2HF2A

Domain shifting confirms monomeric structure of escherichia sugar phosphatase suph
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
270
structure length
266
Chain Sequence
LSVKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASNNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKNFVACGLQSAYVSENAPEAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDDNNHEGALNVIQAVLDNTSPFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugar phosphatase supH
publication title Domain Shifting Confirms Monomeric Structure of Escherichia Coli Sugar Phosphatase SupH
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 79
structure length 266
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.1.3.23: Sugar-phosphatase.
pdb deposition date 2006-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 2hf2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hf2A01
1N9KA 4KX5A 2Q4RA 2OA0A 3ZVLA 2CFRA 2I6XA 3AR6A 3QX7A 5A3RA 5AK5A 5AVUA 5AKKA 4MWOA 1AQ6A 4Y2JA 5ALZA 4BX0A 5AESA 4JDPA 4AS3A 3QU2A 2EATA 2G80A 1RQNA 5AKGA 2YJ3A 2PQ0A 3MC1A 2B82A 4DWOA 2P69A 3UMCA 3UMBA 3AR7A 2B30A 1PW5A 3E58A 1TE2A 4CF3A 1TJ5A 3QNMA 3NANA 1QYIA 4OFZA 4IFTA 3F9RA 1SWVA 3CZ4A 3EWIA 5AKYA 1XPJA 4UMEA 2FDRA 2WF5A 2NO5A 4UMFA 1EK1A 1S2OA 1O08A 4YIHA 1RPZA 3N07A 4EEKA 2FPXA 3R09A 2RAVA 1Z4OA 2C8KA 3A1CA 2WFAA 2PR7A 4Y2PA 5AW9A 1YDFA 4UM7A 4UU0A 2NYVA 2I54A 2QLTA 1IWOA 4J2TA 1VFPA 4UAUA 3KOOA 3U7HB 2YMQA 4BEWA 5ALJA 2JAUA 2YBDA 3PCTA 2HHLA 4Y2VA 4GIBA 3W5DA 4OHFA 3B9RA 1RQLA 2ZG6A 4OCZA 4BNDA 1L8LA 3KZXA 2OM6A 2IA5A 4XPZA 2FUEA 2ZBEA 2R8YA 3KBBA 1ZD5A 3MN1A 3NASA 1WPGA 2PKEA 2ZOSA 3KD3A 4YIKA 2R8EA 2CFSA 3IRUA 1K1EA 1XP5A 2ZBDA 4HGRA 3D6JA 1TJ4A 4RETA 3FPSA 3K1ZA 2BDUA 5AW1A 2EAUA 4XQ0A 4EX6A 3ET5A 3P96A 3OTQA 2ZBFA 1VJ5A 3UMGA 5AK3A 4BKMA 1QQ7A 4Y2QA 3FZQA 1L7PA 5AI6A 5AI8A 3M1YA 4Y2RA 4YH1A 2C9MA 3WK9A 5AKXA 5AW2A 4KNVA 3W5AA 3ZW7A 3EPRA 4YCNA 1F5SA 3ONNA 5AM5A 2ZXEA 3NUQA 3OCYA 1ZD3A 4I9FA 3U26A 1T5TA 5AM2A 5AW0A 3VAYA 5T41A 4C4RA 1NF2A 2C8LA 3S6JA 3WKCA 4YCLA 1ZS9A 3W5BA 4FFDA 5AI4A 1NRWA 3BWVA 4HGNA 5ALRA 2I7DA 2QYHA 3N28A 4UAVA 4NAVA 3DNPA 2HSZA 1L8OA 3DDHA 4DCCA 1J8DA 4QQFA 1T9ZA 5AKHA 1SU4A 1RLMA 5AKIA 3RFUA 3A3YA 4EENA 2VKQA 2G0AA 5AVQA 2W11A 2OBBA 3J7TA 2YY6A 4BYGA 1VJRA 2R8ZA 1Z4MA 2P11A 3AR3A 3PDWA 4G63A 1LTQA 1N8NA 3SHQA 4EX7A 5AM0A 3WGUA 4YCMA 1TJ3A 3EF1A 3OCVA 1RKVA 5ALLA 2ODAA 1RC8A 1ZD2P 4UMVA 2ZBGA 3QU5A 4H1WA 2FPWA 3AR2A 3E84A 3ED5A 5AK4A 2D2VA 4ZEWA 4BNDB 5AW3A 3PGLA 4F71A 3SF0A 1S8OA 4DFDA 1Z4JA 3IJ5A 3MPOA 5ALDA 1RLTA 4NWIA 5AKZA 5AVVA 2HX1A 5ALNA 1KYTA 4EZEA 3PGVA 1Z4QA 3L8EA 2FEAA 4Y2UA 3B8EA 5ALPA 2AUTA 5AVWA 2G1AA 1YJ5A 1L7MA 2GHQA 3WK6A 3ZTYA 2HDOA 2CFTA 2GFHA 2YJ4A 3M9LA 1U7OA 2GHTA 5AI0A 3HLTA 3SKYA 2JAWA 3N1UA 5AI9A 3ZI4A 2AGVA 3HYCA 2Q4TA 1Z4NA 2G06A 3U7FB 2IOHA 3QU9A 2YJ6A 4C4SA 4AP9A 3E8MA 2RBKA 4E88A 1ZRNA 5ALKA 5AI5A 5E0OA 2G08A 4KN8A 4Y3UA 3ZTWA 3ZVNA 4C4TA 5AVYA 3E81A 1T5SA 2CN1A 3OCZA 4CF4A 3R4CA 3AR8A 5AM4A 3U13A 1Z5GA 2HF7A 3KDPA 4G9BA 1RDFA 2FI1A 4BEVA 2JAOA 3FGOA 4HGPA 4PNHA 1Z4IA 1O03A 5IT4A 1Z4KA 3A1DA 1XVIA 3OPXA 5AW7A 4Y2YA 3AR9A 4NV0A 3DV9A 2B0CA 3MMZA 4BX2A 1L6RA 2R8XA 5AM1A 1U2SA 4UM5A 5IS2A 1WZCA 5ALEA 3WK4A 2YMPA 4I9GA 3QU4A 5FP0A 3NRJA 4OD0A 5AVSA 4UU1A 1Z5UA 2MU1A 2W4MA 2NO4A 1WR8A 2RARA 4ZEVA 2IOFK 2O2XA 5JJBA 2X4DA 3NAMA 5AHXA 3FPBA 2BDEA 2HCFA 2FPSA 1Z4LA 1QQ5A 1RMYA 2HO4A 2MSNA 1ZJJA 1QQ6A 1ZD4A 1JUDA 4NFLA 3L8HA 5AKLA 3L8GA 5AIAA 3ZUPA 3SD7A 5AW4A 4L6AA 2I34A 5AVXA 4QJBA 5AKJA 1LVHA 5ALSA 4XOUA 1Q92A 3L0YA 2O9JA 1YV9A 3EF0A 3A1EA 3QXGA 2B8EA 3W5CA 3NIWA 4UASA 4BX3A 3U7GA 4RESA 5ALMA 4DW8A 1L7OA 3WK8A 4HYTA 5AK6A 5AIBA 1CQZA 4IG4A 2I55A 3WKEA 1YS9A 3WKDA 3QLEA 3WK5A 4UATA 1SWWA 2IOFA 1X42A 5ALOA 4J03A 1RMTA 2B1RA 2GMWA 5ALYA 5A3SA 3DAOA 3OCXA 3GYGA 1RMQA 2WF7A 4YGYA 5AM3A 3ET4A 4NABA 3SKXA 1WVIA 3FM9A 3B9BA 4KNWA 2YMLA 5AW6A 4CE6A 3QYPA 2YJ5A 3NALA 3AR5A 4F72A 1RKQA 3L0BA 2HEGA 3BA6A 1NNLA 3QU7A 5ALIA 2EARA 4Y2XA 4MUMA 1RLOA 5A3QA 5AW5A 4UW9A 3WK7A 3U19A 1TA0A 3ESRA 2HOQA 3FVVA 3L1VA 3N8GA 5ALXA 1ZRMA 3AR4A 3L8FA 2AMYA 2HI0A 3QUQA 2C88A 1L7NA 5AW8A 3I76A 3IB6A 2B8JA 3R9KA 3L1UA 3QUCA 4AS2A 2YFYA 2WM8A 2OYCA 3ZVMA 5ALQA 5ALFA 2WF6A 3N5KA 4L6CA 3I6BA 2W43A 1EK2A 2BY4A 3I28A 5AVRA 3QGMA 5ALTA 4ZEXA 2G07A 3SLRA 3TLMA 2RB5A 4KX3A 1MH9A 5AICA 1Z88A 5ALWA 3UM9A 3L7YA 2AH5A 1Q91A 4CNQA 4EELA 3QUTA 4HGQA 3L0CA 3I1YA 5ALHA 2FPRA 1RRCA 3OCUA 3ZX4A 2JARA 4HGOA 2C4NA 5ALUA 5AVZA 4L57A 2G09A 2FPUA 4UMDA 1QH9A 1Y8AA 4Y2TA 3RF6A 3KC2A 3QUBA 1U2TA 2P9JA 4BBJA 1YNSA 4CF5A 2HF2A 3ZWKA 2P27A 5AVTA 3ZWDA 1RKUA 3ESQA 4FE3A 1Z4PX 3WKAA 3U7EB 3ZX5A 1U7PA 5AKEA 1U02A 4HAIA 2DQSA 4KYTA 3CNHA 4FYPA 2WHEA 4B6JA 5ALGA 1J97A 2IYEA 1FEZA 4GXTA 3SMVA 2YN4A 1YMQA 3L5KA 4JB3A 4Y2SA 2JGAA 2WF9A 5IT0A 2FUCA 1ZOLA 4O8CA 5ALVA 2WF8A 2YMMA 3OCWA 2Q5EA 3WKBA 2B1QA 4XE5A 2I33A 3WGVA 1CR6A 2GO7A 3ZU6A 4UARA
chains in the Genus database with same CATH superfamily
