4BMYA

Structure of futalosine hydrolase mutant of helicobacter pylori strain 26695
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
230
structure length
225
Chain Sequence
b'VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIPESAIFIETSESLNALAKEVANEQHIVLKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISANADEEDAFLEKSAQTSAKFLKSMVDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MTA/SAH NUCLEOSIDASE
publication title Structural Enzymology of Helicobacter Pylori Methylthioadenosine Nucleosidase in the Futalosine Pathway
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 77
structure length 225
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bmyA00
2QTTA 1TCUA 4JOSA 1Z36A 1A9TA 2HN9A 4M3NA 1PF7E 1Z5OA 4NY1A 3DF9A 4RJ2A 5EUBA 3UAYA 1K9SA 3FAZA 2I8AA 1PK9A 3KUKA 4TTAA 1ODLA 4DA8A 3PNPA 1Y1TA 4KN5A 2AI3A 4YMLA 5C80A 2QSUA 3OF3A 1RYZA 3INYA 4NSNA 4TXLA 5CYGA 1U1GA 2I4TA 1PR5A 1RR6A 4M7WA 4G8JA 3P0FA 5F77A 1PBNA 1JDVA 3K8QA 3EMVA 1V45E 3DDOA 3FB1A 5IFKA 4DA7A 1JP7A 1NW4A 3OCCA 1LX7A 4DA6A 4ECEA 5EPUA 4E1VA 1YQQA 5B7QA 1VHWA 1OV6A 1Z33A 4UC0A 1YR3A 3BSFA 1U1FA 4TS9A 5KB3A 3E0QA 1A9RA 1VHJA 3P0EA 5ETJA 4BMXA 2OC4A 1ODKA 2QTGA 2RJ3A 3KU4A 1SD2A 3ONVA 5B7NA 4L6IA 3OOHA 3IEXA 3ENZA 1OU4A 3MB8A 5F7ZA 1JE1A 5CXSA 1T8RA 4F2WA 3K8OE 2ISCA 3UT6A 1RXCA 4TXJA 4F2PA 4MCHA 1QE5A 3KHSA 4JWTA 4WKOA 4R2XA 4EARA 4BMYA 1Z37A 2ON6A 1ULBA 3EUEA 1ULAA 1Y6QA 1Y1QA 1PW7A 3OOEA 5F78A 4F3CA 2Q7OE 5JPCA 3DPSA 3FUCA 4LZWA 4OY3A 1TGVA 1SJ9A 1ODIA 2A0YA 1RCTE 4YO8A 3UAXA 3LBAA 3SCZA 4TTIA 3KVRA 2XRFA 3KVVA 4M1EA 4FFSA 3QPBA 1ODJA 3D1VA 2GUWA 4BMZA 3PHBE 5F7JA 4R2WA 1A9OA 1PR1A 2OECA 1JPVA 2AC7A 1T8WA 1TCVA 1RXYA 1RFGE 4DABA 3GB9A 1Y6RA 1Z35A 1G2OA 3OPVA 3UAWA 1M73E 3OZBA 1RXSA 5FAKA 1JDZA 1WTAA 1Z5PA 1YQUA 4L0MA 4H1TA 2H8GA 3O6VA 1I80A 4G89A 5CYFA 4DANA 4F1WA 4L5CA 3DP9A 5CCDA 4WKBA 1B8NA 1U1DA 1A69A 2HRDA 4OGKA 1LV8A 2B94A 3LGSA 4WKCA 3DJFA 1TGYA 4QARA 4YJKA 2AI2A 1PR4A 3IOMA 5DK6A 4D98A 3E9RA 4WKPA 1Z38A 4R31A 1A9PA 1V2HE 4WKNA 1FXUA 3ODGA 2A8YA 3O4VA 5K1ZA 3PNSA 1T8SA 3UAZA 1A9QA 3BL6A 4L5YA 4GLJA 3EEIA 4G41A 3T94A 1V48A 1OVGA 3NM4A 1TD1A 4IP0A 1NC1A 1V41E 3NM5A 3NM6B 4OGLA 1ZL2A 3MMSA 1SQ6A 3PHCA 3KVYA 1ZOSA 4D8YA 5IU6A 1Z34A 4TXMA 4MCIA 4TS3A 1K27A 1U1EA 1LVUA 4K6OA 3FNQA 4I2VA 5B7PA 2A0WA 5F73A 2OXFA 3LA8A 5CXQA 4U2KA 1Z39A 3FOWA 1T8YA 5F76A 4DARA 1JYSA 1NC3A 3GGSA 4PR3A 4D8XA 4MARA 3UAVA 1PK7A 1B8OA 3F8WA 1RSZA 3BGSA 4GMHA 1Z5NA 5EFOA 2HWUA 3E9ZA 1PR2A 4P54A 4DAEA 1Y1RA 4LKRA 1JDUA 1YBFA 1Y1SA 2OC9A 4QATA 1N3IA 3OZDA 1PKEA 1RT9A 4OJTA 4TXHA 2QPLA 3EUFA 3NBQA 4TXNA 3OZCA 1OTYA 5I3CA 5B7GA 1JE0A 4LDNA 1OTXA 1A9SA 4TYMA 4X24A 4OF4A 1XE3A 4PNPA 4QFBA 4JP5A 4OEHA 3FWPA 5F7OA 4DA0A 4QAQA 1PWYE 1ECPA 3C74A 4F3KA 1V4NA 4D9HA 4TTJA 4QASA 4LNHA 3TL6A 1JDSA 4YNBA 4GLFA 5F7XA 1PR0A 4D8VA 1YRYE 1T0UA 5CCEA 1OUMA 1U1CA 2QDKA 4DAOA 2AI1A 3BJEA 1VMKA 1CB0A 1JDTA 1VFNA 1K3FA 2IQ5A 1CG6A 4LNAA 1RXUA 4L5AA 4QEZA 1Q1GA 1V3QE 3U40A 4GKAA 1PR6A 4EB8A 2A0XA 1SD1A 1C3XA 2PGAA 3OZEA 2HSWA 2BSXA 2P4SA 4BN0A 4NS1A
chains in the Genus database with same CATH superfamily
3CJTA 1R5NA 1KH1A 1TCUA 2J5KA 2Q2OA 3B2QA 4NY1A 3G2NA 4OJKA 4PLWA 2JFWA 5GIOE 1NLYA 2CLLB 3ELYA 3L8HA 4L4ZA 4DCJA 4DSTA 5CLJA 4EYKA 3QKWA 2C98A 1E1RA 4LYAA 3Q6IA 3K9CA 3STVA 4D7AA 1VFPA 2AWNA 5JYDA 3I34X 5E7IA 4UOEA 1ND5A 1XP5A 3KD3A 3SEAA 2IOQA 5KWEA 4PSDA 2DPLA 2HA6A 1DX6A 5M7EA 3IVMA 3CBQA 4YRGA 2AI3A 3E48A 1Y1PA 5EJFA 5MN6A 1SD5A 1ZSVA 4E2YA 2JLZA 1H8EA 3IAFA 4FHEA 4AS2A 2IGBA 3VDRA 4XD7D 5FWNA 2RI6A 3JQ9C 1QTRA 1TW2A 2EG5A 3L43A 4UE6A 4PIPA 2P5YA 3LUFA 2DBZA 2PEZA 3AFMA 3ICQB 1UIMA 3IPAA 1JDJA 1OXSC 2WP0A 1IBMB 1A3CA 2OXRA 2BGUA 4P4NA 4XXHA 1EFRD 2B8NA 5LBTA 3V1LA 2JGRA 5F77A 1M1YE 3NETA 5BV8A 5KHLB 1UIRA 1QF6A 1GG2A 1X14A 4CEJB 5ESXA 3JD0A 3DDOA 3AYZB 3FB1A 1NZFA 2DSNA 1CRZA 5IJ0B 5FI1B 1DQRA 4GM1A 4B6JA 5K01A 5IKMA 2OKGA 3B2EA 4I99A 1L8LA 4DA7A 1GUDA 3FCXA 4XYEA 2VRCD 4Z9XA 1SQSA 3Q1KA 3JU3A 2VDUE 1VL0A 3NWEA 5A4IS 4CMIA 4A03A 2OD9A 1Z5ZA 2D4AA 3AKDA 3ESBA 3U19A 3KFXA 3H11B 3NWBA 1JHVA 4K6MA 4JVSB 5GADl 5LU8A 1L3IA 1ZMBA 1I32A 2MSLA 4Q93A 4CM9D 1P3DA 1MNQA 3GRVA 2QROA 4RA9B 1E59A 5D6OA 4XQCA 3HSKA 2V7QD 1L1EA 3P7MA 3TOZA 1OWLA 2G7MC 4XUDA 3I52A 3A28A 2BFEB 2BEUA 3P4UA 4ZYLA 1F9AA 1H6BA 4P53A 3RUCA 2VATA 4OMCA 4BBAA 1SUDA 1JR3D 1RLOA 2PX2A 3ZD9A 5BSMA 4DJTA 4LJ8A 2BBSA 2VOEA 2DWCA 1EEHA 3U7QB 2A5FA 4Y6SA 2QE6A 5DM2A 4ND1A 4AQ7A 4NU0A 1Y6FA 1K1EA 1SXJE 2G4LA 4O3FA 1SHZA 2DY1A 4UCXA 1ZKDA 4B2LA 4RTKA 2H2HA 5EL0A 2Q1UA 1ODKA 1T4GA 3DNMA 2Q4OA 3N07A 4QUIA 2AB0A 2AHOA 2B35A 4G4GA 1SBZA 4KO3S 2VQEB 1KZYC 2C78A 1ZX1A 3JARB 3ZWNA 3VSCA 4KYUA 4X1YA 3WK8A 3SMQA 4OQ4A 1U7OA 3EFHA 1NYRA 1S2LA 3JYNA 3K09C 4S35A 5L3QA 1BW9A 1C1XB 2AN4A 2XUDA 1G7RA 2PX4A 1LNSA 1JE1A 1IUOA 2XA1A 4ZAYA 4YONB 2F9LA 4Z1OA 4Z6KA 5BQOA 4F2WA 1GIAA 5KYWA 2ZAOA 5LP6F 1D6SA 1GKLA 3G0OA 1WHSB 1ZCBA 4Z8YA 4BNHA 5EZSA 4D9FA 5JANA 2NWQA 2UYCA 1U0SY 1NRXA 2W5UA 3AF3A 3FYDA 4Q6WA 2RHMA 2RG1A 5DXJA 5KOJA 3NBFA 5DM0A 3EGDA 1IQ0A 5J4KA 3I1FA 2RGBA 1N6PA 