2GRJA

Crystal structure of dephospho-coa kinase (ec 2.7.1.24) (dephosphocoenzyme a kinase) (tm1387) from thermotoga maritima at 2.60 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
b'HHHMVIGVTGKIGTGKSTVCEILKNKYGAHVVNVDRIGHEVLEEVKEKLVELFGGSVLEDGKVNRKKLAGIVFESRENLKKLELLVHPLMKKRVQEIINKTSGLIVIEAALLKRMGLDQLCDHVITVVASRETILKRNREADRRLKFQEDIVPQGIVVANNSTLEDLEKKVEEVMKLVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dephospho-CoA kinase
publication title Crystal structure of Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) (tm1387) from THERMOTOGA MARITIMA at 2.60 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 61
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2grjA00
4LBYA 1TMKA 1OXUA 2FNAA 4ACAA 4MKHA 3TSZA 3LO5A 3C5CA 3BORA 5KSYA 4JL5A 4BLOA 3OIUA 1T91A 2FPLA 1MT0A 4BWYA 2FMXA 1E9SA 3F8TA 3B5JA 1E79D 2GF0A 2DWOA 3TRFA 2GEVA 1FMLA 3RS2A 5AJWA 3RRNA 3SNHA 5IK2A 1F5NA 4M1YA 3TH5A 5FH9A 2Z43A 1W4CA 4F4JA 4KVGA 4Q18A 2ORWA 3A1UA 3K0FB 5DYGA 1US8B 3FE2A 3CRRA 1IN4A 1QVAA 2ZITA 3QG5A 1F2TB 4ZDJA 4M9QA 2GBLC 4NHOA 2O0JA 3WYAA 1KTVA 2O8FA 2OESA 4Q21A 5HZHA 3CR8A 5FBQB 1U0LA 2WAXA 2NGRA 1YZUA 2JCSA 1JB1A 3C41J 4BEBA 3LVRE 3WNBA 4BFUA 4IXNA 4L4UA 1EFCA 1ZM9A 1AN0A 4DJTA 3UKDA 4J0QA 2WSSD 2ZM5A 3T15A 3P27A 5AWFC 2J0SA 4Q4AA 5FBVB 2HCBA 3HP1A 1UKEA 1X86B 3B13B 1KKMA 2JLSA 2WICA 3DMNA 3CONA 1Z22A 5AR1A 1JPNA 2R6CA 5L3QA 3K70C 2AXPA 4ON9A 4XD7A 1BYIA 2F7SA 1KMQA 2QP3A 4XSGA 5TB5A 2HT6A 5DN6D 2F3RA 2ZE5A 4KFSA 1XEWY 1OXSC 4QG7A 4D4JA 4C0JA 2JDIA 3RRYA 1XJ0A 5EQTA 5DHAA 1GL7A 4NE2A 4YONB 1OFIA 4JLPA 4YXWA 2CXXA 1ZINA 1IONA 4NYMQ 4B47A 1J8YF 4ABYA 3DO6A 4X8HA 4LV5B 2H8KA 1D2EA 3R8CA 1XEWX 4OHXA 4RD4A 3VR6A 1OXXK 4KSBA 4TTPA 4NCJA 4NL4H 2O8FB 2C77A 1JR3E 5A0FA 4DLSA 1ZU4A 1YRAA 2VSFA 1MH1A 1SVSA 3K8YA 3KJGA 4NP6A 3MJRA 2JLRA 3NTUA 4Q4JA 3MSXA 3N2IA 3MFYA 1RYFA 2ZSEA 2GXAA 1IN7A 1EK0A 3IIKA 3KQUA 1JPJA 3A4NA 1SKYB 4Q4AB 2ZRLA 4E22A 3WYGA 1OHHD 1JJ7A 2IYUA 4UXHA 1GWNA 2F1RA 1JAIA 1ZNXA 2VRWA 3IBYA 3KQLA 3A6PC 3SJCA 1CRPA 1IN6A 5L3QB 2BBSA 4KO8A 3EA0A 1E1RD 4XVUA 3EPLA 1JQJC 1GKIA 3EPJA 4JJZA 4B35A 2GXQA 3GJ5A 3AP3A 3KXLA 3X1WA 3KQHA 1TEXA 3CB4A 2AFHE 3UMFA 1WA5A 3MRSA 2V8OA 4DLUA 1YQTA 1G8GA 2IYSA 4LHYA 4QHSA 1T5IA 1YKSA 2JLWA 4EAQA 1A2BA 2QENA 3AVYA 4HUQB 3KXIA 4A6PA 4V02A 2XOKD 3BFVA 5HE9A 1J7KA 1GTVA 3GLHA 2EFHB 3KJIA 3TMKA 4B73A 3GFOA 3H2YA 4D82A 4TQUS 1KY2A 3KFXA 3AF1A 2HCJB 2QRNA 3QPWA 1WDTA 1DG3A 4RSGA 2OSBA 2BKUA 2CCKA 4FXPA 4Q4JB 1P72A 1MO3A 3MCAA 3K0EA 1D6JA 1KK1A 4AURA 1E69A 1CJTC 3SEAA 3LXXA 5G40A 2OCPA 5G53C 4D2IA 3GLIE 2EFCB 4D26A 2IXGA 1CP2A 1R10A 1N25A 2ZUCA 3HPQA 1T4GA 4IEIA 5TY0A 2BV3A 5FTKA 3UIEA 1VG8A 3L8YA 3B9PA 2OEPA 5JBQA 1OF1A 4Q1DA 1RFLA 2C8VA 4C0LA 4TL6A 3I5XA 2A5JA 4TYQA 1TPZA 4GOXA 1XZQA 2LKDA 2ZJYA 1UM8A 1UADA 2CMKA 4RCYA 1XTSA 3KX2A 4EPXA 4GP7A 4BRUA 1KMHA 5J4HA 1E1QD 1YR8A 2YWFA 1HTWA 3HU2A 1OKKD 3GLHB 3VX3A 2YJTD 5HZKA 2CK3D 3PR1A 3QKRA 4EPTA 4HLUA 4G5SA 4NPHA 4A82A 4DT1A 2QP9X 2DY1A 2VH5R 2ODBA 1W36B 4XJXA 2GVDC 3LQQA 4II7A 1DBSA 1U98A 3AF0A 1N6PA 5CK4A 1ZVQA 1DS6A 4LK2A 4DEYA 1GL6A 3ZH9B 1P9WA 1W46A 4DUGD 2O8BA 1HA3A 3RC3A 1N0UA 4HUTA 3PITA 4CEHA 1N0VC 1Q0UA 2ZRAA 1NRJB 3AGPA 4MGIR 3EZ9A 4MUAA 2IX3A 4BE7B 3NBYC 1G8HA 1DVRA 1RKBA 4L8GA 2KJQA 4Q01A 1YZTA 2AK3A 3FFAA 5EE9A 2PT7A 2WPDA 1IJFA 2IWHA 2IYRA 5JS7A 4TTRA 3QPVA 5JMTA 1XD8A 2C03A 5L3RA 4MYHA 1S1MA 4PSVA 1KMHB 2GAOA 3RRZA 1OW3B 4TSFD 4Q7JB 1XPRA 2D2EA 3ZJYA 1E0KA 4NYJR 4W5JA 2GKSA 4D4KA 2ZROA 1GP2A 3PVSA 2ZYTX 4DT1B 4PR0A 1C1YA 3QKUA 3QUSA 4TLEA 5FL7A 1EFUA 3TK1A 1AS2A 5KHOC 1CU1A 1E2EA 5F9FA 3EW9A 4A0FA 2FJUA 4DSNA 4ZCIA 2PMKA 4ESVA 2AD1A 3IO5A 5HR5A 2CLCX 2CHQA 5EE0A 1U8ZA 2YVUA 4LHXA 1HV8A 3FMFA 2XZLA 2O8BB 3O8DA 2FE4A 2QT0A 4CEHB 2ZUBA 1OFUX 3LFUA 3LBHA 1SHKA 1W0KA 4HLCA 3X1YA 2CNWD 5H8WA 5GJCA 1T3LA 2ZJ5A 3GPLA 3AVXA 2JJ1D 4JLJA 5FOTA 2CVHA 1KO5A 4DLWA 3KZ1E 1T0HB 4LJ4A 1DAGA 2OILA 2HYDA 3A1VA 5JJLA 1T0JB 3I62A 1WRBA 3ZGXA 4QNMA 2W2VA 3EXAA 4LZZA 2GDJA 3BB1A 4AKHA 1FNMA 1F60A 3Q72A 3FMPB 1XXHA 4WIAA 3E5HA 1GNPA 2J7PD 2HJVA 1J70A 2X2FA 3MG9A 4WW0A 3R7WA 3LAWA 4A8JA 2IYQA 2GESA 2XSZD 3RS4A 1Z0AA 1KSFX 1OFHA 2ZI9A 4CEIA 3IEUA 4IDNA 4KV9A 4M4SA 2DFKB 2QAGC 2QE7A 2VO1A 3FPAA 2JLUA 1PLKA 3UANA 2RKOA 3W3ZB 4HLDA 4H1UA 1FTSA 2AKYA 1QHHB 4B76A 1ZC3A 2GEUA 3HWSA 2WZQA 3BAFA 2WHXA 2MSCB 2OCAA 5DISB 5KO2A 3K70D 1E32A 5JCPA 1Z06A 1H8ED 4DLVA 1FPMA 4E5UA 1YR9A 1CJUC 3EWSA 4PTLA 4B71A 3FVQA 2FOLA 1XRJA 4LPSA 4WOPA 4KYUA 4G5RA 1KI6A 2BCGY 4HAZA 4RD1A 1GKYA 1IXSB 1XNJA 5L3SA 2Z5FA 3GJXC 4D25A 2ZVQX 4M53A 2YOGA 2J3EA 3IKJA 3NDBB 3PEYA 4DXAA 5GVRA 4GDFA 1QBKC 1N5KA 4MRSA 3D31A 5IRCD 3P20A 1X1SA 1CF4A 2OO7A 2GXSA 2V7QA 2ZUDA 4UNSA 1G5TA 1D9XA 4AKGA 4HYYA 3DHWC 2G6BA 2C9CA 4MRNA 1R0XA 4A8JB 4GOJA 1NF3A 4CVNA 2D7DA 1HE1C 4JJKA 4DB2A 1QHGA 4MRVA 4CEIB 4BFTA 3VU9A 2QSYA 1VMAA 3HU3A 5KDOA 4A9AA 4ZV4A 4OHYA 1AGPA 3NEJA 3KUCA 2Q3FA 4DLRA 1TAGA 3EZFA 4F38A 3CKLA 4UXJA 121PA 3IILA 1P2SA 2WVJA 5JWRA 3QKTA 2HYIC 2DHRA 4B2PA 3VTKA 1CIPA 1F3OA 2R65A 3Q3JB 3T1OA 4OHVA 3OAAA 4XIGS 1JJVA 