2GRJA

Crystal structure of dephospho-coa kinase (ec 2.7.1.24) (dephosphocoenzyme a kinase) (tm1387) from thermotoga maritima at 2.60 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
HHHMVIGVTGKIGTGKSTVCEILKNKYGAHVVNVDRIGHEVLEEVKEKLVELFGGSVLEDGKVNRKKLAGIVFESRENLKKLELLVHPLMKKRVQEIINKTSGLIVIEAALLKRMGLDQLCDHVITVVASRETILKRNREADRRLKFQEDIVPQGIVVANNSTLEDLEKKVEEVMKLVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dephospho-CoA kinase
publication title Crystal structure of Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) (tm1387) from THERMOTOGA MARITIMA at 2.60 A resolution
rcsb
source organism Thermotoga maritima
total genus 61
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2grjA00
3SU8A 4B44A 3IQWA 2BKEA 5FPKA 4IFEA 3GLFA 4E07A 4PAOA 4DLWA 5TB5A 4ARZA 2ZJ2A 1P3JA 4WAUA 2CMKA 2ZSFA 2C2HA 1C4OA 2IHBA 3IIJA 1NBMA 2CJWA 3MJHA 2CVHA 2O8DA 1UKEA 3GEIA 1VCMA 2YKGA 5KSPA 5FTKA 2R6CA 3REFA 3OIYA 1M2OB 1Z6YA 4JSYA 1A2KC 3PEVA 3EPKA 1W36D 3TUIC 1V5WA 1Z47A 4P33A 4B43A 2GAOA 4P4TA 2QP9X 2VP5A 4AYTA 3HR8A 4LJAA 1AQYA 2C5LA 1ZCAA 4EPRA 4KSBA 4B76A 1AZTA 4TQ9A 4JS0A 2L0XA 1A7JA 1ZUNB 2YVUA 4F93B 1UF9A 2FPKA 3T1VA 5FTLA 1TQ6A 4DCVA 5LD2B 1H8HD 2WSSA 3ZIAD 2GJ8A 4EPXA 1KJWA 3X1WA 5FOXA 2PT7A 2V1XA 2CBZA 4A8JC 4YMVA 3A37A 4EIWA 2JJ1D 4DLTA 2XEXA 3WYAA 3OHMA 3THYB 5FBLB 2Q3FA 5LBIA 3DM5A 3AM1A 2GCPA 2PBRA 3KJGA 2BDTA 3U3RA 1KSFX 4Y0AA 1B0UA 1Z83A 4M1OA 3ASYA 1ZM4A 3G0HA 4A36A 3BE4A 3MLEA 3OAAA 4HAUA 4C3ZA 1CKEA 1S96A 1RRFA 4I4LA 3T34A 1Q21A 2FNAA 2AFHE 4LC0A 3K0FA 3OZXA 1T0HB 2ASEA 3OEEA 3UWKA 3QENA 2P3SA 4BZXA 4ZDKA 1XWIA 2VHQA 1SVIA 1NLYA 2G6BA 2TMKA 3EZ2A 4IW3B 5HR5A 1E2IA 1CU1A 3AVXA 3PEYA 4F4JA 2KE5A 2P6RA 1M34E 1SVWA 5HCNA 1Z07A 2WMNB 2DYKA 3RS5A 4A9AA 4Q4HB 4TTRA 1XRJA 2ZJZA 3GP8A 5DH9A 1T3SA 4TMWA 1E9FA 4ZDWA 4CF7A 2CHGA 121PA 2F7SA 2PMKA 4Q48A 2OCPA 1IN4A 3ZVRA 4RD0A 1EXMA 1YE8A 2W00A 3C8UA 1E99A 4KYUA 5TXGA 1GL9B 3FMIA 4HAWA 4JLDA 2BCJQ 1AN0A 5FH9A 3THXA 1JR3D 2KSQA 4LJ5A 5FPTA 2ORVA 1XMIA 2GXUA 2WBLC 2R44A 3CW2A 2IT1A 1KDPA 4R2HA 2C04A 1VYTA 1DEKA 2XNDD 3CWQA 4TSFA 1VYVA 5CJ2A 2OEPA 4DKXA 3EZ9A 2R6FA 1IHUA 3NBZC 4GPTA 1Z06A 3EWSA 521PA 3A4MA 5JFGA 1UEJA 4H9GA 2BM0A 4CRWB 4RD4A 1U8YA 1GNRA 1OH7A 3V9PA 2VL7A 5TARA 2FZ4A 2H1LA 5BN3A 3KB1A 3WMEA 4O2LA 1IXZA 2ZITA 2V8OA 3UK6A 2O0KA 4PANA 4TMTA 4Q4AA 3QVUA 1NN5A 1N3BA 1HV8A 4Q1EA 3R20A 1XB2A 2PH1A 4NMMA 1E2KA 3MWYW 3MSXA 1E4VA 2P65A 1YR8A 1RJ9A 2WV9A 4B33A 1W5TA 2BVNA 2GJ9A 2OSBA 2QTHA 3SYNA 5L3SB 2H5EA 2WWWA 1MH1A 3FHTA 2NPFA 4BFZA 3DKVA 2J7PA 2BHRA 2HEIA 3ZYCA 5EZ5A 4BRWA 8OHMA 1CIPA 1ZYUA 5J4HA 2FSHA 3EPHA 4K46A 1A2BA 4E03A 2B8WA 1CEEA 2JIZD 1WBBA 1EK0A 5JRJA 2C9OA 4HLUA 2WTUA 4HZUB 1II8A 4I1VA 3I5XA 3QBTA 2AD5A 5A0FA 1X8LA 4KFUA 1MO5A 3KTAB 4MKIA 2VHJA 3KL4A 4PHHA 3GLIE 1E9CA 1OYYA 2G88A 4OKSA 3ONWA 4IDPA 5EXSA 1Y63A 3B6EA 2WWXA 4NBSA 3CX7A 3LNCA 2WAYA 4MRPA 1TUEA 1Q1ZA 1FTNA 3QKSB 3C5CA 3A8TA 1KI2A 4FXPA 1GP2A 1ZC4A 3PUYA 3V00A 2OXCA 1E9SA 1KDOA 2IW3A 5JSZA 3U7GA 2VLIA 1KK2A 1W47A 1K5GA 1L7VC 3VR6A 5KU1A 1C9KA 1TMKA 2J59A 4B2LA 2MSDB 2ZPTX 1S3GA 3TH5A 5IT5A 1LB1B 4LUCA 3VX3A 2VO1A 4EPVA 4JZKA 4NH0A 1M7BA 4TYYA 4PZYA 1VG8A 3QF7A 4Q1CA 2ZI6A 3QY0A 4WOPA 2C96A 2ODWA 3KQHA 2V7QA 3Q72A 1W4CA 5GVSA 1AM4D 2V55B 4JJKA 4M53A 2DFLA 3QG1A 2A5GA 2QMOA 3K9HA 4ITRC 1HE8B 1W5SA 1ZCBA 3O8BA 2XB4A 1PUIA 4NYMR 4Q9IA 4LHZA 2HDNB 1OHHD 2VA8A 1Q12A 3AKCA 1S9DA 4WIAA 4YMSA 1YZNA 2RKOA 3CBQA 2HXSA 4JVSB 2AFIE 4Q5IA 2O8BA 1X8KA 1S0UA 1DELA 1SZPA 1FMLA 1ZM3A 4OJQA 3TVTA 3QF4A 1FUKA 5KOYA 3D3QA 4IVQA 5IDVA 1AGRA 4CZ2A 2GXSA 3CIOA 3AVQA 4DLUA 1R6BX 3JZMA 4M9SA 5M04A 2RGCA 4GP6A 5D3MA 1M74A 2RGAA 1G19A 4LYHA 4TMKA 4XOIA 2RGNC 4F38A 2ZJOA 4M1MA 2QQ0A 3CRW1 4Q4LA 2YWHA 4DDWA 5GJBA 3R7WB 1KNQA 1WXQA 2Z4RA 4Z8XA 4EUNA 2GK7A 1QDEA 4F92B 1EFRD 4BFTA 2J1LA 4QOSA 4TMZA 4MRNA 2P2LA 4Q7MB 3L8ZA 1JQJC 2CHQA 3OE7A 1KKMA 4DCSA 4KO8A 4G5RA 2D06A 3I4LA 1U0LA 621PA 1VPLA 1U81A 1W0KD 5DYIA 3FKQA 1F6BA 1KGDA 2QORA 5FPHA 3GLFB 1DADA 1N6KA 1C1YA 4IKEA 4ARZB 4TQAA 4QGFA 2XOKD 3U44A 3TGPA 2CJWB 2F43A 5JEEA 1OIVA 3WNDA 2O8DB 4LPKA 2REOA 1JPJA 3G82C 5EE9A 4ZDJA 2BMFA 3AGQA 2FFHA 2AN9A 4L9SA 1NSFA 5HE8A 3O8CA 4D80A 5IHPA 1LFDB 4PR0A 5B30A 1XXHA 4ERNA 1Z0IA 4JSTA 4ZO4A 3DL0A 4MUAA 4MRVA 4QRHA 3OFNA 1HYQA 1GIAA 1KK1A 1YQTA 3TR0A 3ZVLA 1CJKC 4US0R 2AD1A 1EFUA 1OXUA 1SKQA 2F55A 4OHYA 1IN6A 2JLUA 5ELXA 5EUMA 3P4XA 2ZRKA 4G5GA 3TW8B 4MYUA 1Z3IX 2LWIA 3PITA 5EXPA 2PL3A 3S1AA 4NHOA 1NJGA 2IEZA 3WY9A 5C1BA 2QTVB 3LLUA 2HT6A 4XVRA 4QGGA 1VYUA 3HP1A 1W4AA 4OK3A 5LD2C 3R9WA 1IY0A 2ZE8A 3BXZA 4QJ3A 5DN6D 2NPIA 4KJZA 4KVGA 1JEDA 2WJYA 1Z08A 2XSZA 3LXRA 1E79A 2QMHA 4LV5B 3UG7A 5C18A 2ANBA 2GEVA 4TN1A 3K0FB 4LJ6A 4O3MA 1I4DD 2FV8A 2I1VB 4I81A 3WYFA 4C7OA 2NO0A 2B92A 3GJ0A 4XSGA 2D74A 2YJTD 4BASA 4MYTA 4UQOA 3FYHA 3EPLA 4KFRA 2VQSA 5JI3E 3NBXX 4NL4H 3BBPA 4QHYA 5TV2A 4JLBA 4C30A 2EYQA 3ZQ6A 4URVR 5BXQC 4DLZA 3JVVA 3NIBA 2AWOA 3RDPA 3UPUA 3U3OA 1N6IA 2GETA 4V02A 4II7A 3RLFA 3ZDQA 2HYDA 5KDLA 2IWRA 4LHXA 3W8RA 4C0AC 5CB6A 3A1UA 4TYWA 2Q9BA 2OFOA 3I1FA 4JBYA 4DVGA 