3A1TA

Crystal structue of the cytosolic domain of t. maritima feob iron iransporter in gdp form ii
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
254
structure length
254
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTILHRMILDYGEKVESEIKKVENFLRDKKLRINPRYFALKYLSGDPEFYSEGVKLGLPELSEEERIGYRLLIAKRKREYVENVVKEAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron(II) transport protein B
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 89
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1tA01
4KJZA 3K53A 3TJZA 3UATA 3VFDA 2C03A 4JSYA 1A4RA 1D9XA 1OB5A 2XNSA 1ZUHA 2IF2A 1JEDA 4DC9A 5DN6D 5JHGB 2Z83A 1AKEA 3AVXA 1IN8A 1P73A 2ODBA 1N6RA 3SR0A 4AC9A 2AWOA 4XIGS 1J8MF 5B64A 1CR0A 1Q21A 2ZYWX 3CX7A 4HB4A 3ZIAD 1MABA 2PT5A 4CEHB 1F5NA 2A7QA 3CPEA 5IHPA 2HYIC 4TYQA 4PR0A 1QVAA 1E79D 2CMKA 3KKPA 1ESMA 4KODA 5CDFA 3SJZA 3PV0A 4Q7LA 2IC5A 1KHTA 4PXAA 4IXNA 4LUCA 4AD8A 3W6PA 4FWTA 2QBYA 2A30A 3ZS9A 2ZJYA 4IDPA 2JLWA 2H8KA 3EG5A 2WICA 1XEWY 3LNCA 1VCMA 4PHTA 3FHCB 5JLJA 2IWRA 1P9WA 5JCZA 1P60A 4F4JA 2R8RA 3BK7A 4R9UC 4B33A 2LWIA 5KNCA 1G3UA 4D80A 1II8B 2RGXA 2Q21A 2NO9A 1HURA 1WA5A 3HJNA 2W2TA 5FPKA 4XH9B 5FI0B 1NSFA 2ZTSA 4M21A 2GZAA 2WKRA 3HU2A 2I1VB 3EZ9A 2ZREA 2XOKD 1S8FA 2QROA 4XD7D 4WXRA 1GZSA 2VHQA 2VO1A 4DBLC 1G7TA 3D6TB 3EZFA 1DAEA 4YXWA 5AJXA 1R0YA 3W5IA 2YYZA 3L43A 4JT2A 4P4SB 1W0JD 4XWOA 3K9LA 1VECA 5LPNA 3MUFA 2WTUA 1NG9A 1OXVA 3SJCA 2E9SA 1G8HA 2JA1A 2NGRA 1LF5A 1Z6TA 3P20A 4RZUA 1BO6A 2CE2X 2D2EA 3C14C 5TY0A 2PJRA 3DKPA 3LW7A 4FWIB 2IEYA 1GFIA 4TMTA 4DCNA 3EPHA 2ZJ5A 3VR1A 3S1AB 3M6AA 4JMPA 3OAAD 3MWLA 2UKDA 3KKMA 1GOTA 3MD0A 2OLJA 5FOWA 1GTVA 1BYIA 3AUYA 1I2DA 2J7PA 4JLDA 4HDOB 4MQBA 1N6KA 3GQBA 1XJQA 2D7DA 5HCNA 3WBKA 5AUPB 3I5YA 1E3MA 3DZDA 3KKOA 5H68A 3TKLA 4QXAA 4HLCA 1E94E 3CBQA 2QMUA 3BH7A 3REGA 2OCAA 2B21A 4WZAE 2PL3A 1ZCBA 2ZUCA 4QFMA 4DEXA 1ZNWA 3G82C 2CL7X 3RSOA 4UXJA 3NG1A 3SHWA 4HUQA 3CR8A 3SJBA 1OYYA 4A1FA 4GL2A 5CLQA 3W5JA 1EWQA 4C0LA 3SYNA 4IFBA 1W0KD 2ZS7A 1FNMA 1AA9A 1SGWA 2FSFA 2QU8A 4Q02A 4G1UC 1NVWQ 4G01B 5EJEA 1VHLA 4WZ6A 3L0PA 4WOPA 2O8FB 4CEIB 3AQ4A 2IYVA 4URWR 3KXKA 3A4NA 1Q22A 2AD5A 2IYQA 1T0HB 4PO8A 4PZZA 1PLJA 3WMFA 5IK2A 1Z83A 3AKCA 4HB3A 1A2KC 2G9NA 2D2FA 1N6LA 1T3SA 1KZ7B 5E4FA 3A37A 1RIFA 1YE8A 3A6PC 2Y8EA 4LYHA 1Z0FA 2FF7A 2GCOA 2WM9B 2KBFA 2J0UB 3EA5A 3K0CC 4TN1A 2P2LA 4C4PA 4QBHA 2CNWA 1CS4C 1KMQA 4IDOA 1NJFA 4WXPA 3FMIA 1K5DA 2QM8A 2ZS8A 4PSVA 1E2KA 4L15A 1X6VA 3X1WA 4BZXA 5K8IA 4MDFA 4Q5IA 4ZI2A 4MKFA 1AS2A 1G7CA 3KUCA 3MG9A 4LBWA 2O8DB 4P33A 1OJLA 2YOGA 2RGNA 3U3OA 5F9HA 1M7HA 1V43A 2ZUDA 4LV5B 3KKNA 3TUJC 1UKEA 4ZCIA 5C18A 1RYFA 1SVWA 1XJ0A 2ZRGA 2PCLA 1YZUA 1HH4A 2DY1A 5EUQB 4DZZA 4PFSA 4B3BA 3I92A 4JLVA 4LY6A 4WIAA 3PCRB 2OESA 1R2QA 3W8NA 3B78A 5BXQC 2QORA 4EIWA 4F38A 2QT1A 2FA9A 5LD2B 2YNMA 1NBMD 1VG1A 2EFDB 2WBLC 3NBXX 2QQ0A 2ZU0C 4P4TA 4ZCLA 2CLSA 1R5OA 2VP0A 4PQFA 4EQ6B 1IBRA 2WIAA 4NP6A 3HPQA 1KI2A 2VRWA 2YHSA 3C4JA 2ZQ5A 1TF2A 3C5HA 3RC3A 3QEOA 4DSNA 1W4AA 1G5PA 3ZQJA 5IF9A 2IXFA 2YZ2A 2QP9X 1HA3A 3W8RA 2R6DA 2BEJA 5EQTA 5KPDA 4IW3B 1IN6A 1DELA 2W58A 3AKYA 1G6OA 2P0EA 2VHUA 3FKSD 3NXSA 4QM6A 3T12A 5CJ2A 5AJVB 1Q1BA 3GP8A 2B92A 1R7RA 2JLQA 3Q5EA 2A3RA 3L0SA 2A5FA 4QG7A 4RZ2A 4JJZA 3JZMA 1IOZA 4FW9A 4Q9HA 5FR1A 1OXTA 2BOVA 3GJ6A 3QBTA 4C7OA 3NHAA 4FMBB 3OFND 1TAGA 3BFVA 5FBWB 4IDHA 4US1R 3EIHA 1NN0A 3EC1A 1U0HC 3ETLA 1UFQA 1KI6A 3C16C 4AWXA 1TQ4A 1TQ6A 4UNSA 2KE5A 4DCTA 4B6FA 3L0IB 1E2DA 2BBOA 4LSGA 4US0R 1E0AA 4AG6A 2BBSA 5K8UA 4ARZB 5FL7A 4Q1EA 3UXMA 5LB2A 1II9A 2I3BA 2YC2C 4P3YA 3LRPA 5KOYA 1NLYA 3IBGA 5EZ5A 1XPOA 2NO1A 2NOAA 2QZ4A 3LA6A 2NPIA 1JNYA 1UAAA 1N5JA 1KZGB 2OHFA 2IUSA 1KK2A 3U3RA 5JRJA 4HB0A 3DM5A 2RMKA 1SXJB 1F2UA 2YOHA 2CBZA 4BECA 2JDID 5KSYA 3NTUA 3GLFE 1FW6A 1QF9A 4Q1AA 1S1MA 3IIMA 4CRWB 2WWGA 2O52A 2YWGA 1XPUA 4TSFA 3WNBA 3ZZ0A 4IDQA 1DE0A 1UM8A 2C95A 3UMRA 2ZRAA 1UDWA 5FL3A 1RRGA 5HZKA 2DWQA 2K5UA 3BB4A 2WPDA 4GP7A 3GPLA 1NBME 3O47A 3IHLA 1XMVA 3THOA 3SZRA 1E9EA 3HPRA 1OFUX 2I1QA 5GJBA 4M4SA 4AYXA 4M1YA 3RS5A 3VHXA 3OF5A 1GSIA 1PJRA 1E9SA 1TEXA 4LI0A 4CVNA 3SYKA 1CULC 3ZD6A 4UQOA 1VCNA 3GLHB 4M22A 5FUWA 5JWHA 4C0BA 2QAGA 2HT6A 5GJVC 3U6KA 1FFHA 4RFSA 3TSWA 3PXGA 1R0WA 3NVAA 5E3HA 4JVLA 2IF0A 2ZRBA 2VTKA 4LC0A 2ECKA 4LJYA 4QM7A 4D0LB 1NLZA 3BB3A 4HAVA 4Q9JA 1R10A 3TMKA 1YZGA 1G3QA 1GNRA 4A36A 2QL6A 4I1UA 2FEOA 1HY3A 4R7ZA 3AVWA 4NONA 4TL9A 1XEXB 1D9ZA 3PEYA 1Z29A 3REFA 2WWYA 5FI1B 4NCJA 1PLLA 2PH1A 4ZDWA 1EFRD 1P61B 4EJSA 3I72A 1FTNA 1X1SA 4B3FX 1T8TA 2W2XA 2VL7A 3BS4A 1AGPA 4CZ2A 4PPGA 1LVGA 2OILA 2NIPA 2WAYA 1UBGA 3PUXA 1V5WA 1QHIA 1EESA 1N6NA 4KVGA 1GL6A 4A8JC 1W4CA 3NBFA 3NIBA 2H92A 1XMJA 1JBKA 2ZE7A 4PC2A 1S9DA 1Z6AA 2RGCA 4L9WA 1R8SA 4URUR 3K1JA 1BOFA 3VR6A 3NC0C 2ZRFA 4BLTA 1EGAA 4FMDB 5CM9C 1RJ9B 3VR2A 3KXLA 1RFLA 3IPXA 2DFTA 4MH0R 5KU1A 4CW7A 1D2EA 2ZRDA 6Q21A 3EPLA 4A2QA 2Z6VA 3PUWA 3NWJA 1SVOA 1DADA 4AURA 4TMVA 3GD7A 4MYHA 1BKDR 4MKHA 1BMFD 4FCWA 5AR1A 5UKDA 1AS0A 5FPSA 1Z2CA 5LD2C 4A0GA 4ZPXA 1UJ2A 4BFUA 3AH8A 4BGDA 1H8HD 3W34A 1E1QD 