3IUYA 1G5PA 2P67A 1JAHA 1PLJA 3BB4A 1NLYA 4JZKA 1EFRD 1TADA 3QOFA 1YZNA 5AJYA 1KI6B 3I3SR 4RZXA 4DLZA 4V0ME 4JKYA 5FL3A 5L3SB 1G1MA 2W6IA 2AL7A 2RGGA 3TIFA 4D0NA 4KLNA 5B57C 1KO7A 3UMRA 4HDQB 1SVWA 4CIDA 2IL1A 2LKCA 4TMXA 3QJYA 4U02A 4NKRA 4E07A 1AK2A 2AN9A 5J47A 4QHYA 3SJZA 1KK2A 3VKHA 4WBSA 1NI3A 1Q21A 1DOAA 2Z4SA 3CUEF 1CJMA 1VIAA 1XU4A 1SHZA 3NC1C 2J46A 1TL7C 721PA 4G3XA 3VX4A 1R0ZA 3OE7A 1VECA 2PBRA 2Z83A 3VU9B 2ERYA 2IW3A 3WRYC 1G16A 4XWKA 1ZJ6A 1M1YE 3BC1A 3F5FA 3U7HB 3K0AA 4PZYA 2IHBA 1OPXA 5BYJA 4LJ5A 3DM9B 3LH5A 2J45A 3U5ZB 3HYTA 4OQLA 1LY1A 1R0WA 4PPFA 5EUMA 1SVIA 3SI7A 2PLFA 2CLSA 2ZYVX 1S9DA 5D3QA 3EASA 3QKSA 3K09A 1JR3A 3VHLB 5K8LA 2BVNA 1WCV1 2NQ2C 1W4RA 2ZE8A 3ADKA 3QXCA 4XSHA 3WMEA 821PA 4M2LA 3CRW1 4FCTA 5AK0A 1VKJA 2W2TA 2I3BA 3RHFA 1FX0A 1E9RA 3IBGA 1X8KA 4X8LA 1XJCA 1KI4A 4KHZA 4Q4LA 2CL7X 4Q02A 1IOZA 2HEIA 3RWMB 4TQ9A 4KFTA 5B2ZA 4ASUA 2ONJA 1UEIA 3T61A 2ZRMA 2P2LA 3UK6A 4A0RA 3AF3A 3ZQ6A 1Z83A 4HZUA 2WSMA 2ZRKA 3MAAC 2QTFA 3TW8B 3K9HA 3GJ3A 2Q6TA 4M9SA 2ZE7A 1Z0JA 2WTUA 1G8FA 4BQSA 1XTRA 2A2ZA 3QBVA 4JLDA 1G3QA 2KB0A 221PA 4V0NA 4GMXA 4AD8A 3VR4A 3AVPA 3K0AB 3GEEA 1SULA 4QJ3A 3DOFA 3SQWA 1P4SA 3M6AA 3VR5A 1P7CA 2XZPA 4PO1A 2YKGA 2R6AA 1G6OA 2IYYA 1NVWQ 2F1IA 3O8RA 3Q5DA 1KO4A 1D5CA 2YOFA 3SBEA 2WM9B 1MABA 2ZVPX 3R9XA 4M8NE 1YU9A 5EXSA 2WWFA 2HXSA 3M0EA 1CTQA 2XNDD 3QKSB 4MGYR 1NSTA 2OBNA 5F3WB 3ICQB 2R44A 4FN5A 4DBLC 3ZDQA 4Q9LA 4LCBA 1P2VA 3MLEA 1ZIOA 2YC2C 3N5CA 3MJHA 4QBHA 2GHIA 3FMIA 1R5NA 1R2QA 4LPKA 4IJMA 4BZXA 1CEEA 2HLDD 3KXKA 1YHNA 1E94E 2OLKA 1S8FA 2FX3A 3GLIA 4MDEA 1RJ9A 1ZNYA 2MMGA 3CF6R 4HZUB 4Q47A 2A5DA 1I2MA 2G1KA 5EE3A 1HYQA 2BBTA 2NPIA 1G41A 1XJQA 2Q3HA 5JWOA 2GF9A 2J7KA 1XX6A 4RZ2A 2OCBA 1BMFD 4URZR 4KODA 1DTSA 5FUWA 4WZAE 5LB4A 4B75A 1OFTA 3ZQJA 1DADA 4R71A 2QPOA 1TQ2A 5EXPA 3VNUA 1ZIPA 3EIEA 4AG5A 2OV2A 4I1UA 4PC6A 2QL6A 4MA4A 2XTNA 4DDWA 1XWIA 1AQUA 1SKQA 1MABB 4FCWA 5F2EA 3S1AA 2D2FA 3VAAA 3Q7QA 3PEWA 4YMWA 2JLVA 4JBXA 2WBLC 4BUJA 4Q1BA 3GJ0A 4D80A 4NZYA 4D0LB 5J4KA 2ZREA 4I1SA 3T12A 4G1UC 2OBMA 4MYCA 1TQDA 3I1FA 4C0SA 3OFND 3RABA 1I4DD 5FOUA 3KUDA 2FG5A 4F93B 2E87A 1GOTA 1KIMA 2ZYWX 3OIYA 1E2JA 1E9AA 3RSOA 1E3MA 2G0TA 2Q21A 4PSKA 4Z8XA 3TKLA 3TJZA 4QM6A 3GLIB 3UG7A 2G77B 3K0CA 4OYHA 1RJ9B 1XBTA 1EX6A 4GI7A 4LYJA 4OBEA 3UMSA 2VSOA 1ONBA 4IOJA 2O0KA 3LBNA 2IBMA 1HH4A 3P26A 3T1QA 2WJHA 5JECA 5C1BA 2ODEA 4TLDA 4DLYA 2GCOA 2QTVB 3GJ7A 2CVFA 4QGAA 1DARA 3ECCA 5FOXA 1QRAA 2IS6A 1N6NA 3KFVA 3PENA 1GL9B 2VHQA 2VP2A 3A37A 3PUXA 4PHGA 2F6RA 3I61A 3FKSA 2QEQA 4KSCA 3NIBA 1Z0FA 3CX6A 1KSGA 3DEFA 4KXFB 4LV6A 1WE2A 2YWEA 2EFDB 3CIOA 3DVLA 3SBDA 4EPVA 2QROA 3S1AB 5EP4A 4OK6A 2VP5A 1GUAA 3IO3A 4JYCA 1UDXA 1W0JD 3PQCA 3BB3A 3C14C 4ESHA 2NPFA 2ZS9A 1W2HA 2WJJA 1K5GA 5C4MA 1F2TA 1XMSA 2NZJA 1BO6A 2QQEA 1XTJA 4KYIB 4QC2A 4URUR 4XWAA 3GD7A 3AKEA 1OXVA 3WRXC 2QBYA 3SYKA 1CR2A 1G291 3AB3A 3OZXA 4YQFA 4TQAA 1E2NA 1VHTA 4JLMA 3CPEA 3CRVA 3GEIA 5BN5A 2ERXA 1L8QA 1NMXA 1Z2AA 2JLQA 5CM9C 3LRPA 3G82C 3MWYW 3AP1A 2IXFA 1EFHA 3RYTC 3A58B 4XTRA 1KGDA 4C30A 5TMPA 2F55A 2D7CA 1NKSA 1OYYA 4FMCF 1M34E 3SHFA 2VPPA 2CJWA 1NBMD 4WVFA 3I73A 4JLVA 2P6NA 2PH1A 2WIBA 3OEED 3SE0A 2GCOB 1JBKA 4IOKA 4NU0A 1X6VA 5FPYA 5GADl 4R2HA 1ZCAA 1KI2A 3G0HA 3I4LA 1Z6AA 4WXRA 4A92A 1AKEA 3AKCA 4IEEA 3ZIAD 2GAAA 2PEYA 1W36C 1AA9A 3T1TA 3U4QA 4Q66C 2A5FA 1DAHA 1KO1A 1R5BA 1P2TA 2IS4A 1E9EA 3Q8XB 1VG9B 2P5SA 4PC3A 4TL7A 4B3FX 1B23P 4RY2A 2J59A 4OHZA 1IY2A 3CH4B 3BRWD 2RGNA 3CM0A 1UBGA 2QBYB 2WWGA 2ZU0C 2R6DA 1F48A 4A15A 2N42A 1W7AA 3PUZA 3W6NA 2GETA 4FINA 2X77A 2JJ2A 2V9PA 1YVDA 2I1QA 4IDQA 1YZQA 5B58C 4NDZA 4GZMA 2QG6A 3BD9A 3P32A 2IC5A 2NOAA 4KLZA 4D0GA 2DFLA 2MSDB 4LBZA 4I1VA 5FPTA 1UJ2A 2FN4A 2G9NA 2W58A 2CJWB 3AEZA 3IGFA 1T3HA 5TXGA 3U61B 1UDWA 4PPNA 2EFEB 5AUOB 5EZ5A 3U3KA 4OHWA 2R8RA 4HAWA 3C16C 3B85A 1EGAA 2AFIE 1E96A 5BYKA 2NG1A 4DCTA 3CPHA 4GSYA 1MRSA 1W2GA 4JVSB 3U4QB 2H1LA 1Q3HA 4JS0A 4DIEA 1P60A 1KJYA 1S0UA 5EJEA 4HUQA 2NTYC 1X1RA 5C18A 1D9ZA 4MGKR 3OEHA 1V43A 4LC0A 2OHFA 3KKMA 2IYVA 1UKVY 5DLQC 1TU4A 1J90A 5EE1A 4Q1FA 3BBPA 3TGPA 2XNSA 4W9MC 1KY3A 1UF9A 1TF5A 4D4MA 2NO6A 3K1JA 3EX7C 4LWZA 1IM2A 4Q48A 3SJAA 2A9KA 2FA9A 4MKGA 3RNLA 2ORVA 2OXRA 4F92B 1F2UA 2VL7A 3MD0A 4H1VA 4MDFA 1XCGB 2DB3A 2K5UA 3QNUA 1W5SA 3W8RA 3CPJB 3EIHA 2DWQA 4V0MA 1UBCA 4HDCA 1S9HA 3K9LA 1LTQA 2Q3MA 3NWJA 4BEJA 3Q9LA 4M1MA 3B1WA 4RKEA 3AVTA 1KOFA 4QGHA 2FV8A 2FPMA 2J1LA 5H68A 1VCOA 3SQXA 3LDAA 3CF0A 1U99A 5CB8A 4U5XA 4A1FA 3GFTA 3A4LA 1CLUA 3W6PA 4JLNA 2V3CC 3TUJC 4DKXA 2CCJA 3W90A 2ODWA 3SFZA 5GJBA 3W6OA 1S2MA 1AZSC 3KJEA 4N0EA 3AV0B 2VP0A 4QBFA 3PXGA 4LHWA 3BS4A 1OXTA 3GLFA 3H1TA 2VLIA 4DCUA 4EFMA 5BW8A 4US1R 3K9GA 1Z6XA 2IT1A 5JEDA 1Q44A 1E2GA 4LSGA 3SDZA 3TVTA 4IFEA 3H84A 1ZCBA 2ZJZA 3BOSA 3WNCA 4TLAA 4DWJA 1GKUB 1NVVR 5HKKA 3SFVA 5G41A 1NN5A 3ASYA 4HATA 4M1OA 2OBLA 3I5YA 1TQ4A 1U8AA 2J87A 3LW7A 4DDTA 5IK2D 2P5TB 1RC8A 2ZSAA 2QMUA 1XD2A 4M1TA 1F2UB 1JXMA 3AVWA 2QN6A 5ANRB 3NVAA 2CNWA 2QUZA 3IPXA 3NH9A 2RGAA 5EP1A 2JJ1A 4Z51A 3AUXA 1FMJA 4B3DA 2GWHA 5FOWA 4A0GA 3FMOB 3TAUA 