3EMKA

2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
246
structure length
241
Chain Sequence
SMFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAELGERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRRNGRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE/RIBITOL DEHYDROGENASE
publication title 2.5A crystal structure of glucose/ribitol dehydrogenase from brucella melitensis
rcsb
source organism Brucella melitensis
molecule tags Oxidoreductase
total genus 88
structure length 241
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3emkA00
2JD0A 1YL5A 1DHRA 3DBVO 4GWKA 1ZIDA 2EGHA 4BO6A 1F17A 2J3HA 2Q1SA 3SXPA 3ITDA 4B4OA 2HK8A 3I9JA 4OQZA 1T2FA 5TNXA 1BVRA 4KUHA 1LRLA 5KNLA 1EE9A 2NTNA 3Q6IA 1LC3A 3ZZNA 4AG3A 1I3KA 4R1UA 2NACA 1D4FA 1I2BA 3IKVA 3ZU3A 3W8EA 2CY0A 5KKCA 1VSUA 4E12A 3R1IA 1K6JA 2A94A 2X0JA 8LDHA 3QVTA 5AXDA 4R4JA 5A5FA 4IJVA 1PJ4A 4FFRA 4J2OA 5DT9A 3I9OA 2JCVA 4RLSA 1NXQA 1IL0A 4BKOA 4A0SA 3QSGA 3WOHA 3IAHA 1I32A 1PGPA 2C54A 1QLJA 1B16A 4JP3A 3S8MA 2I9PA 5JCJD 2FP4A 1UUFA 1W8DA 2CVOA 3VKVA 1EDZA 1PTJA 3H5RA 4MVJE 4WLVA 5CHEA 1VRWA 4R68A 5F1KA 2NVBA 3RUIA 3AI3A 3ETGA 3S55A 3A4VA 1EUZA 5F1OA 1R15A 3H9JA 1BW9B 3NTOA 4YDRA 5JS6A 3JSAA 4CM6A 3DAGA 4HFJA 2DPGA 4YT5A 5TS3A 4L9RA 4FJ2A 4AJHA 2ZTUA 1CRWG 3CIFA 3DZBA 2B36A 4DPLA 4TMFA 3JQGA 3JD4A 3E6AA 4F3YA 2Q2QA 1Q7BA 2D3TA 4Z0TA 3F47A 3L07A 3ROQA 4K26A 3ZV4A 1HDZA 2HMWA 1HDGO 4RZHA 5L4SA 1DBVO 3PWZA 4BO4A 4Z0HO 5G0WA 4CM9D 4D7AA 1N1EA 4D45A 2D5AA 1VE9A 1NPTO 5ER9A 2BGKA 3KLMX 3DDNA 2FPGA 1DIGA 3OQBA 4BQRA 3H3JA 4ESOA 2W2KA 1LDGA 1O0SA 4BNLA 1YBVA 1E6WA 4NFYA 2EP5A 5DBGA 2P4QA 5JO0A 2PD3A 4FD3A 4ZQBA 4IPTA 2VN8A 1NPDA 3EW7A 4N5LA 1RYDA 3B1KA 4JJIA 4LISA 2AQKA 3IJRA 3K9QO 2BI8A 3RD5A 1J49A 9LDTA 4TRNA 2VOEA 2EW8A 4IDFA 2ZQYA 1BW9A 4DTIA 4R41A 4XEHA 1TA4A 2OOSA 3HHPA 3Q11A 3GVPA 4WE3A 2GO1A 2ZIZA 1KVSA 3QWHA 5JNLA 1LI4A 1GV1A 3F4BA 4S1VA 4PVCA 4AICA 4CM1A 5H82A 3UCEA 5I7EA 4OKNA 1RM0A 3GDFA 4IINA 4CLEA 5EJ2A 3ZV6A 3D1LA 4ITUA 4BNXA 2X0NA 1U4SA 4YJFA 4J9UE 1U9JA 3F1LA 4Z3DA 1TT5A 3FCOA 4OSPA 2OO5A 1P1KA 3LSYA 4ND4A 1E1MA 1KIFA 4S3MA 3RQSA 2B35A 1N2SA 3FSRA 2YJZA 5JYDA 4CMIA 1KVQA 2VT3A 4LCEA 5IF3A 3FN4A 4HKTA 5BSHA 3ANLA 5B12A 2V6MA 1PL7A 1V9LA 1X0VA 4RPHA 4DQVA 4WEQA 1U3VA 1PSDA 3JQ8B 4LRSB 5IG2A 1PIWA 5L4LA 1XU7A 3H2SA 2O4CA 4E21A 2EGGA 1WMAA 4KWHA 3FTNA 2GGSA 3JTMA 4EI2A 4KOAA 1JA9A 4JJFA 1PGJA 1ZZEA 1E1KA 1NFRA 1ZMTA 3DTYA 1CQJA 4RORA 3I3OA 2H1SA 1RYEA 2J6IA 4XYMA 3PLRA 1AGNA 1Y8QB 3DB2A 4WNCA 3ITKA 5ENDA 4FB5A 3WLFA 4BKUA 2ET6A 1JDJA 1EVZA 1MG0A 4KDFA 4PG6A 3ROPA 1ZEJA 2BGMA 4B7UA 2NNLD 3NJ8A 4L0QA 5CAEA 1GCOA 2E48A 2Z1MA 1DEHA 4HNHA 5LC1A 2BGLA 1AHHA 5G4LA 2Q1TA 5EL0A 3OIDA 2CNBA 3AI1A 3PGXA 1EEHA 5I8ZA 7MDHA 5ILGA 1Z74A 5A03A 3O8QB 3D4NA 2YDXA 2VZ9A 2XXBA 3ZGYA 2Q3EA 2DUUA 2IDZA 1GUFA 4AJNA 3C1OA 1LDYA 5BT9A 5TIIA 3ZCXA 1E3JA 1I8TA 3HJAA 2B37A 2OFPA 1T4BA 2P9GA 2XXJA 4IMRA 2O50A 1J0XO 4YB8A 3ZWPA 3I9MA 4ZQFA 5ITVA 1E7YA 1XIVA 3TFQA 4PRKA 2TMGA 2NU9A 3WGZA 1FDSA 1EFLA 4NU6A 3TF5A 4HX5A 3DZIA 2C0CA 1U8FO 1DC5A 2X8LA 2YV3A 4WK6A 2NUAA 3KV3O 3VVCA 1N5DA 3INRA 1NVMB 4I9NA 3BTUA 4NBRA 3L9XA 3GA0A 3JD2A 1PGOA 1DRVA 4J91A 3DQPA 1TXGA 4DBVO 1L7EA 4CV1A 1N1GA 1P9LA 3F3SA 4IMPA 1DIRA 5F3RA 2W90A 2HK9A 2NV6A 3Q0EA 4WASA 4BGEA 2UDPA 2FMUA 4KP7A 1IHXA 2A4KA 1L7DA 1YB4A 2Z95A 1F14A 1SOVA 2FZEA 3ON5A 2QYSA 1ISIA 4YRAA 1CQIA 1ZK0A 4U5QA 2IRWA 4BGUA 4L75A 2JD2A 4I08A 1FDUA 3L4BA 4XR4A 4NPCA 3W8DA 1DRWA 4IXWA 3C7CB 4CUZA 2AMFA 3QHAA 2Q4BA 2J3KA 2G1UA 3PWSA 2O7QA 3DAFA 1DC4A 3AM4A 3PDUA 4P22A 4CJXA 1LDBA 4KZPA 4BKPA 1UP6A 1Z6ZA 3JV7A 5I9MA 1JVBA 4ALIA 4R5HA 3T4EA 1NP3A 1D3AA 4IS2A 4MDHA 2GRAA 1DHTA 1Q0QA 2EEZA 1XELA 3C85A 1YL7A 4FFNA 1O89A 3VZQA 1T24A 1V3VA 3PGJA 4O5OA 4OHUA 3A06A 3X2FA 2NQTA 1QKIA 1PZHA 5FF9A 2Z5LA 3LT4A 4R1SA 1UP7A 3U3XA 3AM3A 4HFRA 3LYLA 2GZ2A 3ZHZA 4WUVA 4IZHA 3RBVA 3FNFA 2BELA 1D1TA 3W1VA 3GN2A 2F00A 4GLOA 4IQ8A 3P19A 4XYBA 5F1PA 3FR7A 4DPKA 2QIOA 2HRBA 4ALJA 1GDHA 2OHXA 3ADPA 3OMLA 5HS6A 4Z9XA 3TZHA 1H9AA 1OOEA 4BO1A 1GCUA 1X7DA 2VHYA 3KUXA 4NU5A 4XQ9A 3KVOA 1R4MB 4A27A 1ISHA 3E5MA 4ND1A 3WICA 3B1JA 2G17A 3L6OO 4ZHSA 1KOLA 1WP4A 4AJLA 3HDHA 2EJVA 4B7XA 5TT0A 5CFZA 1IUKA 1QYXA 1GFSA 1H5QA 4L76A 1Y1PA 2PZLA 3GFBA 4UVDA 3SJUA 1MB4A 5TC4A 2YQ5A 4CLOB 1KS9A 1I3LA 4D3FA 4GX2A 1YDEA 4P4LA 2E37A 3B1FA 5G0SA 1UXIA 1I2ZA 2CD9A 1S7CA 4M1QA 3NDJA 5CG1A 3GMSA 1F8GA 2VZ8A 3KLPX 4RPJA 3LLSA 1R16A 3OQ1A 2ZATA 2IZ0A 3HDQA 2PD4A 4A03A 1CERA 1O94A 3G3EA 1QYVA 3I6QA 4R9SA 1PJSA 3K2EA 4HADA 2ZJ1A 1NWCA 1NBOA 4ZVVA 4DLLA 1UP4A 4NHEA 3EVNA 5FWNA 4I5FA 2D8AA 4UAGA 4CMCA 3GFGA 6ADHA 5KTKA 2G5CA 3F46A 3M1LA 2VRCD 3NV9A 2IEBA 1H6DA 2OBNA 1H6CA 3QWBA 2VTDA 4IGFA 3M2PA 4PRLA 1GYRA 1K0UA 2J5RA 1HYHA 1ULSA 4MVJG 1H94A 3WG9A 5CEJA 1H6AA 3L9WA 5CDUA 1IPEA 1BGVA 4U7WA 1LSUA 1ZKMA 4Z9FA 1R0SA 1XKQA 3FNHA 4NBVA 5BNIA 3GMDA 3I9NA 2OGUA 4IDCA 3C8MA 3UN1A 3DAPA 1NAHA 4IBOA 5LDHA 1GR0A 4INAA 5IDXA 1NFQA 5G0UA 3DBHA 4CPDA 1N8KA 1X7GA 3VH4A 4TVBA 4XQGA 2DUWA 4PN3A 3JYLA 1HL3A 2ZB7A 3AWDA 