2GRJA

Crystal structure of dephospho-coa kinase (ec 2.7.1.24) (dephosphocoenzyme a kinase) (tm1387) from thermotoga maritima at 2.60 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
HHHMVIGVTGKIGTGKSTVCEILKNKYGAHVVNVDRIGHEVLEEVKEKLVELFGGSVLEDGKVNRKKLAGIVFESRENLKKLELLVHPLMKKRVQEIINKTSGLIVIEAALLKRMGLDQLCDHVITVVASRETILKRNREADRRLKFQEDIVPQGIVVANNSTLEDLEKKVEEVMKLVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) (tm1387) from THERMOTOGA MARITIMA at 2.60 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Dephospho-CoA kinase
total genus 61
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2grjA00
5EUMA 1OE0A 3B1ZA 4M9ZA 4NCHA 4M0LA 4DC9A 4ERNA 5L8VA 2JLQA 3RABA 1GP2A 2K5UA 5TB5A 4C9BA 4FW9A 4I99A 3SNHA 1RIFA 1BKDR 1IN4A 4WIAA 4LJ6A 4BE7B 4US0R 1W0JA 4D81A 5BN3A 4XWKA 5KDDA 4MRNA 1KNXA 1CJTC 1S3GA 1ZNZA 1ZU5A 3BB1A 4FMBB 4GOXA 4HUQB 1KI3A 3MFYA 4JIMA 3ZQ6A 3KQUA 4PAMA 4Q66C 4RD3A 2VP9A 1KI2A 3FFBA 4QM6A 4G1UC 4DVGA 1ZNXA 3Q7PA 1HT1E 1LVGA 3B60A 4RD6A 2H18A 1SKYE 5BYKA 2IS1A 4Q48A 2C95A 3LNCA 2BDTA 2OV2A 1US8B 2PL3A 1AGPA 4JLKA 4PPQA 3RC3A 2KJQA 5LD2C 1XTSA 3TMKA 1E69A 2ZI7A 2FE4A 4JT2A 1QHNA 1NIPA 3AGPA 1GL9B 2Q6TA 1G7SA 1TF7A 4GP7A 4LOAA 5F9HA 4URYR 1XTRA 3U44A 4C0QC 5IK2D 3AVXA 1WQ1R 2FZLA 2IYRA 4GMXA 3S1AA 1XPOA 4QFMA 2JLUA 1OF1A 4C0HA 3RS2A 3CRQA 5FUYA 2I3BA 1H8EA 2ZE7A 3T12A 3GEEA 4MKGA 2CCKA 3I62A 2YNMA 2R44A 1UBFA 3L0IB 3CR7A 4HDOB 2ATVA 2IS2A 3IBYA 2AKYA 3N70A 2DFNA 2X1VA 1N0VC 2JAQA 5H70A 4DB4A 3R9XA 3ZVMA 2OAP1 3CF2A 1KJWA 4PPFA 4WXRA 1NVXQ 3U7EB 1SVSA 3U60B 1JNYA 4Q1BA 1VCMA 1T5IA 1TEXA 1E4YA 2HCBA 2P3SA 4NL4H 4PO8A 5C2JB 4BLTA 1BH2A 1BYUA 1AK2A 1ELOA 2FJUA 3AF3A 3D7MA 3FDIA 3GFOA 4B6EA 2F1IA 4NYJR 1R5BA 2BMFA 4JLBA 1EWQA 1ZAKA 3SZRA 5JWHA 3B78A 3UG6A 2BIFA 2QEQA 3CO5A 1CJMA 2BKEA 1KI6B 3MUFA 5HE9A 1KNQA 1M74A 3CNOA 4PR0A 4ZI3A 1Q3TA 3AUXA 1R0YA 3K0CC 1G5RA 4URVR 1NVUQ 3T5GA 1X3SA 1KGDA 2D7CA 3T5DA 2ZSAA 3RHFA 3MG9A 3FVQA 4YMVA 3NH6A 3OEHA 4L9WA 4URWR 5ANRB 4HLDA 5K8LA 3IEUA 3NWJA 1T3HA 4MA4A 2GA8A 5E7MA 1B23P 3NKVA 3T1TA 3LX5A 4OI1A 5IF9A 3MD0A 2XNSA 4DSUA 4CEJB 1W5SA 4KJZA 5FBVB 4IDNA 2ZETA 3VR4A 4RKEA 1UBCA 3W5JA 2YC4C 5KSOA 1TAGA 1Z8FA 2H17A 5DIFA 4TLBA 4Q02A 4HI0E 1P60A 4GNKA 4H1UA 3MWJA 1JAHA 1KO8A 1RZ3A 1QDEA 4EJSA 1P9WA 2ZYWX 3AQ4A 3NEJA 4WZ6A 1KKMA 4MKIA 3PEWA 3QXXA 2FV8A 4F91B 4G3XA 2Z0MA 4C0JA 2GK6A 4PANA 4WZAE 1E2FA 4RZ3A 3V00A 5A0FA 4AKHA 1JQLB 2ZANA 1SXJC 2FA9A 3NBZC 4MH0R 1XXHE 2YHSA 4Q1FA 4ZCIA 4KLZA 1NI3A 3KB2A 3WHLA 3R20A 1NRJB 1G1MA 1UKEA 4FINA 3WYAA 1IM2A 4PTLA 3BIFA 2H8KA 1FQJA 1JEEA 1FTSA 3VKGA 3B6EA 2GK7A 2GJAA 3SOPA 3VU9B 2JLXA 3CB4A 2WKQA 1Y63A 4IEIA 3V9PA 4IVQA 2FPMA 4GOKA 2JJ8A 3GLFE 5ELXA 3EPJA 1DARA 1Z6AA 4MGZR 1K6MA 3OF5A 4H9GA 4BLOA 3J81k 4FCVA 4Q03A 5JRJA 2FPLA 4OI4A 3AVWA 3BOSA 4QBIA 2V1UA 1JR3A 3H0KA 2WSMA 3K9NA 3K70C 1XZQA 2Q9CA 3SQXA 1I4TD 1T0HB 2WJHA 3ND8A 3W90A 3TUIC 4EAQA 2FFHA 4LV8B 5HPYB 1G6OA 4BASA 5BXQC 4PZZA 3ZD7A 5FBLB 2F9LA 4M8NE 1XD2A 3X1ZA 4BGDA 1JXOA 1KI8A 1N6NA 2XNDA 4BFWA 4BLPA 3O8DA 3QXCA 4CF7A 2XZPA 3M6AA 1R5OA 2PX3A 2ZSEA 4WW0A 4UNRA 1CRPA 4NE2A 2CL7X 1WCV1 4NKRA 5FTKA 2WBLC 1U94A 4EIWA 4R7ZA 2ERXA 3K0SA 1GNPA 3CBQA 5JHHB 2XSZD 5AJZA 2XB2A 5EZ5A 3L0PA 2ZQ5A 3I32A 3AV0B 1XPUA 1OXTA 1T8UA 4E5UA 1ZNYA 3ECCA 1LB1B 3WMFA 4B6FA 5AUPB 2WWIA 4JLAA 2QT1A 1OXSC 4NBSA 1LNZA 2JLWA 3LW8A 1WE2A 4LBWA 5FPHA 3IO3A 2XXAA 4TMVA 4QRHA 3MCAA 3TW8B 4ARZA 4URXR 4F4JA 2W00A 2BKUA 2G77B 4PAOA 1Q21A 4PSAA 2OHFA 1KDPA 2ZI6A 1KI7A 4Z1MA 1NKTA 3KKPA 1Z28A 1G20E 1I2DA 3PCRB 1QHGA 2ZS7A 4TL8A 4UNPA 1VHTA 1MABB 1XB2A 4LI0A 4DSNA 2WWGA 4BFXA 3O8CA 2YWHA 2DFLA 3DMDA 1E2IA 1NY5A 3T06B 4M53A 4M1OA 2ASEA 1P7CA 1QHIA 5F2EA 4B47A 1D5CA 5EP4A 4LV5B 4W5HA 621PA 2BM1A 5KU1A 3THWB 3RS4A 2I4IA 2UVQA 4CT4B 4EPVA 5D3QA 1QBKC 2H16A 3K9HA 3ZS8A 1W4BA 2C9CA 2XOKD 2D06A 3I1FA 3AVYA 1NLZA 1F5NA 3OAAD 3THXB 4Q9IA 1I4LD 3FFAA 4Q1CA 3NH9A 1SZPA 1YZNA 1TU4A 4JYBA 3PUWA 3Q9LA 5KNDA 1W5TA 1II8A 3EIQA 2XZOA 2GZAA 1XJ0A 4N3NA 3ASZA 4NHOA 3RYTC 1JPNA 1ZMXA 2VHUA 2QU8A 2FX3A 2JASA 2V3CC 4IDQA 3DL0A 2ORWA 2QPTA 3TW4A 2VL7A 2ZJZA 1MR3F 2ECKA 2ZJ5A 2J87A 1T5LA 1YJ5A 3VKHA 3H2YA 2WZQA 2DCUA 1UEJA 3B5JA 4FMDB 1P72A 1L4YA 4ABYA 3WNDA 3SHWA 4C2UA 2VPPA 1U90A 1G291 1MRSA 1VTKA 2QY9A 2R6FA 1QG4A 1KSGA 1D9XA 2OCBA 1HYQA 4RD0A 2OO7A 4OK3A 4RKFA 2FWRA 2GWHA 1WF3A 2YYZA 1WA5A 2MSEB 4HLCA 4IVPA 4R2IA 4Z51A 3FHCB 3MWKA 4QNRA 4OHZA 1A5TA 4PSVA 3HU2A 1DAFA 4MYTA 5K8TA 2BMJA 2W58A 4TYWA 2IEZA 3K0AB 2J1LA 1SHKA 4KU4A 5C4GB 1F48A 4ZDKA 5EJEA 2FFQA 2WPDD 4PC6A 3BE4A 2E1RA 5LDDC 2V54A 3JZMA 2JDIA 1S4QA 2EW1A 3FTQA 4UKDA 2QTHA 3QEJA 1A4RA 3QKTA 2O0JA 1W48A 1CJUC 2ZITA 1EESA 1X8KA 2CVHA 1GKYA 5HCIA 2C98A 2GEDA 3ETLA 2O52A 1N6LA 1YZUA 2QN6A 1G3RA 1TUEA 3PQCA 1M8PA 3TSZA 4NMMA 1Z0AA 2AR7A 2IYSA 3E70C 4FIDA 2QAGA 3RSLA 1XX6A 4V0OA 3V4FA 5C1BA 1CR4A 4P4UA 3CWZA 3U7HB 4Z1MD 3JVUA 2QUZA 4PO9A 2R8RA 3P32A 2PEZA 5FL7A 4W9MC 3GJXC 1CF4A 2VHQA 3FGNA 5GJBA 2EFHB 4KYUA 4V0ME 1SULA 4GZLA 5F98A 1WMSA 1IY0A 3OESA 4JLPA 1OH8A 1BMFD 3D8BA 1E9BA 6Q21A 4S2EA 1DAKA 