2GRJA

Crystal structure of dephospho-coa kinase (ec 2.7.1.24) (dephosphocoenzyme a kinase) (tm1387) from thermotoga maritima at 2.60 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
HHHMVIGVTGKIGTGKSTVCEILKNKYGAHVVNVDRIGHEVLEEVKEKLVELFGGSVLEDGKVNRKKLAGIVFESRENLKKLELLVHPLMKKRVQEIINKTSGLIVIEAALLKRMGLDQLCDHVITVVASRETILKRNREADRRLKFQEDIVPQGIVVANNSTLEDLEKKVEEVMKLVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) (tm1387) from THERMOTOGA MARITIMA at 2.60 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Dephospho-CoA kinase
total genus 61
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2grjA00
3SI7A 2ZRNA 1E69A 1Q22A 2FMXA 2QG6A 2Z0MA 4Q7MB 2FFAA 4TT3A 1OJLA 3K0AA 3L0SA 3LLUA 1I4DD 4I1UA 5FOUA 5E3HA 3K1JA 1XD8A 2AXNA 4QM6A 4PQFA 1RIFA 1XJQA 1IXSB 2W0MA 4PX9A 3H86A 3KFXA 1XPRA 1GL6A 5JECA 1HQYE 2WWYA 1D9XA 5J47A 3MWJA 4LJAA 4JLDA 1YU9A 2F7SA 3UPUA 3I1FA 2PL3A 4OK5A 4RD3A 3WNDA 2ZUCA 3QXSA 1P3JA 3P4YA 4UJ5A 3EAQA 3OZXA 2WJVA 4CEIB 3CX8A 5FTJA 4X8LA 1BO6A 3WBJA 4CEIA 2VO1A 4MRRA 4Q1AA 1US8A 1KAGA 1KI8A 3MWYW 2QROA 3VHXA 4BLTA 2CNWD 5FTMA 2YZ2A 1NJFA 1NN3A 3NBZC 4HEJA 1W0KA 1KSHA 1FMJA 4MKIA 5C2JB 1HE1C 5SZJA 4WXPA 2ZJAA 4GRAA 3AM1A 2D62A 3BH7A 2HCBA 1XDBA 1F60A 2C8VA 3QG5A 5AUPB 4NPHA 5KPDA 1QG4A 4TLAA 2IEZA 1IY1A 1PV4A 2VHUA 3B5JA 2AL7A 2P2LA 1FZQA 3ZQ6A 5HKKA 4V0MA 3THWA 1TUEA 1G8PA 4IDPA 2CE2X 4NBSA 4Q7KA 4TMTA 1DVRA 1OKKA 4V0ME 4DKXA 2VSFA 4BLSA 2UKDA 4Q4AA 1SZPA 2ZI7A 2J0UA 2CHVA 4OHVA 1UDWA 1QHIA 1Y3AA 1XP8A 1JR3A 2HJGA 4HAZA 4IOJA 1ZM4A 1JEEA 1RRGA 1GVNB 5KUTA 1E2HA 1XEWX 3CRRA 4PAOA 1ZCAA 5HZHA 1YZUA 2J0QA 1YKSA 1XZPA 4B33A 2NPFA 5EE3A 3CWZA 1NY5A 1T3SA 2YWGA 5JWRA 2GVDC 5JFGA 4HDCA 4JLJA 2IYUA 1ZP6A 4MGYR 1Z6TA 4QC2A 4L5BA 3A6PC 1ZMXA 4QJ3A 3TW8B 1NL3A 4N0EA 3W3AA 2YHSA 1N6OA 2OSBA 1DO0A 3N5CA 4TLCA 5FOWA 1R0ZA 4RY2A 5H70A 5LB2A 3CPJB 4YMSA 4URWR 2ANBA 4LHYA 3ADBA 2QNRA 3O8CA 2QMHA 4Q03A 4L9WA 4M0LA 1JAHA 1FL9A 4HZIA 4EIWA 4HUQA 1AS3A 1CIPA 2O52A 3HU2A 2J7PD 4PANA 2L0XA 3UWKA 3X1DA 4Q9LA 4YXWD 1G17A 1N5LA 1UF9A 1E94E 3UG6A 1AS0A 1J90A 2A9KA 3HWSA 3LQQA 2OFWA 3UWOA 3LV8A 4TSFD 2C5LA 1E32A 2YV5A 2XGJA 3SDZA 4LJ6A 4TSFA 3VX4A 3HYRA 3GJ7A 4YLGA 3LX5A 5CM8B 1YRBA 4KCGA 2ZRPA 1RZ3A 5HR5A 1GIAA 3RC8A 5JRZA 5SZIA 1H65A 1RC8A 1N3BA 4PO9A 5K8UA 1NVVQ 1VYUA 4Q9JA 5H8WA 5GVRA 1EX7A 3QEOA 4C7OB 5EP3A 3P20A 2O8BA 4AKEA 3CR8A 2QP9X 1JEDA 1U2RA 4MRVA 3D8BA 2ZRHA 1SXJB 4DLYA 1W44A 4KYIB 3K70C 2AN9A 3V9PA 5HPYB 1COWD 5C18A 5DSZA 3KQUA 4QJ5A 2NMVA 4NCKA 3T61A 1MRNA 2CEAA 1A82A 5P21A 3TAHA 1XWIA 2HXSA 4DDUA 4PTLA 4Z8YA 4QBIA 1NKSA 2NG1A 4B3DA 1W47A 4DSOA 3CW2A 4LJ5A 3UMSA 2QAGA 2DFTA 3RVBA 3PEWA 1U9IC 3VR3A 3W5IA 3ECCA 1OXTA 1QDEA 1S96A 4CEJA 5CYOA 2DB3A 3GD7A 3LVRE 1TF2A 3FKSA 1AJEA 4YC7A 2WSSA 4DXAA 1E2LA 1S8FA 3QKSA 4UJ3A 2JA1A 2G77B 1KO4A 1K5DA 1EFRD 3WHKA 1E2MA 1IN7A 2IYWA 1OXVA 4RJLA 4WXRA 2FX3A 5EZ6B 3SOPA 1E0KA 3EX7C 2F1HA 3P4XA 4EPRA 5B64A 3BE4A 1E1RA 1Q3HA 1Q1EA 1SGWA 2PCJA 2ZR9A 3K9LA 3AGQA 4NL4H 1OH7A 4CYMA 4X8OA 2A5JA 2VP5A 5F98A 1D6JA 1SVIA 1YR8A 4RCZA 1Q44A 2R62A 2GXAA 2F9MA 5KSZA 3Q5EA 1I2DA 1KJZA 3AUYA 4Q9IA 4DUGD 3J81k 1E2PA 5JWHA 2XEXA 3GEHA 4B74A 1X1RA 2P0EA 4DHEA 3R9WA 1LV7A 3IIMA 4J0QA 4MKHA 3RLFA 5FBRB 3VR5A 4RZ2A 1Z6XA 2VH5R 2CK3D 2BBWA 3LBIA 5IF9A 1F2UA 1KMHB 4L15A 2RAPA 4OQFA 3L0PA 1TF5A 3BH0A 4MRNA 4A8JB 2QUZA 3AF3A 3N2EA 3QJYA 4ZDJA 3QY0A 3K0CC 2ZE5A 2I4IA 4C0QC 2R8RA 1GL9B 1JALA 4QJ4A 3SN6A 3GJ5A 3K0CA 4XSGA 4BFUA 4POAA 4B48A 4B6FA 2CLDX 3PUXA 5JCZA 1UKZA 2EWVA 1GNRA 2G3YA 2F9LA 1SXJE 3NC1C 1K8RA 1FMLA 4P4TA 1WF3A 1KDOA 1P2VA 3WNBA 5L3SA 2EYQA 4P33A 4OQXA 4A1FA 3Q8XB 3OIYA 1P2TA 1YJ5A 3EASA 4ZI2A 4URUR 4JLKA 2PZEA 1S1MA 2FFBA 2HEIA 3A4LA 1QF9A 2ZITA 3NDPA 1XPOA 5JEEA 3Q7QA 1P9WA 3U3RA 2OEPA 2ZI9A 4QXAA 1R2QA 5DGXA 2V6JA 3EIEA 3RAPR 5EJEA 1RVDA 1W1WA 2LKCA 4Z8XA 4Q01A 2X2FA 3A58B 1A7JA 2ZRMA 5DE3A 2JLXA 3B1YA 3L43A 2AKYA 2WHXA 4MUAA 4YMWA 5HZKA 4GOKA 3THXA 3B1ZA 4QNMA 4GFDA 4ZCLA 1WCV1 1AKYA 2O8FA 1OH8A 1ZCBA 3ZZTA 1YR6A 5FPTA 3EZ7A 5JI2E 3W8RA 4EPTA 3QXJA 1KAOA 4QNRA 3P27A 4G01B 2DPXA 2ZSFA 5L3QA 1OLOA 2BMJA 5FL3A 4LZZA 3PCRB 1X6VA 1F2TB 3ZVNA 1CXZA 1BMFA 4URYR 4V0OA 5FTKA 4W9MC 2PT5A 1UADA 1ZUNB 3Q72A 4KFTA 3SJAA 1VCNA 2QAGC 1KI7A 2XITA 1NY6A 3GLGB 3ZD6A 1ZUIA 2ORIA 2JASA 1W2GA 1PLJA 1N5KA 3LX8A 5G40A 1S3GA 4AC9A 2XZLA 1JR6A 1HT2E 3B82A 4ITRC 4D82A 1E9AA 2WZQA 4ERNA 3B1VA 721PA 3I62A 5HCIA 2O0KA 3PIRA 2BHRA 3EA0A 4X8MA 5JJLA 3KKQA 1D2NA 3K0EA 1CR1A 3RC3A 2QPAA 3OIUA 1Z6YA 2CVHA 4PC1A 4ZCIA 2FSHA 4LRWA 3KFVA 2C98A 4XWKA 3TUJC 2ERXA 2I3BA 2NZ8A 2J7PA 2GTPA 3SQXA 1DELA 2IC5A 4GP7A 4TL9A 4JLPA 2IYSA 2WMNB 4WA7A 3NDBB 1W2HA 3KJIA 1XD2B 4R9UC 3FGNA 4Z1MA 3SJZA 2D2FA 1R0YA 4ACBA 2AX4A 5K8LA 1EWQA 3VMFA 1XX6A 4GOXA 2QTVB 2RGAA 1KK1A 3HP1A 3I4LA 2OCPA 1VIYA 1E1QD 1TX4B 2Z4RA 2ZI5A 3MMPA 3I5XA 3BS4A 2C77A 2XXAB 5J40A 5L3QB 2I1VB 1U99A 2QBYB 3EA5A 1ZD8A 1H8ED 2JDID 1F6BA 4M9XA 1UM8A 4YMVA 4FXPA 2QENA 1E6CA 1P9NA 2REOA 3F5FA 5EP2A 2F43A 3NHAA 1Z0DA 2NZJA 2WPDA 5FOVA 4DSTA 2ZRBA 2X77A 2GJ9A 1W4AA 4MKFA 3DMNA 2ZREA 1G64A 