3EMKA

2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
246
structure length
241
Chain Sequence
SMFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAELGERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRRNGRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.5A crystal structure of glucose/ribitol dehydrogenase from brucella melitensis
rcsb
source organism Brucella melitensis
molecule tags Oxidoreductase
molecule keywords GLUCOSE/RIBITOL DEHYDROGENASE
total genus 88
structure length 241
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3emkA00
4EDFA 2Q4EA 2O2YA 3NDRA 2YYYA 4U0JA 1NVMB 3W6UA 1A71A 1PTJA 3GNTA 3BHIA 4XQ9A 4CL3A 1HDZA 3JQ6A 3JQ9C 3PYMA 4YAJA 3U9LA 1OOEA 3M2PA 1OMOA 3MJSA 5KJCA 3G49A 1ISGA 3ZCXA 3AUAA 2UVDA 4YPOA 5ES3A 4OO3A 5DT9A 3HSKA 3GEMA 1U3VA 2FR8A 1R4NB 3I5MA 3FSRA 3IJPA 1EVYA 4GI2A 2Z1NA 5TNXA 2BI7A 1QSGA 2ZQZA 1ISMA 2JFHA 3JQFC 1SZJG 2FWMX 3RBVA 4DL9A 2VHYA 5CAEA 2OMEA 1C1DA 3GG2A 4J3FA 2BMAA 1GZ3A 1QR6A 3WDSA 2Y1OA 1M75A 1DOHA 3CIFA 4LVUA 3S55A 1O95A 1I30A 1CQIA 2XAAA 3WS7A 5A9SA 2Q1UA 2JCXA 4EEZA 3E6AA 3KYCB 3PIDA 4KUHA 2RH4A 4B8ZA 5B12A 1ISFA 1B0AA 3WGQA 1E6EA 5JPIA 4NFSA 4A27A 3QY9A 2NADA 2X0RA 4XJTA 5BNIA 4KP7A 5L7WA 4PRKA 2EIHA 1LI4A 2BI8A 2R00C 3TFOA 5A04A 4DYVA 1PJTA 1UDCA 3F1LA 1IULA 4IDGA 4KWHA 5JO9A 1GZ4A 2BHLA 1WMBA 4J4TA 2C2YA 4U5QA 2I66A 5BR7A 1Y9EA 3A1NA 3DZFA 5JAZA 3KZVA 3U09A 1E7QA 1X7GA 3C1OA 4Z9FA 1HSZA 1LDGA 3IOYA 5ADHA 3BMQB 1LDBA 1K2WA 4GWGA 1FXSA 1N2SA 3L0DA 4J0FA 5H83A 4GH5A 4KDEA 3GPDG 4TVOA 4WLEA 2EXXA 5JC8A 4WLFA 1R16A 1WW8A 4Z6KA 4HWKA 1WZIA 3V2UA 4XGKA 1K6XA 4FFRA 5IXSA 3BMQA 1WP4A 1BGVA 1E77A 4YT5A 5EQFA 2I3GA 1OI7A 3QWAA 3OJOA 4NBRA 1HDYA 1A7AA 4EITA 2ZCUA 5GZ3A 2PR2A 2FN7A 5JCJD 2C54A 2B83A 1ZK2A 3ENNA 5A9TA 3I83A 5ER9A 4EBFA 1H0KA 4AFNA 1A5ZA 3EGOA 2Q99A 3R1IA 2DTXA 4I5EA 1XDWA 4RLSA 5ICSA 1I10A 3GVIA 2VHXA 3DBHA 2BKAA 3AFNA 4PLVA 3O03A 4Q3EA 3H9EO 1PU2A 1GUZA 4RPGA 4UUOA 3G0OA 3WB9A 4IIUA 4QSMA 1PWXA 1V35A 2Y1GA 4CQMD 4DXHA 4M55A 1BHSA 3R3JA 4GQAA 5KIAA 4U8GA 4XGNA 1MV8A 4XYEA 5T67A 4UEOA 4W6ZA 1YB5A 4JBGA 4E2YA 3K31A 3NKLA 2VT3A 1V6AA 2ZYGA 1HTBA 5L51A 4TRJA 1TI7A 3H7AA 3OETA 3E9NA 4TQGA 5EIOA 2Y1FA 4E5KA 2VNAA 1QYXA 4K26A 1R4NA 1U2GA 2OBNA 3HWRA 4XYLA 4ALIA 2VWGA 1Y81A 3C1AA 3LDHA 1EEHA 3QHAA 4J7XA 3KXDA 1QP8A 4D41A 4R16A 1H6BA 2HU2A 4AJKA 2Z95A 4UAGA 2IODA 2P5YA 5T5QA 1PGQA 1ZSNA 3AM5A 4CM4B 1EFLA 3ZWWA 2IRWA 1GD1O 2P9CA 3PRJA 4YEDA 3ZV4A 4W9NA 1U8XX 1E1LA 5EJ2A 1LLDA 3WFJA 3GA0A 1MG0A 3AJRA 1LUAA 1JWBB 4RPJA 4XYBA 5JE8A 4D3DA 2B36A 2D3TA 4GWKA 1CQJA 2QX7A 1DB3A 1NFQA 2QZ9A 5HBRA 1JU9A 5G0UA 5FI5A 3SLGA 3WGGA 4FJ2A 3PJFA 1IUKA 1GAEO 4QXMA 4TKMA 1CDOA 1KVQA 2PKQO 2WDZA 4PVCA 4XCVA 1EDZA 2NU7A 5DZSA 1WLYA 4YDRA 2GZ3A 5K6AC 3U62A 2YHIB 1T1SA 3LF2A 4NPCA 4WLNA 3JD3A 4Z0PA 1F0YA 1K6JA 4INAA 3W1VA 4A10A 4ID9A 3RC2A 4UVIA 3WQSB 3R3SA 5G0VA 1FJHA 2UDPA 3UOGA 1WWKA 1NBOA 2P4HX 5AQ1A 2B37A 4BMSA 2Y68A 2DM6A 3LLVA 5KJEA 3VH3A 5TRTA 4CMIB 4MIYA 1FDVA 3H9UA 4RVDA 1IZ9A 4F6LA 1SBYA 1A72A 3N74A 4J7CA 3RU7A 4BKRA 4PZEA 3U3XA 1DIGA 4E30A 3OICA 2J5RA 4MPDA 3W8EA 3MZ0A 3KYCA 2QYSA 5GMOA 5I8ZA 9LDTA 2R2GA 4OKNA 1R0KA 5HWSA 4KDFA 1V8BA 3OP4A 3H2ZA 3RFVA 1PJ4A 4KTVE 3W4JA 4L76A 2AQHA 3OEYA 3AU8A 5A3VA 1R12A 1K6IA 3C7CB 4PLZA 3RASA 3WJAA 1Q0HA 4GGOA 3ZHZA 5CEFA 4DBVO 3WGHA 5BSEA 1M67A 1NR7A 1DAOA 2VOEA 5DULA 3QQPA 3V8BA 3MCVA 2GDZA 3L6EA 4HFNA 2NLOA 2JD1A 3BMOB 1NPYA 3D5QA 1IL0A 1UZLA 1PJ2A 4XDZA 4IQGA 2I6TA 2QQ5A 2GRAA 3ORFA 4BNKA 3HDQA 2V7PA 1E7MA 1YWGO 4YB8A 3GG9A 5CG2A 2YHIA 4CLDA 1ZJYA 3SX2A 1I36A 3ETEA 4NH4A 5A06A 4BO1A 2FY8A 4HFRA 3VZQA 1S6YA 5BNFA 1HRDA 2WD8A 5G2OA 2FSSA 1E3SA 2VHZA 1C14A 2W2KA 3GHYA 3INTA 3WGOA 4GSLA 5A5EA 2VYNA 4LVCA 1A4IA 3JD0A 2UUOA 4I08A 3AWDA 1EQUA 2GPTA 1NWCA 1LA2A 4IXTA 4BKUA 4JK3A 3UXYA 2X0IA 1BXGA 2UAGA 1CERA 3KYDB 5BSGA 4J91A 5L3ZA 4R4JA 2V6FA 1GQQA 4O0LA 1P1HA 1XA0A 2XXJA 1HYHA 1XLTA 2C2XA 5EL0A 5MGBA 2C82A 4YR9A 2G82A 2YZ7A 1LXCA 2D0IA 4PLYA 5CP8A 3Q6IA 3RUIA 1MC5A 2DBZA 2P4QA 2EKPA 4BNJA 2CNBA 1HE2A 4IJKA 4DIFA 1SCUA 2Y0DA 5COQA 5JAMA 3HE3A 1FK8A 3HG7A 3VTFA 3ZW8A 3JYQA 1GEEA 3MJVA 1N7HA 3ONDA 3PDJA 4A5OA 3JD1A 1AHHA 1RM4A 1LLQA 4MVJF 1VI2A 2QRKA 2PH3A 3C8MA 4PRLA 2VWHA 5THQA 4IGFA 4B79A 1SNYA 3HNPA 3SLKA 4RF3A 4GLLA 2VUTA 1PJSA 4BO5A 2VWQA 3DMTA 3P2YA 3DQPA 4LN1A 3LT1A 3NT2A 4XIJA 2NU8A 4B3IA 4RDIA 2A92A 3ZHYA 4D46A 2AHRA 2PTGA 1F06A 3F4LA 1E3WB 4ZN6A 2EW2A 3FBTA 1E92A 1HDOA 3KOUA 1KVRA 5TJHA 2ILTA 1F8GA 2VTDA 3ZWCA 2YDXA 3IUSA 3U49A 5BT9A 3ETDA 3WQRA 2OHXA 1GPJA 3GUYA 3NJ4A 3RUDA 1HE4A 2XXBA 4BMNA 4HX5A 1JQBA 4RCVA 4B7XA 1LTHR 2DC1A 5BQFA 3NDIA 3JQ9A 1ZMTA 2JHGA 2PKQP 1KYQA 1O89A 3FWZA 3WNVA 1DAPA 4CM5A 2ZTLA 2PGJA 3FNHA 2AG5A 4CMJA 5JY1A 3MOGA 4M49A 1EMDA 2NTVA 3ZWXA 4LSWA 4PG5A 4LGVA 3WJ7A 5JNLA 4JX8A 1XR3A 4TRRA 4WKGA 3KRTA 3BMOA 2W90A 5HTOA 3IL2A 1J49A 5IZ4A 5DP2A 3WYBA 4TRMA 2W4QA 3JYOA 3JQFA 4FC7A 2XF8A 2Y93A 2X22A 5KVQA 1MG5A 5LDGA 4DWVA 4E21A 4OAQA 4MKZA 1JW9B 3EC7A 1UR5A 4OM8A 2GLXA 1YVEI 4W82A 4CMCA 1XQ6A 5AYVA 2O3QA 1GDHA 4BO4A 