3WYDA 3M2PA 1I13A 1P5ZB 1X0VA 3A4LA 3KK0A 3QLVA 2QRVB 2Z4TA 3HJHA 2Q4RA 2JGLA 4H9GA 2OA0A 4UAJA 1HUQA 2OSBA 2XVAA 5EMLA 4AM8A 4FNGA 4QFBA 1QCDA 1XTTA 3F7NA 2QVYX 2RJ3A 3OHSX 4X7RA 3V8VA 6ADHA 2Y1CA 2C7GA 4X1YA 1NM5C 5FL3A 4DZTA 4QUGA 4RIHA 1EQUA 2JI9A 5AK0A 4ZZ2A 5LKRA 4Z7QB 2W2LA 2DPLA 3IA2A 5CDFE 3C43A 3VKVA 3GNTA 3VJKA 4GYJA 2NT4A 4ZOEA 3GV0A 3UK0A 3PEWA 4IVPA 1S7CA 3A27A 3CNOA 2FPIB 1GA4A 1WCV1 1M8PA 4C89A 2OG2A 4GOMD 5JZBA 3IQXA 2WDPA 1E9AA 4ZVKA 1E0KA 1ZUWA 3GMIA 3MMPA 3C8DA 2QSUA 2QF7A 4DLVA 4LF9B 4F9GA 4YROA 4TL6A 5COAA 3O74A 4OIMA 4Q3OA 1J0AA 1T8WA 1TFUA 2JIRA 2WG1A 2K87A 2XJ9A 2WAOA 1QK4A 1ZH0A 2EKBA 2LDXA 3JWGA 4UMFA 2Z9BA 1N8SA 2C20A 3UGKA 1IZ8A 1G8AA 1PJLA 1Q84A 1WUIS 2BCEA 1SCQA 2OK7A 4DDMA 2IDKA 5K7SA 4AKIA 2BF7A 3EZ7A 2QLJA 1K0FA 1K0UA 2PLRA 4QXPA 3TNJA 1H2XA 2FPXA 3IE2A 3A4MA 4R2XA 5D3MB 4JBIA 2RAVA 3VM6A 3DTYA 3PQ6A 4EB6B 3ZHYA 3M6MD 2WFZA 1QVWA 3RS8A 5HZHA 3VHQA 4X1OA 2PGJA 4CKZA 4L95C 3GLHA 3MS7A 4MVYA 3TAXA 3ZJTA 2I5PO 3VQTA 1CUXA 4RS4A 1IYZA 3ZGLA 4FFMA 4GMXA 3RTGA 2VOJA 5HFAA 3MYRA 1O95C 3V46A 3MELA 3FYDA 3Q6IA 1E2QA 3FKSA 3UAGA 4D9BA 1TC2A 3KT0A 2FOLA 2I2CA 1IFXA 2JBWA 4FDMA 2KSQA 1UKBA 3TSCA 2NO6A 2ZG6A 4FOLA 1L9XA 1GTG1 4EM6A 4IR7A 3I2GA 4BOYA 4DM3A 2P9HA 1XE3A 3ESYA 1IZYA 4W99A 3ZWWA 4OXYA 4KWTA 3MLBA 1N4AA 2QN8A 3DWIA 1OGJA 1PGNA 1LZLA 2IPLA 4MLDA 3T0GA 4BNJA 2XWSA 3O6VA 3H04A 1LBSA 2R8EA 4DSZA 4HC4A 1PD1A 2ZYTX 4U2FA 3HCWA 3I6ZA 2IW1A 1BO6A 1QPZA 2VIIA 2OT3B 3RPEA 1OB2A 3BFKA 1GU0A 3GXOA 1MB4A 1NOIA 1QK3A 2UKDA 4FZRA 4HYYA 4IICA 2VSNA 1IQUA 1R6UA 1TQDA 1XTSA 4R84A 4YRSA 2OMEA 5KYTA 1NW4A 1QYWA 1T2FA 2AEEA 3W6UA 3THXA 4MV0A 2HJRA 2R3SA 1M0WA 3BMQA 1T5LA 2C2YA 3E61A 3MAAC 2XY4A 4J49A 4R8MA 1A77A 4RABA 2D4AA 8LDHA 1JHOA 4TKZA 3OZWA 3ZEIA 1TM7E 3ICVA 4AJJA 3GFSA 2IS2A 4TMXA 3WLPA 2G36A 2GJSA 4IXNA 4Y2RA 1JR3D 1ODFA 1YZQA 2HMVA 2JZOA 1PQ4A 3PI7A 4KYVA 3H42B 3I9OA 3K6JA 4N40A 4TL9A 5K3SA 4B09A 4DKXA 5AW2A 3HGMA 3AL2A 2N1MA 3CUTA 3MTDA 4JJ8A 3WBJA 1CIPA 3NOXA 1M2OB 4HXGA 3UMFA 2IP1A 4OP2A 4DIUA 3O7MA 1FE8A 4JB2A 1N2CB 3SX2A 2VDMB 4HRAA 1ZD3A 3WZLA 3CZAA 1BU8A 2VXYA 3MTAA 1W5BA 3CB4A 2PSHA 3MTJA 4YXWD 3JQ6A 1EX7A 3VSDA 4FBMA 4XFKA 1O94C 2XMZA 3QVVA 4EJSB 2VF4X 2BFOA 5ALRA 1W4AA 1Z2PX 3EGIA 3ETLA 5AHWA 3EQZA 3DNPA 5K45A 4YRJA 3DDSA 4W63A 1UXGA 2BGJA 3AB7A 3A1UA 1DQZA 1WB6A 5AKHA 4ZAVA 1QIHA 2I78A 4OXIA 2YVLA 4P5DA 3I1IA 4YJHA 3WBKA 2XDWA 3ZCXA 1I7SB 1E6WA 3U4QA 4MVJD 4YAUA 5K2MA 3IQHX 2BUAA 4KTVE 4U5XA 5ARCA 2WUVA 5LKAA 2QX6A 2R8ZA 1E1RD 1LBEA 3AR3A 1BHSA 1FP4B 3O1JC 3OQJA 4V0NA 3VPXA 2I4TA 4Z9XA 4J0IA 1TJ3A 5EZQA 1CUDA 1G7RA 5C8XA 3G68A 5K3AA 1LK5A 2AZTA 2YOFA 5EWJB 4AKTA 1XCPA 3EXAA 3WR5A 3BD8A 4YK7A 4B2PA 1DPGA 2W2KA 4KNYA 3H5VA 2Z3ZA 4OGFA 4X6YA 5E6RA 1JBEA 1DO2A 4R7TA 5G0VA 3RROA 2QUHA 2X19A 1DC6A 2ZBGA 1T1IA 1VE5A 3QU5A 4DZRA 2P62A 1PL6A 4IWYA 4EHIA 1XZHA 1MP0A 5L51A 3LUDA 3CS3A 2J08A 5AW3A 2R4TA 4OQNA 4M4SA 4XD7D 1LC0A 3BE5A 4H7FA 3VUFA 2L17A 2OCAA 1W4RA 3SF0A 4BFYA 1QH0A 3UJ9A 3VDXA 2D5AA 2GHRA 4CTJA 1BZYA 3GDOA 4G5YA 2QZ4A 1PQUA 3JQBC 2VPTA 3HB9A 1X1TA 3A25A 1F8UA 5LLDA 3AHJA 2Q5LA 1JHRA 2WU0A 3QKSA 5JECA 1P81A 4ALJA 4NOKA 4C04A 3B6EA 4DCTA 1UQRA 5A5DA 2PMFA 3ANSA 3PXUA 3F7OA 1KY5A 2AUTA 1XAGA 3RKRA 5M7EA 3UPTA 4PXYA 5I9LA 3IP6A 1QHYA 3P20A 1DJPA 4MV3A 1EVKA 1D6SA 3VYVA 3WLHA 2CK3A 3F7MA 3L7CA 4COKA 2QMHA 3JPYA 5E38A 1QYCA 3SVTA 3SXUB 2AGVA 3R9XA 1Z0KA 4C0QC 4MZXA 2YW2A 5BP7A 3R3ZA 2FWIA 3GQBA 1NULA 4LYEA 3ZE9A 2HA0A 3M5WA 3O2JA 4UOQA 3K31A 1IZZA 1OC2A 2G08A 1IY2A 5T3YA 5GINE 4RTKA 4KH0A 4TKUB 2CNWA 3AEZA 1BYIA 3QIVA 3D6NB 3UXMA 2FHPA 3M9WA 4MEJA 4CMKA 2BFDB 4J7CA 3E81A 1GT6A 2NACA 2PT7A 3L8MA 1F14A 4FFNA 4G1UC 4MWBA 3EGDA 5CGQB 2AF3C 4CF4A 3C6BA 3HCFA 3KNZA 1IK6A 1N4DA 3MT8A 4HWTA 1MO2A 2FR8C 3HVJA 2FI1A 5BVHB 2G3YA 2V74B 2NUAB 1C7IA 2ZAYA 3ZGVA 3ILVA 1U94A 4WKPA 4WDQA 3TTXA 2YBEA 3A9CA 3OPXA 2QX7A 1HZZA 3JASB 1PJRA 1UM9B 3IUNA 3KAJA 3NTUA 1G19A 3A6DA 4HNQA 3EIQA 3V4OA 2XCQA 1K8ZB 1JH8A 1LDMA 3WQRA 1NF9A 1VG0B 4FOOA 3E82A 4BUCA 1X6VA 4BX2A 3DO5A 2B4TO 4G65A 2YTZA 2ZVPX 4LJKA 4LF7B 1YR3A 2QQEA 1K4MA 5EP2A 5CP8A 2NUTA 1Y98A 3TNYA 4Z1MA 3RH0A 3HU2A 2Z30A 2PX6A 4TTJA 3NRJA 1YZFA 2ONJA 3A1WA 4Q01A 2JLQA 2V7BA 1VECA 3F5SA 3MWFA 4TTIA 4ZQGA 4E5UA 2H3HA 4XLTA 1UXJA 2W2NA 3TM5A 4FFOA 2B78A 2XLBA 2ZCVA 1Z17A 3EWSA 3KHSA 4LV5B 4RA6A 2H54A 2O2XA 2J3MA 1TAUA 1EDDA 1LPMA 2EJWA 2XTZA 3QEJA 2X4DA 5BYAA 4M0KA 5B1SA 1MCZA 4AN0A 1MPXA 2JD2A 3PHIA 1IEXA 3FNEA 3THWB 4WZBA 2C2BA 1IEVA 4M36A 2NPOA 3AONB 3D4PA 1JDTA 3UIEA 4EMSA 3ZLJA 4RVDA 3ELYA 2SKDA 1K7FB 3KPWA 3KT6A 3M6AA 1A9ZA 1NP3A 2GYWA 5KIAA 1JEQB 2VEDA 5KI6A 1A2BA 1HYHA 3EEBA 4OYHA 3AI2A 1ZINA 2Q8PA 2ZIVB 2NVBA 4HKTA 2G0NA 5AKLA 3GW8A 3U3JA 1DX9A 4GVLA 4UVIA 2O8CB 3V2UA 1NN5A 5D2CA 4XUGB 5IM4F 2PUGA 3NHAA 4X91A 1NM5A 4ADSG 4KHPB 4FLFA 2O2DA 4BFXA 5ALSA 2FR0A 5DE3A 3ME5A 1Q92A 5E7QA 1AF7A 4IINA 4DDWA 1AMOA 1OU0A 4P33A 1XI2A 3KALA 3M33A 2BLLA 2XHZA 3KV1A 3QXGA 1VHDA 1BE6A 1FRVA 4LY9A 4WLNA 5KYXA 5ILOA 3HA3A 4TKVB 4XCQA 2VDPB 3DMTC 1SA0A 1D4ZA 3DH0A 2Z2IA 3FTNA 3LQ4A 4OX9B 4BPBA 5CVVA 1K4KA 1LX6A 3AF3A 4LTMA 4JUIA 5A06A 5BN1A 3KFLA 2FB9A 4QJIA 3WGIA 1JSXA 2ZB4A 4PAQA 3GPCA 2I2BA 1SBHA 1Z5OA 1R0RE 1LV7A 2DX7A 3P4XA 4Q4AB 