3AVXA 3RHFA 1YRAA 1KI2A 3FMPB 3Q9LA 1SVOA 2DFNA 3RYTC 4XWOA 4E07A 2JDIA 4JVNA 1KI6A 1GITA 3SFVA 1NI3A 1P72A 1ZC4A 4QBHA 1XEWY 2FPLA 3R20A 1EXMA 3UG7A 2BBOA 1KJWA 4RFSA 5EP1A 2GAAA 1G5PA 1S9DA 2BEKA 4RD2A 5KOYA 2OG2A 3PJRA 4S2EA 2OLKA 5BN4A 4QOSA 2FZLA 2HV8A 1ZU4A 2GJAA 3MJHA 4R71A 1XFAA 1FNNA 2GXSA 2O8CB 1ZBDA 1J8YF 3UK6A 2W2XA 5KSPA 4BLOA 1G18A 3N70A 1FTSA 4US0R 2ZR0A 4II7A 4LWZA 4BZQA 4O25A 4ZDWA 2RB4A 4QGAA 2BM0A 4FCVA 3Q3JB 2IXFA 5DN6A 4M2LA 5TY0A 3S1AA 4LBYA 1PJRA 3VR2A 2O8DB 2F1IA 3HU3A 5HCNA 2WKRA 1N5JA 1OXSC 3LBHA 1OV4A 1T3HA 2LCFA 5FUWA 4XWAA 3CH5A 4UXHA 4Y0AA 4C7OA 2WIAA 4FI3C 3QE0A 5FL7D 1UKVY 5JZVA 3M6AA 1C4OA 2ZPTX 2ZR7A 1GP2A 4HLQB 2C9YA 4JJZA 4DLWA 5KPJA 3PUZA 4NZYA 2Q9BA 1Q1QA 2H92A 1W0JD 4V0LA 2QZ4A 4RCYA 1A5TA 5FUVA 1VCIA 3F8TA 2QT1A 3DOFA 3BOSA 4M9SA 1WA5A 3M4YA 3NEJA 1C9KA 3WP1B 1P75A 1SVWA 4P32A 2NTYC 4TMZA 5IDVA 1Z2AA 2Z83A 4DT1B 3HDTA 3Q5DA 1WBDA 1E2JA 4CF7A 2N42A 3DPUA 3AVYA 3EC1A 4LX0A 2A5YB 4V02A 1G4UR 2ZRCA 5J5CA 4BUJA 3O8RA 1P73A 1RJ9B 2Q3HA 2XJ9A 4BFWA 2O0HA 3QKTA 3REGA 1YZQA 1ZINA 3GPLA 4DEXA 1G7CA 4KJZA 1J70A 2QAJA 3B9QA 4B71A 1NN1A 4XSHA 5AK0A 2JLWA 1D5CA 2ZJBA 3H0KA 4HLUA 2WKQA 4DT1A 4TMWA 1IHUA 1O87A 3DKPA 4HUTA 2QP4A 1WP9A 5FBQB 5GJBA 2WJHA 2B8WA 3U7EB 4TLEA 3AKCA 2QAGB 2IWHA 1DAIA 2ZJ8A 2A30A 4QGFA 2H5EA 4IKEA 1J8MF 2ZI6A 1NSTA 2WAYA 3KXLA 4PPGA 3TR5A 2ORVA 4LPKA 4QHTA 3AB3A 3T12A 3VU9B 2R44A 2FOLA 4Q5IA 2XX3A 3I5YA 1DG3A 2FGKA 1KYIA 4JVSB 4TN1A 1AGPA 1SXJA 1RYFA 3EPJA 4TYWA 4Q48A 3T1QA 1P9RA 3TUZC 2QMUA 3B8HA 3RDPA 4KV9A 3WHLA 3BH6A 1ESMA 2FJUA 2F3TA 1X8JA 1LS1A 1P5ZB 2GK6A 1FFHA 2O8DA 2A5DA 2R6AA 4Q1EA 2W0SA 1WDTA 2QM8A 4B6EA 3OEED 1OHHA 2GHIA 3ZYCA 1OW3B 4RZXA 3WYFA 2JCSA 4RD6A 4QHSA 1KI4A 3BB3A 2QN6A 4UNQA 4EPVA 3WMGA 1II9A 3IUYA 4LC1A 4ZV4A 1OFHA 2F1RA 1UBCA 5L3VA 1GKYA 2ATVA 1XMVA 1O3YA 1XXHB 3I3SR 2FNAA 4Q00A 4DB4A 1NVXQ 3DO6A 1OH6A 1M34E 1MOZA 1XMJA 3CPHA 3EIHA 4MITA 3R9IA 1Y63A 1K5GA 3ONWA 1VG8A 1G41A 1ZC3A 5E95A 3U6KA 4G5OA 1KI6B 3W5JA 2YWEA 2IYTA 2RCNA 3GJ6A 1GRRA 3RS2A 4EFMA 3LVQE 4R2IA 1RRPA 1QHNA 4PO1A 3MRSA 1Q1BA 2JLSA 1U0LA 2WBLC 3K0AB 3PG5A 1RW4A 1VPLA 1N0UA 3AF2A 4HLCA 2WWGA 1II0A 2OV2A 3L82B 4A2WA 4XVQA 2ZYUX 2JLZA 3RSLA 4YQFA 5AWFC 4BECA 4RD0A 3WXMA 3FFAA 4BGDA 4BFSA 1U0HC 2XXAA 2CBZA 1Q21A 4NHOA 1W36D 2ZE7A 4WZ6A 3WRYC 5LB4A 1SULA 4DSUA 3QKUA 2C2HA 4NCJA 4WIAA 1VIAA 3QKRB 5EE5B 1AZTA 4KFRA 4W7SA 3THWB 2QRNA 4KAXA 2CHQA 3BGWA 1UEJA 3QF7A 3B7GA 4PPFA 3ZIAA 1JB1A 1OFIA 1ZYUA 4LYAA 1DAKA 2FE4A 1DOAA 2JJ2D 4DVGA 4H9GA 1MO5A 1GKIA 2XNDA 5AUQA 4F92B 4ACAA 4RVCA 1E4VA 5AJYA 1CJKC 1ZNXA 4XVRA 2ZIAA 4LJ8A 5ELXA 3SHFA 5K8TA 1MT0A 2G83A 5L3RA 1KSGA 3EPLA 4JT4A 3IHWA 3U3OA 3B6EA 4LJYA 1M6NA 4M1KA 4GDFA 3LW8A 4TZ6A 2EQBA 1W5TA 1YVDA 4Q19A 4HZUB 2O0JA 1QHSA 2CVFA 4D80A 3TAUA 3C7KA 1UPTA 2IHYA 2WJIA 2WTUA 4TLDA 4P4SA 4A36A 1JQLB 4KFUA 1IN8A 3BXZA 3PQCA 5UKDA 3GLGA 4OYHA 3E5HA 1XCPA 1IJFA 3AH8A 4AKIA 1S4QA 1U81A 2WSSD 2ZRAA 4A2QA 1W4BA 3WYAA 1X8LA 4YMUA 3EIQA 4JVMA 3K70D 4US2R 1IY0A 3IPXA 5TDHA 4OKSA 3RS4A 5KSOA 4K46A 1Z6GA 4DCTA 4KVGA 2RGEA 4LBZA 4B43A 1TADA 3U3JA 3GJ4A 4OHYA 5BXQC 2O8FB 2PJRA 2JJ8A 2YYZA 3RS0A 1R10A 1T4GA 3IDQA 1JI0A 1KDPA 1CRPA 4L16A 2WOOA 2F43B 1WB9A 3QQ5A 1NVWQ 1DE0A 1W36B 5FPKA 2P6RA 5KO2A 1L4YA 4JKIA 3THYB 4QGGA 221PA 3LDAA 3ZVRA 3A37A 1FOEB 1X86B 2B7CA 4G1UC 4FMBB 3QXHA 3VKGA 1CJVC 1EESA 1RYHA 3CF0A 4HB4A 2OAQ1 5CIQA 2NOAA 2NO0A 1H8EA 3KTAB 6Q21A 1OKKD 4JLAA 4PQRA 3CONA 4LJ9A 4PXAA 4F91B 1MRSA 2OESA 2QGNA 2V1UA 3RRMA 2FU5C 3NKVA 1VCOA 2RGGA 4BLQA 5FBVB 4HSEA 2YJTD 3FHOA 3AF0A 4XIGS 3VQTA 2KB0A 3I32A 4FINA 2ZRJA 4ESVA 3SJCA 1V43A 2R6DA 2G6BA 4Q4HA 2BEJA 5AJZA 4PZZA 2OAP1 1KJYA 2W6JD 1ZM7A 2IXGA 4JBWA 3MWKA 3PUYA 3DL0A 1W0JA 1KKMA 4EDHA 2ZYWX 2IYRA 2IYZA 3UMRA 3G0HA 2WJYA 3VKHA 4JLVA 3QENA 4R98A 4FIDA 2RHMA 4U5XA 1L8QA 2V55B 3OEHD 4D6PA 3K09C 4KBFA 5AR1A 5L8VA 2REBA 3K70B 3CPEA 2YWFA 2Q21A 4AKHA 5D3QA 4XOIA 2FA9A 5FFMA 1CJUC 1VG1A 2OHFA 3JVVA 3GJ3A 2PZFA 2V4ZA 5DI9A 1S9HA 4BRWA 1DAMA 1JPJA 2XOKD 1UBFA 2J1LA 2GK7A 3OEHA 4JLMA 1MV5A 3EC2A 1BIFA 2JJ2A 1T5IA 2FDCA 2YKGA 4CDGA 2ZXUA 4GPTA 1TUIA 2BCJQ 3GJ0A 2F55A 1AGRA 1E2KA 5H1YA 3X1XA 1SKYB 4PSVA 3THXB 1V5WA 2FSIA 2YOHA 1GUAA 5JSZA 4PQYA 5J4HA 2W6IA 1A4RA 1HEIA 1OXUA 4P0TA 5J4VA 1HH4A 4AKGA 2P67A 1G7SA 1YQTA 2I1QA 4IFEA 3D3QA 1TQ4A 2GJ8A 4HI0E 1G8FA 3V4RA 1H8HD 4GZMA 5CDFE 4FN5A 5JJKA 4EPXA 2X8AA 1SVMA 4EFLA 2VRWA 2ZJYA 3OAAA 1G21E 3I92A 3Q7PA 2WJGA 3GJXC 2R6FA 3FFBA 5GJVC 2ASEA 1UFQA 5TV2A 1YZGA 2ZAOA 4HDOB 2O8EB 4D25A 1R8QA 5FUXA 3UXMA 4LV5B 1ZM2A 2O8BB 2AD1A 2W2VA 4O0MA 2J87A 5FTLA 1OIXA 1S1CA 1N5IA 1F2UB 1TU3A 1IN5A 2CMKA 4LUCA 1XCMA 4AK9A 3A4NA 1VYTA 4AWXA 4C0AC 3TLXA 3X1ZA 1F5NA 4LJ4A 4TT3D 2CCKA 2DY1A 1P4SA 1ODFA 1N25A 1UJ2A 4Z51A 1XTQA 2QI9C 3B1WA 4WW0A 2RGDA 1CLUA 2IS6A 4M1OA 3ADCA 1BKDR 2RH5A 1TEVA 4HUQB 3CH4B 4KLNA 4LJ7A 4DUGA 5KDLA 4NYJQ 1E2FA 4Q4LA 2VBCA 3B85A 5E4FA 4KODA 4M1YA 5LD2C 4OQLA 4UXIA 1NBMA 3A1WA 1R0XA 3UANA 2X1VA 1K6MA 4XTCS 5EUMA 1KNXA 2ZSDA 4HAXA 3CNNA 1GWNA 2ZJOA 3GFTA 4U00A 1CULC 8OHMA 3UIEA 4BLPA 3AGPA 