2NV6A 1DFGA 5KJ6A 3LQFA 1XIVA 2YY7A 3GQVA 4EYEA 3FWNA 5EINA 3VDRA 4JNKA 1SMKA 1YQGA 3CE6A 2GCGA 4AJIA 4OH1A 3E9QA 4BNYA 4YRBA 1Q1NA 3D4OA 5ILOA 1PGNA 2RAFA 1U9JA 2JFGA 3DB2A 2HMUA 2ZTVA 3OJFA 4OXKA 1BW9B 4FR5A 4GMGA 1Q2XA 2ZTUA 3TJRA 2IEDA 4U7WA 1U2DA 3PHLA 1PJQA 4WCFB 1UXKA 3PQFA 3DZHA 4ND3A 2IDZA 1EDOA 3STHA 3IDSA 4IJVA 5JDIC 4PG8A 3NT4A 1T2CA 1VRWA 3HN7A 3C7DB 3OSUA 1P45A 1WDKA 3ZNQA 3FD8A 3G3EA 2BGMA 3P7MA 3H3FA 3GRKA 4ND4A 1U7TA 3NGXA 3DBLB 1QXSA 4L8VA 1XHLA 1Q0QA 2EV9A 3KYBA 4AJPA 3LU1A 1LC0A 3W4IA 1YQDA 3KYDA 1HDGO 1HT0A 2IXAA 2H1SA 4MVJE 4B7UA 2EGGA 3SJUA 2D2IA 1NX6A 4BNVA 3JQ8A 3ZGYA 5CFZA 3JCZA 2YW9A 4CLRA 4EZBA 3GZNB 3PFFA 1I32A 3EUWA 3ETGA 4NFYA 4TVBA 5A5FA 3KM0A 4DIOA 4UULA 2BGLA 3KLPX 3RVDA 3ONFA 1ADGA 1QLHA 1DFHA 4BO0A 3C85A 2HCTA 3AW9A 4BO9A 5L9AA 3M6IA 4PLCA 3TL3A 4ZD6A 1W73A 1CEQA 4R5MA 4B4OA 1KVUA 3PXXA 4FQ8A 4ZICA 1H5QA 2Q2QA 4E2XA 3ZI0A 5K9ZA 1EFKA 1YJQA 2HRBA 2HDHA 3KTDA 3ROQA 2YFQA 3RFTA 3KO8A 1XELA 4P22A 4B3HA 4PCVA 2W2LA 5EERA 4OOFA 3B1KA 4YVFA 4AJOA 1TLTA 3I9JA 4CLXA 3DHEA 4MKXA 1YJ8A 3D4PA 4IMPA 1MP0A 4DVJA 1LC3A 1K3TA 2J8ZA 4FFMA 1DRVA 3AU9A 1HDRA 4CM9D 5HS4A 1Z74A 2FSVA 3LVFO 1LLUA 1DJNA 3IQDB 1T1RA 4M86A 4FOOA 3WTBA 3K5PA 4J49A 4YJFA 4ND5A 4NIMA 2HJRA 1ML3A 1SB9A 4EW6A 1O0SA 4PLWA 4FC6A 3WWZA 4R5HA 1GYQA 4W9NC 3WBBA 2E4AA 4C4OA 4EJ0A 3I4FA 4BV9A 4MINA 1EQ2A 1KS9A 1WPQA 1YBMA 2P9GA 4E3ZA 3D3WA 4Z9YA 1W0CA 1X0XA 1ZNQO 2X86A 4WUVA 1NTOA 3CMMA 3DBVO 3NT5A 3K96A 4I1IA 4HP8A 3RKRA 4ZQBA 1WXDA 4ZHSA 1ZEMA 1MUUA 3GN1A 4K9DA 1LDEA 2JAPA 1GEGA 4QECA 3WG9A 4H16A 1DHRA 2IEBA 3GGPA 3K30A 1PSDA 3VZSA 5I9NA 4QX6A 4E33A 3Q1LA 4TSKA 1K0UA 3VOSA 1B15A 3UKOA 1YGYA 5C3MA 4BO6A 1ZO8A 5BSFA 1GYPA 1XKQA 5K6AA 5L4SA 3MTGA 4TRNA 2W2LD 3F5SA 5B4UA 1DC6A 5CEJA 3CINA 5L95A 2DFVA 5JDCC 3TZKA 4Y8VA 1GYRA 3ABIA 4Q3DA 4RORA 4WCFC 5AXCA 1F14A 3GEGA 1U3TA 3T7CA 4KQXA 4GL4A 5IN4A 2QYTA 4WOKA 4I8XA 4OOEA 1I8TA 5G4KB 3GAFA 4JP2A 2PZMA 3VPGA 4AJEA 1E3JA 5L7TA 1DBVO 1O5IA 2WMDA 3DTTA 2Y67A 1BRMA 1KY5A 3RROA 1PS0A 2E6UX 1ONOA 1CRWG 3KEQA 5F3RA 3WGTA 4XRGA 3F46A 1N5DA 3EVTA 4FJ1A 5EN4A 4MJLA 1RM5A 2YUTA 2VUUA 3OQBA 4ZVVA 3UN1A 5FWNA 1VL0A 3WNQA 1Y8RB 1UP6A 1B3BA 1GCOA 1HDXA 3DZGA 2EF1A 3CZMA 5T8KA 1QYDA 5F1OA 1U1IA 4DMLA 4R9SA 2AE1A 2HK7A 3HDHA 4Q3AA 3ROPA 4BGEA 2QRLA 3GDOA 1JKJA 4PFJA 4HV4A 3RUAA 3ZWYA 4NG5A 1KC3A 4QUKA 3ANMA 1C0LA 2GN4A 3PHHA 3P5SA 3KV3O 5C37A 2YDYA 1NNUA 1KVTA 2WYUA 1A7KA 1DJQA 1OAAA 3DBLA 1ADFA 4I5GA 2PK3A 1U8FO 4U6QA 1ZH8A 2EP7A 1AXGA 5TSDA 2BRUA 4F46A 4W7HA 3OQ6A 1GADO 2GF2A 3I9LA 3JV7A 4AJ4A 4DYDA 4OL9A 3SBOA 2D1YA 4FDAA 3W6ZA 2OFPA 4A0SA 1PJ3A 3ULKA 5EPOA 1Q7CA 1B8VA 3EW7A 3LSYA 4ALKA 1ZJZA 4WGGA 2VRCA 2CDCA 1FDUA 3PWZA 1F8FA 1YL5A 2FPIA 1LRJA 4CQMA 4NK4A 2GN9A 2X9GA 2I9PA 4YJHA 1ZEJA 2VT2A 2ZK7A 4MOWA 2WD7B 4CM8A 2EJWA 1KC1A 4YWJA 3RU9A 3R6DA 4CUKA 6LDHA 2PZLA 2ZIZA 3IIEA 3NTRA 2G1UA 3NUGA 3LK7A 3OH8A 3FPCA 2EKLA 1NM5A 4PG4A 3T7EA 1ZSVA 1LDYA 1GTMA 2JAHA 8ADHA 1E7WA 1T4DA 3FN4A 3PTZA 2HRZA 3PQEA 4PVDA 4JXKA 4B8WA 5KJFA 4FN4A 2P68A 4CODB 4MVJM 5AXBA 4CMEC 1B14A 3VVCA 2GZ1A 4DA9A 1IHXA 1X7HA 2WTBA 4UREA 3WLFA 1E3EA 3ANNA 5ILGA 3HDYA 1PZFA 5H82A 2OUIA 4XD2A 4AJLA 1NWHA 1MFZA 2DLDA 2BGKA 2QIOA 1XEAA 4DC0A 4PN3A 2CDAA 1Z82A 1HWYA 5LCXA 3L9WA 1P1JA 3JQAA 4IDFA 3NGLA 5IDQA 4YQZA 3UH1A 4Q3CA 1XWFA 2NQTA 3U5TA 1TA4A 3KBOA 1WDLA 2VYVD 4OSOA 4RLHA 1BWSA 2C59A 1JAXA 2X5KO 3ZN2A 1P3DA 2B35A 3KUXA 1RKXA 3TZCA 3HADA 2OGUA 2VRBA 4FFOA 3VHRA 4BVAA 1YBAA 1HZJA 4GSKA 4LRSB 4J2HA 4CQMB 3GPIA 1NVGA 4FFLA 2YQ5A 4A7PA 4DGSA 2RIRA 4IY1A 5C7OO 3DBRB 3EY4A 4XB2A 5AOVA 3FR7A 1VL8A 4XIYA 1G0OA 4YJHB 1S7CA 3RBZA 1BDBA 5EQDA 4CV3A 1I3LA 3UAGA 4QTZA 2G76A 1P77A 1ENOA 4I9NA 4LMRA 4UEKA 4B4VA 1Y5MA 1DHTA 1GV0A 2ZB8A 2Q4BA 3VZRA 5I7FA 3GGGA 2GN8A 2IXBA 3DHNA 3OEWA 1JLLA 3OA0A 1Z7BA 3GH3A 3DMYA 3WXBA 3RI3A 3BTUA 4KMSA 1EVJA 4EUEA 1ZK1A 3EHEA 4WJZA 3RUHA 5KVSA 1B3RA 3MWEB 5AXDA 2J5KA 1C0KA 1N9GB 1SB8A 4BNFA 3H5RA 4BQPA 5K0ZA 3PPIA 4FB5A 4HNHA 1WMAA 4BOYA 1ZZEA 1Y8RA 4R1TA 5TF4A 3AUTA 5L53A 3F5QA 1U4OA 1GL3A 3WWYA 1NQTA 4JP3A 4BNXA 1EUDA 2JHFA 3MWDB 3CUKA 3S2FA 5L40A 3OIGA 3OA2A 4BL5A 3BXXA 3AY7A 1VC2A 1YDEA 4GKVA 1Y1PA 5A4DA 3WICA 4K6FA 3FTPA 1KEUA 4E4YA 5TJ9A 2PNFA 3ZWBA 5JCXA 3JQ7A 1M6WA 3K2EA 1I2BA 3I1JA 1BXGB 1HEUA 4BHTA 2CF5A 1GZ6A 1PIWA 2OBYA 5A02A 3HB4X 3GF4A 1PGPA 1J0XO 1Y8QB 4J2OA 2SCUA 2B5VA 4QFDA 1IHYA 2Y1DA 5I7EA 4NDNE 1WVGA 3K8ZA 3G17A 3H8VA 4DLBA 2HLPA 3ZV3A 4W7IA 4YJGA 5JDIA 3Q9NA 2QW8A 3TN7A 1YL6A 1P31A 4CMGA 3M1AA 4D45A 4J7UA 1I2ZA 5KTKA 1NQAO 3HJAA 2H9IA 1PS9A 3QVTA 2FP4A 1ZUD1 2VN8A 4EEXA 1XYGA 1GR0A 2PY6A 4RPLA 4RF5A 3FPLA 2H6EA 5JY6A 4PIVA 5DNAA 3E18A 1PGOA 4FBGA 2BFOA 3FR8A 4E32A 3I23A 1PEDA 4TMFA 2WD7A 5F5LA 4L9RA 1ENZA 1Q0LA 2P9EA 3JQCA 4NBTA 3QA9A 3UF0A 1ZSYA 4ZRMA 1MFPA 2D5CA 4G2NA 1RWBA 1YBVA 1HLPA 4AJ1A 4BNHA 5TIIA 3OFSA 2I76A 1VE9A 3JYLA 1LDMA 4MIOA 4II3A 2VZ0A 1PS8A 4OXNA 1LSUA 5H81A 4R3WA 3RUCA 1XSEA 1EBUA 3OMLA 2FR1A 3JQDA 4J1SA 3H2SA 4IUYA 4BNZA 4CUJA 5A9SB 2C20A 3IP1A 3NX4A 3TZHA 2VZ9A 3JD2A 1E6WA 4OMUA 2IZZA 3AM4A 5IJZA 