3EMKA

2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
246
structure length
241
Chain Sequence
b'SMFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAELGERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRRNGRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE/RIBITOL DEHYDROGENASE
publication title 2.5A crystal structure of glucose/ribitol dehydrogenase from brucella melitensis
rcsb
source organism Brucella melitensis
molecule tags Oxidoreductase
total genus 88
structure length 241
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3emkA00
5DULA 3H2ZA 1N9GA 1Q0LA 1LLUA 4R51A 2J8ZA 4JCOA 1HDGO 5BQFA 2VT2A 1EVZA 3MJSA 4E31A 1LXCA 1ISJA 3EDMA 1BXZA 4GSKA 4MP6A 4QTZA 5B37A 4W4TA 5TQVA 3E82A 4B7UA 1TA4A 2F00A 3I4CA 4UEKA 2Q1SA 3V1YA 5JAMA 3ETGA 4Z0PA 3UCFA 4BGEA 3AWDA 2HKIA 1DFIA 2AEFA 2W2LA 4CR8A 2ZTMA 4QQRA 3GDFA 2GASA 3OHSX 1B26A 2GLXA 2HUNA 3AW9A 5DBIA 3TZCA 2EGHA 2GGSA 1U3VA 2VRBA 4Q39A 4NFSA 5KJ6A 1UDBA 1V6AA 3DFZA 1DLJA 3G3EA 1Q2XA 5G0TA 3WMWA 4KDEA 4UEJA 2JD0A 3NDIA 5IN5A 3PIIA 4U8GA 9LDBA 4BO6A 4BNHA 2Q3EA 5H81A 4NU5A 5CG2A 4BNYA 3UVEA 1TB4A 2FR8A 4LMPA 2C82A 3EVTA 3BAZA 3HDHA 3QVSA 1IB6A 4HFJA 4M49A 5L4LA 3H9JA 4QECA 4R41A 2CF6A 4LW8A 4YT8A 2A94A 2V6GA 3CZRA 4CM8B 3TZKA 3U9LA 1E3EA 2FR1A 3FI9A 1GZ3A 1N8KA 1X13A 3LF1A 2NSDA 1DO8A 1JW9B 4RLHA 4O1MA 1V3UA 3PVZA 4Q9NA 1PS0A 3QSGA 4MKRA 1I01A 4QFCA 1MX3A 1X0VA 4QXMA 3WXBA 1RYDA 2Q2QA 3A4VA 4WK6A 4IY1A 4CMAA 3GOHA 3QE3A 4NBRA 3I4FA 3C1OA 5T57A 5ER6A 5G4LA 1E6EA 2G0TA 3A28A 3I9KA 5G0VA 2IYPA 2B4TO 3GVPA 1T25A 4R68A 1QLJA 5EIOA 4J7XA 1KIFA 1ULSA 1NAIA 3DWFA 3KVOA 4CMKA 4PG8A 5KKCA 3VZPA 4J49A 4ZRNA 3M2TA 2JD1A 3UCEA 1E7MA 4XQEA 1A9YA 4HX5A 3PHLA 2HSDA 4BNGA 5AOVA 4OXYA 4NIMA 2Y66A 3FF4A 5L4NA 3HADA 3QWIA 1H6DA 2GDZA 4AL4A 5EPOA 3PWSA 3ZU3A 1VLLA 3A9WA 2BF7A 4DC0A 4XCVA 3ZV6A 1PGJA 1A4UA 3WNVA 4JN6B 3EMKA 3F1KA 4ALIA 3JQ7B 3CZMA 1G0NA 1DXYA 2DBVO 3DBRA 5HTOA 2Q50A 5L9AA 1GPDG 4FIZA 4JJGA 4JJIA 4JJFA 2BI8A 4BO2A 4KMSA 2WD7B 3BA1A 3H9GA 3ASUA 5C3MA 4PN3A 2GRAA 3AI1A 4L8VA 4K26A 1Y81A 2C7VA 5T64A 3DHYA 2E4AA 3ETEA 3MOGA 5JCJA 3RIHA 1BRMA 4I5FA 1N9GB 3DZIA 2YHIB 1LSSA 1N2SA 2F1KA 2P68A 4J16A 2V6MA 5F1KA 2RH4A 1IPEA 2X9NA 4R3NA 1P3DA 3ABIA 4GX0A 1ZXBA 4B7CA 4E13A 3UXYA 1GQYA 5MDHA 1PS9A 5CP8A 1AHIA 3AM5A 4L73A 2C54A 3RFXA 3W8EA 1JAYA 1FDWA 4DUPA 4E30A 3D4OA 3WYCA 4J2OA 3CUKA 4RPKA 2EJWA 4IM7A 1K5HA 5IF3A 3UAGA 5CDYA 4ILKA 1A7AA 3E03A 1B2LA 5JDIA 3F1LA 1JWAB 2OZPA 1XHLA 1JLLA 1HDRA 1K2WA 2GD1O 3FPLA 3HN7A 5AXDA 2Q4BA 2NVWA 3V2HA 4ALKA 2GN6A 4CLRA 4U6QA 1PZHA 3WGYA 4DLAA 3ADOA 2POQX 5A5FA 2I76A 4MVJP 4GVLA 4AJ2A 1C1DB 3DZBA 4WKGA 5EERA 3SC6A 4BNXA 1NAHA 1Z82A 2ZKLA 2YV3A 4EI2A 1WVGA 5JCXA 4IDCA 5EINA 4LCEA 1Z75A 3UN1A 1IZ9A 3Q11A 1NVMB 2NVUA 2PH3A 3IOYA 1HTBA 2GNAA 2BD0A 4GI2A 3RBXA 3VPSA 5AYVA 1SPXA 3KYDA 1JWBB 4JGBA 1EFKA 1YJ8A 3NDRA 4D3FA 4H16A 4I5EA 3KYCB 3OJLA 1C14A 3ITKA 4IIUA 2YDXA 1P77A 1ZCJA 5TRTA 1NWCA 3GHHA 4NZ9A 1VI2A 1R0LA 3PIDA 3I83A 2BGMA 4IMRA 4FFRA 1PU2A 4BO5A 4YJDA 4MOWA 2JKVA 5JY1A 1UXGA 2HMVA 2J3IA 5MGBA 2PZKA 2OP0A 1V3VA 3LQFA 1YBMA 4NNJA 4FC6A 4XIYA 4AJJA 4BS9A 4KQXA 4PLYA 2X1HA 2NTNA 2GCGA 1MC5A 3P2YA 3GRPA 4YJFA 2OBYA 2OOSA 2TMDA 1SB9A 4MPDA 5DDIP 4ZU3A 3VTFA 5JE8A 2YZ7A 1HF3A 3RFVA 3FBGA 1YOVA 3OJEA 4TROA 4CLEA 4XEHA 3S8MA 3AUUA 3NT5A 3D7LA 3BTOA 1TT5A 1VM6A 1QYXA 1GTMA 2BFOA 4CL3A 3QV1A 5CHEA 1G6KA 3EYWA 2DT5A 5DNAA 2I3GA 4GX2A 4D41A 3DBRB 4DC1A 4BO7A 3ZW9A 4QO8A 3ONDA 4WCFC 1H93A 5BNIA 1KS9A 1PGPA 2EIHA 4OIMA 3RUFA 3GDGA 1HRDA 1O9BA 3CXRA 5CEEA 5EN4A 4N5LA 1RKXA 4CPDA 1I0ZA 4KTVE 3GT0A 3ON5A 5THKA 1AUPA 1Q0QA 3QHAA 3WQQA 3HJAA 2JHFA 4NJMB 2I67A 3KSZO 1M66A 3JQDA 2E82A 2B35A 3E1KA 1NX6A 3H5NA 1M76A 3ZV5A 1ZK2A 1X7DA 1GV1A 3LVFO 5F5LA 1U4OA 2NM0A 4R54A 4XA8A 3WQSB 4ZN6A 4EYEA 3NGLA 4D44A 2AQIA 1P1RA 4CLHA 2C7GA 3BIOA 4I08A 4S1VA 4UUNA 3GNTA 3ROKA 4R4JA 1BDBA 4DTIA 4RDHA 1HDOA 1A7KA 1HDXA 3PFWO 4GVXA 3DBLA 5FI5A 4W99A 5BR7A 1SAYA 4KUEA 1Y1PA 4RDIA 1XGKA 3DOJA 4DQXA 4DVJA 2PA3A 3I6QA 1KOLA 1YO6A 3WOHA 4Q3NA 1KEVA 1R16A 3GVXA 3FD8A 3C3XA 3NAQA 3SC4A 2DFDA 3ZWWA 5JNLA 2CD9A 1F17A 1CWUA 4BVAA 4M86A 5T5QA 5JAQA 3KM0A 2D4AA 5ENVA 2OUIA 3K2BA 4FB5A 3MOIA 5GY7A 5A9TA 2XF8A 3WGZA 4IDDA 2X7HA 1QYDA 3KYBA 4FFOA 3DAFA 5TS3A 5I7EA 4FJ0A 4CM5A 5U4QA 1A5ZA 2VQ3A 5I9LA 3MJTA 4RVDA 4YBZA 2R2GA 1ULUA 3DTYA 3NYWA 1ISFA 2JFGA 3TRIA 1O95A 1GCOA 3OF2A 3ROQA 4AFNA 2NTVA 1VSUA 3NX4A 4YRBA 2WYVA 3RROA 3D0OA 5DP2A 3JD3A 1XQ6A 4BNUA 1PZEA 1M2WA 1FDVA 3M2PA 3TSCA 5CAEA 1W6UA 4BGVA 1CJCA 3M6IA 3E5MA 1T1SA 5KJ1A 1YOVB 1OBFO 3VAZA 3LC2O 1V9LA 5JBIA 3DAGA 3ZHXA 2O7QA 4CM3A 3ZWBA 3U5TA 4U0KA 5A05A 2VHZA 4J1SA 4AJLA 5FI3A 3GQVA 3RJ5A 3ICCA 3ENNA 1WMBA 4ND1A 3DFUA 3UKOA 2YQ5A 3O8QA 4R01A 2HJRA 1UZLA 3F5QA 4Q3BA 2GPTA 3KSDO 4BO8A 4XIJA 3ASVA 1BW9A 3KUXA 4J2HA 4L75A 4CQLB 4A2CA 1KY4A 2O2SA 1C0PA 4QO7A 4OO3A 1GEGA 1MG0A 1TXGA 3TZ6A 1BXGA 2VRCA 4N54A 3MEQA 1HZZA 3FWZA 3OJOA 2VZ9A 5IN4A 2VWHA 2C2XA 4CM4A 1T24A 2DAPA 1J49A 3EHEA 3ADPA 3WX0A 4HXYA 4GLOA 1QSGA 4LMRA 2EV9A 4KWIA 2GN9A 5C7OO 