3AY3A

Crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
266
structure length
266
Chain Sequence
MLNRLLVTGAAGGVGSAIRPHLGTLAHEVRLSDIVDLGAAEAHEEIVACDLADAQAVHDLVKDCDGIIHLGGVSVERPWNDILQANIIGAYNLYEAARNLGKPRIVFASSNHTIGYYPRTTRIDTEVPRRPDSLYGLSKCFGEDLASLYYHKFDIETLNIRIGSCFPKPKDARMMATWLSVDDFMRLMKRAFVAPKLGCTVVYGASANTESWWDNDKSAFLGWVPQDSSEIWREEIEQQAGEIDPDDPAVIYQGGKFVAAGHPDDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD-dependent epimerase/dehydratase
publication title Crystal structure of glucuronic acid dehydrogenase [correction of dehydrogeanse] from Chromohalobacter salexigens
pubmed doi rcsb
source organism Chromohalobacter salexigens
total genus 102
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ay3A01
2VUUA 3GVIA 4O6VA 5A06A 2VWHA 1QXSA 1R0LA 3V8BA 3AUAA 4LSMA 2GASA 2GR9A 3H4VA 4RPJA 2Y1DA 4B7XA 3GEDA 1Y8QB 3LDHA 1ISHA 1PGJA 4Y98A 1K6IA 3GHHA 1DC6A 2AEFA 1UXJA 2X0RA 1ZJZA 3L6EA 3MCVA 3VAZA 1HDOA 1Y1PA 3L6OO 1D7OA 4MVJD 4WEQA 4A27A 1HE3A 4J1SA 2AXQA 4I5GA 1N7GA 3L4BC 3BZUA 2CDCA 3ZN2A 3I9JA 1YOVA 2GD1O 2OGUA 2X0JA 1CEQA 3FPLA 1LRKA 4J0EA 4II3A 5L40A 4EDFA 3NT4A 1EUCA 1VJ0A 3UAGA 3UCFA 3PWSA 2WYUA 2RH4A 1EE9A 1OBFO 4M1QA 3GN1A 1GAEO 4PLFA 2W8ZA 3WIEA 3JCZA 4NR0A 3RC9A 3HHPA 2HU2A 4U7WA 4E2WA 3I9LA 4KOAA 1ZJYA 1NYTA 4ZQGA 3U49A 3WDSA 5IN4A 4II2A 4IIUA 4GGOA 2GF2A 5KNLA 2WJPA 2VYNA 2DUUA 2X86A 1AN9A 1CQIA 3PWZA 4DVJA 5L7YA 1EMDA 3G1TA 4B7UA 1H6DA 1PJSA 4QFCA 4R01A 1PJBA 2Q45A 3ZWBA 2IZ1A 4PFJA 2VOJA 2NNLD 1WAMA 5KWEA 1H5QA 4M87A 4CR8A 1VE9A 3KO8A 2YDYA 4E0BA 4U0JA 5CHEA 4UUOA 2E82A 4CLOA 4FC6A 1ADGA 1C0LA 1JTVA 4R1TA 2I99A 5ILOA 5K6AC 1E7QA 1A7AA 5A3JA 2HLPA 3EUWA 3ICPA 2PA3A 2W90A 3N74A 2O23A 3NAQA 5HBRA 5L7WA 5A9RA 4NU5A 2HKIA 1XU7A 5JYDA 4A73A 2Y68A 3WGZA 1ZVMA 1HSOA 1ZCJA 3AI2A 4HKTA 3OP4A 1BGVA 5JXWA 2FPIA 3NJ8A 1WZEA 4DPMA 4JLWA 4B3HA 1NR7A 4BNGA 4TKLA 2J5QA 4E5PA 5IG2A 4FBGA 1LLQA 2WD7B 1PGPA 1EFLA 3EGOA 4EYEA 2HJRA 3C1OA 1GV1A 2GGSA 3I3OA 4TROA 1DJNA 3QQPA 4OXKA 2NADA 1D3AA 4J4BA 3LVFO 1WDMA 3RIHA 3PP8A 3NTQA 4E2XA 3BMNA 2A9FA 3WX0A 4JP2A 4DIBA 3IIEA 1SAYA 2JFFA 2YJZA 3I1JA 3EAGA 4MVJP 1MLDA 2C82A 3WXBA 4XEHA 4HUJA 3JQ7A 4AL4A 3VTFA 4UUPA 1RPNA 4BB6A 4R54A 2NV6A 3FN4A 3AI3A 2O3JA 1LA2A 3FPCA 3Q9UA 1EZ4A 1BXZA 2PH3A 3WQSB 1HLDA 3K30A 3I6IA 4RORA 4IDAA 4XYGA 4F46A 4YJHB 4JBHA 2O3SA 1QKIA 3F5SA 7MDHA 1NX6A 3BTSA 3BMCA 1U8XX 3EMKA 1YQXA 3ZU2A 2BELA 3PIDA 2P5YA 5AXAA 3ANLA 4RO0A 1V3VA 5G0UA 3TL3A 1GZ6A 2CVQA 1KS9A 3B70A 4U8GA 5IF3A 4XIYA 1XWFA 2FN7A 3ZV5A 1X1EA 1JWAB 2IXBA 4AFNA 4DYVA 2P2SA 3HDYA 2UDPA 4AJPA 4Z0TA 2BFPA 2QQ5A 3BXXA 2NTJA 4QFDA 4EEXA 2I76A 3TOZA 1BVRA 2PR2A 2WD8A 2G5CA 2Q4EA 3LU1A 4GMFA 3RFXA 3W6ZA 4U0KA 3WGIA 2YYYA 3ORFA 1CWUA 2YHIB 5L4SA 1Q0HA 3OQ6A 4NHEA 2ZTUA 4C4OA 3GZNA 3GC6A 1FF9A 4MVJG 1DC5A 1N1EA 1J4AA 2FOIA 3D4NA 3GDFA 1XLTA 2Z1NA 1R0SA 1XIVA 4XQCA 1MXHA 4KDFA 2D4AA 5I7VA 2Y67A 3KM0A 4DREA 4D45A 5C7IO 1HETA 4GGPA 4CM8B 2IZZA 3P19A 4YT2A 2PD4A 1YONA 2VUSA 5JAMA 4MIEA 1KETA 3DWFA 1H93A 5JC8A 3AM5A 3D3WB 2V6MA 4RVSA 3WGTA 2X6TA 2PK3A 1PJ2A 4J16A 3ITKA 2BMAA 3TZKA 2JFGA 1YL7A 4JQCA 5HRUA 2FWMX 4GKBA 3ZI0A 2EW8A 1AUPA 5AQ1A 4CQLA 2Y93A 4RF3A 4XKJA 5KVCA 1E7YA 5FYDA 1YDWA 2V6FA 2VT3A 2YQ4A 3RKRA 5A9SA 3GVPA 2D3TA 5ICSA 3HSKA 4PLPA 1JDJA 3JD2A 2YQ5A 3KTDA 3TDKA 1QYXA 3BMOA 4NFHA 4L76A 3I4CA 4B3IA 1SBYA 3KRTA 1XA0A 2BI7A 3GGGA 3JYOA 3OJLA 2GN6A 5BT9A 4XJSA 3LC1O 3H5RA 1LQUA 2NTVA 2O3TA 1NVMB 1GUFA 3ZWNA 4D42A 3RBVA 3S2GA 1H9AA 2PTGA 3DO5A 1J49A 1UXHA 3BA1A 2BFAA 3STHA 2BF7A 1B8UA 1NPYA 2C2YA 1O0SA 2WSBA 5TLSA 3VH3A 1PGOA 2B69A 5JW6A 2DKNA 3F5QA 3JSAA 2HRZA 3VVCA 2HSDA 5F5NA 3GGPA 2W2LD 1ADCA 5JAZA 2DAPA 1NP3A 4CM6A 5IZCA 1ADBA 1HRDA 4B79A 1JU9A 4WUVA 3O38A 3PDUA 1JKFA 1E3WB 2DFVA 5BSEA 1X7GA 1KVSA 1QV6A 2GCGA 1T26A 2AQHA 5LC1A 4NDNE 5TC4A 3V1UA 1U3WA 1IZ0A 3DZIA 4J49A 3WWYA 4EJ0A 3EZYA 1AHHA 5C7LO 4E2ZA 3TFOA 2Q1SA 2JD1A 3INTA 2Y0DA 3VTZA 3TL2A 2Q1UA 4BNHA 1DHRA 4E6PA 4WOJA 3FNEA 3QA9A 4QECA 3KV3O 3OMLA 1Y9AA 1OI7A 4GKVA 3AUUA 1LI4A 4UEJA 3BYZA 3DHYA 2VHVA 4CMCA 4YJFB 3K9QO 1IOLA 2HMSA 1GQYA 3JQEA 4JJFA 4YJGB 2QRJA 4WKGA 2C54A 3EK2A 2J6IA 5TSDA 3WLEA 2IODA 1KERA 3GY0A 1V6AA 1DIHA 4DPKA 4F6CA 3JQFA 4WOKA 4R1NA 4YAIA 3RFVA 3L0DA 5TNXA 4BUCA 5F1KA 2UVDA 1PJLA 2YHIA 4WNCA 3SJUA 1LSSA 3AI1A 1PR9A 2O2YA 3WICA 2JJYA 1M6HA 5EQFA 3LLSA 4YEDA 4WLEA 1P9LA 3C7CB 4IDBA 3T4EA 4PG4A 2DBRA 2OBYA 2PV7A 2ZCUA 5K9ZA 3FSRA 3WMXA 5CPFA 4RV9A 3PHJA 2AE1A 4KZPA 5IN5A 4RVGA 4BS9A 2ZYGA 2HMUA 6ADHA 3DZGA 5ENDA 4B4UA 4HFJA 4CLRB 5EERA 1P3DA 4G2NA 3OA0A 3H3JA 4A2CA 1LDEA 1I30A 2VCYA 1GR0A 3ULKA 2VQ3A 4XB2A 1HDYA 2RHRA 1DXYA 2W2KB 3BAZA 2VNAA 5KVVA 3VZPA 1JKJA 3IOYA 5I7FA 5JDCA 3WB9A 2AQKA 1WMAA 1DRUA 2YV2A 3LF1A 3DBVO 4HX5A 4RF5A 3WSVA 1E7MA 1PIWA 4ZD6A 4IQGA 1LDMA 5KVQA 5JS6A 1I3MA 3U62A 4KTVE 2VTEA 4OH1A 4ZVVA 4EUEA 4DBVO 4N5MA 2VWPA 1LRLA 4AJ2A 2O4CA 1R4MA 3PEFA 1GYQA 3X2EA 4LW8A 3DHEA 2FZEA 3UGKA 1DIGA 5IZCC 3LC2O 5I9MA 1IB6A 3UCXA 1UR5A 4FFLA 3SEFA 1E5LA 3UVEA 3ZWMA 3VKVA 3GMDA 4Y67A 4IMPA 4OIMA 4EBFA 2HK8A 4NBWA 5KTKA 1LXCA 2YHUA 3LK7A 5F21A 