3AY3A

Crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
266
structure length
266
Chain Sequence
MLNRLLVTGAAGGVGSAIRPHLGTLAHEVRLSDIVDLGAAEAHEEIVACDLADAQAVHDLVKDCDGIIHLGGVSVERPWNDILQANIIGAYNLYEAARNLGKPRIVFASSNHTIGYYPRTTRIDTEVPRRPDSLYGLSKCFGEDLASLYYHKFDIETLNIRIGSCFPKPKDARMMATWLSVDDFMRLMKRAFVAPKLGCTVVYGASANTESWWDNDKSAFLGWVPQDSSEIWREEIEQQAGEIDPDDPAVIYQGGKFVAAGHPDDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent epimerase/dehydratase
publication title Crystal structure of glucuronic acid dehydrogenase [correction of dehydrogeanse] from Chromohalobacter salexigens
pubmed doi rcsb
source organism Chromohalobacter salexigens
molecule tags Oxidoreductase
total genus 102
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ay3A01
1IB6A 4J90A 2FRDA 3ZV4A 1VI2A 4OOFA 2GN4A 4HY3A 4DRYA 3DZGA 4YT8A 4IDGA 3IP1A 2C7GA 1GQYA 3I5MA 3WGZA 2HCTA 2UDPA 2VYVA 3JYOA 5EERA 1E92A 2XF8A 4IIUA 4CR7A 5IZ4A 4XWYA 3O38A 2O23A 1UDAA 1K89A 5G2OA 4BO4A 2I99A 3JCZA 5F1KA 4ALKA 4IINA 4RVSA 2B83A 5ES3A 1JWAB 4BNXA 4XJSA 3AWDA 2IDZA 3GQVA 3KRTA 1NYTA 4IS2A 2GN8A 3OSUA 1ENZA 4MJLA 3OIFA 3RJ5A 3T4XA 1C1DB 3AOEA 4GKBA 5A02A 1HLDA 2ZB4A 3T7CA 4XIJA 3CE6A 3WYBA 1JU9A 1XYGA 1HYHA 1P0CA 3BTSA 1X13A 4MINA 5EIOA 4R5MA 1EZ4A 3JQ8B 1VM6A 4HFMA 2EXXA 3MJCA 3FPCA 1T2DA 3IC5A 4Y6SA 1B3BA 3C7AA 2Y99A 2QZZA 1MV8A 4UVIA 1HDRA 2G17A 2GSDA 2JFHA 1ZCJA 2JCXA 3GFBA 3IUSA 5IXYA 4DYDA 3PHJA 1VL0A 2EKPA 3WMXA 3WNVA 4BOYA 2VHWA 3P7MA 2VOJA 4INAA 4YAJA 4DIOA 3UCFA 3I9LA 1Q0LA 4CMJA 3P19A 4BKQA 5CPBA 3I4CA 4JIGA 2JFFA 3UICA 3WSWA 3QRWA 4BNJA 1ZJYA 4NFHA 3JQ7B 1YBAA 4ZJUA 2HMVA 3FCOA 2CVOA 3EZLA 5AXAA 3NV9A 4HNGA 4P4LA 4S3MA 1TVEA 5IFLA 4P38A 4YT4A 5JFOA 2HMUA 3QVTA 1LDYA 1GR0A 1N5DA 4GQAA 3VTZA 1J4AA 4QQRA 5C5IA 1ZK3A 3I9JA 2Q1WA 4R51A 2X9NA 3JQ9C 5TNXA 4EUFA 4B3JA 2CSUA 3SC6A 2G1UA 4GBJA 3K31A 5TIIA 4YBZA 3ANNA 4PVCA 3RUFA 4HNHA 4Z0HO 1LX6A 1L7EA 1EFKA 1NM5A 5K9ZA 3H5NA 3NT5A 4NNJA 4AJHA 3GFGA 3HE3A 3ETDA 5AXCA 1JAXA 1PGJA 3IJPA 5A06A 2GN6A 1DC5A 5IZCA 1GV0A 2JD1A 4A27A 4CM6A 1H6CA 3KVOA 4JJIA 1LXCA 3ZW8A 2WM3A 2EG9A 2X9GA 1YO6A 5F3RA 4DC0A 1JKIA 1P9LA 3QIVA 4Z9XA 9LDBA 4RPGA 1CIVA 2JFGA 1MUUA 5JS6A 3CIFA 2I6TA 3DMTA 4HKTA 2J3KA 4YACA 4YQYA 4JNKA 3CZRA 3GNQA 3PHLA 1MB4A 1KEUA 2HRBA 4A10A 2E6UX 3I23A 2BH9A 4TZKA 4ZA2A 3VH3A 2VWHA 4CMKA 1CEQA 1ZUD1 2OBYA 4B3HA 1NR7A 4R41A 5I7FA 2Y66A 1YB1A 2W2LA 1HE5A 4FGWA 2VWGA 2I9PA 3G1UA 3OA0A 1PL7A 4FSHA 3RFTA 1ZK2A 1PJSA 2UUPA 2QQ5A 3E18A 4FPXA 4MIYA 1GADO 2W98A 1PQPA 4BNHA 1YB5A 4CMAA 3IIEA 1M66A 1KVUA 3GVIA 3HJAA 4K6FA 3BZUA 4MKZA 2ZTVA 4OOEA 3W1VA 4IJWA 3ZHBA 1WWKA 3RUDA 3V8BA 4IBOA 4WE3A 4L8VA 3V1YA 2OMEA 5C7IO 4HWKA 1RWBA 1XKQA 4RO0A 3AW9A 1LLDA 4W6ZA 1DIBA 1U9JA 3G49A 4PFJA 5LCXA 1LU9A 2IRWA 1HE2A 2VRCA 1K0UA 3DZBA 3ZU2A 4KTTE 4B7UA 1YBMA 4IMPA 3GAZA 1T25A 3NJ4A 4QECA 4DLLA 5TRTA 1QV6A 2OP0A 2Z95A 3JV7A 1ZNQO 1X7GA 4J7CA 2JCYA 1V3UA 2FY8A 1XELA 2VQ3A 4CV2A 3TJRA 1EUDA 2G0TA 4D79A 4ESOA 1R6DA 1DPGA 2OL4A 1P3DA 1O5IA 2WD7B 2C20A 1EQ2A 4XB2A 3WTBA 4OXNA 4CQMB 4OQYA 3ZH2A 3D1LA 1KC3A 1FK8A 2DVMA 1QYWA 3ZNNA 4BQRA 4U8GA 1SBYA 4YEDA 1GAEO 2JHGA 4B4OA 4OMUA 1PL6A 2B4TO 2IXBA 4J2OA 4MP6A 3OHSX 1GFSA 3ENNA 1MX3A 2NNLD 6LDHA 3H7AA 1VL8A 4QFCA 5A5FA 5IJZA 1ZXBA 1U8XX 2HMTA 1EE9A 1NPTO 2X0IA 4YJHA 4DLAA 4KUEA 1SZJG 1UZLA 4L74A 4LCEA 4H16A 4BKUA 1H9BA 1XCBA 3HHPA 5CDYA 2X4GA 3B6ZA 3I3OA 4MVJF 4J1TA 4R1SA 3MTGA 2BI7A 1BDMA 2PNFA 3TZCA 3DFUA 4BGEA 3HB4X 1NPYA 4JK3A 3TOXA 4CPDA 3AM4A 4EEZA 1V8BA 1MGOA 5KOIA 4PGFA 1G1AA 1HKUA 2QRLA 3ENKA 4O0LA 2DPHA 4CLEA 3U09A 4M89A 2DBZA 1KS9A 4MPDA 2W2KB 3TZKA 5THKA 3P2YA 1Z7BA 1ZH8A 4FOOA 4I5EA 4Q3CA 3LT1A 5TT1A 1ADGA 2FR1A 2PGDA 4R69A 5KJ1A 2UVDA 3NAQA 1ISIA 2Y05A 3R0IA 1IHYA 2EWMA 3KYCB 3PFFA 1Y5MA 3V2UA 4BNYA 1R4MA 1I3NA 1U5AA 4OL9A 3H3JA 4IMRA 4M87A 2EEZA 4JJGA 4JBGA 4W99A 1HZZA 4D3FA 5IAAA 1PZHA 3RROA 3ICPA 4MVJI 4CMEA 1IY8A 4ILKA 3H9QA 5DOZA 2PD6A 1E3EA 4M49A 3OJOA 5EMHA 1AUPA 4E4YA 1F12A 3FRJA 1N7GA 3ZV6A 5CDTA 1PQWA 3PIDA 3BTVA 1F0YA 1PJ3A 4HFJA 4RZIA 2W2LD 1ULSA 5IDQA 5JXWA 4OSOA 1PGQA 4Z3KA 4K6CA 3C7DB 1KVTA 3HSKA 4IJKA 1JN0A 1TEHA 1F8GA 1HXHA 4U0KA 1ENPA 4HFRA 4J9UE 2R00A 4LW8A 4ZN6A 3OA2A 1DC3A 2YUTA 4E5KA 3ZHZA 1JW9B 3TFQA 2LDXA 1O94A 3HZZA 4UUOA 2PZKA 3DHNA 1TT7A 4WCDA 2P91A 2VRCD 4E5NA 4R4JA 4RLSA 1GPJA 4ALMA 1Y6JA 3BHJA 1HYGA 3E8XA 1XWFA 4R5HA 3S2EA 3Q6IA 1PZGA 3W8EA 4BGIA 4DPKA 1DRVA 4XYEA 4R1UA 5F1PA 5B12A 4TQGA 2PD3A 1UDBA 1DB3A 3NT4A 4D0SA 1MXFA 3ORFA 1UXGA 3PWKA 2NQ8A 4JX8A 1NP3A 4BMNA 3OMLA 1LI4A 4XX0A 4DBVO 1T24A 4IXWA 2IYOA 5FEUA 4Q3DA 3D4OA 3DWFA 2WSBA 3RBZA 4KWIA 4DUPA 7ADHA 5ICSA 1WDMA 3KHUA 5COQA 1ZK1A 4L9RA 5G4KB 3ULKA 1P1HA 1WZIA 5L4LA 4PLYA 1EVJA 4B79A 3JQFC 2HRZA 2P9EA 3RFVA 5MGBA 4WLNA 2QYSA 4IJVA 1FDTA 1Z73A 4XRRA 2AQ8A 3C3XA 3V1UA 3PIIA 2WDZA 4KZPA 1PGNA 1W4ZA 2A4KA 3GC6A 3SLKA 1FDUA 4TZTA 1KETA 3DONA 2NVWA 3S2GA 4WCFB 3MJSA 1CRWG 3WSVA 4CLXA 3UCXA 4LK3A 2NTNA 1X7HA 4ALLA 2YQ5A 3C1AA 1V3VA 1YB4A 3C1TA 1U4SA 2POQX 1UAGA 3QVXA 4RQTA 5COBA 4FDAA 2EHDA 3BMOA 3ROQA 1C14A 4HBGA 2VHYA 4R1TA 4CM7A 3FR7A 3PDJA 