3A1TA

Crystal structue of the cytosolic domain of t. maritima feob iron iransporter in gdp form ii
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
254
structure length
254
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTILHRMILDYGEKVESEIKKVENFLRDKKLRINPRYFALKYLSGDPEFYSEGVKLGLPELSEEERIGYRLLIAKRKREYVENVVKEAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords Iron(II) transport protein B
total genus 89
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1tA01
1H8ED 4MRPA 4YMSA 2HCJB 1ZVQA 2CDNA 3WYFA 1G8PA 5UKDA 2ZJ2A 5CM9C 4PPNA 3CH4B 2GBLA 1YZQA 2IYTA 8OHMA 4P32A 2FA9A 4NYJR 4OI4A 2A3RA 2GF9A 2KB0A 5F9HA 1CR2A 4LWZA 1JR6A 2QE7A 4TWZA 4ZO4A 4TL8A 4NE2A 1HT1E 4A4DA 5CB8A 4HLCA 1U8AA 1UKEA 2A2ZA 3CONA 2BM0A 1NVVR 1LY1A 3ETLA 3IEUA 6Q21A 4ZCIA 1FNNA 3ASZA 1LB1B 1Z22A 4I99A 3DO6A 4OJQA 4KXFB 1KK3A 1T0HB 1TU3A 4O3MA 1JAHA 2OCPA 2R44A 5HCNA 2H1LA 1YZNA 1Z47A 2ZUCA 4MYHA 3QVUA 3U2QA 3QSYA 4MQBA 5JRZA 3O8RA 1GKIA 4N0DA 3R8FA 3U3JA 2ZANA 1E79A 1M74A 2ASEA 2IYSA 1P6XA 4B35A 4JL6A 3VAAA 2P5SA 2ZETA 3A37A 1UEIA 3IQWA 4XSHA 3AVUA 4P31A 2JASA 2X8AA 5B30A 1UDWA 5FOSA 3HYRA 1JR3E 1D5CA 1VDZA 2NO9A 2QN6A 2X2EA 3Q7QA 3FE2A 5EE3A 4OI1A 4PZLA 3S1AA 3DKVA 1CKEA 4MKGA 2J59A 4ZCMA 1COWD 1FOEB 1MO5A 3KKNA 4C30A 5TXGA 5F9FA 1QDEA 4FI3C 2XGJA 4JZKA 4PAOA 1UDXA 4Q9IA 4KYUA 2ZE7A 1W48A 3QXHA 1CJKC 1KDTA 2XAUA 3CRVA 2JEOA 3NBFA 2QL6A 5LB4A 5A5GA 4HYYA 4PHTA 3CPJB 3WBJA 4F92B 4B6EA 1VYTA 1IM2A 2B8TA 3ZS8A 4X8OA 1XJ0A 2MSDB 4A2PA 4EPRA 1HUQA 3QOFA 4M1WA 3SU8A 1DG3A 4L9SA 4ZPXA 4C9BA 2A7QA 2P3SA 4LGMA 3F8TA 3OEHD 4QGHA 3PUXA 1VTKA 1SXJA 3QPUA 4D26A 1E1QA 1OXTA 3R7WA 3GJ7A 3QF4A 3TAHA 1E2DA 3Q3JB 4DLZA 3LDAA 3EW9A 3TSWA 5E7MA 3HWSA 4Z1MA 4A8JC 2IYXA 3UMSA 1VYVA 2ZYWX 2DFNA 5EXSA 1P61B 1LTQA 2DPXA 4Q4HA 4TMTA 4G5SA 4TLDA 5BWMA 4L15A 2X19A 4JIMA 1P2VA 1ZNYA 4MGIR 2NO0A 4TYYA 1PLJA 2BDTA 1W4RA 3GJXC 2NOAA 1ESMA 1JB1A 3ADKA 4ZDKA 4PO9A 2OLJA 2YKGA 2BBWA 5AUQA 1L4YA 2A5FA 4G3XA 3NEYA 1OT3A 4X8LA 1U9IA 5CYOA 3AGPA 5J4LA 5TMPA 2F9MA 4CEHA 4LOAA 2QP3A 2WJIA 1G41A 2QNRA 4Q4AA 4PZZA 4TLCA 3GFPA 2G6BA 3GJ4A 1UBFA 2GZHA 5GJCA 2QA5A 1GKYA 2AWNA 4M9SA 1MO6A 4OQLA 2FV8A 5JMTA 4M1YA 1EGAA 4Q4LA 5FL3A 3K70D 4HI0E 3UWKA 1N5IA 3GJ5A 2A5GA 4FMCB 1LVGA 4NYIQ 3G0HA 3KQNA 2OFOA 1NLFA 4F4JA 4DLVA 3KL4A 4B3DA 3ZQJA 1AS0A 5H1YA 2ZSDA 1F2UB 3W5JA 2K5UA 4B33A 4D0GA 4YMUA 1QHXA 2QT1A 1I2MA 2ZU0C 4D6PA 2DY1A 1ONBA 3SYKA 1ZM2A 3WNBA 3HDTA 4FW9A 4Q19A 2VHQA 2NO6A 3TRFA 1E32A 2H17A 3U3OA 1N5KA 3LFUA 3EASA 2DWOA 4Q5IA 4IFEA 1YU9A 2ZAMA 3SDZA 1NLYA 3DEFA 2QBYB 4LHXA 1VECA 2EWWA 3HJNA 4ZDWA 2J0VA 3GEEA 2QM7A 4F93B 4KBFA 2IBMA 1S0UA 5CDFE 1NKTA 2VP0A 4A0HA 1G18A 1DG1G 2UZ3A 2FZ4A 3DPUA 3R7WB 5HR5A 2EW1A 4ERNA 2YOFA 4RD6A 1UFQA 2W2XA 1OIXA 4HB2A 2ZE6A 1U0HC 4KBGA 4JMPA 2CVHA 5KO2A 3P26A 1IXSB 3MWLA 2J3EA 3B1VA 4ABYA 3DMNA 3REGA 2JLXA 1GIAA 1PLKA 1Q21A 3GLGA 3BERA 5CK5A 5KOYA 2H92A 4DLTA 1YZKA 1E9FA 2QPOA 4ACAA 5JHHB 4LCBA 4HDOB 5E7JA 5SZJA 5C1BA 1M8PA 3SR0A 1F60A 4HUQA 4NTZA 4ZI2A 2OILA 3B5JA 4DCTA 1EK0A 5CB6A 1OXVA 4Z54A 2JA1A 4LBWA 2FFHA 3A8TA 4NBSA 4WZBE 2AL7A 5KSYA 4A0RA 4DDWA 1Z0KA 3FKSA 1TF7A 4NCIA 4DXAA 4YXWD 1FMLA 2KBEA 4Z51A 1AQUA 3DOEA 4PC3A 4Q1EA 1NN0A 2GKSA 3RVBA 1CJMA 1E9BA 1VYUA 4PAQA 3TR0A 1P9NA 1R4AA 4LDJA 2W2TA 3OFND 2ZR0A 3SN6A 3TH5A 2IHBA 4AY2A 5HE8A 5ANRB 2AD5A 1A2KC 2BKUA 4JVLA 5EQTA 4CRWB 2ORWA 4BFUA 1XEFA 1Q1QA 2C98A 3CPHA 2VP4A 1H65A 1KI6B 5AJXA 1I2DA 5JS8A 4D80A 4K8OA 1YRBA 4G5OA 4XD7D 1RVDA 2JIZA 3TE6A 4TTPA 2HDNB 4A8JB 1F2TB 2GF0A 2YVUA 1SVOA 3P1JA 5L3RA 5FL7A 1W1WA 1L7VC 4IFBA 1E69A 3CF0A 2QBYA 1G3IA 3EZ6A 1S3GA 3U44A 1K5DA 4B73A 3W5IA 4GI7A 2CNWD 3A36A 3C15C 1Z6AA 5EP2A 4EDHA 2IF2A 1W46A 2PMKA 1CJUC 3B1YA 2CE7A 2CK3D 2ZRIA 1QHNA 3SJBA 2QQEA 4D82A 2QROA 1GL7A 4RZXA 1ELOA 4NDZA 2R9VA 1OXSC 1G5TA 4B3FX 1JEDA 1GVNB 1X8LA 4LBZA 3SE0A 2QGZA 4OQXA 4RZ3A 3U61B 1XCPA 4HLQB 1SVWA 2QPAA 3EIHA 1QVAA 2IXGA 4NHOA 3U7FB 4RD3A 5FOTA 5FPHA 3EA5A 2WWWA 3GLGB 1XZQA 1HYQA 3BJIC 4MRNA 821PA 2PZFA 3VKGA 3CUEF 1WXQA 3AVPA 2OBLA 2R6DA 3E2IA 4FCWA 2J7KA 4Q7KA 4FCVA 3GLIE 4DCVA 5CIWA 2G0NA 3IBGA 2Q21A 5B58C 4A6XA 1CIPA 1X1RA 1EFRA 2JLUA 1Q1ZA 5EP3A 2Z4SA 3UMFA 4U7DA 4Q03A 4M9QA 5L3VA 3ZVNA 3ZH9B 2OEPA 1E1QD 3VR3A 1UEJA 3GJ0A 3SOPA 1XPOA 5P21A 2CHGA 2WWXA 2XB4A 2ZRHA 1HE1C 4LX0A 4DJTA 2H7VA 2ZI7A 2KWIA 5CJPA 1UF9A 5IRCD 4B3XA 2ODBA 3BH7A 1AIPA 3FPAA 4B2PA 1HTWA 3P27A 1HA3A 1E2IA 1II8B 4O0MA 2OUKA 5DISB 1KAGA 1KY3A 2ERXA 4PHGA 2ZRBA 4M1TA 1X1SA 2BKEA 1X8JA 1N6HA 2DFTA 3SI7A 1TL7C 4JBXA 2C9YA 2JIZD 2FEMA 4BLPA 1OH5A 2BMJA 1GNQA 4C2TA 1F2TA 4KO8A 2ZRFA 2I1QA 4OHZA 1SULA 4G1UC 1KMHB 1TQ4A 3ZIAA 1ZU4A 1JBKA 5J4KA 1CF4A 1JR3D 1E2FA 1EWQA 1JI0A 2QMOA 4Q7JB 2ATXA 2O8CB 4LJ8A 3OFNA 1W36C 3LV8A 1U0LA 3LW8A 3U3KA 3ND8A 3THOA 1YR8A 1EFHA 5EE5B 5JJIA 3DM5A 1L4UA 1ZM4A 2NPIA 3C8UA 3BAFA 1IN8A 1XBTA 1RJ9B 1JR3A 2ZJAA 3A1VA 1JEEA 1XCGB 1ZCAA 4M1OA 5C4GB 3BC1A 2V9PA 5DYGA 5HKKD 1SXJB 5EXXA 4MRVA 4WAUA 3N70A 1E9DA 5L3SB 2EFDB 1QHIA 2IYWA 1W4CA 3SQXA 1FTNA 2W6JA 3EG5A 2ZRMA 2R8RA 4DSTA 3D8BA 