1YR9A 4ASUA 1TU4A 1Q0UA 4D26A 3DOFA 4YMWA 2IXEA 3THXB 5KPJA 1N6PA 2GJSA 3RRMA 1CR2A 2HXYA 4MDFA 1U0HC 2SHKA 1E69A 2ZSDA 1HA3A 5JHHB 3GLGA 2QBYA 1E1RD 1QBKC 3AKDA 1R0XA 3VR5A 4XVUA 1FW6A 4P0TA 2FH5B 3MG9A 1A82A 4YMUA 3CONA 1T9HA 1E96A 1SULA 3MFYA 2YV5A 3Q7PA 4BWYA 4R7ZA 5FL3A 4TMVA 2ZXUA 1OIXA 1KDRA 1SQ5A 5E3HA 4LI0A 3W8NA 2JDIA 1E2NA 2F9LA 1TL7C 1ELOA 4RZ2A 5FBRB 2JLQA 4DIEA 1G8YA 1TEXA 3BORA 1NI3A 2DBYA 3IBYA 4EPYA 5K8UA 1DAEA 4LHWA 5G40A 1MR3F 3QXSA 4IOLA 4Q4AB 4R98A 3ECCA 4B2IA 2D7CA 3L2OB 3U60B 1U90A 5SZJA 4HB2A 3ZS9A 2YINC 2OBMA 2ZRMA 3T5DA 1T5LA 5JJLA 1AKYA 5GVRA 4NCHA 3EWAA 2GBLC 1RJ9B 4D25A 1Z22A 2C8VA 4OI2A 2ZRHA 1G8HA 3LW8A 4PZLA 1CJTC 2XTZA 3P27A 1DBSA 1ZD1A 1WP9A 3VR4A 4JLMA 4BLTA 5B57C 4L9WA 2HCBA 4JLJA 3EZ7A 3ICEA 3K70D 1U9IA 2FSFA 1DAKA 2ZRGA 1DS6A 3VX4A 3GFTA 1II8B 4HLCA 5J4YA 3CRVA 3NHBA 4U02A 2NO6A 5EE0A 1CR4A 1MO4A 4DUGD 1E9AA 1VCOA 3B9PA 2ZU0C 4DLSA 5DI3A 1NP6A 1XMVA 4QJ4A 4DDVA 5FOVA 4YXWA 1VHLA 2BEKA 2H92A 4MRSA 1G7CA 2C03A 1W46A 4PSKA 1DAHA 2G77B 1RFLA 3RS7A 3NXSA 2ERXA 1QHGA 4IXMA 4ACBA 3I5YA 2ZIAA 4LJ7A 4PFSA 1G7RA 5JSZB 2VP9A 2CXXA 4NCIA 1XTSA 2ZRFA 2W2TA 3R8CA 3NH6A 5J47A 3DHWC 2ERYA 4V0LA 4FMCF 1GFIA 1KKLA 4B71A 4EFMA 1QHHA 4JVMA 3THOA 1XCPA 2Q3MA 1G3IA 2YWGA 2ZS7A 1CP2A 1VG1A 3QXHA 4M9ZA 1E1RA 2ZRLA 1SVKA 1G3RA 3IO3A 4LV6A 4NZYA 5BYJA 2EFCB 4U7DA 1SVLA 4Y0VA 5LB4A 5TVKA 4JLPA 5FL7D 3ZH9B 1E0SA 1PV4A 2BMEA 3SZRA 2QU8A 2ZI9A 2G0NA 1Z29A 1NG1A 2AXPA 3R9XA 3KFXA 1TF5A 1CJVC 3LV8A 4LBYA 4KBFA 3VNUA 3W6PA 2O8BB 1W44A 4V0NA 3EARA 4KXFB 1X8JA 2FWRA 6Q21A 3Q9LA 2GJAA 1EGAA 2DWOA 1JECA 2ZRBA 2FSIA 5E7IA 5HKKA 3GLFE 2ZRJA 3M1IA 4HAZA 2QNRA 1HT2E 5D3MB 2EVWX 1G9XA 5L8VA 1G7TA 2ZUDA 2XX3A 2J41A 4B6EA 2V6JA 2OE2A 1ANKA 2ZYTX 4UJ5A 3CNLA 2KWIA 3F3YA 4IDHA 2GCNA 1W0JD 2V1UA 4HSEA 1OKKD 1P6XA 1QHSA 1TADA 2KB0A 3CX6A 5F9FA 1PJRA 3H86A 3B5JA 4XTRA 2Z83A 1WF3A 3GD7A 1SVMA 1YR7A 1ZNYA 4OQFA 4RZ3A 4S2EA 4J0QA 2ZI5A 2OAQ1 3B60A 4X8MA 4A2QA 4GOXA 2GTPA 3C7KA 3RS2A 5IF9A 4F7WA 3O8DA 4C0SA 1P2SA 3M0EA 4L5BA 4WXRA 4IXNA 5FBQB 3FTQA 1H65A 5DNYB 1K5DA 2ANCA 3U6BA 2W6IA 3SHWA 4AY2A 3U44B 1DAGA 4M9QA 4S35A 2F43B 4B3GA 2ZSBA 4OHWA 2DFTA 3H84A 3HU2A 4NU0A 2HUPA 4MKHA 4WW0A 2PJRA 2XGJA 4ZCIA 3LVRE 4A0GA 2R62A 1XTJA 1FX0A 1VDZA 2IF2A 4EJSA 2BJVA 4C2UA 3QKUA 5KNBA 2QUZA 1E2HA 5CYOA 1XXHB 3P32A 1R7RA 1E2PA 3UANA 3BK7A 4RKFA 3EIHA 1COWA 1Z0JA 4IOJA 4D0NA 5C4MA 3H4MA 2F3RA 4UNRA 4F91B 1QVAA 4MUBA 721PA 5JCZA 1UFQA 1ZD9A 3KJEA 3IHWA 5KUTA 3KX2A 1Q3HA 4P4UA 3AKEA 4FMCB 3S1AB 2Z4SA 4Z51A 2I3BA 4X8OA 2ZYVX 3K0CA 1R0YA 2ZI3A 1LNZA 3VHLB 3D31A 2PJZA 3A1SA 3AV0B 3KJIA 1RYHA 2GESA 2GHIA 4XSHA 3SQXA 1OXVA 3SHFA 4C7OB 5HCIA 2PT5A 2AHOA 2J5XA 4DHEA 2OBNA 3U6KA 2AK3A 1G3MA 1KZGB 2QAJA 4OHZA 2ZE5A 2FGJA 5KPDA 1OFIA 4KV9A 4LSGA 2YYZA 2BWJA 3TE6A 2A30A 1MV5A 4PPQA 1T6NA 4TLEA 4HLDA 3KUCA 1OKKA 4A0RA 1Z6GA 1P73A 1U98A 2C9CA 1ZJ6A 2YOGA 1PLLA 3GJ4A 5G3YA 5FR1A 2QP3A 1TTTA 1J90A 4JIMA 4FWIB 4F4CA 2ZI7A 3GEEA 4PZZA 3GLGB 1DG3A 1OIWA 3QUSA 2QBYB 1UBCA 1GL7A 4P3YA 3LFUA 2W58A 1XTRA 4R71A 1K6MA 3T35A 2WM9B 1WBDA 3RC8A 1R5BA 1ZU5A 1E9EA 3P26A 3QIAA 1N6NA 2CVFA 2F1JA 3IIMA 4Q9JA 4BGDA 3B1ZA 1UDWA 4E09A 2CNWA 4ZDIA 3I32A 4RD3A 1S8FA 3QXJA 3K09C 3QEOA 221PA 1Q1BA 4KBGA 2JLWA 1N5KA 4DXAA 4KLNA 5EE3A 3R9IA 3RWOA 2IYRA 2RHDA 1KMHB 2O8CA 1G21E 1IAQA 3LBNA 3RNLA 2UKDA 1BH2A 1N5IA 2V4ZA 1LY1A 2PLFA 3P4YA 4RJLA 4YDSA 3LAWA 4W9MC 1ZMXA 2GNOA 4LRWA 4QFMA 1UADA 1VECA 3W3AA 4CEHA 4GL2A 3FHCB 3W6OA 2KJQA 5L3VA 1GKUB 1NKTA 4NYMQ 1IN8A 3VKHA 2MSEB 1NN1A 2VHCA 2ODBA 4PO9A 4ZCLA 1N0VC 1D2MA 3IILA 3PEWA 1SXJA 1H8ED 3MWJA 2J87A 4B3DA 2FF7A 2OLJA 2PX0A 2R6GA 1E9DA 1XD2A 2VP4A 5GJCA 5TY0A 5DI3B 4D81A 2Z0MA 4PSVA 1ESMA 1JR3E 1OXTA 2JLRA 3IUYA 3L8YA 2W6JD 1I2DA 2AX4A 4HUQA 5DGXA 3SJAA 2JCSA 1CF4A 2G9NA 4HLUC 2H8KA 4RZXA 4CEIA 1FZQA 1OFTA 1E94E 3AF3A 4NPHA 4DB4A 1DPFA 3FOZA 2W0MA 1X6VA 1G8FA 3AVPA 1BOFA 1E0KA 1LF5A 2ZVPX 4G5OA 4CGZA 1V43A 2QE7D 4DJTA 5SZHB 3U4QA 2UVQA 1J8YF 3HYTA 4Q02A 5HPYB 2CLDX 3FKSD 1LVGA 1EG7A 2N1BA 2LKDA 3DO6A 4LJ8A 5CM9C 3GJXC 821PA 1HH4A 1ZNXA 4GOKA 4DT1A 3FB4A 1QHHB 4PQRA 3I92A 2B21A 1Q57A 5EE5B 2BV3A 1LS1A 5FFMA 3BFKA 1G16A 1YRBA 3OEHA 4EKDA 5KSYA 1YZUA 1P5ZB 1XD8A 1UDXA 2JGNA 3KQNA 1HY3A 4Q7LA 2Z5FA 2WZQA 5B64A 4OI4A 5BWMA 2D4HA 1FNNA 1U94A 3RS4A 3U3MA 4B32A 5D3QA 3BAFA 2Q3HA 3CZPA 2V3CC 2EFDB 3NWJA 4PAQA 4LPSA 4IOKA 3PCRB 1NKSA 3PV0A 4HUTA 4OQLA 3RSLA 1XZQA 4JL6A 2OG2A 4PC2A 2QAGA 2BBTA 3PR1A 3GJ5A 4PHFA 2BM1A 2OV2A 1Z28A 2IWHA 2QRNA 1S4QA 1O3YA 4ESVA 4PHTA 1CBUA 4B3BA 4NONA 2EW1A 4PHGA 2WWYA 3CUEF 4XD7D 3GPLA 1T3LA 3HJNA 2H18A 1H8HA 4W5WA 3ZIAA 2CE2X 3BERA 2GVZC 4QKQA 3C5HA 1JB1A 3NBYC 3PEUA 3QNUA 4PO1A 2O5VA 4TTQA 1XXHE 2ZTSA 5DI9A 4QGAA 3I73A 2JJ1A 4LJYA 3G5UA 5FUYA 2ZRCA 3DZ8A 2QI9C 3PENA 3W6NA 3MAAC 4KITB 3L0SA 3HYRA 4JLAA 2FA9A 1HUQA 5A4JA 3FFAA 4URWR 2GRJA 4JJZA 1ZM9A 3SEAA 5AUOB 1BMFD 2ATVA 1WCV1 3ADKA 2ZAOA 1I2MA 4DRZA 4US2R 2I4IA 3EA5A 4AG5A 2NO9A 1T0JB 5KDOA 5J4VA 3OIWA 2FEMA 3CF0A 4NTZA 4PQYA 2R9VA 1KSJA 1NL3A 3KDSE 3GJ8A 4Q21A 4R9UC 2Q9CA 1OT3A 2V6IA 1IXRC 3Q7QA 