3AY3A

Crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
266
structure length
266
Chain Sequence
b'MLNRLLVTGAAGGVGSAIRPHLGTLAHEVRLSDIVDLGAAEAHEEIVACDLADAQAVHDLVKDCDGIIHLGGVSVERPWNDILQANIIGAYNLYEAARNLGKPRIVFASSNHTIGYYPRTTRIDTEVPRRPDSLYGLSKCFGEDLASLYYHKFDIETLNIRIGSCFPKPKDARMMATWLSVDDFMRLMKRAFVAPKLGCTVVYGASANTESWWDNDKSAFLGWVPQDSSEIWREEIEQQAGEIDPDDPAVIYQGGKFVAAGHPDDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent epimerase/dehydratase
publication title Crystal structure of glucuronic acid dehydrogenase [correction of dehydrogeanse] from Chromohalobacter salexigens
pubmed doi rcsb
source organism Chromohalobacter salexigens
molecule tags Oxidoreductase
total genus 102
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ay3A01
4R1SA 4A03A 3F46A 2P91A 2DC1A 3OJEA 3SEFA 3T4XA 1QORA 2D5AA 1ZSVA 3I1JA 4RLHA 5TJHA 4YJDA 3QIVA 4BNGA 1PIWA 4BNWA 3K9QO 3OBBA 4KUGA 1OC4A 4AICA 2AA3A 3HNPA 3ULKA 3VZPA 4BB6A 2CMDA 4RPLA 1UZNA 1TT5B 4CM6A 1GQQA 2X58A 4FFPA 3CPSA 3DTTA 7MDHA 5HS6A 1Q0HA 3BTSA 1B26A 2FZEA 4N7RA 4XYGA 5JS6A 3D1LA 1LTHR 3ETEA 1CF2O 3KYDB 4IDFA 1NHGA 3Q1LA 1KYQA 3C7AA 5JDCC 3DBHA 3JYOA 3U3XA 3NJ4A 4F45A 3BMQA 4BNHA 4N5NA 3DHNA 1PJTA 3HWRA 3AUUA 1R66A 2PWZA 1PWZA 4XD2A 4IIUA 1TI7A 4GX5A 2TMDA 2Q45A 3IOYA 3WX0A 4CMGA 2QW8A 3GGGA 1E6UA 4XQGA 1HKUA 1A72A 3HSKA 1P44A 4MIOA 4AL4A 5B1YA 1B16A 4H15A 2D0IA 3QV1A 4BKQA 4FOOA 4O0LA 4ONEA 1NM5A 2C29D 3I6QA 2D1YA 3BMCB 4CUJA 3H9GA 5JNLA 2HRBA 3L9WA 3NDJA 4RPKA 2G0TA 3JD3A 2HSDA 4FOSA 5AYVA 4FBGA 1HDRA 3ASVA 4GSKA 3B1JA 5G0VA 1HYHA 4QTZA 1T25A 1ZIDA 4EUEA 2EP5A 3N74A 1TEHA 5TSDA 1KOLA 2R00A 1D8AA 4CPDA 3H7AA 5DN9A 4ZJUA 4WPGA 4B7UA 1DIBA 5ER9A 3RKUA 1YB1A 2ZCVA 3GNTA 4ZQHA 3W1VA 5C7OO 5DBGA 3NUGA 1KERA 4YR9A 3KLPX 2NQTA 1N5DA 1YQGA 3KYCB 5KIAA 3QWAA 4UUPA 1R6DA 1YDEA 1J4AA 1UJMA 1K5HA 2B36A 1YQDA 4NQZA 3FCOA 4LK3A 5L4SA 1Y1PA 3EZYA 4YRBA 4BNTA 1VSVA 3INRA 1DRWA 1TVEA 3ONFA 1HDCA 2W8ZA 4Z3DA 3CUKA 5TNXA 3C8MA 4NBRA 3WR5A 2GD1O 3E6AA 2AW5A 3MJVA 2FMUA 3MEQA 1NR1A 4BMNA 3DTYA 1PS8A 1SC6A 1MP0A 5G4KA 1H2HA 1HLPA 1EK6A 1I5RA 1LQTA 4R5HA 1Z73A 1Y8QB 3OICA 4DGSA 3DR3A 3RVDA 4IJVA 5CDSA 3WTBA 2BGLA 2ZIZA 3COSA 4Z9YA 4YVFA 4TZKA 1RJWA 3FF4A 1ULSA 4R16A 1A9ZA 4MIEA 3B20A 3DEYX 3VH1A 2JL1A 3PTZA 4W7HA 5JMWA 4Z0TA 3U4CA 3WGHA 2HU2A 3E9NA 2D8AA 2VHXA 3E9QA 3PI7A 3H5NA 4XR4A 1Y8RA 1LBEA 1GEEA 1K2WA 1ZXLA 3RUHA 1ZSYA 5BT9A 1BRMA 2ILTA 3I9MA 1BTOA 2YY7A 4PLPA 1ISMA 3TRIA 2SCUA 2EJWA 2V6GA 1QSGA 2BGKA 3WIEA 4OIMA 4MVJE 2FPIA 2O3QA 5HTOA 1X1TA 3M1AA 1GCUA 4DREA 4IS3A 1PQPA 2HDHA 3IKTA 3OEYA 3PIDA 1ZK4A 4GL4A 4RPGA 5IDQA 1SOWA 3GAFA 1MC5A 3TDKA 1O94A 1UZLA 2X0RA 4PIVA 2I6TA 5A02A 1DAOA 2NU6A 4L4XA 2Q2WA 2C2YA 4IBOA 3LSYA 4FN4A 5H81A 6ADHA 1V6AA 3WQRA 4DYDA 3PRJA 3G3EA 5F21A 3UOGA 1LDYA 2DQ4A 1XQ1A 3K5PA 4MVJH 1UAYA 2B4QA 1ML3A 2O7SA 2H9IA 1YOVA 3AFNA 4Z6KA 4RVFA 3JQAD 4BQPA 1V9LA 2O3JA 3LF2A 5IAAA 1TLTA 3P2YA 5CP8A 3V1YA 3ST7A 4ALMA 1XELA 2H63A 1YB5A 2WD7B 4UREA 1OI7A 3RUFA 4CM8B 3ZHXA 4PRKA 1NVGA 4WCFC 5AVOA 3PYXA 2O3TA 3FRJA 4YAEA 3GNQA 1C1XA 1GADO 3RBZA 4D41A 1OMOA 1P1IA 5KNLA 1G0OA 1HE4A 3AW9A 3DBRB 1AN9A 3O03A 4C7KA 1T4BA 4JBIA 4NIMA 1HSOA 4ND4A 4H16A 2UDPA 3B70A 3CMMA 1E3JA 4AVYA 3WNVA 1AUPA 3AOEA 3UGKA 4AJIA 2X23A 1K6JA 3JQDA 4EJ0A 1W4ZA 2GZ1A 4AJKA 3S2IA 1KETA 2JFHA 4CM3A 4E31A 4CL3A 3V2GA 3O8QB 2WJPA 3VZQA 4YRAA 4TRMA 1GQYA 3I6IA 1UP6A 3U5TA 5ILOA 1JKIA 2B69A 2DBZA 4QXMA 3C7CB 3GQVA 3EGOA 4BMVA 3HZZA 4J2HA 1U7TA 1TT5A 2X5KO 1ONNA 5JDIC 3ZNQA 4EEZA 3U4HA 3QVSA 3G79A 1OC2A 1WMAA 2GLXA 2I66A 1DHTA 5BSEA 1X1EA 3GPIA 3KYDA 4Q3DA 4BKRA 5MGBA 1VL6A 4CMEC 3GDFA 1HDGO 2IXAA 2P9CA 4MP8A 3WMXA 3TFQA 1U4OA 4Z3KA 3SVTA 1G6KA 1XG5A 3F3SA 5CDYA 1VI2A 4XYEA 1CEQA 1P0FA 3SXPA 1E3WB 4UEJA 2OBNA 1W73A 4P22A 2BH9A 4DIOA 5KCZA 1Z82A 2CF6A 5TX7A 2GYYA 4M55A 4B8ZA 3FR8A 2VZ8A 1NASA 5GZ1A 3D64A 3BMCA 5JW6A 1Z7BA 2AG5A 4TRJA 3ZWYA 1GEGA 5DULA 1M66A 1HDOA 3HJAA 3EVTA 4YYZA 4FCCA 4QT0A 1M6HA 1IZ0A 2PY6A 3DAGA 2WSBA 3FWZA 4ALNA 3NGLA 4RDIA 2V6BA 1WXDA 3FD8A 5JSFA 5I7SA 4NNJA 3WSVA 2VHYA 5CEEA 1GY8A 3IP3A 4WOJA 4CMAA 3GY0A 2ZYDA 3HDQA 1P3DA 1PJSA 3KYCA 4I9HA 1SEVA 5A04A 1VJ1A 1XIVA 1JTVA 5KJEA 3TF5A 4BO6A 1NQOA 4L4RA 4CQMB 3D5TA 3H9UA 2YYYA 4GVLA 4YJFB 1DAPA 4OQYA 4IDCA 3GR6A 2ZCUA 3QVOA 1ZMTA 1GUYA 4J90A 1XCBA 3D4NA 2CD9A 1NWCA 2JD0A 1ENOA 5LC1A 2VQ3A 1XQ6A 4FSHA 1A27A 5F1OA 1JVBA 1T26A 1DRVA 3RFTA 1RWBA 2WEKA 4IDDA 3MWEB 2WD8A 2TMGA 3PHLA 1Y8QA 3RWBA 2AQIA 1F8GA 3LQFA 2XPCA 1U7HA 1PGOA 2HUNA 2YUTA 4ALIA 1KBZA 2NVBA 3A28A 5T5QA 3RU9A 2JHGA 4XIYA 4EJ6A 2G5CA 4UVEA 1PQUA 3K30A 3TZCA 1DDOA 1PJQA 5TF4A 4BNZA 2I99A 1E6EA 2DM6A 3AWDA 5AXBA 3BTVA 3WGYA 1SOVA 5B4VA 5EPOA 1D1SA 3PHJA 5EJ2A 4JK3A 4BNXA 3L77A 2GCGA 1I3MA 4R1UA 5TLSA 1QYCA 2DU8A 3P7MA 3V2HA 3W6ZA 4IM7A 1IHYA 2EIHA 2XXJA 4RVUA 3L6OO 5L9AA 1U3VA 3T4EA 1OFGA 1IULA 3JQAA 4IQ8A 1K6XA 5GZ3A 4E5KA 1BMDA 2DBQA 1HE2A 2O3RA 4J3FA 1FDSA 2P9EA 4CQMD 2D2IA 3ZWAA 4MINA 3SLGA 4ZHSA 1G0NA 3M2TA 1R15A 1AXEA 3BHJA 4JJGA 1QP8A 2ZATA 4GAEA 2XOXA 5G2OA 1AHHA 1DIGA 4IGFA 1BGVA 4RVGA 2PK3A 1PZGA 3I83A 4QECA 4FFRA 