1UJCA

Structure of the protein histidine phosphatase sixa complexed with tungstate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
156
structure length
156
Chain Sequence
MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELTPCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphohistidine phosphatase sixA
publication title Crystal structure of the protein histidine phosphatase SixA in the multistep His-Asp phosphorelay.
pubmed doi rcsb
source organism Escherichia coli
total genus 51
structure length 156
sequence length 156
ec nomenclature ec 3.1.3.-:
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ujcA00
4D4LA 1T8PA 3DCYA 5CU7A 3MXOA 4ODIA 1H2EA 1V37A 1UJCA 2BIFA 3C7TA 4D4JA 3IT1A 3D6AA 2P6OA 3GW8A 4HBZA 2OWDA 1DKMA 2YN0A 3O0TA 4IJ6A 2QNIA 4EO9A 4ARSA 4E3WA 2EKBA 3QPUA 2P75A 2HHJA 2F90A 2H0QA 1H2FA 2AXNA 3FJYA 1QWOA 3BIFA 4D4MA 1BIFA 1FBTA 2A6PA 2OWEA 1DKQA 3K4PA 3NFYA 5AK0A 2H4XA 1C81A 2DWPA 1DKOA 1QHFA 2P30A 4FDTA 4PZAA 1E58A 3R7AA 4EMBA 1IHPA 3F2IA 3NTLA 1RPTA 2P2YA 2P9YA 4FDUA 1YJXA 2P2ZA 3E9DA 1ND6A 2ENWA 5AJZA 3IT3A 2P78A 1E59A 3DB1A 4ARVA 3K4QA 1DKLA 1YFKA 3KKKA 4PZ9A 2YN2A 2WNHA 1QFXA 2HIAA 2HPAA 3E9CA 5AJXA 3MBKA 3F3KA 3IT0A 2P9FA 3PGMA 3LL4A 2H4ZA 3QPWA 1SK8A 2EKZA 2A9JA 2RFLA 5AJYA 4JOBA 2ENUA 2P9ZA 2WU0A 3E9EA 1FZTA 5HTKA 3LG2A 3HJGA 4TSRA 1XQ9A 4GPIB 4AROA 1SK9A 1SKBA 2WNIA 2EOAA 3LNTA 3GP5A 5CDHA 3FDZB 3ZHCA 2P79A 4D4KA 2IKQA 5AJVB 1DKPA 1SKAA 1EBBA 3D8HA 4JOCA 5AJWA 2GFIA 2P77A 3IT2A 5PGMA 1CVIA 1C7ZA 3FDZA 1RIIA 2P6MA 3QPVA 4PGMA 2PA0A 5CX4A 1BQ4A 4MA4A 2H52A 3EOZA 1K6MA 3OI7A 4ARUA 3EZNA 4JODA 1BQ3A 1V7QA 4IJ5A 4GPZA 1UJBA 2DWOA 1RPAA 1TIPA 1C80A 1NT4A 3D4IA 1DKNA 3GP3A 5HR5A 1ND5A 2I1VB 4QIHA
chains in the Genus database with same CATH superfamily
2G3YA 2QOEA 2FZGA 2VA8A 1W6RA 4N39A 4W7HA 4P92A 3BWEA 4IDNA 2QTRA 4TXHA 4WKCA 5FBKA 3PC2A 3ZN2A 2AOTA 3UUEA 5CVDA 4JVNA 4EI9A 1MX1A 2VAXA 4KQIA 5FPHA 2C96A 5ALSA 2FETA 4DCNA 4G09A 4MB0A 4L0MA 4QUGA 3B3GA 4FD2A 3V55A 2IU4A 4PZCA 2QXUA 1GYPA 5EFZA 4BNDA 3QELA 4ZPJA 1YR3A 1BOFA 1Z45A 2QGZA 2OO5C 3HADA 3HBAA 1XTQA 2GZHA 3OLZA 3PUYA 4RD1A 3V8RA 1T2DA 4G3XA 4IGFA 1W1IA 4MVWA 3GZ4A 4A16A 2X1MA 1G21A 1JAIA 5DJ5A 4BDTA 1WVIA 3M1AA 1SEVA 2EX1A 4LISA 3KD2A 3GI1A 4KRYA 2CL7X 2HJ9A 2WIAA 3K16A 1ABFA 4G4JA 4I66A 2WD9A 2FAXA 5EPEA 1SCUA 3FPKA 2B5OA 3I1JA 4KODA 4O2LA 3FYUC 4DVJA 2ZYHA 1YQTA 4GVPA 1Q1EA 1XD8A 3HB4X 4US2R 4ETWA 5GTDA 3K70C 3QE9Y 3EGXA 4Q02A 2GAIA 4IINA 4DLAA 1U0BB 3IEMA 2GYWA 1F8YA 2ZJZA 2DPMA 4WINA 1N2CA 4DWJA 2DKOA 2I78A 3BOSA 4MR8B 4W1QA 5L53A 4G8BA 3R8FA 3S6JA 3P0HA 5FA5A 4BX0A 5J59A 3QLTA 3RYHB 1BYIA 1H2YA 2PM8A 4ZEVA 5B7NA 3KPWA 4C4ZA 1Q0HA 4G86A 1V4NA 5KDOA 3ADCA 1Z7BA 4KZPA 3SQDA 2YJ5A 2HREA 1W4BA 2XY4A 4QQFA 5KWVA 3PR3A 2OAGA 2PH1A 4OBEA 2EU8A 5KAMA 1HEUA 3LT1A 1HFWA 2IC5A 3DV0A 2AOUB 3H16A 4C29A 1QGDA 3OICA 2CHVA 1J7JA 3MRSA 2FPIA 2P9FA 3QXSA 4JC0A 3LL4A 1V11A 3KSDO 3EFEA 1U9JA 3UK1A 4BO3A 3GLFE 4WECA 2RKBA 4AY4A 3INNA 3C15C 4FIZA 5HTKA 5WRFA 4N0MA 2AFHE 5AFSA 3CSSA 2Q0SA 2I71A 2Q28A 4DA4A 3TKYA 1Q44A 3DWEX 4WLFA 2WWTA 1HDZA 1YB1A 5IEJA 2YW9A 3F90A 2HWXA 3ZU2A 3V8BA 1B73A 5LLTA 4ZU6X 4S1VA 1E66A 4PV7A 5PNTA 4AC9A 5LA6A 3IH5A 1SXPA 5HJEA 1GLGA 1YB5A 2HGSA 3HKBA 4FXPA 4QHTA 4UMEA 4WZZA 4XGKA 2JVIA 1VPVA 4AJHA 1COWA 4JJFA 1JHVA 1O57A 3NWEA 2AUNA 3IXLA 2FTKE 4OJTA 3BF8A 4Z5XA 3C3CA 2RHHA 3AF0A 3LMKA 2IYEA 2J7PA 4RFSB 3HA2A 4TT8A 5E6RA 1HGXA 3CPHA 4QBFA 5KTTA 1YZLA 1WQ3A 2FCAA 5K0NA 4D44A 3EMDA 4YMVA 3CX3A 3ZXIA 1RZRD 4BMDA 2OZPA 7GPBA 1W49A 2NXCA 2JFBA 3TNYA 4A6PA 4C01A 5ICSA 3U16A 3J81k 2R7LA 3ZWBA 3D2AA 3FMFA 2GZ2A 1EP1B 2ODTX 5EKTA 3UICA 4MUJA 4IAOA 2P9TA 3ROEA 2GO1A 4DCJA 2JJQA 3IPRA 2WF5A 3GP3A 2R751 3TLCA 4TTAA 3VSBA 3QIAA 5E9JA 1QTQA 3U7IA 1H65A 4DRZA 4BMSA 4YJFA 1LBEA 2FWRA 4KWEA 2PUAA 1QF9A 3QFRA 3UTCA 1TT5A 3DQZA 1YF3A 3OQMA 5DHRA 2Z1DA 2Q4DA 2VPXA 4B74A 2YWEA 1PJAA 1VI5A 2N75A 4OK6A 4RVFA 3QMWA 4C04A 4AP9A 1QVZA 5JXIA 3AB8A 5IZCA 1GDHA 4QXRA 3W5HA 1ETHA 1Z5UA 2I7CA 4AG3A 5ITSA 2PMEA 2HDOA 1N3LA 3HUFA 3HI4A 2ONKA 4BE9A 2Q9BA 3KOXA 1D1TA 3SQWA 4D3FA 4BN4A 3ADBA 2IVZA 1JA0A 1WD5A 3HCAA 2VBFA 1CZUA 2PL9A 2NMVA 1EUDB 2BUBA 1UM8A 2C2BA 3T54A 4RSRA 1K5DA 4RHUA 1U1CA 2WKWA 4IJVA 3PC3A 3GDGA 2L19A 3JQ8A 3K2EA 4CIXA 4Y2XA 2DWCA 1EWTA 5AH0A 3PJGA 2IEDA 4Z2AA 2XE6A 2HWWA 1TGYA 3EASA 3IP7A 2J0QA 3D6MA 1OXXK 1T8SA 2JHPA 3FTPA 3FPBA 4OQLA 1WXDA 2XT6A 3IQXA 2JIZA 1WF6A 3QHPA 4PFSA 3NGLA 4L28A 5MF6A 3OT4A 3UMFA 4JYCA 3UJ9A 3OBIA 1KQ3A 5HFNA 1RWKA 3CR8A 2JDID 3MB5A 2A58A 2M1XA 1KRHA 3A3YA 3DAGA 4EKGA 1NZFA 2L42A 3IOMA 1EVEA 1UFKA 4M9UA 3URMA 3SDBA 2AR9A 2H17A 1N8SA 4M1WA 3O4RA 4U9IS 4CNQA 2GNOA 2OD2A 3I0ZA 3KYDA 2OFWA 2OC9A 2RGNC 5M7EA 3BFKA 4URYR 3UV7A 4HGYA 5EJ5A 2XZLA 1PJ4A 3WWOA 4FR5A 4O2AA 3I9MA 2VRBA 1JKFA 2DPGA 3E9EA 2H06A 6PFKA 2F8SA 4JIGA 4NONA 2IPLA 3DXFA 1RNLA 2GJ4A 4K6CA 5AK6A 3KBBA 2NUTA 2IODA 5ALDA 2XIQA 2ZB8A 5DOVA 1X1RA 2WNIA 3VM6A 3WGIA 5I7SA 5JTTA 1UK7A 1Z6ZA 3PKIA 5JS6A 1KZ6A 1HY3A 4IQ4A 1H3EA 3QGMA 2PBLA 2GPWA 5A2QA 2VWHA 2QM7A 4D4KA 3TW8B 4M1OA 