1UJCA

Structure of the protein histidine phosphatase sixa complexed with tungstate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
156
structure length
156
Chain Sequence
b'MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELTPCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphohistidine phosphatase sixA
molecule tags Hydrolase
source organism Escherichia coli
publication title Crystal structure of the protein histidine phosphatase SixA in the multistep His-Asp phosphorelay.
pubmed doi rcsb
total genus 51
structure length 156
sequence length 156
ec nomenclature ec 3.1.3.-:
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ujcA00
2PA0A 1UJCA 3LL4A 3QPWA 2P77A 5CU7A 5HR5A 1K6MA 4D4KA 1SKBA 4MA4A 3LNTA 4FDUA 2DWOA 2P2ZA 4PZ9A 1BQ4A 1RIIA 3HJGA 4JOBA 3NFYA 4HBZA 4ODIA 2A9JA 2AXNA 2P75A 3DB1A 3IT1A 3IT2A 1V7QA 3R7AA 3E9DA 5AJVB 4D4LA 2F90A 1BIFA 4JOCA 1QWOA 3PGMA 3EZNA 2HHJA 5CDHA 3GP5A 2HPAA 3K4PA 2H4XA 1XQ9A 1SKAA 2I1VB 3ZHCA 2YN0A 3BIFA 2H4ZA 1DKMA 1NT4A 2P30A 5AK0A 3FJYA 2RFLA 1YFKA 3O0TA 4EMBA 1TIPA 1FZTA 3C7TA 4GPIB 4PZAA 4TSRA 1H2EA 5AJWA 3FDZA 3MXOA 4IJ5A 1V37A 1IHPA 3D4IA 5PGMA 3IT0A 4ARUA 2DWPA 2HIAA 1DKPA 2A6PA 1QHFA 2WNIA 2ENUA 3D8HA 3EOZA 3K4QA 2OWDA 1E59A 2H52A 1RPAA 4E3WA 1C81A 3D6AA 2P78A 4FDTA 3NTLA 2ENWA 4GPZA 2GFIA 1C80A 4ARVA 2OWEA 1T8PA 4D4MA 1YJXA 1DKOA 3FDZB 1ND5A 2EKBA 2WNHA 5AJXA 2P9ZA 1DKNA 4QIHA 3F2IA 1SK8A 5HTKA 2P79A 1DKQA 3IT3A 3MBKA 1ND6A 3OI7A 2EKZA 4AROA 5AJYA 1DKLA 2P6OA 1E58A 2H0QA 2P9FA 3LG2A 1H2FA 5AJZA 1FBTA 1C7ZA 3GP3A 3QPUA 4PGMA 1SK9A 2EOAA 2YN2A 3F3KA 3KKKA 4ARSA 3DCYA 4JODA 1BQ3A 2P2YA 3QPVA 1QFXA 2WU0A 3GW8A 4IJ6A 2BIFA 2QNIA 4D4JA 4EO9A 5CX4A 1RPTA 1CVIA 3E9CA 1EBBA 1UJBA 3E9EA 2P9YA 2P6MA 2IKQA
chains in the Genus database with same CATH superfamily
1ILWA 1J0EA 1FDOA 1DIRA 3CH6A 2G36A 2VS1A 5FA6A 5CB4F 3G79A 1L5HB 1LDYA 1OFTA 1NLMA 3LX6A 1S2LA 3HCPA 3L8ZA 1DAKA 2GCNA 1NPDA 1VSVA 4O25A 4XD2A 3IIJA 3FVTA 2IYSA 5ALTA 2ODAA 3ZK9A 3HC7A 2WE7A 4KE6A 2OTCA 4HNUA 3FYDA 3MT8A 4YMHA 1NVVQ 1XU4A 1C29B 1PFWA 3GNLA 3O47A 4BTLA 2P2SA 3NFYA 1ACLA 2RGYA 3FYCA 1K08A 1M7HA 2MSWA 3QU7A 1CIJA 1L5HA 5EINA 2X2PA 3KZ1E 3QEMA 2G4VA 5EOVA 5GADl 1NE7A 2RHBA 3BWBA 4V0SA 1CUGA 3G3EA 4HYYA 1ABEA 3ST7A 5IT9A 3RYHA 5CD9A 1DE0A 4JFRA 1HL3A 1JDPA 4I55A 5KX5B 3GJ3A 2I1VB 3LBFA 4MX8A 4E13A 3ECAA 1VPEA 4Z7NB 1VYVA 1XKTA 3IDAA 2J0UB 3EDCA 3A06A 3NLLA 2QLNA 4OYHA 4WACA 4N3NA 1TQDA 3GOQA 1W85B 4DWOA 2HDHA 3OQOA 1LV8A 3USCS 1KRHA 1OX4B 3FJOA 4FUQA 4BQPA 1J56A 4QGAA 3GJTA 4DCNA 1E3WB 5JAZA 1SULA 1WKVA 1M2EA 2CYBA 2ZYWX 1SCQA 1SB8A 2GBPA 2GETA 3DUWA 2RI0A 3TTWA 4XD7A 3PXGA 4I5IA 3RU7A 4URVR 1E77A 2EP7A 1KZ1A 2HRDA 1IHPA 3D4IA 3AO0B 3IEXA 2V6JA 3BWYA 1LDGA 2QP3A 4KOAA 1O0BA 5CA1A 1HQYE 3E9ZA 2AS0A 2FEWB 4M9ZA 4MR7B 3DKPA 1YOVA 4MHSA 2FPLA 4ZCSA 2CVZA 4O3MA 3V80A 3CPHA 4HNAB 1ZD8A 5BW6B 3WK9A 2TMKA 5LBTA 2DFLA 3ON5A 2AK3A 1JEJA 5B6JA 3NVAA 2CJWA 3L4SO 3OQ6A 3W4IA 1A9ZA 5F3RA 1Z4JA 3C3KA 3WRXA 4K6KA 2FEMA 1CUDA 1N1EA 1G3IA 2XH8A 3M89A 1KKLA 3OZWA 2I54A 1P75A 3N2KA 4URYR 3VR6A 1SG6A 1UJMA 5BN1A 5HQ3A 1ZMTA 1MF7A 3DWGA 5CVJA 1HDIA 3D3NA 3CSSA 4B3HA 1W34A 1A82A 1QPZA 2YVQA 2WUEA 3P27A 2GA8A 3GL9A 3HBNA 2NVWA 3B8EA 2EZTA 4EEXA 1UQTA 3NVDA 1REQB 3TG8A 1L5ZA 3THOA 1JQKA 2WYUA 3DUFB 1RZRD 1N9KA 4OXNA 4CGZA 4F91B 1T2CA 2H5JA 5EPOA 1BXZA 1H2HA 1U7TA 2W6ZA 5AJZA 4J2TA 3W6NA 5K99A 4CLEA 2A5FA 3I05A 3P94A 1ZK4A 3SDSA 3ADPA 3ZN2A 1F6DA 4BO8A 4IDHA 3RTCA 2XITA 5CHYA 5HQTA 4RGVA 1A9PA 1PR6A 4F12A 2OXTA 3LUFA 4DPKA 1Q0SA 5K0CA 3A1CA 2VT2A 4DL9A 1PWXA 1ZL2A 2ZTVA 1WXHA 1PW5A 2OORC 3U9LA 4ER3A 3P9XA 2P6PA 3ZLJA 4QOFA 3CEPB 2XQJA 2OG1A 1CY0A 1WUJS 2WJHA 3R09A 4IIHA 3G2JA 4AICA 2O2XA 3GDOA 4MVJI 1L4NA 3OM0A 4OREX 1ZIXA 3HO1A 4BRWA 2Y99A 3H2YA 4BLUA 4TMXA 5H0IA 3AW9A 3WGTA 2QYSA 2HJSA 3NYWA 3Q41A 4MP8A 4BTEA 4A6EA 3OQHA 4GXQA 5IN5A 1TZMA 4WCFB 4AUNA 1A2OA 4JX8A 1YB4A 3W5HA 4LTNA 1TYCA 3KOWA 3M3DA 2O9JA 1GNRA 4J0DA 3E61A 5D1HA 2XBMA 4R1QA 1ZUD1 1DCFA 1L4UA 2CDRA 1MABB 1YDFA 3T61A 4NENB 4A16A 2ZAYA 5M7EA 1P5ZB 4DR2B 3ZYZA 2Q0SA 1YB1A 2J32A 4F5ZA 1IOVA 1T91A 3D3QA 3E9DA 4DLYA 5BSGA 5AW0A 1CEXA 4X8LA 4ER7A 5L4LA 4M88A 3TRHA 3ODGA 5A02A 1DEAA 3Q9LA 3OPXA 3OEED 3WAKA 3O3MB 2ZUEA 1SHUX 1UZMA 4L3WA 5BWBA 2E89A 3I5MA 4NBSA 4Y6GB 3EJ6A 1T5HX 5FBVB 1R4ZA 4BNFA 1D4ZA 1H6CA 2A59A 3A32A 3H9JA 4FMDB 4PGGA 1JIXA 3WQSB 2P3SA 3ZCVA 1JFRA 3R5XA 2HUNA 4Q1FA 2GD0A 4WGGA 2EYQA 3C1OA 4LC9A 3M1LA 4AYTA 1IY8A 2FMFA 4R2XA 1C4KA 2VYCA 3U5ZB 1N2CA 3KLOA 2IELA 1T0UA 2C8VA 2YJ4A 4H0NA 2OGTA 2GO1A 4WTOA 3HV0A 1ZN8A 3LIIA 4KQJA 1RYZA 3ZKWB 1LDNA 3TE6A 2ZJ7A 4YMTA 1E79A 4NOKA 1JNYA 4P58A 5A5GA 2CXXA 4BIIA 1ZNXA 5KX5A 2BE9A 2AJLI 3NATA 4OH1A 1G8KA 3OLYA 1Q7TA 3M1YA 3UHFA 5JFGA 2FWJA 4S2UA 2HMAA 4RVGA 1GNQA 3LOUA 3NUQA 4Y0VA 4BB9A 1C81A 3NH6A 2DPXA 1OFIA 5FNVA 4BV3A 5JXWA 3NC0C 4IF6A 5DRTA 3LNCA 1OXKB 1K88A 2FCAA 1L7XA 3PFBA 3RD5A 1CZOA 2BKVA 3CTPA 3QBDA 3PR3A 2AUNA 3DXXA 1TQ8A 4B3DA 3HK2A 1GAQA 5D5QA 2BCEA 1RQXA 4Q4HB 1F8UA 3IAHA 3O9VA 1T0HB 1X7WA 3GIDA 2ZULA 1EHCA 3BXGA 4Q1VA 4Y9SA 