1UJCA

Structure of the protein histidine phosphatase sixa complexed with tungstate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
156
structure length
156
Chain Sequence
b'MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELTPCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphohistidine phosphatase sixA
publication title Crystal structure of the protein histidine phosphatase SixA in the multistep His-Asp phosphorelay.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 51
structure length 156
sequence length 156
ec nomenclature ec 3.1.3.-:
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ujcA00
4D4MA 2YN2A 5HTKA 3F2IA 1BQ3A 5HR5A 1RPTA 4PGMA 3QPUA 3DCYA 2OWEA 3MXOA 4ODIA 3GW8A 3GP5A 3PGMA 2A9JA 4GPIB 3E9CA 3K4QA 3IT2A 2RFLA 2H0QA 1C80A 4QIHA 3GP3A 1DKLA 3F3KA 4ARSA 2P6MA 2P2YA 4JOBA 1RIIA 3FDZA 3ZHCA 3LNTA 2A6PA 3NTLA 1YFKA 4D4LA 3EOZA 2P78A 4EO9A 2F90A 3FDZB 3K4PA 3MBKA 3R7AA 1NT4A 1E59A 1FZTA 3EZNA 1DKMA 2H4ZA 4FDUA 2P9YA 2EKZA 3C7TA 3QPWA 4IJ6A 2WNHA 3QPVA 2P2ZA 3O0TA 2P75A 1V7QA 3FJYA 5AJVB 1H2FA 2H52A 1QFXA 2HPAA 5AJZA 5CX4A 5AJWA 1V37A 3IT1A 3NFYA 2ENUA 4HBZA 1QWOA 1SKBA 3BIFA 2HIAA 1UJCA 2I1VB 4PZ9A 2IKQA 5AJYA 3IT3A 4MA4A 5AK0A 3OI7A 4D4KA 2GFIA 2WNIA 4GPZA 1SK9A 4JOCA 4ARUA 1ND6A 1SK8A 4E3WA 1H2EA 2EOAA 2OWDA 3E9EA 5CU7A 3DB1A 3D6AA 1RPAA 3KKKA 3LL4A 2BIFA 3HJGA 3E9DA 4D4JA 4ARVA 2H4XA 4PZAA 3IT0A 4EMBA 5PGMA 1FBTA 1CVIA 1DKOA 1QHFA 4FDTA 1K6MA 2EKBA 1DKPA 1T8PA 2P79A 1DKNA 2AXNA 4TSRA 1BQ4A 2YN0A 2WU0A 3LG2A 1DKQA 4JODA 2DWOA 1TIPA 2P6OA 1SKAA 1YJXA 2PA0A 3D4IA 1E58A 3D8HA 2ENWA 5CDHA 2P77A 1IHPA 5AJXA 2DWPA 4AROA 1ND5A 2P30A 2P9FA 1C81A 2P9ZA 1XQ9A 1UJBA 2HHJA 2QNIA 4IJ5A 1C7ZA 1EBBA 1BIFA
chains in the Genus database with same CATH superfamily
1TM5E 2WIFA 3EH2A 4U2CA 1OZAA 4CM3A 2JF0A 4J03A 1JR3D 2G0TA 3W8FA 1YH3A 4NLLA 3WV5A 3ANXA 1E7RA 2Q4BA 1G8SA 2P7IA 3TTVA 1NW4A 3N76A 5FADA 3OE7D 1U8XX 4BNLA 3BWYA 5DW0A 2H7VA 3LY7A 4AJPA 1U3UA 3FI9A 3VDMA 4BNUA 1C8LA 1F5SA 1I2AA 4GS5A 1ZOLA 1WSBA 2K87A 3AJ8A 3L07A 5KUTA 5DNYB 1DIAA 1MV5A 4B87A 1WQ4A 4H7HA 4Q48A 1Q12A 4BTEA 4JGIA 4KKVA 1IB0A 4TRJA 5JXJA 4YJ2A 2C07A 2D1FA 1RWWA 4PC2A 1II0A 3WFJA 3PI7A 1QORA 3PLAE 2IYLD 4V0ME 1I4OA 3NJ4A 4MK4A 3CZ4A 5D84A 5IM4A 3EFHA 4XM1A 2F59A 4X91A 4CNBA 5KX5A 1A8IA 1YR2A 3GLIA 3DT6A 3EVAA 4OQFA 5K6AA 4JUIA 5EXEA 1JHRA 2Q5CA 4BWYA 4CR7A 3QVKA 3M5CA 4NENA 4RTPA 2GHRA 1CUAA 3L41A 2GDJA 4KZPA 4M1EA 3TSAA 5CXUA 2ZJZA 3WFIA 1NW5A 3PEFA 1OWNA 4WFIA 3P2EA 4G86A 2FN7A 2O06A 2Q9BA 4D3FA 2LBPA 2ZJBA 3FX2A 1MDFA 1Y1LA 2AR7A 1QV6A 2WF9A 5AKXA 3T3IA 5EJ4A 2R6CA 4ML3A 5LL6P 4MP6A 2DKNA 2HF9A 1SHTX 3OKCA 1KYVA 1E1NA 4PZLA 3I52A 2EW1A 2OHGA 3AHFA 4MS3B 5B7PA 2PXHA 5DYTA 1I36A 1KF0A 2V9PA 3B36A 4IXTA 5TQJA 2Q5QA 4G5HA 5JZOA 5TEVA 4Z7QB 3GCXA 4NE7A 5C8YF 2ZT5A 2V8BA 4CCSA 2F6RA 4MVJA 3T41A 3L8GA 1FMLA 3N2YA 5JFGA 5K45A 1XZAA 4BCCA 3CUVA 1II8B 2JIMA 4G65A 2H18A 2JI7A 1SUAA 3OJEA 5CP8A 2X40A 4F60A 5CDUA 3ZH9B 1QOQB 3MT0A 3QXHA 5F1YA 3ROTA 3K09A 4E15A 4JGBA 1MG0A 1QS0B 1FMJA 4TN1A 3MD0A 4ZZ2A 5NLLA 4TV9F 1QHFA 2HK8A 2YMMA 2YJ5A 3LBFA 1M66A 1N5LA 2M1XA 3OOHA 4TWAA 5CUQA 4ND5A 5AFSA 3S8YA 1RJDA 2Z2JA 3ZZUA 2HSGA 4WKGA 4Q02A 1NX6A 5FJJA 3LQFA 2AN5A 3NAQA 3W3ZB 1C41A 1JXAA 2WFLA 1PG2A 3Q11A 1YRYE 3GT0A 3DULA 2JEZA 3R0ZA 3SIXA 1M6NA 1V1MA 4D02A 4XFJA 2V1UA 1I10A 1KFKB 4R1UA 2CF5A 2E4YA 4D8VA 4R8RA 1TO6A 2ZSHA 1OH7A 2D3WA 3FCSB 3AK4A 1HNXB 4JZKA 3O21A 4K3UA 4B8WA 2PXCA 3IQEA 2BISA 3QNUA 4OO3A 1LS1A 3I4LA 3L0SA 4IJVA 3HP4A 1OBCA 3NOVA 2GS9A 4RO0A 3V7UA 1GTSA 3UGQA 2WWIA 1O6CA 5GONF 3T3EA 1OLXA 1YRQA 3RS4A 2MU1A 3IUMA 4LWQA 2QTRA 1M75A 3IX7A 3WRYC 2O48X 3NVKI 1FS5A 2V1XA 4KQIA 3PWKA 4BYGA 3H6KA 3M6WA 3GU3A 2A3RA 3E8SA 1N75A 1Y3HA 1B8PA 4QL3A 5BNWA 1IHDA 1KEUA 3QVTA 2YNMC 3IIMA 2N75A 2PSDA 1KZ1A 4ER7A 3O31A 3GFBA 2VYQA 3FMGA 1ISPA 4BO0A 3WNDA 2FQXA 1SIWA 4W9NC 3ZV3A 3WGMA 5FOQA 1BEUB 1XPRA 1HNWB 4H15A 5CT8A 3NMUF 4R01A 1G5FA 4PQRA 4GOXA 5IVIA 4HNUA 3WOVA 2VYCA 3JTMA 5AICA 1USKA 2AQ8A 1F6DA 1GL6A 3QA9A 4P54A 4DCSA 1NFQA 1Q0ZA 4IZIA 4RD1A 4CLXA 1ZH8A 1QC5A 4Y6PA 3PNVA 1GAQA 3W04A 2XZOA 3SC2B 3CVUA 2O2EA 3QG1A 2O0HA 4RESA 3N0RA 4BE4A 5JHGB 3A9VA 1BHJA 1WSAA 4U39A 2O52A 4P32A 4GI3A 3RYTC 1KWGA 4I1YA 1VIYA 3DMYA 2WHPB 1ISFA 3DPSA 1FC0A 2EFEB 1BMDA 4GP7A 3UFXA 1D4ZA 3B38A 4KRFA 3GFVA 3IOMA 4KODA 5TPWA 2H5EA 2Q3CA 2WC1A 4DE5A 3K1JA 3R9WA 1FS6A 4DNFA 4NCXA 1EJ6A 1T2AA 2ZSKA 2F48A 3E03A 3KT8A 3Q8KA 3LHDA 2AMYA 4OBBA 5C5CA 4TXLA 2ZKIA 4MULA 2IEDA 3OWXA 1YC2A 4HLNA 4HNQA 4KQGA 2FGKA 2WD7A 2OENG 5IP5A 2FWJA 2NTVA 1OFUX 3L8EA 5I7AA 3UJ3X 5FUQA 3NP7A 1M7HA 2Z4RA 2L19A 2OV4A 4KQWA 1G59A 3MWJA 4XFKA 3I1IA 3DEAA 4R7GA 3VO2A 1VB5A 5JQGA 3F97A 1D1SA 2P11A 3H42B 2PRZA 3CZ9A 4J2HA 3LQ2A 1QHNA 3L4EA 4Q9LA 1R9GA 1A7AA 4Y8VA 5TE9A 4B83A 2XWQA 1Y0BA 1EFDN 1AHHA 1FTYA 1GPBA 1QTNA 1HEIA 3CSUA 1H3FA 1X3SA 2QMZA 4PNPA 4KQ6A 4ER5A 3U16A 4TKMA 2AFIE 3BRSA 4DA7A 1R64A 3IVRA 3HV2A 3UMMA 2R44A 3BIJA 1P7WA 1X87A 5DIZA 4YXFA 1COZA 1VLQA 5B6JA 1K6MA 4GICA 2PA3A 3ABQB 2HA6A 1WDLA 3BBLA 4TUYB 2FQYA 3N5KA 