1VCIA 4CIDA 2ZR9A 2BIFA 4N3NA 4XVQA 2FN4A 2WSSD 1WE2A 2D7CA 3FFBA 3L8YA 5EP4A 1IN5A 3U44A 5FBRB 521PA 1F6BA 5EXXA 1YR9A 3D3QA 5JJLA 1S0UA 4JBWA 4ZDJA 3B1WA 2N1BA 2QE7A 1CR4A 1XRJA 3LX5A 4KITB 2WWIA 3SDZA 1KO7A 1H65A 1ZBDA 3CRMA 3ICQB 2GBLA 4RD0A 4IFEA 3EASA 4GNKA 2XJ9A 3B7GA 3NBZC 4M1WA 2F3TA 1OIVA 4NBSA 4K81B 2GJ9A 3NBYC 4A0FA 1E2HA 3THXB 2YC4C 4HB2A 5JJIA 2J7KA 5FH9A 1DPFA 5C46F 3ZLJA 5BYJA 2A5JA 4B74A 3GLGA 4H9GA 1XXHA 2RHDA 1U99A 1DAMA 2R6FA 3RWMB 4NDZA 3SHFA 3T5GA 5JECA 3FHTA 4OJQA 1E1RA 1OE0A 1TL7C 3DOEA 4AKIA 1N3BA 2F43A 3CZQA 5CLLA 4OK6A 2H7VA 1CP2A 1KOFA 2QSZA 3QXJA 2D62A 2VEDA 1DARA 4GMXA 2J1LA 3HWSA 1SVLA 1TQ2A 1G5RA 3R7WA 1XMSA 3TW4A 2IYXA 4DUGA 2WVJA 1A82A 1LF0A 4MKIA 1R5BA 4C0QC 1KNQA 2ZUBA 2FGJA 2HEIA 2H1LA 1SULA 2YWHA 1KDTA 4JJKA 5EE1A 5B58C 1N6OA 3QPWA 3BRWD 2AWNA 2WJGA 5DISB 1WBBA 4MDEA 2CHGA 3KQHA 4FIDA 4LJAA 1GITA 2BEKA 3GFPA 2MMGA 4PAMA 2DFLA 3TUIC 3R20A 3J81k 5GVSA 1IN7A 4GOJA 4XVRA 4PSKA 1EX7A 3A1VA 4LHWA 2XAUA 2J45A 4YQFA 1U2RA 5KTYA 2V7QD 3LBIA 1XPRA 2FWRA 4ZDIA 5HPYB 2ZANA 4Q1CA 3ZJYA 4TYPA 3IQXA 4LJ8A 3BH6A 1EK0A 1ZM7A 2NO0A 2VHTA 4B47A 4DKXA 1M74A 3B2EA 3Q3JB 2BHRA 1J99A 4QGHA 2OBLA 3GMTA 2JJ1D 3BH0A 2E87A 3QF4B 3MSXA 1OH8A 4PPFA 3X1XA 2MSCB 1P2VA 1XZPA 1VHTA 1JAHA 1Q0UA 2OUKA 4X8LA 4O0MA 4Q18A 3OE7A 1QHGA 2L0XA 4LJ9A 4MRSA 4CT5A 3NH6A 4V0MA 1IHUA 3IBYA 2G88A 2GHIA 1N0UA 4OQXA 3QIAA 2ZI9A 3I61A 3QENA 2QAJA 3RRMA 1P3JA 2CDNA 1JR3D 4KXFB 4NCIA 2RCNA 5J5CA 3PFIA 2XNDD 4BFVA 2X2EA 2JCSA 3AB3A 2ZRKA 3QF7A 4D6PA 3ASZA 1LS6A 1WCV1 2GCPA 1XWIA 1G291 1A2BA 4F4CA 4G5SA 3SE0A 3CF2A 1UADA 2WJYA 2ZYVX 5HE8A 4GZLA 3OIVA 2IS2A 1NL3A 3PG5A 3VKHA 4UNNA 1Q3TA 4LZZA 4DDVA 4A8JA 3MGCA 2REOA 2H18A 2FSHA 2HCJB 2GETA 2NG1A 4BZQA 2GTPA 3RANA 2FMXA 4L9SA 3GLIA 1X8LA 2D4HA 2C5LA 5TVKA 2X19A 4PHGA 3CZPA 4Z1MA 3O8RA 2QPAA 1JR6A 4EAQA 1S4QA 3FPAA 3RS0A 5KYKA 1SZPA 2IS4A 1T5IA 5DIFA 4TQAA 4JZKA 3DM9B 1KY2A 2ZIAA 2RAPA 1N6PA 2REBA 1M8PA 2ZSAA 4LOAA 3T06B 3KB2A 2CK3D 1XTKA 1DO0A 2P6NA 2ZRPA 3U3JA 1FOEB 4MYUA 4QOSA 1NY6A 3DKVA 3QPVA 4LPKA 5EXTA 1W4BA 4BLSA 2JIZA 2RGDA 2WAXA 3GEHA 3E70C 4DLYA 4MUAA 4FN5A 3B1YA 4UXIA 1IXRC 4EPYA 4D0GA 1QZXA 1UKVY 1SVMA 1FX0A 4I81A 2GNOA 4GDFA 5JEEA 4IKEA 5C4MA 1AIPA 2QQEA 2OZEA 2QAGB 4MGYR 1SXJD 4FMDF 3OHMA 4DCSA 3SEAA 2RGEA 1VCOA 1ZC4A 2W6JA 1KMHA 4GOXA 4ZCMA 2VF8A 2F3RA 4PZLA 1C9KA 3M4YA 3UMFA 1G9XA 3V9PA 2IX3A 2O8EA 4URZR 4BRUA 4EUNA 1GRQA 1Z07A 1ZNXA 4WAUA 1Q1ZA 3TVDA 2EWWA 3C15C 3SOPA 3WYGA 1PVOA 4YMUA 1L2TA 2RGAA 3QSYA 5FOSA 4C9BA 3EPJA 5BQ5A 2QY9A 2V4ZA 2FU5C 3B82A 1TMKA 2WWWA 1US8A 4QNRA 4PHFA 1OKKA 1JR3E 1JALA 4GSYA 5EP3A 1E69A 3T61A 3VU9B 1XU4A 2VLIA 3QG1A 4Q48A 3T15A 3WMGA 2YV5A 4PPNA 1E9DA 3WRXC 1U0LA 2JJ2A 3I8XA 4GMDA 4LDJA 5FUYA 2EVWX 3QKSA 5FOVA 3SN6A 4KLZA 4CEJA 4QJ4A 2AD1A 4ASUD 1SKQA 1ZC3A 4BQSA 4Y0VA 3I73A 1G8YA 4ABYA 2VP2A 2BM0A 4M1OA 3MCAA 2BKUA 3O8DA 1FMJA 2G6BA 3B1ZA 5G3YA 1KNXA 1EWRA 4AKGA 1GILA 1G8PA 2XSZA 5BN3A 2D06A 2ZJ2A 1E0JA 4A9AA 1FZQA 1YR6A 2QEQA 5DNYB 4G5GA 4TQ9A 5AUOB 1U81A 2CL6X 2D3WA 4CYMA 2VF7A 4Q21A 1QG4A 3NH9A 2O8BA 5GJCA 1JPNA 1L4UA 3TH5A 4JYBA 4AKEA 4TLBA 4EFNA 4C0KA 2J0SA 1X1RA 2OBMA 1FQKA 4BWYA 1W36B 3IHWA 1N2CE 3K9HA 4R2IA 4DCVA 2C78A 1UPTA 1WXQA 1VPLA 2W0SA 5D3QA 2Q9AA 1QVRA 5AUNB 4Q66C 2W0MA 3BC1A 1P75A 3ZVRA 3HU3A 1VMAA 3CW2A 1G1MA 2GDJA 1JQJC 3CNLA 4LK2A 1U98A 3I1FA 4NCKA 5JCPA 5C4GB 4KFUA 4KHZA 3AKDA 1ZW6A 1SXJE 2ORWA 4P0TA 5D3MB 2AFHE 4JVSB 2OV2A 2ZI3A 3IO3A 4A6PA 3N70A 3RVBA 4BUJA 5TV2A 3NDBB 1XTIA 2BV3A 1FUKA 3JZAA 1CXZA 2OT3B 3DVLA 2IW3A 3CRW1 1ELOA 4BRWA 5CYOA 4GBMA 4W5JA 3H2YA 4BLRA 4ZIRA 1G16A 5DN6A 1HV8A 4ERNA 4R71A 2OG2A 4S2EA 3C8UA 3LX8A 2WHXA 2BCJQ 3IIJA 2A5DA 4Q47A 3ZIAA 2G0NA 1IQPA 2GILA 2ZRMA 5E7JA 3KL4A 1CRPA 1DO2A 3VR3A 2AL7A 1TQDA 4TQUS 4B3CA 5C2JB 4RKEA 1WBDA 3GLHE 5J4LA 1NP6A 3QQ5A 4JVMA 3P26A 1E79A 4NCHA 3U7HB 4A4DA 4CF7A 4LJ4A 1W7AA 1E98A 2MSEB 4PANA 2IYSA 4NCNA 1M34E 1AKYA 2ZS9A 1JQLB 3F5FA 3RLFA 4S35A 3GJXC 3RHFA 4D25A 2AX4A 1DBSA 1RVDA 2OBNA 3BGWA 4LCBA 4IJMA 3W3ZB 2F55A 1GKUB 5HCIA 1QG2A 3IEUA 2ZYUX 4RCZA 5JSZA 1KI8A 2AXNA 2IBMA 3AGQA 2JLXA 4NYJQ 5ELXA 2C04A 4Q4HA 2WIBA 2BKEA 2PJZA 1G20E 2F6RA 1T8UA 1VYVA 2C99A 2NTYC 4H1UA 3ADDA 5DLQC 1R4AA 1E4YA 3VR4A 4B2IA 1NJGA 2PBRA 1G41A 3M0EA 4U02A 1UBFA 2XOKA 4DSUA 4B44A 4UNQA 2ONKA 2XITA 4D4JA 1O3YA 4XD7A 2H57A 4OJKA 3SNHA 4K8OA 2FPMA 1KAOA 1PUIA 1RE0A 1HQCA 3T1QA 3QEJA 1AQYA 4KV9A 1W0JA 2HJVA 2P65A 3K0FA 3TUZC 1A1VA 4PPQA 2AFIE 1LY1A 1E0SA 3GJ5A 3H84A 5P21A 1G21E 2WJVA 3DO6A 4Q1FA 3A1SA 2ZVQX 3K70B 3VAAA 3OAAA 2QMEA 4OHZA 3THWB 1NVUQ 4G5QA 5F9FA 3KXIA 2HV8A 3LAWA 4B75A 1CJTC 3SS8A 1CLUA 3U7EB 3BFXA 4Q4JA 2PZEA 4A92A 1BS1A 2ZJZA 3QVUA 4YONB 2ZJ8A 1U8AA 5FPHA 5FTKA 1HEIA 3LH5A 2VSOA 2Z4SA 2XB4A 4LPSA 1MO6A 4DDUA 4JLAA 5SZKB 2GEVA 2WKQA 4MRNA 1XD2A 2QGNA 4MYTA 3O8BA 4EPWA 4MRVA 2WJIA 1OXXK 4ITRC 4IXMA 4MA4A 3VHLB 4NMMA 5HZHA 5KSZA 1F60A 3MLEA 2XTZA 3N5CA 3RS4A 3THYA 1W0KA 1QHHA 1CTQA 3QVVA 5IRCD 2DFNA 1KO8A 3WHKA 2XB2A 1H8EA 1N6HA 2X8AA 4UXHA 4YMSA 4QRHA 3CB4A 3AVUA 2FZ4A 721PA 3MAAC 