3A8TA 3RBAA 2A0UA 2ASVA 1TKAA 4OSOA 1P5HA 4HJRA 1KYXA 1XT6A 5IZCA 2C1XA 2JZOA 1RXIA 1VLHA 2HJ9A 3SYKA 3MLAA 1R5BA 2XJ4A 5ERXA 4V3CA 3VR2D 3C6YA 3SZUA 1BJRE 3V42A 1W5TA 3I12A 4NJEB 3E35A 1NW7A 2A9PA 3G7UA 1XD2B 4ADSG 4NIMA 1TKBA 2DBYA 3QKSA 1NLZA 3AR5A 4D9CA 1QIHA 4DDKA 3WGJA 2Y3IA 3IRUA 3P4UA 4CLHA 4JLAA 2L0XA 4IX9A 4PAWA 4JC4A 1T9BA 1J49A 2AJDA 1CRLA 1M6NA 1ZD4A 3MTQA 4GLFA 4AJHA 1P2FA 3L1IA 1VJ0A 3KQOA 2H0RA 3CVVA 3FTEA 1ZRMA 1MGPA 1OFUA 2O3TA 3P0IA 2GTHA 4NVRA 1N36B 1F2UB 3M3PA 1MHPA 4BXOA 1B6GA 1UBKS 2PX8A 3LPNA 3ZY6A 4E70A 2IEDA 3CZ5A 4HJXA 1QQ7A 2QZ4A 3TCXB 3IKLA 3DBRB 1N8TA 1R3DA 1TI7A 1GV0A 5ALIA 3KR2A 3R5SA 8GPBA 5KMGB 2IIBA 1ZVJA 3ZE7A 5MDHA 4U5QA 4MGEA 1GTG1 5DSTA 1BEEA 4ND7A 3R76A 4BAUA 4OAPA 4GUAA 2YC2C 2JI4A 4NCAA 2CL0X 3DBHB 4P9NA 4AJOA 5IJ9A 5LPNA 4JHLA 3TL2A 3D4PA 3OF2A 5KYUA 1EGMB 3X1JA 1CULC 2QZZA 1TGYA 4D3ZA 5E6SA 3TTVA 4L3OA 2C03A 3RVBA 1MX1A 3WICA 2DR3A 3EAQA 5A3VA 3I04M 3O8LA 3Q1KA 2XZDA 3VZDA 5D6OA 1W6UA 3L4BA 5CVVA 4IOMA 1LBTA 2YZKA 4TUYA 1RC0A 4KBGA 4P8RA 3OE4A 2CVFA 4YV1A 2MSKA 4B31A 2C07A 4W5WA 1S8NA 2YOHA 4FMCF 3BB4A 3P9YA 4IUDS 4TTJA 4AJNA 2PUGA 4ICIA 2BAGA 4EG6A 1D07A 4HTFA 4IQ8A 1IM5A 4U7PB 2AEEA 1YJ8A 2NUTA 4J49A 3COJA 4FJ2A 3OLCX 1GU1A 5EUBA 3BJZA 3U40A 5FRDA 3L43A 4BE4A 5K3CA 1DUIA 4QATA 4RF5A 1PCXA 3A3YA 2VF5X 3IQWA 4MWOA 4Q37A 4QU5A 3KEGA 5G1PA 3KKLA 3SD7A 2WBLC 1UP7A 1Q57A 4WK0B 3CUWA 4ZAZA 2AC4A 1VHJA 1O97D 1OXSC 1UT5A 4KWIA 1VG0B 3FW1A 4MJLA 4EHJA 3CPJB 1JVBA 1OIVA 4YONB 3VHRA 3TR6A 4NTZA 3AUAA 5LIPA 3SX0A 2CXNA 2FDRA 1G8FA 4QKQA 1OLOA 1AUVA 1HZJA 1CDOA 4OXRA 1RSZA 1NXXA 4I50A 4K8RB 2F1IA 5ESXA 1I33A 4Y2UA 1M76A 2OXEA 1PJ2A 4JR0A 4WW0A 5D3QA 5AW2A 1ZJWA 1M5RA 1E94E 3K8QA 4ITVA 2VHWA 3FH0A 3FUWA 4CU5A 1TM7E 2OV3A 3HN7A 4KDEA 4OO3A 4AZVA 2CSXA 2QRZA 5JSZA 1SK8A 2Q21A 5LOVB 3FX2A 4Q24A 4RAQA 1GPWB 1O6GA 4HEA1 3PFKA 3PXEA 3R4CA 5ALFA 2AE2A 1CY1A 2O3JA 2WPNA 3FWYA 3IPYA 4QICA 4AROA 5JWHA 4R0VA 4CCSA 2HUPA 2ANBA 3KXDA 1EZ1A 2VPQA 3VKGA 1NUSA 5FTKA 4GBMA 2GZMA 2C0CA 4ZVQA 1X1AA 3AV0B 1VIVA 5I9IA 4M99A 4B3FX 2ZBDA 3SBXA 4AFNA 4QOEA 3K35A 6ADHA 1T5IA 1DIOB 2X77A 2WOJA 3ZC3A 1P8AA 4O4HA 1MFPA 1I5OA 1WUHS 3MUNA 3GW8A 4MDEA 1GFIA 3O3CA 3I9NA 3TW8A 3MOGA 3VR5D 1AE1A 1KBOA 2Q3MA 2QI9C 3L8HA 5DB4A 2LRHA 3PNOA 4LGVA 1CUEA 1KAHA 3EOBI 2GZAA 1LDBA 4BU0A 2VDJA 5TMDA 4P3KA 1N32B 1RADA 2KM1A 1J5EB 4UUQA 1Y5MA 3HI4A 1JVNA 1MXHA 4A6XA 1WMFA 5K7SA 3UB4A 721PA 4IEIA 2QQEA 2WTNA 5ARCA 3LO5A 3WG9A 2Y0EA 1DQRA 2JAPA 5HRUA 3O8QA 4RDXA 4KZKA 2R8YA 3ZGOA 1UK9A 4P3XA 2OVBA 4WN9B 3PZRA 2OLJA 4GC9A 3WGGA 4MROA 1KOJA 3RSZA 1IZ0A 3DAYA 4C06A 2PS0A 1BA2A 4AG3A 1ZVQA 1XL0A 3CVUA 5AI8A 1DB3A 2VZ8A 3AR7A 1TPZA 3EF3A 3MT9A 2XGOA 4REOA 1KEVA 4NS1A 5DM0A 2NU7A 3F6EX 5IANA 4YMGA 4RBNA 1TA4A 1JEQB 1XA3A 5CAEB 3DA8A 1YUMA 4XYGA 5AVRA 3C3MA 3ICEA 4TWBA 1QIFA 1N92A 2FVXA 2ZT6A 3ETDA 3P97A 4YREA 4C3ZA 4CDGA 2GM3A 4EATA 4ZEOA 1L4GA 2QZSA 3LBAA 4PONA 5SZKB 4U2FA 3WZ2A 3HYTA 1UADA 1EBFA 1UJ5A 4WLNA 3V1MA 2ZRJA 4NX2A 2Y67A 4ETNA 1A5SB 2AN4A 4CEHB 1YQTA 2P90A 2HSDA 3TMYA 2XPCA 1JAHA 3C1TA 5KB3A 2HHAA 2O1EA 5J4KA 2CV1A 5ALLA 1SRQA 1OUMA 3GEPA 3Q3EA 4BQQA 1ZOOA 3LXXA 4WFKA 5JQGB 2OCXA 2PR2A 2XD4A 1EFRD 2QD3A 3KZMA 3H4MA 3N5KA 3R3WA 3GDWA 6GPBA 4JLVA 4QPZA 1YHYA 1MJNA 3WLNA 5DM4A 4Q18A 4XQEA 2RGEA 4YUYA 4X1IB 4DCJA 1L3CA 1Z36A 2NX2A 4PAMA 4PO1A 5JAHA 2KS6A 2WPDD 2PUFA 3JSAA 2QZPA 3KQVA 1YTUA 4GX5A 4E4YA 2F1OA 1KS9A 1Q92A 1KMHA 2M6KA 2W37A 3RC7A 2PQ6A 2HJGA 3DCJA 2DFVA 4CFYA 2RIPA 5KWEA 4RH0A 1PZEA 1XSEA 3S2FA 1NVMB 2IX9A 5JNRA 1JQ5A 3O03A 4EO7A 4IFTA 2V8BA 5KX5F 4IVRA 2VP3A 2DR0A 4G23A 4JKIA 1N0UA 4N6OA 1FDUA 4N03A 2UUCB 4E5NA 1X0XA 2I34A 1RAIA 4HX9A 2JH8A 4KRFA 1NBMD 1KOLA 4DWVA 5AJYA 3R8CA 4WX2B 3C4JA 3JZAA 2O0JA 4J76A 4M46A 3JYLA 2CK3A 3MTIA 1LJ8A 1SG9A 3V9AA 2B35A 1CQPA 1GJRA 3DAPA 1G21B 4JCCA 4E7PA 2PT9A 1ZH0A 2QUAA 1E18A 3CH4B 3EUWA 2QSUA 1A88A 3IXQA 3NYRA 4G1MB 4I0WB 5BO5A 3L93A 4HQ0A 4G0NA 3AY0A 1RFGE 5JEDA 1OLXA 5DHUA 4AMGA 1OPRA 4X60A 5NULA 2DUMA 3SXJA 4O02B 5KVSA 4YTEA 1U0NA 2XIQA 2YWBA 3E9EA 4JL5A 4OGGA 3GJ0A 3O4IA 4AU1A 2XB9A 1KKUA 1V11B 3HXKA 1SXJC 5DNVA 1ORWA 5DZSA 5K05A 4ZOLA 3DS8A 5B4TA 4EW2A 5EZSA 2EKLA 4TPKA 3DTYA 4V0QA 4YH1A 5KTKA 5KWIA 4O4IF 2CNWA 3JQAA 4UPEA 1EUDB 4YPOA 4DDUA 4CE6A 1RJFA 1HLDA 3PF8A 4JUDX 2BZSA 3K7EA 4IFEA 5G4KA 2O8CB 3GJYA 4Q48A 2DWQA 3H83A 4QJ4A 3I53A 3R9KA 2XRMA 4BIMA 2OBYA 4QECA 4CEHA 3EVGA 3SS7X 2QUZA 4L85A 3OC0A 4K6CA 1FYVA 4FYIA 5THXA 3CX4A 1A4RA 2UYCA 1C1YA 1PG2A 3AY7A 4GUDA 2W00A 3HKBA 1NTOA 3BWEA 1UBGA 3W06A 2K7ZA 3N1UA 2XXAA 3UGJA 3HJBA 4P4TA 1BXGA 1WCIA 3OIGA 3FYHA 2X6TA 4XFJA 4X61A 3RIHA 4B8ZA 3K2QA 1J4AA 3E3LA 2FKAA 3DZJA 4KREA 3QZUA 4JI1B 1ZGJA 1GPKA 4DMUB 2NN3C 3ONDA 5IFKA 1XP8A 1PGQA 4I8XA 4IEEA 2ZJAA 4JI5B 2NPFA 1U9YA 1IRXA 3KAQA 3VAYA 5LQDA 2J46A 2Y2VA 2ZTSA 4HFJA 5BQPA 1WIWA 1Y80A 1MUUA 1V4BA 1XD8A 2FSFA 4CKZA 1TT7A 1FLNA 5KNCD 3M7IA 1R4MA 1TFUA 1QP8A 2H5LA 5CR9A 3WHPA 5BRNA 1T5SA 5FBKA 2IYRA 4Y9RA 5K9ZA 4JXKA 4MPRA 3AUTA 3EVFA 5ERGB 4LDRA 3K1TA 4EKEA 1XTKA 2JFVA 5B30A 2R7LA 3A4IA 4HNQA 4P86A 2IDZA 