4Y9SA 3SNHA 3WTCA 4AXXA 4QXAA 3BJZA 3O82A 2XMCA 4WXHA 1O3YA 3AW9A 1B8NA 2MSDB 3R2JA 4YT2A 1M2VA 2FQ1A 2ZWPA 3DHNA 3KZ1E 3WNVA 1QRTA 3NV9A 3ZZ1A 4CV1A 3F1KA 4NJEA 1VFNA 1HE3A 1UCFA 4UDOA 4IIJF 3FM9A 4X20B 5BN5A 2AYXA 4B0OA 2NU8A 3KOMA 1CZKA 2ATXA 2EFDB 2GK6A 1R0CA 1CY6A 1Y4ZA 3WL8A 1U8TA 4OLBA 1Z62A 2Z2XA 5DW0A 4CXMA 4AMUA 5ERYA 3SJCA 2XAAA 3IEUA 2EWVA 5AOVA 1G66A 3KDSE 3BCUA 3FGZA 1UT5A 4B6FA 1LI5A 4UW9A 2PL5A 1J25A 4OHBA 2AUNA 2W6ID 2JIOA 5EMJA 1O95A 2R8BA 4GHWA 1PFWA 2OB2A 1X19A 1A1SA 2YWXA 3DYIA 5B6PA 1GNPA 2PGAA 3H17A 1M7GA 3AHCA 2WUGA 2QNRA 2A9RA 1YK0A 1RLJA 3ETGA 1ZW1A 3UHPA 3OX4A 2CLEB 1E5LA 3AJAA 1J8MF 4DV3B 2E3JA 3C1TA 2XMRA 3KSUA 1OWPA 1V8FA 2QWXA 4PR0A 4V0MA 5LQSA 5L45A 4GX5A 2VP3A 4GSLA 4AS2A 1GZ7A 4L5CA 1T4CB 3VC7A 5KNBD 1WDKA 1DIBA 3ZVMA 1CF4A 4B7UA 1JAYA 1XHEA 2GEFA 4L6CA 1P4RA 2BHSA 2AQHA 2I71A 4MGYR 1B3BA 1ISGA 1R74A 4MWDA 4C3ZA 1CQWA 2CLIB 4Q7EA 5B4UA 1A27A 1RJWA 1S7GA 1UP6A 2VQ6A 3EW9A 4LPSA 1QG4A 1V5EA 3RSCA 3EPHA 2IZOA 2DUJA 2IYFA 1RI5A 3N8HA 3MRXA 4E2FA 3QTBA 1G8JA 4EO4A 1UPAA 3C2QA 3MWLA 3OOWA 2GCIA 1U5BA 2HUNA 2IZ0A 1X1EA 4B45A 2OILA 2ZM6B 5LDHA 1GPH1 1FVHA 5FFFA 3RIMA 3I5XA 1CHDA 4II7A 1TOAA 3A9UA 3NM5A 5BUSA 1EFPA 3IOMA 4UNNA 2APJA 2VQFB 2DPYA 3HZRA 4A03A 2XCRB 4B34A 1TLTA 1G3QA 4PYNA 3QVUA 2OZEA 4RMJA 1NN0A 3OQ1A 4G0ZA 4BATA 4RY2A 2JCYA 4LC0A 4MRSA 3SIXA 5LP6B 5C51B 3VKGA 1O94A 3C1UA 4Z99A 5ENDA 4QXOA 3SFZA 3ZHOA 121PA 3L79A 5BSWA 3E53A 4K1XA 2VL7A 2PX8A 4Y6QA 1KY2A 3IEKA 3VKWA 4IF6A 4UBKA 3OIDA 1USUA 2HQ1A 2PWBA 3I2JA 2REOA 3FCCA 4JI5B 1THTA 1YRWA 4B6JA 2YWCA 4EPVA 3CGWA 4RADA 1I5RA 4UHHA 2XQJA 5L6MB 1KMHA 2QRZA 4ND8A 3ZZTA 4DA9A 1FFHA 2PZGA 3CRW1 1J24A 1XCMA 3H5OA 3WYEA 4JU8A 1XCOA 1L4BA 4MGZR 5KQPA 1BVYF 1VL5A 3B6JA 1CJUC 2C2KA 4F46A 3NHUA 3OQNA 2CBGA 1YQXA 2WKQA 1HL3A 3GHYA 4BRUA 3UJDA 2P2NA 4HOYA 3DWGA 3GGOA 4UBIA 2WUEA 1KSJA 2H4FA 3I73A 2YYYA 1M6YA 4BTVA 2GUGA 2R97A 5JOQA 4I4CA 1OPXA 1HTTA 3G5MA 4RLHA 1XOIA 4OHVA 4OUKX 3TE6A 1QUEA 5JFTA 2C1ZA 2IH2A 1PJQA 2VT2A 4H60A 2C78A 2D5CA 3AOEC 3TQHA 3MA0A 2G9UA 1FYWA 4BGUA 1T25A 4ACBA 5JNTA 2ZUVA 4M7RA 4EJFA 4MKXA 1QTQA 2Q6TA 5KNCD 2I6XA 3AR6A 4Q1VA 3I09A 1M6WA 1JHYA 1NQUA 2BZSA 2O6LA 3ECCA 3GA7A 2NV6A 3ESBA 3JQEA 3LAWA 2CHQA 4R9UC 1T24A 4YAOA 1ZY2A 4MI6A 1LBIA 3F4LA 1NVXQ 1NVTA 3JQBA 2WICA 1DAHA 3CJRA 3DOIA 3EJ6A 3J80A 1UDCA 2EATA 1BW9A 2WABA 3AHHA 4W7HA 3WB9A 2D54A 5JSUA 1DWPA 1SH7A 3ZLTA 2D7DA 4TN1A 4BP9A 2HMYB 4GLOA 5TMEA 3WICA 2BHNA 2YL2A 3FTFA 4B3GA 4QSHA 3KZNA 1J2RA 1GSAA 2FSPA 2LP4Y 4JR2A 3DULA 3QXCA 3GMSA 1F5NA 3D8UA 3I0ZA 3P4YA 4Q1BA 3I83A 4NV3A 3WHIA 1OXVA 1PT5A 3NDJA 1KAOA 4BGDA 1XTBA 1VPEA 2C1EA 1PQWA 1KJ8A 4IFTA 4BCBA 1A7AA 2BGTA 1JAIA 5I7EA 3T7IA 1TM3E 4DREA 1WHTB 2Z9DA 3V1TC 1ELOA 4WRRA 1E2IA 3L7OA 1XLWA 5KAMA 2BFWA 3O4GA 4JQOA 3HWWA 4HAVA 1ZH6A 3G2JA 1O97D 1DAKA 2PZEA 1S2OA 2CUNA 2VAPA 3A58B 4RF4A 2IYLD 2OWEA 4GZ6A 1OLSB 3QPVA 1RPZA 1XEXA 3SQXA 5E6UB 3TFWA 4YECA 3L1KA 3R09A 3EZ2A 4IRXA 4HZUA 4RENA 1V37A 1GLNA 2XTAA 3N2GB 3FPEA 4CCAA 4O2AF 3ZE1B 3ZDDA 2X2EA 2OD2A 2QU7A 4ENUA 1GPMA 3HKCB 3TX2A 4C7OB 3SGLA 4CQJA 1JVNA 3OX1A 1C9MA 2FR8A 2IGTA 4WERA 4V1CB 3IVGA 5LNK1 2WEKA 3EBOA 1EI9A 2LW7A 2VJBA 3DDNA 3IOEA 1P8AA 2ZPUA 3ABSB 4MB2A 4MA4A 2PJZA 2ZRPA 1WCXA 4AYTA 4P6VF 5HRCA 5F73A 2VRBA 1SOWA 3IT0A 1ENPA 2O07A 2VSFA 3C24A 1C7ZA 1VHWA 3BQ9A 1KMIY 4NDAA 5CYPA 5DH9A 4CFYA 3WDMA 5AOBA 2I8LA 2F3SA 3TW6A 3OKAA 2V5AA 2I22A 2B98A 6PFKA 3K70B 1IXRC 2B7BA 4RL6A 2J7PD 2SBTA 1N6NA 3O2NA 1UIRA 1NXQA 2CL5A 4M37A 4OA5A 4IVNA 5HKLA 2IELA 1I94B 2J0EA 3KVRA 1UXKA 4Q1EA 4ND6A 1TMYA 2AFHA 5EKDA 1I3KA 3MTIA 4IDEA 1VRVA 1TJ4A 1XZ8A 2WWHA 5EHNA 4LXTA 5JSFA 3IJPA 3W5JA 2SKEA 3A8TA 4K46A 4RPHA 1M73E 5D5QA 1IOWA 2D1FA 2Z09A 3VJMA 1EFLA 2QAGB 2QD5A 1V8ZA 3V4FA 4N5IX 3IR7A 3KXLA 1F1JA 1ZK2A 4FGKA 2XE8A 2DHQA 3KWFA 2R00C 5EEGA 3C3DA 4LDQA 4Y6LA 4YRCA 4DB2A 1XEWY 5K09A 4MMXB 1E20A 4WBNA 3WMWA 2P78A 4KRXA 3I6IA 4MUAA 1XK7A 5G0TA 5ARBA 2B34A 2H4WA 4LDRA 4JHXA 3Q0TA 2L0XA 4AJ2A 1YR7A 1JTVA 1GGJA 2UDPA 3JYNA 2HU8A 5A5EA 1NBME 1MOPA 2DFLA 1KNXA 2GT1A 4P86A 5H9VA 3B1YA 4YEDA 5DBHX 3W04A 1JKXA 3WKCA 3A9RA 4CM9A 3DMTA 5ADUS 1RM0A 5LUAA 4WGGA 1J9GA 2EKZA 4KXMA 3FVQA 1M6NA 3RODA 2A9VA 4N7JA 5HEKA 1ZLYA 4K9QA 3TBKA 1OYOA 4D4GA 3BF8A 1DS6A 4XR4A 1J8DA 4IJMA 5CJJA 4N8EA 4QIHA 4GKJB 5F2OA 2WC1A 1W73A 4K9SA 1Y82A 2P65A 1CDZA 4FP9A 4QC2A 2YWHA 2FPOA 2AG5A 2O5VA 4NYIQ 1JDBC 4JMLA 2BISA 1VBMA 3DZCA 3LF2A 4OJNA 4XSHA 3CLRD 2EKQA 4IOKA 3EQ7A 1AGPA 4P08A 4R2IA 5JH7F 2FW9A 2P4EA 3OM8A 2OHXA 3M6XA 5DK6A 4YR9A 5KDDA 2H1WA 4QYIB 2R7NA 4C6HA 2VSXA 3K0AB 1KVTA 3RNOA 1OGYA 5HOEA 4QDJA 5DGCA 4UBJA 4YI5A 1TVEA 2QRMA 3GG2A 3V2IA 1QIMA 1X1RA 3D5QA 3KTAB 3MFYA 4Z4EA 4O4JA 4UTPA 1IN4A 2V9ZA 1UKYA 1RKVA 1V6AA 4LI0A 1Z0JA 1G8PA 4BBPA 4DRZA 1J21A 2GEUA 2ZUTA 1C3OA 4BGIA 2DBYA 3N3AC 1L5FA 2RGDA 3LPCA 3GLHE 3EIOA 2XITA 3AEKA 4MO9A 5E7IA 2ZUEA 5BQPA 2TRSB 3G6KA 2GZ1A 1PGJA 1C29B 2WWWA 1SHZA 3AY3A 3U80A 5JV5A 4K2AA 5DYIA 5KHOC 4PLFA 4C87A 1CZNA 3S2EA 1YA6A 2SCUA 1BMDA 3HU3A 4P7FA 4PN7A 3TXXA 1S2DA 4H4DA 2R66A 4DY6A 4HAZA 2GZMA 2WA1A 5ECDA 5G0WA 2X5OA 4EUEA 