5DU2A 3T9DA 2XECA 5IUJC 3BCRA 4CFSA 2PHZA 4B40A 3AIMA 2ZYDA 4Z49A 4Q39A 1H2WA 2HYIC 4UU1A 1TD1A 3A7DA 2FPGA 4BNUA 4TKMA 2EQAA 1IZ8A 2MYNA 1P1CA 4LRTB 4US1R 4MARA 4OBWA 1G8YA 3CW8X 2O7SA 3E15A 2QTCA 4R2LA 1OXKB 2PO5A 1C4WA 4Q4HA 1YVUA 2WNSA 4IJ5A 4QFDA 3V32A 1G9TA 2IIVA 1CSEE 1WPRA 1XTUA 2FWNA 2XJ4A 1SAYA 3QUTA 3UKDA 3GFSA 3TTXA 5JSZB 1KYXA 4PXSA 1Z33A 4AIRA 3DB2A 3IBTA 1KO4A 3F5QA 1E20A 2I55A 2UYOA 1XO1A 2V54A 3TLGA 4BVLA 5LZ7A 4UCFA 2G72A 4KIJA 3NAQA 3ES9A 1CJCA 4MKIA 5K0BA 1X39A 3WGKA 3ZE2B 2FLKA 1QVRA 3TLKA 3FCSB 4WBXC 4CEJB 1ZH6A 1W581 4ZEOA 1EE1A 1ZN7A 3BICA 3ETCA 1Y4UA 5EKDA 2PQ0A 4UEQA 3RANA 2X8JB 4HUJA 4YDSA 4LYHA 2HGZA 1YBHA 1YR2A 3HCCA 1CUZA 3WRYA 2JFUA 5KSYA 4ON9A 1H9CA 1SCQA 3ZV7A 1JBQA 3KYCB 4TTPA 4XWOA 4A36A 3QXCA 5DCYA 2HO4A 5AW9A 3BTUA 1ISRA 4LMBA 2ZBUA 1IUKA 4M7RA 3X2EA 4KFCA 2O23A 1ZFNA 4RF3A 2PO7A 2NVWA 4I4LA 3HEBA 2IV3A 1DRWA 4HLQB 3GJ7A 4OXRA 4E32A 3ZIAD 1E58A 1JIXA 5IJ9B 2PKCA 1Z63A 1SBQA 4RTOA 3SZMA 5F2KA 5LP6F 1EE2A 3PWTA 5CCEA 1TZBA 3CEHA 1E2LA 1N0IA 1NZJA 3H2HA 2PQ2A 1I24A 2YFHA 1XCOA 1B7GO 1BS2A 2YUIA 3MWYW 4MQBA 1PV4A 4NYIQ 4XRGA 1PE0A 3CUYA 5KVAA 1YFKA 2PTGA 1YQWA 2ADMA 4BVBA 2CXPA 4CLXA 3WL5A 1RJGA 1W73A 3ZDAA 1NMYA 3E4DA 3ZWKA 1M7HA 3NHKA 3ZU4A 2RGBA 2GLXA 3C5CA 3VYTB 3MUFA 4NR0A 3R9KA 1PLLA 3ZU6A 3CWZA 3L7BA 3EUFA 4N0EA 2HJVA 3DAYA 4J7UA 2FQ1A 4QTYA 2MWMA 1OLXB 1H1LB 1EHCA 1TK9A 4F7DA 1C3XA 2J31A 2XCRB 1BDMA 2RHOA 1E4EB 2GBGA 1G8GA 4RXUA 3W5SA 1YCHA 2WVGA 3OQPA 3S8YA 2O6LA 2HV9A 2J3MA 2VUUA 3O21A 4TL7A 4TMXA 4EG0A 3PJRA 1YZ3A 3Q0TA 1Y8RB 1NVEA 3DA8A 2MYPA 2D0DA 3NCTA 3SLRA 1QQ7A 2QLMA 4EUSA 2BFBA 3RC9A 1YA8A 3MPUA 3QEBZ 1YB4A 2C9CA 3IHWA 2HCFA 4GGMX 4IHJB 2WPDA 3Q12A 5EXXA 1FZQA 4I8IA 4P22A 2YX1A 4AD8A 1PDOA 1GZVA 1SXJE 1XP5A 3GLTA 4YYZA 2GZ1A 4QLAA 3FDZA 4IX9A 3RF7A 1UR5A 3AQ4A 3DL0A 4XIIA 1V41E 1Y4DE 5GONF 1NHWA 1GRRA 1RCUA 1RC0A 3GZNA 3HXTA 3O90A 4QATA 4J9UE 3MTEA 3EIUA 4BBJA 4HADA 3GC6A 1E2UA 1V8ZA 1P5RA 1DX9A 4RA6B 4WCVA 5C4MA 4WKNA 3VJRA 3DZ8A 4G1EB 5A4JA 1KMCA 1VIAA 2YIMA 3NDIA 3EDMA 4UDNA 4UFNA 2DULA 2HBYA 4ND3A 1FLVA 2B35A 2VHEA 4JJ7A 1CNMA 1EVKA 2YYYA 4XIYA 4C14A 2QNBA 2EARA 2QTAA 3TBKA 1QYDA 3H9QA 4EQZA 1OA1A 3RVRA 1MHTA 5K99A 5FUVA 2BGIA 2CXRA 3PICA 1KI2A 5LC1A 1HMPA 2F3SA 1PJSA 3HXOA 4YFVA 3LGXA 1UJCA 4B5KA 1ZMBA 2MR5A 3ND9A 4MV7A 1LV7A 2DGDA 4FMPA 1HT0A 1F4LA 2WHXA 4GSLA 4HUQA 4WESB 4Y6RA 5DN6A 4WKGA 2HA3A 1GAQA 3AK4A 4NVRA 5BW8A 3FY4A 4F5WA 2PSSA 5ALEA 3E3AA 3VPCA 1Q1AA 1KO8A 5I7AA 1NV9A 5BQOA 3WJ2A 3A1DA 3ZHQA 4BYMA 1M34B 2J33A 1E77A 5JS8A 5DW0A 4XYMA 3W5JA 4ARZB 1Z0ZA 4X1KB 3H8JA 2G1KA 2O05A 2PWPA 2VPZA 2Y93A 4C7VA 2I67A 4M9ZA 1VKNA 5BSMA 2I4TA 2J48A 2HR1A 1L3IA 3LK7A 3O4JA 3UPDA 3SSMA 4PC3A 1RKXA 1T5SA 1L4FA 2PCLA 2BJWA 1CY4A 1OFVA 1E2KA 2Z09A 1JN0A 5AI9A 3KR0A 1U81A 4YUYA 2NPOA 5I3ZA 3RUHA 2VDLB 1PL8A 2QX7A 5LYJB 3HZOA 5SV2A 2GAJA 1PEDA 3EZ6A 3I2JA 3IUMA 4PO9A 2H8KA 1DUVG 2X0KA 3KUCA 4ARVA 1G20A 1PQUA 3I5AA 3L7YA 2YNMD 1Z4OA 3LSYA 3VNRA 1C7IA 4DTIA 1FRZA 4FGWA 4EG4A 4FFBA 5LMZA 2AZ4A 3AVVA 1O54A 4MULA 3GQVA 3N87A 3V2UA 2H1VA 4DZZA 1NI4A 4LVCA 1PR0A 2QI9C 4H31A 3AWDA 3HCPA 1RVV1 1YZTA 2FMIA 3ZWPA 4OHYA 5E38A 3HBJA 2D2IA 2FOIA 2JIQA 3OPNA 4ISBA 3AVUA 5FTMA 5IWAB 3BWBA 4D3ZA 3PQ2A 5ENDA 5E1DA 6GPBA 2NV6A 3LDAA 4G0NA 4ECAA 3K0SA 2R4UA 1C7QA 1E89A 2HOQA 1LJUA 4LTDA 5FBZA 4AB1A 1NQVA 2NPFA 3ZI4A 3PDUA 2BD0A 1RHQA 1V5EA 2Q27A 4F3RA 3X1YA 1JG7A 3OEHA 5JCJD 3W3AA 1MJHA 3SVTA 3KSUA 4EG7A 2O20A 1M6HA 4FYVA 3O8QB 3BWXA 4LCBA 1MOZA 3H2SA 1AK1A 3VO8A 2HRRA 3D8HA 3QU9A 4J90A 5G4LA 1PVDA 5K7SA 1SHJA 4H7PA 1NC1A 2PT6A 4EMSA 2LGJA 1YZKA 1NUSA 4L2IA 3K0FA 4LXTA 1TQ6A 2BFPA 3AFMA 3DFFA 1VDMA 2EL7A 3ZLUA 2H51A 3PQ6A 4NK4A 1HZZC 4F56A 4XFJA 5I9MA 3LKVA 1YZFA 1W6UA 2VXCA 1FP4A 2GM4A 3NBXX 4LQDA 4IH9A 4JODA 4ZVQA 3LLCA 1GY8A 3C8MA 3B3FA 3WL3A 2R5WA 4HQ6A 1PBTA 4HOYA 4V38A 3KQKA 4HDKA 1RBMA 3GMDA 2QT9A 3WOHA 1VCMA 1I3MA 1QO0D 2X5NA 1EVZA 2RH4A 3IODA 4UDXX 1A4RA 3PQ5A 3R41A 1AD2A 1T4GA 2Q9CA 2FF5A 3LVRE 4NJOA 5KYVA 1NXTA 3CE9A 4FUTA 4YAFA 5H9VA 1S1CA 2BMDA 4DIOA 4EECA 2XYHA 3ZHXA 4BBPA 2R6JA 1BAPA 3N58A 3AG5A 2BIFA 2EZTA 4P83A 3MBIA 3DYVA 1ZOLA 4MS4A 4CN8A 4RGQA 1GPH1 4IVQA 1CC1S 3B9BA 1AZSC 3IAAA 3SM3A 3WKDA 3WADA 3ZU3A 1LBTA 1CRWG 1PLJA 4U5QA 2DH6A 3IBSA 3L8DA 1IY1A 4HXYA 1YHNA 1OPXA 2E0IA 2UVDA 4QREA 2VSNA 3P9CA 3LP5A 4DXAA 3CLUC 3AG6A 4AJOA 1ESMA 3MILA 1IN8A 1ZJZA 4GPBA 4NCKA 2FXIA 4WN9B 2PUEA 2UV8A 3SQOA 1L7RA 4J1TA 5JI2E 1T25A 2H1SA 5D51S 3FTEA 3DKRA 1EAYA 3R3JA 3SYRA 2X77A 1A2KC 2AIRA 4Z9FA 1NC3A 4JLMA 3S2EA 2LKDA 1XCBA 3OUTA 4MWBA 4Q4DA 3KQNA 2X6RA 2V6FA 1IQPA 2W6QA 1AF4A 2XRFA 4QPJC 4WLVA 2C29D 3I2YX 2JGFA 3B3JA 1JKMA 4JH0A 2RKWA 1V5IA 4ZU3A 1OILA 4R9SA 4BTLA 1GL3A 4CG1A 4CI9A 2FUKA 2CXOA 3N8KA 1P1IA 4PANA 4TN1A 1SH7A 3UH1A 1T1EA 3KSAC 1WHTB 1XU4A 2ZE8A 3CVOA 2F1IA 3P52A 3QEOA 4RD4A 3UTDA 1TVEA 3J80A 1ZR4A 2P9YA 2XYQA 3G2PA 3NTVA 2I6SA 3Q4GA 3SKVA 4YPOA 2JFQA 4KAAA 5CXUA 5BNIA 3EAFA 3HVRA 3ZW9A 2IWHA 2C99A 3S1LA 4MWSA 1BJTA 1S2IA 1NJ8A 2R47A 2RAFA 2Z56A 2AG0A 4RTSA 2G6BA 4DR6B 3V00A 2ES4A 6REQB 3M82A 5I8WA 