2CDNA 1ETUA 1G16A 1R0WA 1W48A 2IYXA 2YVUA 3BFXA 4DLUA 2GJSA 3MG9A 2OXCA 1A1VA 1SKYE 4DCNA 3IIJA 4AYXA 1HT1E 3NC0C 5AUOB 4KO8A 4A82A 1MABB 4D26A 4KFSA 1IBRA 2ZANA 3FTQA 4B32A 1VTKA 2WAXA 3C5HA 4M21A 4XH9B 1ZNWA 3I61A 4P31A 3C16C 3MWLA 4OHXA 3THYA 1D2MA 3ZDQA 1XTJA 3BORA 5JMTA 2CXXA 4TMVA 1Z0FA 1U8ZA 2BCGY 4IXMA 5JSZB 4C2UA 5FPHA 4AY2A 3BFVA 2HF8A 2PMDA 2RGNC 1YZTA 1NJGA 4MRPA 4RSGA 4E5UA 1NG9A 4ASUA 3NH9A 4HAWA 4IXNA 3IPYA 4Q4JB 1DEKA 2XTZA 1IOZA 1LFDB 3KB2A 2GRJA 5BN5A 3BAFA 3U7HB 1NKTA 3THOA 3NBFA 3KUDA 3LNCA 3VR4A 4LYJA 1GG2A 1GRQA 1SVKA 1DPFA 3RSOA 4N1AA 4D4JA 2JATA 4KITB 3VR1A 1UKEA 1Z5ZA 1ZRHA 2D4HA 1M7HA 1KZ7B 1XTKA 3AP1A 1DADA 3LQRA 5FPSA 1LNZA 4M53A 2CL6X 3W6PA 2YINC 4P4SB 4TTRA 4YMTA 1JQJC 1GRNA 3MCAA 5DNYB 3VNVA 3AP3A 2ZE6A 3IEVA 2WV9A 3ZZ0A 1DTSA 1UBGA 3QPUA 3U3MA 2P65A 1XJCA 5K8IA 2HLDA 4RKEA 4S35A 3PENA 5JI3E 3K9NA 3O8BA 4P4UA 5EZ5A 2QT0A 5CLQA 3T1VA 1ZM3A 5A5GA 1N0WA 4ZO4A 1VDZA 2ZSAA 2IS2A 3IBGA 3L0IB 4TMKA 3K9HA 3PEVA 4KSBA 3MLEA 3AEZA 5JHGB 3FE2A 3CNLA 3PFIA 1KGDA 1PUJA 1T0HB 2RGXA 2WSMA 2ZVPX 4O2LA 1W4CA 5AUNB 1ZD1A 5E7JA 2O5VA 2XTMA 3PR1A 1H8HA 1JAIA 4EQ6A 5TB5A 4LHXA 1QHXA 1XEXB 2ZRDA 1U94A 5CDFA 1DAHA 3KTAA 4W5WA 2C99A 2OM2A 3AVTA 1EWRA 2VQSA 3HR8A 2PMKA 521PA 1QVAA 1BH2A 3O8DA 4X8HA 4BFXA 3U60B 1LVGA 2GF0A 3RWMB 3KL4A 1NP6A 1KY2A 3T06B 1N6IA 4M1SA 1GTVA 1ESNA 3KJHA 4U02A 2H1LA 3WRXC 5TXGA 1NN5A 1GNPA 2FSGA 1QVRA 3BK7A 3KJEA 4PSAA 1NMZA 421PA 3ZLJA 2KSQA 4V0KA 2QE7A 2IBMA 1ZAKA 5HE9A 4DCUA 2G1KA 3ZVLA 4QBFA 3CIOA 2ZI4A 4OHWA 1EG7A 1FX0B 1G5RA 5D3MB 1FUKA 2EU8A 4C2TA 4ZDIA 2ZJ5A 2P3SA 4NCHA 4UNRA 2HDNB 1E2DA 4V03A 1E79A 1ZM9A 4F38A 3T5DA 2V9PA 2ZYTX 3ZVMA 1NIPA 1J99A 3QBTA 4I1VA 2PT7A 2WM9B 4EUNA 2A5FA 4PR0A 4B34A 2FEOA 2GF9A 2VSXA 1ZIPA 2LKDA 1YR9A 4FMCF 4H1VA 2IS4A 4LBWA 2DR3A 4JIMA 1G3RA 4IHQA 4C9BA 4UQOA 1UDXA 4Q66C 1JR3E 5BYKA 1RRCA 4QG7A 4TL7A 4HZUA 4PC6A 2ZETA 1KIMA 4GBMA 4KHZA 2NO6A 2OE2A 3ZH9B 2JLUA 1VCMA 4GP6A 3MAAC 5CK5A 2GWHA 3EW9A 1NBME 4UNNA 1UBEA 3FYHA 4I1SA 3GQBA 1NIJA 4IOLA 4RZ3A 3DEFA 3RANA 4A8JC 5JRJA 4AYTA 5KDOA 4I4LA 1CP2A 4W5HA 2ECKA 5IHPA 1GKUB 2AK2A 3M0EA 4IDHA 2GZDA 1IAQA 5DHFA 1F3OA 1FPMA 1P6XA 5HTKA 2RMKA 2HCJB 5GJCA 4JLOA 5KYKA 2TMKA 3SZRA 2VL7A 1TU4A 1HTWA 2YC4C 2V8OA 3TJZA 4EKDA 3B78A 3SJBA 2BJWA 3UMFA 5BW8A 4DJTA 3FOZA 3IQXA 2V7QA 1EGAA 1DO2A 3H1TA 2ODNA 3KKOA 2ZVQX 5FOSA 3KQKA 1S0UA 3KKPA 5B57C 1CF4A 2WICA 2ZYVX 3DM5A 3ZS8A 1OH5A 3K8YA 1MO6A 3SS8A 2IYQA 1G8HA 5M04A 4AI6A 1MABA 2A2ZA 4ZDKA 1ANKA 2BDTA 5JHHB 3FKQA 4OK3A 3BFKA 3AVOA 3U7GA 1CJTC 1KY3A 4Q9KA 1OYYA 4HB2A 3KJGA 4TMXA 3FDIA 1LB1B 3KKMA 1E1QA 1ONBA 1S3SA 1Z47A 3DM9B 1RJ9A 3GLFE 2DBYA 1N6LA 4M22A 2QGZA 4JSYA 1NLZA 2KBEA 2VA8A 5J4KA 2VP2A 4BE7B 3PITA 1EFCA 3B2EA 4BFVA 1II8A 4BFZA 2EYUA 2ZS8A 1JXOA 2P5SA 3T5GA 1JJ7A 4JT2A 1XCGB 1XB2A 4BEBA 1AKEA 4B2LA 2XOKA 1IM2A 3LAWA 4B44A 1KK2A 4NONA 4YDSA 1CS4C 2FH5B 2PCLA 4AD8A 1DBSA 3RWOA 3CWQA 1E9FA 4E22A 4DRZA 2MMGA 4PC2A 1Q57A 2DHRA 2RHDA 4PC3A 4DWJA 2V1XA 5TMPA 1E0JA 4Q1BA 5EXSA 1EFTA 3NHBA 1YZKA 1CR4A 1VYVA 4V0NA 2KBFA 3FMIA 1KHTA 1ZJ6A 4GNKA 1Z07A 4PC7A 1QBKC 3I8SA 5EXXA 2G1JA 1VHLA 4YXWA 1SVSA 1XPUA 1B0UA 4HYYA 1Z8FA 4FMCB 2PH1A 4NYIR 3R8CA 1J7KA 1JBKA 4JZKA 1DS6A 4CZ2A 3KQNA 3R7WB 4JVLA 4B76A 2ZSEA 3CM0A 1FP6A 3BWDD 4OJQA 2E9SA 4URXR 4JLNA 4MUBA 2Y8EA 4JYCA 5CJPA 1QHGA 1T5LA 2Q9AA 4A6PA 1L4UA 3ZJYA 1HE8B 1QHHB 4HATA 3QXCA 3SYNA 1GM5A 5AJWA 3M1IA 5DO9A 4MGKR 4I81A 3DHWC 5CLLA 2UZIR 2BIFA 3IHLA 1KTVA 3NG1A 4US1R 4A0GA 3GFOA 1LW7A 1JNYA 4RFSB 1NMXA 2QE7D 4IJMA 5TARA 4PSKA 4A0FA 4B3XA 3TUIC 3X2SA 2WOJA 5EXTA 2QU8A 4E03A 1TQ6A 4N0DA 2ZJZA 3VNUA 2LWIA 3LBNA 4NYJR 1TEXA 4QHYA 4IVQA 1Q12A 2QTHA 3RNLA 1NMYA 4TTQA 1OXXK 2IA5A 3OE7D 3SYKA 2ZUDA 2HLDD 5IRCD 2VLIA 1Z29A 2CCGA 5JWOA 2V54A 1S2MA 4WVFA 3VAAA 1KKLA 1YZNA 3C8UA 3BERA 3SBDA 1Z0JA 2J7KA 2VF8A 1MKYA 4MA4A 2GCPA 2DWPA 3I73A 1SXJC 3A36A 4I99A 4OJKA 2BWJA 4RD1A 1E3MA 1KI9A 3AQ4A 1DARA 3PUWA 3W9YA 2QTFA 1QZXA 2ZM5A 2GZAA 821PA 4QM7A 4CRWB 3A1SA 3DMDA 2CNWA 1WBBA 2OT3B 1XD2A 5EE1A 4DC9A 4Z54A 2GAOA 1VECA 2OBNA 2RKOA 2GESA 3K0FA 3MSXA 4BWYA 4D4LA 4TYPA 3SR0A 1MR3F 3U5ZB 1N6RA 3HU1A 4KXFB 3P32A 2GCOB 2JLVA 4GMXA 1E2NA 2SHKA 1KK3A 1R6BX 1T91A 1WXQA 2WKPA 3QBVA 4LI0A 4NKRA 5DHAA 1E96A 4AG6A 4AYWA 2XB4A 2O8EA 5SZKB 4OI1A 4N3NA 1RRFA 1SHKA 4B73A 2D2EA 4U7DA 4LHWA 1XBTA 3U44A 1WQ1R 4DZZA 4PPNA 4DLRA 4IDQA 1P60A 2ODEA 1KO7A 1T8UA 2Z6VA 1IQPA 3QEJA 3LWNA 2GA8A 4FW9A 1DAGA 2IT1A 2QMOA 2O8CA 2C04A 2HT6A 1AQUA 1GOTA 1E9RA 3OE7A 3QG1A 4C0SA 2GDJA 3NBYC 4LYHA 4EPWA 3EZ2A 3TSOA 4CT5A 1U90A 2QP3A 2NPIA 2Q9CA 3FPAA 4CIDA 1ZNZA 2R65A 1G291 1EFRA 1G3IA 3AUXA 3EWSA 4D0LB 1E2QA 2WJJA 3PVSA 1SXJD 3FKSD 3C14C 2PJZA 2QRZA 3BC1A 3LH5A 1QRAA 5G3YA 3EZ9A 1U8YA 4I1OA 2D06A 3TVDA 3QXXA 4MKGA 4DLSA 2OCAA 2BMDA 3PUVA 4KVAA 2XSZD 2AFIE 3K09A 2VHQA 3A1TA 4PHHA 1NVUQ 4LC0A 4MH0R 3QI2A 3X1WA 2W6ID 2OCYC 2CCJA 4OQNA 2Q6TA 3MJRA 2QBYA 4AG5A 4GL2A 3G5UA 4DLZA 3U4QB 4CW7A 2PLRA 5BYJA 1IXZA 3W8NA 2IK8A 1GL7A 2D74A 4DLVA 1XMSA 2NQ2C 2PZGA 4ZIRB 3QF4B 3HPRA 5G3ZA 2H16A 3CZPA 3TE6A 