5AIAA 1GNLA 4OJYA 1EUCA 4TX1A 1PQYA 4XGRA 1F4LA 4IQFA 1OTYA 2GPNA 4KO1S 5KMGA 3A32A 2PL9A 4ZXFA 2IDKA 1T4CA 3GXOA 1Y33E 3LWBA 4FE4A 4AD8A 2BBSA 3QW4B 3SEAA 3HLKA 3NLLA 5GADl 1PJTA 2BH9A 2R9VA 3BMNB 4DF3A 2BC9A 3FGPA 3KHKA 3NANA 4WEOA 2I4NA 1NNI1 4I9UA 5DM2A 4EBFA 4HUQB 5E6RA 1SHZA 2O19A 1RKXA 4OCZA 4BU1A 4KSBA 1XU7A 3HFJA 4Q01A 3E5MA 3H83A 1HSOA 1FX0B 4TVKA 1TUBB 4BAZA 1NR5A 1K68A 4OUKX 1TECE 4C22A 1XTTA 1G5HA 3GJQA 4DA9A 3QM1A 4D57A 4KQXA 1J5XA 5HX7A 2RGNA 2EFGA 5LSAA 1OILA 2E85A 3QPUA 3OOJA 1ORRA 1VJRA 1XA3A 4MLPA 1DRWA 2JFWA 2ZWPA 3NETA 4AKEA 4DNPA 1GR0A 2ERXA 4JLSA 2G06A 1F17A 2ZROA 3PDHA 5CG2A 2CXUA 2NX2A 3QWFA 4OXXA 4GNKA 4H4EA 3IBFA 4QFCA 1GDHA 1I01A 1IVNA 1GPAA 1J2YA 3KZVA 3QPBA 2QMUA 4JLPA 3FETA 3BS4A 3P5SA 4XDGA 2Q21A 1R0YA 1VE3A 4N65A 5JZSA 3RC2A 4FWIB 3AZOA 3MGBA 4RPHA 2D1QA 1HE8B 5MFZA 2FPLA 3U1VA 3SS9X 2W83A 3CLTD 3TW4A 4M49A 3MTQA 4OKNA 4HEA6 3C1OA 2O8CB 1WAMA 5CM2Z 3JU3A 4FSDA 5DLDA 1VKZA 4YV1A 2CDNA 1QYIA 2XKBA 3CUUA 3Q2KA 5CLIA 3WWCA 5BUCA 5KIAA 5EKDA 1DG9A 1KFEB 3IP1A 3JVVA 1E1DA 3P27A 4M1YA 1DBPA 3SS7X 4AY4A 4BKQA 4EJ0A 4KB5A 5CYOA 1NMQA 1I7QB 5IH7A 1I51A 5FO1A 1GAXA 2BFPA 1WNFA 1V35A 2CCKA 2CY0A 2DFPA 4MNTA 3VNSA 3ZDXB 1IH8A 3DXXA 3NDIA 5BP7A 3S28A 4L8FA 4HK4A 2ZB3A 2J0EA 5TARA 1I7PA 4M0KA 4IDOA 3G85A 4L16A 1QGUA 4G36A 3SHOA 5KNDH 1HZZA 5EMKA 1U6IA 2BGRA 1PGJA 1SFRA 3T15A 2OB1A 1CJUC 3E3NA 4DG5A 5TX7A 3X1XA 2X0FA 1E2EA 5TMEA 3RJMA 2J4CA 1CDZA 4CMEA 3IO5A 3K5WA 1BWPA 2DHRA 2QRMA 3PI6A 1Y6QA 4A6PA 5E7IA 3IV6A 3VTFA 3CNQS 3D0OA 4GI2A 2FSFA 4HDNA 4YN3A 3HL0A 4EO4A 1CZKA 5DOVA 2FMFA 3I23A 3K9HA 2W4IA 3TEFA 3VOBA 1F8XA 1FJGB 5DBIA 1KOFA 1GTL1 1HDYA 2EIHA 1HFJA 3IILA 5EE3A 4YRKA 1IBKB 4IDEA 2GCOB 3UCXA 3V46A 1RPAA 1VHDA 4FFRA 4IV5A 1N5IA 1XA0A 1KKMA 1CP2A 4I50B 4DJAA 4EX6A 2VA9A 3B51X 1NM5C 2JZNA 2QAGB 5I01A 4K9SA 2ZITA 4Q12A 3IJPA 1WY7A 2G9ZA 1ENOA 2ANBA 4EEXA 1OI7A 5A5VA 5B57C 2NU9B 4MP3A 4S1WA 2CYBA 2FK7A 2JFVA 1PNQA 2H7YA 4FDMA 2AN1A 2M1ZA 1MORA 3S27A 3VAYA 3VKWA 2CDRA 2QJTA 4F2WA 2QUJA 2P62A 3GA7A 4L57A 2DPGA 1Q1BA 2GM3A 4J7UA 2Q5OA 1W88B 1KYWA 1M0SA 1ZXXA 2I4LA 2FUCA 4YJHA 1AV6A 1U2DA 4LYHA 1H6DA 2M6KA 4PLYA 1E0DA 3A06A 1EZ1A 3OAAD 5AKGA 3X0DA 4D6XA 4ARIA 4XYBA 2PGXA 1MXHA 1ILWA 2YWHA 1KI6A 4S1TA 4U9UA 4AJNA 5M5BA 4JBNA 5YASA 1L3CA 1QYWA 2DFDA 2IEIA 1GRCA 2P77A 4FGSA 3WBBA 5BR4A 4NQRA 5DNDA 1MX1A 2ZR8A 4D92A 5C7LO 1TB4A 3WKAA 1NF9A 4UE2A 4V3BA 1XE3A 1TD1A 3RAFC 1UKBA 2XZLA 4R8SA 5KYXB 1DTEA 2RHGB 4PYRA 4J9UE 3A28A 3U7GA 2OV2A 3O2SB 4BGIA 2NSHA 3PIDA 4KUGA 4V0QA 2FWIA 3QU5A 1Y9AA 3VO9A 4RJ2A 2NPFA 3WLQA 4F9FA 2G71A 2PFSA 1LA2A 3GGSA 3TW8B 3GJSA 3DCYA 4MV7A 4Y6RA 2PNJA 2VNHA 4NABA 2WB4A 5ALSA 4DA4A 4FJ0A 1XVTA 3HNOA 5C3UA 3ORFA 2AJTA 4HB4A 1FCJA 3RYIA 3K31A 1HT2E 3COSA 2V0CA 4G8CA 3KEOA 2UZAA 1U7TA 4PLVA 2HDWA 5LOVF 3TQRA 1NUSA 5DNWA 4LYFA 5K0LA 5K8JB 2ACEA 3VJMA 2V7BA 4L02A 4WJKB 4D9BA 1CBUA 3BTUA 4ZOLA 4MUBA 2VNSA 1U8EA 1U7HA 5J4KA 1RC0A 4U7HA 4BNJA 4IKEA 5LB4A 3HDQA 5DSXA 3NM5A 1XROA 2D0DA 3R44A 3O75A 4FKBA 1CYDA 4HPJB 1B2LA 2RGAA 4B3SB 2QTZA 2CMDA 3P9SA 4OHZA 4M87A 3MG9A 4P3KA 3FZNA 5JBNA 2UUCB 2GD0A 4CU2A 3GFRA 4OIFA 4BV8A 3VC3A 4G5OA 4HO1X 2VR1A 1WLYA 3C45A 1FW8A 4Y9RA 3V8BA 4C20A 1GPUA 5AUPB 2LPMA 2UVPA 5SZIA 2GK3A 3EXHA 4DYVA 5BNZA 4CKWA 1ABFA 3D6NB 1UJCA 5CIQA 2VLBA 3AEKB 2VP6A 1NF3A 3P9ZA 2Y2UA 3LC7O 3K5PA 1KI9A 4IILA 4E21A 4YMLA 3D7KA 4KL8S 4ENWA 2E18A 4JA2A 4R5HA 4BP8A 3N0XA 3ZJ5A 3OJOA 1H22A 1Y3CE 3O8QA 2GYYA 4N3CA 2NYRA 3AVQA 3Q3JB 4ZREA 1OH6A 1C1XA 4IWYA 1IJBA 4F8EA 2W90A 4YQFA 2CGEA 3L8CA 4LDNA 1K4YA 4U2BA 2ZUCA 1PVOA 3U3DA 1OAAA 1UP4A 3C7KA 2IYYA 2OUKA 2VATA 4LJYA 3ADPA 2VC2B 4E1AA 1Z7YA 2PGNA 4ND3A 5LQRA 2XGGA 1NJ1A 1R74A 3JWJA 2X41A 2JI4A 5FR2A 4ARVA 2BMVA 4UBKA 2Q3MA 1XMJA 2X42A 2QZPA 4DR7B 1X3LA 3H9UA 2B9EA 3FVRA 4XI9A 3SQWA 1UBRS 1VBMA 3QYAA 2Y1GA 2EGUA 4JUAA 1ZH2A 2Y1CA 1YS6A 2A59A 2RKOA 4C05A 2J3IA 5ELXA 1T25A 1Z28A 1ZGJA 4IH9A 1WHSA 3AO0B 1T24A 3TI9A 1QJ4A 4CW7A 2ZWAA 3V2UA 3P26A 4UW9A 3W78A 4DDMA 4EYQA 2X3UA 1W0CA 3OLVA 5J2UA 1EGVB 3LVQE 3D8UA 4IH4A 5EIHA 3ABZA 1DZ3A 1OB2A 1H2RS 1N2EA 1CEYA 1YS2X 3G0DA 4EMUA 3VMFA 2RGEA 3KKLA 1HI9A 1N8TA 3PQDA 4NC9A 1QMGA 1D1TA 1AGPA 1RZ3A 1J20A 1EU1A 4IP0A 3IHLA 2MSCB 2OUIA 2P67A 4WLNA 4FYJA 2JJ2A 2C8LA 2ZRBA 5IAGA 4F86A 4RY8A 5JE8A 3UENA 3W5AA 2QX8A 1F4PA 5JMPA 1EDZA 1KAEA 5A0FA 1IG0A 1XNGA 4BNTA 5GVSA 1JA1A 3L6DA 2PWAA 3FTNA 2P40A 5EE9A 4ZI2A 1FUUA 4YJFB 3R9IA 2KS6A 3QKTA 3EQ9A 1RMTA 2XQKA 3NORA 1VM6A 5AWFC 5BW4A 2P4SA 1XQ1A 3ETGA 4PHGA 4R1LA 3H87A 4NHOA 3TOSA 4TYYA 3LWDA 4B4UA 1QQAA 3FG9A 4S2UA 4B3JA 4PX5A 2R6GA 3CZPA 4RXMA 2EDCA 1M0TA 3ZE6A 1WVIA 4K6MA 2RGGA 4RHXA 3FOZA 3QTTA 3FTDA 2XECA 2VTEA 2ZEJA 2QZZA 3T7JA 3MC1A 1K7XB 3AB3A 3HXMA 3HDVA 4TPKA 4UNSA 1QAQA 2I2BA 3U3OA 3GA0A 5LQJA 3CH4B 5L3SA 5K3AA 2OP1A 3KAKA 3ZV7A 3MTBA 8GPBA 2VZLA 4HS4A 3EIXA 2G83A 3A6PC 3CUSA 2HA0A 3HJBA 3GJ7A 4WA8A 1XCBA 4MP8A 1Y3BE 3FFAA 3KBBA 4H77A 2PUWA 3A2MA 4LHYA 5HUHA 2P2GA 1PT5A 4FOOA 4K6CA 1S2MA 4B46A 2BFDA 1RJ9A 1PVDA 4Q3OA 4UQLA 4NY1A 2R1VB 1UT8A 3EAGA 4KXQA 3J7TA 1XAIA 