3AM1A 4A8JC 2GK7A 3GLGE 1K6MA 5IHPA 3EWAA 5CLQA 3J81k 1JEEA 4C0BA 5K8IA 6Q21A 1RRCA 4LGMA 4Q5IA 4WZBE 3ASZA 1D8TA 3THYA 1RVDA 1GVNB 1HQCA 4HB3A 2QGZA 3U6BA 5KSOA 2QRZA 4QHTA 5JCZA 1QHSA 1A2KC 4ZI2A 4NYIR 4LBWA 4LX0A 1WXQA 3GLFB 3N2EA 1M8PA 4L15A 1MO5A 3AGQA 4BZQA 1IXRC 4DIDA 2XSZA 2OLJA 4N1AA 4QGFA 4JL8A 5CM8B 2EU8A 3FOZA 2D74A 5FBRB 3E70C 3WY9A 1VPLA 4MYTA 1CBUA 1HUQA 4MKFA 1P2UA 1GITA 4XD7D 3KB1A 2CCGA 2W6JA 4MUBA 2BCJQ 1TUIA 3AVOA 2ZJOA 1VYUA 2HUPA 1OJLA 4C0HA 3FYHA 2JDID 1AIPA 5SZHB 2WJGA 3KJHA 4IOMA 3U3OA 2G0NA 1LV7A 3PG5A 1TF7A 2WMNB 1XD2B 1COWA 4JLKA 1N2CE 4HZIA 2BM1A 4OQNA 2XITA 4NCHA 1TTTA 2KE5A 2BEJA 1G20E 1KNQA 3GP8A 3MUFA 2WKRA 2BWJA 2JAQA 4HAYA 4CEJA 1JQLB 2ZAOA 1Z3IX 2LCFA 3AH8A 4CW7A 1ZC4A 2FSGA 521PA 4WXPA 2ZRGA 3CF2A 4R98A 1OH8A 5DH9A 1FUUA 1PVOA 4ZPXA 1UAAA 1E2HA 2RHMA 2OUKA 1IJEA 1N6KA 2CL0X 4UKDA 2IA5A 1NVXQ 4C0AC 3THYB 4K8OA 5CLLA 2ANCA 1FTNA 1LB1B 1ZP6A 2WMOB 1N5IA 1N6IA 5B64A 1R8SA 5A5GA 1KJZA 3UATA 2DPXA 2FH5B 3W34A 3NC0C 5L3VA 3FHOA 2IS1A 3QE0A 2I1VB 3VNVA 2XTZA 3LW8A 5JEEA 4AWXA 1CS4C 1CULC 5DE3A 4Q9JA 3X1XA 5E4FA 2DCUA 1UBEA 2OCYC 2HT1A 4OI1A 2ZI5A 1G64A 3ZVMA 1R4AA 4PHTA 4CYMA 1OB2A 3AF4A 1YRBA 1KK3A 4LJAA 4US2R 1QHHA 1Q3TA 2JGNA 2XEXA 5CIWA 5JSZA 3QVUA 4C0QC 5ELXA 1R0YA 1ZM7A 2W00A 2JLXA 4R7ZA 1U9IA 4OQFA 2G88A 3ZVLA 3WNDA 1NJGA 3TVDA 1SXJA 1UPTA 1E0SA 2FFAA 2YYZA 1U2RA 1YR7A 1HT2E 2VF7A 4IFBA 4CEJB 1II9A 3RLFA 1GM5A 3ZS8A 2YNMA 5IDVA 1W36D 1Z63A 1GRQA 2Q9CA 2PX0A 4UJ5A 3EC1A 1GRNA 2CHVA 2OAQ1 4O3MA 2WJYA 1W47A 3ZYCA 5F98A 1N6LA 4ZO4A 4OI4A 2QNRA 4GMDA 1Z0IA 4N0DA 4JVNA 1J2JA 1Z07A 3U7FB 2BJVA 4Z1MA 3OESA 1ODFA 2C95A 2JJ8A 3PFIA 2YZ2A 4Q7KA 1KDPA 2ZJ2A 3K09C 1QG2A 2X8AA 1E2FA 1E2PA 1Z47A 4PANA 3WXMA 1X8JA 2C99A 3MWKA 3VFDA 3AUYA 1NKTA 5AUNB 2VEDA 2GCNA 1U94A 3A36A 3ZD6A 2IUSA 3TUZC 3W5JA 1XCMA 3OF5A 4JVMA 1QDEA 5JSZB 3B6EA 2G3YA 3CNLA 3LD9A 1XEFA 1W44A 2FEOA 3QVVA 1L2TA 2ZI7A 1NG9A 1SXJB 3SJBA 5FPSA 3KQNA 1IN8A 5HPYB 1AJEA 3ND9A 1YZLA 2WIAA 4HAVA 4XOIA 4F4CA 3FKQA 4Q4HA 4QXAA 3FWYA 5CYPA 4IW3B 4ARZA 2J41A 4Z8YA 4C7OB 1IQPA 4POAA 1ZD8A 2FU5C 5LBIA 3PUYA 4C9BA 2AHOA 1CXZA 1LS1A 1K8RA 4ACBA 4Q1EA 1DAKA 3QIAA 1MKYA 1SQ5A 3JVVA 4JMPA 1XTQA 4O0MA 2FDCA 3R9WA 4TTQA 1NLZA 4GNKA 3IPYA 4KFUA 1VYVA 1QG4A 4D81A 3WYFA 2XJ4A 1Q12A 4EFLA 1SKYE 5K8UA 4TLCA 4KJZA 3O8BA 4Z54A 1EESA 3RS3A 3Q5EA 2IS2A 4NYJQ 1TEVA 3LXRA 1QF9A 3LQRA 4QJ4A 4W7SA 1AGRA 4C2UA 2W0SA 4AI6A 2PJRA 4CDGA 3DDCA 2WPDD 3BH6A 3C7KA 3RWOA 2WKQA 2GXUA 4ZKDA 5CITA 4ZDKA 4URYR 5GVSA 5HE8A 5K8TA 2QMEA 4F4IA 4LI0A 4E03A 3X1ZA 1CR1A 2EYQA 4AY2A 2C5LA 1M7BA 4Q9KA 1E4YA 4OI0A 1G8YA 4LOAA 1V5WA 2FFBA 2FGKA 3KTAA 1ETUA 4UQOA 5KTYA 3EPHA 1E9FA 5KPDA 4EPYA 5M04A 4Q4HB 3VHXA 5BN3A 3TNFA 4ARZB 2ZRDA 5FL7D 4TMWA 1HQYE 4G0NA 1J99A 3C15C 4M9XA 5FBLB 1N0WA 1EX7A 1HY3A 4JT4A 2JLZA 1GILA 4NCIA 4RKFA 2REBA 5E3HA 2UZIR 4FCVA 4FMBB 1DEKA 1S4QA 1KO8A 2C9OA 4BLTA 2LWIA 4LDJA 5KSPA 4DCSA 3GCGA 3ZVNA 2JIZD 4DCVA 1N5LA 5FR1A 3V4FA 3FHTA 3SYLA 3VKGA 1G7RA 4B43A 4TWZA 3IHLA 3HDTA 4C4PA 3B78A 4GRAA 1YE8A 5IT5A 4LUCA 3QXHA 1OB5A 3B1YA 4V0OA 3SN6A 3AKDA 1EWRA 1AS0A 3W5IA 4B2LA 2BBOA 4ILEA 1TUEA 5TVKA 1KNXA 3PEVA 3NBXX 4JBYA 4US0R 1LVGA 4UNNA 1Z0DA 1A7JA 4IHQA 1FW6A 3D3QA 1D2MA 3K0CC 1QHYA 2O8CB 3SHWA 5BN4A 5L8VA 2YC4C 3GJ4A 1XMIA 4DC9A 2GZHA 3Q85A 4CZ2A 3O47A 3F0TA 3KTAB 1KI3A 2IYLD 3UPUA 1WQ1R 4RD6A 1VCIA 2ZSDA 4A2QA 5J40A 3FTQA 2BMFA 2QE7D 3THXB 5JRJA 1NJFA 5EUQB 1ZUIA 1NL3A 2D06A 5LPNA 3SR0A 3ZS9A 5BWMA 1IAQA 2E1RA 1H8HA 2B6HA 2KBFA 4PXAA 621PA 4DDUA 2EQBA 4M1SA 1I4TD 3WP1B 2GZAA 4BFXA 5EXTA 5E7JA 5LD2B 4TZ0A 4PC7A 4PAMA 2VYFA 4KU4A 2ZTSA 5E7MA 1XB2A 1QHXA 1R8QA 2PCJA 3BGWA 1P5ZB 3E1SA 1ZRHA 1E98A 2ZANA 4BLSA 3BFXA 2NO7A 2PJZA 1IXZA 2CLDX 4B48A 4JIMA 2P65A 3LX5A 2GVZC 3AVVA 3FB4A 5J4VA 3CZQA 2A78A 1ZM3A 3BERA 1VG1A 3T5GA 1G18A 2V7QD 4YLGA 4YMSA 2Q9AA 4Q9HA 3DZ8A 2GTPA 1W0JA 2KSQA 3ONWA 1K5DA 4KVAA 4I1OA 1UKZA 3DKPA 3E2IA 2BC9A 2AWNA 4X8OA 4AYWA 3EG5A 3NHBA 1G17A 1RPZA 4MYUA 2QM8A 1KDTA 3H86A 1E2LA 1MV5A 1HE8B 1XMVA 4DCNA 4ERNA 5BXQC 1RIFA 5AUQA 3ETLA 5KUTA 2PL3A 3C5HA 1A4RA 1G3UA 3CNOA 5JI2E 4TT3A 3VR1A 3V4RA 3GLGA 3D7MA 1RRPA 1TQ6A 2FZ4A 4QBIA 4P32A 4DSOA 3L0SA 3KKPA 2QU8A 2KWIA 3KB2A 4PO9A 2MMCA 4YC7A 1CJVC 4BLQA 2DYKA 4QFMA 3ZZUA 3U3JA 4MITA 4F91B 2RGNC 1E79A 5H70A 4EKDA 5F9HA 1HEIA 1I2DA 2WWIA 2ZSBA 3KL4A 4DZZA 4JSYA 2H57A 3TBKA 4CF7A 1GDDA 3DOEA 5C2JB 2CDNA 5P21A 2VP4A 4DVGA 2WWWA 4EUNA 4BZPA 3SC3A 4R9UC 5FOSA 4W5HA 4OI2A 3C8UA 4L9SA 1KK0A 3PCRB 4FI3C 2N1BA 2WJIA 1HT1E 2A3RA 4LBVA 2E9SA 4JT2A 4BECA 2VHCA 3KKQA 4EJSA 1Z08A 3O8CA 3U7GA 1Z28A 4B33A 1B0UA 1WBBA 4ITRC 1ZNZA 4BLPA 3QSYA 2WSSA 3ZZTA 4IDOA 3SS8A 2IF0A 2D4HA 2IYXA 2J0UA 3RAPR 1X3SA 4JKIA 1JR3D 3BJIC 3GLGB 1G4AE 1JNYA 2R9VA 5C4GB 2O8EA 3IQWA 2BOVA 4O2LA 2D3WA 1ZM4A 1RZ3A 1TNDA 1M7GA 5E7IA 3M1IA 3R20A 2ZRFA 2R6GA 3I72A 5DN6A 1FQJA 1ZW6A 5TARA 4QM7A 1T9HA 4RD0A 2CL6X 1N6HA 4PAOA 2V1XA 2FFQA 3K9NA 4PSAA 4BFYA 4LHZA 4TMVA 1QHNA 1LF0A 3MGCA 4O25A 3NH6A 3QEOA 2VIIA 1U0JA 1E2IA 1ZUHA 4I4LA 1W1WA 4GBMA 4URXR 3RRMA 5GJWC 2YWGA 1M7HA 5FTNA 4AKEA 2QMHA 