3A1TA

Crystal structue of the cytosolic domain of t. maritima feob iron iransporter in gdp form ii
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
254
structure length
254
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTILHRMILDYGEKVESEIKKVENFLRDKKLRINPRYFALKYLSGDPEFYSEGVKLGLPELSEEERIGYRLLIAKRKREYVENVVKEAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron(II) transport protein B
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 89
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1tA01
1XTSA 2QN6A 2JJ2D 2RCNA 3MWYW 5G3ZA 3TKLA 1ZNXA 4FINA 3D3QA 3U7EB 1Z22A 3EWAA 3OIVA 1CR4A 1QHYA 1NY6A 4KBGA 4V02A 2J0UA 4EQ6B 4GZMA 4Q1BA 3S1AB 5AJYA 3NBXX 2IC5A 4UJ3A 3QUSA 3TSZA 2IYXA 5EZ5A 3TBKA 2ZRJA 2XTNA 2XSZA 5JBQA 1OH5A 3CZQA 1KMHB 4BWYA 3FWYA 2ERYA 4ITRC 1MO6A 3BK7A 5FOUA 4LJ6A 3QXXA 4IFEA 3C15C 3IDQA 4KI0A 4LDJA 5JECA 1G6OA 2QM8A 5DISB 2ODNA 5JHGB 5EP2A 1HUQA 2GJ9A 1VG0B 1E96A 1CR1A 4IDOA 1XPRA 3P26A 2ZUCA 2ZYWX 2BV3A 4BFUA 4TL8A 3L82B 3KQLA 3A6PC 4M9XA 3T06B 2NMVA 4L5BA 2UZ3A 4ILEA 2CK3A 4HAYA 1OB2A 5J4KA 2GXAA 1QBKC 2VH5R 1ZNYA 2R6GA 2WWWA 3GEHA 3K0FA 1J90A 3KQHA 1NSFA 1W4CA 2FFBA 5KNBA 4JL5A 1JB1A 1YZQA 4DDTA 3NHBA 4DVGA 2ZJBA 2CCKA 4J0QA 1SKYB 3UIEA 1T91A 3IILA 5IRCD 2J7PD 3UMSA 4U7DA 1WF3A 2YKGA 2IHYA 1R10A 1VYVA 3PEVA 4Q4LA 5JS8A 3RWOA 4C0JA 1MABB 4OHZA 4MYUA 2NQ2C 1TQ6A 4QJ5A 1RPZA 4Q9KA 5CB6A 4EDHA 2V55B 4PQYA 5CB8A 2LKDA 4OI0A 2KBFA 3KXKA 4XD7D 1MKYA 1YRAA 5G40A 3QQ5A 3PG5A 3THYA 1YQTA 3GLGB 1XMVA 2ZSDA 3TUZC 3ZD6A 1JR6A 3I3SR 3IKJA 2WWXA 2F9MA 6Q21A 3HPQA 4EJSA 3NG1A 2I3BA 4M53A 4BFXA 2ZXUA 2CVHA 2AN9A 1R6BX 1NF3A 4A0HA 4LJYA 2YVUA 1W48A 4TYYA 4PC2A 4MKHA 4QBFA 4HB3A 1PVOA 1PUIA 1ZC3A 1P73A 4IEIA 5HE8A 3K0CA 3I4LA 4OL0A 1Z0KA 4ZDWA 2IXEA 1R5OA 4NZYA 2V8OA 4B43A 2F3TA 5H8WA 3CNLA 2PL3A 1CU1A 1HQYE 2D2EA 2WBLC 2GAAA 3AF4A 1E9DA 2V4ZA 1HH4A 4AKEA 3PEUA 1QF9A 2QGZA 1GITA 1FUUA 5FBRB 5AJXA 4KJZA 1IBRA 2XOKD 3X1YA 5FUWA 1XMJA 2BBWA 3WNDA 1KSJA 5CM8B 3THOA 2JLYA 1Z28A 4TT3A 2C04A 3TQFA 1TMKA 1P62B 4QKQA 2HYIC 1E94E 3RSOA 1XJ0A 2PEZA 1GZSA 1B23P 2NO1A 1YHNA 4LHYA 4M0LA 1EFHA 1OFIA 2ZYUX 4XTRA 2JLSA 1F5NA 2FEOA 1CJMA 1OXUA 4RJLA 4BFWA 4CW7A 2Q9CA 3THWA 3E70C 4DB2A 2RGCA 2C8VA 3I73A 3AKEA 2C77A 3Q7QA 1ZINA 3DHWC 5FPSA 5FBQB 3CPJB 5L3VA 2XB2A 5M04A 2HF8A 4ESVA 3QOFA 1Y3AA 2ZRNA 3ZVLA 2ANBA 2CE7A 2RH5A 1P2VA 1QRAA 1XEXB 2HLDD 3EXAA 2CHQA 3GLFA 1N6OA 4ZCIA 2H92A 3TRFA 5JI3E 1KYIA 3Q72A 1H8HA 1QDEA 3AB3A 3I61A 2ORVA 1HA3A 5AUOB 4AY2A 3RSLA 4NDZA 1HT2E 2J0UB 4IEEA 2HF9A 1LNZA 4QGGA 1N6NA 3VR5A 4WZAE 4A4DA 3WRYC 5JWRA 1DOAA 3EWSA 4A6PA 1NVVR 4KLNA 4NCNA 1US8B 4JKYA 2Z5FA 2AXPA 2CEAA 2R2AA 1OT3A 2W2TA 2OEPA 3FDIA 4U00A 3ZVRA 2HXSA 3ICEA 3SFVA 1P9RA 4I1SA 1Z0IA 1PLLA 2GESA 4PX9A 4TLDA 2Z43A 3AVOA 3MFYA 4P4UA 1KNXA 1T3HA 1ZIOA 4TL9A 1A82A 1NN1A 2G0TA 4AK9A 2F6RA 4Q4HA 2J41A 3EPHA 4GRAA 1JBKA 1R5BA 4TLBA 1KO5A 5L3QB 4Z1MA 1W0JA 3TE6A 3VMFA 5CJ2A 2VYFA 1CJKC 2P6UA 3SJAA 2GEVA 2ZRMA 3DZ8A 2JLXA 3NDPA 2JDID 1G5PA 3K0FB 2AKAB 1E2QA 1F6BA 4N1AA 3QKSA 2ONKA 4PHFA 4S2EA 3VKHA 4GMDA 2IF2A 4KO8A 1WA5A 1W2GA 1IN5A 4EIWA 1L7VC 1U81A 4JVSB 4P4SB 2RAPA 4OI1A 2YOHA 4A6XA 1FQJA 1T3SA 1NL3A 1U0HC 3B1XA 2YOGA 4Z8YA 1R5NA 4AIIA 1HE8B 1ZU4A 3X1ZA 4PANA 4C9BA 3B82A 1ZD1A 3EIHA 1XWIA 5C1BA 4GL2A 3OE7A 3BFVA 1D2EA 3KB2A 4PR0A 5F9HA 2IYZA 1Z47A 1TF2A 1KI8A 3PCRB 2ZI7A 1IONA 1ZM9A 4NYJQ 3MWJA 2L0XA 2F55A 4QC2A 1OPXA 4TTPA 3QKRB 1HURA 2QA5A 1Z5ZA 4CRWB 5BN4A 1Q1BA 3GJ3A 1SZPA 1XZPA 4P0TA 1OSNA 1ZW6A 2AK2A 2ERXA 2FGKA 3CH4B 4JVNA 1QHHB 3NC1C 1XFAA 2QY9A 2AD1A 4QL3A 5EP3A 4JLBA 4HI0E 2NPIA 3RAPR 3G5UA 1OFTA 1M2OB 4X8HA 3GLHB 3NBYC 1YR6A 5KHOC 2CJWB 2QE7D 2GXQA 2JCSA 3U7HB 2WJHA 1SXJE 3AV0B 4LYHA 5TV2A 5BYKA 3CRVA 4LJ7A 2HDNB 4C30A 4OI4A 1MO5A 4D81A 5D3MA 5FL7D 1UBEA 2GF0A 5KDLA 5BN5A 5KSOA 3CM0A 4M22A 1ZJ6A 3TW4A 1NVVQ 4HLCA 3GFOA 1VCNA 2ZJOA 1RVDA 3UMFA 1XBTA 3A4NA 2ZSBA 4JT4A 1T0JB 2QENA 4IJMA 5KSPA 3T5GA 1GUAA 3W3ZB 3ZZ0A 1ZVQA 4M9QA 4D4KA 2P67A 3LBIA 3HR7A 5JLJA 1PJRA 2GBLC 1T8UA 2OAP1 2BWJA 3UXMA 3UKDA 5JSZB 1CXZA 4L16A 1KO4A 2AR7A 2OFOA 1SKQA 1E99A 3IPXA 221PA 4LSGA 1Q0UA 3DDCA 4C0LA 4IW3B 3DM9B 4C7OB 2VP4A 2J0SA 2GHIA 4OK5A 2IYQA 4B3DA 4BFTA 3K8YA 3GFTA 1ZM3A 4KITB 2ZS9A 1CKEA 2ZRBA 4TMKA 4XOIA 2GRJA 3REFA 3WXMA 2V7QA 3QVVA 5JHHB 1UFQA 5DIFA 1ZNZA 4NCJA 3E1SA 2CVFA 2H1LA 2YV5A 2IYTA 2GWHA 1S1MA 1U8YA 4UXIA 1KGDA 2QQ0A 4OI2A 2QT0A 2CLDX 3AGQA 3HJNA 3UWKA 3BGWA 3W6NA 5J47A 1S9DA 4D26A 2MSEB 4HUQB 2C96A 4PO9A 3OEHA 5DO9A 1VTKA 5DE3A 1NIPA 4QRHA 1EWQA 1SULA 3QIAA 3B2EA 1GRRA 5DGXA 4MGZR 3V4RA 4DLTA 5SZJA 1G8PA 5FL3A 1TADA 3ZIAD 3BXZA 2GXSA 5JMTA 3IIKA 5BWMA 2C03A 3LFUA 5KOYA 3LV8A 1ZRHA 4MKFA 3FPAA 5KTYA 1KSFX 3QBVA 2H8KA 3LXXA 3QPUA 2G9NA 1UAAA 2KJQA 1G8FA 2WIBA 3P4YA 5J40A 1EFTA 4GOXA 5F98A 3TJZA 3EC2A 4GOJA 1M34E 1HE1C 4P33A 5SZHB 5B58C 3O8DA 5IF9A 1J7KA 1X8LA 3PVSA 3LVRE 3TGPA 4DLYA 4G5QA 4KHZA 4JL6A 1CJUC 1UBGA 1XJQA 4Q1FA 1A7JA 5LB4A 4JLVA 2ODBA 1LVGA 2HYDA 1D6JA 3LX8A 3QXHA 4I81A 2IF0A 2WAYA 1XJCA 3QENA 5GJWC 1FUKA 1Z0DA 1NBME 4W5HA 3KB1A 