3IIJA 2JJ1D 3KQNA 2JIZA 2OILA 3EZ2A 1DTSA 4LJ5A 3AVUA 1YZQA 1H65A 4NTZA 2OUKA 2DWOA 4LJ7A 4EPWA 5FPKA 1E3MA 1ZJ6A 3A1VA 4A6PA 2EFGA 5HZHA 3EWAA 1LS6A 2QENA 4N1AA 3D6TB 3R7WA 1G8HA 3CX6A 1M7BA 2ZRPA 3U2QA 3TK1A 4A2WA 1ZC3A 1EG7A 2D2EA 2ZJ8A 1E9EA 1XTJA 1KSFX 4TMTA 1KMHA 4I81A 2BBSA 3QKSA 2CHVA 3WRYC 2VP0A 1KO5A 4Q4JA 4E07A 1JB1A 3IKJA 2REXB 4MRSA 2W83A 1LFDB 1Q0UA 4WA7A 3UKDA 1W0KD 1CLUA 2QP3A 4ZDIA 3MMPA 2PZEA 1SGWA 2CCGA 5GJVC 2HV8A 5CLQA 1MO4A 5JCPA 4B73A 2N46A 2UZIR 4IFEA 4Q1DA 3ZIAD 3SBDA 1A2BA 3SJCA 3GEHA 3L8ZA 2CLDX 2Z83A 2F9MA 3K53A 2NPFA 2YOGA 1PZNA 2ZUDA 2DHRA 2VRWA 2OE2A 1XCPA 4U02A 3SE0A 5DI9A 3SR0A 2QQ0A 3PEVA 1X1SA 3C41J 3AVQA 3LBIA 1CR2A 2Y8EA 3AF0A 3FOZA 1JAIA 3K0FB 1AIPA 4X8HA 1NSFA 4I1SA 5FI0B 2FF7A 4AIIA 1ZU4A 4B2LA 3QKRA 1LW7A 2ZJOA 4DDWA 2CDNA 4XIGS 4JSTA 1VIAA 2PLRA 1E96A 1NVVR 4TQUS 1CKEA 4CEIB 2FOLA 4JVNA 4XD7A 3ZIAA 1IY1A 1CP2A 721PA 1CEEA 1X86B 1PUJA 4JLMA 3U44B 1XP8A 3P20A 4C7OA 4HLUC 3U4QB 2DB3A 1VPLA 3KXIA 4KFSA 2QPAA 4TLAA 4DUGD 1SVKA 1XTKA 2ZRBA 3KX2A 5SZIA 1AA9A 4Q5IA 2IK8A 2OG2A 1XTQA 3CH4B 2GF9A 3KXLA 5CYPA 4B3XA 3TJZA 2A3RA 2Z6VA 1FMLA 5L3QB 4M1SA 1N5LA 2GJ9A 4A1FA 2V4ZA 4LWZA 3B2EA 3E5HA 4Q7JB 3K1JA 2QAJA 3AKCA 3BGWA 1NVVQ 3DM9B 1HV8A 4M22A 3THYA 3BFXA 3F8TA 5C18A 4C7OB 3OE7D 1PV4A 2GJSA 2R6CA 4OJQA 2A7QA 4DDTA 5JCZA 4MYUA 4XD7D 4LHZA 2FSGA 1E9CA 4P4SA 1IOZA 3CZQA 2J59A 1Z0FA 2WSSA 2OBMA 4C30A 3FHOA 1VG0B 1ZVQA 3RAPR 1XXHA 5AJYA 4RCZA 1XTIA 3WRXC 3P27A 3BS4A 5LB4A 4JLJA 4FXPA 3VMFA 4L16A 3VNUA 1KDOA 2AFHE 2A5GA 2GBLA 5TARA 1ZYUA 2A5YB 3I5YA 3BWDD 1N6KA 4TWZA 1CR1A 4D4KA 1YR6A 3K0FA 2ORIA 3LLUA 4JYCA 1YHNA 2JJ2A 5JS8A 1OV4A 4ZCLA 2G9NA 4AKEA 1J7KA 1COWD 3EPLA 3T61A 1ZUNB 2CCJA 2PZGA 2YOFA 4FMCB 2HUPA 3W6PA 2R2AA 1HH4A 1X1RA 2C5LA 2NO1A 2R62A 2RGAA 4MDEA 5EP2A 2JLSA 3LX8A 1S8FA 5GADl 4MGIR 1JI0A 5AJWA 1TTTA 4LJ4A 3U3OA 1DPFA 4G5OA 4KLNA 5FPSA 3WNBA 1CBUA 3D3QA 4LBZA 2ZR0A 4C0KA 1AN0A 2ZI3A 3Q5DA 1E2JA 5JRZA 3RS0A 1G21E 3ZGXA 1T3SA 5CITA 1E32A 3RS7A 2ODBA 4HB4A 3U7GA 1XMIA 2J7KA 4PFSA 1SKQA 2QI9C 2XTMA 1E99A 2C2HA 1SQ5A 4WVFA 2ZI9A 1GVNB 4LHVA 3BBPA 1L8QA 2N1BA 5SZJA 4LHXA 2PCLA 2G1JA 1YZGA 2ZRNA 1S1CA 1Z5ZA 2L0XA 3P4XA 2RCNA 4Q4AB 4Q01A 1TL7C 3LAWA 3TKLA 2GXAA 3QIAA 1FUUA 4HAVA 4NCKA 1J8MF 4B75A 2WWFA 3AKDA 1P9RA 3GCGA 3TH5A 1DAHA 1II9A 4NCJA 4I1OA 5TMPA 2XXAB 1Q1EA 3AUYA 2FEOA 3WYGA 1UKYA 1P6XA 3NTUA 2RHMA 2NOAA 4HUTA 2OEPA 5DH9A 4OI0A 2FFBA 1QHYA 2PCJA 2C03A 4X8LA 3D31A 1X8JA 2BCJQ 2D74A 4AKGA 3LD9A 5G53C 3AVPA 3ADBA 2O8DB 4JL6A 4A2QA 1OH5A 2B92A 2IYUA 2ZR7A 1HQCA 5L3RA 2LKDA 1N3BA 1E1QA 4L5BA 4RVCA 1DADA 1LF5A 2HDNB 4KBGA 2R65A 2ZRFA 5FPTA 2WV9A 5BN5A 1OSNA 4Q7MB 1E2QA 1XNJA 1U0LA 3TUJC 5HKKA 2XZLA 2J7PA 1NJGA 2GESA 1G4UR 3EZ7A 4W7SA 4FCTA 3DDCA 3W8NA 1RRCA 3IHWA 5KUTA 3Q85A 2C9YA 3DZ8A 4PSKA 3GD7A 5JSZB 3C5CA 4GFDA 1TUIA 2H5EA 4HEJA 1RE0A 4AYWA 4LJAA 1VECA 2I1VB 3CPHA 1BS1A 4QG7A 4URZR 4UXJA 3I4LA 1KO1A 2WJVA 1WB9A 2CBZA 4LYAA 4KCGA 1CU1A 1NSTA 1Q1BA 3W3AA 3T1OA 5J4VA 1W2HA 2ZRHA 1F2TB 1Z22A 3UMFA 4TMZA 3TAHA 4Z8YA 2QPOA 1G5PA 2I1QA 1EXMA 2ZRAA 3LBHA 3EX7C 1TQ2A 2WSSD 1NBMD 4DLVA 5KPJA 1CXZA 4XSHA 4GDFA 4AY2A 4CEIA 3DZDA 4OHVA 3TLXA 1K5DA 4PO1A 1GILA 4TTPA 3IGFA 4IRUB 1N5KA 5KYKA 1WP9A 4OHXA 1W36D 1E2LA 4LK2A 3X2SA 3EARA 1JQJC 1DELA 4BFZA 3B9QA 1O87A 1N5JA 3A4NA 2KBEA 1NMXA 1KAGA 2B7BA 1ETUA 3QENA 3NBFA 1E4VA 2W2VA 2H57A 3EASA 1J2JA 3A6PC 4UXIA 5B2ZA 5LBIA 4BEBA 3I73A 5J4LA 3OAAA 4EPTA 1SXJA 3GLIE 3TGPA 3REGA 3KFXA 1UDWA 3UMRA 4FD2A 4ESHA 1N6HA 4GPTA 1DAIA 3O47A 4HSEA 4KBFA 3DOEA 1NN5A 3VKWA 2XEXA 1NL3A 4TN1A 4QHSA 4R71A 1VG1A 4BQSA 3RSOA 1BIFA 2P67A 3LH5A 2W6ID 4JS0A 3SJBA 4KFTA 4B2IA 3CF0A 3QY0A 4EFLA 4KYIB 2IXEA 4WOPA 4Q9KA 3BB4A 4B76A 4TLEA 2PMDA 1U9IC 2IS6A 1FZQA 1H8HD 2ZS9A 3OIVA 4RD2A 1WBBA 3VNVA 1I4DD 4NYIR 4ACAA 4BFYA 2BEJA 4TT3A 2HF8A 2ZJAA 2GXQA 3THWA 4NU0A 3C5HA 5IT5A 1OYWA 3DVLA 1A82A 2QTVB 2Z4SA 1RRFA 3HR7A 1DE0A 1RPZA 2ZUCA 3QQ5A 1EK0A 2P2LA 4O2LA 1UBGA 2IT1A 4W5WA 1TADA 5AUOB 4AD8A 2C77A 1GNRA 2QQEA 4UJ3A 4FWTA 1NLYA 2YINC 3AP1A 1GAJA 1W7AA 4GZMA 4Q9JA 3RDPA 1IY2A 4R98A 4AG6A 5JHGB 1U99A 1OH7A 2QT0A 1YR9A 4TYYA 4RJLA 4D2IA 3K09A 4B71A 3K9GA 2F1HA 1RW4A 3BD9A 4DXAA 2R6GA 3QG5A 1N2CE 5BQ5A 4JLNA 4HAYA 3W5IA 2O8BA 2GVDC 3JZAA 2P65A 1V5WA 3NEYA 1GM5A 3ZVNA 3B1YA 3HU1A 3MGCA 1IQPA 3H84A 4TQ9A 5H1YA 3FMOB 4B43A 1N25A 3GMTA 3VR3A 1T3LA 3GJ5A 4E03A 1GKUB 3L2OB 2ZYTX 1KDTA 5HZKA 1SVLA 4BRUA 1VHLA 1MO3A 1XD2B 3F5FA 2KWIA 3IPXA 2ZU0C 2BVNA 3QF7A 5DLQC 4WAUA 1Z0KA 3CWQA 4LC1A 5UKDA 2C99A 2IUUA 3BRWD 3NC1C 3CR8A 3JVVA 3DM5A 2BBOA 3LBNA 3R9IA 2YC2C 5L3SA 1EWRA 2B7CA 4QGHA 1QRAA 3GFTA 5FOSA 2A5DA 2RAPA 2BBTA 2IYTA 2EWVA 1W4AA 3CRW1 2JGNA 3KKOA 5KDLA 4D0NA 4A15A 2CNWD 2QBYA 2G3YA 2WIAA 4OYHA 5L3SB 5KO2A 4P4TA 1D2MA 1G17A 4NCNA 2OAQ1 4OQFA 2J5XA 2ZYVX 3C14C 3GLIB 1Z2CA 1MV5A 4AWXA 3TBKA 1ZRHA 4PC2A 3LWNA 1OB2A 2QA5A 4PX9A 1NBME 2VO1A 3L8YA 3TSWA 4O25A 1BYIA 3UG7A 3W9YA 4O3MA 4JJKA 1OB5A 1OXXK 2WMOB 3KJHA 3KQLA 1YR7A 3ND9A 4Q47A 3BERA 4KODA 1XD9A 2LKCA 1JR6A 1MO5A 1XFAA 3KKQA 3OHMA 1XD8A 4PXAA 5D3MA 4IDHA 