5FA 2OQ2A 2VXOA 1XNHA 4EG1A 2I1LA 1EFPA 5LLTA 1TEZA 1NURA 2H29A 3P0IA 5TEWA 3HV0A 3ZUGA 1X6VA 1QQTA 1QTQA 3ZJTA 3ND5A 4ZT7A 1MB9A 2B7LA 3DO8A 4MVYA 1IQUA 3HZRA 4JXZA 4FZJA 2CYCA 4E1AA 1GPMA 3AG5A 5J59A 2TS1A 4R2MA 1T6YA 1I6KA 3C8ZA 4K0RA 1UFVA 4YP7A 4X0EA 4I6GA 1KORA 1RQGA 2J5BA 2JA2A 1M8GA 3LE8A 5F23A 2WB2A 1YULA 1NUSA 3FY4A 2E21A 4MUKA 2QTRA 1V47A 3D6VA 2AG6A 4EG5A 3RK0A 5TS2A 2J07A 3QE4A 2HMAA 2X1LA 1N77A 2CYAA 2C5SA 4ZCPA 1YIDA 2VTBB 3UMVA 2BYTA 2H2AA 2X0KA 1N2EA 2QJFA 3H9CA 4PBSA 1V8FA 3ZIUA 3GMIA 1NSYA 4MW0A 1KH2A 3FDXA 1JEDA 2XRYA 1H1TA 3MLBA 1JMVA 3HMQA 2D13A 4MAFA 1Q11A 2QUKA 3FH0A 1WXHA 3CLTC 4MWCA 2A1UB 1LI7A 3UC5A 2Z08A 3P0HA 1IQRA 5JBNA 1O97D 2AZXA 5LM3A 4ZT6A 1KAMA 3HL4A 4J75A 3COYA 1GN8A 4EFKA 2PZBA 3L93A 1M83A 3VU8A 4EG7A 4MW7A 1JZSA 1O5TA 3M5WA 1JIIA 1OWLA 4ARCA 3VGJA 4J76A 1XNJA 4JZYA 1F7UA 1T6XA 1M8PA 1S4MA 3AFHA 3PXUA 3LOQA 3SEZA 1T9GS 4A91A 3OTWA 2XRZA 1O94C 5LFAA 1VL2A 3IOBA 5BNZA 2CFOA 1NI5A 4WNYA 1JHDA 5IHXA 2D5BA 4ND7A 1VBMA 2J4DA 1IQ0A 1IH8A 2G36A 3BL5A 3ND6A 1TQ8A 5KCMA 4EG6A 1U0BB 4S1OA 4JXXA 4NX2A 1M8KA 4G5YA 1PFVA 1WJGA 4OUDA 4UZEA 2A1TS 3KT3A 4RUKA 4DDKA 2DUMA 1MAWA 1P7PA 1U3DA 4R2LA 4ZCQA 3JXEA 3N05A 4MUGA 4ZT3A 3UK2A 4ZCTA 1ZH0A 4NAHA 3KT8A 2YY5A 1KQPA 1MAUA 3MXTA 4MW6A 1I6LA 4HPWA 1YI8A 1OWNA 1R6XA 1B6TA 1Q77A 3RFFA 3SDBA 4QBTA 3CA8A 2QJTA 3AL0C 4EF6A 3F3MA 4CDNA 3CR8A 3TQOA 1K4MA 2A4MA 3NBAA 4AQ7A 2EL7A 1OWMA 3CLTD 2PZAA 3A4IA 1JZQA 1TYDE 3INNA 4NAUA 3AKZA 1QU2A 3IVCA 1FYDA 2CT8A 4P2BA 3S3TA 1WXFA 1IVSA 1O97C 3PRHA 1J21A 1VBNA 4L2IA 1GLNA 3X1JA 2O5RA 1R6TA 2WQ7A 5DB4A 1MC1A 1JGTA 1J09A 4AS1A 1Q15A 2J09A 4UZFA 2DERA 1EJ2A 1YIAA 1XNGA 4MQ6A 1I2DA 4DLPA 1EFPB 1KH3A 2GKSA 1U3CA 1PFYA 4YP6A 1O94D 1N2BA 1LW7A 4XFJA 2D54A 2HGZA 1EUYA 2V0GA 5KHAA 3IH5A 4ZT2A 3ISJA 4CT0A 4DE5A 5DK4A 2X1MA 3IUEA 1KQOA 3TZEA 4MW4A 3X1MA 4R0NA 2DEUA 3HFJA 3D6UA 1NUTA 1H3NA 4MUIA 4GRIA 1R6UA 3FIUA 1O95C 4MUNA 2E18A 1YUMA 2BTEA 2AKEA 3QTTA 4PY2A 2A88A 4H3SA 2CV2A 1QJCA 3ZJVA 2ZP1A 4PBTA 3DLAA 2PG3A 2RE8A 4ZT5A 3TS1A 4I6JA 1MBZA 2V0CA 1KP2A 1JIJA 3COVA 1OWPA 4EG4A 4KR7A 5TEVA 3MUEA 1QU3A 3COZA 1N78A 2GM3A 3PNVA 4KPUA 4JYZA 1N1DA 3KFLA 3RBAA 4CQNA 4XFDA 1ZJWA 3H99A 4CDMA 1NUUA 2X3FA 1JECA 1H3EA 1WXEA 1EXDA 4MWDA 2CV0A 1T9GR 4MUJA 1N2JA 1EE1A 4ZT4A 2QUIA 4NZPA 2A1UA 5KWVA 2YXNA 1VBKA 3SEQA 2DETA 3H97A 2DPLA 5FO0A 3SZ3A 1U7XA 1KQNA 2DR2A 1PG2A 1OBHA 3SYTA 1M8FA 1CT9A 1EFVB 2NZ2A 3SZGA 4YMIA 3G5AA 4Q16A 2A1TR 4MWBA 4KR9A 1QRSA 1K4KA 3NBKA 3ILVA 2QUHA 1NUQA 2A7XA 1O96B 3FOCA 1KKUA 1G8GA 1MOPA 4NATA 1O6BA 2YWCA 2QTNA 4QRDA 1TYAE 1PFWA 1GTRA 3ZXSA 3Q12A 1M8JA 5J5AA 3TNJA 5H16A 1MRZA 3NV7A 2GOYA 1COZA 3FI0A 3N9IA 1OD6A 2O8VA 2A84A 1IHOA 1O95D 1JIKA 3LCJA 4F4HA 3PNYA 4U8HA 1EUQA 3SP1A 1N2OA 1SURA 5FO1A 1G59A 4MVWA 3U1VA 3P0JA 5HG0A 3N8HA 1K92A 4U63A 4EGAA 1GZUA 5HUHA 3N2YA 3K9WA 2E89A 3TQIA 3ZXIA 3I05A 3DV2A 1U7DA 4MW1A 3RHSA 1J1UA 4DDHA 3A2KA 3PNBA 4EG3A 3ND7A 3FETA 1N3LA 1G8HA 3QTBA 4MLPA 3CVWA 1WZ2A 3CLRC 3L92A 3COWA 1H3FA 1QNFA 3X1KA 1D2RA 1BS2A 5IJXA 3IMCA 3UY4A 2IELA 3E27A 1MJHA 1A8HA 3G59A 3IOEA 4MW2A 2ZUEA 5DEOA 2JANA 4HJXA 1FFYA 4MVCA 1WQ4A 1I6MA 1QRUA 1WY5A 1F9AA 1ULHA 4MW5A 5K0TA 3A04A 3VRHA 1O0CA 4MW9A 1TFUA 3CVYA 2NSYA 4ZCSA 4RPIA 3ZJUA 1KAQA 1OWOA 3AIIA 1PFUA 1IRXA 2R5WA 2WSIA 1NUPA 3FHJA 3CLUC 1Q19A 1ZUNA 2OV4A 3IODA 3RJZA 3GUZA 2CV1A 2JAXA 4MWEA 5K0SA 4BWVA 4EG8A 3IVXA 4YBRA 4DNXA 4K03A 1VLHA 1XJQA 2PZ8A 3Q4GA 4ARIA 1GAXA 1X8XA 2EJCA 1KR2A 1O0BA 1TYBE 1KP3A 4ND6A 3IOCA 2VTBA 4HJRA 1Y42X 2PIDA 2E0IA 3CLSD 1YUNA 2QUJA 3CVUA 1JILA 1M1ZA 1QRTA 1NP7A 1K97A 4KPUB 1J20A 2Z09A 1N2HA 3K32A 1GTSA 3CLRD 4OJMX 1MB2A 1N75A 1PG0A 1HYBA 4F3RA 1OBCA 3MMXA 1J70A 3CVXA 5TGTA 4MULA 4HK4A 5AHWA 1T6ZA 2CYBA 3DPIA 5J58A 4KKVA 1LI5A 3GLVA 3IUBA 3IMGA 1F7VA 1N2IA 1N2GA 1EFVA 1WQ3A 3FNRA 3OP1A 3A05A 4MUFA 3CLUD 1G8FA 5FNZA 1O96A 2DLCX 3FG9A 2RD2A 3CVVA 3H9BA 3G6KA 3IDFA 3P52A 2IJGX 2A86A 2QTMA 1IFXA 4GU5A 1ILEA 4KR6A 1WXIA 1DNPA 4MUEA 1JEEA 4NDAA 3RK1A 4OUDB 4DJAA 1KH1A 1F4LA 4XSVA 1WKBA 2DXIA 3FWKA 3HGMA 4I6EA 3CLSC 1ZH6A 4G6ZA 3IMEA 3KT0A 1TYCA 2CSXA 5HUJA 2IP1A 3IVGA 2HZ7A 2Z3VA 4Q93A 4JFAA 1NYLA 1J1ZA 1NZJA 4PBRA 5EKDA 2PXHA 4MVXA 4TS1A 3Q10A 3ZGZA 3UOWA 2CUZA 2QJOA 2ZUFA 4QREA 1WOYA 4L2IB
chains in the Genus database with same CATH superfamily