1W44A 1TF2A 2XJ4A 3D6TB 1YKSA 4W5HA 3IHLA 2REOA 4PQRA 1P60A 4E5UA 1LF0A 1Y3AA 3I5XA 1OH7A 3KKOA 5FPTA 4AD8A 1CR4A 3PUYA 2QRNA 2QG6A 3D3QA 4GRAA 3OEED 3U5ZB 1IN5A 1ZNWA 3KTAB 1P2UA 1SZPA 4HLUA 1TEXA 1WDTA 4JLVA 3HR8A 1CJVC 1WCV1 2BHRA 3GD7A 3GFOA 1S8FA 1NN1A 4DLUA 1ETUA 1H8EA 4OK6A 5CYPA 1J99A 5JECA 5KDOA 2CJWB 1Z0IA 3CRW1 3THYA 3ZDQA 2V6JA 5FBQB 1YQTA 1SKYE 2ZRJA 2RHDA 2BIFA 5L3QB 2G1KA 3KUDA 221PA 2CL7X 1OE0A 4C0SA 5JEEA 2CE2X 2QMEA 2QSYA 5DNYB 2XZOA 1S3SA 4QBGB 2CVFA 3RC8A 2RHMA 4WBSA 3ZYCA 2B7BA 4IOMA 3EPKA 3PEUA 4P4SB 4ARZB 5GVRA 3TVTA 5ELXA 2HXYA 3RNLA 3B1ZA 3H0KA 1II9A 4RKEA 1UBEA 1E2QA 1T5IA 4W7SA 2GNOA 4MKFA 2OM2A 1LFDB 5SZKB 4ESVA 1CP2A 1FP6A 4TMVA 2OBNA 4TQAA 3RHFA 3W3ZB 1VHTA 2CLSA 2KJQA 2ZE8A 4UJ5A 2GVZC 1AM4D 3I3SR 2JGNA 4JLKA 2IA5A 3RS4A 3GP8A 3U3RA 1G291 2B8WA 4OHWA 1TEVA 5FL7D 3RANA 4EUNA 1O87A 4OBEA 3C5CA 3G82C 1RE0A 721PA 1OFUX 3BFKA 4M4SA 1N6RA 4G5GA 1CRPA 4QGFA 3W90A 2Z83A 2WJJA 4P4UA 5G3ZA 3IEVA 3QKSA 1H8HD 3TW8B 2GWHA 3QENA 3VR6A 4A82A 3PG5A 4WW0A 2RH5A 2QPTA 2Q3MA 1E1RA 2G9NA 1F6BA 5FPSA 3ZJYA 4HZUB 2NQ2C 3TBKA 3B6EA 1GILA 1OPXA 3MUFA 4NYJQ 3ADBA 2ZS8A 3AH8A 4LV5B 4V0KA 3R9XA 2A5DA 4PTLA 3FGNA 4Q9KA 4TL9A 2FX3A 3TVDA 3UMRA 1U8YA 4P4TA 5FPYA 1NVVQ 2WMNB 3O47A 3LD9A 1D2NA 2Y8EA 2YC2C 4BEBA 4A2WA 3EPLA 2AFIE 1EFCA 2ZI4A 3CWZA 5FTLA 4DWJA 2ZI5A 2NZJA 4KODA 5FBRB 3U7GA 1IY0A 4RD4A 5DGXA 3GMTA 3UKDA 1E2PA 2GCNA 3K9HA 3SJZA 3IIKA 3U6KA 1XPRA 5C46F 1E2MA 1EX6A 2C9OA 2ZRAA 3CLVA 1NMZA 2DWPA 4TL6A 4QKQA 4D4LA 5L3QA 1J8MF 1UBCA 4TLEA 5GVSA 1AS2A 4IXNA 3MSXA 4Q1FA 1FW6A 3NH6A 5K8IA 4CT5A 4DEYA 4Q01A 2ZUDA 3EZ2A 1P5ZB 2ZJZA 2ZUBA 3L0SA 4ARZA 3M4YA 1KO8A 3LQQA 1KI6A 3PEVA 1OHHD 2Z4RA 1MO3A 2PT5A 3VFDA 4JVNA 1Z3IX 3T06B 2GJSA 4YC7A 3D31A 2HXSA 2FMXA 5CITA 3MLEA 2VEDA 4H1VA 3QI2A 4BFWA 2HT6A 4C0HA 3BK7A 4FWTA 3EIQA 2Z6VA 2QSZA 4H1UA 4I1UA 5LBIA 2P2LA 1CU1A 2Q3FA 4HAYA 2R6GA 3W34A 4K46A 621PA 3AVWA 1FQJA 2JLRA 4PR0A 4XD7A 2GEVA 1Z6YA 3ZLJA 4US2R 3QNUA 3RRZA 4Q7LA 3VNUA 1R10A 4FXPA 1Z2CA 4E22A 1JJVA 2FNAA 3FKQA 3T5DA 1OB5A 1Z63A 2N1BA 5FUWA 1I4LD 1LV7A 2GA8A 1N25A 1NF3A 3ZD7A 2GRJA 3ND9A 5AJYA 4EFNA 1MH1A 2VYFA 1KK0A 2WWGA 2REXB 1U2RA 3LW7A 3B8HA 1TAGA 3MWJA 2JCSA 4P0TA 3CW2A 3WP0A 4NH0A 3ZS9A 3WP1B 2Q3HA 2IS4A 4QNRA 4IW3B 5IK2A 3GLGE 2RGEA 1AGPA 2WIAA 2WKQA 2XSZD 3K0CC 2KSQA 4MYTA 4AYTA 2N42A 2PZGA 3B1XA 1DOAA 3CH5A 3E1SA 5D3MB 4Q4HB 4R71A 4KFSA 5J4HA 4IOJA 4LV8B 2A78A 1TQ2A 4EIWA 4JL8A 2QI9C 2VP6A 1NG9A 2PH1A 1NJGA 4IEIA 3KFXA 1JXOA 4JKIA 2ZYVX 4MDEA 2OXRA 3KB1A 2BBOA 1XEWX 2I4IA 2ZQ5A 4QHTA 3NBZC 2GAOA 1KSHA 1KI9A 4GT1A 3WNDA 3SC3A 3TQCA 4CEIA 3NG1A 1RFLA 1II8A 3RS3A 2D3WA 1OFHA 1LS1A 1Z28A 3HYTA 4HAWA 4LY6A 2VRWA 5JJLA 2AHOA 4Q4AB 3JVVA 5JCZA 1SVSA 4Z1MD 3FOZA 4BZQA 1KHTA 2WWHA 2GCOA 4JKYA 3KQUA 2WTUA 2HYIC 4IVQA 4DCUA 1EWRA 3HU1A 2VSXA 4Q1DA 3OEHA 1QHSA 1QF9A 2ZJBA 1X6VA 1QRAA 2IEYA 2KBFA 1KI8A 4V0MA 4B3BA 3AM1A 2V7QD 1YHNA 4NONA 1W4BA 1F2UA 5BYJA 2WAYA 1R5NA 3B1WA 1U0JA 3K9LA 3CX7A 2FGJA 1R8QA 3SS8A 2OFXA 2JJ8A 4XVQA 4B43A 2JDID 1JPJA 4MYCA 1X86B 1H8HA 4RCZA 5FBWB 4KFRA 4AG6A 4ILEA 1P72A 2VH5R 3GJ6A 2CHQA 3IIJA 2GXUA 1GAJA 1R0XA 1DPFA 4EPWA 2QP9X 1GRRA 4PAMA 1T3SA 1E0AA 2AFHE 4PPFA 521PA 4RY2A 4AKHA 1ZAKA 1E9AA 2VA8A 1AN0A 5K8UA 1Z83A 1X3SA 4MRSA 2BMDA 2CLCX 5H70A 3EARA 4BEJA 5F3WB 3EPJA 3RSLA 3SHFA 4EJSB 1NNEA 3O8CA 4QM6A 2G3YA 2ZI9A 3F5FA 4CT4B 4NYMR 3PENA 2QMUA 4MITA 3KQKA 4FIDA 3QKRA 3KTAA 2B6HA 2QTFA 4JJZA 4GNKA 2J0SA 4HB0A 3ICEA 3T1OA 3PITA 3MG9A 4DCNA 3W6OA 4L4UA 5FUYA 4FMDB 1G5PA 3C4JA 4HUTA 2J1LA 4R9UC 1FX0B 2QGNA 2F7SA 2VL7A 1QG4A 2WSMA 1KO4A 2QAGC 1XD2B 2CJWA 3THYB 3CWQA 2EQBA 4QC2A 1K8RA 1V43A 4GP7A 1W49A 4OHYA 2D2EA 1AGRA 2TMKA 2XZPA 5G40A 3KB2A 3PQCA 4JLJA 2IWHA 4XJXA 2GCOB 2KI5A 1D2EA 2AK3A 3WNCA 2CCGA 1JJ7A 1U99A 5L8VA 4WIAA 3R8CA 3C16C 3Q5EA 1W2HA 2IT1A 2J45A 3NKVA 1E9EA 4ACBA 4HB3A 2J0UA 4HAZA 3TR5A 3I61A 1TQDA 3P32A 1WRBA 4BRUA 2OO7A 2Z5FA 3Q85A 2W6ID 3RS0A 4D4KA 5GJBA 1XX6A 4UXIA 3GEIA 4ASUA 4PSKA 2ZE5A 3FMOB 2AWOA 4M9XA 3UXMA 3ZVLA 5J4VA 1KK2A 1QHHA 1XEXA 5HTKA 1DAGA 4XVUA 4G5RA 2VPPA 1W4AA 4ASUD 2FE4A 2IYUA 4B2LA 2EFGA 1SVKA 3DM9B 1SQ5A 2R6FA 4A1FA 4IOKA 5CLLA 2W6IA 5DE3A 2EFHB 3AP2A 4W5JA 2VHTA 4JJKA 4NCJA 5M04A 3QKSB 4EJSA 3LY5A 1W0KA 2RGNC 1KO7A 4PZYA 5EZ5A 3W6PA 4J0QA 1TUIA 2ZEJA 1Q0UA 1TX4B 3PR1A 4RFSB 1KY2A 3RSOA 1G19A 1VHLA 3AVOA 1DE0A 2G83A 2GZDA 4E03A 2MMCA 2RGDA 2ZR9A 3E5HA 3ZIAD 4BPBA 5EZ6B 2WHXA 4PO8A 1N5JA 3Q72A 1Z06A 1KDPA 4PFSA 4C0KA 2FSGA 2LWIA 3A4LA 3SFVA 2AX4A 2ZRLA 5TVKA 4XH9B 5E4FA 3AF3A 1XEWY 3CR7A 3IO5A 3RRYA 3GEHA 1ANKA 2OBMA 4BRWA 1NBMA 4WXRA 5KSOA 2O8EB 1W0JA 3WMEA 1CTQA 2ODNA 4M2LA 4GDFA 4NL4H 1ZW6A 4HAXA 3W6NA 4JSYA 1P73A 3BFXA 4NPHA 4YMWA 1Z6TA 3THXB 2AXNA 1S9HA 1NMXA 1G64A 4IDHA 2PBRA 2WPDD 1TADA 3MJRA 5HZKA 1JALA 4NCHA 1IOZA 3HPRA 2BOVA 4JSTA 4LYFA 3F0TA 4PX9A 2IWRA 5AJWA 2EFEB 4R98A 4M8NE 1PV4A 3I8SA 5EP4A 2WMOB 3B2EA 3QXXA 3LQRA 1NI3A 1VG0B 4TN1A 1OIVA 3THWA 2IYLD 2A5JA 4URVR 2WOOA 1WBDA 2IK8A 1NBMD 4PQFA 3T35A 3I1FA 3O8BA 3B9QA 3BD9A 2QAJA 2NG1A 3LLUA 5DO9A 