4BMYA

Structure of futalosine hydrolase mutant of helicobacter pylori strain 26695
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
230
structure length
225
Chain Sequence
VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIPESAIFIETSESLNALAKEVANEQHIVLKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISANADEEDAFLEKSAQTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MTA/SAH NUCLEOSIDASE
publication title Structural Enzymology of Helicobacter Pylori Methylthioadenosine Nucleosidase in the Futalosine Pathway
pubmed doi rcsb
source organism Helicobacter pylori
total genus 77
structure length 225
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bmyA00
2AI1A 1ZOSA 2BSXA 4DA6A 5F77A 1JDSA 4TXHA 5CXQA 2AC7A 3DP9A 2OC4A 5CCDA 4WKCA 3FNQA 1JDVA 1A9QA 5F78A 3BJEA 3BSFA 4QATA 3OOHA 1A9TA 3U40A 1OUMA 3OZCA 4GLJA 1PK7A 3UAZA 1RXCA 1Y1SA 1RT9A 4OY3A 4YNBA 4L5AA 1PR6A 1PR5A 1FXUA 1SQ6A 1SD1A 2HN9A 1PF7E 4PNPA 4EARA 5B7PA 3UAVA 5C80A 4YMLA 1YQQA 1PK9A 3LGSA 4TXLA 4X24A 4OGKA 4NY1A 3OF3A 1LVUA 1RXSA 1U1GA 4QASA 2A0YA 3FUCA 3PHBE 1PR0A 1JPVA 3MB8A 3DJFA 4TXNA 3O6VA 4DA8A 4WKBA 4D98A 3LA8A 4TYMA 4WKOA 1ODKA 1TGVA 4D9HA 3DF9A 5F7JA 2A0WA 4JWTA 4LKRA 4GMHA 1PR4A 5IU6A 2HSWA 5CYFA 1LX7A 5B7QA 1OU4A 2QTTA 4TS9A 5I3CA 1OVGA 1NC3A 1JDZA 4TTJA 1RSZA 1JE1A 1Z38A 1A9OA 4I2VA 2AI2A 4MCHA 2Q7OE 4F3KA 1A9SA 2OC9A 5K1ZA 5CYGA 1Z5NA 5EPUA 3QPBA 2GUWA 3K8QA 5B7GA 1JDUA 3E9RA 5CCEA 2AI3A 3T94A 1ECPA 4D8YA 4U2KA 1Y6QA 4TTIA 1G2OA 1T8WA 1Z5OA 4DAEA 3UT6A 5DK6A 4QEZA 1YBFA 3PNSA 1Y1TA 3KHSA 2OXFA 4ECEA 5KB3A 4UC0A 1WTAA 2A0XA 1ZL2A 1Z34A 3SCZA 3K8OE 3OZEA 4TS3A 1ODIA 1QE5A 1U1CA 1PBNA 3C74A 1JE0A 3OCCA 3BGSA 3DPSA 1OTXA 1PR2A 4R2WA 1VHJA 4M1EA 1T8YA 1JYSA 5IFKA 5CXSA 3FWPA 1PKEA 4GKAA 3FAZA 2RJ3A 1ODLA 1Q1GA 3F8WA 1VHWA 5F7XA 4F3CA 1V41E 4BMXA 4D8VA 3OZBA 3ODGA 1XE3A 1Z39A 3ONVA 4L0MA 1CB0A 3KVRA 2HWUA 1RCTE 4OGLA 3OPVA 4JP5A 5F73A 4LDNA 3EMVA 3KUKA 2QDKA 2QPLA 1N3IA 4JOSA 3GB9A 5EFOA 4G41A 1TCUA 2HRDA 1CG6A 2I8AA 2B94A 1Z36A 2QSUA 3MMSA 1RXYA 1SJ9A 3TL6A 3D1VA 4LZWA 1Z37A 2PGAA 3P0EA 3UAYA 1RFGE 1Y1RA 1Y1QA 1VMKA 3UAXA 1U1DA 2P4SA 3INYA 4QAQA 4P54A 3NM4A 1YR3A 3FOWA 1B8OA 3KVYA 4L5CA 4R31A 5F76A 3OZDA 4KN5A 1V48A 1V3QE 1U1FA 1K3FA 1V2HE 2OECA 4GLFA 4K6OA 4YJKA 1TCVA 1RXUA 3NM6B 4DA7A 1U1EA 1TD1A 1I80A 4IP0A 4WKPA 4M3NA 4D8XA 4BMYA 3IEXA 3E9ZA 4PR3A 1YRYE 1T8RA 2QTGA 4RJ2A 3NBQA 4DA0A 4QFBA 1Z33A 4M7WA 3BL6A 1ODJA 1RR6A 2IQ5A 5EUBA 1OV6A 4G8JA 4WKNA 1NC1A 1K27A 2A8YA 4F2PA 1JP7A 1A9PA 1OTYA 1Y6RA 1M73E 1T0UA 4OEHA 4FFSA 4EB8A 2H8GA 2XRFA 4E1VA 1PR1A 4DANA 5F7ZA 4G89A 4R2XA 1V45E 3PHCA 4BN0A 1RYZA 1JDTA 3E0QA 1NW4A 3KU4A 3EEIA 5JPCA 4NS1A 1K9SA 4TXMA 3UAWA 1VFNA 1PWYE 2I4TA 1Z5PA 4TTAA 4BMZA 2ON6A 4LNHA 4L5YA 2ISCA 5F7OA 4F1WA 3EUFA 4NSNA 3FB1A 3KVVA 3OOEA 1ULAA 1C3XA 1V4NA 1LV8A 5ETJA 4DARA 3NM5A 4OF4A 4QARA 4TXJA 1A9RA 4LNAA 4YO8A 3ENZA 1Z35A 1T8SA 1A69A 4MARA 4L6IA 4OJTA 4F2WA 4MCIA 4DABA 3LBAA 4H1TA 4DAOA 1ULBA 3EUEA 3PNPA 3O4VA 1TGYA 1PW7A 3DDOA 3P0FA 1YQUA 3IOMA 5B7NA 1B8NA 1SD2A 5FAKA 3GGSA
chains in the Genus database with same CATH superfamily
1XMQB 4J4TA 4KXMA 4TZ6A 2IZOA 4B33A 1ZOSA 4RY9A 5FOSA 2YZMA 4W9RA 3C4JA 1IH8A 1P4SA 3P45A 4M8NE 3ZJUA 2VAVA 2Q3HA 2DQYA 2NTEA 4IM7A 1RJFA 1V8PA 3DC2A 3FNQA 1TW2A 3GR6A 3I0ZA 4UUOA 4CQLA 4ARIA 5D01A 1A9QA 4ZHQF 3GLVA 4FKMA 5FNVA 4ZVQA 1EEHA 5CD9A 1GZSA 2FSHA 2ZUVA 3K0FB 5FA5A 4ZO8A 1IWPB 1O6ZA 3A2MA 3F9RA 3QF4B 1I24A 4ZRMA 3ZCQA 1GKLA 3VJKA 1E77A 3RPEA 1AC5A 1ZGCA 3IPXA 1AT1A 3LHKA 4PINA 3B1XA 5A71A 3A26A 2FOXA 2W6NA 2JBWA 4MPRA 1NIPA 4LS3A 3SOZA 1DC4A 4B6GA 5CA0A 1FFDA 3RSHA 1ZM4A 1OR8A 2FG7C 3UK0A 3FYCA 3Q98A 5K0NA 3AO0B 5KNDA 3BWYA 3QITA 4OY3A 4LSWA 2Q5QA 3SJZA 4XJTA 2FEOA 3JWJA 1M8PA 4E09A 4F46A 4PXSA 3WZ2A 2H0RA 3AIOA 4MUJA 5I9TA 3THOA 4F72A 2F43A 3ADPA 2CZQA 3B7GA 2NVWA 1KR2A 2O0JA 4Z1MD 5KC9A 3S2IA 4LHXA 3U48A 3DFIA 4C06A 2JI9A 5C80A 1GZUA 2GPBA 5C5IA 1JPJA 1BD3A 1JR4A 5FNZA 3WB2A 3IAHA 2PKRA 1R6XA 3A2NA 4I1SA 4QPJC 4FN4A 3ZLUA 3QE4A 1F9AA 1P4RA 3DZBA 4RHTA 4E5PA 1NJ1A 1GU7A 3QSGA 4MI1A 3TUZC 1RXSA 1U1GA 3L41A 4OXYA 4LDRA 3CKKA 2L19A 1R8YA 2P9YA 2YWCA 3HZOA 1IQRA 2GJKA 3ABSB 2EFGA 3OT1B 1CRLA 1CQIB 1AE1A 3PX2A 4KWEA 5C4GB 2ZTSA 3O3MB 4BMVA 2HWXA 4F4DA 5IT0A 2Q45A 3GJ7A 1M72A 2BKLA 2Y9PB 2VAWA 4G9GA 4NYJQ 5IYZB 3IAXA 3RYCA 1RYEA 5EHXA 4W8HA 4OFWA 4AZ3A 4WN9A 4B3RB 2AC2A 3HWX1 4QXPA 3DLCA 4MV5A 3EARA 3FGNA 4IGKA 3WK4A 4LQDA 3BWVA 4I5IA 1IMJA 2B4AA 4BB0A 1JIQA 2VP6A 1O95A 2EJVA 3LA8A 1DBWA 3R77A 4UM9D 3U13A 5REQA 4EKDA 4B3MB 3OCYA 3AUXA 5DBEX 3EAFA 5F5XA 3R7FA 3T95A 4MI9A 1G21B 3VYTB 5HKKD 1GARA 1TTQB 1Y4ZA 1U8FO 2REQA 5U9CA 2W2NA 2QTCA 1Y8AA 2RCNA 2EC5A 2BWJA 2IXAA 1NI3A 1A7KA 2BKXA 2Y76A 3N5CA 1V5FA 1KPIA 1MRZA 4PZPA 3ZV4A 5LLDA 2B0CA 1UK6A 3DCJA 1MJNA 3QMPA 5KX5F 2FMUA 2H29A 4MR7A 1O4WA 3ZJ5A 4Q9DA 2X8WA 4TL7A 2C03A 3HVUA 1F51E 2BFCB 3AZOA 4MUGA 5H3CA 1A7AA 5CYFA 2JGAA 1GZ3A 1G8KA 1P75A 2WMOB 2AVDA 4CV3A 4OHCA 2H4XA 4Q3KA 2Z95A 2IPMA 3KR9A 3WMRA 1PYOA 1J8MF 4HRXA 4C07A 1S2DA 3PNVA 3PGVA 4LNUA 3ZTTA 3AEQB 