3U3KA 3JQBA 2VAWA 1KAGA 3AG6A 3RLIA 4MUHA 1QZTA 1Z73A 2Q6LA 4WKCA 5HM8A 2EATA 1QDEA 5H1YA 3TLGA 5ESRA 1R12A 3ELBA 1R8JA 4E32A 1RPAA 2R1TB 4ZFNA 2O3JA 4WDRA 5I6DA 4LYFA 2R8RA 4FGZA 2VXOA 2BGMA 3JALA 4AKHA 3VPCA 2VOJA 4Q48A 4TTSA 4PICA 3H5RA 2QX4A 3V8EA 1E3IA 3P9YA 1TXGA 1VSVA 3W5DA 2CZQA 2WUGA 1PLLA 3ENQA 4TSFD 4UTXA 1EM8A 3T1QA 1NDUA 1DFIA 1SC6A 5K45A 5CA0F 5J9FA 4ETNA 4Z4FA 4MVYA 1VMAA 4OA5A 4ACAA 2G25A 3DZJA 2ZULA 3KPUA 1CHDA 3HJNA 3NOQA 3HYSA 3R6TA 1QKKA 2B1RA 4FZJA 4KVAA 4W1SA 3BIXA 3RYIA 2BT4A 1KI2A 1HMPA 3QVWA 1J7KA 4F2GA 3DBVO 3H5OA 1XSEA 2W00A 1GGFA 3FZQA 3ZIAA 3GQBB 3A9RA 1FFBA 3V2IA 2HHJA 4XX1A 1ZZEA 3K09A 1M2VA 4HDNA 5ALYA 3TDKA 1RAEA 2JCGA 1ADBA 4JODA 4E5NA 3FRJA 2ZUCA 3LE8A 5JCZA 2VNKA 4W5NA 1U5AA 3RS7A 4S1WA 3IHLA 3R5XA 4YVFA 1G7SA 2VP5A 3FBTA 3M6IA 1ZWLA 2KQUA 3FCSB 4I9UA 3HCDA 1GSOA 4HS9A 4JYCA 5AW0A 1PIWA 2AUNA 4ZJZA 2W6OA 5TGDA 4EH1A 1SIWA 4ZQEA 3ST7A 3HNOA 4ZCPA 3WDMA 1XEFA 3TOXA 1G3IA 4B3SB 1SB8A 3BHMA 1N2EA 2ZSKA 1YB4A 3L8HA 3FF1A 3QHPA 4EK9A 1TIPA 4WD3A 1XMQB 4X63A 3ZXYA 3DFMA 5AM0A 2Y05A 2I66A 2AG0A 1SU6A 4YJ3F 1YTLA 3HB5X 1SVOA 4CKEA 1BVRA 3A9TA 3LUFA 1MRSA 3CLTC 1U8EA 3EC1A 2QVYX 3QSGA 3U16A 4R8MA 2XQGA 2Q3HA 3FFBA 3RVMA 4AKTA 4ALIA 1TD9A 3QY9A 2GD1O 1FTWA 1N1MA 5EGSA 4CM5A 5LZ5A 1LF0A 4ZT6A 2C5GA 2CD7A 2QNRA 5IJ0A 2WAOA 1VSTA 3HL4A 4P4LA 4H15A 1GN8A 4MSUA 4UOZA 4CEJA 1PJZA 4V0SA 1S0UA 5FHQA 2BC9A 4P33A 3U4QB 4MW7A 1BQ3A 1HZJA 1AHPA 3HBAA 1YAHA 4BMCA 3INRA 1QORA 3KS9A 5KYYB 3TSOA 3IE1A 4DA6A 4YCAA 4HS4A 1G3RA 3PNKA 4G5SA 2AG8A 2KBEA 4J6FA 3UAVA 6ADHA 1ZUWA 2QR5A 3CEHA 4TYYA 1JJIA 3EMDA 2FKNA 4YRTA 2PHZA 3NJ8A 2C77A 4HAIA 4ZPJA 1UBMS 1HSZA 5D3QA 1TJYA 3ZNNA 4GKJB 2FUG1 2HWXA 2ZVDA 2D1YA 3PE3A 1UWCA 3KAJA 1QXSA 4DMRA 2I0FA 1KEZA 1P9RA 1U98A 4NBRA 1GPYA 1NBAA 1KKLA 4HN9A 1NW9B 1JHAA 1GU7A 1TQ8A 1MT3A 3ELDA 2C29D 1RRGA 4HDRA 4RTPA 3OTOB 3GNQA 4G5YA 4W99A 2XQJA 4YJHB 5D8DA 3THXB 1FXWA 3DEHA 4X1IB 3FF4A 3ACCA 1VI2A 4GDMA 4JL6A 2CDAA 4DDKA 4BNZA 1YR3A 3ZD6A 1SZPA 1ZM2A 3DZBA 3JXEA 2MYNA 1BEEA 4HYYA 1G8AA 4N39A 1HTBA 4MKZA 4OV6B 5L95A 3K70C 1DHTA 2JRCA 4P0QB 4LZPA 3NHFA 2WVHA 3NQ41 1Q7GA 3ESDA 2FRDA 3VC7A 4GL4A 1K6IA 4K6CA 2FCRA 3FGZA 4GMXA 3GFFA 1FDIA 3KUKA 1N57A 2MTBA 4MYCA 4KPGA 3TQOA 3T99A 2FPLA 2FPUA 4NYJQ 2ZTMA 5BYJA 3CLTD 1ZK2A 3RWOA 5JWOA 4FDUA 1VDMA 3FWHA 2ZRCA 3D6TB 4R2WA 4U0KA 1B26A 3P26A 2VDOB 4FN5A 4Y2QA 2DFKB 1O97C 3A4TA 3L7YA 4W7SA 4BNDA 3BGSA 1J2JA 4F72A 3WK9A 1MAVA 3SYLA 4C4PA 2EX0A 1GKUB 2HDWA 2VNSA 3UUWA 1BCRA 1NN0A 2GXUA 2YN0A 2JD2A 1OZFA 4Z8YA 4F60A 2Q1YA 4HP8A 4M1QA 4RHXA 4NFSA 4R54A 1YIAA 2P2ZA 2NTEA 4FNGA 4RXTA 1C9MA 1U7UA 3C3BA 5IK2A 1Q22A 2FZVA 3E2IA 3QVKA 3GF4A 3W1VA 4LSWA 4AF8A 2ECPA 4HDOB 5LQRA 2HXYA 4DKXA 2QG6A 1D6NA 1QSGA 3NHJA 4UHKA 2Z2ZA 5F52A 3DUFB 3MAAC 5IS2A 4OLAA 3STVA 2B8NA 1UC5B 7ADHA 2PCJA 2X7XA 2IYQA 2L0XA 3ESYA 3JX9A 4BB9A 3T1HB 4Q4AA 2G9ZA 2GDJA 1OGJA 4DQDA 2DH5A 3I6ZA 5DLPA 5B53A 1RQ2A 2ZU0C 1Z6PA 3ZWOA 1XJWA 1G7RA 3ZGOA 3VYRB 4F92B 3A3PA 1OXMA 3C7TA 2C5FA 2VHZA 1NUTA 3JWEA 1R0WA 1SXJA 2I6UA 3W5UA 1T9CA 1Z12A 3I92A 5FLEX 5EJMA 2X14A 4OQXA 3QTTA 1E9AA 3K70D 4OXXA 4N76A 3O8OA 4ZOLF 2Y1LA 4P0TA 1BU8A 1BYUA 2O2SA 3WGZA 5IT9A 3AR3A 1W7AA 2HQOA 1Q1ZA 4O4JF 5BRJA 2RHLA 1KETA 3LT4A 2W4MA 4IYRA 5DK6A 3IALA 3U4GA 1BXGA 3KV3O 1X7YA 3CJQA 3TJZA 2FPMA 3WTCA 1QU3A 1N0IA 1RCUA 2GX6A 4HXFB 3TDNA 4YDQA 2QMUA 3LBAA 4MRRA 4RPJA 2HUPA 3GFGA 1JUDA 3R3YA 3ADBA 1SG6A 1K7YA 1Q1GA 2HC9A 3H99A 4ALLA 1C1HA 4WKBA 5SY9A 3VPXA 3ZBUA 4TUYA 1U5BA 4S2UA 1AKEA 1T9GR 1XCLA 5EMKA 3ZDRA 5AUOB 2MOKA 3V4PB 9ABPA 4DJDC 3T06B 5IT5A 1WSBA 4RKQA 1FJGB 4BMPB 2HGSA 2GRAA 1UOQA 2VP2A 1KOGA 3FKQA 1XVLA 4QSMA 3L46A 4TQGA 1RWBA 3M4JA 3N5CA 1YQEA 3JVDA 1AKNA 4JB0A 1M0EA 2F9LA 4KQGA 3CKLA 4W5HA 5FI1B 5KTRA 5ENDA 3S27A 5ALXA 4POAA 4WX2B 3DLTA 1HOXA 2IYUA 3BWMA 3O2NA 1VLMA 2PU7A 1KNQA 2VSQA 3GIWA 4K6HA 1YI1A 2VSOA 3C16C 3GFRA 2Z9BA 2VBCA 1DRWA 3CV3A 4PLVA 4CMJA 2UV8A 3QYPA 5I4CA 4KWCA 5BN4B 1W52X 3V4LA 2PAAA 2QTNA 1UQRA 1I1NA 1PJLA 1CUUA 2WD9A 4X44A 4AMBA 4EBFA 3ERCA 2Z2XA 1I10A 1X92A 4B2PA 3AT1A 5HS4A 3EFHA 1A8PA 4EY8A 4MQUA 1FSFA 5TNXA 1T10A 3DHNA 1UKCA 2ZRHA 4N5DA 1KZYC 3BJEA 3JZAA 4EJ2A 3F5SA 4LFBB 4H3VA 1KMHA 4O2AB 3QFCA 3GJYA 4P22A 4U2CA 5C7LO 1CNEA 1EPUA 2YMMA 2VZ0A 1OGYA 2QBYB 1VE9A 1WXWA 2VJNA 1CQXA 5AJTA 2VHXA 4HDSB 1U1GA 5JVDF 4HEA6 1T9HA 1EUQA 4OQPA 4C0BA 4YI3A 2VDMB 1H8HD 2IXFA 3BIFA 1KIAA 5YASA 3U1VA 4D8VA 4GPEA 5HG0A 3WP1B 5C7OO 1UZMA 4YRNA 3ADDA 2CNLA 1UBRS 3A7EA 3CRW1 8LDHA 3FBWA 3B1WA 5AJUA 1DWPA 1P2GA 3JARA 5F9MA 2GN4A 2GT1A 4JL8A 1SULA 4EGAA 1EI9A 3RC3A 4W9NC 2EERA 3N2YA 5C35A 1DFGA 1Q44A 1EKXA 1MA0A 1IZZA 1U1FA 3JQAA 4UQPA 2BELA 2ZJAA 1J49A 4JI6B 1MVOA 4YX9A 1D8AA 1OC4A 1CHNA 4QXOA 3VZDA 2FEXA 2BZSA 4D98A 3Q5DA 1SVIA 3FWYA 2WU3A 4KI7A 1W5BA 2WIFA 3H2YA 2B1IA 4HPJB 2JLWA 1H0HA 3P19A 2V6IA 4MLPA 3W4IA 1IN8A 3P2IA 4DLKA 5L3SA 4C1NA 2PX0A 1KC3A 1L5LA 1KY5A 1Y3FE 4J7XA 1H3FA 2HJRA 3SG0A 1B4DA 2WWWA 1E1LA 5I9MA 3SN6A 4QO7A 3ENWA 1E96A 2VUTA 4R31A 3UNXA 1Z6AA 3MMZA 4M9RA 5BR1A 5JNRA 4P92A 1YJCA 4HNGA 1RRFA 4FEEA 2F59A 1XVUA 3ZE6A 1YZHA 2DKNA 2F67A 2ZJ8A 3SX0A 4HNHA 1TFUA 3DOEA 4FBGA 4MKRA 1ZP6A 1YCDA 3BIWA 4QYWA 1GM5A 3MT7A 3MTJA 5EIOA 1ZA1A 1WCXA 4BNMA 3SC6A 1YJBA 1BH2A 2Y1DA 3COPA 5JPDA 4E46A 2WTUA 3HA7A 2ZSDA 4BNXA 1PUJA 4EYKA 1V9LA 4PLWA 1XD8A 5FPQA 1OI7A 1TF7A 4W82A 4JU9A 1U28A 4IUCS 5AI5A 1I80A 2JAXA 3I1JA 3EHDA 1VL1A 3DUWA 2REBA 3R3VA 3DLBA 4AJOA 5H83A 1NVMB 4B7CA 2X5OA 3PFWO 3NC0C 3N7AA 3AUUA 1E6MA 3PCTA 4ZO6A 4DWWA 2O8BB 4MYHA 1I32A 4QC2A 1QG0A 5EEHA 4GPAA 1ESEA 3MGCA 2ODQA 2IOQA 3AEKA 4FS8A 4MPTA 1NMSA 4Q3OA 3E2PA 5JC1A 3GDGA 