2GRJA

Crystal structure of dephospho-coa kinase (ec 2.7.1.24) (dephosphocoenzyme a kinase) (tm1387) from thermotoga maritima at 2.60 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
HHHMVIGVTGKIGTGKSTVCEILKNKYGAHVVNVDRIGHEVLEEVKEKLVELFGGSVLEDGKVNRKKLAGIVFESRENLKKLELLVHPLMKKRVQEIINKTSGLIVIEAALLKRMGLDQLCDHVITVVASRETILKRNREADRRLKFQEDIVPQGIVVANNSTLEDLEKKVEEVMKLVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dephospho-CoA kinase
publication title Crystal structure of Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) (tm1387) from THERMOTOGA MARITIMA at 2.60 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 61
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2grjA00
3LX5A 5D3MA 3PQCA 1W1WA 4IHQA 4Q7KA 4HLDA 3U5ZB 1AKYA 2WPDD 5F2EA 2CNWA 3TLXA 3K09A 5CK4A 1AKEA 1R0ZA 4RD3A 2IBMA 3CX7A 4KV9A 4C0JA 3EPLA 3ZVRA 4UNNA 2J0VA 3SEAA 1Z3IX 2ZUDA 3IEVA 3BOSA 1G9XA 1E2JA 4FN5A 1Q20A 2ZUBA 1J8MF 4XH9B 3TRFA 3CNLA 2R65A 1AIPA 3HR8A 4JVSB 4TL6A 4DUGA 4IVPA 1ZRHA 2LWIA 4CYMA 5HTKA 1P9NA 4ZDKA 4C4PA 1AQYA 4JMPA 4NDZA 1G8PA 2R44A 3WMFA 2OZEA 1KIMA 4N3NA 2PMKA 2QROA 2QM8A 1Z0AA 2CNWD 4DCTA 1TMKA 1HYQA 2BJVA 4GOKA 3K53A 4NCIA 3IHLA 1XTIA 1NVVR 4V0OA 2ZRBA 3RAPR 3I5YA 4G5GA 4Q7LA 1P73A 4U5XA 1IY0A 4CEJA 4BLQA 4OQNA 3QKTA 5EXPA 2W00A 3Q85A 1COWA 4DUGD 3NHBA 4Z51A 3AF3A 4Q02A 2FFQA 4KSCA 2GJ9A 1LB1B 2OEPA 2W6IA 4WZ6A 3HPQA 4KFRA 5BN3A 4EPTA 2QP3A 3B78A 4DCSA 5FOXA 1ESMA 2FU5C 3IQWA 2AR7A 4IEIA 1E9EA 4H9GA 3SQWA 1W0JA 1Z47A 3AKCA 3CKLA 1NBMA 2B8TA 3PUYA 2BCJQ 5BN5A 1GWNA 1UDWA 3E5HA 5F98A 1CLUA 1N2CE 1P61B 3A1WA 4PC2A 1CR1A 3B5JA 1W36D 4V0ME 1VG8A 3THWA 2JLVA 3MG9A 4PSAA 2XGJA 1U90A 3LO5A 1MKYA 1E94E 3GFPA 4Q7MB 4LX0A 4Q5IA 4Q7JB 3CH4B 4KBGA 3VNUA 1E0AA 1COWD 1JR3A 3H1TA 1DG3A 1GKYA 2GRJA 2J0UB 2ZJ8A 1RKBA 4LY6A 2W6ID 4IXMA 2MMGA 2PLFA 1ZUIA 3VTKA 4E03A 3IQXA 4F92B 4GZLA 5EP3A 3OESA 1W0JD 1NBMD 4N1AA 2ZJZA 4DLTA 2BMJA 2IYTA 1OH8A 1FZQA 4NCNA 4B44A 4F4IA 3U44A 3WHLA 4NE2A 2NO1A 1S9HA 1CU1A 3GPLA 4I99A 1II0A 4QHTA 4TL7A 1KAGA 1VECA 3CR8A 2QY9A 1XZQA 1IXSB 3UPUA 1II9A 2ZRFA 2ZAMA 2Q3HA 2JLYA 1E96A 3K70C 3U7GA 2PZGA 1EFHA 4UNRA 1JR3D 1SXJA 2PH1A 5SZJA 4GFDA 1D9XA 4A0FA 4TQ9A 4DSUA 1OFIA 2O52A 1Z6XA 2ODWA 4N0EA 3NBXX 4AKEA 1G6OA 4MRVA 3GD7A 1EGAA 4R98A 3AKDA 3AVXA 3K9NA 5KPDA 1JJVA 1A2KC 4CGZA 2QE7A 4KBFA 4PAMA 1E2PA 2WHXA 2Z83A 3LD9A 3QXHA 4KAXA 2ZI3A 1ZM2A 4K46A 2R6CA 1X86B 1RYHA 5ANRB 3N2EA 3WP1B 1FX0B 3AP3A 2QBYB 3RC3A 4ZV4A 2OM2A 2C9YA 1K8RA 3A58B 1XEWY 4HAZA 4QNMA 1M6NA 4I81A 2DYKA 3DVLA 4NYMQ 2NIPA 4QBIA 4R2IA 3N2IA 3QPVA 4B3DA 2OAP1 1SXJD 1FUUA 3M4YA 2WOJA 4ASUA 4TTPA 3LXRA 4NYIR 2GKSA 2EU8A 5KUTA 3D3QA 5EQTA 2ZREA 3FHCB 3LX8A 2JLQA 3EZ7A 1XEWX 2ZIAA 3ZQJA 1VCNA 2VEDA 2G1JA 1Q1ZA 4JVMA 4EPYA 1G3MA 4WVFA 1E0SA 4V03A 4B3FX 1FUKA 2NQ2C 2F6RA 1U94A 2QP9X 5BN4A 1WP9A 3KKMA 2ZRJA 1N3BA 2OLJA 4FW9A 2WM9B 3NTUA 1ZC3A 1F60A 3K0CC 3MUFA 1O87A 4V0NA 4AY2A 4IEEA 3PG5A 4D2IA 1HY3A 4ESVA 1KI3A 4ASUD 3LDAA 3OAAA 2ZJ5A 1G8YA 4KODA 3BB1A 1M74A 1ONBA 2PJRA 1D5CA 1SVSA 3QVUA 1DAGA 1G3QA 4ZDWA 3SHFA 1XRJA 2F43B 4D6PA 2QN6A 1JEEA 5K8LA 3E2IA 4JLOA 4Q9HA 1N0UA 1W2GA 4BEJA 1G7CA 1NN1A 3KKPA 4LCBA 1Z6YA 2ZUCA 5L3SA 1RC8A 1OW3B 3EIHA 4KHZA 3Q5DA 1ODFA 1CR2A 1OF1A 4XVUA 3CH5A 2A5FA 5FH9A 1HH4A 5AJZA 5CYOA 5FBQB 1ZBDA 2A2ZA 3B1ZA 5EP2A 4YMTA 2V6IA 4IDQA 4OJQA 4CEJB 3OAAD 5CIWA 1XPUA 3DPUA 2PMDA 3W3AA 1RRPA 3AKEA 3EAQA 3T15A 2ZPTX 4GT1A 2O0KA 2P5SA 4HB0A 4HI0E 3AM1A 1AS2A 1TTTA 1E2HA 1KYIA 3R7WB 3EASA 2IX3A 3OHMA 1E3MA 2QM7A 3C41J 5LB2A 3AF2A 2FX3A 3FDIA 1N5IA 4HB3A 1KHTA 1W4CA 3U2QA 521PA 4L9WA 2BHRA 3B13B 4D4LA 4DWJA 3GEIA 1DE0A 3UMRA 3SJCA 1EESA 3CWZA 2B7BA 3QG1A 4RSGA 4WA7A 4CEIA 2BEKA 3HDTA 2DFTA 3AB3A 2O8FB 3MWJA 2Z5FA 4RD0A 3CX8A 4TMXA 1P60A 3THYA 2CL0X 3EIQA 3VU9B 2X2FA 4A0GA 2BMEA 5DIFA 1UFQA 3CF0A 3LW7A 4HUTA 4LYHA 2NTYC 3GLGB 4DDUA 1US8B 4YC7A 3EX7C 3HP1A 1HA3A 4A6PA 1TX4B 3VMFA 4LI0A 4X8HA 2P6NA 4Q4HB 1PVOA 3V4RA 5IDVA 3B85A 4HATA 4IXNA 4KFUA 2FEMA 2XX3A 4Q9JA 5AJYA 1QBKC 2UZIR 2XOKA 3QG5A 5AJWA 1VG0B 4HB2A 4I1VA 3VX4A 1L4YA 2ANBA 3NVAA 5EXXA 5FOWA 4NZYA 3U3JA 2CE7A 1RE0A 3VR3A 4O3MA 1XZPA 4Z8XA 4XSHA 2QGNA 3CPEA 3BS4A 3FKQA 3JZAA 4O2RA 1W44A 3B8HA 2GJ8A 2EYQA 4WOPA 4TLEA 2ZSDA 1IY1A 3O8BA 3WNDA 1QDEA 5IHPA 3ZVLA 4JVLA 1YZKA 1UBGA 2IXFA 2QMEA 1WF3A 4PHTA 4PR0A 5JJLA 2GJAA 4MYUA 2ZSBA 2D2FA 2NPFA 1W48A 2AD5A 4Q48A 5J4LA 2QSYA 5EE3A 3GP8A 3PVSA 4UNSA 1KK0A 1XTQA 1ANKA 1G5RA 2VP2A 4TMVA 1PJRA 4PSVA 1DG1G 1VCOA 2J0QA 2ZI5A 2XOKD 3DKVA 2YWHA 3TAHA 4ARZB 2QQ0A 4B3BA 2F3RA 4IDPA 3WBJA 1XMJA 4UXIA 4FCTA 3LRPA 4NCJA 2C2HA 3KTAA 3QEOA 1DELA 4FCVA 4URWR 3SYNA 5HKKA 4MGZR 4DHEA 2GXQA 3CX6A 4C2UA 4DVGA 4HAXA 4PTLA 4F38A 4JLJA 3U7HB 4WW0A 4HDOB 3GLIA 2XZOA 4CEHB 1BMFA 2OXRA 3SBDA 4ZI2A 4ZDIA 5FTKA 2Q3MA 1HURA 1VMAA 4O25A 4RKFA 3ONWA 1OPXA 3ASYA 2G9NA 1NSTA 1WDTA 3S1AA 721PA 1Z83A 1OYWA 4PHHA 2VTKA 5F3WB 5E7JA 2KJQA 4US1R 3K9LA 2GCOA 1MABB 1A82A 3AP1A 4KXFB 1N25A 5GADl 4JJKA 4BFZA 3UK6A 4TYWA 4YDSA 5HKKD 1G7SA 1OXVA 1XB2A 3KKOA 5P21A 1KDRA 4BFWA 1L4UA 3QF4B 4BUJA 2HLDA 2KI5A 1BMFD 