3BB3A 2EU8A 3NIBA 1SXJB 5AUNB 4BFSA 1SXJD 4M1YA 1AS2A 4US2R 1U0JA 3PEYA 2O8EA 4DC9A 1HT1E 4C0QC 2HT6A 1RFLA 4IVRA 2YJTD 3EC1A 4B33A 1UKYA 2ANCA 4FN5A 4JLKA 1KJZA 3AVQA 3U44A 2C9OA 3KFXA 5F2EA 1QHXA 1VIYA 4EFLA 1W47A 1CULC 1OXSC 5JWOA 3CBQA 3T34A 5KNCA 1M6NA 4LZZA 3TR0A 1C1YA 1E79D 1OIVA 1H8ED 2ZE8A 3OEED 5JEDA 4JSTA 4UNNA 2PLFA 2C9CA 4BLPA 2P6RA 1NN5A 2LCFA 2WPDA 1QHNA 4KFSA 3GJ4A 4TMVA 2R6DA 3KTAB 1LB1B 4MGKR 2CL7X 4V0MA 1RRFA 3D31A 3C7KA 4LBVA 2FGJA 2PZFA 2ZAOA 4Z54A 3W3AA 1UKEA 3GJ0A 4A2WA 1QG2A 3IHLA 1AZTA 4NL4H 4A8JC 4NBSA 2ZJ5A 2B92A 4JVLA 1A5TA 3WYGA 2XNDD 3T1VA 2IYWA 1R7RA 1YRBA 5TB5A 1CIPA 1U98A 2WKRA 1AM4D 1E69A 3R9WA 1IXSB 3BIFA 2JIZD 4L9WA 2ZRGA 4BZPA 1E9EA 1E9SA 4QHYA 3HYTA 4M21A 3OF5A 2XX3A 3QVUA 5HZHA 1NJFA 2CNWA 1YJ5A 3LH5A 3FTQA 4BZXA 3BS4A 1XTQA 3L0IB 1DAGA 1C9KA 4NMMA 1XPUA 2O8CA 3V4FA 5HKKD 1DPFA 4LBYA 1RC8A 3LAWA 4URWR 3PXGA 3AVWA 2QTFA 1KTVA 1N6IA 1FPMA 3GJ7A 4DB4A 2W0MA 3EX7C 3TLXA 1OW3B 721PA 1ZC4A 4Z51A 1IAQA 4BGDA 2YNMA 3MRSA 3CX7A 3BC1A 1Q22A 2O0JA 4O2RA 1GG2A 3O8RA 5EXSA 4Q7MB 3ZVMA 1DG1G 4RD3A 1XTIA 2ZR7A 1XXHA 3AVPA 3X1DA 3LW8A 2A5YB 4DLXA 2WWFA 5JCPA 4NONA 4PPNA 1II8A 1FNNA 4TYWA 4W5JA 4PQFA 1N5KA 2Y8EA 4URYR 4FIDA 1OKKD 3ZS8A 1BOFA 2MMGA 2AHOA 4B48A 2I1VB 3K9HA 3RC3A 2NO7A 1N25A 3VR4A 1Z3IX 4B44A 2QT1A 4JSYA 4ZIRA 3GLIE 1DEKA 4Q21A 4OK6A 4PHGA 3ECCA 1XDBA 1M7BA 4DSOA 1G18A 4ZCMA 3A58B 2WKPA 4TTQA 4MRVA 2QG6A 4TQ9A 4NP6A 4P32A 3NKVA 3R9IA 4Z8XA 3I1FA 1E2GA 4FWIB 2ODWA 1NBMD 4IHQA 2C95A 2FPKA 2VHTA 3G82C 2DCUA 4GNKA 2JLZA 1KKMA 2DY1A 2IT1A 4DSNA 1Z6GA 4R2IA 2D74A 1NMYA 2RGBA 1VCMA 5IK2D 2E87A 2QP3A 2WJYA 3SU8A 3GEIA 5FBWB 4FD2A 4N0DA 2MSDB 4D4MA 3LBHA 1GL7A 2ZRCA 1VHLA 4MUBA 4OYHA 2RMKA 1XPOA 1YZKA 2VHCA 3P27A 3ND8A 1KI6A 4RCYA 3SYLA 4PC3A 4RKEA 1WQ1R 4TTRA 3BAFA 3JZMA 4WBSA 4G01B 4XD7A 3OFND 1I2MA 2JLQA 4PTLA 1SKYE 1M8PA 3TAHA 1DAEA 3LW7A 2HUPA 4WVFA 1Z0AA 3K70B 3VHXA 3WY9A 1RYHA 3I5YA 4M2LA 3SN6A 2Q21A 1IY1A 3RABA 1W2HA 4AYWA 4RD1A 5F3WB 3KJEA 1RJ9A 5CITA 4TSFA 2XB4A 1Z6YA 4M9SA 3KZ1E 4MDEA 4UKDA 2FEMA 2NO9A 5AJZA 3RS5A 4HAXA 3B9QA 4TN1A 3IEVA 1S0UA 1KI1A 2JJ1A 2V9PA 3QXJA 1MO4A 4IDPA 2NPFA 5HZKA 4WXRA 1CTQA 1R8QA 4WZ6A 4Q7KA 1RE0A 4KLZA 1CR2A 3SS8A 1HEIA 2BHRA 4GSYA 3VX4A 1VECA 2O8FB 1W36B 1WBDA 3HU2A 1OH8A 1S9HA 2W6JA 4ACAA 2A9KA 5C2JB 4YXWA 3IBGA 3B6EA 3SBEA 2XOKA 2XTZA 3GJ6A 1SVKA 3X2SA 3ZQ6A 4FWTA 2Q6TA 4K46A 1FTNA 4LPKA 4JZKA 4Q4AB 2ZETA 4CIDA 3TNFA 4ZI3A 3FKSD 1E9RA 4KODA 1XNJA 2JGNA 4RFSB 1QHSA 4TYPA 2NZJA 1NVWQ 8OHMA 1ZUIA 2BOVA 1W46A 2VP6A 2ZANA 3CRW1 1U8AA 4IDHA 4A9AA 1E0JA 1E2HA 4XVRA 4CEJB 1NVXQ 3AUYA 3BOSA 1W0KA 2BMEA 4C0SA 4JJKA 4N0EA 2LWIA 2Z0MA 2FFAA 1OYYA 4X8OA 1YZNA 3CH5A 1JQJC 2QQEA 1N0UA 3CPEA 5DH9A 1KDTA 4JLPA 3GLIB 2VTKA 4JBYA 4ZDIA 3U3MA 4DJTA 1PLKA 4CGZA 5AWFC 3Q7PA 2D2FA 5CDFE 2FMXA 2HLDA 4A36A 1F2TA 1FX0A 1YU9A 4JKIA 1G3UA 1U9IC 2PJZA 4Q9LA 4DLSA 1TPZA 2QBYA 2O5VA 1CR0A 3LX5A 4BRUA 3CX8A 1D9XA 1KO1A 1OV4A 1VPLA 2OAQ1 2DWPA 2WJIA 4AYTA 4GT1A 4ASUA 1JR3E 5KPDA 2FF7A 4US0R 4BLSA 1T3LA 3W8NA 4UXHA 4ZDKA 2ZR0A 4E5UA 2IHBA 4DIEA 3L8ZA 5A4JA 1W4BA 2VBCA 3SI7A 2WSSA 1G6HA 1AQYA 5CLLA 2O8BB 1F3OA 2FSFA 2BJWA 2O0KA 1WXQA 3PQCA 4KVAA 4OKSA 3W34A 4Q4JA 2FNAA 1ZD8A 1NMXA 3KKQA 4L15A 2QORA 4QXAA 1Z2AA 3NBZC 2OHFA 1RKBA 5FFMA 4BQSA 3THXB 1GAJA 1JXOA 4M9ZA 4RD4A 3IUYA 3E5HA 1U2RA 2WHXA 3JVUA 4R9UC 4C0KA 3HR8A 2ZVQX 4X8MA 2VF8A 4WIAA 2RGXA 4R7ZA 5JWHA 1YE8A 5L3RA 2FZ4A 1WDTA 3CKLA 3VU9A 1LY1A 3B13B 1JALA 2D7CA 4YDHB 1E9AA 1KI7A 2QAGA 1KJWA 2ZYTX 2GVDC 2XGJA 5C18A 4DT1A 5E95A 2ZRFA 2ZYVX 2VRWA 4I99A 4CEHB 5CJPA 5EUQB 4JLMA 1IOZA 4MITA 5B57C 2QZ4A 3BFKA 1P2SA 4AKHA 4LC1A 2ZPTX 2H16A 4PO8A 2OE2A 4GFDA 1VYTA 2BMDA 2H57A 2FU5C 4IOMA 3EPKA 5AR1A 1KI6B 2W58A 1N6RA 1GNRA 3KXIA 1ZUHA 3VR6A 5EXPA 1GRQA 3PENA 3QF7A 3DOEA 2XZOA 5EQTA 5DYIA 2WZQA 2YC2C 3PIRA 1GP2A 1PUJA 1KAGA 3VKWA 1AGRA 2IS6A 4YMTA 1TQ2A 1EGAA 4M1OA 2OO7A 1HQCA 1TEXA 4V03A 1YKSA 2GCOA 3AH8A 1YR9A 2IYUA 2QPAA 1RJ9B 4OQFA 4BFVA 2ONJA 4Q1DA 4XJXA 1CJVC 1Q1ZA 1JAIA 4B74A 1GKUB 1P7CA 1HV8A 1DAFA 2RGAA 2C98A 4RSGA 3ZS9A 3CUEF 1ETUA 5CIWA 1ZYUA 1W4RA 5E4FA 3SQWA 1G7CA 3ADCA 4UXJA 4LV6A 1KY2A 3U7GA 2GJKA 4V0KA 2OBNA 4NYJR 4NU0A 1P9NA 2Q3FA 1X1RA 4NCIA 5GJVC 1P4SA 3PV0A 2OILA 2ZU0C 3ZGXA 3GLHE 4DKXA 3PJRA 4B3BA 2B8WA 2BCGY 3QJYA 3AKDA 5K8TA 4H1UA 5J4VA 2A7QA 1JR3D 3SBDA 1QG4A 2HT1A 2FSGA 1CJTC 3HPRA 4IVQA 1E2FA 3CRQA 4QM6A 4QBIA 3EW9A 3H84A 1P60A 1TX4B 1E1QA 2IX3A 1AS3A 4BECA 1G7TA 2FDCA 2P5SA 3PUWA 4YC7A 2NGRA 4TYNA 1E4YA 4LJ9A 2QMHA 4NH0A 2QRZA 4DIDA 3A1VA 1E98A 1E2KA 2W0SA 4B3XA 1NVUQ 1Z07A 3GPLA 5FOSA 2GZAA 3F5FA 4RZ2A 2W00A 5FTKA 1FP7A 3CO5A 1U99A 4B35A 4N3NA 2OZEA 4EPXA 2XSZD 4OQNA 4JLNA 2CL0X 3BB1A 5AUPB 3NH6A 2G88A 2ORWA 1P2UA 5B30A 3B8HA 1RIFA 3A1WA 1BKDR 2VSFA 1MO3A 4B3FX 421PA 1KO7A 1OYWA 5G41A 2EFGA 3L8YA 3QE0A 2F43A 3SDZA 1OHHA 4HLQB 4M1WA 2QBYB 1U8ZA 2DPXA 4Q9JA 3QXCA 5CM9C 3TSWA 1AK2A 2A2ZA 4F4CA 1SVWA 2ZVPX 3LWNA 4MKGA 5FBVB 3OAAA 1KK2A 2B7BA 3B1YA 2EFHB 3SOPA 4XVUA 2CK3D 2AKYA 3PITA 4RD2A 1XRJA 4U02A 1FTSA 1UADA 5FPYA 