2PNJA 1T9BA 2G67A 5HF6A 2GK3A 5BXQC 3A9WA 3QBJA 4B4VA 3QVGA 5BPFA 5C1PA 2LE0A 2AFIA 3ZHRA 5A6SA 3AQ4A 3L4BC 4I5IA 2VTBA 1NHGA 4HJRA 2D2IA 3ESQA 3LHIA 2IH4A 3QX3A 2HADA 5CUQA 4TVBA 1DRKA 1Y7IA 3N2LA 3AWIA 2UYCA 1KR5A 3Q98A 4BFWA 1VHDA 2XCIA 4WCDA 2Z6UA 2G17A 2W0SA 3HJCA 2ZIAA 4QEDA 2IS4A 4PLFA 3QUCA 1EP9A 3KBBA 2NT4A 5ALWA 3QKSA 1V96A 1NMEA 4L5IA 1G38A 1P6QA 2A5JA 5FP0A 3HM2A 5FLXA 2C97A 2ZB3A 3ASYA 4JL5A 4N1AA 1J20A 4I2VA 3IAS1 4OBBA 2DT5A 3E70C 4KGDA 4RO0A 3WRVA 4AZ3B 4D4IA 3CJTA 4K46A 3R9XB 3RSZA 3CO5A 3OAAD 4HC4A 4GI1A 4RPGA 3D4IA 4CQMD 3M0EA 3GEHA 1MNQA 2OGSA 3FMVA 3VHXB 5JADA 1BXZA 4UD2A 1GUFA 1U8CB 4I55B 3AGPA 5G3ZA 3TYXA 3VA7A 5AHWA 3AFMA 1R4NB 1J0CA 1DKQA 1WMFA 2ZJ6A 1H8ED 3K2QA 4LJ5A 1R8QA 2JLSA 4O4LB 4XCXA 1LI5A 2OXFA 2Z8ZA 3IUBA 4ZEMA 4RW0A 5BNIA 4WZAA 1ECCA 2W2XA 3NW9A 4BO3A 3OBIA 4YJ3B 2MT9A 1F8FA 5KU7A 1OFHA 5I3CA 3IUYA 3QHQA 2QMHA 3ZHQA 1VIYA 2GLXA 1M1YE 1IWOA 3KZXA 3PXAA 4N8DA 4PLYA 3PNSA 1YRLA 3LH5A 1PE0A 1M5TA 1CZNA 1YS6A 4UHEA 3VH3A 3G2OA 4EY6A 1W48A 3QUAA 4NCBA 4L22A 2RCNA 4M7RA 4H08A 4MIYA 1KRWA 2GHIA 4LV6A 2R84A 4N9QA 1JQKA 1PR9A 3NIWA 1JA0A 4JP3A 1A8QA 2IJGX 2XWPA 3UJBA 5JNLA 2AFHB 2VA9A 1IFXA 2G5GX 3T8YA 2PZJA 4D6PA 2Q9CA 3KZOA 5KNDA 1WF6A 3WGIA 4E11A 1RCFA 1JEEA 1QPZA 3G3EA 4LBVA 4Y8VA 2QQ5A 3WGYA 5LCXA 1XFAA 3A37A 5A3JA 1X94A 2HF8A 2NG1A 3M8KA 5A5GA 2XAAA 1K6MA 1XDDA 3FIJA 1NZFA 4PPGA 4B74A 5E8JA 2C9MA 4QIHA 4XSHA 4BNFA 3HSSA 1JXOA 2EGHA 1TCUA 2VYND 4JLDA 4JJFA 1FYVA 3AR4A 1JI3A 4HDKA 4TSKA 5JTUA 2X0RA 2ODBA 3ABOB 1JV2B 3O95A 3M3PA 1XN4A 1ZIYA 3QU4A 1DBIA 3TR6A 5I9IA 4RKWA 4PZPA 1Z7WA 5GJVC 3RNLA 1TYCA 2GUWA 1X1RA 2HSWA 2XXAB 2B6NA 2WAYA 2D2EA 4I4LA 2OO5C 1NV8A 1XU9A 1KEWA 3QEOA 4GUAA 2WJHA 4PAWA 2Z1NA 4TL6A 3GB9A 3Q3HA 3BXZA 1CRQA 4AJIA 1UP4A 2DR3A 5T8KA 3L8CA 4C05A 1MH9A 1LI4A 3PRKE 5G4KB 4EEKA 5CA1F 4DQVA 3ZK9A 1YC5A 3BHJA 4BU0A 1U7XA 3T3NA 1IZ0A 4XWYA 1FTNA 4DCCA 1L7AA 2VJMA 5G0TA 4E30A 4WFJA 5HIAA 2YWBA 3PD7A 3OIFA 2M6SA 3PI7A 4FGLA 4YRMA 2KX7A 1I0LA 4OBWA 5KYWA 3OQNA 1WXGA 5FBZA 1CP2A 1HSOA 4S04A 3PFBA 5LQKA 4HNVA 5JECA 3Q8LA 2FRVA 5EQTA 3SSAA 3FYUB 2QVZX 3QNUA 4LKOA 4HNTA 1M34A 2QX9A 3FB1A 2YTZA 4UHFA 1JIUA 5C8DA 3N8NA 2F9FA 2MSWA 2EZTA 4F9TA 5ITZB 4RL6A 1AZSC 2OBMA 4HRYA 4NEQA 1EE2A 4PAGA 3VVBA 1MB9A 2OCLA 4L27A 1KDPA 1U2ZA 3OQMA 4Z4QA 1PVVA 2GM4A 2ZZNA 3IP9A 5AKLA 4QG3A 5EWJA 1NVDA 4NNJA 1NM5C 4X54A 2XKKA 1FPQA 1F2TA 3HUTA 1WP9A 1PTJA 2VBGA 3G0CA 2DYKA 4DR3B 1NT2A 1O4VA 1U3UA 5DGHA 3RFUA 2RBKA 1GOTA 3U9SA 3DWIA 1AQIA 3W7BA 4LMPA 1I6KA 1DMRA 3C8ZA 3QQ5A 2PKCA 2Q99A 1ZN2A 4NBSA 4NU0A 1FZTA 1GTVA 3E9YA 3NBUA 3VNRA 2HQBA 3C3AA 2H5JA 1KMIY 5JWHA 5IDXA 1A97A 3IJEB 2EP7A 2G4CA 1VPDA 1ELOA 5SZJA 2GPAA 2H17A 2O6HA 3KXPA 1M7GA 3JATA 4JJ4A 4GWKA 2V4ZA 1Z63A 2G9QA 4MRNA 1UT8A 5J23A 1ABFA 3MWYW 1II0A 4GWGA 4R1QA 1OU4A 5BW8A 5KEIA 4XX0A 1P61B 3EGDB 2HMUA 4B31A 3GBSA 4MVJM 1F0KA 2OPBA 4O4IB 2O05A 4F2WA 1FE8A 1NQVA 1NSYA 2YN2A 3QF7A 2WNSA 4HWOA 3GG9A 1E6EA 2BCEA 2PRZA 2QD4A 4RABA 3TAUA 5E1BA 4RGQA 2IFTA 3A0UA 4XGQA 1JBEA 2VK4A 4AO7A 4YMGA 1OH7A 1HDGO 1LSOA 2D13A 1E89A 2GN9A 5D5HA 3UCFA 1X0XA 2IPLA 5AKKA 5JAQA 2YCBA 2DFTA 3JQEA 5IYZF 3VR2A 2XVZA 3N0TA 3BTUA 2XZOA 2JVIA 3VR6A 7MHTA 1XLTC 3UMMA 3NWBA 2DQZA 3NIDB 4IIUA 4JLVA 4LNUB 4FM9A 3QF4A 3TLCA 4R1OA 3UUGA 2ET6A 3EAFA 1Z6TA 2UUAB 4F9FA 3MAJA 1Y7TA 1CEXA 4KDCA 4CF3A 4QDTA 1JIIA 3AR7A 3TSCA 2BJWA 4AKEA 2Q1XA 3R4CA 1DJPA 1YRQA 4I4NA 1RSZA 4Q4JB 4BCCA 4CLOB 1NVKA 1UWVA 3TKYA 3D02A 4YIHA 2DBYA 4UUAA 3NHKA 2VKTA 3DTYA 1U4OA 1L5SA 4BEJA 3OF5A 2Z6QA 2WHXA 2WJ6A 3L3BA 3E35A 4YAFA 2C9BA 1O94C 1OLXB 3ABQB 3IQFA 3QKRB 5BN5A 1W0KD 2XRZA 3IOBA 1W2HA 3OE7A 4UDOA 4HFMA 4CUZA 1TAGA 1EJ0A 3EZGA 4MX8A 1NJ5A 1UK6A 2AE1A 3NVAA 4IRXA 4DGSA 5AW5A 1XQWA 3RFVA 4FDLA 3V4SA 1Y34E 3F5QA 1LDEA 2HDOA 3V1NA 4DANA 1JBQA 1KU0A 1NQ5A 4JP5A 4LJKA 4S1OA 5TV2A 3RVQA 3W1WA 5L7TA 3CVXA 1W1WA 3EGVA 3EVTA 3U7FB 4NQRA 3DB1A 3W4KA 4DXDA 4E5SA 1ZLXA 2H2WA 1YU9A 5E4YA 2DWPA 4EKNB 1VGRA 2JIDA 4DV5B 4IDFA 3PI6A 3CY6A 5REQB 1X15A 2PGXA 1YZFA 4DKJA 2SCUA 1V6CA 4RHTA 1PLKA 4Y6SA 3Q8XB 1U2GC 2CLMB 3DDCA 2PUEA 1UMBB 1PP4A 3LY7A 4Q7LA 3Q8KA 1GKIA 1NF9A 1SU4A 4JEHA 3SDBA 1GGNA 2OFPA 2IW3A 3O3CA 1W5SA 2DQ4A 1JQDA 3CX3A 4HWKA 4K3VA 1IIRA 2AQKA 4L28A 3T61A 3ZHCA 3N2KB 4BXOB 3PTLA 2Z98A 1L7NA 3G9UA 2A0YA 4U9IS 4P83A 1SXIA 1RXWA 3L9WA 2LVBA 3S3TA 4OFXA 1PR3A 1NN5A 2YC2C 2WV9A 3EPLA 5TSDA 1X14A 2QXUA 2Z2YA 2WJZB 5LP6B 5JJIA 1GLNA 2AA3A 3PEUA 1FMJA 5DYWA 3VU0A 4B6OA 3R0XA 3FFWA 2W70A 1XRPA 1ISJA 3A0RB 5T64A 2ODWA 4M86A 3OX1A 1U9YA 1ZM3A 5I9SA 1B14A 4A2QA 5GJWC 2AXNA 2DERA 1FVHA 1QIGA 4RS3A 4EDFA 1Z6XA 3NOXA 2XI4A 4DCVA 4L0DA 1U7HA 1RYFA 4L5YA 2PH5A 3FLBA 3KPJA 4CKYA 4YP6A 1L1QA 2R6R1 5E6SA 1O94D 1L7XA 4XAQA 2D54A 2HGZA 5BMVA 3TG2A 1BHJA 2QQ0A 1Y5RA 2C8LA 3RAGA 4Q01A 3BULA 1JTFA 4RANA 1N3IA 3ISJA 5EJ6A 1N7GA 1OXTA 4QULA 4ATNA 3D8UA 1JEYB 1JPUA 2AN9A 2ZIGA 2W6ID 3HS3A 4ND3A 4RPHA 4BO5A 8ADHA 5IWAB 1NXTA 1X1TA 2FEAA 1G41A 3ZKWA 1Z2PX 2IZZA 