3A1TA

Crystal structue of the cytosolic domain of t. maritima feob iron iransporter in gdp form ii
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
254
structure length
254
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTILHRMILDYGEKVESEIKKVENFLRDKKLRINPRYFALKYLSGDPEFYSEGVKLGLPELSEEERIGYRLLIAKRKREYVENVVKEAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Iron(II) transport protein B
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
total genus 89
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1tA01
3RRYA 1TNDA 2X8AA 3GLFE 4HLUC 1KDTA 1E2NA 1X86B 4OQLA 3DEFA 1G21E 3KKQA 4IDQA 2PEYA 2OLJA 2ATXA 2B21A 2GEVA 5KSOA 2CK3A 2IYXA 4B74A 3ICEA 1LS1A 3OE7D 4RFSA 2W0SA 3TUIC 4M1WA 5BXQC 1GNPA 2BJVA 3R9XA 5FBLB 3R8FA 1DBSA 4IOJA 1E0AA 3RS4A 1KJYA 3LQRA 8OHMA 1RE0A 4C9BA 1M2OB 1S9HA 1X1SA 3GLFB 3B60A 3H86A 2ZRLA 1XU4A 1E1QD 4DLVA 4D0NA 1BMFA 4OJKA 1E9BA 3Q7PA 4DCNA 2F1HA 4RD2A 5BN4A 2FF7A 2GKSA 1EX7A 4TSFA 5HR5A 2DCUA 1GL7A 3AGQA 1OJLA 4Q66C 1RPZA 1P2TA 3KL4A 3IILA 4DLUA 4MKIA 2GK6A 4LRWA 3ONWA 3FKQA 4OJQA 2WM9B 1NG9A 4EQ6B 1DG1G 4BGDA 2AX4A 5EE0A 2OM2A 3KJHA 1S8FA 4KFTA 5GJCA 1FFHA 1LS6A 2C99A 3VAAA 3FPAA 5KPDA 4EPRA 4DLWA 4MH0R 1AA9A 4LJAA 1KIMA 4Q7KA 3PJRA 2IS2A 4OHXA 3TW8B 2C95A 1ZNXA 4JKIA 4B2IA 3WBKA 3EZ7A 1N0UA 3IEUA 5LBIA 5IDVA 3VQTA 1MOZA 5P21A 3SOPA 4UNSA 1ZNYA 3VNVA 1G16A 1H65A 3BFVA 3THXB 6Q21A 4RD4A 1G17A 3B1YA 1CR0A 4Y0VA 1NJFA 2VHJA 1KMQA 1N6RA 1YR7A 1ZIPA 2ANBA 4WA7A 3GCGA 1ZBDA 2CVHA 2P5SA 3EPKA 3X1ZA 1P9NA 2QI9C 3IIMA 3F3YA 1XDBA 2WKPA 3BH6A 1KK0A 5DLQC 3FKSA 3B13B 1UBEA 3M0EA 2ZJ5A 1VHTA 2ZJBA 4PO1A 3HU3A 3TQCA 5D3MB 4A82A 3AUXA 4DC9A 1F2TA 1CS4C 3NHAA 4GZMA 421PA 4PZYA 3U2QA 4O25A 2OBLA 1WRBA 2AK3A 1R8SA 4QJ5A 2OFOA 4AY2A 1G5PA 1ZM3A 2O8BB 3QJYA 1CP2A 3TUZC 2WWHA 5CB6A 4Q1BA 2XJ4A 1BO6A 1R5OA 1OFUX 1W0KA 3IUYA 3KB2A 2PLRA 4DDUA 4GZLA 4R2HA 4A6PA 1RC8A 4AD8A 1XPUA 1GKUB 4HZUA 2ASEA 3SDZA 4QFMA 3EZ2A 4TMVA 3CX6A 2PT5A 3CRVA 3TMKA 4ZDIA 1E2LA 1XMJA 3EZ6A 4IDOA 4US2R 3GLIA 4HAYA 2RMKA 3U5ZB 1DE0A 1XP8A 3SJCA 1TQ2A 1EX6A 2F43B 3GLHE 1T4GA 1U99A 2DFKB 2ODBA 1EGAA 1SHZA 5KHOC 5DE3A 2IWRA 4J0QA 4LJ8A 3AEZA 5AUPB 2V7QD 5IT5A 4JVMA 4LJYA 4XSGA 2ZRDA 4QBFA 4C0QC 2MSDB 1N6LA 3B1XA 4QBIA 4JMPA 3W3ZB 4A0FA 1FTNA 5TARA 2YKGA 2ZJ2A 4TQ9A 4M21A 2FGKA 2Z4SA 4D4KA 2NG1A 3LFUA 3GEHA 3GLHB 1KO4A 5JJLA 3LVRE 3V00A 1A1VA 3RC3A 4RKFA 1DARA 3MLEA 3THYA 2RGGA 3RWMB 1OXXK 1XF9A 2J7PA 2I4IA 5FOSA 1VCOA 1W4RA 2FJUA 2Z6VA 3G82C 4A6XA 4YDHB 5HCNA 5F9FA 5JFGA 5SZIA 4CGZA 2LWIA 4HUQA 1DPFA 4G3XA 1HQCA 4G5RA 2QORA 1EFUA 1QVAA 3CW2A 5FBWB 4MGKR 3KFVA 2ECKA 3K9HA 4Q19A 4B73A 3C16C 4HAVA 2ZSDA 3MGCA 4LPKA 3T5DA 4F92B 1K5DA 3RDPA 4KBGA 2R8RA 5EUMA 3QQ5A 1XMSA 3NBFA 2DWOA 1JALA 2ZROA 4Q1EA 2G9NA 4XVUA 1VECA 2ODWA 4OYHA 4P32A 1XEWX 1U2RA 1XEXA 2Z43A 4Q1FA 3W3AA 1YU9A 4WBSA 3AVTA 2PMKA 4OKSA 1PV4A 3MWKA 4TYQA 2VHUA 3CRMA 5GVRA 3Q5DA 4FCVA 5HPYB 1KTVA 4IXMA 3AB3A 1U98A 1XTSA 1CIPA 2AKYA 1GKIA 1KOFA 4IDNA 2RHMA 3ZIAA 4AI6A 2IEYA 4MRSA 1VCNA 4QJ4A 2AXNA 4G1UC 4IVPA 4NZYA 3ZZUA 4D6PA 1E9SA 1GKYA 5C2JB 2ZREA 3RWOA 2QBYA 3CM0A 1IXRC 2Q0HA 3W5IA 1W0JA 4GRAA 1NBMD 2GXQA 3WXMA 2QEQA 1W7AA 5FTMA 3K0AA 1XBTA 3CRRA 1UKZA 5IK2D 4NDZA 5FL3A 1MO4A 2IS1A 2FZLA 1HQYE 2VRWA 1R0WA 3T61A 1T5IA 1BYUA 1TF7A 2IYUA 1P7CA 4TTRA 2L0XA 4DIDA 4TMKA 3GEIA 3RS2A 3VKWA 1ZM9A 2D3WA 2FPKA 3FYHA 3QIAA 1EWRA 4A8JA 3CH5A 1TQDA 4URWR 3BB4A 1QRAA 3PEUA 4L5BA 2KSQA 3OE7A 5CJPA 4XH9B 2BHRA 2YOHA 4BPBA 1HT2E 3D6TB 2O5VA 1D2MA 4PC7A 4Z8XA 2WOOA 1F2UA 1C9KA 1RRCA 1T3HA 2RGXA 3GJXC 4HI0E 5FTJA 2LCFA 3U3KA 1MRSA 1E1QA 2IK8A 1OYYA 4HDQB 1TUEA 4LUCA 3L8YA 4LOAA 3NBXX 1KNXA 3CWQA 3AVQA 1J8YF 3UK6A 1E4VA 2ZE7A 2KE5A 3I4LA 4XJXA 4I1VA 3AVPA 1GDDA 2IYTA 3QSYA 4PHGA 2PJRA 1JQJC 1KI2A 4BECA 2KWIA 1QHGA 3BBPA 1W5SA 4IDHA 3NDPA 2W2VA 4M9SA 2EFDB 3C7KA 3G0HA 4AKHA 2R44A 4TLDA 5JZVA 2QL6A 1VG9B 3SQXA 4EUNA 3RNLA 4LX0A 4WVFA 3ASYA 1QVRA 5EE1A 3ICQB 1W48A 4Z54A 4BE7B 3C15C 2CMKA 3AKCA 4KFRA 1KI6A 3KJEA 3K0CC 4RD0A 4DWJA 3RAPR 5L3VA 2FDCA 4ILEA 2OV2A 4JLNA 3FB4A 4EKDA 4GMXA 4Y0AA 2VSXA 1UADA 2OCPA 1LF5A 3GJ7A 4NE2A 4O2RA 5BYKA 3FE2A 1ZW6A 1KI3A 4TWZA 4D81A 2NGRA 2YWHA 3O8DA 3ASZA 4PPQA 3SFZA 4E09A 2OFXA 3ZQ6A 2CNWD 2RGEA 1IY1A 2GDJA 3TK1A 1JJ7A 4Q4AA 3L0OA 1HT1E 1MKYA 5CK5A 1TQ4A 3T1QA 3UMSA 3I61A 2JATA 1W5TA 3MUFA 4JLPA 3O8BA 1U81A 1IY2A 3BXZA 4IKEA 2AK2A 2WZQA 1KAGA 3KKMA 4LHZA 2HV8A 1EWQA 1DVRA 4B6EA 2ORWA 3TSZA 4B75A 1GP2A 2GCNA 3VKGA 3ADCA 1Q3TA 2BIFA 4DBLC 1JEEA 2D62A 2HYDA 4US1R 4JJKA 1P5ZB 5KU1A 4JLJA 2KI5A 2DWPA 2LKDA 1E4YA 4JBYA 5B2ZA 2VF7A 4YMSA 3PUXA 1Q21A 5L8VA 3GJ5A 2BBSA 4HLQB 2IXFA 4PTLA 1GZSA 3KKOA 4PZZA 4YXWD 4C2TA 3HPRA 3PEVA 1NSTA 1ZC4A 4IDPA 2ZRGA 3B5JA 1IN7A 3B9QA 3T15A 4KLNA 3WP0A 1GWNA 1C1YA 1KKMA 1OHHD 3WYFA 5B57C 4BFUA 1FQJA 1H8ED 3ADBA 1DELA 1XTRA 4AYWA 4Q7MB 1CR1A 2CVFA 4F91B 3ZLJA 2HXSA 1U90A 4W7SA 2JGNA 4NYMQ 5E95A 3BIFA 2ZS9A 2REXB 5EQTA 5A5GA 2V7QA 3HR7A 3MWYW 3ZVMA 1NVVQ 1NKTA 3NTUA 4S2EA 1SXJC 1ODFA 2JLSA 3L8ZA 1E2DA 4UQOA 4OQMA 4HYYA 4PPFA 4AURA 1P2UA 2JA1A 1K6MA 