3AY3A

Crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
266
structure length
266
Chain Sequence
MLNRLLVTGAAGGVGSAIRPHLGTLAHEVRLSDIVDLGAAEAHEEIVACDLADAQAVHDLVKDCDGIIHLGGVSVERPWNDILQANIIGAYNLYEAARNLGKPRIVFASSNHTIGYYPRTTRIDTEVPRRPDSLYGLSKCFGEDLASLYYHKFDIETLNIRIGSCFPKPKDARMMATWLSVDDFMRLMKRAFVAPKLGCTVVYGASANTESWWDNDKSAFLGWVPQDSSEIWREEIEQQAGEIDPDDPAVIYQGGKFVAAGHPDDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glucuronic acid dehydrogenase [correction of dehydrogeanse] from Chromohalobacter salexigens
pubmed doi rcsb
source organism Chromohalobacter salexigens
molecule tags Oxidoreductase
molecule keywords NAD-dependent epimerase/dehydratase
total genus 102
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ay3A01
3G49A 1Z82A 4PZCA 5ENVA 5TX7A 4B7UA 2QRJA 3VVCA 4DPLA 4I5EA 1EUDA 4IDCA 4BNGA 3U4HA 3O9ZA 2AQKA 5DT9A 1FDTA 1JAYA 1P31A 5ITVA 1IUKA 3K73O 4R5MA 1ZBQA 4A03A 4BNWA 4QX6A 1UJMA 2AEFA 5FF9A 1R15A 2WD7B 4ZGWA 1UZMA 2AA3A 1U5AA 4WNCA 3SX2A 2WE7A 3EDMA 1SPXA 3DBRB 2R6JA 2WTBA 5JPIA 3VZSA 4DC1A 4E2XA 1O94A 3GEMA 3ZU2A 3AM4A 4ZQBA 4ZN6A 3C1TA 1NFQA 4MVJI 4OJNA 1T2FA 1YB1A 5L53A 4R69A 1ISJA 4CODB 1T1RA 2X8LA 3UN1A 3MJCA 3COSA 1YKFA 1YB5A 4IQ8A 4RF2A 3ADOA 1T4BA 1DJQA 1E3WB 3EGOA 3Q6IA 4EI2A 2YQ4A 5JO0A 1NFFA 4AJIA 1XWFA 4ALMA 3IIEA 2RIRA 3T7EA 3V1TC 4TZKA 1HSOA 2HJSA 4FIZA 5K6AC 4GVLA 3AFNA 4EBFA 1BXGA 2X5KO 2Q46A 1GY8A 4P8RA 5I7VA 5JNLA 1P1IA 1XA0A 3AUUA 1A5ZA 1F06A 3K5PA 3F3SA 1E3SA 2GZ2A 1LI4A 3PJFA 1I8TA 1P0CA 3JQGA 4W6ZA 1UDAA 2E6UX 5G0SA 2X86A 3CINA 4YEDA 3H6KA 4UVHA 2HMTA 3LYLA 3NX4A 3G3EA 2D1YA 2C2YA 4TRJA 1QYVA 2GRAA 3HN2A 3RUEA 2PK3A 1L7EA 4UVIA 1DRUA 3IJRA 3D3EA 2W90A 3KUXA 4R54A 1AHIA 4G65A 4UUMA 3ZH2A 1IPEA 3ZWPA 1MFPA 2VRBA 4FJ0A 3R0IA 4HFJA 3BMOA 4MJLA 3RBZA 3WQRA 3HNPA 4XCVA 4B3IA 5DCWA 1C1DB 1YL5A 2EW2A 3GEDA 4IDDA 4PLGA 3ROQA 3VHRA 3DHEA 2Q2QA 4BUCA 4K26A 5KIAA 3OQ1A 3N74A 4HBGA 2HCTA 1BTOA 3G1UA 4MVJA 4NK5A 4EGFA 4DLBA 1U4OA 4FS3A 2EKPA 2BI7A 5L95A 1U5CA 4GBJA 4R4JA 5TF4A 3LDHA 4OKNA 2NU7A 3TZKA 3MTGA 1W6UA 4FGSA 3CMCO 2NNLD 2PH3A 3ETGA 4BMSA 4JX8A 4NJMB 4RORA 3GZ4A 3N58A 4YTEA 3WNVA 5FI5A 4K1LA 2O7QA 2A92A 2I67A 1E1LA 5TS3A 1XU7A 2EV9A 3E5RA 4BNMA 2P4HX 3LT1A 4UUPA 2V6MA 4TSKA 4U0JA 1J5PA 3PJEA 4MINA 3GNSA 2QZZA 3OJLA 2WJPA 3MJEA 2Q4BA 5COAA 4DL9A 4MVJH 4ZQEA 2PZMA 1X15A 2CZCA 4WLOA 1DAPA 4IIVA 3JQAB 1F14A 4UVGA 3G0OA 3IMFA 2X23A 3LC7O 4CM1A 5F3RA 4BNTA 3PWZA 5IXSA 5JBIA 1G6KA 3WFJA 3K2BA 3FNHA 2B36A 3KYDA 1PR9A 1CETA 3KEQA 3STHA 1PJCA 1RYEA 4L0QA 1R16A 4YDRA 3NUGA 1N1EA 2Y0DA 3RUAA 4E3ZA 4E5KA 4RVHA 4ALJA 1T2AA 3OJFA 