3TZ6A 3RU7A 1N92A 1E0DA 1KYQA 5B4VA 1ZXBA 4I9NA 4I5EA 1AXGA 1B14A 3UH1A 1ENZA 3GR6A 4MINA 4OQZA 4GWGA 1BW9A 2WYVA 4FC7A 3L9WA 5TIIA 3G0OA 3VZRA 2IRWA 1SO8A 2NVUA 2EHDA 4IDGA 3RJ5A 3H9JA 3PYLA 2D5AA 5DBFA 1XKQA 2P68A 4IMRA 5CDUA 1PEDA 1DAPA 3D1LA 1U1IA 7ADHA 3V1YA 1DO8A 2OXIA 1VSUA 1I2CA 2OMEA 3QWFA 3D7LA 4GVLA 5HA5A 1ISFA 3KLPX 1GADO 1VRWA 3DOOA 3KLMX 3JQFC 1NASA 2FZWA 2PH5A 4XRRA 1H2BA 1PJCA 1L7EA 3OHSX 3IL2A 3WSWA 3DAPA 4FOOA 1YJQA 2EKQA 4AJ1A 4RCVA 3D4PA 3S55A 2PFGA 3WNQA 1PU2A 1NQAO 4BNMA 1CETA 2NU8A 4DL9A 5I8ZA 4WGGA 4L4RA 4R5HA 4YJFA 4IGFA 1YOVB 3MJTA 2VWQA 4QTZA 2ZB3A 4J3FA 4S3MA 1FMCA 1HDRA 2OFPA 3W8FA 1W0CA 4CLEA 2JFHA 3NTOA 2B35A 2VYND 1U9JA 4HNHA 1T2FA 4Q3BA 1UAYA 3FWNA 3GOHA 3LF2A 3NTRA 1U5AA 5CEJA 4ZQHA 3PI7A 3WGHA 4BMSA 2HRBA 2C29D 1N9GA 3RKUA 1LJ8A 4E21A 4BB5A 4BNWA 1EEHA 4HY3A 4FJ1A 1VPDA 2E4AA 5JDCC 3AOGA 5DT9A 3TJRA 2E48A 4O0LA 1O6ZA 2CVZA 3DFZA 4DQXA 1M2WA 1FDTA 2YDXA 3WG9A 2RAFA 5JCJD 3VVBA 4PLYA 4C7JA 1E3SA 1ZUD1 2RH8A 3S8MA 1IZ9A 2ZTMA 3O8QB 2IZ0A 2I67A 3GVCA 4TQGA 4AJIA 3TPCA 1PR3A 1JAYA 1C1XB 1U5CA 4M54A 5JMPA 3JTMA 3CEAA 1HYEA 1FDUA 2V65A 4Q3AA 2CY0A 4CMAA 3QW2A 3GT0A 1P44A 4CLOB 4KDEA 1CIVA 2A94A 2JKVA 2R6JA 3ZNPA 3SLGA 2SCUA 2GERA 4YACA 3ZWCA 4IDEA 2WMDA 4ZJUA 3CPSA 2EGGA 1DEHA 4UVIA 4ZQEA 3Q6IA 4O63O 3JD1A 1TLTA 4WPGA 3ONFA 5IXSA 4Z6KA 1ZBQA 3AFMA 3FNFA 2O3UA 3JQAB 1PL8A 3DC2A 3KXDA 4FFPA 1RM4A 1YQDA 4MJLA 3WGOA 1IHXA 1UUFA 3KOUA 2B37A 3JYQA 4BL5A 5I7SA 4HFRA 4D44A 1VKNA 5H82A 4YAKA 2ZKLA 1ZXLA 5AXCA 3GGOA 1YBVA 3FCOA 2VYVA 4OXYA 3WIDA 4J1TA 1V3TA 1W4ZA 5ER6A 4BQPA 1X0VA 4CM7A 4AJLA 1SMKA 4MDHA 4HBGA 3LC7O 5EPOA 2VT2A 1IHYA 1VJ1A 3VHRA 1F8FA 2H6EA 1B3BA 1DLJA 1DFHA 3P2OA 3FTPA 3BMNB 3E8XA 3OA2A 2HMVA 3BHMA 4FJ2A 4FOSA 3UICA 4XR4A 3GNQA 4WNIA 4LVUA 1LQTA 2PNFA 4KUGA 1JVSA 2A92A 1WNTA 3ZW9A 2E6UX 3GUYA 2AMFA 4J90A 5C7OO 3KSDO 4NPCA 3KSUA 4UVHA 4XZ3A 1WZIA 3ZWVA 4ALKA 3JQ7B 4I5FA 2BI8A 3ETDA 3D4OA 3WQRA 1HXHA 4RF2A 5G0TA 3JQGA 2Z5LA 1Y5MA 2GN8A 3KYDA 4RZIA 4A0SA 1F12A 4AJJA 1VL0A 2NQTA 4RVDA 3O03A 1D4FA 4Y6RA 1LDBA 4WLVA 4L75A 4BKPA 4D0RA 2WM3A 3TWOA 2X5OA 5CDYA 3BMCB 4E33A 1FXSA 1M67A 5JFOA 2FR0A 3OIFA 4E13A 2XF8A 4R4JA 2POQX 1LDYA 1TVEA 1U28A 1Z45A 2NVBA 3I4FA 5EMHA 4M49A 5DCWA 2GN4A 3U4IA 3JQ9A 4CV3A 2ZATA 3JQCA 4BMNA 4XYBA 3WQQA 1C1DA 5EQDA 5AXBA 3OETA 4ALLA 2P4QA 3QVXA 4J9UE 2FPGA 5IFLA 3DR3A 2JL1A 1ZNQO 5T57A 3QY9A 2X5KO 4BNIA 1U3TA 3GZNB 1AHIA 4QUKA 5COBA 3ENNA 4TMFA 4RGBA 5F1OA 3E9NA 4R9RA 5KJCA 4NI5A 4M86A 4KQXA 3RUEA 1GQ2A 3GRPA 1X0XA 1E6UA 2Z95A 4CMIA 2BD0A 1H6BA 3CZMA 2OOSA 4ND5A 1XCBA 3NT2A 4FD3A 5T64A 2O2SA 3PLRA 3O8QA 4QO7A 3DAGA 3E1KA 4XR9A 1Q0LA 3OM9A 5JLAA 4F6LA 1C1XA 1N5DA 4J7CA 4ZGWA 3I5MA 1ENYA 1T25A 3ADOA 3INGA 1Z74A 4Z3KA 3D5TA 3IP1A 3HDJA 1NQOA 1U2GA 3MTJA 1IULA 1LSUA 1CJCA 1YQGA 2Q99A 3SC4A 4CM9A 1PSDA 1CDOA 2Z1MA 3E9MA 3GG2A 5DZSA 3RUHA 1E92A 1YDEA 1X1TA 4Q39A 1WP4A 4CQLB 4E2YA 3NKLA 4U6QA 5JPIA 3ZV4A 2X7HA 3IS3A 4XYEA 4UAGA 3HFSA 2I3GA 1F8GA 1ZFNA 2GO1A 1R0KA 4OHUA 4FPXA 5A9SB 2J5RA 3O4RA 4W9NA 1E1MA 3QWHA 4CJXA 5KKCA 5MGBA 2TMDA 2NQ8A 4O59O 3T7EA 3BMOB 3KETA 1ONOA 3JQAA 3X2FA 1EK5A 3H9QA 4RPHA 1QSGA 5DF1A 3ZWPA 4J2OA 5U9CA 3TF5A 5JAQA 4E32A 4PLWA 3QJ5A 2HK7A 1UXIA 1DIRA 5TT1A 1I10A 4CLXA 4R1UA 4XA8A 3DB2A 5B12A 2QYSA 1A7KA 3AY6A 4ESOA 4NBRA 3GA0A 2J3KA 4OGWA 3ANNA 4FR5A 3C1TA 4YRDA 4RJTA 3WMWA 3DBHA 4YAGA 4L0QA 4YBZA 1QR6A 4CR7A 1B0AA 4HXYA 4FFOA 1NHGA 5AYVA 1U3VA 1YVEI 5JO9A 5T6BA 4LGVA 4IQ0A 1PL6A 1G0OA 3E6AA 2ZB4A 4BVAA 2IYOA 3GZ4A 1TI7A 2D0IA 4L9RA 5A9TA 4PZCA 4JROA 1O9BA 4RVUA 4E4YA 3NT5A 1OFGA 1B7GO 5HWSA 3JQ9C 1UXKA 3U09A 3Q1LA 2O50A 4PIVA 3WTCA 2PKQP 3WS7A 4PLGA 3QRWA 2EEZA 2DU8A 3SX2A 3VH2A 3F46A 2HO5A 1WPQA 3B1JA 2UYYA 2FY8A 1KC1A 4BO6A 3CKYA 1BXGA 3IDSA 4DWVA 1PJ4A 1Z75A 4WLNA 4IXTA 1HT0A 5ENVA 5COQA 5DCUA 3KEOA 1HWYA 5L95A 3JYLA 1OOEA 4CV2A 4DIFA 3ZZNA 1S7CA 4IINA 3RWBA 4PRKA 1UZLA 2XXBA 3KYBA 3R6DA 4XQGA 5B4UA 5HTOA 2FR8A 4RVHA 3NDRA 1Z73A 3CH6A 4ONEA 4G65A 1PS8A 4KTTE 2O7QA 4UREA 1YBMA 4LMPA 3GLQA 5DCYA 3HG7A 5FF9A 3AFNA 5HM8A 1WWKA 1VSVA 3PK0A 3D0OA 3KZVA 3C24A 4J7UA 5L7TA 1IL0A 1LSOA 5GZ1A 2V6BA 2Y1GA 2X9NA 3GQVA 3DMTA 2XAAA 1GYRA 2VN8A 3WFIA 4GH5A 1K2WA 1NWCA 3H5AA 1E1KA 3AOEA 5JAIA 1JLLA 3UN1A 3JQ6A 1EDOA 5BQFA 5G0VA 8ADHA 4CL3A 2PY6A 2W98A 4FGSA 4DLBA 4D3FA 5B1YA 4DC0A 3JD4A 4JJGA 4E5KA 4RVFA 5L3ZA 2I5PO 1QV7A 2WWRA 4HWKA 4MVJA 2QHXA 2Y1CA 4R16A 2ZB8A 4W9NC 3CXRA 3ZWWA 4MIYA 1ZO8A 3I23A 4IDDA 3U5TA 1KEPA 4WJZA 4RLHA 4DQUA 1EK6A 1DIBA 1GQQA 2R2GA 3M1AA 2EKPA 2ZYDA 1E3LA 3DFUA 2GNAA 3LQFA 3ZDFA 2Y0EA 3OQBA 3W6UA 1GV0A 1M75A 2WDZA 3DBRA 3H6KA 2DUWA 3ZNOA 2P5UA 2ZJ0A 1UH5A 1GCOA 2PGJA 4ITUA 3VDRA 4LVCA 2GZ1A 4BNKA 2IE0A 3NV9A 3IJRA 2NLOA 1U7TA 3RUCA 4ZHSA 1VLLA 3DHNA 3JQDA 1TA4A 5A4DA 4J9VA 2ILTA 3HDHA 3R3SA 4CUKA 5EJ2A 4CMGA 1EE2A 1R4MB 1A27A 2B4QA 3BMQA 1LX6A 3GMSA 4Q3DA 2Q46A 1C0IA 2QZZA 4RPGA 2IYPA 1I3NA 1Q7GA 3WWZA 4JXKA 2HMWA 1QG6A 3OEWA 1FDSA 2ET6A 1TEHA 4B4WA 5IDQA 4CUJA 1CQJA 1R16A 5AXDA 4UVDA 5FWNA 3KEQA 3BHIA 3MOGA 3U4DA 1O94A 4YYZA 5CEEA 4J0FA 1ISMA 4GVXA 1DOHA 4E5MA 1FDVA 