2GRJA

Crystal structure of dephospho-coa kinase (ec 2.7.1.24) (dephosphocoenzyme a kinase) (tm1387) from thermotoga maritima at 2.60 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
HHHMVIGVTGKIGTGKSTVCEILKNKYGAHVVNVDRIGHEVLEEVKEKLVELFGGSVLEDGKVNRKKLAGIVFESRENLKKLELLVHPLMKKRVQEIINKTSGLIVIEAALLKRMGLDQLCDHVITVVASRETILKRNREADRRLKFQEDIVPQGIVVANNSTLEDLEKKVEEVMKLVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) (tm1387) from THERMOTOGA MARITIMA at 2.60 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Dephospho-CoA kinase
total genus 61
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2grjA00
4D4JA 5DSZA 3UMRA 2EWWA 2W2XA 4PO1A 1KK3A 1N5IA 3AF2A 1F2TA 3THXA 4TMZA 5L3QB 2C2HA 1E9EA 1G9XA 3IEUA 3RRZA 2J0UA 2ZPTX 1XD2A 4Z1MA 4UXHA 1CIPA 3DMDA 3WMEA 4I1OA 2CNWA 1FP6A 1AQUA 2AWNA 4JBYA 1NBMD 3QPUA 4L5BA 2O8DA 3FPAA 1D9XA 4FD2A 3LXRA 2CMKA 3OHMA 5CYOA 5J4YA 4URYR 4IJMA 5A4JA 1BYIA 3TR5A 1WDTA 1OPXA 3ZIAA 5SZHB 2FG5A 3KKPA 4DLUA 1MO4A 2IHYA 1UKYA 4LV8B 5B58C 1W5SA 1QG4A 1F2UA 3NXSA 3VKGA 4A2WA 1WE2A 4KFSA 4MGYR 2IYSA 2OAQ1 3WYGA 1E2GA 1YRBA 2D2EA 3GP8A 3H1TA 4PQRA 2N42A 4X8MA 3WMGA 1HQYE 1E4VA 1Z6GA 2VP5A 4H9GA 3KFXA 3OESA 2P0EA 1LFDB 3EARA 1YZKA 1KI6B 1Z0DA 1XTSA 1ZNZA 2G83A 4TWZA 3CPJB 4XVUA 1G3QA 3AGPA 1AJEA 4ZDKA 4U00A 2DWPA 1V5WA 3RABA 1YHNA 2ZXUA 4FMCF 1KKLA 1WA5A 3AGQA 2GXSA 1P7CA 3K53A 4NU0A 2WJHA 2GNOA 2WOJA 2F9LA 5F98A 2CLCX 2ZR0A 2BBWA 1E2MA 621PA 1DAHA 1CU1A 1EWRA 2G0TA 1S2MA 3CNNA 5EE5B 2DFLA 3B9QA 4JL8A 1E9FA 2GZDA 3KB1A 1XCGB 1SXJE 2R44A 2AWOA 2MMGA 3KJIA 1XMJA 3CO5A 4Q19A 3SJAA 1RE0A 3IILA 3VR5A 1H8HA 1BKDR 1ZM7A 4C0BA 3GLFB 3GLHA 3SNHA 1IXZA 4IEEA 1UJ2A 2GBLA 2ZI3A 5CJ2A 4B2LA 1KI4A 2WJIA 1Q3HA 1FUKA 3TE6A 2OFXA 4JJKA 3TK1A 2VP0A 5JJIA 4CVNA 1DPFA 4NYIQ 1A5TA 4ZI2A 1W49A 1QRAA 4JYCA 2PJRA 3K9NA 4GBMA 4LHVA 1OKKD 4UJ5A 2CNWD 4B75A 1U94A 4XVQA 1T3SA 4HAYA 1N6KA 4MA4A 1YKSA 2XJ4A 4QOSA 1Z0IA 2R9VA 3IBYA 3RDPA 1W46A 3TR0A 4Q9IA 2FJUA 4JLBA 3RRYA 1E9DA 2YYZA 3CIOA 4O2LA 2GKSA 2PZFA 3B1YA 5KOYA 1OT3A 3SJBA 2QP3A 3H4MA 1B23P 4AURA 4HLDA 3KXKA 5JSZB 2EFHB 1OIWA 3LLUA 1W1WA 1U98A 4HAZA 1KDOA 2AL7A 3QKRB 3U7EB 4B73A 2WMNB 3ZD7A 4GOXA 4HB3A 2GJ9A 4KSBA 3MCAA 4B2IA 4CT5A 3RRNA 2Z5FA 2G1JA 2P5TB 2YOGA 1CJUC 2C96A 1VYTA 3PUVA 2FX3A 2VA8A 3PUXA 4PXAA 2QTFA 1AA9A 5AWFC 3WNBA 1G1MA 3EZ6A 5KTYA 3FMPB 4HDCA 2QI9C 3AKCA 4QG7A 1QHNA 4M9ZA 4L8GA 4Q4HB 4YLGA 4AWXA 3RNLA 3BS4A 2QZ4A 4ZO4A 1Z06A 4II7A 1T8UA 3EWSA 2ANCA 3SJZA 1P2SA 1NVUQ 2X2FA 4DIDA 1US8B 3TMKA 4LC1A 1IY0A 2OCBA 5F9HA 1R5BA 2C99A 3LO5A 3K09C 2CK3D 3QKSB 4ARZB 1ZIPA 3RVBA 3GFPA 2ZRKA 4A8JB 1YR6A 2A5DA 821PA 4BZPA 4ILEA 3CX6A 3TSWA 4DC9A 1Q20A 4WA7A 1JPJA 4D4KA 4ZCMA 1EG7A 2XXAA 3O47A 2PEYA 3IPYA 3BB1A 4Q4LA 1LY1A 3A1VA 1ZM3A 1W5TA 4JL5A 4RD3A 5CB8A 1AS3A 4MDFA 1QHYA 3ZVLA 5FPSA 2RGNA 3K8YA 5C4GB 4DLVA 1VCNA 3RS5A 1QHIA 3EWAA 3QXCA 5EZ6B 3VR1A 4A1FA 4V0LA 1E2QA 2PT7A 2A5YB 4Q7LA 1HEIA 4QHTA 3WY9A 2GVZC 1OH5A 2QP4A 1ELOA 3CRVA 3B2EA 5JHGB 4QJ4A 1Z0AA 1EESA 4G01B 2O5VA 1P9NA 2ZRGA 4MGIR 5LD2B 1S9HA 1MO6A 5GJVC 5J4LA 2VRWA 4M1WA 1GILA 4Q4JB 3QXHA 2ZI5A 3AKDA 1OLOA 5JMTA 1XMVA 4E22A 5L8VA 4S2EA 5FUVA 4B47A 1AM4D 2ZQ5A 3X1WA 3BH7A 4WW0A 3MWLA 2GTPA 3LV8A 4KBFA 1W44A 3ZJYA 1NF3A 1X8JA 3CKLA 4DXAA 1N3BA 4URVR 2C78A 3Q72A 1GRQA 5H70A 3DM5A 4NPHA 4OJKA 4IDOA 1SQ5A 2CJWB 1QZXA 1QF9A 4B3CA 2ZJ2A 3GJ7A 3OAAA 4TYNA 4US0R 2J87A 2JLSA 5KDLA 1XEXB 4BLPA 5JWOA 1ZNYA 1E94E 1W7AA 4F4CA 5F9FA 1OYWA 3WYFA 3C7KA 1KMQA 2HJVA 2FFHA 3Q7QA 1ETUA 1K5DA 4FMDF 3F3YA 2V6JA 2EFCB 1N0UA 1HUQA 1Z0JA 3W5IA 1CTQA 2ZITA 4PZLA 3GPLA 3KQNA 2J46A 3KJHA 4P32A 1FL9A 3GLHB 1YR9A 4B2PA 3D7MA 1W48A 4W7SA 3A6PC 1DTSA 2XTMA 4AIIA 4EPXA 1ZNWA 5K8UA 2FOLA 1E96A 2ZYVX 1E9RA 4LCBA 3ND9A 1Z8FA 4JBWA 4HUTA 1FNMA 3MMPA 4TLDA 2GA8A 2SHKA 4C2UA 2KBEA 3U7GA 3ADKA 5HCNA 1KO4A 1XPOA 3LDAA 1R4AA 3TBKA 4Z51A 1G6HA 1KK2A 3GFOA 3ZIAD 1NLZA 5EP2A 3QVVA 1CJVC 3F5FA 2MSCB 1E0SA 2GZAA 1J2JA 4RZXA 721PA 3K0SA 1IXSB 2IYZA 4DLXA 5LD2C 3CW2A 3OFND 4HZUA 4KFTA 5HTKA 4QFMA 3J81k 4N1AA 4IXMA 5TB5A 5BWMA 1S96A 3KQHA 4JSYA 3HU2A 3T15A 5TMPA 5G53C 2Q3MA 2VF7A 1G16A 2WWFA 2XZPA 4TQ9A 4XSGA 1CULC 2KI5A 2QENA 3C8UA 1AIPA 1LS1A 4C0KA 4R71A 4D0LB 4QJ3A 3OIWA 1NJFA 4PC6A 2R6AA 2MMCA 1GL9B 3GCGA 4WXPA 1E69A 1GKUB 2YVUA 5FOTA 4JBXA 4HSEA 5JRZA 2P65A 1J99A 2GCOA 4C0HA 2D62A 4Q4HA 1GL7A 2VHTA 1T6NA 5EZ5A 4BFSA 5DI3B 1OB2A 3U3MA 1Z5ZA 3DZ8A 4MRRA 1GRRA 1WCV1 1N6HA 1R8SA 2YWEA 2IYRA 1VHLA 5FR1A 2DFNA 1RIFA 1JR6A 3NC1C 2FN4A 1Y3AA 1ZAKA 3K70D 3E70C 1U8AA 2QM8A 4BLTA 1WBBA 5DYIA 3B1XA 4LOAA 3CZPA 5DLQC 2OZEA 3BFXA 1UM8A 3FHCB 5G3ZA 1NKTA 2JASA 1GIAA 1TNDA 3L0SA 4A36A 1KZ7B 2B8WA 1N0WA 1KMHA 3RWMB 4M1MA 3BGWA 1G8PA 3QPWA 2FPKA 4YONB 1P2UA 1E9BA 1ONBA 1KI3A 4GZLA 1COWA 2LKDA 4I1UA 521PA 2IUUA 3V4FA 5HKKD 2H7VA 4OKSA 3SQXA 1SVOA 1G5PA 4HUQA 3B1WA 1JEDA 2FEOA 3NWJA 4V0OA 2WIAA 3LXXA 3W8NA 4JLAA 4Y0VA 2H57A 1I2DA 4D82A 2E87A 2VP2A 4A2PA 2OBLA 3W34A 4C9BA 1GNQA 4PAMA 3C4JA 2ZI9A 2PX3A 2IWRA 1GNRA 3DEFA 4KLNA 3PJRA 3CNOA 2PX0A 4JT4A 3CX8A 1SVIA 2EW1A 4Q4AA 3SU8A 1XJ0A 