3ZE9A 5FJJA 3UG6A 4AQYB 1WBJB 2CUZA 2F48A 3G0GA 2OGWA 3PE3A 1W0JA 4MQ4A 1CS4C 4E51A 3NRCA 3HABA 4C7JA 3EGEA 2MU1A 3F8SA 3F7NA 2QQFA 4KKVA 2PO5A 3JYQA 1P4SA 2D1RA 1IN4A 3CZCA 3AEXA 1BHJA 3OJLA 5TT0A 4RELA 2YV1A 5LZ2A 4HNGA 3JALA 4HBGA 1EQAA 1T2NA 1Y4SA 3Q3IA 2OWEA 3W1VA 5B4VA 3VKUA 5LN1A 4KBFA 2H2FA 3THWB 3E15A 4J4TA 5E95A 3NOQA 4N01A 4GRAA 4ARZB 3IIMA 3EULA 3EGDA 3CKKA 1W88B 3E5NA 4HP8A 1FLAA 1Q2UA 5CW2A 1SM4A 1BE0A 3C7AA 1GUZA 4PZEA 3RKUA 4DV4B 1G3UA 2HQSA 1NNLA 2J4FA 4N8DA 3BDIA 1C50A 2PV0A 1JG1A 2XGSA 4FYJA 4J6EA 4WOCA 4YV7A 4ZK6A 4XFKA 4DR1B 1XDWA 2VSNA 4J1TC 4HR7A 1NUQA 1T6ZA 5AP9A 4EZIA 3R7DA 1WQ1R 1EE9A 5H81A 3LRTA 3DF7A 3OHSX 4QGFA 4WXYB 2D00A 3GMIA 5MGNA 1EM8A 2XUQA 4XUCA 3IAM1 3P20A 1M74A 1G1MA 4GBED 2FP4B 4ALLA 4QBFA 2EGHA 1DBPA 1R0BA 1JPUA 2BWJA 3RUCA 3NDPA 3ZD9A 2C88A 1YRWA 2FK7A 2ZUWA 5FO0A 3G8DA 3T7DA 2D7JA 1N2JA 2G1PA 1JDNA 1QJ4A 3QFHA 2EU8A 4H6XA 5I7SA 4D2IA 4NZOA 1CNFA 2G25A 2VO1A 3SHQA 4CODB 2C1ZA 3QE4A 5K51A 3SBOA 3FR8A 3L7CA 1P4AA 3HL4A 3GDFA 2JVJA 3ZHBA 2YFYA 2DSNA 1E2HA 2BGRA 1ZAKA 3H9EO 3IPXA 3IQIX 3RC2A 3WK7A 1TEZA 3QWBA 2WDZA 1U1GA 1PV2A 2HSEA 3GOHA 1NR1A 1TIBA 2JFXA 3K9GA 3CX6A 4PPQA 4JVMA 4ZODA 1GLNA 5DT9A 1RE0A 3PJFA 1J0AA 4J75A 1E8NA 3KEOA 4U7HA 3OPYB 3I64A 4U00A 1T8TA 3NC4A 1H1LA 3HU3A 4HUQA 4E46A 2AFHE 3G0OA 4JOCA 2W9XA 1GDHA 2VAPA 3AW8A 3AFMA 2IDKA 3E4CA 3O5AA 4HGQA 1K3FA 5L3RA 4EARA 4QFDA 5AVUA 1XDSA 4H15A 4KB5A 1TX4B 3VTFA 4UJ5A 5TDHA 1YF3A 3E81A 4J0IA 4LQDA 4NU5A 2VDPB 1OXXK 5L3ZA 3KUUA 1PEDA 4RPIA 4LJAA 1EFVB 4AJ2A 4DANA 2BRUA 4JJKA 5EGNA 3UH1A 1PIWA 3LIPA 4L6AA 2RG7A 1SCDA 2REBA 5A5FA 1CDZA 1UPXA 3ESDA 1VRCA 1WHSB 4WADA 4IGKA 1TNDA 4WK2B 3H1BA 1PGPA 1NONA 4YDSA 3V33A 3I76A 4OX9B 4ZVMA 5KBYA 1CNMA 3UV7A 1OR8A 3V7NA 1YZ3A 1NJ6A 1CUUA 2PH3A 3QNWA 4Z9YA 1TAQA 5IH7A 2FN8A 3D0KA 1X77A 3HZRA 2B6HA 1RRFA 2I7CA 4ND6A 5CDUA 3B7PA 5BSKA 2ZE5A 1YO6A 2VJOA 4RD3A 2WQ6A 2AR0A 3FNGA 3UOAB 5KKAA 5F9FA 3THYB 5G0UA 3I72A 4ZO8A 2R1VB 1S01A 2M1XA 2XB4A 4NY1A 1GZVA 4O1MA 4EENA 4N48A 1J99A 3AOEC 1WL8A 3M5PA 3PQDA 4M1ZA 1KOFA 4CF5A 1AO3A 3PQFA 4KJXA 2DT8A 4ECEA 4FFVA 1WZUA 1TC1A 4YJ2B 1G20B 1G5PA 4FGJA 2DUJA 1PR9A 1H0HA 1T2EA 1RI3A 5ALGA 4JN6B 1D0SA 1H1TA 1KMNA 2OY0A 3I28A 2IPXA 3EXFA 1DEOA 4LJYA 4AX4A 3QBTA 4UQOA 5FQOA 4TKZA 1L3IA 1VQ1A 2RH4A 4I2VA 1D1SA 1R8YA 2I3GA 5JWOA 3HCBA 1TM4E 1UJ4A 5LDGA 5IXSA 2ARKA 2WT4A 3BB1A 4JI6B 5AKEA 5KSPA 1Z6ZA 5J2UB 1A4UA 1P61B 2ZG6A 3LUGA 5ALOA 2FPPA 3AF5A 5K3BA 4IS3A 3QFSA 2C2OA 3DUFA 2NSDA 3RUFA 4G86A 1HBJA 4AZ3A 2NVOA 3TOCA 3QV2A 1N57A 1TRHA 3U81A 1EG7A 1XROA 3CUUA 4NRDA 1KJJA 4W1SA 1XJ0A 5D8DA 1J6UA 1COWD 1LPAB 2V5AA 4RANA 3A11A 4BO3A 4Z9XA 4HVLA 1RXWA 2YY5A 1QJCA 4I08A 4UHCA 2DJIA 4O5OA 2II6A 2VRWA 4P38A 3SGLA 4ND8A 5AVWA 1F60A 4NATA 1I4OA 1A76A 2IKQA 1ZMXA 2IY7A 2VPTA 3QQPA 4OJNA 1U8YA 4MYDA 1BEUB 3SVZA 4CQMA 4ED9A 3HTXA 1PP4A 1KQGA 4X90A 1EE1A 1F17A 3OQVA 2WV7A 3LGSA 4FDUA 3WADA 3HH8A 4LGYA 2GF9A 1U28C 3VPDA 1OGJA 3ILYA 1LSUA 1GADO 1YR7A 1SUPA 4KE7A 5EP2A 1T8SA 1NF2A 3HRKA 5HIMA 3UWMA 5BNZA 4KPFC 5BN4B 3PI7A 3ROZA 1RQ7A 2O7VA 3JZDA 2HD4A 3NHKA 4DC1A 3QSYA 2GDJA 4LSWA 5AHRA 1O5OA 1QHNA 1XDGA 3DB1A 3I5UA 4I9UA 4G07A 3HYCA 1P1IA 1YU9A 3VJMA 4AF7A 1D6MA 1YZVA 2PS9A 4F9GA 1THGA 4Q01A 2E18A 3LE8A 1WB9A 1H2YA 1F6BA 3ZCTA 1VPVA 2BJHA 2I80A 4QUJA 1QQ5A 4HMPA 4JLKA 4YWHA 2GEUA 1R0LA 3BQMB 2QRKA 3I2GA 3SF8B 1LX6A 3BXPA 3R3VA 2JIMA 4BBZA 3N59A 2BEUA 2QMHA 4BX3A 3MK31 4Y2XA 1B3RA 4ONEA 5E8JA 2PFGA 3S4YA 1XKXA 5L8VA 4B8YA 1KH1A 2Z2XA 3MW8A 1EBUA 1NP6A 1JHVA 1YL7A 3THSA 3A1EA 3ZG6A 4BNGA 4DDMA 5DN6D 1IU9A 2FPMA 2RHRA 3QU2A 4JB0A 1TZJA 4EGJA 2JI9A 3KJEA 5L7YA 3QXCA 1DIGA 3AIIA 2IH4A 4NENA 3ZWPA 4C4RA 4AJ1A 1ABBA 2QDKA 3PQEA 3GRZA 1B2RA 3LRXA 5LJIA 1UMCA 3C3EA 5I9SA 1K9SA 1TL7C 1U6KA 3OTGA 1L5KA 2GFHA 2D1YA 4KPUB 3JQ8B 5DOVA 4DYVA 1YUBA 2ACWA 2X5NA 1S2OA 2CLHB 4RA6A 2KSQA 2P4UA 2WF7A 3ZJ5A 1T9DA 2HXGA 2Q4EA 4RCZA 2D2EA 2P5TB 4CL0A 4JSTA 5JE8A 1QNLA 2BUAA 4LWPA 1YRQA 2GEVA 4KPYA 3ZIAD 2NO6A 2WJZB 5JUWA 1GZ3A 2OV6A 1X92A 2O0LA 1UBUS 1NBMA 1EJ0A 2FU5C 1OFGA 3O2JA 2E0IA 1CETA 2CE7A 2MIIA 2NQTA 4LJKA 4O4JA 2DCUA 3U39A 1J20A 2VOJA 5K0LA 1W5FA 1VJDA 2QQ5A 5TEWA 1IBKB 4AUMA 2DFDA 2UZ3A 1JUDA 1VI5A 2KW5A 3L6DA 3NONA 2A5LA 2FUKA 2W4IA 1DMRA 2LUOA 3D6FA 5GIOE 3OO0A 4FR2A 4CM3A 4EZEA 2AN9A 2QRVB 4XLTA 4M0EA 5ED0A 1YZTA 5EJ2A 4PF1A 2WRZA 1QYCA 5JG7A 3C6QA 1QHYA 1Y4DE 3PGXA 4MS1B 5E38A 3ETLA 1KSGA 2G0AA 3CRW1 3O9ZA 2IEAA 1E9RA 3SDBA 1OKKD 1VIAA 2NACA 5A5VA 2I9KA 1SOUA 2QPLA 3IESA 4JR1A 5ESWA 3MIIA 4MQUA 5BNIA 1O97C 2A0FA 1SVUA 2G5CA 3JQGA 5CT6A 4DR7B 4D0GA 2ODPA 4M7RA 1Z34A 2PGJA 2FYTA 3LWNA 5ESRA 1XZFA 1XXLA 1CUHA 1P2SA 2HA4A 3B51X 2RSLA 3GRFA 3L0SA 4IUYA 4LYHA 4QXAA 3QUCA 3OE7A 1M5TA 4MUXA 2FJPA 4WK6A 4BUJA 1VE7A 5BVHB 4N0QA 2AOUB 2H2WA 1E3MA 3TW6A 2QXYA 2EG9A 1DKUA 1WVGA 4IV0A 5K09A 4B87A 4M0FA 3RUIA 1FYEA 1IIBA 2HA6A 4FFMA 4K28A 3CT6A 2ZU0C 1K8YB 4HNAA 1NBME 1YE8A 3EQ6A 1UBCA 3F5MA 4R9VA 1Y9JA 4IX1A 1P72A 2D5BA 1UC8A 2GPBA 3NUZA 2GXAA 1G20E 4BP1A 1L5LA 3T8YA 2J9XB 4MW2A 4U8GA 2WMOB 4FU0A 4XVHA 1XIVA 4LK2A 3VVMA 2Q41A 