9LDBA 3ROQA 5EINA 4P4NA 4UUMA 2HCTA 4BNFA 3WYEA 1E1LA 1KVTA 1MC4A 1BW9B 2NVWA 3WGQA 5DNAA 4BGIA 3K6JA 4X54A 4YAJA 4DMMA 3QVTA 2NVUB 2Y1FA 4H16A 1I32A 2IXAA 3GAZA 3HN7A 4PG7A 3OEYA 2I9PA 3K96A 4KMSA 3GAFA 2EKLA 2BLLA 3GFGA 4FIZA 4BO5A 5KOIA 1ZK4A 2NM0A 3ZWYA 1DDOA 1WW8A 1SZJG 3NDIA 3SBOA 3BTVA 3EVTA 5G4KA 2D1YA 2CMDA 3LT4A 4ID9A 1C3VA 2JHGA 4ZRMA 2VUTA 1MG5A 3DMYA 1A71A 2O3QA 1P1KA 4YR9A 1PTJA 2W4QA 3PJGA 4D0SA 1V8BA 1Y8RA 2G82A 3QWIA 4PG6A 3INRA 3E9QA 1R15A 4EZBA 5A03A 3HN2A 4G5HA 4B7CA 1YH3A 1T2CA 2J5KA 3C8MA 4TWRA 4YA6A 5G0SA 3UCEA 1KBZA 4HV4A 4J6FA 3COSA 2CNBA 4M89A 3RCBA 4RPKA 5L51A 1D1TA 5KJ6A 5IDXA 2LDXA 4TRRA 4B4VA 1EBFA 4UEOA 2QRKA 3HB4X 2G1UA 1ONNA 2CDAA 1MX3A 4KWIA 4XYMA 1ZK2A 3AW9A 4QQRA 5A5FA 1ML3A 1MA0A 4GLLA 1Y81A 4K28A 2VZ0A 3PHLA 3C3XA 3ASUA 1P33A 3ZNQA 4CM4A 1UJMA 1X7DA 3GNSA 3MWDB 4DQVA 2EV9A 4WE3A 5DULA 1IYZA 1H6CA 2HJSA 4FFNA 1H2HA 5EN4A 1N9GB 3DZBA 3FNHA 1I0ZA 1T2AA 2P9EA 2J8ZA 2PD6A 1U8FO 2EF1A 3AUTA 3EW7A 1G6KA 1LLUA 2HK9A 4NNJA 1W8DA 3DEYX 3PHHA 4IDCA 1GTMA 3RVDA 1HF3A 3EY4A 2V6GA 3F4LA 2NTNA 4NZ9A 4LMRA 4MO2A 4UVGA 4D3SA 1XDWA 3ZU5A 4LCEA 1YB5A 1P1IA 2EW2A 3EZLA 4EW6A 4EI2A 2H63A 1T4DA 4XGIA 1HE5A 2VWGA 1DRWA 3JV7A 2P4HX 3TFQA 3ABIA 4A03A 1X14A 3JD3A 4TRJA 2D59A 1ULSA 1PWXA 2GUGA 4E5YA 5TJ9A 2BGLA 1O8CA 3EC7A 3HQ4O 1OC4A 3I9NA 3RU9A 2X9GA 3ZW8A 2DFDA 3ASVA 4FCCA 3TN7A 3V5NA 4ZN6A 4KWHA 1JW9B 3F6YA 1AXEA 2XOXA 2BRUA 3GRKA 4CM1A 4YRAA 5JSFA 1E7SA 3PJDA 3K2BA 4BOYA 3I83A 3W4JA 1EVYA 2FSVA 4BGVA 4BNNA 1E6WA 1NBOA 1HSZA 1QMGA 1VL8A 3FD8A 3I9KA 2UUOA 3RUIA 2VZ9A 1D8AA 4GAEA 2YFQA 2Q50A 1ZIDA 3KVOA 3E48A 4N5LA 5C5IA 3CTMA 2WE7A 1BG6A 2OL4A 2DM6A 1JWBB 3FI9A 3EHEA 3PXXA 2BKAA 3AY7A 3GN2A 3R0IA 5DOVA 4NJMA 3PQEA 4BNUA 4XDYA 5JY1A 3DBLA 3GPDG 2QYTA 1O5IA 8LDHA 3P2YA 5DP2A 2HAEA 2YW9A 5KIAA 3PGXA 3C1AA 1DFGA 3TZQA 4IM7A 4CMBA 1TXGA 3G79A 2ZIZA 3MJVA 2LDBA 3HE3A 2PZKA 3HNPA 4I9HA 1ZSNA 3V2UA 1P74A 1HEUA 5TQVA 4Y9DA 4CLDA 4RZHA 3TNLA 4MKRA 1LNQA 3GH3A 1YRLA 4TKMA 1T24A 1B8PA 2DTXA 2UUPA 1Q7BA 1I01A 1Y6JA 1PL7A 1EUZA 4GBJA 4MVJH 4NQZA 3CIFA 1BTOA 1JQBA 1P0FA 3L07A 3Q2KA 4B4OA 3D64A 1LU9A 1P0CA 2B0JA 4IY1A 3A4VA 4K6FA 3R3JA 5GY7A 1XSEA 1QYCA 3JQGB 1MG0A 2HQ1A 5KCZA 2Q49A 3OIGA 1QP8A 2V7PA 3E18A 3KYDB 3WGGA 2YV3A 1EDZA 4TRNA 1NFQA 3I9OA 3QSGA 4XDZA 1RM3A 4F3YA 2NACA 2Y1OA 5ICMA 2AW5A 4JBIA 4P22A 4PLHA 3D3EA 1B8VA 4ALJA 3OIDA 3JQBA 1X7HA 3AWDA 4KUHA 4YAEA 4D43A 9LDTA 5IDWA 1KVUA 1ULUA 5CG2A 5DP1A 4RDIA 1Z6ZA 4B8WA 2W2LA 1ZK3A 3BTOA 3CE6A 3VZQA 3EVNA 1WMBA 2EP7A 3FF4A 3OJOA 3OJEA 4OO3A 5F5LA 5C37A 1WDLA 2G76A 1C1DB 1N2SA 1ZH8A 4XCVA 3WBFA 3IP3A 1MV8A 4B3JA 1LDNA 2B4RO 1NFRA 2Y05A 3PPIA 2Y99A 4DBZA 1RJWA 1YB4A 1EQ2A 2NU9A 4WLFA 1V3UA 4ZQFA 4IS3A 2VHZA 3ETEA 3TQHA 5G4LA 3P7MA 4J7XA 1SPXA 1E3JA 1ZEJA 3VC7A 4BMVA 2Y1EA 3U9LA 3Q3CA 2GLXA 3PQDA 5LDGA 3F9IA 4BO4A 2I66A 4DIOA 1B15A 3GEMA 1DHTA 4GSKA 4DPLA 4XQ9A 4OQYA 1DAOA 1I36A 1HKUA 4LISA 1NAHA 2EGHA 3GFBA 3OH8A 4CMIB 3Q11A 1QLJA 3ETGA 4CM9D 1NPDA 4YT8A 4YWJA 1AE1A 3NGXA 3PFWO 4O1MA 1K3TA 3ZWOA 3FRJA 4FGWA 2P91A 1SNYA 3L6DA 3DONA 4FQ8A 3Q2IA 1LSJA 3RI3A 3RUDA 4R1SA 2C5EA 4P38A 5T8KA 2DBZA 1FDWA 4OXNA 2E37A 2X58A 3K2EA 3K73O 4XYLA 5GMOA 4ALIA 1IUKA 1YE3A 3DQPA 3JQAD 1A4IA 2O3RA 3AM4A 2IEBA 1PQUA 1T1RA 3AU9A 3Q0EA 1CRWG 4Q3NA 4QSMA 4DC1A 4CMJA 2AE2A 4NG5A 1B16A 5MDHA 3WBBA 1L7DA 2Y66A 4GX5A 1I2ZA 2YUTA 2C7GA 4AJNA 1W73A 2EJVA 4NBVA 3BIOA 1QYDA 4W4TA 3BHJA 4CLHA 4TVOA 3NUGA 3MTGA 3L4SO 1HYHA 2OO5A 3M2TA 1GZ3A 1PGQA 4IS2A 1BSVA 1R4NA 1BMDA 1P1HA 1PZGA 1YWGO 4PLCA 1X13A 4R9SA 1LEHA 3T4XA 1PQWA 2B36A 3NYWA 1J5PA 3OJFA 4Z3DA 4AJOA 1OZAA 3WTBA 4BNJA 5TGDA 4XX0A 3IC5A 5BNFA 4OJNA 2XXJA 5CDSA 3DBHB 4ALNA 3PYXA 3WFJA 4F45A 1VJTA 2X0IA 1YXMA 1R37A 2VHXA 4OSPA 3HWRA 4NK5A 1MC5A 2QG4A 3F47A 4TVBA 5ADHA 5IJZA 1HDCA 1O95A 3MJCA 3PJEA 5IXYA 3UXYA 5T67A 1RYDA 4H3VA 5T5QA 5GZ3A 2XPCA 3LZ6A 4EEZA 4GPD1 1DRVA 2PLAA 3JQ8A 4JN6B 2ZB7A 4FFRA 2EIHA 2H5LA 1HTBA 3A06A 4LN1A 5ER9A 4Z9XA 2JHFA 2RCYA 5DN9A 1QYWA 4DXHA 4GWKA 4ND4A 1H0KA 3W8DA 2AG8A 2C59A 2IDZA 2EG9A 4P8RA 4Z9FA 3ZWXA 1J6UA 2X8LA 1NPTO 2CF6A 3OF2A 4YVFA 1BXGB 1ZKMA 3UKOA 3E5MA 3DXFA 3MJSA 1LDGA 1RYEA 3ENKA 3F1LA 2GN9A 2A4KA 1HDGO 2PGDA 3FHLA 2C0CA 1MUUA 1S6YA 4N5NA 4QO8A 1NM5A 2Q3EA 3ZH2A 3RSHA 4DTIA 4HFNA 1E77A 3AU8A 4JCOA 3JYPA 3PHIA 5G2OA 4BKUA 2C2XA 4WCDA 5DBGA 1DB3A 1I2BA 4E12A 3N58A 1SEVA 4J43A 4ZU3A 3H2SA 2VHWA 1EBUA 4MVJF 1CYDA 1Q1NA 3GUCA 4DMLA 1YJ8A 3ZGYA 1PS9A 3WLFA 1SOWA 1ID1A 4W82A 2ZJ1A 3KHUA 1ZK0A 5COAA 3DOCA 4DA9A 4CV1A 5T8KC 1NTOA 2JCVA 5GZ6A 4EGFA 3MEQA 4PLVA 4XRGA 1V0JA 1ZK1A 1ZMOA 2JD2A 3RC2A 2CUKA 4CM5A 1GPJA 3RBZA 1XG5A 2Q2QA 5KJ1A 2O7SA 1Z7EA 2OP0A 3W1VA 2PZLA 4GMGA 1GUZA 1KVRA 2BH9A 3QVSA 4NFYA 2ZQZA 4A5OA 4D3DA 3W8EA 4CQMA 5HS6A 1DJQA 4H7PA 1DC4A 4GSLA 3S2FA 4JP3A 1ZSVA 3LT2A 4IJUA 4RLSA 3NX4A 1VM6A 5JY6A 5I9LA 1R6DA 3E5RA 4MIOA 1L1FA 1UDBA 1KEWA 3DBRB 2VRCA 3LT1A 2BGMA 4NMHA 3FBGA 5C3MA 1MB4A 2GZ3A 2UAGA 5LDHA 2BFOA 1WXDA 3WJ7A 5THKA 1HDZA 5EESA 1RKXA 1A9YA 2VOEA 4JIGA 3RUAA 4AJEA 2ZCVA 4ZICA 1E6EA 1PZEA 2CF5A 3D5QA 1ISJA 3GDOA 4GX2A 