4TZ6A 1SVOA 4TMZA 3GLFE 4DHEA 2IYSA 1G21E 3LVQE 2ATXA 4MA4A 5FI0B 4F92B 4B75A 3U60B 3HWSA 4B2IA 4HZUA 2ZREA 3PUZA 4QNMA 4QJ3A 3W5IA 1N3BA 4URZR 4C4PA 1CF4A 3GJ8A 1OH6A 4HAUA 1P61B 4MYCA 1G1MA 3R20A 4WZBE 4AG5A 2OT3B 2JLRA 3OESA 3SJBA 1KI3A 2GF9A 1T0HB 3C5HA 2WJVA 2VP0A 4XWOA 5K8LA 4A8JA 3VNVA 1KSHA 3FB4A 3K9GA 5F9FA 2OCYC 4ZKDA 1Q3HA 3DPUA 1GRNA 1SVSA 2HEIA 3C16C 3SFZA 2QAGB 2IYLD 1VMAA 2GETA 4RCZA 1UJ2A 5BN3A 1VIAA 3U3JA 3THYB 3WMEA 3KKNA 3QKUA 2OCBA 4ESHA 2V6JA 4TLAA 3CF2A 1R0ZA 1T9HA 5H68A 1RRPA 4MYHA 4LV8B 4EJSB 1JPNA 4Q02A 1JJ7A 3SC3A 1N2CE 2CLSA 3PR1A 2OESA 1N6KA 1B0UA 2XXAA 1NG1A 1TQDA 2A5FA 1UBCA 4O25A 3ADKA 1NI3A 1W1WA 3RRYA 2QUZA 4DUGA 2RGNC 1Q12A 2DFLA 1K5GA 2R6CA 2WJGA 2IXGA 1P75A 4JLOA 1CEEA 3RS2A 1G9XA 2VO1A 1M7GA 4Q03A 3C5CA 4TMTA 4CT5A 5KDOA 1P6XA 1M7HA 4QGHA 1J8YF 4DDVA 1R2QA 3D7MA 1IN7A 4OBEA 1CLUA 4Q1CA 2NO0A 4B71A 3A1TA 5EUMA 2ZIAA 4GZLA 2IEZA 2KSQA 2WVJA 5FOVA 4AC9A 1D2NA 4ACBA 1HY3A 4NYIQ 1K5DA 1Q44A 2PJRA 4KV9A 4B6EA 3KKPA 2FJUA 5JRZA 1S8FA 3DOFA 4TT3D 3KJHA 3WMGA 2C99A 5J5CA 5C4GB 2PCJA 1ZAKA 2PLRA 3TQCA 1E1RA 3KUCA 5JJKA 2IUSA 4AWXA 4HB4A 3IQWA 1XF9A 2KBEA 3TVDA 4PHTA 5FBLB 2JJ8A 4KU4A 4QNRA 3BH7A 5DSZA 2XZLA 2B6HA 2VHJA 4L8GA 1AGPA 1BMFD 2IUTA 2R6FA 4H9GA 3KX2A 4H1VA 4JJZA 5FTMA 4C0BA 3THWB 1GM5A 1IN8A 1MRNA 2C5LA 2NOAA 4EUNA 2AWNA 4DLUA 4YDSA 1UBFA 2R62A 1G3QA 3BH0A 1WMSA 3T1QA 2BKEA 1L4YA 3NH9A 4DEYA 4MH0R 1Z29A 4PPGA 3K0CC 4LCBA 5DN6A 4WW0A 3ICQB 2YHSA 1G20E 4KYIB 2D7DA 1M1YE 4G5OA 3J81k 3GLFB 2ODEA 3HYRA 3TVTA 4TYQA 1KOFA 3NTUA 5LPNA 1H8HD 1FQKA 1RW4A 4PPQA 2J0QA 4LHZA 4DSTA 2QPTA 2BVNA 1DAIA 1JQLB 1ZM2A 5BQ5A 3I72A 4D25A 1OFUX 5TARA 5TDHA 3MCAA 4MRNA 3SNHA 5CIQA 5FUYA 2NO6A 1G4AE 2AXNA 3FFBA 2B8TA 3N2EA 5EXXA 3WP1B 3KFVA 2ZE6A 1DELA 2BKUA 4KVGA 5AUQA 3ZQJA 4DCNA 4POAA 3IEUA 4JYCA 1IN4A 2QM7A 2OXRA 5K8UA 3H1TA 3KL4A 3KXLA 4DBLC 4PO1A 1II9A 2IK8A 2GNOA 4A1FA 4FI3C 4OK3A 4MUAA 4OJKA 2GTPA 4Q4HB 5DLQC 3Q8XB 4YMWA 4Q19A 1X6VA 4Z1MD 1DADA 2HXYA 4KBFA 2ZRLA 1WBBA 4CEIA 1COWA 1P5ZB 4OHYA 4RVCA 5AJWA 1IHUA 3IGFA 4Q00A 4BASA 1Q57A 2B21A 4DLVA 1TF5A 2Q0HA 4JBWA 3LBNA 2W6IA 2WJJA 3F8TA 1JAHA 3QKSB 4CDGA 4D82A 3U6BA 2WTUA 4AG6A 2WWHA 5ANRB 1P2TA 2CLCX 2UZIR 3AKYA 4XIGS 1KI4A 4FMBB 2VSOA 2FFHA 2G1KA 1WCV1 3L0PA 3RS4A 1G17A 1GTVA 4IVPA 5FOXA 4HDOB 3QEJA 2ZUBA 1P72A 1A1VA 4QFMA 2P3SA 3E2IA 3HP1A 3CWQA 1W44A 1ZIPA 3OE7D 4G0NA 2HCBA 4GPTA 4QBGB 1XCPA 3FMIA 1Q21A 2FZLA 4LYAA 3ZZTA 2VQSA 4DDUA 4IOKA 4JS0A 4FCVA 4IDQA 1UDWA 3O8CA 1TQ4A 2GK7A 1EFRA 2VA8A 3QNUA 4LYFA 2BMFA 3AVYA 1X3SA 2DWOA 4DWJA 1FMLA 3VFDA 3EA5A 3H2YA 1I4LD 2PT5A 1KKLA 1E9FA 1KI2A 2X2EA 3SJCA 3R9XA 1EXMA 2HV8A 2FN4A 1Z8FA 3O8BA 4ZCLA 4A0GA 1DAHA 1CBUA 4BLRA 4B34A 2VP2A 2BM1A 4YONB 4I1VA 5KO2A 4PHHA 2XTMA 4RD0A 2ZSAA 5J4LA 2WOOA 1SXJC 3DEFA 1KHTA 1E2JA 2DBYA 5D3MB 2E1RA 3MJRA 4QBHA 4QHTA 3A36A 2EYUA 3B1WA 3FHTA 4IOLA 2QTVB 2H18A 3Q85A 4NYMR 5KYKA 1OFHA 1WE2A 4A82A 3AKCA 1EX6A 1R0XA 3KJIA 3GMTA 2JJ2A 3T1TA 1Z2CA 5JCZA 3FHOA 1YZUA 2GJ8A 2ZTSA 3SR0A 4MKIA 4TL7A 5DNYB 3U4QA 4F38A 3T15A 4EQ6A 2FG5A 5EP1A 4MDFA 2NTYC 4XSHA 2F3RA 1S3SA 4BFYA 4JMPA 3RANA 1D5CA 4HEJA 4HAVA 2J3EA 2X2FA 3FMOB 3UMRA 4V0ME 1FMJA 3CW2A 3DKPA 4Q7LA 4GMXA 3LNCA 3A8TA 5A5GA 4BE7B 4IRUB 3AUXA 3PUXA 3C4JA 3LLMA 1G7SA 3RHFA 1S4QA 2PZEA 3TIFA 4EFMA 2WWYA 4ON9A 2F1JA 2V7QD 3O47A 1OXVA 3MUFA 4JLAA 2ZAMA 5AK0A 2OM2A 3RLFA 1XZQA 2EVWX 1U90A 2REOA 5DHFA 4PZZA 3KJGA 4IXMA 3CONA 4MGIR 1E9BA 4HUTA 1TU4A 5LD2B 3NDBB 3CPHA 2QRNA 4KXFB 4LHXA 3BWDD 4PFSA 4R2HA 1KDPA 2CXXA 5EE0A 5BXQC 4A15A 3R8FA 1J2JA 3OEHD 4B3CA 1G5RA 1QVRA 1NIJA 2AL7A 2WWIA 4PAMA 2ZRDA 3UATA 5CK4A 1E0SA 3RC8A 2ZI5A 3L0OA 2QP9X 4LWZA 2XJ9A 4BUJA 1XTJA 1ZCAA 3BD9A 2J7PA 4NTZA 1VG1A 3SE0A 4JLJA 2A78A 2Z4SA 5E7MA 3C14C 2CBZA 4LV5B 3W6PA 3A4LA 2IL1A 3BFXA 3GEEA 1MABA 4B76A 1KO8A 1XXHE 2H17A 2F1IA 3OIYA 5TVKA 2XNSA 2X77A 2CHVA 2AK3A 3QBTA 4XWKA 2W2VA 3EZ6A 1T6NA 4Q01A 3GFPA 3TK1A 1KY3A 4NCHA 1T4GA 4QOSA 3U2QA 4A2QA 4HB2A 1IXRC 4YMSA 4IOJA 3GLGA 2YYZA 1CS4C 4IFBA 4C0AC 3FVQA 3K70D 1VG8A 4KSCA 4XVQA 2ZJYA 1KK1A 3I92A 4OHXA 5HCIA 3F0TA 4NYMQ 2EFEB 4XSGA 2ZUDA 4FW9A 5CK5A 1ZP6A 3B5JA 3EAQA 3IO3A 4PZYA 2GAOA 2VF7A 3HDTA 3B1VA 2G3YA 2ZJZA 4TLEA 1G291 2O8EB 2PX0A 1RZ3A 4B3GA 2GZDA 1ESNA 1YZGA 2OCPA 2VSXA 3IIJA 2O52A 4HZIA 2RGDA 3KQUA 1Z6XA 3RS3A 4DCSA 4DRZA 4EPWA 2OUKA 1EK0A 3U44B 4OJQA 3P20A 4FCTA 5HPYB 1GSIA 5KUTA 3AF2A 3PEWA 2ZU6A 4PSAA 4EAQA 3EZ2A 1UF9A 4D6PA 1W36D 3AF1A 4Q1AA 5JEEA 3CR7A 1R0YA 1E2NA 3BH6A 2R9VA 3SZRA 3NC0C 3B7GA 1UEJA 2N42A 3A1SA 1G5TA 3U61B 3LRPA 1ZBDA 4B47A 3QF4A 2X1VA 4LRWA 4HLUC 3LO5A 1SVLA 4W5WA 1DTSA 5HE9A 2H7VA 4PZLA 4AKIA 1YVDA 3K70C 4LJ8A 3TW8B 1F2UA 2DFNA 4I1UA 2FH5B 3RNLA 4UNPA 4LI0A 2ECKA 5DYGA 1G3IA 4BEBA 4ZV4A 4HDCA 1CRPA 4LJAA 1FW6A 4DCUA 1ZNWA 2V1UA 3DMNA 2V54A 4JIMA 2IWHA 2FPLA 4C2TA 3NWJA 1VYUA 1KDOA 1O3YA 4PAOA 4F7WA 1BS1A 4FCWA 3H4MA 3P1JA 2CNWD 1XD9A 4HAZA 3W90A 5TXGA 1R4AA 2O8CB 2DFKB 5IDVA 1E2DA 5EE5B 5HTKA 1XEXA 2O0HA 4OQXA 3K09C 3OIUA 3AVUA 5SZKB 3CWZA 3NEYA 4AD8A 1W36C 4E22A 2P0EA 2R8RA 1BIFA 3MMPA 