2NSYA

Crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis in complex with nad-adenylate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
271
structure length
271
Chain Sequence
b'SMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NAD SYNTHETASE)
publication title A novel deamido-NAD+-binding site revealed by the trapped NAD-adenylate intermediate in the NAD+ synthetase structure.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 105
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2nsyA00
3SEQA 4K0RA 2BTEA 4QRDA 1KQOA 1NUUA 3SP1A 1U3DA 3MMXA 1NP7A 4RPIA 4EG4A 2X1LA 3DV2A 1T6ZA 2C5SA 1H3EA 1T9GS 3CR8A 1JHDA 3H97A 4KKVA 4HK4A 4P2BA 2H2AA 3P0IA 4CDMA 2VTBA 4MUNA 2QTNA 4MWEA 2HMAA 3HV0A 3ISJA 3PXUA 3CLUD 4HJRA 2GM3A 3H9CA 3SDBA 1WXFA 3E27A 1O95C 3RHSA 3SYTA 2PXHA 1MC1A 4DJAA 4EFKA 1TYBE 2QJFA 4DNXA 4EF6A 1PG0A 1PG2A 3FOCA 2QTRA 1OWOA 5EKDA 4UZEA 4MW6A 3G5AA 1Q11A 4AS1A 2PZBA 3IOEA 2A1TS 1XNGA 3COZA 3HL4A 3KT6A 3P0HA 3GLVA 1WY5A 1TYCA 2J4DA 4GU5A 4DE5A 3IODA 1QJCA 2X3FA 3IVGA 3MUEA 1OBCA 2EJCA 1EFPA 4ND6A 1ULHA 5J59A 3TNJA 2EL7A 1NUTA 2WSIA 2JAXA 2WB2A 4ARIA 4S1OA 1O5TA 1H3FA 4JFAA 5TS2A 2A86A 5DB4A 4DDMA 4YBRA 4ZT5A 1G8GA 1R6XA 3D6VA 4PBTA 3FH0A 3L93A 4MWCA 4MW2A 3X1JA 2G36A 3H99A 3FI0A 5FNZA 4MQ6A 3SZGA 1GAXA 3KFLA 1IVSA 1N78A 2QUHA 3ND5A 4G5YA 3I05A 4MW9A 4XFDA 4ZCRA 1GN8A 1K4KA 2D5BA 3A05A 3LOQA 1KAMA 4MWBA 3TQIA 1G8FA 4NZPA 3CLUC 3PNVA 3QTTA 5HG0A 4MW5A 2E21A 3MLBA 2DUMA 3AL0C 1OD6A 5F23A 3P52A 1IHOA 1H1TA 2CT8A 5H7XA 1KKUA 3KT8A 1IQRA 4NDAA 4RUKA 4U8HA 1MAWA 1MJHA 1EUQA 4Q93A 3Q12A 4FZJA 3COWA 1JGTA 2H29A 4YP5A 3AG6A 5HUHA 2CSXA 3FY4A 4JYZA 2DXIA 4I6EA 3NBAA 3ZUGA 4H3SA 4MVCA 1JEDA 4F4HA 2E89A 4WNYA 2RD2A 3ND6A 3CVUA 1MRZA 1MB2A 3PRHA 3VGJA 3VRHA 2WQ7A 2D54A 1G59A 3C8ZA 1N75A 3N2YA 3CVXA 3CLTD 4WSOA 4U63A 3IH5A 2DLCX 5BNZA 4JXZA 4MVYA 3TZEA 4J75A 4ZCPA 1EXDA 2CYCA 5TGTA 2E0IA 2V0CA 3ZGZA 1JIIA 3FNRA 4DDKA 1VBMA 1T9GR 3RBAA 1O97C 2TS1A 1H3NA 1GLNA 2J07A 3ELBA 2OV4A 1EFVA 1WXIA 3IUBA 4MLPA 3IOBA 3PNYA 4F3RA 1MAUA 1OBHA 3CLSC 4MWDA 1PFWA 4UZFA 1FYDA 5J58A 4G5FA 1PFYA 2QUIA 1WKBA 3AFHA 2A7XA 2CFOA 1KH2A 4MW7A 1ILEA 4KPUB 1J70A 3AIIA 1O96B 5LM3A 1V8FA 1FFYA 4QBTA 1WZ2A 3KT0A 3FDXA 4HJXA 3DLAA 2CV1A 4DDHA 3N9IA 3OTWA 2ZUEA 1QQTA 1WOYA 3AG5A 3L92A 4Q16A 1JECA 5K0SA 1XNHA 1JMVA 1EJ2A 1F9AA 1WJGA 1GZUA 1PFUA 3IDFA 3N8HA 1QRUA 3CLRD 3NBKA 1O0CA 2J08A 1EFVB 1EUYA 4MVXA 1P7PA 1DNPA 2R5WA 1Q19A 3K32A 4E1AA 3BL5A 3LCJA 3KT3A 1N2JA 1Y42X 3HGMA 1OWLA 2IP1A 2BYTA 2DEUA 1U7XA 3LE8A 4A91A 1D2RA 4GRIA 1JIKA 3QE4A 1GTSA 3Q4GA 4EG5A 1TYDE 1R6UA 1JEEA 1T6XA 1X6VA 1M1ZA 4HPWA 1M8FA 4EG7A 3A2KA 3TQOA 1NI5A 1ZUNA 4MUJA 1N3LA 1KR2A 3DPIA 4R0NA 4BWVA 4DLPA 3H05A 3K9WA 5HUJA 3S3TA 1V47A 3IVCA 2J09A 1YI8A 4MUFA 2JANA 4MULA 2Z3VA 1KQNA 2DERA 1K97A 1ZH0A 2IELA 4I6GA 5JBNA 1R6TA 2IJGX 3FHJA 4MUIA 3H9BA 3IMCA 2CV2A 1KAQA 1N1DA 2CYAA 1IQ0A 1A8HA 2CYBA 1QU2A 3ZXIA 5J5AA 4ZT3A 1M83A 1IH8A 3SEZA 1NZJA 3ZJVA 4MUEA 4KPUA 3RJZA 2PIDA 4YP7A 4JXXA 1O96A 1YUMA 2A88A 1F7VA 1O95D 2B7LA 3Q10A 3G6KA 1SURA 2WQ6A 1O0BA 3GUZA 5KHAA 1N2GA 1O6BA 2CUZA 3CLRC 3MLAA 1BS2A 1KORA 3NV7A 2V0GA 4OJMX 2YY5A 1J09A 1O94D 2YWCA 3UY4A 4ZCSA 4CDNA 5DK4A 1XJQA 2A1UB 4J76A 1TFUA 1QTQA 3U1VA 2HGZA 3FWKA 4NX2A 1GTRA 1KH3A 3IMGA 5FO1A 2ZUFA 1Q77A 4ZT6A 4MVWA 1NSYA 5IHXA 1WXEA 2DPLA 3UOWA 3CA8A 2PG3A 3IUEA 4MUKA 1YIAA 1EE1A 1KQPA 4X0EA 2DETA 1VLHA 3TZLA 2D13A 2VXOA 5KCMA 1GPMA 1JILA 1M8KA 1KH1A 1T6YA 3CVVA 2XRZA 3HMQA 3A4IA 3RK1A 3GMIA 1OWPA 4L2IA 2AZXA 1M8GA 3DO8A 2J5BA 1LW7A 1WQ3A 5LFAA 1TQ8A 5TEVA 4KR7A 3F3MA 4PBRA 4G6ZA 1IFXA 4EG3A 3AKZA 3QTBA 4KR9A 4ZCQA 2OQ2A 4MAFA 3TS1A 1U0BB 2A1TR 3RK0A 3FIUA 3ZIUA 1RQGA 4XSVA 2O8VA 4OUDA 1NURA 3UK2A 1VL2A 1U3CA 3A04A 3IOCA 4EG8A 1CT9A 1ZH6A 1K4MA 2A84A 1J1UA 2CV0A 2QUKA 4PY2A 3G59A 5IJXA 1KP2A 1JIJA 1F7UA 3INNA 4NATA 3CLTC 4EG1A 2GKSA 1TYAE 2QJTA 1M8PA 2PFSA 3UC5A 1O94C 4YMIA 1PFVA 3P0JA 1J20A 1JZQA 2QTMA 3JXEA 4L2IB 4R2MA 3HFJA 1UFVA 2AKEA 1IQUA 4CQNA 1I6LA 2JA2A 4QREA 3FETA 3IMEA 1S4MA 1NUPA 1X8XA 3CVWA 4KR6A 1QU3A 3SZ3A 3COYA 1ZJWA 2A1UA 1OWNA 4MUHA 4PBSA 3N05A 1OWMA 1N2IA 2NSYA 2VTBB 1F4LA 1N2HA 1G8HA 1YULA 4ZCTA 1O97D 4R2LA 5KWVA 3OP1A 4OUDB 4ZT2A 2A4MA 4NAUA 2DR2A 1VBKA 4MW0A 1QNFA 2QJOA 2O5RA 4YP6A 3X1MA 4TS1A 3CLSD 1IRXA 2PZAA 1N2BA 1LI7A 1M8JA 3IVXA 1YIDA 1I2DA 4AQ7A 3UMVA 1J1ZA 1VBNA 1JZSA 2AG6A 4ZT7A 4EGAA 3ZJUA 2Z09A 1MB9A 3M5WA 5DEOA 1B6TA 3HZRA 5FO0A 5H16A 1XNJA 5LLTA 2PZ8A 1WXGA 3VU8A 3CVYA 3ZJTA 1MOPA 4ZT4A 1I6KA 3RFFA 4K03A 4I6JA 1WXHA 1LI5A 4JZYA 4MUGA 2GOYA 3ZXSA 1HYBA 1I6MA 1K92A 1NUQA 1TEZA 1YUNA 1EFPB 4CT0A 1QRSA 1N2OA 2I1LA 2YXNA 4U7JA 1MBZA 1Q15A 2X1MA 1NUSA 3PNBA 2X0KA 1QRTA 4ND7A 1WQ4A 2YWBA 2ZP1A 5AHWA 4NAHA 3D6UA 3ILVA 2NZ2A 2Z08A 3X1KA 2RE8A 2HZ7A 1J21A 1N2EA 2QUJA 4MW4A 1N77A 4XFJA 2XRYA 4ARCA 5TEWA 3COVA 3MXTA 1COZA 5K0TA 2E18A 4EG6A 3ND7A 3FG9A 1NYLA 1KP3A 1U7DA 5DASA 4MW1A
chains in the Genus database with same CATH superfamily
