3AY3A

Crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
266
structure length
266
Chain Sequence
MLNRLLVTGAAGGVGSAIRPHLGTLAHEVRLSDIVDLGAAEAHEEIVACDLADAQAVHDLVKDCDGIIHLGGVSVERPWNDILQANIIGAYNLYEAARNLGKPRIVFASSNHTIGYYPRTTRIDTEVPRRPDSLYGLSKCFGEDLASLYYHKFDIETLNIRIGSCFPKPKDARMMATWLSVDDFMRLMKRAFVAPKLGCTVVYGASANTESWWDNDKSAFLGWVPQDSSEIWREEIEQQAGEIDPDDPAVIYQGGKFVAAGHPDDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glucuronic acid dehydrogenase [correction of dehydrogeanse] from Chromohalobacter salexigens
pubmed doi rcsb
source organism Chromohalobacter salexigens
molecule tags Oxidoreductase
molecule keywords NAD-dependent epimerase/dehydratase
total genus 102
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ay3A01
5FI3A 1F0YA 1I30A 2BHLA 2JD0A 4L4XA 2JAHA 4I8XA 5COBA 1PJSA 2PKQP 3GH3A 2CDAA 5HWSA 2X5OA 2QW8A 4DTIA 4R3WA 1JKIA 4BHTA 1DIRA 2YY7A 4IIVA 1LLUA 5ILOA 4UAGA 5KOIA 3PHLA 1HL3A 2FSSA 4Z9XA 4BS9A 5JYEA 4QTZA 2OO5A 4JQCA 1XG5A 4A10A 3ST7A 3ZI0A 3F1LA 3VZPA 2DBQA 3ZU3A 2BKAA 4R9SA 4L4RA 3DC2A 1LDEA 3VZSA 1ZJYA 4R1UA 5DP2A 3ZWBA 2VTEA 3DBLA 3OP4A 2EKQA 4RVDA 4GAEA 4CLHA 3RJ9A 4GX1A 5C5IA 4II2A 1B8PA 4J43A 3K31A 4YAIA 5TGDA 2SCUA 2VCYA 3DFZA 4U0JA 4BO5A 2EHDA 4II3A 3DHYA 3G0OA 3JQ7A 3AOEA 1ZEJA 2JCXA 1DLIA 3MCVA 3OIGA 3QVOA 4PCVA 2PK3A 4LN1A 2JJYA 4EITA 1XWFA 1T4DA 3INTA 4QFCA 1EBFA 3SLGA 2CUKA 3HJAA 1CYDA 1QYVA 1JKJA 3VPXA 2RH8A 1ZKMA 2V6BA 2YJZA 1TA4A 1LTHR 2EKLA 1K2WA 5THKA 4DMLA 5I9NA 3ULKA 1LEHA 1KEWA 4J4HA 4XZ3A 2Z1NA 1X7GA 3GGGA 3FCOA 2HMUA 4OGWA 4WE3A 2GUGA 3JYPA 3WYBA 4OMUA 2NU9A 3A06A 3U4HA 3HDQA 2AMFA 4KWIA 4BNKA 4RJTA 5A4DA 3KSDO 3DZIA 1GYPA 4HFNA 4CMJA 2P91A 2P9EA 4FCCA 4RF4A 2IZ1A 1HEUA 3GEDA 4CUJA 4YJHA 3LZ6A 1PR9A 1KOLA 1UP6A 4CMEC 3I83A 4BNXA 3NYWA 5COAA 4CM3A 4E5MA 5TNXA 3IUPA 1PL7A 3KBOA 3PP8A 4EJMA 1OMOA 3QWHA 1O8CA 4IDEA 3JQCA 4FFPA 1OI7A 4S1VA 4I5GA 3BIOA 1DSSG 3JQ6A 4YJFB 1N92A 4BNYA 1ZK1A 4J1QA 2AG8A 1LRKA 3JQAB 2W8ZA 3C7CB 1YS4A 3L6EA 3FNGA 3BMQB 4WGGA 3FTPA 5BSHA 3SVTA 1XEAA 5T64A 2VN8A 1LXCA 4GSKA 3GQVA 1VKNA 4BNIA 4AJHA 1VLLA 1WMAA 1E3IA 5JYDA 3PWZA 3DEYX 3PQFA 4WASA 3EZLA 3RU9A 1LDMA 3ZN2A 1M6WA 4O0LA 5CP8A 4MO2A 4J7CA 3RUAA 2I9PA 1U9JA 2NWQA 3JCZA 2PH5A 3KRTA 1NVTA 3FI9A 2DFDA 4RPGA 4LW8A 3GEMA 4NFSA 2EJVA 2PA3A 4CM8B 4ALIA 4E5YA 2ZYDA 2LDXA 3QHAA 2B35A 1TT5A 2UV8A 3L6OO 4O6VA 2FR8A 3DMTA 2NQTA 4QUKA 2BD0A 5DBFA 1Y7TA 1UZNA 1NWHA 2DC1A 1N9GB 3PHGA 4HWKA 2Y68A 3D4NA 2ZTUA 2Q4EA 3CZRA 2IYPA 1X13A 2OP0A 4PLHA 5A05A 2GN6A 2Y1OA 1HDRA 1W6UA 3I9KA 4ZQFA 2WYUA 4HV4A 1PS9A 3LT4A 3EYWA 2ET6A 3O38A 1R66A 3VVCA 5JS6A 1E1KA 1NAHA 2I67A 1F8GA 4ND3A 4P4NA 3RJ5A 3W6ZA 5L4NA 4UUMA 3DHNA 4BGIA 1PJTA 1H0KA 1G6KA 3KXDA 3DFUA 1LI4A 4D41A 4Z0TA 1XELA 2VOEA 3AJRA 2C7VA 2A4KA 4XQ9A 3JQFA 2RHRA 2GGSA 3U5TA 3RWBA 1VPDA 2ZTMA 4PLGA 1MFZA 3RC1A 1ISFA 1BW9A 4NFHA 1YJ8A 4OSOA 4NBUA 2GERA 1ZJZA 3RFTA 1ISIA 2NSDA 4HY3A 4J4BA 4UVEA 5F1OA 4E31A 4DIOA 2VZ9A 2HMVA 5LDGA 3GVIA 1B0AA 4LVCA 3D0OA 4FBGA 2YDYA 1P9LA 3DWFA 1DRUA 2AEJA 1U2DA 4Y8VA 4AJPA 1Z7EA 3MOGA 1BG6A 4PRLA 5IDQA 5ILGA 5IG2A 3JQAD 4AJOA 2P68A 3FNEA 5DDIP 1ADFA 1YH3A 3DZHA 4YPOA 4XYLA 5BSFA 3U4CA 1NQ5A 1A5ZA 2EP5A 3Q6IA 1HDZA 3WSVA 2JD1A 4M87A 2D1YA 2CSUA 2QRJA 4CR7A 4L73A 3KETA 1B26A 4JLWA 2J5QA 4F6LA 4R1NA 3H9EO 3GDFA 5JDIA 4DVJA 1GZ3A 2QRKA 2Y0DA 1DJQA 3FPLA 4FN4A 3H3JA 5IFLA 1NVGA 2DTDA 4ZJUA 1Y5RA 4WOKA 3KVOA 1C1XB 1VC2A 3LVFO 5IN5A 4ALJA 5IZCA 1H2BA 1YKFA 3FBTA 1PJQA 3VPHA 3A28A 5T8KA 4NU6A 1GY8A 3P19A 3N7UA 2F1KA 3BTOA 3GUCA 3TFQA 4YA6A 5I7VA 3OEYA 1GV0A 1ZK2A 2D3TA 5A1TA 2OMEA 4BO1A 3WMWA 5JY1A 4QXMA 1EE2A 3ZHZA 2WD7A 3WYCA 3WLFA 3ZV3A 4XJSA 4ND5A 3NJ8A 5FFFA 1R16A 3BMCA 3BMOB 2CF5A 3UUWA 5CHEA 1P74A 2UAGA 4R51A 2Y0CA 3GLQA 4MIYA 1H9AA 1W4ZA 1I0ZA 2NLOA 3M6IA 4XD2A 3WR5A 2A9FA 1ADGA 2X6TA 4XJTA 1WW8A 3WGOA 1HE5A 3OICA 4FGWA 4XEHA 1P44A 1DAPA 3OIDA 3RVDA 1CDOA 3OM9A 3U3XA 4CLRB 4HKTA 4YACA 3DBRB 5KTKA 4YJGB 4DPLA 2UUPA 2VTDA 2AEFA 1DO8A 4BMNA 4CQLB 1GUZA 1ZH8A 1MUUA 5DOZA 4LCEA 4I08A 2ZTLA 2B36A 3FNFA 1VL8A 4W4TA 3VPSA 4AJEA 9LDBA 2DBZA 3I9JA 3A9WA 4AICA 1X0XA 1LLQA 1BXGB 3W8FA 3BHIA 1HYEA 1PS0A 2B37A 5JC1A 1WZEA 4MP6A 3AUSA 5IXSA 1JTVA 2EJWA 4XB2A 5J23A 4CQMB 3ETDA 4KQXA 2YHUA 4CMHA 3BTSA 4BKQA 5CPBA 4EEZA 5I8WA 1PWXA 1XA0A 4ZA2A 2EGHA 2VNSA 1DC3A 1ONNA 1TXGA 1YB5A 3IQDB 3WMXA 4FSHA 2HJRA 3WWYA 1KEVA 1GQQA 1PZHA 3RU7A 5MDHA 1KS9A 2AEMA 1WP4A 4KUEA 4FD3A 4YDRA 2I76A 4Q3DA 1DIHA 3TZHA 5DCYA 1VJ0A 3D3EA 3IP1A 5TJHA 4A26A 3VDRA 4J0FA 2HDHA 1CRWG 2O7QA 4I5DA 1E5LA 1YL6A 2D8AA 1D1SA 3I9MA 4U0KA 5TC4A 4S3MA 2BI7A 3B6ZA 3DZGA 4Y6PA 2X4GA 5EERA 2VRCA 1JW9B 5AYVA 2WJPA 4WJZA 4B4OA 4XCVA 4EEXA 4M1QA 4AL4A 1PTJA 2X22A 4E12A 3PLRA 3E82A 1GTMA 1MX3A 1P1HA 5A3JA 4GWGA 2LDBA 3DMTC 1X0VA 3CXRA 2IE0A 3WFJA 3PTZA 1ULUA 5ADHA 1ONOA 4WEQA 1AHIA 4IXWA 4MDHA 1U4OA 3ICPA 3B1JA 3WIDA 1OAAA 3DAGA 1OBFO 3P7MA 4W9NC 4NG5A 4R5MA 3LYLA 3FR7A 4R41A 1U7TA 1XLTA 1ZMTA 5GY7A 4C7KA 1DLJA 4UEOA 3PI7A 4MVJG 4OL9A 4Q3BA 4UREA 4R68A 3I9NA 1HTBA 4CLOB 2ZQYA 1ONPA 2X1HA 4BGUA 2BFOA 4CMIB 2O2YA 2BMAA 1V3UA 2B69A 5JNLA 