4I8IA 2I65A 1U3WA 1T6BY 1SBQA 1DC8A 3QW4B 4TMFA 5E6UA 2CVZA 3RVNA 4U02A 2FW7A 2ST1A 4Z0PA 3RVLA 2DCMA 2FOLA 1PNRA 1NY6A 3EIHA 2C5FA 1NC3A 2H2AA 4JELA 4E5KA 3DS8A 4G09A 3EWIA 3JASB 4PC2A 2CHUA 4LBWA 3V2UA 4BMSA 2QBYA 2VO1A 2IZZA 2CXNA 1Z4MA 2FFJA 4I19A 4MR9A 4B40A 3SJAA 1Y7LA 4G37A 2I3AA 5HIMA 2NUPB 2YIDA 4GRIA 3LCRA 1E4OA 4JU9A 4MPPA 3K4PA 4Y2QA 3VJRA 3K92A 3D81A 3RG8A 1E3JA 1WXGA 4LTDA 2Z56A 2EGUA 5JATA 2QTVB 3D5EA 3F98A 3OZTA 3LBHA 1EFAA 1ADBA 1KZYC 2W6ZA 2XEDA 4IXTA 4UW9A 3IAS6 5DX0A 4CDRA 1Z4LA 3Q11A 3SHVA 4JBXA 1L8AA 5D7BA 5L4NA 1ZJJA 4QM7A 3KKEA 4MLPA 4OXNA 3R9KA 4OOFA 2EGHA 3HXQA 1N78A 2FRDC 3GP8A 3UHFA 4YP7A 2WU8A 1SG6A 1XJ0A 3DMNA 4H4DA 2ZREA 1Z7EA 4OP1A 3T35A 2QQ0A 5DN9A 4BC1A 4D9MA 4GT1A 1WNFA 1YZGA 2WT9A 4FE7A 5AW5A 2P4QA 5HWSA 5JNWA 4DCSA 3NTVA 4RV4A 3WA7A 1XVLA 1DWPA 1ZA2A 4D1YA 5DW3A 4KN9S 4M22A 3D8BA 3GPLA 4JA2A 4MKIA 4UNRA 5F3WB 2FLWA 2OPBA 3EZLA 5FV7A 2H2FA 4ECEA 4HGQA 1DGQA 3SHOA 4UPVA 1CIPA 1PQYA 3L4SO 1V16A 2CLKB 2Z4TA 4IL5A 4D5EA 2E1RA 3O8OB 3MWLA 3ZKWA 1PBTA 1G3IA 3KD2A 3KJFA 1I3OA 3QWFA 5AK0A 4CKYA 1EE2A 3GP3A 3KWMA 1FUIA 3PQ4A 4MVCA 3AF6A 2IHTA 3JY6A 3NANA 1ODIA 4YAWA 5JS1A 4AMYA 3OIFA 5A3VA 1FRFS 3N74A 3AL2A 4ZCPA 4BGEA 2JK0A 3Q72A 1V4BA 2KMLA 1NBMA 2IS6A 1EWQA 4CM5A 3SBEA 4E0BA 3M6VA 1PS8A 2FHSA 4MAAA 4QYIA 4YPOA 5BW4A 1PJQA 2H3EA 5AKEA 1SXPA 1NVDA 1G3UA 4YUZA 2YYSA 3ZGLA 4UQLA 4WCVA 1E3TA 1IZ9A 2RHDA 2VC2B 4DXDA 3I28A 4TKVA 2ZRJA 4H7HA 3TTUA 3ZWNA 4BVGA 3FYSA 4IMPA 4PG5A 5LCXA 2DPHA 2HYDA 2VZLA 4CLRA 1E5QA 1H8ED 3LCCA 1Q7GA 3MERA 1J42A 2QTRA 1A2KC 4QOJA 4QWMA 4KB5A 3S28A 3L6DA 4OH1A 1FF9A 2CJWB 4QRDA 3WWOA 4QA9A 3PGA1 5FWXA 4IDFA 1EVYA 3A7EA 3IMFA 2P4EA 2X0RA 4RAQA 1C0EA 4LJ9A 1BWQA 2P6UA 3L8YA 2OB2A 3ZHXA 3AVWA 3T4XA 1KHHA 2XKKA 3LT2A 3EXFA 3D6HA 3VXKA 3NHBA 4Q9JA 2DTDA 2RH8A 1QFZA 1NJSA 2JAQA 5EJEA 5C53B 5DTIA 4DCGA 1ZL0A 1GUYA 2BMWA 3KXPA 1WX1A 1RBMA 4BBPA 1G0OA 4EMBA 3RUIA 2NVOA 3BXZA 1F14A 2VUHB 3R74A 3OCXA 4A8HA 1QFSA 3L8DA 5KHLB 1H3NA 2FU5C 2GUGA 2NNLD 3BTVA 1Y80A 4R2LA 1U4OA 1JS1X 5BPHA 1HR0B 1J9EA 4QG3A 5A03A 1GYPA 1Y63A 2HO5A 1RCTE 3G8BA 4BQIA 4DVGA 5G4LA 2YV3A 4RGYA 3LC2O 2TMDA 5JS2A 4GKBA 4GPTA 1KIFA 3FSJX 2WWXA 3EFBA 3TTXA 4FFBB 1W36D 3X44A 2R7MA 4X6XA 2Q3DA 4PC7A 5DT2A 2Y6UA 2IELA 2X6RA 1V8DA 2VBIA 1GD1O 2I87A 4RPKA 1C1XB 1U7HA 5M3BA 5B6JA 2UUAB 1PFUA 4R3NA 4K05A 5EIXA 3PRHA 1Y4DE 4MGYR 1JEQA 3FUXA 3LVRE 4DPMA 1MO2A 2ADOA 5EIAA 2RG1A 4DL9A 1ECCA 4AP6A 3ETEA 3M1YA 4P82A 4RD3A 2B34A 3VR4H 1YZUA 4X1YA 2GGSA 4GYYA 1HX7A 1PWEA 4UNQA 2W0SA 1CUSA 1WDWB 2J9GA 4V2IA 4AN1A 3TL6A 1B8UA 1Q0SA 4O4LB 1IN8A 2VATA 1D2MA 1Q16A 2PRJA 4CUZA 4YV7A 2B4QA 4NPCA 3UMVA 2J59A 2DC1A 1IZ0A 1Y42X 1XMIA 1KSHA 3B5JA 3QVVA 1RJDA 4Q7EA 3KD3A 1RXWA 1Y1RA 3A6JA 4BLPA 2DE0X 3EF3A 4HWSA 1EP2B 1QV6A 1H1DA 2NZ2A 4MP3A 3SFTA 4C0KA 1CUGA 1PVVA 1W34A 1E6MA 1ZJ5A 4JLMA 5DHAA 4DZTA 1VGVA 5KKCA 2WD9A 4ASUA 2JIOA 4P86A 4EABA 2P9ZA 2B7LA 3RS5A 4CU2A 3W06A 2CYBA 1ZUD1 2VUSA 4UHBA 2WMNB 2Y1GA 3VSBA 1VHDA 5AKHA 1XZQA 5CNJA 4ZI3A 1U8TA 4BNDA 3FOWA 4LUCA 2N42A 1L4MA 2BGIA 3I05A 3LYUA 4GX2A 3UH0A 2GN8A 4IOJA 4E07A 3L1JA 2HXYA 2VYFA 3GYGA 5IUJC 3S1SA 3A3KA 1P6XA 1H1LB 3M8KA 5FPHA 1RWOA 2PO5A 3EEYA 1O94A 1SVLA 4XB2A 2P69A 3WYGA 2HREA 5ICMA 1VPEA 3JWEA 3AFHA 1LQ2A 1X77A 3OC6A 3RFXA 4K0KB 3K2QA 3WWYA 2X6QA 4D74A 3ENVA 3R75A 1IONA 3ZYCA 5AOAA 3N0XA 5D3ZA 3GLKA 1I5RA 4RTKA 1L5HB 3CV3A 2ZTHA 1SXIA 4NJEB 3ABQB 2VSFA 1UODA 3C39A 3D8RA 4RZQA 4GZ3A 1TJNA 4D0NA 1D4FA 3K70B 3CKMA 2VG8A 3GFSA 4Q3BA 2WAAA 4UMDA 2WG2A 2DTXA 4OLFA 4KQHA 3WDSA 3CXRA 4F2DA 2NAFA 3K72B 2J4DA 1GYQA 2AVNA 1Z3CA 2QT9A 1KE1A 3PYLA 3HO8A 2J33A 2X8BA 1DX4A 3TDNA 4F3NA 5EUCA 1H2BA 3RJZA 4R2IA 1GUFA 4KBGA 2ZRDA 3PC3A 1FP7A 3HDGA 4H59A 5KTPA 3UATA 2QRGA 3OD5A 3LPMA 3F5DA 3OM1A 4XDZA 4EVIA 1DCMA 2YRWA 3PQ7A 1QP7A 1A7JA 4OHPA 4BO5A 2OGUA 2P65A 5K3FB 5K8UA 2Q5LA 1W9MA 3JQGA 3GJTA 3VNAA 1Z33A 1HBJA 2YFYA 3IVGA 1DTSA 1OVMA 5AP9A 4YCNA 3QOFA 4GOXA 1TNDA 4RL6A 1NT4A 4EKGA 5C1PA 2ZSFA 2SKEA 4W9MC 5BYBA 1JQBA 1XC7A 2XWBF 1DPGA 2P1ZA 3OMLA 4FHEA 3ZJ4A 2PZKA 4KE6A 4KRGA 3R7WB 2BFBB 5K0LA 1JLSA 1P0FA 3ESZA 2MMCA 4I9UA 4B3XA 1OAOC 3QVUA 1K08A 2X5NA 3SSAA 5FQOA 2WZCA 4PQFA 1R5NA 2FNAA 5KREA 1NBOA 5D87A 3A32A 4ESOA 5FA6A 2G06A 3F6BX 5FYDA 5G53C 4X9XA 2O5EA 2A5GA 2H5EA 5B4TA 1P6UA 1H93A 1P7WA 4RLQA 1ORRA 2JCXA 3F4KA 3RVQA 5IF3A 2Q5HA 4MDEA 1BE8A 1JAYA 1QE0A 2UAGA 3VR4D 1PR1A 1NQXA 2YOFA 5DWVA 4D4HA 3K9LA 4OQFA 4ZAYA 4DANA 5ICGA 2Z1DA 3ZWKA 2QQFA 2C7PA 1N3BA 1G5PA 1XLTA 1K89A 2JHCA 1QYIA 2PS1A 3AC0A 5LZ8A 5AVXA 1EFHA 4DG9A 4PYLA 4DYDA 2FPPA 3BXXA 1YB7A 1PDOA 3JXEA 4MPDA 2ZP1A 1CFZA 2PGOA 2II6A 3IEIA 3ML1A 4WDQA 3PTLA 3C0KA 3DJYA 4ALKA 1VKZA 3FBWA 3MCUA 3HN7A 1CDOA 1XN4A 3E3NA 4FFLA 3VYVA 3I2FA 5JMTA 3MJRA 1NVGA 2WTAA 3BH6A 4GOJA 3U37A 3TNYA 4IGIA 1G8PA 2O1EA 4B3FX 2QE7D 3M3HA 4E4RA 1X38A 2VHVA 3HA7A 1W52X 1SQ0A 4J7XA 4JR1A 4QLAA 1DIBA 1T15A 2HSDA 4EUNA 3B82A 2ZPTX 4KXFB 5MN5A 3EPHA 4NYMQ 2WIDA 3QG1A 3WL8A 2DERA 1LJLA 2ZUDA 3N1UA 4I9GA 4AO7A 4YY3B 1ZWLA 3IH5A 3OUUA 2CFOA 1B76A 1UKEA 4YCLA 3AGQA 3KPWA 2E5FA 1HYQA 3O91A 