4RXMA 3OTGA 1CUXA 1N2XA 2BYTA 4RMGA 2F3SA 2CNKA 2JIBA 2ZS7A 4KFSA 3DEZA 4XB2A 1U2DA 5TF0A 4AUMA 1ZGHA 2JLCA 4LYGA 3T54A 2CXQA 1XOIA 4W7SA 2BT4A 1PZNA 5DYYA 4ZI7A 1WLYA 2R66A 2ZAGA 3EULA 2MWMA 3NUZA 3PK0A 4HWRA 4A16A 2HLPA 2V6FA 3RIEA 4YJ2A 1QHSA 1LDMA 3O4IA 4AX8A 2B7BA 3DD5A 4U7JA 3KT8A 5TV2A 3NUQA 1U28C 3OJEA 2VIIA 2X58A 1CNFA 4G5QA 4DS3A 1WLSA 4BAZA 4K6KA 4IWYA 4R8VA 5JNRA 2I2AA 5KQGA 3HUEA 3LQYA 3OAAD 3WK9A 4FX5A 1ZW1A 2D6FA 4DWVA 4NPCA 3EXG2 4Y67A 1Z15A 1B6GA 3MGAA 2C1XA 4LZZA 1KQNA 4FDUA 1JXOA 1VIDA 3HWSA 3V1NA 3ITKA 1M8PA 4B3GA 2Q6LA 2Y9PB 3QOYA 3WL3A 4ITVA 2E55A 1IJFA 1NW3A 3KE9A 3L6DA 1PGQA 4FYXA 3TJRA 2GPBA 2WF6A 4H6XA 3UMGA 2CLEB 1NW9B 2EFDB 1WZIA 4FFSA 5L40A 1QM5A 2QMYA 3QITA 1UBTS 3R5HA 3RSSA 3SOPA 3S55A 3WLQA 2ZIXA 4RF3A 1WMAA 4ZV7A 3MIIA 3GP8A 2WUDA 2WMDA 1Y81A 1ZXLA 4KUGA 4EGSA 1KXZA 2RHOA 1Q2XA 1QOZA 4WDRA 2WSSA 1NW8A 1UMBA 1ZC4A 3KNZA 3ONEA 3AB3A 3WGJA 2BTQB 2NOAA 8ADHA 1W5TA 5JRDS 3QSYA 3N8GA 1T9HA 5I9LA 2DHRA 1QOQB 1DEOA 4ZTUB 5JISA 1PKXA 2ONYA 1G2OA 2OKCA 1V5WA 2GZHA 3A3OA 3QVJA 3N7TA 3OPVA 3Q9UA 1IY8A 2ZTUA 5AUQA 1VIYA 3LW8A 1P8AA 2F43A 2HUNA 2I6XA 3TKAA 4YUWA 5BVHA 2JRLA 1GCGA 1HDRA 1B73A 4HGRA 3B9BA 2C58A 2G71A 3DKPA 3NASA 3LNCA 1IHYA 3I1IA 2ZSDA 1Z0ZA 2P4EA 5FAKA 3NU1A 4KR0A 3HCWA 4M83A 2NQ8A 2VDWB 3D7NA 3MSCA 4KN9S 3REQA 1SUIA 3W2EA 4AY4A 4DLWA 4J8PA 4FPXA 1CR4A 4XFKA 1E2FA 1WETA 1TAHA 3LD9A 4AZSA 2PPVA 3QMVA 1A50B 1P6UA 3D3QA 2C5HA 1RJFA 1J5PA 3IOBA 4LV6A 2JGNA 2PKCA 1X8LA 2Q45A 3DG9A 3GZNB 4JP1A 1PZGA 3G2QA 3CZRA 4G89A 4KUHA 5BT9A 1I4TD 1O2DA 4PYNA 2I76A 1Z4KA 3M6AA 4JLDA 3V8QA 3VTFA 3GHHA 4REOA 1UBEA 3H5WA 1ZN9A 1AQUA 2F48A 4LK2A 4M86A 1YS4A 2XRMA 4YREA 2I1WA 4HLNA 4A6PA 4Q47A 3RYFA 4OYLA 3PA8A 5A4DA 4C88A 2CLMB 1A96A 1UBHS 3OEHD 1OLXB 2PZAA 2RDMA 4OPMA 1QQ7A 4ZP1A 4L6AA 5F12A 3U37A 1ZVVA 3HC7A 4BECA 4H15A 3LVBA 4AKGA 5AJWA 3STUA 3FOAA 1U3VA 2JRCA 2ZATA 4ZICA 2OZEA 1Y8CA 2FWAA 2GDZA 2V9PA 3U4IA 4C7VA 2W8BB 4B0OA 1YL7A 4EFKA 3EISA 1RACA 1PR4A 1DBWA 2O3QA 1RHQA 3GC6A 4X7MA 1YZNA 1FDTA 3TPZA 4FINA 3E9RA 3LA6A 4EUHA 5D3MA 1ZIPA 4WKPA 4F6RA 2OBFA 4A3SA 4LJLA 1HV8A 1JGTA 3LS2A 1A9PA 5GZ1A 3QU5A 2HCBA 4FGSA 1VG1A 1XJ0A 5FTMA 2TMDA 2XUZA 1KQPA 1KZ6A 1RRFA 1XVTA 3ELWA 2FJUA 1BXZA 2VK1A 2QLFA 4JLSA 4LXYA 4L5JA 1DEKA 5AUNB 2O57A 2C88A 2XGOA 1NBOA 3EHEA 4XWAA 2Q27A 3GIWA 3HCRA 3HB5X 4HLCA 1PEYA 5IW8A 1Q2UA 3G9XA 4EB0A 5JS1A 1LPOA 3K5PA 2E4WA 3EWAA 2DLCX 2AX3A 2NT4A 4P2BA 1GYPA 4Y0NA 3QQ5A 4R98A 1YWGO 2TECE 3RRYA 3WBJA 3GGOA 3IQEA 2IVFA 4HDNB 4KB5A 3W3ZB 2ENWA 3UQYS 1BD3A 4RACA 3LO5A 1SK9A 2B8JA 3NX4A 3TZQA 4E15A 1JT9A 2CJWB 1S4QA 1DUVG 4UEQA 5IMBA 3WL7A 4V1CA 2AS0A 5I48A 4ICIA 1NVBA 3UC9A 5LDHA 3QE0A 4O33A 1KK1A 1SXJC 5HNKA 2IYLD 1P7PA 2REXB 4HDCA 3G5AA 3GRYA 4OHPA 2QZJA 1ECGA 2R8XA 4Y1EA 4FFPA 1UBSB 2ZJ5A 4AZ0B 4GR9A 5A05A 5FP0A 3TAHA 3HG7A 5KTTA 3VYWA 4GD3Q 4PE5B 2MHCA 1RLMA 3MOGA 3G2LA 3CE6A 4ME6A 5KC9A 5ALIA 2ODBA 1GRQA 3TSZA 3KEQA 3AEQB 3ZCXA 3O84A 4YP0A 1VYVA 5IKEA 4QVKA 4KR9A 1TTHA 2GN8A 2PH3A 5JZVA 4YQYA 2GZAA 3FD8A 4D82A 1E1YA 4AWBA 4BJ5A 1HT3A 1ULUA 4GOMD 4F5DA 1CY0A 1FFXB 2PY6A 2G5GX 1YIAA 2ZJZA 4BV3A 4D8WA 2HQRA 1E3LA 2NUPB 1EUCA 1DHTA 4GIBA 1N7JA 4PLVA 4RK1A 4DDKA 2XIJA 3TQHA 2HJGA 3GLIE 2QB5A 3K05A 1V47A 1L5WA 2LIVA 1GPKA 3HBJA 4LZJA 3K71B 1E3WA 2AJDA 5DM60 4TWRA 3IT1A 2GZ2A 4MW7A 1BDJA 2Z95A 3BTOA 3MOSA 3G0CA 1DDIA 3RTEA 1FMFA 4U7GA 2HWYA 1EBUA 1T8YA 1KYZA 3CLUC 5A6VA 1M8FA 2GCOA 5SZJA 1MZPA 4QBHA 3H2SA 3ZWYA 5FTWA 2Z9BA 4Y2HA 1H5QA 2G1UA 4PLHA 4Z5XA 5C37A 1MKYA 1M2GA 3VYRB 5KTSA 3N2EA 4A36A 1VBFA 3VH2A 1WB4A 1V3TA 3HJTA 1ECFA 4WV3A 3RANA 4ED9A 3ETDA 2YWHA 4AICA 4F4CA 1GTL1 3E82A 4BC0A 1U7UA 2Y68A 3LY7A 4GZMA 4Y98A 4R2JA 1A98A 4YRZA 3DFFA 3PQ4A 2BHNA 1YRQA 2Y76A 5AM5A 1HX7A 3NHJA 4OXRA 3UHOA 5ES3A 3KDSE 4BKUA 3PTZA 4D8UA 1WZCA 3E8MA 4TWIA 2B5WA 2WTMA 1UKEA 1Z6GA 2AJLI 2P1RA 3VNRA 4HB4A 4LE1A 3OG9A 4P54A 4BMVA 4J0DA 4E21A 1W35A 4QWWA 4J94A 3O8BA 1TMKA 4XIFA 4BP8A 1WXIA 2WWVD 3O1JC 3LLUA 3SZ3A 1GOTA 2VBGA 3JALA 1H2EA 2P2YA 2O3SA 3EG9A 4LNUA 5CH3A 1U5BA 3IDAA 3HCFA 3HM9A 2V1XA 3F3SA 1RYDA 1T5IA 3BFVA 3C1UA 3FE2A 3KLOA 1KTIA 3L6CA 5EJAA 1PKEA 2UZAA 4OJTA 1ZM2A 3KL2A 2QJOA 3IOEA 4EKEA 1P31A 4OKNA 1AZSC 3JRNA 5HWSA 4CEHA 1GQRA 1XN4A 1O4WA 5AW6A 2QQ0A 4GPIB 3NBQA 1R8SA 5D51S 4KVFA 1H2HA 2ZUWA 4RYDA 2WKRA 2BFBB 3DOJA 5AW7A 3AJAA 3P9SA 2CBZA 1USKA 4CM8A 4CN8A 4DLNA 1RCUA 2V7XA 2IXGA 5ESRA 3DE3X 2H11A 3FPKA 2B3DA 3LAWA 3VTAA 1XPJA 5A5FA 5LLTA 1I4EB 1N8KA 2Z8ZA 3UC5A 1A8IA 2YL2A 1XZLA 4PSAA 2WYWA 4DW8A 2PUBA 3KQYA 2ZBEA 3QMPA 4RVOA 1E9RA 5AI5A 4BP9A 4EUFA 1U8XX 5AW1A 2JFHA 3CW8X 3AI7A 2QR2A 1IATA 2MU1A 4GMKA 2BR3A 2B99A 2FDRA 1O3YA 1GTSA 3HCBA 3NBUA 3FPJA 1GADO 2VAWA 3R3WA 2QRLA 4J1QA 3CKMA 5GTDA 1JEDA 3HY6A 3PT5A 3SFZA 4WN3A 4FKZA 3UPUA 3IX7A 1BGVA 2HK8A 4GOLD 3FNHA 2A14A 1FUIA 4MJXA 1XCLA 3EZNA 4Z3DA 3SEFA 2AG8A 3PPXA 5EHIA 3FUWA 2HJHA 2UZ0A 4WXHA 3UK7A 3IV9A 2XLBA 1QGAA 1XQXA 4WLOA 2VPZA 2VJQA 4IIXA 5E9QA 4Q1FA 3HEMA 4J90A 2FX3A 1PT5A 3G82C 4D3XA 4BE4A 5DGXA 1GNLA 4KPEC 1SFRA 1DXOA 1L4KA 2PRZA 1HRKA 4OXXA 1ESMA 3GY0A 2ZXEA 