2PT7A 3WMFA 3U4QB 1OF1A 2ZRPA 1E9CA 3AVXA 3UK6A 2VP5A 3CX6A 1GILA 2GILA 4M4SA 3BJIC 3B78A 2ASEA 3OZXA 2CL6X 1O87A 3T1OA 5A0FA 5P21A 2XJ4A 4I4LA 2TMKA 3FMPB 1UDXA 5H70A 1EFUA 1US8A 5GVRA 2R6AA 1N5LA 5FPTA 1TEVA 4S35A 5JS7A 1I2DA 3GCGA 1XXHB 2W2XA 1L4UA 3VKGA 4TMXA 2QEQA 1II8B 3VX3A 1XU4A 4LPSA 4BRWA 3M4YA 2N46A 1YZLA 4GP6A 5FH9A 1SVMA 2WM9B 2JA1A 4DSUA 1SQ5A 1V43A 3RS7A 2DR3A 5L3QA 4ZIRB 1P9WA 4PAQA 1H65A 2HJVA 2GDJA 3MD0A 3ZJYA 1GWNA 2WSMA 4L9SA 1LF0A 4PXAA 5DI9A 2JDIA 4ERNA 1Z6TA 1JECA 2V1XA 2V6IA 4KSBA 4PC1A 1OIXA 1S3GA 3U3OA 1NY5A 2HCJB 1JXMA 2IBMA 2V3CC 4IKEA 121PA 2QMEA 2PH1A 3FYHA 3WNCA 4Q7JB 2G77B 2RGNA 4Q9HA 3LXRA 1XD2A 3CR8A 4P4SA 5FUVA 3P32A 1VHTA 2SHKA 2CMKA 3L2OB 4R71A 5KPJA 1Z0JA 3WRXC 1E6CA 2D06A 1TAGA 3I62A 5TY0A 1X8JA 2VPPA 1LV7A 1KSGA 1F48A 2ZRKA 3CRMA 1TU3A 2FWRA 3B85A 4Q9IA 5J4HA 3JVVA 3IPYA 4C2UA 4G1UC 1S2MA 1Z06A 1L2TA 2QAJA 4G5RA 2RGGA 3LDAA 2I1QA 5EXTA 4B2PA 3EARA 2GBLA 5E7JA 1EFCA 1UM8A 2RKOA 1A2KC 4O3MA 1D8TA 3CIOA 1YR8A 3BORA 621PA 4PC6A 1E32A 3QKRA 4MQBA 3AEZA 1SVIA 3MWLA 1I4DD 3RDPA 2GEDA 2XEXA 3HU1A 3WYAA 1QHHA 1AKEA 2YWEA 1XTRA 1JNYA 2FPMA 1N6HA 2WAXA 2WICA 4LGMA 5ELXA 4YMVA 3G0HA 3EZ9A 3GLHA 4BEJA 1DAKA 2QE7A 2CJWA 1JEDA 5TMPA 4TSFD 5JZVA 2Q3HA 3WBJA 3A37A 3AVTA 1XEWY 1X1SA 5FL7A 2J5XA 5FTLA 4MRSA 2ZI6A 2EWWA 4XH9B 5JJIA 2IYVA 1UPTA 1BYIA 2JJ1D 2REBA 1LW7A 1MOZA 5HCNA 1K8RA 1XD8A 4ZO4A 1SGWA 521PA 3L0SA 4KFTA 5FPHA 1FL9A 5EJEA 1G3RA 1X8KA 2G83A 4P3YA 3ASYA 4LJ5A 2W6JD 2WIAA 4YXWD 2YINC 3AQ4A 4ZDJA 2ZS8A 4O2LA 2EWVA 3K1JA 2QP4A 1V5WA 3CLVA 3LLUA 1W49A 2FFQA 2ZR9A 4BLTA 3KUDA 1N6LA 4EPTA 5JSZA 1FZQA 3RRNA 1A4RA 2VEDA 3QF4B 3ZZUA 4LOAA 5EP4A 1BH2A 2BCJQ 4PSVA 2KE5A 4Q5IA 1DS6A 4ARZA 4C7OA 2GXUA 1FOEB 2XITA 3KQKA 3CF0A 4BPBA 4CF7A 1F2UB 1ZM4A 4V0NA 3R7WA 2GZHA 3I32A 1W0KD 1CRQA 1BMFA 4D2IA 4QGAA 4QJ4A 1TTTA 3U6KA 2JLVA 3ETLA 3HU3A 1TNDA 1VG9B 2K5UA 3QXSA 3FOZA 3IO5A 1RRGA 2E9SA 5IT5A 5GVSA 1N0WA 4UQOA 5DI3A 4I1OA 3TUIC 3Q9LA 5B2ZA 4DEXA 1G16A 2XAUA 4MYTA 1MH1A 4RZUA 4ZI2A 2G6BA 1HYQA 4HUQA 4B6FA 4FMCB 1F2TB 1FX0B 1XMIA 2C78A 3I8XA 2N1BA 2MSCB 4B2LA 4EPYA 2QTHA 1Z0FA 4QG7A 4NYIR 4M1KA 4MRRA 1W4AA 4JL8A 1VCOA 2QMOA 1MR3F 4DCVA 2IEYA 4V0LA 2VIIA 3ZIAA 4Q66C 3NHAA 3WNBA 3FHCB 4ASUD 5CYPA 3N2IA 4OHVA 2IXFA 4K8OA 4EPRA 1KDRA 3FE2A 2PZGA 3MG9A 1ZUNB 1NN0A 4LUCA 2JASA 3K0EA 2WSSD 3EZFA 3QPWA 1NG9A 1E4VA 2WWGA 4G3XA 2H5EA 3EA0A 2PMDA 4JBXA 4Q47A 4DDWA 1ONBA 5LDDC 2WV9A 3AF0A 4GDFA 4Q4JB 5J4YA 1DBSA 2D4HA 4HDQB 3ND9A 2AX4A 3CNNA 1Z6AA 3LQRA 2GK6A 2Q9BA 3M6AA 4NCKA 1DAMA 1L8QA 1C4OA 3FKQA 1W7AA 5CLQA 1BYUA 1Q1EA 3BBPA 2ZROA 2BM0A 1LS1A 2HJGA 4TQAA 4E09A 2AWOA 1A2BA 2J0VA 2ZI4A 2REXB 3SQXA 1GL6A 1MRSA 1OXTA 3W6OA 3RVBA 4BZQA 3IBYA 5KSYA 3A1UA 2QPOA 4G5GA 1SXJA 2KB0A 3VU9B 3IIMA 5LB2A 3VR2A 1XD2B 2ZQ5A 1G4UR 2RHDA 1X86B 2BEKA 1D2MA 1QZXA 4DT1B 3TSOA 1E0AA 1U0LA 4M1MA 3VHLB 1JPJA 3GJXC 3ADBA 3AF3A 1QVAA 5C46F 2J59A 3TH5A 3MLEA 3DKVA 3T5DA 1E2LA 3BE4A 3T12A 2EQBA 1E2PA 2WMOB 1E79A 2W83A 1GNPA 1H8EA 1JI0A 2GVZC 3OEEA 2YWGA 2GA8A 2ZI9A 2QROA 3ZH9B 4AYXA 4E07A 1EG7A 1LF5A 3FMFA 3NEJA 2QMUA 2JAQA 3U5ZB 1PLJA 4D0NA 1Z83A 2DYKA 2GCNA 3KTAA 2ZJAA 1AIPA 1T5LA 1XTKA 4RKFA 2OFWA 4K81B 1QHGA 4F93B 4ABYA 3VNUA 1YR7A 3ADDA 2UVQA 1JEEA 2JATA 4LJ4A 2NIPA 1UEIA 1DG3A 2A5GA 1NNEA 2PEYA 5G53C 4FMDB 1IY2A 2DFTA 2PBRA 2GCOB 2XNDA 5LBIA 1WP9A 2OSBA 1F60A 5UKDA 5FR1A 4HATA 5GJBA 3A4MA 1KNQA 3ZYCA 4ZPXA 2AFHE 4JVMA 2JIZA 3LY5A 4URXR 2IS1A 2O8DA 5JJLA 2P65A 2QAGC 3MWKA 3AVVA 4DXAA 2ATVA 2VL7A 3FFAA 1YZTA 1TF7A 2ZS7A 3T35A 4Q18A 2ZM5A 2P6NA 3WP0A 5HKKA 1XEFA 4HSEA 2XZPA 5FUXA 4M8NE 1LTQA 1OH7A 3M1IA 3QG5A 3H86A 3MJHA 3PFIA 2IYRA 4EJSC 4RZ3A 1EWRA 2J87A 2YWHA 4BLOA 2BBOA 4GP7A 5FPKA 2C2HA 3BB4A 1FP6A 4DLWA 3BERA 5GJCA 4YMUA 2A5DA 2OG2A 3PUVA 1N0VC 1JJVA 2Q9AA 3SEAA 4O0MA 3K0SA 2IA5A 5JFGA 1E1QD 1NLYA 4LHVA 4ARZB 1AN0A 3RWMB 1ELOA 3D6TB 2GJSA 5SZIA 1G8HA 3W5JA 4TQUS 3UPUA 3R7WB 2OFXA 1KK3A 1PZNA 1TL7C 3QSYA 2ORIA 1J70A 4LY6A 2BBTA 1OKKA 3D8BA 4AKGA 4UNSA 3K9LA 3WHKA 1KJYA 5EZ6B 1WB9A 2BC9A 5D3QA 2VP9A 2ZEJA 2RB4A 1I4TD 5DI3B 2FV8A 4LX0A 1IJEA 3LQQA 1OLOA 2LKCA 1OJLA 3PUYA 3SHFA 4CYMA 1Z08A 2JEOA 2JLWA 3U3KA 4YLGA 1T8TA 1XCMA 2B7CA 3EASA 1NBMA 2EW1A 2IW3A 2P2LA 2F43B 1NKSA 1OHHD 4FXPA 2QSZA 4LBZA 1KK0A 4A92A 1NLFA 1XX6A 2YC4C 3U3RA 3EIQA 1GKIA 1KZGB 1ZM7A 3AP1A 2CCJA 4EFNA 1OIWA 3F3YA 4XTCS 5IK2A 4YQFA 4DLRA 5JI2E 3OAAD 3EG5A 1QHIA 3UANA 2X19A 3DM5A 3CRRA 1W0JD 1E2EA 4LHWA 4PC7A 5FTNA 3X1XA 4DLZA 1LFDB 1IQPA 3AP3A 3EZ7A 3WYFA 2Z4RA 5FTJA 1EX7A 1TUEA 1KIMA 4QM7A 1ZD9A 1NP6A 3VR3A 2BIFA 2DWQA 4HZUB 1IY0A 1NSTA 2F7SA 2I4IA 2R44A 3K0AA 2BEJA 1Q3TA 2FSIA 2QNRA 3DVLA 3RRMA 4DZZA 4RFVA 5GADl 1U94A 3OFNA 2EYQA 4NKRA 4HLUA 3NVAA 4GI7A 2CE2X 1NMZA 4CT4B 3U7FB 2ZJ8A 4FMCF 3MAAC 1KAOA 2P5TB 2KWIA 1Y63A 3N70A 3NXSA 4D0GA 4A8JB 2VHUA 3W8RA 4M1TA 3BRWD 3T61A 1XP8A 3QG1A 5EE9A 3QEOA 3DO6A 4P4TA 2G0NA 4UNRA 5L3SA 3ZD7A 1E3MA 2ZJ2A 2C9YA 3ZDQA 2G1JA 4JYBA 2AFIE 5K8IA 2F1HA 1G19A 1ODFA 4IXNA 2NG1A 1TUIA 2MMCA 1AKYA 4NPHA 3IHWA 2VLIA 2YZ2A 2Z6VA 4JLDA 3RS0A 1Z63A 