5AJYA 3T1TA 4WBSA 5EP2A 4B3XA 1FX0B 3BS4A 4EJSB 2G3YA 2ZUBA 2WJGA 3SJCA 4JYBA 2J45A 3UIEA 2DR3A 1P2TA 3KXIA 1AS2A 1QHYA 4LBVA 4Q00A 3VHXA 3W9YA 4ABYA 4LZZA 4BEBA 1R10A 3AB3A 2Q9AA 4QNMA 3CO5A 3U7FB 3MJRA 2OILA 1R0ZA 2WVJA 3PUVA 2REXB 3NEYA 4KHZA 3U3JA 5KHOC 3L82B 1HQCA 1JR3A 3AUXA 5KO2A 1F2TB 1SHKA 3WHKA 4IDNA 1II9A 2OFWA 2Y8EA 2ZQ5A 2IYLD 4D4MA 2GCOA 3DOEA 1RE0A 1AS3A 2XNDA 1OF1A 1KSGA 2HF8A 4F4IA 1E0JA 4V0MA 1J70A 3B78A 3DZDA 2OLKA 1GVNB 1BYUA 4LOAA 1PVOA 4M2LA 3IIKA 4R2IA 2YNMA 3W5IA 2P5SA 2WWFA 3BFVA 4PXAA 2AKAB 5JI2E 5EXXA 1CR0A 1GG2A 4M1KA 2Q6TA 3A4NA 4TL9A 3WHLA 4DDTA 4UNNA 3GLGE 3RAPR 3IPYA 4OYHA 2ONJA 3CPEA 3VR1A 4ZV4A 2XXAA 1IBRA 4LDJA 4LYJA 4URUR 2ZRDA 4PTLA 4A2PA 2OHFA 4Q01A 1DAMA 1PLJA 5JLJA 1XMJA 3SC3A 3AH8A 3ZZ0A 2JJ2D 2A5YB 2BCGY 3ICQB 4Q9LA 5HE9A 1PZNA 2HLDD 2Q0HA 4YMTA 5C4GB 3JVUA 1IN7A 4JLOA 1J7KA 1XMSA 2LCFA 3ASZA 3BGWA 4TYQA 2IYYA 2JIZA 2CDNA 2P6NA 1T8UA 2ZYWX 4UJ3A 2MSCB 2FE4A 5CLQA 3WRYC 1E9RA 4FINA 1Q1QA 1S2MA 3MMPA 2RMKA 4OQMA 1XF9A 2QM8A 1HE1C 1TF2A 2C78A 1J99A 1E3MA 3LXXA 2IYSA 1KDTA 3QEJA 1FUUA 4BLSA 3M6AA 2UZ3A 5JEDA 2RGDA 4UNPA 3I62A 4C2TA 1LS6A 1UBFA 3OF5A 1KJZA 4BECA 3GJ3A 4HZIA 2IS4A 2P6UA 2PZEA 5AJXA 4PQFA 1W7AA 3B85A 2J0SA 5KSOA 1J2JA 2B7BA 3JZAA 1R8QA 2ZAMA 5H68A 2QQEA 4TZ0A 5F3WB 2O8CB 1M7HA 4PC6A 1AS0A 3AF4A 4FCVA 2IS2A 2F1HA 2QSZA 2BBOA 1LW7A 1XJCA 4W5HA 3O8RA 3T06B 1TQDA 5CLLA 1XBTA 2YOHA 5J5CA 3K8YA 3Q5EA 5SZKB 4CEHB 2R65A 3U61B 3X1ZA 2QTFA 1G20E 2QPTA 4TL8A 1WE2A 4G0NA 3UMSA 2FFQA 2AK2A 2G1JA 4LBWA 5ANRB 1S1MA 5DHAA 5KYKA 1KO8A 3KKQA 1KAGA 5J40A 1SXJB 1W49A 2GA8A 5JWOA 4V0KA 1LV7A 1TUIA 4LC1A 3SBEA 3WBJA 4LHYA 5KTYA 1UPTA 4KFTA 5F98A 1XD2B 3I8SA 1OHHA 1KMQA 3QXCA 4YQFA 1P7CA 4JVNA 3V4FA 1U9IC 4JKYA 4PC1A 4HUQB 4N1AA 4QHSA 1A1VA 1E1QD 4CEIB 1KO5A 4W5JA 4RVCA 1GOTA 3X2SA 3HWSA 4POAA 2IL1A 2NO7A 2NOAA 2ZJAA 3IBGA 2IYTA 4BPBA 3EG5A 3GLHA 1DTSA 2A2ZA 1Z8FA 3U4QB 1IJEA 3NG1A 1P4SA 1IONA 1DO2A 5KDDA 3KKPA 1W48A 2D2EA 2V54A 2IX3A 2OCAA 1NMZA 4FMBB 2MMCA 1EFRA 5BW8A 4D0GA 4G5QA 4ZPXA 4DT1B 2H7VA 2RGNA 3D6TB 4LGMA 4L4UA 5FTMA 4N0DA 4I1SA 3HPRA 3HU3A 4OQXA 1W0KA 2RGEA 4ON9A 4PPFA 2X2EA 3THWA 4NKRA 3HDTA 5FUXA 4BZPA 4JT4A 4AI6A 2KBFA 1W4BA 3AUYA 4MYCA 4EPWA 2QY9A 3AF2A 5FI0B 3MUFA 2XOKA 2ZYUX 4C0QC 3TKLA 4DCUA 1E32A 1E2EA 1ZNWA 1IJFA 4A2WA 4AK9A 3B1YA 1G4AE 4H1UA 1Q44A 4OK5A 3ADBA 3EC1A 2IYQA 5TDHA 4YDHB 1W36B 2QAGB 4EPTA 3DMNA 5CK4A 2NIPA 1NVWQ 1XTIA 1LTQA 5AWFC 1P60A 4KAXA 4OBEA 1ZIPA 2ZSEA 2Z6VA 1XEWX 2XAUA 4GNKA 4AWXA 1TF7A 1BKDR 4KYIB 1VG9B 4CW7A 3PUXA 3ZD6A 1N25A 2JAQA 1RPZA 1ZD8A 5H1YA 4KLZA 4MGYR 2D62A 3GJ7A 4JVLA 4Z1MD 4B73A 4GZLA 2BEJA 2AR7A 3KKOA 2N42A 1DOAA 3ETLA 1M1YE 4TQUS 4QM7A 3VR3A 1D2EA 3MGCA 1GRNA 3CH4B 2ZM5A 1MABA 4OJKA 3BD9A 3N70A 3U7EB 1VG0B 2R6AA 1Q22A 4B3CA 2IBMA 4IHQA 3TSWA 4BLRA 2IYUA 4PC7A 1YRAA 1CJUC 2B7CA 5DN6A 2GJKA 3UWOA 3BH7A 1NN3A 2DWQA 3J81k 1DAIA 1YKSA 4E5UA 1GKIA 3TQFA 5C2JB 3LH5A 2NO1A 4RFSA 1E1QA 3V4RA 4JL8A 3TAHA 1KO1A 3U5ZB 1W1WA 2ZS9A 4PPNA 3DDCA 5AJVB 1UAAA 1YVDA 1EFCA 4LX0A 3H2YA 5FOUA 3B8HA 4MH0R 2PZGA 5JMTA 2EFGA 3CR7A 4LJ9A 1QRAA 3CWZA 3SBDA 4GOJA 5B2ZA 3RRNA 1NNEA 4WZBE 3AVWA 1G8GA 4D4KA 2YC4C 3KXLA 2RGBA 4KSCA 2F1RA 4EJSC 1XP8A 2XJ4A 2FPLA 4OQNA 1OFUX 4IEEA 4HYYA 2YZ2A 5FUVA 1EX7A 4CVNA 1MRNA 3I8XA 4DSUA 1L4YA 4QHTA 1OXSC 3PFIA 4GFDA 5AUPB 4QBIA 1UKYA 3I61A 2MMGA 2GCOB 2J46A 3WNCA 2ZE7A 4CEJA 1OJLA 2YWEA 4O0MA 2RHMA 3SN6A 3W34A 1CTQA 3CX8A 3CRQA 2HF9A 4QNRA 3WBKA 2PEZA 4URZR 4JT2A 4JKIA 3KXKA 1ZC3A 1GNPA 1UBEA 4QJ5A 4TL6A 3WRXC 2IF0A 3K0CC 1ZM7A 3QF4B 1D5CA 4NYJR 1Z6XA 2PZFA 5CDFA 2XXAB 1GITA 1UKZA 3QXXA 1E2LA 2PMDA 1K8RA 1CXZA 4QXAA 1XU4A 2AKYA 3LA6A 4GP7A 5FI1B 5JJIA 1QZXA 2FMXA 3ZLJA 3VU9A 4XVQA 2QMEA 4GMXA 4DSNA 4DSOA 1AK2A 1XZPA 4OHXA 1NSTA 1NN0A 1X86B 1OV4A 1UKVY 2VTKA 2W0SA 2ZS8A 3VR2A 5CIWA 2JATA 2A7QA 4G3XA 1Z0DA 2ZRIA 3CF6R 2CCKA 3MRSA 3FHOA 2GXAA 1JPNA 1CR1A 2F9MA 3K0AA 3L0IB 3NHAA 1Z0FA 2CK3D 5E4FA 3T61A 4DUGA 4DLVA 2BIFA 3M4YA 1SHZA 2FFAA 2EWWA 2HJVA 1N0WA 4HAVA 4ILEA 2J0UA 4GRAA 2NG1A 3RRZA 1KI7A 3VQTA 2BOVA 4TT3D 1MRSA 2B6HA 4HATA 2ZI4A 1TQ2A 3PQCA 1SXJE 2WPDD 4FW9A 4LBZA 3RS0A 4LWZA 3AGPA 3AF1A 2J3EA 1QG4A 1QHIA 1U8AA 4A4DA 1N5LA 4C0KA 2D3WA 4PO8A 3D7MA 2FFBA 4V0OA 2WKQA 2VP6A 3LY5A 4JLKA 1Q20A 4XWOA 4TZ6A 4EQ6A 5GADl 4Q7JB 1RKBA 2PX3A 4BFYA 5JBQA 1US8A 2BBWA 5H70A 1GSIA 1JNYA 1RYFA 2QGZA 4YLGA 3W90A 1TQ4A 1M8PA 5IK2D 1G18A 2O0JA 4TL7A 3SQWA 2QSYA 3C14C 4KI0A 2NQ2C 1NBMD 1NIJA 2EFEB 5DO9A 3PUWA 1QG2A 2OBLA 2QGNA 4QGHA 2FZLA 1CJMA 2O8FA 1OB2A 1OB5A 1MT0A 4QG7A 4CYMA 1A4RA 2K5UA 4FN5A 3RHFA 1DO0A 5FL7A 3QKTA 3VAAA 1FL9A 4DCTA 3TNFA 3I72A 4OI1A 2BJWA 4FWTA 4LJ4A 5DYGA 2BKUA 2O8EA 1N6RA 1ZW6A 2CEAA 2IYWA 4AYWA 1SXJC 2BMJA 2WSSD 5BQ5A 1XPOA 3HU1A 3N5CA 1BYIA 5CYPA 4HDOB 2ATXA 1HQYE 1Q3TA 2ZJ5A 1VMAA 3GLHB 3X1XA 3KFVA 1Z6AA 1ZINA 4QL3A 2VPPA 2GVDC 4FD2A 5DSZA 1W0JA 4DDUA 4C0BA 5BYKA 4D4JA 2QZ4A 3OAAD 4XWAA 4BFWA 1MOZA 5C46F 1T4GA 3QPWA 4P4SA 4A15A 1G5PA 4NCJA 4Q19A 3AKYA 4TYPA 2CK3A 3A1WA 3WP1B 2A3RA 2OO7A 2WICA 4V03A 1YZGA 3OEED 3THWB 3EASA 1N5JA 4NYIR 5DLQC 