3GLFE 4GZMA 1W7AA 2FSIA 2R65A 2W0SA 1AS3A 2G1JA 3BGWA 2VF8A 3GCGA 2HT1A 1Q3HA 1OYYA 3NTUA 1FFHA 4MKHA 1WBBA 2VHUA 3B85A 1NJFA 1NSFA 2PJRA 4IDNA 4TZ6A 1J70A 1HT2E 1DBSA 1D6JA 4M21A 4B6FA 2Q9BA 2P65A 3I92A 1RIFA 1G3UA 1T8UA 2J41A 4QRHA 4DSOA 4E09A 3WY9A 3K0AA 2WV9A 1XU4A 4A6PA 1Z0FA 3AEZA 4AIIA 5CJ2A 4KLZA 2ZR7A 5D3MA 2IYQA 5E7IA 5H8WA 4RD2A 2PCLA 1RRPA 1GFIA 4IDQA 3NVAA 2ANBA 2OESA 2JJ2D 2GXAA 5F98A 2RKOA 2XXAA 2IS1A 5JCPA 2ONJA 2OAP1 1PLLA 2PX3A 1YR9A 1ZNXA 1CULC 1G9XA 5TB5A 1GL6A 2YNMA 1U8ZA 4LK2A 4V0NA 4BFXA 1QHGA 3RS7A 1WMSA 5DHFA 3GLIB 3OAAA 1G16A 1Z0AA 3U3MA 5IHPA 3K0EA 2H5EA 3GPLA 1E2HA 1GL9B 2BC9A 1BYUA 1E4YA 2UVQA 4HSEA 4QGAA 3OEEA 5CK4A 4CGZA 2YYZA 4NP6A 5E3HA 2A9KA 4CIDA 1RYHA 4JL5A 2VSFA 2ZI3A 3ZD6A 3KJIA 4MKIA 3VQTA 5LD2B 3L8ZA 4A9AA 4KV9A 1N2CE 4MH0R 2I3BA 1NVXQ 1RYFA 3NIBA 3SBDA 2RGBA 1E99A 5G3YA 2Q9AA 1KOFA 4AYXA 1KDRA 2ZJOA 3EWAA 2WWYA 2FZLA 4DT1B 2V8OA 2XJ9A 2O52A 2ZXUA 4II7A 3NC0C 3SNHA 1VCIA 1G7CA 3KKMA 1E2GA 4EQ6A 3T1VA 2ZIAA 4C7OA 1ZIPA 3TLXA 3TSZA 2O8DA 1P3JA 5FBVB 4U02A 5C2JB 5BXQC 3WMFA 1TPZA 2IF0A 1ZC4A 1WA5A 3C41J 2BBTA 3QE0A 5JI3E 1D9ZA 3MRSA 1E2LA 2V4ZA 4PPGA 4V02A 4AG5A 1A2BA 2HYDA 4B76A 4DZZA 3K0CA 3T12A 3CNNA 4TTRA 3IGFA 3K0AB 2WICA 2IXFA 5KTYA 3B7GA 1KJYA 3RDPA 1RRCA 2WKRA 4NCNA 1XMVA 4L16A 4KSBA 3I8XA 4KAXA 3WBKA 2QY9A 4V0OA 4A2QA 4HB4A 5JWHA 3C7KA 1OF1A 3M6AA 2D7DA 4US1R 1XTRA 1IQPA 4FCTA 2VIIA 4LHYA 4LJ6A 1FPMA 4UQOA 2BEKA 1ZP6A 1SXJE 1OJLA 3PXGA 1FX0A 4KHZA 2CLDX 4TSFD 3BS4A 3SJAA 2WWIA 1NN5A 3I72A 2WSSD 4EPYA 3V9PA 1D9XA 1P4SA 2CMKA 1G8YA 1FL9A 3QEOA 4IDOA 2G77B 4DLWA 3BFVA 4V03A 4UXJA 4US0R 2VP5A 4N0EA 3AUXA 5B2ZA 5TARA 5JRJA 1G4UR 4Q48A 1EX7A 1RPZA 1HQCA 1RW4A 1KK1A 4LYAA 2VO1A 2WVJA 5GJWC 2YWHA 1N5LA 3M1IA 5CM8B 2AR7A 3NDBB 1NY6A 1WB9A 3VTKA 3O8DA 3VMFA 3MAAC 5KDLA 4DHEA 1S9DA 3UG7A 2ODEA 2OFWA 2C04A 1FZQA 4JVSB 4B74A 1OKKA 3TSOA 4AK9A 1GTVA 4CEJB 2OHFA 4DT1A 1NRJB 2RCNA 2H18A 4UKDA 4F4IA 3W8NA 1KJWA 2GHIA 4ZDJA 4BLSA 3QXCA 1SKYB 4JYCA 5AJVB 3QXSA 5GJVC 4EQ6B 2GEDA 5TV2A 4CF7A 4XSGA 1IXZA 5KSZA 1T91A 3QXJA 4DDVA 1AK2A 4ZDIA 3LLMA 5FUVA 3BRWD 3HR7A 2DYKA 3QKUA 4XTRA 1P75A 2Q9CA 421PA 1YR6A 1XTQA 2WSSA 1W5SA 1DELA 1N0UA 3OHMA 4Q18A 3ZGXA 5LDDC 3U60B 3GLFA 4LZZA 1U94A 1CEEA 3EC2A 1G17A 3FFBA 1G8FA 3RRNA 3TUZC 3PFIA 4EKDA 3U4QB 3AV0B 2X77A 2CBZA 1FMJA 4JBWA 4IRUB 2WZQA 2BM1A 3F3YA 4M9ZA 4KI0A 4BFTA 1CS4C 2CCJA 2IXEA 4GOXA 2H16A 4TYWA 1S4QA 2J7PD 1GDDA 4JBYA 1M34E 1ZM7A 3QEJA 1ESNA 2QAGA 1JECA 2O8FA 4GOKA 1SXJC 2BJWA 3U7HB 4TL7A 4O2RA 3PUWA 1F5NA 3T61A 1XP8A 3I32A 4ZV4A 3DKPA 3LX8A 1A7JA 3BIFA 5FOWA 5KNBA 2J87A 5C4MA 4FINA 4I1VA 1ZC3A 3KXIA 4XTCS 3FKSD 4OYHA 2J9RA 1MRSA 4QFMA 1AZSC 5JZVA 2ZM5A 1G3QA 2BCGY 2Z0MA 3LH5A 1Z0DA 2AKYA 2BMEA 4OI0A 4MGZR 2GXSA 1CR0A 2BCJQ 2OG2A 3QUSA 3SYLA 3ICQB 4GL2A 1J90A 3FMFA 2WAXA 2IEZA 4GSYA 2ZI6A 2AK2A 4AWXA 1T9HA 3VU9A 1S1MA 1N3BA 2ZJYA 1IN7A 5EE9A 3T1QA 4FD2A 2XB2A 4DKXA 4Q1CA 4D0LB 1AKEA 1NVWQ 3LAWA 5KU1A 1OXXK 3DMDA 4IDPA 2NIPA 4DDUA 4Q66C 4QBIA 3MD0A 5BQ5A 2VP9A 4BFZA 3VR4A 5C18A 4LBVA 1OB2A 3AKEA 4KJZA 2FFAA 1ZD9A 2VP2A 3BXZA 4DCSA 4Y0AA 1KSGA 3BWDD 4AURA 4IOLA 3V4RA 3AKCA 4C0AC 1EXMA 2QUZA 1KI1A 4LHVA 3GLFB 2YC4C 4DUGA 3AF0A 1U9IC 3L0OA 2ECKA 4JLAA 1E1RD 4TQUS 4DLXA 3MWYW 4M1MA 2NGRA 3JZMA 2ZS7A 4UNPA 2R6AA 3T5GA 2OZEA 2IUSA 4KFTA 3OF5A 5G53C 1R0WA 3PCRB 3KQLA 4L9WA 2HJGA 1VPLA 1IN4A 1Z6GA 1Z8FA 2C03A 3EAQA 5CIQA 3LWNA 5FBLB 4EPXA 4OQFA 1GSIA 1GZSA 1MOZA 1R0ZA 2FGKA 4NYMQ 3TMKA 2BV3A 2FF7A 3QJYA 4IJMA 3AVQA 5IF9A 3AKDA 3NH9A 5SZIA 1PVOA 5FH9A 1T6NA 2OLKA 4JS0A 2RMKA 4K81B 2WJVA 2XTNA 3IDQA 1SHZA 1X8KA 3K9NA 3VR2A 3WHKA 4C3ZA 2WM9B 4F38A 5BN4A 1XJQA 2A5YB 2ZRCA 3GFTA 3LBNA 4MRRA 4JVMA 1VCNA 3NWJA 3FHCB 4GBMA 2IX3A 1XMJA 1GP2A 3GLIA 4LRWA 4DLSA 5E95A 4I4LA 1IAQA 3KKQA 1R8SA 3S1AB 4TMXA 1VCMA 1Z6XA 1E0JA 1UKYA 2DFKB 4YLGA 4LJ9A 1YJ5A 3AP3A 3FB4A 4OHXA 5DN6A 1NMYA 4EFLA 1FUKA 4NYIR 1YVDA 2RAPA 4R2HA 4JLMA 1A82A 1VG9B 3BB1A 3LXRA 2ZJ5A 2OXCA 4PHHA 4DIEA 1J8YF 1XDBA 4X8HA 1QG2A 1KAOA 2PJZA 1RZ3A 1B0UA 3IILA 4LJ7A 2IYRA 4ZKDA 1PUJA 4M22A 2O8CA 3DZDA 4RSGA 2CL6X 1FQKA 3KJEA 1DAKA 2XNDD 1SXJD 4YMTA 2UZIR 2F1HA 3WYAA 2D62A 2CK3A 3LVRE 4RJLA 3TK1A 5BN3A 4C7OB 1UKZA 2O8DB 1RKBA 2BWJA 2XNSA 3TUIC 2CNWA 3MWKA 4RD0A 1SVMA 2UKDA 3QF4B 1O3YA 3HPQA 5AR1A 1QHHB 1XEXB 1Z0JA 3BH0A 2HCBA 4LHWA 2GJAA 4P3YA 4RKFA 1DS6A 1JPNA 3NBXX 4D25A 1WF3A 2CCKA 3L82B 4PO1A 2Q6TA 3KX2A 3MCAA 5L3SA 2JAQA 2RGNA 1YZTA 2QU8A 1DAHA 2YZ2A 2V54A 1W36B 1LW7A 2VLIA 3FWYA 3P4YA 2ZRDA 3ZVRA 3CX6A 4OHVA 4YDHB 4AKGA 3DHWC 1KSFX 2JDIA 4DIDA 2YJTD 3H84A 1CRQA 3N2IA 1R2QA 2ZRPA 1JQJC 1Z07A 3Q9LA 2C95A 2WWFA 3RABA 3UIEA 4DB2A 2ZSAA 4QHSA 4LPKA 2Z43A 4B3GA 4DBLC 2C96A 3EXAA 5AWFC 4TMWA 4EPTA 3OIYA 5FTJA 2QRZA 4URXR 5LB2A 2ZSEA 1D8TA 2FPKA 4MDFA 5HCIA 4C0JA 5HPYB 3IKJA 3WHLA 4AKIA 1G8GA 4IKEA 3CBQA 1I4TD 2CEAA 5KNDA 5K8TA 5JLJA 4JLBA 4A15A 4RD1A 2I1VB 2KE5A 4DC9A 1HURA 1T3HA 3WRXC 4JT4A 2GJ8A 4BQSA 1B23P 2O8EA 3L2OB 2X1VA 1ZM9A 3DVLA 1KSJA 4ESHA 3ZQ6A 4DDTA 3FDIA 3BE4A 2ZTSA 3THXA 3PUVA 4BZXA 1G6HA 1G4AE 