5ER6A 3CZMA 4JK3A 4JJGA 2B5VA 3O03A 5KWEA 1ENYA 5JCJA 2RAFA 4F6CA 1A5ZA 1XR3A 4WOJA 4YACA 2Y93A 2DPHA 1IPFA 3RROA 4G2NA 1Z45A 1AN9A 5FYDA 4WCFC 1LLDA 3W8FA 3H9EO 3GNTA 4ZRMA 4GQAA 1U3WA 4OM8A 3W6UA 1IYZA 3CH6A 4BQPA 2OP1A 1LX6A 3W4IA 2CDAA 3FR8A 4BNHA 4LK3A 1HWYA 4DMLA 1T2EA 2VHWA 3WTBA 3NGLA 1W73A 1XEAA 1OC4A 5L51A 4EYEA 4WLNA 1KVUA 2X4GA 3BYZA 1SMKA 2J5QA 1P0FA 1R4NA 2JD1A 4M89A 4OKIA 4WNIA 4CUKA 3ZHBA 4EUHA 5T67A 2VCYA 2AHRA 4F45A 3BMOA 4HWKA 4PZCA 4CM9A 1CF2O 3DZKA 2IODA 2DVMA 4Y67A 3HFGA 3GG9A 3FNGA 3D4PA 3HQ4O 3GGPA 5BNFA 3BXXA 1E3SA 1NYTA 1R0LA 2YFHA 5JYEA 3I52A 4OH1A 3RASA 4Q3DA 5IZ4A 1CIVA 2XPCA 4QECA 2DQ4A 3V2HA 4NK5A 4TZTA 2B69A 3MCVA 3Q3CA 1E3EA 1X13A 2QRKA 2Y99A 4OOEA 1IULA 3VTFA 1E5LA 1M67A 2OZPA 2V7PA 5DBFA 3V8BA 3QV1A 4TKMA 5CDSA 1IY8A 4BV8A 3E1KA 4PLFA 3DBRB 3ADOA 1AE1A 4YCAA 5DCYA 3AOEC 5I7FA 5L7WA 1PL6A 3INTA 2NTJA 4RF4A 2FHSA 2WJPA 4WCFB 3PHHA 4XIYA 1PJBA 3RVDA 4JBIA 5DZSA 4DQXA 2AQHA 1UZLA 2B83A 1GADO 1GD1O 4EJ0A 3TQHA 3U4CA 2ZTVA 5C7IO 3S2EA 4BV9A 4FGSA 2Q46A 4J0EA 3V2GA 1BMDA 1IZ0A 1GEEA 3VDQA 2HLPA 5AOVA 1SEVA 3MOGA 2PZMA 5HWSA 1EQUA 4EGFA 3EVTA 3SX2A 3RUAA 3UOGA 3UW3A 2HCTA 2I67A 3EAGA 4ZQEA 4YAIA 4GVLA 1H2BA 3DFZA 1U3TA 4N5MA 4AJPA 4R69A 3CEAA 1NVTA 3DZHA 5HTOA 2FRDA 3E82A 2EG9A 2B5WA 3BHJA 3RI3A 3SLKA 3RUEA 3VPGA 3Q9UA 2V6GA 4IQ0A 5JMPA 4FJ0A 4FCCA 1Y6JA 4RGBA 5CDGA 4JN6B 3VPHA 1HYEA 3KXDA 2VOJA 3AM5A 3H2ZA 1PS8A 2PKQP 1DAOA 5JDCC 5KOIA 5IJZA 3HB4X 1EBFA 1PJ2A 3G49A 3DBRA 2DFDA 4PFJA 5IAAA 3WYCA 2C2XA 2Y1OA 3HZZA 4YA6A 5B4TA 1SAYA 2NVWA 3GN1A 5I9NA 3DL2A 1Y5RA 4WCFA 3D3WB 3IP3A 3QWIA 1DFGA 3H9UA 4DIOA 2NTVA 2O23A 1VL0A 3RSHA 4NDNE 1PZGA 1E7WA 4KWIA 1F8FA 3ANNA 4IJKA 1DFHA 3ZDFA 3UF0A 1WXDA 4LMPA 2X0IA 4NZ9A 1M6WA 2VHXA 1HETA 4EEZA 5DULA 4JP2A 4TSKA 5TQVA 1OFGA 4U6SA 1U5CA 1OAAA 2VT2A 4BMNA 2EXXA 4DUPA 4MKXA 3CMMA 4LSMA 4W4TA 2C5AA 4K28A 5LDGA 1VJ0A 3WR5A 4J2HA 1DIAA 1I3NA 3C7DB 3MTGA 4YRDA 2YHIA 4O63O 3ZH2A 4FW8A 3I23A 4DGSA 3ZWYA 3CXRA 3KSDO 4A10A 1XHLA 3KHUA 1I5RA 2FR0A 4HFNA 4FOOA 4HFMA 2AEJA 1OMOA 3R3JA 5AXAA 1GYQA 2X9GA 1HE4A 4O6VA 1MXHA 4J7CA 3AU9A 2VZ0A 1SB8A 2DM6A 4MP3A 1G1AA 1VJTA 1N7GA 2OORA 4M55A 4OAQA 4BS9A 1ZK4A 2JHFA 5T8KC 3AOEA 1V3TA 4G65A 2HMUA 2I5PO 4ALMA 2I6TA 3D3WA 4GX0A 1PZFA 2GSDA 2NLOA 2VTEA 4R9RA 1LQTA 1FDVA 4CMKA 1WLYA 4FGWA 1M76A 5JY1A 4AFNA 1U2GA 1UR5A 2QZ9A 4I5GA 4TRRA 1WAMA 2NVUB 1V0JA 3F5QA 2W2KB 1GPJA 4PLHA 1RM4A 3L77A 1JKJA 2Y05A 1WMBA 4OIMA 1KVTA 2B0JA 1K89A 1BTOA 3LZ6A 1NNUA 2GD1O 1I3MA 1X1EA 2E82A 3GF4A 4BO3A 1KEPA 3VAZA 2HMTA 3EY4A 3WIEA 3UCFA 1E3IA 4JBHA 4PLGA 2I99A 3ZWAA 4QTZA 2AE2A 1NR7A 3KYBA 2Y0CA 4XIJA 4QFDA 4J90A 3FNEA 3UCXA 1HRDA 2NWQA 3G17A 4PVDA 1EZ4A 1YS4A 3KYDB 5EESA 3JQ7B 3IS3A 4HV4A 5G4KB 1BSVA 5JDCA 5FFFA 5L95A 3GZNB 1YJ8A 4ZU3A 2UUOA 2Y1DA 4J0FA 5TRTA 3ZU2A 1CETA 4YJFB 3KOUA 5CG2A 2ZB3A 5LCXA 1TT5B 3RUFA 4B4WA 4MP6A 3K6JA 2W4QA 4CM7A 1UDBA 1G6KA 1T2CA 3K31A 4RVSA 4KQXA 3U49A 4CMIB 4CR8A 1YB1A 3AI2A 3GH3A 3L0DA 1K2WA 3RC2A 2NVUA 3I1JA 4FJ1A 2HSDA 4JGBA 4HXYA 1UXJA 2A9FA 5EQFA 3JD3A 2DLDA 5TJHA 1SEPA 3IJPA 1SB9A 3LT0A 3BMNB 2ZCVA 4CQLB 4LVUA 2PNFA 3DHEA 4OGWA 3RBXA 3UAGA 4CLHA 4CQMA 1DOHA 3O38A 4PLPA 2YW9A 2PV7A 3G79A 4ZGWA 1G0OA 2WWRA 3PQFA 3SJ7A 1B26A 1QYWA 3RBZA 4QEDA 2JAHA 1J5PA 2VUSA 2O2SA 3JQAD 2Z1NA 3U0BA 4E5PA 3KYCB 1B3BA 2I3AA 1WVGA 2R6JA 1EQ2A 2ZKLA 1XA0A 3KYDA 1UH5A 2PK3A 3JQ7A 3GG2A 4N54A 3WQQA 5G4KA 2HU2A 4ALKA 1LEHA 1YE3A 1HSZA 4R1NA 5F21A 3A14A 3LQFA 3GZNA 4PZEA 5G0TA 3ZV5A 3F5SA 5CEEA 1T1SA 3PLNA 3QQPA 3TZ6A 3SBOA 4TVOA 4XRRA 3RFXA 4JLWA 3PQEA 3FBGA 5T8KA 5G0VA 1EBUA 1DPGA 3AY7A 3MZ0A 3T7CA 1PJTA 2VWPA 3L4BC 4GSLA 3QVOA 4AJEA 3ZW8A 3INGA 1U5AA 1PWZA 4D43A 4FFPA 3S2GA 4QO8A 3GRPA 3BMNA 4QFCA 5BQFA 1B8UA 4YBZA 2ZJ0A 2VRCA 1A7AA 1MA0A 5EERA 3VTZA 4G5HA 1C0KA 5TGDA 4CQLA 2RCYA 4RV9A 1ISFA 1LA2A 3NGXA 4Z3KA 2JAPA 3V1UA 1C14A 3MJSA 3NX4A 4PLTA 4RPLA 3U62A 1E0DA 3W6ZA 3DR3A 5IZCC 5U4QA 3QWFA 4IY1A 3E8XA 5A06A 3VPXA 2AXQA 1K3TA 1R12A 4NFHA 2D5CA 2PZKA 1YQXA 3KYCA 3IP1A 5A9RA 1WPQA 3AUTA 2C5EA 3UUWA 5COQA 4OYRA 4XGNA 2WD8A 2PLAA 2RIRA 1YDWA 1ADBA 4XDZA 1FK8A 2VYND 3FHLA 3GVCA 4FIZA 4Z9YA 4NBTA 1FF9A 3TZQA 1T4DA 2NU7A 1TEHA 5DCWA 4ONEA 1EVYA 5DNAA 1I33A 4FPXA 1KVRA 1SC6A 1ZK2A 3GOHA 3ICCA 3MWDB 1NQTA 3SVTA 4DA9A 1PS0A 1I01A 3UGKA 1Q0LA 4Y8VA 4MPDA 4BL5A 5BSGA 4N18A 1P31A 1GYPA 2YHUA 1DAPA 4HY3A 3M1AA 2DTXA 3Q2KA 3ZWVA 1C1DA 2UYYA 2C29D 3DOJA 4XYGA 4K6FA 1G0NA 1ONNA 4E2YA 1GQ2A 3CINA 3NDIA 3QY9A 2P5UA 2VHVA 3L4SO 4U8GA 1VL6A 2HK7A 2X5KO 3BMCB 5GMOA 1Q1NA 1LRJA 2RH4A 3F4LA 1P1JA 4TRJA 2HKIA 3O9ZA 3WGHA 1DJQA 4UREA 3U4DA 2EJWA 1BXGA 3BA1A 3DMTC 1K5HA 2E6UX 4G81A 3V2UA 4RF2A 1FXSA 4Q3BA 3HNPA 1P3DA 3PHLA 4ND5A 4KMSA 1OBFO 3PQDA 5AVOA 1NPYA 1Q0HA 1LUAA 3IMFA 4YYZA 4YT2A 3I9KA 1ZCJA 2AW5A 3EZLA 1EMDA 1NQ5A 3EZYA 4AVYA 2FSVA 2YUTA 1BXZA 2DT5A 1KETA 2EERA 2Y68A 3NEPX 1E7QA 4JNKA 3JYPA 1M75A 3GPIA 3L6EA 2NU8A 4CM4B 3D7LA 4BNFA 3WJ7A 2A35A 3U09A 4BNWA 1SO8A 3OQ6A 4BVAA 1PQPA 1R66A 1EVIA 3G1TA 4XYEA 3BTSA 3OP4A 3DHYA 4WPGA 5EMHA 4K6CA 1BWSA 1ZSYA 2VUUA 4ALNA 5ICMA 