3QUSA 1BYIA 1OT3A 3NBXX 2N46A 3D7MA 3BD9A 1AQYA 3CX7A 4MDFA 4M9ZA 1GNQA 4LCBA 3K53A 1ZVQA 1D2EA 2C96A 3V4FA 4JL8A 4Q02A 2Z5FA 4DSNA 1NNEA 2RGNA 3EZ6A 2MSDB 3WP0A 2HUPA 1TQDA 2R9VA 3ADKA 5HE8A 4NDZA 1OB2A 2PLFA 3F3YA 4EJSA 4EJSB 1XF9A 3B60A 1AA9A 5ANRB 5CJ2A 1G19A 1YR7A 3RS7A 4OI0A 2GCOA 4GI7A 3IEUA 4NU0A 4M1MA 1GILA 3H4MA 4OI2A 4EFNA 3TW4A 4B3FX 2FZ4A 2J0VA 3R8FA 2ERYA 1Q3TA 1P62B 2WVJA 3B1XA 2ZRGA 3DKVA 4XTRA 1MO4A 3JZAA 3QKRA 3QF4A 1W49A 3LD9A 4XD7A 1BOFA 1TL7C 2FGJA 3I8XA 1T9HA 2J9RA 2WWHA 4BRUA 2PEZA 3AKDA 4Q7LA 2GZHA 5JEDA 5FBLB 2FPKA 2ODBA 2V3CC 4KSCA 1FTNA 4AURA 2J41A 2DWQA 2IXEA 5J4LA 1CRQA 2VSOA 1E9CA 5DYIA 4WZAE 5IT5A 4NTZA 2DFKB 2GILA 3KUCA 4FCTA 4L9SA 4Q9HA 3ZS9A 4LK2A 1XU4A 2WPDD 2Q0HA 3VR6A 4C3ZA 1Z2CA 2QMEA 2A3RA 3G82C 2HT1A 2CJWB 1HYQA 3OAAD 1U8AA 3TVTA 4D2IA 3QKSB 1OPXA 3GJ8A 2VP9A 3IGFA 5G53C 2IYLD 3NTUA 4Z1MD 5HKKD 2XZPA 1M1YE 3NH6A 1WE2A 1N6NA 3BB4A 1FNMA 4TLBA 4XVUA 4DDWA 2CLSA 2ZE8A 3IILA 3SBEA 3A1VA 4LV8B 5CITA 4LHVA 4NCNA 3GMTA 1OFTA 4HDQB 4DIEA 3QPVA 2QA5A 4B2PA 3GP8A 5DLQC 3LY5A 3U2QA 4BZXA 2MSEB 2BKUA 1AK2A 1PLKA 5C4MA 2UZ3A 2IUTA 4DCVA 3U44B 2WMOB 4BZPA 4LGMA 2DFLA 3F0TA 1R5NA 3OF5A 2H7VA 3CRMA 2H57A 4IEIA 2NO1A 1J2JA 2AWOA 1R5OA 2AK3A 1Z0KA 3LLMA 3GFPA 1G5TA 3T1TA 2IF0A 4A8JA 2J0SA 1SQ5A 1KSFX 2YNMA 1KMHA 1F48A 4UNPA 2BV3A 2A78A 4B47A 2J46A 5GJWC 4EAQA 4NYMR 3CLVA 3LA6A 3KB1A 3KDSE 4C0HA 3EARA 1IN4A 1ZUHA 3CUEF 3VU9A 2OFXA 1NLFA 5F9FA 1N2CE 3CX6A 4IEEA 3RABA 4PHGA 3ETLA 2C9OA 3EWAA 5EUQB 2GEUA 2ZRIA 1AZSC 1OF1A 3EXAA 5DN6D 1TF7A 2C9CA 5EE9A 5F2EA 2NIPA 1FW6A 2GVZC 2DCUA 4QFMA 4TQ9A 4ARZB 1EFUA 3ASYA 3KXKA 4LBVA 4G5GA 4E09A 1P7CA 1MO3A 4P3YA 2G9NA 2G0TA 3GLIB 2F6RA 3D6TB 2J3EA 4XD7D 1UAAA 4Q7JB 1XEFA 4CGZA 4NYIQ 1DG1G 1NVVR 5KNDA 3A4MA 2VYFA 2AFHE 2ONKA 3SEAA 3TRFA 4LOAA 4TYQA 4OHZA 4YONB 1N0VC 4MQBA 1R4AA 3RS5A 4XJXA 1HQCA 1WMSA 1YHNA 2XB2A 3GLIA 4QL3A 1N6HA 4F4JA 4JS0A 2CE7A 2C78A 2EFDB 4Y0VA 4URZR 2ZS7A 1T6NA 4IDOA 1XXHA 5EXPA 4R7ZA 2FEMA 1E0AA 2JIZA 3AVUA 4TL8A 1GSIA 2OCBA 3REFA 4CEHA 2R6GA 3CO5A 1HURA 2D7CA 2UVQA 2D3WA 4O2RA 4A0RA 3KQLA 1BS1A 2J5XA 1XD9A 4B3GA 1FQJA 1KO5A 2PEYA 3OIWA 4Q1DA 2HF9A 4RZUA 2JLRA 2CK3A 4LDJA 4G3XA 5CM9C 5KNBA 1ZNYA 1M74A 2H8KA 1GDDA 3I72A 1RE0A 1E98A 1XTSA 2EWWA 4DDTA 2QPOA 2GETA 3AVVA 4IRUB 3RRNA 4IOKA 1E2GA 2BMEA 2IF2A 3IBYA 2JAQA 1W46A 3EG5A 3VTKA 1US8B 1LY1A 1TPZA 2GBLA 3JZMA 1R7RA 3KQHA 2HXYA 1XNJA 4CEHB 1SVLA 5FBWB 2PX3A 3FWYA 4ZI3A 1EFHA 1Z28A 3SC3A 3TKLA 4TWZA 1OYWA 3ZD7A 2IWRA 1ZD9A 4JBXA 4TZ0A 2AD5A 3ZGXA 3RRYA 3ZIAD 1OE0A 3CF2A 1G3UA 2Q3MA 4ZKDA 1E9DA 1II8B 2YWHA 4A15A 2JIZD 1I4TD 3U6BA 4FWTA 3DDCA 3LW7A 1M7GA 3P26A 4A0HA 2CJWA 4OK6A 2BKEA 1G9XA 3CF6R 1RKBA 1JXMA 2OXRA 4O3MA 1OFUX 2H18A 3NEYA 4PAMA 4HB0A 2QM7A 1Q1ZA 4M9QA 2JLYA 1RPZA 2FSFA 2XZOA 1TTTA 4F4CA 3ZQJA 1IXRC 4JL5A 2IUUA 5GADl 3FVQA 4MYTA 5FOXA 3IQWA 3WMFA 4LV6A 2ZS9A 3GCGA 5KU1A 5IK2A 5DI3B 4DCSA 3ASZA 5H68A 2FV8A 2IS1A 1G8YA 3RS3A 4ARZA 4PZLA 5IK2D 1D8TA 2IL1A 1KMQA 2B21A 1PVOA 3B13B 2OZEA 1E1RD 2WWFA 3ICQB 2J45A 2VHJA 5FH9A 1I2MA 5J4YA 3GLFA 1FP7A 2NO7A 4LHZA 4Q4AB 2BVNA 3AVPA 2N1BA 2GJKA 3VX3A 3BB1A 2FPMA 4MGIR 3SFZA 2W00A 5JLJA 1YZLA 2OLJA 4NCIA 4OI4A 1XTRA 2XTNA 5E7MA 2IYVA 3CZQA 3SU8A 2D7DA 3ADDA 3HR7A 3AF1A 3QVUA 2FFQA 4UXJA 5FR1A 2QSYA 4Q47A 5BQ5A 3T15A 3L8ZA 3TGPA 2BBTA 2A5GA 5CB8A 4D0GA 3HYTA 4M1WA 1IONA 3S1AB 1ZIOA 1C1YA 3UKDA 1Q0UA 2A7QA 2GEDA 2IEYA 4YDHB 2CHGA 3TH5A 4BEJA 3BRWD 2DYKA 2F3RA 1NBMD 3K0SA 1OHHD 2QPTA 3QNUA 3AVQA 4MYCA 2JLQA 3L8YA 1NG1A 3H84A 2GXUA 3N2IA 1RFLA 2J59A 4NP6A 3GLHA 4JMPA 2QQ0A 2K5UA 2ZEJA 3B9PA 1COWA 1A2BA 2DWOA 3OEEA 1JECA 5E7IA 3WNCA 3AVWA 2EVWX 3SYLA 4OBEA 1UEIA 4FD2A 5LD2B 2JGNA 1CJMA 1G7TA 1F2TA 3U3KA 1R8SA 4EPYA 3U4QA 1A2KC 2OBMA 2CL7X 4A6XA 3BJIC 4BLRA 4OQMA 1FX0A 2OO7A 2VP0A 2VHTA 1M8PA 5LBIA 3V00A 5BN3A 4D4MA 5F3WB 4HB3A 2IHBA 2IYYA 2ZRKA 4Q4JA 3PEUA 3WMEA 4C4PA 4KBGA 2QEQA 3GLIE 1Z08A 1Z6AA 4F4IA 3SNHA 2VPPA 4A4DA 1NSFA 2KI5A 5C4GB 2GEVA 4TL6A 1XXHE 3DOEA 2B92A 5B2ZA 3EPHA 1JR3D 3AP2A 1Z22A 2VHCA 2B7BA 1X1SA 3ICEA 1SHZA 3FB4A 2HJVA 2EFCB 2G88A 5FI0B 3OHMA 3WBKA 3CKLA 4G0NA 3T34A 3LO5A 2C03A 3GEIA 4WZBE 4QGHA 4JKYA 1E4YA 3EZFA 2KE5A 1ZU5A 3AF4A 2P6NA 4TQUS 5KTYA 1IN6A 2WWXA 4GOJA 1TQ2A 1P61B 3W3ZB 4ON9A 2ZUBA 4F7WA 1XEXA 1E99A 3E1SA 1CU1A 4EQ6B 1NRJB 4IW3B 2OUKA 4RFVA 3MUFA 3LXRA 1JJVA 2ZU6A 3KKNA 1VMAA 1WRBA 2ZSBA 4LYFA 4ZCMA 1E2EA 5JCPA 1T8TA 4ILEA 5DISB 2B6HA 1W0KD 3T35A 3L0OA 4BQSA 1ZW6A 3LXXA 1LTQA 1M7BA 4IVPA 1KO1A 3OESA 2IX3A 1XRJA 1Z63A 5GVSA 3TNFA 2E1RA 2W6JA 3CR7A 3DZ8A 4NMMA 3FHTA 3C4JA 4BFYA 1OIWA 1HV8A 1W4RA 2CLCX 2GCNA 2AKAB 4IFBA 1NN0A 1U98A 3W6NA 1KDTA 4MYHA 4D81A 2H17A 1AS2A 4DIDA 1LS6A 1Q20A 3K0FB 2CL0X 1TMKA 3WY9A 3JVUA 4PFSA 3CRW1 5FOTA 2XJ4A 2PX0A 3QIAA 4JBYA 4ZIRA 4MDEA 2AWNA 2ZJ2A 1E2IA 3LFUA 3TSZA 3W6OA 3QSYA 2ZI3A 2VP4A 3VKWA 3MD0A 4PAQA 3W34A 2ONJA 4L4UA 4PO8A 5KNCA 2ODWA 5FL7A 2MMCA 4GZLA 3IIKA 2XNDD 1ELOA 5FTNA 1P2SA 3CNOA 4KI0A 4FWIB 5FR2A 4C0JA 3C15C 5EQTA 1VG0B 5KHOC 2R2AA 3PV0A 2HYDA 2C95A 1BMFD 4IVRA 4NE2A 1T0JB 1Z83A 3BBPA 