4UBLA 4HVTA 5BSVA 4MR7A 5DN9A 4ZK2A 1M7BA 3ADPA 3GUCA 2V8OA 4EGAA 5B36A 4MUMA 4I9FA 1TU4A 5JTUA 1KI8A 1N4DA 2AQIA 3EMBA 5CGQB 3WRXC 3QW2A 2E55A 3W5BA 1Z47A 1JHRA 1FS4A 5AKHA 1ZVKA 5A06A 5A1JA 1O94D 2C95A 3JYQA 2FB9A 4JLDA 1SVIA 4Y2HA 5KO2A 4DDMA 2IYLD 1NVDA 3LNTA 1PJCA 3CEMA 4BAGA 3QP9A 4FWIB 4OB7A 3FNGA 4QUBA 1FTYA 3TRHA 2ZSJA 4D0LB 2NUBA 3HDQA 1SU6A 3F7OA 4G5GA 5DPMA 3WGQA 1R37A 1A7AA 1YB6A 2G77B 3QKTA 4FFOA 4OP3A 5CP8A 5IUKC 1FMTA 2G76A 4Q9KA 3JAKA 3SJCA 4C7OB 2DU8A 5AW1A 3R3XA 2GN0A 2B6HA 4N8DA 4EX7A 2YFQA 3WV4A 1SIBE 3IIEA 1WKCA 3KB2A 4FFNA 4RCYA 3V7NA 4A8JA 2C0PA 3F1LA 3R6TA 2IFTA 1O89A 1IWPB 1VA4A 2RHTA 4AZWA 3N53A 4UMFA 2Y77A 4KQFA 3WL4A 3VSCA 4U7WA 3WLFA 1ULUA 3BMOA 1CUUA 3KZNA 2JJ2A 4WVLA 1VJDA 5KMGA 3Q9NA 5P21A 3OT1B 4C6SA 4M38A 1Y8ZA 1ES9A 4H3HB 4W5QA 1UDXA 5JZVA 1M1YE 1QIDA 4GX1A 4MIEA 5AKYA 3TAUA 1AB6A 1J2YA 4ZOBA 1LX6A 3PHBE 5CB0A 4ZV7A 5IHXA 4BTEA 2IEBA 3U7JA 4LWPA 4QHSA 2F1OA 4WJLA 1NYLA 1U0SY 4D80A 3DP9A 3DEKA 1OW3B 1CQZA 1DQZA 4UVIA 2AD1A 1OX5A 3LOPA 3T9AA 4AQDA 3PB3A 1XQXA 4KMSA 4W6QA 4R2WA 4KQXA 3HJUA 4A3SA 5BYAA 3RVMA 5CA0B 1H8ED 3VMFA 4RIGA 1G8AA 4NFHA 1O3YA 4KDCA 3SEZA 5B2FA 4I9UA 1KRWA 4KQ9A 4KO8A 4E6PA 2OLKA 2QHXA 5JAHA 2ICAA 3ETEA 4NJEA 4P4LA 2W6JA 5K0GA 3W8EA 1ULAA 1XMIA 3RS3A 2ASVA 3GX1A 2HHJA 2D2EA 4RQUA 4UUOA 5DGTA 4CKCA 2BYTA 1QHNA 1ILWA 1ZM2A 3I4FA 5E0OA 2GPTA 3WMEA 2Q1TA 1N6RA 2IDJA 2ATIA 4L5CA 2YC4C 4PC6A 1KIMA 4QPPA 1YR1A 5D3MB 3ZQUA 1NX6A 1SC3A 2RMKA 3LCJA 1Y6QA 2A9FA 3QWBA 1KI7A 4LXQA 3JVVA 4QLBA 1ZA1A 2VZEA 1L4EA 2VXOA 2IX3A 5L3VA 3GELA 5K0TA 3LV8A 3MERA 5JRDS 3UIEA 5DASA 1QIIA 3ZCVA 2ZI6A 2VA9A 2O2ZA 4CUKA 1W5BA 4CEHB 2X86A 2IH2A 4EB6A 1YI8A 2Z04A 4LZZA 3F8TA 1SWVA 4B32A 1A9OA 1E1MA 4U1RA 1GGEA 3WR5A 3KQWA 2JFVA 3EHEA 2C58A 2GB4A 3M9WA 1EIZA 4UUBA 3RB8A 4EA9A 4RKQA 1X2EA 3BGIA 1TLLA 3QF4B 1X7DA 4XM2A 1Q2UA 1DS6A 1Z73A 4OUDB 5HKBA 1DELA 1DAFA 1HBJA 2GSDA 2Z8YM 4RVGA 2YVUA 4WZAA 1D8TA 1XCMA 2QVBA 2X3YA 3TWOA 4EQ6A 2HWUA 2XUKA 5BWLA 1HZJA 2E18A 3PKZA 1AN9A 3PEFA 3QEJA 4JI6B 2CWDA 2FY8A 3W4KA 1HT1E 3HH8A 4KQ2A 4U9HS 3UJAA 3LUCA 1P74A 5HUQA 2BEJA 3C4VA 3MCWA 4DEXA 1T43A 2E7ZA 1E9EA 3D1VA 3QLVC 5ANRB 3ZGOA 3GLSA 3OQHA 4FINA 2E85A 4MYUA 3TNLA 1PSZA 1KVRA 4F60A 2WTUA 1PRYA 1QCYA 1LRJA 1ADJA 3TW4A 4AKHA 1CFJA 1N2SA 4TV8A 1SBIA 3M2PA 4EVRA 1ESNA 1O1YA 1XWWA 3BFXA 5DYYA 5H82A 1XZKA 4KXQA 4RSMA 5K3FB 4UZSA 3SIXA 2VEDA 5LOVA 3FVRA 3H2JA 2JVKA 3M9XA 5EL0A 1OU4A 1ZD3A 4FR2A 1Q11A 4U7JA 3INRA 1XDBA 3GFQA 3C98A 1GZHB 3DONA 2HSGA 3U3RA 2XJ9A 5IT4A 5EEGA 1NMEA 2FQXA 1KHHA 2FDXA 1A98A 2A35A 4BO8A 2VWPA 3JY6A 3SHVA 2GLTA 3FIJA 2VHJA 3IQHX 5KWJA 2EFYA 1V8PA 4W99A 1ZZEA 3T3EA 4WFKA 4RTPA 3PPIA 3F4LA 2BEWA 2YBEA 5TVKA 4NHOA 2EFHB 5ALVA 1IXRC 3DP7A 1ATZA 2I4NA 1VHTA 2R8PA 3LKZA 4IILA 2AFIB 2VSOA 1ZU4A 2R87A 1K5HA 3QBVA 1T2UA 1XXHB 1IZ9A 4MAFA 4JT4A 4MPJA 1TLFA 4D9BA 2O8DB 4IRUB 4R2XA 1JU9A 3DL7A 4F0JA 3VYRB 3SXJA 4IWNA 2EWWA 2CLFB 5FHRA 5J58A 4KXMA 1PFWA 1ZITA 3WMWA 5IDVA 1AK9A 3HFGA 2Z58A 3Q3GE 1EIWA 1KK2A 3LC0A 3V8VA 1SQSA 3DZDA 3FLEA 3G1WA 3I52A 4XDYA 4KYVA 5AHRA 1AHPA 2AG6A 1BGXT 1E3DA 3G2HA 3M83A 4KH0A 1OXSC 5A7FA 3H5NA 4E3ZA 3WV5A 1TTHA 4NYMR 2ZJFA 5AVQA 3LUGA 4BO1A 4QDTA 3SBDA 3M81A 4FE7A 3R3VA 1R3UA 2L17A 2R60A 1KI4A 1P4HA 4GI5A 4BEWA 3PEWA 2I9KA 3A6HA 1ZD1A 1QRSA 1D8AA 1JDVA 1VGRA 3E48A 4BMOB 5BWCA 2QTGA 2Y1WA 1E3JA 1SOVA 2UUPA 4IJMA 5FI1B 2RB5A 3HB1A 2H4XA 2GBLC 3MD0A 5AK0A 5DGHA 3T4XA 4ALKA 4BX3A 3GLHA 3BKXA 3NC0C 2VQSA 4EH1A 2AR7A 3ITKA 1DTSA 1V6AA 1WB4A 4JASB 3VR6H 5EEHA 3ZDEA 5L6LB 1B0UA 1ULSA 1UWLA 5IT9A 2EV9A 4YHBA 2WQ7A 1BSVA 1H0HA 1KAMA 5AKLA 5KNDH 5IKPA 3GBVA 3ER9A 1V7CA 5KQMA 4X3OA 3WHKA 1FFGA 1YHYA 4KLCA 4ZPXA 5FJJA 5GWXA 1CP2A 2V7BA 3FKJA 3HR8A 3N0RA 5JALA 3GEHA 3RTBA 4B3TB 3DO8A 1FQJA 4OFBA 2P69A 2HNAA 3FVVA 3E7XA 1AKTA 3OJXA 4KQJA 3DOFA 4Q3BA 1DCKA 4H1TA 3SC4A 4C89A 1KC1A 2A5JA 2IZ0A 5EWJB 1YRBA 2XEXA 1VE7A 2ZETA 1RMYA 4FBMA 4UUPA 5D01A 2IHYA 2ANBA 1K3UB 2BFDA 4G0ZA 4NPCA 4OK3A 3RE1A 1B74A 2PUTA 2W2TA 1TJPB 4QPCA 5G4KA 2AC4A 4QC2A 5IP5A 1EP3B 4G0WA 3SHQA 5JATA 1NVBA 4PLPA 1JSXA 3TZCA 2CC2A 2AL7A 4OA8A 2Y05A 2JLCA 5B3KA 4WXEA 4HPXB 3K9GA 4M76B 1XJ5A 4AZSA 2OV8A 3LHKA 4NXNB 3CXUA 2P3SA 3JX9A 5E3HA 1H93A 3RRZA 1DJLA 1N6OA 5J47A 4HQNA 3OA2A 4JFAA 2CB0A 2G6TA 2ZYAA 3QBJA 4LZLA 4PBRA 3SBXA 3ZJ5A 4TZKA 4CMCA 3FWHA 4EGFA 4IZIA 1ZH8A 2EL9A 1D6NA 3LP8A 3PD1A 3IP3A 4Q6WA 1PX2A 4PYKA 1EDOA 4X61A 4BQEA 1DFHA 1VJ0A 1PQPA 4AM8A 1MORA 3BEDA 3WP0A 3EVTA 3BZUA 3PYLA 4JBYA 1IXZA 1Y8QA 2E48A 3QVLA 1NLMA 1GV0A 3E81A 4Q9AA 3M5DA 3JQBC 5J4LA 4PGMA 1ZQ1A 3GIWA 3AFNA 3I58A 3AB7A 3B36A 1FP7A 4DBZA 1VKZA 2W43A 1FW8A 4MRMB 1BDJA 1CUSA 3SU8A 2AW3A 3EFOB 1ZN9A 4ZTBA 4BN0A 2HQSA 3D4IA 4OL0A 3UH0A 3WLQA 4YXWA 1CZOA 5BVGB 1VCOA 4D0SA 1I5RA 1U9IC 5JCOA 2GKOA 5IJAA 3WGNA 2D0IA 3H1FA 4Q3CA 3EQ2A 5CDYA 4WZBB 2ERXA 3AVXA 1R10A 3K0CC 2PSHA 2C7OA 1HDEA 4OQXA 3B8HA 4DV6B 1P18A 2JNWA 1K08A 2QD3A 4AN0A 4N5NA 1G19A 2V4MA 2UYCA 5BQ5A 3PCXA 1Q2XA 2O0LA 3HDYA 4ZO7A 3VYSB 4M46A 1O4VA 3AJAA 1WQ4A 1Y1QA 4X24A 2X3UA 1JWAB 5TGTA 3DE6X 1CBUA 1GZ5A 