4LC1A 2AD1A 3HP1A 4P4SA 2NMVA 1EESA 2V55B 1BS1A 4JLPA 2QE7D 3K53A 1P2TA 4I1OA 1J2JA 4CEJA 3ADDA 1W47A 1UADA 4KVGA 3Q5DA 3OE7A 1OSNA 1ZYUA 5BW8A 3K09C 2FN4A 3K70C 1GG2A 3CNLA 4BGDA 4BLTA 1E4VA 2GK6A 2BBSA 5AK0A 1YRAA 3Q7PA 1Q1EA 3U7EB 3VX4A 4DSNA 1SKQA 5KDDA 1R6BX 5EXTA 3LO5A 1XJCA 3N5CA 4LI0A 3CR8A 4QJ4A 4WXPA 1BOFA 1EFRD 2YHSA 2WBLC 2F1JA 4HAVA 2QT0A 2ZSBA 1E0KA 1G7SA 3CRRA 1JQLB 4NZYA 4TTQA 5DN6D 2XOKD 2GDJA 2NO1A 2BEJA 3QY0A 5HZHA 4PC2A 2EU8A 2MSEB 4OL0A 1VIYA 2HLDA 4NMMA 3U4QA 4HATA 1EG7A 5JEDA 5TY0A 5DSZA 1IHUA 4QXAA 1OFTA 4KVAA 1SGWA 1IJFA 4HZUA 5DI3B 2IW3A 3VR1A 2AKAB 1G7TA 2VHCA 2ERYA 2ZPTX 2OV2A 3A6PC 2QAGB 4MUBA 5J4YA 5KPJA 2W0MA 3L43A 1BIFA 5DH9A 2DWQA 4BE7B 1KNXA 3RRMA 1AZTA 2CXXA 2QTHA 3LRPA 1V5WA 1OV4A 3K1JA 1E2EA 2JJ1A 2XNDA 5FR1A 4KCGA 3WYGA 1GUAA 2FOLA 1JAIA 3X1YA 3A58B 1XXHE 3ZVMA 4RFVA 2FSFA 4HAUA 2C77A 2GJKA 3MFYA 3DDCA 1GNPA 3RC3A 4V0LA 1BH2A 2FWRA 2O0KA 4FMBB 1XMIA 4PXAA 1W36D 2O0JA 5FR2A 1R5BA 2P5TB 5DLQC 2C9CA 3CM0A 3VNVA 2D06A 4M1SA 2VHJA 1YZLA 1XB2A 2D74A 3UANA 5JBQA 3B9PA 3PUZA 4LJYA 2OCAA 2DHRA 3RS5A 5B64A 3AVTA 2V1UA 3X1WA 2J46A 3A1TA 1OLOA 2R2AA 1KJZA 4AC9A 1TMKA 1GRQA 2IYZA 4QBHA 5JJKA 4PC6A 5KNCA 3IO3A 4ZKEA 1FUUA 5FPKA 5HE9A 4DEXA 1OFIA 4L8GA 1DTSA 1FNMA 2L0XA 1VMAA 2JLSA 3CRQA 3Q8XB 1PUIA 3IPYA 5EUQB 2J0QA 3KKPA 3UPUA 2VF7A 1NIJA 3KUCA 3H4MA 2PEZA 4HLUC 3V00A 1EFUA 1MABB 1ZJ6A 1SVIA 2B7CA 4HDCA 4HDQB 2IUUA 1OIWA 2RGAA 3CB4A 1MR3F 2W83A 4LBYA 3EWSA 3SBEA 1D2MA 2IUTA 3DZ8A 4YONB 2GESA 1N6NA 2FEOA 1Z08A 5IT5A 5J47A 4RVCA 2REBA 1XFAA 5DI3A 2ZROA 2NTYC 5BYKA 4G01B 1N6OA 3H1TA 4QGGA 1CLUA 1F3OA 1Q12A 4ZIRB 3K09A 4TMKA 4WZAE 1IONA 2GCPA 2SHKA 5AUPB 4EFMA 3C5HA 1AJEA 4Q9LA 3CPEA 4DLRA 4B48A 2O8BA 1M6NA 3ZZTA 4ITRC 3U6BA 1E79D 3NHAA 1ZM3A 4CVNA 2RB4A 1W0KD 1DADA 3TJZA 4MUAA 4A0GA 3FHTA 1E9SA 1M7GA 2C78A 1DAEA 3GLHE 3UK6A 2DCUA 1ZUNB 2J7PA 1TQ6A 1Q20A 5J40A 5FTNA 4CEIB 3I62A 4XOIA 1N0WA 1KKMA 1W2GA 4LYHA 4CYMA 2OAQ1 3QPWA 3RAPR 4BFSA 3CF6R 1TNDA 1KMHA 1MKYA 1BKDR 3T1TA 4HLDA 1VIAA 4AI6A 3RLFA 4BLRA 3VHLB 4KYIB 2IYYA 4Q7MB 4DVGA 3L0IB 4IHQA 5DHAA 3A4MA 1OH6A 1PJRA 4GPTA 3I73A 3QKTA 4BUJA 3K0FB 4HZIA 5JS7A 4Y0VA 4UNNA 4PPQA 2GK7A 1KZ7B 3BORA 5AUNB 1Q57A 1C4OA 3MMPA 4LJ5A 4MA4A 4C0QC 2PX0A 2X2FA 3B78A 1P2SA 2IS2A 1UM8A 4S2EA 2VQSA 3NBYC 1E96A 3AP1A 4PSVA 4GZLA 4X8MA 1US8B 3FMPB 3T15A 4M53A 2ZJ8A 5DIFA 3ZZ0A 1A1VA 2YWGA 1SVLA 1Y63A 4NCKA 1LNZA 1N0VC 4TMZA 2GILA 1G5RA 4ZIRA 1KGDA 4PSAA 4MGYR 2E87A 4D81A 2FDCA 1GNRA 2F6RA 2XX3A 3X1ZA 1XTIA 4R7ZA 3E70C 3ASYA 1KI4A 5TDHA 1A4RA 4PQYA 4Q4JA 3L8YA 3OZXA 5FOXA 4DRZA 2V3CC 3W3AA 3CZPA 4QJ5A 1CXZA 4D0NA 2OCBA 1XCMA 3PVSA 3QKRB 4Z8YA 5G41A 3AVYA 2PEYA 4QHYA 2ODWA 4IVRA 4PHFA 3IUYA 2JLZA 4GMXA 4IVPA 4QBFA 4I81A 3SJCA 3AVVA 4KFUA 2O8FB 4D4MA 1XTSA 4JLNA 5H68A 1TU4A 1PZNA 1QBKC 3KXLA 121PA 1KDOA 1XRJA 2EYQA 2P67A 3HU2A 1YZGA 4PANA 5AJZA 1YE8A 4TLAA 1COWA 3AF2A 3BOSA 3PEWA 1KO5A 1AKYA 1II0A 4YQFA 4HEJA 1DO0A 2OSBA 2ZVPX 4PC1A 4LV6A 4EPVA 1QZXA 1ZD8A 3H86A 1HE8B 3X2SA 1BMFD 4QJ3A 1TTTA 1NL3A 1ODFA 5A0FA 1KYIA 2ZREA 4E07A 1BO6A 1OYWA 1G21E 2YWFA 2YV5A 4FMCF 1E2JA 1LS6A 3IHWA 1T5LA 3K70B 1NN3A 2GZAA 2DFLA 1VKJA 3KJHA 2J0UB 1OXUA 3AVXA 5FUXA 1IJEA 3GJ8A 2BMFA 1G6OA 3A1UA 3B82A 1KTVA 3CRMA 1KKLA 4LJ4A 1XNJA 4M0LA 2C99A 5FFMA 4D2IA 1U90A 3RWOA 2JLYA 2D4HA 2FFBA 3P4XA 4TYNA 4U5XA 3QG5A 3UG6A 4KU4A 2WOJA 4OK5A 1VCOA 3EX7C 2O5VA 3A1SA 2HEIA 3BBPA 1Z5ZA 3AUYA 1DAMA 3KJGA 3QPVA 2IYVA 4GOJA 4NU0A 1RRFA 3A1WA 3K0SA 4LHZA 3R20A 4R2IA 4WVFA 4BLOA 3BB3A 1GITA 4BECA 1Q22A 1R0YA 4OQMA 4URWR 5JHGB 4CDGA 3VKHA 4B34A 1ZMXA 4B47A 3NHBA 3QBVA 2EVWX 3OAAD 4UNRA 4RFSA 2ORVA 4WZ6A 1DVRA 2C2HA 1L2TA 4QL3A 4Q4JB 5IK2D 1VG1A 4C2UA 4Q9JA 1CJTC 5FTMA 5KPDA 2P6RA 2QQ0A 1WE2A 4FMDF 4OI2A 1YZUA 4F4CA 1XD9A 1HV8A 4D4JA 3UWOA 1VG8A 2JJ2A 2ONKA 1DO2A 2QM8A 3OIWA 5LD2C 4F91B 1NKSA 1S2MA 1G3RA 4TYQA 3H2YA 1J7KA 4Q21A 2XEXA 2HLDD 1M2OB 2ANCA 4KITB 5SZHB 2B21A 3CF2A 2IC5A 4XWKA 1MRNA 2WJGA 1XMSA 2F1RA 2IS6A 2R62A 4Q1AA 3CIOA 3CX8A 3FTQA 2QEQA 5EUMA 1GM5A 1K5GA 1ZUIA 4ON9A 3EZFA 4URZR 4BWYA 1KIMA 2DBYA 2YWEA 3A4NA 2E9SA 1P9RA 1XXHB 2YOHA 2Q0HA 3AKYA 1NVUQ 1ZUHA 3FMIA 1G20E 1KO1A 4O2LA 2HJVA 2IL1A 3OIVA 1ZD1A 1A5TA 4BFVA 2QORA 5JSZA 3LNCA 2D2FA 2ZITA 4B75A 3AQ4A 2WIBA 1NBME 3VX3A 3NEJA 4NKRA 3THWB 2GEUA 5EE0A 4A92A 1M7BA 2JATA 3EIEA 1HQYE 1T4GA 2B92A 2J5XA 2P6UA 4FWIB 3MGCA 2OT3B 5DYIA 2YOGA 4QOSA 2W2VA 4O25A 4JYBA 4AKEA 4C0LA 1DARA 4Q00A 2AXPA 4L5BA 5F2EA 1HY3A 4MGKR 2XTZA 2ZU6A 5JWRA 4LUCA 2GETA 3RYTC 1KI2A 1MABA 3SFZA 3L0PA 3QVVA 5FI0B 4YMVA 3ADCA 1WP9A 4IXMA 5HKKA 4QG7A 4ZCLA 2A30A 4CW7A 1FTSA 1IY2A 3TGPA 2WJHA 1I4DD 1Q1BA 4ZI3A 2ZYTX 4HUQB 3FVQA 4GMDA 5FOUA 5K8LA 2PL3A 2WPDA 4CZ2A 4U00A 1W5TA 2DB3A 1UKVY 3SYNA 3ZZUA 4Q1BA 3CZQA 2FPLA 4B44A 4BLQA 3V4FA 2NO7A 2GAAA 3K8YA 5A4JA 1KZGB 2HUPA 4Q47A 2O8BB 1DAIA 4B71A 1E98A 3KXKA 5KYKA 4JT2A 1NIPA 2F43B 3K9GA 3EZ7A 3DOFA 3SEAA 4XWOA 1P9WA 3LA6A 3IPXA 3TNFA 2NZ8A 2EYUA 4QNMA 3AF4A 2XXAB 1QHYA 1IBRA 4A36A 1LF5A 1HEIA 1JXMA 1MO4A 1R5OA 2F1IA 1N6IA 3NDPA 1QVRA 5FOVA 