4I1UA 3QBVA 2OT3B 5KO2A 2L0XA 2VF8A 2E87A 2V55B 2CLSA 3ADCA 1U9IA 1Q1BA 3VKWA 3WNBA 3UATA 4E5UA 5C4MA 2XB4A 1XP8A 1OFHA 1UKYA 4IOKA 1ZNWA 2P6UA 3BGWA 3ND8A 4Q18A 4P32A 4MKFA 3SYLA 1NRJB 2RGXA 1G20E 1X3SA 1PUIA 2HEIA 4B2PA 3QSYA 3QF7A 1UKEA 1YE8A 1N0VC 4QHSA 2AK3A 3EXAA 1Y3AA 4RJLA 2X2EA 1UAAA 5L8VA 2HLDD 2HJGA 3Q7PA 4LV8B 4Q66C 1QF9A 4DLYA 4U7DA 2RGNC 2BMDA 4G1UC 4LPKA 3LLUA 4GMDA 3SJAA 2A9KA 1GOTA 4WIAA 1XTJA 4KFTA 1O3YA 4W9MC 2E9SA 1JEDA 4JLPA 4RFSA 3FVQA 3UANA 2FEOA 1RJ9B 3IO5A 5C1BA 5JSZA 1IN5A 1D2MA 2XTMA 4URZR 1IAQA 1VHTA 2IHYA 3H4MA 1UBCA 2IS6A 4EPXA 3KDSE 4P4UA 2ZRLA 1P7CA 3CBQA 3KJHA 3RSLA 1GZSA 4PPQA 2W6JA 4B71A 4HAVA 1VG1A 3TIFA 1S9DA 2LCFA 2NG1A 3P27A 1GDDA 1NKSA 2QEQA 4PHFA 4JL8A 4RCZA 1N6KA 4WBSA 2J41A 1G4AE 1Z8FA 3TUZC 3L0SA 4HZUA 4DRZA 1E69A 1YQTA 1JXMA 4JLKA 3B82A 4QC2A 4CDGA 3ZJYA 3QOFA 5C18A 2REBA 3DL0A 3KL4A 4ILEA 4BFXA 2ZI4A 3QENA 1OH7A 2FF7A 3AVVA 2GZHA 2HF9A 221PA 3SC3A 1P2SA 1TU4A 3ZZ0A 2PX0A 5JFGA 1ESNA 4TLCA 4ON9A 5FR2A 2GVZC 3M0EA 1SKQA 1ZP6A 3IIJA 4P3YA 1W0KA 3UG6A 2A5YB 5JEDA 3MJHA 4W5HA 1Z07A 2VSOA 1K5DA 3A4NA 1QVAA 3P4YA 3BH0A 3WMGA 2ZSAA 3EWSA 4KITB 2YVUA 4FWIB 1YVDA 4W7SA 4EAQA 1XBTA 3I5XA 1LS1A 1KSHA 4B34A 1YZGA 2DBYA 2ZR0A 1GAJA 1LF0A 2OHFA 3VX3A 2F3TA 2AKYA 1TQ2A 4A36A 4M21A 1GNQA 3AGPA 2ZRIA 2IF0A 3QI2A 2IEYA 5JECA 1W0KD 4EJSB 4F4JA 2W0SA 3TVTA 2AN9A 1G18A 5B30A 1OV4A 1IN6A 2P3SA 3C4JA 3U3RA 4BE7B 1R5BA 4QL3A 5DNYB 1V43A 3MGCA 4AYTA 1T9HA 4O0MA 2AXPA 2IK8A 4DDWA 2REXB 3GJ0A 2ZRHA 4XWAA 2XTZA 2QMOA 3MLEA 2IS1A 3JVVA 1T6NA 1A4RA 1G6HA 1NN3A 1ZJ6A 3HWSA 4WXRA 4IJMA 4DBLC 2FPLA 5A5GA 2PEYA 3IIMA 1KZ7B 2A5JA 3UG7A 3OIYA 4M1MA 3TKLA 4V0KA 1NJFA 4BZXA 1FP6A 1KSJA 1L7VC 2ECKA 5D3QA 2XITA 1X8LA 1OE0A 3CR7A 2EWWA 1FL9A 4L5BA 2V1UA 5H70A 3MMPA 4OHVA 4DXAA 2Q0HA 3VR4A 1GITA 3T61A 1U8AA 2OBMA 3IKJA 3TSOA 4MRSA 4TQAA 4LC0A 5KTYA 4LYJA 3VFDA 1YZQA 1XJCA 3WHKA 3LBIA 1OH6A 4BZQA 2DB3A 2G3YA 2IYLD 2N42A 2VBCA 3T1OA 4MQBA 2P6RA 4XTCS 3RWOA 2VHCA 4DCVA 2ZQ5A 3FE2A 4B3XA 2Q9CA 4DT1B 3BB4A 5DISB 1GSIA 2X77A 5FUWA 5HCNA 1EWQA 1D8TA 2FSHA 4ZKDA 2NZ8A 2I4IA 5BYKA 1AZSC 5JRJA 3U6BA 1ZW6A 2YWFA 4BQSA 2IYUA 2BV3A 4UQOA 1KTVA 1D2NA 3IDQA 2JASA 2GXSA 1G3IA 2XAUA 5JHGB 4GDFA 4BFTA 1GRNA 5FTLA 1KI8A 5FPSA 2NPIA 5TDHA 2Z4SA 1BYUA 4IKEA 1YZTA 3LVRE 1NN5A 2ZSEA 5KDLA 1KKMA 2WSSA 4G5OA 1TF2A 5CIQA 1KAOA 4FMDF 1SULA 2RGDA 4Q00A 4KLNA 3PUZA 4OL0A 2K5UA 1N6IA 4JYBA 1PLJA 3DZ8A 1HQYE 2PX3A 2DFKB 2DHRA 2TMKA 3MJRA 3VQTA 3PUVA 3KJIA 3MWYW 2WAXA 3PCRB 2PBRA 2F1JA 4Q4JB 1YR8A 1I4TD 3K09C 4ERNA 2IC5A 4JVNA 1XCGB 1YR6A 2V6JA 4EKDA 1OKKA 2R6GA 2IUTA 2O8DB 2DR3A 5F9FA 1GNRA 1KSFX 2WSSD 1IHUA 1NMYA 3L0IB 4OQLA 4RFVA 1OB5A 3SE0A 3TUJC 1FX0A 2QBYA 1U0JA 3Q8XB 4LC1A 1JR3E 3B9QA 1CBUA 4TMTA 2YYZA 1FOEB 2NO6A 1UJ2A 1C9KA 1XX6A 3QJYA 1DAEA 2ZE5A 5CM8B 1DAFA 5FTJA 1GKIA 4YLGA 2OCAA 4QGHA 4BFVA 2OXCA 3GCGA 1E32A 5J47A 2C5LA 1HE8B 3B1VA 3NH9A 1JBKA 1OKKD 2FNAA 2Q3FA 2ZYTX 1W36C 2BVNA 1JPNA 3PEVA 1DO0A 1KI6B 4G5RA 4EFLA 1IN8A 3FKSD 1QHGA 4B2LA 3VHXA 4LK2A 2OLKA 2OILA 3TBKA 4E22A 4BFSA 3O8CA 4GL2A 3WXMA 4ZPXA 1SXJE 2CHQA 1CF4A 1SHKA 5FPHA 4NL4H 2GJSA 4NONA 4C0LA 1KMHB 1N6OA 4XWKA 4OQMA 2QMUA 1XD2B 1DEKA 1FPMA 3QKRB 5H8WA 1T8TA 1ZCAA 4QBGB 1MO3A 1TEVA 2H18A 2BM1A 3SNHA 4QHYA 1IXRC 1RRGA 2HCJB 1E2QA 3GQBA 3NHAA 5HE9A 4E07A 4AYWA 3ZD6A 2XSZA 2F43A 3C15C 3BFXA 3K1JA 1OXXK 5KSOA 4Q01A 1AJEA 3CLVA 1EG7A 2H7VA 1SKYE 2WWIA 1JB1A 1TUEA 2FN4A 4QNRA 1NJGA 4DLXA 3TMKA 3IEUA 3ND9A 5DHFA 4AD8A 1KJYA 4EUNA 3QXCA 1FNMA 2DPXA 2ZYWX 3CO5A 1XFAA 2YOHA 2FV8A 5FTNA 1C4OA 1DO2A 1XDBA 3Q3JB 5DE3A 4CVNA 5TV2A 3AQ4A 1D6JA 4M1WA 4B3GA 1RYFA 3CIOA 2XSZD 4A9AA 1R0WA 3R7WA 3L0PA 2ANCA 2FSIA 1KDTA 2WIAA 1Z08A 4MGYR 2GCNA 1G19A 1Z0IA 4IVRA 4MRRA 3ETLA 3O8RA 4QKQA 5GJWC 3GLFE 3DOFA 2X1VA 4LRWA 1SXJC 3RHFA 1G5TA 2R62A 1E2DA 1R0YA 2MSDB 1UKVY 5EXTA 1YHNA 2ZJYA 1W2HA 1TUIA 4Q9IA 4C7OB 2FFHA 3LLMA 1T0HB 1U99A 4DLRA 3GLHE 4LJ8A 2O8FA 1XU4A 2GA8A 4TQUS 4QGGA 3IHWA 4YMUA 2QAGB 1E9AA 3FHTA 4RY2A 2PZFA 1U81A 3VU9A 2OV2A 2WJYA 1P62B 4L4UA 2GTPA 3JZMA 1CJMA 3X1ZA 2RHDA 4TLBA 3U3OA 3ZS8A 3P32A 3T35A 2YNMA 4DDTA 1ZNXA 2LKDA 2QT1A 4DIEA 3GLGA 3QXJA 1US8A 3RS2A 2KSQA 3VKHA 2AX4A 1Q57A 1VIYA 3OIUA 4A6XA 5KYKA 4MYCA 2HV8A 1DS6A 4Q4HA 3QKUA 3U3MA 2N1BA 4C9BA 1KK2A 3CF2A 3SYKA 4LYAA 2FA9A 3QNUA 2UZ3A 4XIGS 4HDCA 4DEYA 1E1QA 2KE5A 4F91B 3BRWD 1JR6A 1N6RA 1SHZA 1CXZA 3SHWA 3OEHA 4MDFA 1DAHA 4LDJA 5LB4A 4DKXA 2JATA 3DMDA 1XTKA 4BRUA 1G7RA 3NH6A 3CONA 2PCLA 4OBEA 2EVWX 1QHNA 1SVKA 4Q4LA 3FWYA 3PJRA 1CEEA 1N6NA 4F93B 4DC9A 4HSEA 2HYDA 2ERYA 3C14C 4GPTA 2GEDA 4HZIA 1KO8A 4C0BA 2ZR7A 1CJUC 1WCV1 2YJTD 5DI9A 1OH5A 3A1SA 1GVNB 3AUYA 5L3VA 4ARZA 4B35A 4PC3A 5JI3E 3TAUA 5DN6A 1NG9A 2BM0A 3OEHD 4DCNA 4KFSA 4LV5B 4UNPA 4DJTA 2ZJ2A 4LV6A 4NU0A 2VRWA 1MO6A 4ZCLA 2MSEB 2IT1A 2QE7D 4NHOA 1JECA 1E2GA 1TQ6A 3WYAA 1Z6TA 2D3WA 1IXZA 3LY5A 4TL8A 5AWFC 3SR0A 1MO4A 4TL9A 1Z2AA 4CEHA 4LJ6A 3BC1A 5CB6A 1ZU5A 4B47A 1T0JB 3FTQA 2BC9A 3EZ9A 4BZPA 1S3GA 4Q1EA 421PA 4BLSA 1KNXA 2GK7A 4NP6A 5LD2C 4M22A 5CDFA 1Z29A 4LJYA 4URYR 1D9ZA 1R8QA 2HCBA 5DN6D 