4DPMA 4ZHSA 2GUGA 5L53A 4OQZA 3D5TA 3WTBA 2WM3A 3EW7A 5EMHA 4PCVA 4BHTA 4A73A 4DBVO 1UP7A 4JLWA 5FYDA 4GMGA 3LZ6A 4KZPA 4NMHA 1B0AA 4RPHA 3VKUA 4HP8A 4XYMA 4O5OA 4XR4A 4E5PA 3T4EA 5CPFA 4AVYA 2OHXA 1TEHA 1V35A 3GAZA 2QIOA 5COAA 5J23A 2EKPA 3HWRA 5LDHA 3DTTA 2CFCA 1E77A 1X0XA 2IEDA 2DTXA 2W8ZA 1E1NA 2Y0EA 5C5IA 1F0YA 4WE3A 4FBGA 1E3LA 1FJHA 3DL2A 1TT7A 3D4NA 3C7CB 3HNPA 4J0EA 1IZ0A 4DMMA 3CPSA 3ST7A 4YT5A 4GBJA 4DPLA 3BMOB 4CM1A 3WDSA 1UP4A 3H6KA 3ZWOA 1B16A 1XSEA 1B8VA 4R3WA 1EVIA 2ZCUA 3D3WA 1WDMA 2P9EA 3PHJA 3ZNPA 2HU2A 5ICMA 4BUCA 1C0IA 4FFNA 2GR9A 1YDEA 1QP8A 2NU6A 1LRLA 1YVEI 3OQ6A 5I9MA 1IE3A 2NNLD 2XPCA 4JP2A 2PKRA 3I1JA 3PTZA 3DXFA 1Z7BA 2A4KA 5IXYA 3K6JA 1I36A 2XOXA 1H5QA 1ZEMA 1B15A 1KEWA 1K3TA 1P1JA 2OMEA 3P19A 1TI7A 2I9PA 4KOAA 4KTTE 2H63A 1KVTA 1BGVA 4IGFA 4D7AA 1U3UA 2PGLA 3L4SO 4J9VA 4RVSA 3WTCA 5T67A 2EERA 1EUCA 1WDLA 4BKRA 5I7FA 1ADGA 1DC6A 3QVOA 4WCFA 3UGKA 2Y1GA 2GZ3A 2UYYA 5FFFA 3V2GA 4DRYA 5I7VA 1T2DA 4WLEA 5ICSA 1T2EA 5IAAA 3HZZA 4HY3A 3DZGA 4B4OA 4WNIA 3AM3A 1VL0A 4HFRA 1AGNA 2R6JA 3H9UA 3O8QB 3MCVA 3LU1A 4LRTB 3U49A 4FOOA 1BTOA 2EKLA 3T4XA 4GSLA 5IDYA 5TNXA 2HRBA 1BW9B 2CDCA 3ZDFA 4RVFA 3AI3A 4NBUA 3E9MA 2DPHA 1HE4A 5JO0A 3ENKA 2Q99A 1GFSA 4LRSB 4XYLA 1BXGB 1SZJG 1Y8RB 2CVZA 4WOJA 1ONPA 4ZD6A 4O63O 2OBNA 1LI4A 4CM4B 1U28A 1PX0A 3KB6A 1E1LA 2HJSA 1ZUD1 4HFNA 5A04A 3KRTA 4J4BA 3G1TA 2WJPA 4BMSA 4CODB 4A26A 2P9CA 2P4QA 3FHLA 4UEOA 3ZWMA 4D42A 1ADFA 5JC1A 1HEUA 3Q2IA 1HZJA 1NM5A 1HE3A 4J3FA 5DF1A 4Y6RA 3PJDA 1PGNA 2PLAA 5GZ1A 3DHEA 1E5QA 2GZ1A 2D59A 3ZI0A 4K6CA 2XXJA 5U1PA 2CUKA 3F9IA 4DMLA 4F6CA 1CIVA 3PP8A 4BO0A 1IYZA 2A35A 2D2IA 3QVTA 1PQUA 4A10A 3ETDA 1G0OA 1O8CA 2AQ8A 5CFZA 1D1SA 2BKAA 2E49A 2Y1FA 3ONEA 2Q2WA 5JLAA 2Q4EA 1QG6A 4M1QA 2IDZA 2DUWA 4AJPA 4IZHA 2YV2A 4MIOA 2JD2A 1DRUA 4RLSA 4BL5A 4PGFA 5JMWA 1UH5A 3ZHYA 2DUUA 4O6VA 4H15A 1Z74A 3GVIA 4EW6A 5F3RA 1PWXA 4JP3A 2JCVA 3IUPA 4GMFA 2HMTA 1ZK0A 5K0ZA 5KOIA 4BGUA 3D4PA 4RF5A 3VHRA 1OC4A 1ENZA 2ZYAA 1PJCA 5K6AC 4IIVA 1KY5A 1ISHA 2BI7A 5AXAA 3FNEA 5JY6A 4FFPA 4WLUA 4YTEA 1V8BA 3GGOA 3VDQA 4IQ8A 2WTBA 3M1LA 2QQ5A 5IDWA 4MVJA 4M89A 3E48A 1MXFA 2WYWA 4AJ1A 5CDTA 4MVJE 1R0SA 2EJVA 3W4IA 3VH1A 1GYRA 3PPIA 4BNMA 2FSSA 4OSPA 5KVQA 3JQ7A 2ZB3A 4TRJA 4B8ZA 1CDOA 3B1KA 4MVJM 1O5IA 1EZ4A 4TWRA 1HL3A 3TDKA 4NPCA 3PFFA 4WCFB 4DGSA 2WD7A 2HK9A 4XB1A 2E37A 3K96A 1EMDA 4FFMA 4RVHA 3HN2A 4PZDA 3B70A 5F1PA 4E12A 5GMOA 1HXHA 5KJCA 1I10A 1U3WA 1LLCA 2YHIA 4R16A 4EUFA 4YEDA 1OMOA 3TNLA 2CNBA 4IDBA 2X4GA 4KDFA 1HWYA 1DB3A 3EC7A 1E7RA 4YJHB 4YWJA 3RUAA 3U4HA 5JXWA 4DL9A 4OHUA 2AQKA 1XCBA 1KVSA 1LQUA 3KEOA 3FNFA 3I5MA 1YONA 5DCYA 2D5CA 1C1XB 2B36A 1I30A 3KO8A 4NI5A 2WDZA 2DLDA 2PK3A 3L9XA 3V8BA 1GPJA 1E3WB 4NQZA 1LLQA 2NLOA 4O59O 1RPNA 2X8LA 2YFHA 3C8MA 1PGOA 3ANMA 4NG5A 4OM8A 1DOHA 1P1KA 2PZMA 3HDYA 3QQPA 3HB4X 3H3FA 2BFMA 5G2OA 1C1DA 1ADCA 1SB8A 3BMCB 4P8RA 4WEQA 1SOVA 4J7UA 2OGUA 3OMLA 3C7AA 1VSVA 1P33A 3CIFA 1PGQA 3KV3O 4ID9A 4YB8A 4W9NC 1ZSVA 3RUHA 2CSUA 4FN4A 2DPGA 1M67A 3PLNA 4LN1A 1BVUA 3L9WA 3BTSA 4WUVA 1YQGA 1T4DA 2DKNA 2HK8A 1GR0A 2ILTA 1MUUA 4JK3A 4G65A 4CUKA 3CINA 3KYCA 2G1UA 1Y9AA 2FSVA 4ESOA 4OKIA 4E32A 2DC1A 1NXQA 2IXAA 2WD8A 2DM6A 3LF2A 4J91A 4QT0A 4B4UA 2YUTA 1A72A 4MVJI 2FR0A 1DIHA 4J1NA 1DRWA 5AXCA 4EUHA 4BNZA 4Z3KA 5DT9A 4D0SA 3GEDA 4II2A 5DBGA 4A27A 4EGFA 2Y05A 5H82A 3ZU4A 3PGXA 1M75A 4TMFA 3ZV4A 3GF4A 3ZGYA 2PGDA 1N7GA 4B4VA 4G81A 4F3YA 1XWFA 2JAHA 4J1QA 4DYDA 2GN4A 2H1SA 4FW8A 4UUOA 3KOUA 4M54A 1QYVA 2IZ0A 2AG8A 1CYDA 4P22A 1UZNA 4IDFA 2HK7A 3JQ8B 1GYQA 3RJ9A 2HMWA 5EESA 2C07A 3Q6IA 4D45A 5GZ3A 3RUDA 1F8FA 1GL3A 4YRDA 1J5PA 3ZWAA 2W2KB 4E3ZA 3GC6A 1PQWA 3CMCO 2VHXA 2YJZA 1F12A 4XRGA 4FJ1A 4XGKA 2A92A 1CRWG 1ZSYA 2WEKA 1KERA 1YWGO 4YYZA 2QG4A 3VKVA 4XD2A 4RQTA 5L51A 4PLCA 4XDYA 1O94A 2YYYA 5A03A 2VUTA 3AOEC 3B20A 1DC5A 3QVXA 1W8DA 3C24A 4NJMA 4GL4A 1MA0A 4WECA 4E5MA 3ZH2A 4J90A 3VZRA 4QEDA 4CLXA 5JFOA 3PEFA 2ET6A 3H7AA 2PZLA 4OSOA 2O3UA 2IXBA 2VWPA 3A1NA 3JD1A 4RQUA 1MC4A 4JXKA 4ZA2A 5COQA 2O48X 3ZNNA 2YFQA 3NV9A 4LVCA 3JQAD 1HE2A 4N18A 1ISIA 3AUTA 1QYCA 2HMUA 2I66A 4NU6A 4E0BA 2YY7A 1HLPA 4CR6A 2VNAA 1PZFA 2EG9A 3H2SA 4CV1A 4CMGA 4JROA 1WWKA 3IQDB 4Y9DA 4NR0A 5JDCC 1L7EA 3MJ4A 3QA9A 3H4VA 4ND2A 1DDOA 5G0SA 2X23A 3ROPA 3PDJA 4OXNA 4TKMA 1ENOA 4FD3A 4IJWA 2G17A 3M1AA 2J5KA 3PYLA 2VNSA 1LU9A 3K30A 5I8ZA 3WYBA 3DZJA 3IUSA 1KC1A 1DLIA 1NR1A 1D4FA 1S6YA 1PR3A 1UXKA 1MLDA 1NQTA 2VT3A 3RI3A 1Y8QA 4D79A 2Q49A 2GZ2A 1NFFA 2O50A 3MJVA 1NPDA 5LC1A 1UJMA 1JA9A 5B4TA 3L07A 3RBVA 1ADBA 4R1UA 2V6FA 2AEJA 3V1TC 5JCJD 4YAEA 4AJIA 3ICPA 1N92A 1DBVO 2LDXA 4G2NA 3C1TA 3AI2A 3NT2A 4PRKA 5ITVA 5K6AA 3IL2A 1U9JA 3EZYA 4GX5A 3TJRA 2VUSA 2ZCVA 1JVSA 2HCTA 3GMSA 1KVRA 3FNHA 1C3VA 1FF9A 1GADO 1ZSNA 3UH1A 2B5WA 2JJYA 4TRNA 3SVTA 1A71A 3F3SA 4CM7A 5TC4A 4J6FA 4E5NA 4PG7A 1YRLA 3FNGA 4CLOB 1DJQA 2I99A 4NHEA 3RAJA 4U5QA 1EVJA 2GO1A 3LK7A 1E6UA 4Z3DA 1I2ZA 2RBEA 1HETA 1PJ2A 4TVBA 4WPGA 3E18A 1V3TA 4CM9D 2X0NA 4RORA 1KEPA 5KVSA 1FDSA 1YQDA 1NBOA 3RSHA 4YJGB 3NGXA 4TSKA 3WGTA 2BHLA 2O3JA 4JBIA 