3IPYA 3TE6A 3T5GA 2VHCA 1YVDA 2ZRCA 2QBYB 3OAAD 3BFKA 5L3SB 1L8QA 4E03A 3DKVA 2QPAA 3RS5A 1U94A 2FPLA 1OT3A 1QBKC 3K0AB 1YZLA 1YR6A 4CW7A 2F3TA 3AF0A 2NMVA 4AKEA 3IO3A 3AH8A 4G5OA 5EXTA 1MABA 3W8NA 4BRUA 2E1RA 1G8FA 5HCIA 4XIGS 1NIPA 3RYTC 1XEWY 1N25A 4KFSA 2BKUA 3KJGA 5JCZA 4B3CA 4ZIRA 3PITA 2Q3MA 4A8JB 1U8AA 4YDSA 5G53C 3TH5A 2O0HA 2KBFA 2OXRA 1Z47A 2CJWA 2A5DA 4RSGA 3W34A 1ZUHA 3WNBA 4TMZA 1F2UB 2J0SA 3A1TA 3B1VA 1UBCA 4U7DA 2F7SA 3I62A 1FX0B 2QGNA 4FW9A 4BFWA 3NBYC 2Q3HA 1KAOA 4WIAA 4YMUA 4O3MA 1ANKA 4LBWA 3CH4B 3VR3A 3P4YA 3AVOA 4IHQA 3SJBA 3IKJA 1KZ7B 3PCRB 1NVVR 3P32A 5DNYB 1JECA 2CL0X 3LA6A 1TX4B 3LWNA 1IONA 4TLCA 1Z28A 2H17A 3H84A 3RRMA 1OSNA 1NBMA 1S1MA 3D8BA 2QENA 3A37A 4O0MA 4HLDA 4DLYA 2WWFA 5LDDC 3PEYA 3LD9A 5J4YA 4YMVA 2GNOA 5IK2A 2GCOA 1YZNA 621PA 2PX0A 2ZRAA 3QXHA 2V3CC 1LNZA 5K8LA 3QUSA 2C03A 2IS4A 4OI1A 4Q1DA 2FX3A 3VU9A 2CCGA 1KI6B 1RRPA 5AUNB 1E2MA 2QUZA 1ESMA 1DO0A 3T1VA 4BLRA 4C7OA 2NPIA 2ZITA 5JCPA 3CR7A 3AGPA 5FPHA 5E7IA 3IO5A 3RS7A 5EP1A 3E2IA 3FGNA 4W9MC 1SKQA 4P4SA 3A8TA 3NH6A 4LYFA 3KUDA 2C9OA 1X8KA 1G1MA 3LRPA 4D2IA 2AWOA 3EIEA 3GFTA 4KO8A 4KVAA 2OHFA 1HEIA 2GETA 2G0NA 2DFTA 3QKUA 1FP7A 2HEIA 3ZS9A 2GVZC 3ZGXA 1AGRA 1MV5A 1Q44A 2OE2A 4M1SA 3NG1A 3TBKA 4KHZA 1NKSA 1T91A 4NTZA 3REFA 4FWTA 4TZ6A 3GJ0A 4Z8YA 2VSFA 1QF9A 3TGPA 2IYSA 3A1WA 2FSGA 1OV4A 4G5SA 4P31A 4RD1A 5LB4A 1VG1A 3I72A 3RRZA 3CNNA 1FNNA 1PLJA 4OHZA 2J0UA 1CR2A 4MUBA 1EXMA 3I3SR 1A2KC 1ZCAA 1KSFX 3TLXA 2XXAA 1E3MA 3EWAA 1CF4A 2VSOA 1KMHB 4Q1AA 3AVXA 2C9CA 2ZR9A 3DZ8A 4FIDA 1KO5A 2QPTA 2C04A 1NI3A 5B64A 5KYKA 3WYGA 4NKRA 3ND9A 1IN6A 1XXHE 1P6XA 4GMDA 2GF0A 2QSYA 4FWIB 2GAAA 1D8TA 3NEYA 3R9IA 3QXXA 1G7CA 1XJ0A 2FFBA 3U44B 1KZGB 2BV3A 2CNWA 2FNAA 4HB2A 1NF3A 1R6BX 1VTKA 3BWDD 1OYWA 2ERXA 5AJXA 4N1AA 2PCJA 2RKOA 3QKTA 4QHYA 1T8UA 1XXHB 4TMXA 1ZUNB 2CE7A 2IYWA 2ZQ5A 4XVRA 3ADDA 4FMDF 1SXJE 3FMPB 1U9IA 2ODEA 1UKYA 1SZPA 4PO9A 2QTFA 4A92A 1E6CA 2R9VA 1Z0AA 2DY1A 1F6BA 1G5RA 3ZVRA 2YC4C 2O8FB 1VMAA 1KSGA 3GJ3A 1MABB 2IUUA 4PHTA 1N0VC 3RS0A 3HP1A 4EIWA 3SYNA 5JBQA 5DO9A 2HUPA 3W6OA 3TW4A 4YXWA 1SXJB 1JXOA 3W9YA 4DDWA 4F4JA 1QZXA 4G5QA 3SC3A 2DFNA 4Q9IA 5FPSA 1OHHA 1E2QA 2VP0A 1H8EA 3LV8A 4QL3A 2B8TA 1HURA 3UANA 1W36D 1MO6A 1NN0A 1K5GA 3QENA 2ZRPA 5JI2E 4ITRC 2CJWB 4AKGA 1U0JA 5FL7D 2OCAA 3FVQA 4M0LA 4JLAA 1E2KA 1XB2A 1XMIA 2MSEB 3H2YA 4KBFA 1MT0A 1OXVA 1NBME 4MKFA 1G3IA 1Z2CA 5H8WA 2C78A 4TZ0A 1T0JB 1SGWA 2ZJOA 3B82A 1Z6YA 3AVYA 1P62B 2QMOA 4NCJA 1EFRD 4YQFA 5HZHA 1ZM7A 2GA8A 2V8OA 1E1RD 1G291 1IXZA 4JZKA 3RS3A 1NSFA 4BLQA 3QPUA 1FUUA 3RSOA 2G1JA 2C96A 3QPWA 3OAAA 3OF5A 3P20A 1UFQA 2PL3A 4QBHA 3ZQJA 4URXR 2W2TA 2J1LA 5FPKA 3T1TA 3K70C 4QHSA 1TAGA 1ZVQA 1CEEA 4X8MA 4BFXA 2VA8A 2GCOB 2WIBA 2WOJA 2ZR7A 1A7JA 2FMXA 1NN1A 4EPXA 1GG2A 3VKHA 1EFCA 1KDRA 3VU9B 2FU5C 2KJQA 2RH5A 4CZ2A 4F38A 3PEWA 4C7OB 1EG7A 2ZE8A 2WHXA 4POAA 2RGNA 3KXKA 1FZQA 1HE1C 3AF1A 4Q48A 4A9AA 4JT2A 5DN6D 4ARZB 3EG5A 4AYTA 3FMOB 1OH7A 1CTQA 4M1KA 1KK1A 1L2TA 1UKVY 2ORIA 2QMHA 2VTKA 5AUOB 1JEDA 4JLBA 4ZI2A 3B6EA 4A2WA 3TUJC 2D06A 1AS0A 2IYQA 4NYIQ 3DL0A 2E9SA 3ZH9B 2DBYA 5EXXA 1OIXA 1I4LD 1QHYA 1YHNA 3BH0A 3MFYA 2VP9A 3A4NA 3M4YA 4BZPA 1OIVA 2WICA 4PAOA 2CE2X 3NBZC 1E0SA 2CL6X 2ONKA 3AKDA 3B78A 2J9RA 5EXPA 3UG6A 2WBLC 4C3ZA 3LLMA 2W00A 5F9HA 2O8EA 4LJ5A 3GD7A 1W44A 1QG4A 2CBZA 1VCIA 3SHWA 1UBFA 5A4JA 2ZE6A 4IW3B 3R7WB 2JLYA 5M04A 5CYOA 5EE5B 3K0EA 3GFPA 3SZRA 1Q0UA 1NL3A 1CJMA 2ZRMA 5FOXA 2ZSEA 2JASA 2NTYC 4ZCMA 2IYRA 3BK7A 2J0UB 3BB3A 2QT0A 5JEDA 2OLKA 2BMJA 1YZTA 3WBJA 4DB2A 3JZAA 5ANRB 3NVAA 2VP4A 3EC2A 3QXCA 1RRGA 2V54A 2YNMA 1Z06A 3LNCA 2PX3A 2GWHA 5JRZA 4FMBB 3IQWA 4XTRA 1GITA 3SBEA 4JYCA 2HYIC 4FMCB 3QPVA 3OIYA 4HSEA 4M1MA 1XCGB 1QHXA 3IPXA 1M7HA 1Q12A 4QM7A 4C30A 2O8CA 4URVR 2B7BA 3QI2A 3U4QA 1Q3HA 4DT1A 2LKCA 1QHNA 1TL7C 1WP9A 3BE4A 2TMKA 3BJIC 4V0MA 2N1BA 2GZAA 5BN3A 2ZRNA 2W6IA 1T0HB 3O8RA 1GTVA 4BLOA 2XSZD 3T1OA 4M4SA 4QXAA 1DG3A 1G8HA 2ZYTX 5AJWA 4M1TA 5GJBA 3BRWD 1FMLA 4D4LA 1UF9A 3K0SA 4TMTA 5EZ6B 4DCTA 1G19A 1ZC3A 2C98A 4PZLA 2UZIR 3KKNA 4QNRA 3FMIA 4M1OA 3HR8A 1LV7A 2ZI6A 4ZKEA 4EFLA 4FINA 3PUYA 5FOUA 3RHFA 2G3YA 3U6KA 5KSYA 3OHMA 3I92A 4I1UA 1XPRA 4TL8A 4Q7JB 4AG6A 2QP4A 1LW7A 5J4KA 1ONBA 1R10A 2XZPA 4R7ZA 3U3MA 4LJ4A 3OIUA 1FP6A 1XD2B 4Q03A 4B48A 1US8B 1ZIOA 3BOSA 2CHVA 3LY5A 3ND8A 4XWOA 1YKSA 4LBYA 2JLXA 2Y8EA 4B32A 4F4CA 2VHTA 4LV5B 4OQFA 4PANA 4YONB 2GEDA 4RD6A 1FPMA 1D5CA 2YOGA 2G1KA 1OLOA 4BWYA 1KO8A 5SZKB 1XTQA 1E9FA 3A58B 1WBDA 1IN5A 3TQFA 521PA 2ZRJA 4MRNA 3K8YA 4WOPA 3LXXA 2IWHA 4C0JA 4ZDKA 3M6AA 3E70C 1DOAA 1CJVC 3EZFA 4RZ2A 3VR4A 3WMEA 1G6OA 2F1IA 2Q3FA 4IFEA 2ZI5A 1NRJB 5CK4A 4IRUB 1JR6A 2W6JD 2ZETA 5HE8A 3THWA 2OO7A 2QTVB 3KFXA 4RFSB 4PX9A 2GK7A 1XD9A 4RD3A 4RVCA 2QAGA 4PPNA 2OG2A 2WJHA 4B3DA 3K9GA 3NDBB 2GXUA 2BDTA 2H57A 3ZJYA 1K8RA 2QSZA 1UDXA 4JBWA 2QTHA 1DS6A 2R6GA 3V4RA 1GAJA 3JVUA 5FI1B 4RKEA 3A1SA 721PA 1OW3B 3CLVA 5TVKA 3AKYA 2IEZA 3IHWA 4A8JC 4DHEA 3TR5A 1G8YA 4U00A 1E9AA 2BMEA 4QKQA 1BKDR 2V1XA 4TL6A 4BFTA 4QOSA 5EJEA 4V0LA 1D2EA 5DH9A 5K8UA 