2FMXA 2IYLD 4PO8A 4P0TA 5BN3A 3QXSA 5CM8B 1D6JA 2J45A 3QF7A 1LW7A 4G1UC 1T3LA 2ZVPX 2WKQA 2RB4A 5KSOA 3I62A 4AD8A 4AKEA 8OHMA 3RSOA 2NGRA 3DDCA 3SYNA 3AVWA 4XWOA 4EFNA 3QXXA 3ZZTA 4ZIRA 3KX2A 3TAUA 3MD0A 4HLUA 4PHTA 1R0YA 3BFVA 1IHUA 5J40A 5SZJA 4DLSA 3P26A 1RC8A 1BS1A 2I3BA 2IS4A 5DH9A 1NIPA 4ESHA 1RKBA 3THXB 2OFWA 4EAQA 2EFDB 2PZEA 1TQ4A 3SN6A 2JLUA 2IS6A 2I1QA 4LYHA 4N3NA 4Q1EA 1U99A 1XPUA 1ZM2A 1JXOA 1IN6A 1U0HC 5KDDA 1XD2B 2VHUA 4Q1BA 2GEDA 3PUYA 5HR5A 1FFHA 2CVHA 3K0CA 2OT3B 2FA9A 3B6EA 5L3VA 1KI8A 1Z3IX 1KAOA 5FL7A 3U3OA 3OEHD 4NDZA 1U9IA 2FFAA 1AK2A 3VHXA 3K70B 1PV4A 1R2QA 3CF2A 3X1YA 4ERNA 3I72A 2J1LA 2N46A 1GKYA 5JEDA 1K5GA 3VU9B 3U3JA 4AYWA 4US2R 2ZRJA 2WWGA 5FOSA 1G18A 4OQMA 3UXMA 4D80A 2WSSD 1I4LD 1X86B 2QL6A 2R2AA 3FMFA 4I1SA 3NC0C 2GJ8A 4WOPA 4G5SA 2REXB 3CB4A 4M53A 1QHHB 3IHWA 2MSDB 5FUYA 1ZM9A 1DO0A 1NVWQ 3VR3A 1XXHE 3RYTC 3SJCA 4BZQA 2O52A 1KI1A 4GMXA 3HYTA 2B6HA 2WTUA 1OH6A 1S3SA 5J4HA 1VHTA 4TMKA 4HAVA 3I4LA 4IOKA 1DAFA 5KPJA 1NL3A 1FTNA 4TSFA 3GJ4A 1NN0A 2CXXA 5AJYA 3DMNA 3NHAA 4DLZA 1YZQA 3SHFA 4P31A 2ZI7A 2ZSBA 1B0UA 4BLOA 5FR2A 1U8YA 4DJTA 1ZC3A 2XAUA 3IIKA 3BC1A 2ZRHA 4CT4B 4EKDA 3I8SA 3CR7A 5KU1A 3PUZA 3FHTA 3ECCA 2NZ8A 3U2QA 3AVPA 4M8NE 4DSTA 3PUWA 3X2SA 2FH5B 2IUSA 1CR2A 4AY2A 1CKEA 1OKKA 2C03A 2ZRMA 4DSOA 3IUYA 4QM6A 1ZBDA 1G8GA 2J59A 3NTUA 4LGMA 2OV2A 3U6BA 3O8CA 4LJYA 1NLFA 1E32A 3QEOA 1CJMA 3U4QA 1HURA 2XTZA 1M6NA 1D5CA 2IA5A 2XTNA 4C7OA 1FMJA 4U5XA 2ZRAA 4TMTA 3EASA 3KKOA 1I4DD 3TGPA 221PA 3F0TA 2FNAA 5FPKA 4KSCA 2VSOA 2OEPA 2V9PA 1G8FA 2EYUA 1J8MF 2ZUDA 2XXAB 1E2FA 4UJ3A 3CRW1 4CRWB 3RLFA 1X8LA 3NH6A 4L9WA 2ZROA 1NLYA 4TT3D 1AZSC 4EFMA 4QBHA 5FOUA 2IXFA 4EFLA 3VTKA 3MGCA 4ACBA 5G3YA 4KFUA 3FDIA 4DLWA 2G1KA 5AR1A 2LCFA 2PLRA 3IEVA 5C18A 2VIIA 3T61A 2J0UB 4JL6A 4EJSA 4Q1DA 3UANA 4DCTA 4P4UA 1T0HB 3OZXA 4HB0A 1E1QD 5HE8A 5L3SA 1T9HA 4RZ3A 4BFUA 2BMJA 4R98A 1DEKA 2EYQA 1OHHD 3PXGA 1LTQA 4E09A 1VDZA 1ZC4A 4DDWA 1W0JA 4WXRA 2KWIA 3GLFA 4R9UC 1JNYA 1UBFA 2W6ID 1UBGA 1W4AA 3Q85A 5L3RA 2JCSA 1UDXA 1OIXA 2BKEA 4MRPA 2GDJA 4B35A 1CJTC 2XOKA 1AQYA 4NHOA 4JMPA 2DB3A 3AVUA 2R65A 3W3AA 3K0FA 2AR7A 3ADCA 4UXIA 2ODEA 1N5KA 1PVOA 1D2MA 2ZSAA 3A1TA 4V0NA 1CJKC 4RFVA 4QKQA 5KSYA 2VF8A 3CRMA 1XMSA 3GJ6A 4Z8XA 4DCNA 1PZNA 3R7WA 4YXWA 3JVUA 1KDRA 4ZCIA 4GL2A 1M8PA 4P3YA 2NIPA 1N6LA 3BH0A 4NH0A 4PHHA 4POAA 2W6JA 1TAGA 3B1VA 2HYIC 2EFEB 4QGHA 3VAAA 1VECA 5JSZA 1R5NA 1G8HA 3HJNA 3LQQA 1T0JB 1NNEA 1D8TA 3KZ1E 4NTZA 4JVMA 3OF5A 1SKYE 2OCPA 5EP4A 3BJIC 2ZE5A 2OXRA 3FKSA 4G5OA 3L82B 1WXQA 5DIFA 3WXMA 4MRSA 1IXRC 4URXR 1U9IC 1W2HA 4MQBA 1G3MA 3R9IA 1C1YA 1UBEA 1HT1E 1ZIOA 1ANKA 4TSFD 3AF0A 3K9GA 1XTKA 1X6VA 1P4SA 3M1IA 2NG1A 2OLJA 3LWNA 4NKRA 4C30A 2VQSA 1XZQA 2BM1A 3HPRA 3THYB 3H86A 2ODBA 1SZPA 3KXIA 1DO2A 2R6DA 2BCGY 1Z63A 4Q1AA 3BE4A 4HZUB 1MRNA 4A0HA 3E1SA 1DADA 4CEJA 4RD0A 3ZGXA 3IKJA 3ZVNA 1UEIA 1NBME 3Q5EA 3T5GA 1U90A 2L0XA 1XCMA 4EPYA 2WOOA 2JJ2A 3HU3A 4LJAA 1N25A 4OYHA 4Y0AA 2Q9AA 1YJ5A 3X1DA 4QBIA 2BDTA 1S4QA 3ZVMA 4URZR 4EPRA 1G7SA 1P73A 3GLHE 1OXSC 4OHZA 3ZS9A 1NP6A 2GXQA 1AN0A 2ZE8A 3MJHA 2F55A 4NMMA 1F2TB 3FKQA 4LHWA 1IBRA 5CIQA 3IO5A 4DUGA 3LVRE 4FCVA 4U7DA 5FH9A 3ZD6A 3L8YA 4YMTA 3AV0B 1Z6YA 2BHRA 3GMTA 5ANRB 1G7RA 2REOA 3TIFA 1PLJA 3HYRA 4NYJQ 1PLLA 3C16C 1IONA 1G64A 2WBLC 1MO5A 2C5LA 5KPDA 4KFRA 2AKAB 4PR0A 3ZQ6A 2P3SA 1XJQA 3CPHA 2Y8EA 4Q4JA 4BGDA 1MKYA 5JFGA 1W4BA 2VBCA 3FOZA 1IN7A 4CEIB 2GK7A 1QHSA 1XRJA 2G3YA 3GLIA 1L7VC 2GJSA 2P67A 2FSHA 1MR3F 3TW4A 3PIRA 3QIAA 4KHZA 1NJGA 2ZI6A 3IGFA 4M1SA 3UG7A 1HV8A 4DDVA 4LWZA 2V3CC 3EA5A 4HUQB 1V43A 1NG1A 2CJWA 1ZVQA 1J7KA 3EPLA 1U0LA 4NCKA 1QHGA 1IAQA 3OE7A 2QY9A 2HEIA 3ZZUA 5AUOB 2NOAA 1W0JD 1YZLA 3EA0A 4ZDWA 4YMUA 4Q4AB 2GF0A 1ZRHA 4MRNA 4R2HA 3JZMA 4PAOA 1KDTA 1SULA 3LX8A 3N2IA 2YZ2A 3QUSA 5AJZA 4AC9A 2G0NA 2OHFA 3VNUA 3G5UA 2PCJA 1G7TA 3IIJA 4EJSC 4B34A 4V0KA 1UFQA 2QU8A 4PAQA 1E2IA 4B3BA 1HH4A 2ZRDA 5CM9C 3VR4A 3TW8B 1C4OA 4IVQA 3B82A 2AXNA 2F1HA 2J0QA 1US8A 4BFTA 5H8WA 3VX4A 3R20A 4QRHA 2VO1A 2QPTA 2ZR7A 4MUAA 1F2UB 2XNDD 5JWRA 3ND8A 3QXJA 4TLBA 2V55B 5AJVB 5A5GA 3CX7A 3MJRA 2RAPA 1XCPA 3RC3A 4UNRA 4BZXA 5B30A 1CXZA 1GSIA 4AYXA 3WP0A 5GJBA 4OHWA 4BFZA 4MH0R 4RFSB 3G82C 2IBMA 2WSMA 4BECA 5LB4A 3LAWA 1S0UA 5E4FA 5B64A 1VG8A 4TT3A 5JCZA 3MWYW 3HP1A 2CHQA 3KXLA 2UZ3A 2ZJYA 2B21A 1MO3A 4LY6A 4P4SB 5B2ZA 2YNMA 3ICEA 1NMYA 4HLCA 4XJXA 3AF1A 2GXUA 5KDOA 2QRZA 3O8DA 3P32A 3TRFA 4C0SA 3B7GA 3THYA 2AFIE 3HR8A 2GWHA 3QY0A 1UPTA 5IRCD 1U0JA 1Y63A 4LJ4A 3HU1A 3EXAA 3AUXA 1CLUA 1SHKA 4C0JA 2W6JD 4RY2A 4IEIA 2OLKA 2ZS7A 5J5CA 3LQRA 4IOJA 2BMEA 4Q9LA 3C5HA 4NCNA 1OIVA 3UKDA 2ZM5A 4ZKEA 1CRQA 1W4RA 3L0PA 4M2LA 2IHBA 4FCWA 4Q66C 1FX0B 2IYTA 4OL0A 1E2NA 4E5UA 4GSYA 2HLDD 3K9HA 2I4IA 2A5FA 1TQDA 2GZHA 3THWB 4TLAA 5D3MA 4B32A 5BW8A 1WRBA 2ZU0C 1MV5A 4DUGD 4TZ6A 1XJCA 2O8EA 1G4AE 1CF4A 1LS6A 3W5JA 1IY2A 2ZYTX 1KNQA 5E7JA 2IK8A 4LHZA 4B3FX 2ZE7A 1OFUX 1OXXK 2ATVA 2VEDA 1SVKA 3KJGA 2JJ2D 4X8LA 2WM9B 5H1YA 1G5TA 1KO1A 3NHBA 3CWQA 1OXTA 4DVGA 1IN5A 3K70C 5DHFA 2BBOA 2BEJA 3LNCA 2QRNA 3MAAC 4JS0A 