2NU6A 2VYVA 1D4FA 1EUZA 1JVSA 3IJRA 1T25A 2ZCVA 5I8WA 1B8UA 1E3IA 3MJEA 2WSBA 4IMRA 1C1DB 3UUWA 1O9BA 4N5LA 4M1QA 3RD5A 2DPGA 2DU8A 1ENYA 2AW5A 4W99A 4L74A 4MVJG 4EUFA 4TKLA 4Y6PA 4J1QA 5HA5A 4D79A 4RQTA 3GN2A 4CMKA 3HUDA 1F17A 3A06A 1X14A 3FBGA 1JDJA 2DKNA 2IYPA 3PDUA 4F6CA 4J1NA 4J0EA 4PG6A 5G0SA 3RFXA 1R37A 2HAEA 1VL6A 2FPPA 4CLRB 2J6IA 2HJSA 3D0OA 4FOSA 4R1UA 4Y6RA 4DRYA 4E2WA 3NDJA 4GPD1 2O4CA 4S1VA 1HYEA 3NV9A 4O1MA 2B69A 5IN5A 2CF6A 2O50A 3QRWA 1D1TA 1E7YA 4YXFA 4E5YA 2DFDA 2DUWA 3DR3A 4FSHA 3AI3A 3DO5A 4CL8A 1L7EA 1NQOA 2PH5A 4FIZA 1IE3A 2IE0A 3IP3A 2WEKA 4IJUA 4E0BA 1X1TA 5L7YA 3TFQA 1Z45A 3AFMA 2HQ1A 3WSWA 4PZCA 6ADHA 2V65A 3AOGA 4GX5A 3HQ4O 3M2TA 1KERA 4Z3KA 1P1RA 4WLUA 3CPSA 4RPHA 3AY3A 5F5NA 1C1XB 4H3VA 2POQX 1LDNA 2G5CA 3D4NA 1KVSA 1R4MB 1QG6A 3BYZA 2HUNA 2V6BA 1DIAA 3I4CA 3C1TA 4K28A 3AUUA 1I2CA 4YQYA 3EDMA 4RZHA 5LC1A 3CMCO 4YT8A 4AJJA 4UVGA 3FCOA 2DAPA 4YAEA 2D5AA 2PD3A 1I3NA 4YJFB 3ZW9A 4A2CA 3RKUA 2AEFA 3GT0A 2AQKA 2O48X 3BMNA 1DLJA 4EJMA 3RC9A 3PQDA 3NJ8A 4CMIA 3LZ6A 1JN0A 3RJ9A 3GFBA 2D4AA 2EKQA 3TZ6A 1JAYA 1T2DA 4N5MA 2VYND 4ONEA 3QVWA 1JVBA 1SAYA 1GFSA 4ZQFA 5I9MA 3H3JA 5GY7A 2O3RA 4N54A 3RIHA 4CM6A 4Q9NA 1EVIA 1YO6A 3EZYA 2WYVA 1HE3A 5J23A 1ADCA 5DOZA 5DN9A 5G0WA 1R6DA 3TOXA 4IS3A 4J4BA 2GUGA 4CMBA 5IZCC 2O3SA 2ZQYA 4O63O 4GBJA 2PFGA 2X1HA 3R0IA 4P8RA 4WEOA 2VOJA 3TWOA 1TT5A 1SEVA 2J3HA 4YJGB 3IUPA 5BSHA 1LJ8A 5L45A 1KIFA 1W4ZA 4ZRNA 3E9MA 1YRLA 4ZU3A 3ZWOA 1GUYA 4ALJA 4N7RA 7MDHA 3GR6A 1MGOA 3D7LA 4CLHA 2GERA 1J6UA 4U0KA 4R54A 4QO8A 1W8DA 4WNCA 2IZ1A 2X8LA 1DIBA 3EYWA 4NQZA 1NR1A 1VPDA 4CMAA 3GZ4A 2GD1O 1Q7GA 1NVTA 1QORA 1VJ1A 4WEQA 1VSVA 1CF2O 4QFCA 3UFXA 3KLMX 1ZBQA 4MP3A 3GNQA 3HDJA 4HKTA 1LX6A 2CD9A 3L6OO 4PLPA 3ZH2A 4WASA 3WFIA 3ZDFA 2DT5A 1UAYA 2CVOA 3G79A 3L4BC 3AUSA 3VH4A 5FEUA 2OL4A 3JYPA 4RDHA 4CMEA 2BFMA 1H2HA 4IDBA 2EWMA 1DLIA 1LLCA 1C0PA 1UXJA 2YJZA 3ZNOA 3K92A 1X0VA 3RBXA 4XEHA 4CQLA 1JKFA 4OQZA 5TGDA 3L6DA 4RVHA 1RYEA 1I3KA 4RVUA 1OC2A 3S8MA 3GEDA 1CYDA 4ALLA 2G0TA 5CDYA 4FCCA 3VKUA 4G81A 5JMWA 1ZW1A 3B20A 2O3TA 3DAFA 3DL2A 4BUCA 1YS4A 1BXKA 4Z3DA 1LQTA 5FI3A 5CDSA 2O3UA 4J1TA 5ER6A 3BMCA 3O8QA 1WNTA 3A9WA 1HETA 1NFRA 1YOVB 1MLDA 4DTIA 2TMDA 4OQYA 4DQVA 2D8AA 4HXYA 1H93A 3K73O 2PZJA 3MOIA 3BA1A 1J4AA 4CR7A 5T6BA 2WWRA 3WQQA 1YL7A 3WMWA 1AXEA 1R66A 4MVJD 4NFHA 5DBIA 1VSUA 2FZEA 1P1IA 3F1KA 1ZKMA 2GASA 3HZZA 3ITDA 4M54A 4E5PA 3KETA 1CETA 4ND1A 2PGLA 3IS3A 1E5QA 2F1KA 3GVPA 3QE3A 4WK6A 2B4QA 1V3TA 2FPGA 1N92A 2BF7A 5CPBA 1SPXA 3A28A 3DAPA 1G0NA 4YACA 1NASA 2HMSA 3ZWPA 3CEAA 3QLJA 3LLSA 5L4NA 1I24A 4XQCA 1PWZA 5IDXA 4CM1A 1IYZA 4R68A 3AM3A 2ZJ0A 3V5NA 3ZNPA 1E7SA 1KBZA 2Q2WA 4BNGA 5JO0A 1E1KA 4HNGA 1VJTA 3AOEA 3W4KA 3H9JA 4AL4A 1N1GA 4QT0A 3LT2A 5T64A 4YAGA 5IF3A 3GVCA 1WDMA 2NVUA 4R9RA 4DLLA 3BMNB 3PI7A 3QV1A 3IMFA 4XQGA 1UJMA 3SJ7A 1GY8A 3BZUA 3FTNA 2WE8A 4RL6A 5JS6A 1RPNA 1FF9A 4YAKA 2CY0A 4M8SA 2LDBA 2JFFA 3OECA 2ZATA 4R41A 4XDYA 3ZV6A 5F1PA 3VPFA 2E82A 3ASUA 1IPEA 1NAIA 1VM6A 1JTVA 2FHSA 3F47A 4Y9DA 4AJ2A 4OIMA 2PD6A 2NVBA 3VAZA 1N9GA 4R3NA 5CDGA 3SEFA 2C7GA 4IDAA 3GAZA 1NPDA 1VJ0A 1ORRA 5FYDA 3UCFA 1QV6A 4J9VA 1LU9A 3AI2A 3E5RA 5CHEA 3TPCA 1R4MA 2QHXA 4F3YA 4ND2A 3TDKA 2Z5LA 3OJ0A 3PHGA 5CDUA 5C7LO 1UP7A 2FRDA 2GZ2A 3ZWAA 4IJWA 4E31A 1CJCA 2AA3A 2W8ZA 2HK8A 4BGVA 3S2EA 4ZQHA 1GU7A 3ENKA 3JQEA 2PGDA 3U0BA 3DMTC 1O6ZA 4RJTA 1EK6A 4IGEA 2I5PO 3Q0EA 3ZV5A 3IAHA 1XG5A 3OF2A 3BTVA 3GDFA 1H6AA 4F45A 3W8DA 2Q49A 2AQIA 4OJNA 3U4DA 4B4WA 2O23A 4ESOA 5ITVA 4JBHA 1KEVA 4NJMA 2GN6A 2NNLD 3JQGA 4Y98A 1YDWA 3GVXA 3VPXA 1PL7A 3DXFA 3OBBA 3QVSA 4FPXA 4IZIA 3VH1A 1E5LA 3ZU3A 4DIBA 4Q3NA 5TS3A 2X23A 4H15A 2NSDA 4NBWA 4BO2A 1T2FA 2PKRA 4ZQGA 3A14A 4CM4A 5ENDA 4DQUA 1ISIA 5F1KA 4DPMA 3V2GA 4XZ3A 1YONA 2X5OA 4HFMA 1E7RA 2P5UA 1AN9A 1EVZA 3SC6A 4NJOA 1MX3A 3K2BA 1EZ4A 5HRUA 4YCAA 4LW8A 4GLOA 1H94A 5JYEA 1E1MA 3BTOA 4AVYA 4BGIA 2VNSA 3CSDA 3GMDA 1BW9A 2ET6A 4R1NA 3KHUA 5KWEA 4LSMA 4P38A 4Z0HO 1SO8A 1MXFA 3H5NA 4L75A 3DBHB 3UW3A 4MVJA 2RHRA 3D1LA 5IFLA 3OIDA 4E5NA 1UXGA 4W4TA 1PZHA 1XGKA 2O2SA 2DTEA 1A9YA 5ICMA 3WGZA 2OZPA 2EP5A 4A73A 3B1FA 1WZEA 3GMSA 1DPGA 5CG1A 1E0DA 1T2EA 4WE3A 5T57A 1MXHA 3N58A 2C07A 3MJCA 2A35A 3ON5A 4JROA 3IKTA 3Q2IA 1D7OA 4C7JA 2HMTA 4ROSA 1UAGA 3WSVA 1PGJA 4O6VA 3INGA 5JAIA 5ENVA 2O7SA 4MVJI 1DO8A 4MVJP 1ENPA 4D0RA 1Q7BA 1ULSA 1ISHA 4L73A 2EEZA 5IXYA 4A03A 3PEFA 1NHGA 3GLQA 4IDCA 3FI9A 1DIHA 3BMCB 4CMHA 2QRJA 3B1JA 4D43A 1V0JA 2Y66A 4N5NA 4Z0TA 4AJHA 3U4CA 8LDHA 1Z75A 2EW8A 3T4XA 3O26A 1P0CA 1F12A 3DAGA 2FMUA 3HN2A 3ONEA 3VPHA 4JQCA 1PJCA 3ADOA 1PZEA 1P44A 1P0FA 3JQBC 5TX7A 2VTEA 3UGKA 3EK2A 5I9LA 4PGFA 5HS6A 2NM0A 3AI1A 3F6YA 4J90A 4X54A 2C0CA 2C5AA 1T24A 3GY0A 4TWRA 2GO1A 2HMWA 2JJYA 1E3LA 4HUJA 1DFIA 4IINA 2YV1A 3TQHA 3FF4A 2VZ8A 2NUAA 1LSSA 4GMFA 2O3JA 3X2EA 1PQUA 1Z73A 1DDOA 4CR8A 3PLNA 3HHPA 3MTJA 3PGXA 4KZPA 1E1NA 2CSUA 4NU5A 4XGIA 3H5AA 2B4TO 4ALMA 1T2AA 4CLEA 2A4KA 4ZJUA 3P2OA 2UYYA 4E12A 1T4BA 1NQ5A 4D42A 4EI2A 4IS2A 4CPDA 4BO3A 1I0ZA 4B4UA 4IXWA 3A4VA 4NZ9A 2FOIA 3ST7A 4L0QA 3GNSA 