4ITUA 4D0RA 3JYQA 3DB2A 3MJCA 3OSUA 1LC3A 1DSSG 1EVYA 1RM4A 3UW3A 1Q7BA 4B3IA 1U2GA 3E6AA 3RBZA 2CDBA 4GX1A 1SCUA 1XR3A 3QRWA 4IJUA 4PRLA 2EKQA 4ZQGA 5JW6A 3SBOA 4BNTA 4TRMA 5HS6A 5I9NA 2I65A 3T7CA 4FSHA 4CQLA 2BMAA 2V65A 4BGIA 4MP3A 2ZTLA 3MWDB 4FQ8A 3JYLA 2J5RA 1I8TA 2JL1A 2HLPA 5T8KC 2QYSA 3V1UA 2FPIA 3VZSA 4D3SA 1K6IA 1AXGA 4W7HA 3RFTA 1Y5MA 1SO8A 4KP7A 5AVOA 4YT2A 1ONOA 1GCUA 3P2OA 4CMIB 1M6HA 4ZQFA 4J7CA 4ZJUA 4E2XA 1X15A 2B37A 3FRJA 3GZ4A 4MVJH 1OZAA 3TOZA 2JCYA 3OA0A 4Q3AA 1YL6A 5G0WA 4TKLA 5TX7A 3Q9NA 1WPQA 4CMBA 4W9NA 1R6DA 3IJRA 3L6DA 5BSEA 1GD1O 1XDWA 3EUWA 4L74A 4PG5A 1P0CA 4XWYA 3ZWVA 1M6WA 1DIGA 4XQGA 1DJNA 1EUDA 2P2SA 1LQTA 4PLVA 3RUIA 4OL9A 4W82A 3W6UA 4DPKA 4L4SA 4OGWA 2B83A 5TSDA 5IDXA 1K6XA 4QSMA 4M55A 4YT4A 1IY8A 5CPBA 1CETA 4CMHA 2FN7A 3WJ7A 1MFZA 4DWVA 2B4RO 1QXSA 1CEQA 4DREA 4WJZA 4I5DA 3NEPX 3N7UA 1Y8QB 5K9ZA 3I9MA 3BMOA 5CDUA 1X7HA 2J5QA 4GKBA 3RD5A 3OJ0A 2DBZA 1PWZA 4ROSA 3DOCA 4P38A 5L40A 4CQMA 1T2FA 4MO2A 5H83A 3WLFA 3BYZA 5KJEA 3U62A 4E21A 1N1EA 1D7OA 4Y98A 3I23A 2XAAA 2J3HA 4HWKA 4OMUA 1R15A 2JAPA 1RYEA 4JX8A 3VH2A 4A7PA 4D3DA 1F8GA 4ZQEA 5JAIA 1ID1A 4DIFA 4ZQHA 4K1LA 4WOKA 5I8WA 5G4KB 4L76A 3S2GA 4BNFA 2ZIZA 1BWSA 3AU9A 3LT2A 2HDHA 3HDJA 3UOGA 3WG9A 3WFIA 4DLBA 4W6ZA 3ZU2A 1BDMA 1XLTA 3WGOA 3DQPA 3DAPA 1Y7TA 2E48A 3IP1A 1ISMA 3OH8A 3EK2A 2P91A 2PGJA 3NTQA 3RU9A 3STHA 4I1IA 3H8VA 1HYEA 1LRJA 1SOWA 4CV0A 1WLYA 3AOEA 3CTMA 4BKQA 2RHCA 1MGOA 2PR2A 1FDTA 4N5MA 4EJMA 4EEZA 1I5RA 2FWMX 1NPTO 4HUJA 4CUJA 3OIDA 2X5KO 4CV2A 4E2ZA 2Z1NA 2X0IA 1Y8RA 2BELA 1H94A 2J3JA 1IOLA 3WS7A 2O3QA 1P45A 3NTOA 1MV8A 3I9JA 1DIBA 1WNTA 1XQ1A 3RASA 4I9UA 1GU7A 3DR3A 3X2EA 1YB4A 4EUEA 1PIWA 2YHUA 2X86A 5JDCA 1P0FA 3C85A 5ES3A 3WGIA 5DOVA 3F46A 2H5LA 3CKYA 3DBHA 2O4CA 1VJ0A 4BNNA 4XJTA 1WZEA 2GYYA 3TOXA 3GFBA 1KYQA 3SXPA 4B8WA 5F1OA 2X22A 1I32A 4BNKA 1LDEA 3P5SA 1YKFA 3ZV3A 3P7MA 2CF5A 1LTHR 1N5DA 1YB5A 2AQHA 4AJKA 5A02A 4KWHA 1NFQA 3RKUA 4RPGA 4AJOA 1U7TA 3AK4A 3WR5A 3DZFA 5KVCA 1ZK3A 1ZMTA 3HSKA 1WDKA 1GQQA 1ZXLA 3W4JA 4DIBA 3ORFA 4EDFA 1A27A 1QR6A 2C29D 1AXEA 3JV7A 5IZCC 2EWMA 1RWBA 2O3TA 4U0JA 1ORRA 4HNHA 2VOEA 4EITA 2P5YA 4RF2A 4ZGWA 4YCAA 2C20A 1ZBQA 4F46A 1G1AA 2D0IA 1Y5RA 1PJQA 2HAEA 1Y9EA 4RV9A 1ENPA 5KIAA 2O3RA 2ZB8A 4GQAA 2Y1DA 2GF2A 2VRCD 2B69A 3FPCA 2RH8A 4XJSA 2X9GA 3GNQA 4ND4A 2JCXA 2QZ9A 2UUPA 3MWEB 3PLRA 4CQMB 4F6LA 1UZMA 2BH9A 3QIVA 2C5EA 4BMNA 5DP1A 2EGGA 2PNFA 3X2FA 1PJBA 4FCCA 3GEGA 4MKZA 1MP0A 2AW5A 1ZK4A 1PR9A 1UAYA 4RCVA 1PEDA 3NDJA 4FPXA 1EE9A 3FSRA 4DA9A 3H9EO 4WLVA 4OOFA 1R0KA 4Y6SA 2AHRA 2VN8A 1I3NA 3FCOA 4DIOA 3WSWA 3WGQA 3PDUA 1R4NA 4URFA 2E6UX 1P1HA 1EDOA 4XR9A 2C0CA 4PG4A 3DMTC 1SMKA 4UAGA 4FFLA 2EXXA 3BMNB 1JDJA 1HLDA 1VKNA 1J4AA 1XYGA 7ADHA 1EE2A 1JVBA 2O3SA 4GGPA 1O0SA 1I33A 3GEMA 1NNUA 1T26A 5T8KA 3ZU5A 4UVIA 3RC9A 4CL8A 1DRVA 4BO4A 2AE1A 3QLJA 4CJXA 3A06A 2YV1A 4YJHA 1ONNA 2PKQP 3PRJA 3B1JA 1IUKA 4J9UE 3BHIA 3N74A 1K6JA 5TIIA 5JYEA 5IFLA 3INRA 1LSOA 4B4WA 1U2DA 4BMVA 1CQIA 1C1XA 1H9AA 5DCWA 1RJWA 5C7IO 5ADHA 4J4HA 1ZH8A 1E3WA 1E0DA 1XIVA 3I9LA 3JQCA 3GZNB 1GAEO 1I3KA 4BNJA 4B7XA 2UAGA 3KETA 1GZ6A 5A3JA 4UVGA 1HYHA 1YB1A 5KNLA 4YXFA 3FN4A 3V5NA 1LJ8A 4NFYA 1JKJA 3DBHB 3BMCA 3IKVA 2G5CA 5GZ6A 1WP4A 3ANNA 3IS3A 2OXIA 9LDTA 1GUZA 2QYTA 4O0LA 2PKQO 2DU8A 4P4LA 4QFDA 2WE7A 3ROMA 2WSBA 3ZWPA 1QRRA 1Z45A 5L4SA 3GLQA 3KLMX 1XELA 2NUAA 3CMMA 1X7GA 4CMJA 1DIRA 1QV7A 3OIGA 4H3VA 4QUKA 4UVHA 3ZHZA 5A4DA 1ZW1A 2EF1A 4Y8VA 1ZKMA 1JN0A 3LSYA 4B79A 4BQRA 1A4IA 4YRAA 4OJNA 5BSHA 1E3IA 4K9DA 4OKNA 2X0RA 5JMPA 3ZHBA 1I3MA 5DZSA 1HDZA 2GN8A 1YGYA 5TJ9A 1F14A 2PY6A 5ER9A 5KKAA 1VL8A 1OI7A 4J0FA 1U5CA 1AHHA 1UDAA 2UV8A 4PLWA 2Q1WA 2P9GA 3TPCA 1WXDA 4MINA 3I52A 2CVQA 3S2EA 3TL3A 1IPFA 4F45A 1YL5A 4RF4A 5L45A 4IXTA 3AM4A 4IUYA 5LCXA 3WLEA 4K6FA 1K89A 2YQ4A 3OQBA 3EVNA 3RC1A 1E7WA 2X9VA 2Z95A 3O03A 1VKOA 2IRWA 3LT1A 4D46A 2TMGA 5T6BA 1H6CA 4FS3A 3WJAA 4W7IA 1BG6A 1VPDA 2Y1OA 1P44A 3JQ8A 5ILGA 3GUYA 2Y0DA 4Q3CA 4R9RA 3C1AA 3PWZA 4BKPA 3FTNA 2O7SA 2VYVD 3ZWNA 2W2KA 3VPGA 3OETA 3OP4A 3RCBA 2R00C 3LC7O 2EP7A 2PD4A 1BVRA 4IJVA 3IJPA 4GKVA 4WLOA 5DN9A 1B8UA 1R4NB 2Q2VA 3BTUA 4FGSA 4HFMA 4R69A 1FDUA 5FEUA 2BFAA 1XU9A 5C7LO 2AXQA 2HRZA 3GDOA 3GNSA 4PLTA 1NASA 1IHXA 1UUFA 4XGNA 2QHXA 3B1FA 4GWKA 5A06A 4L4XA 3VVBA 3O26A 3GA0A 3JYOA 3WYEA 1E1MA 2HMSA 1Z6ZA 1T2AA 3GR6A 4BV9A 1BXKA 4R5HA 1SC6A 2VYND 1EQ2A 4B3JA 4C7KA 3D3EA 3AY3A 1E3SA 3C7DB 3DBVO 1KEUA 3IAHA 4Z9YA 5A1TA 1XG5A 1HSOA 2IEBA 2P4HX 3IDSA 4R1SA 3AU8A 3BTVA 3WWYA 2AMFA 1NWHA 4RPJA 4MDHA 4DXHA 5KVVA 2NU8A 4TQGA 1EFLA 1DHTA 3UHAA 1R66A 3LDHA 5B12A 4H7PA 1HDCA 1QV6A 4E2WA 4HV4A 1E7YA 4CMCA 1SNYA 4KUHA 4XDZA 5HS4A 1DAPA 4IQGA 4MVJD 2RHRA 3AFNA 4AG3A 5KWEA 1Y6JA 5A9SA 2GSDA 5IZCA 4I9NA 3SJUA 3K2EA 5ILOA 3AFMA 2UVDA 4PLHA 3NJ4A 3PYXA 4RVGA 3UCXA 4BKOA 3PJGA 4DLLA 2DFVA 2NV6A 4I9HA 2VWGA 2SCUA 4DQVA 2AEMA 4JQCA 3TF5A 1H2HA 4IJKA 2I3AA 3UUWA 1R4MA 4BOYA 1IHYA 4LISA 2EW2A 4BV8A 3L6OO 4XB2A 3IC5A 3RU7A 5BNTA 2YDYA 1MG5A 3GFGA 5DOZA 2V6BA 3GMDA 4A0SA 5A9RA 1R12A 2HQ1A 2Y67A 3FWNA 3WWZA 