3RF7A 2FW8A 3THXA 4Q9HA 2VHQA 2CFCA 2ZAOA 1KYIA 4AY5A 1ZM2A 1CFJA 3E82A 4D4LA 4DS3A 2W2NA 3E03A 1S3SA 4MWSA 4BVFA 1QLHA 4BKUA 3BWMA 1MX3A 1WDTA 2F1HA 3CJQA 1T9CA 2J3IA 4QG7A 3PHGA 4WNAA 2AFHB 3SZOA 1MIOA 1DBRA 2YN0A 1I6LA 5FR2A 5IAJA 4A3SA 3WWOA 4J3FA 5IKPA 3TZCA 2PMCA 5I9BA 1V16B 3ZQ4A 1JQLB 1P3Y1 4LMAA 3WISA 1XEFA 1EFUA 3DOFA 1N2BA 2AYYA 2OL4A 1II9A 2VXBA 3EOAI 3HZHA 3OOJA 3D9QX 4WVFA 4HXFB 3W5IA 5JLJA 4M1EA 3TEFA 3SZLA 1YB2A 3DPIA 4D9JA 5DYGA 1E9EA 4CCYB 1UM9A 3P9SA 4FYWA 5JPIA 1S96A 2YW9A 1Y3AA 2RBEA 1TT5A 1U9JA 2FZ5A 4MVJF 3W77A 1Q2XA 2C3MA 5FD8A 1W9HA 2OR3A 1R15A 4LOLA 2JFBA 5COBA 1K4MA 1XTQA 3UYLA 3E23A 3GLHB 1L4BA 1VL6A 3WYAA 1Y1RA 2HYDA 4MVJE 3VU9B 1RI2A 2HDWA 3IDFA 1I9GA 2WIAA 2ADOA 1MV8A 3ANSA 2GRJA 4J9VA 4QU9A 3H6KA 2ZBPA 2W2LD 4RZXA 4A23A 3ER8A 3UJ7A 1JGTA 2O1XA 3CIFA 5FLYA 5ERYA 4QUAA 3TG2A 3HMQA 4M1KA 3PS9A 3UZUA 3ZDRA 4WINA 3LQ2A 4UBNA 3ZWNA 2HFKA 4R16A 4F3CA 3WS7A 1JEYA 4D9BA 1YRYE 4H18A 4PYOA 4D3DA 2ETXA 4NH4A 3V4PB 2B1IA 2V1UA 1T2FA 3RVRA 2YFHA 2EHJA 1SBZA 1EINA 3DMTA 2JJ1A 4D9GA 3QX7A 2P9EA 1ADCA 1RZRA 1U11A 1FRVA 1TW3A 3JRXA 3LJKA 1OFHA 5HK8A 3HGTA 1Z75A 4TVSA 2BHSA 1G7SA 4WZAA 2ZI6A 4ZHQA 4V2IA 1ACJA 1QX3A 2ZB2A 2HA0A 3AJDA 1KU6A 1P2VA 2WC1A 2PZEA 3AP1A 3LXMA 1C7FA 3FFTA 4KLZA 2WJWA 4OAOA 5BN3A 1HLFA 2Q2VA 2XOKD 2DULA 1MZVA 1XZHA 4MV0A 4PYQA 5FV7A 1EXWA 3FOBA 1J22A 3ASYA 3HKDA 3OLVA 4XGQA 5IUKC 4N39A 2J5KA 5AXBA 4IHKA 3BE8A 2PT5A 3RODA 1H4QA 1JKJA 2PZLA 4U7JA 3DQQA 5AKYA 3HP7A 3N8KA 4HWTA 1HY3A 2C5FA 1KJWA 3BL6A 3VR6H 1Z35A 5JSFA 3WMEA 1KK2A 4ZU6X 1QR6A 2C7VA 4MUHA 5B2FA 2RHWA 4FGZA 4KUHA 1RQGA 3DHWC 4J0KA 4R2IA 4W5HA 4MWBA 2GB4A 2XWQA 3DF9A 2AG8A 3L8CA 4D8YA 1W36C 1K5PA 1O58A 1WMSA 2R84A 3VI4B 1NN5A 3GVIA 5EJ5A 3MWEB 4J1NA 3C41J 3SHOA 3J7AC 4KI7A 1YMVA 2B69A 4KLNA 1UOEA 5FO1A 4YBRA 4BKRA 1NQUA 3NWJA 4NE7A 4UCFA 4B7ZA 4LCBA 4O4LB 5AUQA 2H65A 4Q3EA 3NDBB 3U17A 3TRDA 3UK7A 1DFHA 1H8HD 4JT4A 4OHZA 1AUQA 1FLVA 2IHUA 1LLUA 1X14A 1SQ6A 1PJCA 4LNHA 3TZBA 5EWMB 1PJSA 3ES9A 4TTPA 1XWFA 4K9RA 3F5SA 4A15A 4D9NA 5E6UB 4AG6A 2GPYA 1XQ1A 2DH5A 4OD0A 4YLYA 5DF1A 3TLJA 5KDDA 2AD5A 2GTIA 5K8CA 1PK7A 3ADOA 1EU1A 2Z5GA 3L0BA 3OIFA 2YTZA 3G9XA 3NKVA 3AI1A 1U8EA 4KN6A 4LSZA 4RZQA 3OY7A 1D8AA 1QB7A 3WLEA 2CSUA 3U1TA 1TDJA 1ZICA 1KQOA 2GERA 4UBKA 4C6TA 2PGIA 3LV8A 4LW8A 4EOGA 1I4LD 3VC1A 4YAIA 4I1YA 3ONNA 1YRBA 3NB0A 4MQEB 1ITZA 2V7BA 3DCIA 5HIAA 3TSYA 1N34B 2I1QA 2ZFUA 1AZLA 2JGKA 1AMNA 3W3ZB 4JLJA 4D82A 5LD2C 1DAGA 1JDBB 4LMRA 1NBWB 2CVQA 1RD4A 2WSSD 1NM5A 1FP7A 3N8IA 1Z63A 1D2MA 2GT1A 4XB2A 3IQGX 5L3VA 3I4LA 3A7DA 1EFTA 5CW1A 4DCOA 2VAMA 1AHNA 4GX1A 4FWTA 1YIOA 3C4QA 4C9BA 4RKYA 5AI0A 3BL8A 3C5WP 3PE4A 1ISFA 1WKCA 2NTEA 3ZVKA 1HM5A 4LF6B 4N49A 1GZUA 2H52A 5LWQA 5B1DA 3OT1A 5F2NA 3HNOA 1A3CA 1OWMA 3QVGA 1E3LA 2WMNB 4EMTA 2Q8QA 1F8FA 5IBQA 5B1IA 2OCGA 5U4QA 1RYDA 3ETGA 3PX7A 2QT1A 3NBKA 1JJIA 4KXLA 4XSGA 1UWLA 1YZFA 2GN2A 3ELDA 3KSRA 3QOFA 5ER6A 1ZN7A 3ZGNA 4BBJA 5IAKA 2ZRQA 3PBKA 2E4XA 1X94A 2PD3A 2PYIA 3HBLA 3FDZB 3H9BA 4HDKB 4FXOA 4I5DA 3O4GA 3GUCA 4MS4B 4M38A 5AHKA 3TD2A 1ACMA 1O4VA 1O89A 1EWRA 2VDQB 1Y6JA 3VU9A 1UT6A 1Y89A 4GOOD 3AKCA 4NYIQ 1GTVA 3PA8A 3V4OA 1Z2OX 3RRMA 1ZL0A 3WHKA 1C1DA 1U2ZA 1YDHA 2WUVA 4PFKA 2P11A 5EJIA 5HCNA 4TV9A 5TQ0B 4L02A 4ACBA 2D59A 2W6ID 5AVJA 4D25A 3DMPA 5FBQB 1Y4UA 1FFEA 1MAWA 1WPQA 2MYPA 4LNUB 1ZCFA 1H0KA 4G0VA 1XZEA 4WNYA 2ZRLA 2GR9A 3CNHA 5H5JA 1BCRB 4HH1A 1KMCA 2XUHA 3NDJA 4OLJA 1T8WA 3D1LA 5DDIP 5SYMA 2NTNA 2PRKA 3SX2A 4HY3A 4ZVTA 1DIAA 5KSZA 3CEAA 4WA7A 5EIHA 4ZZ1A 5JRDS 3CKYA 3D0RA 1V96A 2ZT7A 2R7KA 4GX0A 3FCYA 2VP2A 3RTEA 4O2AA 4M89A 4RSHA 1T5DX 1ZA1A 3CY6A 1G291 3EA4A 3DOOA 4RL6A 1LW7A 2MINB 3TO5A 3UTCA 1NRWA 1Z74A 4EHBA 1GZ4A 3H7AA 1OXTA 5EHNA 4RC9A 1CBUA 1ESEA 1TMGE 1NJSA 2ORIA 4K5QA 4WN3A 3VKHA 3GXOA 3TZEA 1VBFA 2GPAA 2XMPA 3E2MA 3L8DA 1M2FA 3A4LA 2R7AA 4H2DA 2Z3VA 1U1EA 2JFGA 3KSDO 3T9BA 1L6RA 3A0UA 4IIEA 2VTKA 2QROA 5B7PA 1XO1A 2PRJA 4BNMA 2ECKA 4TXHA 1E0AA 4AP5A 1Q3KA 4FGWA 4DIDA 3ROQA 3W1EA 4YJ3F 3AY3A 4AO7A 1AQNA 4ZJPA 4BJ3A 3TX6A 3N0XA 2VR1A 1U3VA 3LPMA 2OCPA 3GH3A 5BQXA 5HS4A 2XYPA 1TK3A 3PRHA 4BQFA 1C14A 1U90A 3M1AA 3JWPA 1K66A 5JC1A 4BO0A 2I29A 4RHUA 1CUJA 4N5HX 1W47A 4JBHA 3GD7A 3HCEA 3DXZA 1M2OA 4UU8A 4NJMB 4RSMA 4ZZ3A 2YNMD 5JSHA 5L7WA 4X62B 2C98A 2AHOA 5TF4A 1C0IA 2ZLBA 3D54D 4HQLA 4URFA 2QLJA 5AJWA 2IUUA 1I0LA 1LZKA 2V7PA 2J8ZA 2X9GA 2I8AA 4AK9A 3K2BA 1YB5A 4ZJUA 3HQ4O 3HA3A 2P41A 2CNKA 3PGJA 4I9NA 1NI5A 1QOQB 2B4QA 1C7EA 5DGHA 1VXOA 4B3MB 1QBGA 4ND1A 5M34A 3C6ZA 3LD9A 1VECA 3W7BA 1QAQA 3W9SA 1TKRA 4EVSA 1L4KA 3BJIC 5DK6A 4MUGA 1TZBA 4HN9A 4Z1OA 1PSDA 4AWXA 4DPLA 2CLSA 4RWEA 4Z2AA 5ADUS 2HV8A 1F0PA 3NBAA 1CQJB 2QM8A 4NYMQ 4ESHA 4UTRA 2ZWAA 3QV1A 3M8KA 4J0HA 1B7GO 1L1RA 4HDSA 2WG1A 3P8ZA 4FMCB 4DWJA 3ZZUA 4NMHA 2P65A 2JLVA 2XT0A 2VCHA 3R3SA 2BUCA 3D8UA 4C04A 3RRJA 3G8YA 1QH8B 3U6BA 1IJBA 4BB6A 1C0PA 1TVCA 2QRUA 2JLUA 2C58A 1DAEA 1EXDA 3IR5A 4FI3F 2C2YA 1YIAA 2HNAA 2ZWVA 4A7PA 3IT3A 4JJIA 3SAJA 3AHEA 5FTNA 3ZBUA 4B32A 3D1JA 3QOWA 4ZDIA 2E4AA 5THQA 4BS9A 3KAKA 4N4AA 5KU7A 3WQQA 1QF7A 