4MRPA 1RRCA 2A30A 3K09A 2O8FA 821PA 1XB2A 3EIEA 1U9IA 2D62A 2ZE5A 3CB4A 1ZU5A 1MT0A 3RRZA 4LBWA 4B73A 1VDZA 3GJ5A 1DO0A 2BDTA 2FE4A 2PCLA 5HR5A 4II7A 1DE0A 4CVNA 1ZCBA 1NN3A 2XXAB 1P3JA 5FOTA 4LC0A 4DUGD 3ASZA 4Q4AA 2NZ8A 2AD5A 2QL6A 3FKSA 3VQTA 3KKMA 1G8GA 3VTKA 4UJ5A 2IS4A 3RYTC 1DVRA 1S1CA 3Q3JB 4RFSA 3B60A 5KDDA 3I5XA 4P31A 1VCIA 4BLQA 5C4MA 3WBKA 5BW8A 2RHMA 1E2IA 2J7KA 4CEJA 3CZPA 1AQUA 2OBMA 4TL6A 4D4LA 3IQXA 4Q48A 1GVNB 1UKVY 3CF6R 3S1AA 2O8DB 3SJZA 1GKYA 2BBSA 2A3RA 2OBLA 4XWAA 3AGPA 4JT2A 4AI6A 1NLZA 1W5SA 4Y0AA 1KMHA 4IDNA 1R0WA 3GLIA 3TR5A 2ZSFA 1AZSC 3QI2A 2BJVA 3V00A 1E1RD 3M0EA 2YWFA 5KSZA 5FI1B 4W7SA 4F4IA 2X8AA 4NHOA 1G8YA 4F4JA 4D4JA 2IWRA 4D80A 1CP2A 4OQLA 5FR2A 2UKDA 4L4UA 3ZVNA 2WOJA 4WOPA 1ESMA 4TMWA 2GJAA 2J45A 2A5JA 2CHGA 1HTWA 1Q1QA 5JRJA 2OLKA 1FFHA 2CDNA 3NBFA 3ONWA 3UG7A 4HYYA 2GKSA 4OHWA 4RD6A 4CZ2A 2FA9A 1PV4A 3W9YA 4URUR 5E3HA 1BO6A 2PMKA 1ANKA 1NJGA 2ZI3A 2D3WA 3FGNA 4FMDF 1GIAA 5DN6D 4G5SA 5CYOA 4UNQA 3EPJA 1IXZA 1K6MA 2F1RA 1NRJB 2O8BA 1MV5A 1GDDA 1N5IA 3TAUA 5KU1A 1DO2A 3LD9A 1GOTA 2ZRIA 3CNOA 1AJEA 3K53A 2KI5A 3SYKA 4HLDA 1N6PA 3MGCA 1E2MA 3DMDA 1E0KA 2R65A 4TWZA 3KQNA 3THXA 3GP8A 3JZAA 4KFUA 1R8SA 2DB3A 3AP2A 1G7RA 5H1YA 5EE1A 5KNDA 3KDSE 1GL9B 3GD7A 3SHWA 4C3ZA 4F91B 5BYJA 4TLCA 1RYFA 4KYUA 1G41A 4EKDA 1EESA 2FOLA 4QGFA 4ZKEA 3MSXA 4V0OA 2IUUA 3L43A 1W5TA 2EFDB 3B1ZA 2F9LA 3N5CA 4B32A 2OCAA 1J99A 1II0A 5DHAA 3B9PA 2OLJA 1ZMXA 3SYNA 4PQRA 3AM1A 1D9ZA 1LS6A 4R98A 4HAWA 4KCGA 1KI9A 4E03A 3C8UA 1OB5A 2ZRHA 4CEHA 2WKQA 4US1R 2BMJA 5E7IA 1KZ7B 3KKOA 4HB0A 4BFZA 4NE2A 4OQMA 3REGA 4CEIB 1XMSA 2FSHA 5LD2C 1COWD 2YOFA 2ZRAA 5L8VA 3EPLA 1IJFA 2OXCA 2W6ID 1J8MF 4U5XA 1SHZA 2DHRA 1XCGB 5AJVB 1SHKA 2GCPA 3I8SA 1M74A 2PX3A 3K0AB 4KFRA 4TZ0A 2J9RA 3K9NA 1DARA 2ZSEA 4X8LA 3Q5EA 1G3MA 4Q1EA 5FOWA 2QSYA 1KMQA 4GBMA 4WXPA 4WA7A 4W9MC 3DZDA 4PPFA 2WMNB 2VHQA 3GQBA 4RY2A 2J46A 1UKZA 2QI9C 2CCGA 2IS2A 3DL0A 2ZE7A 3TMKA 1XEWX 4M1SA 5L3SB 5G3YA 2Q3MA 4A0FA 4AURA 3OHMA 1GFIA 4Y0VA 1N5JA 3C41J 4RZXA 1VKJA 3VR1A 4LYJA 3ZLJA 4D0LB 1EFRD 2OV2A 2WPDD 2FX3A 4MGYR 5B64A 3VAAA 3H0KA 1G64A 4WAUA 2EFCB 2IYYA 1FNMA 4URVR 3GLGE 5CDFA 1WRBA 3X1WA 1Q20A 4EPVA 1GNQA 1S96A 4QHSA 4A0RA 2JLUA 3Q5DA 3QKTA 4DCTA 1T5IA 2QU8A 3V9PA 1AA9A 3LA6A 3OIWA 3WHLA 3UG6A 2Z83A 3UWOA 2RGEA 5IHPA 1IM2A 1AS0A 4GOKA 4KAXA 1JR3A 3TUJC 3P4XA 3QY0A 5EE3A 1IN6A 4C0HA 1NKTA 2J1LA 2ZITA 3QPVA 4LK2A 4A2PA 2GEUA 3R8CA 1OXXK 4PSKA 2QGNA 1OE0A
chains in the Genus database with same CATH superfamily
2QN6A 2RCNA 3O74A 3MWYW 3TKLA 1GDTA 1ZNXA 5JQGB 2LZ0A 2O3JA 3SQMA 3D3QA 1CIJA 3EWAA 4ZHQF 1CR4A 4V02A 1NY6A 1XL0A 2J0UA 1MRZA 4Q1BA 2ENUA 4RV4A 4DRXB 1E6MA 5EZ5A 2GH1A 3RARA 2XTNA 4NECA 2XE8A 1PT8A 2MWMA 4QA9A 4Y6LA 4ITRC 5CDSA 2IV7A 1M0WA 2PSEA 2JAXA 2JCYA 3BK7A 4MI6A 2YN4A 3ONDA 4U7PB 5ESWA 4DARA 5LLDA 1G6OA 1VJCA 2QM8A 2ODNA 4AICA 5LQAA 1JEYA 3UJBA 2GJ9A 3KT3A 2JAPA 3GIDA 3TTXA 2O2CA 4MVJE 4P54A 4WTOA 3QKIA 2WY2D 4NV1A 5FAXA 3COYA 1Z5WA 3BMCA 2JIBA 5CM2Z 5ICEA 2ZUCA 2GS9A 1U6IA 4F1JA 1OFUA 3PPIA 3BMQA 1DAOA 2C8KA 3ZV6A 2CZCA 3CCFA 1FRFS 3FB1A 3GXOA 2EBUA 4ZCTA 1RM3A 3R3ZA 4HAYA 1W52X 5JPDA 1P7ZA 3M81A 1CQJA 3CR3C 1ADJA 3A6GA 3DEAA 3OFSA 4FZVA 5U4QA 5EJ9A 1QBKC 5GZ1A 1ZNYA 4TXHA 5TIIA 2VJAA 3GEHA 1J90A 3K0FA 3O3CA 5GPBA 3PGKA 4GLJA 5CA0B 4BU1A 5I7HA 3KQHA 4FWBA 3I2GA 4YRRA 3D6NB 4ZYVA 5JC1A 4PZ0A 3FZYA 4NPAA 4H6XA 4L6CA 4RABA 5LZ7A 4KE9A 2BZ1A 5LWQA 7MDHA 4JL5A 3T9EA 3MTQA 1NXTA 4Y0NA 1SQFA 4DVGA 2ZJBA 2CCKA 4ZO6A 1T91A 5E0KB 3WO0A 2P35A 1QRRA 1YJCA 1S2DA 2J7PD 1N5RA 4QECA 3UY4A 1FQOA 4U7DA 3UFBA 1BX3A 4BP1A 1RXWA 1R10A 3PEVA 4Q4LA 5FWAA 1SKMA 1PEKE 4C0JA 1NBOA 4Q34A 4AN1A 2RHBA 4BO2A 2J3KA 3MOGA 5JDIA 3QA9A 4L6IA 1IOVA 4GMGA 4EUEA 3ZV7A 5LMZA 2WQ7A 3TRDA 2Q4TA 4MUXA 2C1ZA 3PE6A 2IEDA 2OBFA 3C3KA 5I7SA 3Q12A 1P1FA 2YIVX 4LDNA 4AZWA 4KV7A 4WK6A 4UHHA 3AHCA 3JWHA 2RH9B 1PIWA 2ZJ3A 3RJ5A 1YQTA 2ZYAA 1X7DA 2O4UX 4XM2A 3CKMA 4BVAA 1XMVA 2ZSDA 2IKQA 3OO1A 3I3SR 2WVAA 4V24A 5EC8A 2JFUA 1VPVA 2F9MA 3W2TA 2JFFA 1JF8A 2ZJ0A 2I3BA 1MORA 4J7CA 4BFXA 1OV6A 1FLAA 4BNUA 4GKAA 5JS2A 4Z4HA 3S2FA 1L1EA 4MS3A 2VUTA 3UHFA 1OTHA 2VJCA 2XNJA 1VJ1A 4YT2A 4CG3A 3HO1A 4XE5A 1UBHS 2EZ9A 2I7XA 1ISPA 4J4HA 4TV9A 1Z0KA 1J2UA 2UZ1B 1V7PC 4NESA 3QFRA 2IXEA 4R2MA 4HDNA 1S2IA 4D9EA 2YRFA 3N87A 4DNOA 1HLDA 3FWHA 2BFWA 3CNLA 4RLSA 3SF0A 2JVIA 2PZAA 1GUZA 1HNNA 1O4WA 2C59A 2VPYA 3ZWMA 1UBSB 2GAAA 3OZIA 2BZSA 3PEUA 1RYNA 4E2FA 2R1ZA 1K86A 1OR8A 2PH5A 4GXRA 5FBRB 1FUUA 3GBVA 4C89A 1USWA 2WD9A 2XOKD 3BRQA 5FUWA 1KU6A 3EFOA 2R48A 4MYDA 1ZLYA 1KSJA 2V9CA 4J9UE 3THOA 1EEXB 2JLYA 4H0NA 4BYMA 3VOAA 2C42A 2CSXA 1N2ZA 4LXIA 3ZCQA 1XJ0A 1FSGA 4B1FA 1U0TA 1XMOB 3HM2A 3G2MA 5TQ2B 1A4UA 3V2HA 4CTKA 4WNYA 3S29A 3IS3A 3QPBA 3UK1A 1MQ9A 4FFSA 1PZXA 2ZYUX 5AVKA 1CJMA 4I5IA 4CW7A 1W9MA 2HA2A 5K0SA 5IJWA 4FDAA 3LO8A 2PIDA 3LP8A 3ZGVA 2AS0A 2PSHA 3AKEA 3Q7QA 3U9LA 4Y9SA 2IXTA 4KFCA 1AY0A 1QKIA 1WZIA 2PR7A 4ZOLF 1RXEA 3RS9A 4R9SA 3VNQA 1F51E 1YQWA 1DUIA 2SNIE 4KGZA 3LXUX 2NO5A 3KT8A 3WYCA 4FQ8A 4Z9YA 1A8SA 2P5YA 4KR9A 