1UH5A 1H93A 4E6PA 1VL6A 1XU9A 3CXRA 3MJTA 3OIGA 4NK5A 5JCJD 4NH4A 3Q2KA 3BMNB 3GT0A 3DAGA 3RD5A 1HSOA 2DBQA 1MLDA 2I3GA 1M75A 1HDYA 3MTJA 3M2PA 1YBVA 3Q2IA 4CLOA 4NBVA 3H9EO 3DZFA 3VPXA 4WJZA 1YS4A 5A9RA 3TWOA 3DBHB 4E31A 1ZEJA 2V6BA 2Q1UA 4AJIA 2Y67A 1I01A 4BNUA 3NGXA 2X7HA 5TGDA 3VPFA 4RL6A 3TZHA 3E5RA 3PYLA 4M8SA 2D5AA 4NFSA 1GV1A 2FPPA 3LZ6A 2WE8A 3O8QA 4W4TA 4A03A 4RZHA 4E2YA 5IDWA 1R66A 4CMGA 3LC7O 4M86A 1X1EA 1WW8A 2EKQA 1E5LA 1HRDA 3NT2A 1A4UA 4E13A 1K6IA 2ZCUA 1LBEA 3GN2A 3ZNPA 2YV1A 3ZWVA 1SPXA 3G0OA 3AM5A 3S55A 3WQSB 1E3WB 2OO5A 3KYDB 4OO3A 1OMOA 4IPTA 4GX1A 2EGGA 4DVJA 1GUZA 4IZHA 5A3VA 4CV0A 3DHEA 4ZQBA 3PQDA 4CM8B 3DR3A 4JJFA 1WMAA 4Z0TA 4EEXA 4FJ1A 2YV3A 4NFYA 3GAFA 2YFQA 1NFRA 2FP4A 2JD0A 3ETGA 3UAGA 1MG0A 2JCVA 5KTKA 1B8PA 2NTVA 4E33A 2P2SA 1DC4A 2CDBA 2DBRA 2O4UX 2AHRA 4NZ9A 5L9AA 4GX2A 3F4BA 4WGGA 4GWKA 4BNTA 4YVFA 3ROKA 3TQHA 1DFHA 2FZWA 4O6VA 1HTBA 3JQ9A 3HUDA 5CEJA 4NG5A 1XLTA 3AM3A 2EP7A 5JO0A 2Q50A 3OJEA 4GI2A 4PLHA 4BNZA 3GA0A 1VSVA 2V6GA 2NVUB 1NFQA 1ZK4A 5CHEA 3ZI0A 4U5QA 1LRLA 4EUEA 3GVHA 3LLVA 4BNGA 3RU7A 1B26A 2VCYA 1FXSA 4XQCA 3JQEA 2FPIA 3IDSA 5BSFA 5DP2A 4BNMA 5I8ZA 1NFFA 3I6IA 3PVZA 4KWHA 4KTVE 3OBBA 1IYZA 2VT2A 5JE8A 3LLSA 3GH3A 5DBGA 2CDAA 3FNGA 4M1QA 5G4LA 4CUKA 4D3DA 2C2YA 5JO9A 1HE3A 2YW9A 2I5PO 1BVUA 3QVOA 4LRSB 3QE3A 4PLWA 3DB2A 4KQXA 4NBUA 4NPCA 2GZ1A 5DCWA 2JHFA 3L0DA 1A4IA 2XPCA 4CQLA 1PZEA 4NMHA 1MG5A 1HWYA 4H7PA 3VZRA 1OOEA 3FTNA 3HADA 5EESA 3HN7A 1RM5A 2FSSA 1J0XO 4CL3A 1YQGA 3VTFA 3R3JA 4WEQA 1C0KA 5T8KC 1ISHA 3TFOA 3GY0A 3QVWA 4MP3A 4XQEA 1JDJA 5AQ1A 1JKFA 4MKRA 4L75A 3RSHA 2OUIA 1DJNA 1HE4A 1JA9A 2GDZA 2LDBA 1U3VA 3JQBA 5KWEA 1YOVA 5TQVA 1T4DA 4TKLA 4RVHA 5KCZA 1QP8A 4R1NA 1ORRA 1S6YA 2IODA 3O4RA 1D8AA 1PTJA 2VOEA 1E6UA 1YRLA 4FIZA 4CM4A 3ZV5A 3FNFA 3KSZO 5IN5A 4XGKA 3RC9A 1E1MA 1PGPA 4I5DA 3WFIA 4R68A 1PSDA 1J49A 2P4HX 4Z9YA 5K0ZA 1M6HA 3A14A 3KV3O 1LLQA 2A35A 1W73A 4IDCA 4FFLA 4TRNA 1ZZEA 3D3WA 1UZNA 3F4LA 2RH8A 3FNHA 2NU6A 1ZSYA 4DL9A 1BSVA 1U5CA 3PEFA 3D5QA 3PJFA 3GGGA 4RVFA 1ONOA 4FFOA 3NKLA 3RKUA 4R3NA 4JP2A 2C5AA 2E49A 2J5RA 1DLJA 1M2WA 2V6FA 3ZCXA 4WNIA 5B4VA 3GRKA 1CWUA 2NSDA 1P45A 4PG8A 5A05A 5F21A 5JC8A 4ZQEA 4Q3EA 1NTOA 3LT2A 4DIBA 1LQTA 2V65A 3WB9A 1YXMA 2BFMA 3AY7A 1UXHA 3DZHA 4WOKA 2GERA 3WG9A 4UUNA 1M76A 4OIMA 1MFPA 1Q0HA 1OZAA 5G0UA 2GGSA 2P9CA 2QW8A 4DIFA 3G1TA 1PIWA 5EINA 2CDCA 1PZFA 3B20A 4FFMA 3QW2A 1W6UA 3BA1A 1KBZA 3ANLA 3SXPA 1G0OA 1WVGA 5ER6A 1ZO8A 2IZZA 1JVBA 4P4NA 1Y8QA 3U5TA 3SX2A 3B70A 3FHLA 1PX0A 4FJ0A 3D5TA 4KMSA 2DC1A 1Z6ZA 2EIHA 4CMIA 3GEGA 1Y8RA 3GNSA 3GR6A 2Y1FA 4CL8A 2FR8A 3M1AA 4GSKA 5CFZA 3R6DA 1P33A 4YR9A 5CDUA 4BQPA 4AJKA 2Q45A 2Z5LA 1AN9A 4P8RA 4HP8A 2HK9A 2Y1CA 1I8TA 3DAFA 4BUCA 2GZ2A 4YWJA 4XA8A 3A28A 4F3YA 3IS3A 5KIAA 1ML3A 2JD2A 2HMSA 3P2OA 1ZW1A 4IJUA 5CAEA 3KB6A 5KKAA 1EUZA 3RUCA 4RGBA 3Q9UA 1AHIA 4UUPA 4GGPA 5TJHA 4BB5A 2X0JA 3I6QA 4PG4A 4W82A 3GVXA 3CSDA 4NHEA 4TVOA 1GEEA 4J2HA 4YRDA 4FCCA 2HKIA 3EK2A 3M6IA 3DOOA 3AK4A 4OJNA 5LC1A 5JMPA 3ONDA 4Q3NA 3IUPA 2YYYA 3OIDA 3GGOA 3TL2A 4XQ9A 3IKVA 4L4XA 3QQPA 2IEDA 3E03A 3BTOA 1HDXA 4CLDA 3U3XA 1LDMA 5LDGA 1VE9A 4W7IA 2ZTMA 4GMFA 1EDZA 1B7GO 1B15A 4QO7A 4D43A 4RJTA 5LDHA 1LQUA 1R0KA 4WLVA 3KXDA 3WR5A 1RYDA 2Z1NA 3K2BA 4W9NA 3UN1A 4BGUA 5IG2A 4ND1A 1Z7EA 2JL1A 4PG5A 1E7SA 1ISMA 1R37A 1ISJA 4K28A 1T2EA 2Q1SA 1A5ZA 4R3WA 5A3JA 2O3SA 2AMFA 3PWZA 3CH6A 2EJVA 1P31A 1U7HA 1PJ2A 2AEFA 5K6AA 2PKRA 4ZRMA 2VUSA 2OORA 5JBIA 2FSVA 2BFAA 4UVDA 3JQFA 3HG7A 4DWVA 4PLCA 2NUAA 3BMCA 3DTYA 2R6JA 2X0RA 3EAGA 1LDBA 5IDXA 4XDYA 1IZ0A 3JQAA 2GF2A 3R3SA 3FNEA 4XCVA 3PTZA 5JCXA 5TC4A 4BKRA 4BO9A 3JQCA 1VJ0A 3VVBA 3GEMA 5B4UA 1FJHA 3DZKA 4CLRB 1SEPA 1ZBQA 2AG8A 3ZNOA 4BKOA 1ZFNA 1H94A 5KJ6A 1BMDA 1V6AA 3OJLA 3MZ0A 1DFIA 4QX6A 3DBLA 2ZKLA 4CM1A 2E37A 5L40A 4G81A 3JQGA 4L73A 2Q46A 4TKMA 4CODB 4R16A 4ID9A 2PH5A 1SB8A 1HDGO 4UULA 5DZSA 1Z74A 2HQ1A 4PZEA 3RBXA 2ZIZA 1P1KA 3F1LA 3GG2A 4K9DA 2Z1MA 3PHGA 1E3JA 1DO8A 1WLYA 4BO7A 1YL6A 2I76A 2PZLA 3KOUA 2GO1A 4EUHA 3LC1O 4XQGA 3K9QO 3VH2A 1HYEA 3K8ZA 3DZIA 3PFWO 1ZKMA 4GX0A 4PLGA 1B8VA 3CEAA 3GN1A 4PIVA 4WLOA 3TL3A 4B4UA 3JQBC 3KUXA 3L07A 4A0SA 3UFXA 4HV4A 4YRAA 2Y0CA 1B8UA 2RBEA 4DMLA 2C59A 4DXHA 4PLPA 2FOIA 4OKNA 1KYQA 4E0BA 1PWXA 4MVJD 1VJTA 5A9SB 3PHHA 1EDOA 4R9SA 1DIHA 4ALIA 2UAGA 3U4CA 1PR3A 2ZK7A 1I2CA 4DTIA 3L6EA 3OEYA 3H6KA 4YRBA 1M6WA 2FR0A 2O2SA 3QV1A 1QRRA 3CMCO 4RCVA 5EQDA 4GX5A 4OHUA 1BG6A 3ZWBA 1LC3A 2CUKA 1Z45A 3JYPA 4LMPA 3BTUA 4YA6A 2VYNA 3TZQA 4DPMA 2GUGA 1QYCA 1Q2XA 1YH3A 3L6DA 3LF2A 5DN9A 4YB8A 2Q2VA 5IF3A 1IPEA 3MEQA 4L0QA 3SBOA 1N2SA 3K6JA 4OSPA 2PD4A 4BV9A 1JWBB 4Q9NA 3KTDA 2PGLA 2PR2A 1E3SA 1AXEA 4NJMB 4JBHA 3EY4A 1YL7A 3O9ZA 4BS9A 4FB5A 4N5LA 3LQFA 1PQUA 3GPDG 3DAPA 1BGVA 1I32A 1O9BA 4BL5A 5JPIA 4YJFB 2PWZA 3WQRA 3DC2A 2QHXA 4D41A 1HLPA 4OXYA 4R9RA 9LDTA 1XG5A 2BFOA 3HNPA 1OC2A 1RKXA 3MJEA 5EN4A 2GRAA 3KBOA 4GSLA 4C7JA 3UGKA 1CYDA 4DQXA 1HF3A 3O26A 5IXSA 1UAYA 4B8ZA 5HM8A 5T5QA 3QP9A 1R4NB 1EVYA 4DA9A 1L1FA 2JAHA 5JCJA 1NASA 2RH4A 1BW9B 3KSDO 3KO8A 3QWIA 5EQFA 2AQHA 2GYYA 