2CVZA 3PXBA 1TAHA 4Y1RB 5K9ZA 2R7MA 4FONA 1GUFA 1HY3A 3VISA 121PA 2VTKA 2WWRA 3CR3C 1K5PA 4S1VA 3GLHE 4TMZA 3VPXA 1JWAB 3BXPA 4K8RB 1P81A 3JQ6A 3VC7A 4R1QA 4RH0A 3WB1A 1A82A 1YSCA 2COKA 2WM3A 3LX4A 3QLTA 4ZIRA 5CA1F 2ZJ0A 3LSTA 5BSFA 4MVJD 3ICEA 1F0YA 3KFXA 3ZBQA 3MJ4A 3REFA 5IF9A 2VJLA 1EDEA 2ZIGA 2R1TB 1JPNA 3N2KB 1P1RA 1PV2A 2XDAA 2BEWA 1OH5A 1PGOA 1ZG3A 4X6UA 1IWOA 4JIGA 2ZVQX 2JLCA 4H0CA 3W0LB 1T9BA 2BVNA 5F2KA 1KWKA 1NNLA 3M2TA 4J0KA 1XQXA 3B1JA 1XEXA 1M34E 2YFQA 1HNZB 4YALA 3ZCSA 1VKJA 1DO2A 4EG8A 2IE0A 3FJOA 1RI1A 4WK6A 2JARA 4DJ5X 4D9NA 1YBHA 1L7QA 2BAGA 1PWEA 4FKZA 3WADA 3ND7A 4Z3KA 1I4DD 2MYPA 4ZZ3A 3FHOA 2HTFA 4ZD6A 2M9MA 1KERA 4OK6A 3AHHA 5A5EA 2VHQA 1OE0A 2J0VA 3BIWA 3O9VA 5G4LA 3ISJA 2B3TA 2OCBA 3CQ9A 3U7RA 4LXQA 4RUKA 1FFHA 1GZ4A 1W44A 3H9EO 3SF0A 1P61B 2FLWA 1JDZA 2GHTA 3DDHA 3WIBA 3QVVA 1D8TA 1JQDA 1QGAA 1KJJA 3ABSB 3CO5A 4JASB 1GT6A 4RELA 2DUMA 4XM2A 1UWKA 4AJJA 4IIFA 2QNBA 3HU2A 1Q7GA 1N0WA 4FR0A 4IIBA 4D43A 2H0AA 4J7CA 4R68A 4JMLA 1LBIA 1TCUA 4RV5A 3JQ9A 1J6UA 1SU8A 3GFOA 3LDGA 4RYLA 1QUFA 4PHFA 2H57A 4OQNA 3NHRA 2K4MA 2V58A 4WXYB 1ONBA 1QO0A 2VWPA 2XYQA 4IHJA 1XLWA 5ALDA 1P4SA 4BX2A 3VGJA 2BI4A 5FV4A 4BO1A 2GYUA 2PKXA 3RWMB 1M7BA 1W85A 3B20A 3Q7PA 4FEYA 1B8OA 1T6YA 4IXWA 2AZDA 1ZGGA 3Q8LA 3MAJA 2GARA 2EQBA 4RIHA 4D4MA 1BDHA 1P0FA 4DNQA 2VDUE 3B53X 1YB4A 3I6ZA 4YQZA 1KAOA 3OLCX 1IOVA 2XZPA 2VHJA 3MOGA 1GDTA 4CQNA 4JEHA 4AI6A 3L4BC 1JFFA 4QGGA 2DGDA 4Z9AA 1EX1A 3ZLVA 4ETIA 4WERA 3VQTA 3L05A 1D0VA 2BRUA 2GT1A 1GM5A 3MQ2A 4ZMSA 5ALVA 2WPDA 5DN6D 5JDIA 3R3XA 3KSDO 4NXNB 1QRTA 1UR5A 3AFMA 3DMHA 3IE2A 4G3XA 4A15A 4U9IS 3MT7A 4YRSA 3KEQA 5CPFA 3L6UA 4F12A 4NKRA 4ZGBA 1T4DA 2F90A 4Y0VA 1QVWA 1XQWA 4YUWA 4JLWA 3GLFA 2V7XA 1GNSA 1TZKA 2R97A 2IXTA 2O2HA 2QT0A 1JG7A 3FYHA 3UHJA 4D9IA 3O0TA 4GPBA 5F1OA 3JWIA 4FGZA 1V7QA 5BXYA 1E9RA 3ZIAA 2JPDA 3OJWA 3BE5A 1Y1RA 2CVHA 3QBEA 1SVIA 5FTJA 2YCBA 3ZBUA 1GXSA 2RHWA 3D9QX 4GSKA 3V4PB 3ILVA 3IT1A 4CIDA 4E07A 1ZR4A 4W5JA 5J2TB 1QUEA 1G64A 4EO7A 2HIAA 2IHJA 3NYRA 3P0FA 5E4JA 4DXDA 3VMMA 1IIRA 2GVDC 4G1MB 4PVCA 4ARAA 4JLNA 4HUTA 4M1QA 5JW6A 3P2MA 3ELYA 5FA5A 1Z38A 4ZCTA 4E70A 3ZLJA 1SHKA 4HEJA 4P35A 1JEQA 4EH1A 1X1BA 1EVIA 1X2BA 3BWMA 4CZ2A 4EG0A 1MW9X 3IUPA 5DJ5A 1WKBA 3CZMA 1PFQA 3LY5A 1H2EA 1X7YA 1X9GA 3V8RA 4LNAA 4LC1A 2F3PA 3GDHA 3ZDZB 4Q34A 2G82A 4IF6A 5F51A 3QEMA 3NDPA 3CKKA 2R751 3VC1A 3TX6A 4XQCA 2IYZA 3D3WB 5HFJA 2XCUA 4JITA 2XYVA 1SZJG 1N2GA 5T6MA 1CUVA 2JIZD 4I1OA 4WOBA 2ACWA 4QXQA 2C9CA 2BFBB 3TXAA 3TQHA 2WYOA 5EJAA 1DKPA 1Q0RA 1ZOPA 3MTDA 5FBKA 2B0JA 4DIKA 5GIPE 3DD5A 5JQWA 3SZGA 1P2UA 4OFBA 1D07A 4RK5A 3VU1A 1K8ZB 2WVJA 3AOGA 3P0JA 4MITA 2JJQA 4DWOA 5KVSA 1W2GA 4DSTA 3BQNB 3DOOA 4P7GA 1N2OA 4QSMA 3UWPA 2B7BA 3KO8A 1F2TB 1N78A 3IP5A 1PGNA 3FSRA 3W7VA 1GKKA 3VX3A 3LTEA 1Y42X 3A9RA 7ADHA 1PJLA 3Q1KA 4MAMA 1ZW1A 2XTNA 2WICA 1EK1A 3L04A 4FFOA 4MW7A 5JD3A 4A8HA 3TR5A 3BKXA 4M36A 4ZHSA 3I28A 1F3LA 3FPLA 2XA2A 1QNFA 3JRXA 5CB4F 3DE6X 3TG2A 3WGVA 1HOXA 1N9GA 2LUOA 3PCRB 5GM1A 4BY9E 3JQAA 3L93A 4BO7A 3SXUA 3TD6A 5IDQA 5EPUA 3K8ZA 1H4TA 3GGJA 4IRUB 4GMFA 1GDDA 5CK5A 2JFYA 3AWDA 5FUMA 4QEKA 4RV4A 4FBLA 5TQ2A 3ZWQA 3H19A 2C4UA 4CDGA 1W36C 4IG4A 3UJAA 2FPOA 3ANLA 1WXIA 3K2IA 3GO4A 3A9UA 4FEEA 4PGFA 3LK6A 4DCCA 4OD0A 1Y82A 2CK3D 5H3CA 4KIWA 2WDPA 3PDIB 1Y4AE 4RFLA 3VNUA 1IY9A 1D4OA 1ZM2A 5DYYA 4DGSA 1ZLXA 2K2QB 2Q1WA 1JP7A 3DTVD 4U7TB 4OFXA 5JCJA 1FA9A 4EMSA 4QJ3A 1I1HA 1OOEA 4P4NA 5EHZA 4DG8A 3OM1A 1XK7A 2OCXA 4KDEA 1R8SA 1T5IA 2IGTA 1RW4A 3AEXA 3DTNA 3DZBA 1GLVA 1QPBA 5BSMA 1LQ2A 1AU9A 4CEIA 4TYMA 3RREA 4F6RB 4ZEMA 2GA8A 5DXJA 5CJJA 3WWOA 1NWCA 4GLFA 2EKZA 1G2QA 4ISBA 4WK4B 1ETHA 1OBOA 2EFHB 2QF7A 1SXJC 1NHWA 3CS3A 3NGMA 4EYEA 1KP2A 5JBIA 2HEGA 2KE5A 4B5KA 4OQXA 3KQUA 1SUBA 1TPZA 1W96A 2FLKA 2OQ2A 2P2DA 1KH1A 3EVFA 4GECA 1VPLA 2OCAA 1OPXA 1FLNA 2GCPA 4WZAB 4XX1A 4C03A 4D82A 1IBMB 1CUGA 5LMCA 2Y9MB 3HB1A 3PNPA 3TTSA 4UKDA 2C8VA 2QQ5A 4OP3A 3ZY5A 3PSAA 2LVBA 2ZREA 3ED1A 5IEBA 3VKFA 1P1KA 3CSSA 3ZQJA 2IBMA 2Q46A 5EJ7A 2Y0PA 2TECE 3B48A 1IAVA 3DQQA 1KZ4A 3JYOA 3OJ0A 4MEAA 1DT5A 3LXRA 2R8RA 4KIGA 4CETA 1DC4A 5JYCA 5JUWA 2Z9BA 3AVYA 1B0UA 1JXQA 3CF4G 3CX4A 3Q0EA 3GNQA 5AW6A 1JH9A 1HETA 3QYJA 4IM7A 1GZDA 1E1RA 5GY7A 2AEJA 2X6TA 3WIUA 2H1WA 2OD7A 3V97A 1H4VB 1SCJA 2SBTA 1DWOA 1GCIA 1PQ4A 1P91A 1DX6A 1Q3KA 2EATA 2VEDA 2WF6A 3L0DA 4H6WA 1CHNA 4PNEA 4EJ2A 5JR3A 3IEIA 3HVRA 1KJ8A 1P5ZB 2AJCA 1BE6A 3HCDA 3OQJA 3C6BA 4F4HA 3F5SA 3URMA 2D74A 3QVUA 4LDZA 1Z4JA 1BDMA 4POAA 4WRRA 2Q0HA 3ZV4A 4B7CA 4Q1BA 4EUNA 3ZGZA 2C5EA 1ZK1A 2OD9A 2ZPAA 3IPXA 3AKDA 3OX4A 3OPYB 4MZXA 5AQ1A 1UDBA 1ST2A 1KVTA 1XDWA 1J8DA 4ZO6A 2J6BA 1CV2A 1XCGB 4REQA 1PZGA 3D02A 1B74A 2X0EA 3T4XA 4ZYVA 1HPLA 1Q50A 3H8SA 3IMKA 1QWSA 4Z9XA 1IXYA 3FWNA 4KFCA 3RAPR 1NRJB 2JLAA 4OPMA 2ZQ5A 1ZBQA 2HCFA 1G4HA 1SRQA 2JCYA 4UUNA 1ZU5A 4W7SA 4XASA 1DWPA 4GKBA 1H3EA 5CLQA 2O2DA 3Q9UA 4Q93A 2NP6A 1XD2A 2RDMA 1VRWA 1Z4KA 2PT5A 2YASA 3FFTA 1K08A 4I4CA 5F1KA 4DV6B 1FSPA 3OMLA 2H16A 1L4LA 2QN9A 5LA6F 4AS3A 3HZHA 1XAJA 5FPSA 1RXUA 4AKSA 2Q7DA 1LDMA 1AT1A 5LZ9A 