1CTQA 5CM8B 2CK3D 2XOKA 4FI3C 4KVAA 2J0UB 1W0KA 4GOJA 1GL6A 1WXQA 1G5TA 4Q7LA 3QE0A 4HAXA 2BV3A 2KI5A 4MDFA 4PHGA 2EWWA 4OI2A 3BJIC 2V6JA 4GI7A 3SEAA 4RFVA 1W44A 2ZE8A 3IUYA 2EYUA 4D25A 2Q9BA 1Z07A 5KSZA 5JSZA 4TLCA 1XJCA 2PJRA 4RCYA 4V02A 1KJZA 4L8GA 2OM2A 3TQFA 1W36B 1KAOA 1UKZA 1JPJA 2J3EA 2IA5A 2DBYA 3A1SA 1KY2A 1U81A 2ZAMA 3GJ4A 4AKIA 2MMCA 3ZZ0A 5FTJA 1G7CA 5EXTA 5BWMA 1RRGA 2GDJA 2JDID 5EP1A 3I92A 1G41A 3K0EA 1HT2E 5DSZA 2X77A 1DOAA 1IHUA 2FZ4A 1Z47A 3SN6A 1ZINA 4LHYA 1NMZA 2QMOA 2IX3A 4MRVA 4YMWA 2CJWB 1G3UA 2CEAA 1Z08A 4O2RA 4LRWA 2FMXA 4PPGA 3EWSA 4IOLA 2ZE6A 3PXGA 1U0JA 3KB1A 2QRNA 3KTAB 5AUNB 5J4HA 4HB2A 1XEWX 1YZTA 1IN5A 1GZSA 3BH0A 4TQAA 5CK4A 5FBRB 5CB6A 2RGXA 4TMXA 2GNOA 1NIJA 2IYWA 1N0UA 4TL7A 3FE2A 4JKYA 4NYJQ 2JLYA 2ORVA 1XEXA 4MQBA 3GJ8A 3U61B 1T9HA 4HZUA 4QGGA 1G8GA 5DO9A 1QHHA 2IUSA 2ZREA 1UBEA 1WBDA 1E2DA 4I1UA 2YV5A 1G19A 4N0DA 3R8CA 4GMDA 2WPDA 4MUAA 1E94E 1VYVA 2X19A 3OE7A 2BEKA 3PUXA 2DFTA 2QZ4A 1E1RA 3AVOA 2ZU6A 1Q44A 1DO0A 1NBMA 1G3QA 1NY6A 1EX6A 1KIMA 1GDDA 3W3ZB 2GRJA 1ZD8A 3CH5A 3QEOA 4NZYA 2QG6A 1RJ9A 4LPSA 4A4DA 4LY6A 1T8TA 3ONWA 4HAWA 5FBWB 4QJ5A 2VEDA 3SS8A 4IEEA 5CDFA 2QAGC 3VR1A 2JCSA 1AKEA 4KFUA 3NXSA 4ON9A 4DCUA 5HE8A 1E9RA 3HP1A 1MH1A 2KBFA 3T34A 4LSGA 5CK5A 2W2XA 1LV7A 3UIEA 3REFA 1RVDA 2A30A 3DHWC 3IIKA 3RVBA 2FGJA 3UWKA 4CT5A 2WKPA 4JBWA 3NHAA 1VMAA 3LLMA 1RYHA 4OK6A 1KDRA 3BH7A 4EPRA 4IOKA 2JLZA 2O8FA 2JLRA 4OBEA 4ZO4A 4U5XA 1IAQA 1Q3HA 5K8UA 4IDPA 5E95A 5L3QA 2IYXA 2F3TA 1SVWA 4KVGA 1OHHA 4ZDWA 4DT1B 2J9RA 1P73A 2W2TA 4P0TA 4QOSA 1F60A 3LW7A 4Q9LA 4DT1A 2JLVA 3KJEA 2SHKA 4A0RA 3HJNA 2DWQA 4MKHA 3EIEA 3U3RA 4EJSB 4CRWB 1GITA 2RGCA 4ASUA 3BFKA 3I5XA 1HE1C 1Z0DA 1XEWY 2OZEA 3X1XA 4F7WA 1R8QA 5DN6A 4LBYA 3A8TA 1WRBA 4DLZA 2PLFA 3PVSA 5J4YA 1NLFA 4M9XA 1G6HA 4M9QA 5DE3A 5LD2B 4PAQA 1Z6XA 2DPXA 3X1DA 1KY3A 2CHQA 4Q4JB 4B3CA 4NDZA 2WJJA 4GL2A 3EAQA 1S96A 1GUAA 1Z3IX 1RJ9B 4QC2A 2IF0A 4JLDA 3GLGE 1XMSA 1E9FA 3B1XA 5G3YA 1W49A 5HKKD 2NIPA 4Q21A 3AKEA 3EPHA 5GJWC 4L9SA 3QKUA 1XRJA 5EE5B 2C96A 5BYJA 1HA3A 1YKSA 2CLSA 2GCNA 1E9SA 4F93B 4AI6A 2IYLD 3C7KA 1J8YF 3RRNA 4DLXA 1ZBDA 3NC0C 1E79D 5KNCA 2WICA 3PIRA 4G0NA 1OFTA 1Z6YA 2ODWA 4CIDA 1CULC 1S3SA 3Q5EA 4CZ2A 2ZPTX 1S2MA 4BEJA 2GCOA 1N6IA 1CR0A 4JLVA 3PITA 1Z2AA 3BAFA 4DB2A 2YWFA 4EPXA 4LDJA 2QORA 4QBGB 3CNLA 1A2KC 4WXPA 1ESNA 2NMVA 1A1VA 1JJ7A 1KKLA 1G8PA 1E9DA 4G5GA 4Q4LA 3LQQA 1GFIA 1HTWA 3CPJB 1IXRC 1P2SA 2DWPA 5FR1A 1FTNA 3A1UA 1M7HA 2FNAA 3RS3A 4QM7A 3FKSD 3K8YA 1P4SA 2QTFA 4MYCA 1ANKA 4EQ6A 4BWYA 2PT7A 2OCYC 4MYHA 4IOMA 4EFNA 3UPUA 3AEZA 4BZPA 4JVSB 2ERYA 3IIMA 4HDCA 3PFIA 4D4JA 2V7QA 1KSJA 1NP6A 2VSOA 1IN7A 2J0VA 4TTRA 1Z6GA 3EG5A 3Q3JB 2IWRA 4YXWA 3KTAA 4OHWA 4TYPA 3CRMA 2BC9A 1R10A 2D62A 2VF7A 3FMIA 4D82A 1HEIA 2HYIC 5JFGA 2OLJA 3IHLA 3MAAC 1TQ6A 4M4SA 3ZZTA 4FWIB 1DG3A 2AL7A 5FUWA 4Z8XA 1U9IA 4D26A 2G1KA 3CLVA 4J0QA 1NG1A 3EA5A 5DNYB 1GRRA 1G18A 2VP2A 2G83A 1XXHB 2LCFA 3H1TA 4BFVA 2OXRA 1YZKA 2UZ3A 1A7JA 1XMJA 1J70A 3KJGA 3QXHA 4H1VA 3U6KA 4RFSA 4C4PA 2V55B 4CEHB 3Q72A 3GLGA 3ICEA 4RZXA 2HYDA 4FMDF 5G40A 2IYYA 1YU9A 3K70B 3GLGB 1QVAA 4LHWA 5FR2A 1AS0A 1NG9A 2X2FA 1UPTA 2VP4A 2ZS8A 4RFSB 2OFXA 2ZRKA 3VQTA 1VG9B 4XVRA 1PLJA 2QAGB 4OK5A 2DR3A 3LDAA 1ZC4A 3L43A 3TNFA 3FPAA 2ZUBA 3BH6A 2P6NA 1D2NA 3AP3A 4S35A 4YONB 5FI1B 2IWHA 4RSGA 2XITA 2B21A 3LXRA 3ICQB 2V6IA 1ESMA 4MRRA 2EFEB 1U2RA 3L0SA 2VHJA 1Q22A 2AD5A 4IKEA 1XPRA 5F9FA 2RMKA 2ZIAA 4XOIA 3U3JA 2GF0A 4CEHA 3TVTA 3P1JA 3VAAA 1COWA 1F3OA 4JMPA 2F1JA 2QRZA 1KMQA 4DRZA 1GWNA 3SI7A 2NO7A 4Q4HA 4QHYA 1LF0A 2W0SA 4D6PA 4K81B 2H92A 1R5NA 1SXJE 3GLIA 4HB0A 5JEEA 1Q20A 3C4JA 4TZ0A 3PUYA 1P2UA 1X6VA 3L82B 1TQ4A 2ZRLA 5EP3A 3EZFA 4A92A 4Q1AA 4P31A 4B3DA 2RKOA 2WHXA 4EJSC 3GQBA 2ZROA 3I8SA 1YE8A 2ONKA 4P32A 4ZKDA 3LY5A 3RWMB 2WWWA 4JL5A 2NO9A 1SVIA 4JZKA 3T1QA 1E1QD 4B3GA 4F92B 3G0HA 3UK6A 1CJKC 4KSCA 5EXSA 3TUZC 1XCGB 2W6IA 2GBLC 1OHHD 1EFHA 3VFDA 2J41A 3VX4A 1FQKA 2FSFA 5JECA 4DSTA 1G8FA 4M2LA 4TL9A 4BUJA 1OPXA 4DLSA 1Q1ZA 2JA1A 3NBYC 5KTYA 4C0LA 1HURA 2XJ4A 5CJ2A 1KI4A 4B3BA 1FNMA 4WBSA 3VR6A 2ZI4A 2DFKB 3EZ6A 4RY2A 1BO6A 4LYHA 1P61B 3DEFA 4I1VA 1T0JB 3QBTA 1GOTA 3DKVA 2P6RA 5FUXA 4V0KA 2W0MA 4ZPXA 2HCJB 1W1WA 4D4LA 5JZVA 2QMEA 3EC2A 3SHFA 5B30A 4K8OA 4OQMA 5A5GA 3RNLA 2RGDA 3WNCA 4QGAA 5J5CA 3ZZUA 4NONA 1GSIA 1R2QA 2ODEA 1U8AA 5KDOA 2OXCA 4IHQA 3ZH9B 1U8YA 3MRSA 2XB4A 3LRPA 3ZQJA 2JJ2D 1D8TA 2HT1A 3NVAA 5FBQB 4ARZB 1RYFA 1XDBA 3KQHA 3B85A 2B6HA 5J47A 1F2TA 2W6JD 1K5GA 4TLDA 3Q7QA 4A0GA 2AX4A 1Z83A 4DZZA 4QL3A 1VCNA 4F4CA 1VKJA 3T35A 4P3YA 4TYNA 4R9UC 2OBLA 2D4HA 3KL4A 3PUVA 4BLRA 2H1LA 4P4SB 2ZJBA 5DISB 1YRBA 2OFOA 3FHTA 3TAUA 3GLHB 1IBRA 2A5JA 3QG1A 4PC1A 4DCSA 2RGNA 3QI2A 3ZJYA 4IFBA 1OT3A 3B13B 1UDXA 4RD4A 3OFND 2GXUA 5JEDA 2NGRA 1PUIA 4DEYA 2XJ9A 3QOFA 4IOJA 1AZSC 3A1TA 1UAAA 3QVVA 2PEYA 2RGEA 1E2GA 3PV0A 4BLSA 1K8RA 2ZVPX 3LO5A 4ZDJA 2RGNC 1AQUA 1TEVA 2CE2X 3AF4A 1E1RD 2GILA 4IXMA 4A36A 2VLIA 3KUCA 4HATA 1VIYA 221PA 5DHAA 1NJFA 2G0TA 3QXSA 5HTKA 2GETA 3LV8A 5FOXA 3NIBA 4X8MA 1ZIOA 3BORA 1SXJD 