1CUEA 4Q0MA 3B70A 1XTZA 4IIFA 4S0ZA 3QMMA 4J2HA 5J2TF 1AMUA 1C7ZA 3RE1A 1T5SA 3K1JA 3HR4A 3G7NA 1D09A 1N5DA 3COYA 3IJ5A 4TLLB 4HAYA 2FK7A 1NG1A 2IJGX 2O05A 2O48X 3JQBA 2P0AA 4M1QA 4URYR 4KIFA 4KO8A 2OXCA 4A1OA 4JT4A 5FUYA 1CNMA 4NCJA 3T3EA 3UMJA 1DT3A 3JZIA 4D9KA 1Z8NA 1W85A 1Q1AA 3V4LA 1JEJA 4DCPA 4LFBB 4YMUA 2JGLA 3LCRA 3OCJA 4EGJA 1YQWA 2Q4BA 1XZBA 3PQ5A 1KVUA 4FU0A 4XLTA 4KIJA 3TWOA 1ESEA 2O8FA 1VRVA 2XQGA 2MINB 5HYVA 5JXIA 1EM8A 1W0KD 1K6XA 4OGGA 2B78A 2ZJ1A 1YCGA 2A0UA 1DRKA 2B6HA 3A9UA 4GP7A 3ZEIA 2UXCB 3I6YA 1X7ZA 1E6CA 4PS1A 2Y6VA 2CSXA 4KJZA 4OLFA 1FYEA 1WEHA 3GDWA 5CB6A 5HPYB 1OH8A 2IYSA 3DZJA 4MB2A 4PY2A 2MYTA 5M2QA 4Q4AA 2EGUA 5DMHA 1U2EA 3N3BC 1VXRA 3P4YA 4M8SA 2VHTA 2QRVA 2Y0EA 3BCHA 1WW2A 1B00A 4B6RA 2CB0A 2O52A 3QF7A 4I5DA 3ZS9A 4WMLA 2UUAB 2RI1A 5MFZA 1FBTA 3IQFA 2X7XA 1BQ4A 4FN5A 5A9RA 4PGAA 4KREA 3VSEA 5DTEA 1T9BA 4ZO8A 3ZHRA 4DBLE 3D5EA 3ZPXA 4GX2A 4L8YA 4K3UA 3TR0A 4L78A 1F3LA 1LTKA 1YC2A 4JLMA 4MAFA 1LCIA 3JZAA 1IDOA 2II6A 4JP8A 3G8AA 1G60A 4IG9A 4Z2YA 4LXTA 2H0RA 4KQFA 4WN9A 1VE1A 5K8JB 1CF2O 2AN5A 5GONA 2HF7A 5F1OA 3TO5A 5EUQB 3H6KA 5T8KA 2OCPA 5EGSA 4ARBA 2WTXA 3QEMB 4NNOA 2J9XB 2YC4C 2YUIA 3CVJA 1KI9A 5BYAA 1WF6A 3L8CA 1AOXA 4Q4CA 1J6UA 1R6TA 3OLVA 1S2DA 4PXYA 1GTRA 1UJ5A 3U16A 3RRZA 1N0HA 5JJIA 4YC7A 5IARA 1FFBA 1M34B 2R1TB 2ZIAA 1BQEA 1CP3A 1D2GA 1JFFA 1ICIA 1LPMA 2UYQA 2VNSA 3CF0A 1O6GA 3FDXA 4PNZA 2X2FA 4Q9JA 2X0FA 5IEBA 4DGQA 2Z0MA 3MINB 1DLIA 2E1PA 4PANA 4RFSB 4NMXB 4XR4A 1D1QA 4EEZA 5HS4A 3FJYA 2FWPA 3C6XA 1L4EA 1N6NA 3ZXXA 1NBMA 1VKRA 1DXYA 2QU8A 4TZKA 1HFKA 1Z73A 4RHYA 1XAHA 4UXIA 1M7HA 1YKFA 1L7VC 2IEGA 3QNMA 5I51A 2G4VA 1VLQA 1RWBA 4DQ0A 1G4UR 1NMZA 2H54A 1EAMA 3I1YA 4EG8A 2WPNA 4NJEB 5JNLA 3EY9A 1GCOA 1HMYA 2E82A 2FE4A 3EPHA 4WZBE 3HPRA 4LDQA 4OA5A 1E7SA 3MXTA 3THWA 1U31A 4RTPA 1E79A 1H9CA 2PCJA 1MW8X 3RADC 5IT9A 3ZCQA 2HF2A 2R65A 5KNBA 1ZS9A 4PPNA 4WLUA 4Q3OA 3U7GA 2I9KA 4W7HA 1NVWQ 4BXOA 1M74A 3BSFA 3RKRA 1DDGA 5E4JA 4AY5A 4E1AA 2V74B 2X9NA 2XAAA 1YVRA 3B48A 4PRYA 2CFRA 4ADSG 2EKPA 5KPDA 4NNJA 1OAOA 4Y2YA 3AR5A 1SCAA 2ZG6A 4AUNA 1TI7A 3HXMA 3L8GA 2C9CA 1T3TA 2A30A 2L17A 1PEDA 3NHLA 4EITA 5IDWA 4CFZA 2EJTA 1PNQA 4GMXA 5G4LA 2NU8A 3WRYC 3ZN2A 2BMJA 3PUZA 2IDJA 4XQ9A 3ZNNA 2F1JA 2QTGA 3FUVA 3H86A 2IF2A 1N6RA 4C05A 2QSYA 3TGPA 2J45A 2JAPA 3CUTA 4N01A 2GTIA 4BP3A 1G0OA 1QHGA 1N1DA 2NZ2A 5JIBA 2EW2A 3PDUA 3AUTA 4C0AC 1VC2A 1GYQA 3CUEF 4ENSA 1GUYA 3EXFA 4GPD1 2CEKA 4BYGA 5F7ZA 1QGZA 1G5PA 5AJHA 5JALA 3RTCA 1TC2A 3K4PA 2XZDA 1MDFA 4GZ6A 1L8OA 3UN1A 3DBHB 2AZ4A 2AA3A 4FZRA 4H27A 4IINA 3I9KA 4FJ2A 2ECQA 4F92B 4P3NA 4YJ3F 3ZX5A 2P5TB 3FYCA 5ALLA 2PXCA 1BZYA 4RHCA 3UJ9A 3R7BA 1XF1A 4M99A 4UHKA 4WCDA 4ARVA 4C03A 2WJ4A 4UATA 4ZZ2A 2OO3A 1CUAA 2DF8A 2C04A 5G0VA 3SJUA 4UNPA 3LVFO 5ALTA 2FPXA 2NO7A 3ROQA 1CY8A 1XDWA 3LT1A 4RHXA 3C16C 4NOLA 5L3VA 2VDRB 1T1RA 5AM3A 1SVKA 5C5DA 2IQIA 4UHHA 2VDOB 1NZJA 2W2MA 3IDZA 4JC5A 5LA6F 3PUXA 5B3LA 2R0QC 1QPZA 5ER6A 3KSDO 3G13A 1Y1QA 3O74A 4KXUA 3D0QA 2LNDA 3WKDA 3GNTA 2HHJA 2BGWA 1CDOA 1Z0JA 3ITNA 4LOAA 5IJ9B 1UC4B 1WBJB 1XU4A 1DEXA 5TGZA 4MS3B 1AGPA 2BY4A 3X1XA 5I4KA 1AMNA 4FMPA 4OY3A 1QO0A 3G8DA 2BBOA 1UZLA 1HT1E 2OVFA 2CDAA 2C9DA 2RGUA 2C2KA 4I55B 4JQOA 1QYRA 3NEAA 3BTUA 4MTCA 9ATCA 4O59O 1JZSA 3M5CA 1O0SA 3A9TA 1QWSA 3MYYA 4CCYA 4H0NA 1ZD5A 4DA4A 1F8XA 1K75A 1GA1A 1NR7A 2A2ZA 4C5CA 4PAGA 1FRVA 1M2KA 3G1WA 4GXRA 5F3WB 3RLFA 1X2EA 4D4IA 1VI6A 1K7FB 4NDZA 2Z2KA 3KEGA 2VDMB 3UQZA 1EA5A 4MV3A 4NBUA 2PKYX 4D57A 3QENA 3C6MA 4NXNB 1T1GA 9ABPA 1GTJ1 5E7JA 4B81A 1ZICA 3T7JA 1W2WB 2HIAA 1Y4SA 1YK1A 1GSIA 2JVIA 2W58A 4IVQA 2I22A 4O2LA 3SHTA 1VG8A 2CWDA 3A4IA 4E51A 5DOVA 5FPPA 4DABA 5DNYB 3GMSA 5INTA 4O2AB 4QELA 2GKSA 4E5DA 1O96B 3BJRA 2GRUA 1UR5A 2WUVA 1WDMA 3Q8WA 5ILGA 5B3JC 1YZQA 1GUZA 1WUKS 2G17A 3GJ6A 3ESYA 3ZTTA 2XXAA 2PQ0A 3K1ZA 2A4MA 4HLQB 4NOJA 3HCCA 4MGZR 5EJ7A 1WCXA 2W6IA 2V7UA 4DBLC 4MHTA 3PTLA 3TXYA 3UJ7A 4DLZA 2O2EA 2QX7A 4O3MA 4J16A 1AHIA 2YH2A 2AOTB 1EPUA 2C95A 1P80A 2HOQA 4WINA 1VSBA 1FB5A 2Q8PA 2WPDD 3TTVA 2WSBA 4NBTA 1LBHA 1LLUA 4HYQA 3W9UA 3NHYA 3TLJA 1F0NA 1TRKA 2N47A 3F9RA 1LA2A 1O6BA 4EY3A 2FP4A 1M6WA 5I7VA 4RXUA 4FZVA 4YI5A 4RVFA 4WLFA 3VR4D 1ISIA 2GM9A 3STXA 3HTXA 3GCGA 4RIGA 2Z4TA 8ABPA 1QGUB 1PR9A 4I08A 3SS8A 3S0JA 4TVSA 2W4QA 1W2HA 2F67A 2FXIA 3AO0B 3ANXA 3HDJA 4KPGA 2O5EA 4NH0A 2GAJA 1WPGA 2FZWA 2ZB3A 3H5OA 5TXGA 1KDVA 4OBWA 4FFMA 1J9EA 3NHAA 2IS2A 4O4IA 1JH8A 3DB1A 1VLJA 2DH5A 3C6BA 4KQCA 1LSOA 2FFQA 1BTOA 2HLDA 4L73A 3KPWA 4N5NA 3INGA 2A9OA 1J0AA 1SOAA 1TK9A 4DIKA 1GZDA 4DMMA 2EDCA 3DBRB 1QHHA 3GAMA 2KI5A 4MV7A 1IPEA 1YRLA 2KM1A 2NO6A 3RU7A 6REQA 2CXOA 2YDYA 2ZBFA 3IUMA 2AXEA 2AJBA 3PNOA 4DMLA 2I3ZA 1GUBA 2R8YA 3KX2A 4HNAB 2OENG 3L8DA 4M89A 3FH0A 2BJWA 3HY4A 2J9ZB 3JZDA 4NLLA 3D4OA 1N5OX 4RK5A 3WWZA 4E32A 2ISSD 5CA0F 1T8SA 1VL6A 2YZGA 1E3DA 2BCEA 3UCFA 1FVFA 3ANMA 3FUXA 1DLJA 3VR6A 5K6AC 1OV4A 1CZOA 1Z2DA 2N42A 3QIVA 4MIOA 4DN6A 3PGMA 4GLJA 4H1UA 3B1JA 5AXDA 3QG1A 1BWSA 1R4ZA 4B6QA 2ZUBA 1W73A 2G5TA 5L4SA 3EVFA 5F5LA 2AX4A 4AJ2A 2BM0A 3AVTA 4G07A 2HEIA 3NHPA 