3VZPA 1GEGA 4J3FA 1LNQA 3SEFA 5TS3A 3MJ4A 1Q0QA 3W4IA 1C1DA 4GLOA 3E5MA 3HDJA 3OQBA 5HWSA 5HRUA 4P4GA 1PJBA 3WGYA 5CEFA 5GZ6A 3FTPA 1GCOA 3PXXA 1MA0A 2XOXA 4XKJA 3WGOA 2X58A 1BXGB 3JQAD 1ZMOA 4MOWA 1UDCA 3JQ8A 3WNQA 1EQUA 4CM9A 5BSGA 5AXDA 4PN3A 1MXHA 1YE3A 4YJGB 3WGQA 1Y5RA 2ZYAA 4IY1A 2DUUA 3GVPA 3U4DA 4F6LA 2V7PA 3H65A 3NTRA 1IL0A 3GPIA 1T1RA 1F06A 2ZATA 3B1KA 3PLRA 5L53A 1NVGA 1N1EA 3K5PA 4XYLA 3VKVA 2X9VA 2V6MA 1NBOA 4OGWA 4II3A 3VC7A 3BMQB 1KOLA 1K3TA 4QEDA 1K2WA 4LVUA 5G0WA 3RFXA 3EVTA 5DP1A 1QV7A 4U0JA 1TLTA 4YT2A 1EVZA 1NQAO 4BO0A 3JQ7A 2YHUA 4NI5A 5GMOA 1LC0A 5T8KA 4BVAA 3O03A 4AFNA 5JAIA 1QLHA 2B69A 3A06A 4RLHA 1WDKA 4CMCA 2BRUA 1VJ1A 2PY6A 2I66A 3UKOA 2A9FA 4FFPA 2YHIB 1GCUA 5L7TA 1TB4A 1N9GB 3WQQA 3JYQA 4I9UA 1K5HA 1DDOA 3NUGA 1PWZA 3W8FA 3WOHA 2BMAA 3D4NA 2CF5A 4BNNA 3I9OA 5BT9A 1G0NA 3NEPX 3H9UA 1H5QA 4GVLA 4W9NC 3ZWWA 4B4VA 3D7LA 5KVSA 3PRJA 3CINA 2UUOA 3RWBA 3NYWA 4PZDA 1DSSG 5JLAA 3VPHA 1PS9A 5GZ1A 1JQBA 2FN7A 1C1XB 1DHTA 3GZNB 3HFGA 4AICA 3ON5A 3TRIA 4II2A 5U1PA 6ADHA 1DXYA 2NU8A 1HT0A 1GZ4A 2VYND 1NR1A 5G0TA 2YQ4A 5G0VA 1GDHA 2A92A 3Q11A 5K6AC 4YAEA 3ZU3A 5A5EA 2DAPA 1N8KA 4PLVA 1VKOA 5MDHA 3I9MA 4BIIA 3H5AA 4A2CA 3CTMA 3F5QA 3OJ0A 4MIOA 1QG6A 2H9IA 1T2FA 5HS6A 2VZ9A 4PG6A 4IDEA 2GNAA 4IM7A 2PGJA 4P22A 2OGUA 4WNCA 3H3FA 4OKIA 1P1JA 2CF6A 5KVQA 2BGLA 4J1SA 5JDCC 1X0XA 1UXKA 4ALJA 2X0NA 3PQEA 2BGKA 4QUKA 3V2HA 5JAMA 3PJDA 3ZHXA 1AGNA 4J16A 4EDFA 4JQCA 3BHIA 3JYLA 4D42A 4ZQFA 1YQXA 4F6CA 1RM0A 1LDEA 4KOAA 5L3ZA 5IN4A 1UR5A 3UCEA 2VN8A 5H82A 4E5PA 1GUYA 2NLOA 4ONEA 3S2FA 2HMWA 2X5OA 3E6AA 4WLUA 3KETA 2DTDA 4YDRA 2DM6A 1IE3A 1T2CA 4FQ8A 2VNAA 2VNSA 2ILTA 2ZTUA 3WLEA 4OXKA 4ZGWA 5KJCA 1S7CA 4BGVA 1R16A 3G79A 5EPOA 2ZQZA 1DOHA 1H2BA 5BNTA 1U8FO 1EE2A 1YDEA 4MO2A 1J6UA 5FYDA 5A9TA 5TSDA 1PJQA 4BO1A 1D7OA 3DBRB 2DFVA 5DBIA 2OZPA 4GMGA 3ABIA 4CM9D 5EL0A 3ZWNA 4KQWA 2GCGA 3QHAA 3QVSA 1D4FA 2Y1DA 1XGKA 2F1KA 3ONFA 2Q2QA 3JD3A 5IDYA 4J0EA 2E82A 1XQ6A 4D45A 3L4BC 1PL8A 5FFFA 4FFNA 5L4SA 4DBZA 3WYCA 1L7DA 1PJTA 1A71A 1LJ8A 5DOVA 1DEHA 1ZXLA 3ETEA 4E5YA 1X15A 4CMBA 1CQIA 1UP7A 4QO8A 2RIRA 2WD7A 4QFDA 2ET6A 4OAQA 4UREA 4XD2A 3WGTA 4DMMA 4XGIA 2I65A 3IP3A 2X5KO 3PPIA 4CQMA 2FWMX 1B3RA 2HLPA 1U2DA 4PLFA 5DNAA 1PR9A 4R54A 5AOVA 2UYYA 2DQ4A 2WEKA 1SEVA 1JAYA 1ZIDA 3GNTA 1ADCA 4Y67A 4CR6A 4D46A 4BV8A 4CV1A 2D1YA 5ITWA 4JBIA 4TROA 4I8XA 2WWRA 4BKPA 1GU7A 4X54A 5A4DA 2O3RA 2B5WA 3LF1A 3I4FA 3M1LA 5ER9A 3T4EA 2HO5A 1LUAA 3N7UA 2Y1OA 1QR6A 3KEQA 3WIDA 1MC5A 2Q4BA 3JQ6A 1WAMA 3MOGA 3NDIA 3U62A 3AUTA 3DBVO 3OETA 4N18A 1HETA 3KM0A 5L7YA 1QKIA 2GN9A 3ICCA 1U3WA 2EJWA 3VH4A 4CMHA 1R0SA 2P9GA 1XQ1A 4K1LA 4JCOA 3INTA 4E12A 1EVIA 4GVXA 3KZVA 4Z6KA 4DREA 1HEUA 3JD0A 4YAKA 2W2KA 4J4BA 3QY9A 8ADHA 3ROPA 1I5RA 5FI3A 3LYLA 1FDWA 2CVZA 2VHZA 3DOCA 2GD1O 2PLAA 4NQZA 5KVVA 3NDRA 5ENVA 3C8MA 3MWDB 2ZTLA 3D0OA 3KYCA 4Y6PA 1A72A 4RVDA 5L4NA 4MVJE 5JC1A 3I83A 1UXIA 3W8DA 2EKLA 3E82A 3L9WA 4LN1A 4DGSA 1BXZA 1PS0A 1NWCA 5JSFA 2X1HA 4E2XA 3H9GA 4TVBA 4IZIA 4TWRA 3RUEA 3E9MA 4W7HA 4QXMA 3BXXA 4WLEA 4FBGA 4AJPA 1SNYA 1XU7A 4ZICA 3ZWXA 4DQUA 2FHSA 3LT0A 3WDSA 4BO5A 4CJXA 1WDLA 3EZYA 2NU7A 4YPOA 3WX0A 2D2IA 2EV9A 3HN2A 1AHHA 1YJ8A 3A1NA 4AL4A 3ONEA 2O50A 3E9QA 3B1JA 2UV8A 3HDHA 4UVEA 4D3SA 2HSDA 1LSUA 4E30A 1U3TA 4BO8A 3HWRA 4AJ4A 3DZJA 4MVJP 1I2BA 2WE7A 3B1FA 3QWHA 4WPGA 5THQA 1NVTA 3WJ7A 5J23A 4WLFA 1O95A 5CPFA 1OC4A 5KNLA 1H6AA 1PGOA 5TT0A 4CUJA 3L9XA 3AU9A 2HU2A 3I1JA 1D1TA 4MVJM 2AQKA 3TNLA 4WUVA 3HDQA 3CKYA 1NQOA 5I9MA 2BFPA 3E1KA 1QSGA 2PV7A 4GAEA 3DEYX 3W6ZA 3LVFO 3AY6A 4WKGA 3DMYA 2WYUA 1XA0A 1XDWA 2HUNA 3GRPA 3L77A 5JNLA 1KY4A 2O7SA 3K73O 5G4KA 3PP8A 3ZWYA 3AI2A 2EP5A 5JYDA 4CQMD 3IJRA 3EYWA 3NTQA 1GTMA 2HK8A 1GQ2A 2PZMA 4O63O 3MOIA 2RAFA 4FJ2A 5A04A 2PKQO 1G6KA 1U28A 4LVCA 2C0CA 3I9KA 4OQZA 2GPTA 4IXTA 1FDSA 1Q7CA 4WCFA 3VDRA 3TF5A 3ZHYA 1PU2A 2NWQA 3WTCA 1ONPA 3EDMA 3PI7A 4YQZA 3COSA 4K26A 5B1YA 3OJFA 4RPLA 4G2NA 3EW7A 3K30A 3PGXA 4A73A 1BHSA 3NGLA 2WD8A 1T2AA 1HZJA 3A4VA 2ZCVA 1LTHR 3LSYA 3OECA 3PJGA 3FWNA 2Q49A 3Q1LA 4M54A 1AE1A 1LA2A 2Q4EA 1GYRA 3BMNA 1NPDA 1SMKA 3OICA 4EITA 4NDNE 3HQ4O 5CG2A 3VZQA 1EK6A 1A7KA 4FFRA 2WTBA 4IDBA 4Y6RA 5CDGA 2WYVA 2DTEA 2G76A 3C7CB 4YYZA 1BRMA 3GMDA 4CR8A 2YDXA 1GQQA 1OI7A 3KEOA 1CERA 4MDHA 4RF4A 3I52A 1DHRA 1BWSA 3WBBA 3DBHA 1VC2A 4RORA 3DQPA 1PJLA 1YVEI 2VTEA 3EVNA 4ND5A 2PFGA 3CMMA 3X2FA 1LDGA 1DIAA 2P5UA 4O5OA 4YJHB 5JDIA 4H15A 4ND3A 1I0ZA 1HL3A 1QYVA 4IDDA 4CUZA 3ITKA 2ZQYA 4GH5A 2D5CA 1LSJA 4J0FA 2B4QA 3UVEA 2C2XA 2CY0A 3GUYA 1E1LA 1NWHA 1NXQA 4PLZA 2BLLA 4MVJA 3W4KA 4AG3A 4EJ0A 4Q3AA 3IKTA 3U49A 5F1OA 4QSMA 4ND2A 2QX7A 4PVDA 2C29D 1E3WA 3KYDA 3INGA 4S1VA 3RUHA 5JY1A 4IDAA 3RU9A 4C4OA 1GYQA 3UH1A 1U2GA 2O3JA 1O0SA 2PA3A 1Y1PA 3N74A 4Y98A 2CMDA 1NHGA 2HAEA 3NJ8A 4GWGA 3BIOA 1WNTA 1KC1A 4CM8A 1IUKA 1DIGA 2ZB3A 5I7SA 3VDQA 2VZ0A 1KY5A 1D3AA 2O2YA 4UVGA 4AJ1A 1CQJA 2X22A 4XZ3A 2VZ8A 3RKRA 4EGFA 1I2ZA 2VUUA 5HS4A 2OXIA 5JYEA 3AUUA 4A7PA 1R4MB 3TSCA 5T57A 1ZVMA 2VWQA 5BSHA 1LEHA 4EI2A 2ZB8A 1T4BA 5DF1A 3DL2A 5KVCA 3OQ1A 4JN6B 1MP0A 3AI1A 