1T4GA 4U7DA 1AKYA 1ZM3A 4NPHA 1SVOA 2C8VA 4KSBA 4XVUA 4GBMA 2BCGY 3A36A 4HAZA 3ZDQA 3PR1A 3U6BA 1TPZA 4N0EA 3IBGA 5AJVB 3HPRA 2IXGA 1GG2A 3B9PA 1FL9A 2UKDA 4OKSA 1II8B 2BJWA 4HAUA 3SYNA 4CEJA 2C9OA 5CLLA 1IJEA 2FFAA 3HYTA 4TSFD 1Z0JA 3FMPB 1C9KA 4JLOA 3THXA 1N0WA 1XF9A 4EDHA 5G3ZA 1T91A 1KI6A 2AXNA 2NG1A 1KJYA 1R0ZA 4DLYA 4US1R 2VF8A 4UNQA 4KITB 2ZRDA 3SBEA 4W5JA 3B8HA 5SZKB 8OHMA 2WIBA 4B44A 2AK2A 2ZRCA 2IHBA 5CB8A 2BM0A 2FPKA 2Q0HA 2WJYA 4PQFA 1EFRD 3IILA 1ONBA 3EW9A 1TMKA 4Q7KA 3KZ1E 5JWRA 5KSYA 3HR8A 1DS6A 2VYFA 3A37A 4Q1EA 5J40A 4LPKA 1OXVA 3E2IA 3GLHE 2QM8A 4LJ9A 1I2MA 1OKKA 1EX7A 2Q3FA 2WM9B 2QGNA 3AVVA 1JR3E 1S0UA 2FSIA 1CIPA 4DJTA 4XWOA 5GVSA 1E2NA 2OFWA 3GLFB 2CK3A 3LVQE 3QJYA 3SQWA 4YQFA 2WJIA 2FGKA 2B8WA 4I4LA 2CVFA 2WOOA 1FNNA 5FTMA 4C0BA 1MT0A 2CE7A 4KI0A 2ZE5A 2ZJYA 3EIHA 4BRWA 1ZCBA 1IN8A 3VHXA 2IBMA 2GZHA 3SJAA 1PLKA 2IL1A 5C46F 4R2HA 1W4RA 2WAYA 4M21A 2O8FB 2F43B 4BPBA 4EKDA 3RS5A 2YWGA 3K0AA 1E79A 5JJLA 4ZKEA 2ANCA 1AJEA 1M6NA 2ZR9A 3MLEA 1EFCA 2QE7A 1P2TA 4QHTA 4POAA 3M1IA 1QHXA 2CNWA 3KDSE 2FN4A 5CYOA 1VCIA 2RGGA 4PHTA 5K8IA 1IXZA 3QPWA 4LJYA 1E2HA 4MITA 1KZGB 3LXXA 2WVJA 3GFPA 5JMTA 5B58C 1X8LA 3K9LA 1TF5A 4RZ2A 2MMGA 2GJ8A 5IHPA 1OH6A 4KO8A 3TIFA 2KE5A 5L3VA 2TMKA 1HY3A 1YZLA 3RWOA 3E1SA 1D9ZA 1OIVA 4CDGA 3ZD6A 2EQBA 4LC0A 1NKSA 2XAUA 2ZTSA 1ZD1A 1F2UB 1Z0IA 4TTQA 1G64A 1QF9A 3N2EA 1G7TA 1OW3B 1UFQA 3NDPA 4C2TA 121PA 2E87A 3K70D 3MWLA 2QROA 3OEED 1L2TA 4XTCS 5CIWA 5EZ6B 3QSYA 1KHTA 4TL6A 3WYFA 4A9AA 3AF1A 4NYMQ 5JLJA 1G16A 1W46A 1HQYE 4V0NA 1QHHB 5D3MB 3VX3A 2QGZA 3GPLA 3P4YA 1DO2A 3NBXX 2V1XA 3VU9A 2IF2A 3EPKA 1TX4B 3QBVA 2NZ8A 2QE7D 1QVRA 4IDOA 3GLHA 2RHDA 4DUGA 3KKMA 2X2EA 4EQ6B 1P5ZB 2JATA 1ZM9A 4V0LA 5CIQA 1CRQA 5FUVA 4D0LB 1R6BX 3B82A 3VHLB 3OEHD 4DBLC 5IRCD 2Z4RA 4DKXA 2HLDA 3R8FA 3DOFA 4HZUB 4YC7A 3T15A 2AN9A 4FMCF 1XMVA 2V7QD 3VTKA 1FUKA 5JI2E 2QL6A 4YLGA 2FDCA 4JKIA 1R4AA 1W4CA 2RH5A 1UF9A 4B74A 5JI3E 4Y0AA 3WHKA 4M9SA 4XTRA 3A4LA 5BW8A 1IXSB 1KSHA 2VIIA 3P26A 2A78A 4TT3D 2GEVA 1E0JA 5DN6D 3G82C 3C8UA 3KQKA 2VHTA 2AK3A 4AK9A 1BOFA 4YMUA 3EC1A 4CYMA 2R9VA 2CMKA 2OLKA 1C4OA 1MABA 1E9AA 3CX8A 4JVMA 4QKQA 2ZI5A 1KMHB 4TYQA 2BWJA 2GTPA 2JEOA 1JR3D 1XEXB 2QP9X 1XBTA 4OQXA 5FPYA 2YKGA 1P2VA 4U00A 1SVMA 5KOYA 2GCPA 5FOWA 3WBKA 4DSOA 2ODNA 1S9HA 4LCBA 1GIAA 1EGAA 1NF3A 1Q57A 5DI3B 3PEYA 5EXXA 4DLUA 1RC8A 4AYTA 4ZIRB 3TE6A 5EQTA 2OCAA 5G41A 1KOFA 1TU3A 1ZUIA 4DCNA 3QNUA 1DVRA 3TR0A 1KK0A 2IC5A 1U98A 4D80A 1UADA 3OIYA 1VG8A 2O5VA 2N42A 1IONA 1G3MA 3DMNA 4B48A 2HJVA 3M0EA 1PLLA 2Q21A 5AUQA 1OFHA 4PZLA 4BFTA 4QXAA 1D2EA 4NYMR 1UEIA 2WWYA 2O8EA 1OJLA 1QG2A 3F3YA 4KAXA 4BLQA 3X1WA 4E09A 2G88A 1KZ7B 2XGJA 2AFIE 2BBWA 3SFZA 4UQOA 5CM9C 2EVWX 3IEVA 4ILEA 4E22A 1DEKA 1DAEA 3DPUA 2BMEA 2WWHA 4ZCMA 4Q4HB 1VCOA 4RZUA 5A4JA 1JXMA 4DDUA 5C4MA 2PH1A 1ZNWA 2G0NA 2PBRA 2VP5A 3IDQA 4IJMA 1OKKD 1MRNA 2QBYB 2ZAOA 1V43A 3MSXA 3U3KA 4B2PA 5FH9A 4A82A 4M1YA 2O8BB 1ODFA 1N6RA 1R8SA 1DAMA 4O0MA 2J7PD 2VH5R 4NH0A 1KO7A 1OFIA 2GXSA 2WTUA 2ZVQX 2HXSA 4AG5A 1J90A 1S9DA 1G9XA 3HU3A 5F3WB 2XTZA 2O8DA 5TDHA 5EE3A 1F2UA 2QP4A 3LA6A 3QPVA 4HZIA 4UXHA 4IXNA 5B64A 1PVOA 3SFVA 5TV2A 1DBSA 4HLQB 5DYGA 4ZIRA 2GZDA 3GJ3A 4YDSA 1H8ED 1M2OB 2FG5A 4M1KA 3U3MA 2G6BA 1KK1A 1Q12A 5H68A 3TSOA 3WMEA 1D6JA 4II7A 4A8JC 2IUTA 1MKYA 4LJ8A 4DIEA 2EFCB 4C3ZA 2W6JA 521PA 3AF2A 1NVWQ 2J0QA 1KTVA 4G5SA 1B0UA 4A2PA 2OT3B 4LZZA 1ZUHA 4D4MA 4DCTA 1E0KA 1GRNA 1OYYA 1RRPA 2ZRIA 3HWSA 2ZM5A 3AM1A 3IPYA 4ZI2A 1OIWA 2VQSA 4ITRC 2J46A 2Q3MA 3AB3A 2OCPA 4KFRA 3W8RA 5JJKA 2P6UA 3GLFA 3QKRB 2ZYUX 3ZLJA 3HYRA 2PX0A 3BFVA 2REOA 3EZ9A 3V4RA 1N5IA 1Z6TA 2O8CB 2GJKA 1KK2A 3QVUA 2IW3A 3G5UA 1XJQA 4BECA 3THOA 2HEIA 2F7SA 3FWYA 4XSGA 4Z54A 1BMFA 2FH5B 2DYKA 3QPUA 2P5SA 2R6DA 3W6NA 2FSHA 4PHHA 1LY1A 2RGBA 2WWXA 1NN1A 1VYTA 3NG1A 4HLUA 1O3YA 1U8ZA 2F1RA 5CJPA 1E6CA 4EFMA 2MSDB 1N6PA 2O0HA 3AGQA 3MWYW 3FKSA 1OFUX 1FOEB 3OFNA 3KKNA 4B3FX 1E2PA 2P5TB 2NTYC 1YRAA 2ZEJA 5FL3A 4YMSA 2AD1A 1C1YA 3WBJA 3CX7A 2ANBA 2O0KA 3DO6A 1E2KA 3L0OA 3PUZA 4JL8A 4ASUD 5CDFE 1AS2A 4TMWA 2X8AA 4A8JA 2D7DA 4YMTA 1W47A 2NPIA 4ESVA 2A9KA 2XNDD 3LFUA 1FP7A 4LV6A 2GEUA 3SJZA 1AZTA 3CUEF 1LTQA 4IW3B 4XJXA 3BK7A 1PJRA 4QBFA 1U0HC 2H7VA 4TMKA 3PENA 3RC8A 4B33A 1H8HA 1NMYA 4F38A 4M1TA 1R0XA 2QNRA 2P0EA 1CJVC 5KNBA 3LVRE 2CL0X 4OQNA 4B34A 1W0JD 1WDTA 5KSPA 2CL6X 4BZXA 5DGXA 5FOVA 5JS7A 2QM7A 4LBVA 4URUR 5TXGA 2OSBA 1N6OA 1SXJB 3UWOA 2KSQA 2YJTD 3IQWA 1VYUA 1ZCAA 4A0HA 4IVRA 4PHFA 2F6RA 1KO4A 1ZM2A 2FU5C 4V0MA 3OIWA 1L4UA 4B32A 3Q8XB 4OHYA 1CS4C 1G3IA 1S1MA 2D3WA 3SDZA 5J4KA 5AWFC 4RD1A 5EE1A 3NDBB 2DY1A 5KHOC 5HR5A 3I3SR 1NN0A 1TF2A 1UKVY 3VR5A 2MSCB 3HDTA 3QF4A 4Q9HA 2NQ2C 4LX0A 4DLWA 1OLOA 1ZM7A 5IK2A 1ZW6A 4LGMA 3MJHA 2HXYA 4HB3A 3I8XA 3C15C 3FYHA 4DIDA 2QSZA 4TZ6A 3DKPA 4OJKA 3EXAA 3CZPA 5AK0A 3WMGA 5LPNA 1HE8B 5H8WA 2V8OA 1E0AA 3K09C 4NP6A 3GP8A 4HUQA 3SC3A 5FOTA 3U7FB 1GTVA 4LYJA 1UJ2A 5EE0A 4Q4AA 3ASYA 3QXJA 3UATA 2IHYA 4HYYA 3K0CA 3RRMA 5HCNA 2F55A 5TVKA 4A6XA 5E7JA 1GNQA 1KI1A 1YQTA 4QJ4A 5FL7D 1KK3A 1IN6A 2PJZA 