1JN0A 1UDCA 1W8DA 4NFHA 4R1TA 3OP4A 4EBFA 3PK0A 2XXBA 4I5FA 4CM4B 4HXYA 1KVUA 3H3JA 1YL5A 4XKJA 4I08A 4CM5A 4DQUA 3JD0A 3H9JA 1Y81A 4AJNA 3MWDB 4PG6A 4RF2A 1K3TA 5C7IO 4CM7A 4D45A 1M76A 1BXGB 5IDWA 4TROA 2Q46A 1I2CA 4PVCA 4E32A 1M6WA 1IZ9A 3C1TA 1MG5A 1QYWA 3F5SA 5K6AA 4PLCA 5KVQA 3C85A 4JNKA 1EFKA 4MIYA 2DTEA 3NYWA 3TZQA 1ZK2A 4O5OA 5CAEA 4URFA 4YT5A 1SZJG 1EQUA 4WLUA 3CE6A 2EHDA 3G1TA 4ZU3A 2WD7A 1QXSA 3E8XA 5J23A 3LT2A 4CM8A 2W2KB 4M1QA 3L6EA 3UCFA 5FF9A 3ZNPA 1QV6A 2ZJ0A 4TZTA 1PGQA 1ADGA 5DP2A 5AQ1A 4HWKA 1Y5MA 3N7UA 3DBRA 4WCFB 4A73A 4RJTA 1NFFA 3ZWCA 1YQXA 2FSVA 4J16A 5KJCA 4LW8A 3HDJA 4J4HA 2CFCA 3K73O 1DHRA 1HTBA 2DTDA 4RDHA 1DJQA 4DMMA 2PFGA 3I9NA 2GN9A 2JCVA 1LI4A 4ID9A 4D7AA 3O8QA 5C5IA 5COQA 4R54A 1CRWG 5JAQA 1C0KA 5I9MA 2J6IA 5BSGA 1O89A 2BRUA 4MOWA 4BOYA 4FJ2A 5G0TA 5GZ6A 3INGA 3OJFA 5THQA 1X7GA 1DXYA 4DIBA 2IODA 2RH4A 5LDHA 1X0XA 2I65A 3AY7A 4KP7A 2X5JO 1PEDA 2AE1A 4WUVA 4IXWA 4J7UA 1R0LA 2BFAA 4R5MA 3QVXA 5EL0A 5T67A 3BHMA 5FYDA 1XDWA 1EFLA 3GZNB 3OJOA 3S55A 4WK6A 3U49A 2VYNA 3V1UA 5T8KC 2X6TA 2E82A 3H5AA 1DOHA 2EW2A 4YAGA 5JDCA 2VRCA 5KVVA 3EAGA 2Y99A 1E3WA 1A7AA 1JU9A 1WMBA 4OHUA 1SBYA 3ZU5A 1DFHA 1NYTA 1QLJA 3U9LA 3U09A 3CKYA 4DBZA 1LLDA 2EV9A 2X4GA 1B8VA 1BHSA 4KWIA 3KUXA 1BDMA 4GI2A 1LDMA 2P5UA 3QWHA 2QYSA 1IOLA 4PG8A 3V1TC 1ZEMA 1KVSA 4B4VA 4EUFA 1WLYA 1WPQA 2OHXA 3KV3O 4YBZA 2B35A 4ZGWA 2HJRA 1WVGA 4ALKA 2HK8A 4EI2A 3L4BC 1P1RA 1I0ZA 4W7IA 1EDOA 1NVMB 1R4NB 4E5PA 1MB4A 3ZWWA 4MVJA 4UVGA 3OETA 3EDMA 3ONDA 1JDJA 4FGSA 1FF9A 2GDZA 1EVYA 5BSFA 1VJ0A 1EVIA 4NPCA 3X2FA 4UEOA 2D4AA 4CQMA 1NR7A 3IUPA 5BNFA 4YJFA 3NEPX 4J4BA 2BI7A 3EVNA 1F8FA 1L7DA 4RO0A 8LDHA 3I9KA 1ZUD1 2X7HA 1SPXA 3LVFO 4W99A 3JQ7B 2GR9A 3R3JA 4L4SA 3SBOA 1EZ4A 2FR1A 2HAEA 3BZUA 5K9ZA 2DBRA 2C07A 2W98A 3PP8A 2RHRA 2VZ9A 5TRTA 3MZ0A 3VH4A 2OMEA 3BXXA 1NPDA 1PJ3A 2EXXA 4FDAA 3CZMA 5HBRA 2H6EA 4WLFA 5DCUA 3ZWNA 5JO0A 5KTKA 2GUGA 4KUEA 3IQDB 1PQWA 2DFDA 4MVJM 1GYPA 1JWAB 2C59A 3AM4A 4XRRA 2NVUB 3GK3A 1Q7CA 1C1DB 1ZBQA 4CMIB 4NR0A 3PYLA 1O0SA 4O63O 3G0OA 3H3FA 1I30A 2YFQA 5JYDA 1GDHA 1PL6A 1FDVA 1PZFA 2EG9A 3FPLA 1CJCA 2AMFA 2JAHA 2HMUA 3WWZA 1T24A 2IYPA 1PSDA 2A9FA 3MJ4A 4AJOA 5EINA 1LXCA 5JY6A 2I9PA 1P1FA 1NAIA 1P9LA 3TL2A 3F5QA 1B8UA 3WGOA 1X0VA 5C37A 4RGBA 2F00A 4D44A 4YT4A 5BNTA 1WAMA 4FFNA 2VOEA 4JXKA 3RAJA 4NK4A 1CQJA 1P77A 4PLHA 5DDIP 1YONA 2G17A 5JAZA 2ZB8A 3F4LA 4ZRNA 5GY7A 4CM4A 2G82A 2B37A 3DZGA 4ALJA 4FR5A 4JX8A 3DZHA 3IL2A 1E5QA 1I10A 3MCVA 1ENZA 1YGYA 2HRZA 2J5KA 4XWYA 1DIRA 1F17A 1JAXA 3WDSA 4FC6A 4DA9A 1YL6A 1NQAO 5KKCA 4CL8A 3RJ5A 3GN1A 1C0PA 3DMTC 3S2FA 4DIFA 1GAEO 1EUDA 1PJ4A 3N58A 3ZWXA 5A5FA 1ZVMA 3B1FA 4MDHA 4IZHA 3RC1A 4P4NA 1NVTA 4Q3EA 5TS3A 5A03A 1DB3A 3ZHZA 2Y0DA 2PR2A 3UICA 5A05A 3DMYA 3ZU3A 3ZHYA 1PR3A 2W2KA 1Z6ZA 3LF1A 5TIIA 1RPNA 2DUUA 4LVCA 4RF4A 4CUKA 1X13A 1UXKA 4E3ZA 3RUIA 5T57A 4OYRA 4WCFA 5ENVA 4FS3A 3MTGA 4WGGA 3STHA 3EC7A 1GR0A 4WLVA 4YQZA 2BELA 3QJ5A 2DFVA 3DXFA 1GFSA 1B8PA 2EKLA 3TSCA 4ZN6A 2V65A 1ZK3A 2IEBA 2JFFA 1LEHA 4GX2A 3AUAA 4AFNA 3JQ8B 3F6YA 2OFPA 2XF8A 1NFQA 1VL8A 5IN4A 2BFPA 4XB2A 3GAZA 3RKRA 3H2ZA 2JFGA 3ZV4A 2PGDA 4KWHA 1V35A 3ZWPA 4Q3CA 4CR8A 2O50A 3TWOA 1XWFA 2EW8A 3VH3A 1UDBA 3TOXA 1E92A 4Y6RA 3OQ1A 1PJCA 4E21A 3PFWO 1R4MB 2HMVA 4GPD1 5C7LO 2VUUA 4PZDA 4NMHA 4BNYA 3TFOA 4HBGA 1O9BA 4ESOA 2E4AA 4AJHA 3QLJA 3L9XA 3BA1A 1BVRA 1QRRA 4BS9A 3WGQA 4DC1A 3DHEA 1EEHA 4EW6A 2PLAA 1MUUA 4RQTA 2PA3A 2LDBA 3OIFA 4WLOA 4Z0PA 2PTGA 4BO5A 5JDIA 1BSVA 1E1MA 1U3UA 1UXGA 4JJFA 1JA9A 4NZ9A 3MJEA 5HM8A 3GEDA 4OJNA 4PG4A 2GN6A 3PQFA 2C20A 4CMEA 1LDGA 2IYOA 1GV0A 1DPGA 1W6UA 1RM0A 2Y66A 3JQ6A 4MVJI 1KIFA 2X22A 4Z9XA 2JD1A 5F1PA 3VPSA 4E5NA 3HDHA 3I9LA 3NTOA 1GD1O 3HB4X 4EJMA 1A7KA 1LSOA 1IUKA 4LRSB 5ITVA 5JY1A 1S6YA 2Y1DA 3RC2A 2Q50A 1F14A 1P74A 2PZMA 3FSRA 1D7OA 3RD5A 4J1NA 3ZU2A 5HA5A 1L1FA 1AHIA 1XGKA 4EGFA 3DZFA 1HEUA 2JAPA 1V3UA 1YXMA 2YV2A 2BI8A 5DCWA 4D3DA 3AUSA 4BNKA 1U4SA 3OIGA 1U5CA 1ZFNA 4AJ1A 1V3TA 3EZLA 1R4NA 4KQWA 2C7GA 3BMNB 4NFYA 4E5YA 3WFJA 4J1TA 3PLNA 2P9GA 3WIDA 1DFGA 3FI9A 3I4CA 3ROQA 3HB5X 3ZWBA 2W90A 2NU9A 3PWKA 3GT0A 1JQBA 3HE3A 3VHRA 3QVWA 1WDLA 2BKAA 3H9EO 3O4RA 3ZWMA 2E6UX 3ZH2A 1WP4A 3Q9UA 4IZIA 3E82A 3NTQA 4Q3NA 5TQVA 1KY5A 4Y6SA 2DTXA 1ENYA 3JQ7A 2ZJ1A 3BAZA 3JYLA 3OSUA 3JD4A 3VPXA 5A9SB 4KOAA 2CNBA 4CMCA 4JP2A 1SB9A 1LDNA 3PIIA 4RVDA 5K0ZA 3DB2A 4D0SA 4U7WA 3M6IA 3ONEA 3Q0EA 4R3WA 4HUJA 3FPCA 3O26A 2QHXA 3A14A 1VKOA 3WXBA 4B3HA 2HQ1A 3RUAA 1X7HA 4Y6PA 4FW8A 4B4UA 3WGTA 2JCXA 3VZRA 1N2SA 4F6LA 4UVHA 1WNTA 1NNUA 1X15A 4XYMA 4XRGA 2VHVA 1I3LA 2I5PO 1LDBA 4J91A 3GLQA 5DF1A 3U0BA 3UF0A 2NVUA 1NAHA 2QRKA 1C1DA 4CMIA 3WNQA 5FI3A 1A71A 4YQYA 3GUCA 3RUDA 4ILKA 1L7EA 1SMKA 4TRRA 2VHZA 3FNHA 3ITDA 5FWNA 1J6UA 4WJZA 5L51A 1K0UA 4EITA 3FNEA 4MPDA 3E1KA 1EBFA 5JCJD 1LDEA 1T1RA 4A7PA 1VKNA 3MJSA 1FDWA 3IS3A 3GEGA 4K9DA 3RU7A 3FN4A 1A4IA 2I76A 2F1KA 5JAMA 2HMSA 2ZB7A 3OECA 3RJ9A 4F6CA 1NX6A 1GUZA 2CF5A 4PLWA 1BXKA 5DNAA 3ROKA 1UR5A 3DBVO 3NT2A 4K6CA 1HZJA 4IJUA 4K28A 3LYLA 5CPBA 4OKIA 5B4TA 4AJPA 2Y0EA 3Q11A 4D3SA 3ZNNA 2UV8A 