2HF2A

Domain shifting confirms monomeric structure of escherichia sugar phosphatase suph
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
270
structure length
266
Chain Sequence
LSVKVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASNNQYYQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKNFVACGLQSAYVSENAPEAFVALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHVALDGIMKPVTSGFGFIDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDDNNHEGALNVIQAVLDNTSPFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Sugar phosphatase supH
publication title Domain Shifting Confirms Monomeric Structure of Escherichia Coli Sugar Phosphatase SupH
rcsb
source organism Escherichia coli
total genus 79
structure length 266
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.1.3.23: Sugar-phosphatase.
pdb deposition date 2006-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 2hf2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hf2A01
5AVYA 4BEVA 2IYEA 3U7HB 3QUQA 3U7FB 3OCUA 5AVZA 5AW8A 5AVXA 2IOHA 3U19A 1L7OA 1Z4MA 3DDHA 4OD0A 1S2OA 1RDFA 2G06A 3FVVA 1X42A 3QUCA 4OFZA 4EENA 2HO4A 1QYIA 3OTQA 2ZOSA 2EARA 1T9ZA 3B8EA 5ALGA 4NABA 2I34A 5AVSA 2PKEA 4KNVA 3E8MA 1RC8A 1CR6A 2HSZA 1T5TA 3ZX4A 4XE5A 4C4SA 2YN4A 4DWOA 2BDEA 2ODAA 4DW8A 1SU4A 2P27A 5AM4A 1Z4NA 2YMPA 1Z88A 2OM6A 3A3YA 5AVWA 2B82A 4DCCA 1F5SA 2I54A 3L5KA 5AW7A 1VJRA 5ALMA 3OCVA 2B8EA 2GO7A 2Q4RA 5FP0A 5A3RA 4Y2SA 5AI4A 2ZBDA 5AVQA 1Q92A 4G9BA 1Z4QA 5AKIA 4I9GA 4J2TA 5ALLA 4AS2A 4Y2VA 1VJ5A 4ZEVA 3F9RA 2WHEA 2OBBA 3A1EA 5ALOA 4O8CA 2NYVA 2YBDA 2P69A 4PNHA 2I6XA 2Q5EA 2VKQA 3QUTA 5ALKA 3SF0A 3U7EB 2AH5A 2C8KA 2D2VA 3CZ4A 2CN1A 5AVVA 2G0AA 2PQ0A 5ALVA 4Y2QA 4AP9A 2YJ4A 4XOUA 3AR4A 3SD7A 4J03A 2HEGA 4UW9A 3PGVA 3AR5A 2W4MA 3ESQA 4NV0A 3PCTA 3ET4A 3ZUPA 1RQNA 2R8XA 4FYPA 3KBBA 5AVRA 4MWOA 5ALIA 2YMMA 1ZJJA 1Y8AA 3FPBA 1NRWA 1N9KA 2C8LA 2GMWA 1U7PA 3OCWA 5IT0A 4MUMA 2MU1A 3NIWA 1L8LA 3ZVNA 5AM0A 4YIKA 2FPXA 1QQ7A 1ZD4A 1TJ3A 5AIAA 4XPZA 2FPRA 3L7YA 2IOFK 4BNDB 3W5BA 5ALJA 1YNSA 2O2XA 3ZU6A 4KX5A 2WF5A 3TLMA 2X4DA 3L0CA 4RESA 1YDFA 2W11A 5AK5A 3RFUA 3WK7A 4JB3A 3BA6A 3N1UA 4G63A 3QU5A 4JDPA 5AI5A 2RARA 3GYGA 4Y2PA 2WF9A 1RLMA 2G80A 3WK6A 3VAYA 2AGVA 2FUEA 3N28A 3BWVA 4YH1A 3NRJA 3W5CA 3R9KA 2GHQA 3WGVA 4YCLA 3PGLA 3UMGA 3NALA 2IOFA 5T41A 3M9LA 5AW4A 4Y2UA 2HI0A 3ZWKA 3AR8A 2JARA 1Z5GA 5AI6A 5AESA 4OCZA 4Y2JA 2BDUA 2HF2A 3OCYA 3DAOA 1WVIA 3AR6A 5AM1A 3A1DA 2YMLA 3L8FA 5ALRA 4YCNA 1ZD5A 1WZCA 3QU7A 3L1UA 4HAIA 2WFAA 3WKEA 5AW9A 3CNHA 1FEZA 3DNPA 2WF7A 3MMZA 4EZEA 4FE3A 3L0BA 3ZVMA 4HYTA 4L6AA 4KNWA 4YIHA 1RKUA 2WM8A 1XPJA 2O9JA 3IRUA 5AM3A 1TA0A 3OPXA 3SKYA 2Q4TA 1RKVA 2R8EA 5A3SA 4QQFA 4CF3A 4YGYA 2P9JA 4B6JA 2G1AA 2C4NA 3MPOA 1QQ6A 1RLTA 4UM7A 2OYCA 5AKEA 1U2SA 5ALSA 5AVUA 2G07A 1O03A 4AS3A 4CE6A 3OCXA 5AHXA 3N8GA 1U2TA 4BKMA 4EEKA 4F71A 2HHLA 1J97A 1Z4IA 2YFYA 4GIBA 2P11A 3I76A 4Y2RA 1O08A 3QXGA 4CF4A 1NF2A 1K1EA 3HLTA 4KN8A 4ZEWA 2JGAA 5AKHA 3KOOA 3IB6A 5ALFA 4FFDA 2PR7A 3SKXA 1Z4KA 3QGMA 3ZX5A 1ZRMA 3DV9A 4BX0A 3WK8A 3NANA 4DFDA 1J8DA 4BNDA 1RQLA 4UASA 3R09A 5AW1A 1RRCA 5ALDA 3QNMA 3J7TA 2CFRA 2I7DA 1WPGA 2DQSA 3PDWA 5AI8A 1YMQA 5ALWA 4NFLA 1IWOA 3AR7A 5AKXA 1L6RA 3QUBA 3EF0A 2G09A 2IA5A 3ZWDA 3E84A 3ZI4A 3B9RA 1RLOA 3WK4A 5IS2A 3M1YA 4GXTA 4XQ0A 2GHTA 4H1WA 1RMTA 4UMDA 2YJ6A 5A3QA 1PW5A 1Q91A 2B30A 4HGOA 2ZG6A 4UAVA 4UMVA 2CFTA 2QYHA 5AW3A 2EATA 3EPRA 5AK4A 4YCMA 3UMCA 3SMVA 3ZTWA 2HF7A 2RBKA 2YMQA 5AIBA 1NNLA 5ALUA 1TJ4A 3FM9A 2R8YA 2FPWA 2FPUA 5ALXA 3NASA 3FZQA 5ALZA 4NAVA 5AICA 5ALHA 1ZD2P 4L6CA 4UU1A 4BX3A 3NUQA 4UU0A 2C88A 5ALNA 3WKCA 2QLTA 4CF5A 5AKLA 1L7PA 1U7OA 3ZVLA 3UMBA 3U7GA 3RF6A 5ALTA 3P96A 3MC1A 1VFPA 3QX7A 2OA0A 2I33A 4NWIA 4BYGA 4ZEXA 5AKZA 3WGUA 3AR9A 2HOQA 2YY6A 4BX2A 3ET5A 1WR8A 2G08A 4CNQA 3ZW7A 1T5SA 4HGRA 5JJBA 4HGQA 4BBJA 3FGOA 1LVHA 1S8OA 2ZBEA 2HDOA 1XVIA 4HGNA 2W43A 2FUCA 3ONNA 3SHQA 1JUDA 4E88A 3I6BA 3WKBA 3W5AA 1ZOLA 4KX3A 4Y2XA 3WKAA 5ALPA 3I28A 1TE2A 5AM2A 1YV9A 2B1RA 2YJ3A 5AM5A 2R8ZA 2C9MA 1Z4JA 3E58A 5AI0A 5AW0A 1MH9A 3EWIA 4C4RA 2HX1A 3L1VA 1L7MA 1U02A 2B1QA 5ALYA 3B9BA 1EK1A 5E0OA 1L7NA 1Z4OA 1Z4LA 3QLEA 3W5DA 3EF1A 3L8GA 1RMQA 5AW5A 3QU2A 2ZBGA 1Z5UA 3MN1A 4OHFA 3N07A 1QH9A 3E81A 2RAVA 3HYCA 3QU9A 4KYTA 1RPZA 3ESRA 3WKDA 2BY4A 4RETA 2GFHA 2FPSA 1ZS9A 2AMYA 3QYPA 1AQ6A 5ALQA 2B0CA 4UATA 2NO4A 2MSNA 1SWWA 1EK2A 1TJ5A 5AI9A 2AUTA 5AW6A 4BEWA 1ZRNA 2JAUA 5AVTA 3KC2A 3SLRA 1LTQA 1SWVA 3FPSA 3I1YA 2WF8A 2JAWA 3ED5A 4Y3UA 3L8EA 2ZBFA 4IFTA 4EELA 4Y2YA 1N8NA 4L57A 3D6JA 2FI1A 5AK3A 3U26A 5AKGA 3R4CA 4EX7A 1RMYA 2WF6A 1KYTA 3S6JA 3KD3A 3NAMA 3N5KA 2CFSA 4F72A 3KZXA 2ZXEA 4IG4A 1YJ5A 5AKJA 2YJ5A 1CQZA 2EAUA 4Y2TA 5AK6A 5AW2A 4UARA 4I9FA 1RKQA 1L8OA 4UMEA 3WK5A 4UMFA 1ZD3A 5AKKA 3UM9A 3K1ZA 1QQ5A 2JAOA 2I55A 2FEAA 4UAUA 1Z4PX 3IJ5A 3WK9A 4C4TA 3U13A 5AKYA 3AR2A 4HGPA 4EX6A 3A1CA 2FDRA 3L8HA 3OCZA 2RB5A 3L0YA 3ZTYA 2B8JA 2NO5A 3AR3A 3QU4A 2HCFA 1XP5A 3KDPA 5ALEA 4UM5A 4QJBA 5IT4A 1YS9A
chains in the Genus database with same CATH superfamily