3EUEA 3DHYA 1U2GA 2V6IA 3CONA 5EMHA 4C4RA 3IDAA 2ZRNA 5EJGA 5L4NA 1YAHA 3DO5A 1MAUA 2JGFA 3NVAA 4PG8A 3D5TA 4G2NA 1WKCA 1M67A 4WQMA 4XYEA 1Z17A 1CUZA 3RYCB 1XOIA 3E9QA 2B5VA 1HQDA 4IHQA 5FPPA 1RHRA 3MXOA 5B37A 1JDSA 2XZTA 2J46A 3O82A 1EQAA 2KM1A 4NOJA 2VNKA 1SPXA 3HB7A 5ARDA 3WGUA 3UJ8A 2WAMA 4DTCA 2XXBA 3O94A 4NU6A 1OT5A 1NL3A 1N0UA 2YWRA 3EUAA 2H1OA 3MEQA 4DXHA 4FNGA 1LDBA 4TQ9A 5B1IA 5IRCD 3TE7A 1G63A 2A35A 2EZTA 3VSAA 5IZCC 3DEZA 2XWPA 2FZLA 4Y6GB 4RSGA 3PITA 1RMYA 2Q27A 3O1HB 3Q88A 4OHWA 2PUFA 1JQAA 4EI9A 3SJZA 4M6WB 1GY8A 2CNOA 2AR0A 4J0QA 5CAEB 2PX4A 4G8DA 3IB6A 4CM9A 1T5DX 1AB6A 3E05A 3KT6A 2PS0A 4H7EA 4H7JA 5GZ1A 1U1FA 3AHDA 4TUYF 4ZQHA 1ZSNA 1TKRA 2PNFA 3DLPX 1J1IA 2JATA 2WG1A 2WMYA 3FYDA 1PGPA 3H7IA 3HGQA 5B30A 1U3WA 4C4SA 3SYKA 4MGEA 1IUOA 2IY7A 3MJRA 2HO4A 4M9XA 5K3FB 1C1YA 4PO9A 1M9NA 5D3QA 2ZIZA 5AK6A 3VI3B 1NZDA 4WCFC 4V0OA 1GL3A 4WOKA 1OZGA 4B3FX 5B2FA 2G5GX 1Z33A 1VRCA 3JAKA 3HEMA 1YQ9A 2X9QA 1B1CA 2J30A 3B1YA 4G1BA 1O89A 2ISQA 1IZ7A 3GFTA 1VDZA 5AOBA 3TL3A 3UJ6A 1U7WA 4P83A 3AUYA 4YAFA 3D0QA 3K2EA 3T9AA 1ABEA 2HBQA 4HMPA 4QTZA 3TZBA 1EFLA 1HLDA 3UH0A 3ZEIA 3E0XA 1ESDA 2Q2QA 3HU1A 5IAKA 3U7HB 1G6Q1 3FCYA 2O2SA 2CW5A 4ZGWA 3HCWA 3ZGNA 4CFSA 4DPLA 2G80A 4B2PA 3UVEA 2C9MA 3TTWA 4F2PA 5HS4A 2C2HA 1J2TA 4QXOA 1SXPA 1CU1A 4KLNA 1CQJA 3GLGE 1B8VA 2LTAA 3EMBA 2BFEB 2H4XA 3R3JA 3OU6A 3OQ6A 3P0RA 5H1YA 1PUXA 2VZ0A 4E51A 4QQFA 3LO5A 4AYXA 2PKQO 1JL3A 3EPLA 1I1OA 1HKHA 1NYLA 3F90A 3PRYA 2O07A 1YOVB 3N8HA 3O4JA 1RDFA 3PHBE 3KB2A 2NU6A 3S2FA 1AQNA 2RHHA 4G4GA 4G9BA 3FKQA 3OZEA 2PUBA 4PIPA 2XB4A 3SVLA 3DFMA 2GD6A 4FZ3A 1DU4A 5JECA 2QM3A 1BROA 2JGLA 4I7EA 3TXYA 2B20A 4LYYA 3SJ7A 1DKQA 3HABA 4N0QA 4REMA 1YJ8A 1VI2A 1NOJA 2EQAA 2H1SA 4G1FA 1U4OA 4KBYA 4LZWA 5T6BA 4V1CB 4L8WB 1I4LD 4P81A 2ODAA 4GI7A 421PA 1XTRA 3ENKA 3G0CA 2PWZA 1SG6A 2B83A 2NZ2A 4OTZA 4TKUB 1E4EB 4ENSA 2OB2A 3RUDA 4MQMA 4Z0PA 3ZNOA 1WCV1 4M83A 4TZ6A 5LZ4A 3PCXA 3AUUA 3FW1A 1LTKA 4P9NA 1DXOA 3JARB 2K5UA 4I6JA 5LZ7A 3DW1X 3JZIA 1VJCA 1HFEL 3PX2A 4HXEB 5C1PA 3CA8A 2NLOA 4DY4A 2YZMA 3H75A 2DUNA 4R51A 3R23A 3HEAA 4YRTA 7GPBA 3PXDA 3RGGA 1GQRA 3KQOA 3PIIA 1OIXA 1DTSA 4K86A 4RLFA 1L4UA 4Z2AA 3CVYA 5CXXA 2UU9B 1LSOA 3HJNA 4YY3B 1GAEO 1KJYA 2YQ4A 3RTCA 4EUFA 5HXAA 2JEOA 4MQFA 3IFSA 1C2YA 5JU6A 1A77A 1O4WA 1ZM9A 1T6NA 4ZU1X 3PP8A 5G1NA 3AXSA 5JD6A 2JH3A 3PR2B 5AW1A 4O2RA 4JI3B 1ZCAA 4W5RA 4R31A 4XSGA 1OA1A 1TTTA 1FMTA 1DXHA 2D1TA 1XXHB 4QU5A 4AMYA 3PWZA 7REQB 1PW5A 4KVZA 1NRWA 1MA3A 3QVWA 3Q41A 4LJ9A 4X20A 5A3SA 3ZUGA 3D31A 2XUIA 3LUJA 5AP9A 1L7EA 5ETJA 1P18A 1GO2A 2J0SA 4DR4B 2O20A 3JYPA 1KSFX 1H6AA 3L7JA 4GLOA 4K9MA 1XTKA 1T3SA 3K0EA 3LUFA 3O3NB 3TZHA 5LQCA 2YZGA 3FGNA 5ITWA 4NR0A 4JLAA 1MG5A 1BMFA 1SVMA 2QTCA 4TTAA 4DIUA 1GUYA 4UDXX 1CF2O 3RUAA 1A5BB 1FVOA 3GJXC 4YMIA 3RSFA 1REQA 1C3OB 1P4AA 2E7ZA 1EFCA 2QPOA 3ZN2A 4OBXA 2H8KA 2WEKA 3QBTA 3KSBC 1P31A 1PT8A 1WPXA 2X14A 4LGVA 2HSWA 4OHBA 1PJ8A 1MIOA 4R3UC 4E09A 5CEEA 2CSUA 3D1LA 2AE1A 3F67A 2VQFB 2YHSA 3VYSB 1H66A 2K2WA 4C0AC 3KSMA 2D5CA 3ECSA 5GJVC 2VXYA 2ZUUA 4RL6A 1T1RA 3WKBA 2PKCA 2IH2A 3D1JA 1L4BA 4ESHA 1NUQA 2ZYAA 3W6UA 3G7SA 5P8WA 3QKRB 4QPJC 3QXSA 4C2TA 2GXQA 3C7AA 2OPBA 2REQA 5EJ6A 1OT3A 2RBEA 1WBJB 2EXXA 3SQOA 4Q15A 4QG3A 1S4MA 4JLOA 2Z1MA 3CWCA 3OTGA 1UBFA 2OG2A 3NATA 3O8BA 1RWVA 4NU8X 3GD7A 4U0KA 5B58T 2C7QA 2YUIA 4MHTA 2CBGA 5EL0A 1RAEA 2KI5A 2D2XA 3H3JA 5EFZA 4J3FA 5IYZB 1DKOA 2E9SA 5A4MS 1QIJA 1A50B 2WTEA 1G5PA 1AO3A 1K97A 1GD1O 1R5NA 1ZMBA 3KT3A 3P9RA 4OREX 4PC7A 2EKDA 3NHMA 4RHEA 3RB8A 4EJFA 1H5UA 4CKZA 3W5CA 1RXVA 4N6NA 1X8KA 3LCRA 1QK4A 5IG2A 4WFQA 5JWHA 4J07A 2C96A 4R2XA 1E9AA 5ALKA 4ITUA 4J2OA 4ALIA 2VYVD 1RLUA 3GI1A 3OY7A 2F55A 4KLAA 2NMVA 1RU3A 2YHIB 2YIDA 4GT1A 4D8YA 1YJXA 1C7RA 5GV7A 3WL5A 4JBWA 2V45A 2J5KA 2VJYA 1HZJA 1ZIOA 3QX8A 4KYIB 1JU3A 1J0DA 4Z9YA 4DJDC 2D62A 4UHHA 3KS9A 5GJCA 4FHGA 1E9SA 3R20A 2Q49A 2JFFA 3LF2A 5BN3A 2A9PA 4GXNA 5H02A 4BB5A 3T7AA 1OXTA 1QV7A 4MR9A 3L1VA 5LWQA 4QQKA 1JDBC 3BRCA 4WBNB 5HZMA 3LDHA 1BX1A 2C1XA 3NV9A 5FEUA 2A5LA 4K7JA 3RODA 3E4DA 4H17A 4E5VA 1HWYA 2E87A 3AETB 2BKLA 5EJMA 4LFAB 2BEKA 3RC7A 2HR1A 2NO4A 3RVJA 1YR3A 5HG0A 2F3RA 3R40A 1Z68A 4KXUA 2WE7A 3U3XA 2X77A 3E15A 1SH7A 4LCBA 2Q5FA 2XRFA 3L18A 4LX0A 2GXUA 2VKQA 2XF2A 1LBSA 3AY3A 4ANFA 2GJKA 1Y9JA 1IUPA 1KQOA 2ZYTX 3A2LA 2XV1A 4ZCSA 4LVCA 2JJ1D 3ZE2B 2I67A 3P32A 2AJLI 3I62A 3E70C 1R18A 4QDKA 2XY4A 2O1XA 1FU7A 1ZOSA 2BONA 2P6NA 3RDPA 3LL7A 2FEPA 3H13A 2UVDA 2TMGA 3QU4A 4TV8B 1XDBA 1FVHA 1KPHA 3CLTC 4M54A 4W6QA 3X3HA 3H86A 4ASUA 1JFRA 1VMIA 1YQXA 4URYR 1HTWA 3PB3A 4B7XA 2VHCA 2NV6A 4DNOA 1E7SA 3Q8XB 3Q85A 1FLAA 4F3TA 1OUMA 2IEYA 5COBA 1XL0A 4F8JA 5HM6A 1GG9A 3NNDA 4LHVA 2QUIA 4GMDA 4CMHA 2OXCA 1SXJE 3UG6A 4O63O 4BNWA 3DDSA 4JOQA 2WB2A 2R11A 4PC6A 1E2JA 3VR1A 1XRMA 1CK4A 4ABYA 2HW8A 4FEGA 1XZCA 1QHIA 1ARZA 3IV9A 5PNTA 1VOTA 4LOAA 2R65A 3BIXA 3NM6B 2ANCA 1SQSA 4OU5A 1NPTO 2RHTA 4V0LA 2O8VA 2C4NA 2WZCA 3FN4A 3OF2A 4IRXA 3MGKA 4MQEA 1JDUA 4YCJA 1NW8A 5K0FA 1FRNA 2CLEB 1NBMD 1ZWKA 2DC1A 3ZTYA 1N32B 2E5FA 4D3SA 5CB6A 1E9DA 4NIMA 