2VIIA 1ZINA 2CL6X 4R2HA 4EPRA 3KFVA 1MABA 2NZJA 1OYYA 4N0DA 2RAPA 4B6EA 2J3EA 5BXQC 4KVAA 2JA1A 1KO1A 2IS2A 1W4AA 1Q1QA 3ZLJA 1WXQA 2EYUA 4LPSA 4ZCMA 5J5CA 2ONKA 1FMJA 5JLJA 2P2LA 1T4GA 3QF4A 1G3RA 3VR2A 5J4VA 3T34A 3CRQA 2OCPA 2IHBA 2VL7A 1YRAA 3BXZA 4X8OA 2W2VA 4V0MA 4A8JC 1ZNYA 1DTSA 2JIZA 4MITA 1E2IA 3BB3A 1HV8A 2MSCB 5E95A 5J40A 4JLDA 3BH6A 1N5JA 4D81A 1Z28A 1PLKA 2ZVPX 3KXIA 3B1XA 5C46F 2GJKA 1XCMA 2E1RA 4NYMR 4OHXA 1ZCBA 2CCJA 1G8HA 3TGPA 1BO6A 1IOZA 5LDDC 1NN0A 1DOAA 2G77B 3NEYA 3M1IA 1K5GA 1YZNA 1X1RA 3C5CA 1R5NA 3ADKA 5CLQA 2IEZA 1U98A 2C8VA 4ABYA 3OE7A 3W5JA 4OK6A 1IN4A 1AQUA 4F4CA 2JIZD 4KSBA 2ZI7A 3QKSB 2ZM5A 1RJ9A 4ZCIA 1KZGB 3RRZA 3U60B 5JMTA 2GZDA 4GOJA 4TYQA 1G8GA 3IILA 1HT2E 1IJFA 4B43A 5A0FA 3KB1A 4Q1BA 4PFSA 4LUCA 4I1OA 2P5TB 1CIPA 2BWJA 4KVGA 5M04A 2X8AA 4PQRA 1EX6A 1GG2A 4P4SB 2VSFA 1KDPA 2WV9A 3ZYCA 3I4LA 3EZFA 1XTSA 4YMVA 4A15A 3CB4A 4ZKEA 4E09A 5FOTA 4OHZA 5DGXA 3BH7A 2WWGA 1KI7A 3BFKA 4QXAA 3EPKA 4OJKA 1F2TB 4QBFA 2C9OA 3OE7D 2GWHA 2QL6A 1NLFA 3RS0A 4EQ6B 3PIRA 4B75A 2KBEA 1OLOA 2AD1A 2ODBA 3ZIAA 4QM6A 1TU3A 5G3ZA 3VR6A 3CPJB 4CT4B 1NKTA 3I62A 3ASZA 2H17A 3AF1A 5EE1A 1VKJA 1QHXA 1J2JA 2G83A 5AJVB 2ZS9A 1NI3A 4YDHB 2RGCA 2ZROA 1FFHA 3O47A 1AN0A 1KJWA 1VDZA 3QUSA 4UKDA 6Q21A 1XPOA 1KKLA 1NVXQ 3Q9LA 2IUSA 1C1YA 4I1SA 2FPKA 4XOIA 2O8CB 3AVOA 4L16A 1ZIPA 3H2YA 4BRWA 2EFEB 2CL7X 4C0SA 3A8TA 4C0HA 5DSZA 4TZ0A 4X8MA 1JPJA 4KJZA 1VIAA 4B3CA 3ZZUA 2BKEA 3A37A 4G0NA 1SVLA 4TT3A 2WJGA 2VP6A 2HXSA 3EA0A 3ZIAD 2B6HA 1IY2A 4LJ4A 3I72A 1HQCA 4TTRA 2X19A 1M7HA 1HTWA 2ZAOA 3ZVMA 5FOSA 3LNCA 4ESHA 2WWYA 4PXAA 2ZRCA 4PPNA 2AFIE 4A0HA 4B2IA 4MGKR 2EFDB 2Z0MA 4KCGA 4NCKA 4PC6A 3K0FB 2PL3A 3QY0A 2YC4C 4BGDA 4EJSA 2H1LA 3RRYA 5B57C 5GJCA 1II8B 1FMLA 3WYFA 2GZAA 5FUXA 3CRW1 4PANA 1OHHA 4B74A 1U9IC 4XD7A 4TT3D 1Q3TA 4OI2A 3ECCA 1E9FA 4A2WA 1GRQA 2OO7A 2Q21A 4Q4AA 4A1FA 4ACAA 4JLNA 3ADBA 1SKYB 2I3BA 1TEXA 5BW8A 1A5TA 2JLRA 2F1IA 5EUMA 4Q1AA 1Z6AA 2VLIA 2ZS7A 1CRQA 1ZD9A 4L9SA 4P33A 1V5WA 2JEOA 4TYYA 1P2VA 3VR1A 1XEXA 5E4FA 5AJXA 3P20A 4D4JA 3PR1A 1E4YA 4UJ5A 1AGPA 2IYRA 5GVRA 2R6FA 3K70B 4MRPA 1Q0UA 3GJXC 4FIDA 3OIVA 3PV0A 1P6XA 2XJ9A 3VAAA 4AURA 1NMXA 2A5GA 1OHHD 1ZM7A 3CWQA 3BWDD 4XD7D 2FMXA 2GNOA 4K81B 3KXKA 5CLLA 2WOOA 4II7A 4BLRA 3HU3A 4FMCF 4OHWA 3GLFB 3I3SR 4Z54A 2DFLA 4DT1A 1P2UA 4AI6A 2REOA 1KY3A 1ZVQA 4MKHA 2A3RA 1TF5A 5AUQA 2J5XA 4NPHA 4A4DA 5GJBA 1MT0A 3NKVA 2ZRMA 1G41A 3GLHB 1P5ZB 3TQCA 2J46A 1RZ3A 4HUQB 1LFDB 1E2NA 1KO7A 3I32A 3RS3A 3L8ZA 3ZDQA 4JBWA 5IT5A 1E99A 2CLDX 2OE2A 5K8UA 1AK2A 1ZD8A 1NVUQ 2ZRGA 1IONA 4DSNA 1LVGA 1F2UB 1G7TA 4ZIRB 1Z2CA 1G1MA 1M2OB 3P1JA 3W8RA 2UVQA 3FOZA 2V3CC 5IRCD 3O8DA 1ELOA 1KNQA 3UIEA 4D0NA 1G3UA 1OIWA 4FINA 1IM2A 4M1YA 2H8KA 5G41A 4URXR 2HT1A 3RC8A 3NDPA 2D2EA 5HE8A 3P26A 1T3HA 2OG2A 1YZLA 2XJ4A 3CM0A 1CTQA 2XXAB 1BH2A 3F8TA 1J99A 1S96A 4TLDA 2J59A 5KNCA 1R2QA 1QHYA 2N46A 3OFNA 1GP2A 4Q4JA 1U0HC 4DEXA 2Q9BA 3FPAA 1F48A 3DO6A 2GF0A 4LGMA 2G6BA 3B2EA 1RIFA 3ZZTA 2O8DA 4IRUB 2I1QA 3FFAA 1SVMA 2R9VA 2HYIC 4QBHA 3QXXA 4G3XA 2ZEJA 2RH5A 2GXUA 3MRSA 4Q1FA 2WTUA 4KYUA 3HR7A 1W5TA 4FCWA 2QENA 1NSFA 2W6JD 1NLZA 3CF6R 2F9LA 4FMCB 3GEEA 4YONB 4OHYA 1Z0DA 1D2EA 2VHQA 5JWHA 4DZZA 4QM7A 1KO4A 4A92A 3AH8A 3OFND 3EC1A 4K8OA 3K0SA 2ODEA 3CZPA 2BBWA 3N5CA 2IYZA 4OI4A 4JJZA 2WZQA 4S2EA 4UJ3A 3TNFA 4G5QA 4IOJA 2BIFA 1KI6A 1R8SA 4JL5A 4GSYA 2B21A 4MA4A 3C7KA 4JT2A 1TQDA 1S1CA 3OIWA 3R9IA 5HR5A 1Z6GA 2J0SA 1XXHE 4NYJQ 4LZZA 3M6AA 5DYGA 4PO1A 1J70A 2C99A 5FBWB 5E7MA 1UADA 3AVUA 1TQ4A 3EW9A 1KMHA 3TW8B 3I61A 1XD2A 3E1SA 4MKIA 3KQUA 3QKRA 3VHLB 3AVPA 3VR5A 4LSGA 5HZKA 1GL6A 3SQXA 2FGKA 3LBHA 2GEVA 2V7QA 4BLPA 3TW4A 5KDDA 2GETA 1S3SA 3KUDA 5AK0A 3X1WA 1FP7A 2ASEA 2J9RA 1OJLA 1TPZA 2YC2C 4TMWA 2DCUA 3OF5A 4RD6A 4GRAA 1GKUB 1WB9A 3BE4A 4UNQA 4Q4AB 1SVOA 1CP2A 3EZ6A 2WJVA 1CJKC 5UKDA 4HLQB 4DIDA 1HE1C 3X1YA 1XEXB 3NIBA 3SS8A 4H1VA 2KWIA 4OI0A 1MR3F 1FTNA 2KBFA 4RD1A 3UWOA 1XMSA 4A0RA 5DI3B 5G40A 2V7QD 2ZRPA 3QPWA 3C16C 2IL1A 2ZYUX 2CJWB 1G16A 5TARA 2F9MA 5KSPA 1RRFA 4Q47A 3RS4A 5B64A 3U4QA 1E6CA 2AL7A 5CYPA 2WJIA 1YU9A 5JWOA 2C96A 3RRMA 4WZBE 5B58C 2QTHA 3AUXA 2AXNA 3TK1A 4L8GA 1N6PA 1KO5A 4EFMA 2BBOA 1VG9B 4Z8YA 4YMWA 3SN6A 4RD2A 5FI1B 1OXUA 4C7OA 1ZM3A 1DVRA 1E2EA 5LPNA 2F55A 2WVJA 4NYJR 5FBLB 2ZS8A 1LS6A 2QAGA 2ZU0C 3J81k 3TR0A 3H84A 1IBRA 4DLUA 4EFNA 2QT0A 1M7BA 5L3QB 3HU2A 4XSGA 3FB4A 4DLZA 2YZ2A 5K8TA 1P2TA 3G82C 4LOAA 3C8UA 3NC0C 4DDVA 2V9PA 1R4AA 4GNKA 1W4BA 4QJ4A 2IW3A 1CRPA 1S4QA 4JLVA 2ZE6A 2IA5A 4LBZA 4LHZA 2YHSA 3IUYA 3K0AB 3THXB 5KSYA 1XJ0A 1B23P 3A36A 2BBSA 3MAAC 3X1DA 1GL9B 3GFTA 2BKUA 5FBRB 1IJEA 2AKAB 2ZI6A 2PCJA 2ZTSA 4DSTA 2YWEA 1B0UA 3V4FA 4GOXA 1W5SA 2IYVA 4HLUA 3SZRA 3F0TA 4NCHA 1T3SA 1VTKA 2V1XA 1LV7A 2G88A 3AP2A 2RKOA 1NBME 3FMIA 1U0LA 4RD4A 4NTZA 3CNNA 1KI4A 4OQFA 2QTFA 2H5EA 2D62A 2O8BB 4BLTA 4I4LA 3D7MA 3KB2A 3QQ5A 2WWHA 3A6PC 1H8EA 1N6HA 3D8BA 5AUOB 2VO1A 3DKPA 2XB2A 2QA5A 2D7DA 1W49A 3Q7QA 2VP0A 1P75A 5AR1A 5JS8A 3W6PA 2VHTA 3EC2A 3IO3A 121PA 4D82A 1NVVQ 2GDJA 2Q6TA 5CM9C 1VHLA 4XVQA 3GJ4A 2QTVB 4ZI3A 