2QE7A 3OIDA 4L1KA 1DC6A 4CM4A 1Z73A 2VJBA 4ZO7A 1S7GA 4ENTA 3A05A 1YR7A 3AOEA 2VSXA 2O3UA 2LBPA 2HM7A 3BGDA 3ESZA 2QTWB 3DOFA 4MP6A 4FFOA 4AY5A 4BQSA 2OWEA 4F3TA 4MQ6A 2I4RA 5EHGA 2EJWA 3LLMA 1H6AA 4AMBA 1TZBA 3CVOA 3PB3A 1QDEA 1R6TA 2RGRA 3NWOA 3PK0A 4D82A 2W2OA 1Z9BA 2XCRB 2PJRA 4O3MA 1WHSA 1TYZA 1Q95A 3OJWA 1F2VA 1N57A 1G98A 1ATZA 1VMEA 3LU1A 1K3FA 5FBKA 1DINA 2VDRB 1B26A 2ZI7A 4Q39A 2ZIUB 1DOAA 1TXGA 1IPEA 1N5LA 1BXKA 1H69A 1WW8A 3ITKA 4M8NE 3NDBB 1SBTA 1HEYA 1RP7A 3WOHA 4CLRA 3SF8A 1SGWA 2QTMA 3IEIA 2IIVA 4FBGA 1KSFX 3JQ7A 3F96A 2WWWA 4FGKA 1GG9A 2XMDA 4OQNA 4XARA 5BVHA 3U44A 2CJWA 1Y48E 4K6KA 3CLHA 4WOJA 2ZU6A 3LWNA 2V9PA 1PVOA 4RZ3A 4UNNA 3PP8A 1CQIB 2HQRA 3LFUA 4G4SP 4NZ9A 1E3QA 4E31A 1GZ3A 4OHRA 3U60B 1QYXA 3SQWA 4NCIA 4GPBA 2I2BA 1FTNA 1CQJA 1IVNA 2CC2A 4L5JA 4L3WA 4RSRA 3M7IA 5DXJA 3VPFA 4Y2VA 3O4IA 4NHOA 3IEVA 3RSSA 3F9RA 3GFVA 2Y3IA 5ALOA 5FBWB 4O8CA 4V1CA 5DBOA 3A1SA 4KSBA 4DZRA 3PX7A 1T2UA 3LHSA 3HCCA 2VAXA 3Q88A 5LLTA 2JZNA 3UWPA 4DUGA 1M2KA 2TECE 2CHEA 2YICA 3M6UA 3NU1A 5KCMA 4EO9A 1AK1A 1N6PA 1P8AA 2C8KA 2WAAA 2WPNA 3PLRA 4HO1X 2QW8A 1GSIA 3E9ZA 4YTEA 2PUGA 4PS1A 2HJRA 4BFLA 4DBZA 3WSVA 2RONA 5I51A 4KDRA 3KQWA 4LF4B 1ACLA 4KU4A 1K8YB 3AETA 4BWYA 1GEEA 4AECA 5FPHA 2BZSA 4EH1A 7REQA 2RHMA 4EG8A 3UV7A 4E94A 3R9IA 5DHPA 4DJEC 1DBVO 4A5OA 4PZUA 1O94C 3T7IA 4LMPA 2IYOA 4WNAB 2ZIXA 2W6IA 4U2EA 3WBFA 2WZQA 5J4VA 3TZQA 2V0GA 3AOGA 4K8RB 4FBMA 4N0QA 4D0GA 1ONPA 2J32A 2WNSA 3GNLA 5IJAA 3W6PA 5HZGA 3LIIA 3L43A 5A6SB 2DLDA 4U2KA 5FBQB 4AROA 1AV6A 3LUPA 4BIMA 2Z5VA 4AJOA 5CCXA 5KNCH 5KYXB 4EBFA 2Z58A 1AJEA 1C7EA 3IP3A 2B9VA 1SKYB 2GA9A 3NDPA 1LSOA 4I4LA 3GLQA 2HLNA 4C0LA 5KTMA 3ZVNA 3QFFA 1GTJ1 1TVKA 2Z0MA 3HSSA 3DB2A 4YP5A 2VP0A 4YMWA 3ROPA 3VPDA 2GYVA 5C9ZA 1TZ2A 5LU8A 5BSVA 2B2XA 2X5NA 3RUEA 3SSNA 3PC8C 2IUSA 4P3OA 1RYEA 3GRCA 3I9NA 5D6OA 3ZOZA 3ANTA 3GPDG 4QRDA 4RXMA 4EYGA 2O0JA 3DFFA 2RGBA 4AMZA 1EB8A 3G1UA 1M8JA 3WJ2A 3NC1C 3IIMA 1Q0SA 4F91B 1P0PA 2FEMA 4GZ6A 2XLCA 2E89A 3K31A 2YDXA 3GCZA 4BQQA 3WK6A 1CKEA 3S8YA 1WZNA 3WXMA 1VZ3A 4YH1A 4RABA 2QRQA 3FVRA 2O8NA 2ZI3A 3G5LA 2IOFA 4J0GA 3GLKA 4B45A 1DQYA 3ZWKA 3GBVA 1U9JA 3MFYA 2ZR9A 1Y7HA 3I8XA 4KQMA 4B7CA 5AESA 1SD5A 3JQCA 3GGCA 3O8LA 4N7JA 1TKAA 4OQLA 3TG8A 2B78A 4ZIRB 1QGOA 4GBJA 2NLOA 4B2YA 2BSXA 5F7OA 4AULA 2Y1WA 4X65B 1BE1A 2QAGC 2VHZA 3A70A 2QZ9A 4FUTA 3TUZC 3L8FA 5THKA 5HJ2A 3WB1A 2PZMA 4YCNA 2DERA 4NCKA 3STWA 3FX2A 4OFXA 4HN9A 3HDQA 4HAXA 4TV8F 1E2HA 3FPGA 1W5TA 3GFQA 3LY8A 2H1LA 3B36A 1Y42X 4HDRA 4AQYB 4LJ7A 3ZLTA 1JILA 5CB6A 2Y1LA 4JSYA 1QJCA 2AXPA 1MW9X 3IRUA 3NAGA 4GBMA 2P6UA 4MX8A 5GM1A 4BVHA 5J3JA 2FMFA 3RYIA 3JPWA 4XTRA 3WGLA 4RD4A 4TQUS 4MICA 4C78A 3AM1A 3Q7RA 3VNVA 4OYLA 1JQKA 1BXGB 4HQ6A 4K8OA 4E11A 1JJIA 3OE4A 3TQCA 2Z6VA 5DXAA 1WU7A 2DR0A 3HB9A 4DLXA 5HE9A 1LC0A 1CFZA 1U90A 2YL2A 3OG9A 3P26A 4Y9TA 3V1TC 3WP0A 3STTA 1N1DA 1Q6ZA 1ZMOA 4BO7A 1ZVJA 1BMTA 2QGFA 4K3VA 1TECE 2ZE6A 2ACEA 4TXJA 1J5EB 3NNSA 4DJDC 4A2CA 4F9FA 1RI1A 4BTEA 4NNOA 1PR2A 4C05A 1E3LA 4CQNA 3M89A 4YRRA 5LA6A 3EC7A 5HZKA 4NBKA 2CLKB 3RRBA 4QEDA 2G72A 4URXR 3GEPA 4K1XA 1T3LA 2XX3A 2FU5C 2OL4A 3NC0C 1V2GA 3TZ6A 2BTEA 1OFHA 4LYDA 1GNSA 4YUZA 4PC6A 2JGAA 3A6LA 5K99A 3GHHA 5SY6A 4F0JA 4QQNA 1E60A 3G23A 3PJGA 5CCBA 3KZMA 1K27A 1OIXA 3C6BA 3LTEA 1P9LA 2I6TA 2G3YA 2IYFA 4V0OA 4NZYA 1WSWA 2QUAA 3V48A 3G2MA 4IH4A 3FLAA 2O0MA 3EVGA 4PG4A 4DFDA 1GNQA 2QE7D 4UBOA 4PSDA 4BV2A 2C61A 4XWOA 3R09A 1QE3A 1MX1A 3VR3A 4Q3KA 4PNPA 2WT9A 4IQ8A 4KBGA 5JAQA 2YWJA 3IYLW 3SFTA 4E30A 3OD1A 1G18A 5I4IA 2PYZA 1KDVA 4R8RA 1DG1G 2HWWA 3LPCA 4F96A 1P0MA 1V8DA 1QBKC 1FFEA 1WXHA 3P2YA 4N3GA 4UCWA 4BFSA 1GR1A 3QQPA 1H42A 4TS1A 1WL8A 1KYQA 1YFZA 1N8SA 2UYHA 3V8VA 3ZWOA 5LBIA 1CUHA 3EXIA 2HPHA 1WVMA 2P9CA 5EE9A 1U2DA 4F2PA 5JNVA 1UKAA 4FCWA 3ZI4A 1R15A 4L7VA 4QLBA 1F14A 2ODNA 5HJEA 2ZAIA 2RHGB 1VHDA 3D8UA 1ZBQA 4D4IA 4FW9A 1Y8ZA 4DPLA 1GD1O 2WU3A 2CV0A 4ER0A 2OM2A 4U8HA 2M6KA 1WLYA 2JIQA 1CIVA 1NW6A 3OSUA 4GPD1 1E1MA 2E1RA 4OOEA 2GCPA 4XUDA 5D3ZA 2QYHA 1M6VB 5I7AA 3THOA 4MVJM 1P73A 2IH4A 3WOVA 1PX0A 4LJRA 4RMIA 2H3EA 3LOPA 1HE8B 4JC4A 4YVFA 2P3LA 1T13A 2EKDA 2HLDA 2HF7A 1PDVA 2IXAA 1AC5A 3GRZA 5EIFA 1JKFA 3DZKA 3ADDA 4DQVA 1R9JA 1TJ4A 3NJRA 4JQCA 4E3ZA 3QLVC 3TVYA 3P0HA 5FPTA 4QM7A 4U63A 3KD2A 3IUQA 1GUBA 4HNUA 1UF9A 1UBMS 1NT2A 2IYAA 2NIPA 4C0AC 3KKLA 1JFLA 2ERCA 4FZVA 4U8GA 1AS0A 3EUEA 1P2UA 2E6UX 4GWGA 2WEKA 4MKHA 1L8QA 4UU1A 3IBCA 5KNCA 4MUYA 2BMWA 4DUGD 4PG6A 1UMKA 3HCEA 4YDRA 3WL8A 3MT7A 1Y7PA 5G2OA 1F1BA 1NVGA 3ANXA 2OHOA 4KWIA 4RANA 4YS6A 5TMDA 2H08A 2HZ7A 1RHKA 2BEUB 2MYTA 2HSJA 3BCRA 4PQGA 3D8TA 3T41A 2IU6A 3LOUA 4EUFA 1NYRA 1YC5A 3OECA 1KKUA 1NR7A 1KORA 1WU8A 1RYMA 3FRJA 1FFYA 4RZUA 5K3FA 3PHCA 4FYWA 4MA4A 3I5MA 3WG9A 3FSJX 1QYRA 4A1FA 2D62A 3EZLA 4WA8A 4KQ6A 5HP4A 1MP0A 2PG3A 1N9GB 2BMEA 2WMYA 3KHUA 4ABTA 1EE1A 4DMKA 2ZTHA 1P9WA 1FMFA 5G1PA 2BONA 3C87A 4DADA 3DH0A 3CW9A 4Q9NA 4RIIA 1EA5A 2GXQA 2ORWA 2OV6A 2P6MA 3GFSA 3L7NA 3FGOA 4RVUA 4URWR 3BFPA 4XW2A 4C22A 4Q4HA 4QYIB 2TSYB 3PYLA 2WKQA 3E9DA 4R1NA 2A59A 4JLVA 4OIFA 2N3ZA 1R3UA 1C3OB 3IQFA 2Q1YA 4W9NA 4H0CA 3K5WA 5CA1B 1ZQ9A 2D6FA 4CMGA 5TR9A 2QJRA 4JIMA 2I4NA 