4D80A 3KV3O 2GNAA 1A7AA 2MIIA 3FWHA 3R0ZA 4MYCA 2BLNA 1DRWA 5CITA 3IR7A 4J49A 5DHUA 1Q1EA 1D1TA 3ETJA 3FXAA 3QKTA 2GYWA 3TDMA 3L18A 1V2GA 4FEYA 2PKRA 2ZS8A 2DT8A 1FFEA 3G88A 3E18A 2OAP1 3EDMA 3LQRA 3QVKA 3A0UA 4OQEA 4BB5A 1B8PA 1DIRA 4EHJA 4M0EA 4EY7A 2FRDC 3FYUC 2IL1A 2XUIA 3I12A 1FNCA 3K0AB 4WZAA 4BMSA 5JWOA 1QG0A 1U3GA 2AEEA 2QX4A 2R5WA 3WLTA 2IS4A 5FUMA 3T5DA 4LF7B 1JRLA 2WDZA 4UREA 1MOZA 2HDOA 3U2QA 5K3FB 5K5EA 4W5OA 3O8QA 4I2VA 4JYMA 1EJ2A 5ICSA 4V3BA 2JARA 4Q9AA 1L4GA 1M0SA 1STOA 2VPIA 4U9IS 1EQAA 2I2BA 1J0CA 2VF7A 1RM0A 2VJMB 4NJOA 2HCRA 2XOKA 3ABIA 5DYGA 3A7DA 3C15C 1XQ1A 3LC2O 5J40A 1O5TA 3GJXC 1UKYA 1MO4A 2MCFA 4Q66C 5AESA 3O90A 3VYTB 1J8MF 4UUOA 2DWQA 5E3JA 3UB2A 1R0YA 1CZNA 3KCQA 2PJUA 4DWJA 2DX7A 3CTPA 4M60A 5F76A 1CY7A 3GBPA 2JJMA 5F4ZA 1QFYA 2YHSA 1ID1A 1QCDA 2B61A 2YFYA 5K6RA 3EVNA 4QYIA 1AKMA 1VHLA 3HFJA 4JK3A 3F4BA 1DWOA 2PX0A 4IJVA 4BNVA 5JV5A 3ZGVA 5ADUS 1LBIA 3OIUA 2RB4A 4K46A 1DQNA 1R1DA 4JDPA 1VG9B 3GRPA 3KLBA 1DKQA 4RFVA 3T06B 1KMHA 4LAFA 2VZ0A 4RA6B 4AIRA 5MHTA 1O5IA 1PJAA 4L08A 4PXSA 5FNVA 3VH1A 4YLYA 2ZI4A 5EFOA 4YT2A 1UFVA 1YR6A 2E48A 5FA8A 2C2ZA 1D07A 3A6HA 2E18A 3I9OA 2P27A 2OYCA 1ILWA 5CFQA 3B7WA 3WGKA 3S5UA 3OFNA 2DG2A 1U0OC 4DDHA 3IEMA 1XA4A 1WWKA 2Y05A 3PFWO 1P60A 4YAEA 4GM4A 2WW8A 5U4XA 3STYA 2UXBB 1YBFA 4U2DA 3FNGA 2QE7A 2ZVJA 2J59A 1F7UA 1BFDA 1Z18A 3HJHA 1N32B 4G5GA 2I2CA 3P9KA 5I9BA 4BO9A 3N05A 1IBSA 1T9CA 2Q46A 2R9VA 4HRVA 1OIXA 1ML3A 2C4KA 3LUGA 4PG5A 1TF5A 3FGPA 3N8KA 4G0UA 3GMIA 4ZOLF 3VR1A 1WAMA 4NC9A 5BURA 5KQPA 3CPEA 2J7PD 3QLUC 4RF5A 3HHPA 2ES4A 4GF5A 4RH1A 1MA3A 2L82A 2VA8A 1PJTA 3HZHA 1S8FA 2XE8A 4N47A 4ALLA 4DZRA 5CFMA 4NWIA 5FKJA 4D96A 1JBEA 4PZUA 5BQPA 4CFSA 4XVUA 2JFGA 4II7A 5DLYA 3EPKA 2O5CA 3QE2A 1MGPA 4XM2A 3G1UA 2ZW9A 4WK2B 2R8ZA 2PZGA 3WLKX 2VDNB 3OTIA 4PYIA 1UADA 3BE4A 4DCMA 2I99A 1PS8A 2C94A 4G25A 3K70B 4GL4A 1JPNA 2VWQA 3R3HA 3OU6A 5GV7A 4FILA 5AKIA 3LUJA 1NI3A 2GZ1A 1PL0A 1QC5A 2A35A 4MZXA 4NPHA 3WIDA 1COWA 1Z9BA 3TZCA 1UPBA 2FUKA 2ZREA 1CP2A 1ZM3A 2OCYC 5ICCA 4Y30A 4XUGB 3K5IA 1WUHS 1GZ7A 1RWOA 1KMQA 2CFSA 2CLDX 1SQ0A 3KR2A 4O0MA 4P80A 3W06A 2ZTHA 3SJBA 4ZEOA 3U3MA 5H59A 1KZ1A 1PN3A 4P36A 3JQ8A 1BMQA 3CUYA 1FUEA 2XHEA 5DNEA 3MOIA 2AN1A 4LHYA 3EE6A 2WYUA 3BBLA 2FSUA 4ZQFA 4PQEA 3TCNA 1EXWA 5K0TA 4U00A 1O9GA 4LRUA 4RL6A 2W42A 5LXTA 4Z4EA 1RPJA 3RS0A 2AK3A 2BFDB 3TL6A 3WQQA 4WK6A 5A7HA 1A71A 3KR0A 4ND8A 2QYOA 4KDRA 2I0FA 1NBWB 1PFUA 3AF2A 4IZHA 5F2OA 2VTKA 3DSRA 3BJZA 5A3SA 4JI8B 1I5RA 3WWEA 4WUTA 1GY8A 4Z7JA 4N41A 4MAMA 4I50B 1Q0RA 4TMWA 3IDQA 4G0NA 2VS1A 4HGQA 2B4AA 2G82A 1P7YA 3DCNA 3J7AC 1B76A 2KW5A 3UMFA 3EA0A 5JW6A 3ZVNA 3F1KA 5AI0A 3KFLA 5K7SA 2Q1YA 4UCWA 4G1FA 4IGAA 4AF8A 2QDKA 4JI3B 2PMBA 1YJ8A 2IPXA 3OHPA 1UZAA 3T5BA 3WYNA 2UZIR 3FZGA 4ZHQF 1LC0A 2ZRGA 1N36B 5AW2A 2EC5A 4KXLA 4FI3C 1ZQ9A 3M9LA 3TZEA 5ED0A 3EX7C 1EVEA 1XJ5A 1R15A 3PEEA 1K4YA 1SPXA 1BG6A 1XHLA 4L5AA 1ZM9A 3FWKA 2IE8A 4FYMA 4ZRDA 1ZNXA 4BNFA 1QLWA 1KGSA 1OILA 3KT3A 1P2UA 1D2NA 2GNOA 4FYIA 1GAJA 1QRDA 3THXB 2WWFA 2HPZA 3X44A 4Z8XA 2AFHB 3N74A 3USCS 5JD4A 1PR6A 4G84A 3L07A 1IQPA 1OGIA 4GLBA 3WGTA 4F8EA 4IDDA 1RPNA 3DQQA 5FOTA 3RG8A 2EGHA 4JBLA 1BKSB 5I8WA 3BD8A 5IZCA 2E4UA 2PGAA 5CA1F 2IRWA 1C8VB 4IRXA 4YAIA 4RMJA 1M6NA 2BEWB 2ZT8A 4OQXA 4WVFA 3RFTA 4MW4A 3VPFA 2WB4A 2WJZB 2X40A 2ZR0A 2P2ZA 5BMOA 4XASA 3MTEA 2I6QA 5FV7A 3S40A 1RC8A 1EUDA 3LQ4A 3OOYA 1TIKA 3CZ5A 1C41A 3O3CA 1ZH2A 3DFZA 3RFCA 4D0LB 5JJBA 3ZDBA 4ND4A 1R6VA 3EAQA 3HFGA 4RJ2A 5AFSA 1X15A 3HHEA 3GEBA 3AI3A 4RZXA 3ZZTA 1UDWA 3OFJA 4LI0A 4QLBA 2P9FA 5J43A 1E7WA 1RKUA 1YKSA 1ACMA 3EXHC 4JFAA 3SGLA 4QOGA 5B4UA 4TWBA 4BVEA 2WG2A 4LYFA 5I7WA 3EPLA 1CR2A 1B0ZA 3ONDA 4KN5A 1JAXA 3FKJA 3DOUA 4WHMA 3RJZA 1EP3B 1EFHA 4KSBA 2P30A 4K03A 5DZSA 3RUEA 1TU3A 5LNK6 4K6CA 1K86A 3DKIA 5AQEA 1C1DA 1YZKA 2JEZA 4PC6A 2XZTA 4PLPA 4ARSA 2WMYA 1PGJA 2WUGA 2YYYA 1XMIA 1ZJ5A 4E5NA 5KKNB 5C1IA 2WWXA 5EP4A 1XQWA 3NW9A 2XEDA 1E8MA 4B44A 2H08A 3PB3A 4H59A 2GSDA 3OY2A 2JHAA 4L9AA 3OPYA 3G9TA 1FP2A 2BEKA 5DU2A 2RHTA 2F8TA 3BMCA 3QKSB 4GS5A 3C87A 2I9PA 5A71A 1BNCA 3Q7IA 1JDVA 1Z2CA 1TK2A 3QJYA 2WT4A 2Y4NA 2G0NA 4IQ4A 1TE2A 1X2BA 4XM1A 3KHUA 3IVCA 2HV8A 5T5QA 5DIFA 3LP6A 4JS0A 3WVNA 5IFKA 1V6CA 2F3UA 3IUBA 1DFGA 3C98A 1GDTA 1ACLA 3PJRA 2AKEA 1YOVA 3NIFB 4PPYA 4U9HS 2IP2A 1M6VA 2NUBA 2IZ6A 3DHNA 3PL1A 2Q7XA 3UJDA 3OCCA 3ZS8A 1NVVR 1AUVA 3NKLA 4DA6A 5AYVA 4R2IA 1M54A 1T2AA 3PICA 1AY0A 3D3EA 5E1MA 1Y9AA 3GLKA 5BN3B 1J8FA 3BIWA 3OHSX 4NULA 3ZCRA 4PLFA 3U3OA 1QYWA 1SUEA 2XUQA 2GF0A 3A6EA 5HZKA 3BH6A 2XQKA 3H7AA 2QUBA 3O1HB 3SYTA 1UKCA 3KQKA 2L18A 5ALJA 2PGOA 2BBTA 1C50A 1OXKB 2I8CA 3DV0A 4ZCIA 3LVQE 4J75A 3PRKE 3GD7A 1A9RA 4FD2A 2OBYA 1O08A 4DSZA 3COZA 4PN7A 4YWHA 2QQGA 3OY7A 2H06A 3HGMA 6YASA 2DLNA 3OLCX 4TUYA 3WYBA 2QAGA 2ODWA 4BMXA 3R5FA 2JGJA 2PLAA 4QIHA 1DMSA 7GPBA 1FMTA 5FBHA 3ZTYA 5JY1A 4PYOA 2J9GA 1GAXA 4K9QA 4YCLA 5LSAA 2PPLA 5B7NA 2EXXA 5BNIA 1DRUA 1E4OA 6ADHA 1JFLA 2HA5A 3KYIB 4ZU3A 4JHXA 2XXBA 1M0TA 4MKXA 4WLEA 5LR6A 4MDFA 2I91A 1E2UA 4QXAA 4RPGA 2OHHA 2Q1WA 1AQJA 3T1YB 4JYAB 4AURA 