4YDSA 1CRPA 1CR0A 2NPIA 1JI0A 5TXGA 4JIMA 3W6PA 4MRVA 1F6BA 1UEJA 4M1OA 3UWKA 1GTVA 2F1JA 2P5SA 1KSFX 1XBTA 3KTAB 3AKYA 1CP2A 3AVTA 4A0RA 5CIWA 1DAEA 3WBKA 5J4VA 1DAGA 4NBSA 4C7OB 5DN6A 5KHOC 2V54A 3EZ2A 4G5RA 3I3SR 4L15A 4XIGS 5DHAA 2ZJ5A 3Q7PA 1AGRA 2OG2A 2FZ4A 1YQTA 3TVDA 4D4MA 2LWIA 5AUPB 4PHGA 1KOFA 4CIDA 3K9LA 2ZRIA 5HCIA 2PBRA 2B7CA 1OFIA 4BLQA 4QC2A 1ZMXA 2BJWA 3LVQE 2JLQA 2DBYA 4IVPA 4JJZA 1KO8A 4Q7JB 5FPYA 3REGA 5EUQB 2WJYA 1T3HA 1XEWX 5SZKB 4CF7A 1NMXA 4NYIR 5IK2A 5C46F 2O0HA 2Q3HA 4PZZA 1E2JA 3UIEA 3NIBA 3SYKA 2A5JA 2Q21A 3GFTA 1TUEA 1E98A 4M1KA 3VFDA 1SXJD 4CEHB 4TYQA 4QGAA 1EFHA 2DPXA 3BWDD 2IF2A 4UXJA 4BFXA 3F8TA 2GETA 1R5OA 4PSKA 2QAJA 2WZQA 4ASUD 4X8HA 2Z83A 1KYIA 2ONJA 3HWSA 3DM9B 3SEAA 2RHMA 1I4TD 3LBHA 4M0LA 3A37A 1W36C 1EX7A 2H8KA 2A9KA 4BWYA 4XD7D 3D6TB 3DKPA 3THOA 4XSHA 1YU9A 3W6NA 1RPZA 1SVSA 4MKHA 1ZCBA 4BLRA 2FWRA 3NBFA 3K09A 4MYUA 5GVRA 4LJ5A 1N6OA 2BJVA 2IC5A 1JPNA 4F38A 4NONA 2QPAA 3VU9A 5F3WB 1DG3A 1KJZA 3LY5A 3T12A 4IVRA 2G88A 1ZW6A 2W6IA 3WRYC 1DELA 2RKOA 1P60A 2AFHE 4LBYA 1JB1A 3IPXA 3B13B 1F3OA 1OHHA 1P2TA 1JAIA 2R8RA 1SKYB 1NVVQ 1GFIA 2F1IA 1WBDA 3BB4A 4RFSA 2FPLA 1RZ3A 1VCMA 1GG2A 4PSAA 3TUZC 2P2LA 2RGNC 4LPKA 3SYLA 3TLXA 3HPQA 1KAGA 1IJEA 1DS6A 1Q1EA 4HEJA 1KK0A 3CLVA 4UQOA 3SOPA 3GD7A 2PZGA 2WAYA 1QVAA 2PL3A 1LV7A 3UATA 3R9WA 3TJZA 4EDHA 2RCNA 2JJ8A 3SR0A 2WIBA 4EJSB 4FMBB 4XWAA 2EWVA 4F91B 3LX5A 1J70A 5FPTA 1ODFA 1ZU5A 2CLSA 1TEVA 3LW7A 1IY1A 4HI0E 4JVLA 4N0DA 4F4IA 3H0KA 4JKYA 1G19A 2QMEA 2ZANA 3ZVRA 3NEJA 5FFMA 1VIYA 2FU5C 1G3RA 3AF3A 3CBQA 2ZRBA 1XMIA 1TPZA 5FTLA 4RVCA 5E7IA 4B48A 4LX0A 2GILA 2PLFA 3ZS8A 4IDNA 3AH8A 1WF3A 2GJKA 4JLKA 2AD1A 3BH6A 4BEJA 3K0FB 1R6BX 2XB2A 4GDFA 1G291 4IOLA 2J0VA 2ZRFA 3EPHA 3RS7A 2WKRA 3QKUA 1XXHA 4RKEA 4PSVA 3TQCA 1L8QA 4DZZA 4PC2A 3R9XA 1RFLA 5BQ5A 4K46A 4EPWA 4RD2A 1SGWA 5D3QA 1QHHA 1VG1A 1W36D 1MRSA 4JLOA 3RSLA 3R7WB 1X8KA 3FB4A 4HB4A 4BPBA 1YZGA 3PG5A 3KQLA 4PPNA 5KNCA 1YVDA 3GEEA 1II9A 5LPNA 5JBQA 2O8FB 3FWYA 4XVRA 1SXJB 2XB4A 3AB3A 2ZSEA 2X19A 4HLQB 3L43A 4E07A 2G6BA 2GAOA 2A5GA 1YR7A 5C2JB 4Z8YA 1E3MA 4OQXA 1VYUA 4B71A 1U2RA 2P6UA 1KHTA 1KJWA 5HZHA 1IN4A 3KB2A 3KTAA 4FWIB 4R2IA 5E95A 3RS2A 4KCGA 3AVQA 1OV4A 4MYHA 1JR3D 1OF1A 3SFZA 3TUIC 4DLRA 1CR4A 1WQ1R 1RJ9A 4DKXA 4WBSA 3REFA 2BMFA 2YKGA 1TADA 1IM2A 2IS1A 1KI9A 1DVRA 2WVJA 1S9DA 1E99A 3IDQA 3E5HA 4G0NA 3RS3A 1P3JA 1W0KA 2F1RA 3P1JA 1K8RA 3FTQA 5FTMA 4RD6A 4MKGA 5KNDA 2ZUBA 3I61A 3U4QB 2WWIA 4GPTA 1U8ZA 1ZYUA 2F7SA 2Z4SA 4HB2A 2CHVA 2JLZA 2P6RA 5FOWA 2QMUA 2VHJA 4MITA 5IHPA 5FTNA 2JLVA 4JT2A 1Q57A 2GCPA 5FL7D 1Q1BA 4LPSA 5JJKA 5EJEA 3RC8A 5JJLA 1BIFA 1KMHB 4YC7A 3DOEA 1QDEA 1TF5A 1G4UR 1TF2A 4D6PA 4QNMA 4HAXA 5AJXA 1OFTA 4LYJA 5FTKA 2GAAA 2IW3A 3JVVA 3ASZA 4P33A 1EFUA 1DG1G 4KLZA 3KDSE 1Z29A 3QKTA 4PPFA 1VTKA 3EG5A 3CR8A 1N6IA 2Q9CA 3UK6A 1A1VA 2AN9A 3B1ZA 1GVNB 3FHOA 4LYAA 5AK0A 4FW9A 3PITA 2JATA 2Q6TA 2W83A 3FFBA 3N70A 2Q9BA 4KI0A 3EC1A 1AS2A 1JBKA 1P6XA 2BBSA 4X8OA 5CDFE 2D2FA 4O0MA 2GVDC 4F92B 3GEIA 4A92A 2XZLA 4OHYA 3K0EA 1WP9A 1MABB 1YZTA 2FSGA 3GLIB 2ZIAA 1E9AA 4GI7A 5FUXA 3I5XA 2NMVA 3LH5A 4KU4A 4QHSA 4Q01A 2F43B 2PJZA 3OEEA 3V00A 5BN4A 4CGZA 1TU3A 4HLUC 2HT1A 3MSXA 3L0IB 3TUJC 3GLFE 1XB2A 4FN5A 2Z6VA 3B9PA 2ORIA 5H68A 5EXSA 1QHXA 4CEJB 2ORVA 5AUNB 2XZOA 2Z0MA 4A0FA 2V7QA 1EK0A 3WNDA 2CCJA 2HYDA 1N0VC 3BB3A 3A4NA 1HQCA 4IXNA 1W36B 4NYMQ 2CEAA 2HT6A 2AK2A 4XTCS 2CCKA 1RRGA 1ESNA 4LJ8A 5CK4A 3AEZA 1TQ2A 3WMFA 3P4YA 2IXGA 3W90A 5BN5A 3KJEA 2WPDD 4OI4A 2WWXA 3U5ZB 1HYQA 1EX6A 5E7MA 4ABYA 4EQ6B 1COWD 4DLYA 2CL7X 1RRPA 4YQFA 4DIEA 2WWWA 1RW4A 4JKIA 3FE2A 3VR2A 4KJZA 3MG9A 5AUQA 2WWYA 2P6NA 1U81A 3I8XA 1M74A 2H92A 3C5CA 4RCYA 4ZV4A 3H84A 2H16A 4OI1A 2QGZA 5HPYB 1XXHB 2JDIA 3PCRB 5JWHA 2X8AA 2DHRA 2CVFA 2ZJ8A 5JS8A 3EIHA 1X1SA 2QAGC 4MYCA 4LBWA 5FBLB 1VKJA 4IDQA 4LYFA 1SVMA 2UKDA 3K1JA 3VR6A 4FXPA 4FCTA 1E0JA 5D3MB 4GNKA 1G21E 2JGNA 1OB5A 4H1UA 2QM7A 3NBYC 4ZDJA 2ZUCA 2ZYWX 2RGXA 3NDPA 2WJGA 4DCVA 3BOSA 5GJCA 2GEUA 2HXYA 4RZ2A 4NP6A 2BV3A 4D26A 3DPUA 2HUPA 5KSPA 3RWOA 1P75A 2OUKA 1PUJA 3GLGE 2O8CA 1CEEA 1KY3A 1D2NA 3FVQA 3GJ8A 5GJWC 2W0SA 4DT1A 1RVDA 2KBFA 1XDBA 4IOMA 2FPMA 3C15C 2QBYA 2O8BA 4JLPA 4G5GA 4EPVA 3D3QA 2JIZA 4BUJA 1Q21A 1C9KA 1FPMA 3DKVA 5JCPA 3QEJA 4DHEA 4O25A 2VL7A 2AD5A 4MKFA 5EE9A 5FL3A 2ODNA 1GITA 1VCIA 3B8HA 4NCJA 4QL3A 4JSTA 1FZQA 3TH5A 1RRCA 1E2HA 5KNBA 1MT0A 2FSFA 4G5QA 4UNNA 3IHLA 3N2EA 1NN5A 3S1AB 2IXEA 4GOJA 2WICA 2VP4A 1FX0A 2YJTD 4F93B 2CBZA 5JZVA 1JAHA 3CONA 1TEXA 2HJGA 1G8YA 3THWA 1E4YA 1RRFA 3DO6A 4NYJR 3U3RA 4IW3B 2IT1A 5BYKA 2D3WA 4HZIA 5CLLA 3UWOA 4J0QA 3ZYCA 5A0FA 4M21A 1M1YE 1S8FA 4JVSB 1QBKC 1T4GA 3CRRA 4KAXA 4CEHA 2WPDA 1AKYA 1W0KD 2BVNA 1S3GA 1DE0A 3KFVA 4UNSA 3U3KA 2JLRA 2KJQA 4LC0A 1Z0FA 3CUEF 5EQTA 3GJ0A 3QBTA 1ZP6A 4KBGA 4OJQA 2GCNA 2DR3A 3WHKA 3WHLA 3UMFA 3T35A 1E2LA 5IF9A 4W5WA 2RGBA 1BO6A 2MSEB 3CNLA 4I99A 1UKEA 3SBDA 4RSGA 1NI3A 2A78A 4FINA 1NBMA 3PV0A 3FKSD 4B44A 2J0SA 1NSFA 1LB1B 3B78A 3UMSA 2FGJA 3OE7D 2F43A 3D31A 3QE0A 1XD8A 4ASUA 5L3SB 4A8JC 4A2QA 1N6NA 