5IH3A 1RAEA 1QYDA 2PVPA 1WKCA 5DTMA 3SP1A 3RVSA 5CDYA 3LW8A 2C78A 1KE2A 1CHNA 5JS7A 3F8TA 1G20B 3WYAA 2CVFA 2Q2VA 1T9GS 4OFBA 3EDRA 1MZPA 3W4IA 2FWJA 4MQLA 4FKBA 4Q3DA 2AFHE 3K6RA 4KP7A 5HKAA 5A6SB 1KL7A 4MUNA 3BZBA 2D5AA 1SBIA 2QTNA 3F74A 1GV0A 3W9UA 1LNQA 1UWVA 3L07A 1DLIA 4BO5A 1BMFA 3DBOB 4X8HA 4P7BA 1IXKA 1A96A 1SC1A 2BLLA 1ZIOA 2HQBA 4EHDA 1DV1A 5DM2A 5TE9A 3SDBA 2E1PA 4C7BA 1L2TA 3EXFA 3L8GA 2BUCA 5CG2A 1Z63A 4UVEA 4UDNA 2HWKA 2RGNC 1U9IA 3RHSA 1PR2A 3SYTA 1W36B 3R6TA 2VHEA 3REFA 1W30A 4LECA 1OTHA 5AUNB 4RVFA 2GM9A 1YE3A 1IXSB 1KE1A 2PX6A 3DAGA 1G3UA 1GN9A 4DYVA 2GKGA 4HUQB 4LHVA 4EF6A 2JA1A 4BNIA 1SU7A 5KDOA 1GPDG 3NTLA 4MV5A 4TKUA 1JHQA 1LPMA 3T3HA 2RGUA 1QPGA 2QJRA 5DCYA 1MF7A 4N3AA 1EX6A 4JXJA 1E1DA 5B2EA 4OK5A 1UIRA 2LIPA 2CLCX 4ZU6X 4OQYA 5IN4A 4CEJA 1UBKS 4Z4IA 3D7NA 2Q5IA 4ZI7A 1PT8A 3W6OA 1WEKA 1CX9B 1KVUA 2Z30A 4EELA 1AJEA 4EY4A 3EMVA 2XUHA 1T0PA 1VXRA 1J99A 2HJHA 1PU2A 1T34A 3D7LA 3NHMA 4K9OA 4NK5A 3PFIA 4IF6A 5IT0A 1LDMA 2VCYA 2BFNA 3G2KA 1P3DA 3OKPA 4CR8A 2WZQA 1BEEA 2IY9A 4RPKA 1WB6A 3M2PA 1UH5A 3ES9A 1K6IA 1P1HA 3H4IA 4IHQA 4PR0A 5F33A 5SZIA 5KNBD 3M9WA 4B1FA 1C7EA 1L5FA 4JA2A 4B6FA 3EK2A 1B0PA 2DPGA 1TJ3A 3N7TA 4B09A 5JEEA 5JDCA 4NU0A 2OLKA 3BDIA 1NN3A 1XRPA 3FPAA 4B2YA 1KPHA 3BSFA 2XMDA 1IPHA 4YYEA 4AZ3A 4XWOA 4D99A 2WV7A 4YRZA 1VA4A 2VZ8A 3D8NA 1EUDA 3UW1A 1QV6A 1X7ZB 1SELA 2H9IA 4BBZA 2AE1A 4K9MA 2BGWA 2UAGA 1Y1LA 3OCZA 2IXFA 1E59A 5DGHA 3OY2A 1WMAA 4REOA 2PPLA 2KM1A 1Y9AA 1E2HA 4YJ3F 3SKVA 5JT1A 4P4TA 1U8XX 3IPCA 3ND5A 3F6RA 3O1LA 4Z51A 4DR5B 3CB2A 3NKVA 1IZ0A 1T4CB 3H4MA 2ACWA 2V6MA 3ICCA 4LGMA 4OSPA 4UVDA 4HT3B 2Z0MA 3JCZA 4KXFB 3TPFA 5LP6B 1WPXA 5ERGB 1PJSA 1YVEI 2XMBA 3HCBA 4UU8A 1X9GA 4G9BA 3U81A 4RXTA 2QP4A 1L7QA 2P8SA 1X8JA 4GWKA 5DLPA 3MTQA 4ZZ2A 3TRFA 4XD7A 5IG2A 3NEPX 1UK9A 3ZLJA 3HM9A 1IHOA 2J4FA 2E37A 2W2KB 3EZGA 3H19A 4TMFA 1JHRA 2RHDA 4UMDA 1UK6A 4U0KA 3JVEA 3KT8A 4TZ0A 1QYVA 1CZHA 2B3DA 2O2HA 1JXMA 5AVKA 3VU3A 5IAAA 5K0FA 5FPKA 4CCWA 5JH7B 4O4JF 1GVHA 1F5SA 5LD2C 4K9LA 4OU5A 3TQFA 3RRYA 3B3GA 2QE7A 3O4RA 4BFLA 2H29A 4WOCA 4PLGA 4X41A 1R4ZA 3AERB 3C74A 4HATA 3G2PA 4AMUA 7ABPA 1ZK2A 4GSLA 1TI7A 2QYTA 1HEIA 4XVHA 3PQ7A 1VL0A 2GERA 3EASA 3CX7A 5C81A 5CT5A 1MABA 5FNVA 1RRPA 1NC1A 1U3VA 3WL5A 1KDYA 4YPFA 2GO1A 1Y6JA 1HV8A 1NVMB 5FHRA 4J0KA 2I2DA 2A9JA 2NO6A 4I3FA 1POWA 3S29A 3IH5A 2O5EA 4BEWA 5A0TA 2GDJA 3BD7A 2UZIR 4CF6A 5BSVA 4AYXA 1W1IA 3FFTA 1P3Y1 3RRBA 5A9TA 5JBQA 2UXCB 3ZWNA 4NS1A 1N57A 4WA7A 5ENDA 1U7ZA 5JC1A 2AUTA 4URFA 4TQGA 1DUVG 1FNCA 4ZVNA 4RZ3A 2R47A 2YMMA 1SCKA 2J07A 3KB1A 2DQZA 3OF2A 2QD5A 9ATCA 2PZKA 3P9YA 4LOKA 4DV5B 5HFAA 3ZE0B 1E6MA 3IOBA 5SYNA 3PQ5A 4E33A 3SR3A 2I87A 2AQKA 4MWDA 2FEXA 3LDHA 3VTAA 4FYKA 4CM5A 3H11B 1QLJA 2GUWA 2MINB 1FRNA 4JAVC 1WS6A 3QEKA 3WDMA 2I6QA 1PJCA 1VE6A 4XZ3A 4BLOA 1K86A 4R51A 4TM7A 3E4DA 5ES3A 4EVQA 3ENKA 3LXRA 1VDZA 2BGKA 2R8ZA 1HYEA 2IHYA 2GFIA 3WSTA 3MVEA 5CXSA 1EDZA 5KSYA 1A95A 3OLWA 4EFDA 1GPWB 1JZTA 4DTIA 4RZUA 4OXNA 3BMOB 3Q41A 4PAWA 2B30A 1SD5A 2LW7A 3QOYA 4HX5A 3UATA 3WLLA 4S1VA 1OLUB 3PLNA 1R4NB 1I3LA 5KZMB 1ZD4A 4NPHA 2IPXA 2W6OA 5EIAA 5EKTA 5BW8A 1ZR2A 1GOTA 4Q5IA 1HTWA 1I0LA 2AR7A 3FMFA 1KEPA 4OQQA 5G53C 4HPXB 4QJIA 3AU8A 4EOGA 4P82A 5U9CA 4U7DA 1M2NA 1PRYA 4N12A 1CU1A 2WF7A 3KYJB 3B7GA 3WGJA 3MTIA 3UKOA 5L45A 5KNDD 4G1EB 4K26A 2Q07A 2VPTA 3FKSD 4TXLA 4EGJA 3RG8A 2I2BA 1Z47A 3NDRA 4TRMA 5BYBA 2Z8ZA 1VLMA 4DCPA 1RZRA 1A69A 4MUAA 2EOAA 1BQEA 5JRZA 5CXQA 2ZSIA 3HP1A 4M76B 1DTSA 4BNWA 3N0VA 1IHYA 5EHXA 4CMCA 3DBLB 3MGCA 2FOIA 4XR4A 5IBRA 3ISVA 4BNVA 1P8AA 1P7PA 5DNYB 1DT3A 4RKRA 1RWPA 5ESRA 2WU4A 5HCIA 1X7YA 3ECAA 5I45A 2Y67A 1MC8A 4DN6A 1H94A 2EHJA 4Y1FA 3IX7A 4B6EA 5AW3A 4B46A 5A4JA 3R5XA 2FVXA 1H1LA 2V4ZA 5MN5A 1RQ7A 3L1HA 3LOUA 5D5HA 1UZNA 1VIMA 1JIKA 4HOYA 4C7OB 4EPVA 5HBGA 3UGJA 3MCUA 5F78A 4AZTA 2P3SA 4KH1A 9LDBA 2Z57A 3CLKA 2CXHA 1SOWA 3L7YA 4EG7A 4JR2A 2CXRA 4S2EA 4ZDJA 5LXTF 4CBVA 5A6VA 3GPCA 2KLBA 4MHSA 3QMWA 2AG8A 4BWVA 4G56A 2PGIA 2WIDA 1CF4A 1D4ZA 3PQ4A 3VPSA 4RZXA 2C9OA 4LC9A 4KIWA 2J7PD 4RCVA 2XAAA 3LT4A 3ROTA 3K9NA 1A4IA 5KWIA 4DEYA 2PXCA 4JSYA 3AWDA 1NMSA 2HT6A 4YUXA 4C0LA 2GO7A 4DOMA 4TMYA 3WQBA 1V1MB 4S0XA 3EPPA 1KAQA 2QTZA 4BQQA 2CV2A 1G4HA 2OE2A 1TA9A 1NP6A 1XRMA 3LX5A 2WPDD 4DLUA 2VNSA 1OIXA 5D51S 5DE3A 4N6NA 3ZXIA 3CF0A 1J8YF 2WNHA 1M75A 4RK6A 2V3CC 1M0TA 2ORVA 4MPTA 3KOOA 4KK4A 3ZJVA 3JV7A 2NO5A 1FJGB 2H3EA 1RKQA 3OT5A 1C4WA 1U1GA 1W8IA 3TX6A 1ADYA 3GHHA 4Q02A 1YUMA 4FCTA 3KYCA 3VISA 4C89A 4ER7A 3SLRA 5ILOA 1T5HX 1MKYA 1AXGA 2ILVA 2OCGA 5L7YA 3EHEA 4MWOA 3ELUA 2BFCB 4HS4A 3V2HA 1NT4A 2EEZA 2R96A 2YYSA 3STHA 1N2GA 5BSUA 2VTVA 4B5KA 2N3ZA 2OB2A 4AWXA 5C1BA 3EEQA 4KUGA 2EFYA 5K3FA 5F2OA 4ZVOA 3SSAA 5B2FA 3KUCA 1TM2A 2O8NA 3ZHTA 3AVTA 1OZAA 2ZRQA 4DMRA 2SHKA 3O03A 4LGCA 3FYUC 3NDIA 1Z6AA 2OUIA 5LXTB 1GTRA 2UVPA 4RULA 1SPXA 4OATA 4MQEA 4AMVA 5JSQA 1TVEA 2FWPA 2EZ8A 1Q77A 3FCCA 5EKSA 5A9RA 3A3YA 1VJDA 3IOYA 4DEXA 4YA6A 2R85A 1NA5A 2C8VA 5BNWA 5BMVB 2AVNA 1DKMA 2C5BA 2MMGA 3K16A 4PTLA 1JIVA 5J4LA 2B1RA 2X0IA 5B12A 2GSDA 1RABA 2FU5C 5KSPA 4LJ6A 2EC5A 3QKWA 5KTYA 2WM9B 4RKYA 5FUQA 4YDHB 