1LEHA 3BMCA 4YJHA 4PIVA 1U28A 1E92A 4KUGA 8LDHA 3L9WA 4OXNA 4K9DA 3AW9A 4NBWA 1ISFA 3C3XA 3DBRA 4F6LA 4NJOA 3GT0A 1U3WA 1ULSA 3RUCA 1OAAA 5EESA 4XWYA 3ZHBA 4BVAA 1ISIA 4F6CA 1IULA 3PVZA 3O03A 4G2NA 3AWDA 1GCUA 4YJFB 5FWNA 2Y93A 4LMRA 4QTZA 4PLFA 3PGJA 1XG5A 2O50A 3PDJA 4YPOA 1K6JA 3SXPA 2YFQA 3NT4A 2YV2A 1EQUA 1X14A 3NEPX 4INAA 1Y9AA 1I24A 2DAPA 1X7HA 1YQGA 3ICPA 3HUDA 1Y1PA 4AJLA 5JO9A 3KYCA 4ROSA 3S2GA 2QRKA 3ONDA 3D1LA 2B4TO 3ST7A 3K2EA 4YJGA 3QLJA 1UXGA 2YV3A 3JQ9C 3D0OA 5F1OA 4BNXA 2VOJA 4CLOB 5CEJA 5B4VA 4IUYA 4W9NA 3WSWA 1IL0A 1DIGA 1NR1A 2BKAA 3O8QB 3PLRA 3WR5A 2VT3A 5IDQA 2FP4A 2E82A 1QV7A 3WWYA 2V7PA 1JVBA 4NBRA 5THQA 4CPDA 3CSDA 5GZ1A 5IZ4A 1K6IA 4R1UA 1H2HA 3ZWMA 5U4QA 3KSDO 4UULA 5DN9A 4XRRA 5IZCC 3I1JA 1QLHA 3GK3A 3KTDA 4GPD1 5CFZA 4A5OA 4WLNA 4HNHA 2LDXA 3RFTA 3KBOA 4WCFC 1UZLA 5BNIA 2GDZA 4FFNA 3VH4A 4AJ4A 3I9JA 4R5HA 1WDKA 3D7LA 2PKQO 2XPCA 3JD0A 3CKYA 4LVUA 4I9NA 5TGDA 4CM4A 3LLSA 2SCUA 1KIFA 3QWAA 4MIOA 4ND1A 4R1SA 5T8KA 3WICA 3K30A 1JLLA 3EUWA 3HSKA 3V2HA 4Z9FA 3VH2A 1MC5A 1X1EA 4L4SA 3T4EA 3UOGA 3I5MA 4FW8A 2FHSA 3M2TA 5CDYA 4CLXA 1GD1O 3C7DB 4I9HA 2R2GA 2RH8A 3I83A 4N5NA 2X9VA 4RPGA 4TWRA 4M54A 3MJVA 4LSWA 4IS2A 1FDVA 1VI2A 1M67A 4EYEA 1NYTA 5HTOA 3ASVA 3W4JA 1O95A 3I23A 3OMLA 3E18A 3MWEB 9LDTA 4CLRB 1M76A 3PZBA 2VHVA 2B5VA 4OQZA 3LT0A 3TNLA 4N5MA 1BSVA 5BSHA 3SBOA 1I0ZA 2I66A 4CUKA 4R3NA 5JY6A 4B4WA 4O0LA 2PNFA 2UUOA 3DZKA 4E5PA 1I5RA 1C1DA 4FC6A 3TFQA 4PG5A 4TRNA 6LDHA 3IL2A 4Q3CA 3NV9A 1TB4A 1G0OA 4YAJA 3L6EA 4GX0A 1JKJA 3QWBA 2O4CA 4FJ2A 3RROA 3AU9A 3QA9A 1DC3A 2ZB7A 1LQUA 2DVMA 3VPFA 1HEUA 5DOZA 3RC9A 4BO2A 3UICA 4ZA2A 1T1SA 2V65A 2VN8A 5A05A 1H6DA 1I3MA 1X1TA 2WWRA 4NPCA 5FEUA 5C7LO 1PEDA 2PZLA 4PLHA 3FWNA 2GASA 2QRLA 4TZTA 3FN4A 4IGEA 3PEFA 4W82A 3DBLB 1SEVA 1P45A 2EP7A 4IM7A 4ND2A 3AU8A 1UZNA 3CZRA 4RF5A 4E2ZA 4BB5A 2HMWA 1H6AA 1VKNA 2QIOA 4L75A 4FSHA 1ZVMA 4QFCA 1JVSA 1YO6A 2DM6A 2V6GA 1O6ZA 4X54A 2RH4A 5JW6A 4BNLA 1RJWA 2FY8A 4ZICA 1FF9A 1H9BA 3VKVA 2POQX 2FZWA 4B7CA 2HSDA 3JQ8B 3TPCA 4E31A 3AOEC 3B1JA 1D1SA 3KYCB 1RM0A 2NVWA 3PQDA 4GL4A 3L4BA 4J0EA 5ILOA 4MP8A 1ADCA 2EF1A 3P19A 4CMKA 3DC2A 4J1SA 4I8XA 4BNFA 2CY0A 2PWZA 1EVYA 2GPTA 3TQHA 4YCAA 1HYGA 4XDYA 1Z73A 1JWAB 3BHIA 4XDZA 1KVRA 3L6DA 1SZJG 5A3VA 3UW3A 4HFNA 1X0VA 4CLOA 2FPGA 4EUEA 2DUUA 2HK8A 5ILGA 2IEBA 2EGGA 4KP7A 2GN4A 4R3WA 5CAEA 4YJHB 4CL3A 1HT0A 4XB2A 6ADHA 5L7WA 3DZGA 4J49A 2J3HA 1IPFA 3VPHA 4TMFA 4BV8A 2BGLA 3JQEA 4BGVA 1R4NA 1MC4A 1EVJA 2FOIA 1LU9A 4Y9DA 1MFZA 4WJZA 1E7QA 3DMTC 3WLFA 3EVNA 4IZIA 2YW9A 1C0LA 4XEHA 2EEZA 4ND5A 1EUCA 3LK7A 4NU6A 3RC7A 