1UJCA

Structure of the protein histidine phosphatase sixa complexed with tungstate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
156
structure length
156
Chain Sequence
MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELTPCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphohistidine phosphatase sixA
publication title Crystal structure of the protein histidine phosphatase SixA in the multistep His-Asp phosphorelay.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 51
structure length 156
sequence length 156
ec nomenclature ec 3.1.3.-:
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ujcA00
1YFKA 3O0TA 5AK0A 4FDTA 1RIIA 1ND6A 2GFIA 1DKMA 1EBBA 3QPVA 2YN2A 3LG2A 2P78A 4MA4A 4IJ6A 2EOAA 1TIPA 1QFXA 2P77A 5AJYA 1IHPA 2WNIA 4ARUA 4EMBA 2P75A 5HTKA 5AJXA 5AJZA 4ARSA 3GP3A 5CU7A 1V37A 1SKBA 1DKPA 3KKKA 1FZTA 1H2FA 3QPUA 3BIFA 3MBKA 3K4QA 2ENWA 3GW8A 3IT0A 2P9YA 2QNIA 4GPZA 3HJGA 4D4KA 1DKNA 5AJVB 1DKOA 5AJWA 2PA0A 1C81A 2DWOA 2I1VB 1UJCA 4JOBA 3C7TA 1QWOA 3QPWA 1BQ4A 2HPAA 4ODIA 2P30A 3DB1A 1H2EA 4JODA 2EKBA 2P6MA 2OWEA 2P2ZA 1YJXA 1E59A 2IKQA 3PGMA 2H4XA 3MXOA 2P79A 1QHFA 2OWDA 3D6AA 5HR5A 1C7ZA 3E9DA 3OI7A 3E9EA 2P2YA 4EO9A 3IT3A 2H4ZA 3NFYA 4D4JA 1T8PA 2P9FA 3LL4A 4IJ5A 2P6OA 4JOCA 2DWPA 4ARVA 2YN0A 3EZNA 1FBTA 3F2IA 3ZHCA 3FDZB 3K4PA 5PGMA 1C80A 2F90A 3GP5A 2WU0A 4D4MA 4FDUA 1SK9A 2A9JA 2EKZA 3FJYA 4HBZA 1V7QA 3E9CA 3R7AA 1CVIA 4PZ9A 2HIAA 4GPIB 1DKLA 2H0QA 3IT2A 4PGMA 1BQ3A 1RPAA 4QIHA 2RFLA 1K6MA 3IT1A 3D8HA 4TSRA 2H52A 3NTLA 3FDZA 1DKQA 3EOZA 4D4LA 1BIFA 1E58A 1ND5A 4E3WA 1SKAA 3F3KA 3LNTA 5CDHA 2A6PA 1NT4A 1RPTA 2ENUA 1UJBA 3DCYA 2P9ZA 1SK8A 2HHJA 4PZAA 4AROA 5CX4A 2WNHA 3D4IA 1XQ9A 2AXNA 2BIFA
chains in the Genus database with same CATH superfamily
4JBLA 2P9EA 5ERYA 3PPVA 3PXEA 1X77A 4H3VA 4AZ0A 4ZGWA 1USVA 2PJUA 4PFSA 4PEVA 4ZVUA 3SSMA 4ZQFA 4DR3B 1HSOA 3AETB 1VB3A 2GFIA 2H3HA 3EAQA 3WLOA 5EINA 1JKJA 3IC5A 4HK4A 3U0BA 1WE2A 1P8JA 3EZ2A 1RZ3A 1X7ZA 3I6YA 1Z62A 2QX8A 3KDPA 3EX7C 4CMKA 4RTSA 2E2WA 2YHIB 3A0RB 2AJCA 2XH8A 2Q4EA 3IUMA 1YZTA 2ZUBA 3NUQA 1P74A 1P2FA 4YRCA 5ITZA 1HTTA 5BSMA 2XF8A 2PR7A 4R2LA 3WWEA 1V7CA 3P52A 2A5GA 2XIQA 3NGXA 3OUTA 3AVPA 3K6KA 3JQ9C 3AKYA 5HJ5A 3GEGA 1QHHB 4GX0A 3BSWA 3MOIA 2XKKA 1GPLA 3IPLA 4Q4DA 5IF3A 4Y1RA 4CCAA 4J90A 4ZIRA 1J24A 1IXRC 3LPDA 5JHHB 5KNCH 1D5CA 1X0VA 3M6VA 4C2TA 3E22B 3BMCB 1Z4PX 3OA2A 3PEVA 2O57A 1D7OA 4PYRA 5CNMA 5E7MA 3KXLA 1L1FA 4B6QA 4CIVA 1E0JA 1S89A 2GPNA 5FLEX 4K46A 1M2EA 5HDBB 5F1PA 1GPDG 3OM8A 5TPWB 3PDCA 1F0PA 3W8EA 4FMBB 1I33A 4MLDA 4BKRA 4CMHA 1K8QA 4AMZA 3H6GA 1T43A 1Q21A 1ZN8A 3T0GA 2OC9A 1M2JA 4DXHA 2C9CA 1B8OA 3HY3A 4YJKA 4DM7A 4KIGA 5BWMA 1Z4JA 1SOAA 2CCJA 3CT6A 4CMGA 2OCGA 4IJWA 1M10A 4BAZA 3IJEB 2UYHA 4MRVA 2VATA 5LM3A 4TUYF 4R2KA 1VE5A 2WD9A 2RGDA 3HEAA 5FTMA 5FWYB 4ZQGA 3KUXA 4LPSA 5LIPA 3ZK7A 5HRCA 1R16A 2ZWPA 1JA1A 1R0KA 2IOHA 1SO8A 1NQTA 1QGZA 3NBFA 4HFJA 5AVYA 2JGDB 3IQGX 2H2GA 1CBUA 3IQHX 4F8YA 4PC2A 2WU0A 4BRZA 4C20A 3QLVC 2DF8A 3ZHVA 1H4SA 4N3AA 3VU0A 3ZZUA 2IZ7A 4XJTA 4FFOA 4YC7A 1I2BA 1Y3IA 3NEYA 2YIVX 4L2IA 2WVGA 3FZNA 1XPOA 2CZGA 2XUDA 1U02A 3KSAC 3EGWA 1RRPA 3Q40A 3EHDA 3CLUD 4MV7A 4P5EA 3QK7A 2PU5A 5U1PA 1OQAA 4POOA 2ROQA 3EEQA 5TQ2B 5EWMA 1RADA 3PXUA 2QLMA 2VF8A 2A1TR 1QZTA 3I6MA 2R5FA 3GO4A 4LOKA 1TQ8A 3FZQA 4QWWA 5CLJA 2IHUA 5HF5A 4M22A 1OE0A 4S2UA 1XD2B 3T4UA 1Q17A 2VYVA 3FSEA 1WXIA 2RK6A 2W4IA 2DHCA 3BE6A 4B79A 4X64B 1BRMA 1GZ7A 1H8ED 2EG9A 2GWHA 2OCKA 2PEYA 4CVNA 2QG6A 3B1VA 3IIJA 5EZQA 4FTWA 4CTNA 4MHTA 1J99A 3OLCX 5JYEA 3CUTA 1HE2A 1ZI9A 5KWSA 1Y8RA 1QORA 1Y3DE 2W0SA 3OEWA 1TX4B 4FJ2A 2JJ1A 5H80A 5KTRA 5L45A 3K5PA 1RI2A 4YRLA 4P54A 2PUVA 3DC2A 4YBZA 3WMGA 2OZKA 4HH4A 3WLLA 4G01B 3CZ9A 3IP3A 4H18A 3VKWA 4EG8A 4IXNA 4F04A 3SQDA 4PTYA 4ZI7B 3RASA 4N49A 3PUVA 3WYAA 3NZEA 4R51A 3CO5A 1Q83A 1XLTC 3GH1A 5TNXA 3ZU6A 4DPKA 3WLPA 3CH5A 4DDTA 2Y1KA 2VSQA 5F1KA 3IYLW 1JLLB 1JHOA 1USUA 4F1KA 3G49A 4TSFD 2IWHA 2E4VA 1DNPA 3KQOA 4D9NA 1CRPA 4ZVQA 4OX9Y 2GXSA 1TMKA 3FTCA 3S2FA 5D5QA 3KDAA 4ACBA 4WN9A 1UJ5A 3INYA 1X3LA 3N0TA 2GGSA 5CIQA 2PA0A 3IKJA 3HUDA 3DOEA 4JBGA 3WWDA 4H7EA 4UVIA 4UKDA 2HBZA 3GRUA 3O83A 2HQ1A 1NPTO 3N2GB 3IR5A 5D84A 3V2HA 5HJ7A 1ZVVA 4NCHA 3FUCA 4O4LA 1Z8DA 1AU9A 1SKUA 1W4AA 2GI4A 1CW2B 4NECA 3AGPA 1Z0ZA 3K92A 5IDYA 1C4KA 1YZLA 1TL7C 3C87A 4INAA 1NZFA 1P4SA 5I9BA 4MGIR 2CHVA 2IKQA 5I01A 1TPYA 3A3YA 3ZPXA 2A5LA 4FK8A 2XQGA 4GD3Q 2TS1A 1LBQA 3BAFA 3RJZA 3UG7A 1M1UA 1RAEA 5DH9A 4A73A 4WJZA 5ECWA 3UOAB 2JLXA 5DGHA 4G4SO 1NKSA 1RYHA 2E5FA 1ODIA 2D1YA 4OJNA 5EMLA 3TOCA 3UF0A 3FTNA 5EKUA 1EXMA 2HCBA 4BNYA 5I7FA 4IJKA 3W5BA 1JT9A 2MT9A 4Q00A 5HQ3B 2QTCA 5DX8A 1LBHA 5B3KA 3F7NA 3B6MA 3JVUA 2JCBA 3L41A 4PPQA 2OV1A 1CZNA 4DMCA 5THXA 4RTMA 1EVQA 2QVBA 3T95A 1TEHA 4YUWA 4AP6A 1CR4A 2WM8A 3OF3A 4GS5A 2ZB4A 2C2OA 4O4IA 3RC9A 5EFZA 3V8NA 1PR4A 2BGGA 5AVKA 4MI6A 2R5WA 3T41A 3CF6R 3DWGA 3MFQA 4HO1X 1ODLA 3DULA 5ALSA 1KAEA 2P62A 2P6UA 4MQUA 4PG6A 4UHCA 4DHEA 1SIUA 5JASA 5LYJB 2YZMA 1JYSA 1R2QA 1V1RB 4L6AA 2WEKA 5DTJA 5EJ4A 4FOLA 4HWKA 3TSZA 