5U9CA 1R15A 3V1UA 1PL8A 1P1FA 2Y1CA 5TT1A 1GCUA 3I52A 2W98A 2CMDA 4BB5A 3Q3CA 2OP1A 5IZCA 4D3SA 1SEPA 1TXGA 4BIIA 1EE9A 4RF2A 4ILKA 3V1YA 4Y67A 2PZKA 5CEEA 1NFFA 4O5OA 5KKAA 2PLAA 1QKIA 2YQ4A 1HL3A 4QQRA 2X58A 2RH8A 4C7KA 2IZ0A 4EUHA 2RHCA 4JBIA 1XU7A 3JQGB 1ZXBA 4I5FA 5DP1A 1PX0A 4J4HA 3WX0A 4CV2A 1PJBA 1GQYA 4NR0A 5EESA 3GGOA 5IAAA 3SC4A 1HSOA 3CTMA 1UDAA 3NRCA 3DDNA 4BKQA 2JL1A 3VVBA 3DBRA 3NTOA 5JC1A 1NYTA 1YB1A 1ZK3A 1GUFA 2UV8A 1AHIA 4XX0A 3PJEA 1TT5B 3DTYA 4L4RA 1P9LA 1EBFA 5DCYA 2E37A 4D0SA 2JCYA 1U5AA 3H9QA 1EK5A 4WOJA 5DBGA 1UUFA 3T4EA 3L07A 2C5EA 5IDYA 1UH5A 4MO2A 4WLOA 1MB4A 2I65A 5I7VA 3PVZA 2OP0A 4BNNA 2WYWA 2CFCA 5KVVA 2FZWA 1LQUA 1O94A 3JSAA 1FDSA 4GVXA 4UUMA 5AVOA 5JDCA 1Y8QA 4I5DA 2P91A 2Y05A 5DDIP 4WCFA 5JAQA 3QJ5A 3MJ4A 2Q46A 4HBGA 2YHUA 5B37A 2ZTMA 1L7DA 3EMKA 4R69A 3TL2A 5JW6A 2J3IA 2Q1WA 2WE7A 2Y0EA 4PLHA 2X9VA 1PQWA 4PLFA 1CWUA 4E5MA 1GV1A 2OORA 1V9LA 3INRA 3PFWO 4XA8A 1DC4A 2VQ3A 3ZHXA 1XU9A 1BVRA 3KSZO 3GHHA 4PG7A 3RUEA 4CM8B 4WPGA 1H6DA 1FDWA 3VDQA 3PYLA 3ZHBA 4IBOA 3JQ8B 1PR3A 3VTZA 4IM7A 1P1KA 3PHJA 3ROKA 1NHWA 2AXQA 3ZU4A 1QLJA 2CVZA 2QG4A 1QYCA 4JJGA 1ZVMA 3L77A 1U7HA 4TZTA 4DC1A 1LSJA 3GVHA 4XQEA 1PZGA 3LT4A 3EVNA 2EHDA 4KUGA 4IZHA 2RBEA 1U4SA 1N8KA 3AK4A 3QSGA 2VHWA 3PZBA 4D44A 4E13A 3RQSA 3S1LA 1UXIA 1DC3A 3ICCA 3WGYA 4RPKA 3I9NA 5BNTA 3ROMA 4XYGA 3DZJA 1JWAB 4CQLB 4CR6A 3AOEC 4EGFA 3G1TA 3MEQA 3VZPA 1ULUA 4CLOB 5KCZA 4JLWA 3UCXA 4UVHA 3SVTA 2BFPA 4BGUA 1Z7EA 3WMXA 1ZK0A 4FFPA 1ID1A 4H7PA 1LSOA 4FGWA 2Q45A 4OGWA 3TOZA 5DOVA 1KEWA 4BO7A 1W6UA 4XR9A 2H63A 3L4SO 3OQ1A 4XB1A 3O8QB 4OXYA 1BTOA 4GX1A 3RAJA 3CZRA 4YT2A 1IPFA 4FW8A 1U3WA 1C3VA 3QWBA 4I9HA 3FNFA 4RVSA 1X13A 2IYOA 9LDBA 1BG6A 1VKNA 2AMFA 4CM3A 3DEYX 3FNGA 4NI5A 2OO5A 1XCBA 2J3KA 2NVUB 2PD4A 4S3MA 3F4BA 1NP3A 3N7UA 2Y1EA 2ZKLA 1E6UA 3ANLA 5JCJA 5JFOA 4LMPA 2BELA 3WIEA 1N1EA 2YFHA 5A1TA 1M6HA 3F9IA 1I5RA 1ZK4A 2J3JA 3GOHA 4GGPA 1GQ2A 4J9UE 1LBEA 3PIIA 4OYRA 4R51A 4YRAA 4QEDA 1Y7TA 2E48A 5LDHA 1LRLA 1Y5RA 3D64A 5JXWA 3LF1A 3X2FA 2AEJA 2I67A 3C24A 2WM3A 5DCUA 2J5QA 2ZB4A 4RGBA 3NYWA 4FFNA 4YYZA 1NAHA 1OZAA 1Z6ZA 4II2A 5KVCA 4XWYA 4MIEA 4URFA 4XKJA 5TT0A 3DOJA 3NAQA 1E3WA 2Q2VA 1V3UA 3H65A 2ZYDA 3WTCA 3OJLA 2JD0A 5DF1A 4MVJH 1H2BA 4FGSA 1B8PA 2DQ4A 5G4KA 3ASVA 1AUPA 3D3WB 5C7IO 1L1FA 3PK0A 1HF3A 3RCBA 3ZNNA 2OOSA 5JYDA 3COSA 1OC4A 1YB4A 2XOXA 3RUFA 3FRJA 1G1AA 5THKA 3QWIA 5IG2A 1B7GO 4QO7A 3UHAA 3O38A 1D1SA 1B26A 2VUSA 4XYMA 3PLRA 1V3VA 4CV1A 2XPCA 3TF5A 4JCOA 3OHSX 1HLDA 2TMGA 2Y99A 4D7AA 4DPLA 1NXQA 4HADA 2X9NA 3O4RA 1X15A 2B5WA 2GSDA 2NACA 2HK9A 4YRDA 3RSHA 1HYGA 2JCVA 2X6TA 1C0IA 3G1UA 2Q1SA 4HFJA 4AICA 1YE3A 4Q39A 2BLLA 4CUZA 1I33A 1ZFNA 3DONA 3KVOA 2DUUA 3WOHA 4IQ0A 3HFGA 3ZU2A 3RJ5A 5G4LA 2GGSA 3I3OA 1D3AA 1H9AA 2D59A 4GVLA 5C5IA 3DC2A 1TT7A 3AY6A 3PHIA 4BS9A 4GX0A 4RF4A 4UUPA 4EJ6A 1ISJA 4OSPA 2ZB3A 3JQ7B 1DXYA 3LYLA 2EG9A 2GYYA 4ZA2A 5A9RA 2X0JA 1VKOA 1ZXLA 4XRRA 2R00A 4U6SA 5G0TA 3GZNA 1D8AA 4TZKA 1ONNA 1PR9A 3B6ZA 3PJGA 3ZWMA 3OM9A 2EGHA 1SOVA 4IDEA 4KUEA 3TSCA 3LC1O 4BNUA 4CLOA 2GR9A 2UUPA 1OBFO 3QW2A 3RC1A 1IZ0A 5FFFA 1BVUA 3QIVA 4O59O 2DBVO 3VH2A 1AGNA 4NBVA 1M76A 4DMMA 3F3SA 4PLTA 1RYDA 2A94A 3LC2O 4JJFA 4NNJA 2DPHA 3D5TA 3JQBA 3PJDA 5U1PA 1T26A 3JYNA 2O4UX 2Z1MA 3GRPA 2NVWA 3I9MA 4IDDA 3GK3A 4KOAA 4WECA 1Y9AA 3OIFA 1DRWA 3FNEA 4KTTE 4DUPA 4AJNA 4Z9XA 4BO8A 5JBIA 3BHJA 3CKYA 5IDWA 1DC5A 3D3EA 5F21A 1LEHA 3EAGA 1MC4A 2VCYA 3IC5A 4BV8A 5KJ1A 4LCJA 4BNMA 1PQPA 1SC6A 2RCYA 3DHYA 2Q1TA 4DBZA 1BXZA 3JD4A 1P74A 3DFZA 4BMVA 2FR0A 4ALNA 5AXAA 5T8KC 3MJTA 3TZQA 2LDXA 4R1SA 3UCEA 3JTMA 4OHUA 4UVDA 4K1LA 5DBFA 4PZDA 2EERA 1QYVA 2DBRA 4MP8A 3E5MA 4DPKA 2AEMA 1A27A 4MP6A 1U3UA 3RC7A 1EE2A 4L4XA 5GZ6A 5A03A 1OFGA 4UEJA 5JMPA 3UICA 2CZCA 3W8FA 4E6PA 1K5HA 4BB6A 2O7QA 3DZBA 3U4HA 1GPDG 3QWFA 1U28A 3PWSA 2V6GA 1PJLA 1UP4A 2PA3A 4G5HA 1BMDA 3E1KA 3NEPX 5TQVA 2DVMA 3KEOA 3U4IA 5CDTA 1X1EA 1IY8A 2WJPA 1N7GA 4UVEA 3PYXA 1FDTA 4MDHA 3DWFA 4J6FA 3GC6A 3H4VA 2Q50A 1AE1A 4E2ZA 3O9ZA 4BQRA 2DBQA 1KY4A 3PZRA 1JKIA 1YXMA 1VLLA 2I3AA 4XJSA 4TROA 1RM3A 1B16A 5I7SA 4DLAA 3TNLA 1C1XA 3I6IA 5CPFA 3JQAD 4YJDA 5KNLA 1UZMA 4R01A 2HMVA 5A3JA 4CM9A 4LRTB 2CVQA 1YOVA 4P4LA 3VC7A 4J16A 3PWKA 4YBZA 2AE2A 3LC7O 4HY3A 5U4QA 4RV9A 2X5JO 2ZJ1A 1TVEA 1XQ1A 4NU6A 4A26A 4FJ0A 5TLSA 1YQXA 2JKVA 4WNIA 1IB6A 3WYCA 1YKFA 2GNAA 4FD3A 1WAMA 4J43A 1DRUA 1KEPA 4KWIA 4LCEA 3ZZNA 4DREA 5KOIA 1FMCA 4WLVA 5COAA 5FF9A 3I6QA 4CM7A 4YAIA 5JSFA 2I99A 4Y6SA 3S2GA 4JJIA 3BHMA 2Y0CA 2CDBA 3LT0A 3M1LA 4P4NA 2YV2A 5ITWA 4CJXA 4BKPA 1UXHA 1G6KA 5DCWA 4BKOA 1TEHA 1TB4A 2AG8A 2DTDA 1H6CA 1HE5A 2HSDA 1H9BA 3TRIA 1CIVA 4BNIA 1LNQA 3E48A 3HB5X 2HKIA 2E49A 2R6JA 2H5LA 1Y6JA 3BIOA 3KSUA 1YH3A 1ZIDA 3VPSA 3FHLA 3ZWNA 3ZU5A 2NU9A 3E03A 3DFUA 3QWHA 4ZQEA 4BNWA 4YTEA 4UUNA 3WLEA 4NJMB 1JA9A 2PV7A 3Q2KA 3CH6A 4LISA 3RWBA 2HO5A 4CV0A 1BSVA 3KSDO 4RO0A 1A4UA 3H9GA 2X7HA 4G65A 3EZLA 1R0SA 4D3FA 1ONPA 3B70A 3WBFA 5MDHA 2W2KB 2CUKA 2B4RO 3I9KA 1I3MA 3S2IA 3V1TC 1U5CA 1DEHA 4M89A 1ARZA 4WCDA 2VHVA 1DIRA 1ADBA 1HKUA 