1OX5A 3ABQB 4MRMB 4EB6A 2DB3A 3L46A 3GCDA 4R6XA 3O8DA 5IVIA 3DAPA 1NVBA 1GKIA 3EVCA 2W6QA 4YLEA 1KMMA 3MJCA 2WJGA 1ADGA 2H2IA 3U37A 4C3ZA 1S2OA 1AMOA 1S01A 2AHOA 1A4RA 2ROQA 4DLRA 5EC8A 2HJ9A 3ABZA 5CT4A 3RWOA 3SG0A 4XJSA 1MTOA 2DT5A 3PCXA 3TDKA 3TLAA 5IHPA 3GQBB 1PNOA 3CXUA 4FR5A 4F5YA 5K6TA 5GINE 3UWOA 3ZGOA 4J0QA 2A1TR 1E5XA 3T7AA 1I9GA 1X77A 2EX0A 1M2OB 4Y2YA 4YN3A 2GF0A 5AHKA 4DMUB 2YVKA 4CTMA 1K88A 1IOWA 2VO1A 5JROA 1DAFA 3UK2A 1HA3A 1Y1PA 5JQGB 1GTG1 2ZUSA 5CDHA 2GVZC 1TM4E 3BXFA 4PNZA 4DG5A 4OM8A 3FVQA 5E2AA 2ACKA 4EKGA 2X7XA 4HEA1 3ZI4A 5JCJD 1M2KA 2QN6A 3HN7A 4QLBA 4Q7MB 3TOCA 2FMHA 1JQ5A 3GPBA 4GPAA 4IFTA 4RHTA 4XYBA 4CLRB 4COKA 1NVVQ 2BM8A 2X77A 4ZREA 3R0XA 3MT8A 2QJTA 2CLLB 1TTPB 1OKKD 2BEJA 2IZ0A 3B5JA 4MVJG 3C8UA 2NUBA 4UNNA 4CTJA 2ZU0C 2JAUA 3JZFA 1W0JA 1UPCA 4Y1EA 4L2IB 4R2MA 4OQFA 4EPTA 3E82A 1P62B 4DADA 3NR2A 2VNKA 1WCIA 2OBXA 4HDCA 3O8QA 2BSAA 3ASYA 3M1YA 1ADJA 5JARA 3AEQB 4ZVSA 5DRYA 1UBHS 3F3YA 4Z8XA 3TJZA 2QRQA 2ECFA 1IXYA 4W5NA 4FOLA 3PFNA 4XIJA 3E8SA 2C03A 2C7OA 2HRQA 1O2DA 5H4HA 1G4UR 3NT5A 1XZQA 1V8PA 2PA3A 3NIBA 3SLKA 4CV1A 3L0DA 4JH0A 1IY2A 3C3KA 4JCCA 4X8OA 1FIUA 1Y3HA 1F4LA 2CMFA 3DA8A 3G2MA 4I1YA 5G3YA 1XC7A 3S2SA 5ALFA 4RPHA 4DV4B 1W85B 2E4WA 1D8TA 3SE7A 2QRVB 3L8CA 3HRHA 3DMPA 2F9MA 3B89A 3QHQA 4PG4A 2L69A 3JSAA 4YP6A 3MAAC 4EKIA 1RJ9A 2GILA 4G4JA 4UDXX 4Z99A 4AL4A 4RZIA 1YMUA 3Q3EA 1I51A 1ZGJA 1E3WB 4JL6A 2BM1A 1DKUA 4G24A 1JPUA 4ZVUA 2KQUA 5KX5A 3OFND 4HNRA 1THMA 3RS4A 5AVXA 3T1HB 2RKBA 1LA2A 4G2NA 2GBFA 4GLJA 4QTXA 4TXHA 2C4KA 4F60A 2HA4A 7MHTA 2V97A 4O1MA 1XRNA 3HYLA 1YZNA 1XELA 3PKIA 4H1HA 3A0RB 3VR0A 4HYYA 4N6GA 1WA5A 2PT5A 3LPLA 2LGJA 3HLYA 5LDGA 5AVTA 1JJAA 3CB4A 1R6DA 4EZIA 1I8TA 1UFRA 4CNQA 1CYEA 5HGJA 1OFTA 2NU9B 2WAYA 3M3HA 2B6HA 2W2VA 3Q72A 3VFDA 1D6JA 2QS9A 1YHNA 4KXLA 4ZRDA 5BV0A 5HOEA 2GOYA 3ONEA 3H83A 2QLNA 4OO3A 2W4MA 1X1CA 4UEQA 5HIIA 2Y4NA 3TW0A 3GNLA 1TGVA 4K6MA 1E6CA 4XDHA 3O1HB 1PUIA 1EM6A 4BVLA 1OZ0A 5C5DA 3THYB 5KNCH 3HDGA 3GFTA 3DKPA 3JQFA 5ECWA 3WHKA 3ZLUA 5KB3A 1MU0A 1ZRNA 5FOSA 1JNXX 1C1DB 5IXJA 1CTQA 1RBQA 3C3WA 2AOTB 4MAAA 5CVEA 2JK0A 1US8A 3P71T 4KN9S 2BELA 1G1MA 5EXPA 1ZIPA 1NONA 4G07A 5DULA 4N0MA 2CJWA 5K4AA 3SD7A 1Z29A 1AO0A 2C5GA 2JAPA 3AEUA 3PUKA 1ECPA 3AYZB 3C70A 3PA8A 4QBGB 4DVGA 2P79A 3GLQA 2VAVA 1DIAA 1AA6A 4IRXA 4M9QA 4QGAA 4GR9A 3P9SA 2PWBA 2HPAA 1XEWX 3VMFA 1FPQA 1UC8A 2YHAA 3BDAA 2NZWA 1Z8NA 2IE0A 1Q16A 1XXHE 4J0HA 4UTOA 4LFCB 3ZCXA 3PI7A 4JVMA 5D86A 5AK6A 1H0SA 2CEAA 4MW1A 1Z88A 2QI9F 5HUQA 4N76A 1Y3FE 4GI2A 3T3EA 4WK4B 3IHLA 5HMLA 5KVAA 4H17A 3ANTA 3GJ5A 2IODA 3DHWC 4OXYA 3WLRA 1AK1A 3OLQA 1QBGA 3R7WA 3LDAA 1USIA 3NW9A 3KEFA 4AECA 2PM8A 2QMYA 3PLAE 2QBYA 5CW1A 3E7PA 1KJNA 3UENA 5J4VA 3T6KA 3DE3X 2QROA 3H5NA 1R5OA 4PHTA 3VHQA 1HDZA 2AUMA 4XGQA 1XMPA 4OQEA 5JZBA 3BB3A 4UEOA 5BY2A 4UASA 5SZJA 5EFOA 3A6PC 4KN5A 1TTQB 2Q62A 4TX1A 5LYYA 5JASA 5LQKA 4M9UA 1K5HA 3LX6A 3EBLA 3PGXA 1DBQA 4DLLA 4OHBA 1FFCA 1J5EB 4C22A 1PL7A 3IDAA 1F8UA 3PDUA 4O2BF 3K09A 5G0SA 4PYIA 3LO8A 4WL0A 5FORA 4EB3A 2HYDA 4XQGA 3FOFC 2OL4A 1NRXA 2JJ8A 2X41A 3FJOA 5KSOA 1ITZA 2JW5A 1PNRA 1GCUA 1Q7GA 4U7GA 2QPAA 3PQ6A 4FMBB 5DVZA 5AVOA 1UXKA 4FUQA 4FR2A 4E5VA 3OVMA 4UMFA 1W7AA 2MWMA 1PUJA 5B3KA 4NP6A 5C4IA 2AK2A 1QK5A 3QW4B 4RKQA 2O48X 1VCOA 1XNGA 3KVYA 1ICIA 2B78A 4Q1BA 3TQRA 4KITB 1JLKA 1PBTA 1B8PA 1M54A 4G2TA 2NO7A 2B8TA 2JD1A 2YH2A 4RIFA 5KAMA 5IMSA 3GFVA 4LRUA 3JQAD 3TZKA 2DH6A 2CCJA 2KWIA 1UKZA 2ODQA 4XUEA 1OBCA 5L3SB 1C50A 1KK3A 2I8CA 1G6Q1 3TFOA 1UDRA 5LA6B 1JFRA 3RASA 1GR0A 3UK7A 1U5BB 4S1OA 4TTSA 1FJHA 3VMMA 3QBEA 4QUBA 4TXNA 2QTCA 4NOJA 3VYRB 2XVXA 4FZVA 1KIMA 1Z73A 2FR8A 2BPOA 1O6CA 2R8BA 1HT0A 4BV3A 1LX6A 1TQDA 2DKOA 2JJQA 4BXOA 4LHXA 5LN1A 4LXIA 4D5EA 4KHPB 3VDRA 4Q9NA 3L9XA 3PF8A 1ZGGA 3KLPX 2YWFA 1ZW1A 3FI0A 5AM2A 2XX3A 4ZAYA 1AOXA 4Q7QA 5BUQA 4MR9A 2W2LA 4YI5A 3I05A 4I2VA 4XFDA 1R88A 3DR3A 5JVDF 3T94A 1RE0A 3SXPA 1K4KA 2DUUA 3NNNA 3TPCA 4TLAA 3GGDA 3GX1A 4CIWA 1XTVA 5KMGB 2O0JA 5AW2A 3ZDYB 2IS4A 4H9GA 3DEYX 3GFGA 4NICA 5IVPA 2OXFA 3H5OA 5BRJA 4LBWA 5D3QA 5ARDA 5EUQB 5F23A 1Z0UA 1P5JA 4EKEA 1CVLA 4YCSA 1O8BA 3C1OA 4KIFA 4U2BA 4D0GA 2JH3A 3RCBA 1MAWA 3N87A 1XNRB 3U4AA 1CUEA 2ODEA 2PAFA 3OQJA 3FCYA 3VNVA 4I50B 3WKDA 1YFLA 2R7MA 3D5EA 2XWJI 4QU5A 4EI8A 1F4VA 2RDMA 3EE6A 4N0QA 4OJQA 1E3QA 4WH0A 5GGYA 4AMBA 5FEUA 2ZQZA 2D59A 2VOEA 4M1ZA 1EXNA 4GICA 3U7IA 2H52A 3PHBE 1NQVA 1QG2A 4EDHA 3CVUA 3L43A 1JX6A 3STUA 3PI6A 3MAGA 1NG9A 4I1PA 2HHHB 2M1XA 2IHVA 1NQ5A 1P73A 2CW5A 2VTEA 3EXHB 3U7EB 2D54A 3ZTWA 1T4DA 4M8KA 2YV3A 3E6AA 2HRCA 2AT1A 4G86A 1H0RA 4HDRB 2Z56A 3MTBA 4LDQA 1XVIA 3IV6A 4YJDA 4ASUA 3TG8A 4QULA 4EW2A 4I99A 1L7XA 1W0CA 2OKGA 4PYLA 2Z6UA 2WP8J 3NMUF 4FIZA 3QOFA 2QPLA 4LWOA 5AICA 1R50A 4YQEA 3ZGZA 1JIIA 3PNOA 3N75A 3S1AB 5HFNA 5E1DA 3T4EA 5I5GA 4EHFA 3L2OB 1JJIA 1Z7GA 3I9MA 2JBWA 4PM4A 5I9BA 3DVSX 4HLDA 4F56A 3BS4A 1G66A 2QAJA 2P9FA 2B5WA 2INGX 5G0TA 3VO1A 4IVQA 2Y0PA 4KW7A 2DHQA 3ND9A 5CLFA 1SUEA 1DELA 3KZVA 3QK7A 3OJXA 4AZWA 5LPNA 4HN2A 5ALJA 5KWEA 1E77A 3EGIA 2WNIA 