1J00A 3ZNNA 3LW8A 2QT9A 4I4TF 3IBYA 2VH5R 1XHLA 2PZFA 4IINA 1Q44A 1MV5A 2MYPA 2VAVA 3KE9A 1XLVA 4O4HB 3M6IA 1L4FA 3E9QA 1QIJA 1NBWB 1T4DA 4RE5A 5DYGA 4R5MA 1OLUB 1PUXA 1GSOA 1KI6A 3GUCA 4IY1A 4QL3A 2DFPA 3O4IA 2WMDA 2IBSA 4FCVA 1F4PA 2RI6A 5FPSA 1EWTA 1IY0A 2EC5A 2QTAA 2VH2A 1UAGA 2C5EA 2PCJA 4YUYA 1GFZA 1ZN9A 2O59A 1RYEA 2OCYC 4H7HA 5GIOE 4HAVA 1MEEA 2FLKA 4KEAA 4LA4A 1PO7A 4XARA 1HG0A 5GJCA 4JVSB 3UB4A 3R5KA 5CJPA 4E1VA 4MQFB 4JP1A 4GOXA 4EPWA 2R1TB 3LX6A 5IJ0B 4J7AA 2F8MA 4BVBA 5CA0F 4GNRA 3DH0A 4LVUA 5A4DA 3AM4A 4Z2YA 5ICCA 4LGCA 5DBEX 3H42B 5K0BA 4XEUA 4CM5A 1TLTA 1TIPA 3BQNB 3DQZA 4DMLA 4Q7QA 3IDOA 1A8HA 3ZV5A 1DE0A 2QKYA 5F51A 4X97A 3PT5A 4REQB 3TD6A 1QO7A 1SJ9A 1XP5A 4LQLA 3TIVA 3ZQ6A 4Q3BA 4F6RA 5BQ3A 5ISMA 4YRFA 4ASUD 4O3MA 2W6QA 1ZM2A 4WWHA 2C3YA 2YMQA 3B3GA 3GZNA 1OBHA 3DEFA 4GQBA 3OOWA 5FF9A 3WA6A 4EJSC 1XL1A 4EY8A 2HN9A 2RC6A 3HR4A 3BX1A 3N2ZB 4GZ5A 5LDGA 2F67A 2ZSBA 4G26A 4LRYA 3QNUA 3QFCA 3ZY5A 4KLAA 1D9ZA 1KYZA 2Y6UA 4DR5B 1T10A 4M1TA 1ORIA 4OK5A 1YUNA 2XA2A 3R6DA 4MV8A 1OX4A 4G6ZA 4UBOA 5DX0A 4EA8A 1G98A 1RAGA 1TT7A 1YJBA 5JVDF 4S04A 2NOAA 4U39A 1XFDA 4WXHA 2H6EA 1UPUA 1S2NA 3RTGA 4DY6A 1XCMA 3M3DA 4DWVA 3R6LA 5HSGA 1HA3A 2DWUA 2VJNA 3RANA 2UYCA 4JJAA 1DTWB 2QAGB 1TGVA 1KEEA 4HRYA 4ARBA 4BX2A 3CKKA 1AUOA 3KVVA 2VYND 4Q1VA 4KR6A 1KU0A 1PEDA 2CVHA 4Y0AA 2Z6VA 2G0NA 1WKBA 2TRSB 2P91A 1AA6A 3SM9A 2XHZA 3P9SA 2ZUUA 3CZRA 1WKVA 4NYIQ 4S35A 1RZRA 1J8DA 4CQNA 1P9NA 2ZJBA 4AZ0B 3FSGD 3RS0A 3HWWA 3WL8A 3PC3A 1LWNA 2J9GA 3NEPX 2G67A 1NYLA 1WSWA 3ANYB 2OBYA 4LY3A 1QH1A 3AHFA 4YT5A 1YIAA 1BS2A 1NVBA 2FPOA 1I6WA 3RYIA 3QXGA 2YY5A 1Q0ZA 2JBAA 1JKJB 4CI0B 5JCOC 4UBIA 2O23A 3R41A 1FTWA 5FR2A 1ESEA 3I42A 1USIA 1FUKA 5B37A 4FE4A 3LQYA 1YZHA 5FEUA 1L5QA 5ITZB 1IZZA 1YNSA 3WLFA 5AQ1A 3DUFB 4AF7A 3IEVA 1GL7A 3A6FA 4R69A 1PKXA 2JJ8A 5NLLA 2BHSA 1UQRA 3AFIA 3SXUA 1Z56C 1SU6A 3AZQA 2HO4A 4RKFA 3T7TA 1WZUA 2G88A 3SZUA 1JP7A 2G09A 2ZS9A 1G19A 3C8HA 4U9UA 1VBFA 4PE5B 5EZ5A 4BO5A 2VTBA 1H9BA 4YRRA 1EJBA 2HDOA 2XE8A 1Y6QA 2IZ1A 4GMKA 2K4MA 3IIEA 4Y1RB 4YP9A 1KIAA 3DTVA 5B2ZA 3BILA 1X7DA 2VUTA 5TMPA 5H1YA 1XZBA 1R0SA 2OB2A 5L4LA 1DEXA 4J3NA 2I2FA 5CMLA 1H0RA 1MA3A 3NOQA 3CB4A 2PWBA 3C5HA 5FFMA 4YP7A 1BXZA 3RAGA 4C21A 1N2OA 4S1WA 5KTNA 3F3MA 2OV8A 4FQ8A 4GKVA 1W1IA 4RSHA 4JXZA 1U0SY 4Q66C 3BXXA 1Z37A 5LZ7A 1E8NA 4F11A 2VBFA 3IBSA 1H2YA 4K2HA 3NFRA 4K6KA 3HADA 4OLHA 1HO3A 1Q95A 1Y4ZA 2FQQA 2WP0A 2YIMA 3WMEA 5BSKA 1XAIA 4Q3LA 3F1LA 1G8AA 1GLVA 3U9TA 3ZS9A 1V35A 3FJ1A 4GYYA 2I4OA 3CSUA 5FLXA 2WHQA 2F7SA 2Z1DA 2FUKA 4Q3DA 4DLAA 5F64A 3W2TA 5TMBA 5JNLA 3DQPA 5AJYA 1FU4A 3U1TA 1SG9A 3UT6A 1RXEA 2QUJA 4NX2A 2HSGA 3LC7O 1OC2A 1U2ZA 2FX3A 2OE2A 2PKQO 3Q2IA 1WEHA 4WLUA 2GEDA 1UZUA 2Q9AA 4PO1A 4HAOA 4IFBA 2V5AA 2VPTA 3RS2A 3RS4A 3HSYA 1CFZA 4F2HA 3AF5A 1EU1A 3ETJA 3RSFA 1YRAA 1T4CA 4XQ9A 2NTJA 3K4QA 1X1AA 4NZPA 5YASA 4JP2A 5HX7A 4MKGA 4GZ6A 4UBMA 1Y1LA 2OHXA 3NHPA 1BKSB 2ZR9A 4O4JA 5B3JA 2X3UA 4DV1B 2JEOA 3D6VA 4K6FA 4EG6A 3VO1A 1NPDA 1S6YA 3ADOA 2XB8A 1GRVA 1I5EA 2BMDA 1WLSA 2D0PB 5EC8A 3OJXA 5EWMB 1N0VC 3TLGA 3VNSA 4AJPA 2ZSJA 2RG7A 2OHIA 2WWTA 1LWOA 1U3VA 2IHKA 1U0GA 3CZPA 4N5NA 2EKLA 1P7VA 4FGZA 4Q24A 3VBEA 4P3KA 1PTJC 3ECCA 5SICE 3PDIA 1PNRA 1BQEA 3QITA 1SURA 1FVXA 3M6AA 1PRYA 1NT2A 2P79A 1S2DA 2P4QA 4IWXA 3CF2A 3AF0A 4YQEA 5JFTA 4O4LF 1QHGA 1YJAA 3FHLA 1AUVA 2DE0X 2J67A 5EMMA 3RFXA 4NNOA 1RWWA 5G1PA 1Y8RB 3EY9A 2XVYA 2HCRA 3HY4A 3L05A 3LWNA 4OL9A 4BASA 5H83A 3N74A 2XYGA 4UEQA 1AKNA 1PDWA 1IBSA 2XYHA 4O5OA 1JTEA 2DBQA 1AK1A 2Q62A 4PU0A 4RF3A 3TXYA 1FP6A 4TYPA 4BB9A 5H3CA 4QQFA 2YYYA 1EHIA 2SNIE 3VV2A 5JXJA 2ANCA 3FBWA 5SY9A 1U3WA 3FMVA 3P2JA 4PPFA 1CX9B 2CL5A 2GFQA 3KOXA 1A4XA 1F1JA 1AK9A 3IAS6 4WKBA 4BYGA 2YJ5A 3FWYA 4QEZA 3MJRA 4FDMA 3WLSA 1XP8A 1L9XA 4ZVMA 1N2CE 3DZDA 1IHUA 4FOSA 4J2HA 5DRTA 4REOA 4TL6A 1E2PA 2ZATA 2RJOA 3EZYA 4O4IF 4Q15A 5LQDA 2QD2A 2PUBA 2VJQA 2PRZA 2DFTA 2YXPX 3IT2A 4HYEA 1RBYA 3VNVA 1GGVA 2PIAA 2IH4A 1M75A 4ENVA 5D3ZA 2BOVA 3QSGA 1V47A 4PNHA 2HU5A 4OQDA 5GWXA 1OBOA 3TNFA 4B7XA 2ZRIA 1MPXA 1OX6A 2H59A 2O4CA 1ONBA 2TMDA 1EFRA 2WA2A 1CE8A 4XJXA 4JI2B 3FKSA 4QXAA 2PJZA 4G5SA 1UBRS 1SFRA 4OSPA 4PLGA 3SXPA 2AWNA 1QIKA 2DC1A 3W3AA 4XYBA 1JFLA 4ZOLB 1I3MA 3U3DA 1KH1A 4IUYA 4XFKA 3N5CA 2NYUA 3TLMA 4BAUA 1DEKA 3FCUB 5IYZA 1X7GA 1WBDA 5DSXA 1UEXC 2Y0CA 3KKZA 1DRJA 4O02B 1R6TA 1ZGCA 4OTZA 5J59A 3GV0A 1J33A 4J7CA 4PFKA 3LPNA 3Q5EA 3U4HA 3VZBA 5K20A 1DC7A 5K8CA 4Y9DA 2MTBA 1XCOA 1HLGA 1WU8A 2IPLA 5K3FB 3W4IA 4BMZA 5EUQB 4TWJA 5GZ1A 3DVSX 1W35A 2DTDA 5I5EA 1ZM9A 4A8PA 1DIOB 1QOZA 1U5CA 5T8KA 5KSWB 1SB8A 3TGLA 1PP4A 2IHTA 2VJPA 3VR6H 5JPCA 2R6HA 1EP1B 1EZ1A 1ULBA 2HSZA 4V24A 5KEIA 4CGZA 1RXSA 1PWYE 1GA1A 3VV3A 3W5AA 2VJDA 1GPWB 3HJTA 2YOGA 1D8TA 4ALIA 3CF4G 2BSXA 3DMNA 2CJFA 1A4RA 1H2HA 1Y3HA 2HCJB 2W2PA 1MHPA 3MD9A 4C0BA 4CGYA 4IV0A 1U98A 3KJHA 1N5LA 3LPLA 4FI3C 1B16A 3EZ9A 1SXIA 4PSDA 6NULA 2DBZA 3L7BA 2ZSAA 2D7DA 3EEBA 3H11A 3NCHA 2NXEA 2PWZA 4OSOA 4MWBA 4LDJA 3RKSA 1Q1ZA 2O0HA 3WRYA 3IQZA 5EL0A 4JP3A 4LXIA 4RK4A 3I05A 5KQMA 2AOTA 4HDCA 1T26A 2P41A 