3VPGA 1MA0A 4C4OA 5HM8A 2RAFA 1ZUD1 1R0SA 3VZPA 4AJ1A 2VYNA 3E9QA 4AJKA 2F1KA 3WNQA 4D3SA 5COQA 5JXWA 1EK6A 4BO5A 4C7JA 2OUIA 3SLKA 3WSVA 4RPHA 2P5YA 3HZZA 2VZ9A 1CIVA 1N8KA 1UDBA 3KM0A 3S8MA 2QHXA 4RVGA 5JCJA 3GVCA 4M8SA 3UCEA 5L9AA 2NM0A 3BTUA 2VRCA 3S2IA 1PGNA 2HU2A 2CVQA 4CMBA 3MJ4A 3DZJA 1BGVA 4JQCA 2E48A 2P5UA 1XQ1A 4DMMA 2ZQYA 5G0WA 3RJ5A 3DOCA 1NQAO 4GQAA 2AQHA 4J6FA 4N7RA 4TRMA 1A9YA 4WEOA 2AQ8A 2VHXA 1EZ4A 1F12A 3CIFA 3RIHA 1DBVO 4O63O 3U9LA 4CQMB 2Y99A 2VUUA 4BMVA 1BVRA 1WDMA 3BZUA 2NUAA 1EDZA 5EIOA 2BFAA 3PXXA 4NBVA 1PWXA 3MJTA 4YRDA 1UH5A 1PZFA 4JCOA 4WK6A 5EPOA 2NV6A 1IHXA 3D64A 3KXDA 2O48X 5JS6A 3EW7A 4N54A 2NACA 2Y68A 1EFKA 1LUAA 4XKJA 4M89A 5GMOA 3NKLA 4DTIA 1XSEA 4JXKA 1P77A 3ON5A 5KKAA 4IS3A 2VRCD 1AUPA 7MDHA 1IHYA 3TOXA 1LTHR 1BXZA 1XGKA 4MP3A 4EUFA 5HS6A 4KMSA 4BNHA 3Q9UA 3ZU4A 2IYOA 1B8VA 2J5RA 1BWSA 2OMEA 2HAEA 3P7MA 1TT7A 2D8AA 1DIBA 4WGGA 4FFOA 4TVOA 1H2BA 3ZHYA 3ZZNA 3ZWVA 1ZKMA 2VTEA 3U4IA 3WFIA 4BO8A 1O0SA 2HK7A 2VYND 2W2KB 4E12A 2NQ8A 1F8FA 2CVZA 2Z5LA 2DFDA 4FB5A 3WYBA 1E0DA 1SAYA 4KWIA 3BMNB 3ZHZA 5BNFA 3ZV3A 3HJAA 2UAGA 4XYBA 2Y67A 3U49A 3AOGA 2D3TA 1P1RA 3OJEA 2X1HA 5I9LA 5IDWA 4I9UA 2QW8A 4BO6A 1TT5A 4B8ZA 1ONOA 1A27A 2OBYA 3C85A 1GCOA 2FWMX 3BYZA 1A4IA 2NTJA 1YRLA 4FFMA 3D3WA 4GLLA 3ZWNA 4ALNA 1U3UA 5FI3A 1EVZA 1I3NA 4CLHA 1XDWA 5JDIC 1DEHA 3K8ZA 3OIFA 2OL4A 1PTJA 2X58A 2GSDA 1L7DA 2C7VA 4BGIA 1NQTA 1KEWA 2NQTA 2PZKA 5BSEA 4NR0A 4NNJA 1ZNQO 2WD8A 3I9MA 4DLLA 4FJ1A 3DDNA 4CV1A 4YRBA 5DBIA 4GSLA 5TJ9A 2EW8A 4QXMA 4CM9A 1CJCA 3CTMA 4PG8A 2EKLA 1E3IA 1ML3A 1XELA 1KETA 1ZMTA 4W4TA 5G2OA 3TZCA 3ZHXA 4U6SA 3ZI0A 3GDOA 4RF3A 1UAGA 2UDPA 1UDCA 4LCJA 3CEAA 4E6PA 4WPGA 3UF0A 4PG6A 3KHUA 1RPNA 4QFDA 4J1TA 1ORRA 5JDIA 1PGJA 1HYHA 1U4SA 5I8WA 2BF7A 2GNAA 1R66A 4M1QA 3L4SO 3K6JA 3BTOA 4YQZA 2PKQP 3CXRA 1C0IA 2CF5A 2JL1A 3EY4A 1LDYA 1QLJA 3K92A 1TXGA 2BFPA 1ISMA 1Y8QB 4KWHA 4LSMA 3PJDA 4CQMD 1GR0A 3H2ZA 1GQ2A 4TVBA 5JE8A 4LMPA 2GUGA 3JD4A 4NFSA 4YRAA 2W98A 5I9NA 1I32A 1CWUA 2PD4A 1ADFA 1QP8A 2J3JA 2PY6A 3LT4A 4JJGA 1F0YA 4W7HA 1OI7A 3SC6A 4M87A 2Q1SA 4IJUA 2I5PO 2OP0A 4ZD6A 1Q0QA 4PFJA 1B16A 3DHNA 1CYDA 4IINA 5G4LA 4Q39A 1LDGA 1U1IA 4N5LA 1S6YA 5H83A 5B37A 1HZZA 4GKBA 3W4KA 1SC6A 4WOKA 1MXFA 3W4IA 3ZWXA 1DB3A 3OH8A 4OMUA 4PLZA 4QSMA 1EBFA 2OORA 1SCUA 2BHLA 4XRGA 1HZJA 5ICSA 4URFA 3K31A 3NTRA 5T8KC 2HRZA 1HDYA 2NVUA 4A27A 1VJ1A 1NWCA 1R4MB 4K6FA 3KO8A 4WCFB 1B14A 4JP3A 2HUNA 3QVXA 4UVDA 4BKUA 1NAHA 3D5TA 2WYVA 3OM9A 2VYVA 3HFGA 1HE3A 1A9ZA 3FNEA 5TC4A 3QVOA 2O3SA 3UCXA 3ZWAA 2EP5A 5TRTA 3Q3CA 1NHWA 4KZPA 2Y1EA 3DONA 4RQUA 3F4BA 