3CH6A 4TKLA 4Y67A 2IZ0A 1P1HA 2CY0A 1I2BA 4OOFA 3WQQA 3FR7A 3TZHA 5L7TA 5JMPA 2C5EA 3K6JA 3GVHA 4WASA 1ZK0A 4CMHA 1HLDA 2Y68A 2IZZA 4BO0A 4OM8A 2FY8A 4E2ZA 1E7YA 5L7WA 1E3SA 1XKQA 2B5VA 2DUWA 4A5OA 4OQZA 3EYWA 4IMRA 4PZEA 4IDBA 3LC2O 3UCXA 4NBTA 3RFVA 4XYBA 1PR9A 1QV7A 2OZPA 2Y05A 4DUPA 3JQBC 1ZO8A 3P2OA 5TGDA 3RUEA 2O2YA 4DTIA 1I01A 3C1OA 1ORRA 1H5QA 5CDGA 4NI5A 3A1NA 3IJRA 3VH2A 3GEMA 4A27A 3ZI0A 1ZJZA 3KVOA 4L8VA 3WTCA 4BO9A 4I5EA 4E5MA 1HXHA 3R6DA 4IXTA 4RCVA 3W4IA 1U1IA 3E5RA 2RBEA 2Z5LA 2VYVD 2VN8A 3GMDA 1ADFA 1TT7A 4BKUA 5BSHA 5CG2A 4JLWA 4CODB 1PZHA 1KEUA 1XR3A 3WOHA 1GZ6A 3KXDA 1XEAA 2CZCA 2E48A 4QX6A 3ICCA 2Y1EA 3JQ8A 2Q3EA 1HF3A 1KEVA 1DSSG 2V7PA 1VE9A 3QVTA 4BO2A 5EERA 5KJFA 1BVUA 4J43A 4R51A 3R0IA 2DLDA 1NPYA 4P8RA 3M1LA 2VYND 2OUIA 3TQHA 3AU9A 3GF4A 4R69A 4GQAA 4CQLB 1VSUA 4W9NC 1XYGA 2VRCD 5KJ1A 1DFIA 4BMSA 1R4MA 2AXQA 2FSSA 2QG4A 1LU9A 2VNSA 1PS9A 3UUWA 1LC3A 4PZCA 4EDFA 2WWRA 3KZVA 4BV9A 4R4JA 3VC7A 2HO5A 5L7YA 3WICA 4NBUA 4DPMA 4RF5A 1BXZA 2X9NA 3GDGA 4OAQA 4LN1A 4UEKA 4WE3A 5CDTA 4YRDA 2CSUA 2YHUA 4E13A 2OL4A 4G81A 5FI5A 3EUWA 3WS7A 5GMOA 1E7QA 4OL9A 1DC6A 3EMKA 5ICSA 1MFPA 5CPFA 4B3IA 3K96A 5JPIA 2WDZA 3F9IA 5F5LA 1QLHA 2BF7A 3D3WB 4XQEA 5T8KA 2JKVA 1FDUA 3ZWVA 4WNIA 3BTUA 3PYMA 1ZK1A 3KBOA 4MVJF 4IDAA 2V6MA 4NG5A 3AY3A 4LVUA 3BTOA 1FXSA 1MXHA 1Q7GA 3WYCA 4YAKA 4MVJD 1DIAA 4M8SA 1U8FO 1KS9A 2EEZA 2EGGA 2WYUA 4PG5A 4B79A 1YVEI 5KOIA 5U9CA 2EERA 3ROPA 3H9QA 1ISHA 2O2SA 3NJ8A 4D3FA 1H6AA 1LLCA 4JJIA 1YB4A 2Q2QA 2PKRA 3JYQA 3OQBA 3NKLA 3LK7A 1E1NA 2YDXA 1J49A 5LCXA 4ALLA 3BMNA 1UZMA 4YCAA 1E77A 2Y1OA 3L4BA 3PJGA 5U4QA 4BO8A 4W82A 1CDOA 5JBIA 4ND5A 3WQSB 2BMAA 2GO1A 5AXDA 3BMOB 5BR7A 2JJYA 2FZWA 2C7VA 4FC7A 1E7WA 1LRJA 2B5WA 1IYZA 1KEPA 4PLGA 4GLOA 1P31A 1WWKA 2YHIB 3JSAA 1GTMA 5JCJA 3Q9NA 3V8BA 4RLSA 3EK2A 1SO8A 1UH5A 2R6JA 2WTBA 1A5ZA 4H3VA 2OP0A 1HT0A 3GVPA 1HDXA 3OJ0A 4PG7A 5B37A 4IPTA 4DLAA 2X1HA 1ZKMA 2QYTA 2WMDA 4NJMB 3VVBA 1N7HA 3G49A 2JD2A 5A9SA 6LDHA 1BWSA 1N9GB 4AJJA 1VLLA 1QG6A 1C14A 2P5YA 2R2GA 4YEDA 2Q49A 2YW9A 3LZ6A 1CYDA 4IY1A 4KUHA 4ND3A 4PGFA 5ES3A 1IPFA 1F06A 4YWJA 5A3VA 7ADHA 5AXAA 5KWEA 4ZQEA 5F1KA 4TVOA 3GVIA 4QSMA 2P4HX 2AEFA 3LDHA 4XCVA 2ZQZA 4UULA 1N1EA 1VPDA 3DZKA 2B83A 3OEWA 5H82A 2PZKA 4J1SA 4N5MA 2EWMA 3WGIA 4OSOA 3C7DB 1YS4A 3ZHBA 1ZMOA 5L3ZA 5C3MA 1R0KA 3MJTA 1D3AA 4HFJA 1QYXA 2J3KA 4WEQA 4KTTE 1PJLA 4DYVA 5IZCC 5KKAA 3ICPA 5I9NA 3CTMA 4EZBA 3SX2A 4GH5A 1IL0A 1MLDA 4Q9NA 3I9OA 3K92A 4JP3A 1YDWA 2VCYA 1B14A 5IG2A 4M87A 4WEOA 4YJHB 3DFUA 2X8LA 4F3YA 3WSWA 2DKNA 4AJLA 1NTOA 3DQPA 4BNVA 2X0JA 5JYEA 4P38A 3GGPA 2Q4BA 1DBVO 3DC2A 4EUHA 2VYVA 3KSDO 4OGWA 2A4KA 2H1SA 4LRTB 1U2DA 2GF2A 4IUYA 1VC2A 4CM9A 2AQKA 2ZYGA 3ZV3A 3D5QA 3LC7O 3OM9A 3S8MA 1I3KA 1QKIA 1ZXBA 4II2A 3WWYA 4C7JA 4D46A 5IFLA 1I3NA 2UUPA 1QYVA 3GVCA 3FNFA 4GKVA 5I7EA 2FN7A 4FPXA 3L6DA 1E7MA 4RVSA 4M86A 4QFDA 2NTVA 3TL3A 1SCUA 2VT3A 3VPGA 3H5RA 1YL7A 4BNMA 4NHEA 4MVJG 2HJSA 2EKPA 3GA0A 3PXXA 4XYLA 4S3MA 5JXWA 4CM1A 1ZW1A 3QWBA 3VTZA 4BGVA 1I2ZA 1ZZEA 2B4RO 4J6FA 1P1KA 1E7SA 4IQGA 1LLUA 4LCEA 4XQCA 3ZZNA 3C3XA 2VTEA 3GVXA 3SJUA 3PQEA 3WJAA 1ONOA 3EY4A 4OSPA 4RF3A 2NTNA 1MV8A 4LMPA 4BIIA 3ZV5A 1O5IA 1O95A 4R68A 3TN7A 3INTA 4W6ZA 4BNUA 1I36A 2PGLA 4YB8A 5EIOA 3ZN2A 4PRLA 2EJVA 5JAIA 1U3WA 3DONA 4JROA 4XGIA 2CUKA 5EQDA 2OOSA 4U0KA 3WYBA 4FFMA 3K2EA 2J8ZA 1EUCA 4IGEA 1GYQA 3HFGA 4P4LA 4G65A 1ISFA 2GZ3A 2B0JA 4BHTA 5BNIA 1YJ8A 4BO7A 3PZRA 2G1UA 1ARZA 3W8EA 4RQUA 1CQIA 1ZEJA 3F1KA 4CQLA 4CJXA 4X54A 5COAA 1VJTA 2YFHA 1EE9A 1PS0A 2GZ2A 4IS2A 4PLFA 3WBBA 3VPHA 3KYBA 1EMDA 1LUAA 2VWHA 3SC6A 4HKTA 3GC6A 1LQUA 3SJ7A 1EUZA 2X0IA 3G17A 1D4FA 2O3UA 2RH8A 3F4BA 1E1LA 4WLEA 4YDRA 3PDUA 1HRDA 3GNSA 4JBHA 2QZ9A 1UP7A 1DLIA 2CDBA 5JC1A 4E2XA 2BFOA 3V5NA 1SAYA 1LSSA 1I33A 4KDFA 1DEHA 5JO9A 3PEFA 4BV8A 3PZBA 3JTMA 1HDYA 2PZJA 4RPJA 2YZ7A 5EQFA 4CLXA 1NQTA 1U28A 1V8BA 2Z95A 3JQFC 4PLYA 1WZIA 3MJCA 4CMKA 2Q1UA 5DP1A 3HN2A 2DPGA 1TA4A 1Q1NA 4DLBA 2X9VA 1PGJA 3I23A 2P4QA 3KETA 1U5AA 2Q99A 5CFZA 4ZQBA 4KMSA 4Q39A 3OFSA 4U0JA 5BQFA 4PLTA 1B3RA 3KM0A 3VAZA 4LISA 3UXYA 1ID1A 2PZLA 1B3BA 2GNAA 2X5OA 3IIEA 3I5MA 4J7XA 3UCEA 4B3JA 2PH5A 3WB9A 5DT9A 4E2WA 5HS4A 2C5AA 4K6FA 1B15A 4R9RA 4B8WA 4N5LA 1Z45A 3WYEA 4FFOA 2W2LA 2POQX 4Z0HO 3WBFA 3BMOA 5EESA 3WG9A 5IDXA 1OOEA 1KC1A 4JCOA 2HMWA 3U62A 4I1IA 1PX0A 2YHIA 1X14A 3FTNA 3RBVA 3UAGA 1GYRA 4MO2A 3ITKA 3ZNOA 3TPCA 2GGSA 2GERA 3HQ4O 4CR6A 4NU6A 2E37A 1BXGA 1I8TA 2ZKLA 2WYVA 3PHHA 4NJMA 4ROSA 4Y98A 4YXFA 3QY9A 4UUOA 4HADA 1N9GA 3GRKA 4FJ1A 5ENDA 1H6CA 3UFXA 5DOVA 4M49A 1BDBA 2VWPA 3AI2A 1GL3A 1H93A 3CZRA 3ENKA 4A0SA 2EP7A 4BL5A 1KVTA 1PGNA 1MGOA 1PJ2A 3RIHA 4LMRA 3H2SA 4CLEA 2Y0CA 4HV4A 1JKJA 5HRUA 3OQ6A 3Q3CA 4YJGB 2DAPA 1QYDA 3B6ZA 1M75A 1GV1A 2JHFA 4GGPA 3JQ9C 1LRKA 4TVBA 4M54A 2A94A 4TSKA 1LJ8A 2NU8A 3L4SO 1PJBA 3HUDA 5B12A 3KEOA 1EK5A 2HCTA 2UVDA 1V0JA 4TWRA 5IF3A 4BNIA 3FHLA 1Q0LA 1HDZA 1RYEA 4AG3A 1P1JA 1YWGO 4RV9A 2BD0A 2CDCA 1O6ZA 3VTFA 5CEFA 4XQ9A 2V6FA 4YTEA 5IN5A 3FWNA 4XZ3A 4QO7A 4B4OA 2QIOA 1HETA 1LA2A 3P19A 4J9VA 2JCYA 5T6BA 