2RBKA 4IH1A 4RTLA 4V1CB 3JYNA 3I6IA 1OBCA 1T9GS 1WZ2A 1LKZA 2JEOA 1T8WA 3ZTWA 1OI3A 3OZFA 1YCFA 2F3QA 4EJSB 5NLLA 4DIMA 1TADA 3LPMA 2FHPA 4GPTA 4NNJA 1U4SA 1DBWA 2BI4A 2HCBA 1TYCA 3IJ5A 1BQEA 3H5AA 3J7TA 1N1DA 4DA9A 2A7QA 5IVHA 5A3VA 3VR3A 5H8WA 2ZBRA 3C7KA 4YCDA 4L4YA 3BD6A 4UDOA 1TFUA 4RVNA 1Q0UA 1E9VA 1XDZA 3E53A 4DA7A 1FJGB 3MAAC 1JZTA 1YL6A 3CBQA 3GGCA 4EFKA 3SBOA 1F9EA 1BVHA 1DJQA 1KEVA 3BEOA 3ZU5A 1QHXA 2IE8A 2ZT6A 1J1IA 3IQFA 1SUPA 3CRVA 2YBDA 1J5EB 2WYOA 4W1RA 3VJLA 4D9IA 2OFOA 2B2NA 4HS4A 4S1TA 2OGUA 4QSMA 1DFGA 4B6GA 1G8PA 4UOEA 3EC1A 3FMOB 5FB3A 2VJQA 3CVXA 3U3KA 2DBVO 1A9SA 3AW8A 3EZYA 2B82A 3F3SA 4IFTA 2OMEA 4HGRA 3USES 5HFAA 4A8TA 4YK7A 3I8XA 4CL8A 4FBGA 3OOWA 4M8IA 3I32A 2CY0A 3Q10A 3PENA 5DI9A 3RJTA 2V7WA 4QO7A 1F48A 1RYZA 3C24A 4MYSA 4NRDA 2PX3A 3HI6A 5CD1A 1O6CA 1QRAA 3NXSA 3PU6A 2IYAA 3IXQA 1NFQA 2AGVA 1LWOA 2PZLA 1L5KA 1XZCA 2ZI7A 5KJ1A 4CLEA 2HIGA 3KZOA 3TIXB 4IHJF 3CLKA 1MGPA 2FWJA 3OOJA 1KOJA 2ZAGA 1P29A 4E1AA 2O5RA 5CDTA 2PBFA 2WQ6A 4INPA 1T8TA 1XRSB 3VAAA 5HFJA 4MYHA 3UF0A 2QRJA 1RQXA 3B1FA 4BFUA 1MR3F 2B4KA 3G5UA 3TOCA 2YQZA 3TH5A 3WKAA 1JL3A 4OH1A 4ES6A 1FQOA 1XHFA 221PA 4PAWA 4US0R 3U1TA 3FNHA 4UUQA 1KKUA 3PZBA 2ZGVA 2VH2A 1VCNA 2BEUB 1KEEB 2CD9A 2G7ZA 2PVPA 1T4BA 3ACCA 2OM2A 2BJVA 4PEVA 1FRQA 5EIBC 4WE3A 4A27A 2RD2A 4LNUA 1UJ2A 1P7ZA 1JR3E 3BGDA 1WY7A 2VN8A 3HU3A 3WYCA 1Q15A 1M6VB 2ZCUA 3EGIA 2CUTA 2YS7A 1NAIA 4XCVA 4I2VA 1HYQA 1QTNA 2W2PA 4FEAA 2FP3A 1CFZA 1BC5A 4Q1DA 4QOHA 4CT5A 1QYCA 1QGYA 3EF1A 1JECA 3K0BA 1T9DA 1L7PA 1I6MA 3CKKA 4GIBA 3QITA 3PE3A 5D5PA 5C4GB 1R0WA 1L5OA 4ZCTA 4KO3S 2CJFA 5BXQC 4M0PA 4FD3A 1PNOA 1TZCA 3AL0C 3OLVA 3TFOA 2FVXA 1KETA 4QXMA 4DB4A 1N9GB 2JKYA 2PZKA 1NJ1A 1P0QA 1QZZA 1XEWX 2V7QD 2V97A 2WK1A 2YY6A 4G0MA 4JDUA 4KAFA 1Z6GA 4GQAA 5CTAA 5K0EA 3WLAA 2BBTA 1NNI1 4Y9UA 2ZW9A 1ZA2A 1Y9ZA 1QIJA 2P1DA 3EWIA 1OZFA 3N2KA 2H3HA 4OXIA 3EDRA 5BY2A 3WLEA 3HDHA 4DG8A 5BVHB 3EEBA 3NATA 4I50B 2WTAA 1U90A 1E99A 4D02A 1AY0A 4HNTA 3H1AA 3BE6A 3N2GB 1CUEA 1OTXA 2GPNA 3MCAA 3QA9A 2QNRA 3GLGA 3LYLA 1J9ZA 3GB9A 2M6LA 4KN9S 3U48A 2H63A 5BV1A 3UKOA 1NLUA 5KYGA 3I4CA 4RVSA 5DWVA 5AK5A 4L3VA 5LYJF 3D6VA 5FTLA 1D6JA 2Q3MA 3ZGVA 4FGSA 4FFPA 4DZRA 4B09A 1KH3A 1I0ZA 3A6FA 2PAAA 2QN7A 2VQFB 2ACVA 4PYNA 3A6KA 4FVTA 2WICA 3IKJA 3VDNB 1WXIA 1T2NA 4LGMA 4Q4JB 2WYHA 1KDPA 3OZSA 2BISA 3P9QA 2HYDA 1CHDA 1NKTA 4V0NA 1X7WA 4MVJE 1N7GA 2VOJA 2BMJA 1YQGA 2WKRA 1MV5A 4X71A 5EVCA 1KJZA 3M6VA 1KMIY 1OZGA 3RRYA 2VTBB 1TEZA 2YIDA 1KP2A 2X7JA 3QXXA 4KITB 2FN8A 3IPAA 1KRXA 4O02B 4MIKA 1W4RA 1ZU5A 4DT1B 1PUJA 4XARA 2J30A 5DHFA 4TLBA 1HFKA 1W44A 4ZV4A 1OASA 1TFRA 4JUDX 4DW8A 1XELA 1ODFA 4KYIB 1Q5PA 4URZR 3ZDDA 1W36B 2YHBA 1JFLA 2ZYUX 4O4LA 4XGIA 3RK0A 4F2WA 2JCGA 4QNMA 2BBSA 4IJWA 3UWKA 3OPXA 4WGFA 5A6VA 2GN2A 2VI5A 2WUVA 1UC4B 1Y1LA 3T35A 4C0XA 4KHPB 1DBRA 1N32B 2PGOA 1WXXA 2FRXA 5I7WA 2X9GA 3CV3A 3R0VA 4FOLA 4KIWA 5GP1A 4BGDA 1MO4A 1FW6A 3Q7RA 4JQZA 4QGSA 1XMQB 3UGJA 2OVBA 2R5FA 3HO1A 4EUHA 3UFXA 2ZIXB 2VP4A 1HETA 4PFKA 4HEA1 3IOEA 3L4BC 4BECA 5AVKA 5GIPE 3V7UA 4LXXA 3UT5A 2OV2A 1UKZA 1MAWA 3EGWA 4YAKA 5L3SA 3IL2A 2OCGA 1RHRA 1J0CA 4ARUA 3WS7A 3F0TA 4D9JA 1V3QE 4RKEA 5JCZA 2D1YA 4WTOA 4QQNA 4LCJA 4HD8A 1SC4A 3K73O 1QGZA 1JLSA 3B1JA 5KYYB 2AUTA 1ZVMA 1ECLA 1Z2NX 3CNBA 3F4BA 5CYPA 2OBMA 1GGVA 3L2OB 3T3DA 3FETA 2O2SA 3K5IA 1L1RA 2C42A 5DNCA 4OKSA 4DQDA 1JJ7A 1GKKA 2B8NA 2PTHA 3BUSA 1EB8A 2DBYA 4JI5B 3PPVA 4KREA 3ESRA 3WLSA 4BMZA 2XAAA 1OBVA 4GYJA 4L95C 4HBZA 4MGZR 4BQPA 5C1DA 1QRTA 2DFNA 3IR6A 2HY7A 1EG2A 4UEOA 2ZAMA 4YLEA 1USUA 1V5FA 3GJYA 3UBMA 4EFLA 1NVKA 1P9WA 2H31A 1YBVA 4HLUC 4KVFA 4Z4EA 3OM9A 3UWPA 3OAAA 3HC7A 2MYUA 4BV2A 1Z6PA 3ESCA 5HZGA 3HXQA 4NDAA 2NP7A 3CNLA 4FJ0A 4CIYA 1LTKA 2P1ZA 4OHMA 5AUQA 2DBZA 1WAMA 1XK7A 4QVKA 3WICA 4I1PA 3IP5A 3H04A 2I4IA 3LUJA 3CSDA 2DR2A 2JRCA 2WU8A 5GZ3A 2X15A 3TQRA 3ILHA 1CIJA 3U62A 2XXJA 5DI3B 3L77A 3UCFA 2NQ2C 2TMDA 1D6MA 1DKOA 1UBMS 3BMCA 4R54A 4PYRA 2OPHA 3RWOA 4QYIB 4ZI5A 1FVOA 3D3QA 2WG1A 2QU7A 3ND7A 4XUDA 3ZUPA 4Z1MD 3ZV4A 1Z28A 1O6FA 1RLMA 1ORDA 4XI9A 4E08A 5K4HA 4BWFB 3G2NA 4Z3DA 3OH8A 5FEMA 5HIAA 2BFNA 5MGBA 4D3DA 1YFZA 1HQKA 1ZONA 3G2IA 4NV1A 3HDGA 3OETA 3GEIA 3V1TC 1XTJA 3FGPA 1I5EA 2X22A 3HHEA 4K6FA 2WUDA 4XOUA 4G1BA 4F72A 1N6LA 3LC1O 4AKSA 2OPBA 2A78A 1V9CA 4YAUA 1HYHA 3GVIA 3PFIA 3MCTA 3AESA 4NYJQ 5FOQA 5K3DA 1RCFA 2VTKA 5KX5B 4K03A 4LEIA 5ITZA 3SZRA 1R6BX 5CBKA 2IZ5A 2QRLA 1EX9A 1J5XA 2Y2VA 1SRRA 2ALJA 4OMDA 1Z0DA 4TMYA 3RYIA 4HTFA 4S12A 1WRBA 2VWQA 3T12A 1XZPA 1NN0A 3GG9A 1ZKMA 2XRMA 5TMEA 4IDFA 4LRYA 4BJ5A 3ZZTA 3T1QA 2W42A 1ZXBA 2IOQA 1HF3A 3AVOA 3H8SA 1AKUA 4EPXA 2YYSA 3ZY2A 4ML3A 5DFAA 1F0KA 3VHQA 4C0KA 3PT5A 2OSBA 2AE2A 4RIFA 3EXHA 4GXQA 4TRMA 3PQ7A 4Z2YA 5AKXA 4C5AA 3A2LA 1QH9A 4XIGS 3ZCRA 2WSMA 2QSUA 3VKGA 1UP6A 2HM7A 3JRXA 4AJEA 5HTOA 4BMPB 3DMDA 4WL0A 1U8CB 3PQFA 4CM8B 4L75A 3VR5D 1H6DA 4CMEC 4DCUA 1RWNA 3M33A 5LVAA 5TQ2A 4H15A 4OQPA 5DGXA 5JDCC 1XTRA 4ZT6A 1TF2A 2ONZA 4MVJI 4YJ2A 3K9BA 3ZXYA 1GKIA 3RWBA 3JQGB 3MWFA 2PUHA 4R05A 1JQBA 1QYVA 4AP6A 1SC6A 2O59A 1JILA 5IF3A 