4LYJA 2R6CA 4M1KA 1JNYA 2OE2A 4TLBA 4WA7A 2JJ1D 1UJ2A 3TW4A 2V7QA 1G3MA 4BFYA 1G1MA 2F3RA 5BN5A 2IHYA 3GLHB 2QMHA 4GP6A 1T8TA 2RGXA 5KUTA 1XZPA 3KFVA 4WOPA 3RS2A 2PZEA 1NY5A 2QTVB 5JWOA 2WKPA 4JLDA 4DLYA 3JVUA 1Q3TA 4B2IA 3BB4A 4EJSC 2PT7A 3EA0A 3KDSE 4KSCA 3K0FA 3RWMB 4URUR 1L8QA 5EP1A 1S96A 3REFA 2ORIA 2VBCA 1W0JD 1R7RA 3R9IA 2JLQA 2XOKA 1FP7A 3LXXA 4G0NA 5JI2E 1M1YE 4LJAA 5JFGA 3P20A 1BYIA 1KI7A 3QIAA 5EXPA 1NSTA 4V0ME 1TF5A 3WXMA 4F7WA 2FH5B 2WJYA 2F3TA 5D3QA 4URYR 2P0EA 2PLRA 2VSOA 1E3MA 1XWIA 4C0BA 3IIMA 3ONWA 2MMGA 3PJRA 2JLVA 1UPTA 2FSHA 4YXWA 1US8A 5EE1A 3T34A 2ZS9A 1KI3A 1E94E 3AB3A 2ZAOA 3OIUA 4B32A 3GQBA 3J81k 3OE7D 4QM7A 4OQNA 4TSFA 2V6IA 1MV5A 4RZ2A 4W5WA 1ZCBA 1GOTA 4JLOA 2ZRNA 4W9MC 2F9LA 1UBGA 1HH4A 1YR7A 1ZNZA 2FU5C 3VHXA 2F43A 1P7CA 2F55A 2GJ9A 2JLWA 2QENA 2LCFA 3G5UA 3TUJC 1IXRC 3LX5A 3ECCA 1XTJA 4OJKA 2W6JD 4EAQA 1XD2A 4CEHB 2HV8A 3N2EA 4YDSA 3PEYA 1K6MA 1GWNA 3PIRA 3BH6A 4RCYA 5DI9A 4H9GA 4C4PA 2HF9A 2VTKA 5KSPA 2EWVA 1N6PA 1AQYA 1GRNA 1OW3B 2PCJA 3LVQE 3WMGA 3B60A 3GLHA 5CDFA 1UAAA 2FPMA 1XF9A 1Z2AA 2PMDA 1P62B 1ZBDA 1IN6A 2LKDA 2GBLC 2N46A 2QP4A 2GTPA 3CKLA 3WRYC 1OHHA 1G8HA 3FHOA 2H8KA 1N6KA 1NP6A 3IBYA 3KQHA 3W9YA 4XWAA 5LPNA 4XIGS 3CO5A 2ATVA 1RRGA 3NXSA 2XZLA 3TKLA 1U81A 2G88A 4UXHA 2XTMA 2HF8A 2C8VA 4IEEA 2XITA 4TZ0A 2DR3A 1RJ9A 4TT3A 1OH8A 2FFQA 2NPFA 1IY1A 4PC7A 2P6NA 3QF7A 4B3CA 1Q44A 2ZYUX 2ZRGA 1AA9A 3DL0A 3QQ5A 3W8RA 4DB4A 2W00A 4OKSA 3NC1C 1WQ1R 1XTKA 1G7RA 1N6LA 4N1AA 3SZRA 4FN5A 1C1YA 1XD8A 5CLQA 2QZ4A 2AN9A 3JZAA 2FJUA 1F48A 2E1RA 1E9CA 3C14C 1DEKA 4UJ3A 3UATA 5KHOC 2G0TA 2RGCA 3EZ9A 3GJ3A 5IDVA 3TIFA 1M7HA 4I1SA 1BMFA 1CBUA 4DSUA 1C9KA 1MT0A 2V1XA 4RZUA 2O0HA 4OK3A 1T3LA 1E2NA 2C5LA 2PLFA 4XVRA 3VR5A 4N3NA 4LPSA 2OCYC 3OESA 1T0JB 1ZINA 4TT3D 2CHVA 3QG1A 1ZU5A 4MYUA 1TUEA 3HU3A 1Z29A 1SHKA 1EFTA 4GFDA 3VKWA 2H57A 3LBIA 1KMQA 1NLZA 2ZVQX 2XSZA 1E2KA 4KLNA 4UNQA 4LSGA 3R9WA 1CR1A 2W58A 2FG5A 2YINC 2GXQA 5FI1B 2GVDC 4Q02A 4TYPA 5AUOB 5FTKA 4G5QA 3EC1A 5J5CA 3MJHA 4BASA 3TQFA 1E6CA 3SHWA 4S35A 3SQWA 5B57C 5GADl 1ZRHA 2LKCA 2MSCB 3B13B 3FFAA 2RGGA 2BJVA 3X1DA 2ZRKA 4LC0A 3I5YA 4P33A 1XXHA 1DAFA 4Z8XA 3X1XA 4Q9HA 1S1CA 3IQXA 4A0FA 3AF1A 4BZPA 5EJEA 4A8JA 2BVNA 2ZSFA 4UNSA 4TQ9A 3AGQA 5JSZB 1E0SA 3KZ1E 3VU9B 1XPUA 3QBTA 1U98A 4AYWA 3CNOA 3D7MA 3U44B 3EPHA 1E9RA 3PV0A 3LBHA 2EFCB 4POAA 3FYHA 2CL0X 1RC8A 1OKKD 2D7CA 3I4LA 3M0EA 3TAUA 1NG1A 1GKUB 1ZIOA 4DUGD 1KNQA
chains in the Genus database with same CATH superfamily
1DEAA 3BMQA 1MHPA 4LN1A 1NXVA 4YMSA 4BP1A 5C7YA 1HO3A 3AQIA 3FYTA 1VM6A 2DKNA 2XGGA 1QGED 1N5DA 1WEHA 2H8GA 4DJFC 3G1UA 4TZKA 3BXHA 3B70A 4NNOA 4P32A 2FA9A 2YXLA 1TD9A 3KQTA 1R27A 2GF9A 2QTNA 3TGWA 1CR2A 3R9XB 3LA8A 4X92A 1H1LB 3KOUA 5L53A 4NE2A 4YJDA 4A4DA 5AVVA 1U8AA 4MUJA 2A2ZA 3KT3A 4F2GA 3R5HA 3KKLA 5BNZA 3NIFB 1LJ8A 2OBBA 5I7UA 4MR9A 2FY8A 4BNMA 5M34A 2O3UA 2FN3A 1FNNA 1Z5OA 2CB0A 4RCVA 1OWLA 3DD5A 4M0FA 1GZ4A 3UOGA 4DCJA 1DWOA 4KLCA 4F1WA 2BGLA 3AM5A 1YZHA 4GR4A 4MVJE 4RLHA 1KK3A 1UMDA 2GBFA 3F6RA 3ITEA 4Q93A 1TU3A 4CETA 2YXDA 5BNWA 2H1LA 4CM8B 1EUQA 2ZUCA 3I30X 1N2ZA 3H8WA 4IZHA 4QGSA 4TXJA 3M6LA 1GZUA 4V3BA 3TLGB 4U9IS 2QZJA 2ZB7A 3NC4A 1D1PA 4B7UA 2OECA 3QSYA 2QR2A 4DLBA 4LJRA 4GXQA 1CZKA 6CHYA 1GKIA 3ICOA 4N0DA 3Q0TA 1UPAA 1GQQA 4FOPA 3RKSA 3KEQA 2AG0A 4RTSA 2QMZA 2IYSA 3EXFB 2UAGA 2C0PA 2P5SA 1IRIA 1UEIA 1DRKA 4P31A 2CV0A 3P71T 5JADA 3IJEB 2VRNA 3HYRA 1WAMA 1JVNA 2A0UA 4LVNA 2QN6A 3PT5A 4HBGA 3FE2A 3NLLA 4KMRA 4MV3A 4PZLA 1T9AA 1CFJA 4M3NA 4UVDA 4JP2A 4E2FA 4KTTE 1VB3A 4LZNA 1YJBA 1EWVA 2H7CA 1MO5A 5JC1A 3ZWAA 4HVLA 5H4GA 4C30A 2BMWA 3TCXB 3QFSA 4QUGA 1QCZA 4JZKA 2D1TA 2YIVX 4PAOA 5TF0A 2VAMA 1ORIA 4ILKA 4BO9A 4KYUA 1W48A 5BW5A 3QX3A 4YQZA 5A5GA 4HYYA 3E6AA 4HQOA 3DL4A 3KJNA 5IYZB 1MIOA 3LCRA 1IM2A 3LHFA 4MUNA 1XJ0A 5B53A 4CG1A 4DR2B 1CJBA 5IKOA 1X77A 1MP0A 4G23A 4HX5A 1XZGA 5ESXA 5EJMA 3R23A 1K5HA 2OB2A 1M33A 2P3SA 4ZPXA 5A2GA 1SXJA 3QPUA 1PWEA 3VR3D 1I01A 3FOWA 4LGVA 1HTTA 1PJ3A 2WWVD 3QF4A 4UM7A 3TAHA 5C8ZA 1E2DA 1PQUA 8GPBA 4DLZA 5E7MA 1UIMA 1C1DA 1IZ7A 5DM1A 4H18A 1T13A 2IYXA 5L3ZA 3UMSA 2ZYWX 4FGJA 3SGLA 1FRFS 3DYBA 3R44A 3ISVA 3FGPA 1ZH4A 2NQ8A 2AXQA 3DOJA 4Q4HA 4TMTA 5BWMA 2X19A 1ORDA 1DI0A 1EDZA 1I0LA 1UDBA 3OPYA 3DW3X 4AQDA 1P4JA 4ZOBA 1PLJA 2HRCA 3C48A 1H2ZA 2HIMA 2XADA 4HDSA 4PWYA 5HX7A 3PTAA 2H1OA 1ESMA 1O9HA 1YGPA 1JB1A 3ADKA 4KLRA 1ZK2A 4PO9A 3WOVA 1GPNA 1ZN8A 1QIFA 1GT91 1OT3A 1T26A 1U9IA 4X8LA 1U3TA 2FSPA 4UU0A 2X42A 3AGPA 4NCXA 3RVKA 3VMMA 5TMPA 4B84A 1B2LA 1RPNA 1KQOA 2BRUA 1SH7A 1ENYA 1U9ZA 2PQMA 2QNRA 3AY3A 3MT0A 4M7PA 5ALFA 3GFPA 3DE0X 2IX3A 1GKYA 2AWNA 4M9SA 1MO6A 3JR3A 4OQLA 1C9MA 3ADPA 1KZYC 1PR5A 3QFHA 3UWKA 5KQLA 2IZ6A 4DLPA 2A5GA 3EVFA 4FMCB 4B6JA 4BNUA 3KLPX 3MPOA 1JKXA 3FBWA 1AF7A 2G76A 3OJOA 4GGPA 4FR2A 4I50A 4YMIA 1V2GA 3P94A 4DLVA 1I4EB 3TXAA 3QTBA 2HSEA 4N9QA 5MDHA 4NU5A 5IXYA 1OLXA 2O07A 1ULAA 2FOIA 2OV6A 1F2UB 3H4IA 3PCTA 4FHZA 4MPJA 3VAYA 2K5UA 2XRYA 3ELYA 1I51A 3K4PA 2CL5A 4B33A 1V5IA 1QHXA 5E2BA 4O08A 4BYMA 4E31A 5ECYA 5B6JA 