2GZ1A 2ROQA 2OM6A 3ZV4A 4BNDB 3PLNA 3QHAA 2P2ZA 2ANBA 3I37X 3H0EA 4KR6A 4CMHA 2Z09A 1KQGA 3GLFA 2IYPA 2H54A 3KD2A 4KK3A 5AQ1A 5JI3E 3DTNA 1YS1X 2V59A 1H8HA 4PSDA 2CLFB 3T0FA 1CZKA 1K7CA 1HA3A 1U1DA 2BDEA 2H31A 3GZ4A 4JGGA 4G0QA 5T8KC 4IEEA 3RF6A 4I4TA 1B16A 4JLSA 5LQRA 2H00A 4GWKA 1P81A 4M1EA 5KSWB 4A6PA 1NVVR 3KR0A 1S4MA 4KLNA 3R0JA 1B2LA 1YRYE 3GGGA 2FMTA 5HGJA 1U0EA 2GBCA 3FZGA 1QXSA 2W2TA 1RKUA 4EHLA 2HXSA 3FRIA 3WLMA 4QPPA 5C1PA 3ICEA 4I1SA 3ZI7A 4TOIA 2VK4A 5GIPE 2UYHA 3LUFA 3HO6A 3ES9A 1TKAA 3USZA 1BH6A 1UC4B 4OXNA 1EX9A 3G2PA 5FLYA 4F4HA 4DV1B 1EVIA 2FR0A 4IQ8A 2G0TA 3SR3A 4TV8B 1KVRA 3S8YA 1I6KA 5CNJA 1XYGA 1I6WA 4IF6A 4LQ4A 1PKXA 1V26A 2PGXA 2J41A 3E22B 1WD7A 1E3QA 3MD9A 4MO2A 4TLBA 4TT8A 3SIPA 3T7CA 4GVLA 1KO5A 5L3QB 4CDMA 3ZXXA 3KB8A 4R69A 3AETB 3HEAA 1TVEA 2VYFA 2P6UA 3SJAA 4AIRA 3I83A 4RHTA 5ARBA 2ZRMA 4FBLA 2JLXA 2GCGA 5C9ZA 3WIVA 2JDID 1G5PA 2Q46A 2XDQB 2WM2A 5HILA 4XIFA 1VBMA 2O9JA 3QKSA 4LXYA 5F1KA 1O9HA 3I30X 5FBZA 5LR6A 1XCOA 4AJIA 3ZTWA 2IF2A 3H17A 4Q05A 1YIAA 3GJQA 4ZJPA 1IN5A 1V41E 3D6HA 2RAPA 4A6XA 3OLYA 4WPGA 4Z8YA 3B1XA 4OO3A 4AIIA 1DC3A 1L5RA 3OM8A 2WAAA 4IMIB 5I3CA 4IWNA 4MR8B 1PR4A 3G2KA 1Q0QA 4LVUA 5F64A 5EUCA 4OF4A 1E92A 3UOAB 2YHUA 4G1BA 3UCEA 2BF4A 5LYYA 3LWDA 1KPGA 3OE7A 1PO7A 3KB2A 4PR0A 2O50A 5F9HA 2IYZA 4C7MA 3H5RA 1KI8A 3NGLA 2PJDA 4LJSA 4ZQIA 1T9BA 2OV3A 4GBJA 4N18A 2J3MA 5FT9A 1ZM9A 2GM4A 3VHRA 4JUIA 4CKBA 3N07A 1TMGE 3MWJA 1N5MA 4K3VA 4LSMA 4W99A 4H7EA 3WA6A 2H4HA 4B80A 1HZZC 3QKRB 5LQNA 2ZT8A 1H85A 1HURA 2GR9A 2QA5A 3RG8A 4XPIB 1PGNA 1UPUA 3KCQA 3PWSA 2HPAA 4W5OA 1IB0A 2I78A 4Q9NA 4RE5A 5FA5A 5BN4A 2N3ZA 1ZW6A 1LEHA 3CH4B 3KKLA 4WK0B 3SZ3A 4G56A 1QHHB 2A67A 2WYWA 1XFAA 3TIGA 3KJQA 2HNAA 3LHFA 4JP8A 3BCHA 4QL3A 5C8VA 1V48A 1JDPA 4HI0E 1PW5A 1ODSA 1NM5C 3G5UA 4EY4A 4FDTA 4BNJA 5DOZA 4H0FA 3F7NA 2D1RA 1LBSA 2WJHA 5TV2A 3CRVA 4EGFA 5D2CA 2HDNB 3GBPA 3ZGNA 1MO5A 1NXQA 1CS0B 2E4ZA 4YJFA 1AXRA 1LPBB 3JQ6A 1DB3A 4KIWA 2RD2A 5KSOA 5BN5A 4BY9E 3LMKA 1E7SA 4G1EB 4J0HA 2Q6OA 1U7DA 3V3KA 4BX8A 3TW4A 4QD3A 3KDPA 4RMJA 1G20A 1I9GA 3PJGA 5A4KA 4HLCA 2XUDA 4E14A 1KXJA 5CBKA 4MCHA 1F5SA 2H0QA 2NVUA 1VCNA 4D8YA 3O8QA 1RVDA 2P2GA 3OC6A 2ZSBA 1X9GA 5AHOA 3FYDA 3W3ZB 1R4NA 3B12A 4D4KA 4KPYA 4EEXA 1N3LA 2D0OB 5U1PA 3HR7A 1GLGA 1RZVA 1ZEJA 5JSYA 3UA3A 3UJDA 2H5JA 3DYVA 4WCFB 2PLAA 1DJMA 4OBBA 3U1TA 2OFOA 3IPXA 3KWJA 4Y18A 1TUGA 4BKRA 3OO0A 5LM3A 4NOJA 3EMVA 3BJEA 4AO7A 3DDCA 1Q0LA 3IOCA 3DM9B 1ZMOA 1K7XB 4IJWA 2J0SA 3T7KA 4OK5A 2RAUA 4B3DA 3GFTA 3ICCA 3TCNA 4EVIA 5A0TA 1YIDA 2I03A 2RDMA 3MB5A 4AMUA 3L05A 4BNIA 1A9QA 3I5AA 3DPIA 1SBTA 3QVVA 4PYJA 3JASA 5E9JA 1KF0A 4YBRA 5AQEA 2XUKA 3S2UA 4NCJA 3WBFA 5JY6A 4CF4A 3O9VA 1G55A 1EJ2A 3P71T 3TCKA 4GXQA 3D6FA 2KLHA 1BX1A 4N6GA 4PYMA 4QIHA 3RYFA 1CYEA 2HL6A 1H6AA 3E7FA 3ZHQA 4AUEA 1ZWLA 4IXTA 3JZIA 4R8SA 3C1TA 2LP4Y 1EM8B 3HJNA 3SIRA 5C8YF 1S9DA 1AQJA 1W34A 2E1PA 2NYAA 3AWIA 1PT7A 2MSEB 2C96A 3IFSA 2ZIVB 5JCJA 3PFGA 4R1SA 1AZWA 5DO9A 5IVDA 3W2GA 4DC1A 5EWJB 4BMNA 1PI3A 3HCFA 5JQWA 1AB6A 2BGKA 4Y98A 3WK8A 3IXQA 3ENWA 2JCXA 1MOPA 1S8OA 2A9QA 2FWMX 1M0SA 4QFDA 2JVKA 1D7OA 3CVWA 5SZJA 1NBEA 1TADA 4ZAXA 1ESDA 2GXSA 3CXUA 2AN5A 2I54A 4LF8B 3AHJA 4IUDS 3UAXA 2C03A 2ZOSA 3LFUA 4OXIA 1RCTE 3HWX1 4MKFA 5BW5A 3OD5A 5E9AA 5TGTA 4UAVA 4AJKA 5KTYA 5B58T 2Q1SA 3CBGA 1KSFX 4FSXA 5CA1F 1X2EA 3QPUA 3GQVA 2KJQA 2WG2A 1NDUA 4LOLA 4R3NA 3W2FA 4R0MA 1PL7A 4GOXA 2OVBA 1F1BA 1L3IA 1ZH2A 1GQQA 4QODA 5FORA 2XHZA 2H1SA 5CFMA 1HE1C 1IMOA 5B1DA 4PG6A 2Z8YM 1J2TA 1ZONA 3P2YA 4LGCA 4Z0NA 4F8YA 1QGAA 3ESRA 2NYRA 1GTL1 2VYND 1B7GO 2VAWA 3KT6A 1HDIA 1K6EA 4KO3S 1CJUC 1UBGA 4Q1FA 5DW0A 1FS6A 1K06A 2IPXA 2HB6A 3JQCA 3LA8A 1VI6A 1QQAA 3ZLJA 1XLTC 3BHJA 3MJTA 2IYOA 3UKOA 2ODBA 2AMLA 3ONNA 1BHJA 4YJ2B 2IF0A 3LGAA 1XJCA 5DYNA 3N2GA 4BVHA 4OJMX 3IKMB 1FUKA 2HA5A 1QDUA 1NBME 4X24A 4ARAA 4DGSA 3WK6A 5EPEA 1MDBA 3LFTA 1IJBA 5A1JA 1N34B 4YI3A 4M1YA 1AS2A 3GPIA 1BFDA 4XFDA 2O48X 5ARCA 5L4LA 3PEYA 4DC9A 1IBKB 2XMSA 3TNYA 1OC4A 3IDSA 4YTEA 2PUFA 3EY9A 3GHHA 1DSSG 2YJTD 3WA7A 2DE0X 3VKUA 3U44A 4LZLA 3JR7A 5HJ2A 2JFNA 3TG2A 1FRQA 1CQIA 4I0WB 2QJFA 3U1BA 2VRCD 4HNAA 3V8RA 4KQFA 5JWOA 1XMQB 1GPJA 1B8UA 3MXTA 5TMEA 2EW8A 3BXFA 1G2OA 1EA5A 2P6RA 1VFNA 1IH8A 3O7MA 4CT0A 3UOGA 1QHNA 3GJ4A 1QVZA 3CUWA 4XDYA 3W7BA 2AVDA 2XYHA 1LB1B 3INNA 4GMFA 1MOQA 3D31A 2V0CA 1USUA 2QUBA 4CN8A 2FGJA 1UAGA 3W3AA 1V6CA 4FS8A 2QN1A 4P36A 5CD1A 3IHLA 2V6MA 2VP3A 4RL6A 2ZWAA 1TUBB 2D59A 2WTMA 4J2OA 4X97A 5JSKA 1T2CA 2ZJ5A 2QPLA 3WYGA 2XKJE 3NHUA 3AEXA 3OTWA 4LRXA 4BJHB 4K9PA 1SVNA 5FNVF 1AM4D 5AM2A 2NZVG 1E69A 2J85A 4UBJA 2IHUA 4NMHA 5LWHA 3CV3A 1E9SA 2QL7A 1VB5A 2ST1A 4QHYA 3DE3X 1ORTA 4M37A 2CNWA 5DSTA 4YN3A 1Y8CA 2D8MA 1BXGB 3BS4A 1XTQA 5C5IA 2CB0A 1YDHA 3MILA 2AIRA 1H66A 4UZEA 4Q16A 4EG1A 1XPUA 1FS4A 1KJ8A 1JHMA 4FFNA 1NDQA 2W2OA 1TT5A 4BVFA 3G49A 3PXGA 2ABWA 4CODB 1JAZA 3AIKA 1KTVA 1QAMA 5G0SA 4V0SA 1A9ZA 4O3FA 4XJVA 3H99A 1TI7A 2IPOA 1OUMA 3TLXA 1ZC4A 3JD1A 4G6ZA 4MPPA 3U7RA 1SXHA 1UP7A 3B6ZA 3CMCO 3MRSA 2WK1A 3EISA 3BC1A 4I55B 4XI9A 2WWVD 