4TRRA 1LEHA 3Q0EA 4MIYA 4E5KA 2WE8A 1LDYA 3VH3A 1UAGA 2W2LD 1PQPA 3ZWYA 3U4IA 5G0UA 1NQOA 4MVJF 4GH5A 1U4SA 4GPD1 1BMDA 3QWHA 4CLOA 4NBTA 3S1LA 1WAMA 3WIDA 3ZW8A 1ZJYA 2JFFA 3I6IA 2FY8A 4RGBA 2UDPA 3I9OA 3EZLA 1P9LA 5DBFA 3KLPX 1JKFA 5TJHA 3DDNA 3DMTA 3PHHA 3K92A 1V0JA 4UUMA 1OFGA 1MXHA 4YJGA 4OH1A 1A9ZA 1YH3A 6ADHA 4ZICA 1QORA 5TT0A 3WBBA 1D1TA 1Z73A 4J1TA 4LK3A 1GQ2A 3GH3A 3ZNOA 4WLNA 3F47A 3JQAA 4IMPA 1N1GA 2X58A 4PVDA 5KTKA 1J6UA 3ZWCA 3JD2A 2IYOA 4IS2A 3K5PA 1ARZA 4TZKA 4YR9A 5EL0A 1CERA 3LLVA 2D3TA 3JQBC 1GYPA 5TT1A 4GGOA 3JQ9C 3RKRA 1GDHA 3F6YA 2VZ8A 4OYRA 4XYBA 1B3BA 3QY9A 1DFGA 4I5GA 5THQA 3IP3A 2VHWA 6LDHA 4IBOA 5IG2A 3GUCA 2FMUA 4JBGA 3LYLA 4PG6A 1YQXA 4CMIA 3OEYA 4NH4A 3PHIA 4BQPA 4IDGA 1P74A 2BFPA 3JQGB 5EQFA 5B4VA 3KEQA 3U4DA 3RVDA 2ZK7A 4G5HA 5F5NA 4DQUA 4PIVA 3JTMA 3GGPA 2C5AA 1HYGA 3HUDA 2WMDA 3OBBA 1Q7CA 1KBZA 2AA3A 3RC7A 5B1YA 4IPTA 1SEVA 3E9NA 1VRWA 3PK0A 5CEFA 4C4OA 3JSAA 4L0QA 2IODA 3U0BA 1XA0A 2A9FA 4CM6A 3WB9A 4MP8A 3G17A 4ALJA 3OM9A 3B6ZA 4WCDA 3JD4A 1LSUA 1KETA 4OOEA 2PD3A 1TLTA 3QP9A 4ZRMA 5A9SB 1VJTA 2CMDA 3PI7A 3R0IA 4BO1A 4IS3A 1T4BA 1U5AA 1I3LA 2JFHA 4BB6A 3OEWA 1L1FA 3FR7A 2O23A 5C37A 1I24A 1D8AA 4MKXA 1NTOA 4CM9A 2B5VA 3G1UA 5DCUA 4II3A 2Y0CA 3SEFA 4K28A 4ALNA 4MVJG 4RJTA 2ZQYA 1H9BA 1R4MB 1GZ4A 3JQEA 4RZIA 1OC2A 4E4YA 2P5UA 2BLLA 4MIEA 1DAOA 3ULKA 2NQ8A 4A5OA 4Y67A 4CMEC 3K31A 1C0KA 3F5SA 3UF0A 1UXHA 2FZWA 3ITDA 5EJ2A 2CY0A 2YW9A 1YDWA 2FZEA 1ZFNA 1FK8A 2ZJ0A 3HB5X 3K9QO 4FJ2A 1PJ3A 1ZVMA 3E9QA 1PL6A 1PS8A 3UICA 5CDGA 1OOEA 5L95A 3D5QA 3TFOA 2R00A 2EHDA 2FHSA 2QX7A 5G4KA 1ZEJA 4FC7A 3RUEA 1B7GO 1XEAA 1H0KA 3R6DA 4GAEA 2FP4A 4OXKA 5COBA 1OAAA 2IZZA 3S2FA 4PLPA 1J0XO 3INTA 3GG2A 2DTDA 3PQDA 2NACA 3QW2A 5L7YA 4XGIA 4BIIA 1VE9A 3JQAB 1U1IA 4HBGA 2VHVA 2B4QA 4KUGA 3R3JA 3DOOA 4PZEA 4NK5A 2HO5A 3WFJA 5ENDA 3VH4A 3E8XA 1E1KA 5IXSA 1EDZA 2Y99A 3BHMA 1ML3A 3W4KA 2VOJA 3EAGA 3Q2KA 4AJHA 1HT0A 3VC7A 3CH6A 2AG5A 4WLFA 2Q46A 1XU7A 1X14A 4HADA 4UREA 4YAJA 5EQDA 3U3XA 1BHSA 5JC8A 1WZIA 4BNIA 4XQCA 1WMAA 3IKTA 2O2YA 3RWBA 4I8XA 3GN2A 3W1VA 1NP3A 3E5RA 3V2UA 2VTDA 3R3SA 2LDBA 3TWOA 5JYDA 3D64A 4IDEA 1K0UA 1JAXA 1PSDA 4XZ3A 3DC2A 3DZHA 2ZATA 4S3MA 3RUCA 4E5YA 1MB4A 3DMYA 1PZGA 4LSWA 2DBRA 5L7WA 2Q1UA 4U7WA 3GVCA 3RQSA 2ZB4A 3GRKA 4JIGA 4PLFA 3W8DA 1WW8A 2NQTA 3KZVA 3QWBA 5L7TA 5TGDA 1Z7EA 3VTZA 4AICA 4YAKA 3L0DA 1NQ5A 4Z0HO 3GGGA 3Q1LA 5U9CA 5JAZA 4NDNE 4R1NA 3GK3A 4BO9A 3BHJA 5TF4A 1ZZEA 1PL7A 2X0JA 2CDAA 1NPYA 1EBFA 4YAGA 3LT4A 5JO9A 3I9NA 4FDAA 1YJQA 3JQFC 3BMQA 1U7HA 1TVEA 5A5EA 1EQUA 3VPHA 2PFGA 4EEXA 1U3TA 4CLRB 2ZQZA 2D8AA 4FR5A 4TZTA 4C7JA 1LNQA 3H5AA 5F21A 3EY4A 3O9ZA 1CF2O 1O89A 1VC2A 4ND3A 4CV3A 2BGLA 1UDCA 1YS4A 2EP5A 1UXJA 4M8SA 1LUAA 1KVUA 3MTGA 1YBAA 4ZVVA 2X6TA 4BNWA 4GWGA 1XKQA 1DC3A 1LBEA 3AUSA 1NVTA 2Z1MA 2NVUB 4DYVA 4Q3EA 4U6SA 1LDMA 3S55A 5IJZA 3KYDB 3QVWA 1E6WA 4Z6KA 3JYPA 1E7SA 1GEEA 3Q9UA 2QRJA 1ISGA 2NWQA 2PV7A 2RAFA 3H9QA 2C59A 2NU9A 2NU7A 1E3JA 3FR8A 1ZMOA 4NBWA 4PLZA 1YE3A 4Q3DA 3DZKA 7MDHA 2Y93A 1I2CA 2G82A 3WQRA 3KXDA 1NR7A 1C0LA 3JQBA 1PL8A 3BMNA 1S7CA 3JQ9A 4INAA 1UP6A 3KBOA 3F4BA 2X5JO 3PJFA 3PWKA 4JNKA 8ADHA 2OORA 1EUZA 3SLGA 2PZJA 3ONFA 4BNLA 4E2YA 4YJFB 1SBYA 1ZK1A 1W0CA 3VOSA 1IL0A 3PZBA 4Z9FA 3SJ7A 4KQWA 4EJ6A 5IZ4A 2PH5A 3MZ0A 3MJEA 1DEHA 3ZNQA 3L4BC 3VVCA 4JBHA 1DIAA 3CEAA 1JQBA 3WGHA 1UR5A 2FRDA 1GUYA 5L3ZA 1EK5A 3GN1A 1NHGA 1GUFA 1TT5B 3ZWXA 4IINA 4GLLA 1HKUA 1T2CA 4CQMD 2IZ1A 4L9RA 1HDYA 4L4RA 3NT4A 1LSJA 4J43A 5I7SA 3A14A 3GZNA 3OICA 4E6PA 2OO5A 1YL7A 4LGVA 4YQZA 1R37A 2OP1A 5JS6A 4EZBA 4IQ0A 4NBVA 3K73O 5A3VA 3IIEA 3HHPA 3G0OA 1W4ZA 3R1IA 3WMXA 1LDNA 3AY7A 4RZHA 1SEPA 3QJ5A 3KTDA 4PLGA 4XYGA 4Z9XA 4ALLA 3TN7A 2FPPA 1LRKA 3OECA 1RM0A 4LVUA 2Y1EA 4J4TA 2QZZA 2ZB7A 1YXMA 2I5PO 4EBFA 3LT0A 4YDRA 1FMCA 1CQJA 3GAFA 1P31A 3QWFA 3GY0A 2AE2A 1MFPA 4NJOA 5CG1A 5IDQA 5CEJA 2ZYGA 3TZHA 1X1TA 2RCYA 1I2BA 3DHNA 4IXWA 3BMQB 3MTJA 3O38A 1LC0A 3PGJA 3PXXA 4P4NA 2DVMA 4CMEA 3NUGA 3DONA 3WGGA 2D5AA 3DBLB 2Y68A 5HA5A 4YACA 1NQAO 5BSFA 3D1LA 2VZ0A 4RO0A 3GPIA 4WEOA 3L77A 3GHYA 1HE5A 4RPLA 4XYEA 5HRUA 1IULA 2WWRA 3SLKA 1HSZA 2X5OA 3LC1O 3AUAA 3KHUA 3ZCXA 1LLDA 4R5MA 3NKLA 2FPGA 4IGEA 4YA6A 3HFGA 5HM8A 4XX0A 1NHWA 2IE0A 3VDRA 4P4GA 4E33A 5FF9A 1P1FA 4YAIA 3GG9A 1RM3A 3FTPA 3NJ8A 4UVDA 4OQYA 4XKJA 4X54A 3VZQA 4PVCA 4CR7A 3QWAA 3U09A 1Q0HA 4ZQBA 3KSUA 4Z0TA 2OFPA 3BXXA 1Q7GA 2QRLA 1PJSA 1LDBA 1P1IA 2EW8A 1L7DA 1QMGA 3SX2A 4AJ4A 1N7HA 2NTJA 1NVGA 2BGKA 4YQYA 1AE1A 1B14A 1AN9A 5BNFA 2C2YA 3H65A 3L6EA 1U8FO 3TFQA 4WNCA 2VCYA 2ZJ1A 4MJLA 4BB5A 3GPDG 2O4UX 4XRRA 3WIEA 3H5RA 3JQ6A 4CLDA 4BKUA 5CDSA 2G76A 1JKIA 4BNVA 4UVEA 3VPXA 3DO5A 2QRKA 3WSVA 4CUZA 4AJEA 3AOGA 4PFJA 2J3KA 3UFXA 3U4CA 1DPGA 2DBQA 4RVUA 2ZTUA 1DFHA 4OAQA 3S2IA 1EBUA 3Q3CA 5HWSA 3HFSA 1ZJZA 4LCJA 1ZO8A 1LA2A 4FGWA 1W73A 1NFRA 4PZCA 2ZYDA 3OFSA 5AXBA 1ENYA 2BRUA 1KVQA 3JYNA 1JU9A 1U8XX 5JPIA 1JTVA 3TQHA 3VPFA 2W90A 3O4RA 3PHGA 3ZZNA 1H2BA 3JCZA 3OIFA 4ND5A 3HQ4O 3TL2A 1VJ1A 3WICA 1GY8A 2B0JA 2Q1TA 1H6AA 2H6EA 2Q45A 3JQFA 3ANLA 2W98A 