4EI8A 3GJQA 4KNYA 1DI0A 3C3JA 1LBHA 3ICCA 4OHCA 1A8IA 1PR4A 4GI7A 5CA0F 5AMXA 3C1UA 3F78A 4N5HX 7ADHA 5LU8A 4OGKA 1SMKA 3GRZA 2PX8A 4WADA 4OQZA 3OECA 1MC5A 3PVSA 3W5IA 2BFFB 4LDQA 5KIAA 1S7CA 3VR4D 2O2HA 2C84A 2D00A 4IXWA 3PI7A 4KRFA 3HKDB 3GZJA 3L82B 3BMQA 3LCCA 2PSJA 1GAEO 5JHGB 3ESXA 1CJBA 2C9ZA 3C7DB 3P1JA 1JLKA 1MQSA 2D1SA 2ZB4A 2FSIA 3U1VA 1D07A 2C2GA 1AHNA 4ZA2A 4IRMA 3L06A 4OAOA 4OHFA 3TE6A 5DIZA 2XDYA 4D42A 3I04M 3DOIA 3FCYA 2C5EA 3Q1KA 4D25A 1RABA 5TQ0B 2GVNA 2HRBA 4MVJG 4CDNA 1A9XA 3DG9A 4B80A 5F77A 2WIGA 4WY5A 4EHIA 3O94A 2QP4A 3U19A 1H94A 1EJ6A 2UZ4A 3BIXA 3BULA 2BFWA 1WMDA 2BBOA 3EY9A 3HKCB 4RZ2A 1U0NA 4C4PA 1TB4A 2GEBA 1C7FA 3R7BA 5E9QA 4KC0A 4XB6B 4U2EA 4BO4A 1W7AA 3H4TA 1HQYE 4KGDA 2CMDA 1TXGA 1GP2A 1T9HA 5DH9A 3KJZA 3QZUA 1GPNA 2ODNA 3I9KA 2X2FA 4Z3OA 2CV1A 3G2KA 1RJ9B 4MCAA 5AM5A 4RA9B 4IZOA 3AB3A 4HLCA 4NAVA 3RF6A 3UK0A 1D7OA 3CONA 3QUCA 1VJRA 3ZKWA 3SHOA 5T8KA 1F2TB 4WK0B 1E59A 2L69A 1DKLA 2F17A 4FB5A 1XZFA 2GHQA 1KYWA 3NG1A 3ZWCA 1NQAO 4XKJA 1YJCA 2WR8A 3BL8A 4OU5A 4RV4A 5EZ5A 5HSGA 2R62A 2VYNA 5BQ3A 3Q6IA 5CK4A 4Y3UA 2JBAA 4E2WA 1K4YA 1KVUA 4FFVA 3E58A 1E4YA 2FWMX 1M6WA 3OJLA 1QV7A 1Y33E 3GZTB 5EIWA 2WUWE 4EGQA 5KTSA 4B7AA 2GD0A 1GSIA 2IWRA 4MW5A 5JDIC 1U8AA 3FWYA 1KAOA 3LW8A 4LTMA 3WMRA 1FU4A 4BNZA 1OYOA 1A9QA 2F43B 5EQDA 5ADUS 5LLDA 1FSSA 4H7IA 3GLKA 4UHJA 3ZY3A 8AT1A 5J40A 1C3LA 3PPYA 3ZNQA 4G8CA 4LA4A 4L74A 3O73A 1HYBA 2HA5A 1USGA 3CC8A 3OPYA 4G81A 4YDHB 2H1OA 2NZVG 2WJYA 2RIPA 1WKVA 1IYZA 4G5XA 4Q4LA 5AJVB 2PX4A 1LK0A 3BD8A 2JGNA 2A7XA 3HVJA 1NNLA 1VI2A 4OGLA 4DY4A 3T5MA 1QH8A 1QHGA 4MW7A 2QD4A 1X7YA 4NQRA 2AJBA 3G68A 1IDOA 1QQBA 1O95C 1PGOA 1JZQA 1D1QA 4QYTA 5CB6A 5JYDA 2I54A 4FC7A 3RQIA 3B6ZA 1QR2A 2J9RA 4CLRB 4JNCA 4LIPD 1BGWA 2RJOA 3H5LA 2BZ0A 1I2CA 4NABA 4LI3X 1TVCA 2RAUA 3O1JC 4B85A 4LBVA 5EAIA 4Z9AA 5FWXB 4ZVLA 4XX1A 1X42A 3FYDA 5KYTA 3DE3X 5DBHX 1H85A 3B7PA 1FNDA 3BRWA 4MICA 4BNMA 1ZMTA 1TK3A 1UC5B 4R68A 5F7XA 2CLEB 2JW5A 3QU7A 2LE0A 3E70C 3WK5A 1QS0B 2W4IA 2C03A 1T2VA 2H5LA 3S7ZA 4M1EA 1DC5A 3ISTA 1FY2A 2TECE 3VNQA 5ADVA 3C3AA 3D7RA 2CDRA 1VMEA 4JJ8A 3T38A 1T3ZA 4C5CA 2FN3A 3O8LA 1CJKC 4U8HA 1GOTA 1Q77A 2G28A 2HDWA 3SIRA 2FDCA 1O5OA 1SPBS 5BO5A 1L5GB 1O9BA 1S9HA 2JH9A 3LPAA 3OQOA 2DQKA 5FLYA 4IF6A 2DQZA 5B4UA 4YV2A 1S8AA 4Q1AA 4DEYA 4MKFA 1L7DA 1UEXC 2M2IA 4C43A 5ICCA 3KKOA 3LUFA 1GTZA 3LO5A 3THYB 1SZCA 5BV8A 3HCNA 1MG0A 1HRKA 1SD5A 3VQTA 2Q07A 1FNCA 5C7LO 4KBYA 1A8QA 3GGPA 2CVQA 3BE4A 5JSFA 1FQWA 4O4HB 1HNWB 3AKDA 5JEDA 3C6BA 4KUEA 5BV0A 2FZWA 2WJZB 1ENPA 2ZJAA 7AT1A 5ALZA 2VC2B 2V7GA 1U63A 2EJWA 3ICVA 4JVMA 4PFJA 1LD3A 1PR2A 2BMAA 3DV9A 3D2LA 4UARA 3LLUA 1J5PA 3CR3C 1YKGA 1K27A 1U8XX 2QRQA 2ZRCA 4PX3A 4XH9B 5AJZA 3H83A 5HBGA 3EPJA 5I7EA 1USIA 2DJIA 4Y9DA 2ZU6A 1P19A 3ABIA 1E9CA 3FR8A 3TM5A 3AF6A 2GRJA 4HQ0A 5IJ0A 1LW6E 1QAQA 3CRNA 1SN7A 3L05A 1AGNA 3HDTA 2QQFA 4ZYZA 3C6KA 4YBRA 2YWBA 5LQCA 4H3SA 5HK8A 2AN4A 4GO1A 1P2FA 1FMFA 3LP6A 1YNOA 4RHYA 3LH5A 3W7BA 3IMFA 1U2SA 5DWDA 1TRHA 1L1FA 3T99A 3NRJA 2HPVA 4G37A 4LDNA 4ICIA 5AI6A 1JKIA 2NSYA 1Y6FA 1YC5A 5IULC 3GEDA 3ZXUB 3VPAA 3WRVA 4NCJA 4Y9SA 4MW6A 1L4KA 2GUWA 4RX1A 4GNKA 1U1FA 2W4MA 1U0EA 2Y76A 3ADKA 2VBIA 4H17A 1CULC 3K1YA 1NKVA 4JBGA 4EATA 3U1BA 1DXQA 2PEZA 2RARA 3I6QA 1Q0TA 2BAGA 2V5UA 4IO1A 3DVLA 4C21A 2O8EA 4BMXA 5DNEA 4HAZA 3ZIUA 2Y6VA 1EFPB 2IPMA 3MAJA 4EMUA 1RI4A 1G1MA 3F7NA 3M6FA 4PRZA 1JGTA 1GQRA 1VE3A 4J43A 1B8VA 1J0EA 4U7HA 3U44B 4P32A 3TSYA 2XTNA 4BLQA 4RD0A 2A30A 3MJEA 4AUKA 1KY2A 1DT5A 2ZUWA 1M2VA 2XDAA 2AOTB 4DGSA 2YCLA 3LUBA 1D2NA 3GYGA 1W5FA 2FMHA 4QGBA 4IX1A 1KJWA 1ZOPA 4DG5A 2E87A 5I8ZA 2HCTA 4EKYA 5EHGA 3H75A 3M6XA 4LMAA 5IH3A 3LF1A 3B3QA 4YMGA 2D1RA 2HADA 3GQBB 3QELB 2AVNA 1CB7A 2NYAA 3HB7A 4HTAA 1PGNA 3K2QA 3T15A 1S9DA 2X8WA 3T52A 3V4VB 3IAXA 1QZXA 4PINA 3F5MA 2QTVA 3G5MA 4IUBS 1JDSA 1A0OA 3Q6MA 2I33A 3QU4A 1G21B 2O0JA 2GDZA 4LYYA 1RZVA 2TSYB 4J1QA 1VRCA 4Y1FA 3JSXA 5FUXA 3WNDA 3LT4A 4OJKA 4C3UA 5J1SB 3NIGB 1WBJB 4QFCA 1MB9A 1N0UA 2O1XA 5HW0A 5JQGB 1J06A 4Y8VA 3ZQ4A 3ENVA 3WK4A 2O2IA 4RPLA 5AOVA 4OI1A 1T5IA 1PG2A 2I3BA 4P2BA 4RS3A 5CAEB 2HJHA 3CUSA 3P45A 4MV6A 4KWTA 1MJ5A 1BIFA 1ZRNA 2YRFA 2D06A 3CW2A 3C97A 1PT6A 3EWSA 4M6WA 4OOFA 4RMGA 3VPDA 1OHHA 4F5EA 2HHCA 2VZ8A 2FW9A 1DAOA 5HEKA 2BLLA 4NQZA 1PZHA 4KAXA 4D97A 5IKOA 4LQ4A 5I8PA 2OP1A 4X62B 1KS9A 5IKMA 2X7HA 3G82C 2P4HX 2H00A 1LPSA 4L4SA 4L1KA 3SICE 2B8WA 4ISCA 4P36A 4XM0A 2EHDA 1ODLA 5K0CA 1O4WA 1IPHA 3LRTA 1KPIA 4YQEA 4F5DA 1P39A 1S01A 1OH8A 3DV0B 2WD7A 3PCTA 4OQEA 2NU7A 3A6LA 4AP5A 1CR4A 1NVMB 4X95A 4GQIA 2VNKA 3QKRB 5KHAA 3SYMA 1V11B 1A8UA 2PDAA 1Q57A 1HE4A 2WT9A 3PC8A 4JOSA 1GRCA 1GN8A 2VAWA 3E7PA 2HQBA 3S28A 3K6SA 2HIAA 4P7GA 2YICA 3O8BA 1DO2A 1G98A 1LB1B 1XQVA 1J0XO 1JW9B 1JLRA 3JQFC 4AXBA 1E9FA 4REQA 4YJGA 1U7UA 4JSTA 5E6UA 3N86A 5DGIA 2BE7A 4JI8B 1OU0A 3AILA 3SIPA 1EFAA 1BD4A 4L7QA 3L49A 4GLBA 3FCOA 4JDPA 2WSSA 4HDNA 4W4TA 3LA6A 2JH3A 3BG5A 3WGVA 4DRXA 2XE4A 3SF0A 2VWGA 2ZSBA 3ASYA 3QWHA 3UFBA 4XWAA 3LY7A 4ZO4A 4YB8A 2BR5A 5JD5A 3AJ9A 3OPQA 4NFSA 1JIVA 4ARBA 1SWWA 3ADDA 