2WM2A 3AFHA 2ZYGA 2Q2WA 5HTKA 4ARBA 3DL0A 1KH2A 5LLSA 3UQZA 1ILEA 4XYLA 4C7XA 5ED4A 2ZIZA 1QGYA 2P35A 4Z9XA 5B3AA 3B3FA 3O84A 5IS2A 2GRUA 1QTNA 3G9TA 1E5QA 2NXJA 3RSLA 5ESDA 3A6KA 2DG2A 3DAOA 3WYCA 1R0XA 1AS0A 2GVDC 1XX6A 3HXPA 1I5EA 3M4YA 5AKKA 5DTJA 1EWTA 1QIFA 4QFCA 4MQMA 4RM3A 5AKHA 3AG5A 5CYGA 4DT1A 5B1EA 4LXGA 1UBSB 3U39A 3DVAA 1N6IA 1OB5A 3SEAA 3BD9A 4KE9A 1W1UA 4M7RA 2G1PA 2VDLB 3ETDA 3HWSA 4FGLA 4Z1MD 1SCDA 1YZFA 3HCOA 2OB1A 3VPDA 2FAXA 1LRJA 4UPDA 1ZICA 4DPLA 1Y4UA 2H0QA 1Q1GA 3DTYA 1ZL2A 3QEOA 1KO7A 3LH5A 4XVQA 4XARA 3FSGD 2H1FA 4PZUA 2R79A 3DL7A 4FFWA 1BDMA 4BQNA 1V25A 1SHKA 1S0UA 1W5AA 4KMMA 3IYLW 3WWEA 2Q4DA 4HADA 1HORA 1ZGAA 4W6QA 1GRQA 3NHWA 4QLAA 4E5KA 5LZ9A 1HNWB 4RNDB 3JWJA 5LNK1 1OGIA 1OH5A 1U4OA 3FE2A 3RTGA 1T15A 1JDUA 4RSMA 2H85A 5F52A 4EMSA 1GGMA 2NU6A 4JJ6A 5J2TB 4WDQA 3JVVA 1S2IA 1A9YA 3ZGVA 1JSRA 1JPNA 3GFBA 4LTMA 1YQTA 2V96A 4M1WA 5AFSA 1K9SA 1MD9A 1YACA 1Y42X 2C2MA 5A7HA 1X42A 4RV5A 1P1JA 2I6FA 3PT9A 1J8QA 3F46A 4GRIA 1KDTA 4II7A 4UZSA 3HYNA 3RTCA 1OLSB 2XDAA 4D8YA 4EHHA 4NFYA 1NXQA 3COPA 1M72A 1ZVMA 5DIZA 5T5QA 1R10A 4B8ZA 3VTFA 4MVJI 3RGWS 1L4EA 2G88A 2R00C 3AI1A 3MGKA 2D2VA 4DLWA 1HYQA 1F2UA 4QGHA 5KYVA 3HSSA 1E2IA 3NM4A 1OZHA 4XCQA 3C3CA 3C7KA 3KBBA 4UDYX 4R2XA 3ZH2A 1NIJA 2V58A 1WZUA 1T43A 5IASA 2D7JA 5EJMA 2N1BA 1QIIA 4HMQA 4LOLA 1A4UA 4MV4A 1GPBA 3GDGA 4WK2B 2Y6UA 4AKEA 4UD2A 2NYUA 4FHDA 4CM6A 5HVNA 4WLOA 3PQ8A 3FNIA 4WOKA 2HK8A 1XDBA 2H2DA 3B9RA 3E9DA 1XCBA 4R1TA 2PUJA 1QGAA 2IV2X 3KLOA 5MGNA 3I5XA 2O8BA 3R3ZA 1ESEA 3BJIC 4QXPA 1B43A 2BFFB 1INLA 4NMXB 2YCLA 1OXXK 2CDRA 3JTEA 3LTEA 3H9GA 5ALQA 1CQIB 1Z07A 5IAOA 2VP9A 1UT5A 3CM0A 4RY9A 4QUDA 4BCDA 1U1CA 3W5DA 2JGMA 3UHFA 1CUCA 2G17A 3M6WA 1MPTA 4GPBA 1NX9A 3HBFA 1YB4A 2ZYTX 1JU9A 1VOTA 2HUNA 1C1XB 1VKHA 3G6KA 4J0IA 3TLEA 3OCVA 3KOUA 1C7RA 5EJEA 4TV8B 1KI7A 1GUZA 5KHAA 4OHMA 1N9GA 2NNWB 3DYBA 3HR7A 4FE7A 4CQJA 2O8FB 2CUZA 2AZMA 2RBEA 4RPLA 1N9ZA 5TGZA 3TSZA 3T5PA 4DSUA 2HGSA 2FPIA 4OJMX 4REMA 5JAOA 2GMWA 2HSDA 1ICEA 4Q7EA 4FFBB 2ZIXA 4LDAA 3KSBC 1O94D 3EOZA 1LBIA 1T8TA 2COKA 2B3TA 4HQFA 4J07A 2G63A 2Q3CA 2FJPA 3AY3A 2PRSA 3PTZA 5AK0A 4BKMA 5C1OA 4LBZA 3D4PA 3EG9B 1QOPB 4BEJA 4IHJB 1XZMA 4KZPA 2M32A 4RA9A 1TMYA 2DHCA 1Q2UA 2XYHA 5AW4A 4DIOA 1PDWA 4KYIB 3D8TA 4QG7A 4F0JA 4UOEA 3FR7A 3P5BA 1DRWA 4DUGD 1WPQA 1W88B 4K7JA 3QA9A 1V41E 1BDJA 1J39A 5FR2A 3IUQA 1RYYA 3KVVA 4HNTA 2QXTA 3ADKA 2XADA 4Y2QA 3ZE8A 4B8YA 4EP1A 1DWQA 1WHSA 2B94A 1EX9A 1EU1A 3AF1A 4FLFA 3OOYA 1EBFA 1WDKA 5DCWA 3BXHA 4M38A 2PWZA 3P20A 3F96A 1BKDR 4XQEA 3DL2A 1X7GA 1XUOA 2PLAA 4D96A 4G5OA 1F9EA 2OAQ1 4ZALA 4IP0A 4NABA 4PAGA 4QFMA 2FW9A 4FWIB 3TKLA 4QKQA 2PO7A 3ZWXA 2PGJA 5HHTA 2X19A 2AYZA 1MQSA 3CJQA 4ZYVA 4N4AA 2WSSD 5EHZA 3R9WA 4RHUA 2GDZA 4D3DA 3X2FA 3DAHA 3OQBA 3EAGA 3JYNA 2GJAA 3JPWA 1TKBA 4YRCA 4BN5A 4MAFA 3PQCA 2E4AA 3OZEA 5FWYA 5AVRA 4RHEA 1AVTA 3JQCA 3IR6A 4F4IA 1S1MA 3A9TA 2QP9X 4MB0A 3ZHUA 1NURA 4EUKA 4MWGA 3GJ6A 5LP6C 4DM3A 2F9FA 4KAXA 4RGBA 2HXGA 1G8PA 2BLNA 3JRWA 4PZZA 5DCUA 1MX9A 3IUMA 4RDXA 3RAGA 4JENA 4MV3A 1ETUA 1XI2A 1Z5ZA 1PK7A 4KFTA 3N2KB 3REGA 1UT8A 3DT9A 2EQ5A 1W4LA 5UKDA 4BQFA 1HH4A 5IJZA 1JIJA 1RRKA 2LTAA 1KSHA 1MC4A 2R6ZA 4IHAA 2F43A 4NATA 3CLTC 3TECE 3WFJA 3QJ5A 1TYAE 2ZB3A 1KMNA 1E5VA 2EFCB 2C1ZA 1QRAA 1TCCA 3AEXA 3BZWA 3HKCA 1G6KA 3PX2A 1HI9A 3GD7A 1Y4SA 4RZ2A 4AG3A 1BX1A 2VAXA 4IQ0A 3EAQA 1W5TA 1NXVA 4JP5A 5KREA 4HQRA 4KV9A 4PO9A 5HRCA 4IWNA 4P5DA 4MUYA 4XDGA 5ECDA 2MYPA 4RKEA 4GM1A 2QTVB 2PVCA 3IMEA 3AESA 2FEPA 1DLJA 3JS5A 4JWTA 3ZY6A 4BVGA 1HF3A 1WG8A 2IRWA 3CVWA 4LF4B 4Z49A 3K9CA 4FHZA 1L7VC 3SS9X 1UBFA 3D6AA 1JDSA 1HTBA 4ATNA 2G25A 3TTWA 5TIIA 4NE7A 1E1QA 2IDJA 1A82A 2NTJA 2VNAA 3KPVA 3DMRA 2GCNA 4JC0A 4PC6A 1VKNA 2Z9BA 2DBZA 3Q85A 2J6BA 2XSZD 4NQZA 1TYZA 3FWNA 2XE8A 2B9EA 4KQFA 4R5MA 3SZLA 3H16A 1OV4A 1VBKA 3L7MA 1OMOA 1U2EA 3JQ7A 4PQRA 5IMBA 4MEAA 4ZO6A 3CUTA 3IEIA 1L7MA 5HM6A 4NPCA 5AKJA 5TB5A 5CA0F 2YHBA 3BHNA 2D2FA 3C5CA 1QF9A 5T3YA 1WVGA 2VP6A 4LNAA 1F38A 1N1GA 2OXRA 2YXDA 1GYRA 2HRZA 3L4SO 3PD1A 3BGVA 1I2BA 5J40A 3S40A 3EUAA 3OM9A 3SJ7A 3N2GA 3FVWA 4L50A 2YWXA 5I7OA 2Q6OA 2FV8A 3C3MA 3H65A 5B5SA 3I5YA 1H0HA 4HEA6 1JSXA 3BXOA 3AP3A 4YJKA 1VHTA 3W4KA 3BGWA 1ECFA 3N53A 3WWZA 3EXAA 4RVCA 1VPEA 1IHXA 2OHIA 2RI6A 3MB8A 3PS9A 4XE5A 3IP8A 3LUJA 5KTKA 1NXWA 1J9ZA 1UJ2A 3BCUA 4Q24A 1WXGA 4TTRA 4DLTA 5H82A 4RK5A 1PN3A 1UFKA 2GSWA 1I6KA 1NMEA 2NAFA 4XEUA 4X1KB 1Y8AA 3FUTA 2PXAA 3AINA 4OVKA 1LI5A 4J1NA 4U6NA 1U28C 4ERNA 1OCEA 3NBFA 5EJGA 3U80A 2FDXA 3KL2A 2B2CA 2NVUA 4FC7A 4W9NA 1GDTA 2QZJA 3CIOA 1F6WA 2I9KA 3B12A 4S3MA 3SHOA 4OHYA 2GJSA 3C3DA 1A7KA 2J0QA 5LYJA 1J2RA 3BE6A 5EXXA 4ZV9A 2ZP1A 2RK6A 1NTOA 4QLOA 3HUTA 4RQAA 3UMMA 2Y1OA 3ETLA 1N2EA 2D3WA 1L1EA 3C5EA 4HO1X 4IJ5A 3QPWA 5DRTA 5LUBA 4MW4A 1UBEA 3B3QA 3VOTA 4LF8B 4G25A 3F6BX 1WBJB 3TOZA 2Q0HA 1QFXA 4QYXA 2WUGA 5DYYA 1XZBA 3WLJA 2QTGA 3AF2A 1Y6ZA 3I2HA 2C2GA 3KPJA 4U2GA 2POCA 1LSUA 1XZNA 1UPXA 3SQXA 4MR7B 1KP3A 3ESQA 3W5JA 2R1ZA 3MRXA 1D0IA 5ALZA 2Z2ZA 1O54A 4H0CA 4LJ9A 5EKXA 5KNLA 3VJKA 4EI2A 