2ZU0C 1BKYA 3DEKA 5KWSA 5KNLA 1NFFA 3L7YA 4MQ6A 3O74A 3HDTA 3C70A 3U3OA 3DVAA 5IJZA 1VFPA 2VK1A 4HX9A 4Q5IA 4X95A 2ZIXB 4KR0A 3SDZA 1NLYA 2QUKA 1M72A 2XH8A 2B4QA 3QE3A 1Z7YA 3C3KA 1VECA 1Y89A 2EWWA 3MWEB 3HJNA 3X3HA 4BO8A 4JUIA 4ZDWA 2VC2B 5EKDA 1GLVA 3IEMA 1YHYA 3OMXA 2P35A 5CDFE 4B7ZA 5BUQA 3IV9A 1DG1G 1LCIA 2Y2VA 5T3UA 3PT9A 5DM70 3CV3A 4L7VA 4G0WA 2OORC 4YT4A 1ZR4A 2JFFA 5CX1A 4HB2A 1Q91A 1JR2A 3ESYA 2BW0A 1U0HC 3S27A 4BZWA 3ZE2B 4JMPA 5KO2A 4DRXA 3P26A 3QUCA 1UXJA 3DEHA 4MWEA 4PCUA 5CR9A 2J3EA 3B1VA 1RQXA 5ALJA 2GDZA 2NN3C 3N5KA 2XUDA 3GLGA 2QTWB 3ILSA 3WDSA 5KOYA 4KR6A 3JY6A 4HJXA 3A05A 3GO4A 4DLTA 1YZKA 1E9FA 3L9XA 4Y2GA 4O4LF 3A6EA 2HSGA 3UYLA 1PFGA 3Q98A 3VZDA 3BMNA 4IJWA 4EYEA 1NBAA 5E7JA 5SZJA 2PXHA 3SR0A 3JQPA 1F60A 4HUQA 4NTZA 1G20A 2VT7A 5CB6A 3DNMA 3RT9A 3ORQA 2JA1A 1V95A 1XAJA 4NBSA 4WZBE 1JWAB 2QE6A 3TL2A 4AZVA 3HB4X 3MIZA 1EXNA 1NV8A 2KBEA 4ZVVA 5HFNA 4YPVA 4HDKB 4PC3A 4CKWB 1NN0A 3WMXA 3RVBA 4UW9A 1E9BA 1L4BA 4CFYA 1JIQA 3KT6A 1A04A 4XDZA 1R4AA 4LDJA 4MVXA 2Q7DA 1I2AA 3D4BA 5CA0B 2YDXA 1T9ZA 1E8DA 3OFND 3QWHA 1RXYA 2ZR0A 5E8JA 3D0RA 1BEUB 2Y1DA 3T4UA 1J49A 4QYSA 5HE8A 5JCOC 2PSJA 2BKUA 4JDPA 4R1OA 3Q41A 1U2PA 3MBOA 1Q1QA 2AKEA 1U2TA 3WA7A 1K8QA 2ILVA 3FPFA 2AN4A 5E38A 5JS8A 2GI4A 5IUJC 4PTYA 4D80A 2IU0A 4G5OA 1RVDA 2JIZA 3HJCA 2HDNB 3PIDA 1Y5MA 2YVUA 4MQFA 5HMLA 5L3RA 1ADGA 1G0NA 1LX7A 1YQGA 2XTAA 3MOSA 3UN1A 3ZCRA 2COUA 4WBXC 1W1WA 3TJMA 3CF0A 2HWXA 3Q0IA 2VLBA 2GPNA 2YBDA 2HX1A 3MHTA 3ITDA 1CJUC 1YL5A 2UYCA 5I5EA 2C4WA 3P0JA 1CF9A 3GJZA 2ZRIA 3VNAA 4C4YA 4WPGA 4GYWA 3ZJ4A 1ELOA 1QPGA 4B3FX 1G5TA 1X8LA 5EIEA 2X3YA 1T36A 4RZ3A 5FWYA 3T5BA 3CR3C 4AIRA 4HLQB 1RFGE 4I66A 4UAUA 2QPAA 2EX4A 1BXRB 2DG2A 2IXGA 2WR8A 3PKZA 2RAFA 3NQ41 3L6CA 2E5FA 3FN4A 1Q15A 4JEIA 4RD3A 3EA5A 1QE3A 1YS4A 4FOSA 4P9NA 1XZQA 2CVQA 3BJIC 3GLGB 3VA7A 4EAAA 4TQGA 1YOVB 2C20A 4P83A 1XZ8A 3HFGA 3L93A 3M1LA 2PUAA 3ZGOA 3OBBA 1F1JA 3KHTA 4Q7KA 3GLIE 1JN0A 5CIWA 5A9TA 4P5EA 2Z8YA 3ZWOA 5B58C 1CIPA 1X1RA 1D2HA 2JFHA 4I6GA 2JLUA 3LPMA 2VYCA 4NULA 1NQTA 1SY7A 3HY4A 2WIFA 3FYCA 3WLOA 2HH9A 2XXBA 4Q03A 2W2KA 4M9QA 4U7DA 2WQ7A 3ZVNA 3OLCX 3ZH9B 2FMKA 4W1RA 4IMJB 4FQ5A 2P2ZA 3DDHA 1XPOA 5P21A 2WWXA 2ZI7A 2KWIA 3CUYA 1UF9A 1QVWA 3CUKA 1CE8A 5EIBC 3HA2A 4B3XA 5IRCD 1AIPA 4P08A 1HSOA 2VVTA 4WNCA 3IB3A 4K05A 3NV7A 1CT9A 1E2IA 4X7BA 4DEVA 5JD4A 1II8B 3ELDA 2OUKA 3HZRA 4O0MA 3ENWA 3KLOA 5G1NA 2PUJA 4GPIB 4OHUA 5TQ0A 4M1TA 1OH7A 4DQLA 1AQJA 4MICA 2QQFA 2JHCA 1ESCA 1X8JA 2G25A 4GEGA 2PBLA 4PPYA 4YJHB 1E6KA 2QZ9A 4FE3A 1KZHA 1RQGA 4MUEA 3LBYA 4YAWA 2NZ2A 1O58A 4O4HB 4L5JA 4BLPA 5DIZA 1OH5A 3COPA 3DFMA 2UUOA 2FWAA 1IOWA 1V8ZA 1WMBA 2QXTA 3BE8A 3R3SA 3L4BA 3ZLUA 4D98A 5IKXA 3ZLBA 5J4KA 1LD3A 1JR3D 3UAZA 4MUGA 2V0GA 3AEQA 4JJ7A 4QT0A 1EUYA 2ATXA 2VDPB 2XE4A 1TM7E 5DHTA 1CNMA 4LJ8A 3OFNA 5J23A 3EB9A 2QY6A 5F1YA 2HMWA 3CEHA 3H11B 4UFNA 3HDVA 3KQOA 2J30A 1EZ4A 5T67A 3PTLA 2RGUA 3ND8A 3O3NB 1GO2A 2XIJA 3D3WA 1HKHA 2NPIA 5AXBA 3C8UA 2XT9A 2R86A 1WMDA 3SD7A 4R8MA 2ZM6B 1RJ9B 3KBBA 2ZJAA 3A1VA 4UHBA 5IARA 1ZCAA 2IY7A 3EXEB 2V9PA 4L27A 1S2DA 2C83A 2C2BA 1LLQA 5BO5A 2Y66A 3DP7A 3R0XA 5TEWA 3UAOA 1T9BA 1PR3A 4M1EA 1BW9B 3OX2A 2EFDB 3E2PA 5AI6A 2DHQA 3RF7A 4N0PA 3TOSA 3EMBA 3NONA 3WFJA 4DR7B 2F8MA 1V3VA 2XJ4A 4BMXA 1L4NA 2WTMA 3AB8A 3PNKA 1PW7A 1U1IA 2REOA 2XNKA 1P60A 4DUPA 2FTKE 3FNGA 3A32A 5FPTA 3D8NA 5IAGA 3STVA 4D9IA 5GOZA 3UVEA 1SMKA 2JA2A 5KCMA 3TTWA 4U8GA 3AZQA 4GRAA 1OREA 4DA0A 4TM7A 2EIHA 3B36A 2VDRB 2DR0A 3WZ2A 5C53B 1M1YB 3O7WA 3QWAA 4HLUA 1TYAE 1LU9A 1TEXA 4ZO7A 3V2UA 3HGQA 3PI6A 2BHRA 4S1OA 3RSFA 1IHXA 3WO0A 4AZ3B 4Z4GA 4MYSA 3G59A 3DEIA 4Y9TA 3NP9A 3FOCA 4DLUA 5EJ8A 1G1AA 4OK6A 2HIHA 2Y1OA 1PUXA 5ALLA 3UMBA 2A33A 2FWNA 2CJWB 3DBRA 4C6RA 1NUPA 3LT0A 3CRW1 4EA6A 3THYA 4MJXA 3ECAA 4JYZA 1SKYE 3HCBA 3ZJTA 2OTCA 2HSWA 4YMHA 1Y1TA 221PA 4JOCA 1N33B 4Z0HO 3P9QA 3TD2A 1N2HA 2QSYA 1A3CA 3DL7A 3RK4A 2XZOA 1PYGA 1HDGO 2I8CA 4DL9A 4IDBA 5FUMA 2ONYA 1GXSB 4IJQA 4PWZA 1CYDA 4IOMA 4XASA 5ECDA 3EPKA 3N2GB 3PEUA 4GC5A 4YUYA 3R7DA 2P1DA 5MF6A 5ELXA 1GPH1 2HXYA 2PUTA 3TF5A 1K7YA 3FJOA 1UFOA 1J00A 1NVTA 2F48A 3I45A 4EA8A 3BXEA 4QAQA 3PE3A 2HWKA 4ROTA 2UDPA 1QH0A 4EJFA 1T5IA 1JT2A 4KPGA 3TRJA 5LP6F 2W93A 1X7GA 2GTHA 3R3HA 4EMSA 1CP2A 2OZKA 4HAIA 2OBNA 1KS9A 1W94A 1C30B 1CHDA 4QDZA 3TLYA 3L92A 3T5PA 1KP9A 3EWNA 2GVZC 3RRXA 1GTZA 2G8LA 4JLKA 2JFOA 3CY6A 3GARA 4OXIA 4URHA 3QYAA 5DBOA 3U3RA 4A6DA 4UTXA 1KWKA 3AJRA 2TRSB 1N7JA 4IZ6A 3UXYA 1Z8HA 4EUNA 2QD2A 1Z4JA 5JJ5A 3RG2A 2NV0A 3CH6A 3GVXA 1RE0A 2DH6A 1OFUX 4BBJA 4E6EA 4DV1B 1ZGZA 4ZVQA 2DUUA 1C9NA 3K31A 3WB9A 2PPVA 2WJJA 3I52A 2ZDQA 5B1SA 5TS2A 3IEVA 4JENA 2GWHA 1IZ8A 1DEXA 4WW0A 3ILVA 1NI5A 3VC2A 5CDYA 4HSGA 1F6BA 3ZJYA 3OTHA 1IEQA 4HZUB 2H59A 1XZLA 2H2FA 3VNBA 3IVAA 4N5DA 3VZPA 2ECQA 5EIHA 3VI4B 3QV1A 3SWWA 4H0FA 4PTLA 4IY1A 4U7HA 4Q9KA 4TL9A 4EEZA 1RQPA 1U8YA 1YE3A 2B5OA 1USIA 4LNHA 4P4TA 5FPYA 1RAFA 1NVVQ 1WDMA 2WMNB 3LD9A 1D2NA 2I22A 3N6XA 5CGZA 3ZNOA 4X6LA 4Y9DA 2EAUA 2AFIE 1EFCA 3NWBA 2I6FA 4RVNA 4ZAGA 3KSRA 3ZK7A 1UJNA 