4A4DA 1XXHE 2WOJA 2GJ9A 1Z29A 5TDHA 2QORA 4XVRA 2HF9A 4LJ8A 5KSZA 4IDHA 1S3GA 1PUIA 3B82A 4EJSB 3T06B 2V4ZA 1BIFA 3B8HA 3DKVA 3IEVA 4B6FA 2RGCA 4PAQA 4IDPA 2NO1A 2V54A 4KCGA 1CR0A 4D6PA 2J0UB 5EE5B 5KYKA 4Q9IA 1KAOA 5J4YA 1OHHA 3BWDD 4TYNA 2RGBA 2O8EB 4TMZA 1QZXA 2XZOA 3CH5A 1GG2A 2V55B 1Q20A 2QA5A 2R2AA 1E4VA 4B6EA 3BIFA 3TR0A 2XB4A 1E1RA 2XX3A 1KAGA 4RD3A 4TMKA 5JLJA 5DIFA 1FP6A 4H9GA 2VQSA 2QP4A 2QPTA 4PPGA 4BLRA 1FUKA 1XPOA 2B92A 3QXXA 4Q1CA 3AKYA 4GFDA 5FTJA 1BOFA 3CW2A 4Q03A 1M6NA 3NHAA 4ZDIA 4KITB 1XTKA 3CZPA 1GZSA 4AIIA 2GRJA 3RS5A 2XOKA 2QM7A 2ZEJA 4PQYA 1CRQA 1G3MA 4JVLA 4B3CA 2YINC 1T8UA 4NCNA 4G5GA 1FQKA 1W48A 1IN5A 4AG6A 2J9RA 2QY9A 2UVQA 3PUWA 4LJ6A 1VTKA 2ZETA 3AQ4A 1ZUNB 5DI3A 4U00A 5HTKA 2EVWX 3MWJA 4HB2A 5DYIA 1OLOA 4NCKA 1SZPA 4B3GA 4BRWA 4RFVA 1ESNA 2Z0MA 3ND8A 1E2DA 3TLXA 3TQCA 4XWOA 1Q1ZA 2Z6VA 3WBKA 2XXAA 3UG6A 1L4YA 2R62A 1GNRA 1U8YA 4L9WA 4HLUC 4V0KA 1IY1A 1GIAA 1II8A 2XAUA 2D62A 2ZS7A 3VKWA 2BJWA 3NKVA 2B7BA 4C0KA 3B2EA 4LRWA 5FBWB 1SVMA 4DDVA 4WAUA 3A1WA 2REXB 2GK6A 4JLBA 1NIPA 1E1QA 4JLAA 2ATVA 1RE0A 2WOOA 2PZFA 1XEXA 4KAXA 4MKIA 1JXOA 1OKKA 2ZR7A 4TN1A 3QEJA 1E2QA 2CK3A 3AP2A 1VCMA 2B7CA 4FMDB 5FUYA 4JBWA 4BPBA 3CO5A 4P4SA 2Y8EA 1P3JA 3BXZA 1IHUA 2XB2A 3AVQA 1O87A 1TX4B 3FKSD 2GJ8A 5JWHA 3EZ6A 1P75A 4FD2A 5DI3B 3AVUA 2DFNA 1Z8FA 2C04A 2J5XA 3CX8A 4DUGA 1G21E 2ZS8A 2EWVA 4AK9A 5A4JA 3WMGA 4DRZA 1YJ5A 4QGGA 4TYWA 4EQ6A 3RDPA 3BK7A 3LX8A 2WWXA 4HAXA 2VTKA 1Q22A 2ZPTX 1XZPA 4YMVA 3EA5A 4DHEA 1QHIA 2ORIA 4C3ZA 2XXAB 1Z6YA 2WAYA 1U0HC 4XTCS 1VIYA 4LY6A 4B3BA 1Y63A 4EIWA 1II8B 2A5GA 3KQKA 2ONKA 1WMSA 1NMZA 1KYIA 1OH6A 2PMDA 2P6RA 1P9NA 1EXMA 2RHDA 2RMKA 3H0KA 1OIVA 1VYTA 4NTZA 1FOEB 5JJIA 2W0MA 4TSFA 4MGZR 3JZAA 1XEXB 2FGJA 2OZEA 1U9IC 1YZKA 1P61B 3CRQA 2GJSA 1SVKA 1KDOA 1E2MA 1OIWA 1SVLA 1SXJC 3NBZC 5E95A 3X1DA 2XTMA 4LJYA 2VF8A 4P4SB 3I8SA 2JLYA 2Z4RA 4G5OA 3EIQA 3QG1A 3FGNA 2ZR9A 4I81A 1DO2A 1PUJA 4C2TA 3HPRA 2KI5A 3WMFA 4Q19A 1ZM2A 3A4MA 1DAEA 2A5YB 3HR8A 4OQXA 1E6CA 3QI2A 5AJXA 3CRMA 4EQ6B 3OIWA 3LNCA 3PJRA 1BKDR 421PA 1E9BA 1T5LA 2QTHA 4JL6A 2WWYA 3NDPA 4PQFA 1T8TA 2ATXA 1LS6A 3BH0A 1FZQA 4O2RA 4A2WA 4CT5A 3GJ8A 1NBME 5JZVA 1LNZA 2BHRA 3LY5A 5CDFE 5KU1A 1E99A 4RZUA 4Q1AA 3BH7A 3QPUA 2JJ2D 1BS1A 3EAQA 3A1TA 2VP9A 4ZIRA 2QQ0A 1KHTA 4R2IA 4NMMA 2GBLA 3HJNA 4V0LA 2EW1A 2J7PA 2O5VA 2OE2A 2HJGA 5DHFA 2F43A 4V03A 4MH0R 2OAP1 1G19A 3GFPA 5FFMA 2RH5A 4CRWB 1JR6A 4LHVA 1Z6TA 2ANBA 4P0TA 2ZJBA 1MRNA 1Z5ZA 2IEZA 1RW4A 2HXYA 4HB0A 4E09A 4RJLA 1DO0A 4P3YA 1Y3AA 1KDRA 2SHKA 4HAUA 1Q1BA 2FWRA 3CBQA 4QRHA 1HURA 2X1VA 4TYPA 1RYHA 2F3TA 1AQYA 3UWKA 4YXWD 3REFA 5SZKB 2IYWA 3QENA 5DO9A 1H8EA 1ZMXA 2CHGA 4OK3A 2H18A 4ZDWA 3WHLA 3OEHD 1Q1QA 4P33A 3THOA 5KDLA 4M0LA 1MO6A 3VQTA 1IBRA 1U90A 2VA8A 2VHJA 3TAHA 3ZLJA 2BBWA 2ZRHA 2AX4A 2PT5A 1GNQA 3BE4A 3KDSE 4PFSA 2FF7A 1MO4A 1XDBA 3CNNA 4PC1A 5G3YA 2VBCA 4CT4B 1OYWA 5FR2A 3T1VA 1KI9A 4ZIRB 5SZJA 3U7EB 4IRUB 2YHSA 4A36A 1AS3A 2PX3A 5KNDA 3U6KA 2P0EA 3NEYA 4B2IA 5J4LA 2F43B 1CR4A 1M2OB 1G3RA 1G7SA 4XH9B 4Q00A 3ADCA 2FSIA 2RGEA 2PZGA 3H4MA 4M1KA 2OT3B 4PHHA 1CJKC 1KKLA 2ECKA 1UEJA 2BIFA 4BFSA 1NVVQ 3I92A 2REOA 3KKOA 2GCPA 5KDDA 4EPRA 2RB4A 4G5QA 3GJ6A 5JJKA 3B1VA 2G1JA 2QT1A 1RRFA 1W4AA 4PZZA 3K70B 4TL9A 3CWQA 4XVQA 5CJ2A 2FSFA 2RGXA 4EFNA 1XMJA 4LYFA 2IUTA 2QZ4A 1EFRA 3QKRB 4MRRA 3UWOA 3R8FA 4BFZA 2AK2A 3BFKA 1E0AA 2V6IA 2UZ3A 5FI0B 3REGA 3L8ZA 4GPTA 4ZCMA 5LD2C 3T35A 5HKKD 1KSJA 4C7OA 3NXSA 5D3MA 1N5JA 4LYAA 2NZ8A 1U81A 2DFTA 3EC2A 4QOSA 4DEXA 4TYYA 2ZI3A 3THWA 4NYIQ 1S96A 3LV8A 4G01B 4UXIA 2JIZA 4AC9A 3L43A 2UKDA 4TLBA 2OXCA 1FL9A 1P73A 1WBDA 4P31A 4NONA 4IOLA 5JI3E 1PV4A 3PV0A 3EARA 4QBGB 2BMEA 4QNRA 1OH5A 1W4BA 2OFOA 2YV5A 3JZMA 2B21A 3GQBA 2ZRPA 3ZZ0A 4HLQB 1Q1EA 2QAJA 3P4XA 1SGWA 2L0XA 2ZIAA 5AJZA 5H1YA 4TMTA 2ODNA 1XPUA 1P6XA 3HYRA 1TF2A 5FUXA 5SZIA 3QQ5A 2A30A 3ADDA 2WWHA 3QF4A 3RS7A 2IYTA 1JALA 4HEJA 1XFAA 2QPAA 2W6JD 3W3AA 2ZQ5A 3T5DA 4EPWA 3RC8A 4WZ6A 1PJRA 5D3MB 1AM4D 1H65A 4Y0VA 5JFGA 1NY6A 2BEKA 2DR3A 3DM5A 4RCZA 2O0HA 3B9QA 1N6RA 4M1WA 3THWB 1COWD 3W8NA 1DPFA 3FDIA 5LDDC 3G5UA 4LC1A 2ZSFA 2MSEB 2F9LA 5FTMA 1A5TA 2O52A 1ANKA 4ZI3A 4DLXA 2GJAA 2C9YA 2OFWA 4DLTA 5EZ6B 4DB4A 3IIJA 3C4JA 2NO9A 2GEDA 4B44A 1JI0A 3IIMA 4LJ7A 1M74A 4HI0E 1KI8A 5KNBA 2JA1A 4KBGA 4FMCB 2IEYA 4UNRA 1C9KA 1UFQA 4FW9A 1NN1A 4W5WA 2VHTA 4PQRA 4FMDF 2BMDA 2PEZA 4I99A 2P3SA 3B1ZA 1XXHB 3PUVA 2O8CA 2XNDA 3R7WB 1L4UA 3D8BA 2AKAB 4PHFA 1G9XA 1OV4A 1R5OA 3I32A 1LF5A 1NVUQ 3QF4B 5FI1B 1N3BA 1S3SA 1GRRA 3FFBA 3PIRA 3ZVRA 3RSLA 1KI1A 3B1XA 1P9RA 3ICEA 4P4UA 1DE0A 5DNYB 1R6BX 3THXA 4URWR 2HLDA 4CGZA 5CJPA 4BFWA 1ESMA 5DI9A 3TUIC 4IVQA 4QL3A 3ZD7A 1II0A 3L0OA 5DGXA 3VMFA 3V00A 2X19A 3LWNA 3JVUA 1SXJD 5IF9A 2ZRCA 1W0KD 4PC2A 1TU3A 2NMVA 1BMFA 5J5CA 4HSEA 2RCNA 2ZU6A 4DSUA 2HV8A 5EXXA 4AYTA 4TL8A 3K53A 2QSZA 2VP6A 5KOYA 1KSHA 1YZGA 2CE2X 1VG0B 5FUVA 4YDSA 3B7GA 2VHUA 2IHYA 2ZYUX 3HR7A 1WB9A 2QGNA 1NSFA 2QI9C 1VHLA 2ZJ8A 5FOVA 4EJSC 3RS0A 2ZE6A 2FFHA 2GNOA 3SZRA 4Z1MD 1UKYA 4GZLA 2AXNA 4A6XA 4L5BA 2FPKA 2BM0A 3TQFA 3X2SA 2J0QA 