3ZI0A 3ELBA 3JCZA 3PIDA 1SCIA 4UVIA 3KJNA 3L4KA 1KEUA 1QFYA 1KBZA 5ALNA 3MWEA 3LSYA 3PXDA 4RD3A 4F45A 1X19A 3LQ4A 4Q1VA 3B20A 3AVPA 2QOEA 3QVGA 1LGYA 3WO1A 3HH8A 2WWFA 2PG3A 4NONA 4PPNA 1SU4A 4X61A 4J0KA 3DCIA 4PQFA 4M99A 1N5KA 2DFDA 2E4VA 2FPWA 1OKKD 2Y8EA 3GZNB 3OIFA 3ZS8A 1HFWA 3HL0A 3KQQA 4CFSA 2AHOA 3DE2X 4OQZA 5FNZA 1N25A 5DGDA 4RV9A 2GA9A 2Z3VA 3HY4A 3TLYA 1HNXB 3H8VA 2Y05A 1R88A 1DEKA 1JSRA 4KAFA 1YAJA 4Q21A 4QPJC 5DHRA 4BKMA 3GLIE 4BVBA 3CISA 5HK9A 5AKKA 3W8FA 2MINA 1WS6A 3PA8A 4DSOA 4ZCMA 1Y7TA 5DJ5A 1J8DA 1N1EA 4FGSA 3MGGA 4P32A 1CVIA 4F12A 1ZOSA 3PQ7A 1JKFA 3I1FA 2ODWA 4HT3B 1SH7A 3MTJA 3G82C 2DCUA 2XVYA 4GNKA 1KYVA 4I50F 2JLZA 1GM5A 5EIAA 3ZLBA 1QLJA 2J8ZA 2JZCA 1IU9A 1M5TA 2XMPA 4OQPA 5H02A 5ED4A 3D43A 4R2IA 2UVPA 2D74A 1NMYA 2C2MA 1QH8A 1DXHA 2RGBA 3ENQA 3I76A 3JXEA 3KSZO 4MXDA 5IK2D 2QP3A 4JHXA 2WJYA 4MCAA 3ZUGA 1AMOA 4FD2A 3BFJA 1VGRA 1B6TA 1FUEA 2W6CX 3RODA 2XT9A 1VCHA 4KZPA 3G7UA 4MUBA 1VHJA 3IPAA 4G0VA 1GQYA 3ROQA 1YZKA 3P27A 5K3CA 5LIPA 4CCAA 3ND8A 3VR3D 1KI6A 2PTHA 3IODA 1KJIA 3UCFA 3KHUA 10MHA 3GGPA 4DWOA 4WBSA 1BQEA 4JJ7A 4EUFA 4HNGA 2FFJA 4XD7A 5GGXA 4PTLA 1SKYE 2Y92A 1P77A 3GJSA 2EBFX 3ITNA 3LW7A 2HUPA 4QE3A 2H7CA 3FR7A 3BCUA 4B6RA 5I6DA 4KMOA 4BNYA 1XRNA 1IY1A 2YV2A 4ENUA 3EZLA 3RABA 3PGVA 3PC3A 4EA9A 1GCUA 4Y1RA 3M3HA 3M70A 2GFIA 2F8LA 1KJQA 1ZI6A 4MJXA 4WOCA 4CL8A 5CITA 1NYTA 1Z6YA 3OCXA 1DFHA 5IMSA 3JQ7A 3NXKA 1AB5A 2P77A 3KZ1E 1X7ZA 4MDEA 4UKDA 4XRGA 5BVHB 2MSKA 4K9OA 3QX7A 2R8BA 3EXFB 3PHLA 5AJZA 5EQJB 3B9QA 4F72A 2NNWB 5HZKA 1YB1A 4REOA 3RRFA 1HF3A 1L4KA 1CTQA 1R8QA 1XYVA 3P2MA 4WZ6A 3SNKA 3BRSA 3Q7EA 4KLZA 3HVIA 1HEIA 4EYKA 2O8FB 4R8RA 4QU0A 2OA0A 3HU2A 4EL0A 1S9HA 1WBDA 1UBJS 1W36B 4KRFA 2E6UX 4ACAA 1ZQ1A 3EQ7A 3IBGA 1LTHR 3B6EA 4TKUA 4B9AA 4M1ZA 1M3SA 2FXVA 1MNQA 3V55A 4HQ6A 4ETIA 3L84A 4EZEA 4GM0A 4S0XA 3X2SA 5HBGA 3UT0A 5WRFA 3VKFA 4ZI3A 4K46A 5IFLA 4FWTA 1J9ZA 1FTNA 2QWXA 2X1LA 5LA6A 2FEAA 1IIRA 4JZKA 3WJ2A 3CXRA 4U6SA 1E9RA 1WUTA 3DT6A 2P4QA 1QJ4A 1QHSA 1WHSB 3PDHA 1YJ8A 4TYPA 2XCQA 8OHMA 1QQBA 5EMJA 2XQFA 3MJVA 3MMNA 4CLEA 4GGMX 1NVXQ 4Y0AA 3TNDA 4ARBA 3LCCA 1J23A 3D7SA 4KIUA 1OFGA 3FPCA 1GG5A 1GFSA 3QI7A 1EGQA 1OYYA 4OKNA 4X8OA 3CH5A 4I6GA 5DLEA 1JJBA 4LDPA 5A62A 1W94A 2XZTA 3C1OA 2QQEA 1QC5B 1BOOA 2ODAA 2VDVE 3ABOB 3BXPA 3KEQA 4EO9A 1TO2E 1CE8A 5AW0A 4ADSG 5AVVA 3ZI4A 3GLIB 3OCVA 4S3MA 3H2SA 3LPLA 1ZXXA 3I04A 1DC4A 2YVLA 4LYYA 4PLPA 5IUNC 4YAIA 2JFWA 3O9ZA 2EOAA 3V1NA 2OOKA 1FX0A 4WFQA 2HXGA 3ELYA 4M89A 1Z4MA 1EVEA 3LBYA 4ME6A 2PJZA 4Q9LA 2QBYA 4D42A 4ER5A 3W06A 1T2AA 3IX7A 1CR0A 1WDMA 2HSEA 3W5VA 1D9XA 3OTGA 4I19A 1O6CA 4PLTA 2OAQ1 1VPLA 4IEFB 1V1MB 4GDMA 2RGYA 4AYTA 2HK7A 2YJ5A 3BAZA 3GDHA 5LYJB 3OCZA 2JGKA 5AFSA 2FMIA 4BLSA 2HC9A 2PVSA 1XTPA 1L4LA 4G84A 4ZN6A 4IJVA 1YR1A 3G8CA 4WOKA 4YK7A 1OBOA 4XYLA 1KZYC 2CJXA 4ZDKA 5LQJA 1PKEA 2XRFA 4DIEA 3JQAB 2QLBA 1T9ZA 4TM7A 3O83A 5IC5A 2QN9A 3R6LA 3BGIA 4PG7A 1G6HA 1AQYA 1UIRA 3WWPA 4LE2A 2FSFA 4MDYA 1IOLA 3PQCA 4GI1A 4L0CA 4OKSA 5K3FB 4XM1A 3TM5A 1P2BA 1DRWA 2FNAA 3C6ZA 1HZZA 3OU2A 5BOVA 4Z3DA 5DNUA 3MVEA 4RORA 2QORA 4RQUA 1J0EA 3WLEA 4CUKA 3EMBA 3P9XA 1HSOA 2QVLA 4DIOA 2AVNA 3U09A 1Z2AA 3E82A 4IDFA 5DPMA 3PHCA 4ETWA 1RKBA 3WLRA 1YJAA 3ORHA 4M9ZA 4XGNA 3E5HA 1U2RA 3NP9A 3FLMA 3IDAA 2WJ4A 3K4QA 2WHXA 4R9UC 1NM5A 1USVA 3ANSA 3FCUB 3HR8A 4NFYA 1DKPA 2VF8A 4WIAA 2RJNA 2LCIA 2BN4A 4E11A 4R7ZA 1ZEMA 4G63A 4N76A 4RCVA 2GNAA 2PQMA 4O8ZA 1GD1O 1Q1NA 1WDTA 4IIFA 1TKRA 3B13B 1I01A 2B1RA 2C9ZA 2D7CA 2HX1A 2IGTA 1T9KA 2X3UA 4I1IA 4YDHB 1TCUA 3GEMA 4ZC8A 5A3SA 4QT4A 2EF1A 1OZ0A 3V5NA 1FFDA 1FXSA 2I4RA 5CX1B 2F3PA 4I99A 3AIMA 4C4YA 4NPCA 4EHAA 2HMAA 2HWUA 4BAZA 2W6PA 3K92A 1Q0TA 2AQ8A 1B0AA 3W79A 1Z4QA 5DMXA 1M0TA 1RI4A 3VJMA 4PO8A 2OE2A 3GX1A 1AX9A 1LRKA 5HQJA 3EWIA 4DIKA 1RBZA 5HRAA 4N6OA 1RLIA 1V4NA 1ZS9A 2GVNA 2NU9A 3CUVA 3E6AA 1JHPA 2W58A 2VRBA 4R9RA 5AR1A 3W9SA 1JZSA 1NX9A 1N6RA 3KXIA 4A1OA 3NW9A 3WYBA 4WCDA 4AJ9A 1GRQA 1NVBA 1V71A 2P79A 1T9GS 2Q41A 3R7FA 3GZJA 5E1MA 4RPKA 3ZCVA 1AXEA 1JWAB 2XZOA 1LDGA 1RQ2A 2OD2A 2BLLA 1Q0HA 1WF6A 2QQFA 3MJDA 2PUEA 3JAKA 2VH1A 2QHXA 4Y2QA 1KAGA 4BZWA 1TQ2A 3AKZA 1EGAA 2XLBA 1ZOLA 1TEXA 1E8MA 1X7YB 5IANA 5T3UA 2GCOA 1YR9A 2QPAA 3E03A 4X71A 1ZQ9A 4BFVA 4WJKB 1T1IA 2ONYA 4NJOA 2PGNA 1UZLA 1E1DA 3RVNA 3NIWA 4Q1DA 1ORVA 2O59A 5JS1A 2P3LA 4A3SA 2NAPA 1JAIA 4MEBA 6YASA 4HUTA 1GKUB 3COWA 1QUEA 3ZS9A 3AHFA 3GLUA 4AZ0A 2VNSA 3N0WA 4QU5A 2C88A 1GV1A 3PK0A 1TYEB 5HSGA 5ALGA 4M60A 3ADCA 1OWNA 1T43A 1LH0A 4BV2A 2VWQA 4C4TA 1H93A 1IATA 3K8ZA 2PKCA 1YJXA 1AUXA 1CQPA 1W1UA 2I33A 5DNDA 4ZVTA 4ZVVA 1E59A 2BAGA 3G9QA 3ROZA 4WINA 4DKXA 1XELA 4Q3BA 3KR2A 1W93A 2O05A 5BWLA 1XV5A 4MB6A 3UK2A 4I5FA 3UBMA 1AKTA 2HJRA 3IVXA 1JR3D 3R24A 5ECGC 1QG4A 2GUGA 3NIFB 2JFPA 1UKBA 3D5QA 4G89A 1ITZA 2VATA 2O4CA 3LHKA 4LW8A 4AY4A 4QBIA 5FFFA 4K6MA 3EW9A 3IPRA 4CCYA 3VH2A 3HJTA 3H84A 3IQDB 4L0QA 2IX3A 1C3VA 4OLFA 3UBTA 3ZLVA 1G7TA 4RTQA 2FDCA 4Z4EA 2HCRA 3F6EX 1VIMA 1E4YA 2FWPA 4LJ9A 5BWOA 1I2BA 3TE7A 1WXFA 4DMLA 1C7JA 2G9VA 4IV5A 4WY8A 3ZDRA 4P8RA 