4IPTA 3DOOA 1B2LA 4ZGWA 4N18A 3WR5A 4M87A 2P2SA 4JN6B 2AQ8A 4NBUA 3WGIA 3GDGA 5TC4A 1P33A 4L4SA 4Q3BA 3ZWVA 5B4TA 4XR4A 2F00A 2VWPA 4KQWA 4MKRA 1MA0A 2NQ8A 5COBA 2V6MA 1NPTO 5JLAA 1M66A 2NTNA 4PLGA 3L9XA 1ZMOA 2B0JA 2QZZA 2YV3A 4GX2A 4OKIA 4BNTA 3ADPA 3HFSA 4IQ8A 1X7DA 2ZYAA 3E8XA 4GAEA 1UZNA 5L4LA 3Q9UA 3BAZA 1O8CA 2G17A 3PP8A 2BH9A 3UVEA 2NWQA 1K89A 2NTJA 4K6CA 5EMHA 3GUCA 3P19A 3JQAB 1EUCA 4YA6A 3VKVA 5HM8A 4DQXA 4RQUA 3IKVA 2ZB7A 4LK3A 4B7CA 3DZIA 4P4GA 4FS3A 3L4BA 1RJWA 3KB6A 1IOLA 1PL6A 3V2HA 5A05A 4RVFA 1A9ZA 1UDBA 1HDCA 4AG3A 4BNLA 2X4GA 3DZKA 1HXHA 1I01A 4I9UA 3SXPA 1J5PA 2A9FA 3QVOA 1M2WA 1QMGA 1DSSG 2PWZA 4NK5A 1RM0A 2OXIA 4YT4A 1LRKA 3GFGA 3DOCA 7ADHA 5GZ1A 1QYWA 4GKBA 4NMHA 2C7VA 3Q11A 1KETA 1BDMA 3C3XA 2EJVA 3ICPA 3I9OA 1SOWA 4NHEA 4RVGA 3K6JA 4B3JA 3WYEA 1KOLA 5KKCA 5B4VA 1R0LA 3QP9A 3H6KA 3NTQA 3QVXA 4JIGA 2X0NA 1HZZA 1QV7A 3WIDA 2Q3EA 2VRCD 4RZIA 4ITUA 3CXRA 1QRRA 4JGBA 5B1YA 3BTSA 2BD0A 3OJEA 4IIVA 3E82A 3K9QO 2JD2A 3C7AA 3ITKA 2C29D 1ZCJA 2BFAA 3PGJA
chains in the Genus database with same CATH superfamily
4EDFA 2M6SA 2Q4EA 3NDRA 2IYWA 4U0JA 3ENQA 4YQEA 4G2TA 2E4VA 2XSZD 5CLHA 1M1XB 2A67A 3A37A 2VAPA 5BV2P 3K1AA 1Y3HA 5E7MA 1I1HA 3ETHA 4WBNF 4CKZA 1RQPA 2DF8A 3PYMA 3SM9A 4EDHA 3TDMA 5A5VA 3X44A 2OCKA 2PKEA 3WGJA 4L95C 3T52A 4U9UA 3VKHA 5I7WA 2ID4A 1S01A 3PX3A 5DT9A 3ZXUB 4GL2A 3VI4B 4DLTA 4TVKA 3I5MA 3M6VA 1EVYA 1DJPA 2BI7A 2A4MA 1SHZA 2NQ2C 2O9JA 4PU0A 2JFHA 5EKTA 2ES4A 4Q6WA 1SZJG 3OTQA 3RBVA 4CEJA 2VHYA 2P77A 2ZU0C 2OMEA 2VDKB 1C1DA 4AMVA 4J3FA 2VLBA 5TVKA 2BMAA 1RQNA 1DOHA 1YMVA 2X5NA 3FAZA 1NDQA 3RJZA 3S55A 5KHLB 3AF3A 5A9SA 4KYIB 2Q1UA 3ZD8A 4MUXA 1FX0B 3CR7A 4B8ZA 2GFIA 4KUHA 4ZDJA 1C80A 2O0MA 1ISFA 1DADA 3WGQA 3ILXA 3ICEA 4NFSA 1JSCA 2V3CC 3KUCA 2X0RA 1OBVA 5IAEA 1KMMA 4K40A 1RVV1 3EOAI 5DM0A 3M89A 1QJCA 2QLTA 4RENA 4KP7A 1XALA 2VPQA 2WJWA 5L7WA 2EIHA 2Y1XA 3ASYA 1DBIA 3CJRA 1UDWA 1LI4A 2PH7A 5LLSA 5LFAA 2AGVA 3O92A 2Q8NA 3E7FA 4DYVA 3ADDA 1UDCA 3LGAA 3QXCA 3RV3A 1N2XA 1X7YA 4D0LB 4IDGA 3NTVA 3B9RA 2DWCA 3SZMA 2II6A 3T35A 4YRZA 5HQTA 1XZIA 4X95A 1E2EA 1S8OA 4NZYA 3NC0C 1WSWA 4F1JA 3Q5GA 4HWRA 2C2YA 4BGDA 5ED0A 1Y9EA 2ZTHA 4PCLA 4PGAA 2VDQB 1QWSA 3TLZA 1ORIA 3CN9A 1TIPA 4AWXA 2YY5A 4Z9FA 3TTTA 3IOYA 4A8HA 4WVLA 3G6WA 5CUQA 1PJ8A 2IBSA 2FF7A 1K2WA 5DV9A 1FXSA 3QPAA 2WNSA 4LJ4A 1E63A 5H83A 4UCFA 3FM9A 5CH5A 3TLMA 3VDMA 4OHXA 4DIEA 3R9KA 2O0LA 4DCMA 4DT1A 1R0RE 4YV1A 4CKWA 2XTAA 4WLFA 5AJZA 5SY9A 1WW8A 2PX4A 2YQZA 4HWKA 3QE4A 2BV3A 4MA5A 3CEJA 4ZIRB 2FXVA 2VSYA 2PS3A 2ZRDA 3N87A 4FP9A 2HPZA 3BMQA 4PR0A 3ZLUA 1BGVA 1E77A 1P5FA 2ZDGA 1WVMA 2V5UA 3WYDA 3REFA 3RC3A 1GPAA 2CCKA 5AJWA 4C0HA 4X20B 2QNIA 3QVLA 4C0LA 3B8HA 1HDYA 4X7PA 2GOYA 2RJ3A 3DTVB 4H77A 1A7AA 4N7BA 4DCPA 1E96A 4EJ2A 3GLIB 4OQEA 2C54A 5L3RA 3JYHA 4E46A 3THSA 3I83A 4EBFA 3CX6A 1R0BA 4QIHA 4AFNA 3UQZA 1VMEA 1A5ZA 3EGOA 2Q99A 4A6PA 3GIDA 2XQJA 2IYYA 1UDRA 4WBSA 1I10A 1OX4A 4LOAA 5ICSA 3KDSE 3L0OA 2I33A 2VHXA 3DBHA 1RJFA 3KVYA 2PX2A 1M1YE 4TMKA 2A0KA 2C2GA 3U26A 3A6DA 2C3MA 3O03A 4ARZA 1GUZA 3F8WA 4RPGA 2A3RA 2AMJA 2EFGA 4ZT3A 3WB9A 3ZHYA 5JZMA 1GPKA 4DXHA 1Z8HA 4WT7A 3DUFA 4GQAA 2XGGA 4L5AA 2EBFX 3N8DA 1ZD9A 2HNBA 3NBXX 4M7WA 5CYFA 1MJGA 2I55A 3MXTA 3IH5A 2YINC 2YMMA 1MC1A 4XOIA 1M1NB 1DX4A 5T67A 3SYNA 4BX0A 3FOFC 1F2TB 1Z63A 2HA7A 2VT3A 1VKZA 3CGWA 2PRSA 4JR2A 1L7OA 4DR6B 4RD6A 3E3LA 4TRJA 5KSPA 3E9NA 3KLOA 4V0OA 2VNKA 2YXLA 1AGRA 4M1WA 2Y1FA 4RK1A 3VRHA 2VNAA 4K26A 4BFVA 2BMEA 4OYHA 2FUNB 3DNPA 2OBNA 1OHHA 3MB8A 1DMRA 4L4YA 2VWGA 3X43A 5KSZA 1NQVA 4B7AA 1QP8A 1ZD4A 2IYRA 1FVHA 4R16A 4ZVPA 1H6BA 4BTLA 4DLZA 5I45A 3BG5A 2Z95A 4PHHA 5D8DA 5DM2A 1HNZB 5JD6A 1II9A 2IODA 2P5YA 1PGQA 1YFLA 4ZOLF 1EFCA 2J0UA 2PXCA 1RU3A 2V7BA 3GV0A 3Q8XB 5TEVA 2P9CA 1GD1O 3WLTA 3ZV4A 4JKYA 4YEDA 2UXDB 3A6JA 3RT1A 5HW0A 4QE3A 4EJFA 4EARA 4WXHA 3GA0A 1MG0A 2J4CA 2YWFA 4OMCA 4TL7A 5DNYB 1H8HA 3AJRA 2J31A 2QGNA 1UINA 3OOEA 4RPJA 2PQMA 5T6MA 3U48A 2B36A 2OE2A 3BK2A 4MRAA 1XQWA 4N9QA 5KWIA 1TTTA 2RGXA 4D4KA 1HOTA 1BDIA 2QX7A 4N6OA 4Q4AB 3AJEA 1E32A 1CEXA 1NFQA 1ZLYA 5HBRA 4BBPA 2VAXA 4H7FA 5AM4A 1TCUA 5G0UA 1LBSA 2CE2X 4LYGA 5B3LA 3IQGX 3AKCA 2PT9A 4NBLA 3VR4A 4QAJA 1JQEA 2GBCA 4C88A 3AR2A 1IUKA 3I8SA 3AEUA 1A5AB 3W5SA 1GAEO 1CDOA 1KVQA 4OREX 2IH2A 4XCVA 3QEOA 2R8RA 5E7JA 5F5XA 2Q8QA 1XPRA 1Z47A 4FYMA 3U62A 4DNXA 4NPCA 3PKIA 3NMUF 1LTKA 1VMIA 1IWPB 3BXFA 3K94A 2NN3C 3R5FA 1FFGA 1U3GA 1JAIA 1NJ6A 1TYCA 1K6JA 3AC0A 4FFBB 5HFNA 2HRRA 4UVIA 3ED5A 3R3SA 1J42A 2QRVB 3ZG6A 8GPBA 3V34A 1S4MA 2V7WA 4LZZA 1EESA 1EVEA 2UDPA 1IN7A 4PNPA 3UOGA 4KVAA 2CXRA 4KSBA 2P4HX 4EJSC 2B37A 2YZGA 3VH3A 1P0PA 4B6OA 2Z8YA 1KPGA 5HIIA 4OM7A 1GL6A 3TTWA 3E35A 4L9WA 1M1YB 1QAOA 4Y2XA 5EJIA 5JG7A 3RU7A 4BKRA 5CFQA 5KU1A 3U2QA 3EZXA 3TLKA 1QO0A 1A9RA 4NCJA 3U3XA 4ZK2A 1DIGA 2PLWA 3DKPA 1C4OA 2J5RA 5K3SA 4OJYA 3JASA 3LECA 4UPVA 3BIFA 2GO7A 5BPHA 4PSKA 4DF3A 5GMOA 4BJ6A 1UMBA 2QUJA 2PBLA 4MW6A 5P21A 1E2LA 1TQ4A 1GZ5A 1BDHA 3OP4A 1C1HA 3EEFA 3H2ZA 4JOQA 3OTOB 1PJ4A 3ORSA 4KTVE 3PRKE 4NZMA 5ETJA 2C9CA 3OEYA 2BFBB 2DFKB 