3AVQA 5ALNA 5DTMA 1EXDA 1JE1A 2A7XA 2ZAMA 3O4VA 1KI6B 1BKDR 2NT4A 5D2CA 5B3LA 1TJPB 2GM5A 4CNQA 5LQNA 2ZPTX 1BOOA 1Q16A 1O8CA 2X13A 1YFJA 3BJZA 2CNNA 2XEXA 4Q4JA 5FBQB 5AYVA 2DZDA 3AV3A 2X15A 2J3KA 3CU5A 3D6AA 1VL2A 4M8NE 5SYMA 2M6LA 5K03A 3GT3A 4M76B 4DA0A 2PKXA 5JAMA 3QBVA 1O9BA 2FMXA 1HLFA 1NBHA 2ZJ1A 5KOIA 4H31A 3CVOA 1U3UA 1P29A 3A9RA 3NTUA 4H3HB 5HK9A 2YRXA 1PQWA 3FR7A 3FRHA 3AUSA 4LDNA 3EISA 5F2KA 1JPUA 2V9PA 4D0LB 2C20A 5HP4A 1MQ8B 3GPDG 3OAAA 1MOPA 1ZRHA 4FI3F 1Z6PA 3KAQA 1QP8A 4MARA 1CNMA 4BO4A 2I7CA 2INGX 2IEZA 4EMUA 3AY7A 4V1CA 2H9IA 5CCBA 2BI8A 2YZKA 3DWEX 1DGQA 2PJDA 4F6RB 2BGKA 3RVNA 1X8JA 1J56A 4K26A 5EJ2A 4YRMA 4QELA 1ZJ6A 2W6ID 5J4YA 3RBXA 3KSRA 5KNBD 4CW7A 4EGSA 1TUBB 3GZNB 5JT1A 1AQJA 4OXIA 4IRUB 2CZQA 3IHKA 4POAA 2ZFUA 4P0QB 1D03A 4HXEB 4DJJA 3O6VA 1YS1X 1UBEA 4RVFA 5DSTA 1T6BY 5KUTA 5IX8A 4QIHA 3ZE6A 1ZA2A 1A9ZA 2IBMA 1OX4B 5IAAA 4GOKA 2VXOA 4JLWA 3W05A 3ED5A 2VDOB 1N1MA 3EVBA 2QTLA 3FMIA 3GLGE 1CRZA 3KZ1E 3RC2A 4ZI3A 1Q0QA 1U81A 3DKPA 3GNSA 4XB1A 5EVJA 5IM5A 1HDIA 2IEYA 1JA9A 2Y2VA 1KEEB 1K2VN 2ZIEA 2IYNA 2OR3A 3OM0A 5A7HA 3TFWA 3ISVA 1IN6A 3QM1A 4ECAA 2ODPA 2EKPA 2GAIA 4N4AA 3GLUA 1AY0A 1OGIA 3ECSA 4IKOA 4OBBA 4R9NA 4H17A 1P4HA 4ZYZA 5F23A 2WIFA 5CW1A 4D8YA 3HKBA 1FDWA 2FR8C 4LWQA 3LGAA 4Z4EA 2YN2A 1NLYA 1QH1B 1VJ0A 2ZVDA 3IP6A 3RYIB 4BV3A 1TCUA 1W0JD 2NU6A 2JBAB 1T0JB 1YR1A 2YWXA 3IVRA 4G5OA 3FCAA 1JXQA 4HNAA 2JGKA 3AIKA 3NC4A 4BO6A 1XJ5A 4M8SA 3VPXA 4ZDIA 3G9QA 3EIOA 4ZRNA 3SSOA 4MW0A 4S1VA 3VR4D 1DRWA 2ZJ5A 1OIWA 5A3JA 2V65A 2XCIA 3T15A 3DM5A 3W9YA 2BZ1A 5I9LA 3KKKA 3JSXA 4Z7QB 2I4LA 1KI2A 2VQ3A 1XTSA 3SXUB 4CLXA 3O93A 4AS3A 5FI3A 3T1OA 2ZM5A 3JYOA 4J16C 3ROFA 4AD8A 4DLXA 1AZTA 3N76A 1R9MA 1U9IA 4MKZA 1SOVA 1E18A 1S9DA 2DRIA 1HFEL 3UJNA 1UJCA 3EPPA 2R7LA 4JJ7A 3CLHA 3QE4A 4QDOA 3DTVB 2HLPA 4KE7A 3HJFA 1HYHA 4TX1A 3MCTA 1MGPA 2ECQA 3QEOA 4AI6A 3JD1A 2GF0A 2PXHA 3JQCA 1JR3A 3DDWA 2BR4A 4NATA 1Q20A 1CHDA 1NOIA 3QF4A 3CX3A 2FZ4A 3LDGA 5EJAA 3ODPA 1TB4A 3RS7A 1PJAA 4WW0A 2XD4A 4B17A 1XNHA 3ZZ0A 1OXVA 1HL3A 5I45A 4W7HA 1D3AA 2VHUA 3FZYA 4TLLB 3KOZA 3AOEA 4ML3A 2I1LA 3DE6X 2JVIA 3AEKA 5DK6A 3ZWOA 4E11A 1T3GA 2QL5A 3MNFA 3TVDA 1FXSA 2VPIA 4TTIA 1GNPA 3UICA 1PT8A 2OBFA 2VCEA 2OQVA 1PJ3A 3A10A 1YZNA 3RKRA 1YCDA 3PC4A 4KPUB 1KMQA 4ZGGA 4L6CA 4FBLA 5TQVA 4NBWA 3IAAA 2ATCA 3AM1A 5EAIA 2WD8A 4D4MA 3WY9A 3PXBA 5BMOA 5IU6A 4KYVA 4FYXA 1A1SA 2H17A 1K7XB 3FOBA 2WFZA 4OB6A 4AO8A 1Y5NA 3H16A 9LDBA 2I6XA 3P9XA 1OXUA 4F9EA 1PT7A 1H8HA 4BFXA 3D3JA 1C8LA 5CEEA 4DA4A 3AIMA 3GDGA 1FQKA 4I2VA 3I8SA 4O4JB 1G41A 1ZMXA 2N42A 1NP3A 3GJ3A 1P0MA 4H08A 3HP1A 3KYJB 2WB4A 4PBTA 2IY7A 5CIWA 3TLGB 3V7NA 3WZMA 3LVFO 4D98A 1HETA 3RODA 3GG2A 2QAJA 1JRLA 2XYRA 4JLUA 4I55F 4I1YA 4X85A 3H2BA 3N8HA 3H5TA 1ULAA 3PFWO 3GQVA 5ALEA 2VNKA 2VNJA 3I2YX 3PDIB 1YRHA 3SHWA 5JWRA 4A82A 2IUYA 2PD4A 1H5UA 4HFMA 2PGAA 2PX4A 4QYWA 3QQPA 1OFHA 1SKYE 2RCYA 4D44A 4IZOA 3K0CC 1QFSA 1MJHA 3O1JC 3G6WA 3ZTTA 3CJQA 1GTG1 3COZA 5EJ5A 3A1EA 5F73A 5MHTA 2XNCA 3PLAE 1RKUA 4OQNA 1NN1A 3AP3A 4JBNA 2C07A 1FNBA 2JA2A 1B6GA 2FY8A 3TQFA 5IYZF 4QXRA 3ZCXA 2EZ8A 3HDQA 1Z45A 4LZJA 3F1KA 1CJVC 1MJGA 1PZHA 1UM8A 4Q47A 3TQIA 3W34A 2QD5A 5FNVA 5H0IA 3ZBPA 1SY7A 2IEBA 2PYIA 1BZYA 2VDRB 1YCHA 4KKVA 3ADBA 1U0HC 3WIDA 3OOSA 3EXAA 4Z1OA 5I4CA 1MB9A 4DBZA 3K9FC 1CEEA 2GZHA 1XTTA 3ANSA 4L57A 2J5RA 5JZVA 2VSFA 3ZI4A 4L3VA 3VHRA 4GLFA 3IEXA 1SVWA 5I7UA 2Q28A 4KUEA 4W8GA 2P9YA 4JB8A 4MW6A 3VTKA 1ZNWA 4KGZA 1MFZA 1GU1A 3R2JA 3A4IA 4JLVA 2M32A 1NW6A 1XU9A 4I9UA 2EHDA 1QWOA 3QVJA 3C6BA 4I14A 4HVAA 2ERCA 3ZWXA 4K40A 1LBTA 3GMTA 3K96A 3MJHA 3OJFA 1H3NA 3NLLA 4C3VA 2BWJA 3CXRA 3L4BC 1CE8B 1CRWG 4UBKA 3WG9A 4BC0A 4CIBA 1AUXA 1L5MA 4FYWA 4P98A 1WVGA 1VSQA 1JN0A 1XEFA 3HCNA 3TQRA 4FXPA 1SD5A 5IMBA 5A02A 3GLFA 5GP1A 4XVCA 4CT4B 1ZGJA 2YYAA 4HNGA 2GO1A 4TS9A 1ZEMA 1UPFA 1W36B 5TVGA 3HG7A 1ZY2A 1A50B 1OZ0A 1IWBB 1NW3A 4WIAA 1E5XA 3S5JA 5LL6P 4RTKA 4G8JA 2BFBA 4GOOD 4ITVA 1UADA 2H4ZA 1Q7TA 2ZYIA 4L9SA 5CLQA 4M0LA 4NBVA 5AM4A 3RDPA 5F3WB 1DBQA 3VI3B 1NLMA 5IH3A 2O1XA 2BY4A 3QLTA 1VL8A 2Q21A 4CTKA 3TLXA 5CDUA 3HMKA 5J1TB 1IMJA 2DFKB 2ZVPX 3UWMA 3ES9A 4GGPA 2JD1A 4A91A 3M6LA 4WASA 3EE6A 1X1RA 3DBLA 3R9KA 3IUEA 5AOAA 1DSSG 1EA7A 2F2TA 3HABA 3OWXA 3I2JA 4WT7A 5TVKA 3WDMA 2F4VB 5L7TA 1I0IA 3SGLA 1HLPA 5L40A 3AU8A 4GX5A 2KLHA 2XNDD 3BTSA 4FKMA 1XDGA 1GPBA 3UXMA 2BONA 1G6HA 3BF7A 1A72A 1ZOOA 2X8BA 1QM5A 4JBHA 4P7GA 4YMHA 5KVSA 2BFOA 4JJ6A 1RLTA 1KJIA 1DUIA 2AOTB 1IM8A 2O3RA 1R6UA 1QVAA 2YWJA 4BHTA 4FMDF 4JUBA 1KAQA 1OLSB 3JVIA 2IYQA 3T3MB 1K6IA 3BC1A 3DG9A 3CN7A 2FDXA 4G9GA 4I08A 1RQNA 1Z38A 4N0EA 3A31A 2ZTMA 4Q4JB 3WYBA 4W5RA 3QEKA 1SBYA 4A5SA 1G3QA 3SQMA 1ZESA 4GC9A 3S2EA 1SXQA 3ZLJA 5JQGA 2BGJA 4C0AC 2X0NA 4AU1A 4YLGA 5ED4A 2BBWA 1DXOA 4FBMA 3WL4A 4B7ZA 3MTJA 2JAXA 4AP9A 3GX1A 2GTPA 4HQ0A 2EG5A 4I4LA 1E4OA 1YE8A 2GH1A 1PX0A 3C4VA 3P19A 3QOFA 4WJKB 4AN1A 3LZDA 3SZRA 2YHUA 1Z68A 3COJA 4DFDA 3UK6A 1A2BA 1NXTA 2QRQA 4UEWA 3WWPA 2GBIA 2AF4C 1YWGO 2AEJA 3G0OA 4BKMA 3JQEA 5J4VA 5LP1A 2VEOA 4WRRA 2GBCA 3UCFA 1PR3A 1T2AA 4HLUC 