4XGNA 2W4QA 3AY3A 3INGA 1N7GA 5I7SA 5JPIA 4A7PA 4CMGA 2DUUA 2VNAA 3NEPX 4NJMB 4DL9A 4YT4A 4ROSA 3GN2A 4PLTA 5CFZA 4O59O 3RBXA 3ZW8A 5G0WA 1IZ0A 3GMSA 3VDQA 2IEBA 3E9MA 2PGDA 4DRYA 1UUFA 3OSUA 4NZ9A 2ZK7A 3AU8A 1TT5B 1RPNA 3PJDA 4A03A 4OQZA 5BR7A 2O3RA 4QSMA 3ZWWA 1PS8A 2ZCUA 4K6CA 1C3VA 1PGPA 4CV0A 4MKXA 1K6IA 2X0RA 1JU9A 2WYWA 3OJFA 3C24A 4QEDA 9LDTA 4MVJD 3LLSA 2Y1CA 1EVZA 3AUUA 2WDZA 1T2FA 3L9XA 5I7FA 3GNQA 1IL0A 1LDGA 4CM9A 1JAXA 4HUJA 4YAGA 4ONEA 4J7UA 4PZEA 1QORA 2PWZA 2YQ5A 4NBRA 3KOUA 5COQA 3GG2A 3SX2A 1C14A 3MJEA 4DA9A 3BMCB 3GA0A 4Z0PA 4L0QA 3B20A 4LMRA 2ZJ1A 3HB5X 3PZRA 4NPCA 5TT0A 3FWZA 1I2BA 4O5OA 3V8BA 3W6UA 4WOJA 3WNVA 5CEFA 5L51A 4WLNA 5T67A 2EF1A 2V65A 3ZV6A 3JYLA 1ADBA 4J2HA 1TT7A 4D0RA 1ZZEA 3HDJA 5AXCA 3FSRA 5KCZA 3JQEA 4TRNA 2NU7A 1E7WA 4B4VA 5B1YA 4BUCA 5A5EA 1I3MA 4BO7A 3RAJA 3OJEA 1DHTA 4E2ZA 3IC5A 5G0UA 4N5NA 2Y0EA 4KMSA 3F1KA 3L4SO 2YUTA 6LDHA 3CSDA 2CY0A 3GOHA 1E7RA 4IDDA 4PG8A 1SNYA 4U6SA 1GYQA 3C7DB 1YO6A 4CM6A 1M6HA 4W82A 2J3HA 1I2ZA 1CEQA 3TDKA 5AOVA 1JAYA 4RV9A 3SJ7A 1ZXBA 4XIYA 3U4IA 3PQEA 4ZQEA 3I23A 5T5QA 4DLLA 1J6UA 4AVYA 3G17A 1E3EA 1MC4A 1RYDA 5JCJA 4IBOA 4J9UE 1B14A 1UDBA 4H7PA 2FY8A 1ORRA 3GZ4A 2H1SA 5TS3A 2FRDA 5A3VA 3GNSA 1EQUA 2G17A 3E6AA 2GYYA 4JROA 2QYTA 1E6WA 3A14A 3QY9A 2EV9A 1X1TA 4TQGA 4WLEA 3NT4A 3GHHA 4ILKA 3UFXA 1M66A 1QLHA 3NUGA 5F3RA 4CJXA 3BHMA 3DOCA 2GLXA 1P31A 4UUPA 1GCUA 2WTBA 4E2WA 1AE1A 3WGZA 2ZYGA 1DIGA 4CPDA 3O8QB 4IJUA 1JQBA 4WNIA 2DVMA 3OQ6A 1SZJG 1PL6A 3WGGA 4MVJP 4D45A 2OXIA 1ARZA 1PGOA 5HRUA 3S8MA 1N1GA 1U1IA 3S1LA 3S2GA 1HE3A 1QYDA 2WD8A 3ROMA 2GD1O 4A73A 5DBGA 2VRBA 2JKVA 1Y8QA 4I5EA 8LDHA 1VSVA 2IZ0A 2AE1A 4DLBA 4D7AA 4EJ0A 5CEJA 3ZWYA 4FS3A 5ER9A 1QXSA 4Q39A 2CVZA 2GF2A 5DBIA 1HDGO 5HTOA 1QSGA 1V35A 3AU9A 3LC1O 4OIMA 2AA3A 5BQFA 1I36A 5JE8A 1NBOA 2X7HA 3W1VA 2IRWA 2NTJA 2VZ8A 1PZFA 4JJFA 3Q0EA 1A27A 4PVCA 4WCFC 3TOXA 4R4JA 4R3NA 4DLAA 3EVNA 4W9NA 1CF2O 4MJLA 4DC1A 1B7GO 3K5PA 4RF3A 1I10A 2HLPA 4UEKA 1LX6A 1XQ1A 3C1TA 5L40A 2C20A 1PU2A 4RGBA 1WDMA 1SEVA 4EI2A 3L77A 4E30A 5JXWA 3U09A 3T7EA 1ENOA 1H9BA 2F00A 4Y9DA 3I4FA 4GKVA 1EK6A 4XIJA 4F3YA 4YT5A 4BO0A 4IZIA 1WDKA 3I1JA 1PEDA 2VUTA 4N54A 4G2NA 2DBRA 5G4KB 5EN4A 3HFSA 5I8ZA 4RVFA 4BNGA 4DC0A 2D59A 4XYGA 2C7GA 1ISGA 2ZQZA 1HSOA 3HDYA 4MVJI 2ZYAA 2X5KO 3VH4A 1XCBA 4CMKA 3QWBA 4GX0A 3GVPA 4FIZA 4NFYA 2B4QA 4XB1A 1JN0A 2B4TO 2W2LA 4QO7A 1E1LA 1B3RA 2Y1FA 1K3TA 1I3KA 2XAAA 3G79A 1FK8A 5JDCC 4XYBA 1M76A 4XRGA 1PZGA 1U28A 3WGHA 1Y5MA 1U3UA 3D1LA 1ZK3A 4R54A 4E32A 3KO8A 4I9NA 4IDFA 3OFSA 3O26A 1XSEA 4IIUA 5IZCC 5I9LA 4WCDA 4XR4A 3RKUA 3SBOA 3ON5A 1Q2XA 2Q99A 1LJ8A 3BMOA 3UN1A 2DQ4A 1SB8A 4WCFB 2R00A 1I3LA 4B7CA 1GADO 2H5LA 4IDBA 4W99A 5C3MA 1T24A 3B1KA 3BTUA 1LRJA 4U8GA 3TJRA 3GGPA 3D4PA 2BLLA 2EXXA 4QO8A 5A9SA 3WNQA 1BXKA 1XGKA 3JYOA 5JO9A 2JL1A 1P0FA 1P1KA 3SLKA 2VWGA 4CUKA 5JFOA 3GEGA 1WDLA 3WFIA 2I99A 5EIOA 2NTNA 1LDBA 4JNKA 1BXGA 1DPGA 1T26A 4BIIA 2P5UA 2EW8A 2EEZA 1B3BA 4IY1A 4FFNA 4NBTA 1OC2A 1HDCA 3RKRA 3H9UA 5FF9A 2QRLA 3PJGA 2BRUA 2QZZA 4D79A 2HAEA 6ADHA 4HBGA 2CMDA 4Z9YA 5TF4A 4EUFA 2YFQA 2FMUA 3DZFA 2W2KA 1DOHA 1UAGA 2UYYA 3HQ4O 4E5KA 2PZLA 4F6CA 2W90A 2ZKLA 3RUHA 5DP1A 3U9LA 4DQUA 5KVCA 4RZIA 1GV1A 5L4LA 3EVTA 3S55A 1KIFA 2BF7A 5BNTA 1NM5A 5K9ZA 1BWSA 1MP0A 4U6QA 3ZWVA 1JKFA 4NJMA 4FC7A 4J1NA 4GQAA 3CTMA 3MJ4A 1E6UA 2VHWA 4LK3A 5EL0A 4YJFA 2X0IA 4YT8A 3FBGA 3GMDA 5H81A 4CLDA 1NQTA 2PGJA 3DBRA 4H3VA 4L74A 1ZIDA 1SB9A 3PLNA 4CLRA 3HWRA 2G0TA 1ZCJA 1I3NA 3PDJA 4FGSA 4TKMA 5KJ1A 3ANNA 4UUNA 1BXZA 4BO6A 4OSPA 1LBEA 4IINA 1YQGA 1M2WA 4FW8A 4E13A 5T6BA 2PKQO 1O94A 5BT9A 5U1PA 2BFMA 4G65A 1HDXA 1U2GA 1R4MB 4TSKA 1NPYA 1UDCA 3QJ5A 2E49A 3C85A 4BO4A 2TMDA 1O0SA 1OZAA 3ZNPA 4XRRA 3BHJA 3PRJA 2GCGA 1V6AA 5JBIA 3D5QA 3GRKA 3GT0A 4E21A 1LSUA 2E48A 3L4BA 5I7EA 4HP8A 3QVSA 4K1LA 3V1TC 3JQGB 3AM5A 2WE8A 3QV1A 3RC7A 1DFIA 2WE7A 1T4BA 2IODA 4ID9A 2CD9A 3NDIA 4ALKA 2Q1SA 1OOEA 4PLCA 4LRSB 3U49A 1EUDA 2Q2WA 1Z74A 2C5EA 1A7KA 1DJNA 5DN9A 5G0TA 4ZN6A 1RWBA 3Q2IA 1ID1A 5DULA 1V8BA 1KVTA 3NRCA 3MJVA 2HSDA 2BH9A 3MWDB 1DXYA 4UULA 4Q3CA 3IOYA 1V9LA 4I1IA 1R0SA 4BNUA 4OJNA 1YXMA 3HFGA 4BGVA 4LVUA 3ZU4A 3ONFA 1U8XX 5AQ1A 1TLTA 3VPFA 1YRLA 3AWDA 5GZ3A 3W4KA 1VJ1A 4CM1A 4E5PA 2BFPA 3RSHA 1Y9AA 1LSSA 4B4WA 5JY6A 4QX6A 2HUNA 2JHGA 1UZLA 5JDCA 1JWBB 1YOVB 2DM6A 5LC1A 3NAQA 2PR2A 3WDSA 4HFRA 2PNFA 1P1FA 3JQGA 4KZPA 4NU5A 2VUSA 3PGJA 5A9SB 3HB4X 3WX0A 4YT2A 3E18A 2C2YA 3DB2A 4NK4A 4XDYA 4RZHA 2WD7B 3D64A 4NJOA 3WQRA 1J49A 3KSUA 2OL4A 4IMRA 3OH8A 2HKIA 2Q1WA 1KY5A 3UCXA 4D42A 5TRTA 5KVQA 5C37A 3N58A 4L8VA 4J49A 4YQYA 5CDUA 2O7SA 4KDFA 1Y81A 4NBWA 3TPCA 4E33A 1XU9A 4BB6A 4N7RA 5IDYA 2B5VA 3R1IA 1NAIA 4GLOA 3AK4A 4BL5A 3FTNA 1O9BA 3P2OA 3TF5A 1MG5A 3IAHA 4GSLA 3VPGA 5FWNA 3OIFA 1P3DA 5JSFA 4YAJA 5H82A 1QYCA 1NASA 7ADHA 4EYEA 1VM6A 1FXSA 4XWYA 4RVUA 5IN4A 1NYTA 3ASUA 4MKRA 1BGVA 3CZMA 4TWRA 4Z3DA 2POQX 4OXNA 4PLPA 1U5AA 1WPQA 2B0JA 2EG9A 2Q2VA 1Y8RB 3UW3A 3VH3A 2DFVA 1FJHA 4E5NA 3WOHA 2FWMX 1Z73A 2ZJ0A 1HDYA 3VKVA 1DBVO 4F46A 2GZ3A 2O3QA 4BNZA 1E6EA 3H65A 1A72A 