3PHGA 5BSGA 3GMDA 1KS9A 5TQVA 1Y81A 1BDMA 1ZSYA 4RZHA 3ZWWA 4EJ6A 2D0IA 1E1KA 2CDBA 4J2HA 4WLFA 1GTMA 3CH6A 1SMKA 2XXJA 4A73A 2ZB8A 3JQFC 5JCJD 1HSZA 4RZIA 5EJ2A 3MJSA 2AEJA 3ZW8A 5L7TA 1TT5B 1HLPA 2VCYA 2W4QA 4MKRA 1U9JA 3WJAA 2BRUA 3D3WB 1O89A 3DHYA 3IQDB 2V6FA 4H15A 1EK5A 4OOEA 3BMQB 1PJQA 4YAKA 3PK0A 3F47A 3AUTA 3UXYA 5LC1A 3FRJA 1DAOA 1HDCA 3ZNQA 3OBBA 3C1AA 3KZVA 4QUKA 1E7SA 3QVTA 3RI3A 4J91A 3HB5X 3KETA 3DR3A 1BW9A 2Y1GA 4CL8A 4OKIA 2A4KA 2J3KA 3JQDA 4YT2A 1HL3A 2IXAA 4YR9A 1N5DA 1TLTA 5I9MA 5DP2A 2FSSA 3FNGA 4AJOA 1Z7BA 3GG2A 2IDZA 4KUEA 4R51A 3WGYA 4BO3A 4WCDA 3WB9A 4XQ9A 1D8AA 1Q7GA 4Y67A 4ILKA 3VKUA 3ASUA 4ALIA 3NRCA 3GN2A 4WLVA 3RJ9A 3S1LA 3UUWA 3JQ9A 2PTGA 4A2CA 3O26A 4HXYA 4DBVO 5JYDA 3ZV5A 3WGTA 4A10A 1KBZA 4UAGA 1LLQA 3C7AA 5FYDA 3U4CA 4XQGA 4OGWA 2EKQA 4OIMA 2IZ0A 4J1NA 4GGOA 2EXXA 1H6BA 3DBVO 4QO8A 1DFGA 2Q45A 1M6WA 3OETA 1XLTA 1Y8RB 3FHLA 3OECA 5DF1A 2R00C 2EHDA 3UHAA 1H9AA 2JHFA 3NTOA 4KDFA 4RDIA 4ZQFA 4HNGA 2BD0A 4Z9YA 3WX0A 3EK2A 3RFVA 1E5LA 5C3MA 1JTVA 2WYWA 1MGOA 1LLDA 4UEJA 5T6BA 3TWOA 4Q3AA 4DGSA 4WOJA 5G0TA 3UFXA 4MO2A 3PIDA 4XA8A 3RAJA 3ZNOA 3KB6A 4MIEA 3V8BA 5A1TA 1VSUA 3UGKA 1EQ2A 3LLVA 4W7IA 3TRIA 2BH9A 3E5MA 2YV1A 4GKVA 4OM8A 4G81A 1UUFA 1VE9A 4DVJA 2IYPA 3E9MA 1SB9A 4DPKA 3GN1A 3JQAD 2JKVA 1WZEA 4HKTA 1ZK0A 1PWZA 1RM3A 1YOVB 3HDYA 1PX0A 3OHSX 2GN8A 3TZ6A 3A14A 2IE0A 3VPXA 5JAZA 1LNQA 1PJBA 3Q9NA 4YBZA 4IBOA 3L0DA 3RASA 5EN4A 3JYLA 1Y5MA 4BO0A 1YE3A 1JQBA 4D45A 4GWGA 1YVEI 3DZFA 1ZMOA 2WM3A 4ND4A 1AGNA 1WPQA 1HE4A 4RLHA 1SOWA 1NVTA 4R16A 1FDWA 3F5SA 1F17A 3EMKA 1EEHA 3RKUA 4HY3A 3AFMA 4BHTA 3GRKA 2D59A 3GPDG 4OH1A 3ROPA 2IEDA 3F1KA 3U09A 2VWQA 2ZTMA 4NBTA 3IKTA 4RCVA 2O2SA 3U4DA 3MCVA 3VOSA 4XR4A 1B8UA 1YQXA 3L77A 3IUSA 1PZEA 2P9CA 1ZCJA 4BS9A 3HQ4O 1N7HA 1IE3A 3QHAA 3S55A 4FGWA 2C20A 3ANLA 5KJ1A 1YJQA 3WGZA 1GYRA 1E5QA 4PCVA 2PA3A 1ZW1A 4IQGA 3BA1A 3SJUA 5HWSA 3O38A 3P2YA 5KJEA 2BFMA 4DIOA 2D4AA 4J43A 3IC5A 1D4FA 3ZWBA 1EMDA 2YJZA 1N9GB 5TT1A 3GVXA 2D5CA 3OQBA 4CV2A 1OFGA 1V0JA 4RLSA 3UAGA 2GLXA 4E21A 4W99A 4LW8A 3DMYA 3BMOB 4XR9A 2C7GA 1L1FA 1QYCA 3FPLA 1A4UA 3DTYA 4GVXA 2YDYA 2ZQZA 2EIHA 2X9NA 3NAQA 2O3RA 1KY4A 2HLPA 3DAFA 3GFBA 4OO3A 1DC5A 1ZK2A 4W9NC 2UYYA 1LQTA 3RBVA 4BNIA 1LDMA 3WQSB 3OA0A 1H5QA 3EAGA 4IJWA 2Z95A 1HDRA 4BB6A 3R3SA 3FTPA 4CLEA 1CEQA 1LSSA 2FZEA 4LGVA 2Y1FA 3GGPA 3TFOA 4YAGA 2AG8A 4ZVVA 4YJDA 5U1PA 1K0UA 4CMIA 4HP8A 4NFYA 5J23A 1P1FA 3PFFA 4XYMA 5CDTA 3JQ6A 2NLOA 2OGUA 3K96A 1W8DA 4AICA 4BQRA 3IJPA 1U7TA 2ZIZA 2FSVA 4FOOA 3WLEA 2W2LD 2W2KA 4IXWA 4E30A 4E32A 2DLDA 3JQGB 5JAIA 3BMNA 5L45A 1Q2XA 