4NFHA 4DBZA 2CVOA 3I3OA 3EGOA 1H6BA 4TVOA 4HNGA 1B3RA 1YBVA 2NVBA 2OL4A 3CE6A 1VL6A 2I6TA 3F4LA 3OQ1A 2PTGA 3JD0A 4XQ9A 3PQEA 4N7RA 3PYMA 4WGGA 4RF3A 2VYVA 3G49A 5LDGA 2PD6A 5BT9A 1E7QA 5JDIC 4R9SA 3INGA 3WNQA 2XXBA 1X1EA 4NK4A 5KJFA 2ZTVA 4LSMA 1PJLA 4UULA 4CM8A 1PTJA 1QLHA 2VTEA 2VWQA 1UXIA 3G79A 1Q1NA 1RM5A 2CZCA 5KCZA 3CSDA 1QYWA 4B3HA 5TLSA 4EJ0A 1DC4A 1NYTA 3PQFA 4YVFA 2UUOA 5B4UA 1O6ZA 1ZNQO 3T7EA 2GERA 5JSFA 4BO3A 3AJRA 3DEYX 3LLSA 5HBRA 2NADA 4FOSA 3K8ZA 4ALMA 2VYNA 1ZIDA 4A03A 1LX6A 1EK6A 3ZN2A 4AJNA 4IDAA 1T1RA 2Y1CA 1LDGA 3N58A 1PJTA 4WASA 3D3WB 4UUPA 1EEHA 3W6ZA 2JHGA 3W8FA 2J6IA 1F06A 3BZUA 4R1TA 3TZQA 1B8PA 2DQ4A 3NTRA 8LDHA 3H3JA 2EEZA 2RIRA 1E5LA 3L4BA 4QX6A 2QW8A 4N5NA 4RL6A 2DTEA 3OJFA 4IZIA 1D3AA 2WYUA 1E92A 3PZRA 2PWZA 2VUUA 1DHRA 1PJ4A 4HKTA 3AY6A 4ONEA 1KC3A 5BSGA 5FWNA 2W4QA 5ITWA 1BSVA 3HDQA 3NRCA 2V7PA 3HG7A 2FOIA 3HE3A 2VHYA 2Z5LA 3OA2A 1QKIA 1FXSA 1GV0A 3JQGA 3FBTA 5AQ1A 4D43A 3GVHA 4M87A 4YPOA 2D1YA 2H9IA 3IMFA 4Y6PA 3COSA 3RC2A 3WBFA 3PJEA
chains in the Genus database with same CATH superfamily
1UPCA 3PL1A 4XI9A 4RS3A 5DULA 3H2ZA 1ZIYA 1SQFA 3THRA 4F71A 1W36D 1I1OA 1LLUA 2P9FA 4E51A 2J8ZA 5HKAA 3ZUPA 1EAMA 1EVZA 1F3LA 1XVAA 3LCCA 3S2YA 1LXCA 1ISJA 3GRUA 4BFLA 2H57A 2C5SA 3JVEA 5BSTA 2ZXUA 3HNOA 3ZBQA 2ZS8A 3RNLA 5KPJA 1NBMA 1FIUA 1PAUA 2FYTA 4B3MB 3E82A 4I50F 1BHO1 4RIHA 4OLBA 1ABBA 1OLXB 1ORTA 4UEKA 3A4LA 1NBME 3K9CA 1TKAA 3AWDA 1DFIA 4CFZA 1GSAA 4KEAA 2GASA 2FDRA 4ESVA 2ZE5A 3M49A 2FSFA 3H2YA 3ZK7A 3CUTA 5DTEA 1DEOA 1UF9A 3TZCA 2GGSA 2DRIA 3NLLA 1CNEA 4EL5A 4LC9A 4NFSA 4A23A 5C53B 3C41J 1V6AA 3NVKI 1VGQA 2R8XA 3G3EA 4O4IA 3L7BA 4ZVMA 4KDEA 2BMWA 1DAFA 3WNCA 3TVTA 4RA9A 3RM3A 1K3UB 4U8GA 3SQDA 5AI8A 1QO9A 1L7AA 3QKRA 3QXJA 2Q3EA 2RI1A 5H81A 5BMVF 4NEGA 4BNYA 4I81A 4N7MA 4B6JA 3IEPA 3ZZ0A 1ABFA 4P3XA 2GTHA 3HDHA 5EE0A 4B9AA 1QO0A 3M81A 3F5FA 1Q20A 3D2BA 4G1EB 1T0JB 1KQOA 4R2IA 2BTEA 3E9CA 4U9IS 2IHNA 3U9LA 1E3EA 2B82A 2FR1A 5ECDA 4B17A 4DWJA 2DJIA 3LF1A 3RVPA 3TEFA 3LQ1A 4QQNA 5TPWB 1JW9B 3RTDA 5FR2A 2A5FA 3PVZA 4BP1A 3OE7D 5CT8A 1EXNA 1X74A 2LP4Y 1I01A 4G0OA 5FDFA 2V8OA 4RM3A 2FV8A 1YZTA 3THWB 3H2IA 4AUKA 1L5HA 4B6QA 2PLRA 4FK8A 1XZGA 3HPRA 4RX1A 5HR5A 3KD3A 3QE3A 5EJ8A 2NZ2A 3I4FA 4YLEA 2REXB 1Z2CA 1AA9A 2OFXA 5G4LA 1E6EA 2GEVA 2XUQA 3A28A 3C45A 3FWYA 3ADCA 4HWPA 3KG2A 4KODA 1AG9A 1T25A 1AKNA 4Y2RA 4F56A 2AJCA 5JZOA 2TRSB 2FWJA 2O5RA 2VH1A 4J7XA 4MUNA 4WACA 4MRSA 5KKCA 2Z4TA 3CW2A 5HIMA 4TL7A 3TLKA 4IOLA 3M6FA 1C7RA 3FXAA 1WJGA 1Y3DE 1TM7E 2BBWA 2I34A 2NO6A 3M2TA 3MS7A 3P2KA 4G26A 2ZDHA 4JLPA 3G8BA 4F8YA 1RAEA 4XQEA 2PX2A 1A9YA 1XPJA 4K2HA 3P0FA 1IUOA 2WG1A 5AJUA 4BNGA 2AFHA 1UT6A 1V6CA 3NVMB 5AK0A 2WJGA 4NIMA 4KR6A 5L4NA 2AFHE 2JATA 2FUEA 1OXBB 2EATA 4LBWA 2AWOA 2QJRA 5HQ3A 3T34A 2IC5A 3PWSA 5FB3A 2BF7A 4DC0A 1NMZA 3ZV6A 1PGJA 1YOBA 2OBLA 2OK7A 3CUSA 3LSTA 3ESBA 1VXRA 3F1KA 2WTAA 3NIBA 3U7JA 4ALIA 3VJMA 3CZMA 5LM3A 4JQSA 4JASB 3T5AA 4CQJA 1A98A 4PO9A 1VKZA 1D5CA 2CXQA 3CSSA 3MD9A 2NO4A 4JJGA 5L9AA 1SHZA 4JJIA 1JBEA 3EXFA 2VJLA 3BA6A 2B3DA 1RPJA 4KMSA 4QEZA 3ASUA 4FMPA 4BO2A 1YFKA 2G08A 3DPSA 4XVCA 4FFSA 3DVAA 1XEWY 2HNBA 3ZQKA 1M6EX 3LVQE 4O02B 4QSHA 4PN3A 1XMVA 5T64A 2O8DA 2C7VA 4A6EA 1O7JA 1JJIA 1LJLA 3ETEA 3H2HA 5B57C 1JLRA 1UFOA 1GNQA 4D81A 3DT6A 3DZIA 4KHPB 1W46A 5J1TB 4RAQA 5C35A 2O7NA 3HY4A 2J9FA 2KHZA 2CLMB 4LE2A 5KDLA 4YNBA 1W19A 3S1AA 1V8OA 4ZKDA 2XNDA 1C7QA 1RJGA 1NVXQ 2H08A 2MIIA 4MA4A 4RZSA 3SDZA 3T06B 3UAYA 3W6NA 1X1QA 1ZXBA 4JR0A 3BXOA 3CCFA 3AP1A 5MDHA 2D0OB 4GBMA 3U17A 1Z5GA 3AM5A 1Y34E 3RFXA 4TL8A 1JAYA 3STTA 1RLOA 3VAAA 3IPAA 2ECPA 2PRJA 4RD3A 2GM3A 2P9QA 1Q1ZA 2FF5A 4YX9A 3U44B 3CJTA 2JI4A 4ILKA 1A7AA 2PL5A 3OY2A 2NXNA 1XA4A 3HZRA 3QBTA 3O4VA 2BE7A 3F1LA 3P1JA 5DWQA 3ZK8A 5JDIA 4EM6A 2FG6C 3VNBA 1K2WA 1HDRA 1NBIA 3FPLA 3HN7A 1XAJA 4KWEA 4QL3A 4LX0A 5B1EA 3WWOA 2XTMA 2EQ5A 3IMGA 4RA9B 5B1HA 4Z2YA 1ISRA 3DEAA 3QVVA 4CLRA 1Y5LA 3QKRB 3CCBA 5EKSA 1NU8A 6NULA 1DCKA 3ZY3A 4AJ2A 2CXOA 1C1DB 1IFXA 3ET5A 3IKLA 1KJWA 5EERA 3KZCA 1JHOA 5EKTA 1LPSA 2BGWA 4M8NE 3ASZA 4EI2A 1HOXA 3ADKA 2BEKA 3KFVA 3OLVA 3IOYA 3R7WA 2IYFA 1XWWA 2YN0A 2GNAA 3CEHA 5FBVB 4DR2B 1SD2A 2VBFA 3RBXA 1CUYA 3R5HA 5AYVA 4ZXPA 2HNKA 3KYDA 3RVBA 4TT3A 1JWBB 1PV1A 1TKRA 2A0FA 3KKLA 4W5OA 1IJFA 4FONA 4UOEA 2JZCA 4H16A 4B6PA 5K99A 5FA8A 5KX5B 3OJLA 1VCMA 2YDXA 4GZLA 3SHVA 5K6RA 3SZLA 1AA6A 1NJ8A 3ACBA 3GPBA 4IO0A 2WYHA 5TRTA 1L5HB 3L05A 1JEQB 3I83A 3F6PA 2HFKA 3HCOA 3NOXA 4IMRA 2FOXA 1RCTE 4YJDA 3JVUA 4FZ3A 4MOWA 3IAM1 5D1HA 2ZQ5A 5F51A 5IM5A 2PUGA 1UFKA 2PZKA 1LJUA 4HVAA 2OP0A 4IIXA 3LQFA 4LHWA 4JEMA 3TR0A 3OZFA 4YHHB 2A5JA 3T5DA 4KQXA 2KW5A 2NTNA 1KJJA 2RGYA 2GCGA 1MC5A 1FCJA 4FZRA 1CZOA 1GA4A 2TMDA 2X6QA 3D8BA 3VX3A 4DKXA 5LNK6 1YK1A 4B6OA 1PLKA 3CCCA 3STYA 2XDYA 2EZ4A 2XCRB 3WGMA 2NN3C 3CUWA 3ELBA 3RFVA 1AGRA 3DE5X 3FBGA 2AFHB 3UK6A 4P7JA 3OJEA 3S8MA 3UUEA 3CZCA 5B1SA 1XCGB 4Y1EA 1U0HC 1OZGA 3NO4A 2CZGA 5FTMA 5LMNB 5JD3A 3LC0A 4OQMA 3DSRA 2QU7A 1UKVY 2Z6QA 3N28A 4D4LA 4ETWA 2BFOA 2OCPA 3OQIB 3F96A 2FCAA 1G6KA 3KPJA 4ZGBA 4EMUA 