4B3GA 2XITA 3U44B 4KVAA 4KYUA 4TMWA 4GMDA 5IT5A 3TVTA 2PMDA 1R0WA 3MLEA 2H18A 1G3UA 2QG6A 2IF0A 5K8IA 4OI0A 2PEZA 4MKIA 4WIAA 3AKEA 3NDBB 1OSNA 2QSZA 2JLXA 3U60B 4MDEA 1G41A 4AK9A 3EPJA 2QP9X 4B76A 3AUYA 5HE9A 1ZNXA 2GESA 2TMKA 1DAIA 1E1RA 3I32A 4V03A 3TKLA 4IKEA 1PUIA 1OW3B 1Z47A 1YZUA 2ZRNA 3WNCA 4B43A 4L9SA 4TQUS 3V9PA 4AI6A 3AM1A 4M9QA 2OXCA 2WJVA 3ICQB 4IFBA 4ON9A 5JRJA 4G3XA 4BFWA 1N5LA 2OILA 3PEWA 4RD4A 2D74A 5E3HA 1J90A 3B85A 1IOZA 4P4SA 1VCOA 4GP6A 2RGCA 4DCSA 2DFKB 5TY0A 2XJ9A 3ASYA 3VKHA 4TMVA 1N6PA 3WP1B 1UKVY 1L4YA 1XF9A 4URUR 4A6XA 2W00A 1J8YF 1FQJA 1VG9B 1GDDA 1Q1QA 1GNPA 3IQWA 2WWHA 4GT1A 2NPFA 4GRAA 4Z54A 5JI2E 2KSQA 2GF9A 2IYXA 3B60A 4KXFB 4YMSA 4DLTA 4ITRC 1NY5A 2V7QD 3FFAA 3IBGA 1GKIA 3I73A 4B74A 5EXPA 4V0ME 2QA5A 4PTLA 3H2YA 1GP2A 1R8QA 4M1TA 1ZD1A 3BIFA 1UF9A 3P27A 2W0MA 3B5JA 5EXTA 3I5YA 2HCJB 3A58B 1TUIA 4A4DA 2F3TA 3MUFA 4XTRA 2WAXA 2O8EB 5JI3E 3PENA 3ZLJA 3ADDA 1NIJA 5TDHA 1E2KA 1WMSA 1EXMA 4LBZA 3GLGA 2D7DA 1YRAA 3PEUA 3RANA 2JLWA 5HZKA 1S1MA 2QUZA 4BLSA 1Z83A 2X2EA 2BOVA 2QT0A 3GEHA 4NE2A 2ORWA 3UG6A 3S1AA 4OHVA 3A1UA 2J7KA 2HF9A 2NZJA 4N0EA 2VSFA 2A3RA 3TNFA 1UAAA 2AHOA 2CHGA 2J9RA 2RH5A 2VPPA 2ZU6A 3FMIA 3AVOA 4GP7A 4QJ5A 3LBNA 4C4PA 2NO1A 3AF4A 5DN6D 4M9XA 4QHYA 1E9SA 4M1YA 1JQJC 2BWJA 2ERXA 5CITA 2UVQA 1FTSA 2H5EA 2BM0A 2YWHA 2GBLC 3GQBA 2VHCA 3LW8A 3W9YA 1RYFA 4LI0A 4TL9A 4C0LA 3LA6A 4AKHA 4DWJA 2OESA 1XEWY 2CCGA 2VH5R 3NG1A 3PQCA 1QG2A 1ZCAA 2YWGA 1SXJC 4KVGA 1XEFA 1II0A 2WJJA 1Z2CA 4NYMR 3BFKA 5FBQB 4FMDB 4O2RA 3WYAA 4M22A 3SZRA 1II8B 2EVWX 2ONKA 3Q9LA 4DCUA 2G77B 3GLIE 1VMAA 4TZ0A 2NO6A 1FW6A 3VKWA 1MH1A 1JQLB 3KQKA 5LB2A 1SVWA 5FOXA 3QENA 3E2IA 4ZCLA 3EX7C 4A15A 2O8DB 2ZE6A 3ETLA 4TL8A 1G6OA 1FNNA 4NZYA 4A82A 4CW7A 3X1ZA 1ZUIA 1KDPA 3K0AA 4DEXA 4BRWA 1F60A 3BAFA 2A7QA 3Q5DA 3T06B 1DBSA 2HXSA 1NRJB 5CYPA 4D81A 3CH4B 1UDWA 1YR8A 2IEZA 4IHQA 3O8BA 4QXAA 4LSGA 1FUUA 2YOFA 4LHYA 4DEYA 2DWOA 4M9SA 4TYYA 3QJYA 4OQNA 2LKCA 1E2EA 1DAMA 4QBFA 2JJ1D 3MFYA 2YV5A 1XTRA 4Q48A 2HLDA 5G40A 1P9WA 2FV8A 3KL4A 2F3RA 4Q47A 2E1RA 2IS2A 2R62A 5FBRB 3AP1A 3FYHA 1T5IA 2J5XA 1Z6AA 1BMFD 1M2OB 3W3ZB 2OFOA 5EUMA 2C9YA 121PA 2NO7A 4EPTA 2C77A 4LUCA 2IWHA 3TSOA 1TL7C 2ZRCA 3U7FB 4LV6A 4QGFA 1NSTA 2CDNA 5JLJA 2O0KA 1BOFA 4JLDA 4W5HA 1FP7A 3CRQA 5DYGA 3DZDA 1A2BA 1LF5A 2D4HA 3SHWA 3VQTA 1LVGA 2OM2A 2CL6X 4XOIA 3AVYA 3BERA 2W2VA 2FF7A 3SE0A 4FWTA 2HF8A 2QTHA 2XOKD 4TL7A 4E03A 4JLJA 4A6PA 3NBZC 1DARA 4RD1A 2ZI4A 4GFDA 1NN1A 4L16A 1JJ7A 1Q22A 1GOTA 2HDNB 4Q7MB 4JZKA 4US1R 4TTRA 4D4LA 4DB2A 2AXPA 1FQKA 2ZR9A 3T5DA 2CL0X 4NCHA 4Q1CA 2ATXA 2OSBA 3KKMA 2GJAA 3QBVA 4LJ6A 2XNDA 5EP3A 2C04A 4F4JA 1E1QA 2QAGB 4LDJA 4BFVA 4Q5IA 1XTIA 2VTKA 2ZSDA 1XZPA 1KI6A 3BBPA 4IDHA 1DOAA 3A8TA 4A8JA 3A4MA 4OBEA 2BBTA 3ZDQA 1JR3A 4JYBA 2DCUA 2F6RA 1TF7A 4HYYA 4H1VA 4KITB 1F5NA 1IJFA 2ODWA 3Q8XB 2VP6A 4C3ZA 2O8FA 4OK5A 1E6CA 1SKQA 4TTPA 3C14C 2OBNA 2ZAMA 2GCOB 1I2MA 1XD9A 1A4RA 4YDHB 5AJWA 4PANA 1GAJA 4TYWA 2XEXA 2WHXA 1Q3TA 1Z0KA 3ONWA 2IYWA 3W6OA 3TQFA 3OIVA 3ZQJA 1L2TA 4ZKDA 4EIWA 4TLEA 3KQUA 2DWQA 1OFHA 3PR1A 2BC9A 1TMKA 1RJ9B 2ZJZA 1GZSA 3QOFA 2OCYC 4BRUA 5B57C 2UZIR 2N1BA 2J7PA 3AQ4A 4B33A 4PHFA 4Z1MD 2H1LA 1OXVA 4IDPA 1G7CA 4Q9HA 1AZTA 1E79A 1HE1C 3L0OA 3RAPR 1XTQA 2F9MA 1E2PA 1P9RA 2FEMA 2J7PD 2RHDA 4PC3A 1BMFA 4TMXA 4U02A 1XU4A 1CBUA 2B92A 1UADA 1IQPA 2PH1A 3QF4B 1OH7A 2JLYA 2GRJA 3QQ5A 1KY2A 2BMDA 5JECA 2FGKA 5IK2D 4QBGB 4KYIB 2FSIA 3OIUA 3PEVA 1II8A 1M7HA 2A30A 2W58A 2JEOA 2ZRPA 3N5CA 1N5JA 1HE8B 1UKZA 3MWJA 5G41A 2AKYA 3RS0A 1XFAA 2E9SA 1EFCA 4W9MC 3EAQA 1P5ZB 4DT1B 3G0HA 1HY3A 2K5UA 4I4LA 5JEEA 2ZTSA 1W4CA 1E0KA 1JR3E 1GWNA 1E9CA 1X1RA 1P62B 1Q1ZA 1NVVR 3A4LA 4ZI3A 1G20E 4LV5B 5L3QA 2Z43A 2XSZA 3GJ5A 2BIFA 2QE7D 3A36A 5DI3A 1R10A 1D9ZA 1KO7A 2YC4C 1O3YA 5TV2A 5DGXA 5CB6A 2FFQA 2V1XA 3QVUA 1NY6A 1F48A 3EZ7A 1OXUA 2ZETA 2OCAA 1TTTA 2BKUA 2ZJOA 2OE2A 4GZMA 1NN3A 4DSUA 5K8TA 1KIMA 1MABA 3K0CC 1ESMA 3HDTA 4MYTA 3P20A 5CDFA 4DRZA 1Z6TA 4LBVA 2QGNA 2RGGA 1EFRA 1KGDA 4B6FA 3SC3A 3FGNA 1UBCA 1Z28A 3BORA 4QM7A 4AG6A 3LFUA 1KJYA 1M7GA 4BEBA 1EFTA 1Q12A 4XD7A 3Q3JB 3SDZA 3NH9A 2OO7A 1Z22A 2PCLA 4JLMA 4OI2A 5C4MA 3PEYA 3BRWD 3KUCA 3QSYA 2QT1A 4LK2A 1NG9A 5KYKA 1OH8A 1R0ZA 3EZ9A 3TAHA 4PPGA 4BE7B 5UKDA 1AGPA 1D2EA 1TU4A 1X3SA 1E79D 2A2ZA 2C98A 1G3IA 2VP9A 3AP2A 5F2EA 3QI2A 4ESVA 5CJPA 1SXJA 3MWKA 5BYJA 2J41A 5CLQA 4AKIA 1HT2E 4OQLA 3CPEA 1CS4C 5KO2A 3HR7A 4OK6A 5JS7A 4JLVA 4LJ7A 1XTJA 3QKRA 4DB4A 2WV9A 5DE3A 2GK6A 2ZVQX 4Q7KA 4TL6A 3I92A 4NCIA 1ZUHA 4C0QC 3U44A 3M0EA 4WZ6A 2IEYA 2NQ2C 2RGDA 3A1SA 4PC7A 1XWIA 2FZLA 2ZRLA 1ZUNB 1FOEB 3A1WA 1G5RA 5J4KA 4Q21A 1KSHA 4Q1FA 5DO9A 1H8EA 3I1FA 1T91A 4DDUA 4WZBE 1ZD9A 1MOZA 3L2OB 1W47A 2R6GA 4V0MA 1GRNA 1R0XA 2ZJAA 1Z07A 1SHZA 2ERYA 3RHFA 4M4SA 2O0JA 1EWQA 1XX6A 1SVLA 4C0AC 1PJRA 4ZDIA 2QMOA 3LBIA 1XEXA 5FOVA 5P21A 4NL4H 3QKSA 3T1OA 4ARZA 3CZQA 4LZZA 2FDCA 1NKSA 2QPOA 3CWZA 2WSSA 3DHWC 4YMVA 3EZFA 3T34A 3LRPA 3NVAA 5EE3A 2VSXA 3LLMA 4I81A 3C41J 2DFTA 3X1XA 4LJ9A 3AP3A 5LBIA 3BK7A 3EW9A 5FUWA 3SI7A 2KE5A 2H17A 4TYPA 