5EXSA 16PKA 2HY7A 4FFSA 1OVMA 2NGRA 3VDMA 1CQPA 2A78A 4FQ5A 4RGQA 1EIWA 2YZGA 1M2FA 2CLKB 1O6ZA 4PIMA 3PC7A 1FTYA 1Z5UA 5CLLA 3HKDA 2I8LA 1IPFA 1KGDA 3QNWA 4K8OA 3ETNA 3ZDAA 4U7DA 5I4IA 2W98A 4MV3A 1GUZA 3O9VA 3T7DA 1TLFA 5K01A 3V5NA 1W8IA 1GKUB 3EXEA 5A0FA 1RQXA 2FPLA 4OYHA 4FYVA 3G6KA 3PK0A 2J0QA 4ZZIA 3BHMA 5LZ5A 1XMQB 3O5AA 5DGIA 3W6NA 1ML3A 5BY2A 3KZMA 1JB1A 3L6EA 2B5VA 1ISIA 1ZCZA 2CGEA 3E3MA 2W7TA 3X1YA 4D4HA 5DNEA 1L5OA 4OKIA 2F3TA 4URHA 2WF6A 2Q1TA 3EZ6A 4IXMA 4J3FA 1HX7A 1T2UA 1WAMA 4EHIA 2EYQA 2JHFA 2X76A 4YR9A 3WBKA 1J0DA 1D07A 2LVBA 3DMRA 2ADFA 3TBHA 4R05A 1J8YF 4Z9AA 1YZQA 1R3DA 1NRJB 1QG4A 5AW6A 5CG1A 1FFXA 3QTTA 3NRJA 1M66A 4FFDA 3T7IA 2LNDA 2NU6B 3EB9A 5FWAA 4BWGA 3WK6A 3TGPA 4MCAA 4HNAB 2AUMA 3D7SA 4LYAA 3EGEA 4RVSA 3SOZA 1JTVA 1QKKA 4DR4B 2A9JA 4GX1A 2GS9A 2R8BA 1KK2A 3IJRA 4FP9A 3GVCA 3EPJA 5AKZA 3ZW9A 3ROEA 3L2OB 4OREX 2PGLA 3V9PA 4P6VF 2FPUA 4N40A 5KWVA 1W5BA 5A7GA 4DIEA 1X7XA 5TARA 3ZXIA 2IY8A 4PO8A 1Q14A 3VM6A 4C0KA 3BRQA 1GQRA 3E8MA 5AM5A 1C7IA 1X6VA 1GG9A 2EJBA 3CIFA 1DT5A 2AVNA 2FFAA 3MK31 3MS7A 2D0DA 2XGGA 3VZQA 3ZBUA 4Z7JA 2QNRA 1OWPA 5HZMA 1EKXA 5E1MA 3EPKA 5C8XA 2ABWA 1Z8NA 2D0OB 1KMCA 5K4GA 1JQEA 1NU6A 1PGNA 1I4TD 3MWKA 4I46A 1I3OA 5CDSA 2JK0A 1P7PA 3QF4B 1KAGA 3VR3A 4F2WA 1P9OA 3TL6A 1JDJA 5FD8A 1BJTA 1NVKA 3QU9A 4URYR 3X2SA 5JE8A 3W6OA 4EATA 2WHRA 2X6RA 3CBGA 3MJFA 3OJWA 4QGGA 5BYJA 3UEOA 1AKMA 3VOTA 5EXEA 1DG3A 2FHSA 3H6KA 2DR0A 3HNOA 2HLDA 3IB3A 4GGMX 2GJ9A 1W4RA 1KJZA 3BICA 1X86B 3ONDA 3BMQA 2Q5JA 3TDMA 2YXDA 2W71A 2I33A 4F9GA 3S8YA 1PJCA 4RA6A 1G4UR 1Y1SA 1J90A 1RMQA 2PQ0A 2ZRDA 1VBKA 3AIOA 2HIHA 4CUJA 2OP1A 5AI9A 3GRYA 1O95D 2VWPA 1DBVO 1U2DA 2HRZA 2HMTA 2OAQ1 3QU4A 4BEBA 1T1JA 1E62A 1Z88A 2F9FA 1R0WA 2V7BA 1QH9A 5LZ2A 2MSWA 1MOZA 3HDTA 3L82B 5KS2A 2QM0A 1GGMA 2FWIA 4CDGA 1VBMA 1SUFA 4UAVA 4IZIA 4PTZA 3UBMA 3ZD9A 5FBKA 4OBEA 1UMDB 1C1DA 1TYBE 1X80A 4EOGA 5FADA 3UT0A 4CM9D 1E3JA 1AV6A 1MTOA 1ECPA 1QIEA 2HSDA 2M1XA 3DEKA 2YL2A 3JQDA 1Q6YA 3MCWA 3Q5GA 4YJDA 4ANFA 4BECA 2CYAA 1QS0A 3H65A 4AN0A 1ACLA 4REQA 1XZNA 2JFWA 4P53A 1NA5A 4AKSA 5I6DA 1GHTA 5GVSA 1V1MA 1D2AA 1HT0A 2QEQA 1J0EA 4EYGA 1COWD 1R4MA 1WF6A 4KQEA 3C5CA 5JCXA 1Z2AA 1DQNA 3IUBA 5HCIA 4LJLA 4QFMA 1RWXA 1U0EA 1YB5A 1YZFA 2H57A 2SBTA 1CUIA 3CG0A 3CCCA 3CRVA 2E9SA 1XRLA 1EDDA 3JZIA 2G07A 4LSZA 3TEFA 4KREA 2D5IA 1NBAA 5HG0A 5B6JA 3QPBA 2GCIA 4LYJA 2F8TA 3I23A 4OM8A 2HF7A 3OX1A 3IAFA 1JDSA 1XHEA 4KAXA 5IZCC 4DUYB 2FW8A 3B9BA 2H2HA 4JBYA 3SR0A 2QX6A 4E1AA 1F3OA 2WM2A 3BAZA 3K20A 4A6PA 2VUUA 1DDGA 1RYMA 1SBIA 1W52X 2BM9A 2WF5A 2KQUA 3PYXA 2WQ7A 3KWLA 4TKMA 5BUSA 5FOSA 3DMPA 2OO7A 2HRQA 4WNAA 5B1HA 4WZAA 1EJ6A 4D02A 2Y1LA 3PPYA 3K15A 4TLCA 5AP9A 5FNVB 1HYQA 1I0LA 4OXRA 3G8DA 4Y9UA 2NUAB 1FMFA 3G2MA 4XDYA 3V9AA 5JY1A 3WLIA 3UV6A 3MB8A 3V46A 3I64A 1V8PA 3SF8A 3FN4A 1G3IA 1Z47A 3QFFA 2Y0EA 4HGYA 1RZUA 1JA0A 3C1AA 2H0QA 1E0KA 2OHGA 4KV9A 2I0FA 1ZJJA 2C98A 2VZ8A 3L7CA 1JQ5A 3Q2OA 521PA 3BIWA 1QXSA 1FX1A 2FPGA 1J4AA 4CQJA 4IMRA 1JAXA 1RI4A 2NWQA 5M04A 2GPYA 3DDNA 1X1CA 3DM9B 4YVFA 5C5DA 1I14A 3PE6A 1BE0A 5CNKA 1YB2A 3D8NA 4PCAA 5ICEA 2R47A 3ZJVA 4Z0HO 2YJNA 2FMFA 1BMQA 4LXQA 5CGQB 4LJYA 2GBLA 2ORED 4C1BA 2XB9A 3BJEA 4GLJA 4M3NA 4Z99A 1JSRA 4C2BA 5I51A 3GLFB 2QLBA 3ORYA 4R40A 1J0BA 4A6EA 4A6DA 3LIPA 1KK1A 2QPTA 3AFHA 3LF2A 2QA5A 1G64A 4R7GA 1Z5GA 3G89A 3NRCA 2N0SA 3JPYA 1H1TA 4F60A 5FAXA 1HXHA 1VSTA 2YXNA 5AK0A 2A7QA 4MEJA 1L5KA 1ST2A 3TR5A 4B09A 2R66A 4DMKA 3NTQA 4H4DA 1DJNA 5C8YB 1UZNA 4IFTA 4K1LA 1V8DA 1E3WA 3I8XA 4DB2A 2B30A 2B8TA 3PBKA 2C4TA 2VSNA 3B60A 3Q9SA 4R7TA 1K88A 2RE8A 2A9KA 4NYJQ 1QV6A 3D54D 5AM0A 5HA5A 3LY7A 2HK7A 1U5AA 1NG1A 2F1HA 3OUUA 1Y9JA 5K6RA 3GZTB 1SHJA 5CU7A 3EQ7A 4J9UE 2EXXA 3UKOA 1CJKC 5KOHA 3DBLB 4EA6A 6ADHA 1TCVA 4Y9TA 4UPDA 1LPOA 1DQRA 2GVDC 2H29A 2ZYSA 3VVLA 3MBKA 2D1RA 1VB5A 1U6JA 2HL6A 1T5BA 4S1NA 1XVLA 2X42A 1IBRA 3TM5A 1E1RD 1UQTA 2D7CA 4EUFA 1VL0A 2GQ0A 2R60A 2H5EA 4A15A 1Z5VA 2ODBA 4JUFA 4ZO7A 5ALDA 3SQWA 1KMIY 2WWVD 3OZEA 4IDPA 2HREA 3DO5A 1UMCA 1S96A 1ZNQO 5EJMA 4EABA 1K06A 1MTZA 2IEIA 1JPNA 2VT6A 4UZFA 3TN7A 2VVTA 4A8JA 4EAQA 2J5QA 2VC2B 1W30A 3KU1A 3QJYA 4PYQA 4FW8A 1U31A 1JS1X 1QYIA 3WMRA 5KI6A 3E6AA 4J91A 2C5SA 3ITEA 1IATA 5JQGB 1CY8A 1S4QA 4WGFA 1DARA 4N18A 4YAWA 4WOJA 2PXCA 2E18A 4ENQA 2ZDGA 3TG2A 1SXHA 1XVAA 3AL2A 4ONEA 4E2FA 2EQBA 3IHWA 2OHHA 2QP4A 3T9EA 4B3XA 5HKKA 1P1JA 2G80A 2I66A 1UFQA 3C48A 4FYJA 4YNBA 4EJ2A 1N5DA 4HDQB 5HMLA 5JNUA 5M2QA 3VZSA 3DW3X 3BL8A 3ZXSA 2D5BA 1X8LA 3P9IA 1AHNA 2HRBA 4DA6A 2BHTA 4ZZ0A 1AMUA 5ILOA 5KWIA 3ZVNA 1RM5A 4CKCA 2K2WA 1M7BA 2QIOA 4WLOA 4UE2A 5L4SA 4ZDKA 1PG2A 2YHBA 3N8GA 5CXQA 4AZVA 1E9EA 4FGLA 2Q5IA 2B8WA 4G23A 4G4GA 5C34B 1A1VA 4E7PA 3PDUA 3H5RA 1AC5A 2XQFA 2C57A 5ALZA 3QLUC 5LUAA 4L85A 3MQ2A 2AN9A 5F4ZA 5HIKA 4P7JA 1E0SA 4NCKA 2MINB 4OSEA 3HKDB 5AI5A 1BQ3A 2O3UA 3ACCA 3BXPA 3K8YA 2BFPA 3ICCA 1TF2A 1I1QB 3OSUA 4TXJA 4UQOA 3RAPR 5BWBA 1T4MA 1EP2B 1YK0A 4FIDA 3NTLA 1MEOA 4RGVA 5CK5A 3I9LA 4IIYA 3GT0A 4QDXA 2I7DA 2XUZA 3WKDA 1BIFA 4Z4HA 3EXEB 1HDYA 3I5XA 5CH3A 1QV9A 1E9SA 4GP9A 