3MCAA 2OQRA 4GKJB 2OV4A 4KO2S 1E2EA 2IUFA 2J9FA 2ROQA 1DJOA 2FKNA 2ZYUX 3KB1A 5EE1A 3ZE9A 3DVAB 1VYVA 3OIUA 8GPBA 4Y9UA 2EFJA 4UHCA 4JL6A 4L08A 5AM5A 2QT0A 3CRMA 3ZNNA 1OREA 5JJIA 2FFQA 1BD4A 2VWPA 3FWPA 1CYDA 1A0OA 1SUAA 3Q8XB 1IEWA 4DLAA 2VYNA 3LH5A 2IU0A 4EDFA 4EZIA 1DCKA 2EFYA 4B73A 1E64A 5JZOA 4AKSA 1Q1AA 2HGSA 2E82A 3HUUA 5DZSA 1UMDB 2JK0A 4IDDA 2QRLA 4DEVA 3WLJA 4B3TB 4KVFA 1AS3A 3CM0A 1IUOA 2GAFA 4EF4A 1L5QA 1DBPA 5B2ZA 2XKJE 2HQSA 4QXQA 4BLQA 4BE7B 3RYCA 3O4FA 4MVJH 2QD4A 5EYPA 4ENSA 1RZVA 3WQRA 4MVXA 5K5EA 5MGBA 3CY6A 2NTYC 1D2AA 1MQAA 2IY8A 1UDAA 2JZOA 2REXB 4KGVA 4N3BA 3ZQJA 1EVKA 4TXNA 2F1RA 1JV2B 1GPMA 4FMDF 3DL2A 4I3FA 2ACWA 3AL3A 2CDNA 4UU7A 3OM0A 4O63O 2J3JA 2XYGA 3EOBI 4IXWA 3FSRA 1DKLA 2ZB8A 3ZY4A 3BPSA 3ASVA 1U0JA 3SZOA 4ERNA 5DKFA 1XTKA 2CE2X 1IQRA 4R84A 1KPIA 1U1GA 4HMQA 4WASA 3TGLA 5JSQA 2XWSA 4OB8A 4QULA 4QVKA 1KP3A 2O3JA 3D1LA 1J0EA 4IP0A 4F21A 5IVPA 3LT1A 5C5IA 2ISCA 2VOJA 3BILA 1EEXB 2A0UA 3DOIA 1GITA 4LNHA 1GAWA 1AGYA 3NHKA 5SZKB 3CKKA 5GIPE 2F8LA 3IUYA 1VA5A 3K20A 5K0FA 4YP0A 1PJZA 2OZLA 4C6TA 2XTJA 1P62B 2UU9B 4YRJA 3SVZA 4JJ8A 1L9XA 4Y6SA 3VNSA 1NQAO 2K5UA 4Q15A 5AHWA 1H1LA 4FFRA 2NU7A 3IELA 4OLBA 2ZKLA 4R0VA 1NM5A 2HCJB 4CV2A 1E2BA 5EP1A 2PLNA 4DMRA 3G89A 4KIJA 1DRUA 2HA5A 3LT4A 3ISTA 4FDLA 2OWDA 3C8UA 1Y3BE 1KYTA 4E7OA 1OX4B 3E0QA 3PPXA 2G04A 5CVDA 2RK3A 1EUZA 2PJUA 4X90A 2PUDA 3DLIA 1GA1A 2OBLA 2R00A 3HV2A 4O4HA 3KLOA 3K6RA 3EGCA 4LRXA 2BUCA 1GN9A 4WHMA 5IMBA 1X8LA 4UNPA 3VR3D 1ZOSA 2X15A 2DFDA 2QK4A 2QP9X 1OT3A 2H0RA 4TV9A 1IK6A 3FJOA 4BO5A 2BGIA 2R4TA 1XNHA 4WCFC 1QP7A 4Y2TA 2JLQA 1E5XA 2ODEA 2NU9A 4RACA 3PJFA 5DLDA 4B3SB 1UMCA 3KQNA 2JAXA 1VSUA 3DCYA 1V4NA 3AGQA 3H05A 2WTUA 4GWKA 3FJYA 3TL2A 2BGUA 3S3TA 4UAUA 3T5PA 4G1MB 1JFSA 5C32A 1F0YA 1RS0A 1R1DA 2D8AA 2VLIA 2OQIA 1A4UA 1SY7A 2JIOA 4URYR 3WWDA 4FYMA 4NZPA 5EIOA 4DIOA 2RC5A 2FUG6 1G6Q1 1I7SB 2Y77A 1ZZEA 1HETA 4RSGA 1Z2CA 2O3QA 5G0TA 2Y6UA 1FS4A 1XQXA 1XEXB 1Z8NA 2XV1A 1KEVA 4ZCQA 4M7PA 1G5TA 1CS0B 2KJQA 4HMOA 3T9AA 1SCAA 2M32A 4GEGA 4URHA 3KWMA 2HD4A 4M3NA 2HLDD 3OLQA 2VNAA 1DBIA 1CEQA 1EFVB 3UH0A 5KJFA 3TQIA 4KO3S 4OSPA 3S2UA 1PT5A 4CVNA 3CZ5A 2OO3A 1YONA 3MUEA 3OCUA 1YJQA 2OBMA 1FTSA 1EGAA 4IXNA 2F62A 3PJRA 2R6ZA 3NEPX 4M89A 1L7OA 2F00A 5JS8A 1DKRA 1YJ8A 5GJCA 1LJUA 1PR3A 5D00A 5KNCD 4IHJA 1A5TA 1J2UA 1RZ3A 3HBAA 4CLDA 4ALIA 1RXCA 3DD1A 2DFPA 5L3QB 3B8EA 3I39X 5CPBA 3OC6A 5CVUA 4CM1A 5FLKA 5HCNA 4OLAA 2IE0A 4UXJA 1W1UA 4RGBA 1Z5PA 2DYKA 1QH1B 2NPOA 3K73O 4S0XA 4YCCA 1JDNA 2EP8A 2HXGA 2O3SA 2X9GA 1T24A 3H5VA 2IH5A 4IJ6A 1DP4A 3H3FA 1G63A 1XD8A 4HAVA 5YASA 2XOXA 2ZSEA 3AV0B 3VZCA 4GL2A 1EM6A 4YP1A 1QHIA 2JAHA 1GCUA 1SC4A 5HF8A 5BSKA 1ADBA 4Q21A 3LL7A 4K9OA 3KAPA 1JWAB 1M1ZA 3NTUA 1X87A 5KOHB 4M8KA 4LRYA 1Z4QA 2NU6A 1NY5A 3KP1A 1K2WA 4X3PA 2BI8A 2J9XB 4YYZA 4L0DA 4K2AA 2B99A 4EB8A 1MIOA 4F93B 1XDUA 5EA2A 2R62A 3RW9A 2GAAA 5CXXA 3HNRA 2C2BA 3BDAA 4DQLA 4IIEA 2NTNA 4AQ7A 1LKZA 2HCRA 2ORYA 3KUXA 1LDGA 5E3JA 5IDQA 4WW0A 1ZD9A 1Y3AA 3FOBA 1BVUA 2KHZA 1KO8A 2VKQA 5FOQA 1PSZA 2Q6IA 1KOJA 2VDWA 3G2KA 4CEIB 3IPAA 1XK6A 3A9VA 4MVJA 4C0WA 4PLZA 1KOFA 3CRNA 4JUCA 4RZQA 4LYAA 3ILVA 5IT9A 5IFKA 1KNXA 2SECE 4GHWA 1JLKA 1RADA 4NQZA 4ZFNA 1T91A 2A5YB 1Y6RA 3B38A 3NBAA 2MIIA 3OIGA 2PA0A 3NHYA 4MV4A 3WBKA 4CGZA 3FNGA 3LQ1A 2QG6A 2Q5OA 2XGGA 2VYND 4J7AA 5DK6A 4YAEA 4B40A 1Y6ZA 3RYHB 4MRAA 1JQ3A 4ZVVA 2OHGA 1OZFA 3H42B 1UOOA 1H2WA 4MWOA 1Z2NX 1GTZA 1Y6GA 3T3HA 2I6QA 2JIPA 3UVEA 4QU0A 4TKVA 1G2IA 3KPJA 5EZ5A 2VP5A 2VUTA 4Z3KA 5JCOC 1FP6A 2CCGA 3BZBA 4CEHB 2I91A 2QPOA 5MFPA 2ZUSA 4BCCA 1RHUA 5AIAA 2IHJA 2RFLA 2FQQA 1JIUA 4TXLA 5FKJA 4D7AA 4XIGS 1JHDA 2O2XA 5KTYA 3I3OA 2D2EA 5JXIA 1U8TA 1BOOA 3M6MD 3QOXA 3A4YA 4DSNA 1Q0ZA 1FB5A 5GWXA 3NHPA 1A2QA 3SLKA 5D8DA 2CFOA 3T95A 3KIPA 3N1UA 1VLHA 1RU3A 2DECA 4G63A 4MGIR 1NLFA 4MSUA 4NE2A 3THWB 2OGSA 2R44A 1TEHA 4YDHB 4F8EA 1WX1A 3IKTA 1ZN2A 3TW4A 3HXOA 3GG9A 3OMWA 5DYYA 3W3AH 5D3KA 3UMGA 4CM8A 3PJEA 5B58C 1W0CA 1YDHA 1AIPA 3GC6A 1RHRA 3AR8A 3SK0A 1OB2A 1O87A 1N5DA 2OB2A 1XZHA 4TYNA 3I72A 1NASA 3D6UA 3K35A 3K9CA 3ROTA 4BMCA 1CR2A 4PYJA 1KK0A 1UBEA 4BFVA 3AI7A 3JRXA 3FUXA 3KEFA 1XFAA 1MJ5A 1SZJG 4ROSA 4RZSA 1JSLA 1K9VF 4R2KA 1BMFD 4PCAA 4QSHA 3ISJA 1NFQA 2AHOA 1KJYA 4YASA 3K1TA 5DT9A 1E0SA 4P93A 5KKCA 4L8YA 4PVCA 5AW9A 1MO2A 1ORRA 2IYZA 4KPEC 4A15A 3N0WA 3QPUA 4BE4A 3ZDAA 2V6GA 1JSZA 3OWXA 1JAXA 1ZK4A 4RS3A 4BPRA 3U0VA 2D3TA 2AF3C 3U39A 4L9SA 4OAPA 5HRCA 2IIPA 4ZI7A 1D4ZA 1HURA 3GZJA 4Z2YA 3RQSA 2QX4A 1OV4A 3T1QA 1W85B 2C4KA 2V7GA 3GMSA 4REOA 4WBXC 4FN4A 1I7QB 2WP8J 3SHOA 3IHLA 5JAUA 2Q3BA 1E2KA 2JATA 4XPIA 1QM5A 3ZXXA 1OFGA 4RPGA 4CF3A 1KOGA 2CLMB 3BE5A 3DYIA 3V1KA 2AUNA 1LNSA 1TAQA 4MYUA 1FX1A 4LRQA 3GEEA 1N5JA 1AXRA 2YHBA 1R9MA 3LWDA 4FYHA 4V0ME 5C31A 2OFXA 3R3SA 1GRVA 2XRFA 1AD2A 3A2MA 1XEWY 3AJDA 2P7HA 1MB3A 3NHMA 2OYCA 3AG6A 3N2ZB 3SI7A 1C0EA 3ROQA 4AS3A 1C9MA 2ODTX 1OAKA 3OPNA 2Z5GA 4RFSA 1IB6A 5JXHA 2FWMX 1AO0A 5GADl 5FWAA 3ELUA 1U2TA 4GP9A 3UC9A 2VFAA 1Z4IA 1JQJC 3IJRA 1P9OA 2VPPA 3V8NA 1E0AA 2NTEA 1L5LA 2QQ5A 1UDBA 3QE9Y 4D26A 3BCSA 3NUZA 3JWEA 3IB6A 3KOOA 5CIWA 