1E2KA 2MHCA 4IQGA 3NR2A 2OWEA 4C88A 2PHZA 3GPLA 2IPMA 4QUEA 3F5FA 1BE8A 3R3YA 5FTKA 1N4AA 5KTMA 1F9EA 1FP7A 1GL3A 3AERB 3DAFA 1XLTA 2XSZD 2WP8J 4JLNA 4GPD1 3BB1A 2AMFA 5JXWA 4LRUA 2L42A 4UQPA 2WTXA 3B8HA 3PR2B 2CSUA 2EW2A 1LBQA 1RIFA 3I9MA 1XALA 2VSFA 3UXYA 2AMVA 5ADUS 4PCVA 3RFXA 3I9LA 2JGMA 2E85A 3K9QO 3WR5A 3QE0A 3AEKB 1XZIA 3I0NA 4M1WA 3VM6A 4GRDA 2ZK7A 4K40A 2XKAA 1U0SY 1N1MA 1HC7A 4U7FA 4AMVA 2DHDA 3S8EA 4D43A 4CLXA 1PX0A 4LTDA 4MKGA 3AEUB 1YOVA 1C14A 1LI5A 4TUYA 4DMFA 1J9EA 5AW4A 1NMQA 2APJA 1HE4A 4XGIA 5B3LA 3OF2A 4ALKA 2YJZA 3SOPA 1XU9A 3L02A 3QWBA 3UB2A 4XVUA 1QHFA 5EI5A 2JW5A 3PITA 4M3NA 1V1JA 4ZAWA 1XWWA 5IASA 1FTSA 3DO5A 3HFGA 1SVOA 2P90A 4TMZA 4L8WB 2IYSA 1G21E 1O89A 3F7MA 4F92B 1J33A 2WJ6A 3RAEC 2B8EA 3PUZA 4F5EA 5DOVA 4QNMA 3DGFC 1UJBA 1N3BA 1O94C 2EWMA 2YWRA 4URZR 3ZUPA 4C4PA 3PI7A 1Y5NA 1BEZA 3NNSA 1M9NA 3AESA 3R20A 3VU8A 4YP9A 1DRVA 2WLSA 2XMQA 2QRVB 4MR9A 4Q6BA 2QN3A 1ID8A 3OESA 4UFPA 2GLTA 2YHAA 3OZEA 3QVOA 2WJVA 2BMWA 1JT2A 4G41A 5I9MA 3ROXA 4XWOA 5K8LA 4MW7A 3FB4A 1RIIA 2AF4C 3PYLA 5KC8A 2I6XA 4ZKDA 3GAAA 5EJGA 4X20A 5DHQA 1KRXA 2QN8A 4CKCB 1B8NA 2BFPA 3C16C 1CUDA 3FWNA 4HGPA 3FTDA 2J67A 2RCYA 4PZAA 2IYLD 4G09A 2GETA 4EK9A 1MJHA 2AYXA 2Q5IA 3FUWA 3LCMA 3VTFA 5BN3A 1JDUA 3AONB 2W8BB 3HYSA 2RHCA 3L8GA 3I6MA 3MUOA 3AB7A 3ZWPA 2ETVA 2W48A 4QOGA 1U2TA 3KKNA 3M8KA 3QKUA 3WMEA 1JAYA 1K92A 3E1KA 3E9EA 4NDAA 1I1HA 4NBKA 2ZYDA 3IVAA 2W4MA 3LY8A 2V58A 1M10A 1C7EA 4OMCA 3U4IA 1JPNA 4LCJA 4NBUA 2P4HX 4CL0A 1KVTA 1QWOA 3SC3A 2CLSA 3PR1A 3TX6A 3QX3A 2XXAA 3BILA 1LKZA 1ONSA 1TQDA 2B94A 1HDOA 5IXSA 1A8QA 3K5WA 4K87A 4DIMA 4GEKA 4HDRB 4JJEA 2DFLA 4JLOA 2R6CA 4KXLA 1X1DA 3CEJA 5DWVA 2VO1A 1ZJYA 3ZNQA 1CFZA 4Q03A 2SICE 3LPCA 3OQ6A 3CUTA 2ZUWA 4DR1B 3LZ6A 4OHKA 2C5AA 1P6XA 4TSRA 1AHHA 1GZUA 1VL0A 2WA1A 1G6Q1 4QGHA 1J8YF 1WVGA 3CQ9A 5FBHA 1UFOA 4DM7A 4EB6A 4DDVA 4KNYA 2X9LA 5FI3A 2Y93A 1CLUA 4NQZA 2CXPA 3E3NA 3ERCA 1CUGA 1O03A 3EIUA 4BBAA 4QDTA 4GZLA 4Z4QA 2IEZA 2QD2A 5FOVA 1D2NA 1EHYA 1HY3A 2V7TA 4NYIQ 2I99A 3RREA 5CFQA 3L8MA 3OKPA 4D57A 4G4SO 3C8DA 2FJUA 3DOFA 3HB4X 2Q2QA 3I1JA 3WMGA 5MHTA 2G1AA 1N7JA 2Y68A 3DHYA 4BYGA 5AVSA 4RANA 2IUSA 3BSFA 1WCWA 3QKWA 2GUWA 2VCYA 2Y71A 1Y37A 3G0BA 2Q5OA 1N4DA 3K73O 1I2CA 1YBMA 4K6HA 3DFFA 5FBLB 1NFRA 1OGYA 2JJ8A 4QNRA 3F46A 5IH7A 4ZP1A 4JI5B 1T3ZA 2JHFA 2QTTA 2W37A 1AGPA 2YQ5A 2YY6A 5K4GA 1LK0A 1FE8A 3KX2A 4ZYUA 4YCJA 1SUEA 2OL4A 5JISA 2C5LA 3FAKA 5C34B 2AWNA 1UBFA 1FS5A 1Q91A 2C1XA 3BH0A 3ENZA 3LOPA 1D2AA 1JV2B 5TQJA 4IDAA 5FWDA 1RAAA 2W2LD 3NH9A 3QVXA 4XFKA 1C1DB 4JU8A 4MH0R 2GO1A 5EHNA 3RVMA 1W5EA 1FSZA 3R7LA 4LCBA 3A11A 4KR2A 4U2CA 3ICQB 3ABRB 1N1GA 1U5CA 3DMTC 2D7DA 1H0SA 1XIVA 4IYJA 3HYRA 4ZVOA 1IVSA 1G21B 3I2HA 4E46A 5B1YA 4RKYA 2QM0A 1UM9B 5KX5F 4IIUA 4RA9A 2RHHA 3NTUA 3R77A 2JIOA 2QAIA 1FQKA 1RW4A 1JFLA 4Z0TA 2NTEA 3JD4A 4DSTA 1A9XA 5BQ5A 1C7FA 1JQLB 1E3JA 3I72A 1DT3A 1OFUX 5TVGA 3UJ3X 2C7RA 4CR7A 4EF4A 1AF7A 1TD1A 2Q3DA 1FU7A 5FUYA 2AXNA 1G4AE 3N2EA 1AHPA 1LJLA 1IBSA 1EVJA 3P0IA 4LOKA 4WCFC 2ZUTA 3SCZA 2HA4A 2X13A 2B0CA 2OB1A 2HJSA 2JAHA 2H29A 4ND3A 4XR4A 5JMPA 4JI1B 3WP1B 2VKQA 4KVFA 1Q74A 1T0IA 1DELA 4AY3A 3B9RA 3REQA 2BKUA 2M1ZA 1E3EA 1E1MA 1KMMA 2WUFA 3L6DA 3O3NB 1G0NA 2M2IA 2YWXA 3DNMA 3MT7A 1TCAA 4JYCA 4P98A 4TS4A 3SBXA 1HE5A 1RWOA 5K8UA 2GI4A 1H2BA 1MCZA 1PGOA 1II9A 2IK8A 3PGLA 4WXMA 2P91A 3R0VA 3ZU5A 2JEYA 3FMVA 4NMWA 3PUIA 2AFIA 1R4MA 3EGXB 2GTPA 2PRJA 4Q4HB 3Q8XB 5DLQC 5DN9A 1NNI1 3B51X 3VPFA 4M0KA 4REMA 5BW4A 1H5QA 1CY4A 2IELA 3KOUA 4XQ9A 4YECA 2QK4A 4Z1MD 1Q15A 1RWWA 2HXYA 3T9FA 1WBBA 4BASA 4DIBA 4EA7A 2Q0HA 2I91A 2IYEA 3LBNA 2W6IA 4JBWA 3UAVA 3I9V6 4WJLA 1JNXX 3F8TA 1FFCA 4N7MA 4WA8A 4RTSA 1S2NA 2WWHA 1ECPA 1L5VA 3ESXA 2UZIR 3JSXA 1LBEA 1TTQB 4FMBB 4MYRA 3OE5A 5DBHX 4YDRA 4BTVA 1CD5A 4UM5A 1DQRA 1G5HA 1T4CB 1ORWA 1PK8A 1WCV1 3FGPA 4O4HB 5EHZA 3QEMA 2UVDA 1GTVA 1NJSA 2H2DA 4IVPA 1AMUA 3IBTA 3E2PA 4CMKA 1HT0A 4B7XA 2BE9A 2VK8A 3P4UA 5ISMA 1NUPA 2FPIA 3DR3A 1W44A 4HWTA 2IVZA 1ZA2A 4INAA 4QREA 5CLGA 1N2EA 2AOVA 1EK6A 4LEIA 5J58A 2I7TA 3UUFA 2EG5A 2CWDA 4FLFA 4QBGB 1YL5A 4RY8A 1XCPA 1M2NA 1T6YA 1PFGA 4RMNA 4RVGA 3DA8A 1U8UA 5HF9A 3NT4A 3TTTA 5L4NA 4R5HA 3IALA 4JS0A 4XLTA 2YJ4A 3PU6A 1USIA 2AE1A 3NDIA 3MTDA 3T1NA 2BMFA 3LWBA 4UC0A 1G8SA 1XZAA 1X3SA 1U0NA 2C82A 2DWOA 3O73A 4QWMA 4UASA 1WIWA 3EA5A 3H2YA 3DR5A 1NF2A 2FSVC 2X2EA 3G5AA 2FN4A 1CZUA 1Z15A 3DBLB 3L0BA 3LF1A 4S1TA 4L2IA 1BCSA 2A0UA 3E61A 4FD3A 2CVOA 4OUDB 3ABQB 3ZE9A 4A0GA 1HTBA 1QO7A 4GXNA 1CDZA 1TZBA 1Q0SA 1SA0A 1QYRA 4MI1A 1HZJA 3UQZA 3N8NA 4I1VA 5KO2A 4Q39A 1UFVA 2QD5A 3SC4A 5B12A 3H7IA 4UUBA 2M9MA 3KETA 4U0KA 3MT8A 1GAQA 4BMCA 1E2JA 3DVAA 4JAVC 2JLAA 3PQ8A 2HO4A 4ALLA 4BLUA 4BQPA 1V39A 3MJRA 4BQEA 2ZBFA 4QBHA 1T36B 2XKBA 1V4BA 3GMSA 5LP1A 1NQVA 2O2YA 5JU6A 2Y3IA 4FFBA 3TVYA 3KJIA 4I5GA 2CFOA 3BE8A 1FP2A 1A9SA 4JOQA 4NZMA 1V95A 3HLKA 1YZUA 2HJWA 2ZTSA 1TA4A 5JQGA 3UTCA 2YHBA 2C4KA 3B3QA 5CB4A 4O4LF 5JAZA 3QMMA 7REQB 4G4SP 1T3TA 1JIUA 2FG5A 3PFKA 2NTYC 3TR6A 2Y4OA 3T52A 2C94A 4DRXA 3ILYA 3RUFA 1ZD2P 2CKMA 3HY3A