4PLVA 3NTQA 2OHXA 5JDCA 3I9NA 4L4RA 1V9LA 4XD2A 1ZSNA 3FR7A 3ROMA 4RGBA 5F21A 4EEZA 5LDHA 4C7KA 4BKOA 1WMBA 2Y05A 2WE8A 3F6YA 1ZK4A 3KYDB 3D4OA 4J4TA 1EDOA 3PGXA 4IGFA 2CDAA 5IDXA 3RU9A 3AY7A 5L4LA 2VZ0A 4EZBA 3DQPA 4IXTA 3TZHA 1U3TA 2JAHA 3LSYA 3B20A 1WWKA 2WMDA 4CV0A 1LSOA 1LDBA 2R00A 3IOYA 3B1KA 2ZTVA 1NPTO 4UEKA 2BGMA 3I4FA 1YOVA 4M86A 5BQFA 3A1NA 1DRWA 1CQJA 1LRKA 3U3XA 3WWZA 3VVBA 2QG4A 1LDNA 1NPDA 1ZIDA 2D5AA 2IZZA 4TQGA 1VL0A 2ZCUA 1VC2A 3CUKA 4HFMA 1ZH8A 2X0NA 3V2UA 5IG2A 3WGHA 1M75A 4UEOA 3S2EA 1PJ4A 3AJRA 1QYXA 1S7CA 3FD8A 4AJJA 1DJNA 2DTDA 3MOGA 3QV1A 1NX6A 1MXHA 3IUPA 1K2WA 1K89A 3GAZA 2NTVA 1Q1NA 1TI7A 2Q1UA 5DDIP 4AJEA 3JD1A 3CZMA 4IY1A 3JQ8A 1SOVA 3QIVA 2B4RO 4RVFA 2EJVA 1Y8RA 4B7XA 1OC4A 4AJPA 4BGEA 4FN4A 3EC7A 3PQEA 2HMUA 4FPXA 1U2GA 4FR5A 4Q3BA 4XX0A 3ZNNA 3RC1A 3MTJA 3WIDA 1SNYA 2VZ8A 2P9EA 5L7YA 1PZGA 3RFXA 1NVMB 1C1XB 2GN6A 2Q2VA 2YHIA 3GVIA 2OXIA 2VWHA 2Y0CA 1PS0A 4U8GA 4BNNA 5THKA 3LF2A 3HWRA 2EG9A 3GC6A 4I5DA 1GYPA 1D3AA 4WNIA 1DRVA 3WGQA 3JQCA 2PH5A 3ITDA 4BGUA 1ADGA 5C7IO 2X7HA 1LSJA 1HE5A 3I3OA 1QV6A 4BQPA 3H7AA 3O8QA 4D42A 5ER9A 1NAIA 3DXFA 1HE2A 2X9GA 1NTOA 3A4VA 3IKVA 1N92A 5KOIA 3OIGA 1P33A 5L40A 3B70A 4Z9XA 3RUFA 4D3DA 4O59O 3H9QA 1X13A 4WKGA 4CMEC 3AUAA 3O4RA 2JD2A 4CMCA 1IYZA 3RVDA 4DREA 3L6OO 1QRRA 1DFIA 2E4AA 1PJ2A 1Q7BA 5I7SA 2DTXA 4PLTA 2X0JA 3INRA 3AY3A 3JYQA 3M6IA 3MOIA 3DZIA 3AM5A 2B35A 3WDSA 4BKPA 1H0KA 4B8WA 3VZRA 3ANMA 2ZB4A 3OSUA 4IDEA 4QECA 2Y1CA 4D3FA 4QQRA 1ZXBA 4PGFA 2GN9A 1J4AA 1V3UA 5EINA 2CSUA 2GYYA 1GPDG 1XR3A 2ZYAA 4B4OA 1JKFA 3QQPA 3QW2A 3D5QA 4RVUA 2BGKA 1PQWA 4P4NA 1E6EA 3U62A 1AXEA 4MVJD 3OP4A 1VJ0A 3I6QA 3E1KA 3LF1A 1YBVA 2AEMA 2X0IA 4Z0PA 5H81A 2UVDA 2G76A 4J9VA 4EDFA 2AQIA 2JFFA 1GZ4A 2P91A 4AL4A 4XJSA 5A04A 2I99A 2VWPA 2DBRA 1YONA 2ZKLA 3FR8A 3GR6A 3E03A 2YY7A 3PHIA 3DMTA 1GU7A 3Q2IA 4I5GA 3AI2A 5CEEA 1D1TA 4Z0HO 1Y6JA 3GAFA 1EFLA 4PRLA 4KDEA 4FOSA 1ID1A 1PGQA 4P4GA 3NT2A 1E77A 2CD9A 5KNLA 3PP8A 3R1IA 3DTTA 1T2EA 4Q3DA 4E2WA 3H2SA 4CMHA 4IZHA 1OC2A 3VAZA 1C0KA 3DWFA 3D4PA 3TL3A 1JAXA 3GMSA 4K28A 4D0RA 4BNUA 2HDHA 2IODA 2CUKA 3PLNA 1E3JA 3ONEA 1I2CA 4O1MA 5FFFA 4BO1A 3E82A 3MZ0A 1JDJA 5K0ZA 4Y6SA 2DT5A 1UAYA 4CV3A 2DBZA 1QR6A 3RUHA 1WDLA 1X7DA 1E1NA 4R68A 2QQ5A 2PV7A 3CE6A 3WBFA 4WEQA 3SLGA 1IB6A 1OBFO 1BMDA 4RQTA 4BKQA 1O8CA 4YT5A 5KVVA 1P1KA 3PHLA 4MVJF 5CEFA 1DHRA 3FPCA 5IDYA 3FBGA 3I6IA 3ANNA 1M2WA 3GDFA 3M2PA 3T7CA 2VHZA 2VNSA 5U9CA 4JN6B 3JCZA 1DDOA 5A5EA 4PLCA 1NR7A 4B4UA 2Q99A 4FQ8A 4YYZA 3BIOA 5COBA 2P2SA 4I08A 5L4NA 4U6QA 5A5FA 4GMGA 1ISHA 5TNXA 4ZU3A 2JCYA 1ONNA 3GG9A 4P38A 