3UJNA 4CQLB 2P1DA 5DX1A 5IVKA 4RE5A 1LPOA 1YKFA 3KEGA 3RVBA 3O75A 4BC1A 2PWPA 3OKAA 4RHUA 3G8BA 3TVYA 3LUKA 2ZPAA 2F9MA 2X58A 2FNAA 3DAOA 4KRGA 2FR0A 4PTLA 5IFKA 4Q05A 1RJ9B 1DJOA 4Z53A 4MV6A 2IWRA 1NQTA 4E2WA 4UU8A 2EW1A 4ER3A 5DYIA 2QR3A 3NGLA 5MN5A 4A16A 2BP7A 1G5QA 4OQZA 1IN6A 5K3BA 4CFYA 4E88A 3JY6A 3W5AA 1Z82A 4KDRA 4H1UA 4MR7A 1T4GA 4MV4A 2GJ8A 1JPVA 3MT0A 1NV9A 1XMJA 1GEEA 3LL7A 2H2IA 1QO0D 3HKBA 2OG2A 3NH9A 4QYXA 3EMKA 3ROGA 5J2UF 4F3NA 4ZOCA 2ETXA 2JD0A 2PTHA 1WXEA 2VF4X 4MWDA 2IU4A 3UM9A 2IRWA 2EBFX 1L7DA 2DAPA 1L5HA 2IYLD 1FVOA 1Q6ZA 3ZHZA 2YW2A 1EWQA 1K3TA 1RI5A 1W4ZA 2PX2A 3JR3A 3OA0A 3S70A 1N5JA 3W7AA 5JMTA 4UCQA 2Y9PB 1O54A 1XTQA 1JFRA 1GGEA 4MYTA 4R5MA 1XLUA 4PHCA 3G5AA 4YGYA 1AUOA 1SUBA 2FV8A 2GEKA 4Q16A 5G0VA 3HFGA 1M33A 2PVCA 3AZPA 1U8TA 3W5SA 4YJ2B 4AJ1A 5IASA 2CL5A 3EWAA 4HQOA 4C4TA 4KX5A 1YF3A 4Z0NA 4I5DA 7GPBA 5D51S 1NI4B 1EFTA 1JDPA 2BTOA 2BTQA 4A6XA 3HA3A 4Q1VA 1B93A 3D3WA 4Q9IA 2GXAA 1UMCA 4NABA 2ZIZA 3LZDA 3RANA 3DVLA 2FFBA 1A5ZA 5BVGB 4OJKA 4OHXA 3ELUA 4C30A 2IEDA 3F8WA 3GLRA 5T4EA 3F2IA 4GLFA 2I9PA 3SJUA 5TY0A 3ZGNA 1AKVA 2YIDA 4U8HA 1MXHA 1CY2A 1G59A 4MVWA 4D8UA 5K7SA 5K0LA 4MQ4A 4MWTA 2GSWA 2C3OA 1FFSA 3I28A 2FDCA 2H31A 3W05A 3U4DA 2B4RO 3E3AA 1AX9A 2QL6A 1YCGA 3UXEA 1T4MA 5FCDA 2NAPA 1T6NA 1JSZA 3EEFA 4K9NA 3WICA 2QRVA 4JIMA 1GNVA 2EC5A 1SHLA 1M2GA 2LGJA 2IYEA 3H86A 3OPYI 3WWPA 3HLTA 4NZZA 3ROPA 2EKDA 2ISQA 3IAAA 3QWBA 3HY3A 4X3PA 1ISGA 1HC7A 3KYCB 3ZCVA 4TVOA 3HB7A 1RU3A 1ZVJA 2J3KA 1ULUA 3GN2A 3R3WA 4LJYA 4OQQA 5AI0A 1AGXA 2O9JA 3VU3A 4QDOA 1AZLA 3RRMA 1Z7BA 4M9SA 1GA6A 2VT7A 1PNTA 4DM3A 1E1CA 5THKA 5U4XA 3ETJA 1WD7A 4G1UC 5LD2C 1NNI1 1YB1A 3LO5A 4UBLA 5C8YB 1LU9A 2NO5A 4KI0A 3UY4A 4B35A 2W42A 4U3JB 1A50B 3G59A 1NAIA 5DEOA 1U9JA 3O21A 4AZTA 2GLUA 2JANA 3LAWA 5AUPB 4B7XA 3U37A 1I3OA 1CUHA 3KZNA 2DPYA 4DZZA 3WNBA 4Q1EA 2RGRA 1NJ1A 5IZCC 4G1CA 3RF7A 1L2TA 1PKXA 2D0DA 2PS9A 3C3EA 1Z4LA 2W4IA 4MW9A 4XGIA 5C46F 1PGOA 4RENA 5DNWA 4C7JA 4E5UA 2QRJA 3R5TA 3LU1A 4JKOA 1FP2A 2ZYTX 3WRXC 1OXSC 2OP0A 3HR7A 4IIJA 4QUIA 3PKJA 1T5DX 1DQZA 3PD0A 2DP4E 4HX5A 3RHTA 1V8OA 2JFYA 4CR8A 4KXFB 2GCEA 4TWJA 1GZ6A 3PDHA 4B1FA 3HABA 3ZV6A 1R3DA 4OXKA 4XDZA 3A32A 4KGXA 2QTVB 4KTTE 3AXTA 1T4CA 2FOIA 3B2EA 1IJFA 1EUZA 1YS7A 3MEQA 3R6GA 4KQHA 2P8SA 4QSHA 4AS3A 3BA1A 1YMVA 4WY5A 2HMYB 2HK7A 4RVOA 4UNQA 3KKPA 3HMKA 3IVXA 4L8VA 4OHBA 2HCRA 4PHHA 4EB6A 3T5CA 2JRLA 3ZC3A 1LS1A 4H3KB 4IXMA 1W49A 5K51A 2B37A 4NHOA 3DAGA 3ODGA 4Q00A 4X7MA 4BGDA 1FF9A 5JD6A 4DB2A 4R1UA 4HWRA 4JKIA 1DKNA 1X8XA 2J4CA 2J6BA 2GWRA 3A1UA 4G4JA 3KQVA 4MVJP 4NDNE 4OYHA 2EIXA 1PT6A 3IXLA 3BIJA 2PBLA 5L40A 1Q0LA 1DIOB 2BEVB 2YJTD 4UHBA 3TZCA 3NJRA 4E1BA 2D0PB 1BMDA 1SKQA 4NMLA 4BLUA 1N2ZA 1YCFA 2BUCA 3G13A 3BXEA 1KF0A 3C6YA 1PGNA 1CZUA 4YFYA 4EJ0A 1KQFA 5AOAA 4FZRA 3DOJA 4LY9A 3WOHA 1SCIA 6REQA 1NP7A 4DIUA 3O9MA 1PL8A 3HWX1 4KPUB 1BCSB 2ZATA 1SM4A 2WUDA 1KJIA 4JCCA 5K8VA 3PDCA 4Q3DA 1XYVA 3BWVA 3LDUA 9ATCA 5F7JA 1GKLA 1RYEA 4MV9A 1OLSA 1YVPA 1OBCA 3K71B 5F7OA 2VPIA 1WB6A 4B6JA 4YQZA 5CB4B 2W83A 4PS1A 4NCNA 2FPPA 4O6VA 2CYBA 1ECBA 3LPMA 3A1VA 5CDFA 1P33A 3ENZA 2B1GA 1E2EA 5JVDB 4UFNA 3GU3A 4BS9A 4LNAA 2PK3A 1J7JA 3HBJA 3L6CA 1RPJA 5ERGB 5B1YA 1T15A 1LSSA 4CV0A 4BP9A 4QGBA 4JLSA 3PRYA 2OV2A 3F67A 4OH1A 3CHYA 3WAKA 1BE6A 3C3DA 3R3ZA 3EY4A 1LX7A 2H0AA 4CL2A 3EG5A 4HFNA 3CF6R 1OJLA 1T1EA 5DHSA 2WP0A 2AL7A 3KKOA 3RAPR 3WGJA 1JWAB 4E07A 5IC4A 4RPLA 1YT5A 5ELXA 10MHA 4H7KA 4CL0A 4EW3A 3WZMA 3R40A 1PJ8A 4WEQA 4YAKA 3G6KA 4PTYA 2A86A 4JV5B 2CMKA 2CY0A 1YK0A 5BV1A 3TZBA 1L4EA 4RIIA 2HEGA 5E38A 5JFGA 2XJ4A 4I1VA 4QDZA 2O8CA 1GTMA 1EUCA 1GZHB 2BI4A 4LHEA 2HRQA 5BN1A 3DWGA 2XNKA 3IP3A 4CKCA 3DR5A 4IFEA 1GZDA 2JKZA 4MA4A 3VSAA 4EHJA 4EX6A 1FP4B 2OZLB 1GFIA 1Z6QA 2XUKA 1MG0A 4FD2A 4JLWA 1F4LA 1N9GA 1I7LA 3IIJA 2L69A 2PUVA 5DGCA 2YNMC 3QMMA 1Y7LA 4WERA 4L9RA 4LI3X 1YS1X 2A9KA 3NTVA 3EXHB 1XDGA 3HGMA 4HGPA 2QUAA 4Q3AA 2RKWA 1QYVA 4TLCA 4F0JA 1QCZA 2ORIA 3QVOA 3DLPX 4G6ZA 1WL8A 2EHDA 3PEEA 3C3XA 4IOJA 4D3YA 3OFJA 3PBKA 2JHFA 3GLSA 4TV8A 3PKZA 4Q93A 4WKGA 1KHHA 1F12A 5AVQA 3V4OA 4NY1A 4JJGA 1M6VB 1NVGA 4K5QA 1G60A 4BN4A 3T15A 1AMUA 1XKQA 1RNLA 2GN2A 3TQCA 5LU8A 4CEHB 3FYCA 2RHDA 1R6AA 1X2EA 4HXEB 5HM6A 5FTJA 5J1SB 2HCTA 3GBPA 4QOGA 1KAEA 9LDTA 1YHZA 2VDVE 4PC6A 4WFIA 1YJ8A 2ZE7A 1AZTA 1X1EA 1P31A 1VMKA 1DE0A 2W2LD 4GOKA 1FJXA 3HDVA 2ZUFA 5FHRA 4FMBB 3WYDA 3FTCA 2QW0X 4YDRA 2R6DA 3T7IA 3SJZA 2WJYA 2R8YA 3FCUB 3VPFA 4MHTA 4BUJA 1X7GA 3KQWA 3DE1X 4DR7B 2GRJA 3A4NA 3AUKA 1PX0A 3O8LA 4KFCA 2J5KA 3BFJA 3LLCA 4GT1A 2OYRA 5ERXA 1CDOA 4ECAA 3BMNA 3GL9A 3KKQA 3OIWA 4ZO4A 4DDMA 5AVRA 5JY6A 3FNGA 3IBTA 1ISSA 3FSGD 4CWAA 1WDMA 2BMDA 1KO8A 2O57A 4PGAA 5TMBA 3DDHA 2NUAB 4JMLA 4PZLA 1F4VA 1KBOA 1DVRA 1H9AA 1KTVA 2QP4A 4JLJA 1P7YA 4GP9A 3HBNA 3C39A 4DBZA 3R7WA 3LY8A 2GN0A 3BE8A 1LJUA 4L4UA 1E0SA 2OHOA 5U4QA 3WA6A 1PV4A 3HEMA 1G20E 3MTDA 5LQCA 2H85A 1U9IC 3EUWA 4NV1A 4QOJA 3FOWA 2ODEA 4DXHA 3EY9A 2PLNA 2PKRA 4FINA 