1CR0A 1AN0A 3GLGE 5FPYA 2EFHB 2P5TB 3D31A 4L8GA 4M1TA 3WYGA 4QRHA 2HYIC 2XAUA 4K81B 1EX6A 1LF5A 4C30A 3VFDA 4WAUA 3VHLB 4GMDA 4NYMQ 4BPBA 3A1UA 1X3SA 3PEYA 1Z0IA 3IKJA 4IDNA 3CBQA 4C0LA 1OSNA 5JS7A 4M4SA 5TVKA 2MSCB 3GEEA 1MH1A 5KSYA 1R5BA 4CT4B 1E9SA 2YOGA 2JEOA 3O47A 2RGBA 2WWWA 2ORWA 5B58C 5FUYA 3T1OA 1E0SA 5L3SB 1I4LD 3FHCB 2V7QD 2ZQ5A 4PHTA 3QPWA 3NIBA 1AM4D 3KZ1E 1SKQA 1G3QA 2BM1A 3FMOB 4FMDB 4MGZR 3CRVA 4LPSA 5SZHB 2JJ1D 1KZGB 2BOVA 4WOPA 4DDVA 1N6KA 4GT1A 2W58A 2GBLC 5C46F 3HJNA 5FI1B 3L2OB 1GAJA 4A9AA 1NF3A 2GKSA 3C5CA 4HAYA 4B2IA 1KK0A 2BMFA 4HAUA 3Q85A 3R7WA 4R2HA 4B35A 1G6OA 4CVNA 5G41A 4G5RA 3TQFA 4KU4A 2P6UA 2KWIA 3CB4A 1N6PA 3KX2A 3QVVA 4JL6A 1L2TA 5CB6A 2FF7A 2X19A 3FMFA 3GLHE 1BYUA 3R9XA 1PUIA 3TSWA 2FFHA 1KDRA 2W2TA 4RD4A 1DAFA 4URVR 4TYYA 1VG9B 2F1JA 3AKEA 3MGCA 5EP4A 1P2UA 1CEEA 3TMKA 4HAVA 2YOFA 2YC2C 1G8GA 3CRQA 1G7RA 5AJVB 2AHOA 4G5SA 1HA3A 4Q18A 3OFND 4GSYA 4PPQA 3AKYA 3IO3A 4LY6A 3SQWA 1M2OB 2FG5A 5CYPA 4MRSA 2W83A 4OL0A 1NLYA 2VP6A 2KJQA 4Q1CA 4K8OA 1E79D 2R6CA 4Q4HB 3IO5A 3UATA 1U9IA 1KOFA 4JSTA 4ESHA 2ANCA 2BJVA 4FCWA 1XJ0A 2EW1A 2NO9A 3ND9A 5LDDC 2RGCA 3K9GA 1OB5A 1KI3A 3OIVA 4PZYA 2V6IA 5F9HA 1CBUA 2EFGA 2EFEB 5JJIA 4FMDF 4NH0A 4A2PA 2ZTSA 621PA 2FWRA 1G4AE 3P1JA 5CIWA 3RRZA 3U7FB 4CEJB 4BASA 4G5QA 4JLBA 5AJXA 3KXIA 5DH9A 3QOFA 2QSZA 3HPQA 1IY2A 1E9EA 1VHTA 4KYUA 1TAGA 2IUSA 1G6HA 4A92A 2WIBA 4H1UA 2ZU0C 1TNDA 2J0UB 1VKJA 1XTIA 1QHYA 3BIFA 4M8NE 2AXPA 2GNOA 5A0FA 5A4JA 1QHHA 5B30A 2VEDA 5KDDA 4D0NA 4DEYA 4MYUA 2VIIA 1X8KA 2ZRLA 1KI1A 121PA 1FQKA 3NVAA 5DIFA 1XZQA 5C1BA 4BFTA 3DZDA 2BBSA 4JYBA 4TQAA 4HLUC 3X1YA 1CR2A 4RKFA 4TYNA 5DYGA 2ZROA 4DLXA 3U61B 2IW3A 2B8TA 2E87A 4W5JA 1E9BA 4DB2A 3LRPA 3DVLA 1HUQA 2GXQA 2QORA 3SE0A 5JBQA 1W5SA 5EE0A 2OILA 3H2YA 4TTPA 4B3CA 4UKDA 1KSJA 3GLHB 1IJEA 2ATXA 2VF7A 1DAEA 4F93B 4ZPXA 1B23P 1KO8A 1YE8A 3A8TA 2VTKA 4Q1FA 4IOMA 4B75A 1PLLA 4C0BA 1FUUA 1KNQA 4B3BA 4EJSC 2G0NA 4PHFA 1OIVA 2Q3FA 2JJ1A 2REXB 3C41J 3E70C 2PBRA 2ZAMA 3TBKA 1W36C 1GZSA 1PZNA 1Z0AA 1Z06A 2AR7A 1CTQA 1D9ZA 3ND8A 4KLZA 4LSGA 1QG2A 4QBGB 1T3LA 4Q21A 1HY3A 5CK4A 5D3MA 4D4KA 3TR0A 1XMIA 1G20E 1Z3IX 1W7AA 3PXGA 3NXSA 4UNSA 3ZZUA 3MFYA 3AV0B 2X2EA 5BWMA 3NWJA 1UKYA 3W90A 3SHWA 3TIFA 2QY9A 1AIPA 3EPKA 2XSZA 2ZRFA 4ZKEA 4DBLC 2Z4SA 2FN4A 2QL6A 4JJKA 2NGRA 2OFOA 3GLFB 5LPNA 1U0JA 1CKEA 1JPNA 1G1MA 2XNSA 4HLDA 4AIIA 2WWIA 4WBSA 4C0KA 2OBLA 3TQCA 4ABYA 4ASUD 1EK0A 4QKQA 2Z43A 1G3MA 1GFIA 5JS8A 5DI3A 3OFNA 3TK1A 1L7VC 2BC9A 2QQEA 3E2IA 1LF0A 4DLTA
chains in the Genus database with same CATH superfamily
4TVBA 2WI8A 3A6EA 4LF4B 4CIDA 2WAOA 3V3KA 1ZUD1 1U2SA 2Z0MA 5JROA 3MUEA 3L0SA 2IPOA 2JANA 3DLTA 3LLUA 4NH4A 1I4DD 1NXQA 5ESRA 5E3HA 4WJZA 4CDNA 4ENRA 2XWQA 5AKZA 4QM6A 1T1JA 1EB8A 3FCUB 5LA6A 1NVGA 3JZIA 3KFXA 2G71A 3ZH2A 1P2FA 4HX9A 4D8UA 4ZGBA 1P80A 1HQYE 4RKRA 5F1KA 2PKQP 3BX1A 1SKAA 2Y2UA 4J16C 5AM0A 2BR3A 3G2PA 2V5UA 3GWGA 2Y68A 4PG4A 2PL3A 3UJ6A 5DNUA 2WZBA 4RTJA 1NW4A 2PUWA 3RVOA 5G1OA 8AT1A 2ZUCA 1CDZA 3ORYA 1DX9A 2I67A 3GV0A 1P3JA 2A1TR 4G36A 4UJ5A 5FBZA 2ZULA 2OECA 2ZT7A 2XYGA 1SM4A 4RADA 2CGEA 3C3DA 2ZIGA 3WBJA 3RK4A 5CH8A 5KWEA 3B53X 3BCSA 4L07A 3ZOZA 5EIHA 2M6LA 2YZ2A 3NYQA 1I14A 4OCZA 5CM2Z 3WL6A 3NBZC 2VJMA 3C6QA 1W0KA 4Y1GA 2X5JO 2YWJA 1U5BA 4FR0A 2X1LA 4KB5A 1HE1C 5LZ5A 1ZL2A 1WSAA 5BQFA 1U02A 2R1VB 3W3AH 3AWDA 2FW8A 1DFHA 3MCUA 5AUPB 5IHXA 1IM8A 1VRWA 4NPHA 5KPDA 1J06A 2DU8A 1L3IA 1U2GA 2I2DA 1F14A 4Q1VA 1SC3A 1YQEA 1EJ6A 3B5JA 4YCSA 4F84A 4MK4A 3VXKA 5HJ5A 2AL7A 3VNAA 5ILOA 1QPZA 1K0UA 1X7XA 5M5BA 4V0MA 5LP1A 5K2OA 4BGIA 5DCUA 2VDQB 3PHIA 5CVTA 2HMYB 3G2NA 4O59O 3F4KA 4NFHA 4V0ME 3CFYA 4EVIA 4DV2B 4JASB 4BNUA 2PDAA 4A5SA 1PEKE 1D8AA 1STOA 5ADVA 1UDWA 2NZYA 1Y3AA 2WFLB 8GPBA 1RBYA 3PJGA 3KKEA 4IOJA 1KKUA 3DVAB 3RUAA 4D3YA 4KQJA 5I8PA 1BMTA 3OJXA 1JEEA 1RRGA 2CDAA 1GVNB 3WLSA 4YAIA 2OCKA 1E2HA 1NPDA 4GM4A 1WNTA 3V2GA 3H13A 2C54A 4R6WA 3UENA 3USZA 4B33A 2TYSB 3HCEA 1P0MA 1XWFA 3FBGA 2RIPA 4NK4A 3N0RA 5JWRA 4JI7B 4MAMA 2Z8XA 4J8PA 4X1IB 4JLJA 1ZP6A 4EVQA 4P82A 1BWRA 3T95A 4BBPA 4QJ3A 3BF7A 3ORQA 1NL3A 3W3AA 1N6OA 2EFYA 4YXFA 1QKKA 5KOHB 3ITKA 4MW2A 5CDTA 4TLCA 5FOWA 1RC0A 5AW0A 5LB2A 3ZWOA 2MDTA 1KBOA 1JVBA 2MYTA 2VXCA 4TKUB 4A5OA 4E5KA 2V45A 4EYSA 3ANSA 3M9XA 3O73A 2VKTA 2ANBA 3WLIA 2QN8A 4H3HB 4INJA 1H4VB 2CJPA 1C0EA 1B15A 2QNRA 3C24A 3KYDA 4IIEA 3O8CA 4HZIA 4EIWA 1CC1S 5BSRA 4X00A 4W5TA 3U40A 2DXIA 1H0HA 3UWKA 5C3MA 2I34A 1I51A 3BD6A 1QGOA 4BO4A 4YXWD 4RULA 1G17A 2GYYA 2WM2A 1UF9A 3B20A 4MA5A 1R12A 3BL5A 4AJJA 1OX4B 3A4TA 3LHSA 4UM9B 1AS0A 2A9KA 3HWSA 3LQQA 2ISQA 2OFWA 2OV1A 3UWOA 5ADUS 1XC7A 2AYYA 4MKRA 4XUEA 2FOXA 1CCWA 4BO0A 2Y1FA 2XGJA 4K9DA 4Q4DA 1PKXA 4J3FA 5G2OA 4LJ6A 4TSFA 1SA0B 1IC6A 1UC4B 2CXTA 3GJ7A 3H2IA 3I34X 4DPMA 1PD0A 4TVKA 2EP7A 3PE3A 3U81A 1ZEMA 2FPPA 2WIJA 1YBMA 5HR5A 4XKJA 3RC8A 5SZIA 1QQ5A 1E3QA 1NVVQ 4UNIA 4Y9UA 4KJXA 1DNPA 3P9YA 2EJUA 2V7VA 3PA8A 1N7HA 2Q4EA 3P71T 5L4SA 1NRIA 4MRVA 4P3NA 3D8BA 4DLYA 3RC9A 2NYUA 2ACKA 3O84A 4F2HA 2AN9A 4NXNB 3G7SA 2PL1A 4LKOA 5HPYB 1NQOA 1COWD 3AQIA 