1V9LA 3ZV3A 2JD0A 3ZWAA 1XR3A 2Q1WA 3B6ZA 2JAPA 5JE8A 4WCFA 5U4QA 4UEKA 3BMQB 5JCJA 1MFPA 2ZQYA 5A5EA 1KVQA 2FHSA 3E03A 3RD5A 1K5HA 4RL6A 3FTNA 1M6WA 4QT0A 5DDIP 3H2ZA 4JNKA 3C7DB 5JDIA 2J3JA 3GF4A 4K26A 3ZU4A 3WJAA 2EP5A 4M8SA 4PLTA 3KYCA 3PTZA 3FR8A 2Q2VA 1SC6A 4PG8A 4R41A 1N7HA 4PG5A 2DVMA 2VTDA 4Q9NA 1NWHA 3U4CA 4PRLA 5ITWA 4Y6SA 2WE8A 3VPHA 2GPTA 3QLJA 1ISGA 1GCUA 1WLYA 1I3KA 3AM3A 3RQSA 2C7VA 2UV8A 4Z0HO 3RJ9A 4MKXA 3VPFA 3K92A 4BNVA 2AHRA 3H9EO 3RASA 4KUEA 4OMUA 3CMMA 1PX0A 4NFSA 1KC3A 4YT5A 4Z0PA 3PLNA 4IIVA 4PLZA 3VZSA 3O26A 3RC7A 1Y7TA 4D41A 1K6XA 4GX1A 4S1VA 2CDBA 1M66A 5G4KB 2CVOA 5BSHA 3MOIA 3T7CA 1DPGA 3GG9A 1LLCA 4AJKA 2R00A 3HUDA 3IAHA 1WVGA 4CV0A 3L9XA 3S1LA 5JO0A 4FFMA 5IDYA 4R3NA 1Y8RB 4IPTA 1PJ3A 1GY8A 3MWEB 5EIOA 4BGEA 3A9WA 1GPDG 4E30A 4CMEA 3I52A 4FB5A 2FSSA 3VH1A 1DC3A 2P9GA 2WEKA 2IEDA 3ZCXA 1PQPA 4FN4A 4O5OA 1MXFA 2D8AA 1KIFA 1HZZA 2PWZA 3A14A 1FK8A 3SLKA 2NWQA 4A26A 1OMOA 1UAGA 4BO7A 2P9CA 4PCVA 1DFIA 1K6JA 3DZKA 3S2EA 3B20A 3DDNA 2DLDA 2HUNA 4LRSB 4NJOA 4AJ4A 4BO2A 5I8WA 1Y8QA 2DTDA 4ND2A 1K89A 1A4UA 4ZQBA 3W4KA 1QYVA 1VKOA 2EXXA 4CM4B 1P77A 3B1KA 5LCXA 1HL3A 3K8ZA 1RM0A 3HDQA 3KUXA 3LSYA 3ONDA 2GRAA 3ST7A 2AEMA 1T2EA 2JCXA 2FPPA 2C20A 2JCYA 1SB9A 4A7PA 4E31A 4RDHA 1JAXA 4JX8A 4OSOA 1UP4A 5TJHA 2FP4A 4IQ8A 2JAHA 2C07A 3ON5A 3ROKA 3SXPA 1UZMA 1ZEMA 4BIIA 4E3ZA 1F17A 1XU9A 2QZ9A 5JCXA 3FWZA 3H9GA 4YTEA 2X5JO 3FNGA 5L53A 1C0KA 3UFXA 3IKVA 4AVYA 1PS0A 2YY7A 1H9BA 3QE3A 3I9MA 4JK3A 4R69A 5B37A 4CPDA 2G17A 1OAAA 4JJIA 4WCFC 1ONPA 1SCUA 3LYLA 2B83A 1I24A 4HADA 2NUAA 1KEVA 4PN3A 1LRJA 4J1QA 4AG3A 2X0NA 5CG1A 1SB8A 3PGJA 3MJEA 4YB8A 5JDIC 4EUFA 4BO9A 1LTHR 3ZHBA 1AGNA 4XQEA 3H65A 3B1FA 2A35A 1RM5A 5H83A 1H94A 1SOVA 3QWAA 1T2DA 2OBNA 2Q2WA 4DGSA 4ROSA 3CMCO 1EVJA 3WGYA 4C7KA 4J4HA 4XGNA 2EJWA 1B26A 1E5QA 4I08A 1PGNA 2X9VA 3DZHA 3RROA 5KJFA 4PZDA 4FDAA 3SJ7A 3SVTA 3QVWA 1U4OA 5HS4A 4ZRNA 3PZBA 3GPIA 5A02A 2PGLA 2ZK7A 3JYNA 4K6CA 4CR6A 3PVZA 2TMGA 4BKOA 1R12A 3VKUA 3AUSA 4EJ6A 4ND3A 1GD1O 5CDGA 4MP6A 4CMKA 1GEEA 1YO6A 2H1SA 4CM3A 5L4NA 3MZ0A 4INAA 2FR1A 2R00C 4NJMB 3ZHXA 2AG5A 3CZRA 1C0PA 1M76A 4BNZA 3RC1A 1Q0QA 2NU6A 3DBLB 3IMFA 4YQZA 4JBGA 5G0WA 3RFTA 3ANMA 2I6TA 4BHTA 5TT0A 2EWMA 2GZ2A 1VI2A 1LC3A 2RBEA 4FSHA 4CMEC 2X4GA 3KBOA 3NJ4A 4J4TA 3CINA 3UUWA 4IUYA 2CSUA 1P1RA 1ZSYA 2QIOA 5CPBA 4I9UA 4RF4A 1R66A 4BKQA 5I7EA 2YV1A 1ISIA 3QP9A 3UHAA 3CUKA 4N7RA 1NQ5A 3ICCA 5L45A 4J1NA 4YCAA 2WD7A 2Q1TA 2PZMA 3IJPA 5IZ4A 2E49A 1UDAA 4N54A 3QWBA 3OFSA 2YFHA 1PWZA 4W99A 1G0NA 1UP6A 4Y8VA 1ORRA 4R5MA 3SC6A 5CEFA 1GU7A 5H81A 4BV9A 2VZ8A 3DMTC 3H3FA 1NR1A 4BV8A 4TRMA 2DBQA 3AOEC 1A9ZA 3DL2A 3P5SA 3TOXA 3PRJA 1K0UA 3KSZO 3ROMA 2F00A 1E7RA 4WEOA 3M1LA 3ZU3A 1KY4A 3U3XA 4DUPA 4NBTA 4BNTA 1PJTA 5A1TA 5KVSA 5I9NA 1XQ1A 1G1AA 1N1GA 3GVHA 3RAJA 4MP3A 3ROPA 1CF2O 4NIMA 4XD2A 4DRYA 4NBUA 1F06A 2GDZA 1BVUA 4CODB 5JNLA 4M55A 4BNXA 1YL5A 1UZNA 2PKRA 4YJHA 2PZJA 4EITA 4D7AA 5TF4A 1LC0A 3WYBA 4P4GA 3C85A 3GNTA 4IDFA 5BSFA 3OICA 4J91A 1ADFA 4U5QA 4MP8A 1U4SA 3GHYA 1HE2A 1C14A 2VRBA 3DAFA 4DLLA 1B3RA 1E1NA 1NVGA 1TT7A 1VL6A 4BO0A 3C7AA 3DTTA 4HP8A 3VPSA 4KQWA 3WOHA 2PKQO 2DT5A 4LCJA 1ZZEA 2QW8A 3G1UA 3CSDA 5L9AA 4BGUA 1PZHA 5TS3A 1NNUA 3IUPA 3H5NA 1VC2A 3EYWA 3U4HA 3ZV6A 4ALMA 3IQDB 1XYGA 3MJ4A 5FI3A 2D2IA 3PIIA 4WECA 3WNVA 1T1SA 2J3HA 1TT5B 3PYMA 2FMUA 5ES3A 4GLOA 3V2GA 4BQRA 3FR7A 3HADA 4GI2A 4BKRA 3L77A 5ITVA 4NK4A 2O48X 1XGKA 3HFGA 3OJ0A 2AEJA 4PGFA 2I65A 1YB1A 4RPLA 1Z82A 3GK3A 4TZKA 4LK3A 1BHSA 3G17A 3ZNNA 2O4UX 3WR5A 2BFMA 1I33A 1E7WA 3DZFA 4CM8A 4IZIA 1XEAA 5TX7A 1Z7BA 1P1JA 1V35A 2VYVD 4CMHA 1P1FA 3E82A 1DLIA 3FBTA 1ENPA 2F1KA 3NGLA 2DBVO 2Y0CA 1LBEA 1NQTA 1BDMA 3D3WA 3H9UA 2OZPA 3ADPA 1NXQA 2X22A 4YDRA 1EFKA 1JVBA 3I6QA 4W7IA 5L4LA 1P45A 4I1IA 1R4NB 5BNIA 3OQ1A 1BWSA 1N8KA 3TZCA 4B8ZA 3GDGA 3QIVA 4HFMA 2ZYAA 3G3EA 3H7AA 1U3UA 1NHWA 3UOGA 3F4BA 1E3IA 1IY8A 4UVEA 1B2LA 4BNYA 1UXGA 3HJAA 1YBAA 4ND1A 3QHAA 4L74A 5JYEA 1ARZA 2QRLA 3OECA 4FJ0A 4PVDA 1OC2A 5CP8A 3H8VA 4YT4A 4Z9YA 1HZJA 2DQ4A 6LDHA 1HLPA 4XIJA 1E3EA 2HDHA 4K9DA 2J3IA 4BO1A 2OP1A 2H9IA 5ILGA 4KP7A 4MVJM 1KEUA 4RQTA 4XWYA 5DBIA 3JQ8B 5U1PA 5CAEA 1FJHA 1LUAA 2DPGA 1U2DA 3PJFA 5A05A 5J23A 2EERA 2CZCA 1Q2XA 3AY3A 3TZHA 1CERA 1QLHA 3K31A 1U7HA 4L4XA 1YGYA 2G0TA 2DPHA 1EUDA 5KJEA 1EVZA 4P4LA 3QVOA 3AJRA 4XB1A 2CD9A 1JA9A 1IE3A 4H15A 1IPEA 3V2HA 2BGKA 3R1IA 2BHLA 3LLVA 4DYDA 3PFFA 3O9ZA 4UULA 1E3WA 4R51A 2X1HA 5KKAA 3VDQA 2GYYA 1DIAA 1QORA 2VNSA 2YZ7A 4L8VA 4IZHA 4IJKA 1UDCA 4AICA 1IPFA 4OOFA 3TSCA 3TRIA 1NVTA 2AQIA 4PVCA 4G81A 1JN0A 3RUFA 4CUZA 4GL4A 3KB6A 3ONEA 4OM8A 3U0BA 1H6AA 2HMTA 4NU6A 4AJHA 5AVOA 1A72A 2DTEA 3A28A 4Y6PA 1GUYA 4BO8A 5K0ZA 4CQMD 1DSSG 4W6ZA 4BO3A 1KOLA 4MKZA 2AA3A 4MVJE 5FEUA 4D79A 5EL0A 3ZHZA 5B4TA 1PJQA 1HE4A 4QXMA 4GQAA 1UP7A 3HZZA 3PDJA 1GYPA 2X23A 1GZ4A 2I3AA 4UUNA 4U6SA 4IXWA 2WYWA 4YJGA 1J0XO 3AK4A 1LLDA 3BTUA 4A10A 3F3SA 3UF0A 1RWBA 1NFFA 2VRCD 5THQA 1YKFA 4CQMB 4E5NA 4D46A 3ITDA 4IGEA 1DBVO 5BSGA 3IUSA 1QRRA 1MFZA 3RBXA 1JKIA 3PHGA 4ILKA 1F14A 4WLOA 5JMWA 4PZEA 1TT5A 5A3VA 