2F9LA 3ZWDA 2XT6A 4F9FA 1WEKA 2C8LA 5KC8A 4IJMA 2J85A 5E9WA 1ZGHA 5JSQA 4N0DA 2BFCB 4EKIA 2HQRA 1Y1RA 4KNYA 4HAWA 2A9OA 3AW9A 2IHJA 3BRWA 1G17A 3K8QA 4ZD6A 1T0HB 4RY0A 5KX5F 5DLPA 4RFLA 3F8SA 3HA2A 4EFKA 1TTTA 1YNOA 2RBKA 2BP7A 2GKOA 4RPLA 3VDNB 3DCNA 4RK1A 2QJOA 4ND3A 3JAMA 1H2AS 1GPYA 2G76A 2JI6A 3A9CA 1OV6A 2Q3HA 2AS0A 3JYHA 1G6KA 1KAOA 4ZAVA 1TI7A 221PA 1EIZA 6ABPA 3TR0A 1EDOA 4B6PA 4I6EA 1AKEA 4BPBA 1QNFA 3CT4A 5AJUA 5JYDA 3AI3A 4IS2A 5AJXA 2YQ4A 1RJDA 4DEXA 4EHFA 4WK4B 3V7WA 2I78A 4YQFA 4GBJA 4ALMA 1EJ2A 1PE0A 2A1IA 3HVJA 4QE3A 1W5TA 3R5TA 1E69A 2AFVA 2O2EA 4LZNA 4I50F 1UAYA 1X7XB 3DOOA 1UT6A 3CLSD 5ELLA 1V3UA 1XNQB 3O2JA 1UC9A 2APJA 2XNJA 1R6BX 3ICVA 5DPMA 3GG9A 4O2AF 2PD3A 4XLZA 3IL2A 1CS4C 3AR3A 4FD3A 3WB9A 1DPFA 1JFTA 3S3TA 1CJCA 2BMAA 3BL5A 3F2VA 3JQAA 3L43A 1RWVA 3C1OA 3HP4A 4JI5B 3L1HA 2N75A 2Q1WA 4EIWA 1GPH1 3C3XA 4RPCA 3R0IA 4MVWA 4EGQA 2BM1A 1XMVA 3I5MA 4M21A 3ZV4A 5LLDA 4OAOA 2JFUA 5DW0A 1O5OA 5ABPA 4JLJA 4HGQA 4ZVOA 3HGTA 1L1EA 2EBHX 4WZZA 3TFQA 4G85A 3TQHA 2JW5A 2ZJ4A 1O1YA 4LTMA 3Q98A 4CM7A 5KYUA 4IWYA 1RLIA 3H4MA 4XJSA 3MN1A 3JD3A 1QRSA 3BMQB 4N5IX 3STUA 1AKVA 3HO8A 1XVVA 2N1MA 2IVFA 5D1NA 3WRWA 2WK1A 4RA6B 2AKEA 2COKA 3C6XA 3LCRA 3T1NA 1T8TA 4NG5A 1EMDA 2HFKA 3WZ2A 3FYTA 1PFKA 4MW7A 4BN4A 4ACAA 1OXSC 4R2IA 3MD0A 3BH7A 2DCUA 2ZSFA 4HLNA 1GARA 4NEQA 3ROPA 5JATA 3OZFA 1EWVA 4MVXA 1I51A 1UC8A 2IU4A 3NAQA 4K8RB 4LNHA 1QP7A 4JS0A 4C14A 2A3RA 1XI2A 1YB6A 4DTIA 4ISBA 1JHXA 3VQTA 4UQPA 1X80B 1C1DB 1P2UA 1Z4KA 4FKZA 2JFNA 1AN9A 3E61A 3NH6A 4OLFA 3RNOA 1OILA 1XKLA 5L95A 3GGJA 1MBZA 2EWWA 1N0UA 3WGJA 1I7PA 4KX5A 4AUMA 5JZOA 1RKBA 1QS0B 1DKQA 1RWQA 2WFAA 5JIBA 1DOZA 1PG0A 2PZAA 4HG2A 4F4DA 1V1MB 1SKAA 1P61B 4JR2A 1JWLA 1JG1A 3PL5A 1R4MB 2XOXA 3ML1A 1C9MA 2UKDA 2XGMA 1V9SA 4AROA 1E1KA 2QE6A 1GITA 2QPAA 2BBTA 2H3EA 1F2VA 4J94A 1ZD2P 4GR4A 3U5TA 2D2FA 3UK2A 2YV2A 5HKLA 3KP1A 3U7QA 1NC3A 1P44A 4YAIA 2UZIR 3E7FA 3NHUA 3GLRA 2LE0A 5T7BA 3U44A 2JCGA 1QANA 5A7FA 1LDEA 1HKUA 2A0YA 2VP6A 3EVEA 2IYLD 2B9EA 4GPD1 4BTEA 1HT3A 2R751 1SCJA 4U6NA 5F33A 1C7QA 3UT5A 4FDVA 1LC0A 1KZ4A 2HPZA 3W78A 2CXQA 1JFFB 3E53A 3A6GA 3HE3A 1H1DA 3OPYI 3Q5DA 3HR7A 3UHFA 4DBLE 2EYUA 1SWVA 1BDJA 1NAIA 2I6FA 4GKJB 3TKAA 2JZCA 4WNAB 3OJEA 4WZAB 1PD1A 3QU7A 1JECA 3BYZA 4ZOQI 2VYCA 1NASA 1TKAA 2IYOA 4R6WA 1NZDA 5BMVF 2FSVC 3GRCA 3ZJ5A 3NV7A 4RSMA 4MW4A 1O8BA 3NJ8A 1PK8A 4HQOA 4ZDWA 3V2UA 4EFMA 1G16A 3SF8B 3EEIA 1PD0A 2ZJYA 4RACA 3VKVA 4D9MA 4MW1A 1Z0IA 3VYRB 3E58A 3HRIA 3QKRA 3UB3A 1ACJA 1NXSA 1LZKA 1F6BA 4ZYVA 1IY8A 4PQGA 1V5GA 3L8YA 1SVIA 3OTIA 3C3BA 4BMXA 1L5YA 2QK4A 3VMFA 4E5MA 4B40A 3HJHA 2FPGB 1EQAA 4TQUS 1M7HA 4W1RA 2AEEA 5BT8A 3U19A 1Q1AA 8MHTA 2QRHA 1MJFA 3LXXA 1WU7A 1K0UA 5AHRA 4MUXA 1HSZA 3DL4A 3N70A 3OQIA 4LFBB 5LDDC 4LJ9A 1GUBA 4KC0A 1FVHA 3GVHA 3MT8A 4RY8A 1GZ4A 1YI1A 2NO9A 1CUDA 1XZLA 1Z5NA 3UVEA 4CM6A 1KJNA 4ALJA 1SQFA 3ANXA 3VZPA 5UKDA 3W90A 2QBYA 3FJOA 3R6GA 2BGRA 2QRNA 3IE0A 4NI5A 2PUFA 1YVUA 5T6BA 5KPDA 5JBQA 5LOVA 3UJ7A 4FSDA 5FWDA 5C1DA 5I4BA 3SPXA 1YS9A 1YE3A 1D5WA 4O5AA 3VPGA 3LQRA 4Z4IA 3W7VA 2VPZA 2Q6KA 4IICA 3OMXA 2H1IA 3F6EX 5E7JA 3WK8A 1NNSA 2R84A 1E3WB 4ICIA 4PR0A 2Q3BA 2YWBA 4B34A 1XJWA 1VLMA 1ELOA 1GYRA 4ARCA 2JFBA 3ZW7A 3GRFA 4G5FA 4M9XA 2OXIA 2GD0A 1VI2A 3O7WA 1QHXA 4UAGA 4DWWA 3W2HA 3GFVA 2D6FA 2YFYA 3FPHA 2W90A 4B9AA 3CUEF 3D7NA 3PHIA 4AJOA 1VPWA 1PVOA 4I0WB 2O2JA 5TT0A 1EX7A 4HH3C 4PO9A 2I6QA 3B12A 1GP2A 1VIYA 2VEDA 2Y4OA 2OZPA 2DFNA 3FI9A 3OO0A 4R41A 2WJAA 5KJFA 3NWPA 3DFIA 1PIWA 3T1TA 1AXRA 1GV0A 1PKEA 2PMKA 3SMQA 3U3MA 5SV2A 2KB0A 3PVCA 5ANRB 1IQRA 1Z6QA 5FLKA 4XX0A 2KBFA 2XY4A 3ZHQA 5BN5A 1I2MA 3P2MA 3U39A 2C2GA 1JYEA 2HR1A 2B1RA 4BVHA 4J0DA 5KNDA 4EAAA 2NMVA 1NR7A 1SZDA 4Q9IA 5EJGA 2VFAA 2FEOA 4J03A 2XE6A 3PLRA 3P4UA 2IYYA 2ZJ8A 3P45A 4I1PA 4FFRA 2V45A 2ZUFA 4G0WA 1KC1A 2F55A 4C0WA 2WNSA 4Y6LA 1KVSA 4B3RB 4E5DA 4RCVA 4YRGA 1ML4A 1N6OA 2G8LA 3MTIA 4ZJZA 5AIBA 1G0NA 3I6ZA 4A8JB 1DCFA 4F3RA 3NIBA 4UOZA 1GSHA 2A57A 1VRCA 3PUWA 3BK7A 4MCIA 5CLFA 1N0IA 4G5HA 1T5LA 3ESAA 1G55A 3KJFA 4AO7A 2IXBA 1I3KA 4N7JA 4LSGA 1JIIA 3TIGA 1VRWA 1QUFA 3TTWA 4ER0A 4Z8YA 3PEFA 1YO6A 4KLZA 4MGYR 4NYIR 4U63A 1CP3A 1L4NA 1VE1A 4FMPA 2P11A 5K45A 3U56A 3DL0A 5F77A 4MUJA 3U9LA 1LI7A 1XCJA 4IOKA 1C4OA 4JR1A 4N8SA 3IA2A 2Q4DA 1Z6XA 1F5SA 3VC1A 3TRKA 3WLJA 4QBTA 3PNPA 2PJRA 3OTOB 2OCPA 5J23A 4QJ5A 1RRMA 1YQWA 3DT8A 4X9XA 3L0DA 2FRDC 2V6JA 4IVQA 2HOQA 4CKCB 3EARA 1TT5A 1U2PA 2WTAA 4OXQA 2ZIUB 5HKBA 1WDLA 4B3TB 3EQZA 1IXYA 4F4IA 3GJ8A 1CYEA 3HDYA 3L6CA 3DUWA 1KP2A 2FWRA 1JQ3A 1VE7A 3HJGA 2CW5A 2PGNA 2M98A 2AKYA 1H2WA 1QRUA 3NGMA 5MFZA 1OWLA 2YOFA 4W1QA 3R3SA 2XLCA 3D3EA 2HPAA 3M82A 3VKUA 1M8JA 1JPJA 2BR5A 1M8PA 2XSZA 4C5AA 3M6MD 4E88A 4JBWA 2CJWA 3HXOA 2UYQA 3UTDA 1TF7A 3F49S 3E5RA 3O26A 5LQCA 3R7WB 2OB1A 4NJMB 1PBTA 1Z35A 1C7RA 2JL1A 4Q01A 5CURA 4IIVA 1IEQA 2NNLD 1RXCA 3AQ4A 2JHAA 5BSHA 1USKA 2OKCA 1C9NA 4D3XA 4ZZ3A 4XCQA 5K3BA 1JEQA 2E0IA 1K5GA 1HC7A 2PEZA 3INRA 4EB6A 1E4EA 3MHPA 1UBTS 5TMEA 3RK4A 2PL1A 2PL5A 1UK8A 1ADJA 1YZ3A 2HF2A 1E79A 4IGKA 2BP7B 1RWMA 4DAEA 