3IPCA 5CMLA 4PN3A 1OY1A 1Z26A 4PYQA 2OORA 4AS1A 3GOQA 2H4WA 1OJ7A 3MTAA 1ZESA 4M1KA 4Q9DA 5ALPA 2VZ8A 3DH0A 3TRJA 4AMBA 4F6RA 2RHMA 1E3WB 1I9GA 1NMSA 3UAOA 4EYGA 1TW2A 2AV6A 3I8XA 1XQVA 3BH6A 3OBIA 4I55B 1IBRA 2QXYA 1P5RA 3EW7A 4KQ2A 1PNTA 4HTFA 3GIDA 3M5DA 1AXRA 4UM5A 5IBRA 1EIZA 2ZBPA 2BHNA 4C7OA 2VNAA 3VH1A 3ND6A 1LBTA 2VH5R 4S1NA 4RJKA 2VT3A 1C4OA 2NU8B 2WF8A 2CV0A 3RIYA 3AEQA 1H1TA 4LPSA 2H92A 3EC1A 1R4MA 4JYBA 2ORED 2F00A 3UWMA 1E64A 1YK1A 3VKUA 3PUZA 1LPOA 1QE3A 3A4NA 2B0CA 2MYTA 3KYIB 3AMVA 3NT5A 4MS4B 1UQTA 2SICE 4AX4A 3P52A 1G9SA 2WRZA 3JALB 3P45A 4Q3NA 4F71A 3LQYA 5K3CA 4RL4A 4KOEC 5BN5A 4GLJA 4ZK2A 3HB4X 5EQTA 2IV3A 3VUFA 1E61A 5GTDA 5DSTA 3QELA 3JSXA 4G5SA 1IYZA 4LCJA 3STVA 2G08A 3UEOA 5C5DA 1V25A 1E6EA 2C59A 3RJ5A 3DLIA 3WKDA 1LPBB 2GYVA 4NBRA 5JCJD 1CJSA 2UUAB 4KGVA 1TQ6A 2KMLA 3A1WA 1E9BA 3L7LA 3SYTA 3VDXA 4RMHA 3DDZX 4EL0A 2HIMA 1RZVA 4C06A 1JYFA 4EKIA 2AZTA 2ATIA 3RKSA 3U9SA 2WTUA 1R4NA 1U9JA 1V8ZA 1ZEMA 4A2PA 4MS3A 3LCJA 1A04A 5B1SA 4EW2A 1N7GA 3AM1A 2O5CA 1AX9A 3C7DB 3AHGA 5FUWA 2QMHA 1IN6A 4IR7A 3B5EA 4YAUA 1T9ZA 5AI8A 5FIUA 5ABPA 1W5EA 2FPKA 3GMSA 1DQRA 1JR3E 2I6FA 2YFYA 2BH2A 1J8QA 3TSCA 1V4NA 4TMFA 5EHXA 3TINA 1BCRB 4HQFA 2UZIR 1WJGA 3ZBTA 4DJJA 4LJRA 3IBSA 5AJUA 2NQ2C 2ZI3A 2CE7A 1ZEJA 2W2NA 4JB0A 4EKDA 3BTOA 2CJXA 2WMDA 4UU1A 5I51A 3EXG2 4NCAA 1L7DA 1XAGA 3ADCA 2GPTA 1QS0A 3NQ41 5CA0A 3IVCA 4D56A 4ZYWA 4RMIA 1WW3A 4EG6A 2B92A 3BL5A 3HGTA 3M9WA 1LDNA 5K51A 1E1RD 1BW9B 3A6DA 2R7AA 4NMMA 1GNPA 4HDMB 5K4GA 4BXOA 2L69A 1RXSA 2EG9A 5IK2A 4B31A 1WDTA 1JDJA 4FFWA 4V02A 3ETNA 5E6SB 4DS3A 1QPGA 2ID7A 1ID1A 4QEZA 4CLEA 2D8MA 5IXYA 4HDCA 1Y7TA 2I3GA 3RABA 5AK0A 4E5MA 2CBZA 4N76A 4PX3A 3TQQA 1P4GA 1TU3A 2V03A 3DBHA 3KFVA 5EZQA 4AJHA 4MDYA 1XRPA 1G8YA 2X15A 1T9HA 3L1UA 4ZICA 1A5AB 4C2UA 1U8FO 1NC3A 3CW9A 2RONA 4YDRA 5I3CA 3HXOA 4JIMA 3U0BA 1HRDA 2CLDX 3M6AA 2Q8QA 3KPYA 3IA2A 2Y1DA 1HDRA 2ZI4A 5IUKC 4FP9A 2F1KA 4GX0A 1XB2A 1QF7A 3RC3A 1DXYA 1FXWF 1G5RA 5IULC 1TQ8A 3OG9A 2EYUA 4Z54A 1W73A 4LKOA 5FOVA 2JVKA 5KYUA 4RK4A 5B5SA 3SBXA 3SSAA 2FVYA 5K3BA 5F7JA 4DUPA 3OEHA 1A7KA 1PLJA 1T2VA 3E84A 4ND2A 1FXSA 5JASA 1E1CB 4H1HA 4HCJA 3DBIA 5F9FA 3ABRB 1M72A 3S1LA 4RBNA 1C0LA 1G7CA 3PLNA 4Q4JB 5HE8A 3R9XA 3CVXA 1LPAB 3EXIB 3MWKA 3OWOA 4BKPA 3UV3A 5CFOA 3KQHA 5AOVA 2XT9A 3UMCA 2YN0A 4HWRA 4LV8B 4MW1A 3IODA 4MKFA 4EF5A 2CC2A 4MOWA 5LBUA 3LH5A 3M6LA 1LY1A 5FO0A 5KYWA 1FFAA 3KTDA 3O92A 3B9BA 3IUJA 2VQ6A 2ZLBA 2WAXA 2PZAA 2WHQA 3MAGA 4N3BA 2OHHA 5DYIA 1E0KA 3SX2A 4DRZA 3T9DA 1NU6A 1QHXA 3R0XA 4X1KB 4MXDA 3W3AA 1QLWA 3AFIA 4YEDA 2QYOA 4K87A 1Z8HA 3B8HA 3PEUA 1QP7A 1WSWA 1Z6ZA 2XA1A 3MRXA 3W5DA 2HXGA 2P3SA 4OM8A 1OMOA 4UVHA 4DXAA 3AW9A 2QW0X 3A9SA 3KR9A 5BW5A 1YVRA 2HRDA 2XUFA 5EGNA 2L17A 2CNKA 3C0KA 4G1UC 1WMSA 3B82A 3ROEA 5BWLA 2VXCA 2VQDA 4IHKA 4B35A 4UAJA 4G26A 2JFHA 4ODIA 2PGDA 1G3RA 4WE3A 4UUPA 4UVEA 4HGYA 1X1SA 3AI2A 3QITA 4CM9D 3EC7A 5EJ2A 4F3RA 4G2TA 2P3LA 1XCLA 3HMKA 5JJ5A 2CNDA 1TEVA 3GQBA 3TQSA 3BVPA 2GM4A 2JG3A 2B5OA 4RZ3A 1BKSB 2FCRA 2ZTLA 2CLSA 3QP9A 1NI4B 1OX5A 2ILTA 3U1BA 1VHJA 4HNTA 3L0IB 4MWEA 4KIJA 1KJWA 1YFKA 1M2KA 5A7FA 3H5VA 2XCTB 1KIAA 2ZBQA 2OBFA 3NBMA 1JDPA 4BFSA 4EELA 4Y2HA 3OE4A 1JU9A 1EAMA 4KACA 5GAJA 2OXTA 2OHXA 1CJBA 3FPGA 2PGIA 1V16B 4DJFC 5E4YA 3ROGA 4ZYTA 5IT5A 3EZGA 1LH0A 4UPVA 5ALUA 2LIPA 3E35A 3ROKA 1GAJA 3QUQA 4O4JF 4FR2A 4CEHB 2P75A 3U17A 3T0FA 4YDHB 1CR2A 1J7KA 3D8NA 3M2PA 5JYBA 5KTMA 1Y4UA 2PYIA 2N1BA 4EHFA 2CHUA 2DLCX 4G4JA 2R6ZA 4JEMA 2FEXA 4KQKA 5U9CA 1VXRA 4ZJYA 1NE7A 5HYVA 2OHJA 1S6YA 1HURA 3BSFA 1XLUA 3DBRA 1MC5A 3TOCA 2GN2A 4NXMB 1BFKA 1FJXA 3BMNA 2CB9A 4QLBA 1BE0A 3OCWA 2WNIA 1WEKA 1HMPA 3KQPA 1BJKA 1EGHA 5EE5B 2R5FA 5EXDA 4KPFC 1KAMA 1Z6XA 2W8ZA 1U8YA 2VUSA 2EAUA 3Q3HA 3R6WA 4FS8A 3LDAA 4QU9A 4W5HA 5AKLA 1ZUHA 2BM1A 2OAEA 4ZV7A 3GH3A 2YY7A 4C88A 2HN9A 4HH0A 1TUBA 2PZ8A 3OJCA 3PUHA 4MWBA 1JKJA 3R5XA 3SJUA 4B33A 2ZS8A 1ESZA 4JI6B 1N57A 1CUJA 1EVEA 1U9YA 5FAXA 3NBUA 3DMDA 1I24A 4QYTA 4TRNA 2O7QA 2IWRA 4G1VA 1K9SA 1C29B 1IHXA 3HFGA 2QE7D 4R2KA 1QFZA 4CLOB 1BKDR 1VYVA 1IDOA 1NVVQ 5C52B 2CE2X 3MJTA 2EJTA 4PC1A 5HQJA 3MVEA 2JBAA 3OM8A 4A9AA 2H2HA 4J0FA 2VRNA 2XGSA 4P3XA 2Y05A 5DTJA 5IPFA 4JP2A 3LT5A 5HCUA 2GHQA 5BR7A 1XUOA 3LPNA 4MB2A 2C7OA 1Y6RA 3ZW7A 5ARBA 1KMHB 3IXMA 2QORA 3E7WA 1JXOA 3HXKA 4BNIA 2W6MA 2QGZA 3R4VA 1EDOA 1SKAA 4I0WB 3ZXYA 2VSYA 4PN7A 1L7AA 1YMUA 2AL7A 2ZXUA 2O8CA 4UHKA 2B30A 2V6MA 2V7VA 1RM3A 4PYOA 4DCNA 4R3WA 4U5XA 2FH5B 5CD9A 5K6AC 3KSRA 4NCBA 3BJMA 3T35A 3NUQA 3DZKA 3FYUB 4K03A 4N3NA 4XCVA 1Z63A 3OFJA 3I0MA 1LLDA 1Z4NA 1E2KA 5CNIA 2VAXA 2FEAA 4IH1A 3WSTA 1GVNB 1AMOA 2ODWA 1FU4A 3D4BA 3ROQA 1T36B 1NRIA 3NTQA 1QAMA 5DHQA 3BC1A 1W0KD 1RAAA 3OLWA 3SHTA 4JDPA 3RUEA 3W34A 5A4IS 3IQHX 5DGCA 4QT0A 3GOHA 3UCFA 4M46A 1NT2A 4F8YA 1K89A 4OXRA 1B14A 2YVUA 1WOYA 1C80A 1PI3A 5AM0A 1J25A 1F8FA 4PLHA 4JOBA 3H5AA 4Y2PA 1P75A 5EPEA 4PQYA 2WABA 4NJMB 2PGLA 2ORWA 3TUIC 5ISMA 3TSOA 4DARA 4Y9UA 2KLBA 5A3QA 2NACA 2XDWA 3PFKA 2XKAA 2R5NA 1PJQA 3BHMA 3GVXA 1E7MA 4J0CA 3GJZA 1MNAA 3COYA 4ZKDA 5BYAA 2B8NA 4GSYA 