3L0CA 221PA 2QAGC 3D4LA 1NUUA 2Q6VA 1PNQA 2WA1A 1XLWA 3EBOA 1O57A 3L7IA 4IX9A 2X1LA 4PIMA 1KJ8A 4R9UC 4QOSA 3T3IA 1DCKA 2AFHB 4IJUA 2WKPA 1Q83A 3PNLA 1U0RA 1RRFA 2Q6TA 3NBYC 3P97A 1QZ3A 2O7RA 3P0IA 1Y5LA 1JG7A 3RKRA 1ISJA 1SC4A 4J03A 2WWHA 3L0YA 3CBQA 1SOVA 3A1TA 4CV0A 4HJRA 4X9XA 2VBFA 5B57C 1L0BA 3NPMA 4OJNA 1AK9A 2G0AA 4F38A 4IAOA 2X2PA 1HGXA 3AI3A 1XEAA 5CFLA 5K3EA 5K99A 1BCSA 5WRFA 1R66A 1SZPA 3E5HA 2H5IA 4O2AF 4C06A 4F46A 3B2NA 5L7TA 1ESZA 3CNBA 5G4LA 2GFQA 3X1WA 2OQRA 2BMWA 1TYBE 3GI1A 4G41A 1IEXA 1W47A 2VSOA 4UCWA 2XQGA 2HV9A 3RV3A 5ALYA 1DRKA 1Z5VA 2WUEA 4LX0A 4EY6A 4LY9A 4L27A 3KB8A 3CRW1 4HX9A 3VR5H 4GYJA 5HA5A 4CV2A 3BAZA 1PJ3A 3W06A 1P4GA 3B9PA 1CERA 4B6OA 4RAOA 4IGFA 2GBGA 3P0HA 2JGDA 2O6LA 2GCOB 2PSFA 2BH9A 1DAIA 3AETB 4ZOBA 3T38A 4B4KA 5B36A 1I3OA 4HRYA 3C6ZA 2QT1A 1T2NA 3KEQA 5F7JA 3TNJA 3NPAA 3CRNA 2XGJA 1AUVA 4XGNA 1NUTA 1DIBA 3GFOA 2NUAA 3MUNA 4MI3A 2WB2A 3OOJA 2VQEB 1EFTA 5M04A 2VJDA 1N32B 2C95A 4Q21A 4YAUA 4MGKR 8GPBA 1Y1SA 3H5VA 4DA6A 3MT7A 4FYIA 4ZTUB 4YPVA 2ZYWX 3OTIA 1FFXA 1X7HA 2OZEA 3ND8A 4PBTA 3OETA 3BRSA 4QQRA 4URXR 1T1JA 3VI3B 4AF6A 1QWSA 1JE1A 2CUKA 1HDRA 3KQYA 2R5FA 3TX2A 4YXWD 3LQ4A 5KOHA 4CNBA 1W5EA 4A27A 1CXZA 1Y9ZA 1JDZA 1AGRA 1Q22A 1WTAA 1C80A 2HA0A 2J1LA 4ZHQB 3DSRA 4QXQA 2MYNA 5CURA 1RD4A 4ZK6A 1KEWA 3MSXA 3FCEA 3TQIA 4JA0A 4WCFA 3GLGE 2QWXA 3ZK7A 3UUFA 3WP1B 3AEYA 3WSWA 2C92A 3C1UA 1DRVA 1G20A 1VYVA 5D3MB 3UN1A 4FGKA 2FSGA 3DZ8A 4IMIB 4UHJA 5EE9A 4IXNA 1NXPA 5A6SA 1YA6A 2IW3A 1MJHA 3L1VA 1PL6A 2KBFA 2H65A 2OV3A 5KPJA 2G5GX 4H7PA 2C20A 2HNKA 3KXKA 4ALKA 3AW9A 1G60A 1W52X 4FBGA 4YP5A 2JCVA 4O4LB 5HUHA 1EXWA 4GX5A 3W5SA 2H3HA 2QL7A 1RYDA 2QG9A 5IUJC 3HR8A 5JO9A 2BIFA 5KBYA 4MRPA 4A8JB 4BUCA 3LXXA 3SBXA 4AK9A 3MELA 1MRZA 4E5DA 1N8TA 1U2DC 3O4HA 4UBNA 4DS3A 2K5UA 5KS2A 4QVIA 4JEUA 1MW9X 3O83A 2YVUA 1RACA 3A4MA 1DXQA 1D2CA 4GUDA 3LL4A 3NHAA 1HEYA 5A05A 3TW8B 1E3LA 3AVPA 3PNSA 1YCFA 4RS3A 4GXRA 1RWVA 2HY7A 3CUEF 2GNOA 2PTGA 2OFPA 3RF7A 2YZGA 4C0HA 3EW9A 3IB3A 1N7IA 4JBGA 2WYVA 2WTUA 1EH5A 3ZDQA 3E35A 1IUKA 2H31A 1EFVA 4MR8B 4YVFA 3E2MA 2IH5A 2HYIC 2Q28A 4ND8B 4KGDA 3PTAA 1EA5A 4AUMA 4KR0A 4JI8B 1WBDA 2HTFA 1Y5NA 3N8IA 3O8OA 2BTOA 3MBIA 4KX3A 3P9PA 5JRDS 1DUSA 4G5FA 5AVUA 4KE7A 2P3QA 3F7MA 4ENTA 1L7EA 4DZZA 3OA0A 1SVLA 4EVIA 1T9AA 2ZRLA 3DKIA 4B7ZA 1YZ3A 1AGPA 4QPDA 4S1NA 3TZQA 1UM8A 2W71A 2QLJA 3CNEA 1Q12A 3NAQA 3QENA 3MJHA 4XR9A 3HRIA 4ZQGA 4YV2A 1JTFA 1IPEA 4R2IA 4QBTA 1ZKMA 1KEKA 1X7ZA 1NF3A 1RT9A 1IIRA 2DHEA 1NTRA 1XRJA 3KQVA 1L5NA 2H1WA 4Y0NA 3L18A 2IHJA 3QIAA 4MLDA 1PZEA 4HCJA 4OPMA 2G82A 4YRTA 1PR6A 1ND5A 2J48A 5J2UB 2ZI7A 3V7WA 5LQNA 5IEJA 1XPOA 2GNPA 2ZR8A 4Q16A 3WWOA 3EC7A 1JWBB 3FMOB 3BC1A 4HH4A 3NAMA 5EINA 3RVJA 5CIYA 5AOAA 1T4CA 2C42A 2G9RA 4KDEA 3UG6A 4YP0A 5LP6A 3L0PA 2YIJA 2K4MA 5FBKA 2YN2A 1O03A 3AM5A 1EGHA 2YS7A 4IEFB 3IQDB 2EWVA 4C0BA 3HP7A 3PUVA 5DEIA 3H4TA 4UOZA 3CV3A 1U1FA 2W2KA 2O5VA 3BHJA 1UZAA 4FDUA 5I51A 2P62A 1T8PA 4JB8A 3TKYA 4MYUA 1JNYA 3JQPA 2NZJA 2RJOA 5JH7A 5FBVB 4I1SA 1P45A 1YC2A 3VKUA 1MW8X 4CKZA 2CZCA 2W6ID 3AF5A 3X43A 3WKAA 4WXRA 3V1MA 2XMQA 5JY1A 3T4XA 3KT3A 1E6UA 3RV4A 1JLSA 3ZDZB 3S1SA 1Z75A 3JTMA 4MA4A 2NZXA 3QG1A 2GZAA 3LE8A 5K0NA 1L5LA 3U4MA 3JR3A 3F5SA 2A59A 2QTLA 5SY6A 4BKQA 1TM7E 3I9V6 3P45A 4EECA 4XWKA 3OJCA 1CQWA 4ENPA 5BVGB 1R6UA 3CYFA 1GT91 1G3IA 2XCLA 1N5OX 3LUDA 3I0NA 4C3UA 3SHVA 3HI6A 3TQOA 1CFJA 5HFJA 1KJJA 2HJSA 3C1AA 4LMBA 3RS7A 5D1NA 4BLWA 2ONYA 5MGBA 2CFTA 4WCFB 4M4SA 2V6IA 5L4SA 4UTPA 4CI9A 1YRBA 2BCJQ 1ONNA 3HLKA 2GPNA 4RJIA 1R37A 4C08A 1I7DA 2O7QA 1HR0B 4MIKA 3PX3A 3QHPA 1YE5A 5H59A 3Q8LA 1NWHA 3KXLA 3H2IA 3FHJA 2WPNA 3WV5A 1EA7A 1XU9A 3CSDA 5KTOA 5AHOA 4EA7A 3JQ9C 5BOSB 4CGZA 3WHIA 1C2TA 2P4SA 2O8EA 5HRUA 1OXBB 1P2DA 2A2ZA 3NJ8A 4PO1A 2MINA 1JA9A 2H2FA 2QV0A 3MWDA 1IH8A 2AV6A 3UHAA 1Z4LA 4GM4A 3ZBUA 2CK3A 4EM6A 3UPTA 1Y34E 2Y76A 3LZDA 3Q1LA 4HD8A 4LJ4A 1NUAA 2EBWA 4H35A 4MO2A 3KEGA 1P1CA 1NPDA 2A88A 3F67A 1NY6A 1N0HA 5IRCD 3OJFA 3RIYA 1NMXA 2NYAA 1G7TA 4NE9A 3BWEA 1EFRD 3BMOA 1Z8HA 1FFDA 4RKFA 3KB2A 3KWMA 2C31A 3TLYA 1EXMA 1R4NA 1SA0B 1Z9BA 2MIIA 2PEZA 2PKRA 1RAGA 1VMEA 2Q5JA 3EDOA 1AQJA 2CL0X 2AMFA 5BRAA 4CPDA 3NV7A 4TS3A 1N6OA 5ALDA 3J7AC 3FLMA 1J09A 1E2FA 5NLLA 2YJZA 3UFXB 1L4KA 3QEMB 2NUPB 3ZG6A 3BRWD 4E32A 5CTAA 2ZYIA 3U1VA 4D43A 2DHDA 3MILA 1QTQA 3W7BA 2XH8A 3BPSA 1AA9A 3NWJA 5EQFA 4GRDA 4FBMA 2HEIA 4L5YA 4ZWNA 1LTKA 3UAXA 5C32A 4CMKA 4N3BA 5F35A 1IM8A 4G36A 2EJVA 1I10A 3KV3O 4Z3KA 3DBLA 1NM5C 5EZQA 1T5DX 2PBLA 3TUIC 1E62A 3E84A 2O1EA 3QGMA 5JDIA 3FOBA 4RPGA 4M0FA 3GK3A 4H7FA 1CIVA 4JBXA 4YRFA 4O59O 3SZUA 4PHHA 1TVCA 5J3JA 2MYUA 4L5JA 3JSXA 4RBNA 2PJRA 1T8RA 1KH1A 4FS8A 2IITA 2Q5HA 2XRZA 1BX3A 3DEHA 3OPNA 3R3UA 4JCOA 1T4GA 1XTPA 2I2FA 5LMZA 1NJ1A 1QH9A 2QTAA 2H63A 4BFWA 4NLLA 1P19A 3HJTA 3CN7A 2J5BA 1LW7A 1AQ6A 5TEVA 4JOSA 1PW7A 3F3MA 5F1PA 4DANA 1SUPA 4M9CA 2V4UA 3D8UA 1KU0A 2VRCD 3UKDA 4UE2A 2C7BA 4YJ3B 1IFXA 2VDQB 5AI8A 4BZXA 2IF2A 2VKQA 2VWQA 2VJKA 2ZCVA 3CQ9A 4BAUA 4D4KA 2J3EA 1FYXA 2I7DA 1IWOA 3NGMA 5CT9A 2KW5A 2XTZA 