1JEYB 4WZ6A 1U1EA 2J48A 4TV8F 3ZHZA 4BMDA 2DKFA 1ZIOA 3ZZ0A 1UBSB 1CUFA 2TRSB 5DULA 2DSNA 5DYYA 3BKXA 5K0LA 3ENZA 3V8BA 3KJHA 3K70D 2HV8A 1PSZA 2GDZA 2KS6A 3L6EA 4NULA 3HR4A 2I6QA 1FS5A 2C7BA 3MSCA 3BMOB 3DFIA 1NPYA 5ELMA 2LKCA 3B6JA 2HN9A 3B52X 1GOTA 4BN5A 2FFBA 3W9YA 1Z62A 4OU4A 1YMUA 4LVNA 3ZCTA 4TTSA 1E7MA 1K63A 2OQIA 3M5PA 2QL7A 4R2LA 3G9XA 5CG2A 5F12A 1WR8A 2IHBA 3AJ9A 4GOXA 4TN5A 4MWOA 3GPLA 1ZJYA 1ZHOA 4V1CI 2FEAA 1VJCA 4NH4A 5A06A 2JEYA 2X14A 1QBGA 1S6YA 2HA6A 1S5PA 1UFOA 2CK3A 4UHKA 5HR5A 3H1AA 1RZUA 1TUBB 2VHZA 4ZI5A 3WLIA 4QU8A 4LHWA 4COKA 4F3KA 1V16A 1UFVA 1QMPA 3KPJA 2WF5A 3CLUD 2JDIA 4GSLA 2WWTA 4IKOA 4NG4A 2GF9A 3G8CA 5AM0A 5A5EA 2VYNA 4LVCA 2GKGA 4E4RA 3V3KA 1T6BY 3AWDA 3V80A 3LP8A 4F1WA 5AVTA 1I14A 4DM7A 1EQUA 2CYCA 2GPTA 3G2HA 3FYCA 1T3ZA 1QO7A 1LA2A 3KE8A 2OWEA 3VISA 3A9CA 1QX3A 3FDXA 3UXYA 1BXGA 3D0RA 3A1SA 1IH8A 3HZOA 3KYDB 1N2OA 2ZPUA 3CZ5A 3OLWA 3Q5DA 3AVQA 3U7JA 4R4JA 1K1EA 1NJ8A 2J85A 2PU5A 2V6FA 4NX2A 1FA9A 5DTQA 5LQDA 3I01M 4PHGA 3UT5B 1Z0SA 4YRIA 2Q3JA 4JASB 1XTPA 2C2XA 4FZRA 3HBFA 5ICGA 1NJ1A 5CT5A 2YZ7A 4AXXA 1JQAA 3QYPA 3C3JA 2D0IA 2K2WA 4FN5A 4IGIA 1LS6A 1XZPA 3FMIA 1K7EB 2WMNB 3I5UA 5CP8A 3L2OB 5E1DA 1RC8A 3E4CA 2DBZA 1E61A 2FOXA 3FVQA 2XIQA 3TIIA 3UMMA 2FQYA 1QH1B 2DY0A 1SCUA 2JVKA 5AK6A 1ZMXA 4IHJB 1FK8A 1W29A 3ESXA 3HG7A 4C06A 3JYQA 4EYGA 3R9XB 4BNMA 3T95A 5AIAA 4AKIA 1RM4A 1T35A 2DFPA 3HCWA 3CVVA 2PH3A 1B4DA 4EMBA 3W9SA 4U63A 1A8QA 3K5IA 3SLKA 4B79A 4LYDA 4RF3A 2HSZA 1KH2A 1O95D 2H0RA 1JIXA 3UUGA 2C95A 2VWQA 4BO5A 5ALKA 1ZVVA 2J46A 5ERXA 3BD8A 4M1OA 1EK1A 3MMXA 3LT1A 3A2LA 3NT2A 1A95A 4TMXA 1YB2A 2IH4A 4EHLA 2C9YA 2UZ3A 1R6XA 2RC5A 3RF6A 5CA1A 2PTGA 5JSZA 5JYCA 1EP2B 2EW2A 5B3AA 3DVQX 2OORC 2EFJA 3ZY5A 5C5DA 1AKUA 2R79A 5TJHA 4TYPA 3T7TA 3T9BA 2QPLA 4Y2JA 2AYXA 2ILTA 5IBRA 3UWKA 2VTDA 1XRSB 3IUSA 4BZXA 4DV7B 5AKIA 2ODNA 3U49A 3AO0B 2PT7A 2X9LA 3KOXA 5IM4A 2OHXA 2QTRA 1KP3A 1VRCA 3NJ4A 1BX1A 4WHMA 4ZI3A 1GZSA 3VX4A 2VNHA 1KF0A 2XODA 3HC7A 4HX5A 4KXWA 1YU6A 2G5TA 2BBOA 4JL5A 2NUTA 1AD2A 1OFHA 2JATA 4Y2HA 2WU0A 3I1FA 3I2JA 4N49A 2IPMA 4GZ5A 4U7PB 4S1OA 4TWJA 1WSDA 3VMFA 3BDAA 3WNVA 3CNBA 3AW8A 1W0JD 1I2DA 6GPBA 4QNNA 1Q0ZA 2PS1A 3OM0A 5EUQB 1COZA 4IIBA 1Q92A 1O6FA 3FGPA 3IBYA 4M36A 4LGVA 3WJ7A 4PO9A 4GI1A 3JWIA 4TRRA 3U9TA 1VDZA 2COUA 3TQQA 3R9XA 1J49A 2V55B 4DV5B 3WYBA 1MC8A 1O87A 2QA5A 4K7JA 4HNTA 1PFUA 1SC3A 5TARA 5FFNA 1LK7A 3K2IA 1MA3A 2Z9CA 1ODIA 3OPQA 2V5VA 3E53A 3AF4A 3GUHA 3MPUA 1BVYF 2F6RA 5LDGA 4C6HA 2ZUFA 1EM6A 1GT91 3IJ5A 5B55A 1UR5A 4UHFA 1Y1TA 3RFUA 4HRAA 1Z6TA 3QNMA 2P11A 2BGUA 4MUMA 4LF8B 2P65A 1GDHA 1U11A 3ZCRA 2PTHA 2NV6A 3MTBA 4KXXA 1JF8A 1PZXA 3C8UA 2RHTA 4LF5B 3R0QA 1TW2A 3V48A 1K98A 4QDJA 1RAIA 1WJGA 3ODGA 3G82C 5DNDA 2NU8B 2HLDD 4EYEA 1U9IC 4IDQA 4AP6A 5EINA 4NDAA 1B43A 4JNKA 3VDRA 3ESZA 5FNVF 4CTJA 4C43A 2GYUA 1NF8A 2EL7A 2PRIA 3E9CA 4G5FA 5LQCA 2QYOA 2ROQA 2ZI4A 3EGCA 3KJZA 4MJ3A 4WKCA 4JU9A 1A2QA 3C70A 2ZTVA 3CH7A 4RBNA 2OO5C 1KO8A 5FWYB 3PHLA 1PJQA 3TYXA 4P5DA 2DXIA 3PWTA 3H2BA 1MIOB 3N5CA 3PQFA 3DZHA 5DSTA 3D4BA 1OWLA 1AHPA 4X3PA 1JECA 1LBIA 3HBAA 4FOPA 4LDJA 4RHEA 3SCZA 3WYAA 1CIPA 5JDIC 5BR4A 3NT4A 2XUAA 3HN7A 5CVJA 2MR6A 3JAWA 4DV4B 2I6SA 4HB4A 4RM3A 4AG5A 1P45A 3KNZA 2DFLA 4N48A 2VYQA 3G3EA 3EASA 16PKA 3ZDEA 1R7RA 3D7NA 4MTLA 2I8AA 1JMYA 1ZINA 1K8YB 1RPJA 1QXSA 4JYPA 2JAOA 3BWMA 3NVDA 3KC2A 3VU8A 2Q9BA 1HNXB 1CNMA 1VLMA 1Q0QA 2B7LA 3KYBA 3SVLA 3HXTA 5EWJB 4W8GA 3KQOA 1PRYA 5J63A 1XVLA 4TM8A 1EFRD 2FK7A 4EB3A 4F3TA 1PO7A 3ERCA 1EP9A 3EXFA 2V9CA 5J4YA 4UZSA 3OUTA 4JP5A 3FYDA 1JBEA 1U04A 2D5BA 5EZYF 4ZAXA 1TM5E 4MUIA 3TZBA 1P62B 1H42A 1I32A 3DHWC 3ETGA 4I4NA 1JLRA 4Q05A 5C53B 2QQFA 4XUGB 4LXIA 2Z98A 3LKVA 1P5HA 1X7XB 4S2UA 4JVSB 2O8FB 4LYYA 2J59A 3AW9A 4CIDA 1TYBE 5L9AA 1KYWA 4HMOA 3FMOB 4PHTA 1RXIA 1X87A 5CX4A 3TL3A 1J8VA 3VU9A 1W2GA 3UK0A 2J4DA 2NZXA 1CY6A 4ZICA 3PXXA 3U4MA 1TU0A 2Q2QA 2NTEA 4WA8A 3VGPA 4E2XA 3ZI0A 1XPOA 2VQEB 3KTDA 1G7RA 2PBFA 2NUPB 3HS3A 1X38A 4WKPA 1RNLA 2O5VA 4ZEVA 1XELA 2QEQA 5AUNB 3B51X 3PC8A 3I2GA 4IO0A 2YXEA 1XL0A 4N40A 3LIIA 5BV1A 3DXZA 2V0GA 5AHOA 3I9JA 3DHEA 1YQEA 4J76A 3LZCA 4MKXA 2F59A 5H70A 3SBXA 4B44A 4DVJA 2ZVDA 2LUOA 1J7JA 3D02A 4YRNA 3K1JA 1KFCB 5HS4A 4CM9D 5IXJA 4H1HA 1LLUA 4JY7A 4IHQA 1T1RA 3DVSX 3AF6A 1KO5A 1Y98A 2H1IA 1A5TA 3QPCA 2JBAA 1ML3A 1SB9A 2H17A 1FU4A 2A33A 4FMCB 3PUZA 4EW6A 3MUFA 3F73A 3GLGB 3WWZA 1S9HA 4FC6A 4YJ3F 3TLGB 4W63A 1J22A 1TAHA 1Z8NA 3QVGA 1P2UA 3I4FA 3GFOA 1EQ2A 1DVRA 1JQKA 3I9V1 3O73A 4XX1A 4E3ZA 2ZBUA 1ZNQO 1J24A 2W00A 1XEXA 2RARA 3NT5A 5EJAA 4QYTA 1TTPB 1SD1A 1WXDA 3H19A 3STUA 1MUUA 3GN1A 4FVTA 5DBEX 1LDEA 5DGDA 3DTNA 3SGLA 1GEGA 4TQUS 1LW6E 1YE5A 5AOAA 4JODA 3WG9A 2IPOA 4BVHA 1J5XA 1DELA 2B3DA 1T36A 3GGPA 4G9BA 4QDUA 3TLGA 4L9SA 5EHQA 2XUPA 2DCUA 1JSLA 2DHQA 2GQ0A 3AF5A 3LRXA 3PNOA 4FFWA 3UKOA 1NW7A 3FLEA 4UHDA 3P71T 3BJEA 1GYPA 5L4SA 2J08A 1JIJA 3EOZA 4TRNA 2I54A 5JI2E 4K0KB 5FCDA 2QNRA 4BFSA 2DPLA 3ZE9A 4R2MA 5IDVA 4HH0A 4BRUA 2CXSA 1ZGCA 1NQXA 3AL0C 4LPKA 4Q3DA 3T7CA 5AXCA 5KWJA 3GEGA 3FHTA 2HQBA 4KQXA 