1RRFA 1ZGHA 4GPBA 4PSCA 4WNIA 3W79A 1JNYA 4WEOA 1HRKA 3CCBA 2AOTB 1ULBA 3RRZA 5GVRA 1E9EA 4UXIA 1ZR4A 4JHLA 4TKLA 4TTQA 1P9WA 4JKOA 4PF1A 1R4ZA 5JY6A 4WGFA 4F9EA 1EWRA 4MGHA 4LS3A 4WZZA 3UJ3X 3IKTA 1D6JA 3CLUC 1BJRE 4YCBA 1AIPA 2GFHA 4A8TA 5AI0A 4C0HA 4RKRA 1KYXA 1SR8A 2ADFA 3WL4A 1XPRA 3TIGA 2FCRA 1T13A 4HTFA 4AMGA 1JJVA 1Z4NA 2FPLA 2QN6A 2RH8A 3EXG1 3ROGA 3BN3A 3UOAB 1P1FA 4BNLA 4NE9A 1YTLA 4E88A 3JWHA 1DQPA 5ALKA 2Y1EA 1N0UA 3K0CA 1TJPB 1DRJA 3AIKA 3QHAA 5EPOA 2WWVD 4C88A 3GN2A 1KI6A 1KZ4A 1NJSA 4R1NA 1KEKA 2IBTA 2EEZA 4G0UA 3F2IA 3GJ0A 2HPHA 1WQ4A 4ZVQA 3O94A 4PX9A 1EM8A 1SOVA 3ANYB 3WL7A 3AF6A 5H9WA 4J3JA 4RORA 2J87A 2XUPA 4NK5A 4RPGA 4OMCA 4FUQA 3RYIB 1QTIA 1BCRB 3WL6A 4ETWA 2VNIA 5CDGA 1VKJA 3KKEA 3ISTA 4HNUA 4ZCIA 2FYTA 4QWMA 4CETA 4CLOA 1UODA 3I2HA 3PNSA 3WS7A 1Z4KA 1ZC3A 1MB0A 2XPCA 2CEKA 2FLKA 1Q0HA 2F3UA 3H75A 4RH3A 4D4HA 3ND5A 1TEZA 2PA3A 4PLGA 4DLBA 3W4IA 3IHKA 3U4QB 1C7FA 2F7SA 2ZJ1A 1R5OA 4M98A 3WADA 4B44A 4BPRA 2MYNA 1JI0A 5F78A 2FQXA 1SKMA 4DPKA 2ZYAA 1N2GA 2JHPA 4DA4A 3CF0A 1YFLA 3ZIAD 1XC7A 2DBVO 3HY3A 1JHUA 2CCGA 1Z8HA 1N77A 3IKJA 3NT2A 4FCVA 4C7BA 1GILA 4PY2A 1ZICA 2HFJA 1VPTA 3ZWBA 5AUPB 2YX1A 2FZEA 3AEQA 3LX5A 1WB9A 1BX3A 3L0SA 4IRUB 4Q4DA 4ZEVA 2IOFK 2YJNA 5LMNB 1XAJA 2DKOA 4URHA 4EBBA 3G02A 1MKYA 3ITDA 3U4IA 4TTRA 1U8ZA 2PMKA 3WYCA 1WZEA 4WJKB 4YUWA 2K7ZA 2NZWA 1NATA 3QPUA 4U8HA 1SBCA 5KDOA 2I0FA 1OF1A 2GZAA 1QQ5A 4CGZA 1OFTA 4J94A 4INOA 4AJEA 1J07A 1CS4C 2DFTA 2Y3IA 3AOEA 3HUDA 3VRHA 1ZG3A 2HRRA 1TM2A 1YCDA 1OLUB 2O57A 3ONWA 1PWZA 1NMQA 2BGIA 1OTYA 3M3DA 4XGNA 4K6MA 1G63A 2VXBA 3HEMA 2ABWA 3VAAA 3IPAA 2PTGA 2R1VB 4LN1A 3WLIA 1B73A 4PBRA 2PGDA 2YJTD 4QJBA 1RPJA 4EQ6B 2WUWE 5K99A 5B37A 2MOKA 1DC4A 5K8VA 3IPXA 4Z4IA 5L3ZA 1ZNYA 2FKAA 4MYDA 5B2EA 1C9DB 5B3JC 2O9JA 1A8UA 1GQ2A 1E66A 3IUQA 1F4VA 4FKBA 1JSRA 2VI5A 2ZJ5A 3BM5A 1QHSA 2G4LA 5EHQA 5TMPA 4AW9A 5K0NA 4GRIA 1F8XA 5ESDA 1I4WA 3OF5A 8MHTA 1RE1A 1LSOA 1JR4A 5ESRA 4CCSA 3O8RA 2Q3CA 4HXFB 3UAXA 2I55A 4RVHA 4OH7A 3ENVA 4RD2A 1QO7A 3HEBA 2VRCA 5FPPA 4MPJA 1L1EA 2I7VA 1QYDA 2F8SA 3LZDA 1KC1A 2CHUA 2D5IA 4WN3A 1XZFA 5DX8A 1BTOA 2GAFA 1R0YA 1XTVA 2YS6A 1RMTA 4I7EA 4MVJG 4OSOA 4E3ZA 3Q3IA 1OXSC 2V6GA 1GUYA 1U3VA 5A3SA 4E32A 2UV8A 2N75A 4NYJQ 2IH4A 3UF0A 1ZOSA 4YP7A 1HE4A 1JHAA 1HFKA 1OTXA 2LKDA 4BYMA 2G8LA 3X43A 5LZ9A 1HWYA 1AOXA 1KAGA 4Q93A 4GWKA 1EFKA 3DZ8A 1PN3A 4JLJA 4M54A 5NLLA 3K0BA 2FN8A 4YQZA 2GNOA 5KMGA 5T64A 4E07A 4WY5A 4J4TA 3OT1B 3QVJA 3UJBA 4F4JA 5KNDD 3THYB 4FBLA 4IZIA 4TWJA 4UOEA 4A36A 2IIVA 4YCAA 3LNCA 1ZU4A 2FF5A 5AD1A 3QPBA 3GGDA 1TQHA 1Z33A 2C3UA 2P4HX 1DE0A 3Q7QA 2TS1A 4LSZA 2IHJA 2JKVA 3JSAA 1RC1A 2XCSB 2PGLA 2CXUA 1KK2A 5I7OA 1GD1O 3PXXA 2YXPX 1L7NA 1VBNA 2P0EA 2WQZA 4M6WA 4R31A 5ARDA 5CIYA 4HFJA 1IVSA 2HA3A 2WWRA 4P0TA 2ZGVA 1JQ5A 3HUFA 1QKKA 3IURA 3SKVA 4JLBA 2WLTA 2WM8A 3GWGA 5GTDA 4UAGA 4ZGBA 1Z15A 3LVFO 1GKKA 4YRAA 4O8ZA 4NXNB 1YULA 3U1TA 2RE8A 3ZU4A 1NVUQ 3NBMA 4CKEA 3IHLA 3C14C 4IUBS 3JR3A 1GPNA 3Q1LA 3Q41A 4G5SA 4JP8A 4M9RA 4PLPA 4OY3A 5EQFA 3T95A 1SVKA 4BLSA 1H5UA 3SLRA 2FZLA 4AECA 2CZCA 4AJIA 3AY6A 2VPWA 1Z16A 1RI2A 2FFJA 2NLOA 3AFOA 3B82A 3OQ6A 4GVXA 4PAOA 4B73A 4KZPA 3T1OA 1H8EA 5E7MA 5FKJA 3A6LA 3ROXA 5I7HA 1VSVA 1R0SA 2GEKA 2NT3A 4TLCA 3PGJA 3ZV5A 4EELA 4L08A 5BQXA 1EBFA 3NBZC 1KJIA 2HMTA 3RF7A 5J4LA 1WXIA 1AUQA 4YHBA 3S5UA 3SIPA 3UMRA 5FYQA 5F98A 3C8MA 2R00A 2R7AA 2AXNA 3R0ZA 3HL4A 1S8FA 1EFDN 2FPUA 3HBAA 1O87A 4FVTA 1EGVB 1R88A 1A4IA 1HTBA 4PGFA 2A4KA 1Z38A 5CH8A 1Y8AA 1WDLA 3I4LA 4Y2TA 1BOOA 2HK7A 2NVUA 1FFXA 1Z12A 3EIFA 3OD5A 2D7JA 3BDVA 4R8LA 3L9XA 4IXTA 3FAZA 1YDHA 5IULC 3SC4A 2C4KA 3D3NA 4RIGA 3L4JA 2OY0A 4HNSA 3UMMA 2O4CA 3QBEA 4P8RA 4R0MA 3ESQA 3KUUA 2DB3A 1V5WA 4FB5A 1GG2A 5IHPA 1GOTA 5A9TA 3LCRA 3MWKA 1RT9A 3CZCA 1T6ZA 2G4VA 3QEBZ 4H17A 4KRYA 1ZK1A 2IHKA 2YASA 4B9AA 1FUUA 1GGHA 4KUEA 1KFBB 1A50B 1YONA 4QVGA 4KFRA 3OZFA 2J31A 3B2EA 1ZONA 1MEOA 2GH1A 3U4CA 1T1SA 3V1LA 3RC8A 2QMEA 3LT0A 2JFXA 4FJ2A 4MDHA 3RSSA 1EXWA 4QBTA 3IT1A 2XW6A 3D0OA 1GN9A 3BRWA 3LSYA 5CUQA 4UEKA 3L7DA 4KN5A 1ZSNA 1CRQA 1JXMA 2PPVA 5JWOA 3X0DA 1UDAA 3ZLBA 5KSYA 4OQ4A 2JJ1A 3PGKA 1T0IA 1BA2A 2DPMA 1NUSA 1UOQA 4MW6A 2AEJA 1IIRA 4IX1A 4DJDC 3G0HA 1ZKDA 3K30A 2HM7A 2ZJ7A 4HDQB 1N5MA 2IDMA 4B74A 4I9NA 3IAM1 4O5AA 1ZUD1 2ON6A 4TQGA 3FDZB 2YINC 2NV2B 2RK6A 4BN4A 3ZCTA 2PY6A 1K3TA 3LX8A 1LXCA 4L28A 2ROQA 3EX7C 4QDOA 3CX6A 3GFBA 4WH0A 3E8XA 3QW4B 2IEIA 3QVSA 4D8TA 2CDNA 5KNLA 1RQ7A 4V39A 5KTRA 1ZOIA 1ODJA 3QWAA 3VPFA 5HPYB 1HM5A 4XM2A 1UAYA 3UN1A 2F48A 4BN5A 2O0MA 5ICCA 1GGMA 1DOZA 1ZMBA 1TUIA 5ITVA 5JWHA 5LB2A 5EGNA 3VR6H 5KJ6A 4C0BA 2H2AA 1OYVA 3Q8WA 2IYNA 3VDNB 4K1LA 5JRDS 1KOGA 1DV1A 5JCJD 3FHTA 3K94A 1IVNA 2B82A 4DLUA 5E2BA 3S4YA 1YVPA 2JA1A 2O2CA 4V0ME 2IYVA 1QORA 2Q50A 1YBAA 3Q15C 2QQFA 3WLFA 2PS9A 2Q3EA 3OTHA 1XJ0A 3EUWA 3FYSA 3L8YA 3SZMA 5L3QB 3R9WA 2D0OB 3L18A 2OGSA 2JASA 4IO0A 1BCSA 2C0PA 4DSTA 5U9CA 5I9SA 3FRIA 3FYUC 3QXJA 2A1UB 5BNWA 2V0CA 4ZQIA 3P0EA 2G6TA 4YX9A 1NLYA 1QGYA 3MJEA 4TM7A 3G9ZA 3Q4GA 4BO5A 2O8FA 1R50A 3G2LA 3NI2A 3T7CA 2PRKA 2XOKD 1XKXA 2IHTA 4D8WA 3NKVA 4WNYA 