4O1MA 3VKUA 3GLQA 1EBFA 3ZDFA 2J8ZA 2H1SA 4Z0PA 1WPQA 5BR7A 4PG7A 1EUCA 3ZWPA 4FOSA 4XYBA 1DJQA 4J1NA 2NVUA 2VHVA 2GZ3A 2PH3A 5FWNA 3TOZA 1PS8A 1N1GA 4MVJH 3WGIA 1H2HA 2YDYA 2DBVO 4EJMA 5EJ2A 1DIRA 4ITUA 1TI7A 1BDBA 3WMWA 3WJAA 4CLHA 5C7OO 1E7WA 3L6OO 3GMSA 3JD1A 5HA5A 2PKQP 2H5LA 1UXJA 2PK3A 4RF2A 3H4VA 3VHRA 4BO6A 4RF5A 1HDCA 3IQDB 3RQSA 1V3TA 4NU5A 1ADBA 1O6ZA 4PCVA 4RPKA 3IAHA 1N7HA 4BMSA 3UXYA 4IQGA 4BNLA 5CG1A 4NIMA 5C37A 2J3HA 3A9WA 3N58A 4XJTA 3F47A 4IQ8A 4AJOA 5JDCA 1MC4A 2JJYA 2NTJA 4BO2A 5L51A 1VKNA 4BNVA 1E7QA 2Y0EA 4TRMA 1NAHA 3QWFA 2BHLA 2YV2A 3KLPX 5AVOA 2RHRA 3WICA 3ZWCA 4Y8VA 3EMKA 3U0BA 3GDGA 5FI5A 3ASVA 1FF9A 1ARZA 1WZEA 4L4RA 2IYPA 1P1RA 1Z75A 3V5NA 4LRTB 5I8WA 1A7AA 4ALNA 4BHTA 2SCUA 2DU8A 3DTTA 4GGOA 1XHLA 2FZEA 4IS3A 2NM0A 1JVSA 2VTDA 3ZNQA 1W8DA 3WYEA 3KYBA 3GHHA 4CM5A 3GF4A 2B0JA 4TMFA 4ZQHA 3SVTA 4AJEA 4XR9A 4FC6A 3WGGA 4M55A 4D0RA 4J4HA 3FN4A 1J5PA 4RF3A 1VSUA 2EW2A 5HBRA 4RPJA 3SLGA 1SB9A 3H9JA 5U9CA 3QWBA 2Y93A 1HDZA 4YT5A 1LSOA 1IHXA 4RVUA 1UUFA 5KKCA 1C0PA 2VYVD 2BF7A 3DDNA 1E77A 1LLCA 3RI3A 2JKVA 3BMOB 3AJRA 4G65A 3L4BA 4GLLA 1FDVA 4DLBA 4E2WA 2PTGA 3GZ4A 2CVQA 4F46A 5JY6A 1LDNA 1M67A 2WMDA 1SCUA 5G0SA 2E48A 7MDHA 1DRUA 1Y9EA 2J5KA 3NTOA 1B14A 3RIHA 2EF1A 5BSEA 3PGJA 1YONA 3WFJA 5CDSA 2D4AA 3ZZNA 1NVMB 1IULA 3CZMA 3QJ5A 4FGSA 2R2GA 4H3VA 5B37A 4CLOB 4YAGA 3UW3A 3DXFA 3ASUA 3RC1A 4Y9DA 1WP4A 2NV6A 1Y7TA 4N5NA 3JD2A 4I9HA 4MVJG 3F6YA 3F1KA 3FWZA 4WCFC 1YDWA 2A94A 2PZJA 1I36A 2VHXA 4PLTA 4YAIA 1ISFA 2RCYA 1Y81A 2G5CA 1EBUA 1P77A 2OOSA 3O8QB 4IGEA 2QG4A 2QYTA 4ZHSA 2AG5A 3CUKA 1N92A 3U9LA 4E21A 1SC6A 2GLXA 3NDJA 2NACA 1VRWA 1DBVO 2W90A 1A9ZA 4WOJA 5B4TA 5T6BA 3SJUA 4EZBA 1GPDG 5BQFA 1B16A 4NK4A 3VVCA 4IUYA 1P0FA 3MWEB 1EK5A 1E3LA 5F5LA 4KUHA 4N5MA 2D8AA 2QZ9A 3PWSA 4ZU3A 5KJFA 4UAGA 2FPGA 1E0DA 3EGOA 2ZJ1A 3PJEA 1MFZA 1F14A 3JYNA 4I5GA 1BVRA 4ZVVA 4FD3A 4E2ZA 4LSMA 4XYGA 4ZQGA 5C7LO 4A5OA 2HJSA 2I3AA 1C0LA 1I24A 1IPFA 2J6IA 4J7XA 5JAQA 4B7CA 5JDIC 3WIEA 2DTXA 3AUSA 3FF4A 3IMFA 5DULA 1LSSA 2OBNA 1KERA 1UP6A 2Q99A 1I3KA 4MIEA 1DAPA 3ROMA 4BO3A 1RJWA 1JLLA 4NBRA 1ENOA 1PEDA 1X0VA 3G3EA 2ZYDA 3OQ6A 3ST7A 4BMVA 1T1SA 3AU8A 3P5SA 4HXYA 2YFHA 3WWZA 3DO5A 1RM3A 1Q7BA 1SO8A 1X7DA 3GVCA 4CV3A 4TSKA 1E7RA 3OM9A 3CPSA 4XYMA 5TF4A 1NNUA 3AOEC 2IXAA 2BKAA 4RPHA 2IEBA 3ZWMA 4J4TA 1VPDA 2P4QA 4XR4A 5L45A 3KLMX 2D0IA 3Q9NA 1TT5B 1C3VA 3QWAA 1ZK0A 1WXDA 2DPGA 2DFDA 2VWPA 4E32A 4MKXA 3GGPA 3HFSA 3NX4A 1H9AA 1B0AA 1X1TA 1OAAA 3TDKA 1SAYA 2AE2A 5GZ3A 4B8WA 1HSZA 4WEOA 1GY8A 4DPLA 1ID1A 4WECA 2GASA 3PDUA 2C07A 1NQTA 2C5EA 1ENYA 4Q39A 5I9NA 1E5QA 2BGMA 4XRGA 1U3UA 3OF2A 3KSUA 1CF2O 2NADA 2YY7A 4CQLB 4BNWA 5L95A 2IE0A 4Z3DA 4YXFA 5U4QA 5JAZA 5AYVA 2VRBA 5DT9A 3TZ6A 3V1TC 3ZWOA 1DRWA 1E6EA 2J3IA 2YZ7A 3F46A 5GY7A 2O3UA 3JSAA 3Q3CA 4PRKA 3JD4A 3V2GA 4EJ6A 4Z9FA 1NQ5A 1LRJA 2W8ZA 3R1IA 5T67A 3ZU4A 3OFSA 3LK7A 4BB6A 5I7EA 1YWGO 3AOGA 2I67A 4ZRNA 2NQTA 3VPSA 1O8CA 3OEWA 4DC1A 1XIVA 4J43A 4TRRA 2XXJA 2B37A 4URFA 1YOVB 2CFCA 4I5FA 4FS3A 3WLFA 1U7TA 1P74A 1TA4A 2FMUA 2J3JA 4CLRA 4CM4B 4J49A 4AJJA 2TMGA 1EFLA 1U1IA 1D1SA 2DKNA 4J91A 1GZ3A 4J6FA 3MCVA 4AJNA 4E3ZA 4HFNA 3U4IA 1YL5A 4KDFA 2VUTA 2Y1EA 2AQIA 2O3QA 3DFZA 3D3WB 4J7UA 1P1FA 4JLWA 3S2IA 3ZV3A 1H6BA 1QORA 2X86A 3S1LA 5CEEA 5IZCC 4J1QA 3RJ9A 4RDHA 1I3MA 2B36A 5A03A 4C7KA 3E48A 3C1OA 4YCAA 1CDOA 4IIVA 1JTVA 4ND4A 2Y0DA 1XR3A 1KVQA 3EUWA 3GUCA 3HDYA 4PZCA 1UZMA 3DMTC 1GZ6A 1E7YA 3VZSA 2TMDA 3FSRA 4B4WA 2BI8A 2C82A 4LCJA 3ITDA 5A9SA 1BTOA 5I9LA 2WJPA 3LDHA 3C85A 2H63A 2ZJ0A 3GK3A 4GPD1 1E3IA 2HK7A 3ZW9A 5JMWA 3LT4A 5COAA 3RBVA 1Y9AA 4UVHA 4CM3A 1A27A 1ZMTA 2XXBA 3JTMA 3OP4A 4YTEA 4KUGA 4XIYA 3ZU5A 2C54A 1FMCA 3AFNA 3E9NA 3G17A 1A9YA 3DOJA 4XB1A 5KJEA 1P1IA 4TRJA 3PYMA 3RUIA 4D7AA 1ZSVA 2AXQA 4N54A 4GKVA 1LLUA 1W0CA 3GDOA 1VLLA 3RUAA 1Y8QB 5JW6A 3ANMA 1KIFA 1Q7GA 2RHCA 4NJOA 2X8LA 1R15A 1OBFO 3PHIA 1R12A 5AXBA 4CMIB 4NJMA 1Y8RB 4U6SA 1ULUA 3FBTA 5C3MA 5H83A 1ZSNA 1YGYA 4YJFA 4RDIA 1E7MA 2QRKA 3SJ7A 3BHMA 1O89A 4EW6A 2YJZA 4OYRA 1R0LA 2CD9A 1Z82A 1T26A 4HX5A 5F5NA 3AI3A 2DLDA 2BELA 2NU9A 3HB5X 4U7WA 3IOYA 3STHA 3RCBA 3K92A 3H5RA 3UUWA 1R4NA 2BD0A 1V35A 1WMBA 1KEWA 1NX6A 1GYPA 4BNIA 4E5MA 2H6EA 2ZB7A 1BW9A 3I9NA 1BXKA 3W6UA 4AJLA 4UEJA 4ROSA 3PK0A 3LU1A 1CETA 3ADOA 1ONNA 1JKJA 4D44A 1GUFA 4I1IA 4G5HA 5L7WA 2HJRA 2GR9A 1V9LA 2Y68A 1QXSA 2HDHA 3FBGA 3Q0EA 3WS7A 1TXGA 3UOGA 1BXGA 3GHYA 4XEHA 1C0IA 3RC7A 2B35A 3M2TA 3VAZA 3VOSA 2J5QA 1DAOA 4YJGA 4F45A 4O59O 4UEOA 4LMRA 4L76A 3FD8A 3IL2A 4R01A 1GL3A 4NBTA 1KEVA 4PRLA 4EYEA 3VH1A 3NRCA 4FN4A 1YKFA 3WGHA 1U4OA 4GL4A 4RVGA 5DCYA 4QTZA 1YQDA 2VT3A 2D3TA 2Q3EA 2X6TA 3BMQA 4DYVA 4DQVA 2P68A 1KVRA 4I08A 1F17A 4FR5A 4B3IA 1V0JA 3QA9A 3AUAA 1AXGA 2CNBA 3BAZA 3LC2O 2X5JO 3W4JA 1EEHA 1K6JA 2DUWA 3U4HA 1NHWA 4JXKA 2O4CA 3BYZA 1PJ4A 4FC7A 1TT5A 4BNKA 2OFPA 3QSGA 4LSWA 1QLJA 2NVBA 1XSEA 4UUMA 2P5YA 2CZCA 2AW5A 1GD1O 2YHIA 1RYEA 3BMCB 2IZ0A 5T64A 1N9GA 2AEMA 2Q2WA 1XEAA 3GDFA 3JQDA 1QYDA 3PYXA 3JQAB 3QLJA 3H8VA 5HTOA 3RAJA 1H0KA 4JGBA 4CMEC 4XGNA 3DHYA 3K96A 3RC2A 1ADFA 3T7EA 