2QG4A 3B70A 4TZTA 3SEFA 3R6DA 1E92A 4A27A 3IUSA 4QFDA 1B8UA 1N1EA 1C0PA 1I8TA 1MV8A 1AGNA 1F8FA 3HADA 2HMTA 5TX7A 1IHXA 2O23A 4JP3A 3IJRA 5TIIA 1LDYA 4P38A 4IJVA 1ZW1A 3V2GA 2X9NA 5B12A 4ND4A 1I33A 2AXQA 4DIBA 2RAFA 4EGFA 3ANLA 1R0LA 1GPDG 1PQPA 3JQ8A 1MB4A 1YWGO 4XKJA 4IGEA 1NR7A 2C2XA 3E9QA 2B4RO 2PZMA 4GVLA 4RVSA 1U3WA 1MLDA 2EIHA 1Q0HA 3UGKA 5LCXA 4DGSA 2JFGA 2VRCD 1GQ2A 2C07A 5G0SA 2QX7A 3X2EA 1BVUA 4LSWA 4NR0A 3WYEA 1OC4A 3F5SA 4XDZA 4MIEA 1UP4A 3OMLA 1QRRA 4TRMA 3Q9NA 4IDGA 4PLWA 5JC8A 3ZCXA 1F12A 1D4FA 3QIVA 2D2IA 2VWQA 3IKVA 1ENZA 2H9IA 4AJJA 4YAEA 4ND1A 3FD8A 2X8LA 1YVEI 3F47A 1JVBA 4BO2A 3H8VA 2A35A 4FFRA 4JBIA 3OA0A 5JMPA 4CLEA 3ICCA 1ZBQA 2EGGA 1Z6ZA 3KSZO 1PZEA 5AVOA 3RUIA 4J4TA 3WGTA 2YDXA 4LGVA 4O1MA 3ROKA 1K5HA 1DHRA 2VHZA 2VYVA 2FP4A 3EGOA 3ZU5A 2DLDA 3WQSB 3ZWMA 2JHFA 4BV9A 1PIWA 1PJ2A 1JWAB 3JD3A 4CR6A 3DXFA 4MVJM 2EKPA 1VE9A 2AE2A 1GZ4A 4TRRA 1RM3A 3RUEA 1BSVA 5CDYA 5IXYA 3ROPA 3VZQA 5EESA 1SMKA 4BNVA 3KEQA 4ZU3A 2C54A 2TMGA 1HLDA 1B8VA 2PV7A 1P1IA 4PIVA 2IZZA 4AJKA 3FHLA 3ROQA 2X9VA 4JIGA 5KKAA 1T2AA 2NNLD 3WIEA 4AJ4A 5KNLA 3C1OA 5KWEA 1DC4A 4YVFA 1CIVA 1E7MA 3HZZA 3JV7A 4ZRMA 3TRIA 1KYQA 3MEQA 4LRTB 5CDSA 4NI5A 2JFHA 4TZKA 1PX0A 1GZ6A 2X5JO 3VKUA 3HN7A 4RF5A 1U8FO 1BVRA 1R4NB 4WEOA 1V0JA 3EC7A 4DPKA 1ZSVA 4CM8A 5TLSA 1H6CA 1PGNA 2V6MA 5IAAA 4OXKA 5TT1A 4CL3A 4IJWA 3T4EA 2C0CA 4AJNA 2Y1EA 1PSDA 1EE9A 1D3AA 2Y66A 1CWUA 3WTCA 1MC5A 2DTEA 2DAPA 3JYNA 2IEDA 4KWHA 1RM4A 3PFFA 4Z3KA 1SC6A 2Y67A 1E1NA 5AXBA 2AQKA 5KKCA 3ZH2A 1CETA 3LF2A 2VUUA 1H6AA 4N5MA 1HXHA 1W8DA 5G2OA 4JX8A 5DT9A 3CPSA 5GMOA 1R4NA 2GN8A 1VI2A 3QA9A 4KUHA 4M49A 1DRWA 4MPDA 4U5QA 1EBUA 4HFJA 1KVRA 5CPFA 4CQMA 3K96A 3A4VA 1IOLA 3M1AA 4YJDA 1W73A 4DREA 4JGBA 4H16A 2VHXA 4GX2A 1H6BA 1RM0A 1SAYA 4BNHA 4C7JA 2AW5A 3ZWXA 2V6GA 1GQYA 4RQTA 1U4SA 3BZUA 4RO0A 3R0IA 3G1TA 4ZQHA 2Q1UA 3K6JA 4LCJA 4XYEA 4YJHB 1R15A 3T4XA 1KEUA 1MGOA 4BVAA 3A1NA 2UVDA 2NU6A 1S7CA 1ZEMA 3OBBA 4FC6A 1PL8A 2BFAA 4CLOA 1CJCA 2HRBA 2P4QA 2WM3A 3DZBA 5FI5A 3WJ7A 3UKOA 4J3FA 3H2ZA 3RIHA 3H4VA 1LU9A 5JAIA 1NFRA 1XU7A 2FHSA 5F5NA 2XXJA 4BNNA 4DQVA 1YDWA 1JA9A 4GVXA 3HUDA 1HSZA 1JLLA 1XKQA 1NP3A 3W8EA 1I24A 1N9GA 3E5RA 3JQ8B 3QVWA 4OKNA 1YL7A 3K2BA 2QYSA 4J0EA 4D3DA 4INAA 1NXQA 3RASA 3AFMA 1PWZA 5TJ9A 1T1SA 4B3JA 1P1RA 3NJ4A 4Q9NA 1GU7A 5IZ4A 1DEHA 4RL6A 4BV8A 2GDZA 4MIOA 3MZ0A 2AQHA 4HXYA 3F9IA 4LISA 2CDBA 3TWOA 4IS2A 3WQQA 3F3SA 4E0BA 3MJCA 1ISJA 3GVCA 5A06A 3AM3A 2BGKA 4BNJA 1N8KA 4EDFA 1L1FA 3MTJA 4KOAA 3WICA 2HJSA 4E4YA 2J3KA 1D1TA 3FNHA 3GAZA 2OZPA 3WS7A 1GFSA 4JP2A 1VSUA 3H9GA 2RCYA 1BDMA 4NNJA 3DOJA 4P22A 2E37A 2GN4A 3AY6A 1HYHA 5IJZA 5JCJD 1V3TA 3ZWPA 4A2CA 1DC6A 1E77A 2Q3EA 2X9GA 5L7YA 2YHIA 3AOGA 2IDZA 1Q7GA 3PK0A 4Y67A 2VWPA 3RQSA 3VTZA 3GG9A 1DAOA 4IJKA 4JJGA 3BTVA 4CM7A 4TKLA 3G1UA 5ENDA 3JTMA 2OGUA 4NH4A 4J9VA 4OOEA 2NACA 4MVJE 2PY6A 3P2YA 1LSOA 1R4MA 3SXPA 1EFLA 4E3ZA 3RC9A 3BA1A 5AXAA 1G0NA 1YB4A 2HK9A 4DMMA 1E3JA 1H94A 1WNTA 3B1FA 3F5QA 1C0KA 4C4OA 2Q49A 3PDUA 1O89A 3JQ9A 5TSDA 1TVEA 3D4OA 3G49A 3I9LA 4UEJA 2J3IA 2Q2QA 4YWJA 1T1RA 4EW6A 3G3EA 5A9TA 1YBMA 4BNFA 5DF1A 3PYXA 3OJ0A 3RUCA 3GN1A 3HDHA 3TNLA 1VRWA 4R9RA 2WYVA 3K2EA 4CM4B 4MVJH 5T57A 2I3GA 1LC3A 3ZWNA 1C0IA 1QR6A 2ZTVA 4BMSA 4PZCA 1P77A 2ZB4A 1E7QA 2AQ8A 1ZVMA 1H2HA 3QVTA 2YW9A 4ZQBA 4RVHA 3NT2A 3NT5A 2P9CA 3DZJA 2GZ1A 3GF4A 4DBVO 3QW2A 2PTGA 3FPCA 4W7IA 2E6UX 2R2GA 2ZB8A 4OYRA 5EMHA 2P9GA 4JBGA 4B7XA 4CMIA 2IXAA 4DBZA 4WK6A 3H2SA 1DDOA 1WWKA 2AHRA 2CNBA 2FR1A 4R16A 4DYVA 1KVUA 1FDVA 1D7OA 1UXIA 3AI3A 3EMKA 4D46A 3GFBA 4MVJA 4CMAA 3D3WA 4ZD6A 3JYQA 1YL5A 3KYDA 3KTDA 3AOEC 3ZWAA 1AUPA 4UUOA 4PLYA 4J2OA 1RYEA 4OM8A 1E7SA 4WLUA 3PFWO 3GFGA 4RORA 3K30A 4IQ8A 1NHGA 4CUZA 2C5AA 2J3JA 2GR9A 5THQA 3ZV5A 1HE2A 5JW6A 3GR6A 3PQDA 2VQ3A 2DTXA 5C7IO 2V6FA 1LC0A 1RJWA 3K9QO 5A02A 4HNHA 3O4RA 4MP3A 3D5TA 4DUPA 1Z45A 5AXDA 2XF8A 1H93A 1Q7BA 5KJCA 3GZNA 4M86A 1GYRA 4YXFA 4XGKA 3LC7O 3K92A 4I9HA 1DFHA 3PWKA 1T2CA 3GHYA 2G5CA 2GPTA 1FF9A 2NU8A 1AXGA 3OEWA 2QHXA 4J6FA 2NM0A 2NQ8A 4YYZA 1L7DA 3HN2A 1O6ZA 4LMPA 4ND2A 1R0KA 2CVOA 1E7YA 3AFNA 3GVXA 2JFFA 3INRA 4GX5A 5KVSA 4PZDA 3DBHB 2AG5A 1QKIA 4XX0A 3C7AA 5U9CA 1SOVA 1L7EA 1KC1A 2I65A 4RPKA 3STHA 4FJ1A 3TN7A 4R01A 1KC3A 1TEHA 2X86A 3RCBA 2EERA 4HFMA 2QIOA 1EQ2A 2J5KA 5HS6A 3UCFA 4ZGWA 4GBJA 4FR5A 2YYYA 1PJLA 4ZRNA 1GEGA 2X0JA 3HHPA 4OOFA 3WGQA 1IPFA 3CMCO 1UXHA 4ALLA 4BO3A 4BKOA 1YONA 4BNTA 1GL3A 3WGYA 1HZZA 5L7WA 3ENNA 2ZB3A 2CZCA 5A04A 3I9OA 2Q45A 3PVZA 5K0ZA 1NNUA 3KV3O 3GRPA 1E5QA 1GCOA 3OQBA 3GDGA 4G5HA 2Y99A 2ZIZA 3UH1A 3ZWOA 4I5FA 4I9UA 2YV2A 5ITVA 3E8XA 2VT3A 3VH1A 1CQJA 3RFVA 3EW7A 4FQ8A 4ZHSA 1X7HA 3M1LA 4B8WA 3SJUA 1CERA 1JDJA 4BKPA 4DYDA 3OQ1A 4WCFA 3RC2A 5JMWA 2ZATA 5BSEA 3E03A 3AUAA 2NVUB 1J0XO 5L4SA 3KLMX 1U7HA 3FF4A 3KHUA 3PHJA 3CKYA 5CDGA 4KTTE 1LA2A 1ZSNA 5C7OO 1N7HA 4YB8A 3OF2A 5IDXA 5HBRA 4DQXA 3DAFA 4M54A 3O03A 1C0LA 4BKRA 3Q1LA 1PGQA 3JD0A 4ZVVA 4IS3A 3UF0A 4WLVA 4B79A 1UJMA 5JAMA 4YRBA 2HO5A 4QECA 4GPD1 2PD6A 3L6DA 4ITUA 3JQ9C 2GO1A 3Q9UA 4ALMA 3WSWA 1YJQA 3H3FA 2FZWA 4IGFA 3U62A 