2WJHA 5GJVC 2FE4A 4LJ7A 2D7CA 4B33A 3QBTA 3GJ3A 2RB4A 1Z63A 2FFAA 1W4RA 2VP4A 4V02A 2CHGA 1BIFA 4EPVA 2RGAA 3L2OB 4QOSA 1Q21A 5DYIA 4PZZA 2V4ZA 4H1UA 2AFHE 2GVDC 3FMFA 1H8ED 3GJ8A 2ZJAA 5EE9A 2Z4RA 1NY6A 4XVRA 1NL3A 2GK6A 2PEZA 4LJ9A 2FFBA 2I1VB 3BAFA 2EFCB 2G0TA 3FYHA 4JKIA 4XTRA 2H92A 1G64A 2ZRKA 2R8RA 1LW7A 2ATXA 3AGQA 1T5LA 3GFOA 3NBFA 3RS7A 3UMFA 4XWOA 3T1TA 2PLRA 3MWLA 3A1UA 2DY1A 1KGDA 2IYSA 5FFMA 5TY0A 3REFA 4FMDB 3B6EA 2Y8EA 2RGBA 4HAYA 3OEEA 4LYFA 4PPGA 3T06B 1WRBA 3W9YA 2FJUA 2C9CA 1I4DD 1XTRA 3PITA 3A1TA 4CIDA 5CITA 3L43A 1VYTA 1UM8A 3L82B 1KI1A 2QSZA 3NC1C 4IVQA 1R0XA 4PAOA 4QRHA 4JBXA 5HCIA 5K8IA 1AS0A 1FQJA 1WBDA 5EE0A 4IDHA 5G3YA 1H65A 1VCMA 1X1SA 2GCPA 3BFVA 4Q9LA 3SFVA 2WAYA 1JAHA 4F7WA 3KJEA 1PLLA 4OK3A 3UMSA 1AS3A 5CK5A 2QUZA 4AYXA 1Q3HA 2WWFA 2O5VA 2ZE8A 2QQEA 4G01B 4PHGA 5TXGA 4KO8A 3RLFA 1KJZA 2FZLA 2GBLA 4QJ3A 3U4QB 3OEED 1EFTA 5AUNB 1RPZA 2NO9A 3W3ZB 3REGA 2A5DA 1DPFA 5F9HA 4MH0R 2FDCA 1UEIA 5CDFE 1FNNA 3QKSA 2GAOA 4RZUA 2ORVA 5JEEA 4JT4A 2V54A 3BD9A 3KJGA 2BDTA 2IWRA 1NMZA 2AHOA 1GFIA 3GMTA 5GVSA 1EWRA 1E2MA 5EE5B 4AWXA 3A4LA 1TF7A 1PZNA 3KQLA 2GXAA 5H1YA 2YOFA 3RS5A 5KNDA 3DMNA 4US2R 1EK0A 3ZS9A 4P4SA 2GF9A 2D74A 2ZVQX 4B73A 3HU1A 1A7JA 1Q1EA 2AWNA 4POAA 2O8EB 2QRZA 2C77A 5JJKA 3NWJA 1F2TA 2P65A 2LKCA 4EQ6A 4V0LA 3MFYA 5B2ZA 1SVIA 1AM4D 4NYIQ 5KU1A 1YKSA 2IXGA 3HPRA 3SFZA 3CRVA 2YWGA 3EZ2A 5DH9A 2OESA 3CPHA 3K8YA 4R9UC 1DADA 3WRXC 4BLOA 2H57A 3LAWA 2QPTA 4B6FA 1JI0A 2CVFA 1OXSC 3UKDA 3EPJA 2HXYA 2AK2A 4P31A 4M1SA 4TYPA 3V9PA 5TVKA 2O8CA 1VCIA 3U61B 1P3JA 1U2RA 2F1HA 2C03A 3TE6A 3K0EA 3VNVA 1OIVA 1NG1A 4CF7A 1SQ5A 3R20A 3EARA 2PT7A 5FI0B 4MYHA 5DO9A 2DFNA 4MDEA 2GHIA 3FHOA 5L3RA 2CCGA 4M0LA 4FWTA 3B1WA 2QPAA 2IWHA 1XD8A 1Q12A 2RMKA 2VP5A 3AF0A 4IFEA 3X2SA 1Q44A 4NMMA 1DAMA 4D4KA 4TWZA 1FW6A 1CKEA 1XXHB 4BFUA 2JLUA 1P9WA 3LV8A 3GJ7A 1ZM9A 1NP6A 2J45A 1X8KA 2GEUA 2QI9C 1E1QD 3K0FA 4Q9KA 1OIXA 1YR7A 4PAQA 2D4HA 1R10A 1XMIA 4PC1A 3X1XA 3IBGA 1R6BX 3BBPA 1S1MA 3QPUA 5EP1A 2JDIA 2OFWA 3PUWA 2ZRDA 1II8A 3SBEA 3R9XA 3KQNA 1ZAKA 3JVUA 2QNRA 4ACBA 2QGZA 4M1KA 1XJQA 4YXWA 4IOLA 4JBYA 2GESA 1Z22A 3IPYA 4HLCA 3SJZA 4DB2A 3FGNA 1ZMXA 4D0GA 1T8UA 2CEAA 2YV5A 2JLSA 5EP4A 1E2KA 1OSNA 1DARA 1LTQA 3F3YA 5BQ5A 3MSXA 4MRNA 2VQSA 5FR1A 5KHOC 4QGAA 4FD2A 4B76A 3ZD7A 2J1LA 4XJXA 4RCYA 2BEJA 4URVR 2JDID 1VYUA 2WKPA 4MKGA 3PUXA 4A2PA 4ZDJA 5EJEA 4M9QA 4AG5A 5D3MB 1XF9A 2NOAA 4YXWD 4QFMA 1AGRA 5LBIA 3MD0A 2CMKA 1CR0A 4LWZA 2ZU6A 3BJIC 1G17A 4WZAE 3BIFA 1NY5A 4HB4A 4BWYA 3U3KA 2FSFA 2BJWA 2JLXA 3GLFA 1MOZA 4FXPA 4GMXA 4UXHA 5SZKB 3R8FA 1F5NA 2OFOA 4JZKA 1N5LA 4LHYA 1CULC 1DAIA 1BKDR 4JKYA 3A4MA 5TMPA 2DWQA 3K70D 2BOVA 3GLHA 2ZJOA 3RRNA 1SVWA 1AZTA 4HUQA 5HPYB 3V00A 3R8CA 4EIWA 1ZC4A 1JJ7A 2H16A 3LVQE 4GI7A 4Q1DA 2QMHA 3NEJA 1EFRA 3GLIE 4KLZA 1KSGA 1F2UA 4M9ZA 4ZIRA 1GRRA 5J4YA 3EA5A 2IYYA 1L2TA 4DLVA 4M53A 1JALA 5FPTA 4PO9A 4B32A 2RHMA 2IF2A 2FSGA 3RYTC 2PT5A 3CUEF 2PZEA 1W36B 2CDNA 1KI2A 3W5IA 2Z6VA 4PZLA 2J87A 3U7EB 2CXXA 3UWKA 3K0CA 4Z1MA 4AG6A 4RZ2A 1EXMA 1WQ1R 4PPFA 2GAAA 3WRYC 3LQRA 1XWIA 4Q03A 2XXAA 3ICQB 1N0WA 3KX2A 5FL3A 1EFCA 1G4UR 3THXA 3K9GA 1E2FA 3L8YA 1MRNA 1EFRD 1Z5ZA 3SI7A 5AUPB 4D26A 3I73A 2ODNA 3EWAA 3N70A 3CZQA 1BYIA 1T3LA 5E3HA 3AKYA 3WBKA 2CLCX 1XPRA 3E70C 1KDOA 1NF3A 3THWB 2VPPA 2ZRNA 1MV5A 2ZI9A 4U00A 1Z06A 4Y0AA 4Z1MD 2EFHB 4EJSC 4JS0A 4A8JA 3CW2A 2EQBA 2G0NA 3WNCA 5JCZA 1YJ5A 2XTNA 2WJJA 5IK2A 4IOMA 4DB4A 3T5GA 1S0UA 1EFUA 3D6TB 1WE2A 2C04A 2WMNB 5ELXA 3RVBA 2YINC 5CJ2A 3EPHA 5TB5A 5KPJA 1S8FA 1K6MA 1ZNZA 3U44B 1NNEA 3UXMA 3G5UA 2XNSA 3MCAA 3W34A 4C0AC 1JQJC 3HYTA 1OFTA 3ZQ6A 1PUJA 4JLBA 3DHWC 3FMOB 3WMEA 4RVCA 4QJ5A 5EZ5A 3RWMB 3GEHA 1ZIOA 3PXGA 3HYRA 2VHJA 1SXJB 1P72A 4P4TA 2FOLA 4TMZA 4W5WA 1Y63A 2DWPA 1FQKA 1LF5A 1UBFA 5IK2D 1ZYUA 2OSBA 1HEIA 2ZE7A 2JLWA 3AV0B 3KZ1E 2O0HA 3NBYC 3LH5A 4JLMA 4PZYA 4QGFA 3ZGXA 4CZ2A 1RVDA 4LBYA 1E79A 4TYNA 2RCNA 4YMSA 4NBSA 2ZANA 3AVYA 1DBSA 4C0KA 2F1RA 4AK9A 2OFXA 5C4GB 3PENA 4JLAA 4BFYA 1E9DA 2WIBA 4GZMA 5CB8A 2HJVA 4JYCA 5FPYA 3R9WA 2B7CA 1ZM4A 2ATVA 4LBWA 4J0QA 1SGWA 3D31A 2R2AA 4KYIB 1WBBA 4JL6A 4CW7A 3CRMA 1UPTA 1G291 3VKGA 2NGRA 1T5IA 5CJPA 4TZ6A 2QZ4A 1KK3A 3B60A 4TN1A 3I92A 4EDHA 5DI3A 4LBVA 2CE2X 2RGEA 1E79D 2J7PA 2WBLC 3BK7A 1HT1E 2CJWA 2EWVA 4GP6A 1PV4A 3SU8A 3BORA 2JAQA 2XEXA 4D0LB 1M7GA 1UKZA 3KKNA 4HAUA 1QG2A 1RRCA 1I4LD 1UEJA 3I1FA 4A2QA 2ZYVX 1J7KA 4M1TA 2WWXA 3AVWA 2V8OA 2ORWA 2MMCA 1TAGA 4IDOA 3PFIA 1J90A 2FPMA 3H0KA 2CVHA 1F3OA 1JXOA 4D25A 5JJIA 3NXSA 1E9CA 3IGFA 3T1QA 2ZETA 2J7PD 1GNPA 2FZ4A 5A4JA 4KU4A 3RNLA 4TMKA 5BYJA 4IFBA 1E9SA 5JBQA 5L3QA 4GP7A 1KMQA 1GUAA 4C2TA 5FBVB 3I8SA 3TQFA 5L3SB 4LHWA 1GL7A 3CRRA 3GJ6A 4AKIA 3KFXA 4US0R 1HUQA 4RKEA 1DAKA 2QPOA 3DOEA 2CHVA 4EPWA 2IS4A 2XZPA 2WSMA 1NIPA 1AA9A 3TSZA 5JS7A 2FH5B 5JI2E 4NH0A 2JCSA 3K0AA 4FI3C 1WMSA 2G1KA 3B7GA 4L15A 4PQYA 2FWRA 2CK3A 2JJ1A 1A1VA 1BS1A 3FFBA 1H8HA 2W58A 5LD2B 2SHKA 1XMVA 4R71A 2ZXUA 1XCPA 2EW1A 2FGJA 3KXLA 1OFUX 1ZUNB 1X6VA 1IQPA 4GBMA 3LW8A 5KDOA 2ZITA 4MGIR 1VYVA 3TUIC 4C0QC 3U6KA 1IN7A 1GM5A 