4KDEA 4Q3BA 3F5SA 5H81A 1E6WA 4IQ0A 8LDHA 1IOLA 4A26A 5DBFA 3UF0A 4NR0A 2JAPA 1C1XA 1KVSA 3GZNA 1X14A 4B7XA 3PLNA 5I7VA 4MP8A 4XDZA 5ITVA 4LISA 3S8MA 3DBLB 5TJ9A 3L4SO 3VPGA 4OH1A 1EMDA 2W4QA 3INRA 2DT5A 3JQGB 3C24A 4IGFA 5BNIA 1RPNA 4L4SA 5CP8A 1HDOA 4HADA 1LRKA 2C7VA 1ISGA 4WK6A 4J9VA 3TN7A 2ZYGA 2R00C 5BNFA 2D59A 3WBFA 1QMGA 1H6DA 3X2EA 3PZRA 1SOWA 4I9NA 5ILOA 4EBFA 4AVYA 3H2SA 4RV9A 3AY3A 4NU6A 4YJDA 2EGHA 1SOVA 1OFGA 1I30A 1ZEMA 2IZ1A 2WYWA 5DCUA 3FR8A 4N7RA 2AA3A 3WWYA 1NAIA 1ZJZA 3F3SA 1UJMA 3F9IA 1E1NA 3UHAA 3SC4A 3D3EA 4BNFA 3ADPA 5TLSA 1B2LA 5FF9A 5ICMA 1QYXA 3MJVA 4HUJA 2XAAA 1DC6A 2EW8A 2QIOA 2OP1A 4AJ2A 4QT0A 5ADHA 2EERA 5DDIP 2O48X 3H2ZA 2Y1GA 3ZGYA 3FI9A 2F00A 3RVDA 5ILGA 1I10A 3EHEA 2B4RO 5ENDA 3ZWAA 5A1TA 1YJQA 1PJCA 3K2EA 3PZBA 4NBWA 3EC7A 2E4AA 3D64A 3FPLA 2OHXA 3AFMA 3GEDA 4JP3A 4KP7A 2B5VA 3GOHA 1IZ9A 3TPCA 3D4PA 4JROA 5TX7A 4OM8A 1K6XA 3OH8A 4FW8A 1UP4A 4RQUA 1DLIA 2O3TA 4U6QA 2O7QA 4ZD6A 2AE1A 3GG9A 1I33A 2G82A 2X23A 4IDFA 3DBRA 1P44A 2Q1TA 3WXBA 4LGVA 4UEKA 1DFGA 1CJCA 1E1KA 1F8FA 1Q1NA 1RM4A 1I3LA 2QRJA 1KEPA 3PQFA 3ZN2A 3RASA 4WASA 2AEJA
chains in the Genus database with same CATH superfamily
4JLKA 1HFKA 1OXBB 7REQB 1M1UA 4AM8A 2GN4A 4FE4A 3G7SA 5DSZA 3DEHA 4UQOA 2C7GA 5G3YA 2IPLA 3ZQJA 1GGKA 4JB2A 1FFHA 4X90A 4YJ3B 1BN6A 1GG2A 1GQYA 2AMLA 3FFAA 3VHQA 3BVPA 2VK1A 16PKA 1XVIA 2UDPA 3JYOA 3HXOA 5C1PA 2X14A 1MPTA 4YREA 3O38A 3BS4A 3HN6A 1K89A 4LWPA 3JCZA 4QNNA 4KYUA 3ZDYB 4R9UC 2B83A 4I1PA 4BNXA 4XJSA 1RI4A 1CJSA 1T1JA 4JWTA 4RFLA 3T4PA 1NYTA 4C4YA 4ZI2A 4IS2A 2GN8A 4NYIQ 4MJLA 4IXMA 2UXCB 4P98A 2BZ1A 1ORIA 2CBZA 3CF2A 3T4XA 1RE1A 4MQLA 5A02A 1R9GA 3MC1A 2GQ0A 2OB2A 2ZBFA 2Q7OE 3FIJA 1M8JA 3GI1A 3TQSA 4AKGA 3D7RA 1DRJA 4HCJA 4IIJF 3NVDA 3ZJUA 1C2YA 1HA3A 1XVVA 3GD7A 5ALRA 2PO5A 1EFCA 2A4MA 1WO8A 3IBSA 4R5MA 4WKCA 5H3HA 4MR7B 4CN9A 1T2DA 3H11A 3IC5A 5ARDA 1UMBB 1B3BA 2OHVA 2ONZA 5M34A 2OZVA 3X3HA 1DQSA 2AHOA 2QRMA 2YQZA 2RGNC 2QRHA 3LUAA 2ZJFA 3ZZTA 2XWBF 4NU8X 1XRMA 2WZQA 5HZMA 5ICCA 2G17A 1ZCJA 4W9MC 3IUSA 1WB6A 3QLEA 1O9GA 1EK0A 2JGEA 3BWDD 5CUQA 3VI3B 2EKPA 3PNMA 5JNUA 2J7KA 4B6RA 3ET4A 1QK5A 4RHTA 1VRVA 2PSHA 2VHWA 5AI8A 2VOJA 4RH0A 3D6MA 2P1ZA 3BRWA 3HA3A 3MWKA 3M34A 2F43B 2JVIA 3I9LA 5E3HA 4IJ5A 4DYHA 3JATA 5CPBA 1QS0B 3UICA 3CNQS 3GQBB 2I0FA 3WSWA 4NY1A 3OPNA 3QRWA 5EWMA 5C81A 3EF1A 4NFHA 2G70A 5IVIA 5T41A 3S99A 3WRYC 3RK0A 4O4HB 1VJGA 1YBAA 2IXEA 2A30A 1EU1A 3MWDA 3EZLA 1OILA 4QZVA 1TVEA 3FYUC 4C05A 5L3RA 3H5OA 4V3BA 1LDYA 5EC8A 2Q3BA 2NP6A 4CW7A 3IQEA 1WOYA 2QI9F 2XUJA 1B8OA 3G5MA 3TW4A 2O06A 3BORA 4YMUA 4NOMA 3OQOA 2Z4SA 3NHZA 1ZOLA 3BFXA 4FHDA 2OD9A 3SE7A 3WLPA 3W5SA 3I9JA 2FSGA 1AX9A 4FNAA 4CN8A 5HGXA 2J3EA 1OZ0A 4G5OA 1E4EB 2WT4A 3QE0A 3R41A 1IMJA 1ACLA 2ODPA 3FZQA 3LUJA 5ECGC 2R3SA 3K31A 1A97A 2WZBA 4GMDA 1SXHA 5EIAA 3WJ1A 2J4FA 3ANNA 1CCWA 2R7KA 4BZZA 2Q1YA 4HNHA 2X42A 1LX6A 2JPDA 2C97A 3PKJA 2V7GA 3FCUB 1L7EA 1NNSA 1U0EA 1T9BA 3SM3A 5ALSA 1FLDA 1MW8X 3KEFA 3H5NA 1B43A 4D57A 2Q8QA 5EFOA 5KSZA 3IVGA 2QLTA 4DJAA 5A06A 3OQPA 3ESAA 5EHZA 3OEHA 4MWOA 2GN6A 4ZI7A 1IEVA 3IA7A 2QL6A 4H7IA 5IZCA 1XEXA 2JD1A 4BQEA 5A62A 3IOEA 1DX9A 4CM6A 1DG9A 3WLNA 3O3NB 5DNEA 1TYBE 4X20B 5REQB 4QFMA 3NCTA 4PBSA 1DJOA 4CCWA 5KOHB 1P9LA 1S3FA 3DOEA 3QIVA 3H2KA 1WCIA 3ACCA 4Z9XA 5EUCA 1Y3DE 1CIVA 1JR4A 2VSFA 3EXEB 3DTNA 3E23A 1DUIA 2O1WA 3WLKX 1T5LA 5EZSA 4X1YB 5KX5B 1W0JA 2J3KA 4YACA 4JNKA 1AU9A 3CZRA 3FAKA 3GNQA 4C01A 2HYIC 1MB4A 1E2HA 2DQZA 3STWA 5ICGA 3AIIA 2E6UX 3PIRA 1EHIA 5T4BA 3VH3A 1ND6A 1ZMXA 3EGVA 5JZ9A 5KU1A 2OXCA 4JSTA 4QPZA 4RDCA 5I7FA 3EXFA 3OMXA 4WADA 5DNWA 3GT7A 2WIBA 4XH9B 3AG6A 4E5SA 2H29A 1KI8A 2W2LA 1I7NA 3UA3A 3W2FA 2PG3A 1SIBE 4KQCA 5H70A 1NDHA 1KMNA 1U8CB 2FPWA 2HBQA 2FLKA 3FPJA 3OA0A 1TK9A 5KHAA 5DN6D 2WIFA 5CX1B 3HHEA 2Z30A 3UPDA 2XTMA 2M6LA 5JALA 1FXUA 4FPXA 4QNMA 3RAEC 4BNHA 1B76A 1F1JA 1PQPA 3C39A 1UBNA 3GUUA 2C7BA 3GVIA 3HJAA 3RS5A 3THOA 2ZTVA 3UG6A 1P7YA 3LL7A 4QOGA 1NQWA 3FLAA 3UMJA 1WWKA 3RUDA 1CLUA 4RKQA 3UGQA 3RRBA 3WHKA 3DCIA 2VI5A 2PXXA 4F9GA 1RWBA 2IPMA 4MGYR 3RRMA 2REOA 3V4SA 1ZCBA 3ROGA 3WIUA 3KVVA 2G9UA 1YZGA 2O2IA 3MMXA 2AFHE 3I6YA 1DAIA 1HE2A 3ILVA 3AR2A 2D2XA 4B7UA 4IMPA 1Y8CA 4RZSA 1T25A 1B0ZA 4XCXA 1PL0A 3DDHA 4JX9A 1IQUA 1VPVA 2HEGA 2YOFA 4OH7A 4QECA 3VBCA 1QV6A 5AM3A 1G5IA 1SCQA 2Z95A 3JV7A 4WN9B 4RHXA 2FN8A 3ZD9A 4G0VA 5A0FA 3SS7X 2IY8A 5LOVF 3I37X 3OF3A 1XQYA 2BTEA 1NLZA 1JBKA 3IELA 4CV2A 3B53X 1MB0A 3PDIA 3F6CA 1JJVA 1CEXA 3O1HB 3TJRA 1Z0IA 1EUDA 2BH2A 5FV4A 1G7SA 2ZJAA 1K5DA 1HEIA 1R6DA 4B6SA 3EODA 3BRWD 4URXR 2OL4A 3D81A 1P3DA 1O5IA 3TTSA 2B7CA 3DHVA 3P0FA 1G2PA 1L5WA 4OXNA 2LUOA 3WRVA 1G5RA 4JKYA 5EGNA 1Z5GA 4KWTA 3ZH2A 3D1LA 1KC3A 3LWDA 3V9PA 1PW5A 4LS3A 4B3XA 3EZXA 5CHYA 1QYWA 1L5HA 1ORTA 4U8GA 4XWGA 4LYFA 2R97A 2JHGA 4B4OA 2ZM6B 2XECA 4CTMA 1CR2A 1FU8A 3OHSX 2RMKA 4G4SO 3TVYA 1U2PA 3M4NA 3H7AA 3PUVA 1BHO1 4QFCA 5A5FA 4QBTA 4Y2UA 5EMLA 4UQLA 4DLPA 1SA0A 1Z88A 2X0IA 1OLSA 1XNRB 1TZBA 1Q3HA 3MWGA 2B4AA 4PYQA 4L74A 3DZCA 1YA4A 3LBYA 4JC5A 3WDLA 5IKXA 1YC5A 2KX7A 3D54D 3OJXA 1H9BA 3U7RA 1WF3A 