2FG7C 2FEMA 4PANA 1N2HA 3ETJA 3M6UA 5E6SB 3PTLA 4DWWA 1EG2A 1GV1A 4CG2A 5L3SA 2OE2A 4DEXA 1VJ1A 3WFJA 4J0CA 4ZTBA 2AN4A 2R1TA 2CMHA 2WHPA 3G2KA 1GZVA 2JGMA 4CDNA 4GQBA 5EJEA 4QX6A 3X44A 2OGTA 2YMQA 4ZJPA 1KYWA 1OD6A 1QCYA 2FFHA 1IPHA 3RHZA 3WGNA 1KHHA 1F6WA 4S1TA 5TSDA 2PZJA 2BE9A 2B5WA 5ITZA 1GFSA 2P40A 2VJMB 1U7DA 2CXXA 4JLKA 1MJHA 3AFGA 2PUVA 3RVQA 3T34A 2FGJA 4UREA 4PZAA 4M8NE 4FWIB 4DUGA 1QQBA 1UBGA 1T4DA 2AG1A 1VJGA 3BTOA 3OLCX 1DBIA 2QR3A 5E9JA 1IJFA 1IM2A 1UUFA 2Q2OA 3NASA 3TW0A 1DIAA 2BFEA 3MGAA 1DTSA 4OHPA 5LWHA 2PE5A 4CR7A 2PKEA 3MJVA 2R9VA 4FD3A 1TRKA 3RVRA 1GZ4A 1LQ2A 1Z83A 3FSGD 3TI9A 2JEZA 4B82A 3RVNA 2H5EA 3GD7A 4FHGA 5IBRA 4HHEA 4LVNA 4QNNA 4JXZA 1O58A 3OZGA 4IG9A 2ZBDA 1RWKA 4HGRA 1KOJA 1N1MA 2WD7B 1XDDA 2Y0PA 3KJHA 3LVBA 4GOLD 4MAMA 5H3LA 4TXHA 3UGJA 3W3ZB 3KB1A 3PL5A 1H1LB 4XQ0A 1Q7GA 4TLBA 3VR5A 1LPPA 2AZMA 3W7AA 3GIDA 1NJFA 4C07A 1KYIA 3Q7PA 4PM4A 4AMZA 2C2HA 4MR9A 5AK3A 4QBFA 5JADA 2FMIA 4CBVA 1FNDA 1TT5A 3TOVA 1P2SA 1QLWA 3C6QA 2HLNA 2OBYA 4LIPD 1OA0A 4I4TB 4X94A 1PUXA 4MIKA 2QG6A 2C9MA 3JAWA 4D44A 1XU4A 5FBLB 1KI9A 3SBDA 4MHTA 4WN9A 4GU5A 4EH1A 2O2JA 1KS2A 2C57A 3OOYA 1UPBA 2PQ2A 1HX7A 2FK8A 3DBLB 1L4LA 2C0QA 2QRKA 3AQIA 5AM5A 2V6JA 1ZCFA 2R8RA 3ELWA 3L77A 1Q95A 5JTTA 3KQUA 1NRJB 2GVZC 3LKBA 4R9VA 2GAAA 2VDQB 4RVSA 1E6CA 1FBTA 1N2SA 2EBFX 1W2HA 2GX6A 3F6EX 4XAQA 1FFCA 1XRPA 3S6JA 2BWJA 1F2VA 1HLPA 3D7LA 2R8OA 2FETA 1QHHB 1DV2A 3MXTA 4X44A 4NAVA 4CKWA 2FW0A 4KK3A 2EQAA 1WMAA 3P4UA 3ZVRA 3B2NA 2PANA 3AYXB 4XDGA 4OU5A 2W90A 4N5LA 2GZDA 5IYZF 4P4LA 4BFUA 3RFUA 4YXFA 3E9NA 3A4TA 2RGXA 1TI7A 3AF5A 3QKSB 4ZK2A 4ZZ1A 1SM4A 1SB9A 4US1R 5J23A 2D2FA 4GQIA 1UJ6A 4EHAA 3FTCA 1DQSA 4LRSB 2J7KA 3A4NA 3M5PA 1NUPA 2IIBA 4MTCA 3NGMA 5KBYA 2VWGA 1EEXB 3U7QA 2LTAA 4ZOBA 2OV2A 5DTRA 4Q3LA 3IVRA 1M76A 3CLTC 2I3DA 1NBMD 3O26A 4NOMA 3RS4A 2NTYC 4WWHA 3A2KA 2WIFA 3TZHA 5DLQC 2HF9A 5CA0A 1O6ZA 1GCIA 3JR7A 4B17A 3DGFC 3OTOB 1T2VA 2HXSA 2DC1A 4M0MA 3BX1A 3O4JA 3GQBB 3WLAA 5CAEA 2PQMA 1W5AA 3EODA 3FLEA 1A8QA 1JXAA 2IQ5A 1L4NA 1T2AA 1WABA 4KE7A 1Y6ZA 4BNDB 4Y6PA 4YRNA 2Y93A 2FUNB 2JLAA 1P7ZA 4RPKA 1Y7LA 1Q16A 1YVRA 4KN6A 1KSHA 1VB3A 1CZOA 1G1AA 4XB1A 3OLZA 1DDOA 3EAQA 3QFFA 1V4VA 1SXJC 1KMQA 3ESXA 4TVKA 5ALNA 4RNDB 4RF3A 1G6Q1 5LYJA 3ZHTA 4FYIA 4JBNA 3H5TA 3L8EA 3KEFA 1KJJA 3K2IA 4XRRA 1J7JA 4AJOA 3RGWS 1NXTA 3GI1A 1P2GA 4IDFA 3E4DA 4E5YA 2QPAA 1J33A 1DEOA 3EC7A 4BO0A 2ZWAA 2C3MA 2R79A 3DJYA 1W94A 2PYIA 4WK0B 2FRXA 3N05A 5BNZA 5LXTB 2C5HA 4E11A 4KWEA 4Q24A 2FGKA 4HEQA 1QG6A 3OTWA 3D7KA 4WLUA 3W3AH 2GHTA 3FNRA 2FWBA 2JAWA 4IOMA 4NZYA 4RAOA 5AI9A 3W7BA 4CL0A 3PEFA 1L2TA 5A6VA 4URWR 2NUTB 3IIMA 5LD2B 4ND3A 3BILA 4TXLA 4EHDA 4ZYYA 2HA5A 4Q1AA 3HA7A 3M4NA 4LZLA 3BIWA 1B26A 4GNRA 5D6OA 2D1QA 4BGEA 3R7DA 2MR5A 1WTAA 1DARA 3GO4A 3HUUA 4RVUA 3O83A 1T2DA 2ZFUA 3PENA 1CK4A 1UJ5A 2VT3A 1KRHA 2XBLA 3V7YA 2GK3A 4IXDA 1OSNA 2UYGA 1MOSA 4QUHA 5G4KB 3OFND 1Y3CE 3OJCA 1OXUA 1C81A 1XSEA 3OCZA 4WZBB 3IAS6 5CVTA 1U0LA 4N54A 3OZUA 4A8HA 4O5OA 1N7JA 2H29A 4X7PA 4DCNA 4DR4B 2ZYHA 5DI3B 1CEXA 5EE9A 2H7VA 3FGOA 2Q0QA 3NBAA 4NC9A 1DEAA 4RYDA 3GFFA 4XIIA 5E2IA 1PLKA 2RHDA 3U37A 1XQ9A 2R5FA 4HX9A 4Y2YA 3KT3A 3T4PA 1N6KA 1USVA 4L8FA 4UHJA 5EXTA 2AK2A 4RX1A 3MFQA 3P0HA 4EI7A 3GLGA 5EY5B 5LYYA 5TEWA 3GRCA 3K6RA 4O25A 2ZIUB 2WE8A 1TO2E 1L5KA 1SKUA 4TQ9A 4Q7MB 4EDHA 3ICQB 2H0AA 2WVJA 1Y1RA 2HSEA 1A9SA 1WTCA 4BVLA 2VUIB 2CWWA 3DTVD 3HZZA 2ZBQA 1S3FA 4R0VA 4XX1A 4IP0A 3ZDQA 4I14A 1ZCAA 2Q3JA 2AR0A 2ZRDA 3MB8A 4QYMA 4X9XA 3S5JA 4ZYLA 3RSOA 1UZLA 3N7AA 1NFFA 1WQ1R 2NXCA 4COOA 1I4LD 2PS1A 1ZITA 3WQHA 2BCGY 4D6YA 3SFTA 3QPDA 1G8MA 2Q4OA 4N49A 2HH9A 1VYTA 3E22A 3R74A 3SBEA 2AOVA 1Y63A 4BNKA 1V1RA 4KXUA 3A3OA 3GELA 3SVZA 3FFBA 4IIEA 1X87A 2BEUA 2YHUA 2Q29A 3L0ZA 3P9YA 4KQ6A 4PZ0A 5E9WA 5JS6A 4LOHA 4B4WA 4X90A 3TOSA 1VI6A 1Q1NA 4BP8A 5BV8A 1Q7RA 2WOOA 3HFRA 2H5LA 3L40A 1ZJJA 4TMWA 4YDRA 5EIBC 2OGZA 3HS3A 4JI1B 4YRBA 2Y9MB 2ID9A 4J1TC 3PK0A 2A8YA 2AR9A 2ISCA 1TMOA 2I03A 4LBWA 4QUIA 1UKVY 2I34A 4W82A 1CQJA 3TUJC 3NAGA 5BMVB 2FQYA 5JNVA 1QR2A 4PG4A 5AKJA 1PAUA 2BRUC 3LHDA 4HEJA 4M1EA 4P82A 5D3KA 4I99A 3KV3O 1IHYA 4K28A 3R9IA 5I8ZA 1FSZA 1U3FA 4TRMA 3ADPA 3QTLA 5SYNA 1CY4A 3FE2A 1MIOA 4A0RA 2BR5A 4BNYA 1CNMA 2C07A 1JB9A 3FPAA 2VK4A 2X5JO 4ZT6A 4EB0A 3LOUA 4NFSA 1I1HA 1R6BX 1A72A 1M83A 4IG4A 4ZDKA 2AKEA 1YKGA 1QANA 3AFMA 2IS6A 4KR6A 2QM0A 3FYUA 3RJ5A 3H5WA 3TDMA 5ICEA 1PJAA 3CO0S 1GDDA 4QZVA 1W2WB 5JCXA 4QM7A 2FOXA 4CM4B 3TG8A 3WB2A 2XMQA 4BGVA 4J03A 2HHHB 2AW3A 1F20A 1NZFA 2HCRA 2ZANA 2NZ8A 3GPLA 2F64A 3R8FA 3FWHA 2N3ZA 1YF3A 4B3RB 3P52A 5ADHA 2BH2A 3GP3A 3D54D 3SKXA 4C0JA 5KWVA 2J6HA 2OC4A 3JV7A 5IDQA 4PGAA 1KH1A 1U2DA 1RWPA 5E95A 1DKQA 4JS0A 3RU9A 4ABTA 3L0BA 4JI4B 2UVPA 5LQJA 3NO4A 4CKCA 1A1VA 1W25A 4R68A 3D9QX 1QV9A 5BV1A 1OH6A 2H4ZA 2R7MA 1D4OA 3MWYW 3HVKA 1UMDA 5BV2P 5I9IA 3VJLA 4PE5B 1U0EA 4DGSA 1KGDA 1A4UA 2DHCA 3KLPX 3HUEA 3IDZA 3I30X 1HDXA 3ESRA 3V9PA 3C4QA 2VSYA 3RK1A 1M34A 4IJWA 5KU1A 2JCVA 3T7TA 1YBMA 3GWZA 1RXYA 2ZYRA 4K6FA 2XE6A 4Y6RA 3HSKA 5B2FA 4HFRA 3L6CA 4MRPA 5IJXA 4GOJA 4FFSA 1CY0A 4FZ5A 4QYTA 3OLVA 