2JGNA 1SZPA 3K9HA 3PEUA 4DLWA 3ICEA 2OCBA 3NDBB 2R6DA 3T5DA 3IBYA 1I2MA 2HF8A 4PSKA 3H86A 2O8BA 2WKQA 2EFGA 3IIKA 3L0OA 4JIMA 4D4MA 2VH5R 3SDZA 4D80A 2HDNB 1EX7A 3TVDA 3QVVA 4CEIB 1OXTA 2CK3D 2JJ1D 2P0EA 4IDNA 4O2LA 1R7RA 4MUAA 4UXJA 1H8HD 4ZO4A 4A8JB 4BASA 3W90A 3LQQA 2HT6A 1FTSA 4HEJA 3THYB 2JJ8A 3LXXA 5SZHB 2ZJBA 2Q9AA 3RABA 2BMFA 1MO5A 2F7SA 3GJ5A 1Z0JA 4M2LA 4M9XA 1G21E 5DHAA 2OBNA 5FTMA 3W6NA 4DCUA 2VP9A 2A30A 1UDXA 1M34E 4AC9A 1I2DA 1E0JA 3KUCA 3OZXA 3W6OA 3G0HA 3FMPB 4C30A 2J7KA 3DM5A 1YRBA 3AVTA 1CJTC 4NKRA 4RZXA 1W46A 2RGNA 2W2TA 4JSTA 4KI0A 3SJBA 4LJ5A 5JWRA 1G8FA 3QE0A 1UBEA 1XD9A 3TR5A 4BEBA 1G5PA 1QHHA 2QAJA 5SZIA 1Q22A 2ZRAA 4PO8A 2A78A 4U02A 3PEYA 3LBNA 5JHHB 4WAUA 3DEFA 1MRSA 2QRNA 1J8YF 3Q5EA 1QZXA 2NO7A 5FUYA 5FUVA 2JLZA 1LY1A 3T1VA 1R5OA 5FOUA 3W8NA 4AIIA 5J4KA 2ZSFA 4Y0VA 4Q19A 5FL7A 4A82A 1E0KA 1N6LA 1TADA 1X8JA 3MWKA 4TSFA 3ZH9B 3PEWA 4ITRC 3WYGA 3P4XA 4JSYA 1NLYA 4DSOA 2WMOB 2QAGC 4S35A 2Z43A 4RZ3A 2YKGA 1QVRA 1QRAA 4BECA 2BBTA 2QU8A 4DLSA 2QORA 2UKDA 4OI1A 3EIEA 3KTAB 1RFLA 3LFUA 1Z0FA 3DDCA 4HYYA 4YQFA 4IW3B 1TNDA 1ETUA 2OUKA 5DLQC 1CR4A 1P9RA 2VSXA 2VF7A 3RDPA 1YZUA 5KSZA 3GLIB 3TH5A 4OKSA 1LNZA 1JNYA 5JRZA 3KQHA 2IYQA 5C2JB 5IF9A 4M9SA 1E1RA 5FL7D 2D06A 1KI9A 4TSFD 1QG4A 3RSOA 3Q72A 1XNJA 3CNOA 4OQXA 4LHXA 3S1AB 8OHMA 1CS4C 1BOFA 2W0MA 2WICA 3WY9A 2OAQ1 1GTVA 1GILA 2GCOB 2VHUA 3IPXA 4HLUC 2OBLA 4MUBA 4X8LA 621PA 4CRWB 2B92A 2R6AA 5EXSA 2HUPA 4P0TA 4BPBA 1W7AA 1KK1A 3THOA 3F5FA 2CBZA 3U7FB 1OT3A 4CT5A 5FPKA 821PA 3RANA 2ORIA 4HDQB 4Q21A 2VYFA 3AF4A 3TJZA 1ZU4A 1M8PA 1QHIA 2C78A 1JAIA 5KNBA 2ONJA 1F6BA 1E1RD 2O8EA 5KOYA 1E2LA 1ZUHA 3SOPA 5EUQB 4URUR 1E9BA 4PQFA 2O0JA 4LJAA 2FG5A 3DZDA 2NMVA 3WP0A 5HZHA 3BERA 3LWNA 1XEFA 2CCKA 1KY2A 2J0UA 3NG1A 1U8YA 1T91A 4R7ZA 2YOGA 3T12A 1N5KA 4FMBB 3B1YA 3QIAA 1Z0KA 1OB2A 4G5SA 1E4VA 2GILA 1P4SA 4WXPA 4M4SA 4AKHA 3KQKA 1NVWQ 3AEZA 1NIJA 1CJVC 1YR9A 1W47A 3TSWA 2JJ2A 3A1VA 2WWWA 1WA5A 5J4HA 4M8NE 2KB0A 4MYTA 4RFSB 1A2BA 2XZLA 5JSZB 3NBZC 5FOVA 2ERXA 2VA8A 1JQLB 1GIAA 3ZVNA 4PX9A 3B9PA 1TL7C 4TLAA 1XXHA 1VPLA 2IUUA 2A7QA 2C98A 3QXSA 1UF9A 2AWOA 2RGGA 2XNDA 1E98A 2WKRA 4C3ZA 2ZR9A 2PJZA 4TTQA 2QP4A 3KKQA 4HAWA 3EG5A 5G53C 4HZUB 2W2XA 2W83A 2JJ2D 3GLGE 1QHSA 1L8QA 1ZD1A 5E7IA 3FKSA 5JCPA 3DM9B 2B8WA 2WPDA 1RW4A 4OYHA 1U8ZA 4QG7A 2IYWA 1S2MA 3AVQA 1MH1A 3C5HA 3LA6A 2P67A 2BCGY 5EZ6B 3ADDA 4W5JA 5BWMA 4LHVA 4M1OA 5JZVA 2NO0A 2XNDD 1QHHB 5H68A 4Q1CA 1E9RA 2IXEA 4OK5A 3QEJA 4B48A 4PC7A 2QG6A 4AKGA 2C95A 3I8XA 1M1YE 2IYXA 3HJNA 2OCYC 1KOFA 2GBLC 2DWOA
chains in the Genus database with same CATH superfamily
3LX5A 3RASA 3DT6A 3TDKA 4IHQA 1NC3A 2ILTA 3L0DA 5DIZA 3WO0A 2DLNA 4EFKA 1X80B 1IPHA 1CB7A 1COZA 3FCCA 1AUPA 3GGCA 3I3OA 3LK7A 2WI8A 1R0ZA 3A9SA 4RD3A 2AHRA 5B3LA 2IFTA 1QIKA 2IBMA 4TKUA 4ER7A 5CFOA 3TZCA 2J0VA 2JBAA 2ZUDA 3BOSA 4PGMA 1LVUA 3ZWXA 3PA8A 2B1GA 4AWAA 2P4QA 1HL7A 2I6XA 1P0QA 2Y71A 1YJCA 2ZUBA 5AM2A 2YY6A 4DM3A 1GGVA 1R5JA 2R65A 4L3WA 2FX2A 2XVYA 3QW2A 4IMIB 1NXQA 1P74A 4TL6A 4ZANA 3EODA 1NDHA 1ZRHA 5DHRA 1HZJA 2LWIA 3HJFA 2PBLA 4Q24A 4K1XA 1AQYA 3BZBA 4C4PA 1G8PA 3JQ6A 3HUFA 2EJCA 3BMNA 3AF6A 1P0PA 2OZEA 5LZ7A 3PDIB 3SGLA 1HDRA 3E8MA 1Z0AA 2CNWD 2GSDA 4DCTA 2H00A 5J43A 4HPWA 1HYQA 2HIMA 4U8HA 5FWYA 2I67A 4MJ7A 1XTIA 4FC7A 3ZLTA 4TQGA 2D00A 4YBRA 3RAPR 4R68A 1Z2OX 1KZYC 1P73A 3TIXB 4DDMA 4CEJA 3ASVA 4BLQA 1HDZA 2AUTA 1JIIA 1V45E 3C7AA 4F8YA 3ZOKA 4KBYA 4TTTS 5ALUA 1LBIA 1FP4B 1P31A 1P5RA 3Q85A 2C0CA 2VNAA 4M8KA 2WYHA 4Q02A 4D9IA 1U28A 2FFQA 4JV5B 2ZW9A 2HOQA 4WZ6A 5BN3A 4OIMA 4EPTA 3CEPB 3ZWVA 1TAQA 4LF9B 1C0PA 1SUCA 5AHRA 1E9EA 4YI5A 1C1HA 1KAHA 3AKCA 1QORA 1R8YA 2J9FA 1JG2A 5BRNA 4YRNA 3E5HA 3FCYA 4Z9AA 4CV1A 1G1AA 2GZ2A 3CZ9A 4KZKA 4YMLA 5JS6A 4FJ0A 5DMXA 2XLBA 1LPPA 3E22B 2O2DA 4LVCA 1CR1A 2YUTA 1L5KA 4PSCA 1VG8A 1RYMA 3MG9A 4PSAA 2GKOA 1OU4A 4NU8X 3LO5A 2A1UB 4K40A 3DV0A 1PJTA 4KBGA 4DR1B 2X58A 2NN3C 1JFRA 4RZHA 3L8HA 1EGQA 4XR9A 2JC3A 4BNTA 1JR3A 5C5CA 1I94B 3FGOA 4Y7DA 1B26A 2XQKA 2TS1A 2W6ID 7ABPA 3UWMA 4G0XA 2HMTA 1ZUIA 3FJOA 2AR9A 3RHSA 1Y1KE 1FNSA 1ISHA 1XN4A 4BFCA 4L28A 3OESA 4BO5A 1GZVA 3H19A 5BSKA 2ODPA 2PTGA 1S02A 3QPDA 2ZJZA 5TEVA 2BMJA 3V8QA 1VKRA 3BFPA 1D5WA 1FZQA 3Q0IA 4NCNA 5DHSA 3RAEC 1Q7TA 1Z7GA 4FYHA 4F4IA 3T3OA 2NO1A 4KDFA 4IXTA 3Q40A 3NM5A 5A9SA 5B1EA 1T8RA 5A6SB 4RVOA 4HAIA 1KAGA 2VJPA 1VECA 2B1JA 1XZQA 1Z25A 4Q16A 3COZA 5GOTA 3VO8A 2ZAMA 2Q3HA 2CUKA 1E96A 3BGOS 1EVJA 4NOKA 1A3CA 4OQDA 1BAPA 4C3VA 2W70A 4UNRA 2JAHA 2X1LA 3DVQX 4UDNA 2AOUB 3ICCA 4FGUA 4RO0A 4DSUA 1WSWA 4LXGA 2AG0A 3R8XA 1RFGE 2QJRA 1NYLA 4AJJA 1G6OA 3QWHA 3GD7A 1EGAA 4KE8A 1L3IA 1FDTA 2B4TO 4QICA 3K9NA 3LC2O 5HRAA 1A2KC 3AETA 3EZGA 1JKXA 3HE3A 2DAPA 3HADA 1UIRA 1IMJA 5B3AA 1ZK1A 4KAXA 3QXHA 3WMRA 2FWAA 1MP0A 3PQ8A 3R2JA 1L1QA 1ZM2A 4J0HA 2IRWA 4K46A 1BWSA 3T95A 2I2DA 1N2EA 2NVUA 3CJTA 3T7SA 1X86B 5ANRB 4ENUA 4WQMA 4ZMSA 1P4RA 3WP1B 1X39A 4G4SP 3RC3A 2OM2A 2OSVA 5K3SA 5GM2A 3CC8A 3S29A 2H7XA 1M10A 1W5BA 2DYKA 2ZTUA 3C85A 4JCOA 3TPFA 5LP6F 3DVLA 3K2QA 3QPVA 3E2MA 4MUNA 4ZD6A 1SXJD 1MCZA 2DGDA 