2QG6A 4Q9HA 1NRJB 3EC2A 2CL6X 1G6OA 1SKYB 1NG9A 4MDEA 2DB3A 2WMOB 1G5RA 1F60A 2CHVA 5JRZA 4RZUA 3O47A 2VBCA 4TLCA 4M1TA 5AUQA 5F9HA 1A5TA 4ZIRA 4U5XA 3GMTA 5DIFA 5G53C 2WWHA 4URXR 3AVOA 3VFDA 2C77A 1I4TD 1FNMA 5JJKA 2VYFA 3CZQA 3FMFA 2X1VA 2CCGA 1IQPA 3RYTC 1OH6A 3EPJA 1NY6A 1G41A 1EFHA 4IVRA 2ZR0A 5K8TA 1RIFA 5IK2A 1W2GA 4TSFD 5FOWA 1W36C 2QAGC 2F6RA 1QVRA 2W2VA 4QC2A 2HJGA 4ZI2A 3LVQE 3L43A 3BB1A 4TLBA 5CB8A 4JBXA 2IXFA 4HAYA 3EA0A 3WNBA 2GDJA 2BBSA 1NVVR 5JS7A 2ZVQX 1MABB 2A78A 1QHXA 2EYUA 1KSHA 2VH5R 3B1XA 1X1RA 4FCWA 3QPUA 5DE3A 2ZJYA 2UZIR 4B75A 5CK5A 4Q1BA 5KNCA 1GWNA 1U2RA 2H17A 3GFOA 3PG5A 3BRWD 4D2IA 2XB2A 1O87A 2WJHA 1XD9A 4IRUB 4IEIA 2EU8A 1KI8A 3A6PC 2Z43A 4DLYA 4RFSB 3LRPA 4PPGA 2AXNA 4EDHA 3UMFA 3QG5A 4FI3C 1OE0A 3CRMA 2JJ8A 3KJHA 2ZE6A 1YHNA 2J7PD 4IDQA 4V0ME 1Z6TA 4B48A 5HZKA 3T1OA 1BO6A 4RD2A 3CR8A 4TWZA 4D82A 1R4AA 2FEOA 3BH6A 2OT3B 1P2UA 1F3OA 3F8TA 1OW3B 4GI7A 2ODEA 3BB3A 3LWNA 4IOMA 3BIFA 4AYXA 1Z5ZA 5G41A 1QF9A 2REBA 2H57A 2FGKA 3EIEA 4L8GA 4AKGA 2DCUA 5CITA 3PJRA 2CE7A 4P32A 4PSAA 4URYR 4UXIA 1E0AA 2IUTA 1PUJA 1TNDA 1JAIA 1OPXA 2IYZA 2JLSA 2NGRA 3EAQA 5E7MA 3B7GA 2IS1A 5GJVC 4NCKA 1D9ZA 1F5NA 3Q85A 1UEIA 4B2PA 1JXOA 4WVFA 3IDQA 2VSOA 1L4UA 2G0TA 4Q47A 4XIGS 4UKDA 3E5HA 2QPOA 4CEJB 2VSXA 3DKPA 1G5TA 1NMYA 3FFBA 2N46A 5B58C 4RFVA 2EQBA 1P9WA 3NDBB 2PCLA 1GZSA 2W83A 3B1WA 3EZFA 3GEHA 3SE0A 5LDDC 4UNQA 3C16C 1IY2A 2VHTA 5L3RA 2FN4A 1KO4A 2ZJ8A 2WJJA 3K53A 1GUAA 2PLRA 3Q8XB 1MO6A 4MKFA 4XJXA 3K9LA 2W2XA 3C4JA 3I3SR 4A6XA 3FE2A 3U7HB 1OH8A 1IOZA 1WDTA 3IGFA 2JEOA 2V7QD 2O0HA 3K09A 5LB2A 1BIFA 3VU9B 1XNJA 3FVQA 2JLVA 1XDBA 2CLSA 1XFAA 2FOLA 2AWNA 3TW4A 2D2FA 2J0VA 2HV8A 4DB2A 1ZUHA 2OCBA 2IK8A 3TK1A 3K70B 5UKDA 1ZP6A 1CS4C 2YOFA 4JLNA 4O25A 4DCNA 1OYWA 2OUKA 3TSOA 4Z8YA 4X8LA 4LY6A 1VHTA 3K0AB 1GAJA 3NC0C 3A4LA 1H8EA 1KOFA 5CM8B 1RVDA 4LCBA 4A8JA 4UNSA 2IS6A 5KSZA 3A36A 2QMUA 3EZ6A 2W6JA 1R5NA 2J0UB 3QJYA 2H16A 3CF2A 5JZVA 1P75A 1R2QA 4N0EA 5K8LA 4HB3A 2O52A 1XEXA 1IM2A 2QEQA 3NKVA 1YU9A 1ZRHA 1P9NA 3LW7A 1KJYA 4PC3A 4N3NA 3AVYA 1AGPA 1DG1G 1NLZA 4CDGA 2XZOA 2VIIA 2QE7A 1KNXA 1T5IA 1WRBA 3OE7D 3ZZUA 2ZEJA 1GNQA 2GF0A 4GBMA 1HURA 3FKSA 1Z0AA 5H8WA 4G01B 4EQ6B 3K9NA 1US8B 1NVXQ 5K8IA 1S9HA 4YONB 3B1VA 1VIYA 3ND9A 2WJVA 3LX8A 2QPAA 2VHUA 5J4LA 1IXSB 3KB2A 4RD6A 4ZCMA 3PUZA 1FP7A 2IYXA 4LYAA 4NP6A 3SOPA 3GJ6A 4AKIA 3AQ4A 1YZTA 4WXPA 4CIDA 3K9GA 1KI6A 3K0EA 3GLHE 4Q1FA 3TBKA 4D0LB 2O8FB 4MKGA 3VMFA 1EWRA 2FU5C 2C98A 2QT0A 3MWKA 1G291 4C9BA 4TTPA 2BMDA 3IPXA 3CPHA 3EW9A 2RGGA 5F2EA 3QSYA 3DMDA 1KO7A 3SNHA 3U2QA 3FMPB 3OFND 1E9BA 3RSOA 1KHTA 1QHNA 1FMJA 2O8EB 2J9RA 4GSYA 1Y3AA 4MQBA 1Z2AA 1FP6A 1W4RA 4MGIR 2GF9A 2GEDA 4B47A 1GDDA 2V9PA 2XTMA 4UXJA 3NBFA 4QBGB 3L0OA 2WKRA 3EXAA 1FQKA 1RZ3A 5J4KA 2JLZA 1SKYE 4MGZR 4D4LA 1B23P 421PA 4M22A 3C41J 3EIQA 4WA7A 4M1SA 4M9XA 2G1KA 4I99A 3SFZA 4XD7A 1ZVQA 4DLXA 2NZJA 2X8AA 1YZLA 4UXHA 4ESHA 1G7SA 4W7SA 3Q3JB 2QL6A 2GZAA 1KI4A 2WOJA 2ZSAA 4TLAA 4AKEA 3K0SA 1Z0KA 5IRCD 4P4SB 2XSZD 4A82A 4KODA 5FTJA 4IFBA 1E79D 3CRRA 4OI0A 2D7DA 3N2EA 4HAXA 1GL6A 4EFNA 5AK0A 1FOEB 1N6LA 1BMFA 2OCYC 4HLQB 4C0HA 4CT5A 4M8NE 1KK0A 1GM5A 1E2DA 1Q1EA 1FFHA 1JBKA 1HT1E 1R0WA 2VP2A 3AEZA 3UKDA 3X1YA 4G5SA 4HEJA 4A0FA 3KQKA 1U99A 2IUUA 4QBHA 3TR5A 3CPJB 2DPXA 2YWFA 4ZIRB 4BQSA 4P31A 2FSGA 1AIPA 3F0TA 2C9YA 4BLQA 3H0KA 4M1WA 1JR6A 1HTWA 4Q66C 3B9QA 3T12A 4ACAA 2PEYA 4IVPA 4ASUD 4BFXA 3A1VA 3T1QA 3NTUA 4Q4JA 4WZ6A 4CT4B 1ZNZA 2XTNA 3SYKA 3ZD7A 1KI1A 4MA4A 3VTKA 3NDPA 2JA1A 2KBEA 2FG5A 1UJ2A 3PIRA 3OIVA 4AG6A 4LK2A 4KCGA 5EJEA 5BN5A 2OESA 1KTVA 3KKNA 1J8MF 1G3QA 2DWPA 3NC1C 3Q5DA 2JLYA 4YC7A 2DHRA 3VNVA 3KQLA 3QKRA 4M21A 2JDID 3QOFA 1EESA 3NVAA 2RB4A 4DZZA 2A5DA 1IN5A 3B2EA 2WAXA 2FX3A 3LLMA 2J7KA 4GT1A 3DPUA 3SYLA 4NYJQ 3IQXA 2F3TA 2FJUA 5FBWB 4JL5A 4JMPA 3UMRA 2ZRNA 3UATA 1E4YA 1T3HA 1D6JA 4C0JA 2X19A 1BS1A 1RRCA 3ZVMA 2BC9A 2WIAA 2HT1A 3RANA 3ND8A 1G17A 1KAOA 2GK6A 3REGA 1MKYA 1G1MA 5L3QA 1E2GA 2ZRAA 1KI9A 3T15A 4JLVA 2OAP1 3GLIA 3AVTA 4DEXA 1P9RA 3L0PA 3T5GA 1E6CA 2FPMA 3BJIC 1FTSA 4KVAA 2C99A 3IEVA 2JJ2A 3A1TA 2GZHA 5FBVB 3SR0A 3F5FA 4MRRA 1CULC 2ZROA 2VRWA 3HR7A 2HLDA 1ETUA 1TPZA 3AP2A 1MO3A 3H1TA 3LX5A 4OHVA 4Q7KA 4BE7B 3WMFA 2GXQA 3LD9A 4RY2A 5CDFE 2ZANA 1XCGB 4Q1AA 3QVVA 2IYVA 4A6PA 2E87A 2P0EA 4DSTA 1UM8A 4YXWD 3UXMA 2NZ8A 3AP1A 4QM6A 3D8BA 1L2TA 1DVRA 4B35A 1X3SA 2YC2C 4BFSA 3GQBA 2XITA 5EUQB 1ODFA 2QROA 3IHLA 2RH5A 1XCMA 1OLOA 2ODNA 1CRQA 5EE1A 1XEWY 1ZUIA 3TRFA 1TX4B 1EX6A 1D9XA 4M4SA 2FDCA 1U8ZA 2CCJA 5FPSA 3KQUA 2QM7A 1GILA 3LBIA 4GDFA 1AZSC 1XEFA 2DFNA 2VEDA 4AIIA 2GILA 3QQ5A 1LF0A 1F2UA 4U00A 3WXMA 4GZMA 3C15C 1RRPA 3E70C 1AQUA 1E98A 2AL7A 5JWRA 4M1YA 2WKPA 1AJEA 1GRQA 3FPAA 1E2FA 2QENA 4OK6A 4LYFA 1I4LD 4RCZA 1P62B 2G83A 3RC3A 5EQTA 3X1DA 4US1R 3RABA 1JAHA 3ZZTA 2WWIA 2WJIA 1T8TA 3OESA 3TUJC 2I1QA 4HB0A 2ECKA 2LKCA 3LO5A 2NTYC 1KZ7B 2R2AA 3DM9B 2JASA 2QRZA 3TLXA 1ESNA 1XJ0A 5DHFA 4B3FX 1RW4A 1KMHA 3K1JA 4L15A 1R5OA 1G6HA 2WIBA 4A8JB 1XX6A 5HKKD 1IY1A 2QP4A 3MCAA 3ADDA 3K70C 3FDIA 1OSNA 4HB4A 3W5JA 3ZS8A 1UBGA 1JQLB 