1I4LD 1U90A 2B8WA 4DSTA 2V9PA 4JKYA 5FOUA 2Q6TA 4QHTA 3K09C 1E96A 2IEZA 2KSQA 3AF0A 4TL6A 3QG5A 2IYUA 1E9FA 1T4GA 1CRQA 1ZUIA 3PEWA 3CF0A 2QG6A 1E2QA 4BEBA 1M7GA 4ILEA 3NHBA 2DWPA 5JZVA 4HAWA 2QI9C 2RH5A 3EPKA 4CGZA 1W36C 5FBLB 4HLDA 3O8CA 1SVIA 2W83A 4L16A 3AP3A 4QGGA 2FFAA 2A9KA 1DG3A 3ZQ6A 5TDHA 2OAQ1 2QUZA 4DJTA 4D2IA 3B9QA 3ZVNA 4PO1A 2ZETA 5CITA 1E9RA 4BFYA 1QHXA 3CONA 4JLOA 2NQ2C 2O8CA 2Q0HA 4DLWA 1FX0B 4O25A 2C77A 5FUXA 2V1UA 4F91B 3SC3A 1F2TA 4JLJA 3KTAA 4DLRA 3K0AA 2VP5A 5E7IA 2NZJA 3TVTA 3BFKA 1P6XA 3CX6A 4OQLA 4YC7A 4C0SA 2RHMA 1SVKA 1ETUA 4QHYA 5G3ZA 4TSFD 2CEAA 2HF9A 4B35A 4DLXA 3MWKA 3ZS8A 1SQ5A 4LJ7A 2RB4A 4AK9A 3LXRA 3QXXA 5FPYA 3GLFA 4IDNA 1XD8A 1KSFX 4DB4A 3OIYA 4MGZR 3V00A 1RRPA 2TMKA 1P2UA 2HF8A 1RYHA 4IRUB 4JBXA 4V02A 2FOLA 5AUQA 1E2GA 3EIEA 3F8TA 4YMTA 1KSHA 2VP9A 1COWD 1NBMA 4M0LA 4I1OA 5FTMA 5L3SA 1S3SA 4X8HA 1M6NA 4HZUA 4DHEA 3ZGXA 2J5XA 1IM2A 2VQSA 3B1VA 4D81A 2UVQA 5H70A 4D4LA 1WF3A 3A1TA 3QI2A 1RRCA 4B2LA 4V0KA 2GVZC 1WB9A 3EW9A 3LQRA 3QKRA 4QBIA 3FOZA 1G6HA 5F3WB 4LHVA 3U6BA 5F98A 2ZAOA 1XCPA 1ZU5A 3LBHA 3AVYA 1E2PA 2IXGA 1X86B 4UNPA 3LLUA 1W48A 2IUUA 3FKSA 1FMLA 3SFZA 2R9VA 1LTQA 1Z6YA 1MABB 3UK6A 5DI3A 3CR7A 3L0OA 2O8BB 1NI3A 2P3SA 4AYTA 5CB6A 1FQJA 4GFDA 4LC1A 4QJ3A 4KBFA 2FFHA 1MR3F 2FPKA 2FDCA 2QBYB 3OFNA 5JWOA 1TUIA 4U00A 5EXPA 1ZYUA 3WNCA 1Z06A 4Q19A 3LFUA 3D7MA 1C4OA 3IO5A 5EXSA 3RABA 3PJRA 2PLRA 1Z0DA 4IVQA 2YINC 1DAGA 1E2JA 2QNRA 4HAXA 1PZNA 2ERYA 1NRJB 3AUXA 2OM2A 1G5TA 1X8KA 2XTMA 2CJWA 3EZ6A 3AF3A 3X1ZA 5DH9A 3V4FA 4QL3A 2N42A 3CPJB 3M1IA 2IS6A 3DPUA 2FV8A 2BMFA 4IEEA 3RYTC 5AK0A 3QJYA 3SYLA 5KNBA 4B2PA 1YKSA 2P6UA 2W6ID 1WRBA 2ZI4A 3FGNA 2JDIA 2QRZA 4D82A 4Q9IA 3K0CA 1W36D 4QJ5A 3A36A 2BMEA 5JFGA 4KBGA 2BJWA 1Z3IX 5KHOC 2FEMA 3KJHA 4QBGB 3E5HA 1HE1C 2IXEA 1P5ZB 1GVNB 2ZE5A 4BASA 4E5UA 2Q3HA 2GF9A 3KJIA 4RD6A 1QDEA 4EFLA 1XMIA 1G7RA 2YOFA 2ZR7A 1S96A 3WP1B 5JRZA 1YZTA 2QE7D 2V55B 2ZSDA 4RD4A 2EW1A 1XTRA 3ZYCA 3IDQA 4XJXA 1E2IA 4KU4A 2EU8A 1XCGB 1XF9A 1MO3A 1DOAA 4RZ3A 1OHHD 3FE2A 2XGJA 5AJWA 2PEZA 1KY3A 4KVAA 1SHZA 1FTSA 1JJ7A 4M1TA 1KI3A 4F7WA 2A2ZA 1J7KA 2XEXA 3HYRA 2C9OA 4NE2A 4C0HA 1OLOA 2BDTA 4L5BA 5FBVB 2ZROA 1YR8A 2QPOA 4TMXA 3BXZA 1AZSC 3RC8A 2R2AA 1DAKA 1G4AE 1I4TD 1MOZA 5KSPA 4HUQB 1XEWX 1NN5A 3WY9A 2BBTA 4EPTA 1AS3A 4E07A 4MITA 3UKDA 1GP2A 2GJKA 4YLGA 3K09A 4UJ3A 4HI0E 3OEED 5G53C 2DYKA 4O2RA 4OQNA 4CEHA 2YJTD 1G17A 1W5TA 1TU4A 2ODWA 3UWOA 1GRRA 3AVOA 1EFRA 2WJHA 5JS8A 4LBYA 2A78A 4DUGD 3LQQA 2CXXA 3MFYA 1W2HA 2Q9BA 3H1TA 4FINA 3VNVA 1G18A 2OCPA 3WHLA 2DB3A 3TBKA 1LB1B 5L3VA 3DMNA 4BFSA 1KI9A 1WQ1R 4LRWA 4ZV4A 4KO8A 2CHVA 2FNAA 1OB2A 1YVDA 4RD3A 1ZD1A 1T91A 4W5HA 4M2LA 3GEIA 3W3AA 1U8ZA 3LO5A 3A1WA 2ZJAA 1JI0A 2EFHB 2GCOB 1XD9A 4N1AA 1P9RA 2I4IA 3DZ8A 5J40A 3X1DA 3BB1A 4NYMQ 1EFHA 5A0FA 1MKYA 3W6NA 4MGKR 2HLDD 4BLPA 1UBEA 2AKYA 2CCGA 4Z54A 3LW8A 2J0VA 5J4HA 1OFTA 4JYCA 2Q3MA 4JLNA 1OIWA 4P4SA 4TMKA 1JXOA 4A0RA 2ZRJA 3AVVA 1H8HA 1Z0JA 1E1QA 2LKDA 2IYYA 3TQFA 3CKLA 3GFOA 3CNOA 3B9PA 1KK3A 3FYHA 2ZSFA 3QBVA 4HATA 4RCYA 3SU8A 4BFWA 3VKWA 3K70D 1F48A 2OLKA 1SXJC 2A5YB 1LV7A 3EZ2A 3S1AA 1QHHB 5EE5B 1S2MA 1T3HA 2O0JA 4URVR 4I1SA 4LYFA 1GG2A 3KJEA 3NKVA 3PUVA 4LHZA 1VG9B 3LWNA 4BLOA 1XZQA 3CO5A 5HKKA 3A4MA 1ZM4A 2QP3A 5DYIA 5ANRB 4A82A 4M53A 4RKFA 5E95A 4TT3D 2VIIA 3TLXA 1UEJA 1FL9A 4LYAA 1OH6A 2GJ8A 3VR5A 1TEVA 5FTLA 3B8HA 3GJ4A 4NYMR 2C2HA 3AM1A 4M8NE 2OFOA 1VG8A 3T34A 5AWFC 2VHJA 3RAPR 2MSDB 3L2OB 1L7VC 1Z6GA 5AJZA 1ZRHA 1Z22A 3CRVA 3P27A 4QBFA 2P5TB 1Z28A 2OCBA 3R9XA 1TADA 5DHFA 4NKRA 3R9WA 3F3YA 5A5GA 2YWEA 1YZQA 3C5CA 1YQTA 5K8TA 3K0AB 1RPZA 3B1XA 2X2FA 4BFXA 3TW8B 1ESNA 3MMPA 3TR5A 4IOJA 5JI2E 2O8FA 3LDAA 4LJ6A 5IT5A 1U0JA 1X8JA 4DDWA 4C2TA 4CEIA 1IXZA 4C7OB 2RKOA 2CCKA 2V6IA 5DHAA 4A2PA 4DT1A 3B13B 4Q1DA 4OI4A 2GAOA 4M9XA 1KI6B 2QPTA 2G83A 2WOJA 1UBCA 4DXAA 5CJPA 5KPJA 4B3XA 2ZRHA 3BIFA 4V0NA 3PENA 4W5WA 2JLYA 4Q9KA 1YZNA 3ICEA 4E03A 4OHWA 5FOTA 2J0UA 2ATXA 1KO1A 4KYIB 2OFXA 3WYAA 2CVHA 3AVPA 3RRZA 1VIAA 3P32A 4B76A 1TF7A 1W47A 2V7QA 3I32A 1R0XA 3CIOA 3CRRA 4K46A 1ZU4A 3EX7C 2O8DA 4FMCB 4E22A 1YU9A 3NDPA 1CU1A 1F2UB 4PC6A 2IYTA 8OHMA 3QUSA 1IY0A 1GM5A 3QKRB 4KYUA 3RS3A 4C3ZA 3OEHA 3U4QA 3CNNA 4Q7KA 2ORVA 2JJ1A 2ZITA 5EZ6B 1E99A 1Z08A 2F7SA 4I1VA 3FVQA 4V0ME 3A58B 1P4SA 2QT0A 4M1SA 2OFWA 4EPVA 2ZI7A 3Q5DA 4LWZA 4OK3A 4RSGA 3T35A 2WV9A 1XCMA 5DI3B 2AK2A 1E2LA 2BMJA 2VYFA 1II0A 4XVUA 4PC1A 3WXMA 2BC9A 4BLQA 3UPUA 2PMKA 1T9HA 3PUZA 4WW0A 1VG0B 3FFAA 5F2EA 1DG1G 1LNZA 1Z0IA 1IAQA 2IYZA 4EQ6A 4TYWA 5KDLA 1JR3A 2CL0X 2O0HA 2F1RA 1OW3B 4RFSB 1MO5A 2PLFA 2GAAA 1UKYA 2VP6A 3W90A 2KJQA 2OE2A 4IVPA 4KI0A 4KLNA 4RD1A 5EE3A 4XOIA 3KX2A 3TR0A 4UNRA 4URXR 4TMWA 2KWIA 1NMXA 2CJWB 3BBPA 1ZJ6A 3FMPB 4XWKA 2PCJA 1BIFA 3LBNA 1EX6A 4NU0A 2IWHA 2YVUA 1XJCA 2OAP1 1A7JA 2ZVPX 1QRAA 3I8SA 3MWYW 2GK7A 2FFBA 2O0KA 3W9YA 4EJSB 3KQUA 3U7GA 2EYQA 3ONWA 2OXRA 4D0NA 2N46A 5GJWC 1OXSC 3K9NA 3KKQA 5J4VA 1PLKA 2R44A 4HAUA 3N2IA 5BYKA 3QPUA 3RSLA 5H1YA 4BEJA 5HE9A 4Z51A 1AN0A 4LX0A 1PUJA 2QN6A 2OO7A 2C98A 2GA8A 