2YZ2A 3U4QA 2HT6A 4GRAA 3H4MA 3WXMA 1F6BA 3BC1A 3KJIA 1R0WA 3KXKA 1XZPA 3AH8A 4BFUA 3RRYA 4YXWD 4DCVA 3TRFA 2ZSFA 3BXZA 4YDHB 2YOHA 1Z63A 2Q9AA 2PZFA 4MGYR 1P3JA 2XTNA 2C04A 4C0AC 4XVQA 1E2MA 5JJIA 2RB4A 4PPNA 3ZVRA 5EUQB 3NHBA 1KYIA 1YVDA 3VR2A 2VHCA 4A8JB 4F4IA 1FP6A 5JWOA 1JECA 4AC9A 5KPDA 4G5QA 4AURA 4JVLA 2WKRA 2ZXUA 3AKYA 2J45A 1OXUA 5IDVA 2AWOA 4HDQB 3R7WB 2CJWA 2D2FA 3T1VA 2F43A 3F0TA 1SKYB 4DLRA 1T6NA 2IYQA 3N5CA 4XH9B 5P21A 1JEDA 1AQYA 2IS4A 3ADKA 4V03A 1XWIA 4AYXA 4GP6A 2GCOB 2EYQA 3B1WA 2CLCX 1SHZA 3I61A 3R9WA 1LS1A 1AM4D 2V9PA 4MUBA 5AJXA 3UMSA 4PC7A 1P75A 4EPYA 1TQDA 4LUCA 2HF9A 2F3RA 5E7IA 5FFMA 1W36C 2IXFA 4CVNA 5FTLA 1JALA 3WP0A 4UNSA 3RRZA 2C78A 5M04A 4GSYA 2VTKA 1XEFA 1FX0B 3AVTA 4M1MA 1P9NA 2Z5FA 1ZP6A 1VDZA 2CXXA 1RFLA 2AKAB 4P33A 3OEEA 2QMHA 4D0GA 3UXMA 2Z43A 1J99A 2KB0A 2ZJ2A 2ZRMA 4L15A 2XSZA 4DEXA 2QSYA 3CM0A 1Z29A 2GAAA 3M4YA 2ATXA 2REBA 3QKSB 3TQCA 2J0UA 3OIUA 2YWEA 3ZYCA 5BN4A 1M7GA 3KFVA 4X8OA 3UANA 2PMKA 3FMFA 1JJVA 2VSFA 4EUNA 3GJ6A 2WJGA 1E0SA 2HJGA 3O8BA 3O8RA 3H86A 1QZXA 2CHGA 1GRQA 2AWNA 5DHFA 2GHIA 3OZXA 3GEIA 3EA0A 4G5RA 4BZQA 2PT5A 5SZHB 1DG1G 4PQRA 1W2GA 4KXFB 3S1AB 2OESA 4MRPA 4G01B 2BJVA 1DAGA 2JJ1A 4K46A 2XX3A 2WAXA 3QF4B 1YR8A 4TSFA 1FW6A 4Q00A 1RKBA 4PZYA 2EFDB 4DHEA 1ZD9A 3IO5A 5EXPA 1EFRA 4MGKR 2J0SA 2LWIA 4QNMA 1TNDA 3CF6R 1OIXA 2YVUA 4Q19A 5LB2A 1HUQA 4B35A 5E4FA 1Y3AA 1EFTA 2ZSBA 1FFHA 2FEMA 4JT4A 2QMUA 3CKLA 4QGFA 2GKSA 2R6AA 4FN5A 3THYB 2O8EB 5JBQA 1XCMA 3QUSA 3RANA 2GVZC 2VBCA 2VA8A 4A0FA 2IEYA 3AP2A 1KI9A 3W6OA 1II0A 5TY0A 3HPQA 4DLTA 3W34A 1FPMA 5GVRA 3ADCA 3IQXA 4LYFA 421PA 4ZV4A 3SYKA 4QBHA 3SU8A 3A4MA 2VP6A 1US8A 1NN3A 3X1YA 1G8YA 1MO6A 4US2R 1JBKA 1AS3A 3KUDA 4KV9A 3WP1B 4L4UA 3LQRA 3A58B 4KHZA 821PA 2EU8A 1ZIPA 2ZSDA 2IYZA 1ZM4A 1AGRA 2B8TA 4PC3A 3PJRA 4GT1A 4MKFA 4CW7A 5GJCA 1P62B 3BB3A 3CW2A 2HLDD 2AHOA 3TR5A 2BMDA 1XU4A 1UM8A 4OL0A 4DDVA 3PEUA 4BFSA 3N2IA 2VSXA 1FMJA 1G7RA 5EE9A 4OQLA 5AR1A 3ADDA 1E2EA 3C16C 1IJFA 3PG5A 3CNNA 3I72A 3TVDA 3A1WA 3CRVA 1L7VC 5DYIA 1M1YE 1MOZA 1FX0A 2JIZD 4WZBE 4JSYA 1E98A 2WMNB 1GKIA 5DI3A 1EFUA 2BOVA 3RLFA 1QHSA 4NYIQ 2AXPA 3GJ0A 1Z06A 5FTNA 2BHRA 2OBNA 5B57C 3SYLA 2ONJA 2A2ZA 2IYVA 3FB4A 3WY9A 3U5ZB 4PQYA 1M34E 4C0SA 2ZRGA 1G4AE 4JBYA 3B1VA 4JBXA 3CRRA 3CIOA 2A5FA 3B7GA 2NZJA 2WOJA 3FKQA 3ZVLA 2Q3HA 2ZRJA 1GL7A 3CPEA 4M1WA 4UJ5A 2NO0A 3MJRA 4Y0VA 4QJ3A 3CONA 2E9SA 4XWAA 1R7RA 3GJ7A 2NO6A 5FOUA 4ACBA 3ZS9A 4DWJA 1Q1QA 4JJZA 4NCIA 4CGZA 4Q18A 4UNNA 2O8CA 4FCWA 1NNEA 2GAOA 5E3HA
chains in the Genus database with same CATH superfamily
3EW7A 1OE0A 3DFIA 4ZOBA 3KQOA 1Z4LA 1PFYA 3NX4A 3OTGA 4NCHA 1WJGA 1YQWA 4M0LA 4WGGA 5AI8A 1U1CA 4Z9FA 1X7WA 5L8VA 5E9WA 3WHIA 5K6AA 2Q4DA 1A9TA 1I4WA 3I2JA 4J0EA 4RPLA 4C9BA 4FW9A 4I99A 3H1AA 4FYXA 5TE9A 3SNKA 3SNHA 3THRA 3DOCA 2ZB4A 3KWMA 4BNTA 1MW8X 1QFZA 4K88A 3NFRA 4RA6B 4XWKA 1RRMA 4FFDA 4MRNA 1NW9B 1ZNZA 4JIMA 2AX3A 3BB1A 1I9CA 4CM4A 4DG9A 1KI3A 5E7QA 1O58A 3BCSA 4PAMA 1EZ4A 4RD3A 3O4VA 1KI2A 1XZDA 1JI3A 4DVGA 4H7KA 2XXBA 3Q7PA 4GUDA 1HT1E 4N5NA 4OX9B 3VVMA 4LXHA 2H18A 2WB2A 1P7YA 1CUCA 2WUVA 3X1MA 4MINA 5KNDH 3S4YA 3WGLA 1US8B 4E1VA 2FQWA 4HQNA 4CKWA 4OXNA 4JLKA 5DPMA 1YS6A 3VZDA 4EJMA 4PPQA 1J5XA 5CCXA 3VDQA 3FA2A 1XTSA 3TMKA 3ZXIA 2UXDB 5CLGA 3OPVA 2LGJA 4F6CA 1RAIA 2F90A 4JT2A 3AGPA 4NAVA 5JMOA 4BS9A 3KPVA 1GL9B 5FNVA 1DQPA 1Y6GA 4KXVA 1BMTA 1X39A 3CTMA 2RE8A 1EI9A 3M83A 4TWAA 3A04A 3HJBA 1QBGA 4D9IA 2IYRA 1PF7E 2SKCA 1I4EB 1PFVA 3DL4A 1P2DA 5C8YB 2HI0A 4C0HA 3CRQA 3EF3A 5FUYA 3ZDAA 5F2KA 2CJXA 3T12A 3E7XA 4HDNB 4O1IA 3RWBA 2QJTA 4YR9A 1MAUA 4C6SA 2VLBA 3OE1A 2CCKA 3MOSA 5EJ9A 5IUJC 1RWXA 1Z38A 3DWEX 2F64A 3L0IB 3CR7A 4QFDA 2WVHA 5EMHA 2ATVA 2IS2A 3SF8B 1GTL1 2C2GA 1CUDA 4KQ9A 1RI2A 1IULA 2ECQA 2WHRA 2P62A 3N70A 4WXHA 3UK0A 3VZQA 2DFNA 4R7GA 1ZZGA 2JFBA 4K40A 2C5FA 4K8RB 1RKQA 3RSFA 5H70A 3L1VA 1JILA 4MUMA 3ZVMA 3L6EA 2A59A 4ZHQA 4YXFA 1PG0A 3CF4G 4P83A 4ZO9A 1FMFA 2FWAA 4EG8A 1FDRA 2TMYA 5EKSA 2Q6IA 1FNSA 3RYHA 4BIMA 2JK0A 3IT2A 3MS2A 1T5IA 5CXSA 1TEXA 4R2LA 1CDEA 1E4YA 3Q98A 3RTDA 3UKOA 4LQDA 3GPIA 4E4RA 3PUHA 5C2JB 1BDIA 2XKAA 3LTEA 1BH2A 1QE5A 3NJRA 3D7MA 1ULAA 3GFOA 4MQFB 2VRCA 4KZPA 1R5BA 3TD2A 4QUEA 1G8JA 4JBGA 4HDKA 5I47A 4MCIA 1ZAKA 4YGYA 3JQGB 1XCJA 2O7VA 5J2UB 1M6VA 1Y7TA 2FPIB 2J09A 1T35A 2BIFA 1NUUA 2COEA 3R2JA 4Y6OA 5LZ8A 1KI6B 2PXHA 2VT6A 1M74A 4I8XA 2FZ5A 3BJZA 3GMIA 3D4BA 1Q3TA 3MERA 4N8DA 2YZNA 1H05A 4A8TA 2FUG1 1KPIA 1NXOA 3H6KA 3JQ9C 3KQSA 2AOVA 1KGDA 4J0GA 2ZJ3A 4IXWA 4YJGA 5KVQA 3FVQA 4FR2A 2NU9B 3J81A 3NTVA 5ANRB 1SCKA 3NTRA 4HLDA 1NE2A 1JEJA 4RBNA 2A9JA 2GA8A 4AN1A 2FP4A 2RHTA 5BN4B 2FPGB 1RYZA 4KMMA 4X20A 4OI1A 3PQ8A 4YJFA 3MD0A 1ZOSA 2XNSA 1P18A 3QE2A 1PRYA 4OUDB 1W5SA 3C6ZA 4KJZA 4BQFA 2ONYA 3QX9A 4HX5A 3EUEA 4RKEA 3ENVA 2YRFA 3OZCA 3VTAA 4ZZ2A 5BSHA 3RHSA 1REQB 1RHMA 3CUUA 3PC6A 4Y2QA 4DOMA 2VBFA 3U4IA 5KNDD 2QM3A 4UUQA 1JTVA 4Q02A 4XDYA 1LVUA 2O6LA 4GNKA 1HG1A 4YAKA 3E5RA 1JAHA 2WMDA 4QSMA 4YMGA 2PG3A 1RZ3A 2ZYWX 3W06A 1AHNA 4WZ6A 4D0SA 2H9AA 3KAPA 2Q46A 3SMVA 2QMYA 1O5IA 1QAQA 2HGZA 