4UBMA 1C1XA 1VIDA 2PR7A 2VJLA 3OJ0A 4BTVA 1N6RA 3F5QA 4WLFA 1NN0A 4EQ6A 1YE8A 4HFRA 4IO0A 3M49A 4C07A 3VOTA 4G0WA 3OKCA 3KEMA 4KE7A 1K97A 1JYEA 1DWPA 3LXUX 4HVCA 4RA6A 3RJ9A 3UO8B 4LJ5A 4IDFA 3KZVA 1WMBA 3OX1A 1TO2E 4LDNA 4MDEA 5DXFA 1J8DA 3BWDD 3K0BA 1HE1C 4J16A 3IIEA 2BKXA 4FR0A 4RXUA 4D0SA 2PL1A 1J0XO 2QLNA 3NVDA 4XYEA 3DFZA 3VPSA 1W47A 3BHJA 3NRBA 3QKSB 1FUEA 3CRQA 1HLFA 4AUEA 4L76A 3SXUA 1V5IA 1ZONA 1YULA 3FYDA 4ESHA 3MLAA 4ZREA 2VLBA 5A4JA 2PEYA 4QTZA 5HK8A 1YMQA 1TI7A 3E8SA 3OLWA 3OJXA 5KSYA 1IWOA 2JW5A 3LK7A 4QOSA 4KIFA 3V4VB 3VU0A 1RRKA 2QVZX 2XBMA 4LTNA 3E84A 1U2DC 4RHEA 2QZJA 3HJCA 3M1YA 4EHLA 1DEOA 4AS1A 2HJVA 3NS7A 3O1JC 1E59A 2QSUA 1MGOA 1NJ2A 2DLCX 3CX4A 3H5TA 1XXHB 1BQEA 1NPTO 3FPCA 4HYYA 3S1AA 3M3PA 1DAGA 4X95A 3EAGA 2OHVA 3KLMX 5FL7A 3TK1A 3H5IA 4MGEA 4Z0HO 1UADA 1EKXA 1K3TA 3RG2A 1U3GA 1GR0A 5KOYA 4Q02A 2X8LA 4NVRA 5KOIA 3T61A 3U3OA 3C3AA 4LYHA 3EZ2A 2XCOA 1NNLA 2IZ1A 2WWFA 3HUDA 4U2FA 3F6YA 2J5KA 4KTVE 1LUAA 1W9MA 1JR4A 1K8RA 4TQGA 3FTDA 3OEHA 1XRNA 3L0PA 1T8WA 1P6QA 4WZBA 3KT0A 3UUFA 2P4UA 4YJGB 1SXJC 2B34A 3LD9A 1MR3F 2D13A 3EIUA 4NAVA 3HR8A 3EG9B 1XE3A 2ZRIA 4FEGA 4H9GA 5GTDA 2ZZNA 1TFUA 4AY4A 1PZGA 3F46A 3DZBA 2C88A 4W8GA 1PYOA 1RBMA 4FPXA 4OXYA 4DLWA 4N0EA 1DV1A 3KVOA 3DPUA 1L7XA 5IN5A 1X7WB 1D2EA 3LBAA 3K0FA 4I1IA 1THZA 4YAIA 4UHDA 4OQXA 521PA 3B6ZA 3GZNB 5JASA 4LVOA 2WI8A 2WTBA 3QNUA 3S5UA 3U3MA 1X2BA 2BVNA 3AX6A 3ZVLA 5C8YB 2WM3A 4H6VA 3U7GA 4U7WA 3I01A 1SO8A 3IHWA 3IQIX 2GRUA 1ZXBA 1NR5A 1S6YA 2H16A 3ENZA 3QX7A 4HPWA 4US1R 3TB6A 4BLVA 2XMSA 1A2OA 1QGUB 4RVOA 5KTNA 1IVSA 4F2WA 4XFKA 1JHUA 3H11B 3HU3A 3K6JA 1WB9A 2HF8A 1WXDA 4N65A 3ABOB 2R2GA 3G79A 3PGKA 2E7ZA 1XDDA 5G1OA 3FTEA 2XUAA 1XMXA 2P30A 2BF7A 3F3SA 4GI3A 4N01A 1H1DA 2IPOA 3W3AA 1K8XB 5G02A 5JT1A 5JTTA 4PQYA 4TWIA 4YQEA 3TSYA 1P3DA 5MFZA 1Z5WA 5JJBA 1N2HA 4XJVA 1DCTA 3WLMA 4WESA 3FWYA 2V0NA 1T9GR 2OAQ1 3HYLA 5FWXB 5I4BA 2RAPA 4CR7A 2QR2A 1MQ9A 1U9IA 4HBGA 1Z0UA 3N76A 2IZ6A 1IOWA 4O4IF 2NSDA 3GZTB 2QZPA 4LN1A 4INZA 1SD2A 3E7XA 2FUCA 3E23A 2P9HA 4J94A 3ETNA 4JLAA 1C2TA 4TV8A 1TTPB 3BIXA 3RWOA 2WTEA 3O3NB 4CKCA 1WPQA 1LRKA 4MROA 5JYCA 1MZVA 3EIQA 3VU8A 4DDHA 2Z6QA 5TVKA 1S9DA 3OIWA 3BXZA 3RVBA 2Q99A 2IX3A 1YFKA 5AM2A 2DHQA 2V59A 2G1JA 3VQTA 3FYHA 2OEPA 3T4PA 3ZY6A 4OM8A 2BGWA 2JGMA 5A1TA 5ARBA 5K0NA 4R6XA 3ZWWA 1WUTA 4G8DA 1MH9A 4IWNA 1G6KA 2OP0A 1KOLA 5CH5A 1NW3A 4BNHA 3BT7A 1S01A 1IE3A 4JGIA 4L75A 1Y1KE 1FPMA 2J85A 4QKQA 1UZMA 4KJZA 2G40A 4UUNA 2DQKA 4V0LA 3DKKA 2A1UB 2VNHA 2H9IA 2RJNA 1M1UA 1XYGA 4TOIA 1PFGA 2CXNA 3WNZA 3WDKA 4EVQA 3JR7A 1FYFA 2GF2A 3ST7A 1TAHA 2ZBGA 1C9EA 2XMBA 3AUYA 2F8SA 5I4CA 2GBLA 2NXCA 1E3TA 2O0KA 3L02A 4FFMA 3T3NA 1T8TA 121PA 4RLFA 2B8TA 3ICCA 4UAJA 3E81A 4Q3AA 4CQLA 3IAHA 1L5RA 3DXZA 1SXHA 2A58A 2HHJA 2M6SA 1RPZA 1O9GA 4HFNA 4HUQA 2ZBPA 3GEBA 4LVUA 2VAMA 3PXGA 2GN8A 1EIZA 4C89A 1PL7A 2O7VA 1TM4E 4M87A 1GPDG 1ZM7A 4FOPA 4DXHA 2BGLA 4IDPA 1M0TA 2CWDA 4OJQA 5G3ZA 1B42A 4V38A 2WZBA 4MGKR 1R88A 3WRYA 2FZCA 3R5FA 1CB7A 1EDOA 3C2QA 3GJXC 3QM1A 1HNXB 1LDNA 2RHDA 4LX8A 3M6LA 1QHHA 2WVHA 4MQEB 2LIVA 4BB6A 3KC2A 5JWOA 2NZYA 1DU4A 2Z2JA 2X0EA 4LI0A 3TMAA 2PL3A 1LWOA 2NO0A 3NHLA 3UAXA 2EFGA 2QA5A 2J41A 1ZIYA 5CB8A 1NUSA 2Z3ZA 4M1OA 1DEAA 4FBLA 5JAZA 3P4YA 4PZDA 3QMWA 2IHZA 3N8DA 2O19A 1UM9A 1NM5C 5LDHA 1QF9A 2FCRA 4G8CA 4IIXA 4BL5A 5B6PA 1Q1ZA 3C6ZA 4BTLA 4L9WA 2DPMA 3FI9A 2AD1A 5LL6P 2P2NA 3AKCA 1X2EA 4ARAA 1SURA 1ZLXA 5T57A 1JEOA 2AG8A 1GVNB 2DVMA 3A6JA 3IUNA 3I58A 4FNGA 4PTLA 4JVOA 2H65A 4E4RA 5FUQA 1LPSA 3BD7A 3GCXA 2PK3A 2X9VA 2ZAYA 3UPTA 5AUNB 5DM4A 2RJOA 4MS3B 2WAXA 4XOIA 3EYAA 9LDTA 5EFZA 4GZ5A 1TQ4A 1XRJA 1UT6A 4J0HA 4NMMA 1PGOA 2JFYA 3KCQA 4HXGA 3GWGA 1FP1D 1Q20A 4UEKA 3WIEA 2VJDA 5B37A 2EAUA 5ER6A 1LXCA 3SQMA 2PKXA 4M0KA 4A4DA 3WTCA 1A9TA 3THXA 1L8OA 4LSMA 5GZ6A 4D0LB 3NVMB 1TQHA 2BBWA 3CZQA 4EMUA 4HLQB 1KFEB 1V7PC 2EDCA 1U2GC 3E5NA 4NY1A 4GPZA 1W6UA 3HJBA 3QOFA 4QDZA 3ZCXA 1UKCA 3FOFC 2CL7X 3I61A 4GE3A 4RKRA 1HFJA 4QRIA 2P9FA 3QEAZ 4EWLA 4Q7JB 2VHVA 4UCFA 4U3JA 2QWXA 4B3DA 3QITA 2GD2A 2AZMA 2REBA 1PG2A 4X94A 5FL7D 4DR4B 5G0WA 2Q2OA 3BA1A 3K94A 3UXHA 4B4DA 1FVFA 3FUWA 4Y6PA 2A9FA 2ZVJA 3M1AA 4WD3A 5DWQA 3D4PA 5BPFA 3IOYA 5CA0F 2QRUA 1NU6A 4GH5A 3SM9A 2PVSA 2W0SA 1RYBA 2ZLBA 4ND8A 5I7FA 2COUA 2ZJ6A 5KTTA 1WE2A 3L6BA 1MO4A 1CB0A 4P2BA 4DRXB 4HQKA 1EGMB 5JYDA 1YOVB 2CXXA 5AH0A 2WP0A 5CNJA 2FEOA 3GLSA 1YCFA 1C8VB 2H5LA 1SC6A 2NO9A 3QIVA 4I5IA 4RPIA 3HGMA 4WNYA 5CM9C 5G41A 3SOZA 5AW8A 1HX7A 4X1IA 4GI2A 5KINB 2A7XA 2Y05A 1J2EA 4QSMA 4IDQA 1E2QA 1SQ6A 2FEKA 3OZUA 2FP4B 2DR2A 1AUPA 2WIJA 1MW8X 3P8ZA 1XIVA 1ML4A 3JASA 2IXTA 2D8MA 3HABA 4M0LA 2IXFA 4NBWA 4OQDA 1ISIA 3QWIA 4U4AA 5DW0A 3TAXA 3VTZA 4MUNA 4BC1A 4EI2A 5I7HA 2QRKA 2Z8ZA 4BECA 1SCNE 2D0OB 2WJ4A 2ZRGA 5EKDA 4UTZA 1C80A 2W2XA 2WE8A 5CVCA 2OXCA 4FE4A 3ADKA 3B3QA 4AUMA 2BDEA 3U1TA 1CHNA 3DBRA 2PE5A 1P7CA 2ODAA 1NBWB 3GN1A 2FSHA 2VJOA 1XAJA 3DE6X 3PCRB 3WRXC 3D6HA 2JBAB 4ZN6A 3DC2A 1N6IA 1X1CA 1KE1A 2XZTA 2AG5A 4W99A 4M8SA 1YVUA 1M2NA 3B51X 4Y2SA 4KLZA 4ZT3A 2XMGA 4KFRA 3W3AD 2P4HX 3LP5A 4DEYA 2MSLA 2Q1XA 3L8YA 3MUNA 3PT9A 