1KY3A 2XCOA 3V4RA 1K92A 2UUBB 3KDSE 3OP4A 1RLUA 3KQUA 3DD5A 3G9QA 3K9LA 1G4HA 1YMQA 5EE3A 3TKAA 4ZMSA 3VKHA 3IP9A 2PPVA 1H2XA 1PZFA 3EJ6A 4DMGA 3V8MA 1RRFA 5JXJA 2JJ8A 1RDFA 4K8RB 4KIFA 5GONA 4DMKA 5REQA 4FJ2A 2H6EA 3PUWA 2ZR8A 3KEFA 2HFKA 5KDDA 1UKYA 4B2YA 4IXTA 2G06A 2WG0A 2UUCB 1EM8B 3RUDA 1XEAA 1GZSA 2V6MA 8OHMA 4Y0AA 2W5UA 1T4DA 3I37X 4Y2GA 3TIGA 2H0RA 4H59A 2OCKA 4XUGB 1K0FA 3RTCA 3SVLA 4QDOA 4CLHA 5JD4A 1HLGA 5KNLA 4K9OA 5BT9A 3AFGA 4TTJA 2NADA 3WJ1A 3ZY4A 2P9CA 4MQEB 4K9SA 2IYXA 1JALA 1NY5A 1GNRA 4KNWA 4Z8XA 1U2PA 2WU4A 4NKRA 4LRSB 2OYRA 1S4QA 3SSAA 4Q3EA 1YBFA 4L50A 4PICA 1NXPA 4RM2A 2GUGA 2HJSA 5B3AA 3RV4A 2P8SA 2V59A 1OFIA 4BKQA 5IMSA 3GRYA 1LK5A 2CUNA 3I92A 3L04A 1AV7A 4I50F 1SA0A 1VSBA 2X7XA 1RI1A 2ZR9A 2WAAA 3NBZC 4RHCA 3STUA 1J20A 3MQFA 4EBFA 1M2NA 2C4MA 4JJEA 1ECGA 4KR0A 4OK5A 1HLDA 2FZEA 1ST3A 1WMFA 4KI7A 5HIIA 2QENA 3LWDA 3P0FA 3ZZ0A 5C4IA 3ENZA 1NA5A 4B17A 1KA9H 4H1UA 1BH6A 4LK3A 1KU6A 2PGLA 3RO7A 1USVA 4E5DA 3IBFA 1MEJA 4GM4A 4GLOA 3H1EA 3D3NA 1AVTA 1CKEA 4MP3A 1NW8A 4GMDA 3HN6A 4YP5A 1Z3IX 1TTQB 1VPLA 4I1SA 1XDSA 1DQPA 1T4MA 1IRIA 2ZWVA 3IS3A 4M1ZA 1E5QA 1XF9A 4RMIA 3G0IA 2NXJA 5ELLA 1G5QA 4GOMD 5EZYB 2P2YA 1CEXA 2ZBEA 3KYDB 1PQYA 5JO0A 2WKPA 2JLXA 2IOHA 1IOWA 5EFOA 1NDHA 3LDHA 3ZGNA 4XX0A 1DWPA 1WHSA 1L4HA 1G6HA 3H05A 5L3QB 1GGFA 1T29A 1WU8A 3FDFA 3MWGA 4WMLA 1I7SB 4P7BA 1XQ6A 3ZD7A 4OB8A 4BQFA 1U65A 3UB3A 4J0DA 2NUTB 2B92A 2XGOA 1ODCA 4E21A 1E4VA 1TAGA 1WXHA 1DHRA 2JIOA 2WMNB 2ATCA 4OGFA 4YRZA 2OCBA 2I2WA 5JQWA 2D0OB 4DCPA 1FZTA 1L5MA 2PR2A 2HNKA 3Q1LA 4NG5A 1RQ2A 2P2CA 3AHEA 4IXDA 2JASA 3HJCA 5ENVA 3K70B 2IQIA 4FT2A 4L73A 1ZK0A 2W2KA 3W6OA 2GF0A 1MC4A 1BMFA 5CEJA 2WILA 5IYZA 1KZ4A 3I76A 2G83A 3GFGA 1J8YF 3UATA 4GKBA 5EP4A 1KYQA 3ZK7A 1GAWA 4BP8A 1XUOA 1X7ZA 3TPCA 3I5XA 4GLJA 2EZ4A 4RPGA 1VYVA 3NJ8A 1XVLA 4CFYA 4C7BA 2RK4A 3B9QA 4BTVA 2XNDD 3IVRA 2V7EA 4JOCA 4Q4HB 4AZ0A 1VHWA 1XTTA 2AX4A 3KLBA 4A26A 2IA5A 2DEUA 1IJKA 3EH2A 3IALA 4Q66C 2CJWB 4S1NA 1TQ4A 3MINB 5EKSA 2QTLA 2LCQA 3TB4A 1TKCA 4GU5A 2XT0A 5HE9A 3BH6A 2ZM5A 2XVMA 1ODKA 3TLGB 3NEJA 1SULA 3UYLA 2C61A 3RNLA 4BB9A 1HEIA 3TEFA 3ZHYA 3S2FA 1VPWA 1SXJC 2MMGA 1SQGA 3KB1A 3H17A 3P5BA 4WXRA 4MI1A 5CR9A 3W6PA 2PZFA 3I62A 3WC4A 4YJHB 5IK2A 4PTLA 1MB4A 4YRPA 1W85A 2QZ4A 2AWNA 2BKXA 2PAFA 3S2GA 2LVBA 3G5TA 2ODPA 1RJEA 3UXMA 3TI9A 1E1KA 1Y3CE 1R9NA 3X1KA 1GZ7A 4RSHA 5HP4A 2Z9BA 1H5NA 1U2GC 3C5EA 2B6NA 2B37A 2ZRFA 3MWDA 2HHHB 2VBCA 3GPIA 1J2EA 5J3JA 2O8FB 4HLDA 5F3RA 2ZBVA 4DIUA 1XD2A 2Z8XA 2AH5A 5A4DA 1R4MA 2BZGA 3M7IA 4ATNA 4FYPA 4ZAZA 1JHAA 2EJVA 2BVNA 4O2RA 4TXLA 1ISHA 1QG0A 2DQSA 2J1LA 3KVYA 4LJ5A 4R1TA 5BMOA 4KR3A 3GL9A 4H16A 2J07A 2VR1A 2YZGA 1UPUA 5FV7A 4OBBA 1BS9A 2VP6A 1SUBA 2WLTA 3OG9A 4PLWA 5C5EA 1FS6A 2APJA 2JH8A 1W9HA 1WXGA 3BD7A 3F98A 3K4PA 4FYXA 5ICFA 3ZQJA 1RWXA 1XROA 3LBHA 2NX2A 5ALJA 4F21A 5A3RA 2WTEA 4JLUA 4NJMB 4D3YA 3OX1A 1QONA 3PR2B 3SC2A 4YCNA 1R0CA 1PBNA 4U3JA 2QRUA 1NVFA 2DPHA 1Z6QA 3ZGZA 1UZMA 3TINA 4U02A 3UGKA 9LDTA 2XKAA 1E0AA 3E5MA 1NW3A 4AKIA 5E2AA 1VM6A 2PXAA 4KQ1A 2V6JA 5IAAA 2AF4C 3RIMA 1GUBA 3KLOA 1TF7A 5KX5F 5TT0A 4BP1A 5LZ9A 1BU5A 3OESA 4PAOA 3H6HA 2OQRA 2BV3A 4X60A 2H5JA 4JS0A 1IPEA 1BD3A 4X97A 3Q15C 4YXFA 3PXXA 1ZDMA 5CFMA 3GLIE 3OX3A 2GILA 2XNCA 1UZUA 3RIEA 5B4VA 2PVSA 1PS8A 2G04A 3BE8A 1LLUA 4R5MA 3X1ZA 3ZE6A 2BFBB 3JYLA 4AIIA 1TTTA 2GFHA 4ME6A 4D7AA 1YS7A 2ZTVA 521PA 3RS2A 1HPLA 2HI0A 2GI4A 5HQ3A 1FTNA 2I6TA 3BXPA 3IA2A 2LDXA 1MB0A 1J2RA 3ZBPA 2HL6A 5LQMA 2VQEB 4CU5A 1WCYA 4N6NA 3SMVA 1OFGA 5KDLA 3FDZB 1L0BA 4PCAA 1D0SA 4UREA 4YA6A 4CG0A 1JKJA 4RESA 3STTA 3BIJA 3IB3A 2ON6A 1ZCAA 3I1FA 3B78A 1ISJA 3SF8A 4FKBA 4M99A 4BP3A 1M1NB 4EX6A 3KX2A 2NQTA 4RVUA 2QAGC 5A2GA 1XF1A 1Z15A 5L45A 4HI0E 1PWXA 5CMLA 1K6EA 3MRXA 4CWAA 4V0SA 5K8LA 2RGWA 5JNSA 1LLCA 1U02A 621PA 1HLFA 3EZNA 3EE6A 2PGJA 3UHOA 4LVUA 4KIGA 4UU0A 5AI5A 4YUVA 5TNXA 2OV6A 5IKEA 1RLOA 2GF2A 3BILA 4P7JA 4FFSA 2IOYA 4GICA 1IHPA 4IHKA 3H5OA 2XVAA 2FWAA 3GRKA 4XZ3A 1IAVA 3DXXA 4HUQB 2NWQA 4IV8A 4MV8A 4C4TA 2H5IA 1LU9A 3U4DA 4H1VA 1TCAA 2H1FA 1N8NA 3IA7A 2NVUA 3AFOA 3HBLA 4LX0A 4PCUA 4R8LA 3H1BA 3TBHA 3ZCTA 3C8HA 4L16A 4TRRA 4CM5A 4GR4A 4KVAA 5CCXA 1U7WA 1LDMA 1VKRA 4HL6A 3V3TA 4DEVA 1YVPA 3ORFA 1GNLA 1FTWA 1CUDA 1PCXA 3JQ9C 3P4XA 4NU5A 4PG7A 2ZUFA 1PX0A 1NX9A 4LUCA 5ALHA 4ZGBA 4IJ6A 1IE3A 1WCV1 3NOOA 1WP9A 4PHFA 4ESEA 1JF8A 5J5CA 1CZLA 4YIHA 4U2CA 1YFJA 2GXAA 4EZEA 3QBDA 4TRNA 3OFSA 4CCSA 2AXPA 2H85A 1I6LA 2AS0A 1JS1X 4ACAA 2GBPA 1CQIB 2R6CA 2ANCA 2PRSA 3U3OA 2P3OA 5HNKA 2ZRQA 3PUVA 2EDCA 4Q1CA 1KBQA 5FT9A 1BDHA 2F67A 1SY7A 2AG5A 4GT1A 4YQYA 1U3WA 5DBFA 1IOZA 5EINA 2X2PA 3IULA 3P2OA 4JBIA 3CIOA 1Z0FA 4C88A 3O84A 1CUBA 4FYJA 2JIBA 2J5QA 4HFNA 3RAPR 5HOEA 3P9PA 5LMNB 3T7RA 4BJ6A 3B8EA 1SFRA 1Z8FA 4I3HA 5J43A 1T0HB 4GE3A 2AOUA 5JI3E 4IXMA 4RIEA 1NVGA 3BJRA 4NC9A 5LYYA 2Y4OA 3TIIA 4DCGA 4DLWA 2BKEA 1E3EA 4ND4A 2BH9A 4IXNA 3B82A 1TO1E 2G9UA 3Q3VA 2Q1YA 4XM1A 2RI6A 2C1ZA 3M4YA 4B3HA 4F86A 4GL2A 2EZ8A 1ZK2A 2QB5A 2W83A 3DCNA 3STVA 2G1PA 1Z08A 1OZAA 3QVKA 4A2PA 1SZJG 1GZDA 1X9GA 3EVBA 4KTTE 