1W2GA 3OEHA 3KUDA 4OK3A 4PFSA 2IYYA 2YC2C 4HAWA 1KNXA 5LDDC 2QE7A 2DYKA 3M4YA 2YHSA 1JALA 2NTYC 3AVVA 4P4TA 4WZAE 1CR1A 4D2IA 1H65A 2R6FA 4HDOB 3QF4A 2IYUA 2QQEA 5JHHB 1ZJ6A 2RMKA 4XH9B 3TSZA 3V4RA 2EQBA 1XPRA 2QEQA 2B7BA 2Q3FA 1ZD8A 1H8ED 5KSZA 1LF0A 1E1RD 3LD9A 1VIAA 2B8TA 3MRSA 5DNYB 3R8FA 1BYUA 1TQ6A 4CDGA 1EGAA 4ZIRB 3R8CA 1M7BA 4BFYA 3DVLA 1WB9A 4OHXA 3KKQA 6Q21A 1PLKA 1T5LA 2X77A 2C8VA 2XX3A 4C2TA 2C95A 4Q18A 4LRWA 4JLNA 3ZH9B 421PA 4CYMA 1KSJA 3IQXA 3RRMA 4Q9KA 5FBVB 2R6CA 2ZS9A 4RKFA 2O8CB 4PQFA 4QGGA 4D0GA 3SBEA 2ZSFA 3IO3A 2QBYB 2YWFA 4YXWD 3VNVA 1AS0A 3U7HB 4D0NA 4FIDA 3FMOB 5SZIA 4AKGA 3RS4A 4LHXA 1Z6XA 2VHQA 1VYVA 3SS8A 2GXAA 1Q0UA 4HDQB 1JECA 2EFGA 2IX3A 1S1CA 2JJ1A 2GHIA 2QNRA 4MGKR 2JA1A 4YMWA 1E0AA 1XNJA 4PPQA 3NEYA 1EFRD 4PX9A 2J3EA 3NBXX 3NKVA 1G17A 4ACAA 4I1VA 4L4UA 2ASEA 3SFVA 2JDID 5CK5A 4DBLC 1K6MA 3GJ3A 2Q0HA 4MUBA 2ZYUX 5FBWB 3WRXC 3CF0A 3QG5A 3M6AA 3PVSA 2G9NA 3UPUA 3ZZ0A 1XP8A 4B3XA 3QPVA 1KTVA 3VHLB 2HCBA 3BXZA 4PC1A 2CK3A 4PZYA 4PQYA 1A2KC 1KI2A 1Z08A 2AK3A 5ELXA 1JJVA 3QG1A 1E2DA 4EUNA 4D25A 2IYQA 2XGJA 4TTQA 2DY1A 2RGEA 1VPLA 4OQFA 3CF6R 1AKEA 2WMOB 4HATA 4DSNA 2XSZD 4PO9A 1N6RA 3PFIA 4KODA 1L4UA 4B3DA 2QTVB 3EIQA 5K8LA 4WAUA 4W5JA 4TQAA 4IRUB 1RYHA 3VX3A 1DAKA 3D8BA 4JVNA 2V4ZA 3ADBA 3CH5A 4AG5A 1A82A 3DL0A 3OAAD 2CLDX 5J47A 2ZAOA 1NMZA 3K0AB 4XWKA 4Q9JA 2XNSA 3O8RA 3IIMA 3OIYA 3GLGB 5FPHA 2BCJQ 4A0GA 4K81B 3T1TA 5BXQC 4ZPXA 1FMLA 2YINC 3DOFA 3OEED 1ZINA 2KB0A 2ZJBA 4F7WA 2O8BB 4EQ6A 1Z2AA 1KI7A 4TN1A 2JAQA 4IFEA 5TARA 2REBA 1YE8A 2IL1A 3BD9A 1HA3A 5GADl 4Q03A 2PMKA 4RJLA 3CM0A 2W2TA 3AVXA 2BEKA 2VLIA 4QNRA 3SQWA 2QSYA 3WBJA 3L8ZA 5EP1A 2QAGA 5EE1A 2C9CA 2QQ0A 4A9AA 4Q00A 2V8OA 1P61B 2GEVA 4MGZR 4V02A 4Q02A 1P72A 3KKNA 3OFNA 5KUTA 2QROA 1JEEA 4WVFA 1P2VA 2CE7A 2QMHA 1GM5A 2IUTA 5IDVA 2WKPA 2OAP1 3EIEA 5EE0A 1IN8A 2ZEJA 2D06A 4S35A 3T1VA 1Q44A 2PT5A 1TX4B 4FMCB 3U6KA 1YZNA 3JZAA 4HAUA 5C1BA 2ANBA 4BQSA 5DI9A 1H8HD 5GVSA 1BH2A 2FE4A 5EXXA 1R7RA 3EC2A 2OBMA 2HV8A 2NO9A 2Z4RA 4GOKA 1HTWA 2NO0A 1N2CE 1ZU4A 2FFBA 2D7CA 4KV9A 2ZS8A 2RGAA 1LNZA 1VG0B 5DISB 1KZGB 2C9OA 5FI0B 3QNUA 1GUAA 1GL6A 1JXMA 1KK1A 5TVKA 4UNPA 3P4XA 4R7ZA 4RCZA 4BASA 1KSGA 3U61B 2ECKA 2YOHA 2QN6A 2AX4A 4CEIA 1A7JA 5FTJA 4CZ2A 3GJXC 5FI1B 3EPKA 2V1UA 2I1VB 4RZUA 1ZM4A 1KKMA 4URWR 3W8RA 5HKKA 1OJLA 2X1VA 2IYVA 4AYTA 4O3MA 1M34E 4KO8A 4DDTA 1QVRA 4B6EA 4UNQA 2V6IA 4FI3C 1NVXQ 2VYFA 5M04A 2EU8A 4UKDA 2QORA 2ZREA 1O87A 1OYYA 1OE0A 2CE2X 4TLCA 1KO5A 3VMFA 3T1QA 1T8TA 2JIZD 4K8OA
chains in the Genus database with same CATH superfamily
4DYVA 5DSZA 1XDGA 3HC7A 3K4HA 2PKEA 3CINA 2X0FA 1IHOA 3OKPA 1C7QA 4KMSA 3A9TA 1F2TA 1TZBA 2QR2A 1ZICA 2WTBA 3KS9A 4U63A 3WGKA 4NNOA 3GXBA 2C2HA 3GDFA 2EFJA 4HUJA 3IUEA 3EEBA 3PBKA 3L7MA 2VK2A 1KE2A 5DM60 1QV9A 1CIPA 3DMDA 1W85A 2OQVA 4I1OA 4X24A 5JH7B 3QPUA 4LYGA 1BXGB 2P0YA 1ES9A 3FPAA 3R0VA 4FD2A 5EVCA 2O2GA 1EX9A 2CMKA 3P8ZA 3SSMA 1XDSA 1SZCA 3OHMA 1P4AA 5IAEA 5C34B 5CLFA 1RJFA 4URYR 1MHTA 2ZDHA 4WJKB 5BW6B 1I7SB 4FEEA 2IIBA 2Q2NA 3HDHA 1R9GA 1WDTA 5TQJA 1QX3A 3CTMA 5K0ZA 3OJWA 1CIJA 3KJZA 2NT3A 3R4VA 1JA0A 1PJLA 3P4UA 3L18A 4JX8A 5LCXA 1EJ0A 1UKYA 2O2HA 3H5OA 1BJRE 1MRZA 1U8UA 1W5SA 2XRYA 3NXSA 4D9GA 4FX5A 3VKGA 2Y9MB 1UT6A 2JA2A 2NZWA 1S2LA 1O6GA 4G07A 3FVVA 4B3IA 5CLJA 4MWSA 5L9AA 1ZR4A 1YK1A 5HBRA 4M76B 3H1TA 1XDUA 4PQRA 4EECA 4IGEA 4L0CA 4X8MA 4JJIA 4BNKA 1ZL0A 2VP5A 1RE1A 4CLRA 5KREA 5AVVA 1WCXA 2YCLA 1JEJA 3EARA 1I9CA 3PFCA 2VN8A 1JAXA 1NC3A 1YZKA 2DCMA 2JHCA 1PUXA 2G83A 3M9XA 5LZ8A 3TNJA 4AUMA 4XVUA 1YJAA 3OP4A 4M0MA 3VSCA 4ZDKA 1E8NA 1A2OA 1F4LA 5CVTA 2EGHA 3O2SB 3AG6A 2UYHA 2ZXUA 2IXTA 3BGOS 4FMCF 4LNHA 3EFOB 4G85A 3S8MA 3SOZA 3O9ZA 1P7CA 3K53A 3PXUA 3UUGA 5C7LO 2EL9A 3I39X 1EUYA 4KQXA 5IJWA 2CLCX 4PZ9A 1WP4A 2P5YA 1VXRA 2INGX 3B51X 3DDUA 4NZMA 2G0TA 3VR4H 2BKVA 4RESA 3PFHA 1IJKA 3KB1A 3KJIA 2AWOA 1D7OA 1QSGA 1XMJA 2O7QA 3M49A 3QUTA 1WETA 1RE0A 1H8HA 2W90A 3ICVA 2GD6A 3QIVA 3VTAA 4OSEA 4PLPA 3SNHA 2FRXA 4IEEA 1UJ2A 2GBLA 4E5MA 1BVUA 4GUDA 4LNUA 2VT7A 3UA3A 3ZI4A 1BVYF 3AFIA 3TE6A 3UAGA 4I2VA 4O5AA 1GZDA 4BP9A 3JPWA 4LQDA 1UZLA 4Y6SA 3LJKA 4ZK2A 4CVNA 3Q87B 4M55A 2WHPB 1DPFA 4N7MA 4NYIQ 1OI3A 1RPJA 1U31A 1W49A 1K66A 4GPEA 3ILYA 2HRCA 1PW5A 4Y8VA 3HCBA 1ENZA 1EVYA 4YV1A 1FU8A 4B75A 2FVXA 4HEA6 4XVQA 4HAYA 2JLBA 4BNIA 4QOSA 1NJ1A 3H3XA 2D8MA 5TS2A 1SG0A 1W46A 2FRDC 3EG9A 1QQBA 4RAQA 2EF1A 4W5OA 4JLBA 1E9DA 3ROFA 1E3LA 2N47A 3B1YA 4I4CA 2VXYA 2QP3A 3ZLBA 5COAA 1MFPA 3KSBC 2CNNA 3CC8A 5KOJA 4OX9Y 3WQQA 4HDNB 4YP0A 5LR6A 3UCEA 1GEEA 1VCHA 2HWXA 4JQZA 4O59O 2MYUA 3ZVKA 1IXYA 5JDIA 2CUNA 2Q07A 4KSBA 3C1OA 2XHEA 3FBWA 1PTJC 3MCAA 4RXTA 4XDZA 2Z5FA 1Y1LA 2AFIB 2P5TB 4IQ8A 3VSAA 4BVJA 2VH1A 5CX1A 5KQLA 3PUVA 4FK8A 1CS0A 2WG0A 4DMLA 1X92A 1WUYA 2GN6A 3UFBA 3WGTA 2PMFA 5AVZA 3HCPA 1ID1A 3GLRA 1YKGA 1LSUA 4ZYLA 3V8RA 4IIJF 4OSPA 1GN9A 5DNDA 4TS4A 4YLGA 2I3ZA 3KWLA 4AWXA 4QTXA 2DTXA 3BUSA 1TZCA 4DQVA 2PR7A 5FJJA 4OMDA 3LQ1A 3PZBA 3GUVA 3IJ5A 4ZO4A 3EWSA 2YTZA 1P2SA 3SJZA 2X2FA 3ZBUA 4DIDA 5JFTA 4P2BA 1W4ZA 2AYYA 2BMAA 2K7ZA 