4CR8A 3ADOA 1J5PA 3RI3A 4M89A 2EW2A 3TQHA 4QQRA 4PLFA 1WAMA 1QV6A 4A5OA 4AFNA 2VYND 4BGEA 1T2EA 1P45A 1HF3A 2G76A 1NR1A 3ZZNA 5B4UA 2O3JA 2YV1A 4G81A 2BI8A 3LSYA 3PJEA 4IDCA 4IXTA 2GNAA 3DMYA 5IF3A 3NTOA 3M2PA 2CF6A 4AJ2A 1KY4A 3H5AA 3L07A 4GLLA 5U4QA 1I01A 2Y1DA 4IM7A 3IDSA 1SPXA 4GGOA 3IS3A 3WGIA 3U0BA 4YCAA 3ZHBA 4AJLA 2DKNA 3CUKA 3DDNA 1KEPA 4U7WA 3I5MA 3RROA 3W4IA 4ESOA 4PG4A 3EK2A 1Z82A 1W0CA 1YBVA 2ZB7A 1VL0A 3QLJA 5JO0A 1I5RA 1NFFA 4YEDA 5F1KA 5JDIC 4BOYA 1YBAA 4A0SA 1ZUD1 1MA0A 3I6IA 4FOSA 1ZMOA 2FZEA 3JQDA 3RUFA 3DBVO 4ZQGA 1SEPA 1TI7A 5T8KC 3VVBA 4B3HA 4YR9A 1XYGA 1VJTA 4J1SA 2FOIA 2JCVA 2PKRA 2O2SA 2BELA 3NTQA 2O4CA 1Q7CA 1EDOA 3ZGYA 1EVJA 3H5NA 3I52A 5H83A 1C1XA 4D3FA 5KIAA 1E1MA 4QT0A 2J5RA 5K6AA 3VC7A 3MWEB 1I2CA 5IDWA 4HADA 1ULSA 1X7DA 3RFXA 4J16A 1GUYA 5MGBA 4WUVA 1EZ4A 3F6YA 3Q3CA 1A71A 3ETGA 4BKUA 5JLAA 3ZU2A 4B3IA 4WLOA 1ISMA 2R00C 3LK7A 5F1PA 1KERA 4OQYA 1O5IA 1IE3A 1HETA 3PJFA 3V2UA 1EUZA 2HK7A 2X0NA 4CL8A 4PGFA 3ZV4A 4RDHA 2GRAA 2WMDA 3AI1A 1Q0QA 2G1UA 4BO9A 3ENKA 1UH5A 1WVGA 3BMQA 4RPHA 4KTVE 1XR3A 1UXJA 2QQ5A 1NVMB 2RIRA 3DTTA 3PWSA 2HU2A 4WKGA 5LDHA 5A5FA 1T25A 2QZ9A 1QYWA 4RQUA 1E3SA 3LF1A 2UDPA 4FFLA 1PQWA 1HKUA 1SCUA 3V1UA 3OA2A 3NGXA 4Y6SA 5TQVA 4K9DA 2H63A 1BMDA 5KVVA 1FDTA 4YTEA 2A92A 2AQIA 2FPPA 1O95A 5DNAA 1MG0A 3CINA 1SOWA 1UXKA 3KYCA 4JJIA 1YQDA 5EQFA 4Z6KA 3WJAA 1K89A 4TMFA 3ASVA 1CQIA 3OECA 3WG9A 2DU8A 1PR3A 1GPJA 3DR3A 3GPDG 3JQAA 5JAZA 4FFMA 4GI2A 3CMMA 3EDMA 2NVWA 3VH2A 4DWVA 3TL2A 4J90A 3H5RA 5C7LO 3AY7A 4ZICA 4JN6B 1EVIA 3OJOA 1XIVA 1IYZA 5DZSA 4D0SA 4XYMA 5ICSA 1SO8A 3IP3A 1QG6A 2D0IA 4N5LA 4K6FA 3FR8A 1R12A 1ZXLA 4EJ6A 3TZQA 2OBYA 1AXEA 1X14A 1WMBA 1V3VA 1XHLA 2NUAA 4AJIA 1C1DA 3CE6A 4CV2A 3PEFA 1UP7A 4Y6RA 2DPHA 3ZNNA 3AI2A 3GY0A 1Z75A 3I3OA 4FOOA 1A7AA 5B4VA 3PIIA 3R3SA 1FDWA 3D3WB 2Y1GA 5CAEA 2IXBA 3TZCA 1A9YA 1LNQA 3LDHA 3DOOA 2NTVA 3K8ZA 3VOSA 5ES3A 4XQCA 3TSCA 3KUXA 1KETA 4UVDA 4PN3A 2OHXA 2BGLA 2GASA 3JQBA 1S6YA 3SC4A 4IQ0A 1ZK0A 2Y93A 3EAGA 2P5YA 4J7XA 2DBVO 2PZJA 3JSAA 2J8ZA 2JCYA 4PLZA 5L9AA 4CLXA 5HM8A 4JCOA 5CDTA 1DIBA 1IPEA 4IPTA 5ITWA 3QWAA 5HS4A 2Z5LA 1R6DA 2PD4A 1NTOA 1N2SA 4OO3A 4PG7A 3IL2A 4E2XA 4WLFA 3JQBC 2I66A 4H15A 2ILTA 3NKLA 1K6JA 3F46A 5L45A 4PRKA 1G0OA 3NGLA 3OJLA 1NX6A 1IUKA 3N74A 2Q46A 4TVOA 3LLVA 4TROA 2H6EA 1Q1NA 3UVEA 4DPMA 4IZHA 4J1TA 3UOGA 2E82A 4P8RA 5ENVA 4E6PA 3ORFA 4CQMD 5CG1A 1A4IA 1Z7BA 3HE3A 1WXDA 2OBNA 3TFOA 5K6AC 1HRDA 2YZ7A 5ICMA 3HSKA 2NVBA 4TRJA 2YV3A 3VTFA 1YB1A 1P0CA 3E48A 1WZIA 1NQAO 2W2LD 3GZNB 2Y05A 1G1AA 2WSBA 3R3JA 3AW9A 4NMHA 3C1AA 4FJ0A 3BMNB 5JAQA 1EEHA 4YBZA 2VT2A 4UVIA 5L3ZA 3VAZA 4F45A 4NHEA 5G4KA 3UXYA 4ALNA 2Q50A 3TZKA 2VYNA 4AG3A 2YQ4A 3H9JA 3KZVA 3S2EA 3RD5A 4CM4A 1IHYA 2C59A 3GPIA 3L9WA 3V5NA 3ABIA 3PIDA 4RLSA 1GAEO 1DIAA 2YHIB 1LRLA 5GZ6A 3WBFA 1ML3A 3UICA 3DTYA 4MP8A 4FFOA 3JQ7B 1F06A 1EVYA 2OFPA 3UHAA 4RLHA 3DHEA 3E9NA 3DAPA 2E4AA 2FN7A 1ZO8A 3CIFA 2W2KB 3H9QA 2O50A 1OFGA 3QVXA 4RVGA 4L76A 4RDIA 4EZBA 3ETEA 3LQFA 2OORA 3TL3A 1E3LA 5KJEA 4KDEA 2O3UA 1AHHA 1MFPA 2FPIA 3JD4A 3K73O 3UCEA 1LQUA 4Q3NA 4B7UA 1PJ4A 2PFGA 4PFJA 1EDZA 4WPGA 3GNTA 3LT0A 3NDJA 1PJBA 1H5QA 3QP9A 2P4HX 1X15A 4CMEA 2FR0A 1E0DA 4OH1A 5GZ1A 4JBHA 2X58A 1ZFNA 1BHSA 4DXHA 5JCXA 1F14A 1J4AA 1HWYA 4Z9FA 1GDHA 1M75A 3C3XA 3BXXA 3ZHYA 1JVSA 2VZ0A 2OOSA 4YAKA 4OAQA 3IIEA 3BAZA 2D5AA 1GR0A 1UDAA 2FPGA 3H7AA 3QQPA 4RCVA 3BMNA 3DO5A 1NPTO 1LQTA 1NWCA 4R5HA 2BGMA 4GKBA 3KYCB 4HNGA 4HX5A 5BNFA 5A9RA 3E1KA 5L53A 4P4LA 3QE3A 1EFKA 1ZK4A 3O8QA 3DQPA 2HK8A 4E2YA 3Q11A 3V2HA 2VOJA 1HE4A 1DC5A 2YFHA 3BYZA 2OUIA 1NHWA 5DCWA 5EINA 2PD3A 3I4CA 2DUWA 1DB3A 1PJ3A 3LC2O 3PYMA 7MDHA 3FN4A 3UAGA 3PHIA 3GGOA 4IUYA 3ONEA 3PHHA 5G4LA 4FJ2A 1VL6A 1QV7A 4BMVA 2Z1MA 2ZCVA 3KLPX 4NDNE 4R69A 2I5PO 1B2LA 3ZWCA 1EMDA 1LLCA 4FB5A 1AN9A 2XPCA 4JXKA 4Z0HO 3KM0A 3PGXA 4CMCA 5FEUA 4W6ZA 1MXHA 2I3AA 3ITDA 5EPOA 3DBHA 4CV1A 4GMGA 1Y6JA 3S2FA 4B8ZA 4Q3EA 3MOIA 5DCUA 3ZNOA 4FPXA 2B5WA 1B16A 1K0UA 1DRVA 2RBEA 4Q3AA 1B15A 3C8MA 1LDNA 3ZNQA 3S2IA 3X2FA 2RHCA 1LLDA 1ENYA 1M67A 3KEOA 5BSGA 4LSMA 1D8AA 2W98A 2GN9A 3TZ6A 4BNMA 3P5SA 4IMPA 3MTGA 2PGLA 2CFCA 3D7LA 5HA5A 1ZSYA 3OETA 4YRDA 8ADHA 1FMCA 1K6XA 1H6DA 5KJFA 1UXGA 4XA8A 4K28A 3RBVA 1Y9EA 4K26A 2X23A 1NFQA 2D5CA 4EBFA 2NVUA 3E5MA 1FDSA 3RUDA 4CODB 1X1EA 1U3VA 4J91A 4CM5A 4NIMA 4D3SA 4WECA 2C29D 3JD2A 1E3WA 3VZRA 1R37A 1HYGA 1I32A 3ONDA 2G82A 4GL4A 4MKZA 5EJ2A 3U4DA 4EUHA 1Y1PA 1FDUA 3KB6A 3NV9A 1NQOA 3DL2A 3ZDFA 5DOVA 1BRMA 3FWNA 3KYDB 1GEEA 3PYLA 3SC6A 2GSDA 2VYVD 3AM4A 3GUYA 4RPJA 2D4AA 5FYDA 4D43A 3DONA 4UVGA 1T2DA 5L95A 1GD1O 1UZMA 3WXBA 3ANMA 1SBYA 3H6KA 5G0VA 2XOXA 4GWKA 1GUFA 1HLPA 4RF2A 1BTOA 1E3WB 1ZNQO 3I6QA 4W7HA 3RBZA 5B4TA 3O9ZA 1KVSA 3COSA 3NDRA 2GZ2A 2WWRA 1ENPA 4M8SA 5EQDA 5F21A 1UAYA 4R1SA 2PH3A 3LT1A 2Z95A 1A9ZA 1P1JA 3L0DA 4WNCA 2PZKA 2C82A 1QMGA 4GMFA 4O63O 1YGYA 3KYBA 1P33A 1Y8RA 2O4UX 3CH6A 1HDOA 3WBBA 4RPLA 1UR5A 1QYXA 3ITKA 5CEEA 4L75A 1PGJA 2P2SA 4CM9D 4MINA 3WLEA 2CVQA 1HZJA 3V1YA 1MXFA 3QSGA 1IULA 2JD2A 1PJCA 2O3SA 4P4GA 1ISHA 3CEAA 2J6IA 4L4SA 