4BB5A 5JMTA 1RU3A 1W85B 3RLFA 1SZPA 2GD0A 1EFVB 3QUCA 3JAKB 3LQ2A 1R18A 3AO0B 5ALQA 1B4DA 1UKZA 1Z13A 4KFUA 1DJMA 1EK2A 1FXWF 2YNMD 1RPNA 5ITSA 2YWDA 5ALTA 3GIWA 4IMIB 2AE2A 3EXHB 3KWMA 3R5KA 4FC6A 1NVAA 1J1UA 4FMDB 2PKQO 2QTNA 1TF5A 3TR5A 3Q6MA 4D9HA 2QLNA 2AKYA 3QBDA 4U00A 5JLJA 4K3VA 2NYAA 1DG9A 1V1MA 4MKIA 5AICA 5ALWA 4IOLA 4MOWA 2XADA 1GNRA 4EA7A 1UC8A 1BRTA 2QQ5A 1X14A 1NV8A 2NU7A 3M82A 3RM3A 1GQOA 1G3RA 4ND7A 5EYPA 3PXCX 1W8IA 4F3CA 3ROPA 3CH5A 2POCA 2XB9A 4F5ZA 4Y2GA 3G79A 3K20A 3DLTA 1W44A 2ZR7A 1CXZA 1AKMA 2HJHA 1CUEA 2QTTA 3JSXA 2QU8A 3OZVA 3H18A 4JY7A 2ORED 1Z8DA 5TQ0A 3RF6A 3LG2A 3UA4A 3ONFA 5EIEA 3EA4A 4CU5A 2YHBA 3ZGZA 2W0MA 5B1DA 4BBJA 4EFLA 4JIMA 1Z18A 4PHGA 3V00A 1UT8A 1O96B 3K2EA 3PSAA 5CB4A 3DZFA 4MAAA 3R77A 4LZWA 5EHZA 3COSA 4MP6A 4KIFA 1F0KA 1RXEA 3X1MA 4KACA 2L18A 2OC9A 2WKSA 4Q47A 1L5MA 1J09A 4FFRA 5BN3A 1A9YA 5BWLA 3E9RA 1UJBA 1XRJA 4F4IA 1Z4PX 3CRZA 3T1QA 1SBZA 4BO3A 3GDGA 2V7WA 3D3WB 4N5HX 3EVNA 2A9PA 2XBUA 4WKNA 3FMGA 5IRCD 4JNCA 3PWTA 3GLRA 3QF4A 4H7DA 3KZCA 1CR0A 1YJAA 1BW9B 1T36A 1OA1A 1WO8A 4F5WA 2REQB 4GXTA 1YMQA 3PNBA 1XTUA 2HCBA 4BMZA 3B1FA 1P9NA 2AMJA 1P4AA 5BT9A 1NPYA 1P9RA 2A14A 5H3HA 2HJWA 2GK7A 5F35A 1TMGE 2WJ6A 2AJCA 4RK1A 4RYLA 2A0FA 3PB3A 1HT2E 2HMSA 3WGVA 1T0HB 1XQXA 5LBUA 1G0OA 4LYDA 1ECGA 2A1TR 4CQLB 2VHEA 3MAGA 3JTMA 1ML3A 4W5JA 3G5TA 2XR1A 4OYRA 4EKNB 4PFJA 4RPJA 4DDUA 2ZI7A 4BJ5A 5B3LA 3DS8A 1E7YA 3H4VA 4W1QA 1TL7C 2ZB8A 3ZS8A 4HV4A 4YV0A 3DL4A 1JDNA 1YR2A 1P6XA 4H2DA 3EB9A 4TLEA 2R751 3HXMA 1YQUA 1XZMA 3C3EA 1JKIA 3C3PA 3PUYA 1XQWA 3Q5EA 3HY4A 4HZUB 4NG5A 1FRNA 2VYVA 4OXRA 4DIKA 4CGYA 3BHJA 4N3AA 2O7SA 5EKUA 2AG6A 4BVBA 1E18A 2PH3A 4MWGA 4E0BA 3WYFA 1GAJA 1LNQA 3A0RB 3TLEA 1TTHA 2RCNA 2X0RA 3NPMA 4OYLA 3CW2A 3KUDA 5GM2A 3AFNA 3ZD6A 2PZFA 4M7PA 4N7BA 2O52A 2FDCA 1WJGA 2D5LA 3HRKA 2MSLA 2XKKA 4CF3A 2VOEA 2EG9A 2XYHA 2WYUA 3S28A 4PG6A 3M5DA 5D5PA 5FCDA 5FRDA 4FHZA 3QKWA 1SBIA 1PJSA 1P1IA 4Q3AA 1M2GA 2CC2A 1X94A 3F3KA 1ARZA 4WKGA 3IIKA 3W9BA 1RAFA 1U7XA 4I9UA 4HEHA 1G7TA 4OX9Y 3ZWYA 5HJ2A 5EFOA 5L4LA 3A9WA 2HU5A 2OD9A 2XUAA 3NDIA 2VA8A 4GP9A 4FYHA 1SIBE 4JYCA 5FQNA 4OUDB 1TQ8A 4HAYA 5LQDA 1LTKA 2V5UA 4PFSA 2VPQA 4JUFA 3K9BA 1NXXA 1XD8A 4IJUA 4JJIA 4FLMA 3RRNA 2W6QA 1NHGA 4YJ3B 1M1UA 2QTHA 5EC8A 1I80A 5HGXA 1HL7A 3C3BA 1SG6A 1SPBS 4WJLA 2PUJA 2GETA 2XRFA 1T0PA 3SIRA 4CUZA 4BV3A 4U5QA 4QREA 3CURA 3BSSA 3I92A 1T5IA 1STOA 2ODNA 4LRUA 1DRVA 2PHZA 5ESXA 4BEWA 2ORIA 1RQPA 2ZIFA 3QIAA 4C08A 4G89A 3BEOA 5K6RA 1CJMA 4UDNA 2DKFA 4DQ0A 4LDPA 2P9YA 1QHXA 4EY3A 3KRTA 1KIAA 2WTBA 1Y1PA 3FDIA 3IAFA 1JJAA 1O0CA 4LAFA 3ZXUB 1UJ4A 1FUIA 4N39A 3I6MA 5DHPA 4B5KA 2RDMA 4YCDA 1XCGB 4UU8A 1I1OA 3JQAD 3EEYA 4FDAA 4IMPA 1EUCA 3WWZA 1QYVA 3EXEA 2JPDA 4E2ZA 1KKUA 2QNBA 2X7JA 4Y18A 1K75A 1Q14A 3U2QA 3FLBA 1NMEA 4YA6A 2V54A 1BC5A 3IILA 1EFRD 3E1SA 4AO7A 1QRAA 4ARAA 3TZLA 5EL0A 1NXVA 4ACAA 1OVMA 4AD8A 4BV2A 2O3QA 2FSIA 1GWNA 2GGSA 1GARA 4HNAA 4KC0A 5CK4A 1PNQA 4TGLA 1UBUS 2ZITA 1HG1A 3WQBA 4DPMA 4RTLA 1Y6FA 3TVYA 3UYKA 1GYQA 2A58A 1WUKS 4G84A 1PR2A 2EJBA 4PWZA 3O9ZA 5TPWA 1O77A 4BMYA 2I1WA 1EVEA 1BKYA 4QT4A 1MQSA 1KZ7B 3A70A 4RA9A 3QE0A 2ZI6A 3W1EA 3LYHA 3OPYI 2EFCB 5C1OA 1K6IA 4HYEA 2JLXA 3V1KA 3SLGA 4X97A 4C21A 2ZWMA 4GLBA 1VG9B 3RAPR 4RD4A 2VPZA 3IAM6 4I1UA 4WZAA 5FL7A 1HNWB 4J1TA 4G24A 1GQQA 1PZXA 4RUKA 1O5IA 1I2BA 2CLFB 3ABOB 3ASYA 3GZNA 3LI2A 4GYYA 4QTTB 2QRPA 2Y1DA 2VJPA 2AI1A 3GF4A 4M8SA 3ZW7A 1WXEA 4O4JB 4QYXA 2O1SA 5DT2A 3W78A 4ALNA 1RJEA 2AG0A 2BRUA 3HWRA 4I1IA 1C3OB 2PFGA 1E7WA 1SGWA 4R51A 4U9IS 4ZV4A 1YAJA 3K0EA 4TRRA 4XLLA 1I14A 4YASA 3DE0X 1MX1A 1U99A 1XDUA 3IODA 3VFDA 4BDTA 2VK1A 2X8BA 3CUUA 4KMMA 4RH1A 4TPKA 4O4LF 1Q3KA 2BR4A 2YV1A 1NAIA 3BXEA 4JOSA 3SE7A 3SHWA 1YHZA 1VKZA 1US8B 2I7DA 1PFVA 4ZJZA 2PWAA 5EPEA 1HPLA 4J6EA 2MMGA 2SCUB 3PUKA 1M6HA 4L5AA 2QTAA 1NI5A 2H1SA 3X2FA 1O2DA 2QTVA 3N9IA 4Q4HA 1G41A 1SZJG 4PTYA 1WOYA 3GGCA 1URPA 4R3WA 5JAZA 4CEIB 3WIBA 1ABBA 5BR8B 2HR1A 3PVSA 1W88B 2BH9A 5AVQA 1BJKA 1G6HA 4R83A 2WNSA 1SUEA 3UENA 4CLHA 1UK9A 2C2ZA 4DL9A 4H6WA 1NVFA 4E94A 7GPBA 2HT1A 3CEPB 3QJ5A 1KC3A 2WJ3A 1W52X 4TL8A 4DAEA 4O6VA 3A14A 1M7HA 4CFZA 1CVRA 2VDWA 4UM9D 3TJRA 2YZKA 3E9DA 1MAHA 2I76A 2OVBA 2XYPA 5C46F 2JKZA 5C18A 4H3KB 2VAMA 4OHRA 4TS4A 1RQ2A 3PE4A 3HM9A 2E6UX 4IDGA 1K98A 3BQMB 2XTJA 3QV1A 4Y6OA 3I6QA 4BMCA 2G5TA 3P0FA 1X8XA 5IK2A 2XZOA 3JVIA 3ASUA 2YDXA 2PSJA 3FWPA 2FDXA 4JROA 4NPCA 4B9EA 4TUYB 4WXMA 4D0LB 1TU0A 3TRIA 3PGLA 3HNOA 3RYHA 2J9GA 1VL8A 5I8PA 1ZCBA 1TCAA 4G0PA 1PL0A 3RIHA 5KVCA 3AXTA 3V80A 3QOXA 4FEAA 1RJFA 3JALB 1ZCJA 2GJ9A 1SCDA 1SPXA 2PQ6A 3JWIA 2X8WA 2PS3A 1D2GA 1I0IA 1WU7A 3AC0A 3GLFE 5BSFA 4IQ0A 1EB8A 1QNFA 1S4MA 1SBYA 2WVGA 1C30B 1AKWA 4HQOA 5FJIA 1O6CA 2ECPA 5J9FA 3WJ7A 4CLOB 1ZJ6A 5CEEA 5JXIA 3TFQA 3LRXA 2QL7A 5LZ5A 2IZ5A 2R7KA 4NAUA 1WCYA 4IHQA 1AXGA 3PKZA 1V5GA 3RUFA 1Y7PA 2CVOA 3G3EA 4DYVA 1LTHR 5CGZA 7AT1A 3A6ZA 3O1IC 1I24A 2ZRHA 3DAGA 4ZFNA 3LQQA 4AT1A 4CI0B 1YMUA 2R96A 4K05A 1NG1A 3SKYA 2JAPA 4BZWA 5IC5A 2SICE 3EMDA 1JIVA 3KG2A 1PJ3A 2G7MC 2OZLB 2XT6A 2LPMA 2EXXA 1PFUA 3PD1A 5DLPA 1J56A 3H4IA 