2R7MA 1P77A 3FRHA 4NF2A 2Z5GA 1YT5A 2A9PA 2IYNA 1FLAA 3FHCB 2ZIUB 3VBCA 4A0HA 3OX4A 1JEDA 1ST2A 3HCEA 2WM8A 4DSNA 4EB0A 2ZJ2A 4YUZA 1CJVC 1F51E 3ENKA 1S96A 3CU5A 1DCTA 1LLQA 1V2HE 3KHKA 4RFSA 5FHQA 1GUYA 3R20A 3ESYA 1DXYA 3TQQA 4C4RA 3WIEA 2J3KA 4DLSA 4I81A 4BOYA 1ZMRA 1E1QA 1SBCA 3BGVA 2V6BA 2Y68A 4RANA 3L07A 2OFFA 3AI3A 4L2IB 1GG5A 4L8VA 5JWRA 3JRNA 3G89A 4CQMD 5CDHA 1H1TA 1XBTA 3N8GA 3GRUA 4RMJA 4DLKA 1MHPA 1XLTC 4EHHA 3VI4B 1SUCA 1FP4B 2Q3DA 2VHCA 1OQAA 2WWYA 3U60B 4AULA 4YP1A 1AE1A 4OAQA 5IVDA 4BNGA 1C1XB 1JNYA 4AF7A 2KBFA 3ONNA 4HQLA 2ZPTX 1K8ZB 3UK6A 2OORC 2NO6A 2AOVA 4G65A 3OWHA 1MQ9A 4JQYA 2O06A 3H0KA 2W6OA 4FYYA 1E3IA 4ZODA 2Q2VA 5BWOA 1Z2OX 2ID8A 2WM3A 3RR2A 3DLHA 4NXMB 1GG2A 3QWIA 4KI0A 1M2HA 4CQJA 2P9JA 2YXLA 4HGQA 1CZHA 2OHJA 2A0WA 3R7FA 2LW7A 4DSAA 3DOEA 4MS4B 3ZR4B 1K4KA 2B1IA 5SY9A 3G1UA 3P4UA 3W8NA 3U5ZB 1KI1A 2FW8A 4JJ6A 3EFHA 3PEVA 1WQ1R 2XHEA 4W9MC 2I5PO 1ZSNA 4UCQA 3FBTA 2BGRA 1L4NA 2J6BA 4MGYR 2K7ZA 4EHAA 3V4OA 4A5SA 5F23A 3IMEA 3F6YA 1EUDA 1N57A 4F3CA 4LYAA 1RVDA 2B3DA 4MUYA 3RSGA 3TQHA 5DTJA 4ZICA 3R9WA 3DCIA 3R0ZA 3CH5A 3E5NA 4DLTA 4GMKA 2XIJA 1S89A 5BUSA 3RTGA 5AQ1A 1FSGA 2PX0A 4L76A 1N77A 5IG2A 2F4NA 5AHXA 2LIVA 4Z4QA 3A6GA 3H9UA 3MGBA 3MQ2A 3P9ZA 3IDZA 4HGOA 3ZK8A 4UTNA 1J8FA 3O74A 1W9MA 4KR9A 3A58B 1BHO1 3EGVA 3JZFA 4HQFA 3E27A 1KQNA 1K8RA 4JXZA 1NBMD 2ZS8A 4KBGA 2FZVA 2QRMA 1ZOOA 1UFOA 2SCUB 1I4EB 1JR4A 3TEJA 4FZVA 4JT2A 4S0XA 3U0VA 3FLMA 2HUNA 1KIAA 4KU4A 1QZ3A 3PD7A 1C9EA 3FSEA 4BNNA 5AI4A 1ZWLA 2JLRA 4QRHA 2Q9UA 4OGWA 2RCYA 2CHUA 3V33A 4B4OA 4DANA 2Q0XA 1SBZA 1F12A 1EK6A 3LOQA 4OP2A 4B1FA 1JHUA 3AKEA 1QHSA 4LQLA 2FK8A 1QAOA 4RQBA 3VHLB 1HNZB 1N9KA 1TL7C 1XEFA 2BZ1A 2VYVA 3BKWA 5H16A 1QH0A 3RSLA 4B71A 4PLTA 1BMDA 1L7VC 1M8GA 2ZVDA 5CH5A 2WYUA 5F21A 2WT4A 4DDHA 5BORA 4S1WA 1E2MA 1W88B 2V4UA 1L4BA 4R8SA 3LT2A 1KI9A 2WJAA 5GM1A 2HJWA 5G53C 4B7UA 1EXWA 1VL0A 2CBGA 2IP4A 4N47A 3GAZA 3U7GA 1NM5A 1PUIA 2R4TA 4W5WA 4HUTA 3JS5A 3U2QA 2F3UA 3EGCA 4F7WA 4AWXA 3HL0A 4Q3LA 3MJSA 3TJZA 2AKEA 4CKWB 4ENSA 3EIFA 5ES4B 3NRBA 4DR2B 3HR7A 4O0MA 5A0VA 2VK2A 1DV2A 3CLVA 3KTFA 3L7IA 4U7PB 4FILA 1E9SA 2PUJA 3Q5DA 4ZO6A 5F12A 4CEIA 3Q2OA 2Y1CA 4P8RA 3VBEA 1M2OB 3C48A 4LYDA 5E1MA 3ER8A 4A15A 4WUTA 3BMOB 4J3FA 4IPTA 2XWQA 3HXLA 5EUBA 3SJZA 3ZWWA 4BNIA 5EG5A 5JSZA 4JBHA 3AEQB 1SHLA 3GCDA 2D4HA 2XMSA 1F1JA 3B7WA 4ZALA 3GUZA 2FOXA 2R4QA 3N6VA 2P6MA 5CIYA 3IQEA 5CLIA 1OB5A 4F12A 3EB9A 1U3TA 2JS7A 3KQQA 5CVCA 3OI7A 5KJFA 1EK5A 3MJDA 2GA8A 3DLCA 4ZI3A 1BQ3A 1U0JA 4WY8A 4LFAB 1WTAA 1Z5WA 3BGOS 3NIDB 4LJ9A 1JPVA 1XJ0A 5BR8B 3DKIA 1M1ZA 4ZI7F 2HPHA 2AYYA 2I1VB 4QDJA 3B38A 3FTDA 4NPAA 3LFTA 3E0XA 3KIPA 2I7DA 5C3UA 1KDOA 1GYQA 1K8QA 1KYTA 1WNTA 2ORED 4ZEXA 1R3DA 1IU9A 2PRIA 4HP8A 1OWNA 5BYKA 3TSCA 1R18A 3V2IA 1H4SA 4B8ZA 5JQGF 1PL7A 4PLGA 4PRYA 2WUEA 4WOKA 1Y3HA 3TCKA 3KYCA 4CKYA 1T0UA 4Z7NB 4A2CA 4J16C 4A23A 2ZK7A 1NQOA 1C1DB 1YUBA 2JI4A 3NHJA 2D2FA 4XJTA 5F1KA 4BWVA 1IY9A 1ZLYA 2EGUA 3RSQA 1NU8A 3ZS8A 1Z5PA 2EBWA 4Z7QB 3LHSA 3FUVA 3LFHA 2Q5HA 3OO1A 4UBIA 3B2EA 4TT3D 5EMHA 4AO8A 3BB1A 4B3DA 1IN5A 2DSTA 3OQIB 5HIKA 2DSNA 1JMKC 3OQBA 4IVRA 1NXOA 1V7PC 2C4VA 2W8BA 4JLPA 1CHNA 1YRWA 3COZA 5GOZA 5IJ9A 2JLZA 4M8LA 3RIXA 4L72A 5ITWA 5G0WA 4DXHA 3WQRA 4TTRA 2YH2A 4MUHA 2L18A 2VKQA 1A7JA 3CZMA 4Q03A 2XXAA 3ANNA 3HCWA 3L84A 3PCRB 4JNKA 2KMLA 2ZIFA 4H08A 4TXJA 4OFZA 1Y1TA 3KZVA 3ZXSA 3FM9A 3W5AA 4BKMA 1CP3A 3EG5A 3QU5A 1C8KA 1OREA 4X6XA 5HKKA 1WU7A 2OHGA 2B5WA 3WDSA 3IVXA 3KVVA 1PS9A 2ATEA 4LSGA 3EHDA 4JLBA 3DTTA 2R00C 1RZRA 2HLHA 2GZDA 3GEMA 3SR0A 3PLAE 3ZE9A 4CCAA 5B7QA 1GCUA 3D1JA 2ECQA 2FUG1 3ILVA 5K6AC 1ELOA 1H1LA 1OLXA 2FSVA 2H18A 4WXHA 5F1OA 3ZHBA 1KO1A 1I4OA 1PNTA 3ET4A 1U0LA 4R31A 5HF9A 1N3BA 2VCYA 5EE5B 3SLGA 1YOBA 1Y1RA 3L0YA 2XMBA 1Y8RA 3K8QA 4TV8B 5EERA 4MRSA 1F2UB 1TKAA 3ZI0A 1PFUA 4DREA 1A5TA 2O7RA 4IHJA 1FLNA 5LOVB 1OH6A 2QTWB 4M9XA 4AMGA 1UL1X 1LS1A 1UOQA 1ESZA 2DBRA 1ZBQA 4G85A 1CIVA 3HWSA 3CZPA 1QUFA 4PIMA 4O5AA 1Q95A 3GFVA 3QPDA 4GX5A 4JA2A 3VTFA 4CFZA 4NSNA 2IBSA 3DUFB 3GFPA 2VJNA 3O3MB 4BKOA 1AZLA 3QKUA 4HNQA 2HF9A 4OYRA 4PX9A 4RA6A 4ZT3A 1KEKA 2CK3A 2C82A 4QOGA 3VXKA 3EQ8A 3LPDA 1ZZGA 4QPNA 4C6RA 1P73A 3Q9SA 4YMSA 4GZLA 2UZAA 3VNSA 2NT4A 2Q9AA 3JATB 2Q5QA 3KXDA 5I4KA 3AIKA 1M0EA 4YRAA 3OCWA 2AT1A 3K7EA 5KNBD 4NU6A 4G1MB 2YVLA 5CGZA 1SU8A 3MWKA 3QVSA 5A9SB 1JAHA 4J0CA 2W4QA 2QVLA 3RJMA 1UK8A 5SY4A 4RORA 1SXIA 2ZRNA 3PIDA 4OUKX 4E5UA 2Q5EA 1OTYA 4DF3A 2KS6A 3WWCA 1U8ZA 4AWBA 1SOWA 2W11A 4RTNA 1ZESA 4WESA 2E4YA 3H18A 4GBJA 5EVJA 1OYYA 2BHRA 2ORYA 5D3ZA 1P2DA 3EULA 5CCBA 2Z6AA 2FSFA 3VVLA 4QRDA 1RWQA 2JCBA 2O3RA 2A8YA 2VUTA 3HUEA 4G1FA 5JJIA 2XVXA 1M34A 2JDIA 2FGKA 3AHFA 4B5LA 4DMRA 3H5TA 3IUPA 2ADFA 4P3XA 1G8SA 2OG2A 3CBGA 1FJ2A 3F9RA 3FB1A 3K9CA 1O58A 4URUR 5F52A 2ZXUA 4FPXA 2WRZA 4C22A 4HDOB 2R5NA 3LIIA 4B4UA 1OPRA 3HVUA 3WSWA 3UQZA 5T6MA 5A0TA 1R0ZA 5JMWA 4IJQA 3W1EA 3FUUA 4OXNA 3H2ZA 3R3UA 2CE7A 4P35A 4D99A 2X5JO 3ITNA 3RKRA 1K1EA 2PU7A 3WNQA 3GLHB 3DC2A 4C3OB 3DHYA 2EW8A 3PEUA 1R1DA 5ALFA 1AKQA 3PRKE 3G85A 2FEAA 2IW1A 2WW8A 4MVJP 