1ZSNA 2C82A 3GRPA 5DCYA 3ENNA 4M89A 5TC4A 4QQRA 2J5QA 2DT5A 4YJHA 2FWMX 1H6DA 3SLKA 1K89A 1T2DA 1K6IA 2I3AA 3PQDA 4GGOA 3AUTA 4MKRA 1E5LA 1ENPA 4KZPA 4WOKA 1HSZA 1VL0A 5U1PA 1C0IA 3RCBA 4PVDA 4IJWA 1HE5A 1T4DA 3ZGYA 4NH4A 1UUFA 2BLLA 1IPEA 1J5PA 2FOIA 3W6UA 2Q4EA 3AM5A 3IP1A 1MX3A 3OJLA 5FEUA 2NSDA 1H94A 1UAGA 2ZK7A 3E18A 3ADPA 1LSJA 1FJHA 3WGZA 4XGNA 4CMJA 4DMLA 1UDAA 3GZNA 4RVHA 3R1IA 3RUCA 5ICMA 3D7LA 4CV3A 2DPHA 1Y5RA 4KTVE 2FR0A 1HWYA 4OXKA 3DOOA 2O4CA 5JC8A 2VUSA 4IJKA 4WECA 2BHLA 2FPPA 2RCYA 4WCDA 4AJ2A 1HZZA 3C24A 3ZCXA 4ZQGA 4RZHA 3GFGA 3PJDA 5IXYA 2ZTLA 4IDGA 3I9JA 1PZEA 2J3JA 3JQBA 1JWBB 4E4YA 5JFOA 2D3TA 3O9ZA 3WLEA 1MFZA 3JQGB 5EN4A 4R3NA 2VOJA 3GG2A 1HYEA 4NBVA 4YACA 1Y6JA 5T64A 4TKMA 3ADOA 3PLRA 4F46A 2FHSA 3ZU4A 1QR6A 3VZSA 1GPDG 3FTPA 4D0RA 2ZB3A 1Q0QA 4J1QA 4B4WA 4JQCA 4RZIA 3OA0A 1RYDA 4INAA 2WYWA 3QWIA 4L75A 1KVRA 4MP6A 4Q3AA 4TMFA 3H65A 9LDBA 3D0OA 2NM0A 1NP3A 5CG1A 4OO3A 3CIFA 1GZ4A 4UVDA 4QFCA 3DWFA 3JQAB 4DVJA 3A06A 3BYZA 1E3LA 3S1LA 2O4UX 5I8WA 1Y7TA 3TJRA 3UW3A 2XAAA 3IKVA 1EVZA 1DC5A 3GHYA 3H8VA 4CLHA 4DLLA 5IJZA 3PGJA 1NPTO 4JN6B 3ON5A 2YV1A 1NHWA 4W9NA 2OGUA 2Y1FA 4RPHA 3K8ZA 1E0DA 2WE7A 3TZ6A 3U4DA 3ZV6A 1GZ3A 2HK7A 3QWFA 1KY4A 4PLZA 2PH3A 3DFZA 3ETGA 3DBLB 2UYYA 2VWGA 5DOZA 1YRLA 1MC4A 3GG9A 3O38A 5CHEA 1RM3A 1X7DA 2DVMA 2O23A 1Z75A 3IUSA 4E2YA 1G1AA 3TNLA 4Y8VA 1B7GO 3RC7A 2GSDA 2YV3A 4E0BA 2AQ8A 1ADCA 1T2AA 4XR9A 3RQSA 1XU9A 1SNYA 1UXJA 4DRYA 4PN3A 4TQGA 3E48A 5ITWA 3QW2A 4QUKA 4LSWA 1U3TA 1EE2A 1LSUA 1PU2A 3IAHA 1E3EA 1SB8A 1XA0A 2ZTMA 4XJTA 3H4VA 1TB4A 3K2BA 5IZ4A 3VDQA 1J0XO 2IXBA 4CLRB 2Q2VA 2YQ5A 3PGXA 3HFSA 1PGPA 4L0QA 3W8FA 2R00C 3PVZA 1T1SA 1EDZA 3GPDG 1NBOA 1CETA 4J2OA 1H6BA 5A5EA 4BNJA 1PTJA 2AE2A 1XHLA 4OKNA 2Z1NA 4ZRMA 4K26A 4GVXA 3LLSA 5I7VA 1FK8A 4D42A 2GASA 5DZSA 1WDMA 2NWQA 3K31A 4NJOA 1DJNA 1E6WA 2AQHA 2FR8A 1RM4A 1T2EA 3PHGA 1TXGA 4JGBA 5L45A 1NXQA 2IRWA 3GMSA 3PFFA 5TT1A 1QMGA 4A2CA 2NNLD 3JQCA 3GGOA 3F47A 2YQ4A 4YT8A 4BKOA 3KHUA 5A9TA 3SC4A 4BB5A 1ULUA 3I4FA 2GN8A 1T2CA 1LRLA 3ANMA 2IDZA 2NU7A 3DAFA 1V3VA 3I52A 3KSUA 4B7XA 5B4UA 3IC5A 4XDZA 4YJGA 1GPJA 4H7PA 2J3IA 2YJZA 3VKVA 3C1AA 3JCZA 3ETDA 3DDNA 4OXYA 2P68A 4BO3A 5CEJA 3KSZO 4ITUA 3NGXA 3X2EA 4O1MA 1PL8A 3JV7A 2NQ8A 2QZZA 4XIJA 3D4OA 1H2BA 3R3SA 4CV0A 1JW9B 1U9JA 2NVWA 3RASA 3BIOA 3GZ4A 4AJ4A 4CM9D 4DQVA 1RKXA 4IDEA 4JIGA 5LDGA 5IZCA 1KVQA 2EKQA 4HNGA 4NDNE 3S2EA 3JD2A 3RC9A 1RM5A 4N54A 4O6VA 1DLJA 1BG6A 4OH1A 4IQ0A 2PD4A 1GQ2A 2QQ5A 4Y9DA 2I67A 2QX7A 4ZA2A 1IHXA 2J3HA 4BUCA 1DO8A 3V2UA 4OOEA 2HKIA 2WE8A 1BW9B 4S1VA 4FJ0A 5IDYA 1F0YA 2PKQP 3NTRA 4XX0A 1GCOA 1YH3A 5HWSA 4CV2A 1ONPA 1XU7A 4NBWA 5TT0A 1MXFA 3FBGA 4N18A 3PWZA 4YPOA 2Y67A 1AE1A 1R0SA 2Q1TA 5A06A 4MVJP 3UN1A 1EBUA 3PHIA 3NDIA 3P5SA 4FQ8A 3RROA 4XB1A 5L40A 1ADBA 2ZYAA 4YA6A 5AXCA 5MDHA 3ZW8A 3EW7A 2RIRA 4CMBA 3WFIA 4IIVA 4L74A 4LSMA 2VUTA 3LT1A 4BNNA 5H83A 2X0NA 3DOCA 3NDRA 2PV7A 4D79A 2NTJA 3AY6A 2CVOA 9LDTA 3W4KA 3JQGA 1O8CA 3TOZA 3LC1O 4I5GA 4CLOB 2ZQYA 1DC4A 1WDKA 4E6PA 4E33A 3Q6IA 4IINA 3JQEA 4CLDA 2J5RA 4I9UA 4MKXA 2LDXA 3MOGA 3WGGA 1YE3A 4ND1A 5G0WA 4DPKA 1YO6A 1SEPA 3RSHA 4A26A 3PWSA 3UVEA 3LT0A 4U6QA 1N7GA 1U8XX 4CUZA 1UXIA 1A4UA 1GUFA 2HMTA 4RORA 3OF2A 3WMWA 1MA0A 2RHCA 1ZCJA 3CINA 4NU5A 4B7CA 1OZAA 4E30A 3JD1A 1CIVA 2EF1A 3AOEC 4BO4A 5L4LA 5EMHA 1UP4A 2ZTUA 1E3IA 3HHPA 2FRDA 1U2GA 4G5HA 2P2SA 3HG7A 3VOSA 4TRNA 3FNGA 4BVAA 4I5DA 1OAAA 3DZIA 2CVQA 3ORFA 1I24A 3ASUA 4XA8A 3DZBA 1IY8A 3T7EA 2GN4A 4ZD6A 5FFFA 4HNHA 4DXHA 4GMGA 2VTDA 4JBGA 4I9NA 2AHRA 3HN7A 1VM6A 5IXSA 3KTDA 3OMLA 4BGUA 1IB6A 3NT4A 4KQXA 2ET6A 3NT5A 4DBVO 3AI1A 5JLAA 4DPLA 1T2FA 4XGKA 1LLQA 4EEXA 3E5MA 3KB6A 1XSEA 4A10A 3GHHA 4DQXA 3DBLA 1GU7A 5AOVA 3KLMX 1CERA 3DAPA 1HE3A 5DBFA 4HY3A 2VT2A 3JYPA 1N1GA 2FPGA 2NLOA 5KVSA 2VWQA 1Y9AA 3DBHB 2OP1A 3BMQB 4P4GA 3CSDA 2Y93A 4U8GA 3VDRA 3U4IA 3PPIA 2W4QA 3IJPA 1ZH8A 3CMCO 3QA9A 2BFMA 2D5CA 2OORA 2W2LD 1R37A 2GRAA 3JQFA 3OIDA 1I32A 4DWVA 1YKFA 5ER6A 5G4LA 3W4JA 3L07A 1HYGA 3LLVA 4J4TA 1B2LA 3UKOA 3PJFA 4GSLA 2Y1GA 4W4TA 4BNLA 3PJEA 3BHIA 1EVJA 5G0SA 1LNQA 4CLRA 2VZ0A 4J0EA 1LC0A 4HX5A 4DC0A 1WW8A 2FP4A 5F5NA 3T7CA 1ISJA 1DRUA 1NWHA 1ISGA 1C3VA 4GLLA 2C0CA 3QE3A 1YBVA 2PD6A 2O48X 4OXNA 3D4PA 2D59A 2OBYA 3ANNA 4U5QA 5JE8A 4C4OA 4FFLA 2HLPA 2QRJA 4D43A 4L73A 4YAIA 1YJQA 3I3OA 3A4VA 5ADHA 5JCXA 3M2PA 4CR7A 2Y1CA 2EGHA 4BO1A 4XEHA 1NQ5A 1M2WA 1VRWA 2O3SA 3IMFA 3OHSX 4HFNA 2IZ1A 2WM3A 3NAQA 4NK5A 3QSGA 3HDYA 1NFRA 5KVCA 2VRBA 3KEQA 5A4DA 3KRTA 2B4TO 3QRWA 2A35A 2ZTVA 1JLLA 3HADA 2AEJA 3H6KA 1OBFO 3DHYA 3GOHA 2H5LA 2Z1MA 8ADHA 3DMTA 2RAFA 3B1KA 4R1NA 1P45A 3LU1A 1AXGA 3WLFA 3ZDFA 5G4KB 4R41A 1B0AA 2UUOA 1DC3A 2QRLA 3F1LA 2DBVO 4ND2A 3Q2KA 3MTJA 3WJ7A 1F12A 3AI3A 5KJ6A 2O7QA 2Q1SA 4GBJA 3GH3A 4CV1A 4UAGA 3QQPA 5THKA 3AU8A 4GWGA 4J7CA 3AOGA 4RL6A 4UUNA 3JQ9A 3E9MA 3IDSA 3KO8A 4ZVVA 4K1LA 1R16A 1P33A 4MJLA 3GFBA 2X9GA 3RFXA 4DL9A 5DBIA 1N92A 4WLNA 4XJSA 3UH1A 1UXHA 1A9YA 4R9SA 1XLTA 2CDAA 3VKUA 1FMCA 2NACA 3NV9A 5L95A 2AG8A 2E49A 4QO8A 2OO5A 2GPTA 2ZB4A 1PWXA 1Y8RB 1E1KA 4U6SA 2IE0A 