5J59A 3SYKA 4DUZB 3DD5A 4A6DA 1G5HA 4F6RB 1W4RA 2ECFA 2JH8A 3WQRA 4B09A 1QQ5A 2VHJA 4I4TB 5CMLA 2QW8A 4ZYWA 2YMQA 1P0QA 3NANA 4N7RA 4EAAA 4N6OA 3KOOA 4F46A 1DOAA 1ECJA 1YE3A 3DKKA 5LMNB 2NO0A 4ZZ2A 4AXBA 1IHDA 5DGIA 1WUHS 2IYPA 1JHYA 1UBUS 4WNAA 3OIDA 1L4LA 1RRPA 2OCBA 3NTXA 1M72A 3ECCA 3ROEA 821PA 3A6JA 3I64A 2X1LA 4M76B 2QN7A 1A9ZA 2ZRMA 2XNHA 3I6MA 4EJFA 3I61A 4LQDA 4AJ9A 1D2EA 4URUR 4DLVA 5HNKA 4NDZA 4GDFA 4XEUA 1OPRA 4YWJA 1V1RB 4WGFA 1CJKC 2FGKA 2RH5A 2WSLA 3BJIC 5J40A 4HUJA 4WXPA 2P65A 5C31A 1ST3A 3TBFA 4LDZA 3E22A 4MVJI 5FAXA 3SHTA 5IDQA 3DDNA 3KYDA 5HEKA 3EJ6A 2XAUA 1YB5A 3S2SA 3E7PA 2KW5A 5ILOA 2P27A 3UWPA 3Q87B 1Q0HA 1ZGJA 3FH0A 3FUTA 2ZIWB 3MGKA 3OE4A 4CV2A 2YC4C 3SVTA 1A69A 1FBNA 3BFKA 3T1VA 2WFLB 3L7OA 1X7WB 1GNLA 5KDLA 1WCIB 1WKCA 3QTLA 3U17A 1CUIA 2J33A 4Y6RA 3AP2A 3VFDA 2PJZA 2R8BA 4GGOA 1IJBA 2P5SA 5AKZA 3UTCA 1VE1A 2PUHA 3AVXA 1L7QA 5EOVA 1QP0A 3B2QA 1JZSA 3PHIA 1P3JA 4CF7A 2C7PA 3RBZA 4JT8A 4NHEA 1L4HA 4O8CA 4NULA 2I6GA 4W9RA 1S01A 3FOBA 2XKJE 5AESA 2FSPA 1WVMA 1ZGZA 4W5JA 1S4MA 1U0FA 2DZDA 1RZ3A 2AXPA 2H52A 1FFGA 1Q50A 4Z0TA 3ZY2A 4LPKA 5KSPA 4QDXA 4EX7A 1YJQA 3DPSA 3WK7A 5EE5B 1UT6A 4D8WA 2NUTB 3IKVA 1T2VA 1V8ZA 3JS5A 2YUIA 4FFLA 4QYSA 1I51A 3A6ZA 4J4BA 5CW1A 3P94A 2J48A 4DMGA 4MARA 5DHUA 5EINA 1UEXC 3T52A 1V26A 2FK7A 2FMIA 4WNCA 3AV3A 4ND7A 5LSAA 4Q0MA 2XYRA 5M7EA 4MK4A 3L5KA 3ND6A 1H6AA 4A0GA 4AP6A 2CHUA 3MQFA 2H1HA 4XXHA 5JHGB 4F21A 3EZNA 5HPYB 3WWYA 5KSYA 5EP1A 3OOWA 5ALFA 4CF5A 4UZEA 1G21B 3PFNA 4GBED 4CIBA 4YRRA 1Y63A 2SICE 1E2UA 3RCBA 2G0NA 1P60A 2R4TA 1WXQA 4J16A 5H8WA 5L3ZA 1YZQA 3EB9A 3IP7A 4G0UA 3TXAA 4YRAA 3OLYA 5DNAA 2YY7A 4G3XA 2PBZA 3DYBA 4NAHA 3DGEC 1DTWA 1A1VA 4YAOA 4AUEA 1JEOA 4KWHA 3CLKA 1WU7A 1YZKA 1NW3A 1FLAA 4NZNA 3IUPA 2H9AA 4CDNA 3BD7A 3KD3A 2CE7A 3IILA 4A7PA 1L4UA 2BBSA 5B4VA 1LSJA 1ZDMA 5I3ZA 3OM0A 2DPMA 1NJSA 2EL7A 3BAFA 5AM5A 3AKZA 5ESXA 4EQ6B 4QHTA 2WZBA 1QIFA 4PZZA 3IBGA 2C5AA 3OPVA 4MYRA 1IVSA 1JR3E 2EWMA 4YV7A 2YXDA 4YIKA 4WOJA 2X22A 1P19A 4LV8B 2ADMA 3MUNA 4B3MB 4G4SO 1R6TA 4H4DA 2QNBA 3R2JA 5FQOA 2CDRA 1UKAA 2ZRBA 3K94A 4KE9A 1P1CA 3PFFA 4PO3X 3RB8A 4AX4A 4E0BA 3L40A 1JNYA 4V3CA 2Y1OA 3KFVA 4UJ5A 2CHFA 2PANA 5U1PA 2R97A 2ZZMA 3UQYS 5KWJA 4TMFA 3WNZA 2HA5A 2HN9A 4L8LA 1UEIA 4U7TB 1IWPB 2FWRA 4EJ6A 4A91A 2GTHA 4G8BA 4IYJA 4CLRA 4BKUA 3D4PA 4HDQB 4YJFA 5E2IA 4ENUA 4BEVA 4ZI7A 2ZSUA 1DJNA 1KYVA 1VIVA 4UEJA 2FEKA 4EO4A 5ELLA 1AQNA 2ZIEA 5C5DA 1FFEA 3LT1A 3IS3A 2JGMA 4BBJA 1UKVY 3EF0A 4BTEA 3EIOA 4CKWA 5C53B 1KNXA 3KVNA 2TMYA 1F3LA 2XB4A 3J7AC 3WBFA 4PX5A 1P5JA 4TUYF 5AKIA 2O5EA 5AD1A 4HDMA 4UEKA 2PLFA 4TSFA 2CV2A 3CZPA 2ZP1A 3DEJA 4A82A 4F3CA 5EQDA 3MGBA 2FWMX 3IIMA 2V0CA 2X4GA 3A9VA 3WBKA 2FJ0A 3CKKA 2NQ2C 4ZVTA 5K0ZA 4GX1A 2ZLBA 3STWA 1KY4A 3AK4A 4D9GA 1XJ0A 2Q1TA 5CBPA 4O2BF 3DZ8A 4PVDA 4DIKA 3QLVC 3GMDA 5DT9A 4EENA 5LIRA 2V98A 5A02A 2OBNA 3WO1A 1ZN7A 3AUJB 2II6A 3V32A 2O8EB 1WOMA 4C89A 1PFGA 1BKDR 1GZ5A 3U3RA 1WNFA 5C4MA 1YVUA 1V2GA 4IZHA 1C3EA 1ML4A 2GFIA 2HF7A 4CPDA 4BBZA 2CLIB 3JASA 1KI6B 1JSLA 3KTDA 3UB4A 4ZCMA 2CF6A 4BO9A 1WXXA 2DLNA 1N2JA 3B9QA 3DAFA 3ESRA 3R5JA 2XRFA 4I1SA 4J0HA 2WD7A 4TGLA 1B8OA 4GSLA 3VYUB 2C4WA 3ZQ6A 2VR1A 1PJ3A 1RXYA 5K05A 1W36C 3IJPA 5K4HA 1ZHOA 4AIRA 3NHBA 1GITA 3LCVB 3UGTA 2XBUA 1S3FA 1G8MA 1H2YA 3Q9NA 5FI3A 3M1AA 1FS5A 1RHJA 4D46A 4O63O 2FW6A 5CVEA 5CFRA 1XRNA 3HKDA 2X5JO 3QA3E 4IM7A 4HVTA 4J6EA 5BUCA 4R2XA 4MKFA 1TM3E 5JEEA 3I5AA 3TXXA 1I2BA 4P7JA 5J5AA 3D6NB 4RS4A 3PHCA 1KS2A 3KELA 4Y98A 5EQJB 4BZWA 1COZA 3JQ9A 2VDWB 3OQJA 3HYNA 4OU4A 4RA9A 3ROMA 3U3JA 1PCXA 2FEPA 5J2TA 3KB1A 4IKOA 1P2DA 1QR2A 2RAFA 1TUGA 4LDPA 4WASA 3F7OA 5AWFC 3OT1B 1VJ5A 2DHQA 2WYHA 3EQ9A 4B71A 1CJTC 2A7QA 2P75A 2XEXA 1U2EA 3D8TA 2XMDA 1G8KA 1IUNA 1FY2A 2YJ6A 3K73O 5TQ2B 2AR7A 1DI0A 4Y1FA 2NU8A 2Z95A 2BFCA 3ONEA 4JC4A 4HBZA 3VOAA 2JFOA 5AK3A 1GRQA 4HB4A 2N75A 4F71A 3AFIA 2OMKA 3FE2A 4JBGA 2UZ0A 3BBPA 2WW8A 3GCGA 3CTPA 1MX3A 1QAOA 1ZGGA 2F2TA 2J9RA 3H3JA 1JE1A 2JEZA 4UMVA 4RZHA 3OM9A 2HO5A 5AI8A 2VVTA 3V2GA 2VDJA 3TNDA 4A92A 2V6FA 5JW6A 3TFQA 1QQAA 3E9ZA 2B1QA 4RF5A 3VC3A 2CXRA 1KYWA 2QTCA 3FYHA 5IKPA 2A9RA 1M2OB 1G63A 2C78A 1QHSA 2XQVA 3OZGA 1KKMA 1NVWQ 2AJBA 4HZGA 5CEJA 1KRHA 5ALQA 1OOEA 4R68A 3AMVA 5H02A 4D3XA 1J99A 3CZ4A 4Z9XA 2G63A 1AGPA 1PJRA 1QZZA 3AWDA 3O5AA 4EVIA 2IS1A 3RIYA 3LUBA 5I45A 1OPXA 1W36D 4S24A 3TLGB 4EHHA 2QLBA 2AYYA 1M6YA 1MJHA 4N7BA 4MW2A 3DKRA 4K6MA 2GXSA 4EJSC 4Y2UA 3JALB 5DNDA 2CDCA 4FC7A 2FSIA 4KXQA 2C1ZA 2AT1A 4RVNA 3WMEA 3ZY4A 3ZE1B 3KQMA 4LYYA 3DNMA 4A1FA 4K8RB 3MRSA 5E9QA 1A1SA 3TH5A 3VR1A 4LYAA 3BGVA 4KHZA 2X41A 2W2PA 2XMRA 2XW6A 1EM8B 2ZJZA 3NNSA 3O3MB 2JGDB 4FMPA 2IEYA 1VRCA 2ATIA 3ER6A 4G89A 4NBWA 4EHDA 1E79D 4X84A 4B83A 5AW7A 5AVSA 4DV4B 4XB1A 3RYIB 2H8GA 5TDHA 2VTDA 2ATXA 4BX2A 1C8VB 4L57A 1GKYA 1LC3A 1YA8A 3LVRE 4JLPA 2V8OA 4M1TA 5KVAA 2CV1A 2OV6A 4LVUA 4FSXA 1H0KA 1TQHA 3P9CA 4LCBA 4URHA 4YMVA 4HDNB 1M2VB 4D4LA 2D2VA 5H80A 1OX5A 2Q3CA 2R3SA 1Y8ZA 1VHJA 