2OT3B 1ESNA 3I73A 4NCHA 3IIKA 4B35A 3Q72A 4DCVA 5FL7A 1UM8A 3I5XA 1IXSB 2CCKA 3L82B 4P33A 2JLUA 1G4AE 1N0WA 3LXRA 3AF4A 4I81A 3K70B 3ZZ0A 4U02A 5CJ2A 1UEJA 1R0XA 3QXSA 2VH5R 1TMKA 2X77A 4C0HA 2QGZA 4II7A 2W0MA 3EPHA 1EFRA 2FZ4A 1XX6A 1E1RA 3SHFA 4L15A 1GM5A 3TIFA 2IYZA 2WVJA 4M8NE 1YZUA 2WJIA 4QG7A 2VL7A 1S3SA 3V9PA 2ZUDA 4IVQA 2FGJA 4GPTA 4AC9A 121PA 4LZZA 1NLYA 2K5UA 3A36A 2GRJA 2ZANA 1YR9A 2BEKA 4C0BA 4EJSA 4Z51A 2OBNA 1I2DA 1JI0A 4UNPA 2OESA 3VFDA 3X1YA 2QAJA 3KJIA 2R6FA 1JXMA 1J7KA 4GDFA 2PBRA 4CIDA 4HB4A 4QJ3A 1KI8A 2R6DA 4BZQA 2ZUBA 4YMTA 2CL7X 1S96A 4JBXA 1ELOA 3LO5A 4TQAA 4PAMA 2GJ8A 1F2TB 2A5JA 2AD5A 4HAZA 4UJ3A 3GJ4A 3QVUA 2ZXUA 4CEHA 5BWMA 3I8XA 1L4UA 5DN6A 3H1TA 3GLIE 1Z29A 1NP6A 2J0VA 2D7CA 1AKEA 1T8TA 1R4AA 2WJJA 3AKEA 4KLZA 4QC2A 5CIQA 5F98A 4Q4LA 1FOEB 1W4AA 4KYIB 3T12A 3DVLA 3WMGA 2YWFA 1W49A 3F5FA 2C5LA 5GJVC 5JMTA 3VX3A 1VIYA 2NZ8A 4DT1B 2HF8A 4HZUB 2GAOA 2JIZD 1P9WA 3MD0A 5E7JA 1YE8A 1ZNWA 4OHWA 3IDQA 3CKLA 1ZM4A 2JLWA 4Q18A 4NCIA 3GLIB 2WTUA 4B47A 1KO1A 2G77B 4PSVA 3K09A 2WAYA 2BCJQ 1WMSA 1Z08A 3R20A 4JLVA 1IOZA 1BH2A 1RVDA 4GL2A 1Z6GA 3QVVA 2RAPA 4LPSA 3OEED 3VR2A 2OAQ1 2QNRA 4HLCA 2JLRA 4JLKA 3UPUA 3C4JA 4JL5A 4B3GA 1X8LA 1P75A 3LX8A 4LJ6A 2FWRA 3E5HA 3OFND 4M9QA 1Z0JA 2IT1A 1G3RA 1QG2A 5C4MA 1KGDA 1DAIA 2Q9AA 3NEJA 5FUXA 3EASA 4LHXA 2FE4A 4MRRA 4B2LA 2BWJA 3CUEF 1CRPA 1G9XA 1EESA 3TRFA 3DOFA 3THYB 4D26A 1OXUA 1OFTA 2FG5A 3AUYA 4EPYA 1TTTA 3SI7A 4C0LA 4M9ZA 2CHQA 2ZIAA 1A82A 2VBCA 3CIOA 4Q7LA 3WHLA 2IC5A 4BFVA 2AFHE 4HUQB 5L3QA 1G64A 3C5CA 1XCMA 1AS2A 1S2MA 5E4FA 5KNCA 1DO2A 1O87A 1Z0DA 3MAAC 1BYIA 2P65A 1N6IA 3LW7A 5DI3A 2WV9A 2WWGA 4MYUA 4Q9LA 3SNHA 1Z0KA 2ZJAA 2B7CA 1KY3A 2YVUA 2HJVA 4NP6A 4ZDWA 1LY1A 3CRQA 1ZD1A 1HTWA 4E07A 2XSZA 2XGJA 3OIWA 5JS7A 2QN6A 2V1UA 3RRNA 4AIIA 3LH5A 3AP3A 4P3YA 1J8MF 2GTPA 4C0AC 2IA5A 3VNUA 1XEXB 2F1JA 4EFNA 2J5XA 4OQNA 1A2BA 1W46A 3CF2A 5KDOA 3FFAA 4M1YA 4Q4HA 2ZI4A 1R0YA 4Q9KA 3HDTA 2EFEB 1GUAA 1VHLA 3WRXC 3X1XA 4TYWA 1HE8B 2BKEA 3RC8A 2ZJ8A 3LBHA 2EFGA 2H18A 1X6VA 4JIMA 1G4UR 4ON9A 3UWOA 1Z0IA 3DHWC 3F8TA 3BORA 3KXLA 3LBNA 4W5WA 4DDVA 5A0FA 4HB3A 1OH6A 2JLVA 2X2EA 1RIFA 3IBYA 1XMVA 1E2PA 1W36B 4KSBA 3EX7C 3P4XA 2VHQA 5KDDA 1FL9A 5AJVB 5EUQB 2QM7A 4QGFA 1KK3A 4CDGA 1JJVA 5TY0A 1YZGA 3KTAA 2FFQA 3CRW1 1VG8A 3SE0A 3AVVA 2HT6A 5FUVA 4HAUA 4DJTA 1WQ1R 1BIFA 4QNMA 1XPOA 4RZUA 2DWQA 3MG9A 1KDPA 1QDEA 1RZ3A 2PZGA 3GMTA 3QEJA 5C1BA 3N70A 4DSOA 1V5WA 1KK2A 1GIAA 3C8UA 3D31A 1T3SA 2W6JA 2J87A 1E9EA 1GL9B 1G8GA 4DUGD 4JKYA 2JJ1D 5E7MA 2XJ9A 2IYVA 5FBRB 5G40A 4EJSB 4FI3C 1IHUA 1WCV1 2GZDA 1ZAKA 4KXFB 4UXIA 3IGFA 4DLSA 1XJQA 2QROA 4L8GA 1TEXA 4NYMR 2RGBA 1IAQA 3UXMA 1YRBA 2RGCA 1Y3AA 2A3RA 1U0HC 4EDHA 5DHAA 2YWEA 1FTSA 2ERYA 1IN8A 1DEKA 5CDFA 1KJZA 2I3BA 3EPLA 4K8OA 2CCJA 3GPLA 2EW1A 1KSJA 3AQ4A 1J90A 4CEHB 2F9LA 2OCYC 4MQBA 2REOA 1S1CA 3KQHA 2BBTA 4HEJA 2ZUCA 2NO6A 4PXAA 4ZCLA 5FTKA 2IUTA 1LB1B 1PJRA 2GBLA 4LC0A 2PZFA 2XOKD 4NONA 4GOKA 2EYQA 4DZZA 4QHTA 5JS8A 2QY9A 1N5KA 3PR1A 1RRFA 2GJSA 3T35A 4TLAA 4PPGA 2ZRFA 3JZMA 3L2OB 2P67A 4OI2A 4OQXA 4V0KA 5EP2A 1TADA 3HU1A 2PMDA 2J7KA 2VLIA 2ZU6A 2Q9CA 3PXGA 1WBBA 4D25A 2OSBA 3SEAA 4IXNA 5FI0B 3UIEA 1Q1QA 4JS0A 1E2GA 1A4RA 2ZS7A 1AQUA 3GLFA 1L4YA 1Y63A 2C8VA 1CXZA 1JPJA 2I1VB 3WY9A 1P4SA 1N6PA 2NZJA 2QZ4A 2PLFA 4L4UA 4MA4A 2JAQA 3SJAA 4BEBA 2R65A 1AZSC 2ZI9A 4PR0A 4Q4AB 3KQLA 3P26A 4GFDA 3BAFA 2OZEA 1I4DD 2DYKA 1IN4A 3LW8A 1SVKA 5L3RA 4LI0A 5GVSA 1T9HA 2R62A 2W2XA 2ZSBA 2W6ID 3K1JA 4A0RA 1ZP6A 2P0EA 1LFDB 2QU8A 4LK2A 3W6PA 2XITA 3KX2A 2NO0A 2WSSD 4HZIA 4EFMA 2AWNA 2J0QA 5FR1A 4EPTA 4EQ6A 1TF5A 3DM9B 2VQSA 4NPHA 4A0HA 4CEIA 3NWJA 1G3MA 2ZSAA 3ZZTA 4EAQA 1PLLA 3TVDA 3RANA 2D7DA 2GHIA 2PCLA 2XTMA 2BM1A 1UAAA 1KI4A 3AP1A 1XZPA 2FFAA 5DI3B 2JJ2D 4NYJQ 3TAUA 1GOTA 1Z63A 2JIZA 2CXXA 1E9CA 2GJAA 3TSWA 1WF3A 3MRSA 4JVSB 4W5HA 1OH5A 1U9IC 3THXA 3IQXA 2F9MA 2AD1A 4BLSA 3VR5A 1VPLA 2Z83A 4A0GA 5F3WB 4TYYA 2Z0MA 1DAGA 1CJKC 1H8HD 1XWIA 1XFAA 2DFLA 3WP1B 3EW9A 2YHSA 3HYTA 1JAHA 4V03A 4MGYR 4Q02A 2A9KA 1OFIA 3M1IA 3UWKA 2AN9A 3OEEA 1E96A 4IJMA 5IRCD 4WZ6A 1KKLA 4O2LA 3K0FA 2HCJB 1XTIA 3CO5A 5LD2C 3QBVA 5TV2A 2ZR0A 2QP3A 3OFNA 3QKSA 4KODA 2ZYUX 3TNFA 2EU8A 3FHCB 1XTJA 2NO1A 1KO7A 5C4GB 1NY6A 3PVSA 4UKDA 3SJZA 2MSCB 3LX5A 3I5YA 1AQYA 1FMJA 4FD2A 2AHOA 3VX4A 1S4QA 3SFVA 2IYLD 3FMFA 4B2PA 2JLZA 4Q9JA 2J41A 3IEVA 2H92A 1A5TA 3CPEA 2ZVPX 1GRRA 1GNQA 4URYR 4ERNA 4IOLA 1N5IA 2A5FA 4Q5IA 3SBDA 4H9GA 2NIPA 3SS8A 2QRNA 4WW0A 2IF2A 2PH1A 1X8JA 5CM9C 4NCNA 3PG5A 1DAFA 3WMFA 1P3JA 3B1WA 3RSLA 4LY6A 5DSZA 2F43A 2QP9X 5J5CA 4D4MA 4ZIRB 1HA3A 1ZU5A 5FOWA 2WSMA 1N2CE 3ECCA 2B8WA 3G5UA 5CDFE 2P3SA 4TLEA 1XZQA 1Z6TA 4TMWA 2QT1A 4H1UA 5EE9A 2WWYA 1KSHA 2Q6TA 4QGHA 3N2IA 2V9PA 3EIQA 1EFHA 4A1FA 4BLTA 5FUWA 1AM4D 4JLDA 2BCGY 1DAEA 2RGNC 4F4IA 3JVVA 1R0ZA 5FOVA 4MYCA 1Q1BA 2ZYVX 4MRVA 2ZI7A 3NKVA 4PC6A 2ZJZA 3ZS8A 5K8IA 2FSIA 3CF6R 4URZR 2IW3A 2N42A 5JSZA 3ZVLA 1OXTA 2ZYWX 2YV5A 1NVXQ 4QBGB 2VP2A 4AKIA 3MJRA 5AR1A 1N6HA 4B71A 1I2MA 1M1YE 1M6NA 4B3XA 2EVWX 2I1QA 1KY2A 4L9WA 4YLGA 