4KOEC 4M0EA 3HCFA 1QHHA 4WE3A 4PN3A 3ZK9A 4YRLA 1M2VB 3IURA 5B4TA 5JQWA 4O3MA 1GKYA 2IEBA 5TMEA 3EA0A 2NXEA 1U3CA 1CUYA 3HB9A 4ITVA 4CDRA 1CT9A 1V1MA 1K4MA 1GU0A 1ZMTA 3HO1A 2VZ0A 3IJ5A 1OV6A 1RRGA 2QUKA 1H8ED 1XZGA 1DJMA 1OY1A 2C29D 5KOJA 3GY0A 4HVTA 1RBMA 3DTNA 4ZHSA 1P60A 4J94A 1FE8A 1YU6A 2Z95A 2FWMX 3B6IA 3CMMA 3JQGB 2JAWA 1BNCA 4Q3EA 3AP1A 4YUVA 3ZTTA 5BWMA 3HXOA 4M7WA 2GKSA 2FWBA 3W05A 1QQ7A 3IAFA 3N58A 3OF5A 1YR7A 2CCKA 5GMOA 5JCOC 3BSWA 3CC8A 5B7PA 1XQVA 2QUAA 3L6CA 4AF8A 4FCWA 1DTEA 3UYKA 1YZTA 2AFRA 2YOFA 2BFCA 2VYVA 3WL8A 3O1JC 4EPYA 2AKEA 1E3MA 2NN3C 7REQB 5AJWA 1FDRA 4EJMA 2WJ6A 5CVVA 3LIPA 2H7YA 2OO5C 4XJXA 4UBKA 4G9GA 5KDLA 2ZJFA 1MB3A 3GA0A 1YU9A 3K5HA 1WW2A 1G8MA 2VA9A 3QLUA 1ZNQO 2VR1A 4PTZA 2Q1UA 3KSDO 3Q7TA 2VYFA 1OVMA 2FE4A 5DCLA 1LFAA 4WQMA 3ETJA 5TY0A 2B69A 2OBYA 4U7TB 5CGQB 2WSYB 2Z4SA 5BV7A 4QWMA 3IXQA 2UYHA 1P80A 1SQGA 3D4OA 3ETEA 4WNAB 2G8LA 3BA6A 1P2TA 1S3IA 2RH4A 1BJTA 3VYUB 3AR2A 4YJGA 1X14A 4MLCA 1JV2B 3MMZA 3CISA 5M34A 1ABBA 4YV7A 5BMVA 1G5TA 4IV8A 4YAFA 1K8YB 1XHLA 2B4QA 3S5UA 2F17A 4QYTA 3AB7A 3W1WA 1WUYA 3GOHA 4F7WA 5HKBA 1E9SA 4LDZA 3K0EA 1DIHA 3K35A 2QN3A 4N5DA 1G17A 4XJTA 1I2DA 3I2FA 4FEAA 4MRMA 3RU7A 4MTLA 1YZKA 1F6BA 4KAJA 5G0VA 3CVOA 5L3ZA 4BX9A 4B3GA 4LWPA 2X5KO 3EVEA 3IAXA 4Q4JB 5CB4F 5JFOA 3A9UA 3I92A 5EMNA 4ECEA 1OGJA 3Q7PA 4FQ5A 4QOGA 2FFBA 1XDUA 1ZU4A 3DMTC 3E7WA 4P4GA 1T9DA 4YASA 4GDFA 1J5XA 3LRXA 2QU8A 2EJBA 3AILA 4MZXA 3R6LA 2H2HA 3F4KA 3GQBA 4KJXA 2PWPA 1GNRA 2IBSA 4J4BA 2JIRA 4P7JA 4DY6A 4Q4CA 2FG7C 2BCGY 3ELYA 5DXAA 1BD3A 2WF8A 4JMLA 1ZW6A 3VR1A 3L04A 1B6GA 3OLZA 4ZCMA 2J67A 5DOZA 3HMKA 3ZDDA 4LHZA 3C7AA 3UMCA 1ACLA 4W8GA 2IEZA 5E1OA 1RYEA 2I1LA 1Q15A 3ABSB 3NAZA 5CEJA 5JQGA 3PNBA 1U2DA 5KVSA 1R15A 2HRDA 4LYGA 3TSWA 2AJCA 3BIFA 5AVJA 4DB2A 3OU6A 1NXOA 2EW1A 2CZQA 2D7CA 3QYAA 3IIKA 5B2ZA 4MV7A 4MQUA 1BOOA 1E7RA 1CJUC 3GP5A 1PTJC 1X19A 3G82C 2GD2A 4YT5A 1E1RA 3V1TC 2J85A 5U4QA 4EHIA 1PEDA 1GT6A 4QUGA 4QNMA 1OF1A 3KAQA 2BCEA 5H81A 3EZ6A 1YQQA 1WSDA 3V55A 3OQ1A 1UFQA 1XZDA 2I71A 1RCFA 3UTCA 3X2EA 5AW8A 1GG9A 1M7GA 3MT0A 1BXZA 1ZX1A 3MMPA 3UCEA 3AEQA 3ZHSA 5C1PA 2UUOA 5AI9A 1WETA 1HT2E 3EVDA 1KAGA 4HBGA 2GN1A 4L9WA 1NP7A 3FCOA 4RD4A 1IG0A 1FDTA 5LIRA 1RW4A 2SCUB 1HC7A 4L5IA 2V03A 4UBMA 4GD3Q 3QBDA 2IYPA 3NIWA 3ZBTA 2QN8A 4DWOA 2GEDA 2H2AA 2AMYA 3K9BA 4HEJA 2BHNA 2PV7A 4H1TA 4MP8A 3T34A 3D5QA 4V0QA 3DXXA 3G49A 1P5HA 3CH5A 1Q0HA 4NKRA 1W35A 1W85A 3EZXA 1Q57A 3AXTA 2CXQA 2QRVA 3CLUD 1FRZA 2V98A 2HMVA 4C2TA 3D0OA 2FF7A 4ZYLA 3DP9A 2H4HA 3G79A 4UEJA 1E3WA 4DJAA 1NBIA 1MVLA 4NONA 1SXJE 1E18A 1ORRA 1JBQA 1Y98A 4JIMA 4C5BA 2I3BA 2GN2A 1PWHA 1IUNA 1NAIA 4WDRA 1L8QA 5H3CA 1E20A 3Q9NA 1ESMA 3WQRA 5K5EA 4QZVA 3BYZA 2VQSA 1P2SA 1TRKA 4JJAA 1C41A 4OBXA 3WK5A 4UZEA 3ZIAA 5JANA 2JGRA 3D1JA 4K05A 4LHSA 4Q48A 3UV6A 1JFTA 2HLDD 3F3SA 2PA0A 3FPEA 2HWUA 2GA9A 3AV0B 1KMQA 1RZUA 4O2LA 1OR8A 1KI3A 1Y63A 3HL4A 4DILA 4L7QA 6Q21A 3GRFA 4OLHA 1KHTA 4X71A 3T9AA 1G4AE 1TYCA 1NY5A 1STOA 5JYBA 2ZUTA 2G9VA 1Z13A 2BUBA 2J5QA 2P0YA 4Y0AA 2HWYA 5JO0A 2JIBA 2X5XA 2PEYA 3E1SA 3RR2A 4MROA 4DMHA 1NSTA 1JSLA 1O6ZA 3OZCA 3NHPA 4FNAA 4U5QA 4WGFA 3VZQA 1VHJA 5CEFA 1NXXA 1FFWA 4BU0A 3TR0A 3UH0A 1Z6TA 1GCAA 2FRDC 3S2ZA 1C1DA 4EO7A 2QW0X 3H0KA 3ID6C 4XUCA 2AOTA 2FPOA 2NV6A 4PLFA 1P9NA 1QP0A 1K6JA 2ATIA 1WHTA 3CW8X 1C3OA 1GQOA 5BR7A 4AW9A 1KR5A 1Z2EA 4QVKA 1QE3A 1PO7A 3H4VA 3GFRA 4KGVA 4RORA 3K8QA 5ALHA 3ZDRA 1JEQB 3PE6A 2Q3DA 4LSWA 4D97A 2CXSA 2R44A 4V0OA 4PRLA 2H51A 1GAXA 1MO5A 3BXGA 4GR5A 4TL7A 1PUXA 2I29A 4KUHA 1IN5A 3IC5A 4KWTA 4Q05A 1XCLA 4R41A 4AKHA 1OFUX 4GBMA 1LSOA 4WXHA 3FPKA 4G81A 4BJ1A 4IDHA 5CBPB 4MWBA 5DGDA 3R75A 4ZAXA 1LWNA 3EFBA 2AXNA 4BJ3A 3OPYB 3NBQA 4HDSB 4EHNA 1TUIA 1H93A 3UXMA 4PG8A 2HA6A 2HBZA 3P52A 2PUFA 2BFPA 2A9QA 1DSSG 1XZEA 3Q5GA 4URVR 3OX2A 3TFQA 3V8RA 3WYDA 1FTQA 3FGOA 5TJHA 3AIKA 3BXXA 4LAFA 4PS1A 1EUQA 4YMHA 1BRTA 3KETA 1T6BY 4A2CA 1CP2A 5KJCA 4BNHA 4RMNA 4R01A 2NOAA 5KTSA 2W93A 3ET5A 4X62B 1NLYA 2BFEB 3KAPA 1A76A 2CGEA 2OK7A 1YB5A 1J1IA 1M6VB 1G9TA 3BN3A 3FTNA 3PEFA 3QE2A 1JEDA 2VLIA 4L02A 2B7BA 1BWSA 5A3JA 5KKAA 1CVRA 1XDZA 2CNBA 3BKXA 3V1NA 3VGJA 1BH2A 1T3GA 4TWIA 1L4HA 1FBNA 1AKUA 1NLZA 2EVWX 1N75A 2ODWA 2PMDA 1YO6A 2Y27A 1T6NA 3DFIA 1ATIA 2GM5A 2IF0A 3OURA 3PGJA 2YWRA 4WSOA 5FOXA 521PA 4BAGA 1KQGA 1MA3A 3EVTA 1CUGA 5JSUA 3HFSA 4BVFA 5BNZA 4N8EA 1EK1A 2GLXA 4BB6A 2IOFK 4IIJF 3E3LA 1GNTA 1Z5GA 4XEHA 4QPCA 2PUGA 3ZBQA 3GGOA 4ZIRB 1MJGA 4FU0A 4WKGA 2I62A 1B4DA 3OO1A 1WPRA 3CGGA 5CDFA 3RK4A 5LMCA 5ENVA 4LPKA 3R3XA 2G80A 3N8NA 1D2AA 1BJKA 1JS1X 2UZ1B 4UAUA 2JHAA 3BGDA 3F8SA 3FUVA 4NEGA 1Y5RA 3I04M 3DULA 2AYYA 3W8RA 4CYMA 1OFHA 2ZLBA 4J0DA 1PFWA 5L3SA 1UOEA 1DIRA 2DLDA 5LQCA 4JUBA 1A5SB 1PZFA 5FOTA 1KYIA 5LA6A 1FDWA 4B4OA 1U5BA 3CONA 3W3AD 3PRYA 3NVAA 4U9HS 4EW1A 5L3QB 4BQRA 2R6CA 4RTNA 2G8NA 1FU8A 3Q3VA 5B3JA 1RTTA 3PV0A 2JRCA 1B16A 1ZN8A 2QV7A 2RKWA 2WU1A 3LQQA 4A8TA 1FFYA 2QQGA 4MVJP 4QU9A 2EW8A 2VSFA 4Q12A 2XVMA 1FU7A 1LVGA 4DBZA 3FWYA 5BNIA 2CB0A 2FFHA 4CG2A 2JI9A 2ZUEA 3OFNA 4PCLA 1Y7IA 4YBZA 