3KJFA 4XEUA 1XYGA 3FKJA 1DKMA 3CUEF 4I50A 4R2JA 4OP2A 4C0HA 4ZK6A 2WI8A 5AHRA 3R7BA 2HJRA 4Q1EA 1FSGA 4O1HA 5DK6A 3ZQ6A 1VE6A 3NG1A 3KEFA 4K81B 5FL3A 4ZCQA 5FBVB 1BC5A 2W6CX 4KUHA 3AVPA 4XVCA 2X1LA 1JILA 3FTCA 3JZAA 4R54A 1YB5A 2ERCA 4KJZA 2JCXA 3REOA 1E92A 4F3YA 4WH0A 4QYMA 1COWA 1SVWA 4LWZA 2ZB7A 1RKVA 4ZFNA 3DDWA 1G4AE 4GC9A 4UASA 1RP1A 1ZNYA 3NXKA 3R3HA 4NEGA 1JR6A 4QZVA 2WW8A 4BZZA 5HBGA 2AI1A 2AN4A 4E5KA 2CV1A 1Z56C 4Q3KA 3U3ZA 4WXRA 3FNEA 4YT5A 5B4UA 5KWSA 4FFSA 5CT5A 4FCWA 3NALA 4QPNA 4R1NA 4OLFA 3SK0A 4TTQA 1ZD3A 3OCJA 2FZCA 4W99A 3VH4A 4EKGA 2Q3FA 2W6JA 4A1FA 3A1VA 2ZE5A 3GNSA 4R69A 2I6XA 5KYXA 1GYQA 4HSEA 3ZS8A 4AICA 3K30A 3OUTA 3SFVA 3JSAA 1HE3A 1QR6A 2UAGA 4JU9A 4DZRA 3OQOA 3QEAZ 4N49A 1MHTA 1W87A 2EZUA 5KQMA 2FETA 2WJWA 1XC7A 5F21A 1Q7TA 3PBKA 2YXEA 4TKVB 4W1RA 5HS6A 4DBLC 4FDTA 1O0BA 5C46F 5B53A 1AGNA 3VR6A 2ZRLA 5KU7A 3BGVA 2NTYC 1BQ4A 4NV1A 1BA3A 2Q5JA 1QFJA 1LSUA 1YZ3A 4IUYA 5M34A 4PLCA 4XWYA 2ORIA 5AM3A 2O6HA 1TRKA 1ENYA 4K9DA 2PU5A 4YT4A 2GILA 2IS4A 3FR8A 4MLCA 3R6TA 3D54D 2YZ7A 1XMXA 1VZ3A 3O7WA 4NH4A 5EP3A 3OFKA 1J00A 1DQNA 2IPMA 3SC4A 3RD5A 5LXTA 5EHIA 5DVZA 4HNGA 3V7YA 1DMRA 2PRIA 4PLWA 3QLVA 4UHEA 1YTLA 1CJCA 1RZUA 3NV7A 1K7FB 2VT7A 3WLHA 4DCMA 4KPYA 2P9ZA 3QRWA 1T10A 1XLTA 3PSHA 4M0LA 4E0BA 1NBAA 3AUAA 3JAWA 3NDJA 3OZTA 1Q7RA 2R7NA 3RYHA 3TNJA 3GLVA 3ZWMA 4G8JA 3CPSA 4TS9A 4JBIA 3ABOB 4E2ZA 1JJIA 1ZAKA 2OO5A 1KQFA 3RS0A 3MB8A 3CEHA 4W6ZA 1X6VA 4QBGB 5BUQA 4JLMA 3LIPA 1UF9A 2QZ9A 1IEWA 2OO7A 4B4KA 2X7JA 4IHAA 3WK4A 4BQRA 5I7RA 4KGZA 2OOKA 4ASUD 1W5AA 1Z4LA 3GJTA 3SICE 3JV7A 1IAQA 2TMKA 3FHCB 3V7NA 3VR4H 1WUYA 1X7GA 4U02A 1V1RB 2C77A 1N8SA 2XMQA 2J07A 3C85A 3MJVA 5KTPA 5D8DA 3W6NA 1WETA 3QFRA 3T1QA 2HUNA 2ZSUA 2QW1A 4J9VA 1U0TA 1UH5A 4PSCA 5KS2A 2ZRCA 5DYNA 4PCAA 4Z7OB 4JYAB 2GUGA 3FWYA 3IERA 3QPWA 3FB1A 3QE3A 5KNLA 2R6AA 2X1MA 2R6DA 4HH1A 3ETLA 5DGIA 5CBPA 1RMQA 1WDWB 3C97A 5JS7A 2X9LA 1LU9A 5JNTA 1KEEB 4MKHA 4US0R 1T6ZA 1N9ZA 1G2OA 1OB5A 3ON5A 4XCXA 1JDVA 1RIFA 3O90A 3E9RA 3HPRA 4O5OA 4CM1A 5BWMA 1XMSA 3DVRX 2CD7A 3C1UA 1H2AS 1Z82A 2VG8A 3RV3A 3RFVA 4DTIA 2ZAIA 4MX8A 1XTSA 4R9UC 4RM2A 5TR9A 4BVAA 4XH9B 4C6RA 2HREA 2QIPA 3UGJA 4URVR 1LK0A 3TFWA 3P4YA 1RYDA 2PXXA 3I2GA 3UW3A 5DNCA 3F3SA 5CHEA 4OGKA 2PGJA 2FW0A 1WVGA 2IEGA 3S1AA 2JCSA 3LD9A 3LPMA 1SC1A 5FOUA 3E9EA 3GZTB 2AUMA 2ONZA 3CX3A 1JIVA 3OA2A 3C15C 4II3A 4YJFA 4A7PA 3OJXA 3PNYA 4QJIA 2H31A 4RXTA 3TFOA 2C2YA 3JYNA 4CMGA 5KWIA 1Z2PX 4UVDA 3IS3A 4KGDA 4BHTA 3PEWA 1MPTA 4RADA 4RAQA 1CZNA 4KFRA 4ZDKA 5JJIA 4KRXA 3TW0A 3EZ9A 2Q29A 2JLUA 4J0EA 5KYVA 3JZMA 1U2DC 2C94A 1WZCA 2I62A 1LQTA 3F6CA 1N2XA 3O93A 2YVQA 1DINA 1TKAA 3QQPA 4HWOA 4B6QA 4IVNA 1KIMA 4HP8A 1N6RA 4WBXC 3IAM1 2XODA 1YVUA 4BO3A 3PGA1 4RHCA 1ISSA 5H9WA 4ZALA 1N3BA 1D5WA 3B6IA 3HBNA 4A0FA 4ZAWA 3GEGA 2HRQA 1V43A 3ABIA 2Y1FA 5TV2A 1VJ0A 2BTOA 3FPEA 5JANA 1AUPA 5CBKA 1U5BB 2X5KO 1F9AA 4PTYA 2XVXA 4ZVRA 3QKUA 1QU2A 1DRKA 2AD1A 1JLLB 2QQFA 2DHEA 4L51A 4M86A 3MRVA 2R1VA 1ZW6A 1C3EA 4BFCA 4UOEA 1Q91A 2COUA 1DAIA 1LBEA 3WSVA 2QSYA 1G8PA 3C4JA 5DKFA 5TLSA 1OYVA 1FTSA 1R37A 3I5UA 3ADBA 2HUPA 3DC2A 5CM9C 1JG1A 1R8JA 2FE4A 3EGDB 4BPBA 1B41A 4IWXA 4NOKA 4GPAA 4S05A 1VE5A 1KHHA 3K8OE 2R4QA 3AJDA 4MYTA 1S7CA 2HU2A 3M83A 4U63A 4Y1EA 4C87A 4EG7A 4G89A 5JAUA 3NHJA 1QRAA 3VPDA 5J9FA 2ONCA 2VRCD 3F3KA 3KJGA 3PX7A 2R6JA 3RVQA 4RNDB 3N2KA 2FDRA 2VDWB 3FE2A 2EU8A 5FQOA 3TJZA 4F9GA 2CL0X 1XIVA 4E88A 4PU0A 3FTEA 3DLBA 2E3JA 3RBVA 4XPIA 1O8BA 1HT3A 4TQGA 1RYBA 4D6YA 2NQ8A 1F2DA 2BMAA 3AM4A 4EA6A 3JVIA 3ILSA 3K9NA 5LLSA 3WLOA 1E60A 3AJ9A 3CZRA 4BFUA 1NWHA 5IK2D 4N5IX 1ZKDA 2QZ4A 3L2OB 2YQZA 1UPCA 1Z35A 4N1AA 4DR2B 1WHTA 4CEJA 5FYDA 1SCKA 3KOMA 1QBKC 4CE6A 4IJ6A 2WSSA 1K9VF 3CH7A 5EJFA 3ZTTA 3UJNA 3GLIE 2APJA 1EWKA 4WA7A 2XA9A 5I4BA 5FLYA 4I3GA 4B84A 4TTSA 1KEPA 3GEEA 4CTKA 4DT1B 2ENUA 4ZI7F 4LI3X 4QPZA 4EY3A 3GN2A 1Z2EA 1H2BA 1DAMA 2PMCA 2B78A 4IGAA 3L6OO 1HG1A 3JCZA 3H2JA 4QUKA 1KMCA 2Z5GA 1J70A 2E21A 3ROFA 1A98A 2DBYA 2ISSD 3IT3A 4MWGA 3T4UA 2ZCJA 4BVJA 2W22A 1PJBA 1T3TA 1V47A 2I29A 2ZDGA 3EEYA 3FNGA 3N2LA 1X1CA 4MV0A 1QH0A 3C3JA 4RZUA 3C5VA 4O4IA 1NBHA 3GQVA 3PGKA 4F2GA 2HLNA 4JVNA 3KQYA 2QR2A 4WN3A 1N5JA 3E3OA 4ARZA 4E3WA 4B4OA 4F91B 1KQGA 3ZLUA 4GMXA 4HVTA 4B9EA 2KQUA 1RI3A 3GEMA 1G8HA 2J3JA 2WR8A 5KAPA 3WWYA 3AI1A 4EF4A 3T7TA 5LCXA 3HYNA 4MVJE 4JXZA 3BEOA 4AK9A 2LCFA 3AL0C 4KWIA 2DFNA 1EKXA 1VKRA 4MEJA 4GRIA 4C07A 2O5VA 1ZNWA 4UM9B 1VCIA 2EEZA 3ECCA 2X7HA 3D3QA 4IZOA 2CZGA 3H2YA 1YR1A 2IYOA 1JQEA 5FFNA 3W3AD 2PMFA 4YYEA 3UBTA 5IC6A 3ZYCA 2GCEA 3KU4A 2PKYX 4RKWA 3DAGA 5ECDA 5EIBD 4I9NA 4J1NA 4Q1CA 3GRVA 3QKIA 3VSDA 4M8LA 4M76B 3S2UA 3L77A 1DOHA 2J41A 1QQBA 1CRZA 3CB4A 2JFOA 5BNTA 1H65A 3L0OA 4DLVA 1UWCA 3ZJUA 3IHWA 3KAJA 4TV8F 4ADSG 3PDUA 3G9QA 1ZA1A 1WZIA 3FWHA 3D4IA 1M5UA 1EP2B 5J1TB 2OA0A 2IXDA 3JWEA 4LJLA 1EUDB 1W8IA 2Y0BA 3PT9A 4U7FA 3RHTA 3RVKA 4EZIA 5DO9A 2ZTSA 3Q3IA 1UKAA 1KK2A 3FIUA 1YU9A 4YMWA 1RQ7A 3DL4A 3GEBA 4IQ8A 4A0QA 4FB5A 3MCTA 3OT1B 2QAJA 2O0LA 5E9JA 5LUAA 2ZRMA 3D43A 1U7DA 1JSRA 2BKEA 3LHKA 5DB4A 2ODQA 