2J59A 1NN5A 3GFOA 4Q21A 2ZRIA 3N2EA 2D74A 4N3NA 4YC7A 1Z0FA 4D4JA 2F1RA 4GBMA 2J45A 4QGGA 2YYZA 2GJKA 2V4ZA 5FBQB 1GILA 3FHTA 3NHBA 4PHHA 5AWFC 4NHOA 2QPOA 3EAQA 1VKJA 1OXSC 2DB3A 3GQBA 1E2IA 3QG5A 5EP3A 4XWKA 4JSTA 4DUGA 3LDAA 2JJ1A 3A1UA 2CLSA 3NC1C 2AR7A 4OL0A 3QEOA 4R2IA 5HTKA 5KUTA 1JQLB 1CULC 1NMXA 4P4SB 3X1WA 4XTCS 4AG5A 4RCYA 2OFWA 1E0KA 1M74A 1RJ9A 4JT4A 4K46A 3KQNA 1U0LA 1X1RA 2OUKA 3GEEA 5F2EA 4ZKDA 4HDOB 1U8YA 2UVQA 2ZSFA 1WDTA 3CF0A 2EWVA 5AK0A 3B85A 2XNDD 1WB9A 1HH4A 1KNQA 5FBVB 3H0KA 4HLUA 4Q1CA 4OI4A 4KFUA 2XEXA 5CYPA 1OKKD 2IS6A 5J4VA 1XD8A 2C9YA 2O0KA 2BOVA 3OESA 4GSYA 3R8CA 2OCBA 3D3QA 5CLQA 4D0LB 4I1SA 2V6JA 1UEIA 3Q3JB 1CKEA 2H5EA 1G41A 4CEIB 4CF7A 1OPXA 2A5GA 3U7EB 2O8DA 2WPDD 1G7SA 2BVNA 2H8KA 2VIIA 2FEOA 5LPNA 3EZ9A 1JR3D 2XOKA 4GNKA 1ZRHA 4P4UA 2REBA 2FOLA 1N6NA 5CB8A 2XXAB 2ZRHA 4TTQA 1Q1EA 5DISB 2ODNA 4KU4A 1CJTC 2DPXA 4V02A 4DXAA 1IBRA 2NOAA 2QQ0A 3EC1A 4KJZA 2JDID 4ZPXA 4M22A 5C46F 4I1OA 1W1WA 1YJ5A 4GOXA 2ZAOA 1M7BA 4GP6A 4B3FX 1KHTA 4XVQA 3U3RA 4V0OA 1JNYA 2RGDA 3D7MA 1II8A 2F6RA 2IL1A 3K0FB 4DCSA 4C0KA 1F48A 2P5TB 4LCBA 3B9PA 2YOFA 3QKSB 5JWRA 4DLXA 2EFCB 4HDCA 2GCPA 4JSYA 4NYIR 4PQRA 4GOJA 2QE7D 3LBIA 3U7HB 1AZTA 2ZPTX 3HWSA 3EPJA 2XX3A 2R6CA 3NIBA 3CNOA 3RVBA 1P73A 3CPJB 5G41A 2WSSA 2D2FA 4H1VA 1E79D 5IHPA 2FV8A 2ZE5A 5JWOA 1T5LA 3PUVA 2QRZA 5HKKD 4MUAA 4NBSA 3U7FB 3AF2A 4PC2A 4B6FA 4MDEA 3BS4A 5BYJA 2JJ2A 4DRZA 2GEUA 2R2AA 1E0JA 4WXRA 5EZ5A 1MH1A 4LJ9A 1DTSA 1JAIA 1N6OA 3MWJA 4PHFA 4XSHA 1UDWA 4OK5A 5LD2B 4PC1A 2D4HA 4XD7D 5JRJA 1FW6A 4HATA 1NMZA 4EPWA 2HCBA 3REGA 1B0UA 4G5GA 2Z4RA 3J81k 2C2HA 2VYFA 5E3HA 2QAGC 2W83A 1H8HA 2R6AA 4B33A 3DM5A 1AN0A 1Z3IX 4JJZA 2HDNB 3QF4A 2NO9A 3Q8XB 2WKRA 3PFIA 4NU0A 5FOTA 4NCKA 3VR6A 3X2SA 3C5HA 1X3SA 5CM8B 3LAWA 1G20E 3IBGA 4LV6A 1NN3A 3W8RA 4BASA 2A2ZA 3CPHA 4N0DA 1RYHA 4TYNA 2ZAMA 3AVUA 1KI7A 1P60A 4FCWA 2ORVA 3I1FA 1SHKA 4N0EA 2NO7A 1KI1A 1W36C 4EPVA 3T34A 3GLGA 1CRQA 4B43A 1F60A 1AK2A 4Z1MD 2FEMA 2GESA 3QNUA 1BS1A 1G3UA 5SZJA 5JSZB 4OK3A 1L7VC 4OK6A 3W5JA 3EARA 3EXAA 3PIRA 1MRNA 3P1JA 3B2EA 4LYAA 1SKYE 1VYVA 4E5UA 5EXSA 3BB1A 4FN5A 1Q22A 4KAXA 3V4FA 1NJGA 3SU8A 1R5NA 4CEJA 1SXJD 4X8LA 5J4HA 5H1YA 3ZVNA 3VHXA 5LB2A 1OB2A 3QKRA 2WMNB 1DAMA 4GP7A 4PSKA 1ZJ6A 3F0TA 2ZU0C 1GRNA 5JHHB 4PC3A 4KI0A 4FCTA 5EP4A 1M7GA 1WXQA 3UG7A 4EJSC 4DCUA 5HZKA 1SKYB 2QG6A 2Z5FA 5JECA 1TUIA 1TPZA 1HYQA 1IY0A 1Z22A 1OF1A 2BMFA 1T3LA 3SYLA 3HU2A 2YINC 1P2VA 1MR3F 1NLFA 2H16A 3QBTA 1RJ9B 4URUR 1W2GA 2ZVQX 3FHOA 4PFSA 4UXHA 1Z6XA 3ZYCA 4TT3D 4Q47A 5KOYA 2IF0A 1J99A 2P6NA 3DPUA 3BERA 1ZUIA 5UKDA 1QHSA 1ZMXA 4LBZA 1I4TD 1P2SA 4L16A 4UNQA 4WZAE 1W4BA 3OIVA 3Q7QA 5L3SA 2O8EB 1DADA 1GNRA 3GJ8A 1XTKA 4X8HA 4ABYA 3RABA 2BC9A 1C4OA 5FR2A 3AV0B 4LSGA 3SQWA 1SVOA 2O8DB 2GF9A 1LTQA 2AKAB 4Q4JA 3WHKA 2CEAA 3Q85A 1S3GA 4DEXA 2GXSA 4I4LA 3DMNA 1JPNA 1Z2AA 2JEOA 1FQKA 3NH9A 5BQ5A 821PA 4FMCF 1UKEA 4F93B 3BGWA 4RCZA 3KUCA 4WZBE 5IF9A 2WIAA 2XZOA 4AYXA 1KI9A 4LYHA 3O8CA 3K09C 3U3OA 4A15A 4JL8A 4M53A 4Q00A 2B92A 4V0ME 3X1DA 1TU3A 1N5JA 1E2FA 2V6IA 1M8PA 2D2EA 3A6PC 4CRWB 5SZHB 1E32A 3UMFA 1G5TA 2RGAA 4LHWA 5J4LA 1ZD8A 1II8B 4TYPA 1FX0A 1XEFA 4ESHA 2O8CB 1GFIA 3DOEA 2HT1A 3CZPA 2RHDA 1HUQA 3U4QB 3L0PA 4P4TA 1S9DA 2VEDA 3FTQA 1JB1A 3I32A 5AUQA 1KYIA 4ASUD 2CHGA 2XNDA 1XCPA 2P2LA 3KXIA 2GZHA 1II0A 3U3JA 1CJUC 1OH8A 1OKKA 2WJGA 1E2JA 5JHGB 4PO8A 3TR0A 1TU4A 5B58C 1NIJA 2YC2C 3E1SA 1R2QA 3CX7A 4MRPA 2F55A 5DI9A 2FH5B 2PT7A 1CBUA 4G01B 2WPDA 3PENA 3FDIA 3WRYC 4MYTA 2EYUA 1GVNB 5H68A 4LJ7A 1COWD 1R5BA 3QG1A 1JR3A 1E69A 3THOA 2VF8A 4Q9HA 4DLZA 4KVGA 1NVUQ 4RJLA 4MDFA 3RLFA 1G8PA 5B30A 4ACAA 4MYHA 3R9WA 3SR0A 4UJ5A 1LF0A 1SVLA 2H7VA 2JDIA 2MMCA 4W5JA 4OBEA 1D9XA 3DDCA 3OEHD 1BOFA 1SVWA 1SVMA 4XOIA 2WJVA 4D80A 3GLGE 2JJ8A 2ZEJA 3IIJA 1QHIA 3QF4B 3VHLB 3PUZA 1SQ5A 3CONA 2BMDA 1E98A 2GILA 2P6RA 3KDSE 3UATA 4NMMA 3SN6A 2RCNA 1ZM2A 4US0R 2G0TA 1E9DA 2IUSA 3O47A 4TTPA 1CLUA 1VDZA 2B6HA 2HLDD 1FUKA 1ZNZA 1E2HA 2IHYA 2QE7A 2WAXA 3CX8A 1V43A 3K0CA 2OEPA 3PQCA 3Q5EA 5GJWC 3ZDQA 5FPYA 4BRWA 4HUTA 2OBMA 4KV9A 5J47A 3GLGB 3THWB 2A5YB 3C41J 5JI3E 3S1AA 4IOKA 3UKDA 2FSFA 3VR1A 1E79A 2QAGB 3PUWA 2FFHA 1NLZA 2KBEA 3BFXA 5HKKA 2ZI3A 4TQUS 4QGAA 5JJIA 1VIAA 4CEJB 3P27A 1N6KA 2CLDX 4DSUA 1JBKA 3CNLA 1KMHA 4GT1A 3QKRB 1ZU4A 2ZM5A 3MJHA 1PZNA 1KDOA 2QA5A 4XD7A 5KNDA 2YWGA 3UMRA 5TDHA 3LQQA 1QHHA 2BM0A 2FSHA 5CIWA 4JVLA 4D82A 1OFHA 3CWZA 4R71A 1M34E 5KTYA 2OILA 3U60B 3U44A 3OZXA 2VP6A 5FUYA 2HXYA 1G7RA 2V55B 2PZEA 4R98A 2X2FA 1Z5ZA 2WWIA 3NXSA 4B3BA 3KZ1E 5JLJA 4LHYA 4RY2A 2X19A 4MITA 2G6BA 3VTKA 1XXHA 2DR3A 4B34A 4PSAA 2YZ2A 2ATVA 2CK3D 3GP8A 4MKGA 5AJYA 3AP2A 3TAHA 5FFMA 5KO2A 4DLRA 2J3EA 1YR8A 3DKPA 3N5CA 1WE2A 2IXGA 4P0TA 4OI0A 4Z1MA 4LGMA 4PQFA 2XAUA 1P72A 3QE0A 1XNJA 5KPJA 2EWWA 4D0GA 2GBLC 1EFTA 1GL6A 5HE9A 2ZS8A 3B7GA 4Q4JB 2O52A 4A4DA 4YMWA 2O8FA 1RYFA 3I8SA 3L0SA 1YRAA 4TLBA 5DIFA 2ONJA 4C2UA 1HV8A 3A4MA 3U6BA 1D9ZA 1OB5A 3FOZA 1BMFD 4Q01A 4BQSA 4FMDB 2BEJA 4MKHA 1Q20A 4TSFD 1SXJA 2IBMA 1PUIA 2XTNA 2SHKA 2NPFA 4G0NA 