3A9WA 3I42A 4NNJA 4DG8A 3WGGA 1TTHA 3MD9A 4XCVA 1JIIA 1THMA 3DR3A 4MQFA 2WKRA 3CEAA 2NNWB 4HNAB 5FBRB 1TT5A 1ZLYA 3ZBTA 3CW2A 4W5NA 5KDOA 3AJDA 4MYUA 4GGOA 2PRSA 3BMQB 3E2PA 2UZ3A 3HFGA 3I8OA 3IBSA 1SIOA 2I54A 3JARB 4GE3A 4LNAA 3WAGA 2A59A 3I64A 3V4VB 1JFRA 4RE5A 4ZDJA 3JYNA 1D6NA 3JQ9C 4IFEA 1S6YA 2FDXA 3GLRA 3HJRA 4M7PA 4M53A 4YECA 4EA9A 4Z5XA 1BDIA 1NNLA 3LFTA 2QAGA 3N6VA 4C43A 4M0PA 1ZOPA 3F7NA 3HDJA 3O74A 3FSGA 1JVBA 1OX5A 4YBZA 1JU9A 2NSHA 5LL6P 2GO7A 1D2GA 2JFFA 5EHGA 4IIUA 3EULA 5BN1A 4X6UA 2FJUA 3DO5A 3GHYA 3K2BA 4JJ7A 4DABA 5SYNA 1T9GR 1B8VA 5LIPA 1Z2OX 5CGZA 3QLJA 4D8TA 3UJ8A 3CIOA 4QQRA 3K15A 3WK6A 1V5WA 3LBNA 3IUQA 1N6OA 4MLZA 4RH0A 4CIDA 4GR5A 2G0AA 1MBZA 4MWZA 5KQGA 1IVNA 4RWZA 3SDZA 1Y1PA 3IQFA 3LBIA 5KWVA 3SHWA 2QW0X 1WPXA 3PT9A 5EE5B 3BWBA 3KQHA 2BM8A 1I4DD 3RHZA 3ZEIA 1JHAA 1RQ7A 1LLQA 2YXBA 2Z5FA 1GPMA 3V55A 1SHJA 1C80A 4W1QA 3GWGA 5EIEA 1G8SA 4ID3A 4HNVA 4LHWA 3ONEA 2O23A 2XUFA 3KOZA 3OQ1A 4FOSA 4BVBA 1P74A 3NBMA 3IO3A 3WV4A 3E9CA 4US0R 4BO8A 3FVRA 1II0A 1FFAA 3B38A 3L93A 1BYIA 2NX2A 2YC4C 3IJ5A 4REMA 5H70A 1O8BA 2YVUA 2A2ZA 1E3MA 1WCXA 1XDUA 3MAGA 2HXSA 2OBXA 2G07A 2RH4A 2J85A 2IV2X 3T4UA 2V54A 5CB4F 1LPOA 2P5UA 4KU4A 1WXDA 1R0BA 5JXIA 3N76A 3TCNA 3AH8A 4HNGA 1D2RA 1U4NA 5LC1A 1M10A 2RFLA 1MIOB 4QATA 4QUIA 3IT3A 4YACA 5CVUA 1USGA 2LBPA 2BP7A 1S01A 3HDTA 4G24A 3NGMA 3GI1A 4ZC1A 4X44A 5G4KB 3RWBA 3TZBA 4ZICA 1Q0HA 1FDOA 4UDOA 3S2YA 4F21A 4JL5A 1UOPA 1DEHA 5K3BA 3ECAA 1F8GA 4L2IB 4C21A 2EU8A 1PK7A 5JW6A 2G70A 5CX1A 1S8AA 3H5TA 3H8VA 3LO5A 4MVJP 5IKXA 3AHHA 2FGKA 4HQOA 3AF5A 5IH7A 3BZWA 2Z1NA 1CJMA 1TKAA 4HXEB 1KU0A 3CNLA 1J0CA 3SSOA 1Y6ZA 1JDBC 1H05A 1YTLA 1LK5A 1P4GA 5B7PA 1B16A 1ZEJA 2QUHA 2VWQA 2I7VA 5DBHX 3RB8A 2D5IA 4TSKA 1VQ1A 1YKSA 2GEVA 1FC0A 2H65A 1W4RA 2VNIA 3EXG1 3MIZA 4HD8A 4OQQA 4DIUA 3ETLA 1NMZA 5EWJA 1PYDA 2ZUEA 2QN6A 5AJYA 1DAIA 2DR3A 4CR8A 3IKLA 2P79A 3HS3A 5K01A 4YWHA 3RT1A 4DSZA 3W8NA 1KI6B 3RS9A 4D6YA 4RNCA 2GERA 3CG0A 1D7OA 1RQPA 2P2SA 3L4BA 4QASA 3LWBA 5AHOA 3HO1A 3WLAA 4BEJA 1ULTA 2A86A 3O2NA 4YALA 1TJPB 5C46F 1BFUA 3RKUA 4WCFA 4ZXPA 2VIIA 5CYPA 3BAZA 2CUZA 2QB5A 2WJAA 4XWOA 1PR0A 3D6AA 4UHKA 1KEEB 1JPVA 3MB8A 4RF4A 4QYMA 1QJCA 2B36A 3NQ41 4OSPA 1Q19A 2D3TA 1A88A 3LIIA 3DJFA 3L8GA 4LWQA 4S2EA 4YJ3B 3B89A 1ZQ1A 2CD9A 2V6GA 1RIIA 3CTPA 1J6UA 4MWTA 3KE8A 3I1IA 4COOA 2L0XA 1DT3A 1E2EA 1PNTA 4QVKA 3H99A 2XQVA 4Q0MA 1QKKA 2LTAA 5CX4A 5TVGA 4EY7A 2DHCA 3FTFA 4PTZA 4LJKA 3KG2A 4NL4H 2WB4A 4EMSA 4D0SA 5E4YA 4BP9A 4WKOA 1SXHA 5JZVA 1B73A 1TGVA 2JZOA 1KERA 4RH3A 1J1ZA 1FYDA 4HLNA 4UM9B 4DR6B 1LDGA 4FYHA 1D1TA 4B3BA 4CF4A 1BGVA 5FFFA 2JAHA 3TBKA 4C03A 1Q1BA 4M6WA 5DZSA 1HC7A 2IYVA 2I6TA 5CEJA 1MEOA 3IYLW 2J6HA 3MF4A 1F8XA 2CL6X 3QV1A 4BMCA 4JCCA 3PV0A 3QKRB 4N7RA 3VNQA 2CV2A 2PTHA 4MKXA 1Y8RA 1FEZA 1R50A 2HHHB 4Z7NB 4EJSC 2ZXFA 1TAQA 2BGRA 4ZK2A 2XLBA 5I45A 1VB3A 2PR7A 1V11A 1L5MA 4DV1B 3IV9A 3SC3A 2ZE8A 3EGXB 3D9QX 4KPUB 2B2NA 4GPEA 5A2QA 4JJ8A 5KSZA 1QLJA 3ZU2A 4DNQA 1VHQA 1UK8A 3NBAA 5HF8A 4UBKA 4ENPA 3K1YA 1Q14A 1KL7A 2A67A 1TB4A 3DQPA 3DTVD 2WDZA 3LQ1A 1NQTA 4DYVA 1K1EA 3CZQA 4CKXA 4CT5A 5BSHA 4O4JA 1M67A 2ODBA 4ZFNA 2CLMB 5KTNA 3QVTA 2QVLA 1M7BA 1N5LA 1XZIA 1YI0A 2WJWA 3ZE2B 5KNDH 4I1VA 4N76A 3JZFA 4TSFA 4EBFA 2J0UA 1UL1X 3FFTA 4ED9A 3KTDA 3CIFA 1VLLA 3EZNA 2FZLA 1RDFA 2QRUA 2V9ZA 1ESNA 2NU6B 3HKBB 4ENQA 4I1PA 1CS0B 2IIQA 4N8DA 2CB0A 5C7OO 2EFJA 5CYGA 4I99A 5TMBA 4OKNA 5E8RA 3H17A 2C9MA 4MQMA 1MRSA 5IAKA 1OH5A 3RH0A 4V0QA 4E88A 1C8KA 1V37A 1MNQA 1YB1A 1T5HX 2X3UA 3IDOA 1Z8HA 2BMFA 4KIFA 2OOKA 2ZWMA 3RK0A 2Q5FA 1KVSA 1D2NA 3C6KA 4G1UC 4LXGA 2K2QB 4P31A 3EZGA 1YQWA 2PWBA 4KQWA 2X0FA 3ELDA 3ZY5A 3HLTA 1OH7A 1UPBA 4F2GA 1H0HA 2C1XA 4IUDS 1TZBA 1P5HA 4QTTB 1VIAA 1QE3A 2IH5A 5TB5A 3KJNA 5K8CA 3O4IA 4Q21A 2IY9A 1ZOOA 1RVV1 1WVMA 5AVJA 4AYTA 4PG6A 1DKQA 3BZBA 3GEBA 1FFBA 3OZ7A 1K68A 3E23A 3QJGA 1X1AA 3N2EA 4KUGA 4S1PA 3FE2A 4D02A 1PGNA 2GASA 1SVKA 2VWPA 2CNDA 1A8SA 1T1JA 2A0XA 3KXDA 3GNLA 4J3NA 2WD7B 1GWNA 1IG0A 1ZL2A 4MDHA 2XBMA 2HV9A 4TS3A 5ELMA 4DQXA 2AXNA 1TAGA 4P5DA 2FXIA 2OFFA 2GCEA 3VSDA 2Q1YA 2YR0A 2EAUA 3FHOA 2GJSA 3CNNA 3DAHA 4CF7A 5CFNA 3W9UA 1QFJA 2YH2A 1U11A 3B6ZA 5IVIA 5EJIA 2J5BA 4JBYA 2BFPA 1JAXA 5BRAA 1VG1A 2QRMA 1UQTA 4P81A 2WWVD 1IJBA 5DLQC 1ISJA 4PNEA 1M0WA 1AUPA 3RSZA 1Y4AE 4DMGA 1YRQA 4IHJF 2H1SA 5EJ5A 2QM3A 1RAEA 5DXFA 2Q1XA 4FNGA 3M5WA 4RKQA 4Y2YA 1DQZA 3IKVA 2LKDA 1XTBA 3BD6A 2WIFA 4KAJA 4R8MA 4CG1A 3RAJA 4WXEA 3EPLA 1LZLA 1DEKA 1GITA 1S8NA 2C3OA 3HCDA 4XD7D 4V1CA 2CXTA 4Q93A 2XGSA 4DMRA 4QBKA 1UKCA 3TAUA 3E7FA 2WWWA 2NSDA 2IS2A 1ORHA 1X7WB 2GOYA 3MTGA 1G21E 4U5XA 5TMDA 3O38A 1NURA 1SUIA 2NO1A 4WXMA 4XASA 2ODPA 5FLKA 3V4RA 4BKUA 2VUIB 4DLYA 1PT5A 1Z0FA 1C3EA 2PJRA 4R9UC 1G1AA 1E0KA 4FBLA 4A2CA 2WZQA 2ONYA 3ONVA 4IXNA 2QRNA 3GFQA 3KKMA 5JXGA 2WE7A 1OZGA 4L4XA 1XD2A 2XOKA 3HCBA 4IV5A 1JXOA 5EP2A 3OLXA 5DHSA 2A84A 3W2HA 5A6VA 5U4XA 1ZMOA 1T3HA 3PPVA 1CVIA 2G1KA 2OV2A 3Q4GA 5ECWA 4EHNA 4MV1A 3E8XA 3F0TA 3N87A 5JSYA 4P3NA 5KNDD 3E61A 2HH9A 5DCWA 1SUWA 3AP2A 1KJIA 1SUBA 1DWOA 2IDJA 3TGWA 1N3IA 