2OWEA 3IEUA 3KSUA 1GSIA 4R1OA 5LP6C 1NVAA 1JHVA 5E8JA 1A9PA 1SURA 1VSQA 1X42A 2BFCB 5BORA 1T8UA 4FPXA 5J2TA 3GIWA 1R15A 1NXXA 1WOMA 2VDRB 1ISIA 3B1ZA 3HVHA 3S8MA 3T99A 3FYTA 6Q21A 1QG6A 5AM1A 3VDQA 5IKOA 3DSRA 1MB4A 2OM6A 1ULHA 2X4IA 5AT1A 5C3MA 1XZLA 2IHBA 3QEOA 5UKDA 3ENVA 3PPIA 5JSKA 4CM4B 5HCIA 5EKTA 4C7MA 4F1WA 4JJAA 5IVDA 1MB2A 5CFPA 1FUYB 5DHUA 2ZSIA 3TR0A 1HXHA 1E1KA 3PGVA 5C8YA 2XCIA 2FHPA 2C9YA 1RRVA 1AUVA 1JBEA 2Y1XA 3QYPA 4UTRA 1KOJA 3DPIA 4Q21A 4EY7A 3JRNA 2C57A 1F1JA 1E59A 4JMPA 4OG2A 5ALEA 3B3AA 3HB5X 3D3WA 2VOEA 5KNCH 2WIAA 1GCGA 4JU8A 5EJIA 3UV7A 2ZUFA 3WISA 3MGGA 2IBSA 1MPXA 5I45A 3JPYA 3A0UA 1B2RA 1HE5A 1YNOA 4TTPA 3CY6A 4X97A 4YRQA 4ZOAA 2I9KA 2QQGA 2IUTA 3MWYW 5EPOA 2QK4A 3FYSA 4E1BA 1MVNA 3R77A 3RFTA 5EJ5A 1YKFA 4MKRA 3E22A 3HZZA 2QP4A 3WAJA 4JP1A 2CFTA 1CIVA 1UDCA 2K6GA 4N7JA 3ZHYA 1WXEA 1F2TA 2RCNA 4K5QA 2RH5A 3Q72A 2V5VA 1HFKA 1R8YA 1JBQA 2VBFA 4L0QA 1AY0A 1POXA 3GFQA 3V32A 5IN4A 2BGNA 2PZLA 2ZIFA 3S2SA 5F98A 2JD0A 4HNAA 4RU1A 4A3SA 1WIWA 1RHJA 5TQVA 1CZUA 2PUHA 5FD8A 3QU7A 4LRYA 2HJSA 3OIVA 3RADC 4ACAA 1PVVA 5GONA 1RQ2A 3KTAB 3DMTA 4KI0A 4QBTA 2AVDA 2BGUA 5FF9A 2R87A 3JD3A 2ZETA 1XX6A 5HIIA 4O0LA 3K32A 1JGTA 5CEFA 1EVZA 2C2GA 1R3DA 2OC9A 1W35A 2RI6A 2BJVA 4Y0AA 1G98A 2YY5A 3E3AA 4GM1A 4RZSA 2OMKA 2I7VA 1XTQA 4DOMA 1L4MA 3MMZA 2GCGA 1O3YA 1SCUB 3NCHA 3UATA 4BZXA 4NESA 3RK0A 1XD9A 4PCVA 3KXDA 3IEKA 3NKLA 4Q6BA 3WY9A 3CTPA 4DBLE 5E2AA 3WK6A 4AJ1A 2O3RA 4JFAA 3S99A 4BE9A 2Z5LA 3O2QB 2X4LA 2NVBA 2C2OA 1E58A 1E79A 1ENPA 2DY0A 2MSDB 3GC6A 4OXYA 1TT7A 3LP6A 1IG3A 2A88A 2WHXA 2PG3A 3NC4A 4XD7A 1CY4A 4IDBA 5BUSA 1EFUA 2NTNA 4Q9KA 4GH5A 4BNDA 5KYGA 2J1LA 3QJGA 2QNIA 3M3DA 3A3YA 1A9OA 2QSJA 3UJHA 1TI7A 3GRUA 3ORRA 1WABA 4KH0A 3U2QA 1ZM4A 5TMPA 5CD1A 1T0BA 1TF2A 4NOMA 1K8YB 4WN9A 4AG3A 3BFJA 4LOKA 2XD9A 1JIIA 4FTWA 4GYKA 1BQ3A 1NRXA 4WZAA 1E3QA 4QGAA 4UE3S 2C2WA 4BUJA 1LB1B 4JJKA 1K6XA 4LHWA 3EPJA 2DCUA 2IZZA 4IS3A 3DBVO 1KGSA 4X6XA 3SM9A 1WG8A 2IIVA 2UYQA 3O8OB 4HEA1 5T57A 3MWFA 3E4CA 2BRUC 2I4OA 2XUHA 4RQAA 1FDRA 1G20B 4PYLA 5ITZB 1H42A 1YCGA 2J4DA 4ARSA 4EPVA 3DLCA 4FHFA 2NVUA 5GOZA 5A4FS 3RLIA 4FX5A 3KRTA 4KE9A 5CYPA 1Z07A 2FKAA 4L5YA 1RYZA 3EXG1 3FCOA 4OMCA 3RE1A 1G6OA 1G19A 5DNAA 3UWKA 1LZLA 1M83A 4TLDA 1AQJA 4G85A 2PL1A 4DNXA 1ZGBA 2XIJA 3BOSA 3GPIA 3QY0A 4QUDA 4QOHA 3ZLBA 3BICA 1KDTA 1AB5A 4P22A 4Y30A 4DMLA 4AN1A 3HUFA 2HPZA 2MCFA 1CUWA 2VJBA 2F64A 4LXXA 1RWNA 1MTZA 3K72B 1E3DA 1P3Y1 1JDNA 1S2IA 1QFXA 2UUPA 4QAQA 1E96A 3P9XA 2Q41A 4ALNA 4XKJA 3T54A 2QTBA 3UN1A 1IMOA 1MX9A 2CFOA 3OETA 1Z3IX 5D00A 4EI7A 4FT4A 2WOOA 4WKOA 4O4HF 4IKPA 3NRJA 4F4UA 1OX4B 1LQUA 2FFRA 1CQXA 2HNAA 2NXCA 2W6JD 1ECCA 3FUCA 1U28A 2CUNA 2FN8A 2GEBA 3N2GB 4JLKA 1H85A 5CFQA 2VPPA 2ZUWA 4Z49A 5JNRA 1WUHS 1WM1A 4FYWA 1PZHA 1OAKA 3CW8X 3HKEB 4GI1A 5A9SB 3FSEA 2FNAA 1H6CA 2Y76A 2PYDA 2QGNA 5K5EA 3UB2A 1NLMA 4ABTA 4GEKA 3VR6D 1UBEA 1XDUA 3W5BA 3RTAA 3NT2A 3C1AA 2DT5A 3HB9A 1H05A 1AXGA 2QZJA 4N4AA 1BE1A 3A2KA 1B23P 4TXHA 1VB3A 1MOPA 4O4LB 2Y4OA 1GQ2A 3ET5A 1KOLA 3DXZA 1GG2A 1MEEA 3N70A 4GZ5A 4HQKA 1EFVB 3G5AA 5B3AA 5THQA 1AKVA 1OLSB 1YZGA 4X63A 4D9FA 5IJ0B 1VYUA 5FWXA 2ZJAA 3PHHA 3HVKA 4B3BA 3QSYA 4FB4A 1HRKA 2AXQA 2BGKA 1ZX1A 2GAJA 1IM2A 2RAUA 2XTJA 2Z3VA 3A0RB 4GIBA 1O95A 2JIDA 2NU7B 2XYPA 4MSUA 3OZXA 4KBFA 4PXYA 5CNMA 5EWMB 1PDVA 5FI0B 1KPIA 1BGWA 1IEXA 1ELOA 1KHTA 1TGVA 2H1RA 1E2FA 3WKCA 5A4KA 1C3XA 3ZGXA 2GBGA 3W77A 1KFCB 2QY6A 4ZCPA 2DB3A 2YDYA 3BCSA 4M6WA 3PUKA 3H99A 5HVNA 5CAEA 4EGSA 1R5OA 1YBVA 4CMBA 1GRNA 4K9OA 2PKEA 4FE3A 3GNTA 1ND5A 4GC5A 4IIXA 4IDHA 3E5NA 4LVOA 3TD9A 3AKEA 3NT4A 4NYMR 1XQ9A 1XYYA 4DWJA 1NPYA 5ANRB 5TGTA 1OYOA 4MS1B 5K3FA 2IOYA 2MSNA 3O7MA 1NG9A 2HU8A 1QM5A 5J47A 1JE1A 2VIIA 3UTCA 1VFNA 2DZDA 1GA4A 3RU3A 3H18A 3VGPA 4BV3A 1V4BA 2ZJ1A 3T4PA 4NZOA 2JCVA 2JGMA 2OFXA 3RS9A 2WWTA 1Z08A 1L1FA 1DKLA 3L06A 1Y8QA 3WHKA 2P2YA 1CR1A 5K05A 4BMXA 5IT4A 2DTEA 1DBWA 1K4KA 3PPWA 1QGZA 3T7KA 4DPMA 2DERA 4JLDA 4WY8A 1Z0IA 2O0MA 1MXFA 1BVRA 3DGFC 3KUXA 4K6HA 4M0DA 4KR2A 3OESA 2W4MA 1EWYA 2ZI5A 2QN7A 3ROMA 2ZS9A 4B75A 2WINI 1DTWA 3BXEA 4YJ2B 2Y0EA 2ASEA 1DCFA 2DYKA 2AYXA 4FMCB 3VYRB 1DBSA 3I6BA 1ODLA 4LNUB 2WKSA 3BKWA 3HCNA 3TF5A 3F96A 4EHJA 1B3BA 1CRQA 1GQYA 4GR5A 2O1SA 4ND6A 2Z98A 1YI0A 3FWPA 2F1OA 3C6QA 2WHRA 4M88A 4QYSA 1QE5A 1DHTA 1YOVA 4UQPA 3VPSA 4D0RA 4D4HA 4C0JA 1ZBDA 5F7OA 3WTBA 1G21E 2WYUA 3MCWA 1H69A 3P20A 5KX5F 1Y63A 2I76A 4H7DA 4NENB 1HL3A 1K6EA 1R3UA 2XCLA 5IW8A 3PQEA 4UARA 3WGIA 2OBYA 3RFXA 2IH5A 1HYGA 3QX7A 3QVXA 2L18A 3Q4GA 3IOEA 1QZZA 4NBTA 3AEYA 1Z39A 1W30A 1FDWA 5I8WA 4V1CA 4XUDA 3EVBA 4DUYB 3MQ4A 4DFDA 3NB0A 2NYVA 4LK2A 1TK9A 5JTTA 4M2LA 2YV1A 3FWZA 1G38A 5ERGB 4MV3A 4AZ3B 3JZDA 3BJZA 1QGDA 3RVMA 3PJRA 3E9DA 1GLNA 1VE9A 1O87A 4MIKA 3ELDA 3IRVA 2FF7A 4FC6A 3GWGA 2XB8A 4NF2A 4X6YA 2ZAMA 3MRSA 2VJOA 1OHHA 2H5JA 2HL6A 3LUHA 3QVLA 1S1CA 3BYZA 3EW9A 4YP1A 5JHHB 3CG4A 2VBCA 4YH1A 2AI2A 4EA7A 2LV8A 4TS4A 1U0LA 1NHGA 5HIMA 3KTOA 4DV2B 3EQ6A 3LPDA 3HJHA 3CNEA 4M0MA 1K27A 4GF5A 4G4SP 3AF2A 4Q24A 3U48A 4QJ5A 2ABWA 1O57A 3VNBA 4RD0A 1Y1TA 