3I01A 2IDKA 3WK6A 5BV7A 1HK7A 2VLBA 1IM2A 2KSQA 3HHPA 1J8FA 3HXTA 4JBNA 5FOUA 5B1HA 5SYNA 2X4GA 1SQFA 2J9ZB 3ZY6A 2YV5A 2XQVA 3MTGA 2BI7A 4J1TA 2GILA 1WMSA 1VXOA 4BASA 1X1BA 1Z4LA 3JVVA 5IT5A 4A2WA 4MICA 1Y5NA 1LTQA 1MO4A 3LXMA 2CSXA 1H65A 1V8BA 3HY3A 1U7ZA 4GKAA 1HKUA 1UOEA 3ENKA 4O0LA 5HTKA 3C87A 4P34A 4CLEA 3U09A 2VCHA 1TW3A 3ED1A 2G4VA 3HCPA 2A33A 1NT2A 2PZEA 2XKAA 4X1KA 5THKA 1UBFA 1APBA 3M33A 2FR8C 2RHTA 1P2SA 5TT1A 2MCFA 1VLQA 3LT1A 4MARA 4BRZA 1DX6A 3LX5A 1ADGA 5DISB 4B44A 2XOEA 1RZRD 2H2DA 1RWOA 1NG1A 2UVDA 1J22A 1XOIA 4KOEC 2XXAB 2FPIB 3V2UA 2C3OA 1JU4A 1PZXA 5ESRA 4ZQIA 1L5QA 2GEJA 2FYTA 4ADSG 3GJ3A 4YY3B 4IH1A 2CE7A 5C4MA 5FV7A 1W4RA 3FRIA 3RROA 4I8DA 3OLYA 1IZZA 4ZZ2A 4D9MA 1D6SA 3O21A 4M49A 3K53A 3A0UA 3OJOA 4V0NA 4ZYWA 3PNQA 4LECA 3O84A 4MMYB 1F12A 1XRLA 4UFNA 3GLHA 4L27A 2PUBA 5CDTA 1TTPB 1XROA 4U7HA 1N5RA 4P0PB 2A9VA 1PJ3A 4UBLA 1ZICA 2W2LD 2XA9A 3FYDA 3BD8A 4NICA 4W9RA 5JXWA 4RD3A 5ECDA 4Z3KA 3LA6A 1FJGB 1TEHA 4WKOA 1R6XA 3OCJA 3VXKA 1BFUA 5EXTA 4QU0A 1VMDA 2XV1A 4DOMA 1NBMA 4M9ZA 5JD4A 4OI1A 4FE3A 5DNUA 3V8QA 3FOFC 3ZHZA 1JW9B 3TFQA 1G60A 1IQ0A 2XRFA 4DWJA 4Z4HA 1O94A 1JHPA 1V25A 1ZONA 4YAOA 4OX9B 3C3AA 3GMIA 1GSIA 3DHNA 1Z07A 4RKFA 3HM2A 5EY5B 1QK3A 4WCDA 1D2AA 5JISA 1P4HA 1XAIA 3A9TA 3ZV7A 3L4EA 3KUKA 4YBRA 4IG9A 4ALMA 3DMFA 2QTLA 2YWGA 2Z04A 3WRWA 4M99A 3WADA 1XWFA 3QUQA 1GA4A 3JRXA 2QD4A 3Q6IA 3D8RA 2CJWB 3N0TA 4FEGA 4QXRA 3DXXA 4WZ6A 4XYEA 2Q07A 1KBOA 2ZSEA 4R1MA 1NP3A 1IAQA 3OMLA 4O1IA 4XX0A 5LB2A 2BCEA 4WK4B 1T24A 4IXWA 4URYR 2IYOA 4Q3DA 3ZWQA 2WSBA 4KWIA 4C2TA 4LIPD 1B23P 1U3CA 5COQA 3KHUA 4Q4DA 3N2NA 1PSZA 2JLCA 2HT1A 2ZSHA 3OMWA 4U9UA 1USIA 2QU7A 4U5XA 3DA8A 4YRZA 1TO1E 5FBRB 2HRZA 1M1YB 1V6CA 3AYXB 3KFVA 1ZJ4A 5CCDA 3T4UA 4WLNA 3KPJA 4IJVA 1AZWA 3IRVA 1FDTA 3V1UA 2AQ8A 3C3XA 3PVCA 2VUHB 4KZPA 2W11A 3R5SA 3VNVA 3C1UA 4EO9A 2H92A 2PMCA 1P61B 2PFKA 4B2LA 2NVWA 2ZYUX 4WCFB 2X76A 2ZRIA 1CRWG 3AUXA 3EIUA 2C58A 2NTNA 4EWLA 4JENA 2YQ5A 1QRUA 3C1AA 1V3VA 2A3RA 3QPDA 1RRKA 1YB4A 2RGXA 3V3KA 4U8HA 3TR6A 3BB1A 4JBYA 1ZDMA 1E1RA 5CNKA 2VP6A 1ATIA 2EL9A 2FEKA 2EHDA 2HNKA 3FNBA 4KO3S 1C14A 1NW6A 1QDUA 3A2LA 2PVPA 3FR7A 3IPRA 4REQA 1GDDA 1H93A 1VRCA 3O2JA 4IHAA 3RVLA 3OIGA 5JQWA 2FE1A 4WT7A 4NH4A 1NOJA 3BMNB 2PU5A 2YWXA 3BF8A 3G2MA 5AMXA 3TZBA 3RO7A 3I2FA 2DBQA 5K0NA 1MLDA 1U8AA 1MJNA 1JPJA 3OZRA 4G0XA 1KTIA 1ZNZA 1MNQA 5IBQA 3M2PA 1YBVA 3Q2IA 2RHLA 4WTOA 2AIRA 2H2AA 4ETNA 5H9WA 2E55A 2Z2YA 3MBIA 3H9EO 3DZFA 3V4LA 3VPXA 5SYAA 3UH0A 5JAPA 3H2HA 2RGEA 1JP7A 5A9RA 3CCFA 3TWOA 4J0DA 3AERA 1ZEJA 2VXBA 2QLNA 5EPUA 1WXGA 2ZT5A 3ZVRA 2Y67A 1UPCA 2Q5HA 4BNUA 5C8YB 3NGXA 1SGWA 3M5DA 5FA8A 2X7HA 4R84A 1VE1A 5TGDA 3H2BA 3T94A 4CZ2A 2XWQA 3E5RA 3FB1A 5L3SA 4FFVA 2D5AA 4E1VA 1PQ4A 2BFBA 2WP0A 4IHKA 1IDN1 1GV1A 3O8QA 1AB5A 4LRUA 1NVDA 5IDWA 3HU2A 1V7QA 1GCIA 4I5IA 2QN7A 1R66A 4RZHA 4KVFA 4D9HA 4E2YA 1L2TA 1ZHFA 5ETJA 4DIMA 4L2IB 2EKQA 2H4JA 3O8BA 5EWJB 4IQFA 4XW2A 2G7ZA 5CFPA 3H42B 2ZCUA 2C5BA 5LFAA 2Z43A 1CY6A 2OECA 3ZWVA 3R6WA 2MU1A 3KU4A 4H35A 3S55A 3RS3A 4EKGA 1YA6A 1E3WB 1WV0A 2YXDA 4ARVA 1OMOA 3MPUA 2AMVA 1CUBA 1IRIA 4MV6A 2W2NA 3EA0A 3TOVA 3EISA 1GNSA 2FFAA 3ZHRA 1R0YA 1QRAA 2Y9PB 4E5YA 5AM2A 2X40A 1F6BA 3AFIA 3AV0B 2B99A 1EFVB 2A0YA 4CM8B 1NBMD 1Z2PX 3HVHA 3EEOA 4HLUA 3OWXA 3K0AB 5K3FB 4REOA 4PSAA 3GAFA 5B1EA 4WUTA 2FP4A 2XYQA 4HNQA 4C89A 1JDNA 2FX5A 2JCVA 3KLBA 5IYZB 1B8PA 1SHJA 4D0GA 4NV3A 3LOPA 4NZ9A 2O4UX 4GX2A 1LF5A 4GUAA 5D5HA 4WGGA 3HVKA 4Y3UA 3TW8B 4BAUA 2JLZA 1XO1A 3TQHA 2W8BA 2FZWA 2FFJA 2XAUA 3ECCA 4O6VA 4KLNA 4Z7JA 3HJHA 1K86A 3ISTA 2AW3A 3HUDA 3EQ6A 2V54A 3OOHA 3SDZA 4DQLA 3AM3A 3VDMA 3COWA 4UHHA 1VE5A 4PHTA 4GI2A 2VH1A 5B3JA 3OOJA 4NYJR 2XZPA 3ZHCA 2BJWA 3GA0A 2AG1A 1OH6A 5DM0A 3CRQA 3E0XA 1P4GA 1NVWQ 5A3QA 3GLTA 2YYAA 3E3AA 2QUBA 3QBTA 4EAQA 3LLVA 2NZYA 2YW2A 4GLBA 2RB5A 1B26A 3RU7A 1N78A 3MFYA 5JECA 2VCYA 1I7LA 1S8NA 1COWA 4JQOA 3R8XA 4XQCA 5BUZA 1CNMA 3E3LA 5BSFA 3A1CA 4DEYA 3LKBA 3FWYA 5E1BA 1NX9A 3HA5A 3I6IA 1D5WA 1SC4A 1VG8A 4KTVE 1BS2A 1Y1QA 3SJBA 1T9HA 3LLSA 1XNGA 4FOPA 4EY8A 5FYQA 1J8QA 4FKMA 5K5EA 2BY4A 1PF7E 4EG5A 1U0HC 1QZ3A 2I4MA 2XRZA 3T1VA 2V4MA 4EQ6A 1DKRA 2VPIA 2WFMA 3Q10A 3TX2A 2C2YA 1CE8B 1ZGJA 1T5TA 2B21A 4LYAA 2ZBGA 1SU8A 3QHPA 1HE3A 2YW9A 4EECA 1BVUA 1KQPA 1OLXB 3T3MB 4RTOA 2VXOA 5JOQA 3QE3A 4PLWA 9ATCA 3R9WA 4NBUA 2HLDA 5DM60 4KN8A 4Z4CA 3O9MA 2HU7A 3QH4A 4HNSA 4WZAB 2GJ9A 2GO7A 4LWOA 1G9SA 2YJTD 4NMHA 4WSOA 4BX9A 4DC0A 3J7TA 4JP8A 4XOUA 4H7PA 3VZRA 2MSKA 5HZHA 3FTNA 3HADA 4XLTA 1QVRA 1NUQA 1KMIY 5F64A 5KC8A 4QOFA 4AMZA 1RM5A 4WL0A 3BCSA 1FJ2A 1J0XO 4CL3A 1IQPA 4XSGA 2ORWA 1NJ2A 2YL2A 5EIFA 1G9TA 3H9CA 1C0KA 3A10A 1ISHA 4LYDA 4HB3A 2YYZA 3GJ0A 3QVWA 4XQEA 3U3ZA 1JDJA 2SCUB 2XR1A 1OLUA 5AQ1A 3IEMA 1FFWA 5FPHA 1A8PA 1ILEA 4OHBA 4IX1A 2XADA 4ZRDA 1DJNA 2OLJA 1Q6ZA 2LDBA 1F3LA 3JQBA 1GRVA 1JNYA 1YOVA 3IDOA 3M0EA 4TLMB 2ZYTX 1T29A 3O1LA 3UGTA 3W6OA 4HZUA 4Y6GB 1CRLA 2BEVB 2KYRA 1J56A 5T4HA 1GM5A 3ZD7A 2OQ2A 5AW4A 2VAXA 1PTJA 4TLBA 4CM4A 1A88A 5UKDA 4Z1OA 1PGPA 4I5DA 4KAAA 2WB4A 1G17A 4HQFA 3TFWA 2RONA 2I4IA 3L41A 