3KQKA 1UBGA 5FH9A 1SULA 5BW8A 4BFZA 2DHRA 3MWLA 3A1VA 3SYKA 2QMUA 3L43A 1UPTA 3U7GA 4IOMA 4TN1A 3TSOA 2CDNA 3MMPA 1SVSA 1J2JA 4KYUA 3TJZA 3K70D 2QMEA 2IX3A 3B8HA 4TL9A 3L0IB 3K53A 2GVDC 1IJFA 1GSIA 4I99A 4LDJA 4OHYA 1E9RA 1AS3A 2AFIE 1S0UA 3KB1A 1D2NA 1OIWA 2WJYA 1ZCBA 5ELXA 1NG1A 3K9LA 1Z07A 3HJNA 4TT3A 5D3QA 1T6NA 2WKQA 4DLTA 1JR3E 4MGIR 3CR8A 5J40A 2ZJYA 3FWYA 4IFBA 4S35A 4BFSA 4E22A 2XB4A 2Q9BA 1N5LA 5KNBA 2VPPA 4DB4A 4MGZR 2FPMA 1ZD9A 2XB2A 3WYAA 4JVNA 4BEJA 1N3BA 3EWSA 1P9RA 4LHVA 2WMOB 4WXPA 5KSZA 4NH0A 4WAUA 1J70A 1SVIA 2WWWA 4C0SA 3GJ6A 3AVWA 1R8QA 1G18A 1E99A 1NMYA 4JL6A 1Z83A 2EFHB 1PVOA 5GADl 4QRHA 3FKSD 2ZRBA 4BLPA 2AL7A 4X8OA 4LWZA 2PJZA 3TKLA 4A2QA 2VP5A 4DIEA 3Q9LA 2AXPA 4IEEA 1AJEA 4IVRA 2PEZA 4LV8B 2QM8A 4FXPA 4KCGA 4ARZA 1MO3A 3HPQA 4ZV4A 3KQUA 1IM2A 2OAP1 4A36A 2OXCA 3EIHA 3W6NA 3BD9A 1TF2A 4LC1A 3ZD6A 4PQYA 1ZINA 1B23P 2GXAA 1W0KD 2GJ9A 2BJWA 1D6JA 1EK0A 4XWAA 5L3QB 1YZQA 3K9NA 4RFVA 2X1VA 1KJWA 3MCAA 3QF7A 4B76A 5EE3A 4DSTA 3FFBA 5TXGA 4C4PA 5AJZA 2RB4A 1XJCA 1CU1A 4RZXA 5JWHA 3QXJA 1ZYUA 1YQTA 2P6UA 1U8ZA 2UKDA 2C77A 2J46A 4ASUA 5K8TA 2XNSA 1YZKA 5KSPA 1Z8FA 221PA 3BC1A 4ZCIA 3B1ZA 1HY3A 1W47A 1NY5A 2UZ3A 3R7WA 4JLOA 4A2PA 3QOFA 1GRQA 4LBVA 1NNEA 3S1AB 2QQEA 3VMFA 2KB0A 4CT4B 4AWXA 1IQPA 3KKPA 3EA5A 4UNNA 4UNRA 4Q4HB 1Q57A 4DDTA 3T06B 1CR4A 4TL7A 4V0NA 1COWA 5JEEA 1VYTA 4IEIA 1RKBA 1VG0B 3BH7A 4NL4H 3WNDA 1II9A 2H1LA 5C18A 3C14C 4DKXA 4ESVA 3AF3A 5D3MA 1W4CA 1MO5A 4K81B 3W90A 3HYRA 5FTLA 3DO6A 2F3RA 2J7PD 4HAWA 1R7RA 1F5NA 1VCMA 2IYYA 3CBQA 5TB5A 5G3YA 4BZXA 2A78A 3QY0A 1QHHB 4LYJA 1NVWQ 1E94E 4CYMA 3OEHA 1RFLA 4R9UC 5DGXA 1O3YA 1AIPA 4QM6A 2O8BA 1ETUA 1W2HA 3A4LA 4RZ3A 1Z6AA 5DYGA 1RW4A 4AK9A 3WNCA 2Q21A 4ZO4A 4KSCA 2BBWA 5H70A 3AM1A 2IHBA 2MMGA 3LVQE 3LLUA 4KITB 4BFYA 1AGPA 1G3QA 3EA0A 1FNMA 3KTAB 2A30A 2CLCX 4HAXA 3U61B 4M9XA 3IHLA 1F3OA 4UXJA 3DMDA 5G3ZA 3TVTA 3NC0C 1IJEA 2HLDA 2YJTD 3ADKA 3H4MA 4NYJR 5DHFA 1PUJA 1OE0A 2BBOA 1G6HA 2W58A 5FTNA 4OHVA 1E2EA 3CZQA 4ACBA 5CITA 2E87A 1PLKA 5BN5A 3MSXA 4U5XA 4DEYA 2HJGA 4F7WA 1WA5A 2ZRKA 4DSNA 4DVGA 1P61B 1VYUA 1TQ6A 5DYIA 2XZLA 4PAQA 1DAHA 5KDLA 4CVNA 4ZDJA 1UJ2A 5CLLA 5JJKA 3DZDA 4HB0A 2JCSA 2WWXA 4GI7A 3ZIAD 2VO1A 4BUJA 3PV0A 2XTZA 2EQBA 3GLHA 1Q1ZA 2FN4A 5TMPA 1TEVA 1XD2A 1US8A 1G7TA 2N46A 2NQ2C 4B44A 3ZD7A 4L9SA 1W0JD 3ETLA 1XRJA 2IXEA 4JLMA 4M2LA 5FPTA 1LVGA 2ANCA 1DAKA 2JLQA 2FA9A 2G88A 1AKYA 2HF9A 4CT5A 4ZI3A 3CB4A 2G83A 2O0JA 2A7QA 4JYBA 2ZTSA
chains in the Genus database with same CATH superfamily
1UM9A 3GW8A 4PZ9A 4C7JA 1BU5A 4RLFA 4UBJA 4X6UA 4JBHA 5KQSA 3WKDA 2VHWA 2WEKA 3GLFE 4HLUC 4U9UA 5DZSA 4OQLA 4B5LA 3DEFA 4BE4A 4W1SA 2HSWA 2Y6VA 4H77A 4Y0NA 1PL8A 2GEVA 2YVQA 1IIBA 5KSOA 2XHEA 4XGKA 3VYRB 2IYXA 4R9SA 1V9CA 4EW1A 4F45A 1LS1A 1Z68A 5BXQC 4JI0B 4M1WA 1WCIA 1RC1A 2BJVA 3R8FA 3CF4G 4AN0A 3UVEA 3R4CA 5K1ZA 3A9SA 1E0AA 3E9ZA 1AKTA 2OR3A 2A1TR 4ZQCB 1S9HA 2LDXA 4N47A 3OTGA 3VJKA 1RAFA 5ALKA 5JNVA 2DKOA 1SOVA 2B4RO 2P2CA 2X4IA 1G21B 3NRBA 1H23A 5IMBA 1Z38A 2G07A 4PIVA 4QEDA 4D0NA 4JJFA 2AOTA 2IE0A 4ME6A 4JI8B 3Q7PA 1SBZA 1Z5GA 4NXMB 2C5AA 2F1HA 1YE5A 2Z5VA 3E22B 3RKRA 3ZYZA 4KPFC 5HR5A 2UXCB 2B9VA 1RPZA 1P2TA 3AZPA 4X1YB 2DJIA 4FOLA 4R2MA 3K31A 2Y9PB 1P5RA 1CUJA 5A4KA 1T8WA 1V39A 3T99A 1YHYA 2CY0A 5BT9A 4BB6A 3FKQA 1I13A 4MP6A 5C8YA 3K2EA 2WM9B 1WIWA 1NG9A 1VHDA 3E2PA 4LOHA 1DG1G 1YBFA 3I3OA 4HO1X 3AO0B 2OM2A 3BDVA 1A5SB 3O9MA 3P5BA 4EB6B 2BFBB 2ZWAA 2RGWA 3WTCA 2C99A 1DC7A 3DQZA 5KPDA 3A9UA 3AETA 2GEJA 3HGTA 3SJ7A 3MHPA 1R18A 2FSUA 2ENWA 2J4DA 2ZWIA 2VDJA 4OHXA 4EMUA 3DEAA 4AS2A 2Y0DA 2EKDA 4E46A 1PJAA 1YAHA 3EZ7A 3IEUA 4RCVA 1AB6A 2ZDHA 2FPRA 4B40A 3JD3A 1QO0A 3A3OA 5LP6F 3G2LA 5IUJC 3G8CA 3H1AA 4WN9B 4HDNA 3FYUA 3IULA 3SC2B 1HDRA 3UJ7A 4E5VA 1JQEA 4P8RA 4ZJUA 7MDHA 2IHNA 3V4VB 3HVUA 5EWJA 3K5HA 5F12A 5DGCA 1DCFA 3GR6A 4IY1A 4Y0VA 1KMQA 1YDMA 4QEZA 4IJUA 2Q99A 3DL2A 4UHJA 2MYNA 4WA7A 1ZJJA 4BBJA 1AKNA 1P9NA 4RY8A 4BMPB 5IXYA 5CT8A 3G8BA 4I1PA 3HO6A 1XDBA 2Q1UA 1EKXA 2E4AA 2WKPA 4GDMA 1LK7A 4HQ6A 5DLQC 2H5IA 5F7ZA 1UBEA 2VQDA 4PO1A 2ZJBA 4UTNA 2H1VA 3TB4A 3LOQA 4A82A 4FCCA 4DLPA 2VDRB 1F20A 5BXYA 5L4NA 5ERYA 3NHAA 4GZMA 3RIEA 3SF8A 4NRDA 1RPNA 1ITZA 2BE7A 3OCJA 1N9GB 3LLSA 5I8ZA 4GECA 1WZEA 1WRBA 3Q6MA 4ARUA 4FYMA 4WFJA 4Z9FA 4QDXA 4WLVA 4D3YA 1TU0A 2LIVA 4AY2A 5KHLB 2C3MA 5JJCA 3IX7A 2O8BB 1EUZA 4KIFA 4BB9A 1N8TA 1X7GA 2WWHA 5FBHA 3WQRA 4MHOA 1BO6A 1R5OA 3JAWA 4BMDA 2PLRA 1JJBA 1RC8A 4ZOQI 4FMPA 1N0HA 2ASEA 3HCRA 3F1KA 3ZHBA 1ORIA 2PT5A 2QJTA 4ZVRA 1LV8A 5GGXA 1YUNA 2GM9A 3F3MA 3GDWA 2JBHA 2XDYA 4IGAA 1NBAA 1LDYA 2ILVA 3MJFA 3EZ6A 4IDOA 4YK7A 2PMBA 4ZDIA 1QR2A 4HAYA 1QRUA 4LJRA 2RMKA 4HN4B 3AOEC 3RSCA 2WKSA 1JDBC 1DE0A 4D5EA 1TQ2A 4PM4A 2BKXA 2JIRA 3GVCA 2G28A 4OXNA 4BGVA 2F43B 1UOEA 2DFKB 5CR9A 1SHZA 3G9QA 3HMKA 4J49A 1ZXXA 3EBPA 1SIBE 4R8RA 1L5OA 4RANA 2YZ7A 5IT0A 3P2KA 4BNJA 3D8NA 3IQZA 1PQ4A 3HR4A 5IT5A 2ZRDA 3NIGB 1AMUA 1K88A 1XZJA 2MSDB 4HTFA 4QBIA 3FFXA 4JMPA 4BNVA 1YIDA 4TS3A 1COZA 2CLMB 4F71A 2YKGA 4RJKA 4XB1A 4M21A 3NCHA 2FGKA 2AF4C 2KPOA 