4AJEA 3FPBA 3LHDA 4M88A 3K9LA 1ZNQO 5D00A 1NA5A 1RM5A 4R3NA 3ZOKA 1FLAA 2YV4A 1E9VA 2XSZD 1ZXBA 2OK7A 4IF6A 1ULHA 4JBNA 4NE9A 4ZCLA 4CZ2A 2IHUA 4B9EA 1J22A 5JQGB 3HN6A 3GQBB 1F0KA 2ZU6A 5K0NA 3ZHUA 1LDEA 4XCXA 1BVRA 1LDNA 1W76A 2HNBA 2IX9A 2X23A 4OU4A 5EJMA 4CQMB 6NULA 3A9SA 5ALZA 4OYHA 4XIJA 4CKCB 3H8JA 4RQBA 3V4VB 5DF1A 3PRJA 1Z2PX 3QVSA 1ENPA 3TOCA 4EPTA 5BOSB 3FLBA 5C4GB 3VNBA 3B7GA 3ER6A 3RFXA 3G17A 5YASA 5LZ9A 3KQNA 5DULA 1CUUA 5KYYA 2F3PA 4YXFA 2H6EA 3QVGB 3IDSA 3MCAA 1NP6A 3GI1A 3OQ6A 3LX8A 3QE4A 4IEEA 1M1NB 1H6DA 5FXMA 2X5JO 3H04A 1TVCA 1FOEB 1X7XB 3QELB 2Q7OE 3UJBA 4QFMA 5JPCA 3ERCA 4DR6B 3O3OB 4G2TA 4UM9D 1A8UA 5FUWA 3RAEC 2H85A 1FUYB 4XSGA 2YCLA 1SOUA 1ZITA 2RC6A 4FMCF 1G5HA 4DRXB 2D5IA 1ODIA 5CB4B 3T9DA 5DBGA 4DMKA 1RCTE 4WW0A 5CDFA 1G4AE 3HBNA 4P81A 4B40A 1BQ3A 2I4LA 3KPUA 3ZY4A 3A6PC 2XITA 2IXAA 3M7IA 3O5AA 5EXTA 5KMGB 5EPEA 2GM4A 1JJBA 1CYDA 2DWPA 1DO0A 4DLSA 3EXEA 4UTVA 3PNQA 2EP8A 1VHDA 1EHYA 3HXQA 3ECCA 3EGOA 3DAPA 4AWAA 3I5MA 3R6DA 2ZQYA 2VHZA 3MCVA 4BLSA 3L82B 1VLHA 4O6VA 4BMZA 2XMSA 3L4JA 5DSZA 1AGYA 3C6KA 3PCTA 4YECA 1M2JA 3EOZA 3K6JA 5LZ7A 1Z29A 1P74A 2W2KA 1XD2A 2X8AA 4RIIA 4UQLA 5AI4A 4HWPA 2I67A 1TYEB 1DSSG 4FHZA 3KOZA 2QLJA 4IXMA 4UE3S 1WSWA 2BJHA 1H22A 5TEVA 4AZTA 4C0XA 2YNMD 3GQVA 4ZO6A 2G88A 4X61A 4B8ZA 2FMTA 1Y6JA 1OD6A 3P52A 3AERA 2DFLA 2C7GA 2VBFA 4A8JB 3AETA 1SN7A 5I8PA 2OV1A 2O8BB 3FRJA 1M6YA 3QK7A 2BE7A 1HQCA 2WAYA 1O97C 1R0LA 3R75A 1DARA 1IRIA 3OFVA 4JJIA 2YOFA 1KFKB 2VOJA 2A88A 4JEIA 1U8UA 3VU9A 3AJ9A 1BROA 1JDZA 1F8FA 2I7XA 3AR2A 1DKOA 1UP7A 3N8HA 4K9RA 5K3OA 1VSUA 1E6KA 4WOJA 2BONA 3TL2A 3VX4A 5CIWA 4EVSA 5BSEA 5C8DA 3KK0A 4XDYA 1UT5A 2ODTX 5JY6A 1XLTA 3UT5A 1SQGA 4HC4A 4KXNA 3R74A 5DO9A 4A0RA 3WKCA 2GDJA 4S05A 3LX4A 4X66B 2VQSA 3FR8A 4R2HA 4M1OA 2X0IA 4QG3A 4R1MA 2VDJA 4D5GA 1QV7A 2IYVA 1FW6A 1M1UA 2Q9BA 3DP9A 4LJ6A 1ECCA 4LJ9A 3SEQA 1B8NA 1DB3A 1N2IA 1Y6GA 2VQDA 2HK7A 3O92A 2VQ6A 4JEMA 4Q7JB 1CZLA 1K7EB 3AUUA 2PZFA 3ORQA 1E1MA 4I9UA 2WTUA 3WYGA 1KU0A 2AJ8A 4FUQA 4NI5A 4AM8A 2A3NA 4TLDA 5DTJA 2FPGB 1E60A 2CB9A 3LE8A 4KI0A 4YJKA 5H8WA 2DT5A 4DV1B 1H8HD 4MGHA 4ER0A 1TECE 3MJRA 4P7JA 1FF9A 2IYQA 1JPUA 1L4HA 5JRJA 4LDPA 1N5JA 4Q18A 4OQMA 5EJGA 4MW0A 2P9JA 5D2CA 5EKXA 2MSEB 3ZJ4A 4MZDA 1DXQA 5IAGA 3ZG6A 2DB3A 5A6SA 3DA8A 4J3FA 3JWJA 5H3LA 4DB2A 3JYLA 1Y5LA 2A8YA 4KIGA 4NYJQ 1YR1A 4A10A 4DYDA 1ZEMA 3V3KA 3ZHSA 2JCSA 1N25A 2EBHX 4L5YA 3HFSA 2F1IA 3ABSB 4MUBA 2DXIA 3LXXA 2J4FA 3CW2A 4IGFA 3CKLA 4H0FA 5K3CA 2R4TA 5AIBA 3X1ZA 1W8DA 4US2R 2IY7A 3W9BA 1VYUA 3EIQA 4P08A 2D2VA 3NOQA 4D46A 1RKQA 3DQZA 3NM4A 3SF0A 3KQSA 1QIGA 4DR2B 4WBNB 3FKQA 3TRIA 4ARZA 1ZUHA 1UPUA 1XK7A 2JGMA 2PR7A 1I1HA 3E05A 3EMKA 1W29A 1CR6A 1DC5A 1SVIA 3KDAA 4LSMA 4ZXFA 1K63A 1Z7GA 2FRVA 1SA0A 3EFBA 1VE7A 2HU8A 1VBNA 3BXOA 3L0ZA 4CM7A 2XZLA 4A92A 2ADOA 3MMSA 3MS4A 3RYTC 1SQ6A 1G6Q1 3TOSA 4J0QA 5JSFA 3H2HA 2AFIE 1LLDA 1JI0A 1O94D 1P8JA 4RNCA 1PJLA 2Q5CA 3CQ9A 3SZOA 4D8YA 3PA6A 2H92A 4GOOD 1CEEA 3GT3A 1U1EA 1AKUA 2C5EA 1G21A 4A0SA 4BLRA 3NORA 3AINA 5LBIA 4A8TA 3M3DA 4YHHB 1XEXA 1FK8A 1IM8A 3DQPA 2GPJA 4M98A 3GJYA 3PC8A 4MPPA 3EF1A 2KQUA 2X77A 1K0UA 5AOBA 1VZ2A 2WD8A 4PYRA 3IQWA 3LDFA 2R1ZA 3NATA 4X62B 5FOWA 1EX6A 2DWOA 2ORIA 4G81A 2BFCB 2DFNA 1BXRA 5HVNA 3GYBA 4CMBA 4EP1A 1FYVA 3DDSA 2O7QA 2VRBA 4PIVA 4YQEA 1UXIA 5IT4A 2Z2XA 1UP4A 3MWKA 3P20A 2LBPA 4N49A 4EFDA 2B1JA 3FOWA 3DUFB 4B7ZA 1VE5A 4FNMA 3SE7A 4GI7A 5HG0A 3F8SA 1JYSA 1Q92A 1G5FA 1HTTA 5LWHA 2I66A 2QT0A 4KIUA 1QP7A 1GU1A 1Z17A 1JDBC 1KI4A 3Q6NA 5IAKA 2ZYWX 1RXIA 3EF0A 3R40A 3S99A 1RDFA 2QVGA 3K6KA 3ZLUA 2AOUA 2NVBA 4ZD6A 2RHHA 5BT8A 3IPLA 2CZQA 4WKGA 4BASA 4B85A 1JQDA 1VL5A 2CNDA 3JQDA 4I1OA 1PJZA 4TV9F 2QVXX 2Y0DA 3LOQA 4IZ6A 3RC8A 4ARCA 4DV0B 5KCMA 2HR1A 2QTLA 5JJCA 5A0TA 3WGNA 1QPGA 3VAYA 3EASA 4Y3UA 4E22A 4TYYA 1TZCA 5COBA 4WESA 2SKEA 1MAWA 1SM4A 1Y8RB 2WM2A 1IE3A 1U3DA 2LWIA 1V0JA 1XP8A 2ZWOA 3C1OA 4M0DA 1NVAA 3OBIA 4X6LA 3WBFA 3R7DA 4ZOEA 4MQEB 3G2OA 4KVZA 4QXPA 1MPXA 4YRSA 1T9AA 1B3RA 3THYA 2X5XA 4E30A 2X15A 4DL9A 4QT0A 2RJNA 3QF4A 1ZLXA 1QUFA 4Q3BA 3OSZA 1MCZA 2G5PA 1LW7A 4RENA 3B53X 4AZWA 4E2XA 5KX5B 5JHGB 1RT9A 2Z1DA 3H83A 1GZ3A 4ZO4A 2WJ6A 4G4JA 1RW4A 4LYEA 3WJ7A 5EAIA 4DIUA 3H9QA 1Z5WA 3EUFA 2Z1NA 4L15A 4TTPA 2VSXA 3IODA 3FFBA 3GFSA 5KYNA 3NANA 4C78A 3AESA 1H0KA 3NIWA 3NNSA 3PXGA 4EYSA 3OSUA 5CPBA 4MKFA 4OSPA 5B7GA 2E37A 4DKJA 3DT6A 5IJAA 1QU2A 2BFFB 3NV9A 3ORRA 2IPOA 1OTXA 2H1WA 4W8GA 4L27A 3F9IA 5BSFA 1P1BA 1Q1BA 3CN9A 1BU5A 2YMLA 4K9SA 4MIKA 2CE2X 2Q5LA 4UDXX 1I2AA 1W19A 3AG5A 5F2KA 3EGEA 4XX0A 3RT9A 1EWQA 3U7FB 3BXEA 3OZGA 1HBJA 5CW2A 4JP5A 2DR3A 3HGTA 2CUZA 5ICGA 3I04A 3IELA 1NN0A 3ENNA 1EJ0A 1EXDA 1YZUA 3C74A 1OAOC 3Q3VA 1IVYA 3FNBA 4O1HA 4M9UA 1L8AA 2NN3C 2AYZA 4Q00A 2FAXA 1JG2A 2CUTA 2AC4A 1CHDA 3CNEA 4N9QA 5K51A 1ZGCA 3OEED 4KO1S 1EWTA 3RJMA 1Z0SA 1U0TA 3GUZA 3L05A 3NXSA 3N58A 5ANRB 3V6LA 3DLIA 4IXNA 3T9CA 2AQHA 1EJ6A 2IUSA 3GH3A 2A86A 3KDPA 1JN0A 1JEOA 3TW0A 3O4HA 3H9CA 2CKMA 1WCYA 3KKEA 4OMDA 2HXGA 4ZO9A 4NZYA 2C2BA 2X3UA 2CN1A 4I1YA 1KDZA 3DGFC 3DM5A 3IE0A 2VTDA 