1K5GA 2PZGA 4GPTA 3UANA 4B34A 1SHKA 1R6BX 1N0WA 3CH4B 1GKIA 2CK3A 2RGNC 1CIPA 2NO6A 5SZIA 4PAQA 4LBZA 1NMZA 1HYQA 4IEIA 4ARZA 4W9MC 1Y3AA 3LXXA 2CHQA 4IVRA 4WBSA 3B5JA 3UMSA 3FMFA 1HUQA 1D2NA 1MRNA 2JJ8A 4JBYA 1ZP6A 4P31A 4X8MA 4ESVA 4QHSA 3FWYA 1G8GA 5KUTA 2CVFA 3ND9A 1E0KA 2JLRA 5B2ZA 1KIMA 1I4DD 1ZINA 1SXJA 4YXWD 1EXMA 2WSMA 3EIQA 3VTKA 5J4YA 4US2R 1KDPA 2WJJA 1YRBA 4HEJA 2AK3A 4B3DA 1XB2A 2QMOA 3D31A 5CIWA 3AEZA 3T1TA 3SBEA 2FGKA 1CEEA 4GOKA 3U44B 3B85A 1W46A 1DAIA 2IL1A 3AF2A 1C1YA 1SKYB 4UJ5A 3I5XA 1OH7A 4OHYA 1NKSA 1NLFA 4P4UA 4LGMA 2VSXA 3A8TA 4LHXA 2FG5A 1W49A 3Q85A 3WRYC 4Q7MB 1Q1QA 2O5VA 2B7BA 2GXAA 1T5LA 2J7PD 2VHCA 3WP0A 1E32A 3HYTA 4O2LA 2UZIR 3FKQA 2X1VA 2V54A 4ASUA 1U9IC 2P67A 4DWJA 3DHWC 2PEYA 3DDCA 1IONA 4FCTA 4RVCA 4PQYA 3GLHA 4XSHA 221PA 1VYTA 1A5TA 2EYUA 2QENA 3CM0A 4Q01A 4TZ6A 3L8ZA 3T5DA 3GLGB 1XXHB 3G5UA 4N0EA 1D6JA 2FJUA 1OF1A 2ZEJA 3SBDA 2V3CC 1OV4A 3MJHA 2F43B 2G1JA 1VIYA 2CE7A 1DVRA 5L8VA 5JJKA 2RGGA 2J3EA 3EARA 4ZDKA 2V6JA 1EFCA 5DYGA 3B60A 5CDFE 2GESA 4B71A 3RNLA 1KKMA 1OIXA 1XEXA 5TMPA 1UKZA 4B48A 4FXPA 3Q9LA 3T1OA 3R7WB 5L3RA 2JLZA 4UKDA 2QA5A 2F1HA 1E6CA 2AHOA 2GVDC 2PT7A 1Z47A 3EAQA 5J47A 3GJ8A 4EFMA 4TL7A 5BN4A 1E2NA 1EFTA 4G5OA 5L3QA 4M9SA 1KO5A 4A15A 1VYUA 5IK2D 1TTTA 4DB2A 2IA5A 2H16A 2ZM5A 1E9AA 3ZDQA 2WKPA 4Q7JB 3I3SR 4LJ5A 2UZ3A 4TMZA 1KJZA 5JWRA 4JLPA 2CNWD 2F9MA 4IOMA 2JLUA 1RJ9A 1TPZA 3U60B 4HUTA 1OFIA 2GKSA 1MRSA 2XXAA 3QKTA 4HYYA 2MMCA 1W44A 2JATA 3IEVA 4ZO4A 4Z8YA 4J0QA 1KDRA 4CT4B 4QGAA 2EFEB 3QOFA 1XTSA 1KI7A 3Q7QA 3A1UA 2GJAA 2GJSA 4BFZA 1XFAA 4H1VA 1KK0A 3TIFA 4AIIA 3TK1A 1IN4A 1Q1EA 5IDVA 3RS7A 3WNDA 5EP2A 3ASYA 3K0SA 1S9HA 2GXSA 3CLVA 4XWAA 4FMCF 1HE8B 2GXQA 1JB1A 1LS1A 3ZZTA 5H8WA 2QAGC 4PZYA 4EDHA 1RKBA 3OIWA 1QHYA 2ODNA 2NPFA 2ERXA 2Z5FA 1RW4A 2VPPA 3DOFA 5TXGA 4DLSA 1H8ED 3GCGA 2GXUA 1U8YA 3QXHA 1ANKA 1NVVQ 1ZMXA 2GEUA 4OKSA 3FTQA 2BCGY 3PIRA 4HLQB 4PQRA 3N2EA 3KJGA 1O87A 2NMVA 4DT1B 4HDQB 2RGBA 3ADKA 4YMVA 5A4JA 1HT1E 1R8QA 4NYJR 2ZPTX 2QTFA 2ZU6A 1EG7A 3AKEA 3AF1A 3THXA 1YJ5A 5HR5A 4OI1A 1ZIPA 3K8YA 4EJSC 3LLMA 4OBEA 2E1RA 1X3SA 1P72A 1ZAKA 4TLDA 1T6NA 4TL8A 2Z0MA 1S1CA 4KFRA 3EC2A 4YDHB 3LY5A 1IJFA 2ZSBA 5CYPA 3KQKA 3OIUA 3MWJA 3KZ1E 3NC1C 4V0LA 2C8VA 3WYFA 4HAYA 4A8JB 1Q44A 2Z4RA 2IYRA 1OT3A 5HTKA 5DSZA 3ZD7A 2GF0A 2W2VA 3GLIB 3HU1A 2DWOA 2R6GA 3P1JA 1E4VA 3BOSA 4QKQA 4BFTA 5CIQA 3U4QB 2FZLA 1GRNA 1P7CA 3IQWA 4R2HA 3U3KA 2WWXA 2FPLA 2ZXUA 3IKJA 4HAZA 2DR3A 2GWHA 1NVVR 3K0EA 1G8FA 1OFHA 1B0UA 1N6IA 2BM1A 2EFCB 2WZQA 5FL7D 5FUVA 1J8YF 1G4UR 4DEYA 4M9ZA 5JBQA 3BE4A 1NMYA 3EZ7A 4RJLA 3KQNA 2V8OA 5C1BA 4HDCA 3DL0A 1Q20A 2GZHA 3IUYA 1OXUA 3UWKA 1KI4A 3SQXA 3UG6A 1VTKA 2IHBA 1YZKA 3A4LA 3ECCA 4FI3C 1MT0A 1KMHB 4ACBA 1CR1A 4PAOA 2GBLC 1KO4A 3TSOA 2O8EB 1YR7A 1Z63A 3CF6R 4ESHA 3Q8XB 1XDBA 2IYLD 1XTQA 1ZCAA 3QF4A 2IT1A 2WPDD 2XZOA 4NHOA 5LBIA 4BPBA 1L8QA 1U9IA 3GJ7A 3UG7A 5SZJA 4NL4H 1B23P 2ZSEA 1K8RA 1R5NA 4AKHA 1US8B 4Z8XA 3QXCA 3G0HA 3U5ZB 3W6OA 4URYR 1QHNA 1DAFA 4NYIQ 4AG5A 3PEVA 1R0ZA 2JLVA 2JGNA 1T0JB 2VBCA 4M1MA 3CWZA 3EWAA 1AQUA 1Y63A 3QKSB 4CEJB 2KI5A 3ZVMA 4KFTA 4TLAA 1G7SA 2CCJA 2G77B 2J87A 1Z6XA 3KFVA 4JT4A 4LYJA 5E7MA 5G41A 4F4IA 3ADBA 3I62A 3KFXA 1FPMA 3VNUA 4ZKEA 1UEIA 2LKCA 2GZDA 1E2MA 3BORA 3VX4A 5KNDA 2Z43A 2WWFA 1XTJA 3H4MA 2NO7A 4W7SA 4WA7A 1ZD9A 4G5RA 3VMFA 5FTNA 3PR1A 1TX4B 4DVGA 2ZRIA 1W4RA 1J70A 2LCFA 5FOXA 2WWHA 2R65A 5EUMA 4ACAA 2XX3A 2VH5R 1DAHA 2HT1A 4NH0A 1WDTA 4ZI3A 5FPTA 2R6AA 2ZAMA 1J90A 1L4YA 2R62A 4MGIR 1OH5A 4JS0A 3SFVA 2G0TA 2XJ4A 4JL8A 2J41A 4X8OA 1CKEA 3X1YA 1CJVC 5GVRA 4NYIR 4E09A 1F3OA 1KDOA 3BWDD 4RY2A 1GNPA 1XX6A 1MO4A 4GI7A 3X2SA 3TSZA 4JL5A 4TTQA 2GRJA 4R98A 1GAJA 3KUDA 4B32A 2PX3A 1N25A 3L82B 2ZRCA 1UDXA 2EQBA 4YMWA 1COWA 3ND8A 3RRNA 4TYYA 4PC3A 3R8FA 3ZH9B 3PEUA 4IHQA 2ONJA 2WOOA 1JXMA 5JEDA 3K70C 1CJMA 2QGZA 1P9NA 1ZM3A 2BVNA 5BWMA 2QP4A 5JS7A 3AP2A 1OPXA 1E9CA 3IPYA 2ZYTX 2WMNB 2DPXA 1TNDA 2BMDA 1AM4D 4M9QA 1KAGA 2HUPA 4L4UA 1Z5ZA 4Y0AA 3K9GA 2J46A 1G3IA 4YDSA 4BE7B 4ZIRB 1HQYE 5KO2A 1JAIA 2OSBA 4RFVA 2ATVA 1JJVA 2AN9A 2NZ8A 3AF4A 2WMOB 4D4KA 1ODFA 3LVRE 4XTRA 121PA 5KSOA 2ZJBA 2AKAB 3AV0B 4QGFA 5DE3A 2PZFA 3VU9A 4V0OA 4D4MA 5JI3E 5LDDC 1KSGA 2HJGA 4F93B 3NEYA 4U5XA 2EFGA 3QNUA 1RRFA 1KKLA 3TQCA 1KJYA 1E2FA 4Q4AA 4G0NA 5L3QB 4NZYA 3U2QA 2V1XA 4POAA 3IIKA 3PVSA 2IHYA 4LV6A 4ON9A 3H0KA 4RD2A 2ORIA 5JSZB 2HXSA 2ODEA 4JLMA 1GKYA 3QKUA 3ZVLA 4OQMA 4DCUA 2FSGA 3TAUA 3NEJA 1E1RD 4Q4HB 1Q57A 2AXPA 3HDTA 2JLSA 2IS1A 3BAFA 5FTJA 621PA 3JVVA 4MUBA 4DRZA 2XXAB 1J2JA 3HR8A 3Q72A 421PA 4N0DA 1W1WA 1KGDA 4QC2A 2B8TA 4Q00A 5CK5A 1ONBA 2W6IA 5EP1A 1UF9A 3TE6A 2DHRA 2C9CA 1ZUNB 4HLUC 1QHSA 1LW7A 1E9BA 4MRPA 3LV8A 4OHXA 3GJ0A 4JSTA 5JHHB 4A0HA 3K0FB 3KDSE 3CPHA 3UIEA 1NY5A 3V4RA 1D2MA 1CJUC 3AVTA 4EPXA 3E2IA 1FUUA 4DDTA 3AP1A 4G3XA 5TB5A 1GIAA 1AK2A 5LB4A 5FR2A 1XP8A 1DEKA 2AR7A 4B43A 1K6MA 4Q4LA 4PTLA 1P2TA 3CRQA 3CX8A 1CJKC 4FCVA 3KQLA 2ZR0A 1JPJA 1MV5A 3MJRA 3SQWA 1II8A 2IYWA 4TTPA 3VX3A 3CH5A 1IY1A 4HZIA 1TU3A 3C7KA 2PMDA 4GP6A 1RC8A 5D3MA 1PV4A 