4HATA 4KZKA 4R8MA 1KH1A 3L4KA 1ODTC 3GUZA 3JQQA 4EI9A 1P4SA 3GAFA 2QVGA 4JP8A 3F97A 4G0QA 3VPGA 5K8JB 3DL0A 4GKKB 3PC7A 2WMDA 2BL4A 3DTTA 1U4NA 2Y67A 1Y6RA 4DLNA 4YV0A 1AKMA 4ZK6A 1KY5A 4M0EA 4C7OB 5IJ0A 3V4OA 1ZRSA 3FETA 4LGCA 1PFQA 3KEQA 1CRWG 4EFKA 3I32A 3F46A 3KZXA 4JC8A 3R41A 4WRRA 4NARA 3EVTA 4JGIA 4IRUB 1C7IA 5EN4A 4MJLA 4E14A 4H1WA 3T5PA 3OQBA 2IE8A 4ZVVA 1VL0A 3DDSA 3K32A 1B8NA 2Z4RA 4MS1A 5GV7A 1Y8RB 3ER6A 5IC5A 1JEQA 1RBMA 2H92A 1CQIB 4MR7A 3CKKA 1TCCA 2QLBA 1AY0A 3DZGA 2EF1A 4GXRA 2R48A 3G7SA 4X7BA 5F1OA 3V4RA 3U7HB 2IY8A 1APBA 1SVKA 4LBVA 4MICA 1FS4A 2AE1A 4LBWA 1H1LB 4GEGA 2EQBA 4Q3AA 4W1QA 3ZY4A 2GB4A 2JFBA 3VV2A 5JJCA 2QRLA 4K9SA 1XTQA 4X41A 3W3ZB 1VE3A 2XCLA 2BFEB 2A7QA 4K3VA 1VFNA 5JPCA 2FPWA 3VYUB 1G98A 1KGSA 1KDTA 2N9UA 4CKWB 1DJQA 1ADFA 4I5GA 5EXEA 1U8FO 4U6QA 1ZH8A 2EP7A 1ZGHA 2CC2A 2VDNB 2ZR7A 3NONA 4L2IA 1EGQA 4L4ZA 4NWIA 4JJEA 2XA2A 4OL9A 2JIOA 2DX7A 1RAGA 3LAWA 3OKCA 4HG2A 5SY6A 3QYJA 4FDAA 3K0AA 4LYAA 3SBOA 3UANA 4A0SA 1NUAA 1ZU4A 1H4TA 5EPOA 3E3MA 5CX1B 1PUIA 1ZJZA 1GRCA 1GTZA 1SXJE 1USKA 1XTTA 1P9NA 2Q3HA 3DZ8A 5K0EA 5KYWA 4HEA1 1F8FA 1USVA 1YL5A 3CURA 1DT5A 1LRJA 4W5NA 3GDHA 2GN9A 2H8KA 2X9GA 2Y3IA 3G68A 4NK4A 1ZEJA 3BQMB 4CM8A 1FSPA 2GXAA 1EBBA 1CJUC 2ONZA 2XCOA 3L46A 4FINA 1TUIA 4B74A 2C4NA 4CUKA 2VKTA 4G36A 1K5PA 2CFSA 1G3QA 2PZLA 3O0DA 2V9ZA 4X60A 3T7EA 4PG4A 2YWXA 5CFMA 2VKQA 1FP6A 1FTWA 1LDYA 1ZSVA 2VJYA 4MYTA 1YFZA 4EW1A 2C5LA 2IH5A 8ADHA 1T4DA 3O2SB 1ZH0A 2ZI5A 4JT9A 1U81A 2J3MA 3A36A 3AUFA 4FN4A 2QL6A 3TBKA 1TMGE 1S1CA 1BHO1 2P68A 1MTOA 4C2AA 2EW1A 1XCOA 4G5SA 5AXBA 3EXHA 3RS8A 1H2RS 1RP1A 2R68A 4JFRA 2VUHB 3CVOA 3EVCA 1GNRA 1YFJA 1PEAA 2YC2C 5HMLA 4KXNA 3KSRA 2XW6A 1PVVA 3VVCA 4ACBA 1IHXA 3FLBA 2WTBA 3PQ8A 2BZ0A 2E4WA 2G7MC 3VPBA 2PSFA 3HDYA 3L79A 3K4PA 1PUXA 4XD2A 3VM6A 1VLZA 5EJ5A 3R5HA 5DASA 1JJ7A 1VP3A 1WULS 2PL3A 3G2IA 4HD8A 2ZZKA 4F2GA 2DH6A 4YREA 3OCXA 1W49A 3FUTA 2CDAA 1Z82A 1EDDA 4DSOA 4FYKA 4B3FX 3FOWA 5EAIA 4F06A 1P1JA 2IZ7A 5H02A 3UOAB 5BV8A 3U44A 2R4UA 2XZDA 3UPDA 1ISPA 3UFBA 1K4YA 2NQTA 1AOXA 2REBA 3KBOA 2QX9A 3OT1B 1WDLA 2E7ZA 2X6QA 2VYVD 3RSSA 2Q7DA 3VBEA 3PGLA 4U7HA 4BZQA 4D4MA 1BWSA 3HVRA 1U8AA 5E0OA 1DO2A 1V2GA 4AMBA 5MF6A 2NUTB 2OYSA 2R86A 3CNQS 4RY8A 5LUBA 1DQSA 3Q15C 4BVAA 3HADA 1HUQA 2VRBA 1T9HA 3QNUA 4RSGA 1YBAA 1HZJA 4ZVUA 5A3QA 1C8VB 4J2HA 4H1UA 4K6HA 1TM3E 1XNJA 2A8YA 1NJ5A 2D13A 2YICA 3GPIA 1Z3IX 4GPTA 4TKZA 3TXXA 1INLA 4GP7A 4B6QA 2X0FA 4BFTA 4RMGA 2OCGA 3EF3A 2FUKA 1VL8A 2H5EA 4FQ5A 4EYKA 4D9NA 1I3LA 2D5LA 2JAUA 4QTZA 5FAKA 3F3YA 3OX1A 3WLJA 4ZOEA 4C3OB 5C32A 4Z8XA 3U7IA 4I9NA 1RW4A 4BAGA 3ET4A 3MBOA 1T3HA 5I7FA 3VZRA 3KDPA 1FMJA 2OSBA 1PYDA 3CR3C 3OIYA 3PI6A 2BHNA 3D8HA 1RTTA 3O4FA 1CZLA 2YWRA 2CUTA 3SM3A 1SOMA 3NCHA 1JHXA 1JHOA 1QRSA 1AT1A 2NGRA 3A0UA 4YRRA 1AQIA 2QYHA 2X0KA 2P3LA 3HJRA 4J0JA 5E6UB 5LZ4A 3BTUA 3EAFA 2X4LA 4C05A 4R2JA 2FMHA 2CEKA 2NXCA 1B3RA 3MWEB 4AMUA 3SFTA 4H4CA 2J9YB 2ZE5A 4WVFA 2DFTA 2SHKA 2OGTA 2YN2A 1N9GB 1NOJA 3EVAA 3I12A 1KY3A 1SB8A 2I1LA 3KJXA 4YONB 4ZJPA 1P29A 1NSTA 3PPIA 4HNHA 4JLPA 1KPHA 5AT1A 3KP1A 2FSFA 3SIPA 2ZIFA 5HUJA 1ZZEA 3K0FB 4CTMA 2R6FA 2ZR0A 4R1TA 4UE2A 5TF4A 1Q1AA 1ZRHA 4MRVA 1BYUA 3AG6A 1JHMA 1MABB 5JD4A 3UAWA 1J39A 3P2JA 1U4OA 1GL3A 1FQWA 2P2NA 4H7KA 1LBQA 4WN9A 4N0PA 2JHFA 3TSYA 1FRVA 1OFIA 1K6MA 3AY7A 4GKVA 4EUNA 5LMZA 2A9RA 1QG0A 2BMVA 3FTPA 1KEUA 3ZVKA 5DX1A 1ECFA 1WHTB 4HDSA 1I2BA 3I1JA 1V25A 5H0IA 4BHTA 3U31A 1UEXC 1D6NA 2BKVA 2Y1LA 4ZCPA 2FF5A 4IDHA 2NXJA 2D1FA 2BFCA 1FLDA 1J0XO 3H16A 4LHXA 4J2OA 2W2TA 5JZBA 2B5VA 4PZ9A 1N8SA 2Y1DA 3L8EA 4QBGB 5EIBC 1OZGA 1JDBB 1YJ5A 1WVGA 1NI3A 2YH2A 3BRSA 3R3HA 1N5JA 1U0TA 4R0NA 4DLBA 5AW3A 2HLPA 2GPYA 1PG5A 3AHCA 3GJQA 4M8NE 3EG9A 1AKWA 3OKFA 2Y0PA 1IMJA 1N36B 2QE6A 2QQGA 3DE7X 3HCDA 3M1AA 3B9QA 2OPHA 1NU6A 2W6OA 4H3HB 4D45A 2GK3A 4Q4DA 2X0EA 3V8EA 4B73A 3W5DA 2H9IA 1SPBS 5F52A 4C7BA 4ABTA 1E0AA 1FPQA 1QOQB 4O2AF 2FW7A 4Q1DA 1W4RA 1KTIA 2PY6A 5JQWA 2QVCA 2RBGA 2XHEA 2Z08A 1YF3A 2HJVA 4HEA6 5JY6A 3UMSA 3VU1A 2PUJA 4FYIA 3E18A 3SZGA 3B2QA 1ZMRA 2F1JA 1OF1A 4QXOA 3ZGOA 3F71A 1G8JA 1K2VN 3FR8A 5JU6A 4KK4A 2WD7A 2NP7A 2QGZA 3EGIA 1QTNA 4ENUA 2VP4A 1ZITA 4XWTA 2GCOB 1E1CB 4X7MA 1N25A 1QHEA 4KSCA 1IZYA 1N2CE 4NBTA 2ZRGA 3QA9A 5ESRA 2NYUA 4NOJA 4ZRMA 3TOCA 5DVZA 2FE4A 1TRHA 3RARA 3SBDA 4BNHA 5BQ3A 1RLJA 3I9FA 2I8CA 3QU9A 4L7QA 1LDMA 1V39A 1VIDA 4S1PA 2BF4A 1XTVA 3DZDA 4HNUA 5A4FS 3BE6A 5H81A 1AKNA 2H7VA 2PYZA 4KPYA 1RI4A 3X1WA 2JVIA 3JQDA 4BNZA 1JG2A 3M3DA 2WKPA 4OUDB 3NX4A 2DJIA 3DKVA 2WD9A 4JI4B 3T7SA 4H3KB 3JD2A 1E6WA 1GG2A 1DOAA 2XYVA 1F8UA 3AINA 4BFXA 2VDUE 4PXSA 4P3KA 5GONB 1LVUA 1WV1A 1Y5IA 3KVVA 5I8WA 2Z04A 4KIFA 5ISMA 3IUEA 2H18A 3CWQA 4I50B 4NYJQ 2P75A 4PWYA 1AQYA 5CH3A 4EB0A 3K71B 2WSMA 4M1QA 3HUTA 2I7TA 3LFHA 3K6KA 4V0LA 3RD5A 1BE6A 4FFBA 3NJRA 2JJ1A 1ENYA 2AW5A 2FCAA 5B1DA 3ABRB 3IHKA 4L74A 4ENVA 1WDWB 2GRUA 3SE0A 4ZFNA 1DAGA 3P9XA 4TKLA 1W1IA 1XEFA 4J1QA 5HILA 4HNSA 2P78A 1EAMA 3GN2A 3IAM6 4JA0A 1LFAA 4CMKA 8ATCA 3FX2A 4R40A 1O57A 4ESHA 1L7QA 1ZGGA 1X14A 4RNCA 1M54A 2W4IA 