1D5WA 2VF7A 5E7IA 2M2IA 4I5GA 3GA7A 1WZEA 1NE7A 3IIKA 4ARSA 3INYA 4K03A 3IXMA 1VIMA 3M9XA 4INAA 2YV3A 1H4TA 1JF8A 3SU8A 4ARIA 1ZEJA 4JSYA 4RYLA 4H7PA 4YUVA 1XZHA 2FTKE 2Q9BA 3IE2A 1E2MA 4ED9A 1GUAA 4M0MA 2B7CA 3WHPA 1TYBE 2Y6VA 1RXSA 5EJFA 2I3BA 2ZDQA 1R6DA 2IUTA 3R9KA 4IIXA 3SHFA 1AKMA 2OUIA 4DJ5X 2REXB 5JRZA 3ES9A 4M1KA 2RGDA 1D07A 4MCHA 5LUBA 4DJTA 3SVLA 2NTJA 4EPYA 4EW6A 3D6FA 4AN1A 1M1ZA 3UAZA 1ADGA 1GCGA 5ALTA 4BPRA 5DF1A 1XPOA 4LRYA 1GKKA 3WGHA 4WIAA 2AZTA 4JUDX 1BJTA 5TMEA 1KEKA 1E5QA 5B4TA 1JZTA 4CKEB 2E1PA 4W1PA 1JT2A 3QENA 1YACA 2JI7A 2HXSA 3NVMB 4KVFA 4RSHA 3KKMA 5B58T 4D9MA 4GEGA 2Q5FA 2WJVA 2MU1A 1W9MA 2GCOB 3O26A 5IJ0B 4X60A 3D3QA 3USZA 3CUKA 2AD1A 1PWZA 4CEJB 1IZ9A 5B2ZA 3GLVA 2VDUE 3BF8A 5BSTA 3AJ9A 2GZRA 2X0FA 3LHDA 1BGWA 1T3HA 1XZMA 2ZCJA 3UJ7A 4I0WB 2JHGA 4P1ZA 5HIJA 1JLLB 2DE0X 4J0FA 1IY2A 1PZNA 2UZ1B 3A2NA 2FSSA 3U7JA 1ODSA 1UDWA 4RIEA 1G8FA 2QMOA 4F04A 3JYQA 3PFHA 4U7DA 2VPWA 3IQXA 2DM6A 4FKBA 3DXXA 3GEGA 1J9ZA 3CMCO 2C0CA 3EQ2A 2FFRA 4O5AA 2PUCA 4NBKA 1ZA2A 1HORA 4FXOA 4KYVA 3C24A 1TM2A 1T0UA 2D8MA 2V0NA 2D2FA 2LCIA 5HOEA 5IXJA 5JNUA 1OREA 2W6CX 2EVWX 1KYXA 3DXYA 3OX4A 4X85A 2UZ3A 3SQMA 1HEYA 3MRTA 4BEBA 1CZHA 3PPYA 4HDRB 3EUEA 3RK1A 4YXWD 3A6EA 4G8JA 2Y77A 5KTNA 4IR7A 5FDFA 4X93A 1D2NA 1ZW1A 4AJLA 4KLAA 2IZ1A 4V0LA 3E1SA 2IIQA 2ZRNA 4WCFA 2WT4A 3QLTA 4DYHA 1ZCZA 4IPTA 1DCKA 1C50A 2BSAA 4HV4A 2QX6A 3DMDA 4EKEA 3H0CA 3NB0A 1FSSA 3K1JA 4WXYB 1Q7TA 4I2NA 1Z9BA 4IMIB 4PPFA 1NRXA 1N0VC 2IT1A 4LUCA 4QHYA 4DSTA 5LJIA 1APBA 1P29A 2VSFA 1N6NA 4IO0A 2IH5A 1HE5A 1R0CA 2N0SA 4FLMA 3SFVA 3WLFA 3N2GB 4HGOA 3ZCXA 4KK3A 4GIBA 3MRVA 4R1PA 3AY3A 1NZJA 2RG7A 3QEKA 3GPDG 5KDOA 1DQPA 4R0MA 1ZBDA 2ZQ5A 3I2IA 3SIWA 1Q83A 2O50A 1NXQA 1EA5A 1OVMA 4D57A 3IV7A 2BHSA 5EJ2A 3FNHA 1J2EA 3UK1A 1DC8A 4IH9A 1OTXA 1TJNA 4G23A 2VZ8A 4WK0B 2ZQYA 3GFVA 3TTSA 5BURA 1VLQA 5K8CA 3VKUA 1H8HA 4LZOA 3ANLA 3QYJA 4DAOA 2OENG 4DPLA 2FW8A 1OZHA 1PBTA 2ORYA 2W5UA 4AJKA 4BNDB 4D97A 4DQLA 1TU3A 1X86B 3BRWD 1Y82A 4IINA 5TE9A 1ZXLA 3ZU2A 7YASA 5I01A 2JLVA 4FE7A 1JFVA 3OMLA 4Z4CA 4LHWA 3TN7A 4BGVA 1XVAA 1BCRB 4OPMA 1QYRA 5HCIA 4UTRA 3O8QB 4UKDA 4YP5A 5ITWA 2WYOA 4NFYA 4M21A 1KO7A 2R85A 1X0VA 1XNHA 3MB8A 5JSYA 4EG1A 2WSSD 3O4GA 4WOCA 5K8JB 1DAIA 1AO3A 4OLHA 1QK4A 1WUJS 2BF7A 4J9UE 3TUJC 1ZNZA 5KQRA 3GH3A 4PS0A 4MWGA 5HQJA 5JRDS 4QOIA 2FXIA 1P5ZB 3T12A 2H51A 4BWYA 2JBWA 3CSSA 1RFGE 4F4UA 2WB4A 2WTXA 4KMSA 3K1YA 2AW3A 3B7PA 1SBZA 1CR1A 2IPMA 3BK1A 5EC8A 3DEAA 4Q4AB 4ZDWA 3SKXA 4D02A 4DYVA 4JP1A 4U5QA 3JZFA 1V4BA 4MWZA 3NM4A 4U2KA 1F06A 2UYOA 2YHIA 3UMRA 2GLTA 1YRWA 5C5IA 4E1AA 2FX3A 5A1TA 1ZUIA 4EM6A 5CK5A 2WPNA 4XH9B 2PZKA 2RIRA 4ZQFA 5F35A 3VR6H 2OZPA 5FB3A 4P3NA 2PGAA 4Z5XA 5GVSA 1YNOA 2GGSA 4DBVO 4TXNA 3BSWA 4JBWA 4F91B 1TZMA 4EKYA 1YHYA 3IT1A 3B1YA 4RTLA 3PPXA 3K0SA 3O8OB 3BTOA 4DV0B 2NP7A 5I7UA 1DAGA 3HI4A 2X13A 2ZJ3A 3BCHA 2AWOA 3KVOA 5TT1A 5F5NA 4NEGA 2CCKA 4TXMA 4K9LA 4PYIA 3ZWAA 1JDVA 1BXGB 3QG1A 4YI5A 4A2PA 3RYHA 1X7YB 1R18A 2J67A 3Q1LA 5CIYA 2BYTA 4J4HA 4UE2A 1RLTA 3NT4A 3OOHA 1ZJ5A 5BT9A 5JBQA 1COWD 5H4GA 5L45A 1MOSA 3SQNA 1SU8A 1H4QA 1U0JA 2ZDHA 3HN2A 1ZM4A 1GVHA 2JGJA 1KPGA 1NY5A 1U5BB 1UZUA 2R5NA 1L5MA 5TLSA 4AG5A 1BNCA 4ZYVA 3T38A 1NBMD 3GPIA 1E98A 3R3HA 2QSYA 2MDTA 3GJQA 1P45A 2QVCA 3GELA 1FNDA 3OQHA 3P0HA 3TOSA 1D2MA 1XAIA 1IOLA 3C97A 5JLAA 5COQA 1I4DD 4YJGA 4YRPA 2IP2A 4LC9A 2Y4NA 4FSDA 4D9FA 3SWWA 3KVRA 4QTXA 1TKCA 1VZ3A 3M5WA 2G82A 2WYUA 4PG5A 1WRBA 5FUWA 2VDQB 2IPNA 3VGJA 3I4LA 4RFLA 2BBTA 5AJZA 3JSXA 4R51A 4QZVA 3ZVKA 4YCSA 5JCOC 3B8HA 4GI3A 4GP7A 4ZALA 3S2FA 3AVWA 4I9FA 4XLZA 1ESZA 3OAAA 4CU5A 1DV2A 1Q92A 3DWEX 4CQMA 3QX8A 1CWUA 2DBRA 4P4SA 5DN6D 1UBNA 2Y71A 3NFRA 3PCRB 1A8IA 2P69A 3FTEA 4OYYA 2J3MA 5IW8A 1KMHB 5KTTA 5CVVA 1H8EA 1TIBA 2REQA 3WWCA 2FE1A 3U4HA 1T9ZA 2XDWA 1ZIOA 4UXIA 3IE0A 3RKRA 2YOFA 5DZSA 2XGMA 4EVQA 5IVHA 4G9GA 4WK4B 5E3JA 4YT4A 4E5VA 2MSCB 1SUCA 5CCDA 1U2QA 3OE5A 1SK9A 1WZCA 2XUHA 1S7GA 4AP5A 1H9CA 2E5WA 4OD0A 5FPYA 4F85A 1MAWA 1ZRSA 2K4MA 3RABA 1FK8A 2PUWA 3K0EA 1IN7A 4JOBA 2Q07A 3THYB 4MUGA 2QLMA 3UK2A 2P9EA 5F98A 5BOSA 3OCCA 4UDYX 5KJCA 3DOOA 1HG1A 2V3VA 1RS0A 3B6MA 2G1KA 4RJKA 2D7JA 3CWCA 2A6PA 3JQAB 2OE2A 3RJTA 1K9SA 5IHPA 1IXKA 1UBSB 1KE2A 1Q12A 4CUJA 5JXJA 1RVDA 2C92A 2JZOA 2RK6A 4LVOA 5CPFA 2JCVA 2JEOA 4C87A 2VRCD 1L4GA 5F3DA 2NO9A 2F3SA 5AKGA 1CUFA 2FEWB 2RI1A 3DE5X 4BJ3A 5L3SB 1Z4IA 2J3HA 4I9GA 4RVGA 5IKOA 3KUDA 1EWVA 1EVIA 4K05A 3AVVA 5A2GA 2IY8A 1E0DA 2Y0DA 1UMDA 4UOEA 2VYNA 1X2BA 1DC5A 1LBQA 3DCNA 3OLQA 4U6NA 5E0OA 3EVDA 5IAOA 2ZM6B 3AUTA 4ACBA 4I1UA 4MVJE 3T0IA 1ZSVA 3KD2A 2O5RA 4KFUA 1FJ2A 1YV9A 2GYYA 1YJ5A 1ZJYA 4UDNA 2WTBA 4Q1DA 9LDBA 2NU7A 3NYWA 3KRTA 4JWTA 4NZYA 4S3MA 3EDRA 4IW3B 5EZQA 5T4BA 3D7SA 3G8YA 3SAJA 5A5FA 4AS1A 4ZCIA 1LZKA 4JP2A 3B6EA 1N92A 2QIPA 2G5CA 4O2LA 5KYNA 3GLIE 2C96A 2RGGA 4BO2A 2I6FA 1JG2A 5CB8A 1SVWA 4BP1A 2JIZD 3FTDA 4TQ9A 2AOUA 4HYQA 1NLFA 1E7MA 2P6PA 4GYJA 4ZT2A 1GRNA 3RUIA 3RC7A 5JARA 1JYSA 