4V0RA 4Q47A 3T5GA 4ZQGA 1D09A 2OWEA 2NTJA 2ZWMA 5LYJA 4A1OA 1J42A 3RREA 4ABTA 5EZYF 3TS1A 2NYRA 2V9CA 4Q15A 1KMHA 1JAXA 2IHBA 1XU7A 2O2DA 3HJRA 1NN1A 2V9ZA 2HLPA 4BC0A 3SQMA 5JV5A 5IVKA 4IEEA 4Q1EA 3TJMA 4Y2RA 5AJUA 3KLNA 4M4SA 2JGIA 4V0MA 2BFCA 2Z8ZA 3BWCA 4LJSA 3AVYA 4CPDA 1DPGA 3DFZA 1DIGA 2XQJA 4GRDA 4IIBA 3WY9A 1EQAA 2W8ZA 5BN3B 4P4GA 3WB2A 5TE9A 3ZW8A 2XMPA 3DMYA 3H87A 4G2NA 5ALMA 3SZ3A 3V4LA 1C0LA 4YVFA 4OFWA 5L4NA 4R7GA 1QFXA 4BIIA 1AUQA 3H8WA 2BGMA 1ZUHA 2C2YA 3DULA 3NDJA 4JX9A 5CXQA 3RH0A 3DT8A 3LAWA 4LWOA 3GMSA 1QP8A 2O7VA 1GPAA 4PGAA 4I6JA 4OI2A 5AUOB 2Y27A 2R7KA 2BKUA 2P6NA 3ZEAA 1KQPA 4ITUA 3WLIA 1O08A 2EYQA 3O8QA 3D3WA 1CY7A 1R0XA 3NGMA 1QJ4A 3N9IA 4FUQA 3A7EA 1EFHA 2E1RA 2Z83A 2YNMC 1TEHA 1CE8B 3G0GA 2IS6A 2GN4A 2FSGA 1X1BA 4MRVA 5CVEA 4CIVA 1FQKA 4F4JA 1S1MA 5AWFC 2Q45A 3CG0A 1FNSA 4PY2A 4A6XA 4IIDA 3AYZB 2AFVA 5E7QA 4O8CA 4MDYA 3UC5A 3VR0A 4FSHA 1VOTA 3TL2A 1O8BA 3F3YA 2OBNA 4XCXA 3W78A 3VU9B 2GPYA 1DJPA 2JD1A 5KQRA 2QK4A 1G8HA 3F71A 1DEKA 1PFQA 4R2IA 1IHYA 4C2TA 1BQ4A 3A10A 1A8HA 2X0DA 3B9PA 5EE0A 4ZRMA 2AYZA 4JJIA 3EIHA 1P0IA 2H2GA 4ZXPA 4EUFA 4BAZA 4N1AA 1N5LA 4ETIA 1ARZA 2RH5A 2H9IA 3NAZA 2GJ9A 3AEYA 2Q4OA 1RS0A 3AUTA 1GNPA 3S7TA 1NHGA 4LOLA 4A2QA 3JYOA 4W9RA 2IF0A 3UMMA 1HX7A 4K8OA 1V43A 1HORA 1QK5A 2LDBA 1UZLA 3KD3A 4JIMA 4IUCS 4ZYTA 1MTOA 3GJZA 1UFRA 1T36B 2HWKA 3AF1A 1M1XB 3U56A 3PGLA 1FYVA 1EHIA 3DE5X 4WN9A 4YWJA 2ZSDA 3RPEA 4WCDA 4P53A 3VPFA 4MINA 2GDJA 3LWZA 2ZJ4A 3T5CA 2N0SA 4OHVA 4DCCA 3EBPA 2WLSA 3DOCA 2FE4A 3CEPB 1F20A 2N42A 1XNRB 3E82A 4Q3OA 3M4JA 3CB2A 4WBNB 3DDZX 4KLRA 5CDSA 1UH5A 2WMOB 4P34A 1H2FA 5DKFA 4PZEA 4KLNA 4FCVA 4OFXA 4BRZA 3O2SB 4BX9A 5JYEA 2ZVQX 1WHTA 3HO6A 2O5CA 4XDGA 3CXRA 4JP2A 4C06A 3VPGA 3O9VA 3DDHA 3FFAA 4OKNA 1T9AA 1UDCA 1PFYA 1Z6AA 2NO1A 4OVKA 4UM9D 1S0UA 3T5AA 1C29B 4M1MA 1QH1B 3RK1A 5ALWA 1UPXA 2WWRA 1SUFA 4CNBA 3SMQA 3N5CA 2Y1LA 2PQMA 2G1UA 3KQLA 4MZXA 1GKLA 1Z7GA 5A0FA 3QSYA 3PFNA 3BAFA 2BCJQ 4DNFA 4EG3A 2QMZA 4P5DA 4FHEA 3O83A 4UHKA 2EQBA 2H4YA 3PFWO 4QQKA 1RHUA 1FIUA 4LXUA 2M1ZA 2QVYX 2PLAA 2OUIA 3C3KA 3K3PA 4CLDA 1QTRA 4UQLA 4OB6A 1N78A 2AA3A 3QIVA 4Y67A 1YS2X 4FMDB 3TZBA 4M0UA 2EJUA 1GZ3A 3IERA 2GNPA 3NVMB 4FN5A 4NYJR 2P4QA 1SUWA 1NN3A 3F3KA 3LXRA 1C7JA 3EW7A 3NEAA 4GBED 5SYAA 3TOZA 3I1YA 5AVZA 5LQSA 1VLMA 4JOBA 1H2RS 4LHSA 4JYZA 2ZTHA 7YASA 1X0XA 2PD3A 4C7OA 4IIJB 4TSRA 4BEVA 4ZV9A 1MC8A 3Q11A 3X1WA 1K5PA 5F4ZA 1PJZA 4WN3A 5DRTA 3AXSA 2W93A 2JI7A 3AX6A 3H9BA 1UJNA 4FWBA 4ZT5A 3EXFB 3DLTA 3KKNA 1YQEA 5FADA 4C0LA 1U4OA 3OM0A 5AM0A 4LNUB 2WJJA 2GPAA 2I7XA 4O4JB 4B46A 3OT1A 2N3ZA 4M0KA 3TZLA 2FEMA 4MAAA 3A2KA 2XAUA 4LJYA 1I7PA 1V6SA 4EHBA 3CIFA 2MJLA 1CDDA 3LQRA 1D0VA 1Z0IA 2HHLA 1GSAA 1RI3A 1TDJA 3R9IA 3KPJA 4BQNA 1O94C 2NIPA 3L5KA 4UUAA 2Q2NA 4WZBE 1ADYA 1SOUA 2WHQA 4MR9A 1DG1G 3GEBA 2HUPA 4DJAA 4U4AA 3X1MA 1TO2E 3CUUA 1B43A 1BXRB 3DYBA 5AW4A 1VB5A 5CA0A 1PTJA 3WZLA 1ECPA 2IUFA 1QB7A 3DNPA 3DTYA 1SOAA 5TPWA 1XFDA 3I2HA 3VGPA 2P2NA 4PAGA 3SZLA 4BQRA 3ETHA 2AB0A 1LZLA 2PH5A 1ZEJA 2H65A 3EDQA 2FZLA 3EBLA 3SN6A 1W0KA 5IBCA 4MP6A 1XMOB 2RHLA 3N2KB 1P3JA 4X65B 4AJNA 1VMDA 1TD9A 1RM4A 1CUIA 2V8BA 4QTTB 4PGFA 1GTJ1 3PL5A 3HWRA 1K0UA 1YR6A 1FVXA 3KVOA 1RWPA 5KWEA 2DUUA 3II6X 3CE6A 3RSSA 2D8AA 2OKGA 4DPMA 2ZTMA 1EDBA 3GRAA 3QRWA 1RKUA 4OGGA 1R9JA 2IEGA 4X41A 5D8DA 3S81A 3OMWA 2YV5A 1K75A 3FKSD 5KNBH 3D02A 4J1SA 3PUIA 2MU1A 3QOWA 4O25A 2G71A 4CEHA 3NP9A 2KI5A 3B1ZA 3QPBA 1QOQB 5ITVA 1JXMA 1K06A 5LZ2A 2B4AA 4GW3A 2FA9A 3QVGB 4EF4A 5IAEA 5SZKB 4UTXA 5H9WA 2C57A 5ED0A 3ZHRA 4BMNA 4I9HA 1NJFA 2GS9A 1PI3A 3QF4A 4K9LA 4B48A 3GCGA 5BR7A 4OUDA 1FYFA 5JCJA 3ANXA 1FNBA 2C94A 3N76A 1RKBA 3SKXA 3KHSA 4ZAFA 2HRQA 3NTLA 2ZR0A 2FP4B 3O82A 1V48A 1B93A 3L02A 5EJ9A 3JARA 4LXIA 3DHEA 2DFVA 1N0WA 3ZUGA 1I0LA 4X1OA 3O3NB 3AP2A 4HVAA 4MO2A 4KE9A 4BFVA 5ALUA 1IB6A 3L8EA 4IDEA 3PF9A 5CA1B 1ZNWA 2CLLB 2EBFX 3U4IA 4G9GA 5JRZA 5YASA 4EJ6A 5TMDA 2DFLA 2XUGA 2XMZA 4KFSA 2CNWA 3D64A 3IRVA 1X19A 4F84A 1W4CA 1KOFA 2WWFA 3GN1A 4B83A 1XZDA 1KAGA 1QO0A 4NICA 5CVVA 2PFSA 5K3FA 1XVIA 5F4BA 4ER7A 3TSOA 3N2NA 4QXAA 2PQ6A 1IN4A 4F2DA 1XC7A 3VR6A 2FMKA 3L8HA 4DMLA 1E98A 2EJTA 1B6SA 1Z16A 4D8TA 5EMJA 1E7SA 5KNDA 2X6TA 1XNJA 4RMNA 1AMOA 4N5DA 4DCMA 1Z75A 1ZS9A 4Q7LA 4RVDA 3QSGA 4PAMA 5A5GA 3K09A 2PS3A 3RAJA 4CDRA 4AYWA 1T2FA 4JT8A 4B8YA 3STXA 1L4MA 2DFKB 1YFLA 4WOCA 4F3KA 1TJ4A 5AOBA 2AFIA 3BDAA 1SBTA 4NDZA 1XXHA 3A6EA 1P2BA 2VP0A 4JT9A 1Q21A 2II6A 4WFJA 3D6UA 4O63O 2NZJA 1C7EA 4IOLA 4JROA 3A1TA 2K2WA 4WVFA 2HDNB 4QXPA 1ADCA 1GXSA 4ONEA 2PBZA 1GZUA 1PIWA 1QV6A 1R6XA 4D9HA 1DRKA 1KY4A 1TMKA 2Z2IA 1QO7A 4KH1A 1ZH0A 1KVTA 4CMJA 2UZ0A 2Q29A 2G88A 4AG6A 3NH6A 1G38A 1MAAA 1OWPA 4XD7A 1X9IA 4I1YA 4ALMA 1TX4B 3RI3A 1LX7A 3SOPA 5BV2P 1L7QA 2FDRA 2HC9A 1FXSA 2VDWB 2ZRPA 3WOVA 1ZIYA 4C0WA 3A2NA 3X1DA 4L9SA 3H5VA 2A33A 1OB2A 1PEKE 2WYIA 3FGNA 1CUVA 5FOXA 4BCCA 4C4YA 4Z4FA 3EYWA 1NXWA 1E2GA 3O2JA 3PUZA 5BSFA 3A0UA 3QA3E 2CVHA 2O7NA 2C2WA 1TM3E 2EKBA 1VG8A 1WBDA 2A84A 3CZ9A 5KVQA 5ELMA 3HABA 4HDMB 2C07A 2GYYA 2O3JA 2ZP1A 3AYXB 4N6OA 2EKPA 4OHKA