4C0AC 5HKKD 4Q4JB 4DIEA 1OHHA 2P5SA 3E1SA 4KCGA 1W2GA 4TTRA 4LV8B 1Z2AA 3PITA 1I2MA 4OI0A 1BMFA 4JIMA 3EXAA 1FP7A 1N5IA 4OL0A 1E2EA 1SKYE 1XD2B 1IXSB 3F0TA 1XEFA 2ANBA 2BBWA 4HSEA 2XZLA 1G19A 2WSSA 3Q7PA 4AYWA 1G3MA 1Q3HA 4C30A 1G64A 4XTCS 3THYB 1NIPA 1XNJA 3OEEA 1N5LA 4RZXA 4KAXA 4WZBE 1S3GA 4GRAA 1ZNYA 3OE7D 5DO9A 3FB4A 4KSCA 1ZNZA 2CLCX 4OQFA 1NKTA 2GK6A 2IK8A 4FD2A 1D5CA 3JVUA 3GLGE 1U94A 1XXHE 2JAQA 4F92B 1G3RA 3VKGA 1WMSA 5B30A 5KDDA 1NN3A 2Q9CA 4TLEA 4Q9LA 1P62B 1QBKC 1AZTA 1DTSA 1MH1A 5AJYA 4DIDA 4Q1BA 2QRNA 4L8GA 3IILA 4NPHA 2ZRNA 2BWJA 1N0VC 4EKDA 2YKGA 4OI2A 2SHKA 4JVNA 2HYDA 1ZM2A 4U7DA 5SZHB 3TNFA 1FP6A 3QXSA 2C96A 3GJ3A 5GADl 1FNNA 2OCYC 4ZKDA 5M04A 4PSAA 1BH2A 4CDGA 2O8CB 2DCUA 4LBVA 1NG1A 2YWFA 2HLDA 1TUEA 1F2TB 2KB0A 2ZE8A 3KTAB 5G40A 1CF4A 2DFKB 4I99A 4JLKA 4Z1MD 2B6HA 3OEHD 3AVQA 1NSTA 2ANCA 4OYHA 4TZ0A 4C2UA 2FH5B 3CUEF 3TAHA 2R6CA 4AY2A 1P2SA 4A6XA 2QMHA 3GLFB 2J9RA 1AJEA 3SI7A 1KK1A 2C9YA 3HP1A 4PO9A 4D26A 3TRFA 3GEEA 2OXCA 4DLTA 4B3GA 3THWA 3TGPA 3DMDA 3BJIC 2JIZD 4M1KA 4WVFA 1KTVA 1SVSA 2OEPA 5L3SB 4PX9A 1EFUA 2ZRLA 3FHOA 2ZI5A 4HZUB 4TYNA 1VKJA 4C0JA 1NNEA 1YRAA 5DGXA 3FMOB 4JLBA 4TT3A 4B73A 1IY2A 3U3MA 4AI6A 1GUAA 5KDOA 3QY0A 3QE0A 1W5SA 2F1IA 2J59A 5K8LA 1Z0KA 2W6JD 1D8TA 3RWOA 3RDPA 1OSNA 3EA0A 1LFDB 2F1JA 3EWSA 1M7BA 2QSYA 4NTZA 4PHHA 4DSOA 1XBTA 3PUYA 2VA8A 3WMEA 4A2WA 2D74A 1GWNA 1GL7A 3U61B 1DS6A 2PX0A 4KFSA 1M2OB 3DEFA 1WP9A 3FDIA 5EE0A 3ZZUA 1GL9B 2EWVA 1Z0AA 3H86A 1OKKD 4MYCA 1JEEA 2VP4A 3BD9A 4KSBA 4XSGA 2G3YA 5CM8B 3IGFA 2JASA 4JKIA 5CK4A 2JJ2D 2QTHA 2A5GA 2FFQA 2HXYA 3D8BA 5EE9A 3R8CA 821PA 4TWZA 3MRSA 2GEDA 4JL6A 1JECA 1N5KA 3AGPA 2QM7A 2KBEA 2ZJOA 1Z8FA 2XNDA 3BERA 1AGRA 1HTWA 2FE4A 2H17A 4B6EA 3P4YA 2GCNA 4BZPA 2XTNA 3T1VA 3LVQE 1NVXQ 1ZM9A 2XSZD 1Q12A 4PC7A 5J4KA 1M1YE 2B7CA 2QTVB 4II7A 1KI1A 2HDNB 2H5EA 4GZMA 1BYUA 2G1KA 4HLUA 2DBYA 4MKGA 4QNMA 4OHVA 2XZPA 4DLZA 3GLIE 3CWQA 2ASEA 3SJAA 3I4LA 3U7FB 2X77A 3ADCA 1GDDA 4LHYA 1OYWA 2J0QA 1IJEA 3B6EA 1ZVQA 3PQCA 5CB8A 4I4LA 1NIJA 3VQTA 1RZ3A 5JMTA 2ZE6A 1CBUA 4P32A 2W00A 2BJVA 4GT1A 4DLVA 2F9LA 2FX3A 1YHNA 1YZLA 1KSJA 1ZIOA 2IUTA 1NN1A 2Q3FA 2REXB 2FSIA 2JEOA 3LD9A 4Q03A 1VDZA 3R9IA 3WBJA 5B57C 5BN5A 1GNQA 2P6RA 1KJWA 1TF5A 4EPRA 3P4XA 4O3MA 4OK5A 2CLDX 2ZI6A 2VSFA 5FBQB 3C41J 4DLUA 1T3LA 5TARA 1NF3A 2HCBA 3RRYA 1HT2E 4MRRA 4TLCA 1ZD8A 3KB1A 1KYIA 5BW8A 3GFTA 4Q4AB 3RS2A 3HR7A 4IOLA 5DI9A 1CR2A 3OZXA 4V03A 5FFMA 3OESA 4IOKA
chains in the Genus database with same CATH superfamily
4YRAA 2IGTA 3QSYA 5T4BA 2PE5A 4KGDA 2OGUA 2PZMA 3TJZA 4EL0A 1RLTA 1EDBA 5REQB 3AJEA 4D5EA 4IR7A 2YS6A 4XA8A 3F67A 1H0RA 3IP3A 3F6BX 4OSOA 5DLYA 2B34A 3NAGA 2KMLA 1N5DA 3PNYA 1NF8A 2DG2A 4H6PA 1KDYA 3Q1LA 2X0KA 1AKEA 4DC9A 3UUGA 1P73A 4EEKA 2QRKA 5KDOA 1LZLA 1Q2UA 4AC9A 4MV4A 3VU3A 4P38A 5JZOA 1LUAA 1SQSA 5A05A 2I7CA 2ZYWX 4QYIA 4DIKA 5KTKA 4RL6A 3UT5B 2VHZA 4C4AA 3UV7A 1KERA 1REQA 2R0QC 4JBGA 5IHPA 4TYQA 2HYIC 1QVAA 2CMKA 2JAOA 3KKPA 3OO0A 4D9KA 2O2XA 3MTGA 1KHTA 2GFQA 1FVHA 3PNQA 2C61A 4IXNA 2Q3EA 2I4RA 1GEEA 4AD8A 5G0UA 2XZTA 3ZS9A 1FFAA 2XZDA 2H8KA 4NVRA 4GUAA 2WICA 4X61A 3MW8A 1P39A 2PRYA 5JLJA 2C5EA 2XWQA 3HBMA 4NPCA 2IWRA 3T54A 1E3TA 1P9WA 4IL5A 3FROA 5U4QA 5DM60 4F4JA 1RZVA 4AU1A 5TPWA 2EEZA 2LWIA 1UPXA 3OECA 1JTVA 5KNCA 1AK9A 2RGXA 3MLAA 1YCFA 5E1OA 3ZCPA 5EG5A 1GNVA 2GYWA 2RK4A 4ZA2A 2G6TA 4R54A 3QEBZ 3IOCA 5TEWA 3ETHA 3HKEA 3U17A 2QROA 2QN8A 3RCBA 4G97A 4WXRA 1GZSA 2H2FA 2VO1A 3LYUA 4QXMA 4ZARA 1G7TA 4BB9A 4C1BA 3LQFA 3UKJA 2A3NA 1WHTA 3AY0A 3EZFA 2XCUA 2EBWA 3T3NA 1DAEA 4S1WA 4G5YA 3W2GA 4EYEA 1NG9A 3NOVA 3FHLA 4FHCA 1OXVA 3PSAA 4H6XA 4FGUA 1SVUA 2IY9A 5I9IA 2C7PA 2JA1A 2NGRA 5AH0A 2IP2A 1B00A 2WQZA 2ZG6A 4ZGGA 4RZUA 1BO6A 3GDGA 5TY0A 1MG5A 4FWIB 2W43A 2IEYA 3C87A 1MRZA 3BVPA 3QTLA 4HXGA 2ZJ5A 4DCNA 3S1AB 2WG2A 1JAZA 2CNLA 3QPDA 4LX8A 1YFZA 4K6MA 3O4HA 2BE7A 3MXOA 5AW6A 6REQB 2R6ZA 1BDMA 2V3WA 3L7OA 4U7JA 1PEKE 1ZH2A 4PQEA 4MQBA 4LY3A 2AE2A 3IAHA 5LWHA 4MV8A 2QN3A 5HCNA 3WG9A 5FDFA 4CUKA 1ZSYA 2YJGA 4FVTA 3KKOA 5H68A 3SR3A 1E3EA 1GADO 3BL6A 3K9WA 4JXJA 5CCBA 1SHJA 5F7XA 3V32A 3V2IA 3AZPA 4H08A 3ZWPA 3REGA 2R86A 4J0HA 4REMA 1T0BA 2PL3A 1ZCBA 4XUGB 3NIFB 3CZ9A 4OB7A 4DEXA 5B3KA 3G82C 1ZI6A 3RSOA 3NG1A 4Y1EA 4KGZA 3UJBA 4CMEC 1USWA 3IEXA 2ZYAA 4HUQA 3SJBA 1ODIA 4AICA 4PAGA 5GZ3A 2VJPA 1LI7A 2VNHA 5DHRA 4AZ3A 1W0KD 2I9PA 4FEEA 3KB6A 4K7JA 4C04A 5AOVA 4BLWA 1RQ7A 1WSWA 1WZUA 2C8JA 4DA6A 1ZITA 3JQCA 4XJVA 5EJEA 4L28A 5CLGA 3RYHB 2E5WA 1FP4A 2QUAA 1RXSA 1CRPA 1Y4SA 3DZBA 3HSSA 3SC4A 3BT7A 4URWR 1N75A 4CXMA 4XDGA 2AA3A 5KWEA 1UZUA 2XUFA 1Y1LA 1T0HB 4PZZA 4KNVA 5FB3A 1PLJA 3U1VA 3OQMA 1Y80A 1Z83A 4HB3A 2G9NA 1YBHA 2D2FA 1Y1RA 4IZIA 1UT8A 5EJGA 2YFKA 3OA0A 3FYDA 1M2NA 1KZ7B 2JFQA 5E4FA 2BSXA 4KDEA 1Y7PA 2I76A 5KYXB 2WM9B 2KPOA 2J0UB 4D92A 4HNTA 3I28A 4AULA 2DCMA 1CS4C 1KMQA 1P2BA 2H0RA 2NNLD 2QQGA 1JSLA 4RANA 3FMIA 2X6RA 3GCWA 2ZS8A 1GCGA 4YAFA 1X6VA 2IZ6A 1N2ZA 2MT9A 1NNSA 2NQ8A 1YBVA 2VBIA 3O91A 4DN6A 1Y3BE 2O0MA 5DT9A 5B58T 1NXQA 2WDPA 3AETB 3GJSA 2YOGA 2AZ4A 