1ZA1A 3M4YA 5COBA 1KC3A 4MVXA 2Z95A 3M89A 5EIBC 3TR6A 2WDZA 1Y5NA 2JJMA 1VKZA 2B20A 2E4XA 4H6VA 1JGTA 3D3QA 1M2NA 4ZT4A 2VPZA 3FHCB 2DP4E 3O9MA 4ZK2A 2NXEA 2G1JA 1DB3A 4YJHA 1XK6A 4WVFA 4V03A 4HH1A 1FUKA 4ADSG 2O3JA 3O84A 1NX6A 2QUIA 1PHRA 1N3BA 2ZRJA 3I04A 2QLFA 3O0TA 1LK0A 4FW9A 5K0BA 2WM9B 4LDZA 1QG6A 3P2MA 1F60A 3I6MA 3MMXA 3MUFA 4D74A 4RADA 1O87A 4D7AA 5A2QA 3C2QA 4IEEA 2VFAA 3UO8B 3PFWO 1JDJA 1ZH6A 1YA6A 3RB8A 3V4PB 1KI3A 3TNLA 4ASUD 2HLHA 2ZDGA 3WGOA 2H2DA 2GJ4A 2A1TS 2HL6A 1L3BA 4LYYA 4KQKA 1E6WA 1ZJZA 1KH2A 4ZAXA 2PJRA 1TFRA 1SVSA 3EXEA 1F9EA 4QFBA 4E21A 3C1OA 4P2GA 1SCUB 3WL6A 5K8LA 3I2YX 4CTJA 2IZ0A 1JEEA 2QN6A 4JLSA 3E2IA 1V11B 4EEXA 3L05A 3QBDA 3UAGA 2UXCB 1DV1A 1N0IA 1N0UA 1W2GA 2JVJA 4GUAA 1G7CA 1A8PA 3BYZA 1NN1A 1OX4B 1GPDG 1N3LA 1OAKA 2ZUCA 4ZVMA 4N48A 4YCJA 4IZIA 3BAZA 1CR2A 4O59O 1FQWA 5A4AA 5FH9A 5BR8B 1DG9A 5GINE 1GU7A 4UM9B 4I7EA 5CYOA 1E6LA 5FBQB 4FUQA 4EVQA 4GECA 2A2ZA 2C9DA 5EP2A 3T3EA 4YMTA 5KTTA 3ZJTA 1FSSA 4Y1RB 1Q7EA 1XPUA 3W3AA 1UJMA 1XA0A 1G8MA 4K7JA 1CQWA 1YE3A 2O0KA 2P5SA 3AEKB 4IX1A 2AN1A 1E2HA 3S2FA 2DQKA 5TF4A 5B1SA 5U4XA 2UAGA 2C88A 2PT9A 2IX3A 1RLJA 1EUDB 3K2BA 1ILWA 4ZOEA 1ECJA 3NV7A 1N5IA 4K1LA 2I3ZA 5KYWA 4HB3A 1Z5VA 2NVOA 1PFVA 3FRHA 4B83A 3RQIA 4AVYA 1UFVA 3NB0A 4D4LA 3NJ4A 3FB1A 4N5IX 5H9VA 1HL3A 1WMDA 2BZ1A 2OV1A 3CWZA 5KKNB 2I80A 3QG1A 3UTCA 1Z6PA 4D6XA 1T26A 2TYSB 3KQTA 4S1TA 4WA7A 5EHNA 5KWSA 4CEIA 4R6XA 4KIWA 2PUWA 2O8FB 1QVZA 4PYKA 4BX9A 4TMXA 1QU2A 1MC5A 2FZGA 1WSDA 3HCPA 4MJXA 3EYAA 4U7WA 4WK0B 4E1AA 2ETVA 2X1HA 4QQ8A 3THYA 4U7TB 3O1JC 1FYXA 2O5EA 4YY3B 4YJ2A 5DIFA 3LCCA 1L5VA 4YRIA 3CF0A 2O6HA 1VFPA 2BMVA 3IA2A 3OQ6A 3M4XA 3R7BA 4HDNB 4E6EA 2OHVA 2H9YA 3DBHB 3TKAA 2JBWA 2DQ4A 3DJFA 4BKQA 2I2BA 3G0CA 3EX7C 1NE2A 1HA3A 1W581 1SJ9A 1TX4B 3AO0B 1GG5A 2P91A 4UM8B 3UF0A 3OTWA 2P6NA 2XMCA 2DUNA 5AKIA 5IDVA 5H4HA 2W48A 4MIOA 5MFPA 2FEMA 2XX3A 2XUJA 4Q9JA 5J2TF 3U80A 4N8SA 1T0IA 1Z18A 3PCTA 5DRTA 5E9JA 3OC6A 3QG5A 2PRJA 3ETEA 4OA8A 3ANLA 2FUNB 1L4YA 5EXXA 3SG0A 3U3JA 4NZYA 4O3MA 1RE0A 1MPXA 3ZQKA 4FQ8A 4Z8XA 3E23A 3WYDA 3CPEA 1W44A 3P0RA 1HRKA 3B8HA 2GJ8A 3CX4A 1YT5A 3G2LA 2JIRA 4U1RA 2PGDA 1IY1A 3O8BA 5GPBA 1QP4A 1QDEA 1ZCJA 4RE5A 4CKXA 3B7WA 2QMEA 3ABRB 1WF3A 3CKYA 4PR0A 3TXXA 4FDUA 3ZNNA 3LP8A 4BMZA 2NPFA 3NYRA 4C1BA 1W48A 2AD5A 4YHBA 4Q48A 5J4LA 1C8VB 5IN5A 3KHTA 3PVSA 4X3CA 5C5IA 1XTQA 5DNWA 2XGSA 4LZNA 1ZSNA 1X38A 3UFXB 2VP2A 1TKBA 3IELA 3ZCPA 4BHTA 3J81A 2F59A 4WESA 2XOKD 3T0GA 2E6UX 1FTQA 3E5NA 3GGGA 5AK6A 4ALNA 5LXTA 3FYCA 3KKZA 2VVTA 3VR3D 2Z6QA 1LI5A 3NJ8A 4FFWA 4PCUA 3MRTA 1H5QA 2XUOA 5TGTA 4EKEA 1DWOA 2YN4A 3BGVA 4WHMA 4YRRA 5HWSA 3JYNA 3KTAA 4FFBA 2BGTA 1Z12A 2NT4A 4FCVA 2HU7A 5LOVF 2VZ9A 5IABA 5HKKA 3C74A 2GXQA 1GTRA 2DE0X 4HAXA 3L8MA 4F38A 1JKIA 4O2BA 3R24A 3KSMA 4IKOA 5BVHB 2PHZA 4Y7CA 2FPXA 3O1HB 1J1ZA 2OXRA 1BGXT 2YJZA 2CWDA 3MT7A 4IIJB 1O57A 3UMGA 4ZDIA 1H3EA 1EXDA 1R9GA 1TUBB 3SYRA 1A96A 4KMOA 1OZ0A 4O25A 5JNRA 2AG6A 3ASYA 3JPWA 2A33A 3ORQA 1TK9A 3EB9A 1JKJB 1NSTA 4N8EA 5CW2A 3S1AA 4F85A 1NULA 5KC9A 3BTOA 1XMOB 1AKQA 1OYWA 4QX6A 2X0EA 1DV2A 4WNAA 1AK1A 2UVPA 5E7JA 3HXPA 1M75A 2PKYX 1MABB 4JOSA 1K7FB 1A82A 3AP1A 3EXFA 4G85A 1P7YA 4ZU6X 4DSZA 1ZWLA 1FDVA 1N25A 3V7UA 1ZRNA 1OAOA 3OP1A 3NALA 1I6KA 4C5CA 5GTDA 3UK6A 4W63A 2OFFA 3HCWA 2I7XA 4YBZA 4ZARA 1CZLA 5P21A 1KDRA 4MUEA 4AG3A 2BTOA 4BFWA 1L4UA 4YEDA 1YHZA 1GZ7A 3DBVO 3FHJA 1GTMA 3QE4A 1BMFD 2Z6UA 1CQIB 4NSNA 5ILQA 3DL2A 3INRA 2DPMA 5LJLA 1PGJA 3TSAA 1FDIA 4HGOA 5DYYA 4E5UA 1HLDA 2GK3A 2XB4A 3O4VA 3ZV3A 1R4NA 4LOJA 3OQBA 5LQUA 2BI7A 1LBHA 4DV6B 4P32A 1WNFA 5T6BA 4F86A 2AEJA 2VBGA 3BMXA 2W8BA 3IV9A 5JNVA 2BJHA 3SMVA 4Z7OB 2HBYA 1X3SA 1VE6A 3K31A 1AHIA 2HEIA 4B2PA 1OCEA 3K16A 4X41A 3RU9A 3QF7A 1NW4A 1UKEA 3LSYA 1VA5A 2AK3A 3EXAA 4N65A 4EOGA 3I58A 2ZTVA 1PSWA 2RH8A 5L8VA 2VDQB 2Y1LA 1MMFB 1H2XA 1W8IA 2HJGA 2NTNA 1SBYA 2R0QC 2CMDA 2Q0SA 3BIOA 4XI9A 1RAGA 4RS4A 2RGNC 2BMDA 3OQHA 1GSAA 3KPJA 4RK0A 4RIIA 4EB6A 2IBSA 2A9KA 3IMEA 1XTJA 1YQGA 1FU4A 3FPGA 4J90A 1T8PA 1FA9A 4RAQA 4QUBA 3IO5A 5C1BA 4MMXB 2ERCA 2NVWA 1WDKA 3A31A 2NUPB 5JQGB 4B8ZA 2G9RA 2P5UA 2AW3A 3GRFA 3H4MA 2P9QA 5ALDA 2IS6A 3KDSE 1UFKA 2ZRLA 1D2GA 1P7CA 1XROA 4IV0A 5IUJC 4LRYA 4B71A 4HAVA 1VG1A 3TIFA 4RY0A 3RVKA 4MROA 5DYTA 4BO8A 1AV6A 3DE3X 3H11A 2AX3A 1YJ8A 2F8LA 4FDAA 1KDVA 2JIQA 3IOYA 1XRPA 2FPSA 4BFLA 3DGEC 1JDNA 1SCIA 3TUZC 3L0SA 1OREA 4G24A 3IT2A 3E48A 4JLKA 4QNNA 3LHSA 5BPHA 4J8PA 4QC2A 1C7EA 4BGVA 3QOFA 1DXOA 1Y1SA 5AHXA 3JV7A 2FW0A 3SK0A 4DIFA 2ZAIA 3NFYA 5FWXB 1OH7A 2VBIA 3AVVA 2NADA 221PA 3SC3A 1P2SA 1PO7A 1TU4A 1USWA 2ALJA 3G23A 4ON9A 4TLCA 5FR2A 2VH1A 3M0EA 1SKQA 3IIJA 1QOPB 1UOQA 7REQA 3MBKA 4JT8A 4W5HA 3HB7A 2G6TA 3TJMA 2QT9A 1STOA 4N6GA 3P4YA 3W7BA 5BNIA 5IM5A 3CTPA 5JFTA 3RYCB 4AY5A 2Q0QA 3H5WA 3M1LA 5IJ9A 1MENA 1YVDA 3IP9A 1F8XA 4W7SA 2AF4C 3L18A 3T7EA 1E1NA 1IIBA 2D1RA 1OUMA 2C3PA 3NRBA 2DMRA 4FR2A 5D3KA 3WYNA 4C03A 3MT8A 1CY7A 4E5VA 9LDTA 2EP7A 2HIAA 1LF0A 2WTMA 4C4AA 1I4OA 4F3KA 3KQQA 4TSKA 3SF8B 4M21A 4BMVA 1K9SA 1Z15A 1I7QB 3QI2A 2WRZA 5L9AA 1D6MA 2PH7A 