3QI2A 4FMDF 4RD1A 4D6PA 5AJZA 3FWYA 3VKGA 2VF7A 4FIDA 1XEXB 3BC1A 1ONBA 1U0JA 2R8RA 3CH5A 2HYIC 1YJ5A 2ZU6A 1S1CA 2OXRA 2GZDA 4A92A 4BLOA 3P20A 4KFSA 3OIUA 2OFXA 4TMXA 3THYA 3R8FA 3RVBA 1VTKA 4BFUA 4KU4A 4Q18A 3GCGA 1PLKA 3E1SA 3WP0A 1N0UA 5KNDA 3CNOA 1NVUQ 5FTNA 1D2NA 4NYIQ 2W6ID 4Q1DA 1P2VA 1NY5A 1JEEA 2X77A 4B34A 3ADCA 3QE0A 1KYIA 1KI6B 5EP1A 1CRPA 4OL0A 1S3SA 4QBFA 3KUDA 2IXGA 2OM2A 2XZLA 3UG6A 4XTCS 1X1SA 1XTKA 4HDCA 5AR1A 5FR2A 5P21A 3QBVA 1JJ7A 3LDAA 2IEYA 3QPVA 3CNNA 2CL0X 3CM0A 5AUNB 1Z2CA 4Q4HA 1G4UR 2DY1A 4A1FA 1G64A 3TJZA 1II0A 1COWD 1ZBDA 2GAAA 3CKLA 2ONKA 2OZEA 1WA5A 4ZI3A 3TMKA 4AKHA 1DARA 1JALA 4BFVA 3U3KA 1F48A 3NEJA 2WHXA 4K8OA 5G3ZA 3TSZA 3MWLA 2VP0A 4GMDA 3RWMB 3DVLA 1NVVQ 1VCNA 3HPQA 1EFTA 4G1UC 4C0LA 1E2MA 1OFHA 1CLUA 2E9SA 3LQRA 4B74A 4Z1MA 4IJMA 2E1RA 4TYNA 2QN6A 5JS8A 3NH9A 1N2CE 3BOSA 1DE0A 1D8TA 1YZKA 3TQCA 2JLXA 3B13B 3MD0A 2GBLA 1DAFA 1HEIA 1M6NA 1SVSA 1VKJA 3P1JA 5EZ6B 3SDZA 1EWQA 1GKYA 3PVSA 2RAPA 2IA5A 1AKEA 2GWHA 2ZREA 4L16A 5EP3A 1NBME 2VF8A 4DC9A 1XPUA 1KY3A 4K81B 1T91A 5FUWA 1NF3A 2EWVA 3SJZA 1M7GA 3BB4A 1N6HA 5SZIA 5A5GA 1OH5A 2NMVA 1ZM2A 4PX9A 4A0HA 4DEYA 5L3SA 1XTQA 2ZR7A 3IEUA 4HI0E 4X8HA 2Q21A 4H1VA 1GRRA 4I1OA 3AF0A 4TLDA 5JHGB 4FMDB 4DLRA 3BWDD 1ZU4A 4I1UA 1P72A 4M0LA 3IKJA 1E2QA 4RSGA 1AA9A 3AP3A 4C4PA 4PAMA 4EFLA 2ORWA 4Q4JB 3ZGXA 3BH0A 4HZUA 1W2HA 4HDQB 5CIQA 5AJWA 3SJBA 1L8QA 4EAQA 1Z63A 1NMXA 3CLVA 3KTAA 3ZJYA 2ZJBA 4ZKEA 4XH9B 2GEUA 5E95A 2WOOA 1ZIOA 5EXTA 3ZVNA 2RGXA 3WMGA 4NDZA 3B82A 2YHSA 1KI3A 2IUSA 5HTKA 3W3ZB 2P5TB 3TAUA 5E7JA 3GFPA 3QKRB 2WWGA 2CNWD 4LHVA 3SI7A 1GTVA 4Z54A 1YR6A 5DISB 3WYGA 3E2IA 5FOTA 2A9KA 1N6OA 3QKSA 3DEFA 1KK3A 4Q03A 3BFXA 4FCTA 2C95A 4NE2A 1JXMA 4BZQA 5GJWC 2XNSA 3RRYA 3KZ1E 4WZAE 3TUZC 1TEVA 2KI5A 3TIFA 1WB9A 2ZUCA 3FMOB 4RKEA 4B6FA 1WQ1R 4DWJA 5JECA 5L3QB 1JJVA 5LPNA 2PCJA 3GLIB 1F2TA 4LV8B 1WMSA 2ZETA 4JBWA 4BRUA 4AURA 3CB4A 3LBHA 1G8PA 3VKWA 2A5JA 1FQJA 1SXJD 2J0QA 2B8TA 1SGWA 1ZAKA 2WSMA 5EP4A 4O2RA 1NLFA 3AVUA 2IC5A 4AC9A 3A58B 3KKMA 2RCNA 4BEJA 1KY2A 4MITA 4XWKA 2CL7X 1TU3A 4ZKDA 1VIAA 1TAGA 4DIDA 3N2IA 2QA5A 5HZHA 3TVDA 1KIMA 2CLCX 5BN4A 4MGKR 4AD8A 2ZRPA 2IHYA 1XJQA 2VSFA 2GKSA 5FOSA 1P61B 5JWHA 3RS3A 4BLPA 4BUJA 2R6DA 3LQQA 3PXGA 2A5FA 4JYCA 1JI0A 2ZR9A 2HCJB 1SVOA 1YZQA 2XZPA 1FPMA 1NJFA 3EX7C 4NCNA 3SFVA 2DFKB 2QT1A 4RCYA 1XPRA 4TT3A 1VCIA 1E2JA 3R7WA 4Q9KA 1NIPA 5CJPA 2X2FA 3IO5A 5JCPA 5TMPA 5FPYA 2P67A 2WPDA 1RC8A 1R8SA 2EFHB 4IDOA 2XJ9A 4E22A 3SS8A 1OXXK 3AVVA 2F1IA 1F2UB 1RRGA 2ORIA 4MYHA 3FGNA 4DBLC 1G3UA 3OEHD 3ZQJA
chains in the Genus database with same CATH superfamily
3DTVB 3IT0A 4B44A 1JN0A 1YZFA 1TIPA 2BKEA 1ISSA 2VT7A 1YUNA 2E6KA 4X92A 3OCVA 1FNSA 3KOMA 3OZVA 3UJAA 4PAOA 4ZEVA 1P3JA 3AUUA 3CG0A 4GM4A 3GUCA 3VH3A 3E22A 2ZSFA 1C4OA 2IHBA 2XYHA 3IIJA 1SHTX 3CUYA 5I9BA 4AZVA 1Z6PA 4FSHA 2P4QA 4PGMA 1YVPA 5DMHA 3HCAA 2O8DA 5HS4A 2ODTX 2PX4A 5KSPA 2ET6A 2XGOA 2BSQA 4NNPA 3E3MA 4KE7A 1M2OB 4UBIA 4EJ2A 1W36D 3NP9A 2PWYA 5ER9A 1V5WA 4B43A 2HK6A 3JRXA 3W8DA 1CERA 1HDOA 5JIBA 4P4TA 3IURA 1GTSA 5K8VA 3LJKA 1LBEA 4LJAA 1AQYA 1N9ZA 3EC7A 1ZCAA 5LM3A 5F7ZA 3ZWAA 3ZDZB 2C7GA 3KNZA 1ORIA 4LYEA 3IVCA 1UF9A 3T1VA 2QD2A 3H9GA 2I78A 2GLTA 4K9LA 2BGTA 3C6XA 3K8ZA 1QV7A 3Q3HA 4MOWA 3ZIAD 4DUZB 3IBFA 4HP8A 2PT7A 2XOEA 5FOXA 3DEZA 3RS8A 4A8JC 3VC7A 3CLHA 2VQ6A 3A37A 5A3RA 2ZW9A 2JJ1D 4FYKA 4J0CA 5I4IA 3CCCA 1V3UA 2HEGA 3WYAA 3OHMA 4MWDA 2RHWA 4ISBA 2QVCA 4ZQFA 5FBLB 2QL7A 2PBRA 3KJGA 4D5GA 3WICA 4U2BA 3UKOA 1PV2A 4ZTBA 1B0UA 1T24A 4M1OA 3CLKA 1CEXA 2Q28A 2DSNA 3MF4A 3G0HA 5E4TA 2FQYA 3BE4A 3MLEA 2Z9CA 1M6VA 4C3ZA 4XB6B 5IMSA 3UGTA 3GGCA 1RRFA 4EG1A 3D6NB 4LGCA 1DC8A 2CFOA 2FNAA 3DA8A 1S8OA 4KR0A 5C53B 4DDHA 4WXYB 2NZVG 2F00A 2ASEA 3ZGZA 5J3JA 1CRZA 2EZUA 2VHQA 4IF4A 4DC1A 5D6NA 4S1TA 2TMKA 3AVXA 5HR5A 2R68A 1M2NA 1TI7A 2C7PA 2KE5A 1A69A 1DJNA 3H2ZA 1R4NA 2EGGA 1XU9A 3HCBA 1HYBA 1V11A 3H5WA 4KGDA 4OXYA 5SY4A 4I50B 4AO7A 4AWAA 4Q4HB 3JZDA 4TXHA 1EX1A 2ZJZA 2WIFA 3ORRA 3DZHA 4B82A 1UJ4A 4TMWA 5HRAA 2XCQA 2JCXA 1HE5A 2AOTB 3NR2A 4Q48A 1BJRE 1IN4A 3LC2O 4ZREA 2C84A 4C01A 5TXGA 3DMRA 3FMIA 1C4XA 2O57A 2UYGA 1H0RA 5FH9A 4OHRA 3TPFA 3M6MD 3QBJA 5EZQA 2Q4EA 1KU0A 2AC4A 3MA0A 2P5UA 2V6BA 3N3AC 2GXUA 3R5FA 3JAWB 2AOUB 1PTJA 4LHSA 2NXCA 2YVLA 2COEA 3CWQA 1DEKA 4LOIA 5FX2A 5CJ2A 1QOQB 3E4DA 4AIRA 4F4HA 4E31A 2IY8A 2R6FA 4GPTA 4JJFA 3IAM1 1LNQA 4DMLA 5FA8A 4BDSA 4BVKA 1ZD4A 521PA 5JFGA 1UAYA 3GFFA 1UEJA 1B2RA 5ER6A 2KMLA 2V59A 2VL7A 1N4AA 1LJLA 5AQEA 2LTAA 2WD8A 1XV5A 3W9UA 4F3KA 5BN3A 1Q77A 1ZMOA 3ESQA 2OAEA 1KC3A 1T5TA 2HLPA 3QEKA 1Y7IA 4GI5A 1L1QA 4ETWA 1YOBA 4JFRA 1HV8A 3GUVA 3RTCA 5LP1A 1T35A 4CU2A 1QRRA 2P5YA 3C85A 1VLHA 4RM3A 2R2GA 3ZQUA 1OU4A 2QX9A 5GY7A 2D5BA 2XUKA 4RIIA 4RKRA 2EP7A 1SBHA 4K6MA 4Z4CA 1D8AA 1W5TA 1A3CA 2WQZA 1EHYA 1CQWA 1K3FA 4P4NA 4W1RA 2H5EA 5FV7A 4I08A 1J25A 3BULA 3MTDA 1M2VB 3EXEB 3V3KA 3INRA 2BHRA 5DYWA 4BRWA 5KYUB 1ZYUA 2FSHA 3AZQA 1GTL1 4E03A 2GPNA 4YACA 1KDZA 4F5EA 4Q0MA 4P4LA 5EIBD 7ADHA 3PF9A 2WTUA 1T2AA 4HZUB 1WBBA 2M32A 4N40A 3ANYB 1AU9A 4Y9RA 1X8LA 