4P33A 3CLKA 5HIJA 3I30X 4BMZA 3GARA 1D7AA 1Y8RB 1T5TA 1Q83A 3BXFA 4C7XA 3QXGA 5DNDA 2ZRGA 1XJ0A 3IXMA 4O2BF 1FUYB 2VPQA 2V8BA 2VNIA 4LA4A 5DHUA 2WFMA 5GINE 2NTNA 1E3SA 3PTZA 5EUQB 1LI4A 4DZZA 1JNXX 3PX2A 1J2UA 3HN2A 4X65B 4JLVA 3MWDB 2BJHA 3AG6A 1ZN8A 4AZ0B 3N3AC 4LYDA 1QVZA 4NZZA 1Y4DE 4S05A 3DTVB 4XB1A 3VDNB 1KC1A 2Q1TA 1L4LA 4B0OA 5BXQC 4ZVRA 2QORA 2HCRA 2VRNA 4AS1A 2YNMA 4BTLA 1VG1A 3IESA 2GBFA 2Q4OA 4ZCLA 3AR5A 3N59A 3HZOA 1Z33A 1R5OA 2VP0A 4MB6A 1KR5A 3C97A 2D00A 4O59O 4L0DA 4C22A 2VTBB 3IMKA 1E77A 3UMMA 2VRWA 2J33A 2XMBA 1JQBA 2F8MA 2NT3A 3CEAA 1GR0A 1A9PA 1PFQA 3HCOA 1K5PA 1CZOA 3G17A 3OZRA 4LKOA 4MA5A 5IKOA 1B0AA 1GZ5A 1PK7A 3MJEA 4WFJA 5CFQA 1G5PA 4J2TA 2I7VA 3N2GA 2V5AA 4EUHA 4BVKA 2YBDA 3SR4A 2VUIB 2QP9X 4R8MA 5EQTA 4FYVA 1A2QA 3GOHA 5JZ9A 4F0JA 5G4KA 3CVYA 4IW3B 1IN6A 3I01A 4ND4A 3FKSD 3OX1A 3SEZA 3KSZO 4YFVA 2A0UA 2JFZA 1IH8A 3H3JA 4GX2A 1N34B 2B92A 2B4KA 2WVGA 5LXTF 3Q5EA 4UMDA 2B2CA 3W2EA 4H77A 2YWDA 4LAFA 4C7KA 4U4AA 3F3SA 1YDMA 4QG7A 1MHPA 4GC9A 2G71A 4M37A 2VXYA 3UJ7A 1PHRA 1M1XB 5EQJB 2HRDA 3FSJX 3IPAA 1BKYA 4BNKA 4FC6A 3I0NA 3OFND 3H65A 3T7SA 1USUA 3K96A 3H9GA 1NN0A 3OQIA 4PTYA 5F2OA 4D9FA 1UFQA 1KI6A 2W37A 4HGRA 1TQ4A 5HILA 3NHUA 4CE6A 4FZJA 4DARA 3KOMA 1BSVA 1I24A 1POWA 4MW9A 1KIAA 2BBOA 2ZDQA 3V48A 4AG6A 2JZCA 2RAVA 2ZJ4A 5DMXA 5K8UA 4YRGA 5JMPA 2QPLA 4FDLA 4YJDA 1WLYA 4ENVA 2O1SA 2FWMX 3NM6B 5LJIA 1TCBA 5K7SA 5KOYA 1XPOA 2ZXFA 3OCCA 5BNFA 2C5BA 1UXGA 4OBXA 3HB9A 2NPIA 3RU2A 3T9CA 2QTTA 3U3RA 4EI2A 5H4GA 1KKUA 1LQUA 1MHTA 1FFBA 1FYDA 3HUTA 1SXJB 4BECA 3NTUA 1DEOA 1HTTA 1ZESA 2B4YA 4DM4A 4YJ2A 3D54D 4CRWB 2WWGA 2O52A 4P4LA 4DBLE 4NRDA 5EZYB 4ZAYA 3ZZ0A 5ALTA 4IDQA 1UM8A 4KQIA 2GI4A 2YFQA 1RRGA 2OO3A 3D5TA 2G72A 3CV3A 3JQ9A 2DWQA 1O03A 3BB4A 1FA9A 5B4TA 4Q12A 4KUGA 3WNVA 3WKCA 4TXJA 3MT9A 3IHLA 1KFJB 3L6DA 1BQ3A 1GU0A 2QVBA 4O63O 2BCEA 1GNSA 4MVJD 3THOA 2KM1A 1NBOA 1E9EA 1O5IA 2JGLA 1I51A 4H35A 2GPWA 4QVIA 4Z4GA 1LRJA 3RS5A 3A9CA 2UUOA 4EG4A 3DHEA 1NVFA 3VSAA 3QBJA 4RIGA 1WEHA 3WA6A 4FGSA 1E9SA 1NE2A 1OAOA 4ZOAA 2HIHA 5I7UA 2A94A 4B81A 5BQ3A 3GZNA 3PHBE 1QAMA 4GQBA 1RRKA 2PYIA 4KYVA 4C0BA 1PX2A 2H1IA 4M36A 2HT6A 4R05A 1Y9AA 1FFHA 4U5QA 4JH0A 3TLCA 3TSWA 5A4AA 2FR1A 3DR3A 1LWOA 3I01M 4JVLA 3TLGA 3KVRA 2GA9A 3TLBA 2ECKA 4L75A 2PU5A 4F8YA 2DLDA 1YZHA 2XUZA 1NV8A 1YSCA 4Q9JA 1W6RA 1CEXA 4S1VA 3UMVA 3W9UA 4BC1A 4A5OA 4KE9A 3BMOA 2XMGA 4A36A 2QL6A 1I1QB 4I1UA 4FNMA 1U2GA 2EF0A 1HY3A 1XDZA 3DHNA 3GPBA 2F4VB 5KAMA 3QJ5A 1HDYA 2IHKA 2AN1A 5ELMA 2WWYA 1FPQA 3IXQA 4NCJA 3NHSA 3T4UA 1WG8A 3ZLBA 2PH1A 3ZWMA 1MB0A 4E2XA 4EAAA 4E2FA 3KLMX 4B3FX 4TV9A 3E23A 3LWDA 1AGPA 4PXSA 3ZX5A 2CZGA 4TTAA 3OQBA 5G0SA 4BUZA 4EMBA 2WAYA 4XX1A 1N6NA 1J0AA 3NRBA 3ZHVA 1SXGA 2PN1A 4TWJA 5A1JA 1OYVA 4KOEC 3NBFA 4JBIA 2YN4A 2OXTA 5T67A 2H92A 1EFPB 5DCUA 2EARA 1E5XA 4L9WA 3MT0A 5F2KA 4CQNA 4XPIB 4OPMA 1QH1A 3IB6A 1O77A 3OCZA 2ZRFA 4OHUA 4PG5A 4BLTA 4FSDA 3MBIA 4FMDB 4Q1VA 1RJ9B 5CM9C 1HKUA 5D5QA 5HKOA 2H3EA 3IPXA 5L4LA 3KV3O 2VDOB 2DFTA 2ZKLA 4J4HA 4HN2A 1K88A 2XMZA 4MH0R 2P8JA 4CW7A 5C7IO 6Q21A 4P3XA 3WDLA 3F3KA 1QR6A 4GZ6A 2CL5A 1YCHA 5FIUA 3SE7A 1DADA 2O2DA 5L7TA 1XMQB 1YJ8A 4DV5B 3T7TA 2Y9PB 4MKHA 1Q16A 1BMFD 4IILA 5K9ZA 4UU1A 5ICEA 4NFSA 5KTMA 4BFUA 1YOBA 4I8IA 4BGDA 3QHPA 3VBEA 4CIDA 3LP5A 3HS3A 1EFKA 1FF9A 4MJ3A 1FMFA 4KTTE 3E9YA 1YH3A 3M5DA 4IJ5A 4KK3A 1WE2A 2D7CA 1CNFA 4NZOA 4R1UA 5AW9A 1IN5A 4DCPA 3EVNA 1T0UA 1BOOA 4UM7A 3IEPA 3P96A 4ZI5A 1IBSA 1A8PA 4BXOB 4RVHA 1K8YB 3MBKA 1SBIA 2QE7A 1RPAA 3GFFA 3B5EA 4KITB 4P81A 3MFQA 2DLCX 5BW4A 2GBLA 3JS5A 1WZNA 3R8XA 2IFTA 5KS2A 4UUQA 5L45A 4F2GA 3IPRA 1MFZA 1V8DA 1J8FA 1VA5A 1IXYA 2YIVX 4OAOA 4K81B 4ZPJA 3AT1A 3AUTA 5BSKA 2PQ6A 3KG2A 1C7FA 4P1ZA 3THXB 1MPXA 2YC4C 4HB2A 2ZTLA 2HMWA 1TE2A 3GGCA 2J7KA 4H1HA 4KQGA 2JI4A 3BWMA 5IEJA 3DD5A 4PONA 4UE6A 4JB0A 1CT9A 2OXEA 3B52X 4H9GA 2GZRA 1DP4A 2VUSA 4HHEA 3GLGA 2BGWA 2R6FA 3T5GA 4ROTA 2FWNA 1R37A 2H4HA 2JKZA 1OWNA 3KNZA 3FLEA 2GUGA 3LC2O 3KWLA 1HGXA 3OIGA 4ENRA 4ARCA 1TZKA 1YASA 1YR2A 2A7XA 2BDEA 2HRQA 5CLLA 3QVTA 4J3NA 3RV4A 1KOFA 4MUHA 5TMEA 3WRWA 3QXJA 4HY3A 2YICA 4FJ2A 1T3ZA 3Q98A 2QE6A 3OFSA 2J1LA 4GMXA 5FXMA 4EHKA 3PEYA 1VPTA 3C3DA 1SVLA 1TQ2A 1Z5OA 4NSNA 2P11A 2GD0A 3C3XA 4PNHA 1G5RA 2Y0DA 4W9NA 4YECA 3C3AA 5B6JA 1V4NA 4A3SA 3RVMA 3VDRA 5B36A 2CDAA 2QRVA 4GD3Q 3ZWBA 2VT2A 2UUAB 3PFBA 4DLLA 1A82A 3UFBA 1TUGA 1R5BA 2OQ2A 1X0VA 4C0QC 2ZUBA 3GRCA 3GXOA 3PHCA 2FGJA 5KNCH 1JKMA 1VJ0A 2H1LA 1SULA 1R0CA 2OCLA 2P2ZA 3HJRA 3O7MA 4MGEA 4Y6LA 4Z9XA 1AKMA 2CFCA 2AWNA 1WBBA 1G42A 4JI5B 3T7JA 3C8ZA 3OJOA 4LJAA 3GFPA 1RZRD 3LIIA 1GAQA 2MMGA 4DR2B 4G8DA 1CD5A 1SU4A 3R20A 3WXBA 2A0KA 2QUHA 3ZTWA 5GVSA 2ZB2A 2ZWAA 3R3WA 4GOJA 1KRXA 1YE5A 3A1VA 2MYUA 2ZAGA 2OENG 1OBFO 5L9AA 3CXRA 3HRHA 1LBIA 1OR8A 2NU6A 3LHFA 1MAAA 4FW8A 4BNWA 1G8KA 2YWJA 4CQMB 2FWRA 4HQKA 3QX7A 1BE8A 5LIPA 2ZZMA 3WISA 3ZJYA 1Z4NA 1EUYA 1SA0A 3RD5A 4E31A 1NNI1 4AECA 3IQXA 3OJEA 4AY5A 1K8ZB 2Q5OA 4MUXA 4P4NA 4KH1A 3GO4A 2ZM6B 2C84A 7YASA 3DEIA 2W8ZA 4O29A 1M74A 3F9CA 1PGQA 5FBKA 3L1HA 4OAPA 4YRPA 