5JE8A 1EUDA 2IXBA 5THQA 3BMCA 2Q50A 3RC7A 3UHAA 1M66A 2BKAA 5JXWA 3IQDB 2D0IA 2ZYAA 1ZH8A 3WTCA 3DOCA 4FBGA 1E5QA 2B4RO 4Q39A 1ENOA 5IZCA 2X7HA 4B3JA 5L7TA 5ICSA 2J8ZA 1YB5A 5C7LO 1HSOA 4UEOA 3DZGA 1LTHR 5AXCA 1I0ZA 2FPIA 1HE5A 1KEUA 4WCDA 4A7PA 4K9DA 3WBFA 2BMAA 1N7HA 3HSKA 1SCUA 3H7AA 2RH8A 4CV2A 2P9EA 4QXMA 2YDYA 3WGGA 1WZIA 3P7MA 3PFFA 3GVHA 4CM5A 2D2IA 4BIIA 1ONPA 3R6DA 4E5KA 2VUTA 3ASUA 3Q2IA 4EJMA 1EUCA 2E4AA 4BKQA 1ZW1A 2ILTA 4RCVA 3GT0A 3BTVA 4XA8A 1HT0A 4CM4A 2JFGA 3ZV3A 4B3HA 1EK6A 4UUOA 1H0KA 4GX5A 4RF5A 2DU8A 5ADHA 4CQMD 4XWYA 3A1NA 3JQCA 3OHSX 2IZZA 1C1XA 2JJYA 5KIAA 4MVJD 3OJLA 4NK4A 3PHIA 1J6UA 1JLLA 4WLOA 1ZXLA 4UUPA 2CDCA 1NTOA 4DYVA 3GQVA 2P5YA 2PKRA 2TMDA 1P1IA 4PIVA 1PQUA 4OXNA 5EQDA 4DYDA 2QRLA 2JKVA 4WGGA 2HQ1A 5EPOA 3WNQA 4D79A 2G76A 3I4CA 1UXKA 2X58A 1JTVA 5T64A 2G82A 3IL2A 1X14A 3WX0A 3DBHB 4MKZA 3ZHYA 4F46A 5B1YA 1JKIA 1E6EA 3DMTA 2GPTA 5B4UA 1LU9A 4PG4A 3GAZA 4C7KA 2Q45A 1YO6A 2FN7A 2X6TA 3OICA 5CPFA 1ZK1A 2NM0A 2X5OA 5KJFA 1E6UA 1A4IA 5GZ3A 4XGKA 5DP1A 4ROSA 3BMQB 4DC1A 3W4JA 1WW8A 2CSUA 3GNQA 2BFPA 3WWYA 2CVQA 4I5DA 4RJTA 2HMSA 3QW2A 2WYVA 3HN2A 3AJRA 5FEUA 2YZ7A 4R01A 4YT8A 1QV6A 4CODB 4UVGA 4HBGA 3JYNA 3O4RA 1ISGA 5KKAA 1PL8A 3PTZA 1TVEA 3WB9A 1XDWA 2Q4EA 4FDAA 1H6BA 3OECA 2P68A 4M54A 3AY3A 1DLJA 1R4NB 2G0TA 2OL4A 2EW2A 3PJFA 4BO2A 4C4OA 4RDHA 1YL6A 3BMOB 4E2ZA 1RJWA 4M49A 1QYDA 4BNMA 1HE3A 1V35A 1O9BA 4RVUA 1KY5A 3PDJA 2P4HX 4IGEA 4XQCA 4A73A 4L73A 1P1RA 2PFGA 4MIEA 4QX6A 4W82A 4XZ3A 2HUNA 1HDOA 1YXMA 3IC5A 3NYWA 3JCZA 1YQGA 2WE8A 3D64A 5HM8A 1PR9A 2ZTLA 4LRTB 4IZIA 3G1UA 1HLPA 3RUCA 1Y7TA 2FZWA 1SOWA 1RM5A 1GU7A 1PGNA 3LU1A 4IUYA 4CMHA 3IUPA 5K0ZA 3HUDA 1KY4A 3BIOA 1Z75A 4CLXA 4I5EA 1ZXBA 2C82A 3LF2A 1YWGO 3LF1A 3P5SA 4BOYA 3PVZA 4DIFA 1E92A 3NT2A 3B70A 3TJRA 1GY8A 2ZCUA 4ZJUA 1YGYA 1MG5A 1YQDA 2ZYGA 3BMQA 5A3JA 1YOVB 1PU2A 1VKNA 2CF5A 1BVUA 2BFAA 3JQAB 2QRJA 3RKRA 2VNAA 4EITA 4N7RA 1VI2A 2PZJA 3FF4A 4QQRA 5EIOA 4XDYA 5A3VA 3TWOA 2CUKA 4URFA 3H9GA 2WE7A 2Q1WA 1N9GA 1ENPA 3GC6A 3ETDA 4ZRNA 1MLDA 4WJZA 2FR8A 3ZU4A 4Q3AA 5JW6A 2FY8A 2ZYDA 4DWVA 1DJNA 3S2IA 4BNZA 1A27A 4GL4A 1HE2A 1AHIA 3JQ6A 4UVHA 3F6YA 1P44A 4J1TA 3OFSA 1UAYA 4D3SA 4GWGA 2YFQA 2XF8A 1B14A 5FI5A 4BO9A 4BUCA 2X22A 3PYMA 3H5NA 3PHGA 4W9NC 1NHGA 2CZCA 1E3LA 1EDOA 3GZ4A 2J3JA 4RQTA 4ZQGA 3B6ZA 3H6KA 3RJ9A 3TFOA 3BZUA 4OOFA 3VDRA 2YYYA 4TWRA 4EDFA 1GPDG 2H9IA 3TOZA 5JC1A 4GBJA 3V5NA 2PTGA 4Z0PA 3UFXA 2I3GA 4NH4A 4GKVA 4BGIA 1I36A 1XSEA 3TPCA 1SBYA 4R5MA 4YEDA 1TT7A 1P1HA 1YOVA 5C37A 3H4VA 3VPFA 4EUEA 3QVWA 2EWMA 5L53A 3JQAA 1P0CA 4OJNA 4TROA 1LLCA 1QG6A 4B8WA 3JQ9C 3K73O 1HYGA 5HBRA 1LJ8A 1LQUA 2GCGA 2NSDA 1I30A 3DBLB 4KDEA 5IN4A 5JC8A 1C3VA 3QVSA 3NRCA 1BG6A 3OA2A 4X54A 3WYBA 4TQGA 1JAXA 5A05A 4IDGA 2DFVA 5CEFA 1I10A 1B7GO 6LDHA 1A4UA 1D8AA 2FR1A 3IDSA 1B8PA 1O5IA 2AEFA 4YJDA 4BO7A 2X86A 3VH3A 2WMDA 1IE3A 4RPKA 3OA0A 4YTEA 4ZD6A 5JPIA 1NFFA 1DB3A 4FFLA 1I24A 2Q99A 1LDNA 4XRGA 1U7HA 1MC4A 5KJ6A 2YHIB 4B4UA 1DFIA 1GTMA 1KERA 1P77A 3OEYA 4NBUA 3SC4A 3KTDA 1XG5A 3JD0A 2UV8A 4GSKA 4D0SA 4MO2A 5IFLA 1E3WA 1IZ9A 5BR7A 5T5QA 1JAYA 4BNYA 3F9IA 4P4GA 3VH2A 4BB6A 2X9NA 1XGKA 1LLUA 1QORA 1U7TA 3EK2A 2BFOA 1K6IA 1NQOA 1P45A 5U9CA 3UVEA 1CDOA 1DIBA 2W2LD 3EYWA 3FPCA 1XQ6A 1JWAB 1EFKA 4L4RA 4EJ6A 1AXGA 3QA9A 3WQRA 2YV1A 3HADA 2UVDA 4ID9A 1R0KA 3DWFA 4DPMA 5I9LA 3QWAA 1JQBA 2BLLA 4RLHA 3I4FA 1ZSVA 1F12A 2O4UX 2R00C 3OIGA 1ZMOA 3DBLA 4C7JA 3TSCA 5KCZA 1OC2A 2HJRA 1ZK3A 1MFZA 2PH3A 2VYNA 2ZB8A 2WDZA 4H7PA 1QRRA 5JCXA 1UAGA 1PJQA 2WYWA 4I9UA 3HN7A 2AG5A 1P1FA 3RU9A 2EV9A 3PZRA 4EZBA 2VNSA 2WYUA 3IOYA 3QRWA 1A72A 3NKLA 1YH3A 2GERA 1K6XA 5C5IA 1WDLA 4PCVA 3CPSA 4BMVA 4RVDA 4BKRA 4YQZA 1NM5A 1Y8RA 1I2CA 2FWMX 4MVJI 1C0PA 4YJGA 1Y9AA 4M86A 3VVBA 3DMYA 5DDIP 1RM3A 2NADA 4DL9A 4GMFA 3LLVA 4W9NA 3R3SA 3GVIA 2IYOA 1MC5A 3KETA 1GEGA 4Q3EA 2DKNA 4ZN6A 1Z7EA 1HDXA 2GASA 3VH1A 4PZDA 1EE2A 1U8XX 3MOIA 2IZ1A 1VPDA 1UXGA 3QP9A 1PWXA 3A28A 3ZWBA 2SCUA 4D41A 1HEUA 4NBWA 5CPBA 2BFMA 1H2HA 4WKGA 1B2LA 2B4TO 1P74A 3DO5A 3TL3A 2XAAA 4J7XA 4OQYA 4KTVE 2I66A 3EDMA 4FFMA 4CMJA 1ONOA 2EKQA 4RQUA 2Q1UA 4J4HA 5I8WA 5JY6A 5FI3A 1ISMA 5L9AA 2PA3A 3H3FA 1OI7A 2YY7A 3C3XA 1B8VA 1MFPA 3JQ9A 4BO5A 4CV3A 3H5AA 1ZJZA 4ZQHA 3VZRA 2NQ8A 4YWJA 2HMVA 1VC2A 4GLLA 1H93A 3PI7A 3TDKA 2X23A 3GUCA 4RZIA 4BNJA 3DTTA 3WMXA 5ITWA 3ZU5A 4AJ1A 1V6AA 1V3UA 4Y6RA 3VC7A 5TLSA 3WYEA 4CMAA 5F5LA 3JQDA 2C7VA 1MUUA 4FQ8A 4R3WA 3GGGA 1LBEA 1LRKA 1TLTA 2GUGA 4IS3A 1W6UA 2JHGA 3F1KA 5TT1A 3KB6A 2HAEA 1YRLA 4CQMB 4ALLA 5TSDA 5GZ6A 4J1NA 3E5RA 4HP8A 3DEYX 4QSMA 3PZBA 1EK5A 1ADGA 1PZEA 4WECA 2GDZA 3OEWA 3RJ5A 2GN4A 1W4ZA 3QVXA 1U2DA 4NI5A 1E77A 1HTBA 2BRUA 2AQ8A 3N58A 4LW8A 4DRYA 1QYCA 4OO3A 4IDEA 1KEWA 3ABIA 3V1TC 5JDIC 4E6PA 2O3RA 2BI7A 3MEQA 4YVFA 4BNKA 4XQEA 1FDTA 2Y0EA 4FR5A 4CLRA 4DQUA 2YQ4A 1ZNQO 1VKOA 3JYQA 2CF6A 2C07A 4HUJA 5B37A 3K2BA 5H81A 4XX0A 1D1SA 2VYVD 3GEGA 3WGTA 3GHHA 1HDCA 1NVGA 2PH5A 2C7GA 2R00A 5KJ1A 5ES3A 4UVIA 1RWBA 1QP8A 2W98A 4JROA 5IDQA 1W0CA 5JAMA 4OXYA 1YBAA 1Z73A 5JAIA 4PLVA 2VWGA 3ZWNA 5IXSA 