2AZDA 4RKRA 4AJHA 4DT1A 4AZ0B 1OLUB 2CFTA 1W36B 2YZGA 1EWYA 4YLEA 3R5JA 4N3AA 5DGDA 1H2HA 1DC3A 1GGHA 1PP4A 4L7QA 2FSUA 2HCRA 1BW9B 1PFWA 1OA0A 2QXTA 3IIMA 3MMNA 5E1OA 3RF6A 5HJ5A 1JEDA 4WY2A 2WM2A 2NTVA 4X0EA 4L15A 5JCOC 4OXIA 2A9JA 2IYEA 4BVAA 3M0EA 2X76A 4L0QA 1RYMA 4LC9A 5FKJA 1E5VA 2PZ8A 3KZ1E 2PZLA 3ZDFA 4F5WA 1O2DA 3WA6A 3F74A 3ENWA 4RZ3A 3AHIA 3KQTA 2IXEA 4MV3A 5FI0B 3RYHA 3S0JA 1KETA 5A6SA 1JTVA 8OHMA 5K0GA 3HN6A 1N9GA 4M9CA 2DFVA 1G0NA 1PVOA 1RIFA 2GEFA 3EC7A 3G0OA 4UPDA 4OG2A 3SC4A 2WWYA 2VL7A 1KAEA 3G2NA 4HATA 4BLQA 1M0TA 3U60B 3W8EA 4ZALA 1O0CA 1NNEA 4CMAA 4DDKA 2ZZMA 4FLEA 1X74A 2VK4A 1ITZA 1A4RA 5BR7A 2X86A 5G0UA 1G5IA 1FMCA 2PYZA 4IEFB 2PKQP 2X7HA 2ILVA 2PFSA 3ETNA 2PKWA 3FY4A 1YD7A 3IURA 2DWUA 3RVMA 4A2PA 3ZDYB 4YJGA 3D0RA 2RGNC 3QGMA 2LP4Y 1QH1A 2OCBA 2ZJZA 3DMHA 4GMFA 4ND2A 4R9SA 4UTXA 1XRPA 5BNTA 3RO7A 3WLJA 4AYXA 1YO6A 2Z1MA 3OZDA 2B4KA 4XDGA 2QF7A 3OCVA 4Y0AA 1WY5A 5EQFA 4KXWA 3CNEA 3OCJA 5J59A 2N3ZA 4CEJB 1S2MA 2PUVA 3HUTA 3OUTA 3PQDA 2V3CC 2F59A 4M1KA 2RK4A 1YIOA 4LHVA 5KS2A 1K3FA 5HIAA 3BPSA 3R5TA 2BCJQ 4WAUA 5LN1A 1Y48E 1AHPA 3PKZA 5KYTA 1Q57A 4OQDA 4BAZA 5J40A 3LPAA 1ICIA 1YDHA 2HBQA 2UVDA 5FF9A 1T1RA 2C78A 1RWXA 1Z4PX 1JKMA 4MGHA 5IEJA 2PG3A 2Y66A 4J6FA 1FL9A 1R4NB 4YAEA 5JTUA 1OH8A 4MA0A 2XODA 1WPQA 4KQKA 1YHYA 4UEOA 1NQUA 1P9NA 2INGX 2GD2A 4N0DA 121PA 5ESXA 2J48A 3BGVA 3ZD9A 1QTQA 3BEDA 5BYKA 5CDTA 3D3EA 2NIPA 3CE9A 1YRYE 4BJ3A 2QQ5A 4OHVA 5TNXA 4YEDA 4ARBA 4B1FA 2YHBA 4LE1A 2WK1A 4G56A 3P5BA 4X7BA 1AF4A 1YDEA 2BHLA 5LB2A 4DNFA 2DSTA 4EDHA 3A1CA 4HTFB 5TPWB 1OWOA 3GDWA 2V4UA 4MWBA 1ZCZA 1BXRB 3W6ZA 2JLVA 1OX4A 4Q1CA 1LK7A 2PSJA 4EYEA 2P41A 4ZOLF 4E32A 3JQ7A 1JFVA 1LLUA 2VVTA 5NLLA 3X0DA 2ZPUA 4R9RA 5A4FS 3ER6A 5EZYF 4QGSA 4MPTA 1P5FA 3NTRA 4EOGA 4NBTA 3NTQA 1HE3A 4GXTA 5A4MS 5A05A 3DZJA 1M5UA 3D7LA 1S3GA 3IIEA 3PQ5A 4CFYA 2EZ4A 4XA8A 1H85A 3D2BA 3A25A 5FOXA 5BNWA 4HQRA 5FWYA 4I1YA 2IPOA 2HF7A 5AMXA 2PUEA 2OESA 1FYEA 2Y8EA 3TOZA 3L6UA 2X0KA 3T41A 2O4UX 4PLZA 3HN2A 2GCOA 4TGLA 5C8YB 4BPBA 2Y0BA 1U2RA 4PZ9A 5F3DA 3E7WA 4OM8A 1GGKA 4Y7DA 1JQ3A 2W6JA 4FLMA 1UT6A 1ZESA 2PZGA 3W8RA 3DB1A 2QJOA 2DR0A 1F12A 3GLHE 1CUUA 2VI5A 1BVYF 2XNCA 3IPYA 4E21A 2FX5A 1DQPA 3ED5A 1WXHA 2JHAA 4ARUA 1M1YA 4KFTA 2PX4A 2Y0PA 4ZTZB 3N2GB 3V4FA 2C0PA 3C3PA 5GVSA 1GKKA 2F8MA 1N6HA 4C0AC 5FTLA 2YJTD 3N2NA 4ZWNA 1UKZA 1NBMD 1G4HA 2DFPA 3LY7A 4ZT3A 4ROTA 1HFEL 3KC2A 4COKA 2UZ1A 1VI6A 4BXOB 4N8SA 5GVRA 2R7LA 2E55A 4DC1A 2QRJA 1EIWA 4WEOA 5ER9A 1RLTA 2MMGA 3WJ7A 1N33B 1IEXA 5JSZB 5JYCA 3GUVA 5BSVA 3VHXB 3FF4A 2PDAA 2ZJ2A 4IPTA 3SMQA 1XJWA 1LK0A 1W0CA 3GT0A 4MTCA 3TQIA 3G79A 3EDYA 5J5AA 2HQSA 4H35A 4MMXB 1PN3A 4E6PA 3AETB 1AMNA 1BX3A 3HR7A 3KVVA 4JT8A 2PU5A 4C7OA 4LVOA 5CA1F 3EN0A 3JD3A 3JX9A 3HBLA 1JIXA 2C4TA 2JGJA 4IIJB 3EVNA 4TV9B 4CE6A 4K2AA 2EFCB 3KL2A 3NM5A 1TJ3A 3BE6A 1AQIA 3HZRA 3GMTA 3B60A 5AKKA 2WOJA 3OPQA 4G5SA 3OPYA 1BHSA 1ESDA 1KY5A 3MJDA 3PGKA 4KDFA 4KTVE 1Z35A 3EGVA 4R1LA 3VX3A 4CCYB 1SOVA 4LJRA 4BQEA 4HNQA 4JGIA 3JD1A 2Q3FA 1NVVR 1RE1A 1OIVA 3EPRA 3IUEA 4YRFA 5BOSB 4RF5A 3X2EA 1P73A 1XTZA 3STTA 4MK4A 2ALJA 4C89A 3EQ7A 2F9LA 1K5DA 3KDAA 4XYGA 4OATA 3AVYA 3EXIA 2YJNA 3EB9A 4YQEA 2I3DA 3DE6X 5K9ZA 3VSCA 1FBNA 3BGWA 1LI7A 2YHAA 5A0VA 1O6BA 4EQ6B 3IP5A 1ZSYA 1L7VC 1J1IA 3ICPA 5CH5A 4AY2A 5JADA 2EXXA 2Y1CA 3U3RA 5IMSA 3EUEA 3AY0A 3VSEA 3P2YA 5H9WA 4WESB 2ONJA 4Z4EA 1CJSA 2FWAA 3VO9A 2GAFA 2D2IA 2N0SA 3QH4A 3WB0A 3DEFA 3B48A 3IOMA 3PWSA 4HGZA 3SFZA 1EUYA 1PZMA 2LIVA 1VE9A 4M9QA 2ID8A 1UDBA 3KAJA 3QXGA 5BSEA 5J4HA 1R6DA 2AI1A 2BH9A 3ZWWA 1BRTA 3LA6A 3RFCA 3HBJA 2ZKLA 4L6AA 1MMFB 4Y1RA 3AG5A 3PA8A 4CTMA 2YY5A 1XTUA 4C7VA 1OWNA 1ZM3A 4WBNF 2VH2A 3UO8B 5KNCA 2WIJA 1K66A 3AWDA 4W1PA 1APBA 1WDKA 4G8BA 1B3BA 1E7WA 4JLWA 4JT2A 4X64B 3M6AA 1F06A 4CM7A 3GJ4A 4TWRA 5EZQA 1UJ4A 3Q8LA 3MTAA 4JC0A 1WVIA 3DBRB 3MTBA 4UARA 1YHNA 3T61A 1D2EA 3BFXA 4ASUD 1VDZA 1EA5A 4P34A 1OYWA 3KUCA 3H97A 2RHHA 3AEUB 1DP4A 3V8QA 5BWOA 4W5WA 2JG3A 1TLFA 5C5EA 1IXKA 1XL0A 4FYMA 4PGAA 2ZU0C 3LZDA 4MPJA 4FEAA 4NOLA 4NABA 4DA9A 2TMGA 1BQ4A 1PHPA 4B3TB 5DGIA 1VPLA 5JCJA 3GX1A 4EO9A 3DNFA 2ERCA 3L4EA 2CLEB 3M33A 4C4RA 2X4DA 1UJ2A 1VCMA 2EW8A 4LBVA 4Q00A 4B4VA 2ZI7A 5LMNB 2CCJA 2F1HA 3HNOA 4TV8F 1O94D 3DNPA 1FFWA 1U8YA 2RDMA 4OMDA 4RUKA 3ZPXA 4N48A 2C00A 2Q6IA 4IKEA 3KLBA 4A1FA 2MR6A 5THXA 1EHYA 3E22A 4D4LA 4EVRA 2WYHA 4HDRB 1HORA 3NOOA 3QKTA 4C78A 3V3TA 3CISA 3BRWA 3IOCA 1E1QA 2EWWA 3AUTA 5LNK6 2I4IA 2AH5A 4MXDA 5HIJA 1K6IA 1XP5A 3LNCA 3KIPA 3C5CA 5FOUA 1BXGB 5AUOB 3TRJA 4F11A 2ZYDA 3RRFA 3T3MB 3NHAA 4KRXA 4KQIA 4JDUA 1ZLXA 4QO8A 2W43A 2AK3A 1VTKA 1Y37A 1A8QA 1WMFA 2FW1A 2GBLA 2NTYC 2VT2A 3FKQA 3PFHA 2PL3A 2XRMA 3D4PA 4TS1A 4O4IF 5AW9A 2IP1A 2XLCA 2JCSA 2AEJA 1Q3TA 1NE7A 1RHQA 2BE9A 4CMHA 4E22A 4HUTA 5LU9A 1YUMA 3AERB 1KK1A 3TZKA 1ACLA 1WUKS 2PZBA 3VZPA 3QBJA 4PW0A 1BJRE 1E2QA 1NW3A 2CMKA 3RBAA 3UUEA 1Z12A 2QW1A 2YBDA 3D5QA 2WHPA 4JVMA 4TYMA 2HCBA 3THSA 3MOGA 4ZKEA 2W6MA 2RGXA 3PZBA 1B4DA 1FX0B 4HX5A 3VPDA 4B76A 3CUEF 2G0TA 1P9RA 1Q17A 2WV7A 3N5KA 3TG2A 4NBUA 3ZLJA 4Z4FA 1GLNA 3LJKA 