3NVKI 2CNKA 4HXFB 4Z6KA 1LSSA 4UQLA 1J06A 1XTPA 1U65A 2E0IA 2XUJA 2XDQA 5EJMA 5FI1B 3TNJA 3UGQA 5ADHA 5MHTA 1QWSA 2X0IA 4NJMA 4M1YA 4CTOA 4RTNA 1USKA 4PO1A 3M5WA 4Q00A 3I9JA 4BYMA 3JXEA 5ALKA 3KT3A 1QC5A 1KJJA 1IHYA 2I9PA 2ZULA 3VV2A 1FZQA 2I71A 4D8WA 2I2XB 4NCJA 2GPTA 2X8JB 3P2KA 2YX1A 4JLSA 1SQSA 3X0DA 4AW9A 4XDZA 3A7DA 4BJHB 1LSJA 3AI3A 3D4BA 2PQ0A 4HLCA 3P9YA 4YJFB 1YS1X 4Y2QA 2EJVA 2ORVA 3CLSC 4M9QA 4DB2A 1C9KA 1FBNA 1RQGA 2OGZA 4NU6A 1FDUA 2LRHA 2V6IA 4O4LB 1UBFA 2UYOA 3FPFA 3RNLA 1ZMTA 1ZKMA 1UODA 2AI1A 1E1RA 1KP9A 1LNZA 1UDCA 2JFWA 4ZVNA 4EZBA 3VU1A 3KBBA 4OREX 4Y7CA 5C8ZA 5ICFA 3V1LA 5BV8A 1OU4A 5ALIA 4RIHA 4YBRA 1LBEA 2HDNB 3FPBA 4TXMA 4GOJA 1II9A 1VQ1A 1UK8A 3FFBA 1SK9A 2AHRA 3GNTA 4H3KB 1M1NB 4PLVA 1NVKA 3MQ4A 4HDMA 3TZBA 2QRGA 2HXYA 1PP4A 3KO8A 5L4NA 4ZC8A 3L5OA 3ER6A 1K06A 3BXOA 3TAHA 2NXJA 4J91A 1ZM4A 3HKDA 1J39A 1JFFA 2APJA 3PRKE 4P7FA 5ICMA 1FQOA 5FPSA 3KR9A 2CXRA 3KWJA 4I99A 1IY9A 4MI9A 4B4WA 3M34A 2OMKA 2IZOA 3ZU6A 2P67A 1VGQA 3T7RA 3EWNA 4XTCS 1LC3A 3ZDEA 2R8RA 5BYKA 1VIMA 3HO8A 1NNUA 2R11A 2EL7A 3M81A 1OA0A 4TUYF 2XHEA 3QZUA 4CL8A 3KEGA 2JRLA 2QTHA 4JL8A 2FZEA 5DSTA 3VSDA 3A2KA 1Q74A 3DJFA 1MA0A 4PY2A 3THSA 5TGTA 5IF9A 2WPDA 1E69A 1PJRA 3JQBA 1H05A 3ORHA 3PUWA 3DPSA 5A5DA 5JZVA 5J1SB 1KRWA 5F1PA 4CL2A 4IIBA 8OHMA 1YHNA 1T9GS 1QO7A 1YQDA 4HDKB 4MVJP 3RABA 5KC9A 1NXVA 4BXOA 3UT0A 4A8JA 4CR6A 1NP3A 1KY2A 3LPDA 2QN7A 3KZ1E 3K70D 1XOIA 2R3SA 4D98A 4XD7A 4ZJPA 4KFSA 4OYYA 4B9AA 4IRMA 5KVCA 4HWTA 1JU3A 1P4SA 5BQ5A 2CB0A 1SVLA 3BHNA 2BF4A 3D0KA 3T4EA 1HMPA 2HAEA 2VF4X 1NHGA 2QL6A 3A3OA 2F8MA 2WYHA 3D8BA 3M5CA 1SUBA 2H7YA 3VX3A 7MDHA 4RTOA 2XY4A 2IGBA 5AWFC 2EQAA 2J09A 1K5DA 4HB2A 1WZCA 4HAIA 3GT4A 3ROEA 2HR1A 1ODCA 1UPAA 1X92A 2AWOA 2WICA 2JFQA 3LE8A 1IPHA 3OE5A 4PPQA 1PR6A 1QK5A 3IBGA 1N34B 2CNOA 3O2NA 4OKSA 1RKUA 3UMMA 4DV7B 1OZ0A 4E08A 1ZH6A 4GE0A 1UFRA 4NFHA 2ORIA 2P78A 5M34A 4OH1A 3K8YA 1AKNA 4LJSA 4CQMB 2H1HA 4NBSA 1NZJA 3UW1A 3DTYA 4AF6A 2Z4RA 4FQ7A 3U4QA 4AKGA 1EXNA 4CM9A 5IASA 1JBEA 5T3YA 5BN3B 3ZG6A 4TROA 3EIWA 4PZYA 3GAMA 3GVPA 3FOCA 5FO1A 5K8LA 4HKTA 1R50A 2VCYA 3PRYA 3DCJA 1TW2A 2O7SA 5AVUA 5JZBA 5CYOA 4D44A 2YVUA 1IULA 1U11A 1IOVA 4B8ZA 4PC1A 4X61A 3FSEA 4CKYA 3TXYA 1E63A 1QK4A 4ZOQI 4PCVA 1G59A 1U0LA 1LDMA 2HHLA 3Q3CA 4JB8A 4U39A 1VPDA 2EFEB 3PEUA 4PR3A 2BFBB 4XYGA 5E2BA 1GFSA 4TTQA 3I76A 4ZQIA 3BTUA 4TLBA 1L1FA 3ZYZA 1ULSA 3R7SA 1Y8QB 2GBIA 4M54A 4C4OA 1D2MA 3L4KA 1VMDA 4EQZA 4NK4A 4TXHA 3IR5A 3A4NA 1M83A 1US8B 1XZEA 2FZ4A 1U99A 2XT0A 3NO4A 4J0QA 4R7ZA 1I01A 1OI2A 5DH9A 4MQFB 1ORDA 1QIMA 1RAAA 4QQ8A 1WQ3A 1EBBA 1XMIA 2JKZA 3RU9A 2YV3A 3UATA 5I9BA 3MTQA 1X7ZA 3OT5A 3CNNA 1MRSA 1ZM9A 4P3NA 2WYUA 4P7GA 4TWZA 1N2ZA 1KJ8A 1MXFA 2GKSA 3IMEA 3ROMA 1H9BA 1S5PA 2BGJA 1XT6A 1NWHA 3BF8A 2VJAA 3W34A 2HPVA 1TUGA 5DLEA 2BGNA 4F3NA 4KN9S 2B25A 4NU0A 1IVYA 4D3YA 1IHOA 3ZDQA 3VKGA 1RWQA 2PZJA 4FCCA 3URMA 1ZDMA 4UJ5A 1E77A 3RGGA 2F6RA 1TF5A 4NFLA 5E9JA 4JXXA 1AHIA 1NULA 4NENB 3TTXA 3ZC3A 5BQXA 3HBFA 3P2MA 4FZRA 1NJ6A 1NVFA 3U4MA 3U4GA 3ZWDA 2A67A 3PHGA 3OF3A 3ZW9A 4F84A 4BAUA 3LYHA 5B1HA 1PJSA 2BKLA 4OKNA 3WK4A 3QE3A 3M3DA 4LZPA 3OCCA 4DL9A 2PQ2A 3BKXA 1G2OA 3VR6H 2ZYHA 3E03A 4XEUA 4MWCA 2GYWA 1M66A 4QFBA 4UAVA 4L22A 4WBNB 5GVSA 3D5QA 3A6ZA 1IZYA 5ENZA 1W4RA 3M5PA 3P1JA 5H9VA 5AK4A 4PGAA 3N3BC 5ITWA 3U16A 4JB2A 2GASA 3N2NA 3VTKA 4YPOA 3A0UA 2F4VB 1THGA 2O48X 3UBTA 2NSHA 3BQ9A 5I9TA 4FU0A 2B0JA 1W2WB 1W59A 4EFKA 2VTKA 4QECA 1N9GA 1CS4C 1OX6A 3KE9A 3ZDCA 1Z34A 1RVV1 1V5WA 3OHPA 1EAYA 3CWCA 1RQ7A 3CT6A 3ASZA 3FTCA 4MP3A 4WZAA 4BIIA 4EGCB 4ATNA 2K7FA 3W6ZA 4U0JA 3FDFA 1RI4A 4LBZA 2E9SA 3WC4A 2PZLA 1NXOA 5DEOA 4MV6A 5HQJA 2AW3A 1IJBA 1ACMA 2EHDA 3BWXA 5EG5A 1U04A 2IHKA 2XNJA 3NUQA 3KX2A 1K08A 1P0FA 4CF5A 1YTUA 3I5AA 2J0VA 2PZKA 3LLSA 5EUBA 4Y0VA 1Y5LA 3TSAA 5HKOA 1Z2PX 3KSBC 1O0CA 5CGZA 3UA4A 1LPNA 3KSZO 3L8DA 4ZVQA 2JAQA 1X7YB 3KZNA 1ZI6A 4YRFA 1DIGA 2YXDA 5K0LA 4NNJA 5JVDB 2JD2A 3GFOA 4PXYA 1ZCJA 3BJIC 5CAEB 1STOA 1ZGGA 3BHMA 3OO0A 4D43A 1I2AA 2Q1TA 3DNFA 1YTLA 3JQAB 2ZTSA 4ID3A 4BQPA 1VFPA 3RADC 2EKQA 1E1RD 1Q22A 1LVUA 1HSOA 2F3SA 2VAPA 3B6EA 1I8TA 3E3LA 1II8B 3O73A 4HDAA 4A0HA 3N87A 4ZEXA 3I37X 4NKRA 3TPCA 1MPXA 3EHEA 4B6RA 2YV5A 3WGUA 2V7PA 4NBNA 5LQSA 1NUAA 3JQPA 1Z75A 5BYJA 4R1LA 5UKDA 3R7NA 4PE5B 1TMYA 2WKWA 1R6VA 2RH4A 1UXIA 1T5SA 4QBTA 4I9UA 3ORQA 2QYOA 1CJTC 4P35A 2CNNA 4BRWA 4MHTA 2WIFA 3VNUA 3RTEA 3Q7IA 4M1KA 1GU0A 1H3FA 2QD2A 3EZ9A 1AY0A 3B2EA 1WV1A 4J4TA 4RK4A 4WH0A 4YJDA 4JVSB 1OLXB 1LRLA 3SC6A 4B71A 5FOUA 4V0QA 4QELA 5JAHA 1HTWA 3M82A 4W5RA 2BHLA 4D56A 1PSDA 2H2IA 1BE6A 1JEYA 1JUDA 4AP6A 4H4CA 1ZMRA 4E88A 2WZDA 3QTLA 1PN3A 2GM9A 5E6RB 1JIXA 4KRGA 4Z99A 2OESA 5A7FA 1ZHOA 3OQIB 5F7JA 4AJKA 4Q7LA 3WLSA 3ZU4A 4LISA 4DR1B 1XZ8A 1ZRSA 5KQLA 2RGWA 4X1YA 1JF8A 1EH5A 2NADA 1DOZA 3DVQX 3L46A 3AC0A 4MNTA 4PLGA 1R0CA 5JZ9A 2B3TA 4G5GA 2X2PA 5KQRA 1DVRA 3P4UA 2B61A 1KQPA 2VCEA 4BO6A 1MDBA 5E95A 2ONJA 2B1QA 4HGYA 5EEHA 3MS7A 2PS1A 3ZEIA 4XD7D 3KOUA 4JI5B 4HLNA 4DJJA 4L8FA 2IEBA 3JQGB 5D7BA 2DZDA 2SCUA 1MD9A 4A16A 1Q7GA 1NDQA 1KVRA 1NVBA 3MILA 3JYPA 4O2RA 1ECFA 1NFRA 