2PX4A 3A9SA 1PWEA 3C14C 2CFOA 1WPGA 2Q0SA 2P4HX 3K09A 3D43A 4BLVA 5K0ZA 4YMGA 5F5XA 3H99A 2A35A 4IDCA 4CMEC 4FFLA 3U26A 4YRMA 4XIGS 2A9QA 4KREA 2DPLA 1E94E 1QQ7A 3DMDA 3STXA 1E9DA 2I62A 1BSVA 1U5CA 2DWCA 4QWMA 2LRHA 5CK4A 1SCUB 1VIYA 3CUEF 3I0MA 5LNK6 1RIIA 2XLCA 3CKMA 4RABA 1ONOA 1U0RA 5A7HA 2IL1A 2HTFA 1DLJA 3AUYA 1FFYA 3TX6A 4F04A 4IGIA 2JC3A 1ZOSA 4C6TB 3GP8A 2I3DA 5J4HA 1ONBA 4G01B 3CYFA 3GRKA 4WNIA 5E3JA 4HRAA 3U39A 1P45A 4RWEA 1B6GA 1PQYA 4ZVLA 3CRZA 4E1AA 4F84A 3UJNA 4JOBA 1FIUA 4TSFA 1LQTA 3NBAA 2V65A 1DCKA 4BMCA 3M3DA 4ZC1A 2ZJOA 2CGEA 5K1ZA 3E2IA 2GERA 1YQEA 3NHKA 3NUZA 4NYJQ 3ZEIA 3UAZA 1QHYA 4K6OA 1Q95A 1QLWA 2JJ1D 4Q4JB 5TPZA 1YMVA 2GJ8A 1CUJA 1Q0HA 4DF3A 2BV3A 2V7UA 3RTEA 3PX7A 4DLXA 2QW8A 1V8OA 1VGRA 3LPMA 5AFSA 1Y33E 2QF7A 4OHRA 1H05A 4MQUA 3O74A 1WS6A 3AETA 5KSPA 2A0WA 2GVDC 1POXA 4TS3A 5IP5A 1XKTA 4ZIRA 1Z2DA 3B20A 3NHLA 4FFMA 4HC4A 2AN4A 1J99A 1QH0A 1USWA 4CF4A 4CFYA 1WY5A 4MW5A 1W6UA 5C46F 2ZUBA 4U7JA 2B8WA 3SZMA 2WUWE 5BW4A 3ANLA 3DAOA 3UT0A 3Q40A 4DCVA 5LZ9A 3H1EA 4X45A 2IZZA 5DV9A 4C7OA 1Y8QA 2ZWVA 3EIWA 4MYCA 1DZIA 2HXSA 1G41A 2HPAA 3SX2A 3U5TA 3FMVA 3QKWA 1O3YA 4R2KA 3FPBA 1PX0A 3D5TA 1BQEA 1UM9A 3E9ZA 1JF8A 4LRQA 4NEHB 3U7QB 2EIHA 4MX8A 4ZAXA 5CA0F 4K46A 3GNSA 5LN1A 1E9FA 2NO9A 2Y1FA 4LC0A 3DW3X 3MT9A 4GSKA 3P27A 2ONJA 5CFZA 3SR3A 1CTQA 5CDUA 3FUTA 2Q45A 5KTNA 2PEYA 4P8RA 3K0SA 2HK9A 1HNZB 1AURA 3DAFA 1UFKA 2BZ0A 4ETIA 1MEJA 1MJ5A 2QLFA 3ZCTA 5KNCA 1HURA 1ML3A 2JD2A 2HMSA 5LP6F 1G1MA 4IJUA 1LNSA 3CEMA 2XD9A 2I2CA 2LCQA 1KMHA 3KB6A 3SXUB 1NURA 3UMBA 3IB6A 1H3FA 4RGBA 1Z0KA 1C30B 4WGFA 3IO3A 1WBDA 4IJ6A 3UM9A 2Q6OA 1W2HA 1WPXA 2E7ZA 2ASEA 3AHJA 3I6QA 1TRKA 4NPHA 3CVUA 3CSDA 1M34B 3M9XA 4H4DA 2NX2A 1I94B 1JQKA 1U2DC 1Z15A 2HKIA 4C4RA 5JANA 1EVKA 2WMNB 3DOOA 1C1YA 3G5UA 2JHAA 2ZJ6A 1WOMA 3O3MB 5LC1A 5A5DA 1RNLA 2I2WA 5JMPA 5B7QA 1N6NA 1X1CA 3IUPA 5MHTA 1DTWA 4UCXA 4LTNA 1QTIA 2DXIA 2QAGB 3OIDA 3LOQA 3MIIA 2OKGA 2AL7A 4P2BA 5KWSA 2IYNA 1TJPB 4YRFA 1VKHA 3VO8A 2O52A 3E03A 3LUGA 5CD9A 3GLGB 4P3NA 1L7AA 3K1YA 3TRKA 1IZ7A 1YHZA 2EQAA 2YCBA 1B7GO 2ZR8A 4QO7A 1ODCA 1OAOA 2PYDA 1LQUA 2HA6A 3BIXA 4GZMA 5JVDB 3KXDA 2V7BA 5LDHA 5TEVA 2BP7A 3U7FB 3LUBA 1I2MA 3K2BA 2PSFA 1T1GA 3F2IA 4H0NA 4C03A 1S3IA 3LVQE 5DYWA 3EWSA 1T91A 3UUGA 1XN1A 2ZETA 2OHHA 5AJVB 1VE7A 2IV7A 1WKCA 2VJBA 4C88A 2CL7X 1Z16A 2O8CA 3P9ZA 2C2WA 4M36A 1XLTC 4MKGA 4BFCA 2QOEA 4MUNA 4U7TB 4ZC8A 1GPBA 3IMKA 1XE3A 3NWPA 2PX2A 1QU2A 1T2EA 5KYWB 1BO6A 2GAFA 3RVPA 4CEIB 1CW2B 1JAZA 4R3WA 4TMXA 2W70A 5A3JA 4JITA 2EJVA 1P31A 3O8NA 3DYBA 3ZDCA 5CA1B 1SKAA 3QLVC 3TTUA 3R09A 4ZRMA 5AVTA 1L4NA 2FSVA 1Z28A 3JQFA 3HG7A 4FCVA 4QDOA 3R3WA 4JUAA 4PCAA 4Q4HB 3BMCA 2OZLA 3I8OA 1XYYA 2C9OA 3EAGA 4RULA 1QIFA 1UDRA 5BQXA 2WHYA 1XVTA 4FHZA 4KITB 2RI1A 5K7SA 3SKYA 5IDXA 4IIBA 4XDYA 2AF3C 3UBTA 2GF2A 2FNAA 1NZJA 2VDPB 1U1EA 2ZS7A 3WKBA 2B8EA 1WE2A 1GZUA 2QR2A 1IZYA 4GMHA 2PRKA 2XNSA 3JQCA 3DOHA 3VVBA 4EA9A 1ORWA 4JU8A 3VHLB 4IOKA 1SCAA 3IQZA 2VP2A 3MW8A 4B2IA 3MAGA 1H94A 1LJUA 3PQ7A 2G1PA 3EVAA 2WB2A 4Q9HA 1T4CA 2JJQA 3JX9A 1DFIA 3UNXA 1DJMA 1FVXA 1IBKB 1DC7A 3KAKA 2IU4A 2I3BA 1TMGE 1ZX1A 2QORA 4G81A 1GTSA 3JQGA 4OREX 2Q46A 4KXVA 4TKMA 5A71A 4EW1A 5LXTF 4ID9A 2PH5A 3L7AA 4IYJA 2ZXEA 3FUUA 3GG2A 3F1LA 2WWIA 1XZPA 2Z1MA 1E3JA 1VE6A 3KDSE 2PSJA 4IV5A 1DO8A 1WLYA 4G0NA 1YF3A 1YL6A 3BE4A 4WCVA 2PZLA 3KOUA 4FZ3A 3FIUA 5LZ5A 2OY0A 4BVBA 2RH5A 3IKJA 1K8QA 3LC1O 4LDRA 3H83A 4Y2VA 2D7DA 3KJIA 4PLGA 2RJ3A 2FPMA 2AN1A 3GN1A 2ZM5A 4IEFB 3E9EA 3NH9A 4B4UA 4DM3A 4G9GA 4IMIB 4ZT2A 2XCOA 3UMMA 1N2EA 3CVVA 1PE0A 4Q16A 4HV4A 1UMDA 3L07A 3UFXA 4A0SA 4DMLA 2ZBVA 3QQ5A 2GM5A 1FX1A 1KYQA 1DAKA 1U7WA 3CY6A 3MG9A 3NHBA 3NM5A 3OD5A 1E1QD 4MVJD 4QDJA 4R9SA 5A9SB 2C5GA 1TTQB 3CH4B 3OD1A 4FGZA 2YWHA 5KTRA 4BEVA 2CWDA 4ESHA 1UT8A 4M38A 5KPDA 1PR3A 1L1RA 2ZK7A 4LHXA 4DTIA 1Y1KE 2XUPA 1J42A 2F4NA 3LAWA 4HH3C 4PGGA 3K4HA 2PT7A 1BX3A 1QRRA 2JCGA 1XEWY 3CMCO 3F74A 2H08A 3FRHA 4WFQA 5KDDA 1ZNWA 1O54A 3WB1A 5CLGA 1J2UA 2ZJ3A 3F8TA 2X5XA 1AGYA 1BG6A 1TAHA 2FTKE 2V5AA 3HY6A 4HDMB 4LMPA 3BTUA 3R3UA 4X6UA 3TZQA 4O2RA 1QYCA 1A4XA 3L6DA 1FTWA 2HDOA 3A4NA 1T4MA 2N0SA 1J23A 3NEYA 5DN9A 5K3CA 4ITVA 4AWAA 1WUIS 1FU7A 3PQ5A 4AMYA 4BQIA 3HKBB 4TYQA 1IPEA 3MEQA 4KLAA 3BFJA 2H1HA 3F96A 4PR0A 2OM2A 1D4OA 4OSPA 4RHFA 3GLIE 2PD4A 4J76A 1NXOA 4CIXA 3LXUX 1T6BY 4M88A 7ABPA 1SRQA 3EY4A 4BS9A 1XF9A 1CYEA 1Z25A 2W2MA 3IQHX 1NP7A 4LSZA 4KC0A 4E15A 2F1IA 3G8BA 3UPUA 3L7LA 2OCLA 1EZ1A 3DLCA 2BIFA 2PWZA 3HA2A 1J70A 4IIGA 7REQA 3GUVA 4PS0A 4ZAWA 4EG7A 5BYKA 2G72A 1QOPB 1XL0A 4CEHB 4JHLA 4OXYA 4YJ3A 4FX5A 2BWJA 2VL7A 9LDTA 2NU9B 3PXCX 3ETNA 3KD2A 4Q4AB 5EN4A 4GI7A 1W59A 4GSLA 2D5LA 4C7JA 4RH3A 3Q5GA 2FWBA 3W9BA 2HA5A 4FEEA 3LHIA 1R4NB 1VQ1A 2QE6A 5AOAA 2C4WA 3LL4A 1X7WB 4IH9A 4AUMA 1KU0A 3OOEA 3SQOA 5JCJA 3EWNA 4K9SA 1NASA 2OK7A 3TLJA 1ZAKA 1OX5A 2ABWA 3GB9A 3P0EA 3LUPA 1QP7A 3TQTA 3HDVA 1M7HA 1FDRA 2BBWA 1QGYA 2ZJYA 4C08A 5AUNB 5JI3E 1G8MA 2O57A 4QULA 1TUGA 1LNQA 5E38A 3MJ4A 1Q0QA 5JASA 1I51A 3ZOKA 1QWSA 4EHLA 2OCYC 3FF1A 3KR0A 2AEEA 4G0MA 5HRUA 1W0KA 3IPLA 4FYXA 