4MHSA 4POOA 1OX5A 3W1WA 4OB7A 5AVRA 4NCKA 4D9IA 2RDMA 4YUXA 3LTNC 1RZRD 2CEAA 4DDUA 4OBWA 4PTLA 4Z8YA 5CHEA 3GFRA 3LLSA 5TQJA 3CW2A 2QAGA 4OUKX 4KXMA 3RVBA 2PA3A 3FUVA 1M8JA 3OFKA 2J6IA 1G59A 2YN0A 1IZZA 4NEQA 1WB5A 1QDEA 3V1TC 4AJ2A 2ADMA 4FFOA 1BHSA 3JAKA 2WILA 3S44A 2XADA 1TF2A 1RVV1 3V2IA 2C5HA 3ZCQA 4YC7A 4DXAA 5G0VA 4XRGA 4UJ3A 5HQTA 2G77B 1K5DA 4KO4S 3ANYB 1EFRD 5FORA 2ZIWB 2QDKA 4KLCA 4ND8A 3V4LA 3ZIUA 5K7SA 2I78A 2QW1A 4RTSA 1M34B 4EHLA 4C5CA 1QCYA 2CL5A 3QX8A 4PSUA 1E0KA 1NQWA 1UKBA 2F1HA 3GCXA 3WO1A 4CIAA 3P4XA 3WGHA 2ZJ7A 5BV1A 1Q7TA 2WD8A 4F0JA 5I7SA 5B64A 1U6IA 4IX1A 3OWXA 4YRBA 1OH7A 3AB7A 1RYEA 2IY8A 4WX2B 3H05A 4IRMA 1O0CA 1FSSA 1M2OA 3OOJA 1U7DA 3QITA 1D6JA 3SLGA 1QKJA 1W5BA 1H6CA 5AOBA 3JV7A 3WIUA 3D6VA 4DC0A 3G6KA 4C7OA 1Y3IA 1CUDA 3SSAA 2OWEA 2QR3A 3C3PA 4XOUA 4P4LA 3P0RA 3AUYA 1N32B 5COBA 1VIMA 5AM4A 2V4UA 1YMVA 4CQMD 2CEKA 2YASA 1J21A 4OXYA 4MKHA 1NC3A 3RLFA 3VUEA 5FBRB 1FFGA 1MBZA 4HMPA 2VH5R 1KAQA 2Q2QA 1BQEA 2BBWA 5HEKA 3VOBA 4OJYA 3WGQA 1ZOSA 3HB9A 4EK9A 1DLIA 4MRNA 3BH0A 4TKVA 1Z4PX 2C4MA 4ZDJA 1LJLA 4N8DA 2ZJ4A 3WLRA 1TYCA 1NGSA 4OMDA 3O3MB 3HEAA 5EIFA 1GL9B 1NUPA 2BI8A 4C0QC 1JALA 2O8NA 4KACA 4KE6A 3SN6A 3K2EA 1FC0A 1U0EA 1WZEA 2NZWA 3FCXA 3N58A 4KWEA 2QZJA 4XI9A 4B6FA 2F9LA 1SXJE 4BJ5A 5KOYA 1LPNA 3AX6A 5AICA 1OAKA 2YWRA 3IUMA 2YMMA 2QTLA 4DRXB 4Z4EA 2J4CA 1FMLA 2YY7A 4P4TA 4DV7B 1KDOA 3WNBA 5AH0A 3FRHA 2PUHA 3K9QO 2RHTA 4CNBA 2NSYA 2VBGA 5DOVA 1CF9A 1YJ5A 1POWA 3QZUA 1Q7EA 1E4OA 4URUR 1WXHA 3ZHOA 3JS5A 1WO8A 5IKPA 3VR5D 3A6GA 4RHCA 2FFBA 2HEIA 3D3EA 3WK7A 4IFIA 1A8QA 3ROXA 3NDPA 4RY9A 3WKDA 1U0NA 5A4DA 2AOTB 2ODAA 3Q9UA 4O4HF 3UXYA 2V6JA 3K96A 1M1YB 1ZIXA 2HMUA 3QJ5A 3R5FA 5DX0A 3ROFA 1WCYA 4WEQA 2X2FA 4BN0A 5CURA 1A7JA 1OAOA 1UWLA 4RWEA 1PEAA 4BAGA 1GFZA 1ZOIA 5JAOA 2JLXA 1X42A 1TCAA 3B1YA 3DT6A 4KV7A 1U63A 1GTSA 1Y3FE 1QUFA 2WHXA 3G9QA 3RUCA 5JCOC 3RC7A 4CKZA 3THXA 3EQ7A 2KW5A 3B1ZA 3EFHA 2HRDA 4FE3A 4GFDA 2JZNA 4ZCLA 4RDXA 5EJ4A 3AHEA 4K6CA 2O2CA 4JP1A 1VJTA 2I2BA 2P62A 4PE5B 3NTXA 3ZQKA 1U11A 2AOUA 4XAQA 5M7EA 4F12A 2XY4A 1XQXA 3EZ7A 4KR9A 3IS3A 4KQFA 5FRDA 5JI2E 4UEWA 4RTKA 1Y7HA 3P27A 2DPXA 2ZSFA 1G55A 2IDZA 1D2HA 2SKEA 3FM9A 3NAZA 3OJ0A 3UWPA 7GPBA 2OD2A 2HOQA 1F2TB 2PGJA 5KC9A 3ZVNA 1LW6E 1Q3KA 1B74A 1XNHA 2UVDA 3J7TA 4ALKA 4CL2A 1IWPB 3X2FA 4W1QA 2QAGC 2XITA 3GLGB 1HE4A 1XQ1A 1OGYA 3ZNNA 4KR2A 4UU0A 4OM7A 1O94A 3LX8A 4OFBA 4BQIA 1PEYA 1HTTA 1XZEA 4IGEA 3N0VA 3AO0B 1WSDA 4LRQA 4TT8A 1WXIA 2BE7A 4ERNA 1BKYA 1S02A 4XGKA 3LDGA 2O0KA 2BHRA 2O2SA 2HA3A 2H0QA 2V5AA 4UQPA 1PBNA 1CUEA 5IUKC 2PANA 1WXDA 2HCRA 1Z6YA 3VR2D 2WU1A 3WX0A 3CUVA 2JVKA 4QG3A 4LRWA 2D1FA 2J3JA 1A4IA 2VKQA 5JS2A 3HZZA 4XWKA 4YBRA 2ERXA 5DXFA 1XJWA 1XZAA 2C5SA 2P9HA 3WG9A 2GTPA 4MI1A 3SQXA 4GP7A 4L8FA 4RXTA 5DF1A 2IYSA 3BM5A 1P1HA 2XUIA 4IG4A 4LZOA 3R5SA 2FB9A 4QICA 1XD2B 1GPKA 3KFLA 5F7XA 3SICE 2C7VA 4EVSA 1PFKA 3HMKA 3FGNA 3P9ZA 2G09A 2AFHB 5K8LA 1EWQA 4ACBA 1UXJA 1XX6A 1IG0A 2QTVB 3IOEA 4C0WA 1Z7EA 3HP1A 3EQ6A 2G1UA 2V3VA 3I4LA 5JT1A 4F5EA 3I5XA 3QBJA 1WZCA 2O1XA 4WASA 2C77A 3PJDA 5J40A 3G5MA 5HHTA 5K20A 2HJ9A 1USWA 2GFQA 2QBYB 3AY3A 3EA5A 1ZD8A 1RACA 2JDID 4JYZA 1CLEA 2DPMA 4M9XA 4YMVA 4FXPA 1E6CA 1S7GA 2REOA 3F5FA 1VL8A 5PNTA 2OGWA 1NA5A 4XB1A 3NHAA 2NZJA 2WPDA 5FOVA 4ZEMA 4I1PA 2CJFA 5CFLA 2BTQB 2FRDA 2NU9A 3LNTA 2IKSA 1AO0A 5GP1A 3RHFA 3AVXA 3AJDA 3WIOA 1Q0RA 1JKJA 3HDQA 3CISA 4C5AA 5FAXA 2DFPA 3HNPA 3ZQUA 2NVUB 1PS0A 3UB3A 2NUPA 5F35A 3UG7A 3FSEA 1EXMA 4O4JA 2BBOA 2Z8ZA 2QTCA 3G79A 2GAAA 4BQOA 1B16A 3KKKA 3HJHA 1G5PA 1UBKS 3A9VA 4IIYA 5KIAA 1CDOA 4M89A 4RHEA 3MJEA 3DDHA 3WJ2A 5BN4A 1A9OA 3ECAA 1RXIA 1BXGB 3NHPA 3O4FA 3H97A 4GR5A 3VA7A 1QYRA 1ZN2A 1ZMBA 3ZE8A 5KSPA 4BLOA 1GAWA 3RFVA 2CF5A 3OTWA 3O9MA 2JLAA 4IDGA 1IBLB 2XYVA 2ZR0A 3AJ9A 3JZDA 4II7A 4YRCA 2AR0A 2XDAA 4DMUB 4FMPA 4L5CA 4OHRA 3TG2A 4E5NA 1EFPA 2RB4A 4LY0A 4YAWA 3W8EA 3BMNB 4QGAA 4ARBA 4FCVA 1MV8A 4R0VA 2BYTA 3R7AA 3S7ZA 2IXFA 2AOWA 5HIKA 5JVDB 3WL7A 5IDXA 2HCTA 1PJRA 1A8UA 2R6JA 4G25A 2B5WA 3UAXA 3GRAA 5HCNA 2O8DB 4AJEA 4JC8A 1T3HA 5BV0A 2QJWA 3DWIA 1JX6A 3CH5A 4MKXA 4RJ2A 4XWAA 4Y0AA 2M98A 2X1HA 1XAJA 4FI3C 5DEIA 4MRMB 5JZVA 4DR3B 3PPXA 3Q3IA 3HEMA 3PUHA 2ZPTX 1YQDA 2ZR7A 3H11B 2GBGA 4JXXA 2PSJA 1PJ3A 4R5MA 1VJ0A 2JJQA 3EBPA 5TMBA 3DFUA 1RM3A 4N9QA 2ENUA 4P53A 1QK3A 1JSLA 1MU0A 3O2QB 3C8ZA 4RDIA 4RCYA 3WGJA 3ONNA 1EG2A 5BMVB 2IBTA 4OH7A 3F8TA 2A94A 5T3UA 1CD5A 4RIHA 1LI4A 4WTOA 3ZWWA 4KPFC 2XYHA 4Y6PA 6PFKA 3R3ZA 2WTXA 1YTUA 4NE9A 1C9KA 2GX6A 2WIKA 1P75A 4YMIA 2PQMA 4X97A 4TS9A 1VE6A 4K6FA 4BRSA 1R18A 4TMZA 3QP9A 1F6WA 4JR2A 5A9TA 3H87A 5SY4A 1ES9A 3HDTA 4IHJB 1E2JA 4M0KA 1MAWA 4AXXA 1XN1A 4CCWA 5FA8A 1QH0A 2ATIA 1VLJA 3EC1A 4LX0A 1YS6A 4MWDA 2QX6A 4YPFA 2ZRCA 4DSZA 3GZNB 4MW0A 3V8BA 3TYXA 3HNRA 3TJMA 2P1RA 1GPLA 3AONB 4JGBA 4LMAA 1Z5GA 3UAGA 4E7PA 3QKTA 2XNKA 1NUQA 3C3BA 3FTEA 1ODJA 2PD4A 5DYYA 1P7WA 1FFXA 4XIFA 4DEXA 4X1IA 4KJZA 1BVUA 5IKMA 4P6VF 2VWQA 3JQ9C 5AK0A 2JLWA 1D5CA 1GGJA 1Z16A 2HH9A 1QYIA 2WKQA 4DT1A 1HRKA 1TECE 2CKMA 1F1JA 4G5HA 4BIMA 1QU3A 3AY6A 