2YZNA 3HEAA 3QXJA 2QDKA 2RKBA 3MJTA 5HBGA 4BP9A 2L69A 3P9CA 4IXTA 3WGMA 4B3GA 5H59A 4PO9A 1QH9A 1SUFA 3UG6A 2RAUA 3H6HA 1JZQA 2W90A 2HV8A 5IAOA 3QVGA 4QJ5A 1TF7A 2XUDA 2OCYC 4FOTA 4G37A 4HQRA 2SKCA 4Q1FA 5H4HA 5GINE 3JTEA 1X6VA 4QUKA 3O8QA 4S35A 2QM7A 4M1QA 3FN4A 1ZPDA 3NXKA 1GCAA 2HJWA 1E5VA 1G1AA 2I8CA 3F6BX 4EBBA 2ODQA 1NJ5A 3CNEA 4YO8A 3ES9A 3KFLA 4DDUA 2IYTA 1K7YA 5AI9A 3UCEA 4BMZA 1Z8FA 5C53B 3TMKA 3E53A 1P0IA 1ZXLA 3O91A 4BUCA 1JRLA 2QMZA 1T25A 2DHCA 3C5HA 3CINA 3K70C 5J4HA 1WKBA 2WWTA 3KUUA 3RKRA 4Q1CA 3PDHA 5REQB 1TIKA 4FFLA 2M2IA 5BW6B 1FQKA 4E5KA 1DDGA 4TSRA 3R7WB 4UQOA 4L07A 3L8EA 3RUIA 5JS1A 5H5JA 4KR2A 2EKPA 4TTSA 4EA6A 1A77A 4TTVA 4JBYA 1J49A 5KI6A 2FI1A 1EIWA 2V7UA 3WAJA 2QXYA 3HRKA 2GEUA 2GTIA 5HG0A 1N2CB 3U9LA 3EGEA 1NMYA 5EQDA 3GGDA 4K1LA 5CJ2A 1D1QA 3R7BA 4BGUA 1NVWQ 1JDTA 2CBZA 2F4NA 3S6JA 5KYKA 1WDLA 3HLKA 3KYDB 4CIVA 4D0RA 4F1KA 1QU2A 3EDOA 5B58T 3UICA 4F72A 2ZXEA 2VZLA 4XDYA 2VZ0A 3TVDA 2GNPA 3UMFA 4K9SA 1LU9A 1R5BA 5F98A 3P27A 4BNGA 4L3VA 3JS5A 4LZNA 3D4LA 3DDUA 2AOUB 1EDEA 3ZI0A 4DLUA 5D3QA 821PA 2CXQA 3W1WA 1V47A 3W2FA 2QP4A 2EYQA 3UWKA 1XRLA 3IR7A 2VS1A 4YAUA 3UT5A 1PQPA 3W8DA 5A7GA 3S27A 4L8LA 1C0PA 3EEYA 5L3QA 2QVYX 5CDFE 2ZBRA 1R8YA 3USCS 3L7IA 3OHMA 4GMDA 1Y80A 4KLNA 2OYRA 2WJYA 4HSGA 4QXRA 5FDFA 1TO6A 1W19A 2O2ZA 3DEIA 1YAJA 2COKA 3F9IA 4TT3A 1KVQA 5GQSA 1SUIA 3K53A 2NVBA 2V6FA 3QELB 5K3SA 5EHXA 4HRYA 5FWYA 3GUUA 1W5SA 5CFZA 1F0NA 3LO5A 4FXPA 4YROA 4GNKA 2JLWA 3SYKA 2H4FA 1QP4A 4RKFA 3CG4A 2ONZA 1GZSA 1GZ4A 3EXHB 1PT9A 1L8XA 2C59A 1XEWX 3UXMA 2CJFA 5U4XA 3IO3A 2R25B 1ISPA 4YAJA 3ZXYA 3H1PA 4LF7B 1VPWA 4LF6B 3DVLA 3G0CA 4F6LA 5FPPA 2YWXA 5DSZA 5T4EA 5AVYA 3U7HB 1XMQB 1E3SA 1DUSA 3NTXA 4LC1A 3DMRA 4KR0A 3LRPA 4PR0A 5AVOA 4GS5A 4P4LA 5CM8B 1JXOA 3KBOA 4FOOA 2NX2A 2V3WA 2QQFA 1EVQA 3IP1A 5C8DA 3M9WA 3PVZA 1BDIA 4BZXA 1ZP6A 2YOFA 3DL7A 1QPBA 1JAYA 1H23A 4B4KA 3GI1A 2WWGA 4HQOA 2HO4A 4P7KA 4Q3NA 3RFTA 2QMOA 1SXPA 1FE8A 3AFNA 3DONA 2HDWA 3QEJA 1MLDA 3NDIA 4BB9A 1D1SA 1SJ9A 4O4IA 1TK9A 3MFQA 3NONA 3O9ZA 4UQPA 1U9YA 1OZAA 1FMTA 3AFIA 4MYCA 4YECA 3TLKA 4WRRA 4KNVA 4IIHA 4Y9SA 1Q0PA 4M55A 3C5VA 1YVRA 4KMSA 1IFXA 3Q85A 2BMVA 3OAAA 3R0XA 2ZWIA 4BGIA 3H9QA 5J58A 4LI3X 1H6DA 4DJTA 3Q0EA 5G4LA 2R65A 4Z4FA 4DC1A 3IESA 4XA8A 5I3ZA 2Z8XA 2BP7A 1O8BA 4RPCA 3U3DA 1XZKA 1NWCA 2GD1O 3GGJA 1DARA 3N2KA 1UZNA 4M1TA 3NYIA 4PZZA 4MPTA 1CJBA 1GVHA 1UC5B 3L5KA 3RIMA 5IWCA 4QUDA 1PL0A 3NWBA 5BMVB 1B43A 3P19A 2V7VA 2IEGA 3BDVA 5AVQA 1CLEA 1PFUA 3TRFA 5DTMA 5EIEA 3MWGA 2WA1A 1OYVA 1TF2A 3PFCA 4J1TA 1MEEA 4PLHA 1CZRA 3RSLA 4Z4GA 3L7LA 1JIJA 2A5FA 2CF6A 2DX7A 3GRVA 4MKRA 1LQ2A 1F17A 1YB1A 3S2FA 3ZKWA 1X1AA 1HTBA 1VSBA 4WFJA 2NYVA 2I4IA 2WRZA 1MUUA 4WKOA 5HXAA 1O3YA 3H97A 2I6XA 3CUWA 2BH9A 2RIPA 3DMYA 3O0DA 3TQFA 2WSYB 3V80A 4JT4A 1IY0A 1LWNA 2X0KA 5T5QA 3UUWA 4ZEMA 2WWHA 1MABB 1XKTA 4L2IB 5ED4A 1S2GA 2XXBA 5FTMA 4ARVA 1SVNA 1PJ4A 2VWQA 4ND2A 1NE7A 1HYBA 4AP9A 1E7RA 4X54A 3BTVA 2C96A 3AVWA 2EU8A 4Q3OA 2H17A 2QRVB 1YD7A 1QRDA 3HBLA 4ND6A 5FF9A 2R6DA 3TIGA 4C6HA 1NG1A 4BDTA 3CHYA 2HEGA 3IDOA 1E9RA 3PGVA 3PXUA 4CXMA 2I3GA 1JSRA 2QMHA 2F1IA 4A0GA 4ARCA 4NV0A 3VYSB 4A10A 2A9PA 2ZIAA 1CZUA 3ET4A 3Q3IA 2C1EA 4DM4A 4F4JA 1GQFA 4QGBA 1FQWA 1NN3A 4JELA 1ECLA 1LPBB 4RNCA 4LGYA 4QHTA 3E7WA 5HDBB 1T6YA 1DRKA 2WU0A 4B82A 3UV6A 2Q3CA 1VM6A 1E9EA 5D86A 5ESWA 2CDBA 3A6EA 2ZI5A 2AJDA 4QOGA 2XA1A 3CRW1 3ELBA 5C3UA 1A7UA 5F9FA 2BFPA 2MDTA 1T9DA 1LH0A 2Y9MB 1OXXK 3DVSX 4A3SA 3HZOA 1XTTA 4MUBA 2J0QA 4ZQCB 1T10A 1A9XB 1E9DA 3H2GA 1P2VA 4H3VA 2F7SA 4KQWA 1TVEA 4QWWA 3WL7A 1IWBB 3TIXB 2Q0HA 1RABA 4BNYA 3V6LA 1QZUA 2WDPA 3FZYA 3KOXA 4HB4A 2AMJA 3U1VA 3BA6A 3F8WA 3R8CA 2YZKA 2CYCA 4L5BA 4QYMA 1CDDA 2VH2A 1U4NA 5E0KB 3VI4B 5AHKA 4P5EA 4PF1A 3I2JA 4E5MA 1S4QA 2J3LA 3A58B 4C1NA 4ZYZA 1GQRA 1DEXA 2CXPA 1KJZA 4TTPA 4ZDIA 3PGLA 3F2IA 5AXAA 2DJIA 2O23A 3ZZTA 3M9LA 4A8JC 2X4LA 2V65A 3R6GA 2HA3A 1L5KA 3AHHA 3OZVA 4UOEA 4JLJA 2FPLA 4LXQA 4Q7EA 3QHPA 3TL6A 2FR8C 4ENQA 1F6BA 4AF8A 2YNMA 1E1QA 1KYYA 1M6YA 3PSAA 3Q6IA 2ZUDA 4HVLA 5C5EA 3OT1B 1C7ZA 4ZVRA 1S2IA 1BQ3A 1WMDA 4M60A 4IFIA 4B4VA 1X8XA 2FWBA 1NKTA 4MVJE 4HG2A 1FEZA 1IZZA 1QVAA 1XTUA 4JOQA 4CMEC 4EKYA 1QXSA 2LNDA 3PIRA 3ZWPA 2WQ6A 2AI2A 4M9SA 4IDOA 3AJRA 1JAHA 4HEJA 3OZDA 3ZJ4A 3GEGA 5F7ZA 4PAOA 4UBNA 1Q0UA 5AM3A 2WFMA 4ZI5A 3HG7A 1J5XA 4GMXA 5A5EA 1I1NA 5TPWA 1QUEA 3CVYA 5CA0A 3DE7X 2GUGA 4FT4A 3RASA 4F5EA 1NUUA 4DGQA 1J00A 3T9CA 5H9WA 3T4UA 5JI2E 1QP0A 1B2RA 1GL3A 5FV7A 4URFA 2C4NA 1JDSA 5BXYA 4B87A 2EZ9A 4CMIA 2PKQP 2XH8A 3EVFA 1KEEA 3NIBA 3PE4A 5CXQA 3PX2A 1T34A 2C7BA 4Q9AA 1RC1A 4C4AA 2G07A 1RRMA 2NZ8A 3HYRA 1ZNQO 2ARKA 2IRWA 4Q1DA 4XLLA 3JZDA 3KXIA 2J7PA 4OG2A 4OI2A 3ETLA 3HB5X 2H2FA 3UMYA 2HK7A 1KMNA 1WTCA 1A9PA 4BKMA 5FAXA 4E5DA 3AEQB 1G8PA 5GP1A 3DBLA 3LXMA 2C77A 2XUZA 3FRHA 1P7PA 3LQFA 4KKXB 4TT3D 5A62A 2PVPA 2V45A 2AN1A 1MRNA 1NF2A 3EMBA 3HJAA 2C07A 3HXTA 2P9EA 3HUEA 4M49A 3VKVA 4KV9A 4BATA 1IBCA 4P3KA 1ZD8A 3TNYA 2DETA 1UANA 1WP4A 1XTVA 4EI9A 5KX5F 4JI7B 3O26A 3QGMA 4N6NA 1XQ6A 1W8IA 4XJXA 3SZGA 3C48A 1T1JA 1C9NA 3LUHA 1VMIA 1O96B 1ZXXA 4GX1A 4LQ4A 