1GEGA 2B4QA 5DCYA 5JCXA 3LC2O 1JA9A 2VUSA 1ZJYA 4IDFA 3TOZA 2JD0A 4FBGA 1PL7A 1LA2A 1VL6A 4FDAA 3HE3A 4Q3NA 3RSHA 1DLJA 1U3VA 1GUFA 3JV7A 1NNUA 4MVJM 2HMVA 3E9NA 4Q9NA 4MP6A 1ZFNA 2DU8A 5KKCA 2FRDA 1ZXLA 3NGXA 1VKOA 1T2DA 1BHSA 4LN1A 1PJSA 3NT5A 3QRWA 5JFOA 3QE3A 5T57A 1MB4A 2ZK7A 4L73A 4QT0A 3R3JA 3GF4A 1GQYA 1CDOA 1CRWG 2B83A 5KCZA 2RHCA 1PJTA 2GZ3A 1FDUA 1CQIA 1LDEA 3JQBA 1HYEA 3RD5A 3PTZA 4D79A 1BDBA 5JDCC 1YL6A 1MLDA 4JP2A 4J7XA 3H3JA 4NHEA 1E3LA 3FF4A 1H6CA 1DXYA 2NVBA 1ISGA 5A03A 5K9ZA 5A9SA 4JBGA 5F5LA 2C82A 3WQQA 3Q0EA 4GGPA 3GLQA 5DNAA 3JQ7B 4RV9A 5CP8A 3HHPA 1GQQA 3ETEA 2XXBA 5ENDA 1GPJA 4PVCA 5ADHA 2FR1A 4KQWA 4J3FA 4P4LA 3QSGA 4TKLA 4DYVA 4KUHA 1Q0HA 3PWKA 1MP0A 4CLDA 4J9UE 1DIRA 3TN7A 1YQDA 1DPGA 5DZSA 4DC0A 4R01A 4OL9A 1I3KA 4IMPA 4J7UA 3JYOA 1E7MA 2X6TA 4Q3EA 3GRPA 1SB8A 2ZYDA 1I2ZA 2Y0EA 4CMEA 3I4CA 4EITA 3DB2A 1GZ3A 1ENOA 5L3ZA 3L9XA 5KWEA 1LLCA 1QYDA 9LDBA 2JAPA 4L76A 5T67A 4Z3DA 1DO8A 1VM6A 3H5AA 1LLUA 1Q0LA 4NIMA 2H1SA 1T4DA 2OOSA 3INGA 4PLWA 5DP1A 1R0LA 3GNQA 3SC4A 4E33A 4H7PA 1V35A 4HWKA 4L8VA 3GVPA 4IDBA 2VOEA 2Y1DA 3AY6A 4DMLA 4N18A 2OO5A 3ABIA 4GSKA 2C5AA 3GUYA 4BL5A 4BNKA 5IZCA 3IAHA 1KEUA 3KVOA 1E3WA 3JYNA 1BVUA 4YB8A 4KTTE 1XQ6A 2YFHA 1NHGA 1PS9A 2E49A 2NSDA 5F1KA 3KSZO 3LT2A 1EE9A 5ER6A 3WJ7A 2G82A 4EW6A 2Q50A 2C29D 1IOLA 1HDZA 2GD1O 2H6EA 3DZHA 4FC7A 3PZRA 3ZU5A 1K3TA 3TSCA 2H63A 4HX5A 3VDQA 3ITKA 5CHEA 4JJFA 4LVCA 2OP1A 1XHLA 4IDGA 4MKZA 1QSGA 4E13A 3RQSA 2YHUA 1HTBA 1P0FA 2DPGA 2DUWA 2IRWA 3DAGA 4DIFA 4BOYA 5A9TA 1PU2A 3BAZA 3KRTA 5EQDA 3TJRA 4XGIA 2VQ3A 4CM6A 3ZCXA 4ITUA 4GAEA 5A4DA 2P4QA 5HRUA 3BTSA 5DBGA 4CM9D 5KJ6A 2Y66A 4H16A 1PZHA 2AG5A 2HO5A 3AOEA 1BG6A 3N7UA 3P5SA 4CR8A 1A7AA 4DYDA 4J0FA 1ADBA 2FPPA 4BNYA 2C5EA 2O3TA 1KEPA 4EJMA 3Q2KA 5IXYA 3DOOA 4JNKA 3QJ5A 5AXBA 1Y7TA 3I52A 1LSUA 3E6AA 3ZV4A 1YDEA 1ONPA 2PKRA 2X5JO 3FWZA 3GGOA 2NU8A 4BMNA 2QYSA 3UVEA 2VWGA 1V3TA 3JQBC 4CR6A 4CQLB 4YVFA 4KQXA 4TRRA 3HDHA 3HDQA 3JSAA 1ZO8A 3M1LA 5A02A 4J90A 2F00A 3ZWOA 3NDRA 1VPDA 4XQEA 2ZTUA 4BO9A 1OZAA 3KLPX 4UREA 3LU1A 1G0NA 1B3BA 3IS3A 4D0SA 5KTKA 4Y6PA 1YGYA 4EEXA 1RWBA 1VL8A 1DLIA 4DPMA 1GV0A 3UKOA 3UH1A 5BR7A 5HS4A 3MEQA 1UXHA 2BFOA 5G0UA 2ZCVA 1ZJZA 4YT8A 1T24A 1TVEA 2RBEA 3ZNPA 3B1FA 4IJVA 5IF3A 5F5NA 5HBRA 4XZ3A 2VNAA 2BMAA 4D44A 4J4BA 3PWSA 2W8ZA 4JJIA 1JU9A 2EJWA 4S3MA 3GNTA 3W8DA 1P1HA 3KOUA 4II2A 1Z75A 3OA2A 5C37A 2I3AA 4YACA 1I3LA 3ICCA 5EL0A 3DOJA 2I6TA 1HKUA 2ZATA 4WASA 2ILTA 1FMCA 3CMMA 2J5KA 2NU6A 5AOVA 1IY8A 2PD3A 3X2FA 3WMWA 4BNZA 1E6WA 1MX3A 4Y98A 4CM7A 4CUJA 1DSSG 1GUZA 1PS8A 1IZ0A 1H94A 1LXCA 1YJ8A 