4HNAB 1L1EA 5GJBA 3V4VB 1A98A 1YOVA 3JTMA 2IP4A 4D6YA 5MFZA 2B8WA 2NV0A 1XZIA 3AKCA 2QAGB 3KOWA 2IWHA 2H5JA 2PD6A 2P9JA 1LI5A 2GO1A 2H5EA 3H04A 1DJPA 1GZ3A 2ZI6A 3RVRA 5HIAA 1NSTA 2WAYA 3KXLA 4KQIA 3JYLA 3GUVA 5HZGA 3H5AA 4YJGA 3SSOA 2IEBA 3AB3A 1XVUA 4X6YA 1L1QA 4JJ7A 3LSYA 1LD3A 1ZIYA 1XWWA 2XX3A 4G4SP 3RUPA 3RVDA 1RHMA 4GKAA 5SY9A 1T9DA 4BOYA 5AKKA 3R3SA 1AGPA 2FOIA 2J6HA 3CE9A 1I2BA 3EPJA 4TYWA 3T1QA 1Y6RA 3FZQA 3IPLA 1WMAA 4P7KA 3S8MA 3LKZA 3E9QA 3B8HA 4WCFA 3RDPA 4DIUA 3TGLA 4F45A 2VYVD 2C7BA 3BH6A 3WHLA 3HJAA 4ZI5A 2FFRA 4EVRA 2F3TA 3OQBA 1YZVA 3HA2A 4KL8S 4X95A 5JJ5A 4LX8A 2GK6A 1XZLA 2GR9A 1FFHA 2A5DA 4DYVA 2R6AA 3IT3A 4Q1EA 4BX3A 1Q2UA 2QM8A 3OEED 3KBOA 4H7DA 1SA0A 1RPAA 3NHJA 4LE1A 4OJTA 4Q9DA 2P2ZA 4KTTE 4NFLA 2CLKB 2F48A 4K6OA 4PWYA 5HUJA 5LP6A 2ROQA 4TX1A 3LT4A 1INLA 3UT6A 1VKZA 3BB3A 3WMGA 3ANTA 2FF5A 1CW2B 2B25A 4Y6SA 1WCXA 3IUYA 4F3KA 4Z7QB 2WIFA 4RPKA 2ZTHA 3PRYA 2WUFA 3R3WA 4CTJA 3INRA 3LUPA 5EWLB 1QK4A 2Z30A 1XXHB 2E49A 2SKCA 3DG9A 3L7OA 3R0VA 5ECGC 4Q00A 3S2UA 3KHUA 1PKEA 4OVKA 2HSDA 4DB4A 4DR1B 5U9CA 1OH6A 3CPHA 3EIHA 1FFEA 4XUDA 2XUQA 1IEVA 1Y63A 1M2VB 1VG8A 1UBMS 1G41A 1ZC3A 2PMWB 4CLOB 2IVZA 1K7CA 4L95C 4UHDA 5BV7A 3EQ9A 1AKNA 1RQ7A 2A86A 4V0RA 5IEBA 5CEJA 3GEMA 4CHTA 2IYTA 3GJ6A 5IT0A 4EFMA 5LYJA 1AMNA 4PYRA 3COJA 3ZU4A 2X41A 3Q10A 4FT2A 4MVCA 4A91A 4RS4A 1A9RA 4JP5A 3AR9A 2ILVA 3MRSA 1MENA 4PCVA 1SN7A 1DQZA 4U0JA 4OOFA 3RT1A 4LQLA 1KPIA 3WA7A 4YAKA 2HMAA 2CKDA 3NI2A 4RETA 1GN8A 2QZPA 4XVQA 5BVGA 2JLZA 1WHSB 2OZPA 1K92A 5FLXA 1GHTA 1KYWA 4YQFA 5ALUA 4RD0A 2H1IA 3PLNA 3RT7A 3FFAA 3TB4A 3WXMA 4BECA 2QN3A 4DPKA 1E9VA 1L5GB 2BGMA 4JC0A 4WPGA 1VRCA 3JQ7B 2C20A 3ZTTA 3IR6A 3VDMA 1CQIB 1SUFA 4TS3A 1IPFA 2FMIA 4J0FA 5IULC 3G88A 4NBLA 2C2HA 3AHGA 1KZ4A 4DOMA 3WV4A 1AZTA 2JNWA 1SRRA 2J9ZB 2PPLA 1VL0A 2D13A 4W7SA 4BJ3A 2QQ5A 3B12A 3NPMA 4GM0A 1X7XB 2D0PB 4B2YA 1UEJA 1PS9A 3QF7A 4R1LA 3RQSA 2P75A 5I8ZA 1WZ2A 3GRKA 3ZDDA 4MR8B 1X80A 2HQBA 1ZD2P 4DVGA 3ENKA 2XNDA 4CV1A 3MRVA 5DP2A 1H2FA 1E4VA 4JUFA 3O4RA 3UUEA 4XVRA 5ELXA 3VU8A 3FGZA 4F6CA 1K2WA 2HA4A 1MT0A 4I55F 3HFJA 3NIFB 2HREA 3FLEA 3B6EA 3HBLA 3TGWA 1M6NA 3RBXA 2D8AA 3LW8A 4PGGA 4TZ6A 4GMHA 3T7AA 4Q19A 1QHSA 1E4EA 3TAUA 1TGYA 1TTQB 1UPTA 2B35A 2IHYA 3F4LA 2CV0A 3B5EA 2A7XA 3NRCA 4A36A 5CNMA 1JQLB 1HE5A 1Z25A 2R8ZA 3R6LA 4O29A 3BXZA 2VK8A 3DCJA 2FQWA 3PQCA 2NTJA 2C3UA 3PFGA 3QJGA 4P93A 4QWMA 4QT4A 3GLGA 1DIOB 1S4QA 1WDKA 3I04M 3TN7A 2JHPA 2ZRAA 4DIBA 5EEGA 2MR5A 4GXQA 4ND5A 3ZDEA 1X8LA 4YMUA 2BGUA 1P0PA 4JVMA 4BMPB 4RH3A 3K70D 5TDHA 3RS4A 4OKSA 3W5VA 5IZCC 3HGQA 2NXEA 2B69A 1MEJA 2YMQA 5AI8A 2C59A 4DA4A 4KQKA 3UPTA 2J08A 5KBYA 2RGEA 3ZDFA 5LYJF 3CRZA 5KYYB 4JLUA 3IP5A 3O3NB 2PJRA 2JJ8A 2YYZA 3B36A 4EB6B 3RV4A 3IDQA 3ZLTA 1GZ6A 3IOCA 3OKFA 4X62B 4KP7A 5DPMA 2Q46A 3NJRA 2BRUA 1C4KA 3GYBA 2BM9A 3QQ5A 5D5HA 1WMBA 2DR0A 3D4OA 3HWWA 3PNVA 4MV3A 3SC4A 2VUHB 4RXMA 5EESA 5CB4B 2VK2A 1YR3A 4UOZA 5FPKA 1U2ZA 2C8KA 2D5CA 3Q88A 5KNLA 2P6RA 2Q4TA 2YJNA 3TNLA 1I3CA 4KIUA 1RAGA 4GX0A 3ESYA 4JKIA 1QNLA 2X8LA 4WERA 3RVMA 2AOTA 3FZEA 5CW2A 1EXVA 1FOEB 2B7CA 5JSFA 4H16A 2DAPA 4LJKA 3RYCB 3BIJA 3REOA 1RYHA 1WHTB 3CF0A 4HB4A 2AMFA 2BHSA 2O7VA 5CIQA 5JSKA 3SC2B 3VOTA 5LKAA 4JLAA 5F23A 1NUSA 1POXA 3CONA 3X43A 4AROA 1P44A 4YVFA 1FYXA 1HO3A 2I76A 4IDBA 4AMGA 4WKOA 1RAEA 1QX3A 1FP4B 1PFUA 3G5LA 3EEFA 1Z33A 2FU5C 1NDHA 5FBVB 3SE7A 2YJTD 4XIGS 3VQTA 3V1KA 4XCVA 4EL5A 2QW0X 2B2XA 3I32A 3NVDA 5E1DA 5IN5A 1C7ZA 2Z56A 3HRHA 1H2XA 3AMVA 3IKMB 2R6DA 4Q4HA 3MVEA 5EMJA 4PZZA 2VTBA 3A2NA 2W48A 3L8MA 2VP3A 2YRWA 1MG5A 2E55A 2JD2A 2UUPA 1W0JA 4I9FA 5IW8A 1ZMOA 2QY6A 3EEIA 3PTLA 1JEQB 3LXUX 3OP1A 2G67A 4AO6A 5KNDH 2ZYWX 2UZ4A 2PUJA 3VKHA 1BMDA 4R98A 3N2ZB 1SIWA 1CJBA 2Z09A 3N86A 3ZE6A 3JALB 1SB9A 4ILKA 1C4XA 2C7PA 4L85A 3S55A 5KYXA 4EKNB 5L8VA 2IUFA 3QPDA 1ECJA 2EJVA 3CPEA 2JHAA 2YWFA 1QG0A 3D9QX 4AKHA 4NOMA 1YFZA 3MBOA 2ZCJA 2A9PA 2FA9A 4P58A 5KINB 1VG1A 2OHFA 2NP7A 3JVVA 1KS2A 5JH7A 5DI9A 3ND5A 5I9TA 2JF0A 5IT4A 1FK8A 7ABPA 2I33A 2HRZA 2NUAA 3T3NA 3OEHA 5EERA 3VDXA 3BE6A 2II6A 2QLMA 2ESRA 3HKCB 2NLOA 2JB9A 4F1WA 2X1MA 4EG3A 5I5EA 4EKEA 4E1BA 3CWCA 1WDWB 5BOVA 2PZLA 3OQIB 4ZQBA 3KT0A 1WCWA 1EGHA 2X58A 1V5WA 2FSIA 1MUUA 2QX9A 2YOHA 4TPKA 4WUVA 5E7QA 1LJ8A 4PQYA 5IAAA 3T5AA 2B7LA 2W6IA 2D8MA 4E70A 4FW8A 1A4RA 1OXUA 3DFFA 5JUWA 1QZUA 4I8IA 5DX8A 3LIPA 1MTOA 2A92A 4N40A 2PH3A 1JMKC 1ZSNA 4E21A 4R68A 5TF4A 4EG1A 1TQ4A 2JD1A 3OD1A 3RF7A 4HI0E 3FOFC 4XIYA 1T5HX 3PYMA 3RS8A 3DAPA 3PHCA 4GZMA 5CDFE 3EVAA 3UEOA 4FN5A 1UC9A 3SX2A 2WA2A 3M4ZA 1P5RA 2I6FA 1T8WA 2X8AA 5KOJA 1GFSA 1PN3A 2VRWA 1CQXA 1DX4A 1FUIA 3OAAA 4K86A 3WGTA 2NU8B 2RHCA 1YB6A 3HO6A 3QEKA 3ZTYA 3EDRA 3BTVA 4X1YA 4B3IA 4H1WA 2BR5A 4OP3A 4UQLA 2BFPA 1W35A 4OD0A 5B3JA 1P1JA 2IFTA 4CU5A 3U80A 1UPBA 3K4QA 1XK7A 3OJEA 3E48A 5GJVC 1EXDA 1ACMA 4ZYWA 3AOEC 1ZCJA 5E6SA 1ISGA 2EBHX 2UUOA 3JYNA 3IODA 4ISCA 5EIWA 3OJFA 4A6DA 3NW9A 2JZCA 1S8AA 3WQSB 3SXUB 4YAEA 5LOVA 2ZAOA 1TVMA 1FFYA 4G84A 1R8QA 3PEFA 3UAZA 1KZ9A 1Y5RA 5AMXA 3F5SA 4EHDA 3AJEA 3BJRA 4LYYA 2YVLA 5CA1A 