1SCUA 3WTBA 1XTBA 1T13A 3F6EX 3MF4A 3DNPA 3CONA 1I10A 2Y1WA 3ZQ4A 4C06A 1XHFA 2QU7A 1THGA 1FSFA 1J42A 3OJLA 2P5SA 1YCDA 1EU1A 3W1EA 5EIFA 3MXOA 2BTOA 3THOA 3WIUA 1U1CA 2ZSUA 4KR7A 2P3SA 3HDVA 3D8BA 4UFOA 5JD3A 3ROMA 3DTVB 4ZI7F 3WC4A 1IN7A 4C0LA 1WXGA 3GLTA 3LLMA 1VMKA 4X8MA 3GUCA 1GFSA 3BD6A 4KE7A 3TD6A 3D4BA 3EB9A 4RD4A 4CMIB 3LH5A 2ZZKA 1ONOA 5CX1B 5DM4A 5KOHA 3H16A 4KQHA 3IB6A 2Q4RA 4O63O 4US1R 5E9AA 1Z6PA 3ZW9A 3JWEA 4MGIR 1C9MA 2V5VA 3I2FA 2YXDA 4MWTA 2FEKA 1O8BA 1Q16A 4B73A 4GZ5A 2WG0A 2P9QA 1V3QE 2PS3A 5JH7F 5C1PA 5KDDA 4WA7A 5ALWA 5KUTA 2W2PA 1DIHA 3P0RA 4D4HA 5EQDA 5EJ6A 2XH8A 3R2JA 3AVPA 1T9GR 2IYAA 3C6QA 3JWPA 5J1SB 1TZKA 4EMBA 1UT6A 3QMWA 3BHNA 1OWNA 1T15A 4YQFA 2HBZA 5JVDF 2WAOA 3ZDXB 4FYYA 1ATZA 1FDVA 4E2WA 3HV2A 4DDMA 3N6RA 4PIMA 5AT1A 4Y6GB 3ADBA 4E4TA 1MZVA 2V4UA 4KQ2A 2HHCA 2PGIA 1P7VA 4BN0A 4OHWA 4QGBA 1M8KA 3DEYX 2QUZA 4HAWA 4JOSA 3RW9A 4EVIA 1KK2A 4D45A 4F11A 3HJAA 3P0JA 5ERXA 3CY6A 3GLFA 4MQUA 1XMVA 1YMUA 1JALA 3FN4A 3GHYA 4MYUA 1MX1A 3AEKA 4DUGD 1WXHA 1XU9A 4UD6A 2P9HA 2F1KA 3QJ5A 5FNVF 2XAUA 1ZQ1A 1EQUA 4V2UA 5L3QB 1BW9B 1FNDA 1P75A 2HTFA 3QFTA 1HK7A 5KYGA 4R0MA 4Y9DA 3AW9A 1KFCB 4QG7A 4LOJA 3RIMA 4F5YA 5KYWB 4XTRA 3UK0A 3DFMA 1X1CA 2H2WA 2A5DA 1E1CA 3CUUA 4DLXA 2JJ1D 2ZSAA 4IMJB 4DLLA 5KOJB 1VIAA 5DLEA 5LC1A 2M6SA 2G06A 3U7HB 4MLCA 1JEYA 1A9ZA 3GK3A 4KGVA 4KKVA 1MQSA 4UBLA 4UTRA 3L4SO 4QYWA 1BHSA 1FS5A 5ECDA 3PGA1 2GCGA 2G1KA 2RKOA 3EXAA 3LCVB 3PFIA 5CHYA 4CQMD 1U7HA 1Y37A 1KU6A 1NR5A 1J00A 2EP7A 3AY0A 1HWYA 1ZM7A 2JFFA 3LY5A 4LI3X 1UQUA 1PBNA 3DNFA 3UHPA 3X1DA 5KVAA 1XQ9A 3AV0B 4ZVQA 1E2GA 5BRAA 4TYNA 3UV3A 3BSSA 4ZI7B 4XD7A 4Q1CA 5EMNA 2B30A 3F46A 2XTAA 4U7FA 4MVJG 4XVCA 4YJ2B 4B6GA 3JWGA 3PZBA 4GUDA 4II2A 1K6JA 2PUFA 5IH3A 1DC7A 3O8OA 4EM6A 3L77A 4J16C 2BH9A 3J80A 1VMAA 3A4VA 3CG4A 3FCUB 4MVJM 2EJVA 4MWBA 4UDOA 5E7QA 4TV8F 3OZVA 2H00A 3NWJA 1EFRA 2CF6A 5EIAA 3W6ZA 2I3AA 1BRTA 4FC7A 3L1JA 2Q6IA 1WU8A 3SPXA 3G0GA 1R66A 3HU5A 3SSAA 1GAQA 2VEDA 1EP1B 1XRNA 3KAQA 2E4VA 3ET4A 2CXSA 4YPFA 3WADA 3WZ2A 3F6CA 4JI4B 4II3A 5AK6A 4B84A 2CGEA 4FD3A 2EVWX 5K2MA 5DWVA 2GK4A 4U2BA 3PT9A 2Z8YA 4C20A 1GHTA 1NGSA 3O26A 4BV9A 1SBIA 4ZOAA 2Q2QA 5I9IA 1KYQA 1VHJA 2IYYA 2UVDA 4CM9A 3WKAA 1NN1A 1T4DA 3CLSD 3ML1A 1WJGA 2V7QA 3EYAA 1DG9A 3IPXA 4G8DA 4IIDA 2ZT7A 3H5IA 5K0CA 1GCAA 2DKNA 3SBEA 2NYRA 3CPHA 3MWGA 2RJ3A 4FZ5A 1VPTA 3U6KA 4EAQA 3IQHX 1JR3A 1C7EA 4L6IA 2H9AA 1K98A 2I55A 3U3XA 2NZUG 4K0KB 3QKRB 4QDXA 2WM9B 4BEJA 2VXYA 3D02A 1OX5A 3DEIA 2QG4A 3GBSA 4FX2A 3FLEA 1UMBB 4YI3A 1XVUA 1PJ3A 3SHWA 4DLPA 1QK3A 1WQ1R 2C4UA 2GHQA 1OKKD 1QB8A 4NATA 4QGGA 3TQTA 2OY0A 4LSZA 1F2TA 4LHXA 1YDMA 3RVRA 1LK5A 1YUNA 1P4SA 4B74A 3CH6A 4AMZA 1JU9A 1IHPA 2X7HA 2HIGA 3NRBA 2F43B 4GQBA 4ZAZA 5GZ6A 1WXXA 4RPCA 3KJZA 2OFFA 1P0FA 5DGIA 1XXHE 3I30X 5BVHB 2PAAA 2XD9A 5HCIA 1N6LA 2GVNA 3T1NA 3UT6A 3D4NA 1O9BA 2CXTA 4GZLA 3MJ4A 3U4MA 1R0KA 1YFJA 3REQB 1OI2A 1TF2A 1QE5A 2O2DA 4J2OA 1RI4A 2QXYA 3EIHA 3VYVA 5JUWA 1CQIB 4P7GA 5A9SA 1Z8HA 4P0QB 1JB9A 1Z45A 3H2GA 1L5LA 1NUQA 1YB5A 1K92A 2PSFA 2YV2A 3ECSA 1AKQA 2O3JA 5KYKA 3H5RA 4E5VA 3RNOA 3RWOA 3T38A 4WQMA 1Z37A 3WIBA 4DM4A 2MT9A 5IPFA 1J2YA 3DVAA 2IZOA 1R4NB 1T9KA 1HE2A 3I2JA 4GEGA 4UW9A 4YCJA 3VOSA 3I62A 1NUUA 5C53B 1DINA 2PKEA 3C3JA 3DOOA 2FEXA 3HKDA 3MTBA 4RTMA 2Y1CA 4IKEA 4Y2PA 3U7JA 2BFWA 2RI0A 3AOEA 5E6UA 4KNWA 2WU0A 4LF8B 3DPSA 2VP6A 4B3DA 4FSDA 1H66A 3T35A 4FDVA 2VDKB 4ZA2A 4AB1A 1Y98A 3UCXA 5AVYA 3R0IA 2P9BA 3IA7A 1KYXA 3CF6R 3MRXA 2PYZA 5M5BA 5D86A 2FPKA 1QH8A 1O8CA 2XVYA 4URZR 1LD3A 5D5HA 2UUPA 4FOTA 3O8RA 2VAPA 2WKSA 1P19A 5ENVA 5BNZA 2FR8A 2UVPA 3ISTA 3M4NA 1PLKA 4BAUA 1EGMB 1CJBA 2KS6A 5D3MB 2QW1A 4F6RB 1IBRA 3I64A 5SY6A 1KERA 1Q5PA 5HFJA 3TQFA 3OAAA 1HTWA 2P2CA 3AUKA 9MHTA 5F35A 4G3XA 3AC0A 2X3YA 2DRIA 3MNFA 1USUA 3U81A 4D9NA 4YMHA 3RFUA 4F2GA 2Z98A 1F7VA 1DEHA 2C9YA 3FMPB 3P2MA 4AN1A 3TUZC 2G63A 1SGWA 1J39A 2QTBA 4ZMSA 1VP3A 2Q3FA 1RAEA 1X86B 4OFZA 4EFMA 3RC1A 2BE9A 1HNZB 1ABEA 1P0PA 1C3VA 5EXSA 4R9NA 5FD8A 3W3AH 5KWSA 4D0GA 2YZNA 3H9GA 1Z35A 4W9MC 1QLJA 4V1CB 2DAPA 5ENDA 3N9IA 1AXRA 2QNIA 2EEZA 2ZRLA 3F7TA 4QUKA 2A9JA 1HG0A 3L0OA 5I7AA 1Y3DE 2QS9A 3RS7A 4E5KA 1RXSA 1X1TA 3OZSA 1NW7A 2IIQA 4RESA 3T7CA 3JAWA 1KEEA 1E61A 3F3YA 4OHYA 4QSHA 4I5IA 2O14A 4F7DA 1JIIA 4U63A 3ZW8A 4FMDB 3ZGOA 4D9BA 2R85A 4Z4CA 3IUSA 1M2HA 5LZ4A 2H8GA 5FV4A 5TNXA 4CU5A 2NTNA 4DTIA 1U81A 2HXSA 3KZCA 3O6VA 1I80A 4H35A 1Y8QA 1ZONA 2QR3A 2WM3A 3I6MA 3PFCA 4GX1A 4HLUA 3VYSB 4DBZA 4EQ6A 2M32A 4EEKA 2VYFA 4OHXA 1E18A 2PGJA 2X5NA 1IOZA 1EUCB 1SC3A 3OJWA 4NZMA 2ERXA 1GAWA 3AGPA 2VSQA 4QTUB 1XD9A 1EGAA 1NXVA 2PVPA 1QMGA 1KEKA 4ZYTA 1N5MA 2UDPA 3STTA 3KKNA 3VKWA 3WZLA 5G1PA 1NRWA 2B94A 3D31A 3LDHA 4A8HA 4UNNA 4HQFA 2QN1A 2WA1A 2APJA 3MRSA 4KCGA 2GCOB 1HE5A 1RZRD 3LG2A 5MFPA 3CKYA 4ZFNA 1NY5A 1CUIA 1KI8A 3GIDA 3IAS1 1E66A 2FZLA 4P3KA 1ZGGA 4XYLA 2EJWA 2WV7A 5I9SA 4ZI3A 1OBOA 3W5IA 3WK7A 2WKPA 3OEHA 4ZN6A 5J2UA 1SK8A 3KWLA 2VHYA 1L7PA 1HMPA 2NXCA 1P17A 4QTTB 4OA8A 1Q7RA 3D4IA 4UMVA 3OETA 4G0WA 3N53A 3NYWA 4BEVA 4JT2A 2RC5A 3LK7A 3AOGA 3OM0A 4JLKA 