4DSTA 4CM3A 1U65A 2PRYA 4Z49A 1YWGO 2HRQA 3RQSA 2BFFA 3I53A 3GEEA 4FCVA 4LKRA 3VPFA 1IEWA 2YMMA 4BNHA 4E1BA 5E38A 1PGJA 1LCIA 1R2QA 2PT5A 2X9VA 1GFWA 4HWOA 2IEDA 3AQ4A 2XUAA 4G1CA 4I50B 4TRMA 5T6BA 4MHTA 1Y8QB 1CFJA 4P3PA 1T43A 3BMNA 1CY0A 2ZJ6A 3R3WA 3T7KA 4HZIA 3QTBA 3OTGA 4ONEA 3O3NB 4YDRA 1XKLA 3FCEA 5LZ2A 2V9CA 4A5OA 1NNSA 2EBWA 3ZCTA 1VE1A 2BGNA 2CXOA 3B20A 1VPVA 4HMPA 4HSGA 3DTVB 4NE2A 4IMJB 2VDKB 3JQEA 1EBFA 3I5UA 4BB9A 2ZJ3A 1WO8A 2PYIA 2IHKA 4HNSA 1F0PA 2BGTA 3CWZA 4HYQA 5DTMA 2Q7OE 3RUEA 1Z16A 1RXVA 1MA0A 3CYFA 1WKBA 4XR9A 3RRYA 4PZUA 2Q5EA 4CHTA 2HYIC 4PONA 4AIRA 2W6QA 3K96A 1FW6A 2OC9A 4C9BA 1OLOA 3PFGA 4HGPA 3FCUB 1UJBA 4ZDKA 1ZOIA 2PT7A 3SQDA 1HQDA 2XMDA 3VU9B 1IL0A 3BULA 5IDYA 3N75A 4YK7A 1OJLA 5DRTA 3OFSA 2C4WA 3D4NA 4RFSA 3GEDA 4YMGA 3VAZA 2FR0A 2PAAA 1NUHA 2JIMA 3MCTA 1NBHA 1NVMB 2XMGA 1XAJA 4AJEA 1ZMXA 5KYGA 4QLBA 1W88A 4TTIA 4JSRA 3P0HA 2AN3A 3SP1A 1SN7A 1J33A 5ARBA 1FXSA 4I66A 5FORA 1A4IA 2EF1A 3CPSA 2Z8YA 3IPLA 4NCNA 2DT5A 4IJ5A 3WIDA 3PX7A 2TMYA 3UJ7A 1ZINA 2C2YA 3J7TA 5C52B 3RSFA 3EY4A 5ANRB 5KB3A 4TLLB 3VVBA 1KJJA 5EUQB 3KAQA 3LCMA 2X1MA 3ZHVA 2O9JA 3TPCA 1T0IA 4MKZA 4US2R 3UXHA 2JA1A 4B09A 1H1TA 1W0JA 2R79A 2Z83A 4UDXX 5DYGA 3RRBA 5JS8A 1ORWA 2D00A 3P4XA 3GFVA 1FP4B 3FSGD 5JCOA 1XG5A 3F3KA 4TPKA 1O95C 3WOHA 2GN4A 1Y3HA 2A78A 2XDQB 4TMXA 1BMFA 1DBIA 1R6AA 2GKOA 2QNIA 4FDTA 4EB6A 1VLHA 4I5DA 4PZEA 4FK8A 5JSHA 1GG2A 2JJ8A 2Y0CA 3AIKA 4DIOA 2GO1A 1W85B 1NI4B 3RTCA 2VYNA 4FUQA 3IODA 3L3BA 4I81A 3WMXA 1RC0A 2JAXA 3SVTA 3BC1A 2Z2XA 3T15A 3D2AA 4NCBA 1RKQA 5KWSA 1AO0A 2HADA 5E3JA 4H6WA 4PYKA 4OYHA 5DYNA 2ZIWB 1XVVA 1M2HA 3ZDAA 1D2CA 1H22A 3WGOA 5H4HA 4I6JA 1GL7A 2H06A 3BERA 2R8YA 3GFPA 4J91A 2V1XA 2IJGX 1CKEA 4UMEA 4MYDA 3KZVA 2ROQA 5AWFC 1KGSA 2AGVA 2E7ZA 2HA2A 4N7BA 4DPLA 4FB5A 4IZOA 4F3CA 3A9UA 3U39A 5BV2P 1ST2A 3OZBA 1Z63A 1NZJA 4QPPA 4BNZA 4GQIA 3AVOA 5C2JB 5K8VA 3RSOA 1E9RA 3ZQ4A 4CQLB 5JDIC 4L0MA 4EF6A 4BFLA 5FNVB 1Q20A 2IZ0A 4O08A 2G6BA 4WT7A 3FJOA 3AU9A 3TYXA 3TUJC 2IOFA 1E59A 2M32A 3HR4A 3ZLVA 3A6HA 4AWAA 4ZO4A 5BWMA 4FDUA 4OB8A 3D7KA 3FNRA 3KUKA 4PSKA 1IHDA 1PR3A 5AUNB 5HZGA 1QO0A 3JZDA 5CA0B 1Z0JA 4AUEA 3IEMA 1YRLA 4OLBA 5EXDA 2W8ZA 4BKPA 4N6NA 1US8A 4JOSA 2HMVA 1ECBA 1ZN9A 3EG9A 2AOVA 1UBGA 2HRDA 3EFOA 1BGWA 3WLNA 3CPEA 1T0BA 3T1VA 2F43B 3QWAA 5DM1A 5H81A 3R3ZA 1PZXA 3KQVA 1CHDA 4Q1VA 4U8GA 1XALA 4NNPA 3GLGA 3RVOA 4I3GA 5A0TA 4R1OA 2LRHA 4OXXA 3ME5A 1AZTA 3JQQA 3H2KA 1F7UA 1NIJA 2DHEA 2D7JA 2IYLD 2V9PA 3BAFA 2GBIA 4G26A 3JQBC 1Y7PA 2XWJI 1DBSA 2Y1WA 4CL2A 3DZIA 4DM3A 4ZYYA 1HO3A 1R9JA 3A05A 2LV8A 5JCZA 4Q24A 4YJFA 3VVLA 5EJ7A 1W5TA 4G0OA 1JKFA 2P67A 2IYFA 2W2QA 3MZ0A 3KL4A 3UH1A 3BXOA 2M98A 3H5RA 1M6HA 3MUFA 1TM5E 5DNEA 3K9FC 5I6DA 1T3LA 2E4XA 5ILQA 3RYCB 2OQ2A 3H9BA 5TF0A 4DR5B 4Y3UA 4AZ3B 4WN9B 4RESA 4OAQA 3HRIA 2FPRA 1OFTA 3NXSA 4R31A 1A97A 4UCXA 2EZ9A 3E27A 2O2JA 1ZO8A 4RCZA 1CNEA 3AKDA 4HDQB 3HXKA 1U2TA 3N3BC 4Q02A 5AVQA 5K6TA 4FXPA 3EK2A 5REQB 2FR1A 2ZS8A 2ID4A 2YRXA 4YJ2F 4RIHA 5FBQB 3ZE6A 5TF4A 3COYA 3JWGA 4OPMA 3H4MA 2REQB 4YCSA 1FDSA 1OXXK 3EAGA 3ZDEA 4YJKA 1GPH1 2HK6A 2Y67A 3GBPA 4L22A 4ND3A 4X7MA 4YDHB 2HJVA 5KYUA 3RHTA 4XPIA 1PV1A 3EAQA 3KJXA 2JGNA 5FL3A 1G9XA 5FD8A 3IQEA 1XHFA 2OO7A 4MR7B 2P7IA 3A6ZA 4Q39A 3UV7A 5L3VA 1LFAA 3G9ZA 1BA3A 2OBFA 2PLNA 5LQRA 3CVVA 2OFXA 1PDWA 4EZEA 2AOUA 2NAPA 3LPLA 4WH0A 1BH6A 5JYEA 3R23A 1UFVA 4YJDA 1IVYA 3L4JA 3OE7A 5JC8A 3ZV3A 2D7DA 1J5XA 1ZN7A 2CXXA 3OQMA 1AK2A 3E9ZA 3FN4A 2GJAA 3WJ1A 1QH9A 2V45A 4LNUB 4XUDA 2PY6A 3KQSA 1QAOA 5KCMA 5CCXA 4MV9A 4NRDA 5E6UB 3KYCA 5EP1A 2ZIFA 3K0HA 2GLUA 4ND8A 2V6FA 5FL7A 4URFA 5FRDA 4TVBA 4EP1A 2JH9A 1ZVVA 1SCNE 3PZRA 4M7WA 5E9AA 2R8PA 1GAEO 1EQAA 1PG2A 4LZLA 2QBYB 4W9NA 4JUCA 3HVIA 5DIZA 5F51A 3DTNA 3H16A 1E2JA 4FBMA 1MVNA 4MR9B 3WL3A 1JVNA 2FQXA 3F6EX 4WKNA 3UY4A 1G8MA 2PVPA 1FPQA 4R8KA 2OBMA 5CM9C 1WZIA 3D8UA 3GGJA 5TJ9A 2XPCA 2AFHA 2J31A 2HV8A 3BORA 3PXDA 1OTYA 1Y6RA 3A4IA 4QAJA 1YE5A 4F1JA 1F0NA 2XMQA 2H1LA 3P2JA 5BSKA 3QLTA 5C1DA 1U04A 4IIGA 3ZNNA 1WAMA 1BYUA 3DWGA 1MIHA 4E1VA 2RGEA 3U3JA 5GAJA 4N6OA 5BY2A 5L51A 3BMXA 4JJ6A 1M76A 2GK4A 1H94A 2YWDA 3K3PA 3VFDA 1SOUA 1RRPA 4R0VA 3OOJA 4R9VA 3GPDG 5EE0A 5C37A 4AY6A 3HYSA 4PANA 3ZE1B 1JMVA 4B75A 4EW3A 4OQEA 4FYXA 2PKQO 4WIAA 4RLHA 3KFVA 4JVSB 5DWDA 3T3NA 1KC3A 3OESA 3K5WA 4FX5A 4G36A 2JH8A 1R4AA 3CEPB 3OY7A 4EVSA 2ADMA 1AXGA 1W4AA 1V16B 1E99A 4KQ1A 1G19A 4GE0A 2IXGA 3ZKWB 1ZRHA 4B6PA 4RTJA 2UVPA 2AG8A 4N18A 1YVEI 1KRHA 1NXXA 5GGYA 1VG9B 1QF9A 3L46A 3WAJA 3JAMA 1K7SN 4IIEA 5DRYA 2HXGA 1FYXA 4TN1A 3HV0A 1O94C 2C07A 4BQOA 4GPBA 5MF6A 3VNUA 3RW9A 4QYIB 3OPMA 5EIBD 2KWIA 1EXVA 3PSHA 1KVQA 2UUBB 4AF8A 3SS9X 2PQMA 3K9HA 5DNUA 2J3LA 2GETA 1EFVA 4TKVB 2E4AA 1Z22A 1V6CA 2KI5A 1RXEA 4G65A 2XOEA 4X8OA 4FE3A 4NTZA 3TSYA 2HT6A 1MAWA 2R6JA 2AZTA 1ZUWA 2C8KA 1ZI6A 4RGQA 4CLRB 4RJTA 1KI3A 3JSAA 3NDBB 4HFJA 1OZAA 5AVTA 3IP1A 4MWGA 3V8NA 2X9GA 3BH7A 3UJDA 1SM4A 1TA0A 2ZVDA 1WG8A 2QL9A 4NNOA 5AJTA 3DVSX 3VPBA 2OT3B 1QS0A 2KE5A 4Q7KA 1CXZA 1IFXA 3EA4A 4WFKA 2IPLA 1J09A 2JFUA 2YL2A 2Z04A 5BT8A 1NUTA 