1KK0A 1G7TA 1OYYA 2DT5A 3LECA 4GX2A 3HSYA 4OCZA 4LOLA 5FBKA 2YMMA 3IXQA 2BM8A 5HCIA 1K4MA 4DR7B 3OCVA 2ZRLA 2HJVA 1FDIA 4B3TB 3EXFB 2EJUA 1P6XA 2OXEA 3HKEB 4PQFA 4BP3A 3DOUA 2H16A 5KI6A 3GDGA 3KWJA 5IUKC 1O9BA 2O8DB 5CEEA 1H3EA 2YNMC 1HPLA 3N53A 2II6A 3GJTA 4C87A 4F60A 3ZEIA 1TZKA 3E1SA 3GT0A 2CN1A 5CLGA 5THKA 3QHAA 4MR7A 3KSZO 3URMA 2M6SA 4LZWA 3S1AB 2AUMA 3W9UA 2ZZMA 4FX5A 1ZP6A 3P52A 4HGPA 3I8OA 2B6NA 1PJAA 1QQ5A 5DBHX 4AMUA 1R9NA 4UBIA 1DXQA 1CNMA 3JWHA 2YXEA 2O6HA 1SKMA 3ZHCA 3LY7A 4AO8A 4KK3A 3NGLA 3O2JA 1JSCA 2V3WA 3UK1A 4OG2A 3BIOA 4GP9A 4C14A 2CB0A 3ESRA 3FJYA 4P5DA 4L95C 3HU5A 4NMWA 3SIPA 1AKEA 4RIGA 4N76A 1U28C 2PUFA 2DZDA 4PQEA 3IKMB 4UBLA 4DTIA 3CRMA 1JDTA 2HCFA 1MOQA 3IP5A 1J09A 1Q50A 1SCIA 2YVAA 4HQLA 5CH3A 4GOOD 4ZREA 4AF8A 3PEEA 2RGAA 3QY0A 3DBLA 4B5LA 1D0VA 1SURA 4W99A 5ILQA 2HW8A 2AX3A 1Y1PA 3A6FA 4RDIA 1YBHA 4WWHA 4WNAB 4EGQA 2ZIUB 4PNEA 3ILVA 3O75A 4L5YA 4DVJA 4FBLA 3I6QA 1KH1A 2XMRA 1KH3A 1R16A 4HN4B 4GI5A 4WMLA 1ZX1A 1XWIA 3SC4A 3SQOA 1LTQA 2AI1A 3NHYA 4GF5A 5JNLA 1KQGA 1Z35A 4EJFA 2EZ9A 5IULC 1WEKA 3USZA 2IYVA 3KM0A 5TMEA 2FN3A 4DGQA 2NO1A 3FZNA 4HDMA 4IDNA 3DV2A 5CYPA 4YY3B 3VBEA 3MOIA 1KORA 1X7YA 4EKNB 2JLXA 2IHTA 5HF5A 4C1BA 3UBMA 2GVDC 4H4EA 1HQYE 1Y7HA 4OGGA 2PJDA 1ZWLA 2VZEA 2W48A 2C5GA 3G6WA 1P4AA 3R09A 3GEHA 4JLMA 5E2IA 5EIAA 5FPYA 4CM5A 3I2KA 4DSNA 2OD7A 4BLTA 3EQ7A 3IP8A 5DJ5A 4QDJA 1TU4A 3KPWA 4KAAA 1V7QA 2R2GA 4NYJQ 4L3WA 4YBZA 1ULUA 1YR6A 4P7BA 5FOXA 1Z2OX 3OF2A 4G84A 5A7GA 3ROQA 4AFNA 4AY2A 3II6X 4FYJA 3RROA 3D0OA 3NM4A 4C04A 5DLPA 1FJGB 1JYFA 2V7QA 4ZOCA 4B75A 1K66A 2R2AA 2RHTA 1J33A 3M2PA 4MA5A 3Q0IA 4AKSA 2VP4A 5CAEA 5JNSA 3UTCA 1ZNYA 5G02A 4R31A 4A5SA 3M6IA 4K86A 4MQFB 4PYQA 1GL7A 4QU5A 3VAZA 3LC2O 1F60A 1P2BA 4RTNA 3U7GA 4LY3A 4C21A 1QIIA 4GYYA 4PBSA 2PUCA 1LS6A 3JWIA 4CM3A 4JGIA 4U0KA 5I9TA 2JBAA 3U26A 5CFQA 1T5HX 4QELA 4UOZA 4DA4A 3ZJVA 2R1TA 2H29A 2RHHA 5GAJA 1WG8A 2WU8A 5CUQA 2AMJA 1JZQA 4JJKA 1MT0A 5AI5A 3UKOA 2FEMA 3OKFA 4EF6A 4B1FA 1Q6YA 3O8QA 5F2OA 4DB2A 1B6GA 4Q3BA 1XTRA 4G1FA 5AVKA 4G4SP 2PAFA 3KSDO 3VR3A 4HH4A 3ASVA 1BW9A 1XRSB 4JLSA 4C7BA 5KOHA 4UNNA 1EAYA 2G72A 1YR9A 1QLWA 2D54A 4OLFA 5JXJA 4JVSB 5LYJF 1KY4A 1U11A 2Y77A 2DFPA 2O2SA 3QE4A 4KXLA 5I9BA 3TZ6A 1HFJA 2NAFA 1TXGA 3SHOA 3V4RA 1QDUA 1JHYA 3ORSA 4N54A 4DCSA 5BP7A 4MYDA 5LP6A 2IYAA 3AX6A 2VZ9A 3QYJA 1T24A 3ISVA 2C9ZA 2W6NA 5I7WA 3ZEAA 1JIQA 4LDJA 2A9QA 2P4UA 1QIDA 1CPYA 3ADPA 4HXYA 3C0KA 4I55A 3DE6X 3WX0A 3A2MA 2H17A 2XDWA 3QMVA 5JAOA 4KWIA 3HNRA 1OXTA 4JHXA 4C0KA 1LK5A 2D7CA 3DZCA 2XT9A 4OQZA 1XNGA 2XKKA 3MT9A 4TTIA 2L69A 4ZI7B 5IXJA 2WM3A 4MMYB 5EMHA 4PCVA 4RHCA 3VDMA 4BHTA 4DBVO 1UP7A 3AF2A 3R0VA 2NSJA 3D8TA 5KNCA 1T3TA 3H1EA 4GMGA 4I6JA 1R9GA 4M9UA 1FSFA 4V1CI 2Q21A 2QRQA 4XYMA 1RYNA 4O5OA 4MVCA 3HR4A 4HYQA 2PDAA 4BV2A 3T4EA 1SKAA 1GFZA 4AVYA 3OZTA 3LPLA 1X9GA 1TEHA 3FMVA 3S28A 4REOA 1T5BA 2DUMA 3FDZA 1FYEA 2P8SA 1KP3A 2JGLA 3DTTA 4BZWA 2AFIA 1HY3A 1FRVA 3D81A 1X0XA 4EPRA 2DTXA 1E1NA 1F0YA 1ECPA 3H04A 4WE3A 4CYMA 3GFOA 5K3FA 2AFIE 1E3LA 4B46A 1TT7A 2ONZA 3RFFA 5H3CA 1Y33E 2A67A 2ZI4A 4LEIA 4UPVA 4C20A 2BKLA 1SA0A 1ZIPA 2JFNA 4J0EA 2ZBPA 4QVIA 3H1BA 2JDIA 3UTDA 1X77A 2M32A 4KNWA 2WV7A 2KPOA 1FOEB 1MQAA 2OCAA 4GBJA 4DPLA 2GCIA 4FYHA 1E99A 2YW2A 3VC2A 3EARA 1Z8HA 4FE7A 1E9FA 3FYTA 1XSEA 4GYWA 4JJAA 1X7YB 1B8VA 4UPEA 3LXUX 1IVNA 4WX2B 4RKQA 2AKYA 2QE7D 3ABSB 3D3WA 3GXBA 1WXEA 2OO3A 2P9EA 3NIWA 2H0RA 2HU2A 4YMWA 1C0IA 4QXAA 4Z1MA 4MICA 1DS6A 3L6UA 1EXVA 5EKDA 5EJFA 2NU6A 4JL6A 3IA7A 1O96A 2XE7A 4JP2A 4MR8A 1ZJJA 3I1JA 2XTZA 3PTZA 5FOUA 1Z7BA 3UWKA 1E60A 4CFSA 3UT0A 1I36A 3BFPA 3ZIUA 3ZHRA 3EUFA 1KEWA 1N6LA 3ND8A 5J4LA 3P19A 3AJDA 1TI7A 5BQOA 3W04A 5C31A 1P0MA 4PO8A 2C5FA 4KTTE 1BGXT 1T1GA 1FNSA 3OOWA 5CAEB 1KVTA 2OCDA 2I4MA 2PS3A 2QSZA 3DEFA 4FSXA 5LBUA 3FLMA 2PGLA 3L4SO 3WTCA 3RC8A 2VAPA 4ZZ2A 2QLJA 1TTQB 4ZYUA 2V7TA 2VNKA 3DMPA 3R7FA 3QVOA 4RFVA 5FFFA 4DRYA 2ZJ2A 3EUEA 4IVRA 1T2DA 1TJ3A 2GMWA 4WLEA 2H4XA 2KE5A 3LDUA 3O9MA 5ICSA 1KAMA 1T8PA 2MDTA 1SC9A 3AB3A 3QUQA 3T0GA 5L3SB 1O9GA 3AW8A 3DZGA 4WNIA 3A04A 5C81A 2R1TB 1I6WA 1H22A 1XE3A 2G9UA 5CFLA 3EPJA 2H51A 4JYZA 2BW0A 2IU0A 4AUNA 2O8BB 3CW8X 4WVLA 3O8QB 4BMPB 1LI5A 2A86A 2MSEB 5HBGA 4NYIR 1BTOA 2Z04A 1DT3A 2Z6VA 4DC1A 1BW9B 1FY2A 3FNIA 1O2DA 5KOHB 2CYAA 3GDHA 4IVNA 2H7XA 1XD2A 1XDZA 3KQSA 2VSQA 2GAAA 1KMIY 3TGLA 3L0YA 3REQA 1S2OA 4RJ2A 3ZH9B 1UT8A 1SZJG 2ZBQA 4CI0B 4ECAA 1T9HA 1RIIA 4O4HF 3V9PA 1L7PA 1N0WA 1PJZA 2OE2A 2Y2VA 1BROA 1DQPA 2HJSA 1J42A 1QNFA 2BFWA 1IM2A 1ZUD1 4BJHB 1R5BA 4EI7A 1SXGA 4I55B 1HV8A 1N4DA 3AWIA 3KQKA 4KPEC 4J4BA 1MVOA 1N78A 1QBKC 1F9AA 5DYTA 2GXUA 3FI0A 2EZTA 4WOCA 4TSRA 4DJTA 2YIVX 1DBWA 1XDGA 1U9IA 2HGZA 3Q2IA 1AQLA 1QG0A 3OZDA 4G97A 5DF1A 4HUQB 4Y6RA 3H1PA 3PJDA 3HBFA 1NQUA 1PGNA 2IE8A 2PLAA 3RARA 3A9UA 4RHYA 3DHEA 3DFIA 1E5QA 2ZYWX 1HDEA 1XXHA 3M1IA 3ODPA 4FMCF 1M2OB 4UASA 4UHBA 3ZI0A 1V37A 1C41A 4K6CA 5U1PA 3H6GA 3QLUA 4KW7A 2WWXA 3SZRA 2XWPA 2D2IA 3QVTA 4NATA 1IWBB 1RBYA 2LZ0A 1BOOA 4YI3A 4AO6A 1MPXA 2BKAA 3ONEA 4OK6A 2Q4EA 2Z2YA 3FH0A 