1BYUA 5BN3A 4J0JA 3WJ2A 1PL6A 4NOKA 4RUKA 3BWCA 2JD2A 1ULSA 4QAJA 3TQSA 3C7TA 4IH9A 1QHNA 1T5DX 1V8OA 2P78A 4N1AA 2H5IA 2H7CA 3JALB 4R83A 4C04A 2VSFA 4C4SA 4LOKA 4KQMA 4LNUB 1F6DA 3EG9B 1U5BB 1BS9A 2IYFA 2XNCA 3JZMA 2DQZA 3OE1A 3AZPA 1OF1A 2P4UA 3DZGA 1PSZA 4XQEA 1LSJA 3IESA 1FVXA 4OGLA 4UU1A 3V6MA 5EVCA 3OPMA 3IRVA 4CKZA 2ONCA 1AF4A 3G79A 1RJEA 4TMXA 3S1SA 1TT5A 1BX1A 1P9WA 2QL5A 1D1PA 3ZXIA 1TEXA 3WO1A 3WDKA 4CM8B 3SXJA 4ZYUA 4CHTA 3NIBA 4AJOA 1FRZA 1GCIA 4MO9A 5KC8A 1C8KA 4DA9A 1K9VF 1G41A 1ZCFA 3SSOA 4J3JA 3DVRX 1XUOA 2PCLA 2VAXA 4X3PA 4BNDA 3E1KA 5L7TA 1ZAYA 4L5BA 6AT1A 3ZHQA 1NVMB 1HEUA 1DJPA 2QLBA 5AHXA 1V35A 4B4WA 1CUZA 2WFAA 4HX2A 1NVEA 4JVOA 2HJVA 1A8PA 2I2XB 2VT6A 2OXFA 3DLCA 3EH2A 1YDFA 3C3YA 1S1CA 4INPA 2C9ZA 3DDZX 3PGVA 2K2QB 1OHHD 2XNJA 3JWIA 1SVSA 1QS0A 2XZPA 3A3PA 3BULA 3O1LA 1J21A 4UQOA 3V2GA 3X1MA 1SCNE 4DF3A 3DMFA 1IXZA 3GLUA 1PSDA 3I92A 5CM9C 5FO1A 3S68A 2GB4A 4Y2SA 3MT0A 3WGVA 1EZ4A 3ILYA 1N0IA 4E12A 1FTQA 3HYNA 3VC7A 4EIWA 3H42B 3UM9A 4C2UA 3KKZA 1N9GA 2NTJA 4KQKA 4K05A 1CJTC 4YAUA 2NGRA 2W00A 5CB0A 4JOBA 3N76A 3TW6A 1CEQA 3FNEA 4KIWA 3DMGA 3TG2A 3PVSA 4HWOA 1YHNA 2A0FA 3F8WA 3I6BA 5DGCA 1KBOA 1FC0A 2WYOA 4JUCA 2O7RA 3V97A 3GLGB 2PM8A 3NHZA 1VPWA 1QDEA 1B0UA 1LDYA 2HWUA 3PNMA 3H2YA 2V54A 4I8IA 2RBKA 5DH9A 1YGYA 1NIPA 2XDYA 2JJ2D 3QOWA 7ADHA 2MSWA 3HKBA 2FMHA 1EGQA 1XRSB 1Y1RA 5AM1A 4LKRA 4NU5A 1W85B 2BMFA 4XJVA 1G19A 3AXSA 4MULA 4ML3A 2G67A 1QVZA 3EDCA 1Y1SA 1IN6A 4FONA 3DTVD 1R5OA 4CMAA 5A62A 5SYMA 2KX7A 2J5XA 3IXLA 4MLDA 3FPCA 5EINA 4ZVRA 4F38A 2VKQA 2O8FB 2QVLA 1EM8B 1ND6A 1P4HA 1TA0A 3GLSA 3IAUA 3ZCPA 3FPLA 3MFQA 1TKBA 1X7ZB 2R6AA 1F1BA 3D64A 3ES9A 4KSYA 5I47A 3FOEC 3KSBC 2H0AA 1W47A 4KDEA 3BL8A 3T5GA 1ZUNA 2W2OA 3KQVA 4C2AA 3O7WA 3UW1A 4IUYA 1HY3A 4NHEA 4DHEA 1A5TA 2O1WA 2EX4A 4PPQA 1OASA 1Q14A 2QRVB 2QYHA 2VHJA 1D5CA 2H2GA 3OF5A 5KYUA 3TD2A 5JD5A 2F17A 1YA8A 1QZZA 3QE3A 2RHGB 1G64A 2Y67A 1YS9A 3N6VA 4PO9A 1GRNA 4OQLA 2IIBA 2NQ2C 4YUAA 1YJQA 1NNLA 3RUIA 3LKVA 3EVTA 1YR7A 3S81A 3CZAA 1G3IA 3Q6MA 5B2EA 2J41A 3LOUA 2XVZA 1O1YA 4PNPA 2H4ZA 3KQWA 4LV5B 4JN6B 1OC4A 1I6LA 1J0BA 1Y1KE 1Z82A 2PBRA 4G4IA 4V0LA 4XB1A 3WWPA 5KKCA 3PX7A 2BBWA 3EZ2A 3KYJB 4QAQA 1NX6A 4YN3A 4E5UA 4HRXA 4IMPA 5JXGA 2PNJA 4WN9B 4F3KA 3CIFA 2C5GA 4ANFA 1O87A 4OB7A 4FFWA 5GONB 3I0ZA 2Q99A 2VJDA 4FKMA 4H7FA 5EHXA 1TKAA 5IASA 4F2HA 5PNTA 3I39X 3D7LA 3R20A 5JXJA 3E2PA 1I6KA 2F8LA 1QTIA 3EC2A 4LHVA 4COOA 4EQZA 2PWYA 2QQFA 4K9KA 1RXWA 4MMXB 2OLKA 4UVDA 1JX6A 2B4KA 3DHWC 5CVDA 3ZHBA 3UKJA 1I3OA 5A0VA 1NR1A 2I29A 5DEOA 5MF6A 3E9YA 5G02A 5B3KA 1JFFB 1TJ3A 3HZZA 2CXXA 1AKTA 2CUKA 4B45A 4X71A 2F3TA 1OZ0A 4J2TA 2J6CA 3NBMA 1VKNA 3A4MA 3C3PA 1DADA 3GFRA 1YZYA 2JAXA 4URUR 1AG9A 3KQHA 4RBNA 1XJWA 3G0IA 1CUFA 2O5VA 1A1SA 4TSKA 3AVWA 1BMTA 1Z83A 2X42A 3DKKA 3MQ4A 1D4FA 2LIPA 2X1HA 3LCUA 3NC0C 4RE6A 2VG8A 4FKBA 2B0CA 2FPUA 3VAAA 2YXEA 1LLCA 4DAOA 4TQUS 4WFIA 1NIJA 2PG3A 1P4JA 2P65A 4X6XA 3RF7A 4MGEA 5C8ZA 1A7UA 3GAFA 2OR3A 1VB5A 2VSNA 3FDZB 3W7VA 1M2EA 3I9V6 5BRNA 2OQ2A 4FDLA 5CGZA 4KHZA 2OGWA 1W2GA 4JBGA 4ZCPA 4BY9E 3GFFA 1DHRA 4URHA 3THWB 2Q3EA 1E77A 1AZTA 2EWWA 1NJ8A 2UZ1B 3C6ZA 5JLJA 4BXOB 4IHAA 4DUPA 4LGVA 2ZP1A 3DOFA 3OZTA 4ENQA 3VOTA 3TMYA 4AAYA 4WXYB 1UEXC 3ED1A 1C14A 1W0KA 4ALIA 3CW9A 1AX9A 2A0XA 2CJPA 1TCAA 4B2PA 4X54A 4C5BA 1ZW6A 2DKFA 3CUKA 3H11A 3ZE8A 4JV5B 4YRCA 5JNSA 1K5HA 5I4IA 1BN7A 5KQSA 2NU8B 4RA9A 4AW9A 1S96A 2QTVA 1H4SA 3MK31 2NAPA 1Q17A 4REQA 1FMCA 3OUUA 5CVCA 5F51A 2DPGA 3UNXA 4QWMA 2V3CC 1QQ6A 1PF7E 4E1BA 1G9XA 3GV0A 5JAZA 3RK1A 4EHLA 3JVEA 4GDMA 5T4FA 4EJSA 4LXGA 3EXFB 1ODLA 1L7DA 3F47A 4B17A 3DOEA 2NYUA 2JA1A 1HLFA 3B1YA 3DDWA 2ZJ3A 3R9IA 3M4ZA 2IXFA 2ZI7A 4YMLA 1IOVA 4I7EA 1CX9B 3INYA 1OR8A 2Z1MA 3S7ZA 4BE9A 4AJHA 4Q1DA 1QONA 2XUPA 3KEMA 3MGGA 2NM0A 4HNRA 4LMPA 1ECLA 2P9CA 4BFXA 4YDHB 3Q7PA 1JHDA 2D2EA 3PX3A 4K40A 2I3DA 3PC7A 2QW0X 1RM4A 4TX1A 4WCVA 4WZ6A 1N2CB 1Y5MA 1XTVA 4X1KA 1OSNA 3FDJA 1XMOB 2WIGA 4N12A 2PD4A 4U7DA 2IWRA 4Z9YA 1FUUA 4URWR 3EZGA 3QE9Y 4J4HA 1WXFA 4AJPA 2ZSKA 1JAZA 1VDMA 2PWAA 1WKVA 3K8QA 3KSMA 3OZXA 3BFJA 3QUSA 4YRTA 4BWGA 1I0IA 3AUAA 4UPEA 3U3KA 1WHSA 4EPWA 5KINB 1JZTA 3ZHXA 1S3GA 2M1XA 4FMBB 4FBGA 5CFOA 2ZI6A 4YJ3A 2BFMA 2EU8A 2FG7C 1WY5A 3IUQA 4R1NA 1KVTA 1V43A 2ID4A 1R37A 5IBRA 4FQ8A 3RKUA 4E88A 2JH8A 4QM6A 1QFJA 4KPUA 5ITZA 2DQKA 2VP2A 1C5KA 1NE2A 1WMFA 3CR3C 3DW3X 3AUJB 4TKZA 1W1WA 4ZU6X 1SIBE 1T1EA 3DDUA 2ZE7A 1XLTC 3HJUA 4RY0A 3TQCA 1CPYA 1F6BA 2A4KA 2FR0A 2HJ9A 5K09A 1SVLA 1U2PA 2RK3A 1EWRA 3F90A 1XZQA 3Q7RA 4KK4A 3GW8A 3RK4A 4YWJA 4WCFB 4OI4A 1PSWA 1R74A 2C03A 1PK8A 3LNTA 4F97A 1DE0A 1WXEA 5JPDA 2WQZA 1EIWA 4X0EA 4D6YA 3I2YX 3IEIA 1NSYA 4RHEA 1IDN1 4PF1A 2QLLA 1ZJ6A 1A76A 5BV7A 2RGDA 1P6QA 3IIEA 3S4YA 1N2EA 3SQOA 2REOA 4ESHA 1XN1A 1UJBA 3IR5A 1QQTA 3IP6A 5JAPA 1Z0IA 4OOFA 1V8BA 3N2KA 3KU4A 5SY9A 3C0KA 1DEAA 2OAGA 3IAHA 4MP3A 1IWPB 3ONVA 4TOIA 4CKXA 3DULA 3U44A 1Y4AE 3IDFA 4MS1A 3ZWKA 2CK3D 1FU4A 4L3VA 1VHQA 2XCIA 3ZW7A 3ICVA 5E9WA 3EAGA 4EA7A 4OU5A 1C9NA 5EIXA 1THTA 1X3LA 2ZQZA 3LMKA 2N1MA 3O0TA 1YKGA 4W99A 