4Z9BA 1OFGA 3EXFB 2PE5A 5T5QA 2TRSB 3U6BA 4RMIA 1AZSC 2ATVA 2C5LA 5T4HA 3H2HA 1WMBA 2MYPA 4TQUS 1L9XA 3F47A 4H7FA 2JIZA 4LGVA 2AG5A 1ZMTA 2J7KA 3NVMB 1QGOA 3KWFA 5F1KA 2ZSEA 4FKZA 2ET6A 3M49A 5CLJA 2XOKD 2IUYA 3C5VA 1DG9A 1B00A 1ZS9A 1POWA 3BDIA 4N0MA 1YAHA 4KHPB 2DPMA 4RS4A 3KFLA 2LE0A 1W44A 1KH1A 1E4EA 5HOQA 3P20A 3TBFA 3ZWVA 1L4UA 4AJNA 3H1GA 2VNKA 5JDCC 2GMWA 3JWIA 1ACJA 1H2XA 1LU9A 2ZB4A 4EPRA 2IDMA 2YQZA 3RJ9A 2FY8A 3IPRA 4PRZA 1MR3F 5JYDA 3EVDA 1XUOA 3KR2A 5AT1A 3G0GA 5KHAA 2FFQA 1SO8A 1UC5B 2AEEA 4RYLA 1BS9A 2OZLA 3SYTA 5AM1A 3NPAA 1JEQB 3LMKA 4FCWA 5L3ZA 4Y9RA 3HP1A 3MS4A 4IF4A 1QU3A 1ONNA 2IIBA 1B7GO 2VP0A 1M2EA 4M9SA 2VZ9A 4M9ZA 4X1YB 3O84A 4AL4A 2GNPA 2YWHA 1E3SA 3IA2A 2BZ0A 2PMBA 1CEYA 2QE6A 2ZE6A 3GGGA 1I10A 3TTTA 1Q6ZA 3PQEA 2NV0A 2RHLA 1NBWB 2GPAA 1GNPA 3MCAA 4QEKA 3V8BA 4HX9A 1FS5A 5AUPB 1R8JA 1E2IA 3NKLA 2G5GX 2RBKA 1DRWA 4KJZA 4NU5A 4DMKA 3LNTA 5L7TA 2G88A 2G28A 5GQSA 4CZ2A 1NOJA 3U61B 1QIHA 1PT7A 1A9TA 2GK3A 3GUUA 3CM0A 1KK0A 4JOCA 3WMGA 5LOVF 5EJ2A 1NMQA 1R88A 3DMPA 5EZ6B 1QHEA 2I6SA 1ODFA 1HZZA 2WJHA 4PO1A 1SAYA 5D1NA 3VR6H 5IX8A 1UWKA 5SZIA 3CLRC 1H8HA 1YA4A 1YONA 4TT3A 1E94E 1OT3A 2EFYA 4XGQA 5FUVA 3PNOA 1I36A 3Q10A 3DDNA 4BNDB 1AQJA 3NXKA 5IBQA 3GLSA 3ANSA 1PR5A 2VPZA 2A5JA 4X92A 3W2IA 4CV1A 4D96A 1THGA 1SD1A 1R0YA 2H7CA 1NVUQ 1CR1A 1P29A 4B2LA 2WSIA 1WKVA 2AW3A 2XSZA 4KH0A 3R3UA 1ENYA 4LOLA 1U2PA 1FP1D 4QL3A 1KDOA 3GDGA 4S1OA 2R5WA 3OEYA 4S0XA 4HTAA 5BQOA 1XQWA 1QV9A 1OI4A 3OFNA 4CFZA 4XQCA 3N59A 1Z2PX 2AIRA 3L0OA 3SBDA 3EQ6A 5CAEA 1J24A 1YR7A 3RTBA 3ZYZA 4WBSA 5BT9A 2HW8A 4QC2A 2XTJA 4J9VA 3TXYA 4XYLA 1C14A 1H2RS 4YR9A 1M54A 1U5CA 1MA3A 3J7AC 2J67A 3PHBE 1SG9A 4Z53A 3BE8A 2BFEA 2HBYA 2IE8A 2ZBUA 2WVJA 3PUXA 3RT7A 1PWHA 3UK7A 5DNAA 1I7DA 2BI4A 4ER5A 2EW1A 3R24A 3CT6A 5FFMA 1FUYB 5JJ5A 3H87A 4GXQA 5KTMA 4B0PA 5HS4A 1Q7TA 5J2UA 1VL5A 2EQ5A 5A04A 3V1KA 5BYJA 1BDMA 4Y9UA 4RVNA 2FRXA 2H57A 5ITVA 3I4LA 1LSOA 3P4UA 1NM5A 2RKOA 5B3KA 1CUAA 3T5AA 2YOGA 2XAUA 3JQGB 4WE3A 1TDJA 2Q3LA 1MV5A 2A7XA 2EVWX 3GRYA 3HUDA 1P7ZA 1W5FA 4JUAA 3UAOA 2ZRPA 4F4FA 3IB3A 1S0UA 3HVHA 5I5GA 2G71A 3GFBA 1NF3A 2IEGA 3OMXA 3H5AA 3G3EA 5KKAA 5JCPA 1NJGA 1EA7A 1YBHA 5BQPA 1VL6A 3U4DA 4AF7A 3R09A 2KW5A 2D1RA 4UATA 3CLTC 3LZ6A 3DAOA 4L74A 1LB1B 4P7JA 5FWYB 1PR4A 4DCTA 3D8SA 5ALEA 1J8QA 2JBHA 3FKJA 3DDSA 3DFFA 3W6UA 2OHIA 3ULKA 3OU2A 3FI9A 5KNCH 2WHYA 3ZUGA 1KBOA 4KEAA 1T8TA 2ZI5A 2O2IA 4XQ0A 1DS6A 4RTMA 1T5LA 5BNZA 2EKLA 1KJYA 2V7WA 5FUWA 3RABA 1N2ZA 2ZG6A 1P91A 1U02A 4GLOA 4RU1A 5EP4A 1PD0A 1QB8A 2CWWA 5BV7A 5JPIA 2IH4A 1ULHA 2Q1SA 4QJIA 2QTTA 4KNVA 5ENVA 1GJRA 2H07A 2GNOA 2QOEA 2W6JD 4J0GA 3EE6A 1DXHA 4H60A 4LXTA 1JFLA 3JATA 5B3JA 4YBRA 1XZNA 3EZFA 2HL6A 3UXEA 4IJMA 3K1TA 4KIUA 3HWWA 1SELA 3GGDA 2O14A 4Q6WA 5TQ2A 1U9JA 1NBEA 2FPPB 1S9DA 1SUSA 2HA3A 4HGYA 4GOKA 4WLEA 5CLLA 4CMIB 4DCMA 3WL4A 3ZQ6A 4OBWA 4ZI7A 1BQ3A 2ZSDA 4A4DA 3OE5A 1KYTA 2CDRA 2NYRA 1GTG1 5D1HA 1FBTA 2JFOA 4JLOA 2BBSA 2BC9A 3PHIA 1GT91 4MR8A 4OFBA 2NYVA 3G2LA 1QK3A 5TRTA 3PNQA 4XVHA 1H42A 1P80A 2Y4OA 3EXEA 4RPCA 4M0DA 1YOVA 5SY9A 3RIMA 3L7IA 3VR6D 1ZAKA 2QLNA 4AP9A 5I7VA 4ZD6A 2HA4A 1V96A 2H2HA 1JEJA 2HO4A 3D8HA 1X9GA 4HDNA 3M6FA 4LMAA 4AMVA 4BB5A 4BCCA 4ITRC 2ZS9A 1S7CA 1GR1A 3FYUB 2HLPA 2P6MA 1E1DA 5JY6A 4GXRA 2RHJA 3SE0A 3UCFA 4X95A 2A9FA 4PAQA 3L4BC 4HAVA 4PGFA 2J8ZA 1GGJA 5TT0A 3ZY4A 1Z5OA 4FFOA 2CNOA 3ONFA 5DP2A 3F6YA 1YS7A 1E64A 2FK7A 3TD6A 2UYGA 4GP6A 4IIHA 4CNBA 4ER3A 4MQFB 2YYYA 1NW8A 1TT5B 4KACA 2IYSA 3ANLA 2ZWAA 3VJMA 2OXFA 4FYIA 3F3YA 4NZPA 1Y89A 1WTAA 2MSLA 1EHCA 4NZZA 3UQZA 1ABFA 4D57A 1D1QA 4LCBA 5KJEA 2JLYA 3C14C 3UW1A 4BCBA 2QAGB 2ZLBA 3EF1A 1XXLA 1BHQ1 3GLFA 2PK3A 2EJUA 2R8XA 3RROA 5LBIA 2AJCA 1MC5A 1U80A 1UWLA 1VPTA 2P6RA 4I6EA 1ECGA 3IMKA 3MGCA 3SQLA 4W5TA 3DPSA 4P7FA 1TVMA 1JDNA 1ZK4A 2G9QA 2PSFA 3U7JA 2C4KA 3SXUA 1BNCA 3H2SA 2CVQA 2BI8A 3GA5A 5IT5A 3EXAA 2FTKE 3MJHA 2QVXX 3UYLA 4BJ1A 4I4CA 4YPFA 4HB2A 5BRJA 3BS4A 2AXEA 4B48A 1W30A 2WUEA 5K3DA 3M3DA 4WKGA 4YP0A 3SOPA 4E4TA 4GMGA 4HLQB 3ZCVA 4X8HA 1MJHA 1VCIA 2KM1A 4D92A 2PMKA 4GFDA 1J9GA 1RU3A 3PUKA 5H7XA 2QVBA 3CVJA 4YAJA 5CD1A 3HDVA 1N4DA 4ZO7A 5KNCD 1NZDA 4NMLA 5CBPA 3T3EA 5EE3A 4BMXA 1YB5A 2WPDA 4NECA 2ZSHA 3ISVA 4QUBA 1M6VA 1VZ3A 3ASYA 3HWSA 4ETNA 1SR8A 1CJVC 2O2GA 4YYEA 1SKYE 4EL0A 2AMJA 4LYGA 5KKNB 1JLLA 1IAVA 1NUUA 1RC8A 1PVDA 1YH3A 2AN4A 2K4MA 5EYPA 1BVUA 2BP7B 1I3NA 4IQGA 5DV9A 4ISCA 1OHHA 1NXPA 4JP5A 1JG7A 4C0BA 1ZSNA 4D0GA 2Z6VA 3OX3A 1X0VA 2CXPA 3OEHA 4AUMA 3GCZA 3F6RA 2F67A 1JBKA 3A1DA 3MUNA 5CX1B 5JCJD 1I7QB 2H9YA 3UA4A 4PN3A 2JI8A 3W5CA 1LFDB 3FHCB 3RKRA 4DYHA 3DOEA 1HWYA 5T6MA 2J9YB 5LSAA 5I9NA 3WB9A 3AR8A 5ITZA 4C2UA 1FVOA 4CT4B 4L78A 1XQXA 4JYMA 1T25A 5C1IA 4UDNA 2B8NA 4LXYA 1KI9A 1QB7A 1JQEA 5D00A 1QF7A 4IDEA 4N6GA 4OJMX 4OLHA 3BRWD 4RKWA 4EJMA 1XI2A 2G4CA 3KYBA 1ZPDA 1E1QD 2HCTA 1S2NA 5EWJB 1PJZA 5JNSA 2V03A 4QTUB 3UG7A 4Z1OA 1QRDA 5AKIA 1XNJA 2ZUBA 3ICVA 4DSOA 1O9GA 1I5OA 3P0EA 3JQ6A 3CY6A 2DY1A 4C4YA 3M6XA 1YGPA 1MN6A 2BMEA 2JRLA 4WNAA 1J0BA 5EIWA 1DOHA 1EP9A 1T36A 1AVTA 3IGFA 1F5NA 2AF4C 5KIAA 