3T4XA 3RSQA 3KTAB 5ICEA 1GUZA 4TGLA 4K05A 5AK5A 5F5NA 3WWOA 4M98A 1OYYA 4IX9A 3ONWA 1Q7RA 1RQLA 3ZIUA 1Z82A 2N75A 4D99A 3D59A 5EXSA 4DTIA 1Y63A 4BDTA 2QLBA 3CUSA 2M1ZA 1X1QA 1PAUA 2MIIA 4YK7A 4RJJA 5F2KA 4J49A 5IAEA 3TCKA 1BROA 3AR7A 4H7PA 4HUJA 1TUEA 5KS2A 3O94A 4AF6A 3OY2A 5JCJA 4F2PA 3P9CA 2F17A 1J42A 2QJTA 1ADFA 1C9JA 3NOVA 3QKSB 1KI2A 5AXCA 1HFJA 1L7BA 4FXPA 5MF6A 2IOQA 3IR7A 2UZ4A 3U7GA 3NWBA 5JSZA 2G70A 4GPEA 2VR1A 4HRYA 3INYA 3H1EA 3O6VA 3BMCA 1PNVA 5THQA 5AW3A 3G1TA 4FGZA 5LKAA 1D4FA 2XB2A 4NZZA 3OHSX 4P2GA 1LB1B 3IVAA 5JSFA 4FDTA 4DMRA 2Q6IA 4JOQA 1MW8X 5GWXA 1Q0ZA 2OLEA 3EF0A 3QW2A 4KP7A 3NOXA 4NU8X 4U9HS 4ZT6A 4KQ9A 3WXMA 1EUCB 2AW5A 1Z38A 4OB8A 1L8XA 4EMTA 1GSOA 1YQDA 5FQNA 3Q72A 4D8YA 1C9EA 1RYNA 3CPSA 4C4OA 1WD5A 2IY9A 4CIBA 4EL5A 2YUIA 4M53A 1NQTA 1X7ZA 4ITRC 2AB0A 2DE0X 2BM8A 2FW8A 2GARA 2XB4A 4HDKA 5EJAA 4CKXA 1KERA 2BGGA 4KBYA 3AR4A 1AUOA 2YV1A 5AMXA 3TTYA 1A72A 2YJNA 3VPHA 2VJAA 3CBQA 4PS1A 4RPLA 1B76A 1OZGA 4Q5IA 3U0BA 3DH0A 3BMQA 5EGNA 1SC1A 3ZWDA 1SZPA 1TO6A 3T7JA 1AUQA 1M72A 4B6OA 3I64A 1QO7A 3VVLA 1C8BA 5KOYA 3DOCA 4CMKA 1CUYA 3D3QA 3VOBA 2HRZA 5IDVA 4OGWA 3DR5A 1XFDA 1XLWA 4XVHA 2GXSA 3WMXA 3WKDA 3WWCA 3AVQA 1CY1A 1R6BX 4B4WA 1I1OA 1EBUA 1VJ5A 2PSFA 1J0DA 2VDLB 1N0HA 4XOIA 1L4HA 1EI9A 4TMKA 4C7JA 1MDBA 1NVBA 5EKXA 3UFBA 1ORWA 2P2ZA 4E11A 4Z8XA 1TYEB 1WXQA 2KPOA 2ZQYA 3HQ4O 4E7OA 3KQOA 2WU4A 2Z8XA 1Y9AA 1FVXA 1T9KA 3P9YA 1C3XA 4TMZA 2P1DA 4MRNA 3D3JA 3VNSA 2GN0A 5A7FA 4MW4A 3KYCA 2IVFA 1KKMA 2I66A 4O5AA 2MJLA 4QVKA 3GGOA 2PUWA 5ULLA 4D7AA 2D06A 3BKXA 2FWIA 621PA 1K89A 1VPLA 4BX8A 3FKQA 2DBVO 3IRVA 4G37A 5AOBA 1NUPA 3EDRA 4JFAA 4ARZB 2XADA 4TQAA 1LZLA 3EXHC 3QVGB 1CPYA 2V5VA 2XA1A 2ZIWB 3BICA 2F43A 2WU0A 4WNAA 3V5NA 4AX8A 4CLEA 5J2TA 1DCFA 3WNDA 3LSTA 2REOA 1JPJA 1ZFNA 1QIMA 3ER6A 3R74A 3JQ9A 3O8OA 3AGQA 4X85A 2FFHA 2AV6A 2EF0A 1RR6A 5DBEX 1R6VA 1NSFA 1OFGA 3O8CA 5BSGA 3PDUA 4N7MA 5ERYA 1CQJA 4AJKA 3FMVA 1GZVA 3AJ9A 2Y0PA 1YZ3A 2FHSA 4NQRA 5B30A 1FXSA 1I9GA 1Z0IA 3DC7A 4GP9A 4ZO4A 4MRVA 4QRHA 1X1DA 1H2ZA 3I9NA 3L05A 3OFNA 3AUFA 2I3ZA 3GAZA 4IS3A 1CJKC 1HEYA 2AD1A 3EOAI 5BQOA 1M2JA 2RHHA 1C2YA 3L0DA 4C20A 2QR5A 3Q0EA 1WUHS 3DE2X 3OM8A 2PXHA 4CTJA 3NP7A 4LNUA 3GU3A 1L9XA 2NTJA 4G5GA 1N34B 1PX2A 3EMVA 3WGUA 1K4KA 3EVZA 1NXQA 4GLLA 4NHOA 5TQJA 2R7KA 2QLTA 1RM5A 4PYMA 1VYHA 2IHZA 1CT9A 1VYUA 1SXQA 3N7UA 3FNQA 3FPGA 3HP1A 4IJWA 1IY0A 2VF2A 1J9GA 3P9KA 4OD0A 5IW8A 4YQYA 5HZGA 1V71A 2V6FA 2UUBB 4KJZA 4ND2A 4UVDA 1NXPA 1V5EA 2BLNA 3IV9A 1JEDA 4CDMA 2FPUA 2ZTHA 3C8MA 2JGAA 2VQDA 3B6KA 1SNYA 3Q5GA 4N8DA 1Z08A 4ZQBA 2QMYA 4IQ0A 3E27A 4F5WA 2C42A 3CLSD 3LXRA 4UU1A 5I3ZA 1XTBA 9LDBA 4KO3S 3AFNA 4WEQA 5GOZA 3VPXA 5KMGB 1Z5GA 5KQMA 3K0FB 3G0OA 4O3MA 1IB6A 1XG5A 2JAXA 2I1VB 3PWZA 4I81A 4AJ9A 2Q8PA 3H97A 4C7OA 1BMDA 1SOUA 1D4OA 1GPH1 4UTOA 5IH7A 2YJTD 3ZE2B 1H93A 4MYTA 1POXA 4PW0A 3V1UA 4MUFA 1YK1A 2VQSA 1QOZA 3LC1O 1QIIA 2J9FB 2X4IA 5A6SB 1IZ0A 4N54A 3O38A 4WLVA 3ZQ6A 2VDJA 3OJ0A 3EMKA 3UPUA 4G0QA 1A71A 4BAGA 2ENUA 5HF5A 2GETA 4V02A 5JBNA 3PWTA 2IWRA 5LOVA 1P77A 1FQWA 2CZQA 3IJRA 4QAQA 2Y1CA 4JBYA 4O4JB 4TWIA 5HGJA 4DIBA 4DVGA 1PHRA 2GKGA 4D9EA 1AHHA 1IM5A 1Q0UA 2XOXA 3DOFA 1YJAA 1V1JA 3IB6A 4LFCB 2F1KA 3PUHA 1N6PA 5KPJA 2CMGA 2ZSDA 5JHHB 3K2BA 3GLGA 1UFVA 4YRJA 1VE6A 5CCBA 1R0XA 1UJBA 3OZBA 4KXQA 1Y9DA 3I6ZA 2FETA 1A82A 3MG9A 5A4AA 1ULAA 3KEQA 1SULA 3TTSA 2YV5A 4R1NA 4BWYA 1FJGB 1ZO8A 1MZVA 1GPKA 1CUUA 4WK0B 3P0EA 3I04A 3G02A 4NFLA 3F7TA 4R7ZA 4TMVA 1SQ5A 4UHFA 5E3HA 1ZXLA 1USIA 2NUPA 3BZWA 1JH9A 2XHZA 2EX0A 3DL4A 4J6FA 1T5OA 3R6DA 1O4WA 2FOIA 2QAIA 3DC2A 2VTBB 1TEXA 2NAFA 2VYQA 2OO5A 3IBYA 3UWPA 4EPYA 3HEAA 4GPZA 1JPUA 1MR3F 3QXSA 4R98A 4DA7A 3U60B 1VPTA 3ECCA 1Z2EA 2D7CA 3VJRA 4EK9A 1U90A 1YCHA 3C1AA 1JHAA 4HB2A 3ZS9A 4MB0A 1PZXA 1QYRA 3AK4A 4EX7A 4KXUA 4L6AA 2CYBA 1ECLA 4NCHA 2GBLC 1Y81A 1HL3A 1QP0A 2I4LA 1KH3A 4PZLA 2H1RA 2XTZA 3EA4A 2FPIA 3P27A 4BTVA 5JXHA 1ZD1A 5FWNA 4JLMA 3CHYA 5B57C 3VAYA 2HCBA 3VR2D 1NP7A 3PTLA 1GAQA 1U9IA 4LXGA 5E9QA 2FSFA 2WY2D 1DS6A 1WX1A 5ADWA 1IHYA 2HSJA 4F06A 2JFGA 3E23A 4ND1A 4UUNA 5IWCA 1YC5A 2Z6AA 5J4YA 2J3QA 1E7WA 2PH5A 2WFLA 3LPAA 1ISPA 2NO6A 3PHLA 2H2WA 2ZWMA 4NARA 1E1CB 1YDMA 5JT1A 1E9AA 1LDMA 2NYRA 5CB4A 2W4IA 3P4UA 1LDGA 3QEMB 4ERXA 1O1YA 2DMRA 4UQLA 5I4BA 5DCWA 4DDVA 1I7LA 1QNLA 4UFOA 1UR5A 3IUPA 3I0ZA 4BVGA 1WUYA 4TT8A 2I8CA 1U2GC 3FSEA 4BMZA 2XWBF 1P2GA 4GX2A 3PC2A 4G81A 4PSKA 3S1SA 2LXNA 1DAHA 2ZTLA 5JARA 1SQ6A 1G20A 1GNSA 3KPWA 4N3BA 2BZSA 4U6QA 1UZAA 1GHTA 3HWRA 5BNWA 4LNAA 4Z3OA 3EBLA 2ZIAA 2NNLD 2JIBA 3UK7A 1T2CA 4LJ7A 1G7RA 1AKRA 2FWPA 1K9SA 2C97A 2RHJA 3VYVA 1KZHA 4NCIA 5T3UA 4TROA 1WDMA 4DEVA 3R8CA 4L57A 1IJBA 1ADCA 1J0CA 1H69A 3NH6A 2OVBA 3C98A 1JSCA 2B78A 3A9CA 4REQA 1Z7YA 3E9EA 4OU4A 4V0LA 1GFIA 3BWEA 4B71A 4MLDA 1G3IA 2VOJA 5FYQA 1VG1A 5K01A 1E1RA 4WGGA 3TNJA 3U80A 4X66B 3IO3A 5FIUA 4EH1A 1DX4A 1GLVA 1V39A 2GZ3A 5BYJA 2EFCB 2JI4A 4Y67A 4U7DA 3D8NA 4FFDA 3N87A 2C2BA 1WPGA 4JLPA 1L5OA 4JQSA 5AO9A 3KU4A 3N28A 4IIEA 5FL7D 2QTZA 3GNSA 4B17A 5LQAA 2BMEA 2Q62A 4BQNA 5BRAA 1MFZA 3GELA 4I3GA 