2VSYA 2XYVA 3UF0A 1FFYA 2Q2WA 1PFUA 4B0PA 3GYBA 5HHTA 1ORHA 3W8EA 4BLWA 2IYTA 1M73E 2JCSA 2RARA 5J5VA 2WHEA 3FM9A 4GPAA 4HVAA 1G21A 5KTYA 2FEPA 5FTWA 4P54A 5L53A 2C59A 2XNKA 3HA7A 4M49A 1T1GA 3F5FA 5ICFA 3RSQA 2QTBA 2VKTA 4F5YA 1WNTA 2MMCA 4XWTA 4JELA 2Q9AA 1VGRA 4D74A 5FUMA 2C7BA 3G0CA 1N6RA 2PDAA 3W5BA 1EHIA 2CXHA 1CV2A 1Z2NX 3DVQX 3AUFA 3VUEA 3D7MA 1NYTA 3BXZA 3K70B 1WS6A 3F3SA 4HPXB 4LISA 4Y3UA 3OVMA 3K0SA 1ECFA 1L5FA 4HXGA 2GUWA 1CR4A 3K30A 3MTBA 4ZT2A 3RHZA 1ZINA 3A6JA 5AJTA 4RY2A 4IHJF 2YL2A 5L4SA 5TE9A 2GJKA 2HDOA 3OSUA 4RUKA 5GZ1A 2F7SA 1IZ8A 1YV9A 3OT1B 4MB6A 2D2IA 2OE2A 1X8JA 3ZZMA 1V71A 2H48A 4MRVA 3UAVA 1A95A 2OCBA 5CVUA 3DO8A 4TM7A 4GU5A 1H05A 4F11A 2XMRA 1Q19A 2AI2A 1ULHA 3RVLA 5JQWA 2ON6A 5L40A 2VH1A 3Q3GE 3B70A 4XVUA 1Y9DA 1TPYA 2AD1A 1RJGA 1M10A 1G8MA 1R9NA 4QHTA 1Z88A 2DQ4A 2CHUA 2JH9A 2R00A 4V2UA 3HPRA 3SE0A 1PE0A 2HO5A 4RTMA 4RLSA 1KYVA 2B0CA 3WNQA 2JEZA 1EK0A 3GA7A 4J43A 2WK1A 3P52A 1EJBA 4JJZA 4CUZA 5FBZA 2FZCA 4OHMA 4Q7QA 2OQRA 2O7QA 4PLYA 5JAIA 4LF8B 2PKEA 3T7RA 3FCOA 3SKXA 4URXR 1D4FA 5ICSA 2JBAA 4WXPA 4NI5A 3R7BA 3CG4A 4BFSA 2G6BA 1W75A 3TLXA 3NIFB 1YAHA 2Q5HA 4IZ6A 2ZVJA 5BN5B 4JA2A 2PIAA 3WDMA 2LTAA 4GE3A 2XZPA 4U6NA 4XYMA 4BP8A 4BRUA 1SIOA 4ZO7A 1L8LA 4OHCA 3Q9UA 4KQEA 5DASA 3GVPA 4KZPA 2YQ4A 5KQRA 2ZREA 3DZBA 1AKMA 3HZOA 3ESZA 4YP9A 5K3SA 5E4YA 1DC8A 3OX2A 2X4DA 4C0JA 4DGSA 2OOSA 2GRAA 4EG1A 2O50A 3E9NA 3U3ZA 5FV4A 3STVA 1FX0A 3BILA 1TQ6A 5CIQA 5CM8B 3WIUA 4E4RA 5H82A 1Q17A 1QZ3A 2HWUA 2B5WA 3ZJYA 3QU9A 4RJJA 4HQ6A 1EPUA 1RTKA 3AUJB 1I6MA 4YJ2A 2EW1A 1PJZA 4IIUA 3I5YA 3JQPA 2ZIGA 4RVOA 2C00A 1Y63A 4B85A 4AKSA 2PT6A 2ZPUA 1UKZA 3CUVA 1LRLA 1Z07A 1S4MA 1K7CA 1MDFA 3QY9A 4I99A 4WFIA 4YT2A 2RBGA 3UT5A 4B81A 5K4HA 4C29A 4AWAA 3K6JA 2NW6A 2FZWA 3RDPA 5JJKA 3TWOA 2QAIA 1RCFA 1FSSA 3OI7A 4P81A 4DLRA 1QP4A 5HFAA 1OQAA 3K73O 1Y82A 2QD4A 3IP8A 2IV7A 1DL5A 2B1JA 2F6RA 2ZEJA 3IR6A 2JBAB 1YR1A 5B3JA 4Z8XA 2XRFA 1UXGA 2GJ4A 1WD5A 2O4UX 2WAAA 3BG5A 4B73A 1MC1A 3B5JA 1JQAA 3AI2A 2WJYA 1K98A 3SM3A 2ZRKA 4KYIB 3A1TA 5KC8A 2GJAA 3F3YA 3RT7A 2V03A 1XDUA 1NHWA 3NASA 3W5DA 4O2RA 1P0QA 2HU8A 1B8OA 1DNPA 2ZYIA 4K3VA 1UKBA 4ZT3A 3FVVA 1BO6A 4MO9A 4NDAA 3M6FA 5BW4A 4LXGA 4QUHA 3UMBA 3UJDA 3FE2A 2F9LA 4RK6A 4L5CA 5JBNA 4ZP1A 3JWJA 4RDIA 2UZ1A 3SSAA 2YYZA 1VYHA 4C76A 1MJHA 1XZPA 1M6YA 3CMMA 4TRJA 4RIFA 1RKXA 1PN3A 3S7TA 2YXEA 3UN1A 3W5VA 4PG8A 3WJAA 2JJQA 1Y37A 4HGZA 3TM4A 2OCLA 4RU1A 2G8NA 5CM2Z 3OWHA 3GH1A 2HRQA 2XR1A 2VLBA 3DDSA 2VN8A 1E8MA 3N6VA 4H1VA 1LNQA 1R50A 4NR0A 4Y2RA 2PIDA 3PPIA 5AKXA 2OAQ1 1U8FO 3JRWA 3TVDA 2ZJ8A 4XVRA 4CUJA 4KDRA 5ALPA 4QC2A 2VHVA 1EX1A 1R0WA 4N8EA 1SZJG 3E3MA 4UU0A 2QJRA 2WJ3A 4P7GA 3ORQA 2VDRB 3E0QA 4MPTA 3V2GA 4M8IA 3VNBA 3FOCA 3H5RA 5IBRA 3B3JA 3EA5A 5LP6C 1NVTA 1OX5A 2GPWA 3NBFA 2OHHA 9GPBA 3AKEA 3WIVA 5EIXA 2V7TA 1GLGA 4B6QA 1MRZA 2Y68A 3ZE6A 4EUEA 4R2KA 1MIOB 3AWDA 4EG5A 4ENPA 4F2WA 2A92A 2EFJA 1UOOA 4BVAA 1DCTA 5A1TA 2J08A 4X00A 1IBLB 3T7IA 1BN7A 4H3VA 4KMSA 4TN5A 3K94A 4TOIA 1T26A 4FX2A 4J7XA 5ENDA 3AESB 1LLDA 3KWJA 1E1CA 5AI5A 5JMWA 3A26A 2GEJA 4BQOA 4NECA 3H8SA 3MOSA 2B1RA 1ZM4A 1NATA 3COPA 4IYRA 4OBEA 5DRYA 4ZT4A 4P4SA 4GI3A 1NQXA 3ZGYA 2Y76A 3A2NA 3AERA 3ICWA 3N8NA 2ZVPX 3PDCA 5E6SB 3PSHA 2GBCA 1SCJA 2Z1DA 1B00A 2R60A 2XWSA 4EGSA 3FCCA 1D1QA 2P3OA 1NFQA 2R1ZA 1P9NA 4JLNA 4YRPA 2HK7A 3T3IA 1WV1A 1N2CE 2QRJA 2XDYA 1KFCB 1W1UA 3IJPA 1IOLA 2QR3A 5AD1A 5FHQA 5B1EA 2WICA 1K8XB 1WMEA 1YQGA 1E1QD 1NBEA 2CXPA 3PX2A 4IIFA 4MPJA 2IZ1A 5EWJB 4CLOA 5A1JA 2WJ4A 3ZQ6A 4KO2S 2QX8A 4NONA 3GRRA 2FF5A 1FFGA 4NNPA 2YXBA 4GL4A 4D8TA 4F46A 2WWHA 4EL5A 1E6LA 3VI3B 1RLTA 2H8GA 1E5QA 3ESCA 3GU3A 1SD2A 2PV7A 3PJEA 3ZLVA 4B82A 4C0KA 1CJUC 1GGHA 1QRDA 4M9UA 4NCBA 1NF8A 4RGYA 4F2PA 1KEEA 2OCDA 1F3OA 2OV4A 1P74A 1G5IA 2QSJA 1ZIOA 2C31A 1MQ8B 5HPYB 2Q07A 4NK5A 3QITA 3K70C 2K2QB 1F0NA 1NOIA 4LS3A 2Q62A 4C4PA 4POAA 1KEPA 2N75A 1LBQA 3GLGB 2PA3A 4MS1A 4UE6A 2WZDA 1VA5A 4JODA 4IIDA 1XFAA 3E8XA 1UT8A 4YRAA 4NJEA 3TRIA 5U9CA 4JC5A 1JBKA 1P7ZA 5C1OA 1FCJA 3FFBA 2WZCA 4QQ8A 4R7TA 5K0ZA 2HYIC 2I3ZA 2RGCA 4XXHA 2WTAA 4J3NA 1RYNA 5P8WA 1VL5A 2R6AA 4HLQB 3ZXYA 1CUWA 2JAUA 2RHLA 3PT5A 3NM4A 4DEVA 5J2TB 3OLWA 5ELMA 3VNRA 2FDCA 1RRKA 3WHLA 1G0NA 3ASVA 1MW9X 4ETMA 4ACAA 3OE5A 1EX9A 1P0MA 2QTRA 4G1UC 4UU1A 3ZX4A 3ZVRA 1CXZA 1IM8A 1ZHFA 4BNLA 3ZE1B 1GL9B 2V7XA 4JL6A 2OA0A 1US8A 1A8IA 1XZAA 2Q1WA 1EG2A 5GM2A 1BX3A 1KZGB 4GKKB 1A8SA 4KV9A 4LKRA 5D1NA 3RJZA 3ZTTA 2I6GA 1DZIA 4X8MA 3LZDA 1G16A 1VG1A 3BXXA 3DQZA 2BYTA 2I33A 2I6UA 3BDVA 5HEKA 2W8ZA 3FCXA 4GX2A 2DPYA 2I7TA 4P4GA 2H4ZA 3EXEA 4LSMA 3RSCA 2I3DA 4YRQA 4NULA 5AOCA 1N5OX 3DNFA 4M0MA 1RMYA 2ZB3A 4PM4A 4JK3A 2O2DA 4WNAB 1GV1A 3UAXA 3FZNA 4K8OA 5I4CA 5LQJA 2I91A 3FKSA 1L4MA 1TIPA 1TUEA 3CBGA 5DBGA 5CEJA 4J4BA 2HLNA 3OIYA 4QELA 4FEGA 3TOVA 4B6RA 3H97A 3FNIA 4PZDA 5F9MA 1TMYA 1U7HA 4JOSA 2FSPA 3G2IA 4CMEC 3OQNA 3GNTA 1JQJC 3R3ZA 3THXB 3D5QA 4HDKA 4RA9A 2Z4SA 3NNSA 3DL0A 3VH4A 5A0VA 2Y4NA 5JZMA 3IBCA 1G5TA 3TBFA 2HIAA 3R9XB 3O75A 3SVLA 1T6NA 3W78A 5FBWB 2YRWA 2ENUA 1T4DA 4BWVA 2BFBA 1EQ2A 1KL7A 5ITZA 