3IHWA 3OFNA 1CKEA 2B8TA 1C4OA 4IXMA 5FPHA 1OSNA 1G5RA 4LV8B 2NO0A 4M21A 2F1JA 3GEHA 3GLHE 3GMTA 1KI7A 1OE0A 5LB2A 2FSHA 1XD9A 2XJ9A 3RVBA 2JEOA 2TMKA 4IVRA 5HCNA 3V9PA 3L82B 2VSXA 2GA8A 2N46A 1XP8A 4OK5A 2DWPA 3L0IB 3Q7PA 5JRZA 2R6FA 1BYUA 5JHHB 2AR7A 1XF9A 2KBEA 1NIJA 1OH7A 3NG1A 3R9IA 4D4LA 3P1JA 4B3XA 1PLLA 2ZRJA 4IVPA 2QAGA 1I4LD 3M4YA 1F6BA 1FFHA 3N70A 2W83A 4OJQA 3QXJA 3TW4A 1G7CA 5HCIA 3WP0A 3U44A 2IYZA 3K0SA 1XCPA 1W49A 4GP6A 1A1VA 3P4YA 3QXSA 3VR2A 5CYOA 5EP2A 2ZI4A 4B34A 1T6NA 3FHCB 2X2EA 1FNNA 1DAFA 2W2XA 3NBFA 4NBSA 1E0JA 1LW7A 3MMPA 4P4TA 2IUUA 3U3RA 3ADBA 3CWZA 1DAMA 5AUPB 3LLMA 2JASA 1P62B 2WKPA 3QF7A 4PO8A 4AKIA 3A8TA 2PCLA 1AZTA 1NMYA 1T3SA 4U7DA 4S35A 1JEDA 1EFTA 2Q0HA 1EG7A 4N3NA 1OIXA 4LJ9A 4JYBA 2EWWA 3VR3A 2WJVA 1L7VC 2ZJAA 3CLVA 5BQ5A 4HDOB 5CB6A 1Z6GA 2C2HA 1Z0KA 3F3YA 4OQMA 2WV9A 1ZNWA 4IKEA 4MQBA 4TZ6A 2ZXUA 4FWTA 2IWRA 3HU1A 1NBMA 2J0VA 3OAAD 1AKYA 4OKSA 2EYUA 3IDQA 1GSIA 3OEEA 5CDFA 4B74A 1J8MF 1NN3A 1S1CA 2QAGB 1XTIA 4URVR 1FX0B 3IQXA 2C78A 2IXEA 3W9YA 2QMOA 3U44B 3QBTA 4KBFA 5FTLA 2BDTA 3T34A 2W6ID 4AYXA 2C98A 4DSTA 2IF2A 3ZIAA 4K46A 4Y0AA 1OT3A 1A82A 1E9CA 2HDNB 2ZRBA 4YMUA 3LBIA 4FIDA 4PX9A 4YDHB 4UJ3A 2ZR0A 4M22A 5JHGB 2I4IA 1ZAKA 4A2PA 4FWIB 2AD5A 2GZDA 5EP3A 2H92A 1MR3F 2O8DA 3TSWA 3U60B 1WP9A 2OM2A 3LVQE 2F9MA 1UBFA 5JS8A 2IK8A 3OE7D 4F7WA 1JECA 3SOPA 4M9ZA 4PZLA 1IY0A 2OFXA 1NNEA 4Q7MB 2FEMA 2GJKA 3U3MA 4Q7LA 1ZD9A 2RGDA 5KNCA 1Q57A 2CE7A 1DAIA 1VDZA 2YOHA 1O3YA 3DZDA 3KKNA 4LYHA 4RFSA 1LFDB 4MRPA 1DG1G 4GOKA 1YR6A 1G3IA 2GILA 4GT1A 4B32A 1R7RA 1ZU5A 3CR7A 4BFVA 1E2KA 2C96A 4JSTA 2H16A 2P6UA 2H5EA 4UNQA 3AF2A 1ZBDA 3LA6A 3I8XA 4ZKEA 3WBJA 1KJWA 2B8WA 5GJVC 3A1SA 1PZNA 1KZ7B 4KI0A 1SXJE 1QVRA 4OJKA 4QJ5A 1D2NA 2XGJA 3EPKA 5CK5A 4ZCLA 3DMDA 1G8PA 3TR5A 1ZYUA 1W5TA 2V1UA 2H7VA 3SU8A 4ASUD 5C46F 2G83A 3DL0A 1NLFA 3L2OB 4RZ3A 2HF8A 4QKQA 4HB4A 2ZI6A 1H8HD 4K81B 1RRGA 4NH0A 5DSZA 3MWLA 1NG1A 2CEAA 3EZ2A 3U2QA 3B60A 2O8DB 5FPKA 3SYNA 2FZLA 1DELA 2BMJA 1Z2CA 4WA7A 2AWOA 3UXMA 1ZD1A 3TSOA 4L16A 4BGDA 1N6OA 2ZAMA 3RANA 8OHMA 4JLOA 2F1HA 3EZ7A 4RFSB 4EDHA 1VCNA 1EWQA 1G4UR 2A7QA 2RAPA 4NYMR 4RVCA 1NN0A 5UKDA 3K0FA 2EFGA 1US8A 4BASA 1G7TA 3OIVA 1NP6A 2V6JA 1MOZA 4YMTA 2Q9BA 3DPUA 3WHKA 1NY5A 4GL2A 2ASEA 5AJVB 5KPJA 2NIPA 3OHMA 1ELOA 1KZGB 2JATA 5B30A 2BKEA 5TV2A 4OL0A 2CBZA 5G3ZA 1X8LA 4A0HA 1FP7A 3GLFE 1GFIA 1WF3A 1BH2A 3PEUA 1GAJA 2OG2A 4KFRA 3QY0A 4RD2A 5CIQA 2PLRA 3TE6A 3LLUA 1SVOA 3CX7A 1E9DA 2ZRIA 4PPQA 4TT3D 4UNPA 1G6HA 2ZRNA 2YWHA 2PZEA 2DBYA 3L0PA 3D6TB 4X8MA 2H17A 4S2EA
chains in the Genus database with same CATH superfamily
3NOVA 3LUBA 3HZOA 4HNSA 2QUIA 4CLEA 5KS2A 3C5CA 2H31A 3Q6IA 3BYZA 4FMPA 4ZXPA 4JL5A 1R4MB 4M7RA 1ODCA 1JFLA 1WKCA 2FPLA 4BWYA 1MU0A 3F8SA 5ALZA 1AO0A 8GPBA 1QJ4A 5IYZF 4IWXA 3TRFA 4DA0A 2GEVA 1F1JA 1SC9A 3TIGA 2VHYA 2P6OA 3IUNA 1PD1A 2H2HA 5FH9A 1W4CA 4F4JA 3D7KA 4IIEA 4Q18A 3JQ9A 4UPVA 5ICFA 5A02A 1AB5A 3A1UA 2CJYA 4PYIA 1US8B 3DMGA 3G59A 4HGYA 4NXNB 3OETA 1Q83A 3FE2A 3P9CA 4HQOA 1IN4A 1QVAA 1F2TB 3DL7A 2GBLC 4NHOA 1XRQA 1H22A 3WYAA 1KTVA 1VSQA 3DR3A 5K3FB 3TLZA 2YY7A 2D0DA 2OESA 4OQQA 5IJZA 1ZY2A 2QX6A 1QAQA 1P0IA 3CR8A 4B0OA 3ANTA 3FAZA 1W35A 5JTUA 2JCSA 5EZYA 1JB1A 4ZTUB 3C41J 5GGXA 1SUDA 4FEAA 4RJJA 4O59O 3N2LA 3WNBA 3TG8A 1UJNA 4MV5A 1U9JA 1KOGA 3L7KA 2P3LA 2EARA 2IP2A 3TF5A 4OB8A 3G0IA 3MMZA 1BXGB 3P27A 5FBVB 1GUFA 2HCBA 2JGJA 1UKEA 3GPIA 9MHTA 2YY6A 4CM4A 1KKMA 2JLSA 2HGSA 3DMNA 3NXKA 4HDKA 2F59A 5KJEA 3D02A 3NNSA 5AR1A 3K5IA 1OI4A 5L3QA 3BDIA 1DRKA 1OBHA 2P6MA 1H3EA 4BKQA 1MXFA 1XT6A 2F7SA 1KMQA 2O59A 2HKIA 2PPLA 2ZE5A 3WAJA 4HDMB 5J9FA 4D43A 2GPAA 5AVSA 1CRWG 2PMBA 4Y1GA 1OXSC 2QZZA 2R3SA 3H04A 4R1SA 2ZUFA 1J0EA 1AY0A 4NBWA 4DV4B 4BU0A 5A9SA 1XJ0A 5EQTA 1O95D 2ICAA 5DHAA 5EKTA 4N54A 4LRTB 3EVFA 4DREA 4JLPA 4RTLA 5ALKA 3BSYA 1GTG1 4CR6A 3L4BC 3NYIA 4CI9A 3QEAZ 1WS6A 4X7RA 4W1RA 3FY4A 2H8KA 3AEYA 4PBRA 1XEWX 3VR6A 1DKRA 3LX4A 4K7JA 4YJ2A 3M6VA 1Y3CE 1XG5A 2JI6A 3WLPA 3ZGLA 2C77A 4AVYA 1YIOA 5EIBC 4DLSA 1ZU4A 1FFSA 4N3GA 5I9BA 4MUEA 2QTGA 4UTXA 3ST7A 1U6KA 3GFFA 4C7JA 4CR8A 2ZTMA 1N4DA 5EWJA 4BNIA 4U2GA 2DHEA 4K6FA 5BNWA 3MFYA 4WXYB 3V1KA 2ZSEA 5L4SA 3H5RA 2NZYA 1UBLS 3IT0A 4NOMA 4LMBA 3EA4A 1IN7A 4JHLA 1Y8AA 3EN0A 4IIJF 1T8RA 1UPAA 3DZHA 3VNSA 5CFLA 2BFFB 4E22A 5A4KA 1GNLA 1GXSA 2BFPA 4I1YA 2JAXA 5ALLA 1GWNA 2F1RA 2VRWA 1O0SA 2R86A 1GZ7A 1A8HA 2L69A 2QD3A 3GFVA 4GYYA 4J0CA 4MK4A 4CPDA 1F9EA 4BFLA 2DUWA 4XVUA 4EQZA 1NJ1A 1QIJA 1JQJC 3HBFA 1EI9A 1GKIA 2I7DA 2B35A 3HCDA 2QRLA 4XWTA 1JHVA 2GXQA 5BVGB 1KFEB 3KXLA 2FZVA 5CJJA 3CB4A 1Y6ZA 2AFHE 2ODPA 1WA5A 3DYBA 4EHBA 5I9IA 3MRSA 4FBLA 1FDVA 3CUWA 3ELYA 3V9AA 4UHKA 1YQTA 2Q4DA 3QZUA 4LHYA 4QPZA 4CIXA 5H3LA 1Z8HA 2AEJA 3QVOA 2Z6QA 2F1OA 3WK6A 1A2BA 3NGXA 5FOQA 3AVYA 1CERA 5BUZA 4DLAA 3ZCUA 1U65A 4OREX 1IZ7A 1OYVA 3FNHA 1KP3A 4PZAA 1GTVA 3GLHA 1NTOA 1Q95A 4B73A 1BROA 4LFCB 3WLIA 1JHZA 4DVJA 1RBZA 3CCCA 4IKOA 3KFXA 4JT9A 5BMVF 3AF1A 1PNTA 1WL8A 4CFSA 3ZE9A 4IQ4A 1DG3A 3HABA 2OSBA 2VJCA 3GUHA 5KYXA 1BU5A 2CCKA 4FXPA 4Q4JB 4BQEA 5BPFA 1RQRA 