3L92A 3R9IA 4IDQA 4RIHA 2XYPA 4EJ6A 1JSZA 3DXFA 1ODLA 4Q9IA 5FP0A 2CBGA 4LCBA 4YB8A 5K0SA 1CRLA 3I58A 1XNHA 3ROXA 3W2GA 1EJ2A 1Y9DA 4ZYWA 3AOGA 5HZKA 5KMGA 5K6AC 2O20A 2DOKA 2P8JA 2M6LA 1ZC4A 3HUUA 1Y4DE 4POAA 3DE4X 4WXEA 3JAKB 4LUCA 4RTMA 4AG5A 4DR2B 3UZUA 1CY8A 3HVHA 4WBXC 1L4FA 1ZD8A 1IONA 2OBMA 3WOVA 4DHWA 4IJVA 4I9GA 5K3BA 2GS9A 1IBCA 1LRKA 2GN4A 1TDJA 2WT4A 1QH0A 4R98A 4CF7A 1X70A 1J25A 3VPXA 4F6LA 2BN4A 2ZIGA 5JCOA 1EK0A 4MVJD 4EA9A 3D8SA 1ZR4A 2GASA 3HR4A 1EHYA 1OB2A 4I50A 4LDJA 1KNXA 3ONFA 5EP3A 4B33A 5AD1A 5DTRA 2D1FA 4D4JA 1KSFX 2VEOA 2ZWIA 5ALUA 2JIZA 2WNSA 4DQUA 1DRUA 4XSGA 5I5EA 3AO0B 2I2AA 4PHCA 1IL0A 3NTUA 4CW7A 1JHUA 1PR9A 5BMOA 2C4HA 4HB2A 2B36A 3JQ6A 4JJKA 3ZBPA 4ER0A 3GLUA 1BWPA 3Q4GA 4O33A 3EXHA 2OG2A 2JARA 1HDOA 1JEEA 1QVVA 5G0UA 3VR2A 3HADA 1N5LA 4HDRA 4B9AA 2AZTA 2ZVPX 5FI3A 3WMEA 5JAZA 1FMFA 2F55A 2FW0A 3VHLB 3ET4A 1LKZA 2FW1A 3I6IA 2IEYA 5C9ZA 2ZUUA 5HUJA 4OU4A 1V47A 3IVCA 4L85A 4AKIA 3GZJA 4NIMA 4RF5A 4M89A 3FFBA 3JD4A 4X1IB 1M1YE 1PQ4A 2OORA 1W581 4H18A 4ZVKA 3S1AA 3ZV6A 3EXEB 4RH0A 1E1YA 2H1CA 2A5DA 1SNYA 3ANSA 3HS3A 3S44A 2TMGA 4QDUA 1FJXA 3FTPA 1KO1A 4GI1A 4QYMA 2PRJA 4Q0MA 2FSHA 1OASA 3H9BA 4W82A 4YO7A 2VK4A 5HE9A 5IVHA 2V3VA 3HB7A 1HUQA 4C88A 1YBHA 2PSJA 2RSLA 3DPSA 1IQ0A 3E70C 4FQ8A 2Q3HA 4UD6A 3HEMA 3ZE7A 2IX9A 2Q4RA 1ZSYA 1DPFA 1YGPA 3GFQA 3FJYA 4IDEA 3ZUPA 2PGDA 1GZ5A 1ODCA 2BI8A 4Z3DA 3SEZA 5TLSA 1MENA 1ZJ6A 1VRVA 1G9SA 2O52A 3DV0A 4Y7DA 1B8OA 1OE0A 3DMTA 4TYMA 4HBZA 2BGUA 2O2GA 3X2SA 5JNVA 1F7VA 1O95D 4NZMA 3ROKA 3WNZA 4QXOA 3A9SA 1NJ5A 4GIBA 2H5EA 4C04A 1NI3A 1O0BA 4G0UA 4D9MA 1OJLA 4ARVA 4ZOQI 4QUJA 3Q98A 2PO5A 7AT1A 4O02B 4YCAA 5EIWA 3FPBA 2J9ZB 4TZTA 1PKXA 3MTEA 4O2BB 4XB1A 2OYRA 3QXSA 3EIUA 3KSZO 3F5MA 2V0GA 4P3YA 3FUXA 3GBPA 1WB9A 3GU3A 4NAVA 3RM3A 2ZRFA 3CZPA 4KUEA 1T3HA 4DLKA 2QE6A 2XUQA 3VA7A 4P4SA 2HI0A 1YONA 3AHHA 2V3WA 1JG3A 2QGFA 3EA5A 1P4HA 1N5DA 1YQDA 1ZA1A 2H7XA 3I09A 3RC3A 3DL4A 3G0GA 1U99A 5GPBA 2GPSA 4ZZ0A 1J5PA 5LQSA 5SYMA 2PG3A 5JS6A 1E2EA 1EE1A 1PWEA 4HFRA 3HYTA 4X00A 2OBLA 2P9EA 4L07A 2D13A 3KNZA 3T8YA 2FK8A 3U13A 2VXOA 5KCMA 3WQSB 5J2TA 4QPNA 3KQKA 2XOXA 4Y2VA 1E7YA 1P9RA 1DX9A 3SBEA 1RZ3A 1DQPA 1DAGA 1NFRA 1QB7A 1J24A 3UWKA 4CMJA 4BZZA 1XAIA 1PV1A 1RSZA 4U02A 1XF1A 5DJ5A 1OLSA 4EK9A 1RQXA 1JFFB 2Y8EA 4WOBA 5KYNA 3IBCA 3I6YA 4TRRA 5CPBA 1TEHA 5HCNA 1PEYA 1MFZA 2FZVA 1LZLA 1Z2DA 5JVDB 4KR9A 3ZCRA 5EE1A 3ORFA 3QOXA 2YVQA 3LX4A 2FH5B 2ZQYA 3LHIA 1GJRA 4AG6A 1QFJA 4RTSA 3RK0A 5DH9A 3EXG2 2BKEA 3LUGA 3NS7A 4HAOA 1RQGA 4L0QA 4XSVA 3UK1A 3F6YA 3KOWA 4OUDA 1DKQA 2WMOB 3WGYA 4LS3A 3MNFA 2VQ6A 3BX1A 3OAAA 4L3VA 4P5EA 4AWAA 5AJVB 4AJHA 2A84A 3A2NA 4IIDA 2BC9A 8MHTA 5A02A 1Y6RA 4GSYA 5TQVA 4R1OA 4D3FA 4ZDKA 4XM2A 2NMVA 1GTJ1 1YB7A 1TUBA 2OGWA 3QVVA 4U5XA 5GONF 5ECGC 3DHVA 4QNNA 4B83A 3INNA 5U4XA 1CQIA 4M3NA 4QOJA 3O1IC 1U3TA 4O1IA 2GK4A 3DCNA 2IUUA 1T1RA 1F4PA 1P33A 1TC1A 1UOQA 1M8PA 1DE0A 2PFSA 3PDCA 4OY3A 3ZVNA 4II3A 3O47A 4MOWA 1BG6A 1D0VA 2DBQA 3TD2A 1TECE 5C8YA 1T2AA 3G2HA 1XZLA 1C1XA 5DYIA 1KAOA 4XPIA 4QBIA 2YDYA 3IPRA 1ENOA 5ALGA 1LF0A 3SR0A 2WB4A 1XEWY 2O8FA 2DCUA 2DQ4A 2GLUA 3B3JA 1YS7A 3IBYA 3L4BC 4IF4A 4JLWA 3RSCA 4A8JC 1EINA 3IDOA 3LLCA 2K87A 4KQXA 2FQXA 2Q1WA 2IEDA 3P0EA 5E2BA 4E5UA 3SZ3A 3K73O 4FFBA 3AF6A 4JJZA 4LOAA 3ADDA 3GUHA 1THTA 1W6RA 3FOWA 1XTZA 3HL0A 1EE9A 5ALSA 2FRDA 3ESXA 2RIPA 4UBOA 3EG9A 5IKMA 3SK0A 2JS7A 2IQIA 4KPFC 5KCZA 1CPYA 1N7JA 2VZLA 2W8BB 4NZZA 5CM8B 4ZCTA 4PYOA 2R3SA 5HIAA 3LLVA 5DP2A 1H2EA 5KU1A 2ZSJA 1W88A 3GGCA 3PPVA 4XASA 3RSGA 4EHLA 4MZDA 2HLPA 3GLHE 4KLZA 4MHOA 5AVVA 1FUEA 5FYQA 2R97A 3LC7O 2F1KA 2QX8A 2GN8A 3MUFA 5HK8A 1XZFA 3PP8A 1GQRA 1C0LA 3KOMA 1HY3A 4FEEA 4NK4A 3K0AA 4NYJR 3ZD7A 4G84A 2VYND 1SCBA 1K27A 4NPAA 3UMVA 3QX9A 3LUHA 3MYYA 3WRVA 4OAQA 4E5YA 4F93B 1TT7A 1PZMA 2XQKA 5T8KC 3EEIA 4RS4A 5GOZA 4IYJA 3SNKA 3M5WA 3IP6A 4X61A 3SS7X 3KX2A 4I9NA 4E4TA 2E49A 3M70A 2FX2A 4OFZA 1J06A 1XQWA 2RCNA 3D4IA 1WXDA 4GECA 4CUJA 3M83A 4EMUA 4URZR 4R83A 2ZJBA 2O2XA 2BMDA 2VNJA 5ALNA 1NE7A 5EYPB 1JL3A 1XEXB 2JGLA 5CFQA 3UOAB 1POXA 3CLHA 3EVFA 3O4JA 1WKVA 4M83A 3UIEA 3LPDA 2QVLA 4W9MC 4GGMX 3SJUA 4YMTA 4EUNA 5K8UA 2MSWA 3P2JA 1K92A 2WU3A 1XA3A 4M53A 1YZLA 2QMHA 3ESZA 5SZHB 3BIWA 4BWYA 3QG5A 5IT9A 4XOIA 4JI2B 2J3HA 4BQSA 2D5IA 1Z68A 4WN9A 3RSSA 1L4NA 1E60A 3HKBB 3NAGA 3HSYA 3CXRA 4LGYA 4U1RA 3HH8A 1HLFA 3BH7A 3HXTA 3U40A 4NAHA 3GRAA 1CUSA 2B0CA 3B48A 5A2GA 5JUWA 4E0BA 4EHKA 2Q9UA 5CRIA 3RBVA 3N2EA 3PD7A 2FQQA 1KMCA 4KQ1A 4KGZA 2I4RA 4EGFA 2GZSA 3I9LA 4GGOA 5EJ8A 3OT1B 1KF0A 5ALMA 3WGNA 4ARCA 4HYQA 5ITZB 1COZA 2PX8A 1G5QA 2W22A 4MICA 2Z1MA 4CWAA 3CX8A 4YAEA 1ZU5A 2VWHA 5K09A 2I91A 4CIAA 1MEEA 4D9CA 4EG6A 4LK3A 4MJLA 2EG9A 3T9DA 3GAFA 721PA 1Y33E 3QBTA 1I2ZA 2NTNA 4KQEA 5ARCA 2A67A 1YJXA 1OFIA 3LGAA 3B53X 3EZ7A 1QG0A 1SUIA 4YRKA 3AR4A 4DJJA 4BGIA 5GOTA 1LI4A 5KTMA 3OOEA 4EQZA 2YOHA 3F4BA 1YFKA 3AF4A 3LHDA 3HGQA 4QRHA 2BOVA 3U7JA 1P1FA 5ALKA 2OOKA 1G8KA 4TS9A 4BEVA 4F1JA 1LV8A 4GBJA 4P2BA 2GBIA 2AWNA 2I66A 3IEPA 3TAHA 2PFGA 1JHVA 1PIWA 1I3KA 2VHWA 