1X1TA 3PFWO 2UUPA 1U28A 4II2A 3WXBA 2R2GA 1WDKA 3ROMA 4XCVA 2HRZA 4XKJA 1DC6A 4ND2A 4AJJA 1ZBQA 1CWUA 3KM0A 1DC3A 1VJ1A 4UUMA 1WZEA 3OH8A 1T2DA 2V6FA 3A9WA 4I9HA 4GMGA 5BSEA 3RUHA 2POQX 5AXBA 3AW9A 4MVJA 3QLJA 3VZPA 1O8CA 1X0XA 1BDBA 3SLGA 1ADCA 1R37A 3RCBA 1SZJG 4XGIA 1DO8A 1NHWA 1NWHA 1ULUA 3OJOA 4H3VA 1CJCA 1HF3A 1O95A 5CP8A 1MX3A 4YJHB 4CL8A 3CZRA 1NR1A 2C20A 3OJEA 2C2YA 2P9CA 3KSZO 1SNYA 3FWNA 1C0IA 1RPNA 4MIOA 2DTEA 3I9LA 4CMEC 1DDOA 1M6HA 5HA5A 4JCOA 4AJKA 2DAPA 1ZVMA 4U6QA 2OMEA 4W7IA 4LSWA 4O1MA 4U0KA 4KTTE 1LSOA 4L4SA 4UEJA 1YKFA 3KEOA 3UXYA 4OXKA 1GQYA 4B4VA 1ZFNA 5KVCA 3FBTA 4OSOA 1X7HA 3U5TA 1LDMA 1C1DB 4MVJF 3K92A 1BXKA 3LC2O 1BRMA 3LK7A 2IYPA 2X1HA 4UUNA 4D0RA 4XR9A 3C24A 5ENVA 4EEXA 3WGYA 2I76A 4PG5A 2IEDA 3AK4A 4NJOA 4P4NA 4E3ZA 2Y0DA 1AXEA 3DZFA 4WLFA 1MXFA 3MWEB 3EGOA 1Y81A 4E5YA 4RVFA 5GZ1A 2PY6A 4YT4A 4IDBA 4NIMA 4WLEA 4MVJM 5TJ9A 4W6ZA 1B3RA 3ENKA 4R51A 4RDIA 4AJOA 3COSA 1GUYA 3STHA 3RIHA 4UULA 1S6YA 4NJMB 2GF2A 1BXGB 2QG4A 3GR6A 4RO0A 4YJHA 3RWBA 4AJ4A 3PWKA 4M8SA 1UZMA 2QHXA 4GX1A 3X2EA 4J1SA 5JDIA 1M2WA 3JQFC 4LVCA 3ONFA 1T26A 2AG8A 4RVGA 3H65A 3OJFA 3JYOA 4L8VA 3EUWA 1LLQA 4J1QA 4YAGA 1BHSA 4ND3A 2VWHA 2C59A 4N5NA 3ZN2A 5JSFA 1ZSNA 1GUZA 1J4AA 1QXSA 4A2CA 4PLWA 3DXFA 3WS7A 4DXHA 4Z6KA 5KJCA 2WEKA 1ISJA 2H5LA 4Y6PA 5COBA 3ZWXA 3ZWCA 4BMSA 1RKXA 4IJWA 4Q3CA 2PKQO 2O3UA 1E7MA 3GNSA 1E1LA 4BO8A 2D59A 1Y5MA 2WSBA 1Q2XA 3CSDA 5JMWA 3D0OA 1ID1A 2EKPA 1QMGA 4J3FA 3GDGA 4Y98A 1Y9EA 5A9TA 3VHRA 4BNTA 1JKFA 2GLXA 3UKOA 2OUIA 4P38A 3WNVA 3NUGA 3GAFA 1ZJYA 3LC1O 1D7OA 4J9VA 1QSGA 3RAJA 1XLTA 4RVHA 5KJEA 3HFSA 5DF1A 5MGBA 2VRBA 4NJMA 1A7KA 1KYQA 4UVEA 3OSUA 3PYXA 1SPXA 3WGQA 3AFNA 1NQAO 3U4HA 3DHNA 5T6BA 4EW6A 3JQ8A 1QV7A 5B4VA 3C1AA 1HZZA 4NFSA 3MJTA 4XB2A 4JIGA 5JAZA 4BNGA 5J23A 2AQIA 3TRIA 3SC6A 5HS4A 3E9QA 1FMCA 4RF3A 3MJCA 1ORRA 3H8VA 2OP0A 4CMEA 3ZWOA 4IDAA 3RC1A 4B79A 1Y8QA 2OBYA 4GKBA 4D42A 4XYLA 2PGJA 3KZVA 2QYTA 5IN5A 1Q7GA 2FSSA 3WDSA 4NR0A 4II3A 2DC1A 2V6BA 1QLHA 4O59O 3LVFO 4CMGA 4DIBA 3K96A 4W99A 5CDTA 1E1NA 4QT0A 1C1XB 1H9BA 5DCUA 1IHYA 3EC7A 4GH5A 3GLQA 1WDMA 1F06A 3FD8A 3WMWA 5CDYA 1XYGA 5C7OO 5AYVA 2HJSA 3C7AA 5BSFA 4Y9DA 1GZ6A 4Q3NA 2ZB4A 4FOSA 3O8QA 4O0LA 4DLAA 4B3IA 2RHRA 1L1FA 3B20A 3NT5A 1B15A 3HE3A 1A71A 4WEOA 3GVXA 5I7VA 2J5KA 5MDHA 1GL3A 4B8ZA 2D4AA 2Y67A 4CLDA 2CVZA 1VM6A 4WLUA 1XQ1A 2Q49A 5JO9A 1Z82A 2ZQZA 2RBEA 4E32A 3LT1A 4R16A 4TRMA 2EHDA 1R6DA 5A04A 4JXKA 4NMHA 3IKTA 5L3ZA 3E48A 3U9LA 3JQFA 4W7HA 2X5JO 1KC3A 4E33A 5IDWA 4BHTA 2PGLA 3I5MA 3JQBC 3LT2A 4E13A 3K5PA 5C3MA 4YAEA 5IDYA 4BNVA 3PHJA 2WD7B 1NASA 1GV0A 2DBZA 3ULKA 1UZNA 1GAEO 2W2LA 4YR9A 3DFUA 4L4XA 4XD2A 4CUJA 4J4BA 4GPD1 3ORFA 3TZKA 3QE3A 1CYDA 4CM8B 2H6EA 2GYYA 1LC0A 2AEMA 3E9NA 2O3JA 3E18A 1HKUA 3GGOA 5BNTA 3L6DA 2JFFA 2Y1GA 1AUPA 3PEFA 4A26A 4NNJA 3ENNA 4DREA 3MJEA 5JFOA 3CE6A 4LN1A 1F0YA 3KEQA 1ZO8A 3ZWWA 3LDHA 4H15A 3ZW9A 4I1IA 5DN9A 1BDMA 1HZJA 1U3UA 1ADFA 1XWFA 3PJDA 4TKLA 5EN4A 4BNNA 1UXHA 4E2WA 3DOOA 4NG5A 5THKA 1LSSA 3GHYA 2ZK7A 1Z7BA 2QW8A 1B0AA 3ZHXA 4DBZA 1UDAA 1JN0A 1MP0A 3PPIA 5DOVA 4E2XA 4LCJA 2GNAA 4IJUA 3ICPA 3ZI0A 4F6LA 3NT4A 4R54A 4RL6A 3HDJA 1DRUA 1T25A 4PLYA 4DLBA 2HO5A 1C0LA 4I8XA 4Q9NA 4CL3A 1UDCA 4D46A 1HDRA 2CMDA 3ROKA 4FSHA 4TZKA 2Y1CA 5F5NA 4PLCA 5K6AC 1JU9A 2NU6A 1HDYA 3ETEA 3WLEA 4YAKA 2BD0A 2O2YA 2WD7A 3C1TA 4J16A 1GZ4A 1VL8A 2GN6A 3Q1LA 4GI2A 2PWZA 2JL1A 1ENZA 1X15A 4CR7A 2JCYA 1E7SA 1ARZA 4KUGA 4OMUA 3JQEA 3GEDA 3NTQA 3HDYA 4E5NA 2DBQA 2IXAA 4CM8A 3K8ZA 4BB5A 2PGDA 1N9GB 1TB4A 2EF1A 3WQSB 2A92A 3GDOA 4XB1A 3RC9A 3T7EA 4IIVA 4HNGA 4A5OA 3WFIA 2DBRA 2P91A 1V8BA 1YONA 4IDDA 3CKYA 2DTDA 1PJLA 4Y6SA 2PR2A 2H63A 1IB6A 2EKLA 2O3QA 1R4MA 4QO7A 4CMBA 4GVXA 2GN9A 3PJEA 4PGFA 4E5MA 1OZAA 3VZSA 1CEQA 3BHIA 3PP8A 3NJ4A 3K30A 3WBBA 1DXYA 3WIDA 2GR9A 5TX7A 4L74A 4YPOA 1XU9A 3RFVA 5IXYA 4CLOA 3PIIA 3S2FA 1E7RA 2WM3A 3HG7A 1YJQA 1JVSA 3M2TA 1DLIA 5EINA 3O26A 1A9YA 4P8RA 4QUKA 5A4DA 4MOWA 4RPGA 9LDBA 4FFOA 3WWZA 3HWRA 3HB5X 3WSVA 3BHMA 4R3NA 1QR6A 1YBMA 1JW9B 2XOXA 3JQBA 3PXXA 3LC7O 4PG8A 5AQ1A 3AUSA 1PQWA 3TZCA 5A1TA 1DSSG 4DVJA 1U1IA 3E03A 2GN8A 5K9ZA 3TOXA 5TF4A 4AJ2A 5DOZA 3PRJA 3WSWA 2VYVA 1O6ZA 5KVQA 3JD1A 5HRUA 3WGIA 4CM3A 4YXFA 3DONA 3PIDA 4PG7A 4AJIA 3QJ5A 1VLLA 4DC0A 2CFCA 1KC1A 3D5TA 2QQ5A 4IXTA 4JX8A 2DBVO 2E49A 1T2AA 5G2OA 4H16A 4BGVA 3NTRA 4E0BA 2OXIA 1GQQA 3KBOA 2CDBA 5A9SB 2W8ZA 1TI7A 3MJ4A 4FS3A 4MVJH 1E3WB 5L45A 1LNQA 3ANMA 3R0IA 3KRTA 2B4QA 5KVVA 3P2OA 4UEKA 4EBFA 1UJMA 5JAQA 3TN7A 4MJLA 2O7SA 3BTOA 2QZZA 2Y1FA 4OL9A 4IM7A 3WGOA 2UAGA 3PYLA 2I65A 3KSUA 3IIEA 4DMMA 4E31A 2J3IA 1NAIA 3FWZA 4PLZA 2RHCA 3UH1A 3PK0A 2BF7A 3RU7A 5K6AA 1MGOA 5I7SA 5L4NA 3FPLA 3AOGA 3IUSA 2P2SA 2LDBA 3D4OA 1PX0A 3EHEA 3VPSA 2PD6A 3D3EA 4YRBA 1ML3A 1HXHA 3W4KA 3V1YA 2D1YA 3SEFA 3OBBA 4CR6A 3AFMA 4MKRA 4CV0A 4FC7A 1Q7CA 4MP8A 4R1TA 3T4XA 3ZNOA 1WWKA 2Q2WA 1PEDA 3P2YA 3GEMA 4FC6A 3E9MA 3OF2A 3WJAA 4JQCA 4ZA2A 3RKUA 2Q2VA 2FOIA 2EIHA 1FJHA 3ONDA 1Y8RB 2EP7A 4MINA 4LMRA 4YJGB 2X9VA 2GZ3A 2VQ3A 5U1PA 4EUFA 1LDEA 3NAQA 4D3DA 