4LZZA 4V0MA 2P78A 3BQNB 2JBWA 4UM8B 4F6RB 3SC6A 4EJ0A 3TAHA 1G6Q1 5J1TB 4MGZR 4W63A 1N0VC 4UJ3A 5J2TF 2DUUA 1BE8A 3OT4A 4LFCB 2QGNA 1FMJA 2WYVA 1KMMA 4RZ2A 5F7OA 1RXVA 2WSMA 4CTJA 5H3LA 3TQQA 4FE4A 1LJUA 4HH3C 5B2ZA 1BJTA 4NF2A 4NCNA 1U2GA 2GF0A 2OHXA 3JQGB 3ZXSA 4B3BA 1FNNA 1NYRA 4EGQA 5JDIC 4GNKA 5KSWB 1NXWA 3U7HB 4RF3A 4RHFA 2E4ZA 4LUCA 3KCNA 3W3AH 2WWYA 1LX7A 1RHMA 2RCNA 1R12A 2RONA 1K75A 3I73A 3IMKA 1QCCA 1APBA 3U4QB 1CEEA 3ZWQA 2RJNA 1KAOA 1HR0B 1VJCA 4G5RA 4F7DA 1IZZA 1SU7A 3C8ZA 1IEQA 4MW9A 3SZMA 4BMSA 3HJFA 2FZEA 1ICEA 2ZAIA 1T1EA 3IUNA 3JSXA 5ALZA 4HQFA 3R40A 3KP1A 3STTA 5HDBB 1AZWA 1VB3A 2WF6A 5CGZA 2BEJA 1G4AE 3ROKA 4V0ME 4WCDA 2EF0A 2DLCX 4D79A 1PSZA 2OBFA 1PT5A 1Y6RA 3LZ6A 1R4NB 3FNRA 2IGTA 3BICA 1BS9A 4II3A 1H2WA 4MV7A 4EHKA 1NWCA 1CERA 1JYSA 1WZCA 2IXAA 4GPBA 5KC9A 2PJRA 1Q6YA 2O7NA 1B16A 3PYLA 1R10A 1FYDA 3B60A 2H3HA 2PMDA 4PCLA 1GA4A 2LIPA 5K3AA 1D8TA 2VSFA 2YY7A 3I9MA 4X84A 4AN4A 3DMNA 3EEOA 1FMLA 1Q7RA 1ECGA 2AEJA 2I4TA 2QVXX 2QY9A 3MMXA 5EAIA 7REQA 1RIFA 1W87A 1UINA 5LVAA 1T0IA 2OOKA 5EIWA 4LXUA 4R8KA 1XNQB 3V97A 3IKMB 3SSMA 4IDBA 1KIMA 1R5JA 3L6UA 5I7OA 4FC7A 4DG8A 2DU8A 4UHEA 4RULA 2VUUA 2I9PA 3HY6A 4PAOA 5E3IA 1M1YA 3VVBA 3TCNA 3AHGA 3WGQA 2BEWA 1BA3A 4U9UA 5FWXB 2PE5A 2Z6QA 1LRKA 1OU0A 1I36A 1EA5A 1ZK0A 3R23A 2FVYA 3URKA 3HP4A 5BSWA 1XI2A 2VDNB 3WFJA 1YS6A 1HEIA 1PJRA 1FYWA 4RCVA 4E11A 3ER9A 1O3YA 3NG1A 1N3YA 4AXBA 3PLRA 3EF1A 4H1HA 4RD4A 2FMXA 4C6SA 3DZDA 5H4HA 5AKGA 1N7JA 2Z58A 4L15A 3GZ4A 2GILA 4QYWA 5JTTA 4FCCA 1MIHA 2HDNB 2XKAA 4JWTA 3LS2A 3E22A 3S2ZA 3C7CB 1NY6A 1AKRA 3DPUA 4OHBA 2XNSA 4LY0A 3OOEA 1O95D 2ZB8A 2XYQA 3LP8A 1JHMA 4QAJA 1U7OA 3I5XA 3BH6A 4ZZ2A 1I3LA 3KXLA 3WMWA 2A6PA 3IPCA 3K8ZA 1XDBA 2OGUA 3CURA 3KTOA 2VH2A 3NHUA 1R9GA 2HF8A 4ZCMA 3I83A 4P7KA 3FI0A 2QMYA 4K0RA 3NKLA 3OZCA 4UHBA 5CH5A 1J8VA 4UMFA 2CD7A 2QMUA 2QGZA 4UUNA 2EW2A 3B9BA 4AUEA 4CIBA 5ECGC 2GLUA 4JYMA 3BE6A 4LRQA 4EDHA 1G38A 4CM7A 5DSZA 3E5HA 3N2IA 1D3AA 1AN9A 1PL0A 1FUIA 2H51A 2XOXA 4Y6QA 1BWSA 3AL2A 4RHCA 1CUZA 4CVNA 1U99A 2A5JA 3FMVA 5I4KA 8OHMA 2R8ZA 4D9IA 4JIGA 4RZSA 4TWAA 4Y1FA 1SGWA 3UWPA 4ZQGA 1I4DD 1YK1A 1I7NA 1JYFA 4DC9A 1J7JA 4TL7A 1UAAA 2WG2A 2FRVA 1MB0A 4YJFA 5F4ZA 3PC7A 1Q0TA 2IZ6A 5TQ2A 5BSRA 5LYJA 3F6BX 2NU6A 5BPHA 4RMIA 4BOYA 5HGXA 5LMCA 5GZ6A 4G3XA 4DJDC 4HX2A 4G0QA 3TMAA 5KCZA 4V39A 2WKSA 3CW9A 3OFJA 4Q3AA 2IPAB 4XPZA 5ETJA 1UWCA 3GY0A 3REFA 2Y2UA 1LUAA 1GG8A 2QDXA 1W88A 2FZKA 4KU4A 4UNPA 5F1PA 1BWPA 1QQBA 5KWSA 4PNZA 4HTAA 2X4GA 2QD2A 4LJLA 1ZGGA 1SBYA 4HZGA 1D6SA 1YI0A 3F3MA 3I9V6 4Y2YA 1EIZA 4CT5A 3ZZ0A 5IDVA 3A2LA 1SJ9A 3SEAA 2ID8A 1GSIA 4MEJA 3FLAA 3I52A 1RLUA 3DM9B 4LYAA 3DBHA 4AS2A 4FKBA 5CH8A 4U7DA 3IPAA 1LQUA 1LPPA 1EP1B 1E4OA 1VMDA 4EGAA 5BNWA 4QG3A 3HXOA 1QAMA 2EWMA 2PUJA 3QUSA 2H18A 4IMIB 4O5AA 3IQDB 2SNIE 3JS5A 1F4PA 3HLTA 3G17A 4I4IA 4JITA 3IT2A 1P81A 4LV8B 5D87A 3T7JA 1JMKC 4IL5A 5L3QA 3W5AA 1P60A 3AF2A 2GPSA 4WBNF 3DMRA 5I5GA 1R8JA 5D84A 2X3UA 2JEOA 2ZB4A 3D4BA 3N8DA 2NNWB 3HS3A 4YO8A 2BL4A 2PL5A 1Q15A 4IVQA 1XNHA 3F5DA 3FY4A 3NHYA 3W4KA 5JNTA 2JIOA 1HMPA 4YRFA 3TLKA 2OB2A 5JLAA 1JPVA 5EKSA 3ZLBA 1ZN9A 2O2IA 3HYSA 4KIGA 1T13A 3BRQA 1QRSA 2CF5A 2VIIA 4B5LA 3SQXA 3TB6A 3L7LA 4TMYA 5AH0A 2A84A 5DHQA 1IQ0A 2WZBA 3D6TB 4DREA 2CXRA 1V7ZA 1II0A 1HSOA 3G9UA 3R3YA 4LZPA 3V4SA 3T95A 1XA4A 5KOHA 1L8AA 2YZ2A 3C8MA 4HSEA 4RETA 2Z4RA 1DRWA 4R1NA 2IKSA 3KTFA 4KGVA 4PCAA 2YV4A 5KHAA 4F3KA 1ZLYA 3AEQA 4LXQA 2H2GA 2QV0A 1XR3A 5BSUA 1Q1NA 1XZBA 1DDIA 1Z3CA 1YZYA 4IIVA 4O2BA 4US2R 4L76A 4G0ZA 3ROTA 3WYGA 5HKAA 3Q2IA 3RUAA 1IOWA 2C4TA 3ZWYA 2VZ9A 1BRTA 1DV1A 4WAUA 5GGXA 3SR4A 3L7AA 1SXGA 1WM1A 4OI2A 5DTJA 4INAA 5EESA 2COEA 3KLNA 2FXVA 4IYJA 3L92A 3NPMA 2ZI4A 4CW7A 4BNTA 2Z2KA 1IIRA 2YOGA 2E1RA 4GPZA 3VVCA 5IZCC 4L7QA 2E49A 3RM3A 4EKNB 2ZAGA 4RY9A 2SHKA 4L0DA 1V11A 1YZLA 1TCAA 3PLNA 2FLVA 5HM8A 3TK1A 4FFLA 1GYPA 4YROA 1JWLA 2X5OA 3DWFA 4YFYA 2RC5A 3RG2A 2IDMA 2EIHA 4FW8A 1FNCA 1N6KA 1VCIA 2O0HA 4FOLA 1V1MB 1PRYA 2GEBA 3FNFA 5L4NA 1R8XA 2R0QC 1JSLA 1T3ZA 1WLYA 3VOTA 4BX0A 4TLLB 3W7VA 5LSAA 3AUSA 1A69A 4X97A 1I3CA 3HO8A 3H5WA 1O96B 3R0VA 4HYEA 4LX8A 3ABSB 3SJCA 3GVHA 2RHCA 1XA0A 3HXMA 3DDCA 2JD1A 3HLKA 3W2EA 1C9MA 2DJ5A 1Y5NA 1DTSA 2D2FA 2PZJA 2LDBA 3QSGA 1WY7A 3FHLA 4FNGA 1OY1A 1N25A 1NOKA 2YV5A 2WDPA 3ETNA 5JXIA 2PUWA 5DLYA 2FZ4A 4UBLA 5IH3A 4A0SA 2JLXA 2FZVA 3BN3A 4MV9A 3SE7A 3THWA 1Z0FA 1JDUA 3ICVA 2XNDD 2IODA 5TMEA 1PT8A 1DQYA 1KA9H 1NW6A 2E6UX 1SKYE 3KU1A 3W5UA 4CMHA 1UEJA 5KCMA 4MWTA 1JHZA 1OASA 1V37A 1DO2A 4JYZA 2WAYA 5TNXA 5I6DA 2DZDA 1IPEA 1DUSA 2QN9A 5EYPB 3K9NA 1XTRA 1H1LB 3BEOA 4MVJG 4O59O 3V3TA 5E3HA 1OI4A 4NFYA 2ZJYA 4WDQA 1M6WA 1OLUA 3LPDA 4YDHB 3T1OA 3WGZA 3E1SA 1O6FA 2ONJA 2YY6A 3NW9A 4MVWA 1UBEA 1U98A 2Z2ZA 3G89A 4GM1A 3N2GA 1R0KA 3ZWOA 2RGNA 3GARA 2GK3A 3GC6A 3IEPA 2AOWA 3INTA 4ZHQF 2XMSA 5C9ZA 1B93A 2HCBA 2VP6A 2A9VA 4URHA 3MRSA 4BFUA 1K5DA 2QT9A 4TMZA 3VO2A 2H00A 5HMLA 2EDAA 2EZ8A 4XVQA 5KEIA 1TVKB 3AUYA 3U13A 2MYTA 2PX6A 1GZDA 2XXJA 4LVNA 4MNTA 4V0LA 2XMZA 1KY3A 1KDYA 1QGUA 4YJKA 3QMPA 1F8XA 3Q9NA 5KOIA 