2Q4OA 1RBZA 2FMUA 1MB0A 5LQJA 3O8OA 2BI7A 3IVXA 4QLOA 3ZXXA 2CMKA 4J2OA 4N39A 3U1VA 5KCMA 3Q6MA 4K0KB 3UT5B 1QMPA 3KCQA 2J33A 3H7IA 4F7DA 3WV5A 4NS1A 4C0AC 3TLXA 1E5TA 4BB0A 1IULA 4BEWA 3F7TA 4KAAA 2DECA 4TT3D 5BP7A 5CX1B 1JEYA 2DY1A 3PYXA 4RYDA 1O6ZA 4U2GA 3A4IA 3HC7A 4FDVA 4RVFA 5HDQA 2OOKA 5KWVA 3OOWA 2XMGA 1Q0ZA 1VGVA 1C8VB 3JAMA 3O8OB 3OPNA 4EATA 1DXYA 2X7HA 4RMIA 2ZB4A 2VN8A 1SK8A 4TVSA 2VQ6A 2IRWA 3QLJA 2JC3A 5KDLA 1A9XA 3NZEA 3PQFA 1TTTA 3JQ6A 2VUUA 1K27A 4IXDA 4KODA 2OC9A 1V2GA 5AHWA 3S70A 3V7FA 3A1WA 1R0XA 1HMYA 2JIMA 5BSTA 1BQ4A 1K6MA 3PXBA 3VO8A 4CCSA 1KNXA 5A71A 4U3JB 1E6LA 1GWNA 4X61A 4H6XA 3Q8LA 1L5QA 4NG5A 3M5WA 5ITWA 4RA9A 3CCFA 1FP4A 3N0WA 3TW8A 4BLPA 1OMOA 4BMOB 5ISMA 2HHHB 2GVNA 2JIPA 3WNZA 1A1VA 3DAGA 1P2DA 1SKYE 1UJNA 4OO3A 4OX9B 2FPGB 1HT1E 1NTRA 4Y9TA 3PPIA 3HCFA 3E03A 3OBIA 2JFVA 1BMQA 2FEKA 4LNHA 4B87A 4D26A 5FA6A 2XCLA 1IBRA 3VMMA 4G23A 3F47A 1DCTA 1KFKB 3L7LA 4HPXB 4QD3A 4LF6B 4XH9B 2RJOA 3IXLA 4P31A 4Y9SA 3WHIA 3AESA 2CYAA 3WLAA 1XR3A 1XTJA 4HQ6A 2ES4A 3LLVA 3ZDQA 3E3LA 1OWPA 2P2DA 4JJ6A 1P0IA 4MWEA 5K09A 1U8ZA 3FTPA 2BCGY 3H1FA 2VXOA 3RCBA 5JSZB 4C2UA 1VBMA 4NU8X 1UP4A 3OIDA 1NG9A 1U1EA 4MRPA 4RSGA 3A06A 5REQA 1HL3A 3G23A 3FCEA 1UOOA 4F5WA 1JVNA 5I01A 2OD7A 2BGJA 2JAHA 3MBKA 3RIMA 1HLPA 2XTZA 1IOZA 2BFEA 3A04A 3KB2A 5ERXA 4C6HA 3ZOKA 3BTOA 5BN5A 2IEGA 2X22A 3LNCA 5DULA 4INOA 1GG2A 1VA4A 3PP8A 3DGFC 5IJAA 3TCNA 4UZEA 1XQVA 5E6RA 2F00A 3EF0A 4OQQA 4QSMA 3U4IA 5IM4F 3DQQA 5EJFA 1IDOA 1UKEA 2QE6A 3VR1A 3GQBB 1L4MA 1MQAA 4UMFA 3UWMA 3AP1A 3NHSA 4ZVOA 5AT1A 5TEVA 1BCSB 3LQRA 2Y0EA 3WGIA 3I42A 3W6PA 3A2KA 1ONSA 4M55A 1PV2A 3RFUA 3SHQA 2P3OA 5EG5A 1RHRA 1EX9A 2WSBA 4GAEA 5DNYB 4WFIA 3R4VA 5CG1A 3CF4G 1E4EB 4M9UA 1FRFS 1DTSA 3CUKA 2Q1UA 5CCBA 3FUXA 3CZMA 5BWOA 3UJNA 2HLDA 4RKEA 2HW8A 1YFKA 3RBVA 4B3HA 3LUBA 4PU0A 4S35A 5CLQA 1GRVA 5EIXA 2OVBA 1N0WA 5IXYA 4HWRA 2ZSAA 3GLRA 1H2WA 3GD5A 3K9HA 3PEVA 3EDQA 3FWPA 3ZY2A 1NI4A 5JHGB 3FE2A 1OQAA 2JGFA 5AJUA 3GY0A 2IH2A 1BVHA 1JH8A 3CCCA 1KGDA 1PUJA 2RGXA 1QANA 2AE1A 2WSMA 3P2YA 3QPAA 4D9NA 1AXEA 5AUNB 4ZU3A 5E7JA 1G0NA 4EBFA 5AIBA 3PR1A 5DKFA 2C2YA 1JAIA 2VR1A 4LXUA 4EQ6A 1QHXA 3DNPA 5JBNA 3JVIA 4QX6A 5BQ3A 1TZ2A 4IUYA 5AHXA 2AG6A 3GAFA 1IYZA 2BGRA 5C1PA 1TM7E 4RW0A 1AG9A 4RVHA 4KNVA 1DSSG 3OZWA 1L7QA 4D9JA 2X5OA 2VQSA 3ABIA 3HR8A 1NXOA 3PQ3A 4X8HA 1KY4A 3GCDA 4NVRA 3BMOA 3AL2A 2VT7A 1MAHA 1KY2A 4XIIA 4E32A 1JIVA 1E8MA 1G2OA 2I22A 5I5GA 3ZW7A 2XKKA 1TM5E 4X6LA 3EWIA 1GTVA 3O38A 1ESNA 4XQGA 2FDRA 4FONA 3WRXC 1JG3A 1NN5A 4M6WB 3KQQA 5CR9A 2HR1A 1GZHB 2KSQA 1Z5OA 3D7KA 2I4LA 1ZVMA 1ZUWA 1ZAKA 1IB6A 4DCUA 2JEZA 2G1KA 1BKSB 3CIOA 4RTMA 4O1IA 4RXUA 2JFNA 2XDWA 3HKBB 2UXDB 3ROTA 1Y8QA 1FUKA 2EU8A 3MLAA 3ZK8A 1WABA 5F4BA 1O89A 4CMGA 2B8NA 3RUHA 2RONA 8ATCA 2C57A 4V03A 1ZM9A 2E89A 3INNA 4DJEC 2E2WA 4UM7A 1U5BB 3HJUA 2XUKA 3LHIA 2PT7A 2WM9B 3RSSA 4NNPA 3NAMA 2PUEA 4L08A 3A31A 3T9CA 2GF9A 4EUSA 3M70A 1ZIPA 3EVDA 4B9EA 1KZ1A 4FMCF 1O97C 2C88A 1QO9A 2C0PA 3KM0A 5IVHA 2PBLA 4JIMA 3PFHA 3HVJA 4XR9A 1ZMTA 1UDXA 3QWAA 1FLAA 2B2CA 2R4UA 2YIVX 3EHDA 3TI7A 4TXNA 3P7MA 5BYKA 1BSVA 1RRCA 2CVQA 4HZUA 3LGXA 1YACA 2ZETA 2WF6A 4PC6A 2Q5QA 1BCSA 5DHUA 4AJHA 5I9LA 1O8CA 4ZVVA 2JLUA 1VCMA 3MAAC 3OZRA 3VO9A 2G9QA 4JI2B 4UNNA 5CX4A 1AKWA 3FYHA 4I1SA 3UCXA 1C7IA 1PQYA 2Q45A 1BVYF 1DU4A 2RIRA 1N92A 2G7MC 2ECKA 3KPUA 2JJMA 1QDUA 2WIGA 1JA1A 3M0EA 1SWVA 2R11A 2ZRQA 3DXYA 3W4JA 7MDHA 1GTMA 1P1BA 1VMIA 2E37A 3WRYA 3A27A 4OREX 4FGUA 1GG9A 1YJCA 1K6IA 2JARA 4JLOA 5HILA 3V4OA 2REQB 4EF5A 1T4CB 1A50B 3FAZA 5FO0A 1E3SA 1QIIA 2VL7A 5REQB 4ZEWA 5JSYA 4IIHA 2BJWA 2GQ0A 1DP4A 2BONA 2QRLA 3VZRA 4DJTA 3ZEIA 2OFFA 4D7AA 2YIMA 3EGDA 3H1TA 2GZ1A 3JQQA 4X64B 5IARA 3LHDA 3I23A 4MJLA 2J0EA 4TV9A 5I7AA 3WLJA 5KCZA 1CF4A 4PYJA 4F06A 1LVUA 1IOLA 5CA0B 5LQDA 4MGHA 2FPOA 3C4QA 5LQAA 5M04A 1G8HA 2EIXA 3KZVA 4Z0NA 1MABA 4ENUA 4ZDKA 1ANKA 4G56A 2V58A 2R6R1 3AVOA 2HADA 1SCJA 1UMBB 4M0EA 1KY3A 3MGGA 1P4AA 1OYYA 5CFMA 3UAWA 1PBTA 1C29B 3FDIA 3KKMA 4HN2A 3M1LA 5LDHA 4UE6A 4JYPA 4F1KA 5K0ZA 4OP1A 4PNZA 2A5LA 1O57A 1GL3A 2OUIA 2WTAA 5CFZA 4BFVA 1Z45A 1MOPA 4B79A 4B46A 5HK9A 4JDUA 5GOTA 4U63A 3V4ZA 2HRBA 2P5SA 5JMWA 4LXHA 2SECE 1GPDG 2IZ1A 3BN3A 2IZ5A 1YVRA 3ZW9A 3VZCA 5AK4A 2VTBB 4YCAA 3D81A 1QNFA 1P4RA 4BEBA 4B2LA 2I3GA 3SYTA 1DXHA 1ZRNA 3PCTA 3RK1A 3TNYA 2GN1A 4B44A 4YDSA 1IWOA 4Z4QA 4KMRA 1OVGA 1XKQA 4DRZA 1IG3A 3QX3A 4GPBA 2YNMD 2RHDA 3ZCVA 4DWJA 4RF4A 3AR6A 5AD1A 3ZBTA 1FTYA 1JA0A 1MJNA 1ZK3A 4EQZA 5C3UA 3N2YA 1YZKA 1CR4A 1OXMA 3MERA 2FW6A 4PRYA 4ER5A 4DIKA 4GNKA 1H42A 4QU9A 3CUSA 2FSUA 6GPBA 1YFJA 1VHLA 1NBAA 3EIFA 1V39A 1SVSA 4U6QA 4NBTA 1B0UA 1XVVA 1Z8FA 2NZVG 4XJVA 4E0BA 5H0IA 1J7KA 1EK6A 1VLHA 3O0TA 1N8TA 3KQNA 4IDAA 4QAQA 3R7WB 5FIUA 4JVLA 3HLKA 1P7VA 4ZYZA 3JWGA 2HL6A 2H4WA 2JAPA 2NQTA 1H0SA 5I7EA 3QE9Y 3GFQA 2CJYA 3JWIA 2PKXA 5CJPA 4REMA 1E59A 3NAQA 4A6PA 1L4UA 1I4WA 2JW5A 1UJ4A 3D54D 4M7OA 3VAZA 4HATA 1Y5NA 2VWPA 4L50A 4JYMA 4WY2A 3DCIA 1EXNA 3CIFA 4AS3A 2RKBA 1XU7A 5KAMA 3KXPA 1F0YA 4LOLA 4W1SA 2WRZA 3W4IA 3FYCA 4DC1A 3DHWC 2GUWA