4NQZA 5A9SA 1ZUD1 3CTMA 4YQYA 1PGQA 1ZEMA 3ZNQA 4IQGA 1PJCA 4E4YA 3OETA 1NX6A 2BHLA 3KO8A 5A5EA 1GZ3A 3RUDA 5DP2A 3S1LA 4BNUA 3EMKA 2HDHA 3CUKA 3FRJA 5ILOA 1EVJA 2VHZA 3GY0A 1KBZA 3RFTA 3GK3A 1MV8A 3DC2A 4WOKA 1WNTA 2JCXA 2V65A 2AA3A 3D5QA 1HLDA 2ZTMA 2GZ1A 3VKUA 5JLAA 8ADHA 2Y66A 4XJSA 5GY7A 4M87A 4XJTA 3BAZA 4J7UA 4IIUA 5A02A 3QIVA 2BH9A 4AL4A 4J49A 5DBIA 3M6IA 3N74A 1KEVA 4LGVA 4J4TA 1VSVA 5H83A 2JFHA 4MIYA 1A9ZA 3WFJA 4GAEA 1LSJA 3AUAA 4KUEA 3ZNPA 4YAJA 4JBGA 3AU8A 5L40A 3PJGA 4U0JA 3CMCO 3H9QA 3TL2A 3TNLA 1JWBB 3U4IA 3NDRA 3AUUA 3FTPA 1T1RA 4J43A 4KQWA 2IE0A 4D44A 4ILKA 2QX7A 3I6IA 2Y1EA 4FN4A 1XCBA 2YV2A 4B7CA 3ZWMA 3N7UA 3GUYA 1FDWA 3OM9A 1N92A 3I83A 2FPPA 1IOLA 4BNIA 2AE1A 2F1KA 2O3SA 3ASVA 5JBIA 3MTJA 3ONEA 3VOSA 2LDXA 2WTBA 4CLRB 2X0RA 4GGOA 1PS9A 1P33A 1LXCA 4K1LA 3ZNNA 4J6FA 1PR3A 3FI9A 1YVEI 2VWQA 4GGPA 3OIFA 4E30A 3DZJA 1DIHA 7ADHA 1PJ3A 3OJ0A 5T57A 3Q9NA 5L7YA 3GRKA 5KVSA 4BO0A 5COAA 1U4OA 2O3TA 2O48X 3AY6A 3G0OA 3GPDG 4ZICA 3MJVA 3UICA 3JQGB 3ST7A 4MVJP
chains in the Genus database with same CATH superfamily
4Y2JA 2OLKA 1GG5A 1YL5A 1IQ0A 4GWKA 2Q6OA 1OTHA 5LQSA 1ZJWA 1F17A 2J3HA 3SXPA 5CFOA 1L5HB 3AJAA 3MXTA 3WGJA 4B4OA 1I7LA 1O3YA 4CNBA 1QZXA 4RENA 6AT1A 1SC3A 3V1MA 4KPUA 8GPBA 4KI0A 4QJ3A 2QMQA 2D1TA 4EHAA 5KNLA 2GTPA 3ZK8A 2XSZD 3Q6IA 5KYKA 4QLAA 4JJ8A 3CZ9A 2YHAA 4KMOA 2M6LA 3RV4A 2JGLA 1I2BA 1SBCA 4LJ8A 4RFSA 4Q9JA 3W8EA 4DWOA 1MOSA 1GPLA 2A94A 2P9BA 3UMBA 8LDHA 5LUAA 1G7SA 1QGYA 2EATA 2YQZA 3DVLA 1EVKA 3M4XA 1JEDA 4YAFA 1IL0A 3STYA 3QSGA 3TXAA 3WOHA 3DOUA 5DHTA 2HM7A 1QLJA 1B16A 3OESA 1N0HA 1Z28A 4B3TB 2FP4A 1UUFA 2CVOA 4V24A 5KYXA 3PR3A 5K8VA 1BE0A 2WJIA 1PTJA 4OY3A 1JLSA 5C1IA 5FDFA 1CUGA 2I2WA 2NVBA 2PBFA 3AI3A 4IFBA 3B82A 1OSNA 5DI3A 5F1OA 2JK1A 3H9JA 3NTOA 2IA5A 1U9IC 2VPXA 3CLKA 3E2PA 4PHCA 4RHXA 1YR3A 4G0MA 5SZIA 4LZJA 5JJIA 2A5JA 1YUMA 4CM6A 3VR5A 2DPGA 1OD6A 2GEJA 4FJ2A 2ZTUA 1GGMA 1U5BA 1QGZA 1H65A 3CIFA 4G0PA 4OK6A 3U7EB 3ZBUA 1TLFA 4TMFA 3JD4A 3QU4A 2PUVA 4F3YA 2O8VA 2Q2QA 1CRPA 4IKPA 4G4SO 3L07A 5I9BA 3SY8A 1NXTA 3KZXA 2GN2A 2HWKA 4RZHA 2W2QA 5HZHA 5L4SA 3PWZA 2O0KA 4KW7A 4YCLA 4NYJR 4D45A 5TY0A 3I2JA 2VDVE 3NAZA 3SVLA 3D6VA 1FFDA 1RZRA 1NPTO 3IOMA 4YLEA 1NZFA 3WLPA 4FK8A 2OXEA 3VSCA 4QXQA 3KEGA 5IT0A 1DIGA 2B1IA 4JFAA 1KAEA 2W2KA 1LDGA 3BULA 2AVDA 3I2IA 1YBVA 4BNLA 4R8SA 5D3MA 1E6WA 4KGDA 1HLFA 3C4QA 1KGDA 4EELA 3L6CA 4TMXA 2P4QA 5JO0A 1Q3TA 2Q3LA 5EKUA 1ULHA 1AD2A 3CUYA 4ZQBA 1SG0A 2FN9A 1WMFA 1SQ5A 4A2WA 2XRMA 1NXXA 3RD5A 1SUPA 1CQJB 3CN7A 2QNIA 3CW8X 5F52A 2HHJA 2VOEA 3AEYA 5E6UA 4AP9A 1AURA 3U4MA 2W93A 4IHAA 1TA4A 1VIDA 4L95C 3Q11A 3DCJA 3GVPA 3A2NA 5ALEA 5C4GB 5AVKA 2V7UA 1ZHFA 2ZIZA 1IUOA 4TWAA 1RPZA 1GV1A 3F4BA 1JQDA 4S1VA 3UCEA 1H2RS 5I7EA 4W5QA 1RM0A 2G09A 4IINA 4X7MA 2H54A 2B94A 1A7JA 4N49A 3NBMA 3PB3A 4M83A 2QBYA 1CE8B 5EJ2A 3RT9A 4ITUA 4BNXA 4Z3DA 2JVIA 4AKGA 1ZIXA 1TRHA 4QOSA 4Y2PA 3VI4B 4K87A 4UOEA 2IX3A 5FXMA 4OSPA 1J99A 3MUOA 5A0TA 1ZD1A 2FW8A 2V59A 1QVVA 3DWGA 1D03A 1ZGCA 3AG5A 5FFNA 1KIFA 4S3MA 4HXGA 1OV4A 2B35A 5B2EA 3C6ZA 5JYDA 1Y7LA 3LBNA 4CMIA 1U0HC 3SHQA 3FN4A 1X70A 2ERXA 4Z2AA 1I2MA 5BSHA 5LOVA 5ES4B 4UDNA 3ES9A 3ANLA 5AW8A 1LX7A 3VR2D 1KK0A 4X44A 2V6MA 1PL7A 2GBGA 1X0VA 1B6TA 3H1AA 4IDPA 4P93A 3WV4A 3CVVA 1CFJA 5IC4A 1FFWA 2BLNA 4WEQA 3RRXA 5JSZA 4NVRA 2QKYA 1EFTA 1U3VA 4LRSB 4NYIQ 3R09A 4UPEA 1NONA 2X0EA 3BXPA 2O4CA 4CI0B 2PHZA 2Q4TA 3GAMA 5CK4A 1WMAA 4KWHA 4EFKA 1XZCA 3FTNA 5CNKA 1YQWA 4CDRA 1BKSB 1EDEA 3C41J 4JJFA 4KOAA 3I09A 1KYIA 1NFRA 5HZKA 1VG0B 1ZWKA 4JI7B 5H3LA 1G98A 4MV1A 2LTAA 4RSGA 4GS5A 3LP5A 2HEIA 2MYTA 3EQ2A 1CY0A 3GUUA 4BKUA 4FB5A 1MG0A 3BXZA 4NECA 3AP3A 4Q21A 3OTOB 1T1IA 4B7UA 4EL5A 1VPEA 3DGFC 3G9XA 3ISTA 3PC8A 4RESA 3NJ8A 5AR1A 5IARA 4Z54A 2JIMA 1SU8A 3AHEA 3AF5A 2ZVJA 1DEHA 4HNHA 6GPBA 2DETA 3TLBA 3TSOA 2P6OA 3MILA 2X40A 2Q1TA 3M6LA 3TM4A 2Z2IA 2VI5A 2CE7A 2J0SA 3OIDA 1TCAA 2CNBA 3PGXA 3A4LA 3BSSA 3N39C 3VR4D 4F86A 1N3IA 3QVMA 2QTVB 1RIIA 2QLLA 5ILGA 3S70A 2LVBA 4JUBA 3D4NA 5CHYA 2YDXA 5DTQA 1JXMA 2XXBA 3CF6R 2VNHA 4BVKA 3OFKA 3ZGYA 5HSGA 1NG1A 4B6RA 4AKSA 2DUUA 3OAAD 3O8OA 3ZWQA 2CJFA 3O9MA 4BYGA 4JEUA 2EYQA 3SPXA 5EJ5A 1GUFA 2C4TA 3DOHA 3BXHA 5BYJA 5FOQA 5BT9A 1H3EA 3ZCXA 4OYHA 1I8TA 1T4CA 2D5LA 5JRJA 1IPHA 3QM1A 5KSWB 4M1ZA 4TLBA 1QNLA 4H4DA 2FSHA 1XT6A 1S7GA 4J8PA 3ET4A 3TFWA 4MQBA 3JXEA 2BL4A 3E22B 4JJAA 2R25B 2VA8A 2VP3A 4ZQFA 5ITVA 4PR3A 4X92A 5AVJA 1XDUA 4PRKA 2TMGA 5AJZA 4A6DA 3UC9A 4QGFA 5JCPA 2ECQA 5SYAA 1QU2A 5TPZD 1AA6A 2YVAA 4HX5A 2AFHA 3TIFA 2C0CA 2CLOB 4HO1X 1DC5A 3D1VA 2Q41A 4ZC1A 1KU0A 1U0FA 4N7MA 3S5JA 4IL5A 3LQYA 1MQAA 2CL6X 1VKJA 3QKRA 3I0ZA 3NOQA 2GCPA 1QIEA 4EGQA 2PRIA 2C5LA 3UTCA 2JFBA 4CIBA 1XTQA 4PGMA 3EGXB 1UMCA 1OWNA 4J91A 1BCRB 4DBVO 3RTDA 3N2GA 2YVLA 1GAXA 1JDTA 4IMPA 3N8NA 5BQPA 1DIRA 3WE7A 3BE6A 4YXWA 4OMCA 2A1UB 3Q0EA 4RCZA 1Q0SA 3P4YA 3BJMA 3WIBA 2X8BA 4URVR 2CK3A 1NUHA 3PC7A 3HXTA 2NUPA 4LOAA 4NOKA 2P1ZA 4PXAA 4XVRA 1JDBC 3ON5A 2QYSA 2RJNA 5D1NA 5LMZA 1A3CA 5BWNA 3KQQA 4U5QA 4HAZA 1O0BA 4TYPA 2IV7A 2JAUA 2RB5A 3W8DA 2ODWA 