2IEDA 2VHWA 3NX4A 3PDJA 1H0KA 4J0FA 3ZW9A 4XDYA 5ILGA 3W8DA 4FGWA 3L0DA 4Z9FA 3E03A 4UUMA 3OH8A 3LT4A 4OMUA 2PGJA 4II3A 4HFRA 5A3JA 1DIHA 3AJRA 3GN2A 3VPFA 1Y9EA 1BW9A 2CVZA 3A9WA 4AJEA 1JKFA 4BNFA 3AM3A 3RBXA 2HK9A 4KDEA 1PL7A 2X86A 2I3GA 2Q1WA 3G1UA 1Z7EA 4L76A 3CEAA 3ZWOA 4ZQFA 3JYNA 3QP9A 3RI3A 2NV6A 4J49A 3TZKA 5CDUA 4Q3BA 1W0CA 2G76A 4MKZA 2NUAA 5COBA 4BQRA 1H9AA 1MG0A 3GDOA 4GWKA 4HFMA 5TJ9A 4IMPA 2PD3A 2PKQO 1KC3A 3ANLA 3D3WA 4L9RA 5K6AC 1ZJYA 3QHAA 4PLVA 3AK4A 3AFMA 3OA2A 4GX1A 5L4NA 5F3RA 1JAYA 4I8XA 2A92A 3DZJA 1JVSA 4UVIA 2OXIA 1YBMA 2VNAA 4BGIA 4E12A 2AEMA 1YBAA 3DOJA 1D1TA 4BGEA 3UHAA 1R12A 2UAGA 1KEWA 1YOVB 4CLOA 1LX6A 3VVCA 1FDTA 1EQ2A 1ISIA 4MP3A 3S2GA 2YDYA 1AGNA 1N8KA 1WZEA 4HP8A 4O59O 4G2NA 4R01A 1Z74A 3DO5A 5A9RA 1Q7BA 5I8ZA 3ROMA 3KOUA 1M67A 4FD3A 3ABIA 1Q2XA 1IE3A 3FBTA 3Q2IA 1C1XB 4FIZA 4GX0A 4WKGA 3D3EA 3CXRA 4YAJA 1E7RA 4GMFA 4ZICA 4YT2A 4LGVA 4EYEA 2C2XA 1P0CA 5I7FA 1C0LA 4NFSA 4GKBA 4FB5A 5A1TA 2NADA 2PNFA 1S7CA 4PFJA 5G0UA 2BGMA 2C54A 3NRCA 5I9LA 4J9UE 3EHEA 4WNCA 4BKPA 1HL3A 5L53A 1ZNQO 3MOIA 3GUYA 4PCVA 4QEDA 3DL2A 1CWUA 4LCJA 1H9BA
chains in the Genus database with same CATH superfamily
4A03A 2J7PD 1Q7EA 3OJEA 3P52A 1VRCA 3SEFA 3R0VA 4O2BF 2D5AA 1ZSVA 4QUJA 4RLHA 1MRZA 2UXBB 4Q4JA 3VV2A 3CUUA 4BNWA 3OBBA 4A6XA 2W2QA 3CNBA 1PE0A 3ORYA 3K5HA 3VZPA 1L5FA 1HI9A 2CXNA 1GQQA 2Q4TA 2X58A 4CM6A 4LAFA 4FYJA 3HY4A 2V9CA 1J2EA 1JGTA 4P7BA 3BTSA 4TKUB 3VR6A 3WYAA 1PFKA 4FFVA 4NC9A 4XYGA 3RVJA 2Q5OA 5JROA 3KQLA 3UPUA 5ALEA 1E2IA 1U3FA 4AUNA 1JR3E 2JGJA 4K6HA 1KYQA 4D74A 3DBHA 3JYOA 4A1FA 3BMQA 3K0EA 3G8CA 3MJDA 2FLKA 5FWDA 4BNHA 2R5FA 2W2OA 4N5NA 1Z36A 5LB4A 1XF9A 1PJTA 4DDVA 1NP6A 4NRDA 3BAFA 3AI7A 3Q2OA 4WQMA 1U0HC 3IOEA 1PWZA 1XUOA 3R7WB 4A4DA 1TI7A 2O14A 4GX5A 1NBMA 5JWOA 1Z33A 1N5LA 3GGGA 1UF9A 3TSOA 4C01A 4XQGA 1O7JA 2IHBA 3L7BA 2D0IA 3QV1A 5ALFA 4PYQA 3UUEA 5DLPA 4A3SA 1G60A 2C29D 3Q7PA 5IWCA 5JH7A 2C78A 5JNLA 4LBZA 5DBEX 1PZNA 3IHTA 1JIKA 5E4YA 4RPKA 4D8TA 3DBIA 1AXRA 1DZ3A 4Y2RA 3D4BA 3ZQJA 2NZVG 1PK8A 1XJ5A 4UUQA 2ZRIA 2HSDA 5IC4A 3ASVA 1Q6YA 3V1KA 2FJPA 3B1JA 4GSKA 5G0VA 3WIVA 3ICEA 3ZOKA 1T25A 5GGXA 1ZIDA 3K6KA 3N74A 5LZ4A 4OATA 1JEDA 2ZS7A 3BSWA 2HWXA 4TYMA 4WN9B 5DN9A 4B7UA 4Z1OA 1DIBA 2A78A 5ER9A 1R6UA 4B4KA 4ZQHA 2ILVA 1C0EA 5C7OO 4DR5B 2VSFA 4UBOA 3CLVA 1MQ8B 2NQTA 3KYCB 3L43A 1CUXA 5CCBA 5CYPA 2XZDA 1T3LA 1UQUA 2A59A 1CUSA 2B36A 3IQIX 1NXOA 2PSEA 3HKCB 4PSKA 3ZDAA 4LK3A 5L4SA 4F9TA 1GRQA 5BQXA 1LD3A 4BNTA 2W0SA 3VR4A 1YCFA 2HX1A 2NO1A 3INRA 1UEJA 2COUA 3QKUA 3W5HA 5CFMA 5KVAA 2W8ZA 3N7TA 5TNXA 4AKEA 2Q21A 1CZLA 3SZRA 5BWCA 3G2QA 4IIFA 1JS1X 2EYUA 2GD1O 5LA6F 3E6AA 2AW5A 1Y3CE 1YCHA 3LXMA 2YS7A 2R62A 4A6DA 4PC1A 3EJ6A 4OQNA 1MP0A 2IXTA 5A1JA 1VHTA 1HLPA 4D9HA 1XRSB 4Q5IA 4JNCA 4KX3A 1LQTA 2GMWA 4R5HA 2FMKA 3BMXA 1QB7A 4E1BA 4QLOA 3LL7A 3PE3A 1Z15A 1H66A 3ME5A 3HUUA 3RTBA 4IJVA 1ESDA 1P1CA 1PK9A 3WTBA 5FWAA 1TM1E 5AW0A 3M9WA 4ETWA 4YVFA 1XVLA 2XUQA 5BUCA 1ULSA 1Z5UA 4R16A 1A9ZA 3DVQX 5EJFA 3TAHA 2O8CB 1NVVQ 1B41A 2QRPA 4I3FA 1N4AA 1G7TA 4URXR 5TMPA 2JL1A 3EZ7A 4BLWA 5EHXA 4HDSA 3IIIA 2AR0A 3NCTA 1Z08A 2ZIAA 1WQ3A 3TQCA 3PXCX 2YHAA 4Z0TA 3UFBA 5C8VA 1P3Y1 2WT4A 4LX8A 2XMGA 4GSYA 4KIUA 1D04A 1W48A 4ZP1A 5F7JA 4EVIA 2D8AA 1NMYA 1D6MA 2RIPA 2YRXA 4KYTA 5A3RA 2XYVA 1R6XA 5IPFA 4KCGA 1K2WA 1QTRA 5BT9A 5DM0A 1BRMA 1CULC 1K3UB 5DISB 3MTQA 1DQNA 1HG0A 1HRKA 3I9MA 3IMGA 4MWDA 2WM9B 4UU8A 5H1YA 4BBJA 1ABEA 3VMMA 2SCUA 4DJ5X 1C7EA 2BUCA 4XIFA 2ADOA 2V6GA 4LJYA 2YC2C 1X8LA 3FSGD 5K0LA 2BGKA 5BV1A 2FMTA 3I32A 4OIMA 2O8EA 2O59A 2FPIA 4HPXB 4IF4A 4M46A 1P4AA 1NC1A 2QRZA 4XTRA 1FYEA 3PITA 4G41A 4IS3A 1NI4A 1EWYA 1VBKA 3KQTA 2HDHA 3UT5A 4QVKA 3G2HA 4PXSA 3R9KA 4DLTA 3OTOB 3PIDA 3N28A 4B43A 4KWTA 5JS7A 3M6VA 1GUBA 3F98A 5HQ3A 3A31A 5JSHA 1OTHA 1ZOSA 3Q3VA 4JZYA 3DDWA 1R6BX 2A1TS 5TB5A 4YMWA 2BFEA 2OAQ1 4HRAA 5LZ8A 3UK7A 4QGAA 4RTLA 1MC5A 3KR1A 4YRGA 2BCGY 5B3AA 1AKUA 2OG1A 3F7MA 1M0WA 1RLIA 2BEVA 1RRVA 1V95A 5DLDA 4C6SA 1DAOA 2NU6A 2XRZA 3ZLVA 2FEMA 1A0OA 4CETA 3OURA 1C1YA 1QQ6A 4JI5B 1KR2A 2GQ0A 2QE7A 2FW8A 1DEKA 1E0KA 4JUBA 2Y0BA 2ZJOA 1VPVA 4FN4A 1GR1A 4PIPA 2C5FA 4V3CA 5H81A 4NLLA 1V6AA 4EL5A 5E6UA 4DYDA 3PRJA 3HUTA 4CT0A 1XQWA 1J0CA 3JW8A 3UOGA 1NSYA 3UJBA 5BRAA 2ZDQA 1LDYA 2PRIA 1JG7A 2DQ4A 3PUXA 1W94A 1UAYA 4PSAA 1ML3A 5LIRA 2V4ZA 4KYVA 3BL6A 1PAUA 3AFNA 3EC1A 4HK4A 1H2XA 4Y1EA 3JQAD 5BYBA 4RK7A 1V9LA 2O3JA 3LF2A 1X92A 5J40A 2VH1A 1AS0A 3WWDA 1TLTA 2A1IA 1JG1A 1CZUA 5CP8A 4C43A 3VSEA 2H63A 4LPSA 4MV7A 3UJPA 2WD7B 4QVGA 4C5BA 4DDTA 2C2MA 1IOZA 4H7HA 4MR7B 4ZZIA 1NOJA 3ZHXA 3MILA 1ODLA 1OR8A 4P4UA 4WCFC 5AVOA 3PYXA 2YASA 3DLCA 2O3TA 2R65A 3UEOA 4YAEA 1N2HA 1GADO 2FE1A 5FL7D 1JHZA 3CB2A 1CB0A 3G89A 2JFWA 2VKTA 3A26A 4HUQA 4I4CA 4IRMA 3ZK9A 4EY6A 5A5DA 3L8DA 4XFKA 3MS4A 3SHQA 3O03A 4XSHA 4K6GA 4FT4A 4ZO9A 1FA9A 2VJCA 4FFBB 5BXQC 2UVPA 2GKOA 1P2VA 5D8DA 1E8MA 4LHZA 3UGKA 4R7GA 4ZI5A 1W85A 5DGDA 5I01A 3GGJA 1BCRA 3COWA 4EJ0A 2B8JA 3GLKA 3ZZ1A 5LR6A 3O90A 1XNRB 1IDOA 1RP1A 4CM3A 1OAKA 4IILA 4UXHA 1EJ6A 2V59A 4C4TA 4E31A 4BJHB 4GQBA 4KPUB 