4RQTA 2CXSA 1OGYA 1Z0UA 2P0EA 1XGKA 3GWGA 5IAJA 3JWIA 1U04A 3I2KA 3EQ8A 3CISA 1MFPA 2QGFA 2G3YA 4DTCA 3M34A 1FFBA 3NM5A 2X5JO 2RD2A 3L6BA 4BNFA 1K98A 4GICA 2RH9B 3I01A 3JZMA 3A1TA 1MV8A 1ORHA 2ZJFA 1AQNA 1RLUA 5A6SA 2X9LA 3KUUA 3DW1X 2OCLA 4OAPA 3GB9A 5G1OA 4BDSA 1PW7A 4ZPXA 2EJUA 2QMEA 2PX3A 3L7LA 4JASB 2RCNA 3RRNA 2HQOA 2QTHA 2WYVA 4MUYA 4B44A 1ZKDA 1IUKA 2DQSA 3QY0A 1T13A 3PRJA 3K70D 3ACBA 4GRAA 3MTEA 5DKFA 4B8ZA 3B78A 1NUQA 3C8DA 3NBZC 4HFNA 5K8UA 4EKNB 2O3SA 3JQAB 1TAHA 4FYMA 3C16C 5E6RA 2FNAA 1DAOA 3JPWA 6AT1A 1GYPA 1G8FA 3KAKA 4NV1A 3ZUPA 3EDOA 1D9XA 3AV0B 2CV2A 4JWTA 4CMBA 4H4CA 4G1FA 5LKRA 1IDN1 2JFZA 3BGSA 1U8FO 1P6UA 3OFKA 1PFYA 4KQ6A 3UUFA 4DIBA 3IELA 4ITRC 3V2IA 2AJLI 2ZPAA 3V1TC 1H94A 2KBEA 4JI8B 4P35A 3W1VA 4C87A 4QO7A 3OU6A 3BXEA 3JVDA 5EMHA 5P21A 1ZUIA 3AG5A 4EARA 4YAUA 5LP6A 2CDRA 1J5EB 3R1IA 4IJQA 1WLYA 3DXZA 3ZNQA 4ADSG 3QKWA 4R9VA 4IDNA 1RR6A 3TW8A 3TZBA 2VYVD 3B8EA 3F4BA 4XKJA 5KSYA 3KLNA 3K09A 3TE6A 1WPQA 4F56A 3DBRB 5IULC 1AUPA 1QP4A 2CCKA 1B6RA 1KEUA 5CA1A 3COYA 3IBTA 1SVMA 3JWGA 4HAZA 1CJTC 1TZJA 3H9BA 5A71A 1E3LA 5PNTA 3WK4A 3A8TA 1ILWA 3NDPA 5HFAA 4CF7A 3C41J 1P4GA 3DXYA 2JJ1D 4QYIA 2WABA 4AYXA 4DSTA 4F21A 2OK7A 3H97A 3X1DA 4UHKA 3R3XA 1JAIA 1QVZA 4ZCSA 3TZCA 3WYNA 4GPZA 3EA4A 3RS9A 4DLBA 3TNJA 1JHDA 5CM2Z 3Q0IA 1KI3A 2I7TA 4OHOA 4LDRA 2PZKA 4TL9A 4QGAA 1F8GA 1K9SA 3ASYA 1VG0B 3L0CA 3C5VA 4TMXA 1U2EA 3OWHA 3FTEA 4IIXA 4BEJA 2OCIA 4QPDA 1NW4A 3UAXA 1IBLB 3N39C 2PGOA 4ABTA 2HGSA 1TO2E 2OWEA 1HDXA 1EP9A 3UMSA 2UYOA 2HQSA 1V48A 1RHQA 3C14C 3VO2A 2ZBFA 1ISHA 2XR1A 2YBEA 2YXLA 2F1KA 3L0OA 5TQJA 4GWLA 3SS8A 3VH1A 4WFIA 2WD7A 4BNTA 2ZE7A 3GQBA 4HGOA 2V3CC 2IHBA 4OMUA 3ZNPA 3NHAA 3U44B 2P35A 3R3JA 2E4AA 5T4EA 4YP0A 1FLVA 3DMTC 1OASA 3TLZA 1K7SN 4UOQA 3HN2A 5CYGA 3AJ8A 1KDYA 4KLRA 3SYLA 3IAHA 2W6CX 2HJWA 1BYUA 4NOKA 2WE7A 4QUHA 3UT5B 2AN3A 2Z2JA 4IH4A 1RXVA 1H3FA 2IP4A 1FBTA 2OFPA 4OYYA 3Q8KA 1VCHA 2HEGA 1EWRA 3B5EA 4I8XA 1AKYA 1FFSA 1Z07A 2QTFA 5E9AA 2B0CA 1YRYE 3KQSA 3MJSA 2JLWA 2ZBUA 4LIPD 3D8SA 1PX2A 4JEIA 4PHFA 5IVIA 1DAIA 1LS1A 4JT8A 4LSMA 5CH8A 1U8AA 3CXUA 1YUBA 1EINA 2O3QA 4MGZR 1U28A 3UFXA 3BSSA 1NQVA 3IV7A 4IHAA 5BVGB 2QX4A 3H0KA 2PBFA 3H2ZA 1GT6A 4J2OA 2R4TA 1RLOA 2FLWA 3LT5A 3QKRB 5KSZA 3I3OA 3RM3A 5C5IA 4LXHA 2LDXA 4PGHA 1JFVA 1HK7A 4IH1A 4OGKA 2H4YA 4PLVA 3OY7A 2TMYA 3E2PA 5JAIA 4C08A 3OCJA 3R5JA 3AFOA 1ZHHA 3OCYA 2ZZMA 2GEFA 4FSXA 3S7TA 1Q0TA 3C3AA 1ZU5A 1N5OX 3FUXA 5HWSA 4R5HA 2FMTA 1A4UA 2DBYA 2QSJA 1H1LA 2HA7A 3B70A 3NG1A 4TTSA 5B4VA 1F7UA 1SHZA 1NJSA 1BSVA 1T5IA 4JH0A 1NMYA 2IL1A 3ZJYA 2D3WA 4S1TA 1E7MA 1DFHA 2BZ0A 4Q3KA 2W6ZA 4U2EA 1XRSB 4LAFA 3V6LA 3MTDA 1AUQA 2IY9A 2ZTVA 4G8CA 2RHRA 4Y8VA 2OAEA 1C1YA 1W87A 1XQ9A 3KYDA 5DE3A 2QBYB 4Z5XA 1PZMA 4K9KA 2AT1A 2ECKA 1YACA 2YFQA 3U4QA 4KH1A 3SY8A 2J9YB 3PI6A 2W2XA 5LOVB 3NOVA 1BMTA 4KOAA 3EWIA 2RH5A 4LZWA 4C76A 3Q8LA 3HH8A 1YBFA 3HRKA 1ICEA 2JDIA 4KXMA 4P5PA 5TPZA 5JNTA 2FWNA 2H2DA 4BZWA 2AN5A 2O5EA 4L5JA 4JL8A 1PGPA 3U7FB 3QOYA 1XRNA 3DC7A 4NZMA 4BB0A 4DSOA 1C8VB 3ZKWA 4UMEA 2ZSHA 4FHDA 4EPYA 5J2UA 2QTVA 1QTIA 2C4NA 4ZT6A 1V5IA 5EZ6B 3V00A 1GAEO 5HK8A 5KDOA 3QVUA 3HKEA 3UHAA 5CXUA 1WJGA 1WCYA 2WSLA 2YUTA 3RIXA 4KQMA 2KI5A 4LF6B 3QPUA 1RP1A 4HB2A 1YC5A 1SG0A 4LJSA 5BXQC 2VJLA 2ODWA 3DL2A 3EXIA 3L1IA 5BWCA 2BM8A 1IEVA 3C3EA 4RDCA 5CDGA 2WV7A 4B4DA 1WXFA 4LCBA 2Z57A 4XX0B 5K99A 5BN5B 4M9ZA 1HG1A 3VSCA 1EI9A 5KDDA 2XTNA 3SBXA 3TPZA 2Z83A 4MK4A 1WQ4A 7MDHA 1Z29A 1LTHR 2GYVA 2OZLA 2WE8A 5FDFA 3I9FA 4LGVA 2MIIA 3PCRB 4BMSA 5ALYA 4HUTA 3WWOA 1W2HA 3K2QA 5IJAA 3DF7A 4G1VA 4J7UA 1WZIA 3L6OO 3U3JA 5EHIA 4R54A 5JU6A 3UV3A 1T1SA 1SC4A 3EQ6A 3V7FA 4CIYA 3RTAA 2HT6A 3AEXA 4G4IA 4UM8B 4YRAA 4G25A 1K3FA 1PN3A 2C5AA 2KMLA 1CZOA 4BNHA 3MTBA 4OO3A 1Z8HA 2C42A 3FMPB 3T52A 4RHYA 1GSAA 3WHLA 3HO1A 1X2BA 1DV2A 4QUDA 3R9XA 2J3LA 4M6WB 2WV9A 3C3KA 4Y0VA 4JYBA 2QLNA 2Y1CA 1R27A 2DWPA 3HVIA 3LUCA 4B76A 5C1OA 5HCUA 4XTCS 3VR2A 4C43A 4TZ0A 4KR3A 4M36A 2AYXA 1WHTA 1BHSA 1KO7A 3FCSB 3DP7A 1ZRSA 3DAGA 1B8PA 3N0WA 2D59A 3RROA 3SHQA 1UWLA 2C54A 1TT5B 1KXJA 4NPCA 4NS4A 2ISSD 4AJ1A 4B3DA 4CYMA 1RZRD 5ICSA 1VFPA 1LU9A 2Q4RA 4OHMA 1Q6ZA 3SIPA 4I4IA 1X1SA 2OCDA 3G7NA 3TTTA 4QRHA 2F64A 4LHEA 3ZY2A 1NM5A 3KKEA 1Z28A 2ZYHA 1U11A 4D9GA 4DDWA 4IP0A 3ZDRA 1PR6A 3S1AB 3V4FA 4PZYA 1CCWA 4LF7B 5F98A 3MMZA 5KAPA 1GZDA 1UPXA 2CJWB 1LD3A 4IGAA 1CNEA 1L4UA 4OHZA 2AI2A 4Q1FA 3P0HA 5FQOA 4GZLA 5IW8A 3X1ZA 3G5UA 5TY0A 2KWIA 4JB0A 2EFCB 5DASA 1CF2O 1M2NA 3DE5X 3K30A 4MVJP 4MS1A 3C43A 4KQHA 5BSEA 4NCAA 2R8ZA 3QXSA 4CN8A 2A8YA 2F6RA 1JEQB 3HFRA 3EEFA 3OPMA 4BX3A 4EB6B 2P3OA 3NXKA 3GPLA 1E4EB 2J9FA 2ZAIA 1Z7YA 3DTVD 3L93A 4MQ6A 4C4PA 1Z2DA 4NKRA 1FCJA 5E1BA 1M72A 3W5DA 2R6CA 3RYTC 3EEOA 3ASZA 1QPZA 1D7AA 1UBHS 1HFKA 1ZH8A 1TC2A 2IXTA 1K8RA 4G0PA 3TF5A 4W7SA 3MPOA 3IBFA 1I1NA 1T0BA 2ZIXB 1J0XO 5JWOA 3D8UA 4ARSA 5AKXA 1HL7A 2ZYDA 4KDEA 2IOFK 2G04A 3ZH9B 2X23A 5CBPA 3KEOA 4R7ZA 3BMXA 4MGKR 2VRCA 5KAMA 2G9NA 4BVAA 3N6XA 5IC4A 5K6AC 1P19A 4Q4CA 5A6SB 5SYAA 4F0JA 1Y3BE 3I4LA 1U0FA 1OREA 5FT9A 5ESDA 3KQTA 3S8EA 2QL9A 