3OLYA 1IY0A 4ERXA 4CF5A 2IIQA 4L9AA 4QG3A 3JAKA 2Q0SA 3QKSB 1YT5A 5IJ0B 4H4EA 1I3NA 5IKPA 3GFPA 1J6UA 1ECLA 3OPXA 1OUMA 1YR6A 4TV9A 4WNCA 2CB9A 2H65A 3SZ3A 2GI4A 4DC9A 2G17A 2GLUA 5DXFA 1Q20A 2AA3A 4WA7A 1U3WA 1QE5A 1XCJA 3QLUC 4MUGA 3RARA 4KQCA 2PEYA 1JG1A 2JH9A 1MEEA 5EWMA 2Y6UA 4ZHQF 1LY1A 3CUUA 5CFPA 4ZEOA 1W5TA 4JL5A 2VJAA 2D13A 3DXFA 3RVNA 4EHNA 5BMOA 1UBNA 3MIZA 4EUSA 3RS5A 1QHIA 1I4WA 1N2SA 1SURA 4V0LA 4QHTA 3U62A 3AUKA 3G23A 3IIEA 2Y1DA 2HTEA 4QYWA 1OH5A 1OBFO 2IGTA 4J9VA 4R9SA 5EAIA 3KIPA 4QJ4A 1NOIA 5L3ZA 2O5VA 5K2MA 4C6TB 3UJAA 3MB8A 3HWX1 3SKXA 1XDDA 3VTFA 3MLBA 3QXHA 5F12A 2ZI5A 5EHZA 5IZ4A 4OXXA 2OVFA 4HNAB 3UAXA 2QYOA 1JDTA 5GV8A 4C1NA 5BN3B 1QAQA 4E15A 1MC5A 2ZQ5A 1M1ZA 4L78A 4TXLA 2RGRA 3BL8A 4WW0A 4ZARA 3MWLA 1J56A 4BNHA 1W44A 3ENWA 3DKRA 4ZREA 1J5XA 3HFRA 4DXAA 1N3BA 2GZRA 3DT6A 3ADPA 5EPUA 3DTVD 4WK0B 1BGXT 1QV6A 3AILA 4IDOA 4UM9D 4CKZA 5EWJA 4MULA 1OAOA 1K7FB 9LDBA 2PUEA 1QZXA 4HMOA 3W4IA 3SZLA 3EFOA 3RFTA 4DGSA 4ZHQA 5B3AA 2ZJ4A 1NWHA 3ZV7A 5HS4A 1PTKA 1ZNYA 4M8IA 5JNSA 1W7AA 3M6FA 3BIJA 4GQBA 4U2EA 5F9FA 3P0RA 1U1IA 4Y1EA 3UXHA 2IHVA 4Q37A 1ETUA 3OBIA 4NV1A 5I7AA 4ZMBA 5EJGA 2DPGA 4PZ0A 2ET6A 2RIPA 3LZDA 3KSDO 3LPDA 3KQNA 4DPKA 3EEFA 4DV0B 2PD4A 4MW0A 4YUZA 5JVDA 1E64A 2JFGA 5KTMA 4B2PA 3ANNA 4EYEA 4W7SA 2PGJA 1SMKA 2XTMA 4KAAA 4W1QA 3L8EA 3O8NA 2NO4A 3CGGA 1MQ8B 2B4AA 1E9RA 1DI0A 1WEKA 1Z8FA 3ND9A 1I2BA 4HUTA 4MTLA 1L3IA 3A3NA 1L7EA 3S0JA 5AVSA 4L4RA 2CNOA 2YZ7A 4X1YA 4FYHA 2ONZA 4IIJA 3TBKA 2LV8A 1G9SA 3JQRA 1UPAA 1KK2A 5CT8A 5DW3A 4Z51A 1YE5A 3C8MA 5IJ9A 2ZYDA 1TD9A 1E3IA 5EP2A 3Q1KA 3QVVA 2HA5A 4A6EA 3ETEA 1CE8A 3F5FA 1S7GA 1TJNA 4UQLA 2G4CA 4RZSA 3A9CA 5SYMA 4OU5A 5FBVB 4ZVRA 2W2LD 3ILSA 4HSGA 3K0SA 1IXSB 4DLXA 4O4HF 4RYLA 3DOIA 5HTKA 4KFTA 3J81k 2YX1A 5C4IA 2H85A 3DTVA 4JSYA 3T15A 4TTSA 4CM7A 2CT8A 1VLVA 2EIXA 1G16A 1ISGA 3WLEA 4BNFA 5I5EA 2I33A 3L7KA 4HYQA 4TQ9A 4BAZA 1Y4DE 3LPMA 2KI5A 1O6ZA 2QENA 3C8UA 3TB4A 4BFLA 1R0BA 3EB9A 3N2LA 4C0KA 4QJ3A 1N5DA 3D2BA 6PFKA 1Z7YA 2I29A 2RHCA 3K31A 3ZWAA 1LDEA 2MMCA 2PYIA 2NW6A 2YBEA 4PGAA 2ZDGA 1Z26A 1GL9B 4AJ9A 1GKUB 5FOTA 2Q45A 1RAAA 1QIHA 3PJEA 3WGMA 4RNCA 2XVXA 3FPEA 3D3WA 1ORDA 1RI2A 3N74A 2HCRA 4NNPA 3GJSA 4YAUA 3DAYA 4I0WB 1GL7A 2V03A 4X00A 4MIEA 5H0IA 1QB8A 3VNBA 1T6NA 4INZA 2BT4A 5JRDS 3DF7A 1Q0PA 4MHOA 3PPWA 1YRYE 2XHZA 3U3MA 1STOA 5ESXA 3AETB 4MRRA 2UYGA 5EWLB 3QM1A 1ZLXA 3C7CB 3WV4A 1GPMA 1KORA 5FR1A 2DFNA 1GPDG 4C7XA 3PPYA 3ROXA 3NC1C 1Z4QA 2HPHA 1Y3AA 5HDBB 2I8AA 4DCPA 3K70D 3WO0A 5HF5A 2I99A 4D43A 2GDZA 3B1XA 3CZPA 4LOAA 5BORA 1H4VB 5DLQC 1UM8A 2YXPX 4JUFA 1TNDA 5REQA 1UMBB 2H1HA 4DM3A 3E2MA 3P96A 5LUBA 3S28A 4JUCA 3ODPA 5BNFA 3FTFA 3E1GA 4ZEWA 1KI3A 1VFNA 2W4QA 3PTLA 1WXEA 1LRJA 4R3WA 2C7QA 3SQXA 1SVOA 4HUQA 2FRVA 2G36A 5FXMA 2SECE 1Y5IA 3HDGA 4PCLA 4Z4IA 3NWJA 1VKNA 1FDRA 3N3AC 1I2DA 1XVUA 4IMIB 4D82A 4A2PA 2NUPA 3MT7A 2BZ0A 3W34A 1Z4IA 3CLUC 3UMGA 1VBMA 6AT1A 3AYZB 4CI9A 2B2XA 3AU8A 3MTGA 4DA7A 1GA6A 2YZMA 3CNOA 4WOCA 2Z56A 5DYYA 3H11B 4JT4A 3SBOA 2KX7A 4JI6B 2H4WA 2X6TA 1XJ0A 1F38A 2FMXA 2GPAA 2IYLD 4M0DA 3ML1A 4TVKA 5BN3A 2UZ4A 3QXSA 4BWGA 4EARA 5AHXA 1DWQA 3FXAA 3H5WA 1FSFA 1VSTA 3KALA 3L6UA 4R1MA 3G79A 2EP8A 2X76A 1AB5A 2FFJA 3QF7A 4G84A 1QPGA 4JEMA 4JQYA 1T3LA 2TMDA 2ZVPX 2WKQA 4G2NA 1U2DC 2PU7A 2VDOB 2RB4A 3OIDA 4R5HA 3I62A 1ISSA 4AECA 1V1MA 8OHMA 2CYBA 2BGLA 1TA9A 2NGRA 2A1IA 3F97A 4G0QA 4MS4B 3BL5A 4TRJA 4YQEA 4BO6A 2Q2WA 4XWOA 2N1MA 4J43A 4KQMA 4KUGA 2ADOA 3GLVA 4AP6A 5B1EA 1CG6A 3C6XA 3K8OE 3KOYA 4HLUA 2C5FA 1EP2B 3IODA 4R8MA 1IHUA 1ACJA 3H2IA 3I9V6 1NW6A 3P26A 4DXHA 1FNCA 2SBTA 2YNMD 2H1OA 1YTLA 3DE4X 5I6DA 5DH9A 4ARAA 1XMQB 3GIDA 1I1HA 3DQPA 3ZK9A 1TQ4A 3VPSA 1NKVA 3FCAA 3JW8A 2I1LA 4XWGA 3L1UA 1XJWA 1RI1A 4GKBA 5KVQA 1JXOA 4KH0A 3ZHRA 1UMDB 5KDDA 4U8GA 2BFEA 2C3OA 2ZIXA 3C74A 1T6BY 2W70A 2H63A 1UQRA 4FTWA 3RUIA 3BULA 2A0FA 3U80A 1D0VA 3B6EA 1FDOA 1KI8A 1KAOA 1U3CA 2A4MA 4ND8A 4QU8A 4RHYA 4S0XA 1E59A 2EKQA 5CD9A 2CEKA 2EX1A 2R1TA 4I9GA 2FFAA 1AK2A 2OV8A 4IIJB 3VHXA 4MQ5A 1OFUA 2O20A 3CE9A 4J9UE 3SC2B 4D56A 4D9JA 1RM0A 4RF5A 2F62A 5E1MA 4ERNA 3CF2A 4TS1A 3LL4A 3I72A 3A6DA 2EERA 5EOVA 1P0PA 3TZCA 4FGLA 4EO7A 2J1LA 2OOSA 2CFCA 3ZYZA 3VU9B 4BYMA 5BNTA 1JNXX 1P18A 3W1WA 5J58A 4AYWA 3AI3A 3HKEB 3WIOA 4US2R 2WWGA 4TVOA 2X8LA 5FOSA 3KHUA 3T9BA 2JCVA 4ML3A 4BTVA 4DREA 1QF6A 3FZQA 1I4LD 4LDRA 2QL6A 4M36A 3T7JA 1L5WA 3FMFA 1QXSA 2DWUA 3CLUD 5FEMA 4G5SA 1JFFA 4M53A 3VR3A 3NGLA 1XXHE 1CQXA 2Q28A 2QRQA 2WRZA 4UZSA 2O52A 4PICA 3RYTC 3GPCA 4MO2A 4E2WA 4JIGA 4TV8A 2PRKA 4YP9A 1M8GA 4E5KA 4JBHA 1WSAA 3GDHA 1U2QA 2OD2A 5ALRA 4L0MA 1OH6A 3LLSA 1O96B 4HXEB 3CTPA 4UAGA 1IZZA 1PGJA 3I05A 1CDOA 2SCUB 3DULA 1R4MB 3I4LA 3LXUX 4IOKA 3K71B 1DAFA 1G21B 1FTNA 4CV0A 1Y9AA 5BOSA 4JI7B 2ZIVB 3W2HA 3NHAA 4MV7A 4P31A 5EIOA 2I6FA 3DTNA 1VMIA 4UZEA 1UIRA 1PJBA 1ZGBA 2YY6A 4J0FA 5EEGA 3UQYS 1NMSA 2XAUA 4IJQA 4G9BA 4FT2A 4EKDA 3I8SA 5KU1A 4P3XA 4X60A 2O8NA 2XMZA 3FHTA 3ICWA 3AVPA 4M8NE 3I45A 4JYAB 3UBTA 1TZKA 2IUSA 5K4AA 1CVRA 4RY0A 1CKEA 2C03A 2HRQA 2IP2A 4DSOA 3G2OA 5DEIA 