4Q4AB 1E2NA 3UPDA 5AM1A 4MYCA 4LBVA 5CNIA 5AKYA 3D4LA 2CKMA 2G6TA 5ILOA 2XD4A 1QHYA 1RSZA 5AW5A 3CO0S 4RE5A 1K6EA 3EGOA 4P08A 1Z63A 2JANA 4J2HA 1U7TA 4OYHA 3U5ZB 2C7RA 2Z56A 4UAVA 1TGVA 1L5VA 3UHFA 5BYAA 4D0NA 3QVSA 5HKBA 1F4PA 3G79A 5REQB 1WMAA 1X7YB 1RWWA 2WM8A 3B6EA 4TKUA 1BN6A 4A6PA 1EXDA 1OZFA 4HRXA 2B4KA 3GPIA 5MGBA 1FCJA 1H0RA 2HXYA 2JVIA 4NZPA 2I6FA 4F12A 1ZR4A 4KFUA 4Z9AA 4JP1A 1UWLA 4NYMR 4CMEC 2R6ZA 1DJOA 4MP8A 3VPDA 4ZT6A 4EUKA 3EG5A 5DSZA 1U4OA 5C35A 3GFSA 5CDYA 4MEBA 1P0FA 1KQNA 4I1SA 3R7WA 3SSAA 5WRFA 4QJIA 5LZ9A 3UV6A 2N1BA 5T4FA 5KCZA 1VGRA 2CF6A 4AIRA 1YE8A 1G16A 1J24A 4MUHA 2I8AA 3FR8A 2VZ8A 2AK2A 4I66A 3I04M 2I71A 2XNHA 1JEQB 2VAWA 2PSFA 1ZU4A 1SVOA 1UBKS 5E9QA 3JTEA 5DULA 4LF4B 2A5GA 1SRRA 5AFSA 1XZAA 1PLJA 4A15A 2JNWA 3BWYA 3HJAA 2B92A 4TXJA 4RBNA 3ND7A 2IYLD 4FCCA 2EX0A 4M6WB 1L7MA 3AFIA 1M6HA 4Y2SA 4CI9A 5AO9A 4H4DA 2A5JA 5JT1A 2FE4A 3CWCA 1FEZA 1WZUA 3PPYA 3LLCA 1LBHA 5DH9A 2NXJA 5EZ5A 4WN9A 5JANA 1P9NA 2Z8ZA 1IJEA 2PXXA 1B93A 3CNQS 4K9KA 4YJKA 3H8SA 5J2TF 5I7SA 3D8NA 3IP3A 3CA8A 3CVUA 2XZPA 4QELA 4CMAA 2CJFA 1Z28A 2QA5A 1UFQA 2ZJ5A 2ZI5A 3GY0A 1L7OA 3HDQA 3KYCA 5JI2E 2B61A 3IELA 4I9HA 2I34A 1XF1A 4TTVA 4DLSA 1DC7A 1Q1GA 3C5EA 4O2RA 5CK4A 3Q3IA 1XMOB 4UOZA 4FNMA 1DC8A 1XIVA 3HKCA 1N36B 2LR0A 4QYXA 4MDFA 2NXEA 2PSHA 5JNRA 4CG2A 1NQOA 2YYYA 5K5EA 2I4NA 2WFLB 4U7DA 4YJFB 3CPHA 1ZY2A 3VOAA 2Q41A 1DAPA 3BGIA 3OCZA 4PSUA 5FPTA 5AW1A 3QVOA 4EW1A 2G67A 3DKPA 3GJ6A 3U4QB 1XCBA 4MUGA 4YMTA 1Z0AA 2D5BA 2FQ1A 4BP3A 1AT1A 1A27A 2B34A 3GIWA 5F1OA 1T26A 2EFGA 3ZTWA 4GW3A 2NNWB 3W8RA 1DJMA 1GPYA 1T91A 3IRVA 2P9QA 5CVTA 2HA0A 1F8GA 2EFCB 3K9BA 2XPCA 3NHBA 4U1RA 3C3MA 1FNBA 4CDMA 2QTRA 4CN9A 3EJWA 3A28A 2RD2A 3BB3A 4X1OA 5T5QA 3AP3A 4XIYA 1V9SA 2O8CA 3ZBUA 4UVEA 3K30A 4ZJPA 3ABOB 4NHOA 1PJQA 2RB4A 3TZCA 5DX1A 5TF4A 4R8MA 2KSQA 5C81A 1T8WA 3H5IA 3S4YA 5AXBA 3BTVA 1S2MA 1D1SA 1KMHB 3PHJA 3U7JA 5EJ2A 4JK3A 3QU4A 4PS0A 3L77A 4BMXA 4LRXA 5JASA 4R1UA 3RADC 3D1JA 4DLZA 1II9A 2JDIA 4IM7A 2YXNA 1VG0B 2QAIA 1RHKA 3M49A 3OHMA 3QU5A 2XZOA 2MTBA 3T4EA 1IULA 3NGMA 5IJ9B 1Z62A 5CFOA 3CS3A 5P8WA 5GZ3A 4BZPA 3BERA 2DBQA 3VPAA 4J3FA 4CQMD 2D2IA 1CB7A 2YIDA 4MINA 2VSQA 5DYYA 4C3ZA 3M2TA 3V4RA 3D7NA 3NHYA 2WG2A 1W9HA 2PCLA 3BHJA 2QLBA 5EIFA 1PDOA 1ZCFA 4BLUA 4JJGA 4F11A 3HEBA 2AZMA 3ZBTA 1YFLA 1MJGM 2WWFA 1AHHA 2OCLA 2V7VA 1E9AA 2WICA 1Q91A 4IGFA 3IGFA 4DA4A 4RVGA 5KYYB 3HK2A 1PZGA 4EPVA 2JPDA 3SWWA 5A5GA 2TECE 2CYAA 3OLVA 4G6ZA 1EX6A 1KMQA 4FEAA 4QJ5A 1XVUA 4R1TA 3RVMA 3RW9A 1G41A 2V74B 3CVOA 3KPVA 3MYRA 4I14A 4CNQA 3T1QA 4HXYA 1HLGA 1J07A 4F5EA 1E6CA 3DZDA 3QBEA 4CM5A 4DQUA 2XTNA 3HO1A 1T9ZA 1Y81A 2CK3A 3EASA 4LQCA 3MWDB 4LXQA 2Z2IA 4RF2A 4COKA 1QP4A 2KLBA 3AKEA 2GETA 1M76A 4G8BA 4X24A 2WV9A 3BBLA 4ZXFA 4KQCA 3WKBA 5BRJA 4UEWA 4M9ZA 1MG5A 1OVMA 3LCCA 5DTRA 5IBCA 5GJBA 1Z83A 1D6JA 1E79A 4W7SA 4FBLA 3CG4A 1EFKA 3H1EA 3KJNA 2DTEA 3NYWA 3PC7A 5IH7A 1ZK2A 4O5OA 1GCIA 2GZRA 4EDHA 3RDPA 2HLNA 3STTA 3VJRA 2QRNA 3MD9A 1SZJG 3TJZA 1EQUA 2H4YA 3IXLA 1PBNA 1PV1A 2WD7A 1KFBB 1P5HA 4TWBA 3E8XA 2F1JA 5J23A 1A1VA 1TECE 2W2KB 1DRJA 2B8WA 3EUEA 2ZUFA 5FF9A 2R8BA 1F7UA 1VKHA 4EHKA 5IP5A 2DG2A 4B3BA 3QEOA 4LY0A 3SJZA 2V3CC 1C3EA 5AQ1A 1XMIA 1PQ4A 2C4HA 4RH3A 1Y5MA 5FNVB 4RIIA 5LNK1 3DDHA 2ABWA 2WF5A 2BGWA 4MHTA 2GX6A 3T7JA 1ZC4A 1NFFA 2FMFA 4FFBA 3LP8A 4URWR 4FVTA 3PKZA 2BYTA 4J4HA 2JIOA 4OEHA 3L5KA 2I2AA 3AV0B 4W8HA 4BV2A 3TQIA 2Z0MA 3NOXA 3VR0A 3I9NA 1Q74A 2WUGA 5DVZA 2GN9A 2JCVA 5M04A 1XO1A 2PL5A 2V7TA 2VPTA 3Q5EA 4JLJA 4KPUA 5YASA 5LDHA 4H1HA 5TV2A 3WP1B 3SI7A 1YB2A 4LV8B 4TV8B 3OZUA 5NULA 4PZ0A 3A1TA 1C0KA 4QEKA 1A76A 1DX4A 1O89A 1YJBA 2YJ6A 4MOWA 5CW1A 4BOYA 3UMMA 4KQ9A 5G0TA 5GZ6A 4J0GA 4PC7A 1HT1E 1VHQA 1W0KD 2J5BA 1QGYA 3BORA 1L5OA 2O2EA 1S3GA 2YNMA 5THQA 1ZKDA 3L6RA 4HOYA 4KP7A 3WQBA 2X5JO 4ZI7B 4W5QA 1PEDA 2AE1A 3O2SB 4ABYA 4LQDA 4WUVA 5REQA 1X7YA 3ZYZA 2FAXA 3BRQA 3FVRA 1G8JA 2ZAOA 3QVXA 1E3TA 2K2WA 5T67A 3BHMA 1EFLA 4FHEA 3GZNB 3OJOA 5B57C 4MQLA 1U0FA 3QA3E 4MTCA 2VYNA 4WK6A 4MW7A 3DD1A 4XW2A 3TPZA 1THZA 1C9EA 1SHKA 2P2LA 2QVZX 3FZNA 4YAGA 1O0BA 4FYHA 5KVVA 5HM6A 2Y99A 1NY6A 3D2BA 3FVQA 2CXHA 4AW9A 1WMBA 5FXMA 1YNOA 3NHUA 1Y7HA 3U9LA 4XCXA 5K3FB 1OKKA 2BM0A 3JAKB 1KQGA 5JV5A 2VPXA 2JIQA 3W5BA 1Y9JA 5ESXA 2I6QA 2P65A 1LLDA 2EV9A 2Y1XA 3V7UA 3CKKA 2CFRA 1BHSA 2YN4A 1I4OA 3AF5A 1BJKA 2JAOA 1TKRA 4GOOD 1LDMA 5H3CA 3CE9A 1R9NA 3OJCA 2QYSA 3H5TA 3V1TC 1GZ7A 4B4VA 3IT1A 4IXNA 2R1UA 3KV3O 2OHXA 4M6WA 2DULA 4YBZA 3LUHA 5HEKA 3V4LA 4FHDA 4YJ3F 2HJRA 2HTFA 2VAXA 3HCNA 3V4OA 2HK8A 3S99A 1XKTA 3EVZA 3EEYA 3UOAB 4BU0A 1L5WA 1EDOA 1NJ2A 4ZCQA 2BFNA 3I5YA 2B1RA 4DSZA 4XWWA 3N5KA 1QM5A 1UBTS 2ZWPA 5C1DA 4OQFA 3AZPA 3PHBE 1BX1A 3K2IA 1EVYA 3SKXA 5BSFA 2A3RA 3PPXA 2WILA 2WY2D 3NW9A 3KDAA 5FBWB 1WCYA 1XJQA 3OUZA 1QE0A 1DAFA 4ZT2A 4KOEC 2EKZA 4RTQA 3L0SA 4BAGA 4D5GA 4FP9A 1NUTA 2WFLA 2XR1A 4RZ3A 2XNDD 4YJFA 2HIAA 3DKVA 5A3QA 2XGGA 4JA2A 4UNQA 3QVGB 1O6CA 1I5EA 1W8IA 1XLVA 1XLWA 2YVLA 4NEHB 4RO0A 5ARDA 5KX5B 2DMRA 2GUWA 4Q12A 2X7HA 2ODEA 1E9EA 3U4QA 2PQ2A 1YZFA 2GR9A 2IUSA 3OWOA 3SBOA 3OE5A 