1EEXB 3KWMA 5D5HA 2A58A 2HA0A 1A77A 4ZGBA 5A4JA 3MQFA 1EP2B 3ZG6A 1MDBA 3JU3A 3FMPB 1VJDA 2XOEA 3OPQA 3NALA 1YRYE 2E0IA 3QHAA 2J3KA 1UKVY 4FBMA 3FNRA 2HBYA 1VJCA 3N2EA 1L5SA 1GFWA 3DAFA 2TSYB 3AM4A 4TTSA 3W1EA 4PPGA 4CJXA 3D2LA 4ZC8A 1QIGA 1T0IA 2GX6A 2G9ZA 3JV7A 3RFFA 2LRHA 2NQ2C 1FMFA 1N2IA 1RZVA 1NP3A 2D1QA 2PRJA 4I0WB 4GI1A 4IS2A 2BM0A 4TLCA 5I4KA 3REGA 1Q0QA 5A3RA 1APBA 2BEVB 1ZUHA 1QP4A 1QHEA 4G41A 4F3CA 4RS3A 1T13A 1YL7A 1NKVA 1KIMA 1OLSA 1V3VA 2JCBA 2VTBA 4UATA 2GI4A 4QYMA 4NMMA 3DMDA 1SCNE 5ANRB 1QKIA 4UMFA 5LYYA 3R5JA 1C7ZA 1RIFA 2PQ6A 3R6LA 3OE4A 1A1VA 1UP7A 4KR6A 4UXIA 4LZPA 1A1SA 3DLHA 1GNRA 1Y3CE 3NW9A 4HFRA 4JHLA 5AIAA 1XFDA 2JHCA 1THTA 1T5DX 3RBVA 3T7JA 4XM1A 3KFVA 2AMJA 2P9HA 1A8PA 2IX9A 2X2EA 4RHTA 3RRYA 1R27A 2FUEA 4IOLA 5EJ6A 1SOMA 1ZDMA 2V5VA 3MWYW 3PD7A 4M0FA 3SBEA 5F12A 1H66A 2QIOA 2HRBA 2F17A 4B83A 4DNQA 5CA1A 2O6HA 1BVHA 3NCTA 3D3JA 4F21A 1H9AA 4QFMA 4BO1A 4OFWA 4ZJPA 2MSEB 2YJTD 4DNPA 1JDBB 3KUXA 3KVOA 3TRFA 4DCSA 1ISHA 4YWHA 3HUTA 2G17A 1GKLA 1WP4A 4Q03A 1P2VA 3HDHA 2EJVA 5AQEA 1YS1X 3GCXA 5TT0A 1IUKA 3MWFA 3L8YA 2ECKA 4YP1A 1GFSA 3GH1A 3REFA 1OROA 2ZT5A 4L76A 5DXAA 1RCTE 4PC6A 1SN7A 4JP8A 4UVDA 2YZNA 5TC4A 2JBAB 2YQ5A 2G83A 2J7PA 3L84A 3RVOA 1KS9A 1Y7IA 2NVOA 4PQGA 4A36A 5LJLA 1COWA 1IUNA 1KO8A 1YDEA 4Y2XA 4YUXA 4P4LA 1GA1A 2R751 3B1FA 1TVMA 2CD9A 3K7EA 1XX6A 3WJ1A 1OIVA 3P5BA 3GMSA 5CG1A 1LI7A 4ZVQA 1GNSA 1E94E 5JLJA 3LLSA 4NEQA 4RJKA 4KFTA 3KT6A 1L4GA 2JZOA 4OHPA 1KPHA 1CERA 3L43A 4L2IB 1QWSA 1O94A 4YV0A 4ZKDA 2XLBA 2GXQA 1SHTX 2IEIA 3GJ4A 3I6QA 4EKIA 1YKGA 2C9MA 4ZZ2A 4E88A 3GEHA 3KD2A 1ZQ9A 1TM3E 3RARA 4C3ZA 1N9ZA 4HCJA 4JLSA 1J00A 5JEDA 2H1FA 3IELA 4I1SA 3UMYA 1VE1A 5AI4A 3UKJA 4ZVVA 3ESDA 3IEMA 4FYYA 4KIWA 4NHEA 1S2MA 1WMEA 1NC3A 3O4VA 4I5FA 1NU6A 4LE0A 4UHFA 4X8OA 1W76A 3RKSA 6ADHA 2HCJB 4MGEA 2G5CA 3R0VA 1XZDA 2XGSA 3F46A 3NONA 4IOJA 4E1AA 4U3JB 2F8MA 3V4VB 4IHJB 1KH3A 2QJWA 2PCLA 3E5HA 5IK2D 2IEBA 4GKAA 1S89A 1V95A 3ABRB 1B8OA 3EW9A 4FDMA 3QFHA 4OQFA 3TDNA 1XEFA 3VO2A 4Z7QB 2OBNA 1DWQA 2ZSAA 5F5XA 3QWBA 3PE6A 2BGTA 1A8UA 1QWOA 3D0QA 4YMIA 3SAJA 4JUIA 2Q6VA 4ITVA 3CUTA 2GCOB 1HYHA 3ZD6A 3V42A 3U19A 5AHXA 4R81A 1ATZA 1AQIA 3NAGA 5DM1A 3RJTA 2CXSA 1IPEA 4DQLA 3F73A 1QANA 3G59A 1EFDN 1DELA 1ZGJA 1WKVA 3AY0A 4IDCA 3UN1A 2DUNA 5DGCA 7REQB 4G1MB 3KZNA 1P0IA 3QUTA 4UHJA 1NAHA 4H7DA 3C74A 4KXQA 4RD1A 5CFNA 2HGZA 2FRDC 1NG9A 1GR0A 2H1LA 3BGOS 4INAA 4LXXA 4ZOLA 3WL7A 4JMPA 5IDXA 5ALGA 4IJMA 1W5FA 4PV7A 5EE0A 2E4WA 3OP1A 1H0RA 1TUIA 4R7ZA 1R5NA 1X1DA 1SHLA 4B3XA 2YFKA 4HDKA 2VPYA 2IEYA 4PN3A 1ZD4A 5KWEA 4JK3A 3THXB 2B5VA 3O03A 4RX1A 5CT9A 2UUAB 1QBGA 2QXUA 5JCJA 3RHFA 2KHZA 1L7NA 1VDMA 4TLAA 5FHQA 2BY4A 4HL6A 1I1QB 2QDKA 5K99A 2DPHA 3RROA 3K1ZA 2JJ1A 1TO6A 1AN9A 5FYDA 4WCFC 5DNCA 3W8FA 1WJGA 2X76A 3GNTA 3H9EO 4WT7A 5IEBA 4GP9A 4BQPA 1BKDR 1NA5A 2J3DA 4IIHA 3C4JA 1BJTA 1S1MA 3P27A 4JDUA 4LK3A 2QM0A 3CLSC 1YFLA 1LBHA 1CEXA 4M36A 3V4SA 1IOZA 4ETWA 1TVKA 2XNCA 1H42A 4GO1A 1Z4NA 3ROXA 4O4HB 3SF0A 4HF7A 5KNCA 5LB2A 2Q0HA 2NO4A 4GLJA 2O57A 4F2WA 5L51A 2YCBA 1KVUA 1QC5A 2FAXA 3FFAA 4E5DA 2J41A 2QUJA 5HE8A 3FWYA 2JD1A 4M89A 2P8JA 1JQKA 1JDNA 4RLFA 3PLAE 2H00A 2AHRA 4BTLA 1KOFA 1TA9A 4PZCA 3N8DA 1Q1QA 4CM9A 4J6EA 3OQVA 3RFUA 2IODA 4Z4IA 2ATXA 1JFRA 5JZOA 4DDMA 4N39A 4NS1A 1AHNA 3D9QX 3I64A 3I5YA 3RTAA 1B93A 1E3SA 3TB6A 2G08A 1W34A 4KIGA 5AKGA 3AKZA 1TEXA 4B71A 2C2OA 4OH1A 3WIVA 2YV4A 4IIGA 1G7CA 2JJ2D 2VL7A 3INNA 1OXXK 2XCLA 3M6AA 5AI9A 2I62A 3TIXB 1ABEA 3MCVA 4TTAA 1MCZA 4TZTA 1KO1A 2O8BB 3ICEA 3NANA 1QZUA 2QX4A 4GHWA 3PFBA 2Y99A 4OOEA 4IYRA 1J09A 1E5LA 2OZPA 3EASA 4IUBS 1L4KA 1TC1A 3RE1A 4FNMA 4PXYA 3ADOA 3E7PA 2J0QA 4LEIA 4Q19A 3TS1A 5I7FA 5L7WA 3Q7QA 4MCIA 4RF4A 3ZXIA 2FHSA 4KQIA 5IANA 1Q19A 4WCFB 3ABOB 5KNDH 3NYQA 1PJBA 4OHFA 3HA5A 2MMGA 5DZSA 3OX4A 4Q3OA 5BYAA 2AQHA 2GEUA 1YBFA 3PQ4A 4LDZA 4H59A 4EJ0A 1JSCA 3TNYA 2F43B 3OOEA 4BEVA 1K5GA 3S2EA 1GAJA 4A8PA 3OEEA 4ANFA 3ZCTA 2CEKA 3QLEA 3M4NA 1G5IA 3OUTA 2WF8A 1BMDA 1IZ0A 2PQMA 4HAXA 2JIPA 4KQGA 3VDQA 3H2JA 5I9IA 2H7CA 2J0UB 2PZMA 4E09A 2RGXA 2EEPA 2BTQB 5KTSA 2HB6A 3EVTA 3SX2A 2FPPB 3CX3A 1IDOA 4IIJA 1IAQA 5C34B 1NUPA 1I7NA 2IOHA 3BX1A 3DGEC 3AF6A 3I34X 4HRYA 3K1JA 4ZQEA 3B78A 3QG5A 1LW6E 1U3TA 2GKOA 4K9KA 2J0EA 3LSTA 1FUEA 1TQ4A 5AI8A 2RK4A 3GGDA 1NVTA 2QV0A 3OZFA 1V16B 1YZVA 2GNOA 2B5WA 2J46A 3BHJA 1N32B 2V6GA 4OGLA 5B7GA 4LY9A 5JMPA 4RUKA 1TQ6A 2HQRA 3T35A 2Y0BA 2GZSA 1JHYA 5CCXA 2XUOA 3AF2A 3CZAA 5LPNA 4DEXA 1PS8A 1R1DA 1DAOA 1JZSA 2NUBA 1FXWF 4RW0A 3T3DA 1YV9A 3G8CA 1YULA 2FXVA 3GJ8A 1MAUA 1FC0A 3PE3A 1IBKB 2FQ1A 3DMPA 1G3QA 1ECLA 5JS1A 1G4AE 1RKUA 3GN1A 3NBKA 3ONNA 2EW1A 4OQ4A 3HH8A 1Y5RA 3VRHA 1VHDA 4ARSA 4LGMA 5I9NA 5AOBA 4EB8A 1OBCA 3D3WB 3O4FA 4ZVLA 5AW1A 1YTUA 2H3EA 4G85A 1QE3A 5LUBA 3TMYA 3HBLA 4WZAB 1X38A 3WL5A 4F97A 2BCEA 4IJKA 2WU0A 2ZU6A 2DP4E 1ZOPA 3GNLA 3IJ5A 4RJIA 2DR2A 4EY4A 2BHTA 1SURA 3A1FA 4R2JA 4NZ9A 4RK5A 4BVFA 5JVDF 3FVTA 2XCUA 1E62A 2C3UA 1EDBA 3EZFA 1KY3A 3CZPA 3FLBA 3ID6C 1KJ9A 1PZNA 4HWGA 4L08A 4S2EA 4TSKA 1Q11A 5TQVA 2XV1A 4JC0A 