4N5LA 5FOXA 2YFKA 4D9HA 3JQ8B 3OD5A 2PXXA 3NX4A 5F1YA 4MIYA 5AW1A 2H0AA 2R86A 4M1WA 3TQTA 3IOBA 5IDYA 3AF3A 2ZTMA 5EQFA 4YQFA 5L3ZA 1LBQA 3PL1A 2CL0X 1NGSA 3Q8KA 1R6UA 3O5AA 2F3QA 3UUEA 5TSDA 2EBUA 2KBEA 4WI1A 1OE0A 2B4QA 3TOCA 2FXVA 2AYZA 2WWRA 4DHWA 1FIUA 3ILYA 2G82A 2VNSA 1KAEA 5AKXA 2C84A 4A6XA 5IFLA 1HNZB 4PEVA 1RPNA 1VP9A 2QTVA 2A14A 3FDIA 3GQVA 3FPLA 3KJGA 3L0OA 3QUBA 4QA9A 2QR5A 4TTTS 4AMVA 1RZRA 1QZTA 4LOLA 4RQAA 1RLOA 3K9QO 3PXXA 5FTNA 1XKXA 2LCFA 2WUDA 5G0SA 1M5RA 4LV8B 1MZPA 1RMTA 2HMVA 2PN1A 2Q4EA 3C24A 2PBRA 3ICVA 3OAAD 4P58A 4JOSA 3K32A 4EPYA 4JB0A 3WA6A 1TVCA 2MR6A 4KOEC 4JA2A 2B30A 2O05A 2FQYA 3GMDA 3L6UA 5HS4A 2GH1A 4DZZA 1B74A 2VHTA 3NV9A 4O2BB 5I5GA 2FX5A 3DEYX 1A9ZA 3SPXA 3WLTA 1KHTA 1HC7A 3FNEA 2AZTA 4ZAWA 3IQXA 3OQ1A 4AP5A 4CQJA 5BNZA 2WUWE 1OSNA 2C0PA 2B5VA 2G4CA 1U2QA 5CVEA 5KDDA 3H6KA 3JSXA 4AJ4A 1IQPA 2CLOB 3THYB 3BUSA 4MMYB 1A8HA 1J2TA 3CT4A 1UZUA 1Y5RA 4PSVA 2R1VA 4YEDA 3WB9A 2Q3HA 3QKWA 1EZ4A 3ZCQA 2FFBA 3AXTA 2CW5A 1K7FB 1ZD2P 2AJLI 1T5OA 1NJ8A 4NE9A 4W1QA 4S3MA 2HJ9A 5KWIA 1V3UA 4UU0A 4YXWA 1S8FA 5C4GB 4FJ1A 2B21A 3E1SA 4JYMA 3MTEA 2H52A 4G4GA 3MWEA 4AXXA 3KG2A 4EFLA 3AHGA 1B6GA 3IAEA 2HFKA 3KELA 4HWGA 3RVOA 1DO8A 4GO1A 3SQLA 1KEKA 2GEFA 2Q1SA 1PEKE 3TSOA 1HT2E 4TUYA 2CUNA 2WT4A 2X7HA 4TX1A 3JCZA 5FORA 4MYDA 3ZV4A 2FSUA 1NPDA 3B3FA 4JBNA 4G5OA 4NICA 4UPEA 3R3ZA 5D1NA 4DRYA 1J2RA 4G85A 3EY4A 3O8BA 5K3BA 4IX9A 1Y8RB 1OASA 1NLZA 1NOIA 1NNEA 3EN0A 1UUFA 4X7MA 4CCSA 5C1PA 4CMJA 3VDMA 4LNUA 4KAJA 3P7MA 4V24A 5D85A 2VTDA 3C6YA 3U48A 1UFVA 1JLLA 2A1UA 2GAJA 2RGAA 4UKDA 3OOJA 3B1YA 4WY2A 4K88A 4RY8A 1ES9A 1Z63A 1UQRA 3UJAA 3TTYA 1P7WA 4HY3A 1LJ8A 1TIBA 1U6JA 2A0YA 3Q7TA 4JLPA 4RDCA 5KWVA 5TQ2B 1OJLA 5JMWA 4ZDKA 5FA5A 3IP8A 4E21A 2BOVA 3M1IA 5C34B 5C8XA 1D6NA 2EBFX 1ECGA 3TOVA 1EP9A 1XC7A 3INYA 1T2AA 4UUOA 2RK6A 5ALPA 3HEBA 5FEUA 3KCNA 5T64A 4ME6A 4E6EA 2XZOA 1YV9A 1VIYA 2FSIA 2VRCA 1VG0B 2WOJA 3KHTA 4LRWA 3AG5A 3VMMA 4NCBA 4JGGA 3ZWXA 2C9MA 4OHVA 4D6YA 4W7SA 2ID4A 2GEVA 4XUCA 3RUCA 2R1TB 4ZTZB 4BEBA 4PINA 5KNBA 3CEMA 3MA0A 4WZBE 5CYGA 1WF3A 3BGOS 4XLTA 1Y4DE 4BU1A 3KFXA 1L7NA 2WVAA 2BWJA 2YZMA 3R44A 3QENA 4URZR 1XMSA 2WVJA 1SULA 1PZFA 2YNMD 4EYKA 1R6XA 1FF9A 1E1QD 1L1QA 1P7VA 2Q6TA 3LT5A 5KYWB 3B7WA 4MB0A 1YZUA 1CUBA 2BT4A 5CK4A 3R76A 1DAKA 3HM9A 3PNVA 3T3MB 2NN3C 1GLNA 2V98A 2C0QA 3RSCA 5F7XA 1H8HA 2AIRA 3MN1A 2I4MA 1M1YA 2X5OA 3CCFA 4FLFA 3DOCA 2BKEA 4Z8YA 7AT1A 1FXUA 2FKAA 3QBEA 4XFJA 4WVLA 4TTAA 4AZTA 4KC0A 1U0BB 3AP1A 1XEFA 4ZT5A 4PXSA 3K1AA 2VK4A 3C3EA 3IHTA 3L92A 5J40A 2YV1A 5BW8A 1Z6ZA 5DN9A 1E2GA 2FLVA 3D4IA 5IVHA 1NFFA 2FPSA 2GFHA 1Q7EA 1VG8A 1JSXA 2AMYA 2HA2A 3IMKA 2OHIA 3UUGA 1KO7A 2Q5IA 1SB9A 2B0CA 1SC3A 4OSOA 2P1ZA 3L9WA 4BO8A 5IC4A 3DE0X 4LYYA 5DN6A 1EK2A 3G85A 3R0QA 3RTCA 1YDWA 3QEMB 5K9ZA 1T3GA 1T5DX 3FWNA 5CT8A 5BN4B 1GAEO 2E48A 2JAUA 2ZYAA 1YZKA 4FFVA 4FQ8A 5DLQC 3F9CA 5ELLA 4A0SA 4OI0A 2J7PD 4FHZA 2IEAA 3GJSA 2QRPA 1XU9A 2YH2A 3LZDA 3ZS8A 5KNBH 2O2YA 1TEVA 3RS8A 4CT0A 1O5OA 3L7BA 3DTNA 1R4NB 2QDXA 3Q87B 4GKAA 3N0VA 4GVXA 4OYHA 1TYCA 2CD7A 4RHTA 3QF4B 1A7JA 1F2UA 1RACA 4M37A 1S3IA 3AKEA 1AQIA 1ODLA 4MS4A 1KDZA 3TLXA 3ZGXA 4DY6A 5A2QA 3HWX1 3D6JA 3NP9A 3P5BA 4UM9D 1E1KA 3C1OA 4CTJA 4K0RA 2WYIA 5JCZA 3BIFA 3NM6B 1RJFA 2OXIA 3K0SA 2QPLA 3PD7A 3SQNA 3LBYA 1WSDA 1SHKA 4PX9A 1VJDA 1H65A 4IBOA 1V95A 2MYPA 4UD6A 2XA9A 4U9IS 1T2NA 2XTZA 4ZWNA 4MDYA 3CSUA 3V7WA 3WLLA 3KRTA 1UKBA 4CKXA 5KQSA 3IALA 5SZJA 3VHRA 4GKVA 3AF4A 2ZQ5A 3MWKA 3WRVA 1S7CA 3HEMA 5CURA 1XLVA 1EVZA 1V7ZA 2DQYA 2PT7A 2XECA 5EJ8A 3BB4A 3RRJA 4I9FA 4UHKA 2HU2A 1QONA 4FHGA 1Y7LA 3M6WA 3QVOA 2NO7A 1I13A 2LXNA 3EAQA 1HDXA 1ULHA 5TPZA 3ZJTA 1CRWG 1E4YA 2BR4A 2FW9A 2ID7A 3R1IA 5BOSB 1EWTA 1CHDA 5JROA 4J07A 1P33A 3D3WA 1RZRD 2Z08A 1R5OA 4LF5B 2FWAA 4BLWA 1Z4PX 3R6LA 3CNQS 3ZV3A 4DHEA 4UOQA 5C7OO 3BSFA 4GVLA 3JARB 4TQAA 2O4CA 4J1SA 5ITZB 4ARBA 1SA0A 3T06B 1FLNA 4Z3OA 4N41A 2BELA 2J0UB 4L95C 3EJWA 5BVGB 3NFYA 4I55F 4HCJA 5A0TA 2AJBA 3UC5A 1UEJA 2HPZA 4P22A 2N47A 4P86A 3TW8A 2HHHB 3ZXUB 3D3KA 2J3IA 2O06A 1KZ1A 3MGGA 1G8JA 1OUMA 3BRQA 5ALEA 3DMFA 2WYWA 3I53A 4NOJA 1A8UA 2R8BA 5IKXA 2GFQA 2PY6A 1HK7A 1ND5A 3U9TA 1Z6QA 2POQX 1XTQA 4REQB 4WVFA 4QIHA 1GRRA 1EVYA 2PGJA 1ZGJA 1KJWA 3DOOA 4NEQA 4R1UA 5DASA 3OZFA 5ARDA 4C76A 3FUUA 4FGSA 5KVSA 3QFRA 4WOBA 3VUEA 1KI1A 3NH9A 3JWGA 4WKCA 1KPGA 2I7TA 1V4BA 3GRYA 3GLHE 2H54A 3PR3A 4EENA 1X3SA 2W9XA 5E1BA 5K8TA 1RFGE 2VHXA 3W5JA 4YXWD 4W82A 1X77A 4Q4AB 3GR6A 3HV0A 2ZOSA 3Q11A 4TKUB 3T9BA 4ACBA 4AIIA 2VDNB 1HG1A 1Z38A 3DQQA 3F4BA 4IHQA 1I9GA 4UTXA 4B76A 4US2R 2X0JA 1NMSA 2BSAA 1QS0B 1G5QA 2PKEA 4PZLA 2EQBA 4BNMA 4EM6A 1Y98A 4TS9A 3O3CA 1T5TA 3U6BA 3W7AA 4FMCF 4Z9AA 1X80B 2AJTA 1TAGA 3DMGA 2EW8A 4O2AB 5IYZF 3SC2A 3V8BA 1GHTA 1NATA 1POXA 2X6QA 5GY7A 3QY9A 1RXEA 4M1SA 4PGHA 2PFSA 1PR4A 1U1IA 3A1UA 2OG2A 3MRXA 5FT9A 5J2TF 1KAQA 2HWKA 3PNYA 1XCMA 3QTTA 2QAGB 2VJQA 3BJMA 3LFHA 1IK4A 2I54A 2O8VA 1U7DA 1AGPA 4NMHA 1O9HA 1IN6A 1BN7A 3ODPA 1G7TA 5KOJB 1W36D 4NCHA 2ZBDA 1NQUA 1HH4A 1APBA 4DXDA 5HFAA 5BW4A 4OJMX 1G8KA 3BH7A 1H3EA 4J1TC 5CDHA 1S3FA 1KXJA 5CA1F 1E9FA 