5FDFA 1OH8A 1JDJA 4X66B 1K92A 1DAHA 2C0QA 2ZW9A 3LIPA 5EKXA 4ZVNA 3LJKA 4BFUA 4F6CA 1PYOA 4J1NA 3IMGA 3AHGA 4HUQA 1ZNYA 3KHTA 1HV8A 3QITA 4QBIA 4CLRB 5DNEA 3BE4A 4MPPA 3DEFA 5FI0B 4Y6RA 4DRYA 4KV9A 4F2PA 1SVOA 1UOPA 4KI7A 1IM2A 4JUFA 2JI7A 1TECE 2HW8A 3WA7A 1MO3A 2FFAA 1TKBA 3NV9A 2HGZA 3EEQA 1IMOA 4NV3A 4O1MA 4AAYA 2CF6A 4EF5A 3VA7A 2GA9A 1E7YA 5BWBA 4DJTA 1ABBA 2DUWA 3AB7A 1P3Y1 1M5UA 2NUBA 2OV8A 5MN4A 1NQOA 2NAFA 2PH5A 3IDAA 4FIZA 3QEBZ 2JF0A 1Z18A 1T9AA 3DAYA 3K0SA 5SV2A 4X6UA 1RFLA 3JARA 4JB2A 3OJCA 1LW7A 2C8KA 4BAUA 2Q0XA 2V65A 4FD2A 4GX5A 3RS7A 4BLUA 4UUBA 4YROA 3M2TA 2O0HA 1IG0A 1U5BA 2ZKIA 1NMEA 5FWXA 2Y92A 3OZFA 2VT6A 1XKTA 3DEAA 3V7FA 3EVZA 1JLHA 4PSVA 4BFYA 2OTCA 3OU2A 4I50A 4ZYVA 1EQAA 2P1RA 2X1MA 2ZOSA 4H3VA 4M0LA 3KSAC 4P34A 3D4NA 2IDKA 1QG6A 1P7VA 3BYZA 3CM0A 5CMLA 5B1HA 2OYCA 2O2JA 2GEJA 4FE4A 2FP3A 4K28A 4AK9A 3EB9A 3FOZA 3GJXC 2H4HA 2ZUSA 1BKSB 2PX3A 4YT8A 4AJJA 1I0IA 4UVGA 1E5XA 3WK9A 4PYIA 2YS7A 3EWAA 1BN7A 3FCOA 3DCNA 3ID6C 4UCWA 1TK9A 4YAEA 2HHHB 1CY0A 2D5AA 4YJFB 5HKBA 2AIRA 2J6CA 1BAPA 4YBRA 3RKUA 2FDXA 3GT0A 3TQRA 3BMNA 1DLJA 3D6AA 4DR5B 1FFBA 1Q14A 3DGEC 1JJBA 3HV2A 1W75A 1DKRA 2WPDD 3EMVA 1Z39A 2PBZA 3UMJA 1SWVA 3TX2A 4D9GA 2D4AA 3TZ6A 5J4LA 1F9AA 3P27A 2VJKA 5BSWA 4JL8A 2XUJA 1JVBA 1G3UA 3JXEA 1UANA 3U39A 1GFSA 4LHSA 3HFRA 3KEMA 2VDVE 1FLVA 1I13A 1MAVA 1YACA 4N54A 5GY7A 3RIHA 5JECA 3VDXA 1Q77A 4HDOB 4QQFA 5K3OA 1EVIA 1YDHA 2WYVA 2C5FA 3D8BA 3HUFA 3IESA 3PC3A 3MJFA 1JZTA 4Q9AA 2I2CA 2Z6VA 4QUHA 4R83A 1R6DA 5DN9A 2OK8A 1BFKA 1KI1A 2IL1A 3U17A 4EP1A 4BP9A 5INTA 1TC1A 2BLNA 2BRUC 4GBJA 2PFGA 1G7SA 2REOA 3IRVA 1D9XA 3Q9LA 1FMTA 3WHPA 3R0IA 4QQNA 1RXUA 1QCCA 1ZUHA 2VOJA 4X24A 5AJXA 5EYPA 1SEVA 2RIPA 4C29A 1K08A 2XQKA 4ZAWA 5B1EA 3AVTA 3HCCA 1U2ZA 3B85A 1OA0A 4CIYA 1FP4A 1KIFA 1PW7A 2R1UA 2GWRA 4OK3A 1FFHA 4ZRNA 2NZVG 2GILA 5FUXA 3LI2A 1DC7A 1YRLA 1GUYA 4N7RA 5K0SA 3GR6A 1AUVA 1MGOA 1EX6A 1P4HA 3D7LA 5MFZA 1J6UA 4Q19A 4OMDA 3G88A 4R54A 3D8RA 3WQBA 1W8DA 3KFVA 1FX1A 3CUTA 3HH8A 2CW5A 2EZ9A 4NQZA 4P7GA 3PD1A 3E7WA 1NR1A 3CC8A 4ZHQA 1MDFA 4ENQA 1Z7GA 2JFPA 2GD1O 2FWNA 4HQFA 3LBHA 4BP8A 1KZ1A 3PDWA 3RQIA 4WEQA 2AWNA 1BS1A 2ECQA 2PZFA 3E22A 2R66A 3BWYA 3HDJA 1P6UA 4UMFA 1LX6A 1X1BA 3PXBA 2V8OA 2IHNA 2XY4A 2HM7A 2PT5A 1UAYA 2O0KA 1CRPA 3AUSA 4B17A 3TR5A 1ZS9A 2FHPA 5DM4A 4CMEA 1L5OA 2F3PA 3GEIA 4RSMA 2C84A 3P0RA 2EWMA 3ENVA 3NNNA 4K6KA 1UXJA 1NBAA 2YJZA 3ZZUA 3ZNOA 1CZNA 3K92A 4P3YA 1SUPA 3VZBA 4V2IA 1GGHA 4PC3A 1JKFA 3WMEA 1OUMA 3T5AA 5E8JA 1RQXA 1I3KA 2P69A 4P92A 2E9SA 4TV9A 1XTJA 3TLBA 1BJKA 1SBNE 1CYDA 3GEDA 1SKMA 5BW4A 3H1FA 3DHVA 3RT9A 4BFZA 5CDYA 3L4JA 3T9AA 3D6VA 1XJ5A 2IIVA 4G81A 4G1VA 4P4TA 1MIHA 3B89A 2H1HA 2ZSKA 1Y3BE 4P7BA 5E3IA 3R7AA 2CB0A 3O2JA 2G1PA 3OO0A 3CU5A 4Z3DA 3QIAA 4TZ6A 2ZYIA 3HYNA 2AR0A 3T5BA 5EVCA 1WD5A 2O3UA 1PWYE 4HPWA 4MWBA 4YJ2B 5ER6A 3H05A 2YYZA 3JALB 3QKRB 1JEEA 1OXSC 2OBBA 3PENA 5AHRA 2M6LA 1SIWA 3HVKA 1CR0A 3HJNA 1Z36A 2G71A 2FEPA 3K9NA 3L84A 4HXYA 4DQVA 5FHRA 5BO5A 4PZ0A 4RK5A 3O75A 3BA1A 1J4AA 3N53A 2RFLA 4CR7A 4R3UC 5ALOA 2XB6A 2PWAA 5A6SB 3K09C 4LIPD 3WMWA 3V42A 1YDMA 3U3KA 1E1YA 4F12A 4MVJD 4NFHA 2BHRA 3JRWA 4I5IA 4QVIA 1VSUA 1J56A 1SVSA 1YUNA 1HM5A 1ZKMA 3IDFA 5EIHA 2QVBA 4M54A 5BUCA 2MYUA 3BFVA 4QNMA 821PA 2WJJA 2ZULA 1IY0A 1ADYA 1IOVA 3HO6A 5C1IA 1MEEA 2PGLA 3LYHA 3GVPA 4O2AB 1EFVA 2GEFA 1JU3A 2B4QA 2F8MA 1V3TA 3DEJA 1N92A 4MA4A 5CNMA 5CPBA 5F33A 1NLUA 1SPXA 2WIAA 5FORA 1I6WA 1IN5A 3UHFA 4BATA 1F2UA 4HDQB 4XAQA 4C4RA 3W5JA 4EF6A 4K6OA 4HSEA 4OUDA 2XUFA 3QHPA 1DARA 3X3HA 3AM3A 2ZJ0A 3KQQA 1RYFA 4X8HA 1JE0A 3A4LA 1CE8B 4AT1A 2IWHA 3BH6A 1Z17A 1KBZA 3HP1A 4HN9A 3LVQE 1BKYA 5JO0A 4JI8B 4HNGA 1MKYA 2BDUA 4BUJA 2HCRA 4O1IA 1HT1E 3LDFA 3RS9A 4AL4A 3LT2A 2ODEA 2NVUA 1B6TA 1HQYE 2FEMA 3QOYA 2IZOA 2WG0A 2HWYA 2X8JB 1H0SA 1SCQA 1Q0SA 2QRZA 1UJMA 3QV1A 4XQGA 3TLEA 3TMKA 4D98A 2FPXA 4XVQA 1JHPA 2WP0A 5JS6A 2WTAA 2GHTA 1SVIA 2WU4A 1LPAB 2D0PB 2PUHA 3ONNA 2QZJA 1SHTX 1ZH6A 4M1SA 1RHKA 4M8SA 4MWTA 3R6WA 1FFAA 4MUHA 4R41A 3VPFA 3EX7C 4YCLA 4BX9A 3LUGA 3PFHA 4YUWA 1NAIA 3GLGA 1VM6A 5K3FB 4XI9A 4MQEA 3GH1A 4RK6A 3MWLA 3F47A 4Y9DA 4OIMA 1KE1A 1C3JA 3RBAA 4P7JA 3OZUA 1NONA 2CJFA 2WI8A 2XUQA 4WXYB 4GPBA 5DLEA 4IDAA 3U3OA 4DQKA 5JS2A 3V8VA 4LZOA 2QXUA 3GAZA 3I92A 1BWPA 3GEBA 4JEUA 2PDAA 5P8WA 3FOEC 1QWOA 5JWHA 3CZCA 3KB8A 3Q7SA 4LWQA 2A9PA 2WAXA 4DDHA 2FMTA 4ND2A 1CT9A 5SZKB 4YECA 3OHPA 3QLUC 3CG0A 4LJLA 5C7LO 4OFXA 4JA2A 2FRDA 4MB2A 3SF8A 1JG3A 3VAYA 3AKEA 3IKLA 3ZWAA 4CTNA 2BYTA 3PXEA 2AFVA 5EE5B 2W8ZA 1LH0A 3QBEA 3RW9A 1R5NA 2QM7A 3ZZ1A 1B6RA 4LQLA 3GOQA 3I39X 1C0EA 1QHSA 1SXJC 3I6MA 1WP9A 4M83A 4XX0B 3TH5A 3CO0S 5EJ6A 3FCCA 4LE1A 2VJBA 4EA6A 5AVUA 2QAGC 3QELB 2IS2A 2WAMA 3M4ZA 4JVLA 1V5FA 2P9FA 2XOKA 3IAHA 3FCSB 3VPAA 4QYIB 1ISRA 3HA3A 2W6IA 4KFRA 1BEZA 1M10A 1TVKA 2GK4A 1W88B 3AEXA 1UXOA 2G0NA 3O3OB 1N6IA 1RT9A 3N70A 4N3NA 3FPBA 5ALZA 4ZWNA 4C1NA 4GPAA 3IE0A 1IVYA 4JBHA 1VKJA 4NJMA 1DQRA 2I3BA 1I5EA 2CFTA 1AKRA 3WI7A 4QUDA 1B41A 3TTYA 1D2GA 1PL7A 2C5SA 2VBIA 3QVSA 3OZVA 4IZIA 2P9YA 3ZU3A 3OPY