4KU4A 4JBIA 4O3FA 3TINA 1GYQA 5C5CA 2HA3A 5F2EA 5IJ9A 3HKEA 5AJWA 3GQVA 4US1R 5ALOA 2PEYA 1PK7A 1UBLS 1SMKA 1UK7A 3RHFA 4Q9HA 1E7WA 1QWOA 2FPIA 3ROFA 4EEXA 5GZ1A 1WABA 1PJAA 3AEKB 3A1CA 4LJ8A 2HA2A 4QBGB 4C3OB 3LUGA 4L8GA 1R9MA 3QVGB 3UH1A 4PY2A 5IPFA 2AFIB 4WXEA 3UMFA 3C41J 3D0OA 1W1UA 3HA5A 2HMTA 4MPRA 4LZNA 2P9QA 4I6JA 1TECE 5TF0A 3D3KA 4TMWA 3WOVA 3VNBA 4LMAA 5IRCD 1CQJB 4ZYUA 3KDSE 1ZK3A 2F1OA 2XMPA 2PKYX 1QCDA 3K0HA 1DSSG 2G9VA 3D54D 4L8FA 4QHSA 1XTBA 5FFNA 5PGMA 4G97A 4RIGA 3S2GA 2P78A 5EHXA 3H5IA 2X40A 1P1KA 2DUWA 2YXBA 4HFJA 3QXJA 3RGGA 2P68A 4H60A 2BSQA 1DC4A 4IZIA 3EC2A 1JECA 5L6LB 3EULA 1HEUA 2BJVA 3MW8A 3AI1A 3OESA 3WKAA 3JPWA 4HLCA 2VP6A 2V6GA 5IXSA 4N3BA 4PNHA 2Q0HA 4LTDA 4M60A 2HSJA 2IV7A 3ILSA 5A6SB 4QGSA 3TL6A 5G0WA 3RV3A 1NJ8A 1NDHA 1VCMA 2IDKA 2DPLA 2YUTA 2P2NA 4FI3C 3HU1A 4U7FA 3CCBA 1DAKA 1T5TA 4HQ0A 4BVBA 4WZAB 5F1KA 5LWHA 2BEWA 2OO5A 4Q1BA 4E3ZA 4Z3OA 3ESZA 4XEHA 3SKVA 1VA4A 2OHJA 4GSYA 4UTZA 3HU3A 2H4ZA 2PGIA 3WL7A 2A1TR 4TMVA 4IILA 3ZXXA 4FHEA 2L17A 3I6IA 3S6JA 2EEPA 3UIEA 5CJ2A 1G8GA 1O6BA 4QRDA 2EWVA 3EQZA 1YONA 4S0ZA 2ERXA 4IVNA 2AJTA 3PQ4A 1DC7A 5JZOA 3MLEA 5IUKC 3B48A 4J8PA 2PUDA 3IUQA 4OGFA 4NYMR 4YJDA 4BKPA 4OXYA 4CM3A 1MH1A 3VDNB 1KQGA 4KBFA 4EP1A 1OD6A 1QH0A 3VC1A 1BN6A 3BGWA 4OP3A 3N28A 4MICA 3TTXA 3NBXX 3EISA 4H7EA 3UWSA 4HAWA 4OJNA 4MIOA 1UKYA 3MXOA 3R77A 2PLWA 3WADA 3B7WA 3AIKA 3IA7A 3NIBA 3W77A 5CJPA 2HTFA 4OKSA 1TMKA 4QVGA 1NM5A 2Y6UA 1Z88A 1IN4A 1Z4QA 3B7GA 3BORA 1RLOA 4HDKB 4NARA 1D9ZA 3S7TA 3W9UA 3RV4A 3MG9A 1C0LA 4XYBA 4F5WA 2O3UA 4IS2A 4II2A 1P1RA 2PPLA 1K2WA 3AW9A 1DP4A 3ZCPA 4CT5A 3AO0B 2HRCA 1C3XA 1K92A 1LVUA 1OT3A 1W0KA 3ZX4A 5MGBA 4ALKA 3O1JC 4K81B 5KTSA 3H5TA 5LOVF 3F9CA 2WMNB 2C9YA 1SIUA 4HQ6A 4UOQA 2MIIA 2ZRGA 3RSSA 1QMGA 4DR5B 2FN8A 3IPCA 5JD4A 3N7TA 3GOHA 4HRXA 3ILHA 3DGFC 3QKTA 3EEBA 1B0UA 4FJ2A 3TDMA 5F1YA 3HWSA 1TCAA 4HQFA 4IO1A 3TCKA 3AFGA 4AUNA 2CGEA 3RC9A 3ZE0B 2JLCA 3C8MA 4V02A 1SUWA 2VJMB 1ULAA 5KYVA 3V8BA 1TZJA 5C32A 4AKSA 5KYWB 1D2RA 3E9NA 3ME5A 5LQSA 5EJIA 1JFTA 2PA0A 3BFPA 1N9ZA 5HXAA 1S8FA 5IUNC 1I94B 2FZLA 3II6X 4IJ5A 4J91A 1VE6A 3AHEA 4HJXA 1CUXA 3QPUA 2E49A 5EXTA 4UQLA 4MVCA 3EXG1 1XZIA 1YOVA 3ROZA 3ZU3A 3EZFA 2B4TO 3OZAA 2PPVA 1QRUA 4H59A 3CFYA 5E4FA 3UK7A 1AVTA 3TQRA 3VSCA 4F3KA 1EXVA 3U61B 5AK0A 2C8VA 4NR0A 2HM7A 1UC9A 3L1VA 3VR3D 2I80A 3K16A 1TB4A 5HP4A 4HQLA 1UIMA 1FJHA 1Q1EA 4IJMA 1EWTA 5EWJB 3EUAA 3GCWA 3TVDA 3UCEA 3TQTA 4L1KA 1XLTA 4MI6A 1SQ0A 2OZEA 3ORRA 2JJ2D 3LXRA 3HBMA 3TE6A 1GHTA 4E09A 1L1RA 1XEXB 2CVQA 2BFPA 2D5AA 5ITSA 1U11A 5JISA 5MN6A 3D7MA 3OHMA 4LWQA 4BLQA 4KPEC 4MB2A 2A9FA 2GARA 2VH1A 2Z1MA 3M6UA 1C2YA 2XLCA 2FA9A 3S81A 1RZRD 1IN1A 2IXAA 3ZE9A 3WG9A 3NORA 2WOJA 1EDZA 3DE4X 3M6XA 4KQJA 4CV3A 1TVEA 3LPDA 3QITA 4BYGA 1OF1A 4NS1A 4RNDB 1M1XB 3DE6X 2F6RA 3MRXA 2X8BA 3MWLA 4WUTA 3BXHA 1WCWA 1GRVA 4HGNA 4J3JA 4JYAB 4MPJA 4HADA 4G5OA 3JATB 1O94A 4NNOA 1XRRA 3C5VA 4CR7A 1L1EA 2Q0XA 3SZRA 5I5EA 3IOCA 7ABPA 2ZETA 1I9GA 2XUPA 3GROA 2NVBA 3JR7A 1ZCFA 2ZBPA 3O0DA 5C7YA 2YWXA 5CLHA 3V4VB 3WLLA 5A0FA 4L5AA 1CP3A 3NHUA 5E7MA 1JILA 2W6IA 1G66A 2OM2A 2PWBA 3FDFA 5LZ2A 4BQEA 1LK5A 4IDHA 1Y6QA 4BFXA 2R1UA 2JGNA 4KO1S 5A3QA 4H31A 4OHYA 1NU8A 1PUXA 2OK7A 2WJ3A 1DQSA 3I04M 3F46A 1IEWA 2GKGA 2PMCA 2PX6A 3K32A 3MT8A 1ZNQO 2VF2A 3B3FA 5EMNA 1MB2A 1KEVA 1JG6A 5ILQA 3DTNA 3HCAA 2A3RA 3GEDA 4H27A 4S12A 5FAKA 1JHPA 3K1ZA 4PSVA 4OHFA 4BNTA 2YJ4A 1O6GA 3CF2A 3QF4B 4MUXA 2XXBA 3H2KA 4BGIA 4EGCB 1V11A 2V9ZA 3DPIA 5CGQB 4E13A 1NL3A 2XHZA 3GVCA 4JI5B 2X5KO 1IY9A 3FNIA 3T95A 1O5OA 2RHCA 4QTYA 1CF2O 5LIPA 2BKLA 2ADFA 2RAUA 4ZV4A 1N2IA 1N2GA 1L4BA 3NAMA 1WB9A 1QO0A 3RROA 1WQ3A 4HXGA 1VDZA 3BVPA 1MDFA 3VTKA 2I1QA 2KJQA 2YHAA 1RYDA 3LQ2A 3TGWA 4FB5A 4G09A 2YN4A 1KZ4A 1BE0A 2PSEA 1O96A 3I0ZA 2BDUA 5DIZA 5K3DA 2FSUA 1ISPA 5EVJA 1YGPA 3BDIA 3RBVA 4AJEA 5JC8A 3H9BA 4GKAA 1C1XB 4ZAGA 1CX9B 1JU3A 1KDZA 5EIHA 4CN9A 3JZMA 1NW8A 4II7A 2Q6VA 4XUDA 1WXIA 4OGWA 4MLZA 4E6PA 4G8DA 5LLSA 3BXPA 3WJ2A 1WEHA 2IHZA 4MTCA 4FFDA 2PJDA 1SC1A 5GOTA 3HP4A 4QUBA 5JSZA 4PG6A 1E7QA 1YVRA 2FLWA 5KPJA 3TRHA 1HUQA 3F4KA 4ENQA 3QPBA 4E14A 4TYWA 3VQTA 4XSVA 3AH8A 3O93A 4C0HA 4YMSA 3R0VA 1RYYA 2ZRKA 3BH0A 4GOLD 1NF2A 3NNNA 1YBAA 4UNNA 3B3JA 3TOVA 4MQFA 4XJTA 3DXZA 3LQQA 4XJXA 4BMXA 4AMZA 3K3PA 1D5CA 5JMOA 1WNTA 4DC1A 1AA9A 3ENNA 3Q6IA 1C0PA 1TM7E 3ZZNA 3UG6A 1PNOA 3EXFB 4LOIA 621PA 1TDJA 2HZ7A 4ZU1X 4BO4A 1AF7A 1NYLA 3KOYA 1ZGHA 2XUGA 3M6MD 2R7MA 4PBRA 4DVGA 1UKZA 2CWWA 3LZCA 3OZCA 2C57A 3L2OB 4OHWA 2Z6AA 1PWXA 2ZSIA 4X6XA 4DCNA 2QOEA 3OBBA 2R44A 5K8TA 2CUZA 1ID8A 3VSEA 2QJOA 3QOYA 1WOYA 2VRWA 5ENVA 2GZAA 2MJLA 3L0IB 5H9VA 3I9V6 4RVHA 5H3HA 3BMCA 2E7ZA 1BVHA 2PT6A 1R9GA 4B7ZA 2F3UA 1E6WA 4R4JA 3V9AA 4ALNA 5FEUA 1O03A 2NU9A 4AYWA 1CEEA 4YAJA 1J8YF 3GUHA 4JI7B 4JBHA 5DYTA 3VSDA 1FYEA 2BFBA 2O1EA 3EDOA 1GPLA 3KNZA 4I08A 4B3RB 2O5VA 4MQBA 4XVCA 1OFUA 4HLUC 4TTRA 4QOSA 4U0JA 2FYTA 4X90A 2DY0A 3KC2A 5BMVB 1JAXA 2AUTA 1TJ4A 5B5SA 1B15A 