5AM1A 2AXPA 1NG1A 1J24A 3HKBA 4ZU1X 5ITZA 3NTRA 5E1DA 4LBYA 3WTBA 3G2JA 5ALLA 3L92A 3EARA 1A7UA 2PMWB 3DV2A 1HG1A 5JDCA 4YUYA 3OQPA 3GLTA 3HEBA 1VCHA 2H1CA 1YDGA 5BPHA 2ZRJA 3QUAA 4HAZA 4OHUA 3SGLA 5EFOA 4CKZA 5IJZA 3Q8LA 1QTNA 1GT91 2V74B 4QG3A 2PIAA 2G9RA 3ZU5A 4LCEA 1JFTA 1O94D 1Z2PX 2HADA 1CUJA 1NMQA 2W4QA 1JTVA 4EHLA 3O93A 2FWNA 2XMBA 2C5FA 5DX0A 1W0CA 1UM9A 2VPZA 3H8VA 5KKNB 5I7OA 2Z83A 1MLDA 1YR7A 3GJSA 4S0XA 3DEAA 3KUKA 3ZY2A 4MLPA 2ZI5A 2OAQ1 5FUQA 4YJGA 3GYBA 2RG7A 4YCDA 4C4YA 4PFQA 4CLHA 3L8EA 3OETA 1P2SA 2DP4E 4U7HA 2DF8A 3H11A 2KLBA 3V6MA 5DM2A 3VU8A 2M98A 3G2PA 2ANCA 2HF7A 4FHZA 3U44B 3CTPA 2I91A 1CZNA 4K9KA 1YI0A 3FG9A 5LA6F 4QODA 3CRNA 1KL7A 2HUPA 3S99A 1WDLA 3V1YA 1I7PA 1NFFA 1RM0A 4X5OA 1AA6A 3R44A 1C0PA 1NQUA 4NJEA 1FX0A 3L8FA 4OJYA 1XDUA 3CZ4A 2XWQA 3T3EA 5KNBA 5B36A 4QU9A 1OC2A 3U4MA 1Q7BA 2JI9A 3DVSX 1CDZA 2WV7A 4M9UA 2WHPA 1D1QA 1Q84A 1E2PA 4RVOA 4V39A 4PLFA 2ODPA 3WYBA 4CM8A 4N9WA 4RKFA 4YJ3F 3EIHA 4A7PA 1JG2A 3A3PA 3JSAA 4D0NA 4OYRA 4GZ6A 4URFA 4PX5A 4DV1B 1SOMA 5C3UA 3PNQA 3OZAA 1QVAA 2H1FA 2XBMA 3PCXA 3KZNA 3MVEA 3UC5A 2Z5LA 1UFQA 1XZ8A 2BP7B 1E4EA 3IHWA 4ND4A 1LC0A 4BKQA 3UT5B 1I6KA 4KQIA 5KUTA 3AKEA 3L8GA 2QR3A 4FOLA 5DU2A 2Z4SA 3WX0A 2I3BA 3D6UA 1E3DA 3QELA 4G86A 2POCA 1ZJ4A 3TZCA 4R3WA 1WXFA 2WT4A 4BP9A 1LNZA 4ENPA 2XQKA 1LSUA 4AUKA 1WXGA 2PJZA 4L3WA 3SXPA 4C5BA 1M1NA 4DDMA 1EDZA 4EELA 3N9IA 1CRWG 1W30A 1T8PA 3CR3C 2GTIA 5C81A 4QUHA 1WUIS 3RLIA 2FPWA 4Y2YA 4WZBA 4DBVO 2HIAA 1UDAA 1W85A 2VJOA 4HQLA 2OZLA 2QV7A 5FHQA 3ZTYA 4BQFA 3V8NA 4KIWA 3EGIA 5FPQA 4W99A 3PFBA 5HCIA 4MUIA 3EJ6A 5AI4A 3LY9A 1DPGA 3IUQA 4DA0A 3ZY3A 5KPDA 5AKIA 3GJTA 1FDUA 2EHJA 1IAVA 2YV4A 1Q0QA 2O14A 1DEHA 4EABA 1MV5A 2I2FA 3V7YA 2IZ6A 4HCJA 1KQNA 3N8DA 4IXWA 3NIDB 4RVDA 2XUGA 4J0JA 1U98A 1ZJ6A 3GJ4A 1PLLA 1RJWA 4XPIA 3UJNA 2QP3A 1UQUA 3R40A 3D81A 3UGJA 1M2GA 1XDSA 1BD3A 5KAMA 1J0XO 1PL7A 4F4CA 1UMCB 1N2OA 4OXNA 5KSWB 3OQIA 1CUCA 3B5EA 4JGBA 1O0BA 4LRXA 1KIFA 2OQRA 3T9FA 4CLDA 7ABPA 1SVNA 1L7PA 4YDQA 4X1KA 3JWHA 5IYZF 3GP3A 1DG3A 1OIWA 3LSYA 4GRDA 3QLEA 5JVDB 2OCKA 5EQDA 3PR3A 2AG6A 2QVYX 4P3YA 3ABQB 3PQ6A 3PLAE 3QVSA 3NBKA 2M6KA 2OPHA 1NMEA 1BJKA 1D4AA 4R71A 4LXHA 3DG9A 3KPYA 2WM9B 4HHEA 3DZCA 2C2ZA 3DDSA 2QIPA 4R7GA 2F48A 2XVMA 3P26A 4KQ6A 4IKPA 2Z56A 4O4IB 1PFYA 3O8NA 4KWTA 4B31A 1UDWA 1YF3A 1M33A 4X3PA 4E7PA 5JZ9A 4Z2YA 1G38A 1JHPA 5K2MA 2VWGA 2II6A 4MVJD 3RRFA 1Q1BA 3QGMA 4AJPA 4CQMD 4G0WA 5IEBA 4DXAA 3R9IA 1F9AA 2QX6A 5HWSA 3DBRB 1A27A 5MFZA 3LBNA 4AUMA 2DUMA 1L4LA 1ZJYA 3HUFA 3NTXA 3ORHA 1QYXA 5TS2A 4B3JA 4JI1B 3P4YA 4YDSA 3LAWA 1ZMXA 2K2WA 4IWXA 4OTZA 4PZEA 3A3KA 4PLCA 5IN5A 4AJEA 2JCGA 4Q6WA 4C43A 1UADA 5AW5A 4X9XA 3ZTTA 3GVIA 3QV1A 2ZWOA 4R8RA 1C7JA 3FHCB 4HH4A 2KJQA 4LWOA 5L3VA 1G55A 1EVEA 1IULA 2G4VA 3Q15C 1ST3A 1SY7A 4L4RA 2P8SA 2R96A 5BSEA 2RCYA 3CUUA 4PO9A 4ZCLA 1N0VC 1L5HA 1ZHOA 1Z9BA 2DETA 2NVUA 3HXMA 2J5BA 3PJEA 1H8ED 4GAEA 5THKA 1TFUA 1RSZA 2FF7A 3HS3A 1N1DA 3WK8A 2FZWA 3ESZA 2PX0A 2VP4A 1E9DA 3BYZA 4LNHA 1GPJA 2A0UA 4XEUA 5GJCA 3TZEA 5EWLB 1OXTA 1JR3E 2JLRA 4W8GA 4PTYA 3DBLA 2ZZKA 1I2DA 2X5XA 2YJ5A 4HUQA 3KSZO 1MU0A 1F4VA 2B4QA 3SXUA 4F85A 1CF4A 4WCFC 1FZQA 1ZGCA 5I8WA 1TJ4A 1FDIA 1E94E 5B4TA 5TGDA 1YL5A 2WSYB 2J3DA 4MV4A 2FAXA 5IUKC 3A3OA 2TSYB 4HXYA 5IT9A 3I9LA 5IX8A 4NMXB 3FOZA 4CKWA 1G8FA 2ZVPX 5I9TA 5D7NA 4ITUA 1UIMA 5SZHB 1CQIA 2WVHA 3ZHBA 2IYPA 3GUYA 1BH6A 3IUEA 3LHKA 4LJ8A 3DO6A 1E20A 3GJXC 3UJ8A 3CZ9A 1RYDA 5B12A 3D3KA 1X7YB 1I30A 1V3VA 2DLNA 3IXMA 1R15A 3K1TA 3OIFA 4REOA 5ES3A 3IRUA 1IEVA 2HHCA 1BDJA 1G9SA 4TV8A 2PD3A 2XNKA 3I92A 2B21A 5TLSA 1BE0A 3HL4A 4PBRA 2B6NA 2BV3A 3R3WA 1K1EA 1P0PA 3PXBA 1YRBA 3TI7A 1P5ZB 1XD8A 1UT5A 1MT3A 1ZN9A 1I0ZA 4TRRA 4XKJA 5B64A 4ENQA 1NULA 1OYOA 1P8JA 1FNNA 2GN6A 2HBRA 2KX7A 2YXDA 4UHHA 1B8VA 3U3MA 3WK9A 4BVAA 1NVMB 4FYVA 5FWYB 4DTCA 3ZWCA 2IE0A 3BX1A 1CUWA 4ZU3A 5HW0A 2H4XA 3GDFA 2ZDHA 3Q8KA 4IOKA 4GOLD 3PCRB 4M7RA 1NKSA 5DN9A 4RTMA 3PV0A 4L74A 3R0VA 4OQLA 1P45A 3H3JA 2DPMA 1C5KA 2R5WA 3QK7A 5DYYA 3VBEA 2HXGA 5JCOC 3GAAA 4M37A 3V2IA 5AK4A 2X3YA 5DP2A 1K4MA 2QTMA 2OV2A 1AX9A 1CDOA 4PIMA 4WPGA 4B3IA 4EUFA 1O3YA 3IA2A 1CBUA 5IDWA 2E5WA 1PT6A 1WCXA 1YB4A 2EW1A 2H0AA 2P3QA 2UUOA 3CUEF 4HGPA 1LLCA 4BVHA 3EBOA 3GPLA 3G23A 3HJNA 1CG6A 2AT1A 1H8HA 2ACWA 3ZWYA 2GUWA 1LBQA 2WG0A 4B7UA 2CE2X 3BERA 2GVZC 4G36A 4EECA 1AK9A 2V58A 1GCIA 4N01A 3IBCA 4R1OA 2O5VA 4IIBA 4J1TA 2F67A 4ZHQA 4EHDA 3U7RA 4CKBA 1OX4B 2BL4A 5ALDA 2B5WA 3HI4A 1UL1X 3JALA 3KT6A 4EARA 3PX2A 4KITB 3HYRA 2FA9A 3M4XA 1FU4A 3KTOA 5D86A 4UBJA 3P5SA 3L8HA 2GRJA 3O5AA 4JJZA 4MS3A 3VRHA 1KEZA 2ATVA 1N5DA 1MNAA 4N5LA 3EF3A 2O50A 1I2MA 1QO0A 2PIDA 3GMIA 1AZWA 2FPPA 1G21A 5J4VA 1ZEJA 3BG5A 3OIWA 3CF0A 1FVHA 2Z09A 4L0QA 1TCBA 1EDDA 4H27A 5E2AA 3CJTA 1EM6A 1PU2A 5CHEA 1JQ3A 1W87A 4CV3A 4ESOA 1YJBA 3D0OA 2I4RA 3COWA 2HJRA 5AJYA 3T1TA 5EP2A 3EXFB 3BS4A 2ZUBA 2WJGA 4RO0A 4ZOLF 1Z5WA 3GARA 4UUMA 1Y4SA 2VK1A 3TZ6A 2C4UA 3IXLA 5FP0A 1AS2A 1QHYA 2AX3A 3KALA 3PXDA 1MAAA 1F8UA 1YRWA 1TJ3A 4BEBA 1ULZA 5C80A 1R10A 1SCQA 4QQKA 4JXXA 3NRCA 4OAQA 4QNMA 4ZVVA 