2PJDA 4H7EA 5FBRB 3S2UA 4CV0A 1UJBA 3OZBA 4ZT6A 1L3IA 3USES 1E2PA 3DBRB 4R1TA 2GZ2A 1T5BA 4TM8A 1QZ3A 5C46F 3STYA 4LRQA 4MUFA 1QORA 3CVOA 1DHRA 4RHXA 1UBCA 5IWAB 4OJMX 4BQFA 1U1FA 4IXNA 1FW6A 2ZYGA 3KRTA 4V39A 1R6TA 5K8IA 1A71A 1RBMA 4PZCA 4ZK2A 3RVQA 3TLJA 4Q01A 3KE8A 4URFA 2CF5A 2X86A 1W4ZA 4RSMA 1P5ZB 2WJ3A 2YIDA 4LX8A 5THXA 5K6TA 1PE0A 3BICA 3A10A 4DYHA 3LQQA 1NXSA 1JLRA 3LFHA 4K9LA 1EFAA 3PEVA 1OHHD 1MO3A 4IGIA 4MKZA 4AT1A 4F4HA 3FOAA 4JVNA 2B98A 3MA0A 1DKUA 1K63A 2FMXA 1MB3A 3LHDA 1JF8A 2NUPA 2BUAA 3GDHA 5LQAA 4H1VA 4GIBA 3QEAZ 2HT6A 3V34A 2HPVA 2HK9A 1BRTA 5KJEA 3TLEA 4BL5A 4F6RA 4Z4QA 1PF7E 5LBIA 2QTRA 2P2LA 1CU1A 4G84A 2R6GA 3GVHA 3W34A 2IHKA 3IMKA 4INOA 3I6BA 5G1OA 3EGEA 2JLRA 3GEPA 2V5UA 2WF5A 4BNKA 1WD7A 4MV4A 3LXUX 4AUKA 2X9LA 4US2R 1PL6A 4JHLA 5E1BA 4GL4A 4PZPA 1QU3A 4FXPA 3JALB 1ZVVA 2QTCA 3RO7A 1FS6A 1M3SA 4ZVMA 3E3OA 3ZE7A 3T5DA 1HL7A 3RGWS 4CQLA 2VDNB 3BCHA 2C2GA 4UZSA 1DFGA 3FAZA 4L7QA 1I4LD 2GA8A 2HA5A 3DT6A 2LIPA 3V8RA 4EJMA 7AT1A 1W76A 3HB9A 5AJYA 4QYWA 1K66A 4Y0NA 1MH1A 2OOSA 2VYFA 4D9FA 2REXB 2Z8XA 1JDVA 1HYGA 2Y1KA 3AIOA 3B8HA 1NBEA 1TAGA 1TJ4A 2NUBA 3LT1A 2JCSA 3LW7A 4LNUA 3TL6A 4C5BA 4ARCA 3K9FC 3FDZB 3OE1A 3WP1B 1UFRA 2ZJFA 4C4ZA 3MINB 4RPIA 1XWFA 2X9VA 3DHVA 4QNRA 5IK2A 3Q12A 2Z9DA 2RGEA 1AGPA 2WIAA 1BSVA 1MFPA 1WUKS 3KEFA 3WGJA 4AYTA 2YL2A 4I14A 3B1XA 5D3MB 3KQMA 2ONZA 2C31A 1QAQA 4Q12A 3RD5A 3RFTA 5E9JA 1ZOLA 4LV8B 3B3AA 3MJEA 5HEKA 3OOJA 4LGYA 1TVKA 4EIWA 4JL8A 1BGXT 2VP6A 3BXXA 1NJGA 1Y9AA 2GM3A 3L8HA 1QYDA 2I9KA 3ESBA 1EIWA 3R8XA 4LJKA 1CUIA 2ZQ5A 1XEWX 1GSOA 3M33A 3RFXA 2NXEA 4BO6A 4CKBB 1KSHA 2HHLA 1FP4B 2QW8A 3GQVA 3PPIA 1NVEA 5KOHA 1QYVA 3AG5A 3RS3A 1OFHA 1LS1A 4PFJA 3GRKA 5KHLB 3UA3A 2O1WA 1E5LA 1QYWA 2VRWA 3EHEA 4R84A 5KTNA 3ZBUA 3JVVA 3KWJA 4G25A 2KLBA 4KRFA 4L2IB 2VDQB 3HEBA 3FOZA 3W6UA 1IL0A 1ZUWA 3TIGA 3GP5A 3FFXA 3G68A 4FBLA 3EYWA 3FVRA 1QFYA 2GCOA 4Y6SA 1LSJA 1W5FA 4JKYA 3S0JA 5LFAA 1E6MA 5JAHA 3DEAA 1QGZA 4Z2AA 3NAQA 3M6WA 5GGXA 2VSXA 4IP0A 4Q1DA 4O33A 5DGDA 5I8PA 2V97A 5BSWA 1ADFA 3I04A 3VR2D 1KI8A 3AM1A 1F2UA 2D2XA 1OWMA 1R5NA 1NXTA 2BGKA 5J1TB 4RK0A 1MCZA 2WY2D 3SHQA 3OTOB 1X94A 1ULTA 2F4VB 4XVQA 1PR2A 1N5RA 4B43A 3BGOS 3RASA 4RJIA 1X86B 4IIFA 3DVAB 3GOQA 3PFHA 1XL1A 4KFRA 4YN3A 4NCBA 3HDHA 3KYCA 4ILEA 3IIJA 3PQFA 2CHQA 3N05A 1R0XA 3OU7A 1YQEA 1DPFA 4NICA 3EXEA 5T4HA 4BTVA 3LK6A 1DBIA 2C54A 3MT8A 2BFOA 4HDMB 3OP1A 4S1WA 5KBYA 3Q3HA 3FCYA 4D99A 5CHEA 2VUTA 2YJ5A 4ODIA 1HFJA 3PZBA 3I6MA 3SVZA 2DP4E 3OP4A 1C3XA 3VUFA 4F5WA 1SUDA 3N75A 4YQEA 3RSLA 4JUDX 2HPZA 5LM3A 2VJMB 3JQRA 3F5FA 4B3JA 2OP0A 3FZYA 3GQBB 4DNPA 4RACA 2ZUSA 4CKCA 2DJIA 5CFLA 3PENA 5IAJA 4BMYA 4J2TA 3UV7A 1M1YA 2B6HA 3SS9X 2V3WA 2MYNA 2ICAA 4HRYA 3ICEA 3TLCA 3VHXB 3MG9A 2D2VA 4DCNA 3MWGA 3LHIA 3N0XA 4FMDB 1G5PA 4YCJA 5E6RB 2CZCA 3C4JA 1Z9BA 1YUMA 2QGNA 1FP4A 5I7HA 4BV3A 1YVUA 2JNWA 2O54A 3OPVA 3AEKB 2I76A 4IV8A 1K3TA 3AHCA 3CWQA 3THYB 3DW1X 4QC2A 5BWOA 2MHCA 1LDBA 1PNTA 2OK7A 2D2EA 4G0XA 2PL9A 4XGNA 1AGRA 3C4VA 3AT1A 1VBNA 1X0VA 3C3EA 1LDNA 3EBPA 4GI2A 1GRVA 5KYTA 2QLLA 1E89A 2ORYA 4JLJA 5DNCA 4QBTA 1F6WA 3KBOA 2GCOB 2VBGA 1WDLA 2YH2A 3ES9A 2QOEA 4MQUA 4Q4DA 1XKLA 3ZGVA 1Z0SA 2FPSA 4P38A 1Y6RA 4LVUA 4HY3A 3TB4A 1SKAA 3VZQA 1D4ZA 3NASA 4L0QA 2VS1A 5HG0A 1ODCA 4ACBA 1T0IA 3JQGB 1FCJA 1AT1A 1PFKA 3P32A 3W2HA 4UE2A 3COWA 4P0QB 1XP5A 4H08A 3FUTA 5IULC 3Q85A 1K6JA 1N2OA 2W6ID 4H35A 2HREA 5D5QA 4MEJA 5J2TA 4UXIA 4R7TA 4XR4A 4MQFB 1Z2EA 1FNCA 4JEHA 4C4TA 4YLYA 1A9OA 4PSKA 3P2EA 3LC7O 5J4VA 1U1EA 5GAJA 4DR6B 2Y4NA 3VU3A 1N3IA 1XEXA 5EHIA 1DAGA 1YS7A 4XVUA 2BFWA 2VPPA 3QLEA 2DU8A 4G5RA 3UBTA 1XNHA 1Z25A 3M34A 1WF6A 1SC1A 1KARA 1G5HA 1SVKA 3DUFB 2NU7A 4L8FA 1FPQA 4WFJA 1WV1A 5IVIA 2BGMA 4A1FA 2HUNA 3C6BA 2W6IA 1SQ0A 3ZWBA 5LLDA 3SIWA 2FMFA 4JJKA 4MO9A 3CE9A 5BNIA 4NCJA 2SKDA 3QKSB 4YGYA 4YCSA 2YTZA 5ESWA 4PZYA 1XCJA 5EYPA 4J0QA 1TUIA 1G66A 4B8YA 5JUWA 1TX4B 3M2PA 1CVIA 3FSEA 3PL1A 3JQFA 5K51A 3AVOA 5K05A 1DE0A 1RE1A 2G83A 2R751 1MAVA 2MMCA 2VQ3A 3E5HA 3PFBA 4JJIA 4UVHA 4ZALA 3MNFA 4G6ZA 5IJXA 3WV5A 2HNKA 2YCLA 4DNOA 5A4AA 1GUDA 1RMTA 1PBTA 2IQ5A 3HBNA 3RUDA 5AVRA 5KJ1A 4MRAA 5M2QA 4A10A 4PFSA 4C0KA 1OT5A 2OCKA 1JHXA 4G8DA 1MZPA 3MOIA 3UT0A 1OTXA 1Q0LA 5TVKA 1ND5A 4ER0A 1X15A 3AHFA 1T9GS 1XTUA 3CR7A 2CUNA 3E8SA 3A4TA 2X0KA 3NHPA 4L72A 3CRNA 4BRWA 2PSFA 2VZLA 1MVLA 5DTJA 3PVZA 1JFLA 2YN4A 5KSOA 3ENZA 3WMEA 3WAJA 1CTQA 3DE1X 1YZFA 4UZFA 4ZC8A 4A2WA 4GDFA 1LJUA 3ZWXA 1WOMA 2YZNA 4JSYA 1O6BA 1U02A 3VPSA 1P73A 4NPHA 3NFYA 1P4AA 3G2JA 6AT1A 3G2KA 1QP4A 1S9HA 1JE1A 1TUBA 4OH7A 1TADA 1CQJB 5HZKA 1VGQA 3QFCA 4F2HA 1IOZA 1JHUA 4R1LA 2XUOA 2XYHA 2YWXA 2VAXA 4L02A 5DM2A 5TQ0B 5REQB 3UENA 4EA7A 3RAJA 2FLWA 4E5DA 2AN5A 3I8SA 4CR6A 4Z4HA 3PNQA 1FUEA 1Z3CA 2BDEA 2O6LA 2WMOB 3DKKA 3GUVA 2R85A 3DHNA 2A9PA 3LQRA 4I7EA 4MS3B 5A02A 5FO1A 2H1SA 1W7AA 3E48A 3NJ4A 3R5FA 1OIVA 5CX4A 3THWA 3JRNA 1FFXA 2IYLD 3GWGA 3PXDA 4QU5A 3NTXA 3SSOA 4GKJB 4DPLA 3HXQA 1YZYA 4QWMA 4WQMA 3LP8A 3V7FA 4JVOA 1B42A 1D2AA 3I1FA 3B9QA 3BD9A 4RTKA 4PX5A 2QAJA 4V2UA 2XHEA 