1MO3A 3MCAA 4LDZA 4YGYA 3SIXA 3STUA 3GXBA 4HDRB 3E2MA 1AXRA 4HOYA 5C8YA 2IY9A 2QTLA 3HLTA 3LXXA 1ISFA 3KSZO 1XZAA 4H1WA 2MHCA 2ZJ6A 4G09A 3I37X 2IXGA 1CP2A 1YRLA 3A26A 1R10A 3RNOA 1VE5A 1N1MA 3BEDA 5JNUA 4YUVA 1T4GA 4IMRA 4YAWA 4ZJZA 1OLSB 1XQ6A 3LBFA 4TKVA 1SCQA 3HDJA 4PGHA 3VKFA 3BL5A 2HQBA 1MLDA 2OEPA 1UKAA 1OF1A 3ZH2A 3RVPA 2C8VA 3TLEA 1J8QA 4NMWA 2H5IA 4IUBS 1SUPA 1IRIA 2W90A 3MAJA 2A5JA 3I5XA 5DV9A 1GPMA 4NBKA 4OY3A 1FRVA 2LKDA 3A6DA 5GWXA 1L7XA 3OMXA 3S2GA 2NT4A 1PGNA 4RE5A 3WK4A 4E08A 2BP7A 1X7WA 2B34A 2IDMA 2B25A 5JNSA 2CMKA 4RCYA 1XTSA 4BRUA 2G8NA 2Z95A 3ET5A 5J4HA 1OX6A 2JARA 4ZOAA 3I6YA 3H9GA 4RO0A 5JQGB 5T8KA 5HZKA 3DONA 4EPTA 4P58A 4HLUA 1NQAO 2PAFA 1SKUA 4KTTE 2DY1A 5F2OA 4YRKA 1ZLYA 1CY0A 2ODBA 3RADC 4XJXA 2GVDC 3C6KA 7MHTA 1U98A 2IZ6A 4YAGA 2QL5A 4DYDA 1WXWA 3GYGA 5HK8A 4CIWA 3JQ7A 4LXGA 1GL6A 1X7XB 5B37A 4R3WA 4AMZA 4RE6A 2Y1LA 4MB6A 1HA3A 5AT1A 3PITA 1A9XB 1U1GA 2FN9A 2PD4A 3QVLA 4EA8A 4ZYVA 1N9KA 3MT9A 4Y2QA 4BE7B 5E4TA 2VRNA 1G8HA 2XYRA 2AN3A 3ORHA 5KX5B 4R2WA 3C74A 2GX6A 3L7IA 2X7HA 1Z0SA 4I7EA 1Y7TA 3ANXA 4L8GA 4E4YA 3DVQX 3FPKA 2GBCA 2J3LA 4EATA 2BELA 4ZO9A 2I4RA 4C7BA 3FFAA 5EE9A 1RCTE 4ZRNA 1YACA 1DIHA 2PT7A 3RYHA 1WJGA 2WPDA 1IJFA 3QIVA 1F8XA 2IYRA 4WERA 2QYHA 5F33A 5JMTA 2C03A 2I55A 2QRUA 5G0VA 4A5SA 2OGTA 3N7UA 4FZ3A 5ALRA 1U8FO 2Q5QA 3G1TA 2BGLA 3FIUA 4QDKA 4IX1A 5EJGA 1JEQB 3PFCA 3PDUA 1TC2A 3WLMA 1D09A 4Z3KA 2I33A 3CHYA 5FLEX 5HM6A 4KRXA 4NYJR 4W5JA 3FYUC 2ZROA 3IVAA 2H59A 3MT8A 2ZYTX 1L5ZA 2LPMA 5EG5A 4PR0A 4UMEA 1IAVA 2AC7A 3T54A 4QOJA 2D6FA 1ZCJA 5KHOC 1QGED 3QVWA 3L46A 2PRJA 3G8BA 3ZKAA 2FY8A 3PFHA 4DSNA 1I0LA 1ZRMA 1O77A 3OECA 2IGTA 2CLCX 2NXJA 1X94A 2YVUA 1HV8A 1U2DC 1ZK1A 4V24A 2JI4A 1BTOA 3NGMA 3V4VB 4D3DA 1ZN2A 2FE4A 4E4TA 4UTNA 1WAMA 4G1BA 1EVLA 4P5EA 4BVJA 1OFUX 4GGOA 1M83A 3LFUA 4RMNA 4Z5XA 1SHKA 1FP4B 2H2DA 2IU6A 2WE8A 3FI0A 3G88A 3OP1A 1Z56C 1GFSA 3HKBB 1GQYA 3OLYA 4IV8A 3KZ1E 1T5TA 4LJ4A 2R7MA 2L82A 3IOYA 3A1VA 3ZHTA 5HOEA 4UM9D 2R96A 2FK7A 1T0JB 3LO8A 3TKAA 3TM5A 1N2JA 3BE5A 3SWWA 1YNOA 5L6MB 3MJ4A 1YA4A 5K3OA 2GDJA 3AR6A 4IDFA 4F45A 4R1OA 1L5YA 4MVJP 1XXHA 3QBDA 5KYWA 3E5HA 2X2FA 4PLYA 4E31A 4WW0A 5EHGA 1H0KA 1IL0A 3O2SB 3LAWA 4JUIA 1YCDA 4Z7JA 5JATA 2IYQA 4EUFA 1L5MA 1NVFA 4OJMX 4S05A 3FDJA 4DIBA 2Q2QA 1GCIA 1JL3A 1OFHA 2ZI9A 4D98A 2UYCA 2Q5HA 1ODJA 4G97A 4IDNA 4P3PA 4H1TA 1PJSA 2QAGC 4MQEA 1U4SA 5GONB 4MR9A 2YWCA 3N0TA 3UANA 1JKJA 2R5WA 3D5QA 1UUFA 4H1UA 4PNPA 4XQ9A 1R6DA 3TBHA 2DM6A 3W8FA 3HWSA 1ZH6A 3U7JA 1NC3A 1C0LA 1SCKA 2WVGA 1DFHA 1WUYA 2A1TS 2WHXA 4XLZA 4FKMA 4IY1A 5DYYA 5KO2A 2XMCA 3NWBA 4N01A 3SHTA 2YFHA 5GY7A 3TSYA 1T4MA 1PR9A 4DLVA 5JCOC 4L74A 4ALNA 4E5UA 4CM9D 2AEEA 4PTLA 3WIVA 4FFNA 4F8YA 2QKYA 3GBSA 2YL2A 4L8VA 2XYVA 4G5RA 2QUAA 3UCXA 1KI6A 2BCGY 4RD1A 1V16B 3QYFA 2P9YA 1XNJA 3GP5A 4LDAA 3FFXA 4N5LA 4Y2PA 3S7TA 4DIKA 4Y6GB 1QQ7A 1U7WA 5MHTA 3BZWA 3NOQA 3IEPA 5TGTA 4DXAA 1U8EA 4MRSA 2QSJA 4RZHA 4I55A 5LJLA 2K2QB 3P20A 5IRCD 3PRKE 4DV5B 1WSWA 1JQKA 4XYMA 2OO7A 2GXSA 3E3OA 3PK0A 1QX3A 4X3OA 4AKGA 1GAQA 2HPVA 3RVMA 3A25A 3AF5A 3AHJA 4D8XA 3G5TA 5KNDD 1CHNA 1HT0A 4OFXA 4GX1A 1QKJA 5DFAA 3U26A 4A8JB 1BDIA 3Q2IA 4GOJA 2EKDA 4S1VA 4JJKA 4DB2A 1DBWA 1QHGA 3FHJA 1MIOB 3FWHA 4LHEA 1RYNA 3L7NA 3PEFA 4M99A 1H2AS 3EIUA 4BFTA 4AROA 1GPAA 5K6TA 2QSYA 5KNLA 3NORA 2GTIA 2HRBA 5KDOA 3KPVA 4ER5A 3VC1A 4DLRA 1SN7A 1HYBA 1BW9B 4U3JA 1Y48E 3L9WA 3WRVA 4UE6A 2TECE 4JWTA 3W0LB 4YLEA 3AG6A 3AOEC 5IDXA 4DA4A 3DEJA 3G2MA 3HUUA 3ABSB 3C5VA 4YJDA 1VBMA 4PG7A 4P36A 4NJEB 3MCTA 4NS4A 5I4CA 1QAMA 3QKTA 5I4KA 1L8OA 2GCIA 4B2PA 3VTKA 1CIPA 1F3OA 3Q3JB 2D1RA 5D01A 4XIGS 4F6CA 1JJVA 1ZRNA 1WZEA 4Z9FA 2YBDA 5JJ5A 1JAHA 1PLJA 1Y4DE 3EXG2 3H3FA 3L0CA 3WGIA 1TADA 5D2CA 3TW0A 1YZNA 1RWPA 3HG7A 4FQ7A 1GA4A 1PJAA 3Q87B 3BXXA 4DLZA 4JKYA 5L3SB 1QGYA 3NJ4A 1G1MA 4I3GA 4NBLA 5D86A 2P2DA 1I80A 4D0NA 4PO3X 2ZIWB 5B57C 2YIDA 2G08A 4H35A 4HDQB 2AZTA 4E2ZA 5EXEA 1A95A 1DQSA 1I13A 4FM9A 3PCXA 1DP4A 2FK8A 2CB0A 1WM1A 1YBAA 2W37A 3L7MA 4U02A 3RIGA 3TRKA 3ZD8A 5DHQA 2AN9A 4AS2A 4ZZ0A 2VRBA 3AINA 1JYFA 1KK2A 3C5EA 2IBTA 3MRTA 2O9JA 3CUEF 3HADA 1CJMA 4WK2B 3MCUA 2J46A 1SCBA 1R0ZA 1XZEA 3OE7A 4F2GA 4YP6A 1HKHA 4JU8A 1G16A 4O2BB 1ZJ6A 1M1YE 5I45A 3K0AA 2I65A 2H5LA 1TW3A 4QTYA 5CA1F 1IY8A 1OILA 1OPXA 5BYJA 4UHEA 2HQSA 3VYWA 2PT9A 1AX9A 1U7HA 2J45A 3U5ZB 1GUBA 3H4TA 4PPFA 3OC6A 1SRRA 4YJFB 4M3NA 4D7AA 3E8SA 3PHGA 3PXCX 3VPHA 3QKSA 4YCJA 3K09A 4MHOA 1V7QA 4JOCA 1X2BA 4CLXA 2BVNA 5E1MA 1EK6A 2ZE8A 3O74A 1XRPA 4XSHA 5LP6C 3SYTA 3HYCA 2V4UA 3TMYA 1J7JA 3C39A 4CL2A 1VKJA 2BKAA 2FHSA 2QTAA 2W2TA 3L8DA 1FX0A 4OFWA 4INOA 3RHFA 3BRSA 1TT5B 1MGOA 4Q6BA 5JPDA 1KI4A 1PEYA 1CZUA 3E1GA 4L4SA 4QDJA 2CLFB 1JW9B 1Z18A 2RHLA 3ABZA 1ZMBA 4WKPA 3RWMB 1XU9A 4TQ9A 5LFAA 4ASUA 3NFYA 2P2LA 2CXNA 2B0CA 1XCBA 3GX1A 4A0RA 4AMUA 2E37A 3QMWA 2ZRKA 3NHJA 2QUJA 4X9XA 2OCKA 5HBGA 3B2NA 3TW8B 5IWCA 4R31A 4DANA 2XE8A 2OD9A 2ZIZA 4BO8A 3SZGA 1T0IA 2ZE7A 3QSGA 2WTUA 4O29A 4BQSA 1IHYA 2C4NA 4OTZA 3EH2A 1F51E 4CM6A 3HO8A 3RO7A 2RAFA 3QFHA 1Z6QA 2NUAA 2ZBPA 4CQNA 3A6EA 1GN8A 3GY0A 4R1LA 