4UVGA 2YMLA 5SZJA 2DSNA 3NRBA 5THQA 2BGNA 3C6ZA 3GIDA 5HKAA 1I5OA 1EWYA 1CKEA 2OGZA 4LHSA 5FJJA 1RVDA 1F4VA 2FMIA 2Y71A 2V6MA 3OHSX 4PLWA 5C18A 2CHFA 1EUDB 3DPIA 3L4SO 3FDFA 1OT5A 4XWWA 4WXYB 5KOJB 3PE3A 3GEPA 3OE4A 4CJXA 5ESRA 5GONA 2XB6A 4YDRA 4OVKA 1GILA 1LJ8A 1AN0A 4X1YA 5E6RB 1UCFA 2ZE8A 4MICA 4OHYA 2IA5A 1YL6A 2EDCA 2XZTA 3AWDA 3ENKA 4L5YA 4Z3OA 4YPVA 1HZZC 1Z4QA 2PX0A 4AMVA 4DQDA 3IHLA 3PR3A 4NU8X 3T3DA 4F2DA 1HT1E 1KYWA 2VF2A 1FA9A 3E70C 3GROA 3ABQB 4LJ4A 1FTGA 2EFGA 4TYYA 4OKNA 4RZ2A 4RYLA 1E9FA 5LP6B 4P80A 2UUBB 3ZH2A 1V1JA 3KZXA 4CMAA 5FI0B 3OE7A 1NYRA 2HV8A 3TW8B 2ZWAA 1LBSA 4DANA 3GN1A 3O94A 4NHOA 1RYBA 3RUAA 3BPSA 3OCXA 3TBKA 1SD2A 4DADA 2EZ4A 4BQIA 5KNDH 4CM8A 4UHDA 1L1RA 4BTVA 4EF5A 5A04A 2NU8B 5G0TA 1IPHA 5CA1B 4XYMA 2F8LA 4ZCMA 2OHFA 2YV4A 3C7DB 3FWPA 3Q8XB 5JCJD 1XFAA 1Z18A 2MSDB 2JFPA 5DNUA 5B36A 1PG5A 1FSGA 4LF9B 1C0PA 5DFAA 3VAAA 1EZ4A 3RFCA 5AM3A 4QYIB 1WXQA 3FPEA 4G0VA 1VHWA 3D3WA 3V8BA 2WDPA 4L5IA 4PX2A 4ZODA 3ZZTA 2FKNA 1SELA 3BWDD 1GQQA 1SQGA 4IZHA 1ULHA 1GZSA 2ZRAA 3OE1A 5TQ0A 5BP7A 2E89A 2Y93A 1V71A 4JQOA 2FMHA 3HSKA 1BJRE 5ICGA 3KUKA 2E1RA 1OF1A 4LYYA 4ZYYA 5KB3A 1F2TB 2IX9A 2XW6A 1S3IA 3JRWA 4GHWA 4A36A 3BB4A 1Q77A 3FLEA 3GGGA 4UHHA 4MVJH 5DF1A 3NKFA 4RJIA 1X1QA 4QLOA 1RSZA 5F5NA 4RM2A 2W6JA 3MLBA 2OESA 2OV3A 2QRKA 3NBYC 2WD7B 5F9MA 1BHJA 3ENVA 3GQBB 4KMSA 4TVOA 5K0NA 5G0UA 1ZOPA 4FEYA 3JU3A 1OUMA 2C03A 3EYWA 2GM3A 3RLIA 4AX8A 5JTTA 1MZVA 5J5AA 3VAZA 2OSBA 1BXGB 2YR0A 3G8AA 2QN9A 2EW2A 3WTBA 4WFJA 1CT9A 2Z3ZA 1EFRD 1VA4A 2GZ3A 4KOEC 2WY2D 5DNAA 3UQYS 3FKSD 5LQMA 1Z36A 2DUUA 2YDXA 3AHHA 3LQKA 4I1IA 4MHSA 4OQYA 2O2DA 3LPAA 1YFZA 3JAWB 2J07A 3W3AD 2JLZA 1GNRA 2OOSA 1PYGA 4RTPA 2Z3WA 4H1VA 1PZGA 1ULUA 4UTOA 4EGCB 1TM2A 1CY2A 4F06A 2JD0A 3GBSA 4Q1CA 4RC9A 4E09A 2JPDA 2A0UA 1Z5ZA 2O1WA 4PR3A 4XA8A 4DABA 5IT4A 3FHJA 3JQBA 2AXPA 3UAWA 4BZPA 1E7QA 2XVMA 2R96A 1U0OC 1JR3E 3A58B 3KJGA 3JQRA 3FKJA 3FRJA 4DCOA 2YINC 1IQUA 4INOA 1ISGA 1DTSA 3IBGA 3T3IA 4CXMA 1DDOA 5ADHA 2DLNA 3C24A 2JLUA 1OPRA 3A9UA 3HCWA 4QXPA 2H1WA 3EVTA 4A9AA 2O0KA 3GHYA 4YCSA 1E2DA 3E81A 3QF7A 5LD2C 4G9BA 4G5GA 4D6XA 1S7GA 2H9YA 3L0SA 3GRPA 1XMJA 3H1EA 3O8BA 1JB9A 1H1LB 3HCBA 3O03A 2DM6A 2PFSA 3ET5A 3RHZA 3TOXA 4C7OA 3IX7A 4COOA 3PEEA 1YVPA 1CF4A 4K6HA 2H4WA 2ODEA 4WBNF 2IK8A 1T91A 2WSBA 3QFRA 4DIKA 3A1DA 2WWGA 1TU4A 4EYOA 1O0CA 1WPRA 2YVUA 3RYHA 4A0HA 4Q1EA 3KYDB 3STYA 4BGEA 2FZKA 3OZDA 3RSHA 2FDCA 1RRVA 3NBAA 4RKEA 3DHNA 4RTOA 2BPOA 5GAJA 1LXCA 1MAHA 1Q0PA 3GBPA 2HWYA 3LVBA 4OYLA 5DN9A 3WDSA 5M29A 2JBWA 3L40A 3WQHA 4U7WA 4M1QA 1JJ7A 3TI7A 4CETA 3DAFA 1GTVA 2Y9MB 4ID3A 4M1SA 4ZU6X 2MWMA 1CUWA 3LP6A 3IKMB 3V7UA 5AVQA 3G5AA 1A97A 4XVHA 4L5BA 3WGMA 3MUFA 2P2DA 4UBLA 5GVRA 4GVXA 2SKDA 1H4TA 3R7FA 1DEAA 1NVVQ 4PICA 5LUBA 3ZKWB 4P31A 3S1SA 4MROA 2C0QA 5J2UB 1DB3A 4B3CA 4CKXA 3BWXA 4QOJA 1A0OA 3GFRA 1OMOA 3SYTA 1CB7A 5KMGA 1SQ5A 2GKGA 3LXRA 3TUZC 2X14A 2D1FA 3HN6A 1MHTA 1MAUA 4YRIA 4I5EA 2QS9A 3LHSA 1T3LA 1PWEA 2NO5A 2WWRA 1S4MA 4MCJA 4LJRA 1GNLA 3EXIB 1DLIA 2PYZA 1NMQA 1RPNA 3OAAD 4MPTA 2E7ZA 4LQ4A 4QXQA 4JP5A 3RK0A 4EI8A 2GCNA 3DLIA 3ZWYA 5EE1A 3WGIA 3QE0A 4H4EA 5AKLA 4R8RA 3MRXA 1GZVA 1I7NA 2Q5HA 2VJAA 4L3OA 5DBIA 2QZJA 5JMTA 3F6RA 4QVIA 4B80A 4KPFC 4EDHA 3UGQA 4BNWA 2Q6IA 1ODCA 1I4DD 4IWNA 4LG1A 3H1BA 4NS1A 5DULA 3ESCA 3WS7A 3BEDA 2CHEA 1RE0A 1WZEA 3DT9A 5JZSA 3T3OA 3O47A 4ZRMA 1AKQA 1O3YA 2DR3A 3MUEA 4B1FA 4ZOAA 3W7BA 1LB1B 3BSFA 3C39A 3URMA 3V32A 2P1RA 5AW2A 2O54A 2Q5CA 4FOTA 2A9FA 5JRDS 5HF8A 2PH5A 3H17A 4US2R 4LX0A 3QVMA 1JNXX 4FDTA 3WGUA 5CTJA 4FLFA 1RI5A 2EFYA 1GL3A 1TU3A 2VWHA 3AEZA 3CLUC 4LMPA 1HMYA 1NF9A 4Q37A 3R9XB 4QYMA 4W6ZA 4KVGA 1NJFA 3PUXA 4PZPA 3WGNA 2ZRPA 3VYUB 3ZHSA 5JRJA 1FYFA 4RH1A 2VL7A 3IMKA 4MCHA 4YXFA 1QIHA 1WHTB 1FJ2A 2FW0A 3H2IA 4L8FA 4LN1A 1NI4A 4MWZA 4IVRA 4MZDA 5ALXA 1NJ6A 5H5JA 2V7EA 3T7EA 2O8FB 4PW0A 4U0KA 2FP3A 2VQSA 2ZCJA 4P32A 1Q0UA 2BH9A 2VZLA 3HNRA 3LLUA 3S70A 4LECA 2WJIA 4LYDA 1TYDE 3CHYA 1BU8A 4H16A 3DWIA 4KP7A 3ZY3A 3GLFE 3A4LA 2HYDA 1C81A 2FEXA 3BCSA 2ZANA 4CL3A 4B81A 5CB6A 4PAWA 1VA5A 2B94A 4BLRA 1TVCA 5K8IA 2BT4A 2PVCA 3DMHA 2X9VA 1GAQA 2ZR8A 1K2WA 4IIGA 4RA9A 3OG9A 4WXMA 4X1KA 2V6GA 4DR7B 2JGAA 1XKXA 5HYVA 3IVMA 1V4BA 4ZVRA 3TI9A 1VSVA 4M8IA 1VL6A 2P2ZA 2B1IA 3PB3A 4Q9HA 5K3DA 3HCEA 5HM8A 1KP3A 4G0XA 1NYQA 3RRJA 5A03A 1CLUA 1QRAA 3F5QA 1N7HA 2GDZA 5TRTA 2ATVA 2XHEA 2A4KA 1LJUA 1IM5A 2CB9A 4MS1B 4RKYA 1KZ7B 3WLHA 4ZARA 3ZQUA 4DLNA 3VVCA 2V4MA 3BL6A 4EJMA 2J9FB 1L5VA 5IVPA 4UMVA 2ST1A 2XMCA 2QRVA 4XOUA 1C3OB 1RAHA 3ITDA 4R3WA 3KCNA 2ZK7A 4HYTA 4DR1B 2ZRGA 4L02A 1P18A 3HZOA 5A3VA 3HM9A 5EP2A 1JR3D 1UPTA 3DHVA 5I8PA 5KYNA 1CY0A 4XWAA 4R9RA 1U2GA 3CTPA 2LZ0A 1WD5A 4H1HA 4QG3A 5T4BA 2W2OA 2W0MA 3LPMA 4EHLA 4PIPA 1Y7HA 5HBGA 4EBFA 5B58C 2R0QC 3ZI0A 2VF5X 1L6IA 4UTRA 5BT9A 3YASA 1KBOA 1WB9A 4PFJA 4I81A 2D5LA 5CBPB 1II8B 1GG5A 2VRWA 2RG1A 5TS3A 1FU8A 3A9WA 3CUSA 2J4DA 3FM9A 4TTRA 4J6FA 3TLJA 2GZAA 5DHPA 4XD7A 3EVZA 1GZ6A 1WNTA 4RZ3A 4CFZA 1M74A 2QTRA 4KQWA 1R37A 3H5VA 3HXPA 3WJ7A 3PX7A 1KDPA 2CNWA 4AQDA 1CDOA 2B35A 1KHHA 