1TO1E 3ZU4A 1FSPA 5JC8A 5KYNA 5TGZA 1ZEMA 1Q0TA 3BH0A 5IT0A 3WTCA 1E62A 5ALYA 2IYNA 2OD7A 1DIBA 1P2VA 1TTQB 3LPLA 4FFVA 2R85A 4Q6WA 2W9XA 1Q0UA 4D9BA 3KLOA 1S2LA 3OM1A 5FNVF 4X8LA 4E1BA 3E9EA 3ESCA 2CLKB 3IUSA 5K6AA 3WAJA 3PE4A 2V5UA 2DUJA 2L0XA 3J7TA 4CT5A 3H8WA 2PKXA 3LPNA 3NH6A 4V0MA 4BBPA 3OH8A 2V03A 1DX6A 2FUKA 1HSOA 3QIAA 3DEZA 2Q50A 4JODA 2QAJA 1E20A 2ZOSA 4NULA 4QU5A 3RRMA 3FWNA 4UW9A 4RHFA 2CDNA 3OQIB 4KREA 4QDTA 4EQZA 4YPVA 2R8EA 2J48A 3CBGA 3NXKA 4BFVA 3EDCA 2ZRKA 3G68A 3NT4A 4IIEA 3NHMA 1Q84A 2Z2JA 4DLKA 4DV0B 4F4CA 1G291 1A2BA 2LUOA 1Z5NA 4U8GA 2FMTA 1K75A 4G5SA 3SE0A 4YCBA 4YUAA 1DC8A 2VTVA 5LC1A 2WJYA 5EI5A 2XV1A 3JPWA 4KX5A 1Z7BA 2Q6VA 5ALVA 1OI3A 4I2VA 4DLBA 3PG5A 1VJ1A 3SF8B 3VO2A 1D4FA 1Q3TA 3M9LA 2FHPA 3MGCA 1SCUA 1L7BA 2PRJA 2O7VA 1QGUB 2ZWVA 4A5SA 1X80A 3G2HA 1GGVA 1XTZA 3R23A 1R4NB 5HVNA 3ZWDA 5ALEA 3DUFA 3MOIA 4I1RA 1H2YA 1LBHA 5CVEA 3CZPA 1YQGA 1TT5B 4LCJA 5LUAA 4AO6A 3MEQA 2X1LA 4YBZA 3ENKA 3FLAA 3PDCA 3HI6A 5ECDA 3WQHA 1ZS9A 1MVLA 3Q2IA 1S4QA 3FPAA 3ZE1B 2VKQA 4D8TA 5CCEA 1OAAA 2GO1A 1GA1A 3VNSA 2IS4A 5INTA 3MS4A 3SBXA 3X1KA 2ZIAA 5BYBA 3H7IA 3LGXA 5JDIA 4LKRA 3KB2A 3JYLA 2QTLA 4UTPA 4ZT7A 1DO0A 1VJTA 4CHGA 1LLDA 2ZRPA 1FOEB 3CNEA 3MGBA 5HGXA 1K97A 2X1MA 3SSAA 2G5CA 4UM9B 3QEKA 3HZHA 1X7XB 4FFLA 2DTXA 4LPKA 5JR3A 4OG2A 1DWPA 2JIZA 2P2DA 2Q4TA 2RGDA 4DVJA 3SZLA 1YBAA 2QVZX 1V39A 3GEHA 4G8CA 5BSTA 3S2EA 3WTBA 4DLYA 3B1YA 4UXIA 4GIBA 1Q1GA 4DHWA 5MFZA 2W2PA 3C74A 4I81A 3LL7A 3EVGA 4BQFA 3A6HA 4ER3A 5C4MA 5FA8A 3A25A 2QQEA 2DRIA 4QICA 4MGYR 2ZYIA 3OHMA 1HL7A 1RWPA 4Z6KA 4DAEA 2W6JA 2B3TA 2VF8A 2FQWA 4PZLA 4TKUB 3T0GA 4GU5A 3M4YA 4FOTA 4MP6A 4BO6A 4DGSA 5AESA 1ZOIA 1GRQA 4E94A 1JWAB 4EUNA 1ZNXA 3IDSA 1Q1ZA 3TZBA 3WK6A 3S99A 3C15C 2EQ5A 1PVOA 3BHIA 5LLTA 1L2TA 2RGAA 4GLOA 4PYLA 4QSMA 3UICA 4PHCA 3EPJA 2D4AA 1R9JA 2V4ZA 3B82A 4ZYTA 2Z6AA 5FA5A 1RLJA 4IMJB 1X1TA 2VKTA 3NIGB 4FONA 2VS1A 1JR3E 4QNRA 3HCRA 4BVJA 1LLCA 1N77A 1QFYA 4RPGA 1QQ6A 3QG1A 2I66A 4LVUA 2GT1A 4Q48A 4RY0A 3WMGA 4F6RA 1G9TA 5FUYA 3I8XA 1QV9A 4ONEA 2Y1LA 1V6CA 1MDBA 2FN9A 2GQ0A 2K2QB 3EZNA 4ASUD 1SKQA 1KE2A 1ZC3A 3FW1A 4BQSA 4R2XA 1G8YA 1F8YA 3BTVA 1SXIA 3MCAA 1NJ1A 1FMJA 2G6BA 2WYWA 3B1ZA 3WLNA 2JLAA 1I6WA 2WINI 3L8CA 1B43A 4AKGA 1GILA 1AVTA 2C2WA 2XSZA 2YXPX 3IA2A 2X4IA 1DC5A 1TJNA 2I62A 2DUWA 4ND2A 3WNQA 2FR8A 2ZJ2A 4GVLA 5BV1A 1D4OA 5K51A 1E0JA 1XALA 1FZQA 4MR7B 4U7HA 1YNSA 5G0TA 5EJ5A 1CJCA 4TQ9A 4E5PA 2AG8A 1U81A 3OZAA 4IH4A 4QXPA 5EJ7A 1Y5RA 2HZBA 3SX2A 2BFFA 1SU8A 1WOMA 5GJCA 2O8BA 4IICA 4QPZA 4A2CA 2VAMA 3BMNA 4EFNA 4GSKA 5GM1A 4EECA 3VVCA 5JAIA 4U2KA 1FQKA 4CM4A 3CVVA 1IVNA 1T2FA 3K9HA 5KNDH 1O0SA 2C78A 3K35A 5E6SA 3OQ1A 1ENOA 1UPTA 1YC5A 2G5PA 1UMDA 1U7OA 1WXQA 1EVLA 1X9IA 5D3QA 5MN6A 4FS3A 3L7LA 2EV9A 3ORHA 4GWGA 1JH8A 1Y81A 3BC1A 3PD1A 3R2JA 4TRNA 3RF6A 1EJBA 2H2IA 2BF7A 4R8VA 3VO8A 3ZV6A 5CYGA 4UHCA 3JWPA 2GDJA 4EHIA 1I36A 2VWGA 3P9NA 4CTMA 4FLEA 4KFUA 5C4GB 3S2GA 3RSFA 1K0UA 3ETCA 4CM7A 2JFGA 5AP9A 5J3JA 3TS1A 3C3YA 3VZBA 4AZSA 4H60A 3C3MA 3I12A 3R6TA 4P0TA 1C0EA 1VCHA 1QK5A 3QMPA 3KOYA 3K32A 1LA2A 3AM4A 5IF9A 3OBBA 4PS0A 2K7ZA 2Y1DA 2YTZA 2OZKA 3N70A 4V3CA 3WSTA 3HN6A 3VJMA 4LRUA 4FCCA 1Y33E 3OQPA 4GXRA 3UOWA 3VRHA 1UCFA 3CRNA 4HGYA 3DMTA 1LDNA 1H3NA 1C4XA 2BD0A 2LVBA 4RELA 4YA6A 4BRWA 2Q2OA 4PX2A 1F8UA 4XLLA 1CUGA 3UJ8A 5A4IS 4INJA 4ERNA 2OG2A 1T8YA 4S2EA 4FX5A 3GMIA 2BCJQ 5J9FA 4WDRA 2HADA 3HO8A 3K8QA 4U2DA 4OHOA 3NONA 2V7TA 4I9UA 3KJNA 1DIAA 4GM0A 1XU9A 3E8XA 4J7CA 2PKEA 1TO2E 3T41A 1TZCA 4B3CA 2MDTA 4RKEA 1UR5A 3WYCA 4DXDA 3M83A 1UMCA 3QQ5A 4IG9A 4H3KB 1WBDA 1E79A 1O94A 2QRVB 4IYJA 2WHRA 1AHIA 3HNPA 5FLKA 4A4DA 1FVOA 4EHHA 3V1KA 1E98A 2P1ZA 2MR5A 4E5SA 4WLOA 1ZUD1 4LRTB 4WNCA 2C9MA 3RSGA 1M34E 4V1CI 1JW9B 1Z75A 3M5WA 3F5FA 1GPYA 1VP9A 3F5MA 1RACA 2XUAA 1IWBB 3AFMA 1MENA 2O9JA 3JQ8B 5EIBD 4D25A 2B9EA 3BGWA 4HK4A 4LCBA 4KC0A 4MIYA 1MJNA 4E4RA 4H59A 5K99A 1KMCA 2WD7B 3ISJA 3P9YA 1GKUB 1VHJA 1SPXA 2V58A 1QG2A 3ASVA 1WCYA 2ZYUX 3B9BA 3KEOA 3LT2A 1KI8A 2IBMA 3OFKA 4K03A 1T6ZA 3DE5X 4PYMA 4QFCA 2QG9A 3N8KA 2H4WA 1HNZB 3MCWA 4ZREA 2PJZA 4G0ZA 1G20E 1T2DA 1VYVA 2C99A 2ZPAA 2YYAA 3E3AA 4JQZA 2PBRA 1TZJA 1JHPA 1TYCA 2HEGA 2VYNA 1L4FA 3ZZMA 4TV8B 4EFDA 1UBFA 2XOKA 1IVSA 3P2MA 4DSUA 3SZMA 2YWXA 2XITA 3SG0A 4CR7A 4FN4A 2PRSA 2FPRA 4EX6A 4A10A 4OJKA 4A27A 2Q4DA 2GHRA 3EGWA 1PUIA 1RE0A 2V0CA 4BQNA 5FLXA 4KV9A 4N8SA 1LBSA 1EFVB 1Q1AA 3NTOA 1IEQA 1KJQA 3HDVA 2E21A 2NV0A 3EFHA 3K0FA 5HIMA 2C7RA 2JFOA 3JAKB 4RNDB 1YNOA 4JY7A 1E0SA 2BGKA 1G21E 2J9GA 2WJVA 3JQ7B 4BGIA 4RZSA 4Q1FA 2PMWB 2ZVQX 1P0IA 3A1SA 1XHLA 2BZSA 3K70B 2NADA 1PW7A 5LVAA 5JXJA 3GUHA 1CUHA 3KAKA 5GP1A 9ATCA 1Z4QA 1YJCA 1L1QA 1P8JA 1E5QA 4NU8X 3GPCA 1C7JA 4G5QA 2IV3A 3DAHA 3EDQA 1NRWA 2OC9A 2YHIB 4IQGA 3KT3A 2OV8A 2Z2XA 1OFGA 1KZ1A 1V9CA 2DHCA 3LC1O 4EB3A 3PQ4A 2NP6A 3BFXA 2PZEA 3VNQA 2B1RA 1QGED 4UHHA 1VYHA 4YONB 4MPDA 3UW3A 4CL8A 3TVYA 2GD6A 3S6JA 1T8WA 2QTNA 1DKMA 2Q28A 2UUCB 3WL7A 4EHNA 4DR7B 4GXNA 3U9SA 3SZOA 4OMFG 2VNKA 1J1IA 5AW2A 5CA1F 5AVWA 3IE2A 4ENUA 3O8BA 2IE0A 