5IULC 2VT2A 5DNDA 1PP4A 1JKJB 2LE0A 2EXXA 1ZVKA 5KDDA 4MJ3A 4DDWA 1MORA 1FXUA 1RDFA 3HC7A 3OURA 1DU4A 4BEWA 3O0DA 3IAM6 4LSMA 1FU8A 1ZRSA 4ABYA 5LDGA 1VE5A 4COKA 1I7QB 5B5SA 3FOAA 1DIAA 1I3NA 3MTGA 5KYXB 1E3MA 3GARA 3OWOA 2YHIA 2AOUA 3PRHA 4O63O 3ZH2A 1NI4A 4FW8A 4DGSA 5HKKA 1D9ZA 5CJ2A 5LVAA 1XCOA 3O82A 3ODGA 2B8NA 1XHLA 3BB4A 3HUFA 3Q3HA 5DI3B 2REOA 3IQGX 5C32A 1J1IA 2PUFA 4H0FA 3TVYA 3OFNA 5LZ9A 4P98A 1R00A 4RHCA 3IQXA 4XD7A 3R3JA 5H3HA 2RJOA 2AI3A 1G2IA 3UYLA 1VE7A 2ZROA 4NONA 1G5HA 4O6VA 1J21A 3L7MA 1U5BB 2WR8A 5GV8A 1N2JA 3AU9A 2VZ0A 3IPCA 1SB8A 2DM6A 2IV3A 4FXPA 3LECA 4DA0A 2OORA 4OX9B 3LQKA 2PZ8A 4TV9A 4BS9A 2JHFA 2R4QA 1P0PA 4V0SA 4G65A 2HMUA 2ZRPA 3T1NA 5AD1A 1V1RB 3DEIA 3UATA 1PZFA 1L9XA 4ENTA 1RI1A 3DHWC 1EXDA 2R4UA 5ENZA 4FDUA 1FDVA 2PSFA 2QPOA 5K3FA 4G36A 4TS1A 3AVWA 3JWJA 2QM7A 3I04A 3WLRA 4HLUA 2YMQA 3CONA 1POXA 5ALWA 3WIUA 4DTCA 1L7MA 4AFNA 2HWYA 2QLTA 1U2GA 4HQRA 1IXYA 4QEKA 3W2HA 4FT4A 4I5GA 5K4GA 2GXAA 4ZANA 4D8VA 3F5QA 3NYIA 2W2KB 3W3AH 3NHLA 5FADA 2Z8YA 1RM4A 3RF7A 2X0KA 1ZOOA 1WMBA 4OIMA 2B0JA 4GBGA 1K89A 4GZ6A 1OFVA 1KK3A 1PFWA 3TMAA 1KXZA 2XUDA 3VYTB 2AJLI 3L8HA 1W30A 3OZRA 4U02A 5CJPA 4DARA 4OXXA 3W9UA 4DLVA 4HLDA 5DYGA 2PWBA 3LZDA 5J2UA 1INLA 3ZWAA 1SUWA 2GT1A 4QTZA 2BP7A 2Y0CA 3GEIA 1IFXA 3WKEA 2CDRA 1IZZA 4IF6A 4QFDA 2Q9UA 2C2WA 2V7QA 1X92A 3NKFA 5E6UB 3KXLA 4F5YA 3I8XA 1U8ZA 3K0HA 1EGAA 2JFZA 2I2DA 1NXPA 1Z15A 2GHRA 3PC8C 3G2HA 3IOCA 2C7RA 1EZ4A 5EESA 4ZVPA 1DTEA 2HRQA 3L0BA 4CDNA 3O4JA 4BX0A 5G4KB 1KDVA 1BSVA 1UINA 5JDCA 3UGJA 4NAVA 5CNJA 2Y6VA 3UAOA 3OZAA 3GZNB 1YJ8A 2UUOA 2DHRA 2D0PB 2Y1DA 2REQA 1XD9A 2ZUDA 2QBYB 3D6UA 1EWKA 4BBJA 5C8YF 2WJ6A 2ST1A 3KHSA 3ZU2A 2C92A 2CT8A 1DQPA 5K0TA 3EJ6A 1TX4B 2ZB3A 4Z2YA 4LYGA 4DANA 1SK8A 1OFHA 4GOXA 3RUFA 3MD9A 2MYUA 1GTL1 4Y7DA 2E4ZA 1P1BA 3ND6A 2R1ZA 3BB3A 2WTNA 3KIPA 4CM7A 2V74B 5DM70 3ADBA 1NY5A 3EEFA 2R7MA 3QEAZ 4J29A 5B1HA 2C7BA 1L5GB 1OXBB 2AX4A 4CMIB 3NIDB 3L0DA 3EJWA 1ZRMA 2NVUA 1TQ8A 2Z09A 5FFMA 5DJ5A 5LOVB 4JGBA 4HXYA 1VBKA 1WB4A 2N9UA 1EP9A 2RHMA 4HDRA 1XZNA 4DCTA 2JFUA 3D81A 3ZDFA 1W4BA 3DLIA 4XIIA 1DJLA 5JSZB 3IBTA 3GLGE 1NI5A 5H16A 4CQLB 3GCGA 4OGWA 1DKRA 1WCWA 1CSEE 2IDKA 3VTKA 1DWUA 3SYMA 4CLHA 5KMGA 2DB3A 1DOHA 2GZAA 3PUJA 4O4IB 1WSDA 1F6BA 2WT8A 2BN4A 2RFLA 2YW9A 4BFXA 4F5EA 4FE7A 4EECA 3X1XA 3PQFA 4R8KA 3OIYA 3FYUC 4Y1RB 1SXQA 4C4RA 2HWUA 1J5PA 2VUSA 3DH0A 3JQAD 1AB6A 3KXIA 1KI6A 4C6TA 1LS1A 1ZBDA 2H2DA 2EU8A 4KIJA 2UUBB 3PSHA 4ZOBA 1KI4A 1XA0A 2VHQA 2QAGC 3HM9A 3E3MA 4N54A 3WQQA 3MUEA 5ILQA 5A0VA 1E63A 1JQ3A 3CLTC 5KKNB 5LBTA 1VFNA 2GPBA 1YZTA 3LQFA 4I4TF 1XHFA 3F5SA 5GGYA 5JISA 2OAEA 3PLNA 4JYCA 4ER3A 2CNLA 2R8EA 3S99A 1CJSA 2P6UA 4TVOA 3SKVA 5ALDA 3RFXA 3PQEA 3UJ7A 1AMUA 1E8DA 5ELLA 5G0VA 2VJAA 5JRDS 3N1UA 2HJVA 1JMVA 4PAOA 1T0BA 3T7CA 4DXDA 2O06A 2C42A 3NEJA 2A0XA 1DAGA 2UYQA 2Z5GA 3A4MA 4Y9RA 4ZVKA 3K71B 1X1AA 2HI0A 3FFXA 3PEYA 2YWFA 1JPVA 4ZYYA 3O8OB 3WYGA 1HQCA 4XH9B 4AJEA 4R2WA 3L0CA 5JG7A 1GP2A 3V6MA 5JQGA 3IQIX 3GRPA 2GJKA 2VHEA 4QFCA 5BQFA 5EERA 3GQBA 3VTZA 5TGDA 3AKEA 4Q4CA 2RCYA 2VP0A 4C0WA 4E1BA 1LA2A 3FAZA 1EYZA 4ARVA 2ZIXA 4OQDA 3E8MA 3V1UA 2VH2A 1E1RA 3EGDA 1C14A 1NW8A 3NHPA 1XCMA 3QSYA 2QR2A 3IDOA 3DR3A 3LYUA 2QN3A 2WRZA 4Q9LA 1VGQA 5CVJA 5BSMA 1XWIA 3RLFA 3T94A 4WFJA 3OM8A 1TNDA 1RRKA 2D5CA 2F4NA 1Y1KE 1YQXA 2PZKA 4IKEA 5J40A 3FJYA 3RIMA 3KJGA 4Y2UA 3AEUA 1OXVA 1XUOA 3EGIA 3FYDA 2CXRA 3AUFA 3UUWA 2PGNA 4XGNA 3I05A 1QH8A 4INZA 4IWXA 2QAGB 2V0CA 1YDWA 2WSMA 4QLOA 3ANYB 5IRCD 3CRNA 1FK8A 3GVCA 4WZBE 3ZEIA 5AHOA 4JIMA 5CA0A 1FRNA 2JPDA 1EFHA 2NU7A 4Y6LA 5J2TF 1TEHA 1F6DA 1WMDA 2D5IA 1L2TA 4MWCA 3T1YB 1I33A 1OH8A 3MWDB 1ZK2A 4OHXA 1NQTA 2AZ4A 3TQSA 1ZD5A 2NUPB 4XWGA 3UGKA 3NH9A 5C0OE 4MR9A 1IRXA 2QRQA 1X1RA 3W5VA 3CB4A 4WMLA 3SBXA 1MRNA 4IF4A 2DTXA 3Q2KA 1ZGZA 3DOJA 3GL9A 3AHJA 1ONNA 3VYWA 1OI3A 1S8NA 3VNAA 4B3BA 3E2IA 1MAWA 4RIIA 3TXYA 5EJ8A 1ZC4A 2FUKA 5A4KA 1ABFA 1QHNA 2B2NA 1Y63A 2OCPA 2WUWE 5AK4A 1IQPA 1Z07A 4U8GA 1EUDB 2D13A 2JC3A 2J30A 4UBNA 3GOQA 2VEOA 2X5KO 2ADOA 2VJNA 2DWCA 5LQUA 4G07A 5MN4A 1B2RA 4MQMA 2R5FA 4N1AA 3H5LA 3A9VA 1TK3A 3A6HA 3T6KA 1IWOA 4B6GA 4ER7A 4L3OA 3Q5GA 4KWEA 1FW8A 2J87A 4GUDA 3O9ZA 3WLNA 1FW6A 4UREA 4V0RA 1O94C 2C2HA 1K5HA 4G81A 1OLSB 3WNZA 1FXSA 1Z3CA 2EF0A 3HNPA 1SKUA 4YDHB 4C7VA 4KMSA 4CDGA 5T41A 1H1TA 3H4IA 1XROA 2CSXA 3IPAA 1NPYA 1Q0HA 1LUAA 5J4HA 1II0A 2ATCA 3IMFA 4Q24A 3N3BC 3DQQA 5E8JA 3I9KA 2UU9B 2AOTA 3HWSA 4N41A 3ROTA 4B17A 1NVUQ 4Q4LA 4I4LA 4QYSA 2M98A 3K16A 3Q8MA 1H8HA 3I9FA 3CR3C 3KQTA 2A9KA 1ODLA 2PXCA 3EZYA 1AV7A 2YUTA 2WP8J 3LT5A 3UHFA 3HWWA 4FR2A 3KS9A 4AY4A 1NNLA 2Z98A 1KETA 3NEPX 1ZY2A 2C5FA 1OXSC 1EXMA 3RS8A 5HKBA 1J2EA 3JYPA 2NU8A 3GPIA 4B6SA 2QLBA 3I01A 3MTDA 1OIWA 4KQMA 4EJFA 1H4QA 3G5LA 1BS1A 4YBRA 1TAQA 1DZ3A 2PX4A 3O8DA 4Y2RA 5T4FA 3IE1A 4CKCA 5K3AA 3U09A 4LWPA 2X3YA 3CNOA 4BNWA 5HX7A 2X8AA 1QZTA 4M9SA 3WC4A 1N3YA 4N4AA 4PC1A 1ORVA 4DV6B 1WETA 1OHHA 3LO5A 3WV5A 4DJDC 2WMNB 1R9NA 5EMHA 1RP7A 1KL7A 5LYJA 4IICA 3H86A 2JVJA 4FYWA 5BMVF 3OUZA 1JI3A 1RE0A 2DECA 3R0XA 2HU7A 2PPVA 