2OD9A 1U0HC 2WFLA 3LY5A 4LXTA 5AK0A 1KRWA 5I3ZA 3L06A 3LQ4A 4WFQA 1L1EA 4WKOA 2XXAB 4LE2A 4QXPA 4GXRA 3A6FA 2GEKA 2GM5A 3Q3CA 5JU6A 4CU2A 3QVUA 1ZZGA 1KAGA 3HNPA 4TTQA 4ZRDA 1EWQA 2XB2A 5KDLA 3U37A 2O8FB 1V5IA 1WU8A 5EE1A 2XT6A 3DEZA 3MWJA 3PCRB 5JPCA 2ZBQA 1CT9A 3FSGD 4PPYA 9ATCA 2ZYSA 4M6WB 4YJGA 1FTGA 4BNWA 2R751 4RTOA 1RU3A 2Q3CA 2HR1A 1M67A 4JNCA 1OBOA 2I99A 1E6WA 2P1ZA 2XQKA 1IATA 5FDFA 2XD9A 1OWNA 2JAWA 5IEJA 2C9OA 1GGVA 2HSZA 3U3JA 4L51A 2FFRA 3E9MA 4H31A 4LF4B 1EB8A 4FI3C 4K46A 4JY7A 1IMJA 1BE6A 2GM9A 3BKWA 1T6BY 2MCFA 4OP1A 3CZPA 4OYYA 2KB0A 1P1BA 4EBFA 4CR6A 1BEZA 4M22A 4BKOA 3U7RA 2QAGC 1JBQA 2A30A 3EXIA 4N0MA 4RVDA 3RC8A 2HBYA 1NQTA 5JH7A 3ANMA 4BE9A 4ZZIA 4G0UA 1PHRA 3LQ1A 2QM0A 4BO2A 2C04A 5TMPA 5CRIA 2X6RA 1E4VA 1AURA 1OYVA 1P1JA 1UDCA 4PX3A 5EQFA 4AJ9A 3JQ6A 3RASA 4MARA 421PA 4QUBA 3PICA 1C0EA 2Z5VA 1HORA 3HFSA 4IQ0A 4DM4A 3P2YA 3MBIA 1T3GA 3HCAA 4RVSA 5JMPA 1GTZA 4RH1A 1L7OA 2PSSA 2WIKA 4CEIA 1JR2A 3GN1A 3VH2A 4ATNA 4CR8A 3ZU4A 3UC9A 1NASA 1HEUA 5GM1A 1XRMA 2V7GA 4K05A 1AH2A 1HQDA 4X91A 3ZE2B 4LRWA 4YP0A 4IH9A 3DMFA 3EASA 4MUNA 1JSRA 2GCOA 2D2VA 1F1JA 1RM4A 3O4FA 4JBXA 5DW3A 2EJWA 1WMDA 2XCLA 3V7UA 3CLRC 3KXIA 1FFSA 2C77A 1QGDA 2J5QA 4NKRA 1ULAA 4XLZA 1E2FA 1PZFA 3OPYA 1QK3A 2Q8NA 3STUA 5HJ5A 2JG3A 5HKLA 2OC9A 1U0FA 3D02A 2VEOA 3TIIA 4CIXA 3HUEA 4PR3A 2XA2A 1YZHA 1C3EA 2CZQA 3NWPA 3G6KA 4GC5A 2F8TA 3KTDA 1GG9A 5G4LA 5F1YA 3IUJA 2BMWA 1FB5A 5CIWA 1JI0A 2EL9A 5IT0A 2MHCA 1E3DA 2JHFA 4FHGA 2J67A 2H4YA 4DIKA 1QMPA 4AJPA 3G02A 3K70D 3A4NA 2EIXA 2A7XA 4IUCS 2KLBA 3D3WA 3GRKA 3GRCA 4N82A 1OREA 5ER9A 4KG7A 1WHTB 4MRNA 3UIEA 1W19A 3K1YA 4PPFA 1E1RD 5E7IA 4BX9A 2EJBA 4KNYA 1XVLA 1E64A 3X3HA 2WWFA 3B1WA 3BFVA 3KOZA 1QP7A 4DDHA 4GQBA 1EM8B 1GXSB 1GL6A 2QA5A 2L82A 3L84A 1OPXA 4JWKA 3HXQA 1Z6GA 1SXJB 4LK3A 1LPOA 3U7EB 5JY1A 4PLHA 2V3WA 4HYQA 2FXIA 2HRRA 3Q7IA 2YQ5A 1DQZA 3A27A 5F3DA 3ZZNA 3GFVA 3KQHA 1D0IA 1VE5A 2BD0A 3P9QA 2JEYA 5EIAA 1HLPA 1JMYA 2BBOA 1BKYA 3A9TA 3PHBE 1J09A 4G56A 1KEUA 4CIAA 3ADDA 4DV5B 3VPHA 3VMMA 1Z5WA 2GJ8A 3D7RA 1PK8A 2BFWA 2KLHA 4KGZA 3AR2A 521PA 1LB1B 1OBCA 1G7CA 1NA5A 1ZEJA 3F74A 2YVKA 4FNMA 1Q5PA 2IF2A 4DBLE 1N5MA 3L7OA 3OCCA 4LXIA 2EL7A 1EFPA 3P0RA 1UODA 2AX4A 3UEOA 1L6IA 2P5YA 5A03A 5FLXA 1DC4A 3OIVA 1E0SA 5JW6A 2W6NA 4MIYA 3BT7A 4M1SA 1SOMA 3NHSA 5A5EA 2QMZA 2X6QA 1YFZA 3DVLA 1U5AA 1U2RA 2FFAA 1A4IA 2C2GA 1B2LA 2A4KA 2VNSA 3L6EA 3LDAA 5AK3A 3RQIA 3V48A 5I45A 4A36A 3O1LA 3F6RA 3TN7A 2I0FA 4TV8F 1WZNA 4PE5B 1NPTO 3H4VA 3JR3A 4ML3A 4IGFA 3OUZA 2IE8A 1U2PA 4ARCA 1SBCA 1XCGB 3BZBA 1MAHA 1DKQA 1QKIA 1Y33E 5JV5A 5D7BA 3WP1B 1KWKA 4X6YA 1K4KA 3X1MA 1IH8A 3H3XA 3Q5GA 3SICE 3WL8A 4AS1A 1DTEA 2A67A 4MUIA 3B6ZA 4CKBB 1Y6GA 5DN9A 2G7MC 4I9GA 3ZVNA 1NVKA 4OIFA 4CIWA 3I8OA 2C95A 4NU8X 4IG9A 1G66A 3ZQUA 4DV3B 1ZJ4A 1AZSC 2AN1A 2V9PA 3FNEA 3TNJA 4F0JA 4FCVA 2VYVA 3PDIB 4EW6A 5AQEA 2YR0A 3MRTA 5IX8A 4UM7A 3R74A 2AJCA 1SA0A 3PU6A 1YJCA 1KERA 4KIUA 1LA2A 2LCQA 5CUQA 4ETIA 1YXMA 2RHMA 3N7AA 3LYLA 4K0KB 1G18A 3UK0A 2Q7OE 4EPWA 1N9ZA 1L5QA 1GQSA 1EE2A 3PEYA 4JJEA 3DE0X 3LL4A 4QOGA 1JTVA 1SVMA 3A4MA 3EFHA 1IWBB 4OGKA 4OJQA 4TL9A 5JROA 1QV9A 3OZRA 1YGYA 1YQEA 1XB2A 2TMGA 4KP7A 1QPBA 4OB6A 2ISCA 4OQPA 4WN9A 5CB4B 1Z0KA 4IH4A 3SEQA 3ZHVA 3M34A 2XX3A 4KAJA 4XDHA 3D64A 4HRYA 1RWWA 3NHFA 4J91A 4BKQA 5JO0A 4N5MA 1NG9A 4C7XA 3C6KA 4D4HA 4JXZA 5BMVF 4LBVA 4YC7A 1UFQA 4S1WA 1JPJA 4DIMA 1RP1A 2IXTA 3K0FB 3JQAD 3UJAA 2NSYA 3WKCA 4QM6A 2DY0A 4L72A 4B09A 1Z7GA 2FGKA 5CPBA 1Z0IA 3CEMA 4CIVA 2X8LA 1AQYA 1W52X 3I04A 5EKXA 2ATVA 4GZ5A 4PTYA 4FLEA 3VGJA 3L7NA 4EYOA 5FL3A 5EFOA 2XMCA 3P9RA 3O2SB 1MAUA 2JC3A 2A1IA 1BDMA 3DFFA 4HD8A 4ZKEA 3UT6A 4FLFA 3OD1A 3O0TA 5HFNA 4F56A 5JCOC 1LVHA 1LFAA 4KH1A 1XMPA 2IUSA 4MP3A 2HCFA 3LUDA 2ERCA 4OFZA 4N7MA 4X7PA 4IRXA 4CG2A 2B3DA 2ZPAA 4BP3A 2YMLA 4J0EA 5LP6F 2HFJA 2R6GA 3PXCX 2I8LA 3R5TA 1TD1A 4OBBA 5LOVA 3SHTA 3LXUX 2ZIFA 2H0AA 5JSZB 2JVIA 5AOBA 2JW5A 1TYAE 3AZPA 4NS4A 2P68A 4XCQA 4BMXA 5GIPE 1AKWA 5FPYA 3OPVA 3ZDAA 1PI3A 4KPEC 2D62A 3R0IA 3QHAA 4S24A 2ERXA 3BWVA 3RAJA 4BMOB 4DEXA 2HMYB 1OSNA 4ZXFA 3KD3A 3A3OA 1LCIA 2PUEA 2GX6A 5A4DA 2LBPA 3RTBA 3V8QA 1N8SA 4RKRA 2FR8C 2IVFA 2GPNA 2Y93A 3SLRA 1QB8A 4NABA 3MERA 4ZV4A 3QUQA 5HG0A 3FRJA 2JZCA 4N40A 5C0OE 2XGJA 3OJCA 4O8ZA 4OXYA 4YMVA 5CVDA 1JG3A 2D3TA 3BRCA 4IFBA 3RLFA 3T9EA 3WR5A 1A7JA 4C08A 3HVKA 3B6IA 4EM6A 5KYXB 3AM4A 5JVDF 1GTMA 2JRLA 3PIIA 1Z7EA 3IODA 5L45A 1R6VA 3B1YA 5EQJB 5KOHB 2C5EA 1Z28A 4U2BA 3EPKA 2NZUG 1XKLA 1XCMA 1ISIA 2I4IA 3FLBA 4ENRA 4KEAA 3PUVA 4XTRA 5C31A 3FFAA 3T06B 1KYQA 1TJ5A 1CW2B 4U7TB 3VDNB 4BO7A 1MVOA 5H70A 3L49A 1D2RA 2QMOA 1CLUA 5EQDA 1RWXA 1L7RA 1XMSA 2AZ4A 4Q9IA 1CC1S 3DCYA 1PR4A 3KB2A 3L04A 3SP1A 2NXNA 1T6YA 5EMMA 2G07A 2POCA 3NFRA 3HR7A 4B6EA 3DD5A 5F7JA 1MEOA 821PA 2IYUA 4CT0A 4YMLA 5KWJA 1YA8A 1KRXA 1E98A 4NESA 4U2KA 2RBKA 3C6BA 3LBNA 4NZYA 4BE7B 2O59A 5HILA 1SU4A 1A7AA 1Z0SA 1TTHA 3D0OA 2VAXA 2GBLA 1ONBA 2PA0A 3L9XA 1E1NA 1KI1A 1J2UA 1MA0A 1N2HA 1J90A 1T24A 2WD7B 3D8NA 1AVTA 1PEYA 3D0QA 4C4SA 3OH8A 4EFLA 1PS8A 1YCGA 3BSYA 1BYUA 