2WJ3A 4MWEA 2XMZA 3JATB 5A03A 2C7PA 4RQBA 1RXVA 4ZZ3A 3R9XB 2F48A 1R8XA 1EGQA 4ZANA 4FPXA 3RIEA 4OP1A 3LWDA 4O0LA 3QVMA 1P2GA 1DAPA 1W34A 3MD9A 3U7HB 4EW6A 3WB1A 1NVDA 2W2XA 1Z12A 3A6DA 3U0BA 4E22A 2VQFB 1M1UA 4UTNA 3LV8A 1VPDA 4MMXB 3FYDA 3SY8A 1ZD1A 2OV2A 5GJVC 1SD2A 2C4WA 3N5KA 4FX5A 4FLEA 3L7BA 4EYOA 2A14A 1C2YA 1LBQA 1CJCA 1W0KD 2QW8A 3HU3A 1E3TA 1XJ5A 3IJRA 1B2LA 3PPYA 4RDHA 5B7GA 5IXSA 3I2YX 1TF2A 3C6KA 4NMWA 2IU0A 3GFSA 4AIRA 1G5RA 3JRNA 1WP4A 2XNHA 2YJ5A 4IXTA 5ITVA 4IIGA 2A1IA 4N18A 1NR5A 1J42A 4X1KA 2EATA 2H17A 1F2TA 1ORDA 2WAOA 3BMXA 3G89A 4Q01A 4BWGA 4CM9A 4DB4A 3H5IA 1O94A 1J0CA 2DP4E 1L5VA 2ZPAA 4WW0A 4U4AA 3EIFA 4L9SA 1XL0A 1G8AA 1H0KA 3QF7A 3KJFA 1WMFA 5CW2A 4ZV7A 3UJ9A 1PHRA 2EEPA 1KFEB 1UQRA 3U3JA 1P0MA 5DLEA 1HETA 2I8AA 4CN9A 2Y2UA 4EB0A 5BV2P 5C7YA 1MXHA 1ZM7A 1WOMA 3ETHA 3TO5A 4IQGA 4GPD1 3A7DA 3GRCA 2LPMA 2ZRBA 3KHKA 1I36A 3RYHB 2LWIA 4QU8A 4UQLA 2J0VA 4EARA 4IOMA 4B4WA 1LJLA 2DH5A 4BFZA 1Y5IA 1EB8A 2HWWA 2I4OA 2JFUA 2R4QA 4HZIA 2CL5A 3DWFA 1BGVA 5K8JB 4NBSA 3QKRB 1K06A 5CMLA 4QDXA 5A4IS 1RRCA 3HB4X 2CMDA 2V7VA 5ERXA 3TLKA 1PGNA 4S24A 4ZOCA 1FSPA 5GJBA 3IIJA 2HJRA 5JPIA 3GLGB 2LVBA 1VE3A 4GZ6A 4S1WA 3S27A 3TQQA 2RFLA 2B4TO 3LNTA 1UJNA 1X1TA 2FSPA 4JX8A 4RENA 1BO6A 4C87A 2I03A 3MLBA 2DUMA 3GT4A 4A0SA 1XTSA 4ADSG 2OXCA 1DX4A 3RYCB 1XWWA 2AFHA 4F3YA 4WBNF 2CT8A 3Q2OA 2IXGA 4P3OA 1BXRA 3BFKA 4Q03A 5FBQB 3RBZA 2AWOA 2BZ1A 4DMMA 5IXYA 4P0QB 1QHSA 4V24A 3AFIA 4C7MA 1AKYA 4HDOB 2JIPA 4ZYZA 1K08A 4LX8A 2OFXA 5CNMA 3KUXA 4B43A 1SY7A 2WHRA 3BFJA 5LQAA 3AT1A 1C9JA 3WTBA 4I6EA 1OBFO 4AYTA 3E48A 3NANA 2CVPA 4QJ5A 2H4ZA 4GZ3A 5DHFA 3UGKA 1GPJA 1E96A 1GL3A 5JAQA 1Q3KA 2O3QA 3V2GA 3OPXA 3JZIA 3KSAC 1DZIA 4INOA 3WLPA 4OREX 3EDQA 4Y98A 3IAS1 3CVXA 1ZOLA 4D02A 4RL4A 1ADBA 4EVRA 3GJ8A 3VDXA 4UTVA 3SHWA 1NVUQ 3KKLA 2R6AA 2DLCX 2HRRA 3CJRA 1MEJA 2XYRA 5DTIA 9ABPA 3KTDA 2Y1CA 2DFDA 2P5YA 1N9KA 1TXGA 4O4IB 5F73A 1L7OA 4QOHA 1TL7C 2XYGA 1J23A 4II2A 3QXJA 3PPWA 4Y6PA 2TSYB 2ZSUA 4EITA 1SGWA 4TMXA 4BVBA 5K1ZA 4F86A 1M5RA 2GCOA 3ESBA 1IY1A 3GAMA 1WP9A 4CVNA 5K8CA 3AETA 3OZAA 5KYUB 1GTVA 3PHIA 3A6EA 1GPAA 2OAEA 3AJDA 4O4HF 3AVUA 3BCHA 2IYFA 2TECE 1UIMA 3ON5A 3DE7X 1P18A 5EZSA 1ISSA 4ZGGA 5J58A 5LB2A 1QIHA 5M29A 1RM5A 4N0EA 4GL2A 3NH9A 1FXWA 2YWDA 3PDJA 4AKTA 4B6JA 3WXMA 2NSHA 1FSGA 4RDIA 3A28A 3RS8A 3SYLA 3TD6A 1OFVA 3W1EA 4C1NA 2WIKA 1KPIA 2VPYA 4BMXA 4RMHA 3D7MA 3QU2A 3BT7A 3LVFO 1Z38A 2WILA 4OHWA 3JRXA 5DT2A 3X3HA 2ZI6A 1TZBA 1DDIA 2NAPA 3DLAA 4KO3S 3QZUA 3QVTA 4BO1A 5JXGA 2O2DA 3GW8A 1ZXLA 2CE7A 2ZJ0A 4FNMA 2JJ2A 4XD7D 4DDHA 3HCDA 2V5UA 4B0OA 1OLXB 2IOYA 2C0QA 3QFHA 3AFNA 4ZHQA 1LBSA 1NPTO 1QHGA 3C39A 1N5JA 3NYIA 4MO9A 1GGFA 3K05A 1JMVA 4PPYA 3UBMA 2Y99A 2QE7D 2FWRA 1TZ2A 3HO8A 1ZHFA 2DWUA 1FQOA 1YQWA 2VBIA 3B6EA 3OD5A 3SPXA 4EO4A 3ISTA 2QSUA 1SKBA 1ZDMA 3NBXX 5DMXA 1VZ3A 3IE1A 1E58A 1TQHA 2ECQA 3PC8A 2PS3A 4V03A 5D3MA 5BN3A 4JHLA 5C7IO 3DUWA 3O73A 3M9XA 4B0PA 4RO0A 4Y1RB 4B4UA 4D56A 1EK5A 3Q8XB 1MOSA 3B70A 2ZW9A 4C4YA 3JQBA 1ZIXA 2HO4A 2WK1A 3FD8A 1ADCA 1DKPA 3BERA 3GRVA 5EMJA 3UANA 4O4LA 1IBKB 4RV9A 1KWGA 2PNFA 4DA7A 4ZV4A 4L8FA 2A78A 4A8JA 5B4VA 2IP1A 6ADHA 2NIPA 3HVIA 1GITA 1Z0FA 3W2IA 3WL6A 3AZPA 4IIBA 4QATA 3DWGA 4RJLA 1OI4A 1DQZA 2VDRB 4LDNA 3U17A 4AZ0B 3PC7A 1YA4A 5KO2A 1IZYA 3JVDA 3A2KA 3TW8A 4AD8A 3AUYA 4R1QA 2PS1A 5EE3A 4GF5A 4OAOA 421PA 2XKBA 3Q6MA 3TUZC 3MFQA 4AX4A 1O4VA 1Z8FA 3OJLA 3PXEA 2H6EA 4HFJA 2JI4A 2QKYA 2WUWE 1KK1A 2JFQA 2RI0A 2AN3A 1FS5A 2Y1KA 3H1AA 3NEJA 4US0R 1DAKA 2P2CA 2P5TB 4PLVA 4LDRA 3FDFA 1L5QA 1R8SA 3FX2A 5EIEA 1S02A 2FK7A 4MR8A 3GC6A 3GLRA 1Q0ZA 4QDOA 1IATA 1YHYA 3G2QA 3I52A 1Q0SA 1M6NA 1V9CA 4ND8A 4ER5A 1AXRA 2Y1XA 3ROZA 4MWTA 3KZCA 3SF8A 4ISCA 5ADUS 4J7XA 4IZ6A 3HACA 4M9ZA 1L7AA 3FUUA 4AKSA 4DCMA 1ZJJA 2XBMA 1J7JA 4RM2A 3U9TA 5T8KA 4LZAA 5CH3A 5J5AA 2LR0A 4GX1A 4LXXA 5JLJA 1D9ZA 2MDTA 4V02A 4FSDA 3THXB 2G7MC 1QTIA 2GARA 1NW8A 1USWA 2GYWA 3U9SA 4BMVA 4KPGA 3LVQE 2BF4A 1OX6A 4K6OA 2AQHA 2B7LA 4O2AB 3V8MA 1S3GA 1QCYA 4QEKA 2KI5A 4GP6A 1A5TA 2H9YA 3FGNA 2WF5A 5CD1A 2A9RA 2HJWA 1Y6GA 2P9TA 2J9XB 2H1HA 1RZRD 1IZ8A 5J2UA 5E8RA 3FB4A 2ZAOA 3C6XA 3P26A 2ZRDA 5G3ZA 2BFBB 4QDJA 3ZJYA 1HQKA 2WIFA 4CTOA 3GVHA 2Q6IA 3GP3A 1CS0B 4OHXA 3UJDA 3KLMX 4MKFA 2YWCA 4F9EA 1AC5A 3CX3A 3R23A 2XXJA 4NBUA 4ZCSA 3UY4A 4COOA 4N54A 4OTZA 4DL9A 1JU3A 3EZ2A 2V6GA 3FWKA 3MGGA 2DPYA 4IINA 3WGVA 4YCLA 2O57A 2OSBA 4BRWA 2A0WA 1SKAA 4EX6A 4I66A 1YOVB 4EF5A 1AHNA 2F3UA 3MOGA 4GPIB 4PGMA 1HPLA 2V7EA 4NOLA 5EA2A 4BO3A 4PFKA 3HBMA 4LF5B 3X1XA 3O90A 1DBRA 1E2MA 1QX4A 1DEAA 3K1AA 4FW8A 4HGOA 4OB8A 4QELA 4DKXA 2HQSA 3AR6A 1U9JA 2WDZA 3AFOA 4QIHA 3I53A 3NC0C 3SOZA 3KZMA 3M8KA 5HF6A 2OGSA 3C1TA 3TZLA 2JLAA 1ZM2A 2OZKA 1YTLA 4C9BA 2X86A 3VR4H 3ECSA 1F0PA 3GELA 3V1UA 4GXTA 4GYYA 2LCIA 2PYIA 4HL6A 1F20A 1PT6A 3OUUA 1JDPA 4J1TC 4JQOA 4RD0A 1N25A 3ZVMA 3PHGA 3W9BA 1L8LA 4XUGB 1RHMA 2VWPA 5BVGA 5JW6A 1BVRA 4ETWA 2XQVA 5B58C 2NXCA 2F8TA 1A50B 4I5IA 1B7GO 1PW5A 1RADA 1Y4ZA 4TTIA 1DOHA 2PX0A 4OXQA 1IN6A 4QQFA 4I1IA 2A4KA 2BJHA 2FPLA 4DA4A 2YL2<