5CT9A 4YX9A 1CZNA 3L0ZA 3BZUA 3BQMB 3N2LA 3QBJA 6REQA 4QXOA 3B12A 2W98A 2PKYX 3IVMA 2VZ9A 5ALNA 3VH4A 3MZ0A 1RC0A 2I2CA 2OMEA 3BXXA 1C3XA 1NPDA 2I8LA 3HMKA 3VMFA 1AGPA 5ESWA 4F3NA 1GL9B 2EXXA 2ZQ5A 3WL4A 5JXIA 2Q6OA 4DMGA 1A7JA 3JAWA 2GUGA 2QRMA 5I7RA 4KUEA 2FRVA 3M7IA 4M9SA 1XJCA 3IQDB 5D7BA 4PICA 3QK7A 1RWQA 1VIMA 4GKKB 2WJVA 4G0UA 4U4AA 1KMHA 1WZCA 2CLLB 3TW0A 3X1ZA 1A97A 1Z3CA 3R5JA 5KQSA 1S1CA 2B9EA 2Y4OA 1T3HA 2RGWA 4F96A 2ISQA 3G0OA 2CWDA 3H3FA 1KMCA 2ZWOA 3QKWA 4JL5A 4QASA 2XYRA 1F0KA 3FM9A 1AY0A 4IV0A 2H1IA 3ZVNA 4BWGA 5IJ9A 2A7XA 1Y5LA 3OIUA 2DWQA 3R9WA 4HNRA 1PL6A 4C88A 1FDVA 3FDIA 2OCKA 4MV0A 2AJDA 1G8MA 1CJCA 3WMFA 4CW7A 4F92B 2B94A 3EDCA 4OXXA 1T24A 2GD6A 1BOOA 3H75A 1D2EA 3PQ2A 4BPBA 4ZDIA 4LWZA 5JEDA 4ZXPA 4DSTA 4UHFA 3M3HA 4OMDA 1CZRA 3WE7A 2W6CX 5C2JB 1P9LA 2Q5EA 1G8FA 2YXEA 3PPVA 4QBGB 4RGBA 4YT4A 5BNTA 2AXPA 4DLXA 1WAMA 4CTMA 2VOEA 4TUYF 1SVUA 2IXFA 3VC2A 3I2IA 5KYYA 1HY3A 3VSBA 2HJWA 1CQJA 3FGOA 5K3SA 2APJA 1YONA 4A8PA 5IKXA 5GINE 1YC2A 2KW5A 3R40A 3UWSA 1U3CA 1S1MA 5JYBA 2B37A 3EXHC 5HF8A 3UC5A 3MYYA 4FR5A 3VKHA 1DCFA 3DZHA 5ICGA 3TLKA 1GL7A 3MWDA 4G0VA 1QCDA 4PZUA 2YINC 4P83A 2XZLA 1DIRA 1H8HD 1APBA 4GHWA 1F17A 1RXIA 3VZDA 4K5QA 4FC6A 2FSGA 4EI7A 5EIWA 4NU8X 5BV0A 3RJ5A 2XRFA 1EQAA 1ATZA 4ODIA 3EFOB 3AIKA 3CLRC 1PJ4A 3N58A 4U2DA 5TXGA 4D57A 2VEDA 3B5JA 3VNRA 3L06A 1F2VA 3B1FA 3D43A 4MDHA 3RC1A 1NJ6A 3L1HA 3CN7A 2C9BA 2R8XA 4JUIA 4Q3EA 2FCAA 3ZHZA 4BEJA 4DY4A 1F0NA 1JYFA 2PYIA 4X94A 4MAAA 1UJNA 3OM0A 4XXHA 5KOJB 1QGZA 3G02A 4Y2XA 2FG6C 1P2GA 3ZU3A 1SZPA 1ZA2A 3S7ZA 1U0JA 3GRVA 1LLFA 2W2KA 4MLZA 4BDSA 3LF1A 3AF4A 2ZR8A 1AB5A 1RPNA 2DUUA 2VH5R 4AMBA 3OF3A 3HGQA 2JGNA 2GFHA 3DE4X 1E94E 3RUIA 5AW8A 1UXOA 5FNVA 2OFFA 3GJ7A 4KPGA 1LVHA 1TLFA 1X42A 4NMMA 5E8RA 5ENVA 4HNUA 3MTGA 5DGXA 1D9XA 4JWKA 2C3MA 1GR0A 4YQZA 3WHLA 3HVRA 2BELA 1E1CA 1B8PA 1GFSA 1T9GS 2AN4A 1KH2A 3GQBB 2F55A 4U2BA 5KYTA 2IEBA 3D59A 1ZM4A 2QROA 2VHQA 3DTVA 3EA4A 4GX2A 2H0RA 4P53A 2XT9A 2WWTA 4N82A 1YV9A 2OGZA 3CVYA 2J9ZB 4O33A 1U02A 2J9XB 2FH5B 3MSCA 3DVLA 3MQFA 3LQRA 2GCEA 4GLBA 4Q1EA 3ROZA 2WNHA 2JFGA 3ZV4A 1K7SN 3T5GA 4M1TA 4GXTA 4QNRA 1CRZA 4TV8A 3ZWPA 2ZU6A 4IOJA 2MYUA 2C9MA 3L7YA 1XWFA 3K0FA 2H2AA 4FYVA 3L8CA 4MARA 3VH3A 1NUSA 3K6SA 2GKGA 3RTCA 3O91A 4KQJA 4O3FA 5F12A 3PFWO 4CKWB 2ZULA 2VUUA 1JH9A 3W5IA 2AS0A 4CKXA 3FXAA 5DNUA 1GZUA 1QFXA 2CCKA 2QN1A 3FHOA 1BVRA 1QRRA 4BS9A 4DC1A 4ZI7A 2QTTA 3TKLA 2E4XA 2W2PA 4L51A 1J2TA 3O2NA 3VAAA 5LM3A 4B6PA 3OSZA 3EDRA 2D4HA 3V8QA 4JENA 4EHIA 2PSJA 1OT5A 2K5UA 2LDBA 1FLDA 1P5RA 1SUIA 4WLOA 3RVNA 5I4KA 5JDIA 4UE3S 1DBRA 1U3UA 1UXGA 1R0CA 5EXSA 5B55A 4Y6QA 4E4TA 1DCMA 5HRAA 3O8LA 1Y98A 3L84A 2QPTA 3MJEA 4NZ9A 1LW7A 3AF1A 2RHOA 2RHWA 2GN6A 4PTZA 1AHNA 1NU8A 3CG0A 5CFRA 1P9RA 3R9IA 4B6SA 1U31A 2Q3MA 4ZZ0A 3MXOA 3T1OA 2AG1A 4I8IA 1W6UA 3JQ6A 1LBIA 1ZOOA 4WFQA 3PEUA 4Z9XA 5K3FA 5JJIA 2JD1A 1FFHA 4E5NA 2RGAA 4ZO7A 1RKUA 3CLTD 1T1JA 5HE8A 4J7AA 5FA6A 4QDKA 4F2HA 1LSOA 3E7PA 5JY1A 4US2R 1A2BA 1QKKA 3IUBA 1D7OA 3RD5A 2QPOA 3RG8A 2N3ZA 4F4JA 4JI8B 4KPFC 3JZMA 3KE9A 4HGNA 3EZXA 1WW3A 2GJ8A 4BYMA 5B2ZA 4ESVA 4YIHA 3ZIAA 2H85A 2JAPA 1O2DA 2WWGA 3ROGA 2VF5X 5JALA 3AUSA 1GL6A 3PRHA 2J33A 3OIGA 1ZFNA 5BR8B 1V3TA 5K8UA 1MNAA 1IM2A 4IL5A 2W22A 3FPGA 2C7GA 5ECDA 2XB4A 2G9RA 1DPFA 3G0GA 4P3KA 4QKQA 2WZBA 2JKZA 3KUUA 3CRMA 4QTTB 1OA0A 5H0IA 1UKYA 3FI9A 3A1SA 1T3TA 1VL2A 1IDN1 3GLHE 1JL3A 1U2QA 3VR5D 1QJCA 3D8BA 4QPPA 1JP7A 2XI4A 5I9BA 3PWKA 4YUVA 5KU1A 1JQBA 4QG3A 4ZYUA 3VHRA 4RMJA 3QVWA 4KNVA 3WKEA 5JD3A 3H9EO 5K09A 3ZWMA 1WXWA 1Q7RA 3QUSA 2E6UX 1WP4A 4ERXA 1J5XA 2CVHA 3QVGA 1WUIS 3Q9UA 3PEEA 5FP0A 1H3FA 3LGXA 4FCTA 4IZIA 4PR3A 5KX5A 1NF9A 3ETHA 1YZGA 4BB0A 2CNWD 1KDPA 2ZUDA 5A9SB 2OCDA 3SYLA 1AQNA 2CJXA 2CNBA 4HYTA 3W2EA 3U39A 2XDWA 3FPKA 4JP2A 2BDTA 4B73A 4Z4HA 3KJXA 1GDDA 3SJAA 4NABA 3U1BA 3D2CA 1V1MB 3IAS6 1QFYA 4HUJA 4UZEA 4MYSA 2QHXA 3A14A 3T5PA 2JGAA 1VKOA 1Z2EA 3WRWA 2HQ1A 1M0SA 3PKIA 5GAJA 3RUAA 3WLAA 4LF6B 3LCUA 3IEIA 3LV8A 4JDPA 1DKOA 4D9NA 2PKWA 1MQSA 3KSMA 2JCXA 4MB0A 1N2SA 2ZJ7A 2R25B 4UVHA 2IPAB 2K6GA 4GR9A 4R1QA 4JKIA 1LDBA 2I7DA 4HYQA 4S1NA 3VC3A 5E4FA 5ALVA 4MI6A 1PT6A 2IU0A 3WNQA 3CNEA 5KNDH 5FQNA 3V4FA 5JTUA 4B3CA 5AMXA 3GUCA 2FPOA 4NFLA 1K86A 4NYJQ 1L7EA 4RJKA 4DMCA 2BFFB 2DB3A 2OKGA 4TRRA 5JBIA 3ZHRA 3ITDA 3OVMA 4II7A 5IS2A 1J6UA 4U3JB 4WJZA 3M5DA 2C4VA 1K0UA 2HADA 3BD7A 1NN5A 2PUHA 3E1KA 4GI5A 4JVMA 4UNPA 1ND5A 2JIDA 1N3YA 4BGDA 5JCJD 3FVWA 4BLSA 1BVHA 1VKNA 3P5BA 3MJSA 1FDWA 1VYUA 3IS3A 1SH7A 5A71A 4BQEA 2QVYX 2ZYVX 4MKIA 2AFHA 3NAMA 1A4IA 1C8BA 1JX6A 2BZ1A 2I76A 2YCLA 2HMSA 1IEVA 3AGQA 1XZQA 4YECA 2ZB7A 3WL5A 2XXAA 2FPLA 5EJ8A 5LP6F 1AD2A 3E7WA 2NW6A 4Y2GA 3T52A 1W49A 4RKWA 2AFIB 1KZ6A 1T34A 2PUDA 3S7TA 2PUJA 4K6CA 3Q72A 4EPWA 3LYLA 5CPBA 1JIJA 1XD8A 2Y0EA 4AJPA 1JR3D 5BPHA 3CH6A 5CBKA 3GFPA 4UM5A 3IEMA 2IZ0A 3KAJA 2FWJA 2Z04A 4JYPA 3SDSA 1GTZA 3I5UA 3WV5A 1P3JA 3NAGA 2ZXFA 2GHIA 4E1VA 3N6RA 3TZHA 3U48A 4CHGA 4MRMB 1KI7A 5GGYA 2F17A 3AETB 1D2AA 2F9LA 3E81A 2XQKA 2IIQA 2IZZA 4CF4A 4MX8A 4OM8A 5AVJA 1SZDA 2IHYA 5DXAA 1MO3A 