4PY2A 2QLNA 3HCAA 5JECA 4EJSB 2YFHA 3MERA 1R1DA 4K6MA 2BTEA 1G18A 2G09A 5B30A 5JMOA 3I9FA 2P3SA 2AEFA 3U3RA 1BMDA 1WUKS 3VYTB 4BE7B 3AY0A 5BUZA 4QL3A 4PNEA 3HA7A 1OR8A 2G8LA 5IMBA 3V1NA 4P2BA 3GJ0A 2OORC 2FEKA 4QPDA 1DOHA 3B6KA 4UTXA 1UP7A 5CT5A 4CV0A 4HPXB 2CXHA 3FOAA 1U04A 3JVVA 5AI4A 4PGAA 5E2BA 1A4RA 1L4BA 4WXRA 1ZJ6A 4CQJA 3R40A 1YASA 4RMGA 3AM4A 1TYZA 4DBLC 4DRYA 3I4FA 5BWCA 4E5DA 4WFQA 3IIMA 1N5OX 2ZKLA 3PD0A 2FLWA 1OXBB 1BQ3A 1Z56C 3UG7A 2H1CA 1G2QA 2QRQA 3NBMA 2B35A 4M1MA 3RROA 2NYRA 1NJFA 1KSJA 1F12A 4U2KA 4ZWNA 4HWRA 3QFHA 4E15A 2HMWA 2EQAA 5TQ2A 1W76A 1WCYA 4HDSB 1FUEA 4KNVA 5L3ZA 3O03A 4OHVA 3TTSA 2V1UA 3T61A 2OBMA 3IKJA 3REQB 1JFSA 4BYMA 1NI4B 4TQAA 9LDBA 4UOQA 4ZVOA 1XJCA 1PFGA 5D00A 2NUBA 3LBIA 4AUEA 1O95C 4QULA 2DB3A 3T1OA 4FI3F 3CBGA 4D9JA 3LSTA 4EO9A 3CLRD 3A2MA 3WKCA 1EXNA 3N6RA 2XHZA 4LIPD 3ICOA 4FGZA 2HMYB 2WHPB 1QBGA 5FUWA 1L4NA 1N57A 5ED0A 3SQNA 5AW2A 4NBVA 5KYYA 5ICSA 1F20A 3OJOA 4ZKDA 1EDEA 2A4KA 4X92A 1RD4A 1WW8A 5A71A 3U6BA 1ST2A 1LPOA 1NQTA 3VJRA 4A8HA 3L4EA 4K03A 4LISA 2JFPA 3PQ3A 4LOKA 1QWSA 4FIZA 3K0BA 1O97D 2FRXA 1JH8A 5EPUA 4ZJZA 2YUIA 1TLLA 3VR4D 1JWLA 2JIOA 2JFGA 4QODA 2Z1MA 1RPTA 2GXSA 5JHGB 5K0TA 2BP7B 4RULA 3DT9A 1G21A 2FLKA 4JMLA 4Y6LA 5CDGA 1MJ5A 3VYUB 1PGQA 1Y5LA 3IOEA 1IE3A 1RCFA 4OYYA 5FTLA 1KI8A 2OGUA 1LK7A 3DW3X 4FOOA 2CVZA 3KDAA 5TDHA 1BYUA 3ROQA 4IKEA 3LVRE 1H0RA 5HQTA 3Q8KA 1TF2A 1PEYA 5CIQA 2B4RO 1SG0A 2WUDA 1IK6A 2SCUA 3TTWA 4KLNA 1OZGA 5I45A 4OL0A 4AMGA 4R01A 4GBJA 4JYBA 4OBXA 4AY3A 3DZ8A 2HBQA 3PZRA 4D3YA 2JGDB 4KO1S 4WNCA 4CKEB 4EZIA 3G1TA 5LN1A 1XZLA 3OCJA 5CDTA 3FYSA 4CLDA 2PBRA 4EELA 4DW8A 2WTNA 1LI4A 1DCTA 4D8WA 4Q4JB 1Z36A 1OGJA 1YR8A 3K09C 5H3CA 2IC5A 3LHKA 4ZYVA 1AUQA 1KJIA 4JI1B 3N39C 4C14A 5CTAA 1O5OA 4YCSA 5LQKA 5HRUA 4Q3CA 1SA0B 2Q0XA 5LYJA 4LOLA 5JC8A 2C61A 4OFXA 4PO3X 1GNRA 4KQ6A 1NMYA 4QFCA 5BWBA 2CV2A 1VIDA 2DUJA 1ZOLA 2BZSA 2QBYA 3ZE7A 4LC1A 4F5YA 4XUCA 2YYZA 1XTUA 2P0YA 1JUDA 1L5HB 4PBTA 3KVYA 4G23A 1P45A 1C9KA 1XX6A 5E4JA 3RVPA 4QVIA 5CM8B 4YLGA 3HEBA 3ZY2A 4QGHA 4BB9A 1ZVJA 3GCGA 1OVGA 4Q3OA 5FUMA 5JAUA 2AIRA 1NUUA 2YJNA 3NH9A 1Z5NA 1TA9A 2LIPA 4FW8A 3EG9A 4BX3A 1XNQB 5G4KB 2RHJA 4BAUA 1W36C 2Q6OA 4R8LA 3FROA 5FAKA 3PHIA 4I4IA 2ZPUA 4UUNA 4YIKA 3FKSD 4URFA 1NYQA 1QHGA 4C76A 1X15A 3BCSA 3NEAA 1JB9A 1DKQA 2BTQA 2XBMA 1HLPA 2B9EA 2OILA 3M6WA 4MHSA 3P52A 4O3FA 1JYFA 3S5JA 3A70A 4YRLA 3WK5A 3ZDYB 4PRKA 5K3FB 4HWGA 4ITVA 4N5NA 4O4LF 4ZGWA 5CBPA 4ZPXA 2OV4A 1SXJE 2CHQA 3F3MA 5ADWA 1GUYA 1SHKA 4FJ2A 2GJSA 1Q92A 1BFKA 1PV1A 4RF2A 4OQMA 4B6RA 4D3SA 1XD2B 4RLFA 5EL0A 1PR9A 3WLAA 3S2SA 5ABPA 5G0SA 1S2IA 1T8TA 4QBGB 1PDOA 5H8WA 2PRIA 2ECOA 3SNHA 1IXRC 2P4EA 3LVFO 4II2A 5AW8A 2B98A 4IZHA 2WG0A 3AT1A 4UBKA 4W4TA 1U7ZA 3UAVA 1GZ4A 5CJJA 3KR1A 2QAIA 2F43A 5BPFA 2KQUA 3QYPA 4JI7B 4EI2A 3WLLA 4PLWA 4UZEA 4YMIA 1D3AA 2XUAA 1RWOA 4L3VA 5LCXA 3IVRA 3G1UA 1Z4OA 2H7VA 1SKYE 4C87A 4D6YA 3EQ8A 3VA7A 1JB1A 4OAOA 3EF1A 4QNRA 1MG5A 4FJ1A 3TMKA 1TM2A 2NW6A 3K72B 1U7PA 4IS2A 4AD8A 3LTNC 4GYKA 1XVIA 3RS8A 3PGMA 2VI5A 2ZYWX 5AOBA 3M49A 1QUFA 4MXDA 4V0QA 5EQFA 4AMZA 2FV8A 4CCYA 2V0CA 1DO2A 1XDBA 3P9ZA 5DE3A 3OEWA 3QV1A 3HNPA 3ZJ5A 1UXGA 1KJQA 3KYIB 1IPFA 3K5IA 1QIDA 3NOXA 3R4CA 1AXRA 2H2AA 1YQDA 2YQZA 3KELA 3RVDA 1YRYE 3OZFA 4D8XA 5PGMA 4CTOA 2PJUA 2WIAA 5DB4A 3I5MA 4HNQA 3LT0A 3ENKA 2GCNA 3TWOA 3BL5A 4URHA 2VPTA 3JQFC 4J0IA 2PA3A 1FPQA 4QKQA 1U0RA 2X1VA 4UM9D 1Y4UA 2BT4A 4LRWA 4OMUA 5IBPA 5KYXB 3NPAA 1CIVA 4MI3A 5AKXA 2FY8A 4FEYA 5EXTA 5EYPB 1PVVA 4HT3B 2HXGA 3NGMA 3EZNA 3LLMA 1IFXA 3L6BA 2FHPA 4G81A 1R18A 3F7OA 3GLHE 1XU4A 4J43A 4U7PB 1E9AA 3FHTA 1TCBA 3GARA 4RY2A 1NNI1 2X86A 1U81A 4AZSA 4GI5A 2QXUA 2P9YA 1LD3A 1P62B 3L0CA 3N5KA 4ZT2A 3UAYA 1CJMA 1PZXA 4WY2A 3QITA 4RC9A 1W85A 3U3OA 3RIHA 4ENVA 3P32A 4BMXA 4NZMA 4DAOA 3PR3A 2LKDA 4I6EA 5JCJD 2W2LD 1M34B 3DKRA 5HF9A 3SU8A 2I7DA 1X9GA 2CW5A 3G85A 4FSXA 1Y0BA 3DZKA 2PWBA 4WK4B 4RA6B 1Q57A 1AC5A 3CNHA 3TXYA 4MYCA 2HV8A 4A6XA 4CPDA 1KQPA 3K6RA 3OJLA 4Q4HA 3IKTA 3ZHVA 1RWQA 3QKUA 2N1BA 1VLQA 1X94A 3SYKA 4DBVO 3BJMA 1YR1A 3QNUA 4CODB 2UZ3A 1TUGA 1E2BA 2IU6A 2C7QA 4HDCA 4LXQA 2JHFA 1E1QA 2KE5A 2AB0A 1JSXA 1R6VA 4ESOA 1CXZA 1RR6A 1GV0A 2WLTA 5J9FA 2CC2A 2ZJFA 3D3JA 5LB4A 5CDUA 1Q0TA 1QPZA 2WEKA 4BRUA 4F5ZA 3WICA 3BXGA 4LSWA 5E3IA 3N05A 4HQNA 1UT6A 2F48A 4OBEA 3KEQA 4DA8A 1QHNA 4Q82A 3FWYA 4YO7A 3CINA 1TIKA 4V3CA 1UZUA 4Q34A 3ZWYA 2ERYA 1PJ4A 1VRWA 2FWMX 4Y9TA 3SQOA 2LRHA 1I1OA 4X3OA 4GPTA 1PT8A 2NV2B 4BKPA 1DHTA 4ZI7A 1W9MA 2YJTD 2ZSKA 5A4MS 4ZODA 3R3JA 4OUDA 5EXDA 4PIVA 3QPBA 4ARZA 1QF7A 2VF2A 4L9RA 4CM4B 3V97A 4X6YA 3NLLA 4H3HB 4XB1A 1C9MA 4AZVA 3DDNA 1JR2A 3HB4X 3OEHD 1F5SA 4IXDA 4DCNA 1JLSA 4DJTA 3TZEA 4LV6A 5IASA 4EEKA 1EJ0A 1WTCA 1XDGA 1Q0HA 3HMKA 4MS3B 4NU0A 4ZJUA 5MN5A 5HZHA 1MO6A 5KC8A 3E9ZA 1RLMA 3SZGA 1Z6ZA 1XE3A 4JOCA 1TQ6A 5A0TA 2Q3LA 5JT1A 2FUCA 1Z6TA 1H2BA 3RF7A 4F2GA 3LY5A 4TL8A 3SR0A 3BM5A 3NWPA 2FN8A 2D1FA 1AMOA 5ALVA 1ICIA 3L3BA 1R74A 1MD9A 4RJIA 5I8ZA 3WGTA 5CB6A 2CGEA 1KDYA 3I05A 1R15A 1T0JB 2ILVA 2BC9A 2XDQA 3OLXA 5TR9A 3W5SA 1LBTA 1S3GA 2EIXA 