3H8VA 1BHO1 3GEEA 3EZGA 5ESXA 5KNBD 2DGDA 4I4TF 4LNUA 5FHQA 4QYWA 3HKDA 3PNVA 1RWVA 3WKCA 2F1IA 2O5RA 3JQDA 3SLGA 4YIHA 1B0ZA 1RLMA 3AEQB 1CZHA 3Q5DA 5HJ2A 4X1OA 3WQQA 2ZB8A 1MABA 1KQ3A 2FPGB 2D0IA 1BN6A 2VEOA 3L9XA 4QQFA 4KKXB 1RTKA 4K9SA 4MGYR 3AEUB 5B4UA 1Y4AE 1MAAA 1USGA 2QN9A 1DWOA 2R44A 2WYHA 3CVWA 4FN5A 4N65A 1TKCA 3ACCA 3ZDQA 4Q9LA 1Y1TA 5AW3A 1ZIOA 2QRQA 2YC2C 3FA2A 3MJHA 4YRFA 3AR5A 2GHIA 4RA9B 3U39A 1L1FA 4LPKA 4U7FA 5IJ9A 4R8VA 4ZREA 4LDQA 3ER9A 1QBGA 5FLKA 3FROA 4BZXA 5DX0A 4Z49A 5IJ0A 1V8BA 3KXKA 4XYEA 3RAEC 1S8FA 2FX3A 1E7WA 2QRVB 3NR2A 3P2JA 4KVZA 1ZNYA 3DJYA 4HZUB 5BQXA 4H7PA 2HDOA 4O5OA 3EEQA 4FUQA 1FLAA 1G41A 1MZVA 1WDWB 1M2NA 1PCXA 1XJQA 2CYBA 2PIAA 3OWHA 2FE1A 4U7GA 3MTQA 4GE3A 4M88A 2GF9A 5LYYA 2J7KA 3DBOB 1T1EA 3JCZA 4AMVA 4RVFA 1DDIA 1EAMA 1E8MA 3MQFA 4EHLA 1BMFD 2XOXA 4URZR 5K5EA 2QTVA 1DTSA 4IWYA 1OAOC 1LPMA 4Y2SA 4WK4B 2PS1A 4WZAE 1PL7A 4FYHA 4J91A 1OFTA 8AT1A 2W2KB 2IYPA 2QPOA 2YV4A 5DSTA 5I7HA 1XLTC 2B4YA 5DM60 3NHRA 2V59A 3L7BA 5EJIA 5DTIA 4KXWA 1FY2A 1ZIPA 2QW0X 3VNUA 1M1UA 4PZ0A 3SAJA 4I1UA 1DGQA 1V3TA 3HTXA 2BAGA 3NDIA 1LC0A 4MA4A 2CVZA 4Q3CA 5HIAA 5A0VA 1O4VA 3PEWA 4FOSA 1L7EA 3Q7QA 3D6JA 1YS4A 5HILA 3PC8C 3V2IA 3R5XA 1OC4A 2ETVA 4Q1BA 5TQJA 2ECQA 3FCYA 3NI2A 3MJDA 4NZYA 4D80A 1IOVA 4KITB 3OHSX 2OBMA 4XFDA 2Q2OA 2OZLA 3IESA 2G5PA 3ZOKA 5FOUA 2IEIA 5L53A 1GOTA 1WVGA 3OIYA 2YXDA 4MQFB 4QZVA 4NQZA 1CUWA 1E3MA 2DFVA 4PSKA 4PS0A 3TJZA 1EVIA 1M0WA 1X1AA 5JADA 3VU8A 2G77B 1PNOA 3OLVA 1RJ9B 1Q0ZA 4F5YA 1RADA 2WM8A 2O0KA 1X80A 3LBNA 4XR9A 3K4QA 4MPDA 1HH4A 1Z62A 2GSWA 2WJHA 1GT6A 2HA6A 1ICIA 3ZZNA 1PQUA 4FSHA 5C1BA 4TLDA 3M4JA 1J22A 3IALA 1GLVA 4DLYA 3GJ7A 1EZ1A 5IKOA 3UYKA 4ZT3A 1PSWA 3D8TA 1QRAA 4KIJA 4FILA 3RAJA 3RYFB 3S40A 3SMQA 1O08A 2IS6A 1P6UA 1GL9B 4X00A 2VHQA 5GIPE 1LBEA 5DVZA 4DE5A 2IJGX 3NNDA 4XI9A 1GG5A 3A37A 4EI8A 5JAIA 1IFXA 1NPDA 1MNAA 3C2QA 4KSCA 3NIBA 4UCQA 3WMWA 3CX6A 1V5IA 1W85B 4CF3A 4EGSA 3ONEA 4LV6A 4MS3A 3WA6A 1WE2A 2JHGA 1M1NB 2YWEA 3CIOA 4C4XA 5ICSA 1ST3A 4U2DA 3KR9A 2GEJA 4FDLA 1PFYA 3O1HB 2ZTVA 3BB3A 1JDZA 1WY5A 4TX1A 4ESHA 3G9UA 2WJJA 4M0KA 3TD6A 1RQNA 4WN9A 4WUVA 4D97A 5C4MA 1BO6A 2ZB3A 4XWAA 3V7NA 1XJ5A 1GA6A 2IZ5A 3GD7A 3KEMA 4URUR 1AE1A 2EBWA 3JQ6A 3WRXC 3QWBA 5FKJA 4ZWNA 3AB3A 3OZXA 1M2VB 2Z6UA 2IYAA 2PGAA 4TQAA 1QGAA 3IAXA 3F6RA 3P0JA 1VHTA 1NJ8A 2JH9A 4JLMA 4NV0A 3CRVA 4QAJA 1ZNQO 4AWBA 4BBZA 3HZZA 2ERXA 2JLQA 1Z2AA 3JQBC 3O9VA 1MGPA 4MUHA 4E3ZA 2XDQB 3LRPA 4BNDA 2W11A 3BTSA 5TPZD 3TLYA 4REOA 1FE8A 1BS9A 5FB3A 2FR0A 2D7CA 2F55A 2Z04A 3C85A 1P4GA 1M34E 5B3LA 3KL2A 3H19A 1IWBB 3FSRA 3V2HA 4C6RA 5GADl 1JBKA 3V1YA 1C7JA 2OG1A 2C7RA 1ZCAA 5BORA 1BH6A 3I4LA 4TS1A 1DIOB 4Q3NA 5BYAA 1GYQA 4W6QA 3AKCA 4IEEA 2GPWA 1DHTA 4J29A 1DEOA 4A3SA 3T1TA 5EMKA 3U4QA 3EMKA 1CUGA 1J33A 1DAHA 1D3AA 2ALJA 2JAWA 2YWRA 3AY0A 3HFRA 3OZCA 3GV0A 1EGMB 4A5OA 4C07A 4EUSA 1E9EA 1UXHA 3EGEA 1T4CB 2A4MA 1XDSA 4LFAB 3WA7A 1GAWA 1P5FA 1B73A 4Q3EA 4L3OA 4EFKA 1B23P 1T1SA 4RY2A 2J59A 4R0NA 3T3NA 2GQ0A 4PIPA 3DJFA 3QU4A 3TVYA 3BM5A 5A3JA 1ZW1A 1F48A 1LK0A 5ETJA 5CYGA 4QDOA 1OBCA 3GUUA 1W93A 4N3BA 4DTIA 3PUZA 1FFDA 2GETA 3VKUA 4K6MA 4NBNA 4FINA 3URKA 2JJ2A 3OQMA 1YVDA 1GDTA 4AAYA 1Y1KE 1NONA 3MOSA 2GO7A 3DTVA 5JIBA 2QG6A 1XRLA 3P32A 2IC5A 2J9XB 4LZNA 4OSPA 5MN5A 5C3UA 2DFLA 1I3MA 1KJ8A 1IK6A 2FPUA 3R7BA 3OSZA 4WLEA 5EINA 3AEZA 1R27A 4LK3A 1JEJA 1IULA 1HXHA 2VJPA 1AKNA 5ENDA 3U4CA 5BWCA 4GICA 5T41A 4PPNA 5EJ6A 1NP7A 3MAGA 4GE0A 3OM0A 3U3KA 4TLLB 3VI4B 2JB9A 3C16C 4BTEA 3VV2A 1T26A 1EGAA 2HLPA 2NG1A 2BM9A 3CPHA 5TR9A 2P9JA 3QVGA 4AZ0A 2FKNA 3BK1A 4BJHB 1J39A 3WRWA 2CZCA 5I8ZA 2AG6A 1W2GA 4JJGA 3WLTA 3PHHA 4JS0A 2FWPA 4DIEA 1P60A 1NBOA 4IXWA 4F8JA 3TCKA 4Z4HA 1GG9A 13PKA 3HMQA 1DV1A 4BMSA 2LR0A 4JELA 5HCUA 1EDOA 5C18A 4RHTA 4FW8A 3OEHA 1V43A 3BL6A 3L4SO 4LC0A 2OHFA 3KKMA 2I3GA 1N34B 3BWMA 3QFCA 1I4WA 4DMFA 2VDPB 1KY3A 1X7ZA 2AYXA 1UF9A 4GOND 1YO6A 3WZMA 3QX3A 1RT9A 4EKNB 4EJMA 4P0PB 5ALOA 3OWOA 1BZYA 2E89A 3SJAA 4ZQFA 3MOGA 1ZOLA 1G8KA 2OXRA 2WD7B 4F92B 2GASA 2MIIA 3DFKA 3ZHZA 2VL7A 2DBQA 4WXEA 1RXVA 2K5UA 4NDAA 3QNUA 1CY8A 1W5SA 3W8RA 3EF0A 3EIHA 3L8HA 4V0MA 1H2BA 4HDCA 3K9LA 4BFCA 1KS2A 4RKEA 4E3WA 3D7LA 4HQ0A 2CL5A 4U9UA 1DJPA 1JUDA 2XTJA 5BWOA 2FPMA 4ZT5A 3FYDA 2OB2A 3WO0A 2F8LA 2WTXA 4PN7A 1MUUA 2CXQA 5JO9A 3WLHA 4HQNA 1GZ5A 4U39A 4U5XA 3WL6A 2I1LA 3A4LA 4A1FA 1Q1GA 1UZMA 3ZLVA 4D5GA 2H2FA 4DKXA 3G5MA 4U2CA 1H0HA 3SFZA 5LJIA 1GSAA 5KCZA 1AZSC 4Z6KA 4JEIA 1CJBA 3PXGA 1OXTA 4RBNA 3TW6A 3GEGA 4M83A 5BW8A 1AUXA 1Z4KA 4DMMA 4EP1A 3CLRD 3HC7A 4EMTA 4ZYZA 1W2WB 1Z6XA 3FOBA 4F72A 1FTYA 1OGYA 5JEDA 1E2GA 5K4AA 4ZVUA 3TVTA 2ZJZA 3BOSA 2HSZA 4MZXA 1ZHHA 2X9GA 3KLOA 4MV1A 3JVEA 5HKKA 2D13A 1U2GC 4FHZA 5CU7A 5L45A 4R5MA 3P9XA 2OBLA 2XVZA 1TQ4A 4JP1A 5IK2D 3PR2B 2P5TB 5CB4B 2Q27A 2C82A 3WGJA 5BP7A 5FUQA 3UUGA 1XD2A 4M1TA 5A5DA 1Z8DA 5AO9A 3DOHA 5JSYA 3AVWA 1UOEA 3R5TA 4WFJA 3H5AA 2ZQZA 3KOZA 4FGUA 3NH9A 4NWIA 1JEYB 1NW5A 2QLFA 4Z51A 3AUXA 1HNNA 2IV3A 4YP5A 2R751 4ZOLA 4B3DA 4CG3A 3FMOB 4A8JC 3E9MA 1K6MA 1OMOA 3OE5A 4R8RA 5CLQA 1ID8A 4GR4A 