4CV3A 1Q0LA 4PG5A 4BNWA 2O48X 4YJGA 4XQGA 4NQZA 4CMBA 3T7CA 1U5CA 1KBZA 2FSVA 3AUTA 3PPIA 4BQPA 4D44A 3NTRA 1BW9B 2V7PA 5A03A 2EP7A 2PLAA 2Q1TA 5BNIA 1PQUA 3F4BA 1QP8A 3F4LA 4MVJF 1HT0A 4FDAA 4DIFA 1RKXA 4BQRA 2DPGA 2VHVA 1EUCA 3DBLB 4IQGA 4BNLA 2CDCA 1C1DB 1BDBA 2UUOA 1WLYA 4XGIA 4GGPA 3QWFA 4R1TA 3QWIA 1A4UA 4N18A 5L7TA 1IY8A 4MOWA 1LUAA 1YE3A 2VWHA 1YQXA 2O3TA 3EY4A 1XQ6A 3DZKA 4BO8A 3IMFA 1YOVA 2Q4BA 2JAPA 3FRJA 2HRZA 4UVHA 3GK3A 4OKIA 2I6TA 1DFGA 3NX4A 3L4BC 3WB9A 3PXXA 1Y8QB 4XQEA 3ZW9A 1F17A 3HG7A 4GH5A 2RH4A 4B4UA 4X54A 3IKTA 1IB6A 5F5LA 3GAFA 3EZYA 4PVDA 4KQWA 3ADPA 5CG2A 2A94A 2DT5A 1U3TA 2EWMA 3PZBA 5B37A 1YDEA 3W4JA 1VKOA 4KP7A 3EHEA 3TOZA 2NADA 4OXYA 3LT2A 3QRWA 1N5DA 4IDAA 4NBVA 1ADCA 3W8DA 1XDWA 3GC6A 2HCTA 2IYOA 3LU1A 5KJ6A 3EUWA 4TVBA 4YQZA 2R6JA 3GVHA 3JD1A 2XXBA 1TB4A 4Y98A 3IJPA 1NPDA 1KVQA 2B83A 3ZHXA 4EUEA 5I9MA 4YRAA 4CQLA 4BB5A 2NV6A 3HNPA 4NK5A 2OP1A 4XR9A 2HMWA 1EK5A 3Q2KA 5ER6A 1IZ9A 4PLVA 4KUGA 1QLJA 3JQFC 4OHUA 3OHSX 2WEKA 3WWZA 1LSJA 1RM5A 3WTBA 3MJSA 2HMSA 3VHRA 4AJ1A 2HQ1A 3M2TA 3MJTA 4URFA 4JK3A 4M55A 4L9RA 3GDOA 2VHYA 4PG6A
chains in the Genus database with same CATH superfamily
1JPUA 1ZCZA 4AZ0B 1XBTA 1IQRA 2BHLA 2IEZA 4L4XA 3UUGA 1QHSA 2JAHA 5LR6A 1TUEA 5C80A 1JAHA 4G0PA 4Y2QA 5COBA 2CDAA 3M6MD 3LOQA 1MAVA 4DTIA 2O8DA 1Z35A 4FXOA 3R0VA 4N3NA 1F6WA 1LK5A 4P36A 4BHTA 1DIRA 5CJJA 2HNAA 4FXPA 4CZ2A 4ZZ1A 1F2DA 1LLUA 1JHZA 1NRXA 1FTGA 2HF7A 5KOIA 5ILOA 3PHLA 4AY3A 1LS1A 2F67A 1MGPA 1QIEA 4QTZA 4E94A 3KLBA 3FFXA 1PFVA 2HOQA 1F1JA 3IEXA 4JQCA 4ZKDA 3TNDA 4I6JA 1GFIA 5K8CA 4FMCF 5CX1B 3LVQE 5JH7A 4M0DA 5FBHA 2BKAA 4O3MA 1LDEA 1U0JA 1ZJYA 4G0MA 4MGIR 3TKAA 2YVLA 3DBLA 2BPOA 5DHFA 4EHIA 2HBQA 2EKQA 4GAEA 2GXAA 1SPBS 1YAJA 4GX1A 2XGGA 1B8PA 2CLIB 4II2A 4DEXA 5C5IA 5TGDA 4TYYA 2GTIA 1R6AA 4WL0A 3WIOA 2SCUA 4U0JA 1UBNA 5LOVA 3PHBE 4KX3A 1VPTA 1SKQA 3R74A 5JI3E 1QJCA 2JCXA 3BWYA 3MCVA 3QVOA 5AKZA 4EJFA 3VR4D 4QPJC 2ALJA 2QJTA 3PXEA 3UJDA 5EEGA 2C5LA 2Z58A 3INTA 4R9UC 2P9FA 3SLGA 1PJZA 2JHPA 4HH3C 3LX8A 4JS0A 4B44A 4D56A 1Y48E 1ZINA 3ODGA 5IKXA 3R76A 1LTHR 1ZOPA 2A9QA 2ATEA 3MCUA 3L0SA 1SD1A 3RYHB 1JG4A 2B8EA 3EXIA 5I9NA 4EJSA 2B9VA 1GP2A 1OF1A 1LEHA 1L5QA 1KEWA 4H17A 3AP1A 3ESXA 4HDNB 3DW3X 4ZVLA 3ZVKA 5IAJA 2WHPB 2GN2A 1EAMA 1SCQA 2VSYA 4LQCA 3S68A 4K9RA 1P4SA 2GF0A 1GU0A 5KU1A 4PQYA 1I4TD 2HMUA 3AG6A 5BPFA 1GPAA 3OTOB 5KCMA 4AZSA 4KREA 5F3WB 2BKVA 2QV7A 1GPNA 2Y8EA 2E18A 1PL0A 2QT9A 2AMFA 3HDQA 4QZVA 3OQPA 4BNKA 1BDIA 1VHJA 4S35A 5A4DA 2PO5A 3KSDO 2O8BA 4HFNA 4RIIA 2CMKA 5DFAA 2W6MA 2EJTA 3AJ8A 4RF4A 4XXHA 2JA1A 3EARA 4OQQA 1NW6A 4F06A 1RW4A 2XIJA 4PW0A 1E5DA 4CG3A 3GUHA 3QTLA 1L4UA 1O03A 2XUOA 3K0KA 1UIMA 2VJAA 3KBOA 3DEAA 3OJCA 4IGAA 4HXEB 1OMOA 4QOEA 3VHXA 5DM60 4A2PA 1AQUA 3PUKA 4CG2A 3A1EA 1OI7A 3EJWA 4LYHA 4NYJR 4UBKA 3BIOA 2GEJA 1TTTA 3JZDA 1ZD8A 1N92A 2JIRA 3WYAA 4AM8A 2JBWA 3VSBA 3B3GA 3SK0A 3QPDA 1LRKA 1M74A 3T95A 3GWGA 1FP2A 3AHJA 4GR5A 1SVIA 4AWBA 2PAAA 3C7CB 3EDQA 3E5HA 5H3CA 4ER0A 2UZAA 3JARB 8ABPA 4WGGA 5ERGB 3FTPA 4ESVA 3V4RA 1CXZA 1EFPB 3SVTA 4XW2A 1N5JA 2BMDA 4RK0A 3CS3A 4A6EA 4I8DA 3LHSA 5GIPE 3IEIA 1D6NA 2EWWA 3HI4A 4L0MA 5JTTA 3PWZA 1SIWA 1ACMA 4WASA 4YI3A 5I47A 1EGHA 1OLSB 4OYLA 5TS2A 3GAMA 2R66A 4WN9B 3W06A 3EQ7A 4DUGD 5L6MB 1EGQA 1XNHA 4CT4B 2OCXA 5AI5A 3JCZA 4IIDA 1NVTA 1IEVA 2DFDA 5SYNA 1ULZA 3MB8A 4E5YA 2ZYDA 2DFNA 2QPAA 3QHAA 1LX7A 3O82A 2B35A 3QGMA 4II7A 3L6OO 1GGHA 4O6VA 4JASB 2YYZA 1HG0A 2BD0A 3EQ6A 4M0PA 1Y7TA 3QBTA 1SKUA 2XBLA 3DAYA 5HCNA 4AO8A 1UZNA 2CEKA 3UAYA 3R0XA 2DC1A 1A95A 3RTGA 2M6KA 4CI0B 3DAHA 4HWKA 4PU0A 3D4NA 5AKYA 4O2AF 5K3FA 3CZRA 5IYZB 1E9FA 2RAVA 1X13A 3PPVA 2OP0A 3TBHA 3VU1A 5C1DA 1AS2A 2GN6A 2ZR7A 3KQLA 3EWSA 3PF8A 2FZKA 1NF8A 2OWDA 2RKOA 1W96A 3T34A 1JDTA 1Y3AA 2WYUA 1PS9A 1VCOA 2CDRA 2ET6A 3LT4A 3O38A 3A2KA 4FGUA 1GZUA 1DKUA 3FCEA 2I67A 3JAKB 4O29A 5C8XA 3DHNA 3F8WA 3THSA 2PFSA 1PEAA 3N0VA 4Z0TA 1SZCA 4D41A 2Y92A 2VOEA 4REMA 5CT4A 2UUBB 3MJFA 2GYUA 3JQFA 3ZK9A 4B85A 3KUUA 2V7EA 2P6OA 2QMHA 3GJ5A 3QG5A 3RWBA 4C5BA 3FJYA 5CB4B 4GWLA 4PLGA 1MFZA 1ZC4A 1ZGJA 1J24A 1L3IA 2B6NA 3L8MA 3LXMA 2VXOA 4NFHA 1NYLA 2BVNA 3IO5A 3PNOA 4AXXA 1GNPA 3AEYA 3GCXA 3KLOA 3RFTA 3Q8MA 1ES9A 4J4BA 5J4LA 3NZEA 4LNUA 5DM1A 5LDGA 1IM5A 1KDOA 3FW1A 3AHCA 2VK4A 3LRTA 2XMBA 1JB9A 1JHAA 4LJ9A 5FR1A 2ZRGA 3B9QA 3BF8A 3WADA 3K9NA 4BTEA 4FR2A 3H6HA 3KVRA 4Y8VA 4E15A 3C8ZA 2XZTA 2H7XA 5BWLA 3CVVA 4LFAB 1Z7EA 1BG6A 2IJGX 2P2GA 5AO9A 3TMYA 4EVRA 2J7PA 3I2KA 1X86B 3ZTTA 2NT4A 2Q07A 4Y18A 3F74A 2B99A 4M1OA 2ZJ7A 1PK9A 2ZUVA 5DDIP 1K4YA 2Q6IA 1C7RA 3K9WA 5C8YA 3WLRA 5JJLA 1RI5A 4OHXA 3TTXA 3SE0A 2Z3ZA 5J63A 3TZLA 2QJWA 2XHEA 3IT0A 4LI0A 5CIQA 4Q01A 2IOFA 2J9RA 2PG3A 4MPJA 3DKPA 5B3KA 2D1YA 2CSUA 2QRJA 4CEIB 4L73A 1B43A 3P0JA 4LNAA 1B26A 4GQBA 4LA4A 1GNTA 3LVBA 1MEOA 3CUTA 4HQFA 2JRCA 3H3JA 5C51B 3K1JA 5HIIA 2HC9A 3RTEA 3KAKA 1HMYA 3PSAA 1H2BA 5IKEA 1XEXA 5JS8A 1ZN8A 4NU6A 1F7UA 2A84A 3C0KA 1DNPA 2F1KA 5TGZA 1W0KD 2I6UA 3BTOA 1CR6A 3GUCA 4UMFA 2QLFA 3V8VA 4G5SA 1C2TA 2DBYA 2Q21A 3OEYA 1ZK2A 3IAS6 4EHNA 2WQ6A 4ZDIA 