4IH9A 4D4KA 2HWWA 1BS2A 2XE6A 1LTKA 1QBGA 3GLHB 1KO4A 3CMMA 4LX8A 4YCSA 3OJLA 3N1UA 3NTVA 1ZCZA 4P3PA 1W88A 2PXHA 3LVRE 3TLMA 3V00A 2HKIA 3RC3A 4CMEC 1A1VA 2JIPA 3KPYA 3AR7A 3L4EA 2OYRA 4DQ0A 3NQ41 3COYA 2Q1TA 5FOSA 4BNMA 1O7JA 4Q3BA 5F5XA 4LOKA 3KSZO 2IZ1A 4LDZA 2YJZA 4JCCA 4RYLA 4EARA 2PGDA 4HYEA 2JFXA 5F9FA 2YXEA 3M6UA 2PS1A 1YR3A 1CZRA 1UC9A 1HQCA 3OCXA 3ED5A 1AQIA 1UM9B 1CVLA 1U5CA 4PIPA 2OBYA 2Y2UA 1TCCA 1VGVA 1WM1A 4X45A 5EPEA 3K9HA 2CXOA 1LK0A 2F3QA 3NHSA 1E66A 2G80A 3PE4A 4NZPA 3DE5X 3OKAA 3FGZA 4F92B 4HMPA 3HJFA 5EQFA 5D5PA 3JZFA 1MOQA 1CZNA 4UOEA 3AJ8A 3OCZA 2BR5A 1NT4A 3LX6A 3ZW8A 4EELA 2AFHA 2XRZA 1J4AA 1FRVA 1K08A 1JALA 3F5QA 4RDIA 3G79A 5H4HA 1E60A 1QVZA 5FWYB 3AFGA 4XVUA 2XQKA 3V4OA 4P32A 1XEXA 1J1ZA 1OVGA 2KYRA 4Q1FA 3VAYA 4AF8A 1YU9A 4B83A 5I9NA 3P9KA 1EVQA 2KX7A 3B3JA 4QYXA 4QRIA 5E8JA 4REMA 3UBMA 1PV4A 4TYQA 5GVRA 2F59A 3KKEA 2XQIA 1NJ1A 4MVJH 1KFKB 3JS5A 4IXMA 1GUDA 4PRLA 3LHDA 1RPJA 2VZ9A 1Z5PA 4AY3A 1XTBA 1KOFA 3QX8A 2NXEA 2PZ8A 2RHMA 2IEYA 3ENZA 3LUDA 1ZPDA 2X15A 4GAEA 4QJ4A 4S24A 2AXNA 2DM6A 4G1UC 3WFJA 1O6ZA 4FC7A 1KU6A 3RIHA 3RSZA 2MIIA 1YRYE 4ZAVA 5F5LA 4Z86A 5C2JB 2QBYA 3CM0A 1IXRC 4R2WA 2VJCA 4F2GA 3WGHA 3NOQA 5NULA 2R4QA 4GG1A 4QQKA 2VFAA 5MF6A 5TQ0A 2C7QA 2ZTLA 5C8YB 3DR5A 1BWSA 4D4HA 1QRTA 5JO9A 3CRRA 5TPWA 1RXCA 3WC4A 2PUCA 5IK2D 1PQPA 2BFFA 3A9TA 3PHCA 2JIDA 2HV9A 2YXNA 3ABZA 2PHZA 3ZIDA 4G4JA 3N7TA 4OU4A 3AETB 3NT5A 1T5IA 3T61A 4DJDC 3D0OA 3T38A 1DIHA 4IQFA 2X4LA 2IGBA 4KUGA 3DE3X 3QLJA 3OJXA 3DDOA 4O1IA 1NX6A 2O59A 2B5WA 2CFOA 5AHWA 3DZHA 3F6EX 2XT0A 3ZBUA 2ZWMA 2RK4A 1HKUA 1ZGHA 1EWRA 2ZW9A 1A71A 4A8JA 5ECYA 2WP8J 1ULHA 3BB4A 1CY0A 5KYUA 1W1IA 4G85A 3ENQA 2ECPA 3AY0A 2BHRA 3FYUB 1GHTA 2YOHA 4KBYA 2OXIA 4BV3A 1FF9A 4BPBA 2CLEB 3M9XA 2HRBA 3KEQA 5EWJB 3RW9A 1E3DA 1STOA 4PC7A 1V2HE 3CV3A 3MRXA 1B00A 4CDRA 1C1DA 4H60A 4AW9A 5JPDA 1WKVA 1JDSA 2H2WA 2OGZA 5IVPA 3MUNA 1N9KA 2OAGA 3AEKA 4WACA 4LCJA 1WHTB 5DHQA 4BJ5A 4TT8A 2FMFA 1P7WA 2HA0A 1MRSA 1E1QA 1JHUA 3PB3A 2PD4A 4YJFB 4LUCA 3TDKA 1IAVA 1QLJA 1BD3A 2CDAA 3H8VA 4FFDA 1ISJA 3CWQA 1DKRA 5HJEA 4AKTA 3UK6A 5JXIA 4TTVA 4Z6KA 1AQJA 4MW7A 4DMCA 3AVPA 3QSYA 4H0CA 3UICA 1JQJC 1KI2A 3NDRA 1NV8A 3CJQA 1N2BA 1VJ1A 2XLCA 1J2EA 1F2VA 1W5SA 4IDHA 3OCWA 3LUJA 4UUAA 3TTYA 3KV3O 3D1VA 5AT1A 1GTJ1 1B8UA 2C2GA 2EFDB 2C20A 1LRJA 2ZCJA 2R44A 2ZIUB 1YV9A 3SQXA 3C98A 4LX0A 2G63A 2XF2A 4EJFA 1VL0A 1N33B 1GN9A 1RYBA 4Q05A 5DM0A 2WYOA 1W48A 4IHJA 2WVAA 2NPOA 1IVNA 2ZSKA 1PTJC 2OMEA 3RROA 2YV3A 3DZKA 5DASA 2W6CX 3C15C 2X76A 2HIAA 2OHIA 3AKCA 3CURA 4KFRA 3MZ0A 4TV9F 1KI6A 4UM8B 3MWDA 3K0CC 4DCOA 4RD0A 3AYZB 5JVDA 2FDCA 3L4BC 1NUSA 3QEKA 1KP9A 4C03A 3JQ7B 1WXWA 2XKAA 5EMLA 5LQJA 4BMXA 3IFSA 2BFDA 3QUTA 3CN9A 2R84A 1C9YA 2Z2KA 1PKEA 4BU0A 4NC9A 1UADA 1FDRA 4BVFA 3D8HA 5T4BA 2O0MA 4Y6QA 2WNSA 1KI3A 1NXOA 2W5UA 2NGRA 2YWHA 3O8DA 4TWZA 3ASZA 4D9MA 5TLSA 4DTCA 1QE0A 4G65A 2A0UA 4JQYA 3VJLA 2G9QA 2LDBA 2QN7A 2GDJA 4HTFB 4YCMA 3ZDDA 3WMXA 4DADA 4O4JF 1E6WA 3JSAA 1W5TA 5ESXA 3O8BA 1U7XA 1IY2A 3UOGA 4NMWA 5BWCA 4I8XA 1KAGA 3KKMA 1KEKA 2O7NA 3JQ8A 3WB0A 4BMSA 1RYZA 3WB1A 3IAS6 3VAZA 2PSHA 2LTAA 2SCUA 3CH7A 3OO0A 2GCNA 1BWPA 4GPBA 1KQGA 1JXQA 3EVBA 3ZE8A 1Q3TA 4DBLC 2LIPA 1JEEA 2OYSA 3U3ZA 2HYDA 5E1OA 4HNUA 3A6JA 4JLJA 2DWPA 4KXLA 2BH9A 3LL4A 4GHWA 5B2ZA 1N5OX 2VF7A 3TQRA 3LWDA 2DHEA 5F77A 2DAPA 3GJ5A 1VGQA 2O2SA 4QU8A 3R3UA 4Y7CA 1P1JA 3SX4A 3WRYA 5FYQA 4BVBA 1SXPA 4QARA 3ZDCA 4PTLA 5JAPA 2GAJA 2M32A 1GZSA 1WSWA 2NZXA 4YN3A 2ZRGA 2C9MA 5KNCH 1OASA 4KLNA 2J4FA 3P9SA 3DCYA 1WEKA 3WYFA 4BFUA 1FQJA 1H8ED 1X3LA 3RS5A 5EOVA 4GP9A 3G7UA 1TT7A 4L8VA 4NSNA 5EG5A 2OA0A 3K2IA 1BRTA 5GZ3A 4UEWA 4PYRA 4F91B 3FYTA 3EZXA 1E18A 5BR4A 1U90A 5EWMB 2ZVJA 2V03A 4X90A 3EFBA 4GI1A 2REXB 4C21A 4DCJA 2CNBA 5LP6A 3GT0A 5A5GA 3S2SA 1NVVQ 4S2EA 3A2MA 1K4KA 1DKPA 3ZW9A 3MLAA 4LECA 1XDUA 1JAYA 3P9NA 5KYWB 3DTVB 3T5CA 4IPTA 1K6MA 3PC4A 1PE0A 2Q2WA 1DOZA 1P9OA 3MS7A 4O5OA 4Y2QA 3S99A 4U7JA 4N49A 1MAAA 2ZRCA 3F71A 5DBOA 4XEUA 2QBYB 5JCXA 3BFKA 4ZTBA 1FX1A 3DKVA 1VSQA 1ONPA 1U94A 2FPLA 1B3BA 2JD1A 2OQRA 3R0XA 4GF5A 4MW5A 4P3OA 5CAEA 2WPNA 1L8LA 1YZLA 3ZV4A 4RF4A 1GAXA 4WVLA 1V1JA 3H5LA 2BFFB 3MXOA 2O2IA 3K3PA 3B2QA 4GKBA 3M8KA 3I5AA 1JJAA 2VDLB 3RVMA 2D1TA 3GAAA 2R11A 3W8NA 1HMYA 1GR0A 3IDFA 2ZCVA 2E1RA 3TOVA 1U9ZA 2IHUA 1NIPA 2IEGA 4C4OA 1X92A 1KJJA 2BM8A 3BULA 2EL9A 1XEWY 2RONA 3D6VA 3IDSA 2Q4DA 2BFMA 3LIIA 1TMYA 1BE0A 3KJGA 4F2PA 3PITA 4HH4A 4A8JB 3JWHA 3CA8A 4KL8S 4TUYA 1AURA 5KYUB 2O0HA 3IJEB 3LJKA 5H9VA 3MIIA 3BWYA 1ZHOA 3FXAA 2CLIB 1Q1NA 3DFFA 4KUEA 2X0KA 3DPSA 4R51A 1ZUHA 5LXTF 2NUTA 5AOCA 4OHMA 1C1DB 4EHFA 2J0SA 3CZ9A 3VOBA 4N4AA 2W48A 1B7GO 2F7SA 1FX0B 1Z5NA 2BJHA 2V7BA 4FW9A 4PLYA 3AEKB 4WIAA 3B36A 5FLXA 4AU1A 2NTNA 4I4CA 3LDHA 3AVOA 6ADHA 3OF3A 3N6RA 5TGZA 3BWCA 3NYWA 3RREA 5K3OA 2Z2JA 3A4VA 1S2OA 3A0RB 3P32A 1I30A 4DUGD 2GN0A 1ACLA 2AG0A 3FTCA 4HWKA 4QDUA 1RU3A 2QX4A 4W6QA 4ZO7A 3VZSA 1TX4B 2FW7A 3ONFA 2H1SA 5C34B 3V8PA 4EGJA 1PSDA 1H0SA 5C1IA 1QO9A 2ES4A 1R6VA 1KYVA 4K1XA 3SQOA 1RWPA 4PCLA 4JI7B 1NBOA 