5TC4A 5E6UA 3KLMX 1HDEA 4HWOA 1WXEA 2QN8A 4GLBA 3ILVA 1KY4A 4EPRA 2V03A 1PTKA 5JDIA 3WB9A 4KH1A 4N0DA 3U3ZA 4B6EA 3IKMB 3B51X 1U2ZA 1TYBE 1VKOA 4DSAA 1WXQA 2WM2A 2DKOA 3MAJA 2ONKA 4BNHA 1LU9A 3DR3A 1PTJC 4J3FA 4OLJA 3EMVA 3NDRA 1T4GA 2Z2YA 3EGIA 3IPRA 5C1DA 1B0PA 3OFSA 3T34A 2OCPA 1I4EB 3WL7A 1I01A 3KTFA 3IVAA 3U40A 3O31A 1N2CA 1YRAA 3DAOA 4XRRA 3M81A 2NZYA 1RXIA 3DBLA 1E7MA 4A8JC 2PUGA 1ZNYA 2JIZA 2X3FA 3BCHA 5JR3A 3BB3A 2CXQA 2IH2A 1F6WA 1ZK0A 1NT2A 2Q07A 1IBSA 1P7VA 2Q41A 1PR2A 1Z28A 1CZUA 3A25A 3R09A 5ERXA 4CMGA 3KXIA 4CCSA 2Z2XA 3B1XA 3JVEA 3UT5B 5C46F 3OZVA 4GU5A 3OMXA 3NONA 4B6SA 2W6PA 4DC0A 3QMVA 4OHXA 1Y89A 2CCJA 4K9LA 1G8HA 4MV5A 3BD7A 3C3CA 4IMRA 1K7XB 1JA1A 1V1RA 4ZVTA 3VR2D 1K98A 4P36A 5LP6B 5CCBA 3E03A 2AOTB 2Y4NA 3UQYS 1X1RA 3MINB 1M5TA 1R5NA 3OT1B 4RPGA 5CLQA 3SHOA 1T9CA 3OE7A 4RH3A 2GLTA 4LRSB 4BNNA 3G2OA 2H63A 1AQUA 3L4BC 1ORHA 3I76A 3QKSB 1YC2A 3OZTA 3VZBA 3KSDO 3G2KA 3U9SA 1LX6A 3D4OA 3G9QA 4GOJA 4YAJA 3MS4A 4H08A 4ZALA 1YZ3A 5JZ9A 1KETA 1LKZA 2OK8A 1ORVA 1P1RA 3NUZA 3PFNA 5ADUS 3A2KA 4F3YA 1HT2E 1S01A 3E8XA 3QLJA 1ZICA 4KVGA 3VNQA 5KCZA 2D0IA 3CN9A 4D3ZA 4BNFA 3ZYCA 5JDCA 4NABA 1XTSA 5D2CA 3FR8A 4C20A 4A15A 3BSYA 1ZY2A 1H6AA 1EP2B 4FE3A 3RFTA 5LSAA 3S4YA 4QXAA 3BFKA 1Q84A 4YP0A 1SOWA 3QM1A 3H6KA 3Q7IA 4TUYA 2C9OA 2YL2A 5D84A 4EQ6B 3D8UA 1EDDA 1FBNA 1OLOA 1QONA 3ZIAA 4HFNA 4NV0A 4EYEA 2QRVB 4MV6A 5JALA 4WY5A 3I62A 3FIUA 1NVDA 3C8ZA 1R6TA 2C4NA 4Y0NA 1U0NA 5AJVB 1J2JA 1A9XA 1GDTA 2ZS9A 4DUYB 1H5UA 2I8LA 4DANA 1PEKE 1QCCA 2R8EA 3MQFA 3V4LA 1Q0LA 3O47A 3QUSA 2C5BA 1MJNA 1KKLA 1NVXQ 2OKGA 1PJCA 3RI3A 3BHIA 4I1SA 4FP9A 4BRWA 4C0SA 1F8UA 2CL7X 2EFEB 3A8TA 2O8VA 1Z5UA 5E4YA 3KVRA 3C6ZA 5BSHA 3KHUA 1UP4A 3PBKA 4CKWA 2QYOA 1SOMA 2GN2A 1JPJA 2Y1EA 4HGNA 4KJZA 4NJMB 3U4DA 3ZZUA 2AJLI 3A37A 3RJ5A 4TT3A 3LGXA 4TVBA 2VP6A 2HXSA 4E88A 1GSOA 3HGMA 4F4DA 5K8JB 3N0VA 1IY2A 1PJ3A 1L7EA 5TJHA 2O2SA 3VR6D 2PKXA 4IMPA 1FUIA 1ZZGA 1W8DA 3BF7A 2HK9A 4BCDA 2NX2A 1RPAA 3RT9A 1X8XA 2W2MA 4PPNA 4A0HA 4B2IA 4NPCA 2VT7A 2WTEA 5E6SB 3AUFA 4KVFA 1Y8QB 1UC4B 2A59A 2PL3A 3K0FB 1ULAA 4UEKA 4WCFA 4BVEA 3ZTTA 3JSAA 4PTYA 1MGOA 1G98A 4QBTA 2BFNA 2WWTA 5JSUA 3R9XB 3WYFA 3H9JA 3MBIA 4MB0A 3IFSA 1P7PA 4CETA 3S27A 2KLHA 3JQEA 4YIHA 3V6LA 2LVBA 3BK1A 4NMWA 3SYTA 4LAFA 1Q3TA 3KXPA 5MGBA 4HS9A 2GM4A 3ZDAA 2SBTA 3I04M 2OO7A 2BEWA 1FDUA 1OI4A 4JLNA 4OJTA 4ME6A 1GADO 4D8YA 3ADBA 2I3BA 2NU7A 3DZHA 2WZBA 2VT3A 3DFKA 1A5TA 1O8BA 3O2QB 3VAZA 4D9HA 4Q1AA 1Q50A 3V34A 3KQWA 1PX0A 2GPYA 2VUUA 1C1DA 1V5WA 4P33A 4UM7A 1SBNE 4M88A 4AUMA 5F35A 5CDSA 1UDAA 3D4PA 3SAJA 3HVJA 2AW5A 1FTGA 1RPJA 2JCGA 3DXFA 2ZYIA 3MYYA 3PR1A 4KZPA 3V8RA 4EW2A 1X1AA 2NTEA 3U4GA 3R3WA 3QELA 3JAWA 1EVLA 4IJVA 4PLPA 3DMYA 1TO2E 1ZEJA 4FIDA 2XJ9A 3I53A 4RUKA 4AURA 3O75A 1NVKA 1T6BY 1ULTA 3GLUA 3RYFB 1XDUA 1BS2A 2VG8A 4CVNA 3GNQA 4ZZ1A 4CT0A 4F84A 2XNJA 4K81B 4H7JA 3VZQA 3D3EA 5F12A 5HIKA 1I1QB 4LZWA 1CDDA 3LQYA 2GVNA 4LNUA 5J2TB 3MSCA 4PR3A 3ZWQA 1ZRMA 1HSOA 4HRAA 5FQOA 4Z54A 2G1AA 4FEGA 4DT1A 3K6SB 4IJ6A 1P2UA 3ACCA 1CDEA 2REOA 3O21A 2DQZA 4NPHA 5DMHA 1M83A 3NKVA 2Q5EA 4I2NA 2AF3C 1L4EA 1E2NA 1SK8A 2POCA 3I32A 4OYRA 5DHTA 3RS3A 3VZPA 2R1TA 3FA2A 5K8UA 1CQZA 1ISJA 1E99A 2CLDX 1NF8A 3KYDA 9MHTA 4DG5A 4MEAA 1ZD8A 1ZGBA 5E1MA 1NVUQ 2G07A 2ZRGA 1CLEA 3EFEA 5I9TA 5CM2Z 4DSNA 3AXSA 2E18A 5ALKA 2ZVDA 1G1MA 2BSAA 2O8FA 1BE0A 3FTFA 2ZPAA 3DLBA 1V8PA 3P2OA 4AYXA 4QYIA 2AMJA 4X24A 5KHAA 1NXSA 4YP1A 3U3DA 3UIEA 2PFGA 5B7QA 1Q5PA 5K0JA 3C3MA 1G3UA 2R7MA 4FINA 4URXR 2QM0A 1HYHA 2JAOA 1I2ZA 3U7QA 2HT1A 4E1VA 4CV2A 2CLHB 1IZ8A 3HRKA 1F8FA 1K68A 4IP0A 5HE8A 5JSHA 4L95C 4CKYA 5LOVB 1NJ5A 4ZT5A 1D0VA 5IG2A 4LYDA 1N5MA 1C7RA 2XUQA 4L0MA 4W1QA 1XU9A 3CM0A 5FX2A 3RHTA 1H2YA 4IDCA 3TZHA 4PLZA 3H7IA 3BVPA 1S96A 1ZW1A 1R2QA 3TLMA 5FNZA 4OSPA 1PQPA 3TCXB 1JL3A 2HBZA 3WGGA 1IXKA 2BM9A 2VYNA 4GDMA 4F1WA 4F4FA 4L5JA 1L4MA 4DC1A 1K66A 4XA8A 2XKBA 2C2WA 2X5NA 1N8SA 1SURA 3DO6A 3FIJA 3QSGA 3HCNA 4LGMA 2G6BA 3L1HA 4QO7A 3UTDA 3O2NA 1SO8A 3EDMA 3FFAA 4R84A 3LUHA 2ZAYA 4DV0B 2F3PA 3U19A 2GNPA 2PH5A 4QBHA 1F4LA 1ZN8A 3QXXA 4OX9B 3LS2A 4G3XA 3S7TA 2ETXA 2GT1A 2RH5A 3AX6A 5K8VA 1ORIA 2XA2A 2WTUA 4ER0A 4RTKA 4ZOLA 3HR7A 1W5TA 4BO1A 3ANNA 3R7FA 1MVOA 4LXUA 3M3PA 3FLBA 5F5LA 4HHEA 4FMCB 3GEEA 5HA5A 5BOSB 5KNCD 5DTMA 1C3VA 1D2EA 1Z4IA 1U8TA 2YDXA 1KO4A 4A92A 2OWEA 2IIBA 3BQNB 3OFND 2RSLA 1T9DA 1ODTC 1PJBA 3WK4A 2PX4A 3ZXXA 3ZK8A 2X9VA 4FK8A 2H1WA 4QUDA 1NA5A 2H2FA 3ELYA 4KKVA 4S2EA 5F3RA 3TNFA 4DMMA 1ST3A 4O2AA 5EA2A 5BSGA 1LTHR 1R8SA 2XTJA 2XWQA 5ARDA 2JS7A 3EW7A 5NLLA 4JL5A 3HSYA 2B21A 4PLGA 4G5FA 1WOYA 1NTOA 2ZR8A 1OMOA 3W9SA 3MTJA 1S1CA 1P1KA 1Z6GA 2A94A 2L69A 1MTZA 3VTAA 4DWVA 5L4LA 1J6UA 3WZ2A 2C2MA 4MLCA 2C99A 1TM1E 2QXYA 5CHEA 3GEDA 1L7MA 1FS5A 1UADA 4ZQGA 5E7MA 4ESEA 1PNTA 1SHLA 1TQ4A 3IOBA 2IE8A 3F46A 4H7FA 1KMHA 1AVTA 1RP1A 3TLKA 3TW8B 1GQYA 3I45A 3I61A 4MVJD 3LPAA 4D4HA 5HZKA 2RC5A 4Z99A 2OR3A 2PS0A 1GL6A 1MB9A 4U5QA 1EK2A 5JD3A 4LYEA 2GEVA 2OO5A 4BAZA 3SQXA 2GETA 5AW1A 1S3SA 4XWGA 2ASEA 2J9RA 2EW2A 4A5OA 3I8OA 2DCUA 1P1JA 4RD6A 2E4ZA 1DQPA