1RYHA 3WGYA 2RCNA 3MGKA 3PXXA 4PAGA 1Q7TA 1MHPA 1USGA 2X58A 1IHOA 3O73A 4ZFNA 1O2DA 1UDCA 2GFIA 3K16A 4MR7A 4QOEA 4CM9A 3DPSA 3KR2A 3OX1A 1MXHA 1UMBA 4B46A 1FNMA 5DU2A 1BDJA 1QPBA 2B1JA 5JG7A 3RNLA 3WGQA 2ZYAA 4ETMA 1DBIA 2K7FA 7YASA 3QVGB 2V7PA 2ORVA 3H65A 1W1UA 2GZAA 3NTRA 4FINA 4KXUA 3RVMA 2BOVA 2WYIA 2QSUA 2ZSKA 3KL4A 3VPDA 5L53A 2E21A 4QDZA 4QJ4A 3KU1A 1NVGA 1N0VC 4YRRA 4P53A 5I8PA 3F73A 2V6MA 4UC0A 1SC1A 4N12A 1TPZA 2F43A 3QLUA 2VP4A 4C0WA 1QS0A 3D6UA 4BVGA 2IYFA 2RKWA 1Z9BA 3EVTA 3GQBA 1MTZA 4U0JA 1QWOA 4LY6A 4MJ7A 1K27A 4NI5A 1M2GA 2OZKA 5GMOA 1D2MA 1LC0A 2VDKB 2J45A 3Q3HA 3O03A 4O4HA 2AR0A 4PHHA 5T8KA 2B69A 5IKEA 3EYAA 1CUGA 2IH2A 1TO6A 1RACA 4G1VA 3FZYA 2R86A 4UDXX 5DE3A 5G53C 4JXZA 5IWCA 4PQRA 3UKOA 4X60A 3GJQA 3WA7A 2A9FA 4N5IX 3TLYA 1RQPA 4FSDA 1OV6A 5DHTA 3TXAA 1TC1A 2B7LA 5EZYB 1Y3AA 2LD4A 4JOSA 1ISSA 4XM1A 1ZD5A 1T15A 1F5NA 4Q02A 5AI9A 5EQJB 4BTVA 2VDMB 1M2JA 4YXWD 1GA1A 4AJ9A 2ZUFA 5EE3A 3FMFA 4MVYA 3FUWA 1UT6A 3T52A 5J43A 1E4EA 1OI4A 3G9ZA 4MWZA 1KP2A 4CKWB 4B4VA 4HPWA 3IT1A 2ECPA 2UUOA 3WHLA 1O4VA 3BBLA 4EX6A 1T9AA 6PFKA 4EZEA 2GKOA 3DP9A 2FF5A 2GESA 2QX4A 1AKNA 1DHTA 2H4FA 2BFFB 4DMKA 3LO8A 1RIFA 3M6FA 1JIIA 5YASA 2G63A 2YVLA 1P5HA 2XUQA 4LCBA 1L4UA 1GZ4A 2NO5A 4HXEB 1XT6A 1NR1A 1GDHA 4YAEA 3ZU3A 1N8KA 1S7GA 1VKOA 2XUFA 2LIVA 4PZ0A 2ZJ2A 4A2CA 4BIIA 2XA1A 4BCDA 1RXWA 4D6YA 4X20A 4OHXA 5REQA 1T2FA 1YU9A 2O2GA 3PA6A 4ATNA 1PLLA 3WLIA 1V41E 4E5DA 3K32A 5KOHA 3D5EA 2EP8A 2Y1XA 2OGUA 1RHRA 5GM1A 2D54A 1ZIPA 3LCRA 1AV6A 3EXEA 1P1JA 4BEJA 2PBZA 4FZRA 2LW7A 2CF6A 2YOHA 2G1JA 5KVQA 4OUKX 5JEDA 4PO8A 2BGLA 1OXSC 2XYGA 1GPH1 2YINC 2GPSA 2ZUDA 1J1ZA 1UXKA 221PA 4IXNA 4MB2A 3Q6MA 2CC2A 3CBGA 5IKOA 4U2BA 3WAGA 3GLRA 5DNDA 2GB4A 5EXSA 4RXMA 1PV1A 3ZHXA 1EZZA 4B3DA 4B6EA 2FDXA 4JQCA 4I6EA 1VPWA 3BHIA 5DT2A 3KHKA 4J0IA 5ALKA 4EFDA 3CH5A 4GE0A 2BJHA 2PMKA 1I2DA 5BPHA 4YUZA 5IN4A 3QG5A 3DSRA 4C3UA 3E8MA 4E5PA 3WLHA 1YVDA 4ONEA 5FLYA 3OY7A 4L9AA 4ZMBA 3E6AA 1K97A 2VHCA 3KTFA 5CFRA 3ZIUA 1P1CA 1R1DA 5J1TB 3WAKA 3HB7A 3PV0A 2ID9A 3PQ3A 4QQNA 3CC8A 2R62A 2VNAA 1YRBA 2VNSA 5CX1A 2O2ZA 4OXKA 3V97A 1UDXA 2XOKA 4MROA 3RT1A 4QFBA 1S7CA 4XVHA 4W5QA 3ISJA 2AYYA 4JUDX 3TLGB 3G79A 5AI6A 3HI6A 1VB3A 1ZIYA 1OZHA 4JYPA 4P54A 4X3CA 1OFTA 3FG9A 1G21B 1NMZA 1YDEA 5TSDA 4BO1A 2BEJA 3E58A 4ZALA 1O6FA 3KALA 4XSVA 5DBIA 2OZPA 4CNQA 3PC6A 5JJ5A 4UFOA 4CM9D 3JRNA 2BKXA 4L16A 1XZHA 2DHCA 1P2UA 2QSZA 4MI1A 4E1BA 1QH9A 2F1KA 1MRZA 2FG6C 3LQQA 5LJIA 1ZIOA 4WN9A 3JD3A 5IDYA 1B0UA 2A1TS 4LZNA 3WLOA 2E82A 4NE9A 4D45A 3BIFA 4CTNA 3U9TA 1AA6A 2LTAA 3TNYA 1M6VB 3AHDA 1JHMA 4GBED 4PWYA 1PJTA 1A71A 1DEHA 1ZXLA 1P62B 1X15A 2ZOSA 3DM5A 2BHTA 3E3MA 2GK3A 1KTVA 1TA0A 4YCBA 4QO8A 1EWYA 4DY6A 1LI7A 2J08A 4II7A 2I65A 1Z4OA 1BNCA 3EQZA 2HQOA 3OIYA 4LI3X 3FXAA 4PLFA 4LYJA 1T35A 3K4QA 4GS5A 1PR9A 2VJYA 3EFEA 1OT3A 1ULBA 2DQ4A 1FTNA 2VJLA 1E9AA 5EJ7A 5JZVA 1Y7HA 3G0CA 2YWCA 2AR7A 3NRBA 3QXCA 1M2KA 1YDFA 1JAYA 4RW0A 2IEAA 2Z5FA 2K5UA 4CV1A 1MJFA 4OPMA 1N5KA 2P6PA 4OHYA 1XTSA 4TROA 2HA2A 3IIMA 1HNNA 2WWRA 1G7CA 2C42A 3G7UA 3M6AA 4KIGA 4KAJA 4MI6A 2IVFA 2PTHA 4HGNA 2FW1A 2FWRA 2Q5CA 2O3RA 1B1CA 1LQ2A 2YVKA 2HRDA 5ER9A 5K3AA 2UYHA 2HO5A 4FB4A 3MGCA 3DTVB 3KCNA 2DQSA 4PC2A 4C6SA 2W6JA 5SY9A 5E7IA 4QVIA 1L7XA 1KWGA 4DNXA 1W1IA 2DPMA 1CR4A 3G2JA 1YB7A 2R1ZA 3IE2A 2OAEA 3NDIA 3DKPA 3RHTA 3KWLA 2XB6A 1QE5A 3PPXA 2QN2A 2WM2A 3ND8A 3OETA 4FNGA 3TQCA 1HETA 4EGSA 4F1JA 4ZCRA 1QKIA 1XMJA 4MUKA 1NVXQ 3BXGA 2EJWA 2LXNA 2PL1A 3PEWA 2JH9A 1R0SA 2QN1A 4KCGA 2O8EB 1FU4A 1PLJA 2WM9B 3MPOA 4ZZ3A 2ZYVX 2GZRA 10MHA 2WR8A 3PITA 1H2EA 4UNRA 3TKLA 1L4KA 4XB6B 1V39A 2QJRA 1RPZA 2Y4NA 3KOOA 5JCPA 4LJ8A 3BGWA 3ROPA 5EFZA 1XXLA 3N70A 1ZESA 4DG9A 3VOAA 4KKVA 3FTCA 3PB3A 4JL8A 3TECE 4NQZA 4ITRC 4BGDA 3OLXA 2PVSA 4PZYA 5AKEA 2XXAA 2AI3A 2W6ZA 3T3EA 1UKZA 4QNRA 3D4LA 2XIQA 3PTAA 4XXHA 3DEIA 3JAMA 1UXIA 4NS1A 4L72A 3UXHA 2BEKA 3ZDEA 3DMRA 3QX3A 1U0NA 1J39A 1Y7LA 3OZSA 5B3KA 4LN1A 1QHEA 4V2IA 1PS0A 5EMKA 2VDUE 2Z4TA 3AIOA 3N59A 4E2XA 1Q0ZA 1QUEA 4B48A 5JSFA 5EJGA 4TVBA 3IIJA 4TWRA 2BSAA 3ESDA 4W7HA 5CXSA 5EOVA 4QHTA 1NI4B 3DCNA 4ZICA 2C00A 2C4HA 5F9FA 4MS1A 3EMVA 1CHNA 4PYMA 4BO5A 5KYXA 2JI9A 3L1KA 5AQEA 3MHTA 4BLUA 4YPOA 3WX0A 4MH0R 2ZSFA 1A9XB 3CEHA 5HM6A 4FGLA 4MNTA 4O2AB 3IT2A 1AHHA 1YJ8A 2D4HA 3A1NA 3ZBQA 2A7QA 1NNLA 3ONEA 4PPYA 2XOKD 1K63A 3UYLA 4EPYA 5KO2A 3RS9A 3E9QA 4LTMA 4OA5A 2P9TA 2OXRA 3MAAC 4RS4A 3OIUA 3EX7C 4MDFA 4KQ2A 4UUAA 2JFQA 1JHRA 3LG2A 1MH1A 4D3SA 5KPJA 4ER5A 4Z2YA 1XDGA 1R0BA 2QTHA 4PANA 4WZZA 2BRUC 2WABA 4HDQB 4J6EA 4H1HA 2PM8A 3QWHA 4OGFA 4WPGA 2Y1WA 1Z37A 2ZR7A 2CCJA 3BRSA 4MWDA 5THQA 1NVTA 5B3AA 1O95A 1UWLA 3U48A 5E9WA 3X0DA 5KNLA 5TT0A 4WA7A 3G9UA 3AU9A 3MGGA 2V4UA 4LPSA 5E9QA 4AW9A 4B2YA 2HU2A 1LWOA 4MVJM 4V03A 3BB4A 3KAPA 1HM5A 5AO9A 2CJWA 2NTYC 2XCLA 3A6GA 1N0WA 2BGIA 1SXJE 1G7TA 2GTIA 5IUKC 1RPJA 2PV7A 1SH7A 3WB0A 4YMHA 2CHEA 4BZQA 2P6NA 2QD3A 1XA0A 2FRXA 2XUIA 3GRPA 4O8CA 3QYPA 4Z7QB 5JNLA 3LKDA 4G37A 2JFXA 4Q21A 5CX4A 4D9JA 2Z0MA 1BVYF 3B38A 4ZCSA 3SY8A 2ZIWB 3QK7A 2LWIA 1VCOA 5DHAA 4F5YA 1M1YA 1CQPA