5EWLB 2HNAA 2Q3HA 3ZOKA 4ND8A 2Q50A 3HDVA 2JLSA 3MAGA 5F98A 4CG0A 1M66A 1ZONA 2I87A 1ZH8A 1VHWA 2RHLA 4FBGA 3LWZA 3USCS 3URKA 2ZM5A 3TLMA 1ZQ1A 1BA2A 2Y9PB 4IV0A 1I2AA 3CG0A 1ODJA 1C3JA 1QUFA 3VHLB 3ZQJA 4CW7A 4RTJA 4UE3S 3RVLA 3DZGA 1Q1ZA 3SDSA 3DAHA 3EZ2A 1ND6A 2FPIA 3TUZC 3SOPA 3NFRA 4TT8A 3WBFA 2OZEA 5FTJA 1BAPA 3EN0A 3HSKA 1SCUA 2Q8QA 2Q5EA 4KLRA 3PU6A 3S44A 4AIRA 5FIUA 2V97A 2YDYA 2FZGA 3IO3A 5BW6B 4K3UA 2RMKA 3MLBA 3PFFA 1E5TA 3GVHA 4NY1A 4CM5A 1R0CA 2D2IA 4BIIA 1E4YA 2XUKA 4NXNB 2HBZA 3ASUA 1T8SA 4PPFA 1NVVQ 2ZUCA 4YJ3F 3WOVA 3IPRA 5DK6A 1ZW1A 3U7IA 4O2RA 4RCVA 4CM4A 2JFGA 3MM4A 3RRMA 1YS6A 3V1LA 2W48A 3NPAA 1T4GA 4GX5A 1NW4A 2DU8A 5ADHA 4NP6A 4AXBA 4XWYA 3WXMA 4CQMD 3LA6A 3A1NA 1C7RA 4QM7A 1DX4A 3VKWA 2FR8C 1VHQA 2VCEA 1DAFA 2Z0MA 5BWLA 4X91A 3RGWS 1J6UA 3EIXA 4NH0A 1YIOA 3I42A 4A9AA 4EPTA 3VR4H 3JASB 1YRBA 1AGRA 1JG3A 2PKRA 2WHQA 3P9YA 4OL0A 1P1IA 2X2OA 3EQZA 4CG3A 2N0SA 4YUYA 1CRLA 2X8JB 5GJCA 3D6TB 1JA1A 2DX7A 2PSEA 3WDKA 4AM8A 5FWYA 5EPOA 4D79A 1EG7A 3ZGOA 3MINB 1UXKA 1YCGA 5EJIA 5T64A 2FQYA 2PPLA 4MQFA 4QJ5A 1Y5IA 3ZHYA 2JBWA 2WPDD 4F46A 1C30B 1E6EA 2GPTA 4HC4A 3R6WA 2AKEA 2ZWIA 5E7MA 4BFLA 1A5AB 1YO6A 1K5PA 1ST3A 5IJWA 1ZK1A 3B1XA 2NM0A 4QPDA 2J08A 2W6CX 4B48A 4E11A 5KJFA 1WRBA 1E6UA 1LCIA 4ZVOA 5I01A 3SE0A 2FW1A 2HF9A 4XGKA 1WB9A 4DC1A 4K9PA 1WW8A 2WF6A 3A3YA 1TMGE 3WWYA 1T91A 2B21A 3LIIA 1KDPA 4H18A 2NT4A 3E0XA 1KO5A 1RWKA 3B5EA 3IUEA 4B2PA 3HN2A 4YDQA 3TG8A 3COZA 4EHBA 1WBDA 3IVCA 3WADA 4YT8A 1QV6A 4F8JA 3HGTA 4NCAA 3NR2A 4UVGA 4RZSA 3IAFA 3JYNA 1ISGA 3WYFA 2BGJA 5L6MB 1QC5B 4JITA 3AY3A 2G0TA 4PEVA 3RVQA 1YJXA 4BO2A 2EAUA 4KV9A 4ZYZA 4YO7A 4XASA 4DBLE 4W5TA 3RTCA 2BHNA 5TB5A 5K8IA 4W5RA 3L01A 5I9SA 4M1YA 1QYDA 4JP1A 4A0RA 3MB8A 1O9BA 1KY5A 4NOLA 1XNGA 4IGEA 1WV0A 5LXTA 1JBQA 1P1RA 1TZMA 4QX6A 4PBSA 2P3SA 4LYYA 4I19A 5FI0B 4K9RA 4O02B 4WA7A 1DT3A 4G0WA 2P6NA 2VPWA 1ZRHA 2ZTLA 5L6LB 3RUCA 3KQKA 1F2UB 1Q12A 1GU7A 1PGNA 1T9ZA 4QUJA 4YRMA 5K0ZA 3L49A 4IRMA 4MGHA 5K0LA 4CFZA 4KE7A 3GZTB 3BIOA 3PUZA 1QVWA 3TUIC 1P62B 1YWGO 2VPZA 3OY2A 3P5SA 4HS9A 2JNWA 1W87A 3NT2A 5I48A 1QRAA 4WX2B 4MICA 1Z5OA 2ZCUA 5FPTA 4ZEXA 3QY0A 3B8EA 1GPWB 2GS9A 2WIGA 2EJCA 4B3DA 1O8BA 4BZQA 4JYAB 1VKNA 3IX7A 3FNQA 1SVIA 3EARA 3BRWD 2GMWA 4FYVA 4RHUA 3CEHA 3BSYA 1KU6A 3MAJA 4YS6A 5EHGA 5G3ZA 3DC7A 5ADUS 1K97A 3WWOA 1PNQA 3TRHA 1G18A 1S8FA 4M0MA 5JD6A 4HGPA 2PZJA 3H4TA 4B74A 3UOAB 4B6JA 5ERYA 5A3VA 4PAQA 4MCHA 1H5UA 1LPBB 4EP1A 2YJ6A 4RJLA 3FFTA 2XIJA 2NO9A 3R8XA 2WE7A 5FHRA 1JR3D 4YRIA 2BPOA 3ETDA 4GRIA 3AIKA 2B99A 3FCEA 1RLTA 3NG1A 1MLDA 1SD5A 5FBVB 2WZCA 4OKSA 2VG8A 2W2XA 4RTRA 3G0GA 1N2GA 4LJKA 1DJNA 2LR0A 4IVQA 4FUTA 2QE6A 4BBZA 3JQ6A 4UVHA 3H5IA 4CWAA 3A6DA 3WRVA 1D6JA 5E2IA 3SR3A 3G9UA 3L1UA 3LKVA 3WNCA 1ZZGA 4BO9A 3E9RA 4HSEA 5H5JA 1ATIA 4W9NC 3TLAA 1TVCA 1NHGA 2CZCA 4QUHA 1D0IA 1E3LA 2WIBA 2A57A 4HLQB 1E96A 4L5YA 2GESA 1KZ9A 2FYTA 4ZQGA 1QQ5A 3C7KA 4N82A 2RGWA 4M7OA 4OB6A 2DR3A 1FUIA 1ZM2A 2VBIA 3R74A 3GLFA 1EBBA 1BN6A 4OQLA 5K0BA 4B4KA 3BF8A 4RHYA 1KFEB 4OQEA 4YRCA 1P91A 5TQJA 3FDZA 4UASA 4GKVA 4I3HA 3KT0A 1QHGA 4H7JA 5CH3A 1VCMA 4R5MA 1CZUA 1P1HA 5DE3A 3H4VA 4F6RB 4P0TA 1Z6YA 3BL5A 3DDHA 4EUEA 1SIWA 3QVWA 1XDBA 1DAMA 2JKZA 4JA2A 1P0CA 1P5FA 1XYYA 3T52A 3R9XA 3BF7A 4D4HA 4B8WA 3JQ9C 2Y2VA 4TSFD 4B85A 1HYGA 1DEAA 1TUBB 3BXEA 1LJ8A 1H2EA 3JR3A 5D7BA 2GCGA 2NSDA 1I30A 5HBRA 4Y2SA 1XXHB 2A1IA 2G9RA 2C99A 1EGMB 3KD3A 3NRCA 3QVSA 5JC8A 2FDCA 1U2GC 1XKTA 4M98A 4N8DA 1II9A 2XZDA 4IDGA 3T7DA 3LPLA 1PZXA 4WNAB 3WVNA 5C53B 3H7IA 4IFTA 2RHBA 2GA8A 2WG1A 1L0BA 6LDHA 1NT4A 2J3LA 1L3BA 2PEZA 3N70A 2OFOA 3QVGB 1N2XA 3IDSA 3EGWA 3R6GA 1B8PA 2FZCA 4HGZA 5SYMA 1OTYA 4GM1A 2X86A 3VH3A 2WMDA 4BO7A 1E9DA 5CFRA 3UPUA 2VPPA 3VYRB 1P6QA 3OEHA 2EOAA 3DEKA 3V7WA 2C4UA 1IIRA 1QFXA 4GOLD 1NGSA 1I24A 4I50A 3T7AA 2R66A 3O75A 4XRGA 5LP1A 2H7VA 5KJ6A 2YHIB 3TVTA 3OQOA 2VQ6A 5JXJA 3KTDA 1XG5A 3PV0A 4JSTA 2XY4A 2UV8A 3P8ZA 4WFQA 1M7GA 5IEJA 4LKRA 2F7SA 5IFLA 1U2DC 2DMRA 3RS4A 2BRUC 1KWKA 1A5TA 1T3TA 1C7EA 2F3PA 3Q15C 2ZRDA 2Z2YA 2X9NA 3DCNA 1LLUA 1QORA 2BFOA 4M9QA 1NQOA 2D06A 1CDOA 1DIBA 2G9NA 2XTAA 3ACDA 4L4RA 2AOVA 3CNBA 1EK0A 4CFSA 1TA0A 3K0CC 3WQRA 4F38A 2YV1A 3TLYA 2MJLA 1V9CA 2VHJA 2UVDA 2ZB2A 3B1WA 3DOEA 3HADA 4LMAA 4TV9B 5CDHA 2WWYA 3CKMA 2GKSA 3L1VA 1RR6A 1NJ2A 2PH7A 3QWAA 4RLHA 3AEXA 3NO4A 2YJ3A 3B52X 3VPBA 4MHTA 3ORYA 3EIQA 5E8RA 1D2RA 2O4UX 4UNPA 1RCUA 2IDMA 2CDNA 2HIHA 1OC2A 4MHSA 5TXGA 3RHSA 4EJSA 1FJGB 2IZOA 4P2BA 4RK4A 2XR1A 1ZK3A 4V0LA 3TPCA 3HXMA 4ZAVA 2C7QA 2Q2OA 5BWBA 2VYNA 2YXEA 1IMOA 2HLNA 3B89A 1EH5A 3L05A 3QNMA 4P5PA 5JCXA 2LBPA 4HN2A 3HB7A 4I9UA 4C30A 3L41A 4ENQA 1EVLA 1H8ED 2BKXA 3NBZC 5CX4A 3PZRA 4MQ5A 3RU9A 4QDXA 3WA7A 4EB0A 2OQVA 2ASVA 3AXTA 1CUUA 3V8QA 4EMSA 4EM6A 4KB5A 3IAM1 3EWSA 1RLOA 4I2VA 4WNYA 3L7CA 4RVDA 4B34A 3C3PA 2GBIA 4BFWA 1BDIA 4L07A 1KMCA 3HKCA 4W1PA 3AJDA 1V8DA 3KU1A 5AP9A 3TQCA 5IF9A 4YJGA 2VH1A 2R1TA 5DDIP 4DB4A 4G1CA 5KCMA 1KI7A 5KQPA 4GMFA 2RI0A 5HJEA 1GNPA 3OT1A 3R3SA 2LUOA 1P73A 2N75A 3F8WA 3P2MA 1V7CA 5CYGA 4W6QA 2CYAA 4OYLA