3A11A 3GVCA 2Z56A 3QQPA 5E2AA 4PNHA 2KWIA 1FX0A 1RRPA 1EK6A 4FJ0A 4JYCA 4PONA 5JMPA 5IKOA 1GARA 5C9ZA 1N7GA 2XXAB 3E35A 1OI3A 4TT3D 2E85A 3TNLA 1H1DA 1E1QD 4FEEA 4B6PA 3ER9A 2HL6A 1O95D 4PYMA 2PKQO 4GFDA 1UAAA 1HL3A 1PO7A 4GI3A 5AJXA 5DV9A 4CV2A 4I4CA 1IOWA 4F04A 4E94A 1UF9A 2VHWA 3R8XA 4F2PA 4HAOA 1T43A 1JQLB 2PSJA 3OP4A 4TKVA 4PSKA 1JLLA 4KGXA 1KAQA 2NXEA 1S02A 1QNFA 1R0CA 3NT2A 1X80A 3R3XA 5EHQA 5KOYA 4RFLA 2FP4B 4R1LA 5AVJA 1FPQA 1YUBA 3EW9A 3P2YA 1EEXB 4HUQB 2QTNA 1JIXA 3LT0A 3MT8A 1GA4A 4IDCA 1YK0A 5FA6A 5BW6B 1EH5A 3QBEA 3NTXA 3HWX1 3O47A 2ATCA 2D74A 1VCOA 1WBBA 1Q6ZA 4A2CA 4IFIA 1C0EA 1S2NA 3NAMA 1XDUA 4WH0A 4Q7KA 2R25B 2R79A 4Y2TA 5CT4A 5FPHA 3RUAA 3SEZA 4J6EA 2JS7A 4RDXA 1SJ9A 4XVHA 3RRBA 1QH0A 3Q15C 2NYAA 4ZDKA 4EHKA 4O4IB 3ADKA 3CPJB 3C3BA 2XIQA 1W36D 1DAMA 2ILVA 2YW9A 4PHFA 3AFHA 3ROZA 3DHEA 4JJ7A 2VXCA 3PC8C 1Q21A 4FFBA 4TTIA 4DCNA 1N4AA 2XUGA 1P0QA 2CNLA 4C4PA 5HF6A 1QHHB 4HQNA 5JXHA 2OBMA 1CY6A 3JAKA 3R5TA 2H5EA 3D1VA 1B23P 1SQFA 4XGKA 4AL4A 3ZV4A 2XYPA 4BUCA 4OGFA 4ZJYA 1A5AB 1U0FA 4LVCA 1CETA 2AKYA 4WECA 5THXA 1QVWA 3D6HA 2Y1GA 4JOQA 4D74A 3TRDA 4WEOA 4G23A 4UUAA 4ENWA 3HO1A 2X1LA 5JC1A 1EWKA 2HB6A 3OH8A 1RFGE 2HAEA 4ZJZA 3N3AC 1Y82A 1NBHA 1Q19A 3GEPA 3GB9A 3VKVA 3TLCA 2FZKA 3KSZO 3BXXA 1GO2A 1Y6RA 4FCVA 1AXGA 3RRJA 5K8IA 1T2VA 2R5NA 1UPTA 3CUWA 2JFVA 4JENA 4ZQBA 2XYGA 5CA0A 5DM70 2BMDA 3K8ZA 1TLLA 4JY7A 1YH3A 2PSSA 4HXYA 3SM9A 1XZMA 1Z08A 4G0ZA 4R6XA 1T9ZA 3ONWA 1L2TA 1WZ2A 2VL7A 4GYWA 4PHCA 2A5YB 3JAMA 4UM7A 2PD3A 4DZZA 1QSGA 1C4KA 3HABA 3QJGA 5IC5A 3F4KA 5F23A 2C4HA 5C7YA 1CYEA 4WZAB 1AUQA 1UBJS 1W87A 3U7IA 4HDNA 2BHTA 2W0MA 2PN1A 4NVRA 1GKKA 1EZ1A 4H1TA 4QVGA 4PO3X 1NVTA 2CJWA 2OA0A 3IKLA 3RQIA 4DSUA 2CCGA 2JHCA 4PFSA 4BNLA 2HWKA 1YB6A 4JUAA 3O8QB 1I2BA 1Q7BA 2HWWA 1TZJA 4MRVA 3EUAA 4RMIA 1X1EA 5BWLA 4AZ0A 1J23A 4YBRA 5D85A 4CLDA 2VNAA 4TYPA 3WNCA 4HT3B 3GUYA 2WPDA 3QU7A 2BM9A 3L41A 1EIZA 2OILA 4HY3A 1BCRA 1HLPA 1PD1A 1XRMA 4R40A 4HFNA 4TRNA 3JXEA 4B3SB 3LGSA 2UXDB 2Z5LA 4GI5A 5CB8A 5CVUA 1PFVA 2ZM5A 3K20A 3IULA 4LCEA 3FCAA 4QYIB 2RHLA 2MMGA 2XB9A 5COAA 2NUPA 4C89A 1L7OA 1JIKA 1LWOA 4H7JA 4RCVA 3ISJA 3L0CA 3EEOA 3CZ4A 4JSRA 2YV5A 4M76B 5C2JB 3NKFA 3GROA 1KMHB 5FORA 5CLQA 5L7YA 5JCOA 2DR2A 1ZU4A 3MJTA 3WNVA 5FNVB 1T3HA 3ZUGA 3OFSA 5L6LB 3D1LA 4KN6A 4UEOA 3CO5A 3DJYA 1E1KA 2V59A 5H83A 1WTCA 4ZJPA 4ZK6A 3CRZA 3H9UA 16PKA 5FHRA 1SHLA 3MN1A 1MV5A 3RG2A 4AG5A 3HI6A 5BUZA 2IKSA 3ET5A 3F96A 2WILA 2J32A 4JA0A 2BZSA 5DEIA 1ETHA 4C6RA 5EEHA 4H6VA 2JI9A 4YT5A 2OYRA 2A5GA 2AEJA 1TD1A 2YXBA 1MAHA 2UYHA 1W5SA 2VNKA 4EGFA 2WFLB 5KQRA 1R9JA 2EATA 3MD9A 2I2WA 3C8MA 1KQFA 4J0EA 1LJLA 3SG0A 1UC8A 1OH7A 1WY7A 4BMPB 4XSVA 1VJ0A 4V3CA 3OOSA 2ZCVA 2VK4A 1XKQA 4JLAA 2XX3A 4H1WA 3BGWA 3CVWA 3UWPA 4UVIA 1YS6A 1FA9A 1UPCA 3RU3A 3QUBA 1SY7A 1G20E 4G0PA 4IV5A 2R7LA 3BGOS 2Z43A 4RJIA 3H5AA 3FMOB 4DGSA 3J81A 4MW2A 1QV9A 3K7EA 2C5FA 4LDZA 5D5PA 3GN1A 4Q48A 1VMEA 4Z0HO 3HNOA 3UY4A 4CL2A 4K6OA 4Q3KA 3FNQA 5JZSA 1EFUA 1E2BA 2WJVA 2C2HA 4GLLA 2JIQA 4HAZA 4HWSA 1AQIA 1NFRA 1SQ5A 4NCKA 5IJZA 5IZ4A 4MS4A 1L7RA 1KTVA 2O0HA 1IYZA 2CF5A 3A6JA 2BMWA 3V34A 3TSCA 5I7SA 1II8A 3FJ1A 5J63A 3OKAA 2HSEA 1TUBA 3DV9A 4J1TC 1EAYA 1KKLA 3K2IA 2BGGA 1MO2A 3SF8A 3FJOA 1W0JD 1V4BA 3P9CA 5EC8A 1U2RA 2GN0A 5CK4A 5BSUA 2C3YA 5KWIA 3WGIA 5LZ2A 1NVVQ 4MINA 2ZI9A 3OZRA 3IIKA 3MEQA 3PQ8A 4ND8B 5I9TA 4C43A 4LF4B 2JBAA 1J2UA 3JSAA 1CEXA 1GRCA 3MD0A 4GMHA 4QX6A 3ZDCA 4RIHA 5TPWA 4JOCA 4PAQA 1ZK4A 3ENWA 3PD0A 4B5KA 5KJFA 2BDUA 4I9GA 5DXAA 3J7TA 4IJMA 2HK9A 3UOWA 4FYWA 4AXBA 1LTHR 4GBGA 1PFGA 2DECA 2QMEA 3TIIA 4W9RA 5FBVB 5KIAA 4DXHA 4W5JA 4YRAA 1G63A 1NI4A 2RBGA 1HE8B 1R0ZA 4HAVA 1PFQA 2FFBA 2YZKA 3AM1A 1JJVA 3A1NA 2R00A 3VPSA 1JG4A 1RXVA 5KBYA 1U90A 5JDCC 4PS0A 1P3Y1 2HPVA 2IV2X 2QTWB 1USVA 3OC0A 5COQA 2GAIA 1U9ZA 1ZSYA 1GG5A 3G8YA 4K9LA 4ERNA 1ZA2A 2GLTA 4D4GA 3WFJA 5JZ9A 2PX8A 3I45A 3VKUA 4NECA 4X8OA 1UBKS 3AZQA 4LV8B 4TN1A 2EFHB 2TRSB 3MHPA 2AZXA 4X91A 1XRPA 2TS1A 4ENPA 2GLXA 3DLBA 2ZIWB 4QPPA 3DZCA 1L5RA 5LP1A 1VKZA 2XCUA 3I9FA 3IAM6 4RVCA 4POAA 3ICEA 4GRAA 4BCBA 2P2LA 3HO6A 3D7MA 3WDMA 4ZHQA 4HUJA 5F98A 2MINA 5AXAA 3PUVA 2OHVA 1EB9A 3OX3A 4ZZ3A 1K5GA 2GTPA 4KE6A 4HDMA 1A9XB 2YX1A 3O31A 2QLMA 3I1JA 4KNVA 4PV7A 4X24A 1RHMA 2J7PA 2QQEA 4Y8VA 1OZGA 4XM0A 2YJTD 4H6WA 3KBOA 2ID8A 4C29A 1BHO1 9GPBA 2CNOA 2P67A 4CHGA 3MC1A 4H0CA 3VSAA 1GZ5A 3DUWA 3KWJA 5F7OA 2YVQA 1PGOA 8ATCA 4MWSA 3CRRA 3IV6A 3KOYA 4YLGA 1CS4C 1QR2A 4AG3A 4N7JA 3K2QA 3MSXA 4LTDA 4ZANA 1WDTA 1P2TA 3QIAA 1RZ3A 4I66A 1USWA 4QQNA 2PJRA 3WXMA 3TTTA 2PT7A 2FG6C 1NU6A 3HDTA 2JHFA 4H7HA 1H9BA 1E3JA 2O1SA 5KVCA 3U13A 3ZXYA 1JIQA 2GM5A 3U4HA 5EZ5A 4K2HA 1HR0B 1GAEO 4GXNA 4P9NA 3BK7A 1C1DB 3A2MA 4F6LA 3OQNA 3L1UA 1GITA 3IJPA 1F12A 2B1RA 4OL0A 2HA0A 4ZZIA 7AT1A 1IXYA 4E6EA 3AR8A 1U9YA 3CCFA 4C07A 4KH0A 4KOAA 5EXPA 3W3AD 3ZX4A 3QEMA 3OPYB 5JO9A 3DBLB 3BMCB 3NBZC 2AK2A 1FRQA 1OXMA 4HG2A 1LS6A 2PYDA 4JSTA 4MLPA 5CR9A 4B3CA 5A02A 2VP9A 3DVSX 3LDUA 4DJDC 1ONBA 2BWJA 3HS3A 3IBSA 4BBPA 2IF0A 1TM3E 4M8NE 1HEIA 4ZVLA 4EGAA 1FW8A 1UT8A 3U1VA 3VR2D