3IT0A 3LLUA 4G9BA 3FRJA 5DO9A 3J81A 3DWFA 3GBSA 4DC0A 1R8XA 3AFOA 3L40A 5DW0A 5A6SA 4GP9A 1AS3A 1EB8A 3U13A 4AF7A 1DTWA 4KJXA 2Q4EA 2I66A 1T1IA 3GCGA 4ZAWA 4FYYA 1GCGA 1TYDE 4W9NA 1OYYA 1EAMA 1QLWA 1FFHA 2OLEA 2UYYA 3BMCB 3NZEA 4HH1A 2VHUA 4IHJF 5E9WA 2H00A 2PIAA 4D3FA 4OSOA 2NV2B 2PWYA 3GB9A 4QICA 4D1YA 4D42A 1NSFA 4JR1A 4KRYA 4C87A 4ENWA 1SHLA 1T5HX 1J70A 4TXHA 5SYAA 1QKKA 1SHTX 3WLHA 1T8UA 3U19A 4QRHA 4E09A 4ARAA 1IUPA 1IG0A 3K0AA 2WV9A 2YHUA 5A4MS 4YAJA 1Z0FA 2IPAB 2PZAA 1B15A 1KMCA 4C4SA 1Y5RA 2CUKA 2WUGA 5JQGA 4MTCA 2ZR7A 2O06A 4EK9A 2J5KA 5D3MA 4DQ0A 1D6MA 2HD4A 4XYMA 5E7IA 5HKLA 1X0XA 5H8WA 4FXOA 3WB1A 4NCAA 1N1MA 2E3JA 4IDQA 1K2VN 2JJ2D 4NJOA 2GXAA 2IS1A 5ILOA 3ORFA 5BVGA 2QF7A 2CMDA 2PX3A 1FLVA 1UDCA 1ZNXA 2R1ZA 4MUXA 5TPWB 5TB5A 4KE6A 2QRHA 1QG6A 2YNMA 1C3LA 3B48A 2OWEA 1PJCA 2V4UA 4AJ1A 3AR5A 1ZOIA 3MW8A 3WGQA 1O4VA 1JVSA 4WNAA 1U7DA 2V7WA 4JIGA 5DHFA 4D8VA 5CFMA 3E5MA 3D8SA 1Z0AA 3KK0A 3OWXA 2H5EA 2QTZA 1S2NA 3JQFC 1J8QA 3OEEA 3V97A 2NSLA 2YYZA 4NP6A 3JYNA 2XI4A 2AOUA 3C0KA 4IYRA 1RYHA 4XEHA 3U0BA 2X4LA 1FYVA 4B9AA 2QRLA 3UQZA 4IDDA 4LFBB 3I6ZA 2VWGA 3N2YA 1FFXB 2ID7A 1Y4ZA 1FUYB 3L8ZA 2G80A 1V9SA 2NSDA 2P3QA 3NDIA 2Z30A 4GWKA 2BI8A 2DJ5A 2JKVA 3OD1A 2C3PA 1W52X 3DR5A 5JXJA 1P2FA 1KOFA 1B74A 1IULA 4AYXA 1KDRA 2C8LA 3OICA 4YRDA 2WWYA 1OFVA 4C7VA 2FZLA 1KMNA 1PAUA 1R6XA 3CGGA 3R3YA 3ZH2A 4DT1B 1I14A 2XJ9A 4XJTA 5CP8A 5JTTA 2VQ6A 1TRKA 4II7A 4QODA 4Y30A 6NULA 1VJ1A 1WMFA 2Q5OA 3NC0C 2IYPA 2YFKA 3KKMA 4HO1X 1E2GA 3CVVA 1AC5A 1O8CA 2AOTB 2EX1A 5CXUA 1Y7TA 3O03A 5BUSA 3T1VA 1ABBA 2ZIAA 3CTMA 1JU3A 5DMXA 1WZCA 4GI5A 4U02A 3U09A 4MEAA 5DPMA 3O4JA 4MRMA 3D6MA 1VPTA 3P9SA 1YD7A 3C41J 4MOWA 1XV5A 1GLGA 1BU8A 3P8ZA 3FJYA 4MHSA 3ZEIA 1L5YA 4B76A 3CNNA 4TTRA 2Y0BA 3QJGA 1MXFA 1TIKA 4NBRA 4NMHA 4R5MA 5C7LO 1TM4E 2B61A 5LZ7A 3UM9A 2XA9A 2A9QA 2A57A 4NCNA 2NNWB 3TW8A 3OM8A 4MVJH 3I8XA 2QMQA 5BW6B 5EWJB 4XCXA 3WBKA 1JLLB 4HAOA 2E4XA 5ENZA 4A2QA 2VRCD 5JWHA 2P6PA 4DQDA 3C7KA 2YHAA 3A7DA 3M6AA 1GFSA 1N57A 1WOYA 2RG1A 3FCSB 3E82A 4GQBA 4MW5A 3IOBA 1CNFA 2XDYA 5KWIA 1ILEA 1TZBA 4LHYA 2C1ZA 1I13A 1Z39A 1FPMA 2QYHA 1DAOA 4LJ6A 4NFYA 3LF1A 3NCTA 5TPWA 4DSAA 2HK6A 2XGJA 2VYQA 2V9ZA 1UK6A 3O1HB 1H2BA 1WXHA 1WLYA 2GMWA 2WWIA 1CUZA 3AEKA 3I72A 3KT0A 3MCTA 3OSZA 3WGKA 4EPYA 1P4SA 5CMLA 1G8YA 3QEOA 4BNDA 5BUCA 2BSAA 4Z2YA 3FRHA 2PBFA 4X54A 3KPYA 2GN6A 4XR9A 1I5EA 3AUXA 2FPRA 4AJHA 4WOKA 1RPZA 4RUKA 1RW4A 1KK1A 3T7SA 1XKXA 2VO1A 4KQEA 1FFSA 2YWHA 1N5LA 3FCOA 3B2QA 1T6BY 1P1RA 1F8XA 1JSLA 4RDIA 4WKGA 4PV7A 3RSGA 2ATIA 3ZNPA 3VMFA 1Z4IA 1H4TA 4W82A 3WLSA 3LF2A 4PX3A 1ND6A 2ODEA 2OFWA 5KCZA 1RXVA 4MW9A 1OKKA 3JQGA 3OUTA 4Z7OB 4AK9A 1E2UA 3CFYA 2YZ7A 3AJAA 4BO1A 4D97A 3UHFA 4FSDA 2IZ7A 1V8BA 2H18A 3M6FA 1WZNA 4F4IA 3PYMA 5BT9A 3UAWA 1NT2A 1RYYA 3HKCA 3MQ4A 5AJVB 4J7AA 5LUBA 4Q9NA 4CE6A 1DCTA 2ZBFA 2XYRA 3FWPA 4JI1B 1XRQA 3HXOA 3HR7A 3RIMA 1P3Y1 5IT4A 1ZJ4A 1ETHA 3QKUA 4XTRA 5DJ5A 2BFDB 3WADA 2Q9CA 3ZHSA 2XNHA 2DUWA 1HF3A 5E3IA 5D5HA 1RJWA 1ESZA 1W5SA 3QKWA 1DELA 5EJ6A 1RRMA 1U0TA 2GM4A 2F2TA 4Q18A 3U60B 2P0YA 3DVSX 4HPWA 5DLPA 1CEEA 3CT4A 1G8FA 3BKWA 3UT6A 4EATA 3ZKWB 3NPAA 3I8OA 4QQKA 3ST7A 4EKDA 5BWLA 1WMAA 1COZA 1FMJA 3IQFA 2OP1A 3O9MA 2MWMA 3VO8A 4PGGA 3WKCA 1E3QA 3JR7A 5ICCA 3SCZA 2FUCA 4RXTA 2NXNA 2JCXA 4JBYA 4MUIA 4ZQGA 3HSYA 4FSXA 4UE3S 1M34E 1QYIA 3QEJA 4DABA 4FIZA 3SHVA 1T4MA 3RSHA 1JECA 3UT5A 3OE4A 4GOKA 4WL0A 4UEWA 4RF3A 4GZ3A 4QEZA 4TL7A 4O2RA 2P1RA 5B6PA 3U7HB 2JAHA 2XE6A 4ME6A 4UCQA 2VTBA 1HZJA 1E58A 3BAZA 1XP8A 3OF3A 4MWDA 4RHTA 3T61A 4EF5A 2WD7A 2ISQA 2BGUA 2XUFA 3RVMA 2PX4A 1DTEA 2ZAIA 2DFVA 3WLQA 5KNBA 3OA2A 5C4MA 3Q6NA 2FVYA 3HSKA 3RYTC 3BRSA 4INJA 2ZUUA 4I1VA 1ZC3A 4PR3A 5IANA 5ICGA 3GIWA 3M5CA 2UU9B 2B6NA 2OV4A 3DG9A 3SLRA 1GA6A 1X9IA 3ESCA 2E4ZA 1PU2A 5IBCA 1ZJZA 2J9RA 4QFMA 2YV3A 4K6CA 1GNVA 2Y1XA 3LH5A 1Z0DA 4NVRA 4X1KB 2BMEA 3MB5A 3LP6A 3RKRA 2YWBA 4OI0A 4X7RA 3AFNA 2OG2A 1EX1A 5G1PA 4C6SA 2W70A 5AW1A 4QXOA 1AGNA 3EFOA 3GC6A 3WL7A 3DFKA 4GSYA 1WQ3A 3OT1A 2AFVA 3VU9A 1S1MA 4G0UA 1KERA 3KR9A 2IHZA 3ENQA 3UGTA 4KQ1A 3NI2A 1T15A 4JHXA 4QWWA 5CT6A 1DX6A 1OTHA 2WQZA 4OPMA 5IM4F 5KU1A 2Z95A 3DTVD 2O4UX 4IDPA 4C3VA 5C4IA 1DQSA 4DDUA 4Q6WA 4XWGA 3E18A 5J9FA 2FW7A 4FE4A 1J23A 1M2WA 2QN8A 4MW6A 4XM0A 3TQSA 1L5HB 5BQ5A 1Z0ZA 3G13A 3MIIA 3ABOB 4FHEA 3V42A 4RZQA 4BFZA 4BP9A 5C18A 2BN4A 3RADC 1ILWA 1I3CA 3AKEA 3AHJA 1C7IA 4HMQA 5BSGA 1QNFA 3PRHA 4DCSA 4Y0AA 1RXUA 1BZYA 3A3PA 3BWDD 4KQ2A 4Z5XA 4X1YA 3SX4A 2PWPA 1ZLYA 4RTQA 4C0AC 5ADWA 3L49A 3IMFA 2WNIA 1MQSA 4DUGA 3SZMA 5A9SA 2OHIA 1IMOA 3RUPA 1U9IC 3K1AA 4D4HA 1PQYA 4HTAA 4O3FA 3P0HA 5AK4A 5JARA 1WPXA 4XIYA 2HJSA 5JTUA 4UU8A 2NGRA 3JZMA 1N9GA 3GD5A 5BWBA 2VWPA 5F7OA 3W5SA 4AU1A 4KFTA 4S04A 2VPZA 1D7OA 5T6BA 1PD1A 4HTFB 2MJLA 3KQLA 3BZWA 1KGSA 1BE8A 2EBFX 1Z8NA 2HJGA 3NRJA 3G9QA 1VPLA 4ENPA 3FMGA 3HVRA 5HUQA 4ZYTA 9ABPA 1YHZA 2VJMA 5FBLB 2XIQA 1P1IA 3LWNA 3Q0EA 1J24A 5H83A 3HWWA 2OHGA 1GZSA 4EPXA 3TMKA 1I6MA 3PEEA 4NYMQ 5LP1A 2FF7A 2FPPA 5DX1A 4YRJA 1XIVA 3FCUB 2FZVA 5SZIA 1JQDA 3UH0A