4WK6A 1W6UA 2ZTVA 1ZMTA 2AQ8A 2QX7A 4IJVA 1ZW1A 4WASA 1HYGA 4XJTA 2B5WA 3DOJA 4MOWA 5BNTA 3L4BA 2VHYA 1NAIA 3S2IA 3WYCA 3EDMA 3PZRA 4XGKA 5DOZA 1MP0A 1D1SA 5A04A 4TSKA 5F3RA 4W7HA 4OKNA 2OUIA 5TRTA 4FW8A 3VPGA 4JGBA 4DLAA 4CLRA 2WTBA 3IKTA 2B5VA 2C5AA 4IJWA 1BXKA 4WCFB 3HB5X 2GSDA 4OYRA 1P31A 3A1NA 1F0YA 2W2KA 2B4TO 3VPXA 4K1LA 4EJMA 3M2PA 1Y5RA 4QEDA 5FFFA 1KY5A 3DTYA 1Q7CA 4OKIA 4YRBA 1WDKA 4HNGA 1T4BA 2FRDA 1BRMA 1XQ6A 3DZJA 5JBIA 3GEGA 2NSDA 4NH4A 4N18A 4L73A 3KYCB 5IAAA 4LSWA 5AOVA 3UW3A 4Q3EA 5CFZA 3M6IA 3OSUA 4OOEA 4J2HA 5CDTA 1GDHA 4R3WA 2DC1A 2OORA 1PZFA 3JD0A 1XHLA 4WLUA 3F1KA 1I3LA 4TZTA 3QV1A 4FS3A 4LRTB 3PQFA 3VOSA 2OHXA 3JQBC 4YPOA 1I5RA 3NRCA 4OL9A 1GEGA 1O89A 4GX0A 1EQUA 4L4SA 1HDXA 5FI5A 3W4IA 4CL8A 1BDBA 1X15A 2NU7A 1MGOA 4I5DA 3K5PA 1A5ZA 1ENOA 3VH4A 1EVIA 4OAQA 5K6AA 4EUHA 3PWKA 2PD3A 2RHCA 4I8XA 1SEPA 3LT0A 3OBBA 4MPDA 1I8TA 3V1TC 1YS4A 2CFCA 3NDJA 1GFSA 5F1PA 4QX6A 4MVJI 2Q4BA 3G49A 4YQYA 4YJDA 4IBOA 2ZTLA 4URFA 1TB4A 2D5CA 3Q9NA 4YXFA 5BR7A 3NEPX 3ZHYA 5JC1A 4R68A 1GL3A 3GVXA 1XELA 4BNLA 3N7UA 4ZA2A 4RQUA 2RIRA 1YL6A 4Q3CA 1Y9EA
chains in the Genus database with same CATH superfamily
3NEJA 1L4BA 1XTVA 2VUUA 2WYOA 5AI0A 4BWVA 4M36A 2ZYWX 4MRMB 2K7FA 4EEKA 3DLCA 4EYOA 2VWHA 1R0LA 2IY7A 3JASB 3V8BA 1M1YB 3KR9A 1TUGA 5EJFA 5H0IA 3DP9A 5BPFA 1YJ5A 1U3FA 1UBLS 3PR1A 3SK0A 1DKUA 3RT7A 4U39A 2J4DA 3W5JA 1YR7A 5JI2E 3QPUA 3PITA 4URYR 2QW0X 4M8NE 3EIUA 1XA4A 3LY5A 3KAPA 4DM4A 3K9NA 1CFJA 4MVJD 5FI1B 3OZRA 4WEQA 3ZY4A 4MUFA 1RXVA 2KBFA 1HX7A 3PDCA 3SQLA 3E3AA 1C4KA 3BZUA 3FZEA 4NOJA 1MOSA 3ZN2A 1CY0A 2ZM5A 1DOAA 2NV0A 2OGUA 3TI9A 2BBTA 3TQIA 1MW8X 3HCWA 2Y2UA 4MWZA 3UAGA 3Q7TA 1E66A 1THGA 3NHLA 2WYUA 4G0YA 3U4GA 2GQ0A 3ZGXA 5BYBA 1B1CA 5IARA 3UFXB 3G8CA 4KMMA 4M1QA 3T12A 3GN1A 1QIDA 1FRZA 4X41A 1NMQA 2FQ1A 3O4HA 3H7IA 3WIEA 1ZY2A 4U7WA 3T52A 1QS0A 1GTG1 1ZJYA 4LRYA 3ONVA 2IV7A 2GEKA 4ZOAA 4AP6A 1DUVG 1V26A 2XHEA 3B1WA 4R7ZA 2FUNB 4IIUA 3GPCA 2C57A 4RUKA 2CXRA 4ARCA 2C0QA 3S8EA 1KOJA 3H2JA 4JLMA 3G9ZA 4G01B 1E4VA 2YH2A 3A2NA 2F1IA 3GLUA 3LIPA 1Z5NA 4JL8A 4MPTA 2HPHA 4HRYA 1KYIA 3FNQA 4YRSA 4RXMA 1SUPA 2M9MA 2GBCA 5I3CA 2JJMA 3LUKA 2PX4A 1N6HA 1N9ZA 3DUFA 3UHOA 3X1ZA 1QGUA 4G5RA 4NVRA 4PAQA 4NZNA 2EATA 4I3GA 4D1YA 3MYYA 4JJKA 4N48A 3AVUA 4TYWA 3UJBA 3ZYZA 3EZ7A 1WF6A 1JJFA 4AECA 1EXWA 2YDYA 1EGAA 3BFXA 1RI5A 3KYJB 4U0JA 4PWYA 4UHKA 5G1OA 5JFTA 4NZPA 2E82A 2CWDA 4FC6A 1ADGA 4B46A 3DYVA 1TF2A 4FHGA 3CJRA 3Q3GE 4QFBA 3WLLA 5A3JA 3ICPA 4PXYA 1WXXA 3H1EA 5SICE 4G4SO 1V4VA 1IAVA 1USUA 1XRMA 4UU8A 5HBRA 2Y3IA 1E6MA 3S6JA 5A9RA 1QGED 5L7WA 1UDRA 1G21A 1PKXA 5IC5A 3O3MB 5JYDA 4I2NA 4NDZA 4L07A 2CBGA 5CFOA 4RVCA 4FS8A 3GYBA 1K9VF 3E7XA 4A73A 1MH1A 1RZUA 1TKAA 2ISQA 2P78A 3UYKA 1FC0A 4IIXA 1ZCJA 5EP3A 3AI2A 2D2FA 2P9ZA 5AJYA 1LW7A 1RRKA 4LI0A 4ZKDA 4AUEA 3NJ8A 1WZEA 1XROA 4DPMA 2EGUA 4MUGA 5FFNA 4DSAA 5DGTA 1YVPA 2J5QA 4UHCA 2HO4A 2Q0SA 5IG2A 3AB7A 4MV7A 2WD7B 3ED1A 1OQAA 2OQIA 2R8RA 3WL6A 3PUHA 5JEEA 2HJRA 2IXFA 1NUUA 1WCV1 3C1OA 1OT3A 4KE7A 4KI0A 4BRSA 3C8DA 3KPYA 2AZTA 4GZMA 3RVRA 6YASA 1S4MA 3PG5A 1Z18A 3L0OA 2DPXA 4J4BA 4UTZA 4PSAA 3D8TA 2Q1XA 3RIHA 1RBZA 4QPCA 1KE2A 3KXIA 1OWLA 3SXJA 4JWKA 4KLRA 4B17A 2P9FA 4N4AA 3V97A 4E2XA 4CIYA 4ZV7A 3VQTA 1OLSB 3JAMA 1XD2B 4I55F 5LVAA 4FKBA 4JI8B 2YJZA 4JYCA 4FXOA 3PB3A 1H4QA 3FNIA 1VPTA 1Y6GA 2AJTA 2CXOA 2C82A 5DI9A 3DE5X 5EMJA 3WXBA 2PMBA 4Q15A 2ZI3A 4DV7B 1INLA 3JQ7A 4CU5A 4DLZA 3VTFA 1DBPA 4UUPA 5JH7A 4K3VA 5KVAA 3R0QA 5TE9A 3FPCA 3EXAA 1EZ4A 1RHKA 3LDFA 4KK3A 5FD8A 1E5XA 1D1PA 2E2WA 3WQSB 4BB9A 1II8B 3I6IA 5DW3A 4P5PA 1CP3A 4F46A 4YJHB 2O3SA 1MU0A 4KAXA 2JFVA 1JHRA 3F5SA 3R09A 1NX6A 1D4AA 3IH5A 3MLAA 2O0LA 2AMVA 4EA6A 1U8XX 1HI9A 4XGQA 3NALA 2BELA 1F6BA 2I8AA 2FWRA 1U1EA 1X9GA 2CMGA 4O2BF 4XWAA 2D00A 2BZ1A 1LWNA 3EFOA 1T9CA 1TM5E 1FBNA 4FHZA 1I13A 4RO0A 5LPNA 1GZ6A 2CVQA 2JDIA 1P2UA 2GMWA 5IF3A 3A26A 4DNXA 3JPYA 1D0IA 4B0OA 3RLIA 1CY1A 2VBFA 3IJEB 4FNMA 5CRIA 3L84A 4POOA 3PDHA 5GOTA 3BCSA 4R71A 1ECCA 1C7RA 3NATA 4NCAA 2W37A 2PR2A 5KYUB 2PKEA 4MCIA 2BEUA 1RRGA 1HE8B 4X8OA 2ZPAA 3ICWA 3IP7A 3LY9A 3ORFA 3Q72A 2YHIB 4NV0A 5AM0A 4ZWNA 1Q0HA 1LPPA 1Q17A 3K20A 2MR5A 4N3BA 5HCUA 4QICA 1SCKA 2ZTUA 1XZBA 3H4IA 5FAKA 4QUJA 3HWWA 3T7TA 4Y2UA 5JJBA 2B7CA 3QELB 3VNQA 1N1EA 1J4AA 1Z3CA 3K4PA 3AVQA 3CPHA 1XTUA 3HSYA 3IV9A 5HQJA 2BFNA 1ZONA 1VSQA 2OZEA 2D1RA 2FSFA 2FSGA 5KI6A 4A6PA 5H02A 2X0KA 3WI7A 4B0PA 2AFHE 1QQ5A 3R7AA 3O73A 2YRFA 4O4IF 2QQGA 4DREA 1GKKA 4N3GA 1MEEA 3HVKA 1HETA 4QBIA 4Q4JA 5CCEA 3PX3A 3QFCA 3VJMA 2GYWA 2IZZA 3P19A 3HJRA 5AJVB 5JCOA 3RSLA 3VU9A 4ZYYA 3G8AA 1N9KA 1IRXA 1CR0A 1YQWA 1JQKA 4KW7A 3L1VA 3WGTA 3L6UA 5EYPA 2J9YB 4MV9A 1Q12A 1X6VA 1W88B 1AQUA 2QMOA 4BFTA 5AESA 1DCFA 4C06A 2UYGA 3DAYA 3TOSA 4RJKA 4F1KA 2BMAA 3TZKA 2VK4A 1YL7A 3LFHA 4B48A 4V2IA 4GKBA 4H1UA 4HZIA 4LJ6A 4C3VA 3UT0A 5KB3A 2Y93A 4XKJA 3EF0A 1YVUA 2GEFA 5FYDA 3ZW8A 1YC5A 5CM9C 2BM0A 4UZSA 5FWDA 3RKRA 2XJ4A 4RK6A 5ICSA 3HSKA 4BUZA 1XJQA 3JD2A 3KTDA 1QYXA 3BHNA 1Z0FA 2KB0A 2ODWA 4FCTA 2IT1A 3BK1A 3G2HA 3OTIA 1VL5A 2I6XA 4LNHA 4YXWA 