3JD3A 1GYQA 4MIYA 1B26A 1QORA 5ES3A 2NVUB 3JQ7A 1XKQA 1O5IA 2IXBA 4WCFA 1U2DA 4ALLA 2J5QA 1VLLA 3FI9A 3KYBA 1EBUA 3L07A 1KYQA 1U8FO 4JK3A 5L4SA 4FFLA 1I10A 2HK9A 3WTBA 5K6AA 2Y1OA 4PVDA 2I3GA 1P1JA 3VZQA 3KLMX 3H3FA 1E1MA 3BXXA 5BSFA 5DULA 3G79A 3GQVA 5JSFA 2GCGA 2C0CA 5G0VA 5MDHA 1NQ5A 1NXQA 2JCVA 4YJGB 1KC1A 2I9PA 4IJKA 2Z1NA 4A26A 2GZ1A 3DBHA 5T5QA 2E37A 2J3IA 5AYVA 5KJFA 1KVSA 4PG7A 3OJOA 4UUOA 1EE2A 1I2BA 3GFGA 1V3VA 2UV8A 5TSDA 4GX5A 1LRJA 4MDHA 3X2EA 1Z74A 4OSPA 4MKXA 4BIIA 3RU7A 3C8MA 3TL2A 3F5QA 1U8XX 3PHJA 5F1PA 1NQOA 2JFGA 3WYCA 3GPIA 1AXGA 4OOFA 1A71A 3ZN2A 3EVTA 1PIWA 3VPSA 1C14A 1ZZEA 4D43A 1BW9B 4GX1A 1LC0A 4PLYA 1E7YA 1XEAA 3KSUA 3OIDA 3G17A 3ADPA 4U5QA 2VHYA 5A9RA 2O3JA 5G4KB 3H4VA 3ZDFA 1B2LA 1UP6A 4FFPA 5B4UA 2YYYA 1KVUA 4PRKA 1R4MA 2J8ZA 3M1AA 1E6UA 4XYGA 5JYEA 3V1UA 2NTNA 2B5WA 4IIUA 4AG3A 1M66A 3C24A 5TJHA 4CQLA 4WECA 1DC6A 1PJ3A 3Q11A 3QP9A 4CMGA 1KVQA 4Y6RA 4R1TA 3NJ4A 1KVTA 3ZV6A 2X22A 1B7GO 1NM5A 5I7EA 4ND3A 3RKRA 2O2YA 3C1OA 1B8PA 1NASA 2C2XA 5IJZA 3HADA 2J6IA 3BHJA 3DAPA 1W73A 1GL3A 1CF2O 4L74A 4CLRA 2TMGA 1J0XO 1WZIA 4FFRA 1Y5RA 4O5OA 3H5NA 5ICMA 2G1UA 1XIVA 4LRSB 1SO8A 1PR3A 2PGLA 4RL6A 2QYTA 1RM5A 5LDGA 3PHHA 1N7GA 1E7WA 2BLLA 5B1YA 2XOXA 3OEWA 1UP7A 2DBQA 2Q2WA 3WG9A 1ZEJA 3VTZA 2WSBA 5JAQA 1WMAA 4CM8A 5TIIA 3SVTA 3TDKA 2X4GA 1HLDA 1DC4A 2B37A 2HKIA 3INTA 4B3HA 4OSOA 3DL2A 2RCYA 3GA0A 1KERA 5EQFA 3WGOA 1GUYA 4PG4A 2H9IA 4YXFA 4LISA 4PN3A 2VT2A 3PDUA 4GX2A 3T4XA 4BNVA 3PPIA 1SBYA 4YQYA 5CDGA 5KVCA 5I7FA 2YDXA 3OJ0A 4S1VA 3RBXA 1PQUA 5KVQA 4D41A 1QKIA 1P44A 2W2LA 4PLPA 2AE1A 3H9JA 2O4UX 1B3RA 4BNJA 1P3DA 4BV9A 2QZ9A 3GEGA 4LCEA 1R0KA 5JLAA 1SEPA 3E48A 1KEVA 2Q1TA 1ZK1A 3QWFA 3GZNB 2JJYA 1PJLA 1UP4A 1HDGO 1UR5A 3LQFA 5GY7A 2I65A 1JWBB 3RWBA 4DA9A 3WBBA 4A0SA 1C1XA 2WYUA 2YHIB 1AN9A 1QXSA 3A9WA 3WGIA 4AJ2A 1YBMA 2FR0A 4RVSA 1G1AA 4CMJA 4FCCA 3UCFA 4GMFA 1FK8A 1YH3A 4OHUA 2H5LA 1GDHA 2CFCA 2C07A 1I01A 1QG6A 2DFVA 3PYXA 5CDUA 2IZ1A 3WIEA 2VYVD 4NFHA 3LVFO 1RYDA 2NADA 1UXJA 2DPHA 2CDCA 1Z6ZA 2VUTA 1DIHA 2OZPA 4MOWA 3GHYA 4NK4A 1MG5A 1DFHA 4OAQA 1VSVA 4R9SA 3H65A 3V5NA 3SEFA 4GWKA 1OOEA 4E4YA 5L51A 3NJ8A 2O7SA 5EERA 1TEHA 2NWQA 2YQ5A 2PZJA 3ZGYA 4DIBA 1ULUA 1N9GA 3R6DA 2JHGA 4CJXA 1R4NB 2AMFA 4RPKA 1FJHA 4ID9A 1DOHA 1VJTA 1YDWA 3FNFA 4GLOA 4NI5A 4WLUA 3F46A 3PI7A 3I9OA 3VH3A 3FCOA 5JC1A 4XQCA 3DFZA 1WVGA 3WXBA 3D4NA 1ZSVA 4AJHA 2GERA 2GF2A 3OEYA 3EZYA 3HB4X 3H8VA 4DQVA 5DBFA 2OBNA 4E2YA 2B69A 1E3EA 3JQFA 2XF8A 1RKXA 1BXGB 3QVSA 3FBTA 4CM4B 2PD6A 3W6ZA 2A35A 2FR8A 1DHTA 4IMRA 3RCBA 5A3JA 1H93A 3VDRA 5BNTA 1GFSA 2CVOA 3PIIA 