4OSOA 4HLDA 4YT8A 2D1QA 4XCQA 4YMVA 1R0BA 3E7DA 4ITUA 4IKPA 4P9NA 4XIFA 1SWWA 3GDFA 1CRLA 2PKWA 2BMAA 1ETHA 3YASA 4IHJB 4L8YA 1K7CA 4FZ5A 1WMDA 2MYUA 5I9LA 3VU9A 1CETA 5BYBA 1KP3A 2ZYHA 1KI6B 1RRPA 3MWDB 1SUIA 2QUZA 1ESMA 2R8OA 4BLRA 4EG8A 5JVDB 3V4SA 5FXMA 4CNBA 2NPIA 4FC6A 5LPNA 2Z3WA 4JJIA 5A04A 4UUPA 1JIIA 3AGPA 6LDHA 1SU4A 1JWLA 2YVLA 5M2QA 2XLBA 3K1AB 4QQNA 5E7IA 2OUIA 2DEUA 1RXIA 1C4KA 5FX2A 4EI9A 4B79A 1Q83A 2F00A 2IOQA 1JIQA 3EGVA 3IV9A 4P4SA 3ZQUA 4CTNA 5CT9A 2FPPA 2EX0A 4XUEA 4EGAA 5B58C 4KXNA 1YDHA 2AWOA 2JCVA 5LQSA 2CLOB 2NYRA 4KO8A 1B6TA 3ICCA 3GXOA 2HMVA 4MVJF 1YOVA 5EXDA 4AP9A 1SXQA 4EATA 3IMFA 1ST3A 3GV0A 3QKUA 4P0PB 5IWAB 1RKQA 3ZS9A 4KJXA 4E32A 4LMPA 3ZGXA 4WHMA 1AGRA 1I1QB 1Q44A 2OE2A 1LFAA 1A7KA 3L1JA 4KHZA 4MLDA 5SYAA 5IVIA 4GYKA 1J42A 1OX5A 1T91A 4TZ6A 2VT3A 4FWTA 5K0JA 3GJ0A 1NP7A 1QF9A 3IT0A 3TGPA 5B3JA 4JR2A 5J58A 4P31A 2X0FA 1M6HA 5BQFA 5AXDA 1A5ZA 1ZJZA 2K4MA 3CNNA 4P4GA 1FNNA 3BKXA 3JZDA 4K9SA 3T4PA 3QEAZ 4INOA 1A9QA 1P91A 2EBUA 2WTAA 3R3WA 1T4DA 1BQ3A 3E9RA 3HB0A 5D6OA 4DYDA 3TLXA 2XXAA 1E3MA 3EWAA 1XVIA 1Z82A 4FFOA 3NETA 4Q1AA 5JTTA 4RLQA 3AVXA 3H83A 5DYNA 3M9WA 1OBFO 3M5WA 4DJ5X 5KYKA 4WZZA 3WYGA 2ZJ3A 4Q7EA 4EVIA 1P6XA 3HDHA 5E9QA 5AKLA 1ACMA 1JQAA 2QSYA 3I8OA 2Z57A 3KDAA 2RHBA 4BC0A 2VWQA 3IV7A 5C80A 1PYDA 1DUSA 1O9GA 5J2UA 1UK9A 3NEYA 4U8HA 3EEOA 2QN1A 1M2WA 4LS3A 2Z2XA 1XJ0A 4XB6B 5LBTA 4ICIA 3U44B 3ZCPA 3IUPA 5JJLA 1NC3A 5FBZA 1OYWA 5G0UA 2PCJA 2C4NA 1ULZA 3OKPA 2HY7A 2ZUTA 4QHYA 4PU0A 1H6BA 3DMGA 1XXHB 1R9JA 4TMXA 5KMGA 1Q1AA 5IUNC 1VZ2A 3D64A 2BLNA 5DB4A 1UODA 5AO9A 5IX8A 2IYWA 2PX6A 5CT5A 2ZBFA 4JJEA 4PBTA 4YRPA 1GZ5A 3UC5A 3M6WA 4TKZA 5ENZA 4DREA 4M0UA 4PCAA 1I1NA 4JD5A 2ODEA 3QLUA 4AMVA 1U7TA 1VBKA 4JITA 5E7QA 2R5FA 3AJAA 2FQWA 2DY1A 4LMAA 3WA7A 2W6OA 1F6BA 5CM2Z 1GSOA 3KRTA 3ZVRA 5I3CA 3T3NA 1KSGA 2H1OA 1ZS9A 2H2HA 2WF5A 3AL2A 3DAYA 2IUUA 4CMIA 3QE4A 1R6TA 1TRHA 2K87A 3TZEA 1ENYA 1XWWA 4MB2A 5D01A 1SXJB 1Y6ZA 4N9QA 1QZXA 3LUPA 4G5QA 3SC3A 2DFNA 3ZKWB 1F0PA 1Y9EA 1HPLA 3LV8A 4R5HA 4WKPA 5AW0A 1YBVA 2VCHA 4TUYB 3UWDA 1NRWA 1K5GA 5TMEA 1JHAA 3QFSA 2X3YA 4C0XA 3A25A 4AKGA 1YSCA 1G8JA 3AIMA 1F4LA 1BC5A 1S01A 3GRRA 5DX0A 5L3QA 2Q28A 4RVOA 1E2KA 1NUAA 2MSEB 4F4UA 1EWKA 2GD1O 3BKWA 1MT0A 3HCBA 4BQOA 2C78A 3EVGA 1T0JB 1P4AA 1SVUA 4X1IA 4RVGA 3LRTA 1Z6YA 1N36B 3K8QA 1DV1A 1G9SA 1THTA 1KEEA 4O0LA 4MA5A 5IC6A 1EFRD 2ZYSA 4BYMA 4YQFA 4CKWA 3RS3A 1G8MA 1IXZA 5ED4A 3QPUA 1JQ5A 2Z1DA 1IOLA 4QXOA 1PJ8A 4E11A 2PUWA 3ZWMA 2X8BA 4EL0A 1LSJA 1Z62A 3P9PA 4QBHA 2DMRA 2W2TA 3O92A 4E30A 1NW4A 3AI3A 1HE3A 1T8YA 3T1TA 1G20A 1TAGA 1CCWA 1ZD5A 3EEIA 3HYLA 4X8MA 3BG5A 1VJDA 2F62A 2WOJA 1JUDA 2AX3A 2CMGA 1K3UB 2O3JA 1L5WA 1A7JA 2CVOA 2D5BA 3DW1X 5EQJB 1J5EB 2FMXA 1NUHA 1DC5A 4F38A 1SC4A 2FU5C 3VU9B 1Y3CE 3Q0IA 2FPIA 1OXBB 5BSFA 4EHNA 1J25A 2P75A 3G89A 1QLWA 2VJMA 1X8XA 2ZE8A 3BEDA 3FYUC 1QJCA 3MS2A 3OHPA 4OB7A 1HE1C 4Q48A 1TCVA 4JT2A 4FWBA 5DN6D 3FMOB 3L7KA 1Z4LA 2FKAA 1JG6A 4M1KA 2QD5A 2WT4A 4B6JA 1UKVY 4JT8A 5EZYF 3WQBA 1JEDA 3B6EA 5HS6A 4A2WA 3W7BA 1FNCA 2EZUA 2IYQA 3DZBA 3R1IA 1H5QA 3DL0A 1YS2X 2EJBA 3DD1A 3FCXA 4IBOA 4NYIQ 3ZH9B 1NAHA 2HNKA 3H05A 4JEMA 1I4LD 4JXKA 2AOUA 1J8FA 2VZEA 3MFYA 4IICA 3A4NA 3OJFA 2QM0A 4PAOA 1WG8A 3NBZC 1U8EA 1E0SA 1GPLA 3TE7A 2ONKA 3AKDA 5KHAA 5TMBA 1F7VA 1FVFA 3UG6A 2Q3BA 3ROQA 4M0CA 3V8QA 4CUJA 2V3VA 3MQFA 4A16A 4UW9A 1RMYA 4YA6A 1IBMB 1P8AA 3VUFA 1W44A 3OLXA 1QG4A 4L4RA 3Q3CA 1Y7LA 2CBZA 2OENG 1UBFA 3JQ6A 2C97A 4LE1A 3R7WB 5A4JA 1GDHA 2A88A 5ICCA 1SBYA 4CKCB 3KSMA 5EE5B 3SZRA 1NL3A 1NR1A 3VPSA 2ZRMA 5F1PA 5FOXA 3ER8A 1TC1A 3OHSX 3UT5A 3PVCA 4J2HA 4OF4A 2IYRA 4FFNA 3BIWA 4I5GA 3HSYA 1LWNA 2WA1A 3E8MA 2J0EA 4CTOA 3CLTD 2H65A 1H1LA 2C07A 2FZKA 2FWAA 4JB3A 3VNAA 4CM9D 3WBJA 1NWHA 4DB2A 5ANRB 3KOUA 2EJCA 5I5EA 1PQUA 1JHXA 2VP4A 1T29A 1NZFA 2IFTA 3FZNA 5DXAA 2HSZA 3QPAA 3TZCA 1WSDA 1T0PA 2C2BA 2GWHA 3IQWA 5B6IA 4X71A 5D87A 1KRHA 4MA0A 4JYCA 3SBEA 3KETA 3PGLA 2CXPA 2WAOA 5ICEA 1HWYA 5J2UB 4QM7A 1T36A 3X44A 5M5BA 2DBRA 4XUGB 1FS4A 1Q3HA 3O1IC 3LPCA 1Z7EA 1VKZA 4UHBA 1VHWA 1L1EA 3DVRX 5KVQA 3UJ3X 1QHNA 1TL7C 3BE4A 2R4UA 3HVIA 2TMKA 2GWRA 3NNDA 3DKRA 4FW8A 4NESA 3SFTA 1P0FA 4LRUA 4YUXA 1QZUA 2GZAA 1GARA 4KR2A 3L7IA 4ZVLA 3HA2A 4KP7A 2ZRNA 1Y34E 5LXTA 1JTVA 2W6IA 3ZDRA 5T7BA 4BLOA 3ZY2A 4GR4A 3T1OA 5JC8A 3IE1A 4QXAA 4HNVA 1YOBA 3G59A 4X0EA 2ZYTX 4JROA 3FIUA 1QUEA 2EG9A 5AJWA 3BRWD 4GXTA 2XDQA 5H0IA 4Q3OA 1UF9A 4DMLA 3TG8A 3K0SA 4ENVA 1RLUA 3MGGA 2P90A 4U7WA 3K1ZA 1ADFA 1ZHFA 4QNRA 1QAQA 3PC7A 5C5IA 3G0OA 3VPDA 1LV7A 4PNEA 4CMIB 4ETIA 5LZ4A 3PYXA 5KWJA 3RHFA 3U6KA 2Q5QA 5KSYA 4AS1A 4LRQA 1QP4A 4LFCB 1C7IA 2FB9A 3STUA 2HCTA 5IJ0A 3U3MA 4YAUA 3ZNQA 2AUMA 1NRIA 4B48A 1FP6A 3I6YA 2A9OA 4Q03A 3BOSA 1ZIOA 4EW3A 2CHVA 5LSAA 1E8NA 2WTXA 1DX6A 4HQFA 2DWCA 1Q1GA 2AYZA 2GERA 2ZBGA 1IEVA 2J4CA 4F4CA 4LV5B 1P0IA 4AZSA 4YONB 2GEDA 1FPMA 2FE1A 1C9JA 3EGXA 3ZBTA 4UPEA 4ZHQF 2UZAA 4G2NA 5D3KA 1WJGA 2G1KA 3SG0A 1OLOA 4BX8A 2LCIA 3FHJA 2REQA 2YFKA 3R3XA 4PWZA 4BWYA 2C5FA 1V4VA 1M8FA 2HK9A 3ZU3A 1DLIA 4MEBA 3WAGA 