4B3IA 1BEZA 5B5SA 2WVAA 2BI7A 3LZDA 1BHJA 4O2AB 1E69A 4QULA 4EFDA 5JT1A 3ZJUA 1MTOA 3P97A 4CCWA 3UW1A 4F8EA 3UB3A 5KKNB 1LQUA 2GZDA 1NVMB 1GUFA 3DDUA 3RBVA 3CZ4A 1MJHA 1UXHA 2AXNA 1HE1C 1BHQ1 3AB8A 3OUTA 2BF7A 3FKQA 2KLBA 3STHA 1ZOLA 3ZS8A 1DKMA 4W5WA 2Z8YA 3K1AB 3WC4A 1O0SA 1MO5A 1A04A 3TSZA 1JLKA 1P2SA 1GXSB 1OPRA 4LOHA 3LT5A 1NJ6A 5DM1A 2CFRA 5EUCA 3VR1A 4HAZA 4MR9B 1EUDB 2DKNA 2GJSA 4KO4S 1AKVA 4ARZB 4B43A 1DTEA 3W5AA 1RE1A 4BNDA 5IKOA 4QQNA 4MMXB 4JI6B 2HSDA 1A77A 5F5NA 4ILEA 3VVCA 4UTVA 4ZYLA 2JZCA 1NU8A 2PX8A 3MD0A 3BWBA 5HKBA 2ZZMA 5IZCA 1HRDA 1XCPA 5GONA 3THYB 1E79D 4WUVA 3KZ1E 1ZICA 1JKFA 2DFVA 2XXAA 4QIHA 3SI7A 3ITEA 3O8LA 1RLJA 1BE0A 1QV6A 4RKEA 3W1WA 5J9FA 4L72A 3V1UA 1IZ0A 4J49A 4PHGA 2ST1A 3V46A 5BORA 4EJ0A 4BJ1A 3E2IA 4OBXA 5DX0A 1R6AA 5J58A 4Z4IA 2NUBA 4KBYA 5LP1A 1AHHA 4YX9A 4K46A 1ZINA 2WSSA 1XZ8A 2Y0DA 3HCNA 2YZGA 3TL2A 5EP2A 1SUBA 1JEQA 2Q1UA 1RRPA 2XNDD 3LLCA 4DCJA 4E6PA 4NONA 1IY9A 4GI3A 4K9KA 5CLLA 1PP4A 2M32A 4BC1A 3GBVA 2DR2A 1YCDA 3KKLA 2PXHA 3KV3O 3MMSA 1OI7A 3STWA 1UM9A 3N76A 5HBGA 4D9EA 1QZ3A 2YNMD 3FFWA 3FOAA 3WIBA 1LI4A 4HZUB 4UEJA 2Q4DA 1W0JD 2PM8A 4HAXA 4UBNA 2IXGA 3AR9A 2ZI7A 2XMBA 4YJFB 3ZTWA 3ZXXA 4CMCA 4WKPA 4JITA 5I4IA 2HR1A 3SU8A 1QGYA 3G8DA 4B45A 1RJDA 5HR5A 4JJFA 1UKZA 3B1VA 4AWAA 3G2MA 4OQPA 1IWBB 2QRJA 3H84A 2C54A 5HM6A 2Z83A 3ONWA 4TGLA 2GCOB 4AF8A 5JCOC 1KERA 5K8IA 2C2GA 1VCIA 5KYTA 1DIHA 1VHJA 3JQFA 4QYIB 5B7PA 2H4FA 2CLCX 3DPIA 4JLVA 4HR7A 2BR5A 1H5UA 3OMXA 1D2CA 1MDBA 5LZ8A 3PFCA 2OK7A 7GPBA 2V96A 3S40A 3K6RA 4YFVA 1Y3AA 4B3FX 2XMDA 4PPYA 3SJUA 3AI1A 2REXB 3GROA 3R3XA 1U3CA 4HNAB 1H4VB 1J39A 5AR1A 5KNDA 1I9CA 4Z4QA 2OBYA 4IRXA 1V6SA 3A9CA 4S1TA 4YJ2A 3PTAA 3U7FB 4JLOA 4NE7A 1Q2UA 2ID9A 4DIDA 2YC2C 4HYQA 2B6HA 3PHJA 4N6NA 5FUXA 1NI3A 4LFCB 4F9GA 1DAMA 2WF5A 3HA5A 3KJZA 3NHJA 4RHXA 4DBLE 2A0UA 4P0TA 3USZA 3CWCA 2HMUA 2FSUA 4HFJA 4M0PA 5G1PA 1P3DA 3TQQA 4EW2A 4MQEB 4D57A 3N8GA 4XVQA 2H57A 3RVKA 2C2HA 4EM6A 2IOFA 3H3JA 1C7QA 4FX5A 1OX6A 1LDEA 2IE8A 2XVYA 3BK7A 4A2CA 1NXOA 3NM4A 4AURA 1GR0A 3A31A 3JSXA 2VQ3A 3L8YA 4QM6A 1CJKC 2J9GA 2P6NA 1KSJA 4REQB 1PSWA 3DG9A 4TKZA 4U7FA 2IX3A 5AI8A 4AD8A 3VNBA 1TE2A 3SF8B 5JDCA 4RZUA 3WB9A 3AMVA 3HO6A 1FIUA 1MX1A 5AJZA 4HDNB 3DKRA 5ILQA 4ZHQF 1DOZA 1FYXA 3TTUA 3DDOA 1TC2A 1FJ2A 4IX1A 1SU4A 3TG2A 3KKPA 4X1YB 2Q7OE 4HNSA 4N0DA 1OLUB 2GX6A 4Q93A 3PGVA 1I3CA 4KTVE 2VTEA 5JS6A 1CFZA 1WCIB 4I3FA 5TVKA 1Q83A 1KZ6A 2QSJA 3GELA 4KHPB 1M2KA 4W5QA 2ZS7A 2JJ2A 4K86A 5BUZA 4TUYF 1M5UA 2I2XB 2R11A 1T1IA 1AUVA 1F6DA 2FZEA 4C4YA 5IZCC 1P39A 1OHHA 2XZTA 4QUIA 3IAUA 2NP6A 3GLSA 3GMDA 2Y6UA 4OIMA 4MITA 3WAKA 4NBWA 2B34A 1JKXA 2R97A 3NH6A 3RU7A 3A58B 1KYQA 3AI7A 4BX8A 4PO1A 3PKIA 5C53B 2PGIA 4EFLA 3ROEA 1AXGA 4IP0A 1CRPA 2VF2A 3A3KA 1KSGA 3HS3A 1ENZA 1VG1A 2CLEB 3GR6A 2R6DA 1S7GA 5F7XA 3I32A 3MD9A 4GWGA 2L69A 4J0JA 4DNOA 3UB2A 4DLNA 3HV2A 2H1WA 3KKNA 3L9WA 5CLQA 4YRCA 5CXSA 2JVJA 3C14C 1OROA 3SGLA 1M1YE 2O5CA 4IDGA 2EHDA 3LOQA 3MTIA 5H3HA 2FUKA 2EAUA 1E1RD 1YBHA 3H9JA 1SKQA 1DEOA 1FPMA 3K2QA 1XKQA 2R44A 5LA6A 1Y3IA 4D96A 4HB3A 1QUEA 1PEDA 1Y33E 1DAPA 2FF7A 4X63A 5IMSA 1GFIA 1U1IA 3MSCA 7ADHA 5IM4F 1E2PA 1DO8A 1N3YA 1W4LA 4FD2A 1AZWA 1I14A 2YXEA 3BWMA 1T91A 1I2CA 1ZUIA 1RADA 1MRNA 3D7LA 1GNVA 1LGYA 3R76A 4A6EA 1ESMA 3VDNB 3F3YA 1CIJA 1VRWA 3DOOA 4Q47A 5C1PA 2AT1A 1FTYA 1PK7A 4X60A 3JQFC 3LM8A 5DE3A 4LJ9A 5FPKA 5CX4A 5AOAA 1ORVA 3PV0A 4GMKA 1OXMA 5E1DA 3KFLA 4XD7D 1XEXA 2FPUA 4RMGA 3NHBA 3T54A 1MEOA 2F1OA 3WSWA 1RSZA 3DAPA 3MVEA 1CUXA 4I19A 2IDMA 3BIXA 3M8KA 3NDPA 4FOOA 1IEXA 4PZUA 4EYSA 4X64B 1GUAA 3ZHRA 1N5LA 2PS1A 3S55A 3WL5A 3U7QA 3IE2A 4PSCA 1H4SA 1W4RA 3KQYA 4PQFA 5I8ZA 2EL9A 5LB2A 4JASB 2WJGA 4H7HA 3FDZA 2VWQA 2IP1A 2ZB3A 4S3MA 2IUSA 1FMCA 1HDRA 1E1CA 3OZSA 1U02A 5LJLA 1EUCB 3IAS6 1CDZA 2E4UA 1PVVA 1Q77A 2IDJA 5EXSA 2B35A 3IP8A 4BMZA 1CUZA 2VYND 3NI2A 3ODGA 1U9JA 5C1DA 1EDDA 1KRHA 3Q7EA 2HU7A 3TYXA 2XECA 2P6RA 4KRXA 1I4WA 3AR2A 3LF2A 3W7BA 1U2ZA 5DM2A 1U5AA 5CEJA 4DB2A 2H85A 5KX5A 1Y7LA 1UK9A 2HRBA 4LMBA 1N2CA 1NBMA 1XU4A 2QORA 1N9GA 4RMIA 4E21A 2REBA 2YXLA 3I0MA 3V1MA 3AVPA 4HY3A 1AKTA 3UV3A 3QUTA 2H51A 2I6SA 4K40A 4KPGA 4LHEA 5DT9A 5JDCC 3VAAA 1TUIA 2E89A 3N2KA 3C70A 3KFXA 2ZIAA 1M2WA 3FCAA 4JC8A 3TDMA 1FDTA 2YDXA 1SVNA 1Y1TA 4H77A 3V8VA 3MC1A 2RAFA 4LC9A 2IPLA 4C7JA 3QFFA 2X8WA 1UZUA 4GMXA 4NE9A 4LY6A 3LHKA 1EWYA 3VYVA 5HVNA 1PR2A 3QVKA 4RY2A 1N6RA 2I67A 4TQGA 4YRPA 4DGQA 4ZYTA 1JAYA 1C1XB 1OA0A 1XZCA 4OVKA 2RDMA 3C6YA 3D6FA 1US8A 1CUHA 1E2IA 2ZWOA 1OBOA 5JNRA 1M8KA 3CM0A 2V0GA 1QFXA 1NF8A 3F2VA 4IRMA 4C30A 1ESNA 1HYEA 1AHNA 5DHUA 3FRIA 2V65A 4DDWA 5J2TB 3QW2A 1CSEE 1F5SA 3DGFC 4BP1A 2R7MA 1P44A 2WHQA 3NOQA 2JB9A 4UOEA 1VL1A 1CIVA 2A94A 4ZYWA 2C3YA 1JHQA 4RBNA 3WYFA 1Z6GA 2GERA 3LKBA 2F8SA 2QTRA 1JR3A 1PT7A 1UZAA 5HCIA 1YDHA 2WMDA 3RS8A 3WYGA 1DEHA 2OV3A 3PVCA 5CA1B 5DLQC 2IQIA 3Q6IA 1SCJA 1S01A 2FEAA 2ZYSA 4EP1A 3E35A 3K71B 3UMYA 2I8CA 4D9FA 3FVRA 4RW0A 4X0EA 2G06A 2Z2KA 2B2CA 3KS9A 3AFMA 3K8OE 5JWOA 3KXDA 2W71A 5BN3A 1V4BA 5CGZA 4ACBA 3UT5A 3ZHCA 2QV7A 4YUXA 3AGPA 3H8WA 2EQBA 1XAJA 