3AKZA 1RC0A 4BO1A 2VCHA 3IE0A 1Z88A 3WMWA 4D0LB 3WO1A 5TPZA 5EE9A 3VC2A 3A9RA 3ZBPA 4HWGA 4OA8A 2B7CA 2PL5A 2WD7A 3KKEA 3WLFA 2K2WA 5FFFA 4ND5A 3DW1X 2Q2OA 3VU3A 3ASYA 3BMOB 2D13A 2HL6A 4G5GA 4OJMX 1PLLA 1TCCA 5CHEA 1FFXA 3CTPA 4HLUA 2Y0CA 1XRPA 4C1BA 1CB7A 2ZSDA 1BDJA 4HR7A 1JFLA 2BFFB 1PG2A 1TPYA 2A9FA 1ADGA 3LBHA 4ZC8A 1FS5A 3WR5A 5JYCA 4DV5B 1HE5A 2BFFA 4TVKA 1TIBA 3OICA 4XEHA 2GCIA 4DJEC 3OIDA 4JP8A 1CDOA 1QHFA 1TRKA 2I4RA 5FPTA 2JIDA 4L6CA 3S81A 5FCDA 1MNAA 4HKTA 4UD2A 3PX2A 4D8UA 4BQIA 1GRRA 2GCEA 3MM4A 4L02A 1CJTC 2VTDA 4CQLB 2E4UA 1GUZA 5BSVA 3VR3D 1WX1A 2F7SA 2QG9A 2QGZA 1MUUA 4KXUA 1KI4A 5EHZA 3VO2A 1II8B 3CY6A 3B3QA 3M70A 4I08A 1JZQA 1ULHA 2C42A 3CZPA 9LDBA 4HGZA 4DV2B 3I9JA 1LPPA 2YJ5A 4MHSA 1A96A 3H18A 3FB1A 3LX6A 2FLVA 4HUQB 4O4HA 1QH0A 2IU3A 1T0BA 3O84A 1WZEA 3PPWA 4PSVA 3AUSA 1JTVA 2EJWA 2QVXX 2IH4A 4PPFA 2MWMA 1KYIA 2W58A 4CMHA 3AL3A 5CPBA 4YRGA 5I8WA 2RIPA 3ZC3A 2EGHA 2VPZA 2WKQA 5AKGA 1DC3A 2BKUA 3LQRA 1MORA 1SBNE 1Z16A 5GV8A 3N6RA 3UJ7A 3FWPA 2UUCB 1KEVA 3BSFA 3OX4A 3NP9A 3RU7A 2PX6A 1VGQA 4YAUA 5C1OA 4WOKA 2H4HA 3D3EA 5CLIA 3FFAA 1OYVA 3N2GA 2YC4C 2DCUA 3HCCA 4RC9A 4WX2B 1NLZA 5TJHA 1CRWG 4I5DA 4A26A 1YL6A 1ZU4A 5FYQA 1OTYA 4U0KA 1CUXA 3W1EA 5F5XA 1Y4DE 2BEWB 2C4VA 4LQLA 4Y6PA 3E2IA 4KBFA 1U7OA 4L8LA 4N0EA 3LQYA 4QXOA 5CT5A 1JW9B 1S8OA 1P0MA 1YGPA 2OYSA 5ALIA 3S8EA 4B4OA 3FRHA 3OD5A 1UBSB 3GFRA 4EEXA 2CB9A 3QITA 4ZYYA 5BN4A 1NN1A 1ZD2P 4AAYA 4X65B 1MX3A 5A3JA 3BHNA 1XVAA 4M1ZA 4DMUB 4GWGA 4F85A 3DMTC 3OPNA 1X1AA 5I6DA 3BX1A 4AMYA 2C4HA 2NN3C 3PLAE 1ONOA 3NH6A 2WAOA 4UUQA 1T1JA 2AUTA 2OM6A 3C4JA 2QXYA 1U4OA 3ICPA 2B0CA 3LVRE 3CUEF 3K16A 2FFJA 4DCMA 3P7MA 1XQ9A 4NG5A 2LZ0A 4BZPA 3DLPX 5JVDA 3MRVA 1BS9A 3QMWA 3WWOA 5IU6A 3B13B 3TAXA 5JAHA 2WHQA 1PW5A 1BGXT 4OY3A 2XNCA 4UREA 2GA9A 5IT0A 3RHFA 1QFXA 4C4SA 3NHLA 2Z56A 3ZV7A 5FA5A 4I66A 3CKLA 4M36A 2BFOA 5IAOA 2IYWA 1V3UA 4PO3X 5JNLA 3G8DA 4XGNA 5C53B 3C3PA 3INGA 3AP2A 2QDXA 3I5XA 4MLPA 1WTCA 4N3CA 4A7PA 1U31A 5KSWB 1AKVA 1GZSA 3NEPX 1GTG1 4D8WA 2C8KA 1P9NA 3VO8A 1ZESA 4K6HA 2XECA 3GN2A 3I64A 4QDTA 4PLTA 5EIAA 4Y1GA 3MQFA 4BBPA 4C76A 2ZI4A 4GF5A 2VH1A 1IZ0A 3MGBA 3PU6A 3R44A 5IJAA 2IEBA 2R1TA 1BAPA 1OA0A 4HDKA 5IASA 1TT5B 4KDCA 4BCCA 4QSMA 3U7HB 4Y6QA 4FGKA 2GJ9A 3DFMA 1C3VA 3K0BA 4RK1A 3ZXUB 1MOPA 3ELDA 1E6KA 1U0EA 4NEHB 4EA9A 1MB3A 3DTNA 2WSMA 4YCJA 3C24A 1P4HA 3C3CA 2WKWA 4A0RA 3I1YA 4YRMA 2Y1CA 1E58A 1TCAA 4D98A 1GU1A 5GOTA 4ZCRA 3BT7A 3LIPA 3PNSA 4JHLA 4ONEA 2IBSA 2QMQA 4MW0A 5DXJA 1F3LA 1F5NA 2QP3A 3KOUA 3SX2A 3TAUA 2AXPA 3MJEA 3TH5A 3BMCB 4FCVA 2ECOA 3HCFA 5MF6A 1IMOA 3LL7A 1YZHA 1WSWA 2VSOA 3W6UA 3AINA 4WOJA 3WKDA 1QOZA 3O0TA 2VQDA 4X84A 5T67A 3ROZA 3IALA 3UT5B 2GLUA 4PC2A 3B1VA 2DH6A 3E53A 1XEFA 1GFZA 4AROA 2NSYA 3H2KA 3WK5A 4RHEA 3QVVA 3DCJA 4LJRA 3WGMA 4K6KA 1RWVA 4BUCA 1V6SA 4EUSA 1WPXA 5KYUB 2DY0A 1CJUC 3IPAA 4E2ZA 3STUA 2F55A 1IK4A 3IQHX 2A0FA 2Y0EA 1ZCBA 4KMSA 4BJ6A 2BMEA 1KJZA 4PAMA 5B1DA 3ZVLA 3F1KA 3SICE 3JALA 4IDDA 1E7RA 5KX5B 1SR8A 2F9MA 2HLDD 4DM4A 5J4YA 3TBFA 5ALYA 2JHAA 1YA4A 3GGSA 2R6CA 1XZEA 3C7DB 4JA2A 5DW0A 2XKAA 4IVNA 4YQFA 1TZMA 3EWAA 1I2ZA 3KUDA 5HDQA 4B82A 4EHLA 3LTNC 3SIXA 1GSHA 1H4TA 3WYGA 4Z51A 1JAYA 4RV9A 1SQ6A 1JDUA 2JK0A 2L82A 4RJKA 4DEVA 3PQEA 4ZI7A 4DLLA 1CDEA 1Z62A 5KVCA 3K5WA 3D59A 1MC4A 4JB2A 1RYDA 4FN5A 5IYZA 4KN5A 4TN1A 4LF8B 1QGYA 2J7KA 4ZDJA 4JI0B 3VR6H 4EG5A 1N0IA 3FCAA 3P32A 4DLRA 3OZCA 2JLQA 1NUPA 4KOEC 3GNSA 3BC1A 2R8XA 1U7PA 2G17A 3E6AA 1CUAA 2CJWA 2QTNA 2QYTA 3A14A 4Q4LA 3W77A 3QY9A 4KIFA 5LLSA 1X1TA 3K70D 4EG7A 3ZTWA 1UZUA 3GHHA 3IHKA 3GFQA 3I5UA 1EXWA 4IHAA 1Q0PA 1G5RA 2B8TA 5EIBC 3DOCA 3D2AA 2YVQA 1PV1A 4X0EA 1AQJA 2HT6A 3MPOA 4N4AA 5IXYA 4YECA 5T4BA 3VU8A 1AE1A 1IG0A 2WM2A 4ZYWA 5HZKA 1UINA 3QBEA 2B3DA 2ZJ4A 1BCRB 1GZHB 2P7HA 3LUAA 3OQMA 4CNBA 2REXB 3O1JC 4WNIA 5D1HA 4OCZA 2ZAYA 2FPLA 4HGNA 1P2TA 1SZJG 3Q3VA 5TMEA 3SF8B 4FUTA 1XMIA 2IYQA 1PGOA 4QIHA 4XD7D 1H1TA 4DOMA 1USVA 2EU8A 4A73A 1ACLA 3F97A 3HMKA 1Y8QA 3EYAA 3D3JA 1BZYA 1L8XA 1VSVA 1X38A 3C5VA 2AE1A 2FPPB 4FUQA 1SJ9A 1JHRA 4PY2A 4DLBA 1BU8A 4D25A 3ZWYA 4A6DA 1CNMA 4KRYA 2P2DA 2PSEA 4IKEA 4Q39A 5JVDB 5CA0B 5K8TA 5KNCH 5DBIA 2L42A 3K6KA 1UT8A 2Q6VA 2WA2A 3AGQA 4EHAA 5HTOA 4BE4A 1QSGA 1V35A 4KK4A 3OCXA 4LMBA 4OIMA 1P5HA 1HG1A 2XQIA 3H2JA 5AQEA 5HKBA 1CSEE 2R48A 4MHOA 5IKPA 1PZFA 1CQJB 2X6QA 2ODQA 4JJFA 4JB3A 3SQMA 1G38A 4QOHA 3G2NA 3UK2A 5F77A 5BN1A 3TOXA 4C05A 1W36B 5IAEA 2WHEA 1RLTA 1Y3FE 3NTLA 4B17A 1G17A 3MQ2A 3P9RA 4W9NA 1SZDA 3FUUA 2CCGA 4QU9A 4ETMA 1AUOA 5CNJA 1FNMA 2EIXA 3D8RA 3DE5X 3BM5A 3CH5A 3EA5A 4V3CA 4QPDA 4WQMA 1VIMA 5EZ6B 1LX6A 1YE8A 2FUKA 3C1TA 2C20A 3UOAB 1MC8A 3LUFA 2DUJA 5BWCA 3VJRA 3ZHVA 4QICA 1E66A 3MAGA 1G5PA 4GRAA 4TTTS 3T7EA 5AVKA 2LIVA 1H9BA 4O4LF 3HVRA 2AOTA 5FOXA 3MMXA 4M0LA 1T0JB 3DVSX 4XIJA 1CHDA 3KZMA 1C41A 5DYGA 1A1VA 4YT5A 2JGRA 2JJQA 3AB7A 3IHLA 4DKXA 2OPBA 1KARA 1M6VB 1PEDA 1WULS 5M04A 2YNMD 3A1SA 1KOFA 3HFSA 1SIBE 5EN4A 3T7RA 4RVFA 4BNGA 2Q8PA 1U2QA 3CV3A 4OXQA 2C7GA 2PH7A 5CTAA 3OOYA 5H5JA 4MVJI 2ESRA 2ZYAA 5BV0A 1H2YA 1EJ6A 1BMFA 3K3PA 4EKDA 