5KCZA 4KFTA 4U6QA 4GXQA 5LUAA 1S1MA 1AK9A 1RI2A 1VJ5A 4FHFA 4CKEB 1Z28A 3BM5A 3GPBA 4BFTA 5BN5A 4KR7A 1HORA 3LWZA 1NBMA 3DE2X 4COOA 2JLVA 1SBHA 1MTOA 1SCQA 1ADYA 1UIMA 2Q5EA 3NHBA 4MEBA 3OQOA 1LRJA 4HX5A 4UXIA 2D1SA 1FSGA 3QE4A 4UFNA 1O6GA 3H2SA 3LNCA 4R8LA 5DIZA 3U7EB 1W4LA 1DC5A 3F6RA 3O4JA 3VZRA 3CCCA 5C35A 1I6KA 5HTKA 1X7HA 3O82A 3OJEA 5JD5A 1RWOA 2IEZA 5KPDA 4ECEA 1AA9A 4W5TA 2BR5A 2XOKA 3M6AA 4R16A 1I2DA 3AONB 4G65A 3BL8A 4LMBA 1EWKA 3D6NB 4MS1B 2ZRMA 4H35A 5J59A 1Z17A 3WWEA 3IVGA 4CUJA 1AHPA 5KNBD 1HOXA 3DMDA 4GL4A 3TB4A 2QLJA 1JAZA 3KM0A 3RHZA 1H2FA 4WINA 4B83A 4EHNA 4QUGA 3TE7A 2A94A 5IJ0A 4RH1A 1U8ZA 2WZCA 1GPBA 4X63A 1TU4A 3C7KA 4NONA 3RJZA 4HQ0A 2IBMA 2AC4A 1VKJA 4CKBA 1AKTA 4MP8A 1J0DA 3H1AA 1H8HD 3PFIA 1M2GA 4OHKA 2JD1A 1JHAA 2GEKA 4MITA 4YIKA 2FPXA 1AGRA 1I1QB 2VR1A 2K2WA 4WADA 5LD2C 4AY6A 1PBNA 2LKDA 3FNRA 1EK6A 4ZAGA 4BNDB 4LBYA 3REFA 3H5NA 3NT4A 4QM6A 4M1ZA 1ADGA 4P33A 3F67A 5JW6A 4BLUA 4C30A 4KX5A 4MMXB 1W35A 4IGIA 2W8ZA 4G5XA 4P5DA 4R81A 3ZJVA 1EG7A 1XWFA 1LSUA 3H18A 4U7DA 3VPCA 2BTQB 1WDKA 2KS6A 4H7KA 4ZOCA 4C03A 4EB6B 3QU5A 4JDPA 4RK7A 1YZFA 2HW8A 2M1XA 1SXIA 1Z39A 4H31A 5JSHA 3I9V6 2Y1GA 2WF9A 3FZEA 4ZICA 4HFMA 3WNBA 3FDZA 3HPRA 1V43A 3N8KA 1IB0A 3PQFA 2PMBA 3ZDYB 5DN6D 5BO5A 2GHQA 5FCDA 5BN3A 2C2ZA 2Q5HA 3TLJA 3SNHA 1LW6E 4N3AA 4OHWA 9ABPA 4LHSA 4MRRA 4H7IA 1Q1NA 1UXJA 1FW6A 1U5CA 1C30B 2FSPA 5IDXA 4Q7QA 1KO5A 1Q5PA 1UXOA 3ZD8A 1Q11A 2YNMC 2AK2A 5A3VA 4I46A 5HILA 2VNKA 2O59A 3OZXA 3Q6NA 3G2OA 3G8BA 4XX1A 3QU7A 1A4XA 5DWVA 1WOYA 2WFAA 2QY6A 1Q1GA 1Y3CE 4LE0A 5EJIA 4EZEA 5IMSA 4M0MA 3GLGA 4KXNA 3TRKA 1ZNXA 3QBDA 1NJSA 1JB1A 2I66A 1OD6A 2N1BA 2YVQA 3TFOA 2Q8PA 2ZE8A 4XZ3A 3RT7A 4IDGA 2O9JA 3W7BA 1ZJ5A 1MC1A 1CUDA 4FR2A 4Y1GA 4IVQA 1QAQA 2FTKE 3C3BA 3D6VA 2ZK7A 4L6IA 1QIFA 1DIOB 4HR7A 4A8HA 4BKUA 4B6QA 3V7YA 2Q5QA 5H3LA 2C83A 4QQFA 1UOEA 3L7KA 4MW9A 1E3WB 4RF2A 4MJLA 3USES 1RXVA 1XRMA 2XEXA 2WKPA 2QL9A 1ULUA 4Z7OB 1JIQA 3WHKA 3RHFA 3PNBA 5TLSA 1E9VA 1S8AA 1RLIA 2FHSA 1AZTA 2Y67A 3OZAA 4QD3A 5BQFA 3I3SR 5G40A 4LY9A 1CE8B 3VA7A 1U2PA 3BBLA 4X93A 1O89A 3GU3A 1Z6PA 5TPZD 1VE1A 1RE0A 4DCJA 1QIJA 2Q0XA 2Z04A 5DHFA 3INRA 2O57A 3UENA 4AMYA 4B2LA 2FPGB 4DB4A 3PXEA 4D0NA 1J9GA 1N1MA 3OPYI 4OK3A 1IXKA 5EZYF 4HEQA 3EFOA 5DM0A 2YC2C 1LD3A 2BFCB 4R1PA 4WXHA 4B84A 1Z0JA 3L4BC 1F2TB 5DRTA 3UJCA 3Q5DA 1WCIA 4JWTA 1GTRA 2R6GA 2QVCA 4M2LA 3T3EA 4A0RA 1Z4KA 1FDRA 1R0SA 3ZWVA 2W42A 3PQCA 3DDOA 1D3AA 1U8XX 3OA0A 4GMKA 4BKQA 3VM6A 4MVJG 1YVPA 3SYNA 1XB2A 5CPFA 1JLRA 1R7RA 2VQ3A 1YR8A 3X2SA 3HKBA 4KUGA 3H2ZA 4OMDA 4DV1B 4PRZA 1GG5A 4GC5A 4EHAA 5C51B 2HA7A 2GEDA 3EIEA 5TY0A 6ABPA 1UP7A 4HL6A 4I1VA 2WFZA 5ALDA 4O1HA 4RLSA 2Z5LA 4EW6A 2PSEA 3B1XA 3K5PA 1HRKA 3C14C 3CKMA 2FDCA 4HS9A 1J70A 4RQTA 3KQUA 1EM8B 2HIHA 3K8QA 5F4ZA 2PBZA 1XHFA 3CX6A 2K4MA 1E1YA 3AU9A 4X7PA 5J5AA 4I81A 1PGJA 1TC2A 1FRZA 3L3BA 4MQMA 3F8SA 3INTA 3ZOKA 4N9QA 1VKRA 2R60A 5K2MA 2QUZA 3C97A 3TD9A 5KHAA 5JECA 2HJGA 1E6LA 1NRIA 3DEJA 3PZRA 3N0TA 2GHTA 3W2IA 4E07A 1DAOA 5EP3A 2NU8B 2WJ6A 5IRCD 5HJ5A 1M2OB 4UNRA 4WFIA 1YZTA 3CTMA 4V0KA 1TMOA 5JY1A 4D80A 3LY5A 1ZVKA 2OGWA 4D4HA 2QUHA 2OFOA 2CFTA 1GUAA 2XAAA 3N7UA 2BMJA 3UHPA 5AW3A 2ZJ7A 2D7CA 2EATA 1QYWA 2R9VA 1Q77A 2O8CB 3QQ5A 3G7SA 2VYQA 1Z6TA 3Q2OA 5EGNA 2RBKA 5B6JA 1QO0A 2OD2A 2XMCA 1WG8A 2XEDA 3KXKA 1F20A 3B20A 1OLSA 2JAPA 3IBTA 4IYJA 3ZHBA 2QRMA 2A6PA 2WG2A 3FM9A 3O75A 4P9NA 3RVRA 2CWWA 3L06A 1F7VA 4HATA 1PUIA 4OUDB 2GNOA 3AM3A 1ADFA 1ZN9A 3CO0S 4XQEA 2FPIB 2DY1A 4MLPA 2VXCA 3BD6A 1UJ5A 3EIOA 4FGJA 1CZNA 1Y1QA 2QPAA 2CY0A 1U4OA 3BEOA 4KBFA 2OBXA 3WKCA 2B4TO 5EWJA 3FYUA 4LOIA 1TU0A 2MOKA 2JLSA 2V7QA 4XR4A 3TUIC 3PC6A 3EQ7A 3C1TA 4XWKA 5JR3A 4MDFA 2XTMA 1TM5E 1I6WA 2XVAA 1IAVA 4HVAA 2O8BB 4NZMA 1M76A 1NJGA 2KPOA 1W2HA 3C3MA 4U6SA 1KYXA 2XOKD 4JKOA 4XVHA 3KQQA 2YXLA 1W96A 4MHSA 5FLXA 2KI5A 1W5BA 3C7DB 3SEAA 3T3DA 3VHXB 1D4FA 1MJHA 2GJ8A 3DAYA 5C1BA 1QE5A 3MGKA 4LHWA 1NYTA 5CJJA 2UUBB 4B3MB 4IJUA 3G0BA 1BVHA 4F46A 1CY6A 3W1EA 4AN0A 3EDQA 3T9EA 1GGHA 4RGVA 1W36C 2I87A 4R1OA 3ACDA 4XAQA 2P35A 4BX2A 2IWHA 1VCMA 1GTMA 3B2QA 1KZGB 3RD5A 3Q5GA 4YLGA 1KDYA 3BD9A 4BBJA 4UUQA 1GPLA 3IDZA 4NR0A 4OA8A 1XQ9A 5ENDA 2V7XA 1LVHA 1XNGA 3CW8X 2AG0A 4HGZA 1J8FA 4ETMA 4TKLA 1DPGA 3C8DA 3DO6A 3JY6A 2PUEA 4HXYA 3HE3A 1TIPA 1S1CA 4YT8A 3MQFA 1XCBA 2YIVX 5IJ9B 2FPMA 3LGSA 3ONNA 2XNSA 3HXKA 3MXOA 4PRYA 1M8FA 3GP8A 2XGJA 4P6VF 1KBOA 1GP2A 4WCFB 2FSSA 2I80A 2IHUA 4U7JA 3AIMA 5K20A 3EEQA 5K8CA 1IBKB 1R4MA 4OQYA 4TL6A 4DT1A 2O6LA 2ZUTA 4CQMD 4NH4A 3C85A 2I3DA 4KREA 4D57A 3I1IA 3ESXA 2QAJA 4RCVA 3H3JA 3TLGB 4R68A 1PZHA 4DSAA 1LTHR 4UBKA 2X1HA 1XXLA 1XO1A 3EWIA 1NT4A 3GLIA 3L4JA 5EP4A 1L4EA 2ZZMA 2MSKA 2ZRBA 3UJ9A 1ADCA 5B1YA 1NXQA 1SHUX 4MR7A 4WZAE 3GUZA 4WX2B 5C5DA 2IYQA 1JEQB 5I7RA 2WM2A 1KMMA 5HNKA 1HMYA 3G0OA 1E61A 3O8CA 1BCRA 2ZUBA 3EF1A 4Z0TA 4OH7A 3FLBA 3T35A 5TF4A 3TOSA 1M34A 4E33A 5THQA 4UAGA 1HYHA 3LMKA 1UBRS 1N2OA 2D54A 1GDDA 1E5LA 1HG0A 4XXHA 1T1SA 4KXMA 3PD1A 1XJQA 4P1ZA 1ILEA 4OGKA 3OETA 3TSWA 5DRYA 4JC5A 2IZ0A 1XDGA 3I83A 5FTLA 4KYTA 4CM4B 4W8HA 4FD3A 3WNVA 1ABEA 4P4TA 1G4HA 2ID9A