1UUFA 2HIMA 5DNVA 3TDNA 2RH9B 2PAAA 2BEWA 2GN0A 3I2JA 5LNK1 3VHLB 4IHQA 1HOTA 2NSYA 4K9LA 1DVRA 4MHSA 2PQ6A 3GGOA 2OBMA 4QBHA 3OESA 1SKMA 4OXYA 4QDJA 1QIFA 5ER6A 4BQPA 2WP8J 1I2AA 3PL1A 4LX0A 5KQSA 4JBNA 4HBGA 2OVFA 2PQ2A 3TD2A 3MTAA 1I7SB 1KZ7B 3LKDA 2I4TA 4LQDA 2VT2A 1ZU5A 1F8FA 4M1KA 1VE7A 1DFHA 3P2OA 4I1VA 4NBKA 4Q1DA 5REQB 3JALA 3E8XA 2HMVA 4FJ2A 4RE6A 1E62A 4ZEMA 4JFRA 3WE7A 4I4CA 2LCQA 1ECLA 2J85A 4EL0A 1BX1A 2PNFA 3N2IA 4KUGA 4BCBA 4ZMBA 4HWTA 5KOHA 4QAJA 2G9VA 3KV1A 2IWRA 1WZIA 5BR4A 2BFFA 2ZI5A 3VO9A 2BI8A 5EJGA 4ZU1X 3WQRA 4RF2A 1JTFA 2C84A 4RD3A 3ICEA 2BHTA 4A0SA 2NQTA 4ZO8A 3L7DA 1MT0A 4MKHA 2OGZA 3FPKA 5K1ZA 4UEQA 3V7NA 4EHLA 2D2EA 2FFBA 3BSWA 3NAGA 3QF7A 4UUAA 4CIVA 3JARB 1O1YA 1IAQA 1M67A 4IIFA 5DM0A 2JIDA 4R4JA 2GM3A 4I4TF 1LDYA 1V8OA 2NVBA 1K86A 1M2HA 3HI6A 3I4FA 1FNSA 4M49A 1EM8A 2P2DA 3D9QX 2GN4A 4QOEA 4Q24A 1NW3A 1RXUA 2P7HA 4TSRA 3DTVD 2PZFA 4WJLA 4O2RA 5KNBA 3HV0A 2ZATA 3WDMA 3N8IA 3DFMA 5JHGB 5AWFC 1EE1A 3P9NA 4BMNA 6AT1A 5CVVA 1G8PA 3OPYB 4O4JA 2J31A 4MB0A 1CY8A 1WR8A 1V48A 5K8LA 3CX4A 721PA 2P4QA 3QVXA 4J9UE 3D8RA 3CNLA 4NU8X 3KELA 2XYVA 4DWOA 2JIZA 4UCFA 3F98A 4OBEA 2IA5A 5HFJA 5CB4B 4IO1A 5T57A 1Z0IA 2WKRA 3GO4A 4V38A 4WGFA 2HRCA 5FBRB 3OQMA 1ZJWA 4NV3A 3DTVB 2ACVA 4BNIA 1U3TA 4LHYA 3TM5A 1TM2A 1KOGA 2G9NA 2WJZB 2GPNA 2OD9A 4QNNA 4EHAA 5F1OA 4ZN6A 4WFIA 1B2RA 2JC3A 2QN2A 2PBLA 3FB4A 1VXOA 2NZUG 4M86A 4RYLA 5KJCA 4XPZA 4AI6A 4GPZA 5TARA 1ACLA 1GQ2A 4XGRA 3RUEA 5LUAA 5IKMA 4QOSA 3R40A 5GM2A 2OOSA 4ND5A 2A57A 3VR3D 1PN3A 2QT9A 5K0NA 3NT2A 4FD3A 1T2VA 3UUFA 4BLTA 4MAAA 1IZYA 1H05A 1ZJ4A 3A6FA 1D4OA 1Q0LA 2OORC 2R60A 3HP4A 2VJOA 1EB9A 2H1IA 3H1PA 4F6LA 2GXUA 4DG5A 5B1EA 1U5BB 3D7SA 4ZGWA 3ADOA 3HYCA 2VPWA 1E3DA 3IP1A 1NQOA 4BZZA 2O2DA 1N6IA 2ZETA 1YGPA 1IULA 2VF5X 1BS1A 1P5ZB 2HXYA 1WLSA 5L6LB 2X2PA 4E70A 4IIEA 2I4MA 3G1WA 2BGRA 1ZRSA 5D3QA 2GXQA 4V1CA 3HR8A 3WL4A 1MTZA 2HX1A 4EO4A 5C5CA 1O6BA 4GRAA 2ZJAA 3IALA 3FPSA 2BR4A 3KQVA 4KGXA 3SS9X 2OBFA 2OAP1 4B87A 1SXGA 2PUTA 2QK4A 4D9NA 4CQLB 4NCKA 2BSAA 5JJIA 2O2GA 4U6QA 3VNVA 1XMXA 1ZIOA 1EHCA 4EW1A 1ZD5A 3H2IA 4UAGA 5LQNA 4K1XA 1CJVC 4CHGA 4YLYA 3ELYA 2AVDA 3ZWQA 4DRXB 4OHUA 4AW9A 2FN8A 3OCZA 5ALWA 4NRDA 4FLEA 1TK2A 1SCQA 2QRHA 3ONNA 2Y6VA 4HEHA 1IHUA 4R8LA 4UC0A 4XVHA 3SZOA 4O59O 5IVIA 3BMOB 3X2FA 4L8GA 4RPHA 3N7TA 3SHOA 5C18A 4AY2A 1QSGA 1SR8A 1YD7A 2XZDA 1R1DA 1ZPDA 2Y77A 3HP1A 1E0SA 1KXZA 5DF1A 5EHNA 3QTLA 5GONF 5JAQA 5AJXA 1YVRA 3CLRD 1QF9A 1UXIA 2MSCB 3AKDA 1TF5A 2RK4A 1UOQA 4BQSA 2XOKD 2NYRA 3DB2A 4MCJA 4QXPA 5LQSA 1XVIA 4CT0A 2AJDA 2KS6A 2G8LA 3AY6A 3FCEA 5JLJA 5EHGA 1MB2A 4RJTA 4EWLA 1OI2A 3WMWA 2IYVA 2QV0A 3DBHA 3QI7A 4U7DA 4L0QA 3DEKA 4WV3A 3EE6A 5JO9A 1NHGA 5T6BA 3F9RA 1Q14A 3HUTA 3LH5A 4LGVA 4P3NA 2QXUA 1O2DA 4Q34A 2WLTA 2RG1A 2GZAA 3C8UA 3AEQB 4BVAA 2VBCA 2IYOA 1KO1A 1TI7A 2FSPA 3KQHA 1C7FA 1SBIA 1QC5B 4L9RA 4PZCA 1CZUA 5EY5B 4E4YA 3IVGA 5C8YA 3HXTA 1XYYA 3D7KA 1VGQA 2Y4OA 3SVZA 4XCQA 3D02A 1ZCAA 3BGDA 4TXMA 5B53A 4CF4A 4PIVA 1N2BA 3KPVA 2QDXA 1MQ8B 1LFAA 3AHGA 2IOQA 1CZKA 3AJ9A 3IOEA 3IPAA 2ZSEA 3QRWA 1CQXA 1U3GA 4PPNA 3SX2A 4LY9A 3F46A 3ELDA 1EFVB 4Q4CA 5BRJA 2VC2B 1E64A 2UYYA 1L8XA 1N3BA 2PFSA 1Y8AA 3QHPA 3DVSX 1KC1A 3QUAA 2A8YA 3K70C 5AHRA 1AO3A 3IDSA 4GPIB 4AU1A 2CXTA 4KACA 4DNFA 4BEWA 1OX4B 1Z6TA 2FETA 1NC3A 1ZVQA 4C7MA 5COQA 4D4LA 2DWUA 3VR0A 4F21A 1HWYA 5L95A 2I91A 4QA9A 4EBBA 2ZSHA 4IINA 4FT2A 4R81A 3T5TA 1C2YA 1JHYA 1X7YB 2P2ZA 3ER6A 3RVQA 4MIKA 4AF6A 2J4FA 4Z4FA 1UZLA 2PVPA 2XXBA 3KYBA 4DMGA 1RRMA 4AAYA 3GYGA 2H1LA 5ALEA 2BI4A 2BIFA 2DFPA 1G55A 5AKXA 2HLNA 4KTTE 1JDZA 1QQBA 1YBMA 1U7DA 4LMPA 3BCHA 5DCYA 5FF9A 3RTBA 5HM8A 1KE1A 1WWKA 1VSVA 2NUTB 3D0OA 4X6XA 2A2ZA 2BFDA 3LBYA 3JRNA 4J7UA 4PZAA 3RSOA 2JGIA 2V6BA 1RLIA 1U0RA 2Y1GA 1SUFA 2NO5A 1JJIA 1RLTA 2VN8A 1QQ7A 2Z9CA 1VFPA 3DEFA 3HEAA 3HKBB 4UHFA 3VZDA 4GH5A 1CUYA 4V0NA 1OPXA 1Z5WA 2YVKA 5EE3A 5JAIA 2IP4A 3HNRA 1BKSB 2XT6A 4N9WA 4HSEA 1VIVA 5C32A 5D8DA 3WA6A 1Z4LA 3WZLA 2ORYA 2OBLA 3GMIA 4D9MA 1VSBA 2XCTB 4CL3A 2PGNA 2PY6A 4FGSA 3TFWA 4TLMB 2OYSA 4D3FA 4Q19A 1DUSA 5B1YA 3LX8A 4RS3A 4DC0A 3ZE9A 1C3XA 4DIKA 1V11B 2FEPA 4C0SA 5BV0A 5L3ZA 2FF5A 4HWKA 3M1IA 4MVJA 1EWVA 3PPWA 4R16A 5CU7A 5K4HA 4Q9KA 2PUCA 5IABA 4EGQA 3DDSA 5BWOA 4MIYA 2JFOA 1KEPA 4B75A 3MGAA 3QKWA 5C8DA 2R2GA 2EEPA 3O94A 3B60A 4FFBA 3TGPA 2AZMA 5LLSA 2CHQA 1OTHA 3DFUA 3LYUA 4EX7A 1D5CA 1W34A 4X91A 1B23P 4OQEA 5TS2A 3OQBA 2BEVA 1WZUA 1NVVR 2WDZA 1E8DA 2IYSA 3H6KA 3HXLA 3UJ6A 2ZJ0A 3ZNOA 5L6MB 5JTUA 2PGJA 3V4ZA 4LVCA 2GZ1A 1U7PA 3ZE0B 3IJRA 3T1VA 4LZPA 1RCTE 3PVSA 3DHNA 3JQDA 3OX1A 4BRZA 2ES4A 3HDHA 3Q6MA 3R3SA 2PRKA 2F67A 2OFWA 1TJPB 3A9VA 3KE9A 4H4DA 1P8JA 1GTRA 1R4MB 1RFGE 3C6MA 3RSGA 1NSYA 2B4QA 3AF4A 4XOIA 5C1IA 5A0TA 2Q46A 2OAQ1 1L7QA 1SCDA 1YHNA 2A9QA 1ZLYA 5ETJA 1P4JA 1G2OA 1Q7GA 1EK1A 4MX8A 1V7PC 5BYAA 2HMWA 4GEKA 2ZJYA 3OJCA 4TV9A 5KNBH 4CUJA 1CQJA 3HBJA 5FWNA 3SJBA 2C4UA 3HMKA 1QP7A 1N5RA 4Y1RA 3U4DA 2AF4C 4BCDA 5IVDA 1ISMA 4GVXA 2WAAA 4IVQA 2ZJ6A 3U37A 9LDBA 1OXXK 5EINA 3X1XA 2WIKA 5ENZA 1KL7A 3T7SA 1F0PA 3AJEA 1JXQA 3OHMA 3AM1A 