3SQNA 1A3CA 4IQ4A 1NOKA 2MSLA 2PRYA 3VBCA 1AQYA 4BNIA 1VYTA 4GRIA 4ZT4A 5FEMA 4RXTA 1Y1PA 1QE5A 1T5HX 1MO3A 4IKEA 5GONB 4BS9A 3EGVA 3CZMA 1E3SA 2I80A 1UKAA 4UUMA 4X1YB 2E5WA 2EW8A 1FP4A 1H8HD 4G8DA 2DECA 1FNCA 3A1WA 3PWKA 2B1JA 3F8TA 3DVQX 1QKJA 3Q3GE 3KJXA 4KQGA 4YXWA 3AY3A 4FB5A 3CVYA 2YV3A 4HGPA 4MQ5A 3Q41A 3VR5A 3ERCA 721PA 4XYEA 1JMVA 1THTA 5DCLA 3GNQA 2GK7A 3RVLA 3ZCVA 4YQYA 5L8VA 4P0PB 4G1EB 1YR2A 4CFYA 2IW1A 4AS2A 5FNZA 3RCBA 4TMVA 2FVXA 1T6NA 3HXTA 3JTMA 1EBBA 2Z9DA 4GF5A 3K53A 1II9A 1PZNA 1Z4MA 4QOHA 3U40A 4EUHA 4D5GA 4YMUA 2QN3A 4RK5A 1UPBA 4UZEA 3NHRA 3VH3A 3NP7A 3PUIA 4LRWA 4OP2A 2W42A 4DMUB 4D26A 4HGZA 3OTGA 2XTAA 3ZUGA 3WMFA 3G9ZA 3LGXA 4U6SA 5DI9A 5I7VA 2Y4NA 4FE7A 3H4VA 4U02A 1FLDA 4Q7LA 2IF2A 1ADBA 2XCTB 4YJ2A 1S1CA 1MDBA 2X8LA 1W6UA 2HPHA 4MUEA 1V45E 1GYQA 1ZM4A 2XVAA 3D3WB 3MGGA 5HPYB 3NCTA 3GIWA 2GO7A 2M2IA 2K5UA 3G1TA 2AIRA 1YZKA 1ZVMA 3GFBA 3KJEA 1UM9A 4KO4S 5LA6A 4DF3A 2FMKA 3OZSA 3RI3A 1Y6ZA 2ZTHA 2I03A 3NHWA 1AB6A 4OQ4A 1LX7A 4IUCS 4UHEA 2CK3A 3MAJA 1FUUA 4I3FA 4QPPA 4V0OA 2DYKA 4BFZA 4UULA 5HUHA 1WXEA 5K2MA 1SPBS 5TF4A 3AWIA 1WTCA 4HS9A 2Q2VA 1BCSA 2X8AA 5IC5A 3V33A 4JAVC 2IOFA 4TLMB 1O7JA 5B1YA 1CR6A 5D51S 3QEBZ 5A4AA 4TMFA 3CFYA 1OXTA 2WTUA 2WM9B 5D00A 1IVSA 1F8YA 2Q49A 3FTPA 2YJTD 4Q12A 2KS6A 3FF1A 3IDAA 3TTXA 3CZAA 3X1MA 1WABA 2X9QA 5AXAA 4D79A 5CFQA 1JHPA 4IHJA 5DVZA 2I3ZA 2JFQA 3CLVA 4EB8A 5HRUA 1PBNA 2IYEA 3I0NA 3VTFA 1OTYA 1ZJZA 3BM5A 4FFMA 4B75A 2ET6A 4X8HA 1LRLA 3JXEA 1CZRA 5AOBA 1CERA 1NR5A 2WKPA 4GGOA 4RL4A 3COPA 4MVJG 3UATA 1TA0A 2W22A 1LK0A 3IA7A 3HZZA 2Q5QA 5EUBA 1ANKA 1DX6A 1E1QA 2WHEA 3NBQA 4I36A 1Z3CA 3NTVA 4NYJR 3OZTA 4XE5A 4TYWA 2VKTA 3EFEA 3K3PA 1GGKA 1LDBA 1HE4A 1NUPA 1X70A 2QN8A 4CMEA 2VF4X 4RZHA 5CVJA 3OM9A 3Q3EA 1N6KA 2QU8A 1VM6A 1H5QA 3ET4A 1X1DA 2X4DA 1FDUA 3IAM1 3P2EA 2IU3A 2B6NA 5CFMA 2EDAA 3M1LA 4KFCA 2C00A 4XI9A 3OQ1A 3ORRA 1LPPA 2FWMX 2WIDA 1Q1NA 3GEDA 2WILA 4QOSA 3H1GA 4WK2B 3S0JA 4S0XA 4JQZA 4E07A 3M9XA 1W1WA 2QU7A 4YMWA 4EG7A 4DV4B 1VKJA 2O0LA 3RTEA 1JI3A 1U0LA 3FBGA 3HPRA 3HB0A 1USGA 4Q18A 3E1GA 4EQZA 5A4KA 1FSPA 3DCIA 1JJVA 2X0RA 2FUG1 2Y1GA 1OZHA 1WY5A 4ZC8A 3IIIA 1E7YA 1A9XA 2VHVA 2B5OA 1NX6A 3HCCA 7MHTA 3K1TA 4KH0A 2IHNA 4UFPA 2BE7A 4C7OB 1EDEA 1KR2A 3HFGA 5DGDA 3BE5A 3UC9A 2IT1A 5CVVA 1WVIA 2H1FA 4H1TA 2YWCA 4OI4A 1L4EA 4XW2A 3DE2X 5ALPA 1KK3A 2DHRA 2Q5FA 3RS8A 1LDYA 2CHGA 3GCWA 3OWOA 4LZLA 3RYHB 3SS9X 5JISA 1LLDA 5JG7A 1N8SA 5A9SA 5HFJA 4MRMA 5HW0A 3W8FA 1NSTA 4KFSA 1V8FA 4QGFA 4X7PA 3WV4A 3G2IA 3I45A 4ZEVA 3QUBA 2EFJA 2JARA 2B6HA 2PL3A 1V0JA 2EWVA 1KL7A 2GPJA 3JQGA 3SKVA 1ZA1A 5JAOA 4ND6A 3JWHA 3ICPA 3PQ7A 2NIPA 1ISRA 3FF4A 1TM1E 4U7TB 5I8WA 3H1TA 1T9HA 3B2NA 3E35A 4XQEA 9LDTA 5G4LA 4OHFA 1AB5A 5GV7A 3NPMA 1PZFA 3T0FA 1VCMA 3UJPA 3WYDA 5BSWA 4GZMA 3B6KA 3OCCA 1O77A 1P7ZA 5AJZA 1VIMA 1SZPA 4REMA 2BKLA 2XX3A 1TAGA 3G8BA 2P8JA 3K0AA 4G2TA 4HEA1 1ZRNA 2XECA 5KU7A 1GTJ1 2EL7A 3ON5A 4RVNA 4TN1A 4WX2B 1Z63A 2O8CB 1VSUA 1W4ZA 5JJ5A 1XKTA 4MEBA 2OQIA 1CQWA 1Y37A 5H81A 1QIGA 4Z6KA 2BMFA 3FLAA 3HJBA 4A2PA 4L9RA 2HHHB 3FPAA 4CG3A 3ETLA 3HLTA 4DOMA 4EG5A 3R7DA 2DBVO 1VXRA 2A30A 4O6VA 1MOSA 1RLMA 2A2ZA 3L6DA 4O2BF 3GGSA 3Q7SA 3PIDA 4G1UC 4Q02A 4KHPB 5JARA 2QUIA 2HUNA 3QQ5A 2GZ2A 4YUAA 1LSOA 2LIPA 3UXYA 3P9CA 1A76A 2FUCA 4F38A 3DOJA 3KYCB 4CKZA 4D92A 1N5IA 4DLYA 3G9XA 4JFRA 3D2BA 5F76A 1FPQA 1C1HA 1V41E 2GD6A 3A2MA 2IIBA 3PJEA 3R5SA 4UXHA 3ZGNA 4DJTA 3OCZA 4KO3S 4WZAE 3E18A 3GLTA 4IGFA 1N2ZA 1UFVA 5FOVA 4DC0A 4P5DA 4S0ZA 1L7RA 4HRXA 4PNZA 3SDBA 3GDHA 4DLUA 5C37A 1O6BA 2CLDX 1K75A 4D4JA 2Q46A 3A2KA 2G40A 4PM4A 1E66A 4Z0PA 4ZVTA 1N2CA 1O08A 5SYNA 5JUWA 4QVKA 1EUCA 2A9RA 4BEWA 1P1HA 3IP5A 5DHUA 3NNDA 1GCAA 1IHYA 1NL3A 1R0BA 3M8KA 3SIRA 3DMDA 1LVUA 2PS3A 1G1MA 3BJRA 4JCOA 1NI4B 3IPYA 1DMRA 2XKBA 3KOUA 1QGAA 1AZSC 1H0KA 3MWGA 3KWFA 1JJBA 2B4RO 2XF2A 5IBCA 5JEDA 2X8WA 5JO0A 4JV5B 5LLTA 5A1JA 4TLDA 3G88A 1F38A 1KO1A 1JF8A 3OECA 4PHGA 4RSGA 4RVOA 5FUVA 5BVHB 5K8LA 3Q7IA 3WQSB 1M1NA 4L95C 3C97A 3C2QA 2JLAA 1ST3A 1SKQA 1YVEI 2CKDA 4BMPB 2NPIA 4DEVA 2IDKA 3IPXA 2ICAA 1J9GA 3QBDA 4MDHA 3AF3A 2GYUA 1CEXA 4RA9B 4X1KB 5DISB 2Z9BA 5J2TF 2X0DA 3UJAA 4IIJA 1YS7A 4U8GA 2GEKA 5JC8A 3S4YA 3S28A 2ZAYA 4ENSA 3M5WA 2A58A 3NPAA 2E85A 1JHUA 1JVSA 1RWBA 3LFTA 3TJRA 2PK3A 3A7DA 2DTEA 2I2BA 1RPJA 3KKLA 4H3KB 4DNFA 5DJ5A 1BDHA 2FSUA 1M73E 3FVRA 3ULKA 1YMQA 5EMNA 2F1JA 1L4LA 1ZD4A 2QRVB 1YBVA 5CFOA 4LZZA 5JJIA 4PZLA 2Q1XA 3OP1A 5BPFA 2Q8QA 3C5WP 4JZKA 4ARAA 1J1IA 5IABA 3GI1A 4LVOA 1OYVA 3L3BA 3ZLBA 1C7FA 2Q8NA 2WZBA 2FSPA 1P3JA 3FPBA 2WHPA 3F9RA 5ERXA 1DAGA 2I22A 3SJCA 3WSTA 4A7PA 3JD0A 4Y2JA 3KK0A 3VR3D 1YJ8A 3IPRA 4OMDA 3R75A 4YUZA 1HF3A 1HUQA 4TM7A 1J2RA 3ETGA 2CVPA 4MSUA 2OMKA 3U4CA 4BLOA 4C4SA 2R7MA 2TMGA 5AICA 1AS0A 4P83A 4XUCA 3VYSB 3P9ZA 4OHWA 4UFOA 2HLDD 2GDJA 3BIFA 2Q1SA 4L9WA 4GVPA 2QDKA 2G9QA 2JFVA 4AY5A 1YVRA 1L4KA 4PYJA 4GFDA 4DCCA 5KVVA 2RSLA 1CUEA 2FW1A 2V9CA 4BFVA 1ZITA 1A71A 1WOMA 2IZ6A 4IEIA 5IKOA 1MO5A 5JAPA 1JLKA 2OILA 2IELA 2Q7OE 2J31A 3UH0A 3EBPA 2XWSA 2QV7A 3OLVA 5ALLA 3SI7A 4XWKA 3EXHA 3NVAA