4F91B 4NBWA 2F4VB 3GW8A 4G3XA 3WLTA 2QX6A 1GR0A 4PANA 4MQEB 5J9FA 1T4CB 3OJOA 4CG1A 4M55A 4RCVA 2CEKA 1VP3A 3L7KA 3PQDA 4EKGA 1WDWB 2G4CA 1XXHE 2YHSA 3H1EA 4KLZA 4IX9A 3KB2A 4IV8A 3R20A 1C1DA 1NRJB 2J4DA 1FXWF 4HQFA 3D5EA 5A6SB 4B6OA 1DL5A 4HOYA 4PTLA 1NDHA 3BIFA 2H8KA 5WRFA 4ZV7A 5HRAA 1SCUA 1EGMB 1OMOA 2NTVA 2Z1NA 3VU9B 2FUCA 2JLXA 2WKQA 2WJWA 3CSUA 1RQRA 4G25A 4Y9TA 1E18A 3FDZA 1PJ4A 2UV8A 4LNUB 4WN9B 3GLFE 1E1MA 1T36B 3VA7A 1HL3A 1K6MA 2KYRA 3K4HA 3S2SA 5ARDA 3LIIA 4Q03A 2VYVD 3TTTA 1NXSA 2AR0A 2JHPA 3SXUB 3HDVA 3RASA 1L4LA 4MQEA 2FPLA 3I1JA 4MVJF 4OI4A 1AV7A 3ITNA 4XGNA 4JUIA 5IJ0B 5I4CA 3KKZA 2WSMA 4J1SA 1L1FA 2Q9CA 5BSFA 5JR3A 4U7TB 1QE0A 4BCDA 5KWEA 1Y8RB 2VAVA 4E94A 1TCUA 1J5PA 3ETNA 3NUQA 2X6TA 3ND8A 1Z7EA 3TUIC 3A1DA 5HPYB 3Q9NA 4EY6A 5EVJA 1JJIA 4PZZA 3ZD7A 5DKFA 5FBLB 2F9LA 2JCXA 3X1ZA 1N6NA 4JU9A 2FPXA 4D8VA 3ENNA 3O8DA 1U8FO 3QXCA 1UDCA 1K27A 5T57A 5LSAA 4OHUA 3M6AA 4RULA 1R5OA 4UNRA 1TB4A 2GPYA 1Z4MA 1V9CA 2E48A 2FYTA 4EI2A 3N39C 5CT6A 3HGQA 4XLTA 4EIWA 5P8WA 1U5CA 4DSZA 1SM4A 1RADA 3D0RA 5HQ3A 5HUHA 3OZUA 2M6RA 2Q29A 4L8YA 5L7WA 4RTOA 4YR7A 5JADA 1F7UA 3RGGA 3AM4A 3IP7A 3R0IA 3EULA 4LS3A 5ECYA 2WK1A 1OXTA 1T8UA 2Z1DA 3FMGA 4QO8A 5D84A 4E5UA 1X7XB 3ESZA 4HFJA 4BGEA 5CDTA 2ZVDA 1T3ZA 5AVQA 4JLAA 3HMQA 1I7QB 2UUOA 4NBSA 3B89A 2J5BA 3B38A 2PM8A 4BCCA 2J3DA 3CURA 5FPHA 3IO3A 6CHYA 1Z68A 5ALSA 5M7EA 4D74A 2IFTA 2XKJE 3IP3A 2WIGA 1NVTA 3ABSB 2W00A 1QVWA 3WIDA 4EB6B 2G77B 3ZBUA 2ZI6A 3HS3A 1XQ9A 2FG6C 2Z3VA 4I4TB 4DNXA 1NKTA 2M6LA 4E7OA 4KMRA 5I51A 1W34A 4QJIA 3KEOA 1QHGA 4UNPA 3IIEA 3LUFA 1Z4NA 1PD0A 1T0PA 3G0GA 4DSNA 1PN3A 1P7VA 2BE9A 4BFXA 3KXDA 3DMDA 4G0OA 2HU2A 2GFQA 2HSEA 2WHPB 4R84A 2DBZA 1FU4A 3L7CA 2C2BA 5F2EA 4K0RA 4W5HA 3G8CA 5TLSA 4ZO8A 1F8XA 4FDAA 2Z9DA 4CKCB 1SOVA 2K7ZA 3RS4A 5JE8A 1G2QA 3QEKA 4ZU3A 5BQOA 1DO8A 3WK7A 1P7ZA 2DT8A 2C9CA 2XBMA 2D06A 3I1FA 3M7IA 2PPLA 3ORRA 1F5NA 3K0HA 3B9BA 4PE5B 3IAS1 3JATA 3OZEA 3QBEA 4KWHA 1D0SA 4YP5A 3ZV7A 5M34A 3M9WA 2D5AA 2C5BA 5FORA 5B53A 2OC9A 1SZPA 1D3AA 1X7YB 4P36A 4EBFA 2XWJI 3PUWA 2EJWA 3EFOA 1FFAA 1YQUA 1NUQA 3HFSA 1EFKA 1F9EA 3LL4A 3W1WA 1II8A 1ZD3A 4EG0A 2XZOA 1MX9A 1XCOA 3P0IA 4MUYA 5EKTA 4G8BA 4K9OA 4MVWA 1XJ0A 5BNFA 4NHOA 3OLQA 5JANA 4QDZA 2A9PA 1ZMXA 4W5NA 3PWZA 1J6UA 4DKJA 1U7DA 1U2GA 2FX3A 2JASA 4M1QA 4IDGA 5MFZA 4P3PA 3H17A 2QW1A 1OBHA 4IINA 2ORWA 2E85A 3TW4A 3WGYA 5DK4A 1O6ZA 3TNJA 1ITZA 2J87A 1XT6A 2XOEA 1YJ5A 4FLEA 3VKHA 2GEJA 4LTMA 1CZKA 1EXNA 1CSEE 2C97A 3OURA 4F56A 5I7UA 1FJXA 6GPBA 2YIMA 3S44A 5LJLA 1ZAYA 1NLMA 1FSPA 1TW3A 4ABYA 1VKNA 3B6MA 3FCCA 1QGUA 2CHEA 4MW9A 3ZCXA 1BHQ1 3ZWDA 1G291 2R6FA 2OORC 3I37X 1KSGA 2OCBA 4RD0A 1K75A 2OO7A 4OK3A 1UBHS 4AG3A 10MHA 2HR1A 2A1TS 3E48A 5A3RA 2GWHA 5AP9A 1WF3A 4C20A 1NTRA 2JK1A 2MSEB 2YYZA 3G2LA 5EMKA 1DDIA 4GSKA 4QNRA 5H80A 4OHZA 4F5ZA 5TRTA 2G63A 4PSVA 2UU9B 4MYTA 2OECA 3D5TA 1IZ9A 4G0QA 5AW3A 3MOIA 2IEZA 4IIBA 4LVCA 3WI7A 5C4GB 5IZCA 1F48A 3G5MA 4NBLA 4PC6A 5K3AA 4NECA 3WDKA 4E5KA 2CF5A 2JDIA 3QELA 2UUBB 1S4QA 2AZMA 4MI3A 1JH8A 4TVOA 4HMQA 1W48A 3DBLB 3QBJA 1YD7A 2X2PA 2ZITA 4TS9A 2FUEA 1GKYA 2QLMA 5HCIA 3L9WA 4TRJA 2GEDA 2VOJA 1OFGA 4R8VA 3ETLA 3TTXA 1YZUA 3AUUA 3ZBQA 1JJAA 4IIJB 1ZG3A 5AHWA 3KG2A 2N47A 5JSFA 1O6GA 4XJSA 3CV3A 1Z0AA 3IQFA 1TJ4A 3PZBA 2V6BA 4OAOA 2IYSA 3LGXA 1ABEA 1DKLA 2I0FA 2WF6A 1UODA 4LWPA 1R16A 1D6SA 1CR4A 3WTCA 5C1BA 1OLUB 4P4UA 4ZGBA 2UZ4A 1SFRA 2GSDA 1KQOA 3QLVC 1DMRA 1SC4A 4Z1MD 1TCAA 1ACJA 4F11A 3N2YA 3RC2A 3V1TC 3GJXC 2P11A 3EGVA 2ECOA 4CUJA 3JRXA 3QITA 5GJBA 1Z33A 3TW0A 4U8HA 1I24A 1JTFA 1IY0A 3ET4A 4EP1A 4QU8A 4I2NA 4S1PA 1P5HA 2PSJA 1JX6A 4HGRA 4S2EA 4WCFA 2XTAA 2F17A 3FYCA 2XYHA 3V3TA 3EXG2 1AO0A 1N9KA 4KNYA 2OILA 3EZ2A 4LJ5A 3RPEA 1YZQA 1YXMA 4RXTA 4WH0A 2R5NA 1WUHS 2UVPB 4KXLA 3GPBA 2DWOA 5BUSA 5F21A 3DMPA 3LDUA 1UXOA 4WFQA 5C1OA 5FPKA 1GDTA 2EFGA 1VBKA 5K2MA 5HZHA 4N1AA 2ZT8A 2QENA 3IOMA 2OXEA 3D6TB 5IAKA 3R7WA 3TNLA 1RWVA 1O96A 2CJFA 1M7BA 3U2QA 1BN7A 3EQZA 3QVXA 5HOEA 3HVUA 3OEWA 3TD6A 3ZDRA 1RXVA 2R86A 1MA3A 1BXRB 3QW4B 3SDBA 4OHKA 1MZPA 1A8SA 1KSFX 1L6IA 1QOZA 1XTJA 2K87A 1IQUA 2YJ4A 3H2IA 4TMTA 3VOBA 2BBSA 2DM6A 1RAHA 1WZIA 4OBXA 4UNIA 4GKBA 3OX4A 3GVCA 4RPJA 2JGEA 3R0VA 3HHPA 1JB1A 1JFTA 2VEOA 3RAFC 1UPXA 2QP3A 1SGWA 2PFGA 2Y1WA 3LCMA 3QVSA 5GJVC 4BVEA 4XWYA 5CH8A 1GUYA 5CLQA 3BMXA 3G2IA 5TVGA 2Z9BA 4B73A 3VH4A 4Y2VA 2Y0BA 1A2BA 3GEHA 2I7XA 5DWDA 4L72A 3FDXA 2Z83A 5CXQA 1VL1A 1IVSA 5IEBA 2HHHB 1RKUA 1KBOA 2YOGA 3C3MA 4NV3A 2ZUDA 1Z15A 2QX4A 4E5DA 5K0CA 5ITZA 3UBMA 4U02A 3VMMA 4WEOA 3DHYA 4YAJA 3ROGA 4YMIA 4GMGA 5DI9A 4QDJA 3COWA 3CTPA 5IWAB 1G2IA 3FJ1A 4DMHA 5AMXA 2Y8EA 4TXJA 4IJUA 3O8OA 4DBLE 2R1TA 5D85A 3IQHX 5T6MA 4I1SA 1V3TA 3ZE1B 1ULSA 3C3CA 3U4MA 1WPXA 2B0JA 2ZJOA 3JRWA 2CDNA 2QYSA 3PC8C 2XMCA 4HS4A 4PGGA 3O7WA 2VAXA 2CFIA 2PTGA 4FYWA 5EYPA 5TMDA 4D99A 3TEMA 3NRCA 2PLRA 1E96A 1BMQA 1U8UA 5CBKA 4XD7A 3OWXA 3X2EA 1XSEA 3ZIAA 3U09A 5ALPA 4FOPA 1OBVA 3HSSA 1X3LA 3ZWMA 3ZD8A 1Q0LA 1R3DA 2W71A 3TRHA 3U44B 4C7OA 1CEEA 4HAIA 3DT9A 2DB3A 4Y2TA 4ZD6A 3ZQ4A 1MUUA 4CV2A 4BJHB 