4KIGA 4LK3A 5H3CA 3IFSA 3E7FA 4JODA 1OGIA 5DF1A 3TL6A 1ZRNA 2Z58A 3CSDA 5HKOA 3ZNQA 1F0NA 1EE1A 1LLCA 4IS2A 3HRHA 4QBKA 4XJSA 1DGQA 1TRHA 4P34A 5AJYA 1B0UA 1H9BA 5REQA 3ZY4A 1X7DA 4ENVA 1OWMA 1UINA 1GSHA 2IP2A 3GL9A 5AMXA 3S2GA 3UY4A 5JJCA 1T9GR 5J2TF 1G20A 4PVCA 3RRMA 1ADFA 3GX1A 3RRXA 2CBXA 1X92A 1B42A 1NBAA 1XHLA 5DEOA 3B1WA 4Q39A 2AFIA 1TEHA 3CMCO 4MR8B 2JEYA 3CKKA 3DWFA 4Q6WA 5KYVA 4PNHA 4ZT2A 2PNJA 4YP6A 1MA3A 3GLVA 4GGOA 1A7KA 1O7JA 4YP9A 1ONPA 5KTNA 3GUYA 3OECA 4ZT7A 5LA6A 4XR9A 1G2IA 3SC6A 3UT0A 1LPSA 5HJ7A 3DV9A 2GZSA 2X23A 5BV0A 3JYLA 4OATA 3Q8XB 1J0XO 3HP7A 4ME6A 5IS2A 1WZCA 4M9QA 1GVHA 2IUFA 2ZVJA 3F3SA 3L0IB 1TUBB 1LF5A 3QU4A 3MBOA 2KPOA 4NENA 4XWTA 3VDMA 2EERA 3FPLA 5JDIC 3AFIA 1ZVQA 4Z0PA 2K6GA 4X8HA 3UUFA 3ZV7A 2UZ3A 2W4MA 3A6FA 3G5AA 1P61B 1RYYA 2VWPA 3M6WA 1GO2A 5B7NA 4BQPA 5AH0A 1KVRA 4IEFB 1UBCA 5YASA 4DMCA 4YMVA 1T8UA 2RG1A 4ZGWA 3HJUA 1AMNA 3RUAA 2XSZA 5DFAA 3GGGA 4FYKA 4QGAA 4YI3A 1FSGA 1Q15A 5DV9A 1XA0A 2QEQA 2B6NA 3RBAA 2VXOA 3P2KA 4QFMA 5M3BA 2BJVA 3NFRA 2IU4A 1S8AA 3TD9A 4RIIA 2N46A 3BICA 4HFMA 1RMYA 4J0DA 4OYYA 5DN6A 3AEXA 3FHOA 5A62A 1RYBA 5IN5A 5AQ1A 2GM5A 1IZ9A 4MLZA 5F1KA 3VSBA 3O7WA 4NCIA 1NVVR 2P67A 3PFKA 4UNQA 3SD7A 4H0NA 3GFGA 3EIHA 2VCHA 2UUBB 1B14A 2B0JA 4XDZA 4D80A 2RGAA 2FFRA 2YDYA 4GL4A 1R6TA 5EG5A 3D6TB 4LYGA 2QQGA 4C5AA 1E8NA 4P92A 4XOUA 4RJTA 3F5QA 4KQWA 2OUKA 2DERA 4K0KB 3OQMA 2BGWA 1OHHD 4RCYA 4BEJA 5FBZA 5C8YF 4JBXA 2Z4RA 4ZV9A 4Q7JB 2VATA 3ORSA 4J29A 3R3VA 3OT5A 3WK8A 5EXSA 5HWSA 1JFSA 2B25A 3W5IA 2W6MA 5HF6A 3LWNA 4FNMA 3UHAA 2ZT8A 3JATA 4FQ5A 4LECA 3B1KA 5BRAA 1KEUA 1O9GA 1KDZA 3SQMA 3MJRA 4TLMB 5HNKA 1ZDMA 4IDOA 4XFJA 2C4TA 1GV0A 1SWWA 1K68A 3KJEA 3R7WB 1Z2OX 3OC6A 1N5IA 3DQZA 2H7CA 4H35A 3KQHA 1EA7A 3BUSA 1EVIA 1P1JA 1PI3A 2P91A 5BYBA 1CEQA 2F1KA 1P3Y1 3I5YA 3OHMA 1S9DA 4NDNE 3DLHA 3IPCA 1N0IA 2IXBA 3H2YA 4LBYA 4NABA 4CKEB 3LLVA 4H3SA 3BE8A 4U2BA 3FOZA 4RD1A 1SCNE 1VHLA 3RV3A 2CLHB 5ECYA 2PMWB 821PA 4G26A 3MJCA 2GXUA 3PS9A 3KWJA 3N0TA 1K86A 1BVUA 1YDEA 2F8MA 4LJ7A 2PH7A 3T5CA 4J4HA 4IGAA 1M0SA 3U4HA 3VOAA 3U19A 1HQDA 1L6IA 3RHSA 2GCGA 4DA0A 2PNFA 1RJ9B 4GW3A 2WQ7A 3HKEA 3KO8A 2BELA 4OQPA 1Y5RA 3EZYA 3GDHA 1EPUA 2V3WA 5DM4A 5FO1A 4W9MC 2Q3BA 2WINI 4PO1A 4Y67A 1JSCA 4F4HA 4YALA 1TMKA 2C9OA 2CBZA 4IQ8A 5HBRA 2M6KA 1IONA 1CVIA 3I76A 5JYCA 2FSVC 1ICIA 2ZJBA 3QLTA 2B8JA 3P9KA 3C74A 3O5AA 4XYLA 3GLGE 3ZVKA 5TXGA 5U4QA 2HA7A 2H1IA 4BU1A 1FOEB 4G5QA 5WRFA 3U16A 3DR5A 3KHTA 1X80A 1PWYE 1WF3A 2J9RA 4DRXB 2BZ0A 4F2WA 2H07A 4EGAA 3DNMA 2W43A 4LCJA 4QARA 4QOIA 4Y0NA 1ZXBA 2BMFA 2BI7A 3EZNA 3HBLA 1TYCA 3KTDA 3OQHA 2EX0A 4LOLA 4NP6A 3O8LA 5DIFA 4MI3A 3VVMA 5BXQC 4GLFA 4FBGA 2W6ZA 3PFIA 2IU0A 4DJTA 4C7XA 1KAMA 2V97A 2C9DA 1M67A 5FTWA 2XKJE 5B1IA 4B3DA 6REQB 3U6KA 1MH9A 1XVVA 4JLSA 4ZAYA 1RAHA 5AT1A 1E3QA 3WY9A 4FWTA 1D8TA 4H0FA 5JG7A 1UEJA 3RANA 1E9FA 1O9BA 3NWJA 3OIFA 4BFSA 3AJEA 4NQRA 3V8EA 4JT4A 5BR7A 1C7JA 1OBOA 2JFBA 5IC4A 1T1EA 4L16A 4Y9DA 2C7RA 3NM6B 4I19A 2JARA 3F6YA 1YU6A 5J43A 1Q50A 5IC6A 2F9FA 3A9SA 1K6XA 4JI8B 1BH2A 5B55A 3C7KA 2ZVDA 3U6BA 2I99A 4M55A 5FLKA 1BDMA 5L3QA 5FWNA 1IM5A 1YI8A 3H1FA 4FGWA 4CVNA 1RRKA 2CB9A 4ECAA 3ZE2B 2WE7A 3IT3A 2ZE8A 4MVCA 3RDPA 2NZXA 2WM2A 2J9ZB 3DAFA 3KQYA 3PL1A 1R6AA 4RZHA 3WIVA 3A3NA 4UEOA 4ZCPA 1N34B 3R8XA 1Q0SA 1UC5B 2N0SA 4KGXA 1AK9A 3KXPA 3DBRA 2GSDA 3WMXA 4XJXA 4AP5A 4KKXB 4QPNA 1FX0B 1K7XB 3TEFA 2GDZA 3VI3B 2A5GA 2ADMA 1HTWA 1B6RA 2DWOA 2X3UA 4N3BA 5C7LO 4LJ5A 3CEAA 1GT91 4QOSA 5T4FA 4RMGA 1NR5A 2WV9A 5EQDA 1KZ1A 3D1LA 1PL7A 4RKQA 4K8RB 2YY7A 1FNMA 2NSHA 3WP1B 4ARZB 1H8HA 4L50A 1DUIA 2PSFA 1BX1A 3BXPA 1WHSA 2W37A 2H17A 2H2DA 3D7NA 3MJDA 4N48A 1Q19A 2IUSA 2OHJA 2Q4BA 1WD7A 3KJIA 3P0IA 3GR6A 4GO1A 3SSOA 1NW3A 5IT0A 4UULA 3W4KA 1NU8A 1IB0A 4V2IA 5DYNA 2I9PA 4MRRA 3ANLA 5J47A 1XG5A 4CQMA 1CUVA 1JFRA 1LI4A 1SXGA 1DAMA 4FYVA 4LJ4A 3L93A 5TGDA 2D3TA 3SSMA 1P3JA 4C0AC 4L9SA 1E9BA 3P94A 2O8FB 4B6SA 1LFDB 5I51A 2X1VA 1U1FA 4TV8A 1HT1E 4H15A 1MFZA 3EMBA 1QUFA 2Z8ZA 1IMOA 1NW8A 3D0QA 3NHYA 2GDJA 2VKTA 4KREA 5FA8A 3EZLA 4W5HA 1C1DA 5A3VA 1JG3A 1V3VA 1GPDG 3TN7A 5BQ5A 6CHYA 3T3HA 1K5DA 1W5EA 5A3RA 2G25A 4D98A 5AJUA 2XDQB 3CR3C 1FB5A 2Q9AA 3BYZA 4BNUA 1M34E 1HDCA 2G77B 5EE3A 5AVUA 3BXHA 3BXXA 2VQDA 4R1PA 5AESA 5LUBA 3TR6A 2D00A 2PVSA 3HVIA 2FG5A 3GLIE 4IL5A 4AS3A 4TWRA 3R7SA 3AIMA 3QA9A 4GRAA 4B85A 5K0GA 2R1TB 2XVXA 4UXJA 3CHYA 1SEVA 4X1IA 2O1EA 1TF2A 1SOAA 3OC0A 1N5DA 1QBGA 2X8JA 3D4IA 3PQCA 4FQ7A 5DHTA 3ASVA 4KV7A 4ZEOA 4V1CI 2ERCA 1CQIA 2V58A 3U3XA 1JIKA 3PFGA 4Q9KA 3CEJA 3TKAA 1UK8A 2FJPA 3WFZA 5ITZB 2FSGA 5L3RA 2ZR9A 3WRXC 3VPDA 4DIEA 2KX7A 4QJ3A 3HCCA 5LQKA 2JJQA 1O8CA 5ELXA 3L4BC 5AXCA 3IEPA 1ZA2A 3EAGA 2QM8A 4KPUB 4PSKA 1HLDA 5C8DA 5HZMA 4M53A 3FPHA 2O3SA 4L8YA 2X9LA 4K9KA 2W2VA 3TTTA 2SNIE 5IAGA 3WYAA 4TMKA 4Q9IA 1FTNA 1HEIA 1NBEA 1SCBA 3VR2D 4BS9A 4G23A 3LGAA 3LHSA 4TTTS 3VKUA 2AYYA 4O2BA 5HKAA 2WFLA 1LD3A 1NYTA 2JGDB 3OO0A 2ZSUA 3O8OA 4M7OA 1E2MA 1T0BA 1FJ2A 5K03A 4LZOA 4KU4A 3DE6X 4C6TB 1ZMOA 3TVDA 4YUYA 1B8OA 1W4LA 3OPVA 1TZCA 2IZZA 5IU6A 1MXHA 4JJ7A 3BWEA 2KB0A 1OZGA 3QFHA 2RI0A 