8ATCA 4L51A 4X54A 1WZ2A 1BDMA 1UZAA 3UOAB 1QIJA 2OECA 2SKEA 5E2IA 1QCYA 1NGSA 4LJYA 3QEOA 1E32A 1XFDA 4OO3A 1CJMA 3KQWA 5CG2A 3U4QA 1HURA 2XTZA 4P3OA 3AFOA 4G5YA 2IA5A 4AZ3B 2RIRA 5KTRA 4C7OA 3GBPA 3VM6A 4U5XA 5ALPA 4WINA 2V6FA 4HQ6A 4QUHA 2NQTA 1KZ6A 3SSNA 3IOBA 1H94A 221PA 2GPBA 3F0TA 3PJGA 4K9NA 5KI6A 2A67A 2OEPA 3Q0IA 2GCEA 2V9PA 2VF5X 2EYUA 4LSMA 2IPXA 4URHA 3WMEA 1W75A 4D9KA 1H6AA 5ADWA 1ZNQO 2XXAB 4UJ3A 3T7KA 2JIDA 1NR7A 5MGNA 5B7QA 3RSCA 1PL8A 1A9XA 3GRPA 4MLZA 3RLFA 1DRWA 4L9WA 4EITA 4Y2QA 3WAKA 3N2YA 3EW7A 4EFLA 4LY3A 2TMGA 2GNPA 3WVNA 5A5EA 3IR7A 1I6LA 1WLSA 3FDIA 3I37X 5G3YA 1LX7A 2QTAA 4RF2A 4J29A 4JGBA 5DNCA 3UJ9A 2PLRA 5C18A 3SNKA 1PK8A 3O4GA 3DBRA 3T61A 4DM4A 1KEUA 2EG9A 2I71A 3QLVC 4ER3A 5HTOA 2F8MA 4UBIA 1RXVA 2YVAA 3NOOA 4EJSA 2CZQA 1J0AA 2PSDA 4ARCA 3G2KA 5AICA 3ITEA 1GPUA 2WM3A 5LDGA 1K8XB 3OZXA 3UTDA 1JUDA 2FMUA 2LD4A 3NWOA 1T9HA 5L3SA 4GSLA 2XCSB 1X9IA 3RFFA 1X1DA 1TQHA 1DEKA 4Z4EA 1Y0BA 2IOQA 4G4IA 2AYXA 5G1OA 4BNUA 1QGAA 5KYWA 3HTXA 1W0JA 5DBHX 2ZFUA 3KR9A 1UBFA 2W6ID 2V59A 4PZPA 3AFGA 5L4NA 1EWTA 2D1SA 3ZCUA 1PWHA 1JHQA 1SR8A 1UDXA 1V35A 3F67A 3RUHA 1HDYA 1Q84A 2NAFA 3IBSA 4IAOA 3VU3A 2XOKA 1JBEA 3SYTA 4AB1A 1REQA 3N2ZB 4ZQCB 4BQFA 1IVNA 1PQYA 3PHCA 4J1QA 2X0DA 2QD4A 4UTRA 5MHTA 1YHZA 3A6JA 4WQMA 2D1QA 2ODEA 3PCXA 4C03A 1N5KA 3I04A 2JS7A 4GM1A 4V0NA 1JJIA 2H06A 2OD7A 3D3NA 4PLFA 2FYTA 4RFVA 1HI9A 1QLJA 2A0XA 4EBBA 3OZ7A 5K3OA 1LC0A 2DAPA 3R9XB 3GJ6A 4Z8XA 3LCCA 3RT9A 1I01A 3WZLA 4DCNA 1GZ5A 3IMEA 2TYSB 1L4NA 1PZNA 3R7WA 4H59A 3U39A 4ZCIA 3TRIA 2R4TA 4N49A 4RY9A 1N6LA 4B4UA 4PHHA 3WL3A 2W6JA 1Q1GA 2BSXA 4KO4S 4LMBA 2HYIC 1VECA 1FX1A 4PG8A 1O97C 1NJSA 4M1QA 1HEUA 2J3HA 2YYAA 2WM2A 2O3SA 1HT3A 1QTIA 4JVMA 4BIMA 2QW8A 3A7DA 4PINA 5IN5A 2OCPA 1UQUA 2YVQA 3RTEA 1POWA 5A04A 5EP4A 3BJIC 1MJHA 1QE3A 3HN7A 3QPAA 3UTCA 2K87A 4G5OA 3FROA 3LXMA 3AVYA 1B6TA 1BD4A 1G3MA 1NR1A 3R9IA 1C1YA 4OB6A 7GPBA 3WKAA 4KDEA 3IJRA 4TRRA 1HDZA 1UBEA 4TSFD 2MR6A 2E4AA 1W8DA 4MVYA 1JFFB 3U4CA 1P4SA 4N5DA 4EY6A 1I7DA 4Z49A 4U2GA 5ALQA 5M34A 2CVOA 1J8QA 3LWNA 4C30A 3VXKA 2VQSA 1XZQA 1GKLA 5KQRA 1SQFA 2ODBA 5TE9A 2HWUA 2PX2A 1SRQA 2R6DA 4KN5A 3TGWA 4DBVO 5A7FA 2DRIA 2QF7A 3ETJA 2LPMA 4TRMA 3W9UA 1T10A 1S2GA 2M1ZA 1GA4A 2HPZA 2P9EA 2P41A 3ZU4A 1DADA 4YP5A 3ZGXA 2DQYA 2W48A 4C1BA 1PHPA 3AEQB 5DTIA 1JFTA 4J0CA 5AM5A 3T5GA 2AUNA 1E2BA 1W5BA 1U1EA 1JKJA 1YZHA 2QB5A 3MBKA 4B8WA 3FOWA 1AA6A 5C8YA 2JJ2A 2C3UA 4WFKA 4XFKA 5GONB 5IJXA 1QGYA 2BDTA 4RY8A 2IPAB 4FBLA 4URZR 4D8VA 3HP7A 4FZJA 1P73A 3ICCA 4MUJA 3WGOA 3WLIA 2YWXA 1U02A 1XZJA 2JC3A 4MX8A 1X1CA 2F55A 2R6ZA 3KLOA 4Q6BA 1JHVA 1B1CA 1BMQA 4L1KA 1G8SA 3FKQA 4LHWA 2FUG1 1CERA 4QRIA 5DX1A 1CIVA 1ABEA 1RKXA 2VJNA 3BMNB 4G97A 3ZY6A 1JQ5A 4EJ6A 1F1BA 4Z3OA 4JUBA 4EMTA 2NSJA 2AJTA 5F5XA 3FDZB 5LQCA 1A9SA 4FNGA 1FYFA 1NXWA 4C5BA 1E7WA 2BHRA 1G7RA 3F46A 4YECA 3SKVA 2XNKA 1IDN1 1K8YB 5BMVA 1PYOA 4C6TA 2UUCB 1PLLA 2XDWA 3C16C 4EP1A 4XWYA 2FQ1A 5ITVA 5GOZA 4PR0A 4R3NA 3GU3A 1J24A 4GWKA 4R54A 4BGDA 3LQ4A 4Q4JA 1I0LA 1MKYA 2PWAA 3BF8A 3HACA 2VBCA 3KE9A 3L8FA 2Q1WA 3UQZA 4CM4B 1NJ5A 4OTZA 2GK7A 1QHSA 4L5YA 3F8SA 4MV3A 2FSHA 5D86A 4E4TA 2WFZA 3NLLA 2ZI6A 4ZOEA 2F2TA 2FN3A 3UG7A 3PPXA 2V3CC 4X92A 3MC1A 3OLVA 5DNEA 5AW6A 5DCWA 2V5VA 3IB6A 1M75A 3DVAA 3OPYI 1V43A 3PEEA 4YAJA 1W96A 2IU4A 3GUCA 4A10A 4ADSG 4BBPA 2WZCA 4C06A 1SCKA 1Z13A 3DPSA 4NMWA 3PE3A 1QHGA 4HMPA 2PFKA 1IAQA 1OAOC 3OCCA 4YB8A 2HEIA 5FFNA 4BVFA 2VRBA 2VWHA 4OY3A 3R41A 3H1FA 5AUOB 1N7GA 1W25A 3K92A 5BRNA 4HC4A 4EG6A 1APBA 1ADJA 5DHPA 2AXEA 1ZRHA 2JIBA 4BN5A 3B1FA 3EIOA 1KFCB 1YRHA 3JZMA 5ECWA 6NULA 1XYYA 5JARA 3E8SA 5TRTA 1CZOA 3UENA 2OHFA 2XQIA 1HLDA 2CDBA 3WLHA 1P1RA 1W1UA 3DC7A 3IIJA 4YCBA 3SQOA 4F8YA 5ADUS 5ICEA 4IZ6A 3VDRA 2QL9A 2UVDA 2QTNA 1UFQA 1CB0A 1EDEA 3HMQA 4OHPA 3C8HA 4YY3B 1G98A 1Z3CA 1JTEA 4DS3A 3LMKA 2X23A 4X1YB 4WECA 3QFTA 2AXNA 2VPYA 2PG3A 1NVTA 3O2NA 1EBFA 1V95A 1VOTA 3ORSA 4TWAA 3UJPA 1US8A 2XMQA 4BFTA 3A6HA 2HSGA 3R20A 2YV3A 1OFVA 3OQ1A 1AKMA 4I5IA 3BXOA 2D54A 1HZJA 1N75A 1Y3DE 2XB8A 4YS6A 3A11A 3L9WA 1XRRA 1ARZA 2VNIA 4MUAA 1HF3A 4QAJA 1K98A 5KVCA 5JWRA 1DMSA 3ND8A 3ODGA 2V55B 1SQSA 5AJVB 1FSGA 5A5GA 4Z4CA 4UUNA 3ZXUB 3CX7A 3MJRA 4XW2A 4DPMA 3KO8A 2QGFA 3H13A 1NW4A 2EZUA 3PL1A 1WUIS 4UNRA 3OY2A 3P2KA 3BILA 3WP0A 1FEZA 1Y7HA 3OEWA 1BNCA 2R8ZA 4BFZA 4BVKA 3W7VA 1U0OC 3GGJA 3S1SA 1KYXA 5LB4A 1S0UA 5E4FA 3QX3A 1WAMA 2QUIA 2D5AA 3MWYW 2PMBA 4GXQA 4Q3EA 3A6GA 3HP1A 3KXLA 3SPXA 2UZ3A 3UMBA 2ZUEA 1BS9A 3HSSA 5JY1A 4J6EA 4G6ZA 1Q5PA 2H4HA 3TTVA 1ENPA 3ESAA 2RK3A 2ZJYA 3KT3A 2B21A 3PUIA 5B2ZA 4YO7A 4U9HS 4BC1A 1OXBB 1OWLA 2UYOA 2XUQA 1YCDA 1JGTA 1I14A 5I51A 2QRZA 2JL1A 3ABOB 3P32A 3TRFA 3ESZA 3LQYA 1N2XA 2AR0A 3OIGA 2FW0A 3EY9A 3QY0A 1IQUA 4J1SA 4AQDA 3SF8B 1UPTA 3H4TA 4DJEC 1TYZA 1JN0A 1ZSNA 3EXAA 1YR1A 5T57A 5HXAA 5KB3A 3DEZA 4HAOA 2X4GA 3H9EO 5TQ2A 2ZS7A 1UEXC 5CNKA 1N1MA 1PD1A 5DVZA 3HCRA 4JNCA 3C87A 2I67A 1CY2A 1OAKA 4X1OA 1SD1A 4W5NA 3A2LA 4LNUB 3UKDA 2PY6A 1Q0QA 1U0EA 2G04A 3VC3A 1MAWA 2DUUA 2OZLA 2BDUA 4Q66C 5IBQA 4OL0A 1ABBA 1E2NA 