1ZH6A 1DAGA 5THXA 4Q3OA 5HKOA 2HR1A 2AGVA 3UW1A 4AJPA 4IZHA 4RPIA 4Z4CA 2JD2A 5K3FB 1DRUA 1XDBA 2O0MA 1Y42X 2QTAA 1YASA 4R6WA 2XYHA 2Q7XA 4GI1A 1RAIA 1UH5A 1KDRA 1SA0B 2VJKA 5B58T 3REOA 3OQPA 3H2JA 2PBZA 3HVHA 3L4KA 1Z74A 1EFDN 1DUSA 3M83A 1EYZA 3O2QB 1D8TA 4EW6A 4L85A 1PWXA 3I01A 3BWEA 4JP3A 2JCVA 3PICA 4GMFA 2HMTA 5EWMA 1E1RD 1ZK0A 1K88A 1OLUA 2GEDA 4G8BA 4KAJA 1POXA 4RF5A 4Z8XA 3VHRA 4IIJF 3A8TA 4D82A 2D7JA 3AEQA 1EX1A 1QIGA 3JQRA 2AWNA 4MI1A 5K6AC 1N2JA 2AEEA 4O4LF 3WOVA 3QX9A 1NDUA 1NRIA 1NKVA 3KJXA 1CLUA 3JWPA 2BI7A 3DNMA 5AXAA 3FNEA 5ENZA 1QQBA 3SQXA 3AM1A 2W2OA 1VSBA 2R6FA 4IQ8A 2WTBA 2QQ5A 4REQA 2QQGA 5FXMA 3K1ZA 1CEEA 2D1FA 2PMBA 2WYWA 1XTZA 4QXRA 4W5WA 2EJVA 1MRNA 3L1JA 1N2IA 4L2IA 3VH1A 4TWJA 3DZDA 2DX7A 4KBYA 4TXMA 4DCVA 2HF2A 1Q1BA 3JWEA 4MWCA 5LZ7A 2VAVA 3TQQA 4CRWB 4RW0A 1CFZA 3JQ7A 5BOSA 2ILVA 2HLNA 3B1KA 2IA5A 2UVPA 4B8ZA 4MVJM 3K9NA 4TWRA 5EZ6B 4NPCA 1BX3A 2WD7A 1A5TA 3VDNB 3OBIA 1YCGA 4LQLA 3R0JA 5DNDA 1CUDA 1EMDA 5FOTA 3VI3B 4EUKA 4LRXA 5LZ9A 1ECCA 5B2EA 4FFMA 1T5IA 4MRMA 3HN2A 4PZDA 3SIRA 2B9EA 3B70A 3C3MA 1EDDA 4HLDA 4J75A 5B2ZA 4TTTS 3WGKA 2C4VA 3SZMA 4R2MA 1U3WA 1CV2A 2CV0A 2FPXA 4R16A 4PN7A 5TV2A 1IXRC 3DLTA 3FCYA 1MABB 1TA9A 2QPAA 1DB3A 4M4SA 4DVGA 4CEJA 1E7RA 1JEAA 2WZDA 2XBUA 3FNBA 4YJHB 3RUAA 1JZTA 5L6MB 3UMJA 3B6IA 3S8YA 3ANYB 3UMFA 2OHHA 5TXGA 3RVRA 3REQB 3EXIA 2CDNA 2CK3D 1YONA 1CUSA 3I5MA 5T3UA 4CCSA 4RTSA 1C1XB 2IZ6A 2VNHA 3CKKA 1N77A 2FF7A 4NI5A 1CQZA 1PWYE 3BJZA 3B6JA 4F9TA 2PK3A 2RAPA 3C4QA 1GPJA 1PFUA 1EXDA 2ADOA 4US2R 1LLQA 2PGNA 4PSAA 3V8PA 2W9XA 2ZRNA 4RKYA 2NO0A 1RPNA 2G0AA 3WMEA 2IH2A 4KGDA 1XB2A 3EAQA 4K3UA 4OM8A 3ZQUA 4J0DA 3SQMA 3VTAA 1P1KA 3A6LA 3QQPA 1OFIA 2XNSA 2X77A 3BK7A 3F5MA 3ITNA 4JAVC 1ADCA 4P8RA 5CBPB 2W42A 3ESAA 2JJ2A 4LZJA 3OLWA 5EHXA 2FLKA 2Z43A 3UEOA 1FS6A 1V1MA 3ZZUA 1XXHB 1VSVA 1P33A 2FSUA 2NXEA 3CIFA 3ETHA 4ID9A 3ROXA 4ZCIA 1A82A 3P0EA 3CZAA 3W6OA 1G8SA 2DR3A 3EWSA 3WHLA 1EFAA 4UTZA 1AQJA 4X7MA 4FN4A 3UHOA 4EQ6B 1M67A 4P31A 1GT6A 3N0RA 1VOTA 3BTSA 1F8UA 1YQGA 3LNCA 4P93A 4BLWA 4ENUA 2E4VA 1L7VC 1QAMA 2DKNA 2F7SA 3O7WA 3MTIA 4LWPA 4O2BF 3NOOA 3TD2A 4A6XA 3RBAA 5JHGB 3VKGA 5K5EA 4J29A 4LDRA 2G1UA 3WKBA 3H11B 4OKIA 1NJ6A 4M9XA 1NXQA 2IXAA 2WD8A 2DM6A 2YVUA 3B1ZA 3HFJA 3K0BA 1T34A 2YUTA 3SIWA 3CKLA 1QE3A 3UXMA 4QUEA 3FKSD 4W6QA 5FTWA 1ECBA 2WFZA 1TQ6A 3MWJA 5FJJA 4BP9A 5IT4A 4XOIA 3T1YB 2ZUBA 2AI2A 5F9MA 5J3JA 3BXZA 4GOXA 4G5FA 2NP6A 2QAJA 3CTPA 4C0XA 1Q95A 1MO3A 3NWEA 4P53A 3HP7A 1EWTA 5EWMB 5B53A 4M1ZA 1OLUB 3ZV4A 5BN5B 1MR3F 5K8TA 1JBQA 1YCHA 1ZITA 3HDTA 3ZGYA 3AEQB 4C5CA 4R6XA 2R6CA 4QLAA 4IJ5A 2O2JA 1SU4A 5JVDB 1V5FA 2YJ5A 3TIIA 3VU9A 4HR7A 2ZTSA 1G6Q1 4BMOB 4REQB 1GYQA 5F4BA 4E22A 5HE8A 3RH0A 1PNOA 2W7TA 4MCHA 3SE7A 4AZTA 3DS8A 4L2IB 1OZ0A 1GL3A 2VTVA 2WWGA 1J5PA 3P9YA 6Q21A 3R7NA 1C80A 4KYUA 2VHXA 5HIJA 3K0AB 1F12A 1OREA 1RWVA 4FJ1A 1U80A 2UVPB 1Q91A 1R10A 3BWVA 1Z3IX 3QOXA 4IGKA 2VJOA 3H75A 1ODJA 1VECA 3E0QA 1ZSYA 2APJA 2J30A 1UC4B 1F51E 2J6HA 2WEKA 3N07A 1E96A 2TS1A 3DVLA 1S2GA 1XLTC 3TBHA 1FYWA 1KFCB 1XHEA 2HWWA 5DH9A 3FRIA 3SYRA 3IMEA 1QE0A 3QF7A 2QG4A 3VKVA 4XPZA 1J9GA 4XD2A 4RQTA 5L51A 4MW6A 4YP1A 4XDYA 2BCEA 1O94A 5K2MA 3UB2A 5B3JC 2EAUA 2VUTA 4IO1A 1JF8A 5K3SA 1NNSA 4OY3A 1M8KA 2WHXA 4GL4A 2OM2A 3UAXA 1RXVA 1GR1A 2EFEB 3JR7A 2G88A 4NCXA 4XGQA 3OOEA 4KAXA 4A8JC 5JEEA 2DMRA 1G291 1QRAA 2EGUA 2PZLA 5TDHA 4JFAA 2IXBA 3A1NA 3JD1A 4RQUA 4EO9A 1CDDA 4ZA2A 3ZNNA 1W87A 2ZYHA 2AYYA 3L84A 5EGSA 3PC4A 4Q4DA 4LVCA 3VU3A 5KWJA 1HE2A 4N18A 1XTBA 5ELXA 3V7WA 3BWCA 1VJGA 3NHKA 3ZBTA 2I66A 1PJRA 2A0KA 2ZRIA 4NU6A 4UU0A 3UGTA 3WO0A 1C0EA 4RTOA 3CVUA 2VNAA 4AS2A 4HWGA 6CHYA 2ODPA 3H2SA 5EG5A 2P2GA 4CV1A 1BJRE 3P2EA 5HUHA 2H11A 2V55B 3IQDB 4Y9DA 1CF4A 4R1OA 5JDCC 1NBHA 1OTYA 1L7EA 3MJ4A 3CO5A 3H4VA 3A36A 2X23A 2IPLA 3R5TA 5SZJA 2QDXA 3KNZA 3EY9A 3LUFA 3W5UA 2NMVA 4TKMA 1ENOA 2FPSA 3SLRA 1V1MB 3BCUA 3ZGNA 2JAUA 1NJSA 4LOAA 3DZJA 3A6ZA 2V5AA 5IT0A 4V0RA 1FS5A 3OU6A 5AIBA 1ZH0A 5FPKA 1V7ZA 1PR3A 3K09C 1XZJA 3RI3A 4X45A 2QVXX 3K0CC 1IY2A 4EY6A 3QVLA 2GZ2A 1TZMA 2O50A 3I0NA 4UTPA 2N75A 5M34A 2IDMA 2OZKA 4QBKA 1QV9A 3L7MA 2EW1A 2AEJA 4YAEA 2H1RA 3ICPA 3HVIA 3C1TA 4PRKA 4ZAFA 2VPIA 2E4YA 3LOQA 5DT2A 3IL2A 2RJ3A 4XASA 3GJ0A 3KUKA 2I55A 1AUQA 2WVAA 4CW7A 4RD2A 4C7XA 3RYHA 4D0NA 3BWYA 1QFYA 2HCTA 3DCNA 3TFWA 2J7KA 2OGZA 3HACA 3PQ8A 1T0PA 2XUPA 4Q4AA 3IP7A 2VQSA 2JARA 2JJYA 2ZVQX 5EZQA 3T4PA 2GK7A 5F7OA 1FQOA 4CM7A 1QQAA 3KZOA 1EFPA 4J6FA 5TC4A 3FNGA 4CKWA 1DJQA 2F8TA 5F2EA 3FOCA 3OQMA 4YMUA 1Q6ZA 4U5QA 3UBTA 4BMDA 4Z3DA 1I2ZA 4L50A 1HETA 3A37A 1EZ1A 2O8EA 1VE1A 3AR2A 3VU9B 2G7MC 3E18A 1FYFA 5KVSA 3RF6A 1FDSA 1YQDA 1NBOA 1O6CA 3EWIA 1UBNA 1FTSA 1FNCA 3ND6A 4KO4S 3CG0A 4MWDA 5CIWA 3WGTA 1IN7A 4DUGA 3LP8A 5FRDA 1E6MA 1GG2A 1VE5A 2WABA 2X14A 1E3TA 2IQ5A 3AHDA 4LDPA 2VDLB 4X93A 5BUZA 4HDSB 3ZIAA 2DH5A 3DHWC 3DB2A 3MJCA 3OSUA 3KXPA 3IH5A 4F5ZA 2IBTA 1J1UA 1RM4A 3UW3A 4OD0A 4ZU1X 1GPBA 3AVTA 3E6AA 5D87A 1XR3A 2VA9A 4IJUA 4OVKA 4ZQGA 1IG0A 3ENVA 4BNTA 5I9NA 3LW7A 3SYKA 1I7SB 3H84A 2J3EA 2VT7A 3ZKAA 