4UNPA 3TTTA 2O3UA 3ZQUA 4F5DA 1ZKMA 5DI3A 3EXAA 2EF1A 2YJGA 2P3QA 4JELA 4U8HA 4NCIA 2I0FA 2BL4A 2HAEA 3UMJA 1ZHOA 3SVZA 4CMEC 1I2BA 3LBYA 4QUEA 4MDFA 3HM9A 1X74A 5DLQC 4KTTE 4R1PA 4KXVA 3QEKA 1CFJA 3VYTB 3COVA 1PHPA 4BX3A 3PUJA 1V1MB 2ZBUA 4C4ZA 4D8XA 5TT0A 2E1RA 3EYWA 3OPYI 1EVLA 5LIPA 2G04A 1L5HB 2QN2A 4ZVPA 5M04A 2CF6A 1NQ5A 3L3BA 2XUZA 2FJ0A 2FP4B 4OHRA 1V6SA 4AT1A 3CEJA 4WJZA 1R50A 1BN7A 4MKXA 2AFHB 2IXEA 4YP0A 3TVTA 1C3OA 1QV9A 3UJPA 1PNRA 3AI7A 2I3ZA 2XB6A 5G0SA 4R83A 2L0XA 3LC2O 3DAPA 5HJ5A 2G36A 4MYCA 5MHTA 1T8WA 3E2IA 5I4CA 3ZWKA 2H2AA 2PH7A 1J0EA 2AC7A 2GN9A 4GWGA 3PG5A 5CDTA 3AY7A 3G5TA 5ITVA 2J3QA 4CGYA 1NZJA 4LI0A 3IYLW 2WWYA 1AVTA 5D6OA 2CHVA 3TNYA 4UNRA 2VHYA 1E7QA 1MAAA 4XARA 4AP5A 4BLVA 5JEDA 1T2NA 2IDMA 1JVBA 1F6WA 4TMTA 2IS1A 4FYMA 4FCVA 4QODA 3HVIA 3LUDA 4XIGS 1PTJC 3G8CA 3I1JA 4W5WA 2PAAA 3RFCA 4BNGA 3X44A 5KOHB 1J23A 2G9RA 2R8PA 2GDZA 1XVVA 1H1LA 4URUR 3UMVA 4F4DA 3HL4A 5AXDA 2AZ4A 3SEFA 5JTUA 2Z43A 2ZYUX 3EF1A 2QN3A 1TEXA 5FOTA 3C8MA 4OH1A 4PPFA 4G0NA 2BFNA 1LRKA 5CH8A 4BO5A 2VWQA 3GAAA 3W2IA 5DTQA 3SHQA 1YVPA 1TEZA 3GN1A 5ER6A 1M1YE 1V2GA 3FKSD 3K9GA 1FP1D 2QLTA 1M1ZA 2PTHA 2WJGA 1KP3A 3KLMX 3EASA 1S1MA 1JLKA 2WTBA 3SEQA 1ZHHA 2QXTA 1VLLA 2WD7B 1QHEA 2YJTD 3DE1X 3KXKA 1L5MA 5T4FA 3A6JA 5G02A 1TCVA 5FI1B 4ZOCA 3G82C 4C76A 5DNEA 5H70A 5JQGB 3NYIA 1ML3A 1C4WA 1P7YA 4KK3A 3N8IA 4LY9A 3UG7A 2R1ZA 2PZKA 2PQMA 3V2HA 3U4CA 5AIBA 2EKBA 3I9LA 3G0IA 3KB6A 3KZMA 3VOAA 3AETA 3HI4A 3NIBA 4QOGA 1A8UA 3U4IA 3KQMA 4JYCA 5IC5A 3VVBA 1XMOB 2V7GA 1QR2A 1NUUA 2O14A 4KVGA 4N6OA 5FXMA 2H9YA 4WEQA 1GFSA 2E48A 3G2LA 2DPYA 4UCXA 4J7AA 3B6ZA 3RRBA 2FPMA 3V8MA 1OXMA 2FPGB 3OZIA 3ZCXA 5KNBA 2IP2A 1TF5A 3H2GA 2JK0A 4ARCA 4P58A 1VL0A 1YAJA 2XT6A 3GLRA 3Q3GE 2C7GA 5KMGB 2FV8A 1RHUA 1T4CB 3SE0A 1G2PA 3E9ZA 1WD5A 4OBEA 5IJZA 3U4HA 1QVVA 2J31A 2C5FA 4HNRA 4WUTA 2O7NA 2QLBA 3MN1A 1VJGA 2VOJA 3OCYA 3R5FA 1T2CA 5H82A 3RJ9A 1C3JA 3U6KA 1PNVA 2P4HX 4GPD1 4OB7A 4RH3A 5E6RB 5T64A 1DL5A 4BCDA 5C80A 4JI2B 1SHJA 1NBOA 3IPLA 3I3OA 1OFIA 4QRIA 4WASA 4W1SA 1HORA 1D7AA 2FZ5A 4G5GA 4YV2A 4BMZA 1NXVA 5F7XA 2HRRA 2Z6UA 2P7HA 2RIPA 3IH5A 2AMFA 1J8FA 1Z2OX 3LVFO 1F14A 5AKHA 2CXOA 1O2DA 3LGSA 1DIHA 1P4HA 2AG8A 3PZBA 5HRCA 5K8UA 1O4VA 1U31A 1DOAA 2BF7A 4B2IA 4KWHA 3LBIA 2GWRA 2PANA 4Q4HB 2DQSA 1NE2A 3OT5A 3RJZA 3X43A 2AW3A 3ZHQA 4BNKA 2FPIA 1IL0A 4FILA 3UT5B 1S2GA 2GLXA 4ZQFA 4EBBA 4K46A 5DISB 5AOAA 3TKYA 3M49A 4ETWA 2P9JA 2B35A 4YHHB 4W9RA 2BZSA 1RADA 2CN1A 3C3DA 3K4PA 4J3JA 2GPWA 4RETA 2OKGA 1YNSA 3MMSA 1U9IC 4HZGA 1X94A 2WNHA 4KV9A 4PZ0A 4CR8A 1QSGA 1E3WA 3C6ZA 4ZQGA 3FOWA 3Q0IA 2B34A 5ENDA 2J08A 3DMPA 3BGSA 1W52X 3L8DA 3M8KA 4FYXA 3BFXA 3GFSA 2WU3A 3EEQA 3JY6A 2X9GA 4E1VA 1JYEA 3B78A 1KO8A 5ALYA 2AVNA 4ILKA 2OLJA 1PQPA 2UZ1A 3SQLA 5KX5B 2HF2A 4LZZA 3HUEA 2UZ0A 2E5LB 4WSOA 3PXGA 3JQEA 4L9WA 3TRHA 5F23A 2V0NA 3PNOA 1G9XA 4Q4DA 4WPGA 1QGUB 2FUG1 1ZM3A 2H5LA 4RWZA 5EQFA 5EG5A 3AR6A 1AKWA 5WRFA 3GPBA 3R7DA 2GO7A 2QD3A 1JHXA 3QIVA 5JS6A 2D7JA 2ACVA 2J5BA 2V5AA 4MS4A 1QYCA 1R16A 1QIGA 3FMPB 3JALA 4OXNA 5FBQB 3SE7A 3WJAA 2XWBF 3C3YA 4H9GA 5B55A 4D1YA 3G9XA 3B6EA 3G2PA 5K6RA 4DV1B 3OHMA 2JD1A 4ZDJA 5M29A 1X39A 2QJWA 5JOQA 3PPXA 4HPXB 1Z4OA 3A4YA 3T3NA 4FX2A 3X1ZA 4G4IA 2B8EA 3QMWA 4TT3A 4PSDA 1NJ6A 4UM7A 4DMMA 1NW7A 1NTOA 4RVHA 1RFGE 3D8SA 1RWBA 4G1CA 4XD7D 3HJFA 2CNWA 2R66A 2VHZA 1VI5A 2C9BA 3DGEC 3PU6A 1NBME 1UFVA 2AKEA 3GEDA 4RE5A 5FT9A 3ZDFA 4PO3X 4CHTA 5JRDS 3ZY2A 1P2TA 4IRMA 1H9BA 5JNVA 3NDBB 4OL0A 4Z86A 2QRPA 5AH0A 3HRKA 5EXSA 3ANTA 1E5TA 4L74A 2WTXA 1A95A 1Y5RA 4GRDA 3ELUA 4RACA 2YRFA 1EINA 2CFCA 4HXGA 4NECA 4YJHB 1GRRA 5EY5B 1ZJWA 3DNPA 1JIXA 3IALA 3UIEA 1I9CA 3BB4A 4XLLA 2WUEA 5EUCA 3ZY3A 4YRBA 3BCRA 1Y3FE 1J1ZA 1Q19A 3CWQA 1ISGA 1M2OA 2H7CA 3N1UA 1C9NA 1KI6B 1UODA 3LIIA 4JY7A 1SG0A 2GSWA 2PLNA 3QBVA 1DUVG 4PRZA 5DP1A 3VZQA 2PD4A 1Q15A 2NUBA 3CM0A 3GJ3A 5KINB 2O2JA 2OZLA 3AHIA 4E3ZA 1RBQA 2XQJA 4DREA 3R76A 4BAUA 2VUUA 4OJQA 4DSZA 1OXBB 4RD6A 3CNHA 1E63A 3N8KA 4E11A 4HDMA 4MDEA 1F6BA 4IO1A 4CIVA 1X1QA 4MDHA 3UT0A 4DLAA 4OKSA 3K6KA 1WB9A 4J7XA 2C3PA 4KX3A 5TF4A 4TT8A 2ZZMA 2GZ1A 3W2FA 4EJSB 3IBCA 3RS8A 4OLJA 4UMFA 3EGXB 5DWVA 5G41A 5JAIA 2A4KA 1PK7A 4EITA 3V42A 2D8AA 1UBLS 5HW0A 2FZVA 3DE2X 4NJEA 3RYIB 5ADUS 2CDBA 5LYYA 1I6MA 1NKTA 2A5YB 2FWNA 3AEZA 1GTVA 3CBQA 4UAUA 4ROTA 1EGMB 5K1ZA 4BX8A 4NAVA 4KPGA 4L0DA 2DSNA 3KXPA 1GTRA 3R7AA 4RSRA 1KZYC 5BYJA 3KPUA 4Y7CA 5L3QA 5F2EA 1GNVA 1KETA 1PFUA 4KSCA 5D7NA 3OC6A 4A36A 4UPDA 1W5FA 1M8GA 1M6VB 4V0SA 2QKYA 3AC0A 1UINA 1XRNA 1Z45A 4C08A 2ONYA 2C5HA 2IYEA 1PL6A 1AHNA 4AZ0A 4Q4JA 4E4YA 5AKIA 3EXIA 3TPCA 3R5SA 4UXJA 1WZEA 1FK8A 3BXOA 1LJLA 3PYLA 4HWGA 4NBNA 5A3VA 1D9XA 2E55A 1SQFA 4C0SA 4ZTUB 1NSYA 4KWCA 2V3CC 3T5TA 1UPBA 3KQWA 4YJ3F 1C9JA 1VJ1A 2EX4A 4HAUA 4WBSA 1GGFA 5ADHA 2AEMA 4MRPA 2YZKA 4XJSA 4KKXB 3RWOA 1TRHA 2HQBA 2MHCA 1Y1PA 4X1KA 4BFXA 1YB7A 2RARA 1SK8A 1E7YA 3I2IA 3LQRA 1K7YA 4P4TA 2WJIA 3Q3VA 3SY8A 1T4BA 2ZB4A 5DBOA 5H7XA 3WGTA 4BQIA 5KQGA 3HXQA 1JQBA 1U2ZA 4QNMA 1XZHA 2RBKA 3PC8C 3QSGA 3NTXA 4Q9JA 1C1XB 2V6GA 4D3ZA