1HXHA 2BDEA 4IIFA 3K9HA 3UXEA 1HEYA 1JB9A 2GZHA 5JYCA 1JG3A 3ISTA 4HD8A 5I7OA 5LSAA 5BW8A 3DNFA 1WRBA 1VLJA 1BFDA 1UC8A 1S8OA 1XWWA 4DUGD 2B99A 2X9NA 4C05A 3WGQA 1G4AE 1XQ9A 3M2PA 1JSRA 3PUKA 3H4IA 4NU8X 3NCHA 2ZYTX 1EJBA 2BHLA 3OQNA 4YUWA 2R8OA 1M34A 2LE0A 1P5RA 1OFUX 1QCCA 1WXFA 2VEDA 2ZE7A 1I4EB 3G9QA 3MVEA 4L2IA 4X8LA 2E6KA 3L3BA 2HMVA 5E4JA 3PJDA 1OLXB 1KO1A 3NHBA 3PGVA 1YS1X 4UTZA 2V4MA 5H1YA 1XA3A 1JLHA 1IN5A 4NK4A 1QGDA 2BEJA 3LNCA 2ZW9A 1RQ2A 4K28A 3K70C 4ZV9A 3DL7A 4DMKA 1L7RA 4FMPA 4COOA 3ESRA 4S2UA 1JI0A 2GN2A 2O2DA 1W2WB 3RSZA 2A57A 3GZNB 1UEJA 3LT2A 4M1OA 3UWKA 1GTVA 2PZBA 2VYNA 3JWPA 3W5BA 2P5SA 4PFJA 3NRBA 2WAAA 4Y2SA 1CP2A 1Y3FE 5CIWA 2PL9A 3BSYA 1NR5A 2YNMC 3QKIA 2EJCA 1CF2O 1R9NA 4O4HA 1DAGA 2G6TA 4EKYA 1K08A 1BW9A 3MS2A 5KHOC 2I7XA 2YJ4A 5BSKA 4L85A 3GJQA 4XIGS 3ZC3A 4M0CA 1D2CA 5J2UF 4B5LA 2I2XB 2O2SA 1HRKA 1KJ9A 2C3YA 2BGIA 2ZRIA 3DC2A 1P39A 1OFIA 4HQNA 2XKJE 3T0IA 3ZHOA 2GERA 3A9RA 3H99A 3I09A 4TPKA 5ES3A 3KWMA 5EHNA 4Y1RA 2A9PA 1HZZA 1NPDA 3EWNA 5FPYA 2F59A 1T3HA 4IIYA 4JJAA 5AKZA 1JDUA 1SVUA 2O0HA 3AEUA 1OYOA 4OQQA 4DLBA 1E2JA 4JEUA 1SU7A 5ADHA 1EVIA 3C24A 3U48A 1QOZA 3DKIA 3OFSA 4EYKA 1TUEA 4J0EA 2HIMA 3OTHA 1EFHA 3BWDD 3COZA 3GRFA 3IBFA 5CA0F 1PV2A 4KRGA 2GETA 3VKVA 2QAJA 4NG4A 4PVCA 2GPTA 2WD7A 4X8HA 4YMGA 1H23A 3RVRA 3PD1A 2Z83A 3QFRA 2GARA 2ONJA 3SJ7A 2BUCA 1KH3A 3AEKB 4M0LA 1SD2A 5AFSA 5HKLA 1MJFA 1SU4A 5TPZA 2Z2ZA 3BGSA 4HDAA 4JBGA 4Z7OB 2H8KA 1KVUA 2DQZA 1M1YB 2D3TA 4XD7D 3D6TB 2VDPB 1ZBQA 2HQRA 4JYMA 3SS9X 1AQNA 3CCBA 2AEMA 4LF7B 3W6NA 3KR2A 4O3FA 3PXEA 2VEOA 4L73A 4NF2A 1GU1A 1LBQA 4PX5A 1ZCBA 1A9ZA 3TO5A 1GNLA 4E30A 2CBGA 2B4RO 3AC0A 1FYVA 5GVRA 1M83A 1N6OA 2G9QA 4PBTA 3BM5A 5EJAA 3UJ3X 4YNBA 3WICA 3Q15C 5IBPA 5IBCA 1YNOA 3VU9A 1G4HA 1MXHA 1R0RE 1WQ3A 4QBTA 2E3JA 2G88A 3T12A 3D6FA 3FUVA 1RCTE 4FJ0A 4JI2B 3K9BA 5EJIA 2H6EA 2NYAA 4ZVTA 5TQ0A 1K7YA 1XQXA 1G5FA 1RZUA 3BMXA 3IPXA 1SOMA 1N33B 1JAIA 2Y2UA 1NVVQ 1GFIA 4CMKA 1FRZA 4EA8A 2QMYA 4UTOA 2VHWA 2FPLA 3MWFA 3HFJA 3NFRA 1W30A 5KQMA 4K8RB 1K0UA 4PSAA 1Y9ZA 2OGZA 3HCAA 1EG2A 1CWUA 3HPQA 3MZ0A 5IF3A 3B6JA 1IJEA 1Q1EA 1KK0A 2BFOA 3UJ7A 3GD7A 4P7FA 2PZGA 5K4GA 2LDXA 1RLOA 2OC9A 3TJZA 4HBZA 2O7RA 2AHRA 2JJ8A 3UAZA 4EDHA 4EJSB 2E89A 3UV6A 5A62A 2NU6A 4V3BA 3I0MA 4QTUB 4YJKA 3VI4B 1NVGA 3LW7A 4HI0E 4RLFA 3HBMA 7AT1A 4FFPA 2QMEA 2Z04A 3H2ZA 2RHRA 2AX3A 4CQJA 3O95A 4YT2A 1TPZA 2OD9A 3NHWA 3DVRX 3I58A 2XUKA 2AE1A 1GUDA 3G89A 3A3OA 4P6VF 5E7IA 3ZDAA 2W8BA 2GILA 3BEDA 3ZS8A 3C6YA 4IDNA 3GT3A 1EWKA 3KLBA 2GJKA 2ORED 4JLKA 1Y8QA 3BH6A 3TQTA 1D6SA 1U0RA 3GMDA 2HU8A 2CFIA 3QVGB 4PVDA 5KNCD 2XB2A 1RJDA 3BTUA 2J0VA 2ZRFA 2G08A 2NM0A 4XGRA 2LP4Y 3ABSB 1UIMA 4XOUA 5TMBA 2ZBRA 3RS7A 6LDHA 3ANTA 5HRUA 4KXLA 4PC2A 2WG1A 5A3RA 1RFLA 1YBFA 3WX0A 2RSLA 4EPWA 4MXDA 1VG1A 1W1IA 1MRSA 2IQIA 4JB8A 2WFAA 3R7WB 3RSLA 2C7PA 3ZE9A 1YZGA 4N6OA 4I36A 4RPJA 2PT6A 4H3HB 1AMOA 2Q4RA 3DHYA 3R4CA 4WLUA 5K20A 2O23A 2YXEA 1II9A 3CG4A 4BMXA 5TIIA 3H9JA 1VDMA 3LKBA 3ESBA 1N2HA 1R0SA 1WX1A 3OLQA 2JNWA 4ENSA 4H1WA 2XUAA 1UPBA 3ZEIA 4B17A 3T3OA 1I24A 1RC1A 2B36A 2A5GA 1UBJS 2G5PA 3ASUA 2H7XA 1QO0A 3FGPA 4FB4A 3KHTA 1O8BA 4GKAA 2BRUA 4QUKA 3NBKA 3BE5A 4AX4A 2HBRA 5HZHA 3KTAA 1T25A 2X0RA 3RS2A 4WBNF 2DE0X 1J42A 1JFVA 3AVQA 3M8KA 3L7CA 3R7LA 1JR3D 4YAEA 2D0IA 2W6ZA 4YUVA 1CR4A 1WCIB 3SFZA 4POOA 4GS5A 5K6AA 3IE1A 4EW1A 3HK2A 2QL7A 1D1SA 1DINA 1FCJA 1PN3A 4LE0A 1IM2A 3LLCA 3WADA 5JATA 1B8NA 3N0WA 1T0IA 4LOLA 5H81A 2OGWA 4A26A 2YFQA 1E99A 1W5FA 2ZAYA 3E5HA 5LYJA 4G0NA 3RS3A 4G8BA 3WBFA 3P1JA 4Z3KA 2ACVA 1K8RA 2J09A 5EUCA 5K8JB 1SQ0A 3CVXA 2QSUA 3EUWA 2UDPA 4UAUA 1LZLA 5K09A 1M2VA 2PLWA 2XCLA 1N9KA 2ZUBA 3O9VA 4AF8A 4ALNA 3I61A 2ZJ6A 2B34A 1NFQA 1RABA 3WKDA 5LP6C 2PUVA 3NU1A 2C5EA 3A27A 1BWPA 1WB4A 2OK8A 4JN6B 2CHVA 3HH8A 4CF3A 2HN9A 2HLNA 3JV7A 1QONA 4I5GA 2HLHA 1Q57A 2GCPA 3WS7A 5ITWA 4LPSA 4YLYA 1ID8A 5EJEA 3W5UA 5B5SA 2VJMA 5JJLA 1CFZA 1J22A 2PXHA 1S6YA 3DOEA 4C7KA 3BD8A 2H9AA 3DSRA 4F4DA 4GM0A 3OJCA 4KVZA 4EF5A 1QR6A 3S44A 4D6PA 4F11A 2JD2A 1ZI6A 3KB6A 4YRBA 2GAAA 3AZPA 1IOWA 4F2WA 2H1FA 1TKRA 2BEUA 5HFJA 1X0VA 3HB9A 1KFKB 5HJ7A 2JI7A 4QOEA 4KL8S 2ZVDA 1VTKA 3EG5A 1MZPA 1HRDA 5FLYA 4NNJA 4OAPA 3GRAA 1GZ6A 3PITA 3NASA 4YDRA 2JATA 2Q6TA 3LC0A 4EJ2A 2W83A 3R9KA 5BMVB 4KI0A 2YIMA 3EC1A 1P6XA 5CDFE 1BGVA 1K1EA 3DLAA 5FO1A 4TROA 5EIHA 5D2CA 3OLCX 2ECQA 2GM5A 2PZLA 3IJPA 3S4YA 1YZTA 1E6MA 3K1AB 1RHQA 3KVOA 3I5XA 3HUUA 4K9OA 4NICA 4C43A 5EJ6A 4OKIA 3JQ6A 4QHSA 2Y4OA 3MTDA 2CFRA 3V1TC 2Q3DA 4JXJA 3SVTA 1MFZA 3ISVA 4BC0A 2F9FA 2C31A 4HLUC 1Z0UA 4OLBA 3L0IB 5FIUA 2JJYA 3GRKA 1EB8A 3D6HA 1RQGA 1ORIA 4D8YA 5IS2A 1EFVA 4ZZ2A 3AXTA 4HVTA 5CDTA 2ZBQA 1VXOA 3G2QA 2HGSA 2XMRA 4Y2XA 2Z0MA 1YJXA 4MQEA 3A14A 1EK0A 4TV9F 4MIOA 4FQ5A 1SK9A 4N01A 2CCJA 3JAWB 2PKWA 1P2GA 2HYDA 1DCTA 4N76A 3GA7A 3A4NA 4WDQA 1W36B 2JFVA 1MX5A 2NADA 1P0IA 3ZQKA 1J49A 2AK2A 1OX4B 1G59A 2CCKA 1RJEA 4LJ8A 4TSKA 3W5IA 3AEZA 1TQ2A 1WZIA 5DNAA 5DV9A 5DSTA 2CD9A 2WPDD 4P35A 3OTIA 5HUJA 1M2GA 1F0PA 4IJ5A 1M2WA 2W8BB 4DDMA 4F5ZA 1COWD 3EGVA 2J08A 3AU9A 4KO1S