1VIMA 3GRPA 4KAAA 3LY7A 4EKYA 1Z08A 5B37A 1I10A 4GEGA 2AI3A 1YNOA 1X42A 4G6ZA 4D9KA 2E37A 3QY0A 1B26A 3EISA 1JS1X 2ZETA 3ELWA 3I2HA 1XMQB 4O29A 1CUAA 2QT0A 3KBBA 3IQEA 4UATA 4Q34A 4QDXA 1JLKA 3C3AA 4ZYWA 1SFRA 3D5TA 4JBLA 3O31A 3UK1A 4EJSA 3H87A 3W5CA 3DULA 3HCFA 4QYXA 1A97A 4YJ3A 5H02A 4AZ0B 1E6MA 5LR6A 5TPZA 3KCQA 2IWHA 2YCBA 1GY8A 1T5LA 3REQA 1BNCA 1T2DA 1ORTA 1HTBA 1SBQA 2W6CX 2UVQA 1UJ2A 1XAHA 4LDZA 3G59A 3ORFA 4IRUB 2XLCA 4J16A 1TM5E 2OQ2A 2Q27A 3FCEA 4JB3A 4G1FA 4EG0A 1TYZA 1QTRA 1WXIA 1TUBB 2FLKA 4BATA 3C74A 4BMZA 3IOMA 3Q6IA 4RQAA 3WK5A 5ILOA 3IHKA 1QHHA 1KS2A 3DBIA 3H1PA 3QUBA 2IT1A 2M32A 5JS7A 3K1ZA 4TQUS 4C5CA 3IXMA 2ADFA 2BEVA 4ZQFA 2XUKA 4KWEA 3BD7A 4N3GA 1W1WA 2GH1A 2PKQP 1O2DA 4TTTS 1A8HA 3KNZA 1UPBA 1HG0A 5KTTA 2C4MA 5L6MB 3O83A 2Z57A 2ZP1A 1C1HA 4K6OA 5TJHA 2BR3A 4R83A 3LC7O 2B82A 1LK7A 3FVQA 3FYSA 4GP9A 3TVTA 1D4AA 3WA6A 3WC4A 2I78A 3WLLA 3WRYA 1AHIA 3BJRA 4ID9A 1SHKA 3BMQB 3K9CA 1F7VA 2ZIZA 3HLYA 1SKMA 3UMJA 2H11A 4M87A 3HCDA 4MV4A 4WXMA 5LM3A 2FSVC 4AJJA 1GT6A 4OXXA 3D59A 1XZQA 3T6KA 1QDLB 3BQ9A 5AKZA 2EQBA 3WYNA 2X86A 5C4IA 4FEYA 2V96A 3NYIA 4DSOA 1POXA 5K2OA 3FYUC 1HYGA 2GWRA 3LY8A 1Z56C 1GAJA 3CISA 2QQ0A 5DLEA 4P3OA 2RHOA 3KPJA 5I9TA 5EUQB 1JJ7A 1FY2A 1I3MA 2QVCA 4P2GA 5EQTA 4X0EA 2YWEA 3EPJA 3I92A 4JI7B 1FTNA 4ZYUA 1YASA 1DBWA 3EBOA 4FILA 4TKUA 4A0QA 3DDZX 4L6IA 4F4DA 4M9SA 5ARBA 5BV7A 1HFEL 1YVPA 1K2VN 1XE3A 1Y4ZA 4ZANA 1VG8A 5EKUA 1UKAA 5K6RA 1FL9A 2HJHA 1N2GA 3GLIB 2ID7A 1T6XA 4B47A 1K1EA 4G1CA 3GFTA 1QGYA 3K5HA 1WUTA 4RW0A 5A4KA 4NV0A 2GN1A 5JVDB 2P0EA 4BHTA 5CGQB 4IDFA 1V2HE 3DM5A 4L5BA 2YIMA 3P9NA 3HUUA 2QL5A 5DTIA 3ISJA 2ISSD 1ULBA 3A4VA 3N74A 1V47A 5D3KA 4MWZA 5DEOA 1FXWF 1ZD3A 1NW9B 2QLBA 1OIWA 2J6CA 2YC4C 4R8MA 5E0OA 2FUNB 4LBZA 3FTCA 1HFJA 5K4AA 1YNSA 4YCLA 3R77A 3N58A 3SIRA 3OM1A 2FE4A 1S1MA 2R8PA 1QYVA 2AWNA 4AJLA 1K2WA 4RAOA 1WW3A 3JRNA 3F4LA 1C3VA 1DO0A 3K9LA 3I61A 4PNHA 4Z4GA 1P39A 2QYTA 5TGTA 4DEYA 3IE0A 3GLUA 4BLOA 2B98A 1K6XA 4OA5A 1NJ1A 1LLCA 3CGWA 5JECA 4U39A 3MGAA 1ZP6A 4FPXA 2GKOA 4JUIA 3TDNA 3ZPXA 2YS6A 4DQLA 1AU9A 2QUHA 5ALRA 4ZVNA 4EF4A 5FTLA 3GHYA 3T4XA 1GRVA 1PFKA 2P9TA 4L9SA 4N41A 4BB5A 3CEHA 4AIRA 1ZJYA 1PHPA 5THKA 4DCPA 2ACVA 1KO4A 4XIIA 1A8PA 5BXQC 3C98A 3EF0A 2BUBA 2ZYGA 3G2NA 2IXGA 5HF8A 2C2ZA 4RKFA 2GK7A 1BFUA 1C5KA 4Q6WA 4MRRA 3H2JA 4YQFA 3WK6A 5HX7A 3K71B 3IOEA 2VQDA 2JGMA 2R11A 5KYTA 4XGNA 5AR1A 3MHTA 4GKVA 3NV7A 3AETA 1C1XA 2X3YA 5AESA 4QU0A 1ULZA 9LDBA 3AV3A 4ERXA 2ZZNA 4B6SA 1KZYC 3HJUA 3OAAD 3EOZA 1BJKA 4TYYA 2PT7A 2VP0A 3OEWA 1X74A 1FU4A 5DMXA 3J81A 4KQWA 2VF4X 2UU9B 1IN5A 1MC5A 1Q3HA 2BI8A 3EAFA 2OV1A 4ZREA 3V46A 1P9RA 2H16A 3ZWDA 2YJ5A 1AQ6A 3FDIA 3GFOA 3ZVLA 4X65B 4LN1A 3KPWA 3OU2A 4C30A 4MKHA 5A9SA 4U6SA 2D7DA 1FQJA 2PUVA 1E0KA 4ZVPA 4UULA 2F17A 2ILTA 4I5EA 1U1IA 1R0XA 1TA0A 1JDVA 3OZAA 4NBUA 5HTKA 2B7BA 4DZTA 2Z5LA 5EKTA 1GIAA 3M33A 1VYTA 4N5DA 3RYIB 1L8QA 5TGDA 4B5KA 3QP9A 2YDYA 1THZA 4ZAFA 5I3CA 4CMCA 4FZJA 3DP9A 1DJMA 1G7TA 4DRZA 3G0BA 1DDOA 1OD6A 3UYKA 2BTEA 2CXQA 3AUKA 5A3SA 5AFSA 1VPTA 1PS9A 2RHJA 3TE7A 4HEJA 2W70A 1SAYA 4DTIA 3LCVB 1N3IA 4AJIA 1P0CA 5LBUA 1ZONA 1M8JA 2COKA 2NIPA 2R6JA 1L9XA 1MJFA 3GCDA 3P9KA 3PFWO 4I2NA 3U3OA 1G2OA 3G82C 4YJFB 3UBMA 1EMDA 5I7RA 1C3LA 1YMQA 2O20A 5AK4A 3UFXA 1MEJA 3TKYA 3KQPA 2IIPA 3AVQA 3MN1A 4OHWA 2J7KA 3R5JA 4WY2A 6CHYA 1EP3B 3KOMA 2QBYB 2WYIA 4H0CA 4DA4A 1T15A 2DHEA 3AJ9A 3LZCA 4JJ4A 4KXMA 4U1RA 1GZ7A 1M66A 1QDEA 2DQSA 1GGEA 3DGFC 2FPKA 3KYDA 1A5AB 3OFVA 3ZDCA 2QL7A 3OZGA 2GA9A 1I2ZA 1CR0A 1DCKA 2YHAA 4IIGA 2FSVA 4LQ4A 4TLBA 5YASA 3MIZA 2DOKA 4AP6A 4Z54A 3RC1A 1XP5A 3BFKA 4X6UA 1Z6YA 2R48A 4WZAE 3QEOA 1AKVA 1ECPA 5JNSA 2QVZX 3B1KA 1K86A 2DPHA 3TZQA 1G9XA 2ZWMA 4IILA 3Q5DA 3GT3A 1DJLA 1A9OA 1S9DA 4GWLA 3VHXA 1E60A 2R3SA 4M83A 4Z0TA 3UWDA 3A9UA 5F7XA 3U4MA 2VDMB 1Z2AA 3GMSA 5FBHA 2IOYA 2P3LA 4EQZA 3OQ1A 1TUIA 2LIVA 3GEGA 3WGOA 3CLRD 1V39A 1VHDA 2GZ3A 3ND5A 1D6NA 1FSGA 4RV5A 1FFAA 1GKYA 1YULA 2ZCUA 4ENVA 5B58C 5JSUA 3L6OO 5CA0F 2HJVA 3EGOA 2X9VA 2HLDD 1EWVA 3BK2A 3IUMA 4G65A 3SIWA 1P7VA 2HMSA 3SS8A 5JSYA 3KYCB 5LP6A 3PHHA 1G8PA 3A2MA 1L5SA 1PT9A 4G4SP 1QOPB 1I1QB 4UQLA 5DXJA 2VH5R 2ZYHA 3LP5A 4CKCA 3A31A 4TTSA 5AVSA 3FUVA 3ZU6A 1ZCJA 4C03A 1GG5A 3VUFA 4B2PA 2ZI9A 3DZKA 4MVYA 2H07A 2CFOA 1ARZA 3LX8A 2OESA 3RK4A 1DO8A 1N2ZA 4M8KA 3VPXA 5HOQA 4KFRA 1YQXA 4QGHA 4XGKA 3RHFA 1Z8FA 4Y67A 2R1UA 4UCQA 2GVDC 4MINA 1WDWB 4EW3A 3DEYX 5C3MA 2B7LA 2OECA 4H9GA 3V2HA 5EZYF 4HZUA 4RKQA 3IB6A 2VP9A 1EP9A 3B38A 5MN6A 2HA3A 4MJXA 1MOQA 3C14C 1XU7A 1X70A 5CXQA 2SBTA 1JV2B 4W7IA 2NVUA 2ZS8A 4KKXB 4U02A 4A8JC 1ONNA 1VLLA 2ASEA 3TCKA 1DWOA 4JUBA 2C5GA 3GO4A 1CB7A 4H0FA 1M3SA 4YV2A 1JW9B 1FEZA 1PR2A 1PZXA 2Q4TA 2ZITA 4NYJR 3R9IA 2IS2A 2DHCA 4I8IA 5CCXA 4XWOA 1I2AA 3ETEA 3FBWA 3CEJA 2HF9A 5LD2B 3ZVMA 1Z2CA 1IJFA 1USKA 2CXUA 1DINA 1W85A 1MO4A 1PZGA 4UTOA 5GOTA 1NOJA 4HNSA 2EX4A 3RYTC 1RVV1 2XHZA 3DV0B 2GKGA 3VZRA 2GESA 1W36B 4XDZA 1SR8A 1P7WA 3E53A 3ICPA 1R8SA 4KN5A 3OM8A 1H1DA 1UXJA 2OHGA 4Q19A 1BQ3A 2YV3A 3BHIA 4CMIB 1OAKA 4PX5A 2I03A 4IV8A 4PAQA 4YJHB 1UJ6A