4DR3B 3K4QA 1A2BA 1I4OA 3FFAA 5CLFA 5J4VA 2D5IA 2GN1A 5GWXA 4AW9A 3FUVA 4FQ8A 3JYLA 3A9TA 5AJTA 1XJWA 1CZKA 1MN6A 1JMVA 2W6CX 1QB7A 3ZK9A 2PUEA 4RGQA 2FPIA 1NLZA 2ZPUA 5HDBB 1AXGA 2YV4A 4KP7A 3T3GA 4DBLE 5K8IA 1FPQA 1GCUA 4PNHA 4JB3A 4WA8A 4X91A 4CMIB 3QEMA 2QTZA 4YRMA 3AG5A 4ZQFA 1RE1A 2Q5IA 4KGVA 4NNOA 2C7OA 2QLBA 5ARCA 3WWDA 4MWSA 1X15A 1Z2DA 2H2DA 2QJOA 4RTKA 1IRIA 1ZVVA 3EFOA 5GIPE 1U2DC 1H65A 2ERYA 4JB8A 3AKEA 2EIXA 2COUA 5TX7A 2UYOA 5CT5A 5EZYB 2PMCA 1OIXA 1PZMA 4CKCB 1M83A 1SN7A 2AH5A 1XZPA 1UQTA 3EUWA 4BRZA 3RODA 3ZWVA 1N5MA 3O82A 3LXRA 1W2GA 4KKVA 1DIGA 1WZCA 1H05A 3DB1A 2P2SA 1LQTA 2PUVA 2XWQA 3HYRA 4JL5A 3H5IA 3RUIA 1Y37A 5BW5A 4OL9A 2AKEA 4W5JA 4WKBA 5GVRA 2QJWA 3QFTA 5JRDS 1N36B 4G9EA 3K0SA 2VK1A 4QXOA 4DR4B 4L4SA 1WY7A 4OGWA 4P83A 4XVHA 4QSMA 4G0QA 3AFGA 3CNQS 3W2FA 2PZFA 4F86A 4S12A 4D57A 1MHTA 2VVTA 1Y80A 1N34B 1EFHA 1DTSA 3KTAA 3JWGA 4CMHA 3ZVKA 4IOMA 4R05A 4Q1BA 2FN7A 2A0UA 1K8QA 1Z4NA 1DAKA 1MT3A 3C16C 4AY3A 2XITA 3KUDA 4FKBA 4DWVA 4R2XA 2QTMA 4WJZA 5HPYB 3NEPX 3IEMA 4LI0A 3QW4B 5AJZA 1IM8A 4LC0A 3THSA 1AGYA 1FVFA 4ND8B 1WLSA 1X7HA 4OHVA 3JXEA 3LHSA 4MHTA 3OJ0A 2QGNA 4C6TA 3BQ9A 4P38A 2G77B 4X44A 1KO7A 4IFEA 2RGRA 1P18A 3R4CA 3DAOA 5IBRA 4YPFA 4IKOA 3K16A 1G63A 4XVUA 3BYZA 3THYA 3WGJA 3TAXA 4E21A 4CE6A 3PEWA 4HWKA 4OMUA 2R4QA 1JDNA 2ODQA 1RRVA 4Q4AB 3RYFA 4KXVA 2JAPA 2IOQA 2XUOA 3R7SA 4TV8F 3ZY2A 4WXEA 3LI2A 4JX8A 2CHEA 3PCXA 3VH2A 2JFWA 1RHKA 5JZVA 1F8GA 4IHKA 1TLFA 1QP0A 3NHJA 4CKWB 3RQIA 3LY9A 2Y0BA 1NVEA 4IMIB 1J06A 1ZJWA 1LVUA 4LXIA 4N6GA 4L76A 4B7ZA 3LT2A 3ORYA 4YO7A 3R24A 1OFTA 4H6XA 5CT9A 3WFZA 3WG9A 4BRUA 2AOWA 4B3JA 4X64B 2YZKA 4W6ZA 4Q7KA 4QOEA 5LUAA 1F5NA 3DQZA 2NYAA 3WGOA 5AVWA 3DAPA 3O1HB 3IP6A 4K9PA 1AKWA 1Y7TA 2E48A 4IOJA 2VYQA 3ESQA 2ONCA 2AVNA 2P91A 3EK2A 4Q9LA 1DKQA 1H8HA 3RU9A 4IHJA 3S7ZA 1OB2A 1MJGA 1OXUA 3DH0A 2YXBA 1RVDA 3AOEA 3CUVA 4GGMX 4TV9A 3QTLA 3NYRA 1ZU5A 1UKYA 1MGOA 4P4SA 3TLEA 1X7WB 2HWYA 2OAQ1 4N5MA 5J2TF 1TM3E 3N2KB 4I7EA 1EFVA 4UBNA 4PEVA 3S0JA 2D6FA 1YZVA 4EYQA 4KN9S 3EDYA 2FWMX 3P0HA 3UMBA 3R5KA 3B2EA 3U7IA 3MGCA 4P3NA 4LHVA 2JEYA 4E2ZA 4CV2A 1E20A 3MC1A 2DLCX 5A4KA 3PEVA 5IF9A 5KC9A 2NZUG 3WK4A 1ZLYA 2CJWA 2RGGA 3EGXA 2BELA 2Z4SA 2ZAMA 2V03A 2CXXA 2HCJB 4CTJA 1BCRA 1G4HA 2FPIB 2O8FA 2O3QA 3FW1A 1C7FA 3NTOA 4CTKA 4RESA 3I9JA 4ITVA 1TM4E 3NEYA 1WNTA 1XTPA 1NJFA 1T91A 4JS0A 4X97A 2IYLD 5LJLA 5LQAA 1KMQA 1GU7A 3D3KA 1BVHA 4GKKB 4XD7A 4JY7A 1BKDR 4EJSC 5ES3A 2P1ZA 3WGIA 2N47A 5DOVA 4AROA 1KNQA 3LUJA 3F46A 1HNXB 1JJBA 4Y9UA 2H5LA 3EFOB 4IEFB 2O4CA 4UMEA 4BLPA 1VJ0A 5CXSA 4XJTA 2Q5OA 2XCLA 3DLIA 4EFLA 2ZXEA 4EY5A 1NBAA 1Z5OA 2C2OA 4O2AB 3SXPA 4AS3A 4UDNA 4B8WA 4Q15A 4GP6A 1I32A 4XPIA 1A2OA 2OD2A 5IK2D 1G18A 4F8JA 2J0UA 2C88A 3ZV3A 4FYKA 3EULA 1Q74A 2WILA 3A11A 4I4TA 2AN3A 4EMBA 2QLNA 3D3QA 1U7TA 3EPPA 4GOLD 4K8RB 2V7GA 1ZMTA 3WR5A 4TWAA 5KVCA 4ZDWA 1WDKA 1GQQA 3PKIA 3ORFA 4EAQA 4PBTA 4O4JF 1JR3D 4FKMA 3NHPA 3D3NA 2EWMA 3FCSB 2XA1A 1RWBA 2UXDB 8MHTA 1PVDA 5CX4A 1K75A 2P5YA 4RF2A 1Z7GA 5FD8A 2VBIA 4EHFA 3VVLA 4C3ZA 1ZBQA 2I9KA 1G1AA 2D0IA 4ZYZA 2FPUA 2YHBA 4LF6B 4M21A 4CQNA 2XMQA 1TJ5A 1ENPA 1QONA 3RABA 1J5XA 1SIBE 2FRVA 2Q5FA 3O9VA 4MNTA 3IOEA 4IWYA 2VDRB 1VPVA 4C6TB 2RH8A 4EB0A 2JFXA 1MF7A 3GNQA 4XJSA 2UUPA 3SQNA 3FYUC 3OZVA 3EOAI 2EGGA 2PNFA 1Z36A 5BRJA 2FU5C 3BBPA 3CB4A 4R3UC 4MKZA 2GPYA 1IJBA 3PUJA 3UMYA 1OPXA 4OU4A 2QX6A 3AUXA 2AW5A 1ZK4A 1L4HA 3UQZA 1SD1A 1Z13A 2GLTA 5M5BA 3RYFB 3U13A 3NXKA 5M29A 4Z9BA 1LV7A 1IM5A 3H5TA 2B3TA 4FPXA 4A8TA 1Q14A 4DG5A 1W1UA 1GCGA 1Y0BA 2C5LA 1E1CB 2D1QA 4B6SA 4KR2A 2NU7B 4FLEA 4HAZA 4WLVA 1MZPA 2O05A 1TQHA 4NPHA 4OOFA 5ARBA 2AHRA 2VN8A 3AR8A 3WSWA 3G9XA 1B1CA 6ADHA 1HNNA 2CXNA 2C0CA 3B9QA 4UAGA 5EFZA 2ZWVA 4FFLA 4QTUB 4GE0A 4I46A 3V1LA 1J2YA 2C2GA 4PQRA 5ALKA 4K0RA 3UC9A 3WA7A 3LX6A 2R6HA 4BXOB 3PQ4A 4IHJB 1YQEA 2QUBA 1EE2A 1RRKA 2O3SA 4PYKA 2O9JA 3GEMA 4QFBA 2NPFA 5HJ5A 5JZBA 2VJNA 2FJPA 1T2UA 2HHHB 1FXWA 3OZBA 4GQIA 3PQ5A 4UVIA 1I9CA 2VJPA 3RC9A 4A3SA 3QLJA 4CJXA 5K3DA 4DEVA 2Q6TA 5DX1A 1EFVB 3A06A 2YV1A 4LCBA 1YJ5A 1U0BB 2MWMA 4M9ZA 5TIIA 4KV9A 1J22A 1K92A 2NZXA 4Q01A 2VJAA 5EUBA 2CLHB 3OJXA 2CJWB 1F0PA 2BFEB 1WETA 3K5WA 2ACEA 1BCRB 4A1FA 2O8FB 2DCUA 3I2GA 3N5CA 5JI2E 3NUQA 1ZH8A 2W37A 1E3WA 1E0DA 4N40A 5C4IA 3GZNB 4ZMBA 1I3KA 4BNJA 3E3NA 4B7XA 5A7HA 2ANCA 3PFHA 4OJYA 2FUG6 4GPIB 1AUXA 1PNVA 1O77A 1YACA 1T9CA 2FW8A 2XADA 1S96A 4UVGA 4RH0A 3L8YA 2FP3A 4HDKA 3FN4A 1GITA 3GDWA 4D92A 3ND5A 4YXFA 2XA9A 1VI6A 2D62A 3IKVA 3O94A 4B3DA 1FMJA 1OFUA 3K1TA 5GZ6A 1WP4A 4DRXB 2JGAA 3ANNA 3IS3A 5I7EA 1GUZA 3KHTA 2YL2A 4DLZA 2PKQO 3MJHA 4QULA 4QARA 2PWYA 2RB4A 3CZQA 4P4LA 4U2BA 4YI5A 3WXMA 3ROMA 4DLYA 5DLEA 2J0UB 3L4JA 5D3ZA 1V7CA 5L4SA 1W5EA 2ZUSA 4I4TB 1L8QA 2NXWA 5EXDA 1J0BA 1T0BA 1X7GA 3PEUA 4PC3A 4QM7A 1QV7A 3O8BA 4H3VA 1MB3A 2ZUUA 3R3XA 4U5XA 5H9VA 1ZW1A 4Y8VA 2R44A 1N5KA 1SK8A 3C48A 3C4VA 2BM1A 1VG8A 4YRAA 1FFCA 2HOQA 4KITB 4X1KA 2YX1A 3CGGA 1A8SA 5DZSA 3SI7A 4P3OA 1VL8A 4Y6OA 1U5CA 1UDAA 2UV8A 3EISA 1GTZA 4ISBA 1BZYA 4U6NA 2N1MA 4B2YA 2YBEA 5SICE 1ZNXA