4Z6KA 1JIXA 2BM9A 1XTKA 2QNBA 2ZRBA 3K1YA 5IXJA 3URMA 4ND1A 5CYPA 5E8RA 2GF9A 5BV2P 5KBYA 2A3RA 2HB6A 5DM60 4QTZA 4M1SA 4QG3A 1XAIA 2GJ9A 3AL3A 1SK8A 3F6EX 1RYEA 2X8JA 2XB8A 3PFGA 4WOCA 3B2EA 1YBHA 2M2IA 5DX1A 1T3TA 1NW5A 1X13A 1R64A 1PFKA 3F9IA 3K1JA 3OUZA 5CB0A 2C00A 3MTDA 3QELB 1UMDB 3UAGA 3THYA 3BFXA 3BDAA 3F8TA 1TVKB 1Q50A 4IDFA 4KQFA 4N7BA 1F6WA 5JCZA 2W90A 1HFJA 2FSGA 1E9CA 2K2QB 3HBMA 5IX8A 3RRBA 1Z7GA 4PFJA 2OBMA 4JQOA 2BEUA 2UYCA 1YTUA 4X1OA 1XLVA 1ZVQA 2QTRA 1XXHA 3EIOA 4LQCA 1XTIA 4DUYB 1Z56C 5LB4A 1L5MA 5C1PA 4FXPA 2Y1OA 3H5AA 1KDOA 2XH8A 2YH2A 3ICVA 4ARAA 4EYSA 5LP6C 2A5GA 2DKFA 3UXEA 3BKXA 4EA7A 1P91A 3BWBA 4KXUA 2VRCD 5TARA 4AZWA 5LQDA 3BWDD 1N6KA 1GKKA 2XQFA 1CR1A 5A7HA 1YR6A 1XKTA 2J3LA 3OT5A 2EHJA 1YHNA 2JJ2A 4UMEA 1A98A 3KYIB 2RFLA 4M0PA 1OV4A 2Q1SA 5ITWA 4ZCLA 2YRWA 2G9NA 4E08A 3K9QO 1LDEA 2IY8A 1REQA 1Z4IA 3OBBA 3PSHA 3WRWA 3EPLA 3R6GA 5K6AC 4E2ZA 2L17A 1U4NA 2YWBA 2ZBFA 3OM9A 3NOXA 1YAJA 3JRNA 5KYXB 3ZI4A 3QTLA 4HEA1 3EYAA 2P4EA 4GBGA 1DLJA 1T24A 2RGAA 5EP2A 2IX9A 3LX8A 4FOTA 4CQLA 1JIIA 1RBYA 4R51A 4MGIR 5CFPA 5BURA 1JI0A 2I55A 4G5OA 5FPSA 5TF0A 5AXBA 1B00A 4ZC8A 2HUNA 1H6CA 1N5OX 4ZVKA 4RHUA 3NOVA 1IBCA 3JWPA 1BCSA 3USZA 4YUVA 1G21E 4GRIA 4HUJA 1L7OA 5JH7B 3OBIA 2A1UB 2Q4OA 1I2BA 2OYSA 1B6SA 2ZKIA 2H1RA 3QZUA 1E32A 4XXHA 4X94A 3RS7A 2ODBA 4HB4A 5JROA 4PFSA 4JYPA 4L7QA 4ND7A 2QI9C 2XTMA 2GVNA 4K6GA 3FWKA 3TLGA 4O4IA 1DQZA 1RWBA 2GK3A 1GPUA 3BRCA 1GVNB 4OA8A 2QOEA 3COJA 4NOMA 2XMZA 4U4AA 4BUZA 3A9UA 2QTNA 3BE6A 3D5QA 1YACA 2HRRA 2L0XA 1EGHA 1UC9A 2YCLA 4Q4AB 1TL7C 3CT4A 3JZIA 2HFKA 1UK7A 1IJBA 2O3QA 3M70A 3T3IA 5K7SA 1Q92A 3GUZA 4B75A 5K0FA 2WWFA 3RYHB 4HWTA 3TH5A 3TOXA 2HNAA 3EEFA 3M33A 4I1OA 5DNCA 3SX2A 3L6DA 2X42A 1H2WA 3LQYA 4RL6A 3LF1A 3NCTA 3WGMA 1P6XA 2QG4A 4HUTA 2GBCA 3NAQA 3SFTA 1CY4A 1YQGA 3UA4A 3IC5A 2E3JA 3KUUA 1Z5VA 3OICA 1QHYA 1OX4B 3N0XA 3T7TA 3VOTA 1X8JA 4AKGA 3PE3A 3AVPA 4TMYA 5JSYA 3O8QA 3NORA 5F5LA 1OH5A 3IAM1 5L45A 1CUEA 1EK2A 1HQCA 1W52X 2PUTA 4HDNA 4RK7A 4IIYA 2EC5A 4TKZA 5L3RA 1X1TA 4XWTA 4PYOA 1LF5A 3HA7A 1VZ2A 2FG7C 1SB9A 1MQ8B 1MPTA 2ZRFA 5FPTA 2WV9A 4TXLA 3T8YA 4EJFA 1QR2A 1YBMA 3ZZMA 2VYNA 4ZT7A 1NJGA 5KYYB 3A1NA 5D7NA 2D6FA 4O8CA 3DDWA 4PBSA 5HILA 3HJFA 2R8PA 2R85A 1RRCA 5KUTA 3Q85A 1G5QA 1TA9A 1C3LA 3DZ8A 3R5TA 1ORRA 4IV0A 4PSKA 5EL0A 3C8DA 3QPAA 4QUIA 3LM8A 2KPOA 3N5KA 4GFDA 1OLXB 4KQ1A 3D1LA 2H5EA 4RF5A 1RE0A 4AYWA 4DG5A 1U7HA 4LJAA 5KJEA 4BLUA 4CPDA 3VPXA 2HQOA 1E4OA 1RLOA 1UBNA 2W2LA 4PG4A 3CPHA 1BS1A 4QG7A 3CX4A 5L40A 1KO1A 1WXHA 4LYAA 4O0LA 3PE6A 2AG6A 3LZCA 1FF9A 1EDDA 4KN5A 2IZ6A 1Z22A 4TMZA 7YASA 1P4RA 2I3AA 5JC8A 1JVSA 3LECA 2V45A 3AHIA 5EIBC 3SF0A 1EXMA 1U80A 3HJUA 3ECSA 4FNAA 3EX7C 1I32A 1WF6A 1BKYA 1XN4A 4GDFA 1P1RA 1VLQA 4H77A 4CEIA 1ID8A 3AYZB 4OHVA 3VPCA 1Y9ZA 3JQAD 1K5DA 4PO1A 2AMYA 3OMXA 2CV2A 2WT9A 3KPJA 3LKBA 1N5KA 2SKDA 5KYKA 1UAGA 4OHXA 3KZNA 3TEFA 3BQNB 4CGYA 1QGED 3FUVA 4BFZA 2DHQA 4X91A 4AECA 1XQXA 1UFOA 2G06A 3HY6A 1L5GB 4AJ9A 3ZH2A 4BV2A 4DAEA 1NE7A 1E4VA 2AOUA 1ACLA 4UXIA 4BEBA 2XQVA 2XQGA 4XYLA 3OAAA 4P5PA 4C1BA 2V7VA 1SXJA 4ZRMA 1JU3A 1XQ6A 4B7UA 1CRLA 1UDWA 2PMBA 4FD2A 4JSRA 4GPTA 5LFAA 1B76A 2AKEA 3QU5A 1M66A 3BGIA 4R1PA 1E0DA 4TN1A 1VG1A 5G02A 5JVDB 4BQSA 4R71A 4AMGA 1BIFA 2P67A 1W5BA 2M1ZA 3IQDB 1TIPA 2OL4A 4N3CA 1QH8A 4RGQA 4CLHA 9ABPA 3ZDDA 4I7EA 5AVOA 1EFAA 2NT3A 5E3JA 4B2IA 2WSIA 3CF0A 4GE0A 5LA6F 4EFLA 4C6HA 4WOPA 4Q9KA 5KTPA 2NQTA 1ZK3A 2I67A 2QJWA 4DA9A 4Z53A 5AIBA 1JLLA 1YRYE 3FNQA 1QIJA 2PMDA 3NDRA 1Z45A 1SBNE 3I9V1 4NATA 3PFFA 2IHVA 4NBKA 4RY9A 3UT0A 1SO8A 3KBBA 1FNCA 4EA6A 1A4IA 1PP4A 1U2TA 5DWQA 2ZIXB 3TFQA 2ZJAA 3GGOA 2GXQA 3THWA 1EXVA 4IDCA 1XLTA 5BMVF 1J8QA 1HDGO 2DPYA 1SHJA 5INTA 4L51A 1QF7A 5TEWA 3Q3IA 4D5GA 2ZXFA 1V8FA 3Q3HA 1CUAA 2FW8A 5F5NA 2IOQA 2C77A 1QYWA 3CWCA 4H3SA 2G5PA 2QQEA 4UJ3A 1C9DB 3JQ9A 5ALRA 4Z7JA 2J3QA 3FGZA 4B0PA 3IT3A 4D3FA 1W7AA 3M6VA 2I2WA 3RDPA 4E6PA 3UB4A 1IY2A 3GGCA 1Q7CA 1BDMA 2I71A 2YXDA 3E0QA 4TYYA 3WLFA 4R6WA 3QTTA 4X90A 5JAOA 4XLLA 2F1HA 2CYCA 5A6VA 3H5VA 3WL5A 4DXAA 3VR6H 3BMCA 3QG5A 1N2CE 4U9IS 1N77A 2O8BA 4HRAA 1G63A 4PNPA 3JZAA 1V5WA 1P29A 2I3ZA 1GM5A 3ZVNA 3O5AA 1CUVA 1DC7A 3MGCA 5LOVF 4TQ9A 1L5KA 2UUCB 5A3QA 1BCRA 4MPDA 1HLGA 5DOVA 2XUOA 5ENZA 2C20A 1KDTA 5HZKA 3G5AA 1T6BY 1SVLA 4BRUA 1VHLA 1MQ9A 2NXJA 3TWOA 1IPFA 3IMEA 2PHZA 3IPXA 1TEHA 1T9GR 2HK6A 4LF8B 2P91A 4RL4A 4JASB 4C5AA 3IULA 3L4BC 4HK4A 1PR3A 1FRFS 3HH8A 3UJNA 2Y3IA 4FBMA 3DM5A 3LBNA 3PHBE 4RNCA 2YC2C 5L3SA 1E3LA 1JIKA 2B7CA 3ME5A 3GFTA 5EJAA 4L6AA 2EWVA 2JGNA 2QD2A 2F62A 4CMKA 2G3YA 2P1RA 3PEFA 4QQNA 3OLWA 5KO2A 4HO1X 5F23A 1G17A 3CNBA 1EK5A 2OAQ1 5EHGA 4B4UA 3BTSA 1QFSA 3TBKA 3B51X 2G9VA 3OECA 3KAQA 1NBME 3OQ6A 1A1SA 2RC6A 3CUWA 1E3QA 3F8WA 3L8YA 1B6RA 4O25A 5DGDA 3UG7A 3FNFA 4CTMA 1HFEL 2HA5A 1T6ZA 1T4DA 1O6FA 1VLJA 3R7FA 1OB5A 4AFNA 4D4HA 3ND9A 2QZJA 2R7LA 2JHGA 2VDRB 3BERA 1XD9A 2LKCA 2QM0A 2WMYA 5AKIA 1P9OA 5ILQA 1JR6A 1XD8A 4B3HA 4BJ3A 5D3MA 3TQRA 4YHHB 1LPSA 1CTQA 5CM8B 5U4XA 2XOKA 5AW7A 3UKJA 4F3RA 4KVAA 4NBNA 1SHUX 2OB2A 4PX5A 