4F4FA 3PJEA 1U0OC 2WU0A 4RX1A 5BSUA 3UOGA 5HMMA 5CVVA 3GELA 1GVNB 3LKZA 1C3EA 2GYVA 2QGZA 5KSOA 2QRZA 2H4ZA 4QHTA 5JCZA 1O5OA 1A2KC 1Z6ZA 4NYIR 4LBWA 5FJIA 4LX0A 1NJSA 2JJQA 3E7DA 4MB2A 4JYAB 1KZ1A 3I39X 1U7OA 2DJ5A 1UH5A 3A28A 4BV3A 1YC2A 2OZKA 3AGQA 4I36A 2WP8J 1IXRC 2HA0A 2W8BA 1EE9A 1PT5A 4K9DA 4PQGA 4PQEA 3WY9A 3E70C 2NZUG 3GR6A 1VPLA 3CLHA 3RBXA 1C3OA 3D8HA 5IZCC 2O05A 1ADCA 4TKLA 1ORWA 2W6JA 3E7PA 3AVOA 2HUPA 4C0HA 1K5HA 3IVGA 1XCJA 5F5NA 3ROTA 2GRUA 3KJHA 5KNCH 4O4IF 1YKGA 4JXXA 4XGRA 1ONNA 4YAJA 3ZE2B 2AFRA 1EUDA 2ES4A 4K9RA 1GQOA 2NZ2A 1QYIA 1GVHA 2G71A 2WVHA 3IAM1 2XQIA 4G67A 2XITA 2H5JA 4O02B 4RH0A 4CDMA 2XNCA 1G20E 1KNQA 3LJKA 1UQRA 3LM8A 1E0DA 4OG2A 3F73A 3FDFA 2JAQA 4H3VA 1EVJA 4CEJA 1Z7GA 1VA4A 2QY6A 4BC0A 4MJ7A 1L7OA 4G9EA 4PIMA 5DT9A 2BI4A 3SZOA 4QYMA 3HXKA 5DH9A 1FUUA 3KAJA 1PVOA 2OUKA 1MT3A 1AD2A 1I6MA 2ERCA 2MR6A 1TE2A 3F7TA 3IUJA 3OA2A 2VH1A 4K8OA 2PRSA 4UKDA 5CLLA 2J6IA 1W5EA 3O4FA 1LB1B 3PPXA 1AJEA 2WMOB 1N6IA 3UCEA 4EG1A 4F96A 5CD9A 2GCEA 1P0FA 2M1ZA 1L8LA 2YVQA 3P9RA 4HX5A 3BQMB 2I6SA 1LRLA 2IS1A 2YZ7A 1NBIA 3QE0A 3LW8A 5A05A 5DE3A 5EWMB 3PWZA 4XGKA 2W6MA 1ZQ9A 3RRFA 4DAOA 2WSYB 4DMGA 4TTVA 2JFQA 4WK6A 5DXFA 1AA6A 3HCBA 1IZ9A 1ZUWA 2EJCA 3CZAA 7ABPA 3F6BX 3UJCA 5LQUA 1R4AA 4CYMA 1SCUB 4JOBA 4HBGA 5IXJA 3TFOA 2MYUA 2PGOA 5CDTA 2BHNA 1QHHA 4ARBA 4HWGA 1JLLA 3DYIA 3DDSA 3QVUA 4KE6A 3MWEA 1R0YA 2IW1A 2W00A 4IO0A 4URFA 5CH8A 3NRCA 3EIXA 5AKEA 1PHRA 3NANA 3LKVA 1GQFA 1NJGA 3P9PA 4HLNA 1E0SA 4MNTA 3N8NA 3GAZA 3HVJA 1BSVA 5KBYA 5KVCA 1C9YA 4LXUA 2VF7A 2INGX 4IFBA 2XT9A 2V74B 5JUWA 3R7SA 1VMKA 2O48X 3ZS8A 4C4YA 2YNMA 2UUAB 5CR9A 5F5XA 5I48A 3GLUA 3H4VA 2C1EA 4ND8B 3D7NA 5A7HA 2XR1A 3GVCA 3TCNA 3EC1A 5DM0A 3GEMA 1HT3A 4P86A 2XGGA 2OAQ1 2P5YA 3O8LA 3JD1A 3OM9A 3WQSB 3ZYCA 4IMIB 3FWPA 4FU0A 2ZM6B 1ZCZA 3N87A 4AJ2A 4AZTA 1C0EA 4JFAA 1D6MA 2HMAA 1LWNA 1SIOA 3OESA 2ZIXA 3FPSA 2VDOB 2BH9A 3BILA 4X1YB 2XB6A 1WXFA 4H3SA 3ZCQA 3K8ZA 3PQ4A 1H9CA 2EL7A 4KGVA 3GJSA 3I30X 4KX3A 3ZXXA 1HM5A 2R4UA 3NHKA 3WXMA 3ESBA 3MWKA 4IYRA 3INRA 1PJ3A 2NU8B 2QTBA 4CLOB 6CHYA 1T1IA 4UU7A 3H5TA 5I8PA 1CUCA 1Z38A 5LKAA 1I24A 3TUZC 4JVMA 5K7SA 5JSZB 2G3YA 3VJLA 4MKRA 2QLJA 2PYZA 1AN9A 4JH0A 2R6R1 1UC8A 4U5QA 3VZQA 3UWMA 1W44A 3PQ6A 4JI8B 2FZ5A 3QOWA 1J5XA 4KTVE 4YMUA 1KIAA 1L2TA 1N2ZA 1NG9A 1NI5A 1SC1A 3DHYA 3SJBA 2RHTA 4ROSA 5KQRA 5HPYB 3D0QA 1JU4A 3K72B 1JHYA 3EULA 3EF1A 4ZYLA 4MMZB 3GW8A 2VF5X 4IIBA 4XOIA 2F8SA 4F4CA 3PWTA 1U3TA 3G2IA 4IW3B 1JG6A 3M6XA 2Y3IA 4C7OB 3DVAA 3CE9A 2FU5C 1AMOA 3B9RA 4C9BA 3HBLA 3MQ4A 5DRYA 1UDCA 3FCAA 2OA0A 1CXZA 1K8RA 3AYXB 2IPLA 1OLXB 4ACBA 4CTJA 3H2GA 1SQ5A 1KOLA 5KTPA 4UU8A 4O0MA 1GGKA 1ISPA 4TTQA 3TI9A 4WASA 4NC9A 3SR3A 1NLZA 3D6HA 4GNKA 1IQUA 4MP8A 2Q3DA 1Z5NA 1MAVA 4K05A 1LW6E 5E9QA 5K3BA 2G9VA 4RH3A 3X2FA 4ETMA 4Z54A 1EESA 4ZZ3A 3G1WA 4RL6A 1I1QB 4NYJQ 3LXRA 1T2AA 3LQRA 4FOPA 1QF7A 4W7SA 1AGRA 3EXHB 1T9ZA 1UWKA 4JWKA 4AI6A 3D54D 3NFRA 1NMSA 4RDHA 2GXUA 1W73A 3AI3A 5DBEX 3VSAA 3OTHA 4XWGA 2DHDA 1QO9A 4K1LA 4URYR 4DZRA 3SDSA 5K8TA 5KWJA 3OT1A 4LI0A 1J5PA 3MIZA 3X1ZA 4E03A 2IXTA 2EYQA 4EO7A 1GKLA 2ATIA 1P29A 4B7ZA 2IV7A 3ZC3A 3ANYB 4Q9KA 1QU2A 1PO7A 1G8YA 2BZ0A 4H16A 2QT9A 4BNJA 4D5EA 1DQYA 2FI1A 1RYMA 4IH4A 4PINA 4QXQA 2NXWA 2GN1A 5M29A 3EPHA 3G0BA 4BS9A 5M04A 2R8ZA 1E3IA 4Q4HB 3VHXA 3M9LA 3ZWBA 1CE8B 5H16A 4ARZB 5KQGA 1SK8A 5FL7D 5CDYA 4G0NA 3L7OA 4EHDA 4YPFA 3HCNA 1N0WA 3NBUA 1HY3A 3TQIA 5AIBA 4H7EA 1GILA 2REBA 3IXQA 1I7PA 4EECA 5J43A 5E3HA 2UZIR 5CM2Z 1J9EA 3EGWA 4FD3A 3I2IA 2LWIA 3IOMA 1RYYA 4M37A 4RK5A 3CYFA 4YJHA 4CCYA 5B1YA 4QQ8A 3ZX5A 3BCRA 5I51A 2JIZD 4X65B 5FR1A 1AH2A 1Z4NA 3SYLA 4NU8X 4D3SA 3ZHQA 4B43A 1EK2A 4YJ3A 5AK6A 3IHLA 2VBFA 3H7AA 3IYLW 1BMDA 3QXHA 3V2UA 1TA9A 3U40A 3PHLA 1QP4A 3B1YA 2NAPA 1KF0A 1Q0SA 4ARCA 1AS0A 2Q1XA 3F7MA 1GARA 3CSDA 2QZ9A 5JT1A 1RRCA 4F4HA 3PEVA 3NBXX 1OREA 4US0R 1WWKA 2IX9A 2XZDA 3EUFA 4IZ6A 4YJ2F 1F6WA 5ENVA 5EUCA 1E9VA 4ZANA 3SBOA 3UZUA 1XZDA 1VLJA 2Y1EA 2QD5A 2QV7A 3F6SA 1O8BA 4GUAA 2BZGA 4N76A 1NXQA 5LZ8A 2YZMA 3WLKX 2HJWA 1C1XA 4WCVA 3SHWA 5BN4A 2YC4C 3UICA 1PZXA 3DXYA 2Q9UA 4RXTA 1G42A 1XXLA 3ESYA 3C4QA 4H18A 3B48A 3E0XA 4CZ2A 3F0TA 3ECAA 4L72A 3KYJB 3VJKA 3PX7A 2P6PA 1L7NA 4EG0A 5LQCA 1GU0A 5DXJA 3IDFA 1VCIA 3LT1A 1FJ2A 1ZGJA 3QVXA 5K4HA 5TEWA 4UDYX 1Z17A 3I12A 4DKJA 2GA9A 4WESB 1KQPA 2BKVA 1SD2A 2D06A 1NL3A 5H3HA 4A23A 5LPNA 1GUDA 3DE4X 4QOHA 4MGHA 3SR0A 1IAQA 4ME6A 4C5BA 5HW0A 2E1RA 1H8HA 3KXDA 1IUKA 2EQBA 2FEKA 2C7BA 4JNCA 1RQ7A 1JLMA 1NXPA 1NX9A 4P7FA 2PFSA 4CMJA 5EMJA 1XMXA 2PKCA 3I5MA 5MGNA 3DPIA 4WH0A 3MGGA 2PS0A 2AT1A 4OHOA 5E7MA 1CVIA 1R8QA 3DD1A 3NX4A 4FHDA 1P5ZB 4PZ9A 3ROKA 1N1GA 3E1SA 3OKFA 5KOHB 4LGYA 1UP6A 4YP7A 3OJXA 1LCIA 1WF6A 4BNHA 1MRZA 3LX5A 2GVZC 5G02A 1GGJA 1V3UA 3AVVA 4R2MA 1LZKA 4UHCA 3CEAA 1YT5A 2A78A 3BERA 3IMKA 1XEAA 2HF7A 5JH7B 5CNIA 4F9EA 4KVAA 3DA8A 2AUMA 5AJTA 4HYEA 4DJEC 3DKPA 3I6QA 3E2IA 1C2YA 2AWNA 2IIPA 1XQYA 4JUCA 4U0KA 3U62A 5DMXA 4HKTA 3NHBA 5C8YF 3ER6A 4R40A 2JBAA 5ICCA 3M34A 4KVFA 1MB2A 1I36A 4AKTA 3T9EA 4RKQA 4UEOA 3X1MA 1LK7A 3M6IA 3A2MA