4M9XA 1KVTA 1TYDE 4RMNA 3S7TA 2VF7A 1BDJA 4RA9B 1BW9B 1TZKA 1AZTA 2IKQA 3PXUA 3GRYA 5KC9A 5J1TB 3GRFA 4BGIA 3USCS 5C31A 1R4AA 3GFQA 2YJGA 3KFVA 1H1LB 2DX7A 2Y1FA 3HYRA 3LRTA 3OKPA 3QVTA 3UWPA 3ZI4A 4ZK6A 3HN7A 3S8YA 1NNSA 3S68A 1EGQA 2YWEA 3T1OA 3RC3A 1Z8NA 2YJ3A 4MUIA 4ZAGA 4JD5A 1L8QA 3JWEA 3O2QB 3MGCA 3GFGA 1JHVA 1BFUA 1ZK4A 1DDOA 4LKRA 5BYJA 3DEIA 4GXTA 3H4MA 4YIHA 3BTVA 3SC3A 4C7OB 2A78A 1X1AA 1C3VA 4KO2S 4ZRMA 4LQCA 2VUTA 2PG3A 3MQ4A 1JQ5A 1V2HE 1U0GA 3MB5A 1PFKA 2V7BA 2G82A 3WKEA 3BXEA 3MWEA 3R3YA 3CA8A 2KHZA 3DVRX 4LOLA 4BMCA 1QAOA 3PC8C 4CCYB 1ORWA 2EKBA 4UW9A 5ESXA 5EE0A 3TQRA 1BWQA 5PGMA 4CKBB 3COSA 4URXR 1BE6A 4M89A 1NLYA 3PPXA 2GESA 5ALXA 5A3RA 2J5XA 2ONZA 3NCTA 4IWXA 1UMKA 5DHTA 4JSYA 2W83A 2GEBA 4CQJA 1FVHA 1TVCA 5KJ6A 5KQLA 4TRRA 1G2PA 1AMUA 3MBOA 1EBFA 2IYYA 2NXNA 2B8EA 2QRKA 2QTVA 1C3JA 1OCEA 1CC1S 2E85A 2IPOA 1ONNA 3BF8A 3C3KA 3QBDA 2QRNA 3QE0A 1ZK2A 5EA2A 4AYWA 4N6OA 2WJVA 1WOYA 1ML3A 1QTIA 3OZGA 4L27A 5K05A 2VZ0A 1A3CA 3ASUA 3ET4A 2F4NA 4CM4A 1UJMA 2KJQA 2WC1A 2XGGA 1FU8A 4FKZA 2AFRA 1UK6A 2H7YA 2JFQA 3G2JA 4Y6QA 2VQDA 4WE3A 3ZKWB 4DQVA 2ZRBA 4FFNA 2HJSA 4FMBB 4DW8A 3EVZA 5I7HA 3PGLA 3K15A 3RSZA 2PWYA 4TZ0A 2NP7A 4Q3OA 2I6UA 5C35A 2J8ZA 4L16A 1AX9A 3TQOA 4CXMA 1GUDA 1TMYA 3AUTA 5EHQA 4WBNA 1G6KA 3C8HA 3LGAA 5J47A 4NPHA 4XWGA 2HIGA 4TN1A 4ZAFA 4L85A 4IDCA 4QWWA 4UXJA 3EY4A 4H7FA 3RVDA 4AK9A 1AO0A 4ME6A 4FLMA 1XI2A 1Q21A 3D3QA 3IEKA 1KI9A 2BFBA 3SC2B 1DC8A 3W04A 4UU7A 2NGRA 4ZOLF 2N47A 2WWHA 3PT5A 4Q9JA 5T3UA 3UC9A 1QG4A 4OFBA 1NYLA 5DU2A 4Y0AA 4LCEA 3ZDDA 5F33A 4DIMA 1X92A 3C74A 1BH6A 2Q5EA 5JSZB 2WV9A 5TV2A 1EFHA 2JASA 2Y2VA 1DRWA 5K3SA 4BBPA 2ZUFA 4IDQA 3WWCA 4B85A 1XVVA 3FKSA 2A84A 2D59A 2Z98A 3JD3A 4QHYA 4TRJA 1ULSA 1FX0B 4YDHB 1D6NA 2HN9A 4REOA 3LY7A 3TQFA 1PEKE 3KLOA 5JD6A 3THXA 1ISSA 2BCGY 1H8HD 3N87A 4DT1B 2GUGA 2BGLA 1KZ1A 1VDZA 2X40A 3E22A 1U90A 2NO4A 3I9NA 3K05A 3K9HA 4KLNA 1A9QA 4ZCMA 2QUZA 2YWFA 3ASVA 2BDUA 3GA5A 3R7NA 4MUBA 4X8HA 2Z43A 1DWPA 1W46A 2VK1A 3F6YA 3HY3A 5HF5A 1E9BA 1LLFA 4CM1A 1S1CA 1WCXA 1MB0A 1E7SA 2DSTA 3HO1A 1NL3A 3B12A 4MW9A 2QQFA 4ZO7A 1E2GA 3AH8A 3EG5A 4BGVA 1NBOA 1VL8A 2PSHA 1T9ZA 3EGDA 3I9KA 1OXVA 4US0R 2UUOA 2YMMA 3UJAA 3N6XA 5DM70 2AR9A 3CCCA 2AWOA 1XQWA 1DJPA 1FNCA 1ZVJA 3KVOA 1XCGB 3E48A 2ZUVA 4MRAA 2H11A 5MGNA 1J5EB 2GZSA 2QSZA 1Z4MA 1YDMA 1JWBB 2DM6A 3MGBA 3PXXA 4B40A 3RTCA 5DOVA 1Y98A 3AG5A 1KYVA 3PQEA 3RRFA 4BNUA 1H3NA 2UZ1B 2W0SA 3QFSA 4XDYA 4EI7A 2QYTA 5FRDA 4F84A 3G0HA 2AL7A 2HUPA 3SVLA 1Z0JA 5DLPA 3TZEA 3WLNA 3E1GA 5JQGB 2W9XA 3L49A 3IFSA 1DFGA 3VNSA 3GLFE 2VXYA 2AI1A 4UBOA 3COJA 4IM7A 4CMBA 2X15A 3DL0A 2F48A 3MAGA 1NZDA 4OFZA 1VPVA 3MJVA 2HRDA 3I64A 4DLRA 4OUDB 5E9QA 2PZKA 4KQKA 3R7BA 2ZIUB 4CG1A 3V2UA 2YV4A 1I0LA 4JXZA 1YS9A 3HDVA 2TECE 5TQVA 4CLDA 3V4PB 4QQKA 3O95A 4C0AC 1LNQA 3EDCA 3GH3A 4D97A 2JK0A 2RAUA 2CLIB 3KQPA 3M6WA 2QGZA 1B8PA 2GFHA 1N1DA 4RACA 1FSFA 3VO1A 3L1JA 2ZWPA 3LPLA 3FVTA 3HU3A 3LQ4A 2BCJQ 4MVJH 3NUQA 3X1JA 1JQBA 2YY5A 4O4JF 1MJGM 4OXXA 4V03A 4Y6LA 5BSUA 4BFWA 1LU9A 4K6FA 5JJ5A 1A95A 1C3OB 5FO1A 5KCZA 3OIGA 1QP8A 3KYDB 4NAVA 5TPZD 5A6SA 1KFBB 3UAVA 3QM1A 5EJ9A 2YV3A 3DCJA 4TRNA 4RNDB 1CQZA 2GAJA 2YMQA 3DVAA 1R0ZA 1SHZA 3QSGA 2P3QA 5EOVA 2WTAA 2Y1OA 4DB4A 4JBIA 5F2OA 3UV6A 3O3CA 2QRUA 3OZEA 1X7HA 2PKYX 3O1IC 2DR3A 2R1VB 4DF3A 5IDWA 5ALMA 3OQHA 4Q37A 3TBHA 2B30A 3WV5A 1D04A 1N4DA 1Z6ZA 5BW6B 1KI2A 2XDAA 4Q05A 5E9WA 3LCMA 3FF4A 3CVOA 2BE7A 3Q5GA 4HI0E 3R3ZA 5F5LA 1SBHA 1QIKA 4QLOA 2G76A 1C1DB 1N2SA 4XCVA 2Z04A 4XPIB 2AKAB 3BWYA 2GBLA 1CS0B 1MV8A 1RD4A 4TLLB 3TEFA 3EGXA 1SXJD 2FPGB 3P94A 1V1RA 1L5VA 1GGKA 1JA0A 1RJWA 1Y3CE 1EQ2A 2NU9A 3JU3A 1PG0A 5FLKA 1QO0D 1QFMA 5AI5A 6LDHA 4QPZA 5G4LA 2BEKA 2ATEA 5BOSB 1I5EA 1K8ZB 1FP1D 1SPXA 5FUVA 3RVMA 5C5EA 4B2PA 3A4MA 3GP5A 3Q3CA 3PQDA 4MVWA 2PUEA 3AHEA 5ALUA 4BO4A 4EDHA 2I3DA 2G5TA 1LK7A 2WICA 3L1HA 4DCOA 4N9QA 1JSLA 4WZ6A 1KKMA 3MK31 5LD2C 4C9BA 1SXJB 1YUNA 3B3GA 4K9MA 1Y1QA 1I36A 4P86A 1NAHA 2EGHA 2R6R1 1URPA 3EA4A 4KO8A 3ETGA 4RSRA 1NPDA 4Y2SA 3CIOA 3PFWO 5GOZA 3TOCA 2ACKA 1ZKDA 2Q3CA 2AC2A 3ZWOA 1W0JA 5F64A 3CUSA 2CZQA 4FGWA 1QRUA 4KLZA 3AUFA 1N2OA 4IFTA 5KOJB 4RY0A 2ZSFA 3MCUA 1PVDA 1QH1B 1PYDA 2DWPA 1LSJA 3DGEC 2FE1A 4GUAA 1BFKA 3FUUA 2DY1A 2YCBA 2ABWA 2P75A 3JZFA 2E37A 3BRQA 3D6NB 4C6RA 1AURA 3OKCA 1RXIA 4XYLA 1IUKA 5E3IA 3ZCQA 3JQAD 3DQPA 4QSHA 2IH4A 4KRFA 4MGHA 3G9TA 1P91A 3OIUA 3P20A 2ID8A 4AS2A 3Q0EA 4HMQA 2CXSA 1CRWG 1D2HA 4H9GA 5DXJA 4O8ZA 4OD0A 2ZE7A 4N1AA 1E59A 1MJ5A 3PXGA 1B16A 3BH6A 5KQPA 1KEEA 4QC2A 4MJ3A 2C7GA 4ZVUA 2CB0A 4AJNA 4DR3B 4M0DA 3KTAA 1X80B 2BAGA 1T1JA 2XUDA 3OFND 2JA2A 1EHYA 1FUEA 4UD6A 3EOZA 1PZMA 4MQFA 1G19A 1DQZA 3L4SO 5CXXA 5CCBA 1SIUA 2H2GA 2OO5A 3LYHA 3M2TA 4QUBA 5E6SA 4FEGA 2DOKA 2GNPA 2ZBGA 3N0TA 2VHUA 4WESB 5EMKA 1E3MA 3K6SA 1PZGA 2R9VA 2I80A 1YWGO 3BCUA 4YJ3F 3WRXA 4HS4A 3EPKA 1LEHA 3IUNA 1CEXA 4PE5B 3T4XA 4I1PA 1J5PA 3OJFA 1L7RA 3NOOA 3TZLA 3RK0A 3RRXA 4G0WA 6PFKA 4DHEA 4DMRA 4O02B 1QHNA 3RKSA 5BNFA 3CR7A 5CDSA 4RYDA 4L5JA 1NKSA 1GPKA 2N42A 3EEQA 4PV7A 1R3DA 3OZDA 3PYXA 4UASA 3WFJA 1VJTA