3CCCA 1SQSA 3O4VA 2M6RA 4G5FA 3R9XB 5F7ZA 4BYGA 3CF4A 3LLCA 1Z4JA 1GLNA 2VF4X 3Q5GA 4QO7A 2W2LA 1ST2A 3LT5A 3D4IA 3P0IA 4HO1X 1B3RA 4KV7A 4BU0A 5JRJA 1YVDA 2ORVA 2V4MA 4TSFA 5K4GA 1WV0A 3G5UA 4B47A 1FK8A 2UZ0A 4X3PA 4DDTA 1H4QA 2PBRA 1PZGA 1JYSA 2IYXA 5LP6A 4X1KA 1P3Y1 5E1MA 3R0JA 3PHCA 5DI3B 3RV3A 2VK2A 2PMFA 4E32A 2I2XB 1W9MA 1JA0A 1B6RA 4ROTA 4IIUA 3AKDA 5IZCC 1WZ2A 3RGWS 4ZU1X 3UPUA 3SBOA 1NSFA 4MV6A 5CT6A 3A2LA 1LJ8A 1NIPA 3ROFA 1J25A 2DQ4A 3V1MA 2H59A 1A8HA 3ZHRA 3FGNA 5BVHA 5JPCA 4IF6A 1EUYA 3IVXA 3UB2A 2QYHA 2JC3A 3TSOA 1AO3A 4BRUA 1U5BA 1R2QA 3B1KA 2I6XA 3LW8A 1Z5GA 3MF4A 1X1SA 3E5NA 3TJRA 5GVSA 1Q6ZA 2R6DA 1V4VA 2EXXA 3OO1A 5IARA 1S8AA 5JROA 3WLOA 1TPZA 1K9SA 3QPWA 1P19A 3SLKA 4KITB 2VWGA 5JFOA 2GHRA 2I99A 4FNGA 1UBMS 3E9ZA 2NTNA 2G07A 4JNKA 1BXGA 1JXOA 3NWOA 1DPGA 2HWYA 1Z7YA 3U13A 2Z2JA 3P4UA 4BIIA 4M9ZA 1YR7A 3C6XA 1WSAA 2Y0BA 1M10A 3ZHQA 4Y9TA 4FFNA 3CBGA 4NBTA 3ABRB 1HDCA 2ECQA 3H9UA 3MWYW 4JQSA 1JJBA 3BB1A 2QRLA 3OUTA 4LY9A 4MUKA 2BRUA 2QZZA 1AK9A 2MSLA 2XRYA 4TKUA 2A14A 4WJKB 3UWKA 2C0QA 1E0SA 4FR0A 4Z9YA 5TF4A 1OAOC 4TWIA 4D6YA 1GCAA 2QY9A 3ANSA 8ATCA 4DR4B 3TCNA 1UAGA 1GA4A 2FPOA 3B82A 1J2EA 3LPDA 3ZE8A 2YV5A 3FAZA 2DHQA 3KJZA 4Q7QA 4RZIA 4O2AB 1EFDN 1OHHD 2G4LA 5IYZF 2BF7A 2W6CX 3LSTA 3O8LA 5E4FA 5EG5A 5IC6A 4C21A 5KZMB 3TM4A 1MP0A 3CZQA 5EHNA 2OWEA 4G3XA 4U6QA 2PUGA 5K05A 3MMNA 1MX1A 1KYXA 1SUEA 5C52B 3JRNA 4J1NA 2ZBDA 3DPUA 4KQ6A 4WH0A 3THXB 1O0BA 2D1QA 4ASUA 2JGFA 1T43A 2D1TA 2RDMA 4YJFA 2AX3A 4B71A 3KHKA 4IIFA 4YT8A 2ZRNA 1UMBB 2PIAA 1RI1A 1OH7A 1IBMB 1UOEA 3E9RA 4R05A 3SJAA 3C3MA 1LJLA 1NUSA 3DBRA 4IIYA 3AF5A 1VB5A 1SB9A 4ZKEA 3GLTA 5J2UB 3HWRA 1ORTA 1L4YA 1I3NA 4AQDA 4CLRA 4BLTA 3VC3A 4ETIA 2QR3A 4I19A 5D7BA 2HU5A 1YJ5A 2PQ0A 1KI2A 1YQ9A 3ELBA 3EQ8A 1NVDA 2YBDA 3JVEA 2JEYA 3GIWA 5HCIA 3SX4A 4BO6A 1L8OA 1NBEA 4IINA 3WDKA 1VHWA 1M2WA 5JSQA 5A3RA 2PKQO 2O2HA 1KJJA 1VXOA 1UFOA 2GFHA 5BT9A 1EINA 2BFMA 4G65A 1HDXA 1L7XA 1QZTA 1PJRA 2VP9A 3E3OA 3PX3A 4GZ6A 5L3RA 3W5IA 1YV9A 3QF4B 4YI5A 2FW6A 4JNCA 4MCJA 4BO4A 1H69A 3BE4A 2CD7A 1O0SA 1OZAA 2FWJA 1RAAA 2P0YA 2PKYX 2WW8A 2XKBA 3BHJA 1XZHA 4MGZR 3IAS1 4RWEA 5SZHB 2RI6A 1JLSA 1N8TA 2ASEA 1EJ2A 2HA5A 4MS3B 4IWXA 5DV9A 5IEJA 4EENA 1R50A 2JNWA 2XRZA 1RPTA 3WJ1A 1P5JA 3EZGA 4G9GA 3P4XA 3HEMA 3D7KA 1NF2A 3O8RA 2HA4A 3JQGB 3RTBA 1DFIA 3ZLTA 3NLLA 1T4BA 3FKSA 2IODA 3FZGA 2CVFA 2CD9A 1IZZA 3KWMA 3L79A 5FUXA 4ALKA 4RKQA 4XIFA 4LF4B 3NG1A 1M1YE 4HEA1 3KFXA 4PX5A 3KT0A 3PRHA 4WVLA 5KNCA 4CM4A 1IJBA 4ZXFA 3Q2IA 1G9TA 1ID1A 2XB2A 1FFAA 1KVTA 3NRCA 3HPQA 5BVGB 4ML3A 2PSHA 2ERCA 2KS6A 3H97A 1GIAA 2HXYA 2WT4A 1V9LA 3PTLA 4PXSA 1OBCA 4UULA 3TQFA 3HFGA 3CLHA 3ZU4A 3NTXA 3ONFA 2XZPA 1TLTA 1YACA 2QQGA 4FLEA 4TL8A 4CGYA 4KQGA 5ALDA 3W4KA 4E07A 1BJTA 1ZD4A 4CM1A 4JJ7A 5ED0A 1DEXA 1Z07A 4A8PA 2WFLB 2F8TA 5LD2B 3EGEA 1JS1X 1L7BA 2R86A 4H4DA 2XTAA 3EXFA 3W7VA 4QX6A 1CF4A 2HUNA 1GXSA 4PGGA 5E6SB 5AW6A 4KODA 3DR5A 2DM6A 1YOVB 5GJWC 5LC1A 3UA4A 5BWOA 3O3OB 2YXLA 4H59A 3HVUA 3ES9A 5A9SB 4Q4HB 4JT8A 3DB2A 1JIUA 5DK6A 4Q03A 5JQWA 4YO7A 3SQDA 1J49A 3WQRA 4BB9A 3A0RB 2Q3CA 4N49A 1RDFA 3EBOA 4PANA 3RYCA 3DBOB 2OL4A 2Y1WA 1GG9A 4DXDA 4B3DA 4ESHA 3BFPA 5BMVA 4QPCA 4L72A 1WUYA 2IKSA 3UCXA 2XUJA 2UZIR 2I4IA 4M76B 4L8VA 3HJHA 1R5BA 5DN6A 4DZZA 1L2TA 1PCXA 4J49A 4YQYA 4FDTA 2GBFA 2P9JA 1SUFA 1TUIA 3BPSA 4KDFA 2II6A 3GPBA 3L7MA 2ZIUB 1P62B 2IPNA 1B00A 2C2HA 1FEZA 1ML4A 1DUSA 1XU9A 2QWXA 4ZV7A 2R3SA 3SXUA 3VMFA 5JHHB 5DSZA 2QUHA 4BL5A 1JIIA 3MTBA 1YIDA 2XB4A 5G1PA 4EPTA 4EKYA 1E0AA 3ENQA 1PV2A 4QHSA 1JTFA 1P3DA 5JSFA 5KTYA 2WWIA 2KJQA 3BRCA 3UGJA 3MAJA 3I12A 3CX3A 1JPVA 1NASA 1E2DA 2Y6UA 4EYEA 4K05A 4D4JA 4DSAA 5ES4B 1VM6A 1M1NA 2KSQA 4RVUA 3T3HA 1E2BA 2XMZA 1Z47A 1RZVA 2B1IA 4U1RA 4A36A 4Y6OA 4ZU6X 3FCUB 1K4KA 1BGVA 2ZPAA 4NMXB 1DKPA 2Q5IA 4Z3DA 4OXNA 1VPVA 1WPQA 4BCDA 3UW3A 3FETA 1AUXA 2KWIA 1RHRA 2PS3A 4XVHA 2UVPA 4E5NA 2ZBRA 1VBFA 2FWMX 3Q85A 1Q5PA 3ZZMA 2CXUA 4LZAA 2O3QA 1Z26A 3T0FA 3H65A 5HKLA 2O14A 5LZ2A 1AZLA 1A72A 3DL7A 2WV7A 2I62A 3K2QA 1QNLA 1JHVA 1T2VA 3OI7A 1U1FA 3S70A 3BCSA 2QDKA 2VHCA 1P7PA 5H02A 4A27A 1V8DA 4LYAA 1PNVA 4QFDA 4E08A 1FRVA 2JRLA 4KU4A 1B73A 1I8TA 2FA9A 1MV8A 1AGNA 4DFDA 5K2OA 1KOGA 3EPRA 1CIPA 1WXFA 1PHRA 2ZIXA 3UK6A 1YS9A 1VIYA 3QHPA 2DR3A 1ZUWA 3C48A 5ICCA 4N3GA 1ONBA 3Q15C 4FOPA 4EG8A 1POXA 3I5AA 3RU3A 4XVQA 1TLFA 4JLMA 3TQTA 4NEQA 1SK9A 1RHKA 3HLYA 5B12A 1E2IA 1I33A 2RAFA 1NBME 2ZSBA 1KH3A 4HZIA 2G9RA 2XCOA 4M9CA 2AFRA 2P35A 3RTAA 4BASA 1V8FA 4DDUA 4YRZA 3IPCA 3OQHA 1MB4A 1PJ8A 4ZEMA 5IJWA 3L6BA 3RRBA 4RVSA 5I48A 1TDJA 4DUZB 1MLDA 4CDMA 1TF7A 1Q0HA 1Y1TA 3DDOA 4FWTA 1XNQB 1L4HA 1ZNYA 5LCXA 1G3QA 3EGDA 6ABPA 1D0VA 4XPIB 1D2GA 3UMVA 1GQ2A 3W9UA 1G3IA 4HYQA 7REQB 1TEZA 1PQ4A 4FMPA 2YX1A 5B57C 2Q7DA 1FYDA 2RKBA 3VBCA 4LSWA 1XTJA 2D0DA 3H5VA 5CB6A 3V32A 4AS3A 1ZCFA 3TOCA 5LQCA 4F8JA 2ENUA 3TB6A 1I4LD 2Z2YA 4PLWA 2WWYA 1X19A 1UC9A 1ZI6A 3LGSA 5BOSA 1AMOA 5JJCA 2GM3A 2LPMA 4X1IA 4ZC1A 4TWBA 1D2AA 3QIVA 4RK7A 1MO4A 2ZUSA 3TO5A 3W5SA 5BSWA 3NANA 1P8AA 1ENZA 4Q9IA 1RC8A 2YVKA 4YAEA 4ND1A 1KORA 1R00A 1W30A 