1NUUA 3WE7A 1RRKA 5EJ2A 4P5DA 4X1IB 2D59A 4KQMA 4DGQA 1W34A 4WOPA 3N7UA 2IWHA 2CJPA 2IOFK 1QR6A 1DOAA 3VR4A 1AKVA 4CKWB 2FRDA 3BDIA 3QYPA 2WE7A 4L27A 3Q3HA 1T4CB 4O4IF 1NRJB 4IRUB 1MVOA 3THWA 2V8BA 3PGJA 5F52A 4R1NA 4B7AA 5E8RA 2VJPA 2AMFA 1XD9A 3R9XB 5CB0A 4MVJA 2YWDA 4TVSA 1JQKA 1E1LA 4RVCA 3MN1A 3EFEA 4H1WA 4D74A 3BFPA 4IF4A 2WJHA 5DVZA 3AL3A 2QS9A 3K2QA 3OMXA 1VLZA 4B3DA 5KJ1A 3NDBB 4FX5A 2CW5A 3E23A 1NPYA 3M1YA 3JYHA 4J8PA 4EB0A 3F7NA 4N0MA 2R6GA 3V8EA 1GAJA 3JVUA 4JOSA 4NZOA 4RKEA 5FI1B 3TKYA 4ETNA 3A1SA 2JAOA 3HDYA 3KB8A 2HJ9A 3A27A 1ADCA 1SKUA 2IEZA 1KFJB 3ETNA 3RUFA 3Q0TA 4A8JC 4OHRA 3O4IA 4XYMA 1RZUA 3TR5A 1G8YA 3L9WA 1ZCJA 4U00A 2BMEA 2YYAA 4YPFA 5A7FA 2G6TA 3NVKI 3O8QB 3WG9A 4YEDA 3MMSA 4BFTA 4BCBA 1PCXA 4E51A 5EJEA 2CDRA 3RUPA 5DH9A 2OT3B 5EPUA 1BXZA 3IIKA 4X85A 2DPMA 2O1WA 1SCUA 4JLWA 4PGMA 1YS7A 3QRWA 4H2DA 3TX2A 2SKEA 3BEOA 5CNMA 3G8DA 4P33A 4BRZA 1VLVA 3C3WA 3AF4A 3KL2A 3D81A 5LIPA 4U02A 3K70B 5FCDA 3H9JA 2W2LA 4YJGA 3W3AH 5B7GA 5CJ2A 1CUAA 1DJLA 1UEJA 3A14A 5DBFA 3QXSA 3ZHOA 3LC0A 3V5NA 3KFLA 3A3YA 1UMBA 1EZ1A 3EPHA 1E1RA 3MPUA 4L15A 4QD3A 5EHQA 2Z8ZA 4G9BA 4FKZA 2WVJA 5I47A 1YZUA 4QG7A 2CMFA 3MLBA 2VOEA 3CEAA 2ZUDA 2XGGA 3PNMA 1R6XA 2FGJA 2FWNA 3G7NA 4GPTA 3V55A 3GIWA 3TZLA 1MTZA 2IU4A 4KXQA 2HRZA 4J43A 1QF6A 2XVZA 4DILA 3A36A 3O4RA 3G2QA 2ZANA 2PUHA 2Y6UA 4PINA 4Z51A 4U0KA 3KM0A 1QE5A 1XG5A 4WCVA 1RXWA 5H5JA 1RYEA 4AL4A 1PX0A 3OKCA 4G4SO 4RNDB 3VFDA 1F8GA 5GQSA 4CLOA 4MUNA 2Q7XA 5I7VA 3ZWYA 1D6NA 4X3PA 2R6DA 1BVHA 3U31A 3AZQA 4IDDA 1H1LB 2ZRQA 5DP2A 1UFVA 5KI6A 1BNCA 3O38A 5G4LA 4HR7A 3RPEA 3I04M 1D4FA 1T26A 1A97A 1PF7E 3GYGA 1GG8A 3QVUA 4CEHA 3HVHA 1LWOA 3BT7A 3F5DA 1P0CA 2PAAA 1Z29A 3SEQA 1BEZA 2AMLA 2JA2A 3A6GA 3E58A 1EFLA 3I6QA 4QC2A 4IQ8A 5CIQA 1TFRA 3P2MA 4NBWA 3RSQA 3WFIA 4B3SB 3HKEA 1FDWA 4KYIB 3AJEA 2CLKB 3S2FA 3G2NA 1H2ZA 2IRWA 1W49A 3F5FA 1T34A 4Q3LA 2C5LA 3L0DA 3LC7O 3UUGA 2O7RA 2HF8A 5JUWA 4HZUB 2ZVDA 2GSDA 2UAGA 1O0BA 4U7HA 4EK9A 1M5TA 1HNXB 2PUEA 2NWQA 3GEBA 5E6UA 1RHRA 4NBRA 1EBBA 1QO7A 3JQAB 2WTEA 4Q18A 3GLIB 5A6SB 4TV8F 3NUZA 4MEAA 1PO7A 5DWQA 3IPCA 1F51E 2HTFA 4JSRA 3LBAA 2ACVA 3K09A 2QUAA 1QONA 2WAYA 4XE5A 3RRJA 4DIKA 4Q4CA 3R20A 1ILEA 5AKJA 1Y82A 2IPXA 1BH2A 4ALIA 2QDXA 2XDQB 4GL2A 1NMEA 5LZ7A 1NBHA 2X14A 1NW3A 1NOJA 2PV0A 2JLRA 2YWRA 3HFSA 3RYCA 1YXMA 1Y5IA 1FP2A 1Z5OA 1PN3A 3IKLA 4IYJA 1P75A 3WGZA 2C4UA 3LX8A 4LJ6A 3E5HA 3OFND 1CUUA 1Z0JA 2FSSA 3H1EA 4LDPA 1QG2A 3M4XA 2WNIA 3ZGLA 2CWWA 3QZUA 1Q2UA 2Q9AA 2RG1A 3AFHA 4G1EB 4BNYA 5IJ0B 3EASA 4FGKA 4LHXA 3ZE1B 3O3NB 4B2LA 5B5SA 1ABBA 1HZZA 4AO6A 1G9XA 3DOFA 1UQUA 4RUKA 5J23A 1OBVA 1OXUA 2FG5A 3ROZA 5CIYA 2VXBA 4EPYA 2A84A 3MOIA 2H1WA 2I76A 3O31A 4J0CA 5AQEA 4ZT3A 3SI7A 4FONA 2ZYIA 4J16A 1JMYA 2RKBA 2VJAA 4II3A 4QBTA 2CYBA 5LP6C 3WR5A 5DIZA 1GR1A 2ATIA 2QD3A 2X40A 4Y1FA 2IC5A 3GLRA 2AFHE 1Y1TA 2REQB 1G64A 4HUQB 4PCVA 1TEHA 4QXRA 1XCMA 5E4FA 5EWLA 5BORA 3RJ5A 1O87A 4EKIA 1Z0DA 5KNCA 2P65A 1JAXA 3VPCA 3H8WA 2AZXA 2W42A 1TTHA 1BDMA 3SNHA 3JYNA 1CUYA 2GPBA 2XGOA 4RPJA 2PUAA 4TS4A 5EZYA 2Z6AA 2JC3A 4F8JA 3AR8A 5CA1B 3HS3A 3T54A 2HIMA 3KQWA 4YT2A 4E07A 2QN6A 1HBJA 1ADBA 1A96A 3PC3A 3AP3A 2INGX 2UZ0A 1KMMA 3I45A 1IVYA 4X3CA 3JATA 4KQ6A 2D8AA 3CLKA 1SKBA 3ZZ1A 2NU8B 3KV1A 3FMGA 4I36A 4EFNA 3AM5A 1Y33E 4IX9A 1K8YB 1A2BA 2EIHA 3CF2A 3IUSA 3WL8A 4JI2B 1B6SA 2QIPA 5A4FS 2QUKA 2G9VA 2YRFA 1R0YA 2BHTA 3OY7A 3QVOA 1JIKA 4Z4IA 3H5VA 4D56A 4CF5A 2B4TO 3DOIA 4FFPA 5TPZA 3OQOA 1DSSG 1NQAO 1XN1A 1FQOA 2QLNA 3D2CA 5CX1B 2DUNA 1QGZA 1X6VA 3CNHA 1KH3A 2H3HA 4FYWA 3DHWC 4O4LB 7ADHA 3BORA 3KXLA 3BVPA 5FWNA 1XZLA 2Y67A 1GG5A 4W5WA 4ZQBA 2ZATA 3L8MA 3AFOA 3QOWA 1HL3A 1TKAA 3IB6A 2XKJE 2IYAA 4HB3A 2X2EA 3MT0A 1NHWA 1NDUA 1XMVA 2QL9A 4G8BA 3E4DA 4KNWA 1OAKA 1U7UA 1UXJA 3BMNA 5LWQA 4DIMA 3V4PB 2I3ZA 2FP4A 1SCUB 3ET4A 4WLOA 5EUQB 2QM7A 4RJTA 4QGFA 2HA5A 1I3LA 4YGXB 1JJVA 2I62A 2FFQA 5A7HA 4NICA 3U7JA 3DYBA 4L4XA 1VG8A 4M1QA 1H4QA 1GNLA 3AVVA 2HT6A 4LGCA 4WJZA 1LBHA 5FUVA 5C52B 4WNAB 4DJTA 1CRZA 3MTJA 2C4TA 4BJHB 1RZ3A 3V1UA 4NI5A 2XUFA 4GVXA 2AN5A 4WXYB 4QNNA 2J87A 3OD5A 1PR5A 2QUIA 2JVJA 3CJRA 5F2OA 5DK6A 4Y9DA 1IIRA 4UOZA 2XJ9A 1O89A 3EH2A 5ER6A 3O4FA 5CP8A 4DLLA 3C3CA 1WCV1 2GZDA 1ZAKA 4UXIA 2HSEA 4BNUA 1VJ5A 3PKJA 2GBCA 2WG2A 4DLSA 1Z56C 1JLLA 4OP2A 5E4JA 3PZRA 4L8GA 1R3UA 4AZ3A 4DQKA 2QN9A 1BA3A 4F5EA 1IAQA 1A9TA 3AFMA 1V4NA 2RGCA 3R75A 1O97C 1YMVA 1EVLA 1NE2A 2RCYA 4IZHA 1N1DA 2A3RA 3IQGX 1WB5A 2QTZA 1QP8A 5DHAA 3DO8A 3W5VA 1KJZA 1XTUA 2I3BA 3GEDA 3A3KA 3EDRA 1T35A 4YP1A 4OMUA 4UHHA 1CY6A 4PAWA 5DOZA 2JBWA 4BPRA 3GPLA 4CEHB 2XBLA 1WDMA 3DWFA 3UPDA 1C3LA 4PTZA 5ALHA 1YRWA 1E1MA 2OCYC 4AKSA 2WM8A 4F3CA 3OFJA 4PSDA 1SXGA 2BBTA 4KRXA 5KOIA 4QUHA 1QPBA 3CNBA 2OHOA 3R76A 2X13A 1Y8CA 3I1IA 3HKEB 4BQNA 3A3PA 4BEWA 4Z5XA 1PJRA 4XDHA 3KZMA 4GPZA 3M6XA 3LDGA 4INZA 4NONA 1QV6A 1MB3A 1UBMS 2QL7A 3NUQA 1DIRA 3PX3A 4M0MA 4P92A 4IFTA 3ZX5A 5JS8A 1PD1A 5L6LB 3WLKX 4PPGA 2ZRFA 2ZZKA 4ZHQA 1D6MA 2HA6A 2P67A 4OEHA 4OI2A 1FLVA 1Z75A 3FJ1A 4V0KA 1TADA 2VDQB 4NDNE 4Y1RB 1SBQA 1O0SA 1ZJYA