5BWNA 2Y1FA 2PRJA 1MJFA 5JTTA 1F0NA 1ZQ1A 3MJRA 2F8SA 5ALRA 3USES 4IG4A 4O4LF 2VBIA 1YDEA 2REXB 4MQFA 4R0VA 4KHZA 4BQQA 4Q3LA 3HFGA 1XMXA 5AW8A 3VR5H 1USVA 5KHOC 3L82B 1HQCA 2J31A 2WTAA 4J6EA 4YT4A 4C7XA 1II9A 2I87A 4DCPA 2IYOA 4O2AB 1RYBA 1PQPA 4GYYA 3JAKB 4NFHA 2IYLD 4D4MA 2D5CA 2XNDA 5EIEA 5I47A 4YBZA 2V7TA 2YY6A 3W5AA 3B78A 3DZDA 4GX5A 4JCOA 1GVNB 4K26A 2AR0A 3IIKA 1D6NA 2YNMA 3W5IA 1UOEA 4AMGA 5LXTB 2P5SA 1OVGA 2WWFA 3WL6A 2ONCA 2OD7A 3IUSA 1HRDA 3AY6A 4JLWA 3DUFA 4PXAA 4XGRA 4Y2UA 5EXXA 5I7FA 1EUQA 1JLLB 4M1KA 2OYRA 2Q6TA 4DDTA 2G4CA 3GLGE 2QMQA 4KAJA 5U1PA 2X9QA 2ONJA 3PU6A 2W8BA 3CPEA 3GAMA 2VJMA 1ONSA 4YIHA 2JW5A 2Z8YA 3ND6A 3PE6A 2OHFA 4FK8A 2HBYA 1KARA 1DAMA 1PLJA 1V1RB 1Y0BA 3IOEA 4R31A 3GGDA 1E7QA 3AH8A 4BO0A 5CGQB 1FBNA 2A84A 2HIGA 3NAGA 3CXUA 2GCGA 4IDDA 4M0MA 1MN6A 1X0VA 3M6FA 4A23A 4B0OA 1ZH6A 4D8UA 4GI3A 4RGVA 3SZLA 3AHGA 4B7ZA 4YMTA 3MIZA 3GEPA 4JLOA 3H1PA 2IP2A 4RH0A 3M1LA 1P17A 3DCIA 3JX9A 4S04A 2JVKA 1YGPA 5ESDA 2GO7A 3TS1A 3W6ZA 1UIRA 3PHJA 3KQWA 4EHNA 3ZDYB 2ZYWX 1H0HA 2ICAA 1MVLA 3PD1A 3A7EA 2JEYA 3OT1B 1E9RA 1WZEA 2DQZA 3WRYC 3WOHA 4OQMA 4CNQA 2RMKA 2QUIA 2VRCD 4WOKA 5LWQA 3AM4A 1TF2A 2C78A 3ZX4A 2PK3A 4BKUA 1D2RA 4I4IA 3G0DA 2COUA 1FUUA 2WKSA 5IARA 2C94A 2UZ3A 2HQOA 1T3ZA 4DLPA 1LI4A 5DM70 3E58A 1JWLA 1CYDA 3G0IA 1LS6A 1UBFA 3OF5A 4HNRA 4DL9A 4UUBA 4AY5A 4I66A 2IS4A 2PSSA 2P6UA 1Z7GA 4F3NA 4MKXA 2IYEA 1CNEA 2GS9A 1VPEA 4QT0A 1KQOA 1J2JA 2JVJA 5H68A 4B5LA 1VLVA 3ORFA 4TZ0A 1OZ0A 5FYDA 3KJXA 4I8XA 4PC6A 5F76A 4WXMA 5CT8A 3G5TA 4WSOA 2R4UA 3FM9A 1FDVA 3WKCA 2F1HA 3K3PA 4R68A 3UB3A 2QS9A 4ESEA 1W1UA 1LW7A 1XJCA 3T06B 3GR6A 3L1KA 3LWDA 1Q11A 2JI6A 5IBCA 1XVIA 1HKHA 3WI7A 3D3NA 3N8KA 4CEHB 3FAZA 3LG2A 3U61B 3PDIB 3V34A 1WV0A 1G20E 1QKIA 3ZW8A 4FN4A 4WJKB 4B3MB 3KDPA 1Q50A 2EQAA 5A5FA 1A76A 3TKYA 2H4FA 4C6TB 1T25A 3OC6A 1NJ1A 1NC3A 3C3AA 5ANRB 2WUFA 3FNIA 4GECA 5AI0A 3C7CB 3KKQA 3ESDA 3WLJA 4L0MA 4DR3B 5LSAA 5JWOA 2AC7A 3JWGA 1SU8A 2WJWA 5KYWA 3HCDA 1TUIA 3IVXA 4V0KA 3SBEA 4LHYA 1FU7A 5KTYA 1UPTA 1ZHFA 2FEWB 5DNVA 1GXSB 4RYDA 3G9UA 4LSWA 3G68A 1P7CA 3K0BA 2IU6A 4P82A 1E89A 4KUHA 1DFIA 4PC1A 4W7HA 3ZNOA 2P9FA 3EZGA 3M4ZA 3S5UA 2WTMA 1VDMA 3WGNA 3ORQA 1PO7A 1KO5A 5MGBA 2Y1OA 4RVCA 1T5SA 3H9BA 2OB1A 1YB5A 4PX2A 3GZJA 4GUAA 5K3SA 5CYFA 5E6UB 2NOAA 2ZJAA 3C97A 1WZIA 3LO8A 3TIXB 4F9EA 1XC7A 1DTSA 7MDHA 1G60A 4LXUA 3U4QB 3NG1A 3V8QA 5LP6A 1IONA 1DO2A 4OATA 5I7EA 2YR0A 5EHNA 3A7DA 4AG3A 1M0EA 4NQZA 1JXQA 3SS7X 3T9AA 2OCAA 5JISA 5G1OA 1EDEA 1EVKA 4F4FA 4F3CA 2W8ZA 4D0GA 1SFRA 1RLUA 3K32A 2H7VA 4G5QA 2RGNA 3D6TB 1EXDA 4BS9A 1W52X 5EN4A 1YR2A 4M83A 4AZ0A 4AVYA 2PZBA 3MN1A 4S05A 4HG2A 2WG2A 3WQSB 1FP4B 2OZKA 4DNOA 3SNKA 4RMNA 1W0KA 3K1ZA 4K2AA 4ON9A 4PPFA 4CF6A 3THWA 3ANXA 3FX2A 1B8NA 1SURA 5LYJB 1E5DA 2E4VA 4Q9AA 4BZPA 4F0JA 3B51X 1C7QA 2HC9A 4HH0A 4BY9E 4EPWA 2QY9A 2XQGA 3QV2A 1C29B 1VA4A 4MINA 3WGZA 2ZYUX 3L79A 4KAAA 4B40A 4C0QC 3DMYA 4YR7A 3TKLA 3ZDBA 5A0TA 1NNI1 4DCUA 4V3BA 2PGAA 1OOEA 1E2EA 1ZNWA 5FRDA 5C5IA 1YFLA 3B1YA 5I48A 4NU6A 5ISMA 2X8LA 3I9V6 1O2DA 2A9VA 2J6BA 4YJDA 2QAGB 4EPTA 2QHXA 3DMNA 1NMSA 4RU1A 5ED0A 4M86A 3OIGA 1O6CA 1VA5A 3Q3GE 4FP9A 4UVGA 1NVWQ 1YVEI 4XW2A 1Z4PX 1LTQA 5BQPA 1TM4E 2YV2A 2OUIA 4UZFA 2Z6VA 1JKFA 2XAUA 3B1JA 1F6WA 4ZANA 4UTVA 3RT7A 1XZGA 3KZCA 4KPEC 1MEOA 3I30X 3ZD6A 2JAQA 1ZRNA 2XDQA 5H1YA 1UP4A 5KTRA 5LL6P 3BT7A 1OMOA 1RHJA 2D62A 3UCXA 5C35A 3KE8A 4B73A 3KKOA 1M5UA 2O2HA 2R7AA 3ETLA 1RI4A 4INPA 4J0HA 1RT9A 2OGUA 4CTNA 4ZGGA 1YQUA 2XUOA 1HYGA 3I37X 3U1BA 2FEAA 2VUSA 3MPUA 4MV7A 1THGA 4TVOA 3W5UA 1YWGO 4Y2QA 3QW4B 2UUCB 4YH1A 1D1PA 3P71T 4B3CA 1XU7A 2CXQA 4IHQA 4F8EA 4ZEMA 5LP6C 3LK7A 1K8YB 1PT7A 3B3QA 5DN6A 4C29A 4CUZA 5JPCA 3SEQA 1IUOA 3USCS 2ECPA 4JU9A 2GK3A 1LPBB 3KC2A 2LCIA 5J2UA 3J81k 4L4ZA 3M4NA 1I10A 4ZZ0A 5LZ9A 1EXVA 1T6XA 1XAIA 3RV3A 4CIWA 1L3CA 1E1QA 2PGDA 3LXMA 5B7QA 2PUDA 2JIOA 4GMFA 3GFQA 1UPCA 4FEAA 5EHGA 2IJGX 3PJGA 3T41A 4GR5A 5DTRA 2XUDA 4LX0A 1TUBB 1YVRA 2K6GA 1N3LA 1QCYA 3B8HA 4J07A 1PX0A 3CR7A 2ZIUB 1UWKA 4LJ9A 4W1SA 3VHXB 2G7ZA 3CWZA 5K6TA 4X65B 1FVFA 1G5FA 3O31A 3NWEA 1JHDA 1CS0A 1DXQA 4WZBE 3HYCA 1F06A 1NW9B 2ZBDA 4HGOA 4I8DA 4HXEB 3KO8A 1Z4IA 2YWBA 5A02A 5JD3A 2VF4X 4EJSC 4WBNA 1XP8A 3CVXA 3F6RA 3I2GA 1WZUA 4U9IS 3UAZA 5FUVA 1EX7A 4P3NA 3S8MA 1MRNA 2J3MA 4DSUA 4CV0A 4H3VA 1ZJZA 3MOIA 4QHTA 5TQ2A 2YHIA 4OGGA 4YUZA 3PFIA 4GFDA 5AUPB 4XM2A 3BWMA 4N6OA 1R0KA 3RGWS 1NVDA 1MUUA 4KQMA 4G26A 5CLIA 2WM8A 3WNCA 4F9FA 3U31A 1UMDB 4RHYA 1XHFA 4CEJA 3PL5A 3Q1KA 4MV1A 2I8LA 2YWEA 3ANNA 1SU6A 1WTAA 4A6EA 1K7XB 2ZDQA 3ZCTA 2NZ2A 3W34A 3CRQA 2XAAA 1FDOA 2YQZA 4QNRA 3OOJA 4R16A 2WMDA 2WW8A 5LMZA 3ND5A 3MJFA 3QLTA 2R66A 1ZH0A 1P4HA 3KAKA 3H5AA 4HDRA 1QAQA 4LXQA 4TL6A 5NULA 3WRXC 2IF0A 3M5CA 3HXPA 4YRSA 2RKBA 4RTNA 1Z0UA 3D8SA 1OZFA 2RIPA 4TTTS 4FKBA 4NYJR 5CDFA 4G09A 2PZFA 5KQLA 3IUJA 3NANA 3Q2KA 1GITA 2HWKA 4MNTA 1E2LA 3LT5A 3VSDA 3F97A 4I6GA 1K8XB 2IPOA 1JJAA 1YUMA 2FMXA 3GLVA 3VU9A 2Z57A 3AOEC 4JI5B 4GQAA 1DJLA 4BGIA 4GLFA 4DSOA 2P2DA 2G1AA 3CE9A 2IKSA 3B6JA 4G1CA 4OHXA 1RQGA 1A96A 2Y0DA 4OMFG 2W0SA