5JXIA 3U3DA 1JA9A 5K5EA 1WOMA 2H1OA 3EGIA 4MR9B 5GWXA 4RVSA 3ENWA 1XWFA 4OI2A 4G2NA 4PGFA 1I80A 1F1BA 3L07A 4R8LA 3SEAA 4ZYXA 1W44A 3EDMA 3IUYA 4DLKA 2EYUA 5KTMA 1Z07A 1WDMA 4F72A 4TLCA 1TT7A 1XJCA 5IW8A 2NV0A 1L5NA 1CHDA 4V02A 1HRKA 4L8GA 3OP4A 1QCCA 3MWFA 4MQMA 2C3OA 4ARSA 2DBYA 1SCIA 4U2GA 1U81A 4TWJA 2Q3BA 2B8JA 3PLRA 4UCQA 3RV3A 2MMCA 3ZZ0A 4BNDB 4BVGA 5C4IA 1G7CA 5EXTA 3RFVA 1RRGA 2GTIA 4FFNA 3JWHA 3K0EA 1HLFA 3NVMB 1HT2E 1RM5A 4LXQA 2X77A 3HB0A 3SN6A 4X60A 1U0EA 4EZBA 3L06A 4J2OA 1NMZA 4HNQA 2PFSA 3V8VA 1EVYA 4JP3A 5KWJA 3EBPA 3A2LA 1TLFA 2CJWB 4E2WA 2CEAA 4XYMA 1EP3B 3ADPA 2Q5JA 5KEIA 3COVA 4ECAA 4AIRA 1ZSVA 1DV1A 1RM3A 1WDLA 3JVEA 3M4JA 4LDPA 1BG6A 3JX9A 2F59A 2QSUA 2ZE6A 3MTAA 1INLA 3TLAA 5AUNB 3P2EA 1QTNA 3R5SA 5J4HA 2F3QA 5ALVA 2QVXX 5FRDA 4D3ZA 1ZGJA 1IN5A 3DCIA 4J4TA 2X9VA 3LZDA 4N8SA 1KKUA 2FMIA 3QMVA 4HN9A 5CK4A 1A5ZA 5CB6A 4IQ8A 4YN3A 3SKVA 2GPTA 4JKYA 2JLYA 4RPGA 4KREA 2ORVA 4D43A 3CE9A 3BKWA 3L6UA 4CETA 5BR4A 4LOIA 2IUSA 2XD9A 3H8WA 4PG7A 2AFHA 3HYNA 2GK4A 4I1UA 3S5JA 2YV5A 3F7OA 2C5AA 2OWDA 4OMDA 3K71B 8AT1A 2E4ZA 4CCYA 1HKUA 4FFLA 3ROMA 1H3EA 3KQQA 3OE7A 2ZSUA 3F7MA 1B41A 1E1RA 1Q1GA 4ZVQA 3DUFB 4PYNA 2VDQB 1MC1A 1NBMA 1YJ8A 1G3QA 1L5OA 2EJVA 3VDRA 1MX5A 4WACA 3WR5A 4MW2A 1E3MA 4BX2A 3DL2A 1E92A 2A0FA 4NBVA 5B3AA 1ZD8A 2BM8A 4IMRA 4O2AB 4WERA 2UZ0A 4IDAA 4A4DA 5C32A 2EL7A 3KAKA 3ROFA 2ZBDA 3G2HA 3BSYA 3U49A 3BD7A 3VR1A 3BMNB 3K5WA 1ADGA 4ON9A 4DCUA 4D9JA 1RXWA 5DSXA 3EA4A 3HCWA 5HE8A 1E9RA 3E1GA 2VQEB 3ROKA 1NUSA 2JI9A 5CK5A 1C7JA 4NX2A 3ZVKA 3UIEA 1NMQA 1RVDA 1Z26A 3W9UA 3LXMA 4GR5A 2A30A 2BF7A 2R8XA 3A7DA 3DHWC 1J07A 1L1RA 3UMBA 3PPWA 3IAM6 4E2XA 4ANFA 4DDKA 2PQ2A 4CM7A 4HT3B 3HP4A 2M6SA 2WW8A 3W2IA 5BT8A 5HMLA 5K9ZA 4OK6A 1KDRA 3EDYA 3UENA 2W2KA 3AONB 5KSWB 3BHNA 3TZEA 1XAJA 2ZJ1A 3KZOA 5EHNA 2FPSA 5ESDA 4BP9A 5BQXA 5E95A 3AEKA 3CYFA 5IC6A 3N8NA 1NZDA 1XELA 3PRJA 4ZT6A 5LYJF 2FUNB 1P73A 4X3PA 4QOSA 1F60A 2PNFA 4NCAA 3HZOA 5LUBA 2C29D 4QPNA 3DEIA 3EIFA 3EIEA 1NPDA 1W73A 4L22A 5DTIA 1IEVA 3EOAI 5KIAA 4Y7CA 4CRWB 4FNMA 2ZTUA 5AESA 1HE1C 1HBJA 5GM2A 1QRTA 3ZLBA 1E6EA 1GTJ1 1H1LB 4JDPA 3P97A 1R8QA 2ZYRA 5DN6A 3X1XA 4DZRA 1WRBA 4D9NA 5HNKA 1J9EA 4R01A 4BLVA 1GAEO 1NLFA 2YJ5A 4PW0A 3UOAB 3TLYA 3WQRA 4M9QA 4LCJA 5DE3A 1JLKA 2WTNA 4RX1A 3WLQA 3OX2A 1MLDA 1Z6XA 5FI3A 3X1DA 1L7PA 1KY3A 2XPCA 3GGJA 1X7ZA 3TLJA 3HKBB 4R9SA 2WRZA 3IUBA 3KT6A 1GUAA 3OM0A 4IXTA 4QC2A 4JLDA 2ZTVA 5DHTA 3SZMA 1H3NA 1Y7IA 3G13A 3B1XA 2ZRQA 1PTKA 4MV5A 4KGXA 3RSCA 2NIPA 1WXIA 5F4ZA 2HY7A 4DIUA 1QQBA 4DCOA 2XWQA 5FLEX 3WOVA 1M2VB 5JQGB 1W5EA 1DIRA 4LRSB 1LJUA 4RY0A 1AUPA 2C96A 1HA3A 1YVEI 1YKSA 4GEGA 3WV5A 3MJVA 3KSRA 4KR9A 1E9SA 4AI6A 1Z17A 5KX5F 4YACA 2OGTA 4YMHA 3PLNA 1GU0A 2VSQA 3BXXA 1ZBDA 1E79D 3EG9B 1JLHA 4IZOA 4UASA 3PIRA 3WLSA 4F84A 2FJ0A 2Y27A 2CYBA 3Q6NA 2UZ1A 3LZ6A 4QU0A 1QIMA 4CIDA 1CULC 2C3PA 4PF1A 3HDHA 1J1UA 4CZ2A 2FY8A 1A8QA 1UQTA 4GGMX 2GCOA 3C4QA 3CLSD 3U81A 5LIPA 3N3AC 1C1XB 4JQSA 1BW9A 1GV0A 2PTHA 3EVAA 5CRIA 2HREA 3HYLA 3PQ6A 5AJHA 3ZE6A 4DB2A 4BWGA 3OHPA 2YWFA 4YCLA 6YASA 3WAGA 1IUOA 4WK6A 2VNIA 4BBJA 3S8EA 1TA4A 1UCFA 2L69A 4WXPA 1ESNA 4D02A 4RAOA 3N28A 1C8VB 3A9SA 4M0DA 3O21A 5D5PA 3TQQA 2NMVA 4QUKA 2EKLA 1FFCA 1E9DA 4MQLA 3EVZA 3HKCA 4O5AA 1ZRMA 1HXHA 2DWPA 4XPIA 5FR1A 3KJNA 3A1UA 1AUQA 4BBPA 1R0LA 2AOWA 3FKSD 4MYCA 5JD3A 3AOGA 1ANKA 4EQ6A 5A06A 1DJLA 2PT7A 4CU5A 5C81A 3CBGA 2NTJA 3GCZA 5JCJA 1JSRA 3AEZA 3NHFA 4I55B 4JVSB 1E5VA 1EJ0A 1F0YA 1TYBE 2HRQA 1QPBA 2QJRA 3DMFA 2V7QA 3IIMA 3H9CA 4L3WA 5D3KA 2J5RA 1X92A 2VTBA 1UBJS 4GO1A 3EG5A 3Q3JB 1EHIA 1CJSA 3F5MA 4YXWA 3V2HA 1L6RA 1WETA 3L46A 2DXIA 2BC9A 1R10A 1RTKA 3ZHUA 2X0FA 1HEIA 3FUCA 5DYNA 5I7HA 1GG9A 2OLJA 4PZEA 1RWNA 1TQ6A 3DZHA 3ZZTA 1M2VA 3UJ3X 4F4DA 3JZFA 3QHPA 3WLRA 3GNTA 1ZX1A 4HPWA 1DINA 2RHWA 4TSRA 3L1KA 2GYVA 1SHTX 3GFQA 4AULA 4FOSA 3EA5A 2FPPA 5DNYB 1DJQA 1OBFO 3INYA 1C2TA 2LCFA 4MPJA 3H1TA 3KB6A 2BRUA 4PXYA 2VN8A 5AJUA 2O3RA 2UZ3A 1NFFA 4IO0A 1ISRA 1DPGA 2EQAA 4JJFA 5CLFA 4C4PA 4ZI5A 2QD1A 3EGWA 3OKPA 4C4RA 2W42A 3UUEA 5G40A 4UTPA 4MZDA 3JYHA 2JHCA 5CNIA 3NGLA 5FR2A 2NZXA 2O8NA 2ZS8A 3WQHA 3LUJA 4FB4A 3E9RA 2A5LA 4RDXA 3OLXA 1W30A 4MV9A 4XVRA 2HFJA 4C89A 2PBFA 4P1ZA 3QFCA 1WSBA 4M3NA 1XNGA 1ZN7A 3GL9A 4FNOA 5KTTA 1CETA 1KYQA 1YIDA 2ABWA 3KLMX 4HCJA 4YRZA 4M0MA 1D2NA 1G2PA 4YONB 4Y2YA 4Z1OA 4LJRA 5FI1B 2IWHA 4RSGA 2JI7A 2V7GA 1S02A 2B21A 3O03A 3GLQA 3WB0A 1PK8A 3DT6A 1U3GA 3ILHA 2V6IA 1ESMA 4LIPD 2E5FA 4QXPA 4W1PA 3ICQB 3EY4A 3N8DA 3K0KA 4J0DA 2AD5A 4AN4A 4ZYVA 5SY4A 5CTJA 5F9FA 1NHGA 2ZIAA 3OJLA 4XOIA 3U3JA 2W2NA 4CEHA 1PEYA 1DUSA 4FYHA 2F1JA 1KMQA 4B3MB 3SI7A 2QTLA 5JAHA 4Q4HA 1NOKA 2QVCA 1LF0A 1Z16A 4FGJA 1NOIA 5ILOA 1J4AA 3LGSA 4G0XA 4Z4QA 4L85A 3DOOA 1THTA 3I6QA 5DNWA 4RH0A 4P5DA 1N78A 4RK4A 2ONCA 1PS0A 1P2UA 3L82B 4RIHA 3T7IA 3EZFA 3DE7X 3EXHC 1VMEA 2BZSA 1EVJA 3ZDBA 4FZRA 5GTDA 3NTXA 3MLAA 5C7IO 4REOA 1ADYA 3QOXA 4MI1A 5IM4F 3RWMB 5LP6B 3T1QA 3GR6A 5FUQA 1JXAA 2HBRA 5HXAA 3P9PA 2HM7A 1GADO 1T1JA 5EXSA 2XT6A 3T3GA 3TUZC 1X38A 2D5LA 3DS8A 3SEQA 1FFXB 1NF9A 2JRCA