1YU6A 1LQTA 3KOMA 1PW7A 3PGVA 1QF9A 4NBVA 1E3MA 4RZ3A 3QW4B 4Z4EA 2I5PO 1L5VA 3R74A 2W2MA 3N6XA 5HMLA 4AU1A 1H0SA 4BU1A 2ZXFA 3ET5A 3HLKA 4J2TA 2IYSA 2BLLA 1V1MA 4BQSA 3ZKWB 2ALJA 1WW8A 3QOXA 2HDHA 4G5HA 4R83A 5KX5F 3PPVA 1F8XA 3HJRA 3GRZA 1OSNA 4WLOA 1O08A 2RGNC 2GZHA 3FLMA 5HVNA 3AR9A 5K6RA 2AH5A 3ABRB 1L4MA 1Q7BA 4H18A 3K9FC 1CQPA 3VBEA 1LKZA 1K7FB 4L5CA 2XCQA 1YOBA 2PIAA 2Y0PA 3JQDA 2E21A 3L0OA 3DZKA 1UJ4A 3QMWA 1M73E 4MUKA 5JS8A 5LNK6 1RFLA 1A9RA 1CLEA 2GSDA 3GRPA 3QWIA 3RO7A 3TOCA 2Z4SA 2BP7B 2YJ3A 1P2TA 3FNFA 3MJRA 1H4SA 3FRHA 3QJ5A 1UM9A 5KQSA 1VHQA 2BRUC 5DGDA 1GFZA 4MR7B 1EDDA 2ERCA 3VJRA 2AQHA 2IXBA 4ESEA 1B76A 1CG6A 3KQUA 3U5TA 3HKBB 2VQEB 3PE4A 3H9CA 2RMKA 4Q7JB 4POOA 4JQYA 4YGXB 4B9EA 5FNVF 5JT1A 1VG0B 2GFQA 2P9CA 3O82A 3DTVB 3EF1A 2NVUB 1EGQA 1ACMA 1L5HB 1QV9A 1JG7A 3HMQA 1Q11A 4K6KA 2QUKA 3UENA 5A3RA 1Q16A 2IHTA 4XVRA 3EPHA 4AULA 1GILA 1TM1E 3UC5A 1YHNA 3CRVA 3V3KA 1QMPA 4BMOB 4BNWA 1V2HE 4BAZA 2WTNA 3VO9A 2DSTA 2GF2A 1FU4A 1MT0A 2CMGA 3O4VA 3N6RA 3ANTA 4OAQA 3GEPA 2EKLA 1EVEA 2QTHA 1I7NA 3L93A 1HE2A 1XPUA 4Q7KA 4YRFA 1PEKE 1R50A 1O5TA 3OO0A 1NTRA 1OWLA 2HOQA 3H1GA 1PBNA 1KJJA 1SKYE 1FNSA 2DX7A 3TBKA 1SZCA 2CKMA 2CXHA 1FDTA 2B0CA 2QN6A 2Y93A 3JQFC 4IXDA 4LGMA 4MKHA 4JLBA 2BTQB 4B45A 5TMPA 3Q7IA 2VH2A 1N5MA 1RKBA 3C8UA 3E8XA 1RHQA 2F00A 3G0GA 1AV7A 1GSHA 3LQ4A 5T41A 2FPKA 4INPA 4YR7A 3D3WB 5L9AA 1UMCB 4G4IA 1ECGA 4D8YA 2J0UB 1UJ6A 4BRSA 4UNRA 1U0HC 3VZPA 3O4FA 3DV0A 4OXQA 5BNZA 2X8LA 3LFTA 1DG9A 3GC6A 3PICA 3OCUA 5IHXA 2QL9A 6PFKA 1BGXT 1K89A 2D5BA 1PHPA 2W6PA 2D8AA 4B40A 4RCYA 2CUTA 9MHTA 3WRXA 5IDVA 3M1YA 3F96A 4LHZA 4J0KA 5DP2A 3R5FA 2ZYHA 1JL3A 2QKYA 4KSCA 1E2GA 1S9DA 2XZPA 1ILWA 4RSMA 3ZWPA 5D7BA 2ZJFA 4FQ7A 1UK9A 5HIMA 1V5GA 3NUGA 1X13A 4LRXA 1NT4A 2I8AA 2HPZA 3T3GA 4YTEA 4ZCTA 2YRWA 2QRVB 3Q2OA 1RTTA 4MW6A 4LSGA 1T13A 1R6XA 2HYDA 4URZR 3LX4A 3DDZX 4EELA 4UEQA 1FLNA 3AOEA 1JYEA 3U2QA 3EVFA 3C3YA 3PKIA 3WGTA 4J0GA 4MGIR 5HW0A 4R9NA 4QM6A 1EIZA 1KK2A 3I9OA 2GBIA 4RVSA 3N39C 4I50A 1QU2A 2VUIB 1E1CB 1CSEE 2QAJA 3AVQA 4HGRA 4QQFA 2XBMA 3AEQA 1KRXA 1HNNA 1VQ1A 4Y9SA 3VTFA 4ZI7F 3OZ7A 3O47A 4HQKA 4G37A 2ADOA 1Y1LA 2E4WA 4R05A 3NRCA 1MPTA 1V1JA 2C3MA 4UAUA 3STHA 1RC0A 1NFRA 3N0RA 4YRKA 2FG5A 5I7EA 4TWRA 5DCUA 1PSWA 4G56A 2VQFB 2OKGA 3ZCRA 4AS2A 1RWQA 4P8RA 4AN0A 1XROA 3ZIAD 3HEAA 4OQNA 4Z54A 1EM6A 2E4AA 2W2OA 4IIJB 5CJJA 3T1NA 3ZU5A 2ZSBA 4TKMA 1I9CA 1TAUA 5G3YA 1DCTA 1EZ1A 1R6BX 3G49A 3RREA 1G0NA 1U0TA 3BQNB 1KYZA 2W2LA 2X6RA 4UHDA 2WWIA 3EBOA 2PBRA 3LW8A 4MUBA 5AJYA 3ZJYA 2OHHA 1T4CB 4CIYA 1AA6A 4GOXA 1YH3A 4N65A 3CZ9A 1XO1A 221PA 3ISVA 3QVLA 3PEWA 4BNKA 1S1CA 5JASA 1LLUA 4B8ZA 3CBQA 4UDXX 3AKDA 4UFOA 3RVPA 2Q3FA 1ECPA 3FRIA 3S2YA 1MENA 3WGVA 4EB6B 4RL4A 4DV3B 2LIVA 1IE3A 4WZBA 1LB1B 1R4AA 3BIOA 3EGOA 1LDMA 3FIUA 2RAPA 1MHTA 1O95C 3FSGA 2EFCB 5ETJA 1UZAA 5JI3E 1Y8RA 2I3DA 2WY2D 4MRSA 3I3OA 3T7SA 1I7QB 4L75A 5IT4A 3DMPA 4QRHA 4J94A 2VHVA 4E7OA 1ETHA 2PMDA 3JTMA 3KLOA 3UVEA 1FFXA 8ABPA 5ALSA 3RS8A 3RK4A 5G0SA 1S3GA 1OWPA 1HO3A 4FP9A 1H2EA 1Y6ZA 1J0BA 1KJWA 1YL6A 1FZQA 1OROA 4F96A 2A0UA 1E60A 1DO2A 1JKJB 5C1DA 3KSAC 4W6QA 1Z39A 2D1RA 2O52A 1ZONA 1X1SA 5K0FA 3VYWA 2OT3B 2WWGA 4FEGA 5JD3A 3RR2A 3MQ2A 2DF8A 4QEKA 2AC7A 2C99A 3BWCA 4G9EA 1OLSB 2IL1A 1DC3A 5CXSA 2A78A 3B13B 1P4RA 1I4EB 3F6CA 1PJTA 1W5AA 4PM4A 1ORIA 1OLUA 2FPPB 4KAXA 4NZPA 5KNBH 5LU9A 5J2TF 1VBKA 4FOLA 4INJA 4LJLA 1GTL1 2OXIA 1U8UA 1Y9AA 1K86A 2X8JA 2NZUG 3A6LA 1T0IA 4RM2A 3RSGA 3TG8A 2QU8A 1XD2A 2W7TA 5DNEA 3OFKA 2ZJ4A 1ZAKA 3OY2A 4BFCA 2NU6A 2JCSA 3ZV7A 3S68A 3DZCA 1GG2A 3L8YA 1EK1A 1I3CA 2XF8A 5TPWB 4KYUA 3EVAA 3QXGA 4CCYA 4P32A 4NATA 3GHYA 3NNDA 3ZYZA 1VLZA 1A9QA 2GBGA 2ID9A 2N1MA 2QS9A 3H2HA 4HD8A 4JS0A 4D92A 4E2XA 1QUFA 4Z1OA 2J3QA 2I6XA 2XUDA 2O8CB 3T3EA 1JWLA 1YS2X 3AOGA 3ZGVA 4CLXA 1EUCB 3EARA 4D1YA 2Z3ZA 5KTKA 2YHSA 1O95D 3E9CA 2PD4A 3HZOA 1T6BY 1V9CA 2CXOA 1LWNA 3AESA 4FFBA 4NH0A 3AL2A 3FUWA 3IAUA 1PLJA 3PNYA 5DMXA 5G41A 3RG8A 5CCEA 2HIAA 4UU0A 4KV9A 3MCWA 1DWQA 5C9ZA 1NVAA 3PWZA 3LBFA 1CRWG 1XZQA 3PF9A 3N8DA 2J5QA 4PWZA 1GN9A 1PSDA 3OKFA 3BUSA 1TUBA 2HHAA 2R7NA 4LX0A 5EZ6B 3C15C 3ZHYA 2XPCA 1F2DA 3E8SA 4TV8B 5DTIA 1ANKA 1NULA 3SQOA 2H2HA 5J47A 1OTYA 2YVKA 3AR8A 4H17A 4ENVA 1QKIA 3EG9A 3P8ZA 1FW6A 2OPHA 2XECA 5KREA 521PA 2H7YA 2OO7A 2Z30A 2V7WA 4MKGA 5AW8A 5JQGF 3D4OA 5K3EA 2BGKA 3UGJA 1Z8NA 3AU8A 3PNBA 4M3NA 3ZHUA 3RIXA 4RZQA 3ND7A 1WETA 4LBZA 1EDEA 5FRDA 5F9HA 4EAQA 2FUEA 4I14A 1WMDA 2HX1A 1EEHA 5EA2A 4KN9S 4KVGA 4HEQA 4RD4A 8MHTA 4YJKA 3HK2A 4HTFA 1E3DA 1YR8A 3G9ZA 2VFAA 4GVLA 3MTBA 2GPSA 4HFRA 3BMNB 2EKZA 4LRQA 1N0UA 5L51A 4JJEA 3ZG6A 3H87A 1CR2A 1F9AA 3P9IA 3TRDA 1D7OA 3VZRA 3NO4A 4PNPA 3KAQA 5EYPA 3CVYA 2GD6A 3EXEB 3L8DA 5CM8B 4TRNA 3C14C 3GH1A 3RUCA 2B21A 2CUKA 2V96A 2ZS9A 1BHSA 4PX9A 5E6UA 4PG8A 1HKUA 5DXJA 3R7WB 4BIMA 1SXJD 3WFZA 1JR2A 4LOKA 1O8CA 4OQYA 2YYSA 3WXBA 2VPPA 6ABPA 1PJ2A 5FV7A 2GAOA 4W8OA 2CHVA 4ROTA 5AVTA 4WI1A 1DEKA 1XD9A 4TZ0A 4NBLA 3HO8A