1SCJA 2DHRA 1I7DA 4D92A 2D2FA 4P7JA 4P35A 1E3SA 3ESAA 2AOUB 2HGSA 4OQZA 4MW4A 1E60A 3EYWA 3AV3A 4PZEA 4IDBA 4CIXA 1DG9A 1QCYA 3DMRA 4G1UC 3UCXA 4H3KB 3EFOA 3UHOA 1K8ZB 1X77A 2BY4A 1QV7A 1ZVKA 3R5HA 3NHJA 2H2GA 2JC3A 3QEBZ 5TGDA 4D8UA 4DTIA 3OQOA 4OAPA 1XRRA 1G7RA 1Z4KA 1DKNA 2H1LA 3BC1A 5KOJA 3OFKA 4KN6A 5CDGA 5IANA 5FLXA 3TI7A 1E2EA 3PXEA 4Q03A 4YS6A 2WA2A 2NYAA 3VH2A 2YQZA 3UXMA 3UG7A 4L8VA 4BO9A 1D09A 3HJUA 1Z2AA 4ZV9A 2RJNA 3A1FA 3M3PA 5KNCD 5HZHA 1MKYA 1DV2A 1ZUIA 1TZBA 3TNYA 3K70B 1W4CA 4EHDA 1Q19A 4TLDA 3W4IA 2KMLA 1MVOA 3KAQA 2W83A 1IQ0A 2WHEA 2VYVD 1JJAA 5J5CA 1NOKA 3QEJA 2BSAA 4BKUA 3MQ4A 4FWBA 5DI3B 3BD9A 1KFCB 3X0DA 1G9TA 5BSHA 2V4MA 3GQBA 3RYIB 2RHMA 4RTSA 1XTRA 2HNKA 1XR3A 3GBPA 1GZ6A 3HBAA 3KXDA 4O4JA 2ZIFA 3TE6A 1R0BA 2E48A 2KBEA 2Q3EA 3KL2A 1KEVA 2A9KA 1DSSG 3RS7A 3D02A 2QENA 3THSA 4ECAA 2P1RA 1M34B 2YZGA 5IAGA 4JKYA 4BO2A 1F48A 2GN1A 5IJXA 5FOXA 3TW8B 3VUEA 2CXTA 3PXBA 5DMXA 2XRYA 1NPYA 1T8YA 4P8RA 1TPZA 1RI5A 4YWHA 5FULA 4UDOA 3I01A 5BMVB 2IDJA 3GF4A 1D1QA 3QXXA 1E0SA 2PJDA 4GQAA 1QIFA 2CXOA 1CLEA 1VSUA 1WXFA 4W63A 2OLKA 5TPZA 2Y27A 3LVQE 4BMSA 4MUEA 4CKWA 2KLHA 3V8NA 5BNWA 2XWBF 1G66A 1LC3A 2H8GA 4KRYA 4M38A 3IJ5A 4MEJA 4R84A 3IQWA 4HAIA 3ZY3A 4QYIB 4ER5A 1EPUA 1VIDA 3LUBA 3VC7A 2HO5A 4MGHA 4NOMA 4RF5A 1IRIA 2X9NA 4NEQA 3CVWA 3GDGA 1F51E 4LN1A 1MIHA 5CDTA 5DM1A 1RC1A 3RYHB 4QOFA 2FFQA 4K8RB 3O92A 3NWOA 4E13A 3EUWA 1HNXB 1AZTA 4Y2TA 5GMOA 1LWNA 2H3HA 3UT0A 1MFPA 3B9BA 1VMIA 4KZKA 4ND6A 1DCKA 4QJ3A 5JPIA 2IYSA 2AZTA 2XCLA 2WT8A 1L7VC 3D3WB 4XQEA 3LKVA 2EKBA 5DEIA 5T8KA 2FW1A 3L49A 3NTUA 5CVJA 3TQOA 1GDTA 1K7XB 3KKEA 3ZWVA 5LIPA 2QMEA 1KYTA 1KEZA 1VHJA 2OXRA 3MELA 3PYMA 4MVJF 1WTAA 3VPCA 2GN2A 4UNNA 5BT8A 4HLNA 1SHZA 4XI9A 3O21A 5B7QA 3AFHA 4W6QA 2OYSA 1TL7C 2ZPTX 3OZ7A 3RJZA 3PFCA 1Q7GA 1RW4A 1RYYA 3PGKA 2B2CA 4M8SA 1TUGA 1KSGA 1USUA 1KKLA 1V41E 3MCZA 1L6IA 4QOJA 4RQAA 1NE2A 3K0CC 2QQ0A 4NAVA 3DV9A 5BV7A 4B76A 1L1RA 5C1OA 5U9CA 1N2XA 3M8KA 4MV1A 3FUUA 4UTPA 1EAYA 4I2VA 3K1AB 2C9CA 5DNYB 3ZLBA 2AIRA 4AMUA 4N8SA 4DHWA 1KKMA 2VPWA 3LK7A 3H6GA 1PTJC 1CV2A 1M2FA 2J0EA 2WUFA 3QEMB 4HTFB 3VYSB 2WYIA 2WAYA 1UZMA 1U9IA 1E77A 3L4BA 3PJGA 4FZRA 4RSMA 4YCAA 3DM5A 2PFSA 3L7CA 1SZCA 3MS7A 4W82A 1GGJA 2L18A 3IIMA 4Z99A 3WQSB 4GOLD 1Y1RA 3Q85A 3A2MA 3UAXA 5TVKA 1NXVA 3A7EA 3C3CA 1YDFA 3CJRA 3L8HA 5E4JA 2PJZA 1E7WA 1HQKA 3JQQA 3OQMA 3L6UA 3B9RA 3QLTA 3JSAA 3V8BA 4RLSA 3WBKA 1YFJA 3K16A 1GT6A 2CSXA 1LBQA 1N7IA 1P4SA 3LNCA 4J75A 1I94B 1YTUA 2AKEA 1HT0A 4PG7A 1HDXA 1XCLA 2IX9A 4U2EA 2WMDA 5A9SA 4H6WA 4DARA 2HREA 1BWSA 5E1BA 1KDOA 1N9GB 2E18A 1VLLA 3LYUA 1QG6A 1C14A 1WSBA 3A7DA 3JQPA 4NBLA 3T95A 1RLMA 4KPYA 1N9KA 1ZC3A 2WSSA 4AU1A 2GK3A 3SKVA 1AKYA 3QVMA 3HJNA 1V1MA 2JGDA 3O0TA 2CNNA 2VJPA 1T6BY 4ZARA 2MOKA 1BE8A 4INOA 1UWKA 2HLDA 1VMKA 3OTGA 1P91A 4LOJA 4W9MC 1TMGE 5A3VA 2OO7A 5AXAA 3GZTB 3C5VA 3IA2A 4TYWA 3GVIA 2EF0A 7GPBA 3BBPA 1UMCB 1A8IA 2AEFA 3LDHA 4IIJB 1GKIA 2AKAB 2QVLA 1Q22A 1XTJA 2PKEA 1GU0A 2GZAA 1YZYA 2C8LA 3I73A 2XKKA 4QYMA 3TIXB 3QX7A 4G5RA 4L7QA 3W79A 5EJ4A 1Q0TA 1RWNA 1YOBA 1UMKA 2XHEA 1YS4A 3C7DB 4Q05A 1EFRA 3VI3B 1QHXA 3IT0A 4IJQA 2QZSA 4QGGA 4RE6A 5E3IA 4COOA 3MJTA 5CU7A 4HFJA 2J3KA 2AWNA 4HDRB 3NALA 5ARBA 2XKAA 4U3JA 4H77A 3CTMA 2CXSA 3FGZA 2VP6A 2V7QA 3I9OA 4Q9NA 3HY6A 5AKLA 4AY4A 4JP3A 5A5VA 1QU2A 3A2KA 2NVOA 2XIQA 3KELA 2BISA 4WN3A 4CEIB 1YDWA 2J6HA 1B14A 4DB2A 5IG2A 4W5TA 1JE1A 4PCAA 5IFLA 3VQTA 4YJHB 1SVKA 1UBGA 3G0DA 1Y9DA 5JCPA 4NE7A 1NTOA 5C4GB 2OCGA 3DQPA 3S2ZA 4Q4LA 2X0JA 2A9JA 2XQIA 3FPAA 2Q3HA 3QPWA 1G21B 1ZVJA 2AFIA 2Q4BA 1Y8AA 3K72B 1KAMA 3ESQA 2XVXA 4P38A 3KXKA 5EE9A 4EUHA 3DVAB 3E61A 3O8BA 3FOFC 3GUUA 2H1SA 4EWLA 2WJ3A 4LRTB 4HEHA 4U5XA 1U2DA 3KG2A 4KK4A 2OESA 1QR2A 2ZYGA 4UDNA 1F8UA 1EWKA 1VGVA 2OZKA 3D5QA 3RHFA 1FLNA 2PUCA 1EK0A 3S8MA 1DJLA 1ZD8A 2OB1A 2FPSA 3OI7A 1RAAA 2B1QA 1NJSA 2VYFA 3CR7A 4M9XA 1JI0A 1I3NA 1KO8A 1PT5A 1SK9A 2EFEB 2UUPA 3AETA 1NV9A 3DPUA 3L1KA 4IFTA 3VTAA 1P0QA 4ZVOA 3T3DA 2I55A 5KYXB 3FNFA 3UWDA 3ZQUA 1MHTA 4FOTA 4UU1A 3I72A 1SCBA 1B73A 2AOUA 1E7MA 3IT2A 4QFDA 1J90A 2NTVA 4ML3A 3TLYA 1JSLA 4Q34A 5IT5A 1SUDA 3DW1X 1CY2A 5FBKA 3QMMA 4NHEA 4RJJA 2PH7A 1LQ2A 3D7KA 4MVJG 3BD8A 5CNJA 2FPPB 4B7AA 1X86B 5DYGA 4XYLA 4CM1A 1K08A 1G5FA 2QLFA 1ZW1A 3QWBA 4JLDA 4BLVA 4UOEA 2WV7A 4P4TA 2J3MA 2YWCA 2EJTA 1COWD 1HORA 3KS9A 3LTEA 4K6MA 2EATA 4OQXA 4UM8B 1CVLA 1LLUA 1EFDN 1LVGA 3D6NB 3R8XA 1GLNA 3U7QB 3DDSA 3ZZNA 1TCVA 1NBIA 3BCRA 3C3XA 2DR0A 1S2NA 4US1R 3TS1A 1XAHA 3HRHA 1ONOA 4XLZA 4RF3A 1MRNA 3E2PA 5K20A 3PQ3A 1JHYA 2PFKA 1SG9A 2PWYA 3LVRE 1L8LA 2F62A 2OFXA 2V96A 1O5IA 1O95A 1SA0A 3LFHA 3Q8XB 5DI3A 1FYFA 3WLNA 5EIOA 3RYIA 5JAIA 1U3WA 4XGIA 3IUQA 2OOSA 5AWFC 3WYBA 4ZAVA 2UZ1B 2HWWA 3FZYA 3A11A 3K2EA 2O52A 3KOOA 2XBMA 2BMWA 3B36A 4I5IA 3A0RB 5F5XA 1P2TA 1T13A 1M34A 1P62B 3HFGA 4GMXA 4P4LA 4D8XA 2TSYB 2B0JA 2HJ9A 2YRWA 3TW8A 3BXFA 4NECA 2P35A 5BMVA 3TG8A 3VX3A 2ZIXB 5HF5A 4G5GA 4DCUA 2R96A 4C5AA 1VJTA 3WBBA 1AIPA 3DE7X 1VJRA 3BXPA 3DHVA 3GUZA 1ODKA 1L4MA 2YMMA 3FETA 4AZ0A 1KO5A 4QOSA 5KNDA 3AVTA 4IO0A 4QYIA 2X0IA