3STXA 1ZIDA 4DYDA 1ZWLA 5DSTA 2H1WA 5BVHA 3RSZA 4RNCA 5KVQA 1AQNA 3FRHA 3ZGVA 1U0RA 1F60A 1Z2EA 4RIHA 3MLEA 2DPMA 1WMAA 1J5PA 2FJ0A 1SCUB 1JL3A 3A6DA 3PQ2A 4JXKA 3THYA 1S2NA 2DQSA 2JJMA 4PYNA 4KZKA 4FT4A 1VP3A 2H8GA 1ZK2A 1WWKA 4H4CA 1GRCA 2X8AA 3G9TA 4R31A 5JMWA 1AZLA 3UMGA 2XCQA 4DKJA 5KI6A 1JVSA 3AVUA 721PA 2EKBA 1U90A 2B8WA 3ON5A 4ROSA 1OQAA 2XNJA 4QVGA 4QUKA 4MVWA 3OETA 4C6HA 4C7BA 2XGGA 1R00A 1E96A 2VJCA 4ZQFA 4UBJA 3OLZA 5HK9A 2EG5A 3A1EA 1RAEA 2TYSB 3QG5A 2IYUA 4OJYA 1N5RA 1CRQA 3OE5A 4ND1A 1TVMA 1DCTA 2XTAA 4D46A 3CEMA 5CTJA 1M7GA 4ILEA 5JZVA 4HAWA 2RH5A 1IQ0A 2SKDA 3HBJA 3OPVA 3EPKA 1EGVB 4DUZB 2W6QA 4NLLA 2XIJA 2W83A 5DXAA 3AP3A 3ZQ6A 2FFAA 2CFIA 4B7ZA 3TFOA 3DLCA 3V1MA 4TSKA 3CB2A 4S3MA 2OAQ1 2B35A 3LS2A 1XRQA 3B9QA 4XD2A 4XZ3A 3GDHA 3P71T 4ZAGA 4YQEA 3S8YA 1PJ8A 3A9TA 4RMJA 2NQ2C 5BP7A 1WABA 1KL7A 2DTDA 1AURA 2ZJ7A 1LPNA 4LZJA 5B53A 4DLRA 2VP5A 3WZLA 1XWWA 3BFKA 4Z0NA 2ENUA 2LGJA 2EJBA 3CX6A 4YC7A 1CYDA 3L04A 5EHGA 3WLHA 2WWRA 1ZSVA 1LQTA 2X2OA 1UBRS 3GRRA 2CEAA 4TSFD 5CMLA 3BEDA 4GHWA 4UOQA 5AT1A 3VGJA 3VU0A 4B35A 4BRZA 4DLXA 4AK9A 4Z0TA 3LXRA 1J9EA 3CLUC 1B3BA 1E9VA 2A1IA 2BAGA 2O4UX 3L77A 4IDNA 4RS3A 4TN5A 4PFQA 5BN5B 3VO9A 3JSAA 2YIMA 3UHOA 4L5JA 2NX2A 5IAJA 3ZWWA 1YWGO 2G1UA 2HF8A 2HWUA 2A1TR 2TMKA 4JBXA 4OUDA 4B4UA 4DJJA 2FOLA 1MGOA 2BLLA 1YL5A 4GP9A 3EIEA 3B8EA 4GMGA 2VP9A 4IHAA 4KR7A 3AINA 3OCUA 4RJJA 2VZLA 4FZ3A 1M6NA 4IS2A 1D4AA 2FDXA 4D0RA 3CO0S 4ZVKA 1NMQA 3R3HA 4XOUA 1RVV1 3FCYA 5JNTA 4R9SA 3S4YA 1H2HA 1GUFA 4HOYA 4GGOA 1D2GA 2CYCA 2O4CA 4CI9A 4G67A 2AQIA 3A1TA 5JYEA 4WFKA 1ZGZA 4HGQA 3FCOA 4R8LA 2PUTA 5GV7A 2EX0A 2I67A 4O5AA 4G81A 5ALGA 5JD4A 1V3QE 4JGIA 4LVNA 3F6CA 5JJBA 3FOZA 3PDWA 4E7PA 5F3WB 4LHVA 1L6IA 1MNQA 1T9AA 3LOUA 5HM8A 3LF2A 3K8ZA 2WDZA 3DUWA 5HOQA 1IY9A 3LBHA 2JBAA 3AVYA 1X86B 4X24A 3LX4A 3ZPXA 1W48A 1ZKDA 1ISSA 3SFZA 5D51S 1LTQA 1Z6YA 1F06A 5DEIA 2VJYA 2O8BB 4XX0A 3DEAA 1ITZA 1S2GA 2DERA 2Y66A 4RPHA 5JDCA 4YYZA 2C3YA 1R0BA 3V55A 3F8SA 1JEOA 3OSUA 4F1KA 4ZCSA 5EVJA 3T3DA 4URFA 1DC6A 2FK8A 2FFHA 4GZ5A 1QOQB 1IMOA 5DHQA 4WXMA 5E6SB 2AX3A 1UMDB 4LXIA 1QRDA 2VTDA 4U00A 1T2CA 1O97D 5KTOA 1ESZA 5M29A 1M2JA 1YZYA 2J5QA 1NT2A 3I04A 2NU7B 3QVLA 4MHTA 4F06A 1ZPDA 3FR7A 5TF0A 3EA4A 4IVQA 1XCLA 7AT1A 1ORWA 3N2KB 4HAXA 2PUCA 1WNFA 4RHYA 6YASA 1QPZA 5AXAA 5AVQA 4B87A 5FP0A 5G1NA 4JJ8A 4J6EA 3B1KA 2AXQA 5DH9A 3VDMA 4EZEA 5EKXA 5AVTA 3U09A 1D1SA 2N42A 1JA9A 3HB7A 1GTZA 1RYZA 2XDAA 3QV2A 3RYTC 2C1EA 4R51A 4ZQBA 5T6BA 4B2PA 4LMAA 4I50A 3QE9Y 2R8BA 1VJRA 2WU4A 1WRBA 4MZXA 3WYEA 1I1OA 4XGIA 2QRZA 3ZDXB 4AXXA 2VG8A 4D82A 3K0CA 4QJ5A 3P5BA 3A6ZA 3FPSA 2JGIA 3OC6A 5I7OA 4KBGA 5JFGA 1P1HA 1XVAA 4ZK6A 1M6HA 4XUEA 4D6XA 2P8SA 1HE1C 1QTIA 4U8HA 3K4HA 4YVFA 2XH8A 5K0BA 3C6QA 1FDVA 1V5EA 1UC4B 1O8BA 2GF9A 3KJIA 3P9ZA 4FGWA 4I5IA 4J75A 4UQPA 3IOBA 4NJEA 5A6SB 1M6VB 3OF3A 1PR0A 2YOFA 3DEHA 4BZWA 3UHPA 5JRZA 1D6MA 1YZTA 4REQB 2V55B 4PZEA 5BUSA 1CUSA 4GLBA 1FLDA 1UMCB 4N03A 4UBKA 5JADA 4JUAA 4L3VA 2EW1A 2ZJ6A 4XJXA 1AO0A 4KU4A 4FLFA 5FFNA 1XF9A 4HR7A 3PNMA 3MNFA 3PDJA 2BONA 3GQBB 4O4JA 5ICSA 4E2ZA 5I47A 4WGFA 2WLSA 2PEZA 1X1QA 1FTSA 3TIIA 2CJXA 4MQ5A 2JCVA 4PRZA 1U7WA 4NE2A 2W6CX 3D6NB 2AW3A 3ELWA 3OPYA 4IXTA 3ONNA 4L5BA 3AY3A 3LE8A 2QPOA 1ZK1A 4OXYA 4QA9A 3RU3A 4D41A 5FBVB 5BR8B 4PXYA 4WESB 2R2AA 3FB1A 3RC8A 1G4AE 1NTRA 3HGQA 4TM7A 4X91A 3HTXA 1MOZA 5KSPA 1CK4A 1XDWA 2P2CA 2UVPB 3O38A 3QUBA 4P3PA 3UJHA 4CIAA 3WY9A 1SIUA 2VYVD 4NIMA 2QYTA 5E6RA 4EPTA 3PLRA 5KCMA 4MITA 1NWCA 1RBYA 4ZTBA 2Q4EA 1P81A 1V7ZA 1XN4A 3DBLB 4BTVA 4JEUA 2YJTD 5GGYA 3EIWA 4R3NA 1IQUA 4ZO6A 4D0SA 3AVOA 1IK6A 1EFRA 2WJHA 4GI2A 1G8MA 5JS8A 4LBYA 4DUGD 4LGCA 3LQQA 3MFYA 5DU2A 5BVGB 4EG3A 4R1PA 5ALHA 2D5LA 3HG7A 1NT4A 1VHWA 4RKQA 4XE5A 3WHLA 1A8HA 2DB3A 3FPBA 1LB1B 2SCUB 3MUEA 4PLYA 5L3VA 2FNAA 1RYBA 4CM5A 2XYQA 4P0PB 1ZD1A 4W5HA 5B4UA 1PRYA 1NAIA 1DT5A 4XSVA 2JLBA 1NUHA 1U8ZA 2GCEA 3I6IA 3W3AA 2ZJAA 4EYOA 5CB4A 5F78A 1P9RA 2UUBB 4X54A 3X1DA 3PA6A 5GWXA 4D99A 3T52A 4NG5A 3BB1A 4JCCA 3JWEA 2EJVA 2HQRA 3LPCA 3N05A 4NYMQ 2C07A 3WQQA 1KYXA 2DHQA 2H0QA 3DOCA 6ADHA 5TVGA 2EC5A 4DQLA 1JI3A 2GF2A 4YB8A 5IUJC 2PSFA 1E3IA 2AEFA 2NU9B 3LW8A 3OKFA 2RONA 1MX1A 1PQ4A 3UCEA 4FB4A 4JLUA 4JYCA 3DMPA 8GPBA 4JLNA 1OIWA 2GYVA 4K6GA 4P4SA 4HQRA 3PRHA 1RWKA 4TTJA 4LN1A 4XEHA 4YLEA 2XF8A 3AVVA 2P2SA 3MUNA 5K2MA 4BATA 1T0PA 4B31A 3CEJA 4COOA 1CZLA 3IP9A 1AX9A 1FLAA 3LZCA 1NW5A 2ZSFA 5L95A 1F7VA 1NLUA 4KN9S 3EXFB 2ODQA 4UCQA 4BFWA 2I4NA 4F8JA 1ODKA 2A5YB 1LV7A 2H65A 2ZYGA 3BE5A 5DXFA 3ROTA 1NWHA 2XB8A 1P0FA 3LGSA 4C06A 1T3HA 3ZHZA 2FEKA 4YV1A 1O95C 4LYFA 1E1KA 4O6VA 3M4NA 4LHZA 3AY7A 3GR6A 1W4LA 3LWNA 2D13A 1V7CA 3O21A 2HHHB 3CO5A 2MSKA 1H2FA 3A4MA 4QVKA 5HKKA 4A82A 1H0KA 1EFDN 4KWTA 4BTEA 1XKXA 1LTHR 4RKFA 1O96B 4TT3D 1FLNA 3TLXA 1UEJA 2FJPA 2N75A 4HVTA 3RTBA 2GJ8A 3IC5A 3H7AA 3MYRA 1TEVA 2FWIA 4QUEA 4G2TA 3BKXA 1JT2A 1Z88A 4MO2A 4MZDA 3TQRA 5JZBA 1E6LA 3MWFA 4M8NE 4LXQA 4YP1A 3ZE9A 4ETMA 2QNIA 3BHJA 3KPYA 4HDSA 2DGDA 5AWFC 2ZJ0A 1L7VC 1PG0A 1Z6GA 3B89A 3UA3A 3W1EA 3UWMA 3CRVA