4JLDA 2YYSA 4PPYA 4EUKA 4E88A 3F47A 1J5XA 2FOXA 4BO2A 1XJQA 4YCMA 2NP7A 1U2GC 3DE7X 3UHJA 3WLQA 2A35A 7AT1A 3M9XA 3E81A 5JMPA 3BIXA 4OP3A 3BRQA 4HBZA 4MYDA 2P5TB 4KHZA 4O4HF 5EFOA 5JVDF 3ICCA 5ETJA 1ZBQA 3FVVA 2OSVA 4EVQA 4F1JA 4WBNB 5AVOA 2PL3A 5F7OA 4J4TA 4P31A 3WGTA 2X6RA 3Q7EA 4RMJA 4LGVA 2V7BA 4KR9A 3TYXA 3ROKA 3NHBA 1K5HA 3OCUA 3GLGE 2VHZA 2WTUA 4XB6B 2FP4A 3FPFA 5FUMA 3WDMA 2GM9A 1PJ2A 1F8UA 1JWAB 2C1ZA 4G86A 3U61B 4RJLA 4CR6A 1ZQ9A 4JKYA 5LL6P 3X1JA 3E22B 2X8BA 1CEXA 1NI5A 4MVJM 3TVTA 3BL8A 3RSFA 3ROGA 2JASA 4B34A 1GZ4A 2MSWA 3A1TA 1CD5A 2CVHA 2HGZA 3EIWA 5H9VA 2J32A 1NY5A 5EESA 5HJ5A 2EX1A 2R5FA 4WHMA 1J5EB 3EGCA 3SNKA 4P0TA 4R7GA 2C54A 4X8LA 1HLDA 1XZMA 5AICA 1P1IA 3AKEA 3WAKA 5KU7A 1RJFA 3ROQA 2X9VA 4BX3A 3WP0A 2O07A 3WYNA 4BZZA 1TZCA 2ZM6B 4WVFA 2RHHA 3DUFA 3M3HA 5KNLA 5LQDA 4GUDA 4MAAA 2F9LA 1DC4A 2DSTA 3O4GA 4F3NA 1J23A 2FVXA 3AIOA 4LTDA 1ABFA 4NV1A 3JV7A 3T5TA 1T9BA 1KYQA 1PWYE 1TD1A 4DHEA 3PT9A 3EVDA 4ZAZA 2PWPA 2HMYB 4L4YA 4NI5A 4NMWA 3DVAB 3BXGA 4FMDF 4J76A 1GZ6A 1H2EA 1OFHA 2QVCA 2HA3A 2OB1A 3HN7A 4I1YA 2RB5A 2NO0A 3QVUA 3U3MA 4RF5A 3U44B 2HLDA 1D1PA 5A6SB 2ZROA 3RRXA 3HUUA 2IF2A 4E1VA 4CTMA 2WG2A 5A4IS 1VFPA 2ZWOA 3KQYA 4B9EA 1V0JA 3E84A 2Q0XA 1SQGA 1YMVA 1P72A 4TTQA 3ILVA 4RX1A 4NCXA 1J8FA 3P0HA 5AI9A 2V6MA 4GMDA 4PZPA 1TFUA 3NCHA 2LV8A 4C22A 4OXKA 2QRVA 4EY3A 5E6SA 1P4RA 3RSZA 4RAOA 3T4EA 3II6X 2YMLA 1FJ2A 2HSWA 2Y1EA 3EGXB 3CJQA 4NV0A 5LOVB 1D3AA 2WFLA 2Y66A 1CWUA 3GLFE 4RLQA 1DKOA 1Z06A 4Q47A 2FPWA 1IHDA 1K68A 2IEDA 2WLTA 2P6RA 4KWHA 4Z4EA 4HQNA 4OHOA 4CFZA 1MF7A 2Y67A 3C3AA 3HJGA 5AXBA 2FZLA 4JEIA 5KKCA 4B81A 4D9JA 2XTNA 1KOJA 2GZRA 5DN6D 4N5MA 1HXHA 1K7CA 4M9SA 2ZRIA 4KIWA 3UXMA 2YW2A 4JX8A 3EGVA 3PPXA 1AF7A 3CPSA 5DT9A 5BQPA 4JOQA 2APJA 1R4NA 2P2LA 2BTQB 3CX7A 2B4YA 3OFND 3ZGVA 3OZBA 5FORA 5JZ9A 3VNSA 3WIVA 4NKRA 2FFAA 3OOHA 4KGDA 3WL4A 4JGBA 4UTPA 1IPHA 1J09A 1H6BA 4GX2A 1N7IA 4N7BA 5ELMA 4GIBA 2CFOA 2YMMA 5EIBD 3L4EA 4FBMA 4I7EA 4MWGA 3R7WB 5IH3A 2VJQA 4RIHA 5EWLA 3R0IA 4Q02A 2OE2A 2ZBFA 1CZKA 3Q1KA 5B7QA 4LCJA 5EOVA 3OKAA 3T4XA 4Q7MB 5F98A 3V8QA 3L7LA 2CEAA 3REGA 1S7CA 1V26A 1ZEMA 2V97A 1JPNA 4YGYA 3HKDA 4CLOA 1W19A 2OAQ1 3H04A 4FYPA 2P4QA 5FI5A 2W7TA 2C2MA 2P40A 1T6NA 1XEWY 3LQ4A 3NRBA 4YRTA 3DUWA 3WJ7A 3H2ZA 4YMVA 3A37A 1LU9A 5JAIA 3REFA 1WF3A 2FHSA 2Q3JA 1SUCA 2HRQA 2WDPA 3BGIA 3GZTB 1BCRA 1YDWA 1UBKS 2BR3A 3K2IA 4XWTA 1JA9A 1SOUA 3DKVA 3OTIA 4QXAA 4B48A 2XNJA 1QX4A 3GT7A 4C4AA 1XWIA 2NZ8A 1NV8A 1BCSB 4OXIA 4XFJA 2I6GA 5K0JA 1PR0A 1JH8A 3W8EA 1E62A 5E8JA 4JP1A 3KAQA 3NC1C 4UE2A 2FRDC 3HYNA 2Z09A 3N76A 1M1XB 2X2OA 1H3FA 1XZLA 2FVYA 3G8YA 4ENSA 4RTNA 3R6TA 1MH1A 2JB9A 3AFMA 4KRXA 4B3JA 1BXRA 1R0CA 2PRJA 1GU7A 2ZIGA 4DCVA 5IZ4A 3W5BA 2JFNA 4BATA 4UPEA 1UPTA 2GDZA 5E0KB 4MIOA 1VKRA 3PR3A 4HXFB 5ALLA 1KEEB 1OWMA 3TWOA 4KLNA 4IS2A 3F90A 2OHIA 2YVUA 4E0BA 3MJCA 3AR5A 1RVDA 1B2RA 1JLMA 5ALPA 3V7NA 1YR8A 3JVUA 1L1FA 4KOAA 1CR4A 1WCV1 1IUOA 2DMRA 1AG9A 1O1YA 3A2NA 1S2DA 3EFOA 3KTFA 1XMJA 1D1TA 2DPXA 2OZPA 2W2QA 2WIFA 3A4IA 1GFSA 3CZCA 3PD7A 4O4JA 4OGFA 4V03A 1XXHB 2LCFA 5AOCA 5D5PA 1TJNA 1V39A 3H9GA 4B3CA 2ZFUA 5IVPA 4D5EA 1U94A 1GZ7A 2DGDA 4EHDA 5IJZA 3ZWPA 4I1UA 1XCGB 4TLMB 1DC6A 1E77A 2I1WA 3SP1A 1GGMA 2Q3EA 3L7YA 3EB9A 1TJ3A 3QLUA 3A6JA 4PX3A 5ALTA 3EXG1 1I9CA 2YHIA 4PGAA 2OCIA 1VPEA 2IDZA 4Y67A 1JALA 1MJHA 3ESZA 1XF9A 3GG9A 3OVMA 4BDSA 4JJGA 1JXQA 2WUEA 4C7MA 4U39A 3SXJA 4EY5A 3VKFA 2NIPA 4ER5A 2B4AA 3EXHA 1J1IA 5ENDA 3JTMA 3WLKX 1SKBA 5C5DA 4J9VA 1G7SA 1WXEA 1VL2A 1RJ9B 1CV2A 1UBLS 2INGX 2J59A 3M6WA 3P2YA 4G4SO 4MVJE 4OHFA 4F11A 2QROA 4PRYA 2Q62A 7ABPA 5FPQA 4CIDA 4BC0A 3BSYA 4G0VA 3IUQA 1UADA 3MBKA 2XCRB 3HABA 4HPWA 2XVAA 5AXAA 3VPBA 3QM1A 1YB4A 2JPDA 4F2DA 2QL9A 3BGSA 1E3JA 3GRFA 4QOSA 4JJKA 5HBGA 3MRTA 4C4OA 1C0KA 4KGVA 1F4VA 2Q49A 3PDUA 1VIDA 2BHTA 3G49A 3I9LA 5TV2A 1G8JA 4B0OA 5JSKA 5B6IA 2J3IA 3FSJX 4XSHA 3DE2X 3GJQA 4MQBA 4ENUA 5CCXA 1NLFA 1QHHB 3GCZA 1CVLA 5AUQA 3Q88A 2Q28A 4MVCA 3D6UA 1RLOA 2E1PA 3OJ0A 1SBCA 2R9VA 3MT7A 4HF7A 1XLTC 1VRWA 2EBWA 3G7SA 3Q9SA 4I81A 3AFHA 3CHYA 3OZIA 4KXQA 5DMHA 1N57A 4O4IF 4S1NA 4YN3A 4MVJH 2Q5FA 4EFDA 2E2WA 2XAUA 4RK4A 4B1FA 1F9EA 1SBIA 5T57A 3L5OA 4LQDA 3HSSA 2CJFA 4IVRA 5HFNA 3WK9A 4I2NA 3SKYA 2G09A 1DBQA 2PS9A 2YW9A 4V0SA 4XD7A 2WPDD 2NVOA 2QVGA 2E5FA 2PUFA 1RBQA 2GZ1A 2FLWA 3U7FB 2R8OA 2AFIE 4P82A 4OYRA 3W5UA 2WWFA 1SXJD 1YR9A 4JBGA 4NU0A 4U2FA 4DBZA 4HNTA 3D6JA 1I9GA 2G9ZA 3H2SA 1U28C 2F48A 1TQHA 1TD9A 1C80A 2AHRA 3Q7QA 1FDVA 2PMEA 3WWPA 4DYVA 1M6NA 5KBYA 1TMYA 4L0DA 4N82A 1M2VA 5I8PA 2QAIA 3PQ4A 3GFBA 3EVAA 2Q5OA 1TCBA 2DP4E 4OV6B 4ZTBA 1WW2A 3NHWA 4TTSA 4XGRA 2XQJA 3JYQA 1B6SA 1FP1D 3KTDA 3WK6A 4YUWA 3ZWAA 4S0XA 1AUPA 1U0TA 2VSXA 3H3XA 3HXTA 3LQQA 4R2LA 4J2OA 4UUOA 5EUQB 3UK0A 2XUQA 4QLBA 3E4CA 2C9ZA 5FADA 2YWBA 3HYCA 1WUTA 1UWCA 3GEPA 4JXXA 4CUZA 2C5AA 2J3JA 3B12A 4GOMD 2GR9A 3WYFA 1XMSA 1OZ0A 3ZV5A 5AW8A 1PV4A 1Z0DA 4QBKA 5JW6A 3ZYZA 3UT5A 2VQ3A 4CGZA 3I6MA 5C7IO 2V6FA 2C95A 1KXJA 1OU4A 3F71A 5CBPB 4MV3A 3CWCA 3RGGA 3X2SA 1Q7BA 3BZBA 4HD8A 2O05A 2RK4A 3OLZA 3KQWA 1GYRA 5BW6B