5LC1A 1VZ2A 3OQPA 3PXDA 3ZY2A 3G0CA 2RGRA 4EYEA 3DPUA 4MK4A 1L5QA 5K3DA 3OEYA 1S02A 1FZQA 3OKCA 4KBGA 2WSLA 1ABEA 3AU9A 1NE7A 4BFLA 1OV6A 1J6UA 4WNAB 1SVUA 5CW2A 1TC1A 2HHLA 3VVCA 5FPTA 1G6OA 4E6PA 1D0VA 1TTPB 4IOJA 4JA2A 5CT4A 4YPVA 2QRLA 3ER9A 1GKYA 2HDWA 5DHUA 3TD6A 3B7PA 1P45A 1K4YA 2CCJA 3H86A 3OETA 4MGEA 1IXSB 4N82A 3U7RA 4QPPA 2RGYA 4FMCF 1U6JA 3AKEA 3II6X 4LXYA 5HUJA 5PNTA 5FIUA 3H6HA 1LLUA 1VHJA 1GPWB 4E6EA 3M3PA 4MNTA 3KD3A 1FDOA 1I4TD 2YHAA 3FSRA 3O84A 3P2EA 3UG6A 4BB0A 3MMNA 5CX1A 2PTHA 4AY3A 3BTUA 1DXYA 4EB8A 4I6EA 3SIWA 3VU3A 3W5SA 3IRVA 3PIRA 4EK9A 2AOWA 2OBMA 1G8YA 1CUGA 3AMVA 1GL3A 2NTJA 2Q3DA 3TSAA 5JW6A 2HCTA 4JKIA 5JVDF 4X61A 2QZZA 3LL7A 3K1YA 1OFUA 4GUAA 3UV7A 1VJTA 2V7VA 3P96A 1TZBA 1WU8A 3DEYX 3VNBA 3H4MA 4BX9A 3OTQA 4F60A 4DUZB 5HJ5A 2CFOA 5KCMA 2Y1GA 1HOXA 2HNKA 4FYJA 3HVRA 4OI0A 2VYNA 3K5IA 4P7GA 5E0KB 5KOYA 4LV8B 3E5NA 1OWLA 1UBHS 2ARKA 4YT8A 1HY3A 1XLUA 4L3WA 2GXQA 4K87A 4CM1A 4ZREA 1TGVA 1W0JA 2SKCA 3FZQA 2QKYA 4LOKA 4AF6A 1C1XB 3OBIA 2XGMA 1GTL1 4AICA 4G56A 3T7JA 5B7PA 3SQLA 4OQLA 2DGDA 4JLOA 3H5LA 5EWLB 5HIMA 3I3OA 3JVVA 4MV5A 2H65A 3G59A 1SXJE 2Z56A 2EKPA 4AZSA 4I9FA 4Q16A 1N9GA 3U40A 3AIIA 2W93A 2P8SA 5CAEB 4REOA 4NCAA 1ZS9A 2QTWB 2FNAA 2Y0BA 4J0QA 2VNJA 2OXTA 4XH9B 3RAGA 4R1LA 3HJRA 3T3IA 4BQRA 4C76A 4Z51A 4QE3A 5KX5A 2VP5A 3WIUA 5I7SA 4DQUA 1RRVA 4GF5A 1N92A 3KAQA 2QT0A 4JT9A 1SBNE 4AP6A 1ZXLA 2F8TA 1DBPA 2HRDA 2VYCA 2XDYA 4LHSA 4XQCA 3A3YA 5BN4B 1O4VA 3SS8A 4RULA 4RJIA 5FTLA 4EVQA 4Z8YA 4FT4A 5D01A 2A0YA 4NV1A 1RC0A 3OX2A 1ORVA 2VP9A 2OBBA 5C34B 3ZCSA 5TS2A 4JC8A 1JKJA 3BMCA 1MEJA 3WMEA 2G28A 1HQKA 3UAZA 1ZX1A 4ZHQF 4NZ9A 1A71A 1ZAKA 4OHZA 4CT5A 1BGXT 5A4FS 1LWOA 3WLMA 3QFSA 4EUKA 3SM9A 1BNCA 1JQ3A 4N9QA 3UJAA 3KQPA 1OOEA 2J9FA 3DPIA 2YZNA 3NVKI 1T2UA 5ALLA 2DJ5A 5D51S 5B4VA 2PD6A 3LF1A 1ES9A 4P58A 4JFAA 4EG6A 2ZJ2A 3K71B 1KI8A 1SBTA 3KXIA 2ZSDA 1V95A 3RIEA 1Q1QA 4K9MA 1CSEE 4TZ6A 1WUTA 4K3UA 3IAAA 1HETA 3GP8A 2WG0A 4E12A 5CEJA 4TSFA 4C1BA 3VDQA 1KQPA 2XCUA 3HCNA 5EJIA 2ZJOA 1KS9A 4HI0E 1D1QA 2ZK7A 4D26A 4MCJA 1Q44A 3T5AA 4AULA 4K6CA 3WDKA 2C7PA 1PCXA 2FSVA 3PGVA 1NMSA 1KO8A 4JA0A 5CLIA 3VPSA 3I42A 2FEAA 2QW1A 3FH0A 4B6QA 1YOVB 3NOVA 3IQGX 1GKIA 2Y66A 3O8QA 2ZYIA 5IP5A 3UC9A 4AKEA 2L82A 4B3MB 2ZJZA 3TBHA 2GHIA 2PPLA 3IEIA 3U3DA 4EJ6A 3U44B 4EJSC 2O19A 4UE6A 4R7ZA 2FZWA 1JBKA 1ZIDA 3DUFB 4AY4A 1G5QA 2E37A 2NSYA 2VDRB 4LX8A 4NATA 4KQCA 4DA7A 1NWHA 3U5TA 1DAIA 3IMCA 1SOMA 3S7TA 1II8B 5JY1A 3OI7A 3PUVA 2NAFA 2WM9B 5B58T 1YC5A 5CCDA 1IM8A 1ZO8A 2JIZD 4OMDA 3SJ7A 2YUTA 3WHLA 4B8YA 1WETA 1SG9A 4XWAA 4Y0AA 4ZARA 2VHJA 1JYEA 1XMPA 4Y30A 5GGXA 3GEPA 3H97A 1KPGA 2YH2A 3G0IA 4QPCA 4F4FA 3HJNA 1KEVA 1KDTA 2J0UA 2WIGA 3M9XA 4JD5A 4Z9BA 3KEQA 1SURA 1OKKA 2C00A 1GL6A 4NIMA 1IN1A 4F84A 4WZAE 1FYFA 1ISRA 2JCBA 2O4UX 3AEUB 3QTTA 5DXFA 5AM4A 4DUGD 2PUCA 3O4FA 1V1RB 1Z5GA 2HF7A 1C0PA 4PZLA 4RIFA 2O6HA 3UB2A 3QJGA 2JFQA 3O1LA 3ZV3A 5JPCA 3A6GA 1GG8A 2WG2A 3QBJA 1BS1A 1Z4IA 1O03A 5EZ5A 3VNSA 2FUG1 4BVFA 3QYAA 4YV2A 1MABB 2R25B 4J3NA 2Z8XA 3UWPA 2P4SA 3HJCA 4LNUB 5HKKA 5TQ2B 3HP1A 1BQ3A 3D2AA 1W36B 1CYEA 1KU0A 2XWPA 2O3RA 1YQGA 1P75A 3AUFA 1NW6A 4FN4A 4KL8S 1QC5A 2FY8A 1T8TA 2VS1A 4I5IA 1U2SA 4M76B 3RBVA 3IA7A 2JATA 1D7OA 2W8BB 1JTEA 3ACCA 3DMNA 5AVOA 4KPYA 1CG6A 2ZT6A 4OD0A 2IHUA 4E51A 1M1YB 2PUTA 2PBLA 3NBUA 2VNSA 2DUMA 4LJAA 2DQZA 3RVKA 5F5XA 4UTVA 2XGJA 2M6LA 4XVRA 5JS7A 5DPMA 2IXAA 4HNGA 4ZQHA 1HXHA 3RT1A 6GPBA 3KSBC 1XWIA 2HC9A 2RH5A 3NHSA 3H0KA 1M5UA 2Q1TA 1OC4A 5AHXA 1IXZA 1AB6A 3KSDO 3U31A 4F86A 1Y8RB 4C4XA 5B12A 1XZPA 1L5WA 1ZIXA 2C96A 3R3XA 1TKRA 1TXGA 4G81A 2W2XA 4UEJA 3WLRA 5JANA 3MILA 2XCIA 1WBJB 3K1AA 4GRDA 5BQOA 2BDEA 3ZI7A 4F3NA 4YQEA 3MINA 2IYQA 2IHVA 2OR3A 1I7NA 1BHQ1 4MLCA 4KO8A 4DYHA 5JAHA 2XTNA 3UUGA 5U1PA 2QP9X 4ZI7F 1KARA 1NFRA 1XZGA 1KY4A 2FEPA 1YRYE 4S1NA 1SHLA 1JIXA 3C5VA 1JT2A 2FFQA 5KNDH 5LP1A 4I50B 3P9SA 1V2GA 3ZOZA 2G5GX 3JQQA 2MJLA 3CVJA 4EZBA 5LR6A 5A2QA 2ZR8A 4ZT4A 1GAQA 2FPMA 3TYXA 2H2HA 1VLJA 4BBAA 3N0XA 2GPYA 4QBGB 4RPLA 1LVHA 3K0SA 2QTRA 5F1OA 1BVHA 3ASZA 3ORQA 2WAXA 2X40A 2FWAA 3BERA 3AERB 4RL4A 5AFSA 4HQFA 3EZXA 3L8CA 4U8GA 2B8EA 2DWPA 2W48A 2J4DA 4B33A 2CLOB 4ZC1A 3TEJA 4F2HA 3GVIA 2HA6A 3ABQB 3B1JA 1QU2A 4GSYA 2QUAA 3QX8A 1U28C 2BM9A 3KZOA 5DCLA 4OXNA 5KVVA 3ICWA 1K8RA 3BIFA 3WRXA 2Q7OE 1P0FA 1SKAA 2EU8A 2GWRA 4MW2A 3L4BA 2AX4A 1N1GA 3AESB 3G2HA 5TQJA 2OPHA 3HCEA 2IDZA 4F5EA 5B53A 2XQKA 3SDBA 3M4XA 3PYXA 3D6UA 5CVDA 5FWYB 2CXOA 2YC2C 2R8PA 1RRGA 3OY7A 5ALYA 4EFDA 3R3WA 4I3FA 3ZWNA 1PX0A 1PDVA 2EZ9A 1PBTA 2ZLBA 3G2NA 2QD4A 3L04A 1Y33E 2BI8A 2R5WA 1USKA 3NHRA 1DLJA 3Q40A 4UUOA 4X24A 2PUWA 4DIBA 1UFOA 2D62A 3DOJA 1D07A 1PR4A 1WXXA 2PU7A 3H87A 1ISFA 2A2ZA 3D8HA 4KQ2A 2UUPA 5EZ6B 1SKYB 5ALIA 1EGHA 1G6KA 3M6LA 3NH6A 5THXA 1H69A 5E4FA 4Z3DA 1KAEA 1G20E 2HEIA 4BL5A 2AN5A 5L7WA 1E7RA 2WIBA 2AJ8A 1MJ5A 1N2EA 2YVQA 4FDTA 1XR3A 2C94A 4E5DA 2AFIE 1EZ4A 2NU7B 3AOGA 5J1SB 1AHHA 2ZWVA 3DTVB 2G7ZA 2QRVA 1GGKA 1R0ZA 2TMKA 4HDSB 2V7EA 4RVOA 4RTQA 621PA 4X6XA 5CH5A 1QWOA 2H06A 2PRIA 4ZI5A 5CNMA 5BSGA 1WP4A 1ZM3A 2XUDA 3F8WA 3O21A 3OX3A