3J81A 1XKXA 4Q9NA 2P4SA 5DCUA 5FI5A 4BE7B 2H4FA 1GFIA 3PSAA 4KKVA 3ZD6A 4WCFB 4BN4A 4YXWA 4ZMSA 3TZQA 3EQ2A 1K6XA 4PHTA 5DTQA 5LLSA 2B7BA 2IHJA 4HT3B 1D0SA 3BHMA 5COBA 3RI3A 4TTPA 3DZCA 1HURA 1P4HA 1EB9A 1QTNA 3NNNA 3UOWA 1JQAA 2ZITA 4HDMA 1TUGA 3SEZA 1JWLA 4DJJA 3IMGA 2G08A 1ZNXA 1OXVA 3NAZA 3U49A 2UYCA 2PIDA 3ZU3A 4DV0B 1GA1A 1PG5A 3DAPA 5D3KA 3U6KA 3DVLA 4AB1A 2OCYC 2PD3A 4FNAA 2W9XA 4ZT5A 3JAWA 4I55F 3EQ9A 4NH0A 4KOAA 2H1WA 1T2EA 2ZB7A 2QM8A 3Q7RA 3FAKA 4WLFA 4LGMA 3W90A 5EESA 4Y9DA 3ZU4A 3FPSA 1I2AA 2HSZA 2VDPB 3KPUA 2O5RA 4M0EA 4M6WB 4EW2A 3NIWA 1J1UA 2VCHA 3B78A 2P2ZA 4XUGB 1ZY2A 3JV7A 2ONKA 2B1GA 2PZAA 2AQHA 1NU8A 2CK3A 4BMDA 4WOKA 2NVBA 2E3JA 1O58A 3FWNA 3IT0A 1Y8RB 3H2BA 2VWGA 3EF0A 4FEGA 4GX5A 2OV1A 4IR7A 2HJHA 4E94A 3ZU6A 5KQSA 4QOIA 2WUFA 2OLEA 2O2YA 3IQZA 2FF5A 4E15A 2QP9X 4FMCF 4JFAA 3VM6A 1SU7A 1Y3BE 1HOTA 1USWA 2OCPA 4LSZA 4U7TB 1V11B 4M3NA 3RIEA 4A7PA 5EJ4A 1UDWA 2QHXA 5MN6A 1N9ZA 2CNWD 1UPFA 4RJJA 3N0RA 1MO6A 4G4IA 2D59A 1KEPA 1PGOA 4JYCA 4CKZA 3QP9A 5K2OA 4V3BA 1IIRA 2EQAA 3MMXA 1F4VA 5EJAA 3RT9A 2G9RA 3INGA 3TLGA 5IDQA 4UVEA 5L4LA 3M4JA 4BMOB 4LMRA 2IK8A 5A9SA 2RKWA 4O4JB 3EYWA 2H1HA 3O4HA 3G0BA 3C8DA 5B1HA 4JI8B 2QX6A 3TRIA 2O2HA 1K8QA 3BL6A 4BFZA 2Q6LA 2H31A 2J0UB 3AKCA 2IQ5A 1V9CA 1EJ2A 2PD4A 3UGJA 3CGGA 4P92A 4YT8A 3MMPA 4U5QA 3ZVKA 1ECFA 3LDUA 2AYZA 3F5MA 5IJ9A 2R6FA 4F86A 2ORVA 2AHRA 3HCAA 1U7UA 2FGJA 5JCXA 1TIPA 2FUCA 2Q21A 4FGSA 3ENNA 1ILEA 2GF0A 1CQWA 2HPHA 2W2OA 3A4VA 1GNLA 5BSGA 3U7GA 3ZHQA 4ARSA 1JG4A 1UBHS 3K31A 4NJMA 2UXCB 4BQRA 4EX7A 4RVHA 1NTOA 1CZOA 1EZ1A 1FQOA 1M0SA 3T5MA 4D9NA 4NULA 4X71A 1R6VA 1TI7A 1IK4A 4ZQBA 1NN3A 2Y68A 1NNI1 2PQ0A 3AFIA 1V3UA 3OKPA 5KYWA 4DMCA 3DG9A 2DBYA 2EERA 2XY4A 2PIAA 3PC7A 3HDYA 3W1VA 2JATA 3G2PA 1JEAA 2P9JA 5AJZA 5ELXA 2QTMA 2IUTA 4M55A 2HOQA 4J8PA 1RADA 3KQOA 4G4SP 2NU8A 1LDMA 4DGSA 3KU4A 3C45A 4ALLA 3EVTA 5HQ3A 3WKCA 3TIXB 4JKIA 5ES3A 2MYUA 3O4JA 1CRWG 1DT5A 2I4RA 1QONA 1F8UA 1KMHA 2XNJA 2PVCA 3T0FA 4J9UE 1JALA 3GAAA 3FPKA 5EXSA 5KTTA 5CT9A 4OHOA 1BMFD 2X4GA 2GVDC 5HHTA 1C8LA 2GARA 3OZVA 1DTEA 1THZA 1G7RA 1T9CA 2P75A 3A4LA 1VJDA 3DCNA 3GFTA 3LVQE 3EDOA 1JUDA 1FDTA 4IV8A 4BQSA 1G4AE 5IAGA 2G8NA 1HRKA 2FEMA 1S2IA 2GTHA 3ET5A 3CINA 3QU5A 2B5OA 4MUFA 4B5KA 1IJFA 4YV2A 1DI0A 2I2CA 1J2UA 4UEQA 1A71A 5ALKA 5FBVB 2NUAA 4MUIA 1YIAA 4UEJA 1XWWA 3GNSA 5BUSA 3W5HA 2K7FA 2OHGA 4MRMA 1WE2A 2Z2YA 4X6LA 1LDYA 1EUQA 1TQ4A 1KBQA 2FETA 4X7RA 5SY6A 1YRAA 4V1CB 4OF4A 3EXHB 2YYAA 5IHPA 5KINB 3HVRA 3U44A 1JGTA 5JQGA 1H2FA 4OFZA 4YO8A 4H08A 1WUYA 2PJDA 2NG1A 4NG5A 4YS6A 4FQ8A 4DXHA 3EGEA 4L5JA 2LD4A 1NUQA 2IHBA 1ID8A 1GKIA 1CVRA 3P2EA 3DE1X 3LL7A 2BSAA 5ADHA 1XDZA 4L8WB 3L77A 4QICA 2X0DA 1K4YA 1N2IA 3FYTA 3L7JA 3LVFO 3R3XA 3VU8A 4HDAA 3WDLA 4W7HA 5FADA 3NBUA 3RFTA 1J5PA 1P17A 3AY6A 3LYLA 1XD2B 4EJFA 3QVMA 3QWHA 1EKXA 1PLLA 2QORA 1E9EA 1LZKA 4KQJA 4ZAGA 4WGGA 1XPJA 1TMYA 2JVIA 4RD2A 1QO0D 5IJXA 3LTEA 5CFLA 5C1OA 2G7MC 1U6JA 5C51B 3BBLA 1KARA 3B8EA 1JECA 2GLTA 2J3KA 4I9FA 3BK1A 4DT1B 2R6DA 4ER6A 4TYNA 2Y1EA 3C43A 2QZ4A 4G84A 4XIIA 1SD2A 1IUPA 1JG1A 4H0NA 4J0QA 1UQUA 3GGSA 4MITA 2R2AA 2AC4A 1TQ6A 3VNSA 2XUKA 4BB6A 4A0QA 3S1AA 1KI7A 1DTWA 1MFZA 2IOQA 4BZXA 2VDVE 3EIEA 5A7GA 2E6UX 4C6RA 4TLAA 1XN1A 1O57A 4TXHA 3NRBA 2QW8A 3ORSA 4PLCA 1R8QA 1Z0ZA 2WF9A 4NOMA 4UVIA 1Z0AA 4B84A 4EMTA 5K6AA 2VRWA 5EXTA 2P4HX 1SCBA 4YI5A 3PWTA 1HMPA 2ZSJA 3RYHB 1USKA 4EELA 1E2UA 3GH1A 4JI1B 4U9IS 4FIZA 2WVHA 1ZH2A 2C31A 2J4CA 3C1OA 1N9GB 2HIHA 3E2MA 4I4IA 3F78A 5EG5A 3FHJA 5M7EA 5IYZF 2RI1A 4U63A 3UC9A 4M8IA 3LOPA 3K6KA 1Z25A 4BVEA 1LJ8A 1WBJB 3UF0A 3WNVA 6Q21A 1WMEA 4OB6A 3IAUA 3G2KA 3K5IA 4E51A 1V3TA 4PO8A 4AMZA 4GDFA 3ASUA 2PUJA 3UAZA 4GMKA 1IC6A 1NY5A 3UHOA 3TM4A 3GJYA 1WB9A 2EKDA 1P5RA 1RD4A 4YNBA 1CZHA 3TSOA 4EAAA 1Y9EA 2EWVA 1ZGAA 4C6TA 4YJGB 1DC6A 4URZR 2GHTA 1QH1B 4EARA 1E89A 1T2FA 4JBWA 3N2LA 3UAVA 4BZPA 2ZR0A 4GWGA 2ZUCA 4RMHA 4YMLA 2LCIA 1CLUA 3MPUA 1NYRA 3SQWA 3KTAA 1QFYA 1AN9A 4G81A 3WYEA 3F4BA 4EG6A 2FEAA 2PWAA 4NX2A 5AVYA 2ZULA 3CLVA 3DPIA 2ZR8A 3BXPA 3KZNA 3L7AA 3C7DB 2LUOA 1Q11A 3GJQA 3GRKA 3MM4A 3F5SA 5EGNA 3QYAA 2HIAA 4B6QA 1H6DA 2TECE 2NQ8A 2JVJA 3U2QA 3OQNA 1NBME 1HM5A 5F3RA 3V33A 3VO2A 1VKJA 2B8EA 2W2PA 3CSDA 4R81A 5BSWA 1CW2B 1EVLA 1G8HA 3C6QA 4FDMA 4KSYA 3NTXA 2AN5A 3E7PA 4QREA 3B8HA 3C3CA 2CUKA 3EASA 4BS9A 3OKAA 3H2YA 4BP8A 3OT4A 1JTEA 3O6VA 1FTWA 3UK1A 3KOYA 5FL7D 5CIQA 3WLIA 3F6PA 4D98A 3ICWA 4F84A 2AWOA 2VP3A 2JLUA 5TGDA 1HFKA 1TXGA 4HEA1 1E9DA 4NEGA 5HR5A 3M4YA 4QXQA 1E7RA 3E7XA 3GJXC 3A6KA 2X77A 1KYYA 2FZ5A 1KJNA 2XMPA 3FPBA 3D59A 1T2NA 3JQ7B 1EWRA 2WA2A 1Y9AA 1FSFA 5CCBA 3B1VA 2VHTA 1JB9A 3FPLA 1GGMA 2FN7A 4ZN6A 5IKMA 2CBZA 1JQKA 3I6YA 1EZZA 4I5GA 3VVMA 4TRNA 4M87A 1T13A 5ERYA 2MSKA 4K6FA 3I34X 3ZDXB 4KR7A 2HIMA 1G7SA 4RZHA 4YASA 5TE9A 1BTOA 2QZJA 4CTKA 4O59O 4DR4B 3VR2A 3Q8KA 3O2JA 5EC8A 1KVUA 2V8OA 3DBOB 4Z6KA 1SC1A 1WB6A 5SZKB 3A04A 3FDFA 1KGDA 2OMEA 5I47A 2GCOB 1T9HA 3P8ZA 2J6CA 5I3CA 3E3LA 3DLTA 5JAQA 2RBEA 3SZRA 3BWMA 1SQGA 4DKXA 4UOZA 5B58T 4JNKA 5HIKA 5DI9A 4B9EA 4KE9A 1L7BA 1AU9A 1V7PC 3GLIA 4DDVA 2H52A 3GMDA 1XEWX 2XDAA 3PU6A 4IH9A 3T6KA 1TCAA 3HJAA 4EHAA 5IKEA 1UJ6A 1M1YB 1UQRA 3CH7A 1AQUA 1RAFA 4W8OA 2YTZA 4A10A 5D3MA 1ZW6A 5ICFA 5BUCA 2CV1A 1G41A 3PEVA 4KGXA 3N8IA 1ENZA 4MB6A 1TF7A 3ZXUB 1TVKA 2VQFB 1SKUA 1V8ZA 1QPBA 3QNWA 5LP6C 2G09A 3AF3A 1FYVA 5FBHA 3WMWA 3ETHA 4D9GA 5DN6A 2ZWVA 2WDPA 3ZWOA 3K5PA 4BLWA 1G8GA 1P1KA 2ZROA 1VC2A 3DMDA 4MS3B 4UULA 5KBYA 1OT5A 3LQ4A 4TLMB 3NCTA 4QU0A 1M8JA 5E2AA 3T94A 5JBQA 3LY5A 1YB4A 1ECLA 1ZMRA 3FA2A 4C3OB 1ZUIA 3CONA 5DCYA 3SZOA 1K6EA 2GPYA 2O8BA 4JLUA 4MYTA 4F8EA 4AJLA 1Z6QA 3WNCA 1BDBA 1VI5A 4DAEA 1MTZA 3AVVA 4C7OB 1V39A 4FYVA 3C1TA 3JYHA 4LRWA 4K3UA 4QEZA 4YTEA 5L7WA 4Y7CA 4KK3A 1FFGA 2EP7A 2PCLA 2WYUA 5TV2A 3RV3A 3JZMA 4XSHA 1G5RA 3MG9A 1B41A 1YCFA 2PSSA 2RK3A 2XKAA 2BISA 3K9GA 4KZPA 4KRFA 1FDIA 5COQA 4AD8A 3OPYB 7AT1A 1NULA 2P8SA 1C30A 4PO3X 5JEEA 4N41A 1RW4A 2JIZD 1PNOA 1SKQA 1NJ2A 2HEGA 1GNSA 1WVGA 3P97A 4IKPA 1R10A 5AVKA 5AW0A 2GXUA 1CCWA 4E2WA 4IHJA 5IAEA 5JRZA 1DFIA 4NESA 2DPXA 3BFVA 4HJXA 5TLSA 1SCIA 1UXIA 1EFTA 2PV7A 4QRIA 2IL1A 4HRAA 2YVLA 3OJOA 4P38A 4DUZB 1Q3HA 2RMKA 3EXIB 1S9HA 5AW4A 3EG5A 3D7SA 3FUWA 1TYBE 5JJIA 4B6FA 3HPQA 4GKKB 1UT8A 3LUHA 3FBTA 1NKSA 3PI6A 5JUWA 4RDXA 1ORVA 5TJHA 4X8MA 4BNKA 4XPZA 1OBVA 4K9KA 4MV8A 1JYSA 1NUAA 3L7KA 2QD1A 2R1TA 2P9QA 4PU0A 3G7UA 4YLGA 3WX0A 2GN2A 4ARCA 3EUAA 1NT2A 2RHWA 2BFAA 1K88A 3NHFA 1CEQA 5F5LA 1CIVA 4PHCA 4YQFA 1RTKA 1PTKA 3ND7A 4O4LF 1ZX1A 2I03A 2X5KO 1T6XA 1Y1KE 1TM7E 3CX4A 4GRAA 1ODLA 4X20A 1MQ8B 3VH2A 3RWMB 1YB6A 4Y1RB 3IBGA 5B1SA 2D7CA 1V41E 3AI1A 1NRJB 3U4MA 3NW9A 3DE0X 2R68A 1USVA 3FYHA 1FRVA 2D8AA 3NAQA 3EOBI 3B36A 4WASA 4RDHA 3V8PA 4UCWA 4EMUA 5KJ6A 2O20A 2RG7A 1U31A 1GNTA 1KI4A 3MRTA 4AC9A 1QAMA 1QHGA 2QSYA 2WHEA 1TTPB 4R16A 4PTYA 4P4LA 1J23A 3GJ6A 4B4WA 4QYXA 1PKXA 3USZA 3Q1LA 1NF2A 2ZCJA 5CVEA 1H8HD 3Q8XB 2OYCA 4TT3D 3ZW8A 2GWHA 4XIYA 6GPBA 5JS7A 2IY7A 4I14A 3RVDA 4P4NA 5HK9A 3R8FA 3I76A 1OXTA 3A0UA 3AM1A 1A82A 3EUWA 3NOXA 1MC4A 2EDAA 2G72A 3ZZUA 2PZEA 3ANNA 5DSXA 1WUIS 3FHTA 3IKMB 4LI3X 1P31A 2G0NA 1U3VA 2XSZD 5H3LA 1M6YA 5HM6A 4NBKA 2GD1O 5BW6B 1T9DA 3MJEA 5IDXA 3E22B 3OLQA 4D8WA 3OFND 3LPDA 3ID6C 1MX5A 3NMUF 5EMMA 1KOFA 1JFFA 2DB3A 2H63A 2FSGA 2I71A 3KKOA 2DUJA 3D8NA 4I1OA 3SHTA 4EF5A 1LC0A 3F46A 2AD1A 4LOIA 4UJ5A 3TO5A 1N1DA 5AKGA 4RK7A 2X2FA 4MZXA 3SJCA 3U19A 1R6TA 2JD2A 1Q0TA 4DDTA 1YS1X 3I9V1 3IT1A 1FJ2A 5CHEA 3DHWC 5CEFA 4U6NA 1Q1NA 3RYFA 1FIUA 5CJPA 1EX7A 2GD6A 1B74A 4H1WA 3N3AC 3NB0A 4HMQA 4WZBE 1W4LA 4NONA 3G85A 2C5BA 5EERA 3T3IA 2D4AA 1WW2A 1J25A 2RGCA 3KWLA 2PGJA 4MGIR 4MOWA 5HCIA 1A50B 1DBRA 3GQVA 1UUFA 4BO6A 2J5RA 4U7WA 1JH9A 1BKYA 4OHXA 1IULA 3N8DA 3F5QA 3FTQA 5H82A 2R1VA 3FBGA 3I2YX 3WO1A 3E81A 3D02A 5DASA 3JAKA 4CG0A 4LF7B 2Y27A 3GRPA 5FDFA 6REQA 5IK2A 1W9HA 2WHPB 4NYMR 4XLTA 1E2HA 2QTBA 1QTIA 5C4MA 4GDMA 3BMCA 4P36A 1VJGA 1QNLA 3LKZA 3OSUA 4Y2SA 1SZCA 2P90A 1I0IA 2GAJA 4BEWA 1E1KA 3JQPA 4I4NA 4QXRA 3SK0A 1T2CA 1SXJA 1MB0A 2C0CA 4GLFA 3WLSA 1W94A 2A30A 2OG1A 2Q6OA 1EM6A 2HDWA 4EEZA 2BFFB 3INNA 4NCJA 4P5EA 4PLYA 1GA6A 2G67A 3D3NA 3G2QA 3KYIB 1NVXQ 4J0HA 2OXCA 2HGSA 1H6CA 3OSZA 1PJLA 4JJEA 1YK1A 2OL4A 2IZ6A 4JENA 1KFKB 2PA3A 1JIKA 3ONWA 5DOZA 1JLKA 3A6FA 3BMNB 3LDAA 4BMYA 5MGNA 5E3IA 3UB4A 1DELA 4QJ3A 1M6EX 3CLHA 1E2PA 5JZMA 4ZAWA 1R5BA 3B3QA 1FU7A 1SC9A 3Q7PA 5HILA 2OHJA 3QE2A 5G1NA 4L7VA 3BJZA 3I3OA 4XJSA 4D7AA 4ZCRA 4GLLA 4HWPA 5DXAA 3OE1A 1EBBA 3PWKA 2BY4A 2N1MA 4A2QA 4DA0A 4O1IA 3TQFA 1Z47A 4M1QA 5I7AA 1DUVG 1E3LA 4MQ6A 3RASA 3GRVA 3TW6A 3AKZA 3EZXA 1E2FA 1N2GA 1D07A 4HWTA 3VOBA 1KORA 3G89A 5IULC 1AMOA 1TC2A 4G8JA 4EPWA 2XA9A 4DMLA 2JJYA 8ABPA 1OU0A 3AI7A 1XRMA 1CY6A 1UANA 2AYYA 3I0NA 4II2A 1XAGA 3F71A 2IZ1A 5IM5A 3C4VA 4QUHA 2O19A 4ZU1X 3T3GA 3K0CA 3ZQUA 2XRYA 3B1YA 1GSIA 1GVNB 1SA0A 3QRWA 4LI0A 4EAQA 1XF1A 4DM7A 3PLAE 4DCPA 3QX8A 2RC5A 1TRHA 2VHCA 3H9UA 4RFSB 4FHDA 4EB8A 4D46A 2CYAA 2ECFA 1E5TA 2P5TB 4C4AA 2FRDA 1FXWF 1GPAA 1W88B 1NASA 3UJ6A 1Q0PA 4REOA 3PKJA 3KT6A 2O1XA 2QM7A 2C94A 4NI5A 2J32A 4XM1A 2DFKB 3OPNA 4YAOA 5DBFA 4A27A 1ZIOA 2X2EA 2FWMX 3COZA 3KHKA 3KOUA 4TUYA 4Y6LA 4RZIA 3ESBA 2KLHA 1EDOA 2O7SA 1AG9A 421PA 2CJXA 9MHTA 4K6MA 2QR3A 4H77A 2WT4A 3GG9A 3GO4A 3X1XA 1PUJA 2VYQA 4J6EA 2O0KA 5K0FA 3UA3A 1DAFA 3KB1A 4FMDB 3IV6A 1AGPA 5FV4A 1E9SA 2FMKA 3T5TA 3PJGA 3H7AA 1R6BX 1THTA 4MW4A 4ZYXA 7GPBA 5KAPA 1VBKA 3NBKA 4LJ7A 3IUBA 1V5IA 2J09A 2C2HA 4EFKA 5TXGA 1LW6E 1DB3A 1YKFA 2R6R1 3L01A 4JLAA 4EB6B 2C2MA 5FTWA 3TFWA 4URHA 3PUZA 1K3UB 1P61B 4JA0A 2C7BA 3Q7EA 2COKA 4R83A 2J0QA 5EUMA 4P7GA 2VSYA 4M7OA 4IO1A 3E1GA 2I1VB 2MTBA 3K5HA 4MO2A 3PGLA 2OCDA 2WOOA 1ND5A 4F4UA 3WBFA 2QMEA 5BMVB 1NLMA 2GN9A 3MXTA 1KYVA 2I1WA 4KIGA 4KR0A 5AOVA 2IVFA 3OIVA 3S5JA 2VAMA 2VQSA 4S05A 3HJUA 4BV8A 5CLGA 3E8SA 2VT3A 2ZFUA 3LX4A 3UB2A 1JA1A 5CB8A 2AR0A 2ZXUA 3QEJA 4AJIA 3DMTA 4EUHA 2HD4A 1UXOA 1T3TA 3HCRA 1Q15A 2WPDD 1V8FA 1EGMB 4CEHA 7MHTA 3TR5A 1AK1A 1PX2A 3MSCA 4PWZA 3JR7A 4Q05A 2V3VA 3WIOA 4A9AA 4A82A 1IWBB 4KQCA 4BAGA 3THWA 1IN7A 1P1JA 2H1VA 4U7FA 5C1BA 3KQQA 4Y67A 4WK0B 3N8GA 5T41A 4A6PA 3NO4A 3EIOA 3HYCA