4XIJA 1LC3A 3H5RA 1KOLA 1MUUA 3KV3O 2AE2A 3WYEA 5IFLA 4IQ0A 2ZJ0A 3ZWYA 1HF3A 2EERA 2NU9A 4CQMA 2O3QA 5LCXA 3DBHB 3HG7A 1KC3A 2Z1MA 4CM5A 1XCBA 3BTVA 3NGLA 4I5FA 4J4HA 4RVDA 3AI1A 3P2OA 1X0XA 2CF6A 4HFRA 4GI2A 2PGJA 4F3YA 4XGNA 1M6HA 4RJTA 3QY9A 1B0AA 3GH3A 1BRMA 2ET6A 2PFGA 3I9LA 4MVJE 2HMSA 1I30A 4XYEA 3E8XA 1XU9A 5B12A 4QO7A 5GZ6A 5HA5A 5CG2A 4O6VA 1MV8A 1I33A 4YA6A 1R37A 4WLEA 1C3VA 2DBVO 5JY1A 5G4KA 3ZU3A 4Z0TA 1AE1A 4DXHA 3HN7A 2BELA 1N2SA 3EZLA 4OXYA 2RHRA 2AXQA 4WUVA 2A94A 5T64A 3W6UA 2O3UA 1W4ZA 3DBLA 4WE3A 5AXAA 3W8EA 4CMIB 3LC1O 5AVOA 4II3A 1ENPA 1PGPA 5A06A 4RDHA 5C7OO 3GZNA 4TKMA 4JLWA 4CMAA 3SJ7A 5ITWA 4DLAA 2D2IA 2G5CA 3I9KA 1O9BA 2GR9A 4RPJA 5BT9A 5C5IA 1ZK3A 3ZW9A 4ZRMA 2Q49A 2QX7A 1WP4A 4MPDA 1IZ9A 3PFWO 4EJ0A 2YZ7A 1KY5A 1NP3A 4XJTA 4UVEA 5TLSA 1K5HA 5DCUA 5EMHA 1NWHA 5DOVA 5B4TA 1WAMA 4DUPA 1W0CA 1XYGA 4J2OA 1GADO 5AXDA 4CR7A 1X7GA 2BI8A 2C59A 2ZB3A 4OYRA 3RC2A 3IP3A 4OQYA 3PYLA 4IPTA 4ZQHA 1GZ6A 5H82A 4BO4A 3JD2A 3VTFA 3AUSA 3LZ6A 3KEOA 4DQUA 1RM4A 4MVJG 4R1NA 4E0BA 4FD3A 1J6UA 2HJRA 4JROA 2GO1A 4RO0A 1P74A 1WLYA 4JIGA 5GZ3A 1YS4A 2X5OA 3A06A 2TMDA 3IDSA 3FSRA 3PYMA 2AHRA 4IDAA 4ESOA 4EUHA 1LRLA 4E5YA 3HFSA 1JN0A 1WNTA 4R9RA 4H3VA 5JAMA 3ORFA 1GEEA 5AXCA 1V8BA 1Y9EA 1A7KA 1HRDA 2OFPA 3U0BA 2WD7A 3B6ZA 3PJGA 3Q1LA 1ENYA 4ZHSA 4YJFA 3F4LA 5CPFA 1LX6A 2DTEA 1ZEMA 1AHHA 3WTCA 2YUTA 3VC7A 1MG0A 4BKRA 1PL8A 4DRYA 3AK4A 3U5TA 1FXSA 5AQ1A 4RF4A 1YXMA 4AJNA 1Z45A 4UUNA 1NVGA 1LBEA 4J1QA 4GH5A 4ZJUA 3EYWA 1Y8QA 4XB1A 2JFHA 1FDSA 3C7CB 4LRTB 4Z3KA 4E5NA 5JMPA 1P9LA 2JCXA 8ADHA 4D7AA 3ENNA 4L4XA 3ROKA 3JTMA 5IN5A 1HXHA 3DEYX 4ONEA 4K6CA 1C0PA 4Y8VA 1QYWA 3OF2A 3OFSA 3RUIA 3BMQA 2V6BA 2VTDA 4MVJP 3A28A 3MWDB 2XAAA 2EWMA 5CPBA 3WS7A 1U7HA 1YB4A 1YWGO 3NYWA 5CG1A 2FPIA 3QVWA 2FMUA 4PZDA 2Q1WA 2CMDA 4G5HA 3H9GA 2A9FA 4J16A 3OICA 4L9RA 4DWVA 2HRBA 2B0JA 4TROA 1NPYA 3NDIA 3GHHA 1V6AA 4XYLA 4DBZA 4NZ9A 5JMWA 4E5MA 4M49A 4HUJA 4JGBA 5MGBA 4ZRNA 1ENZA 3WOHA 4BO7A 1WW8A 4AVYA 4PZEA 4XIYA 5JC8A 2PGDA 4OXKA 1HWYA 3RUDA 3W1VA 3H9UA 1J49A 4DQXA 3QWIA 2ZTLA 2VHWA 4B79A 4J7CA 1YBAA 3W8FA 4KTVE 1VRWA 4D46A 2AW5A 1Q7CA 3K9QO 3TF5A 4M55A 1CERA 5IN4A 4A7PA 3V1YA 1BXKA 3WGGA 3AI3A 4U7WA 2PR2A 3L4BC 2I76A 2FN7A 3PQFA 4F46A 3BHMA 2DQ4A 3QWHA 4NG5A 3WMXA 4NJMA 3VH1A 4CUZA 3FTNA 2JD1A 4B3JA 4ZQGA 1LJ8A 4NH4A 1HDXA 3DO5A 5KJCA 3V2GA 1PL6A 1T25A 2HQ1A 4RPLA 2WDZA 1T26A 3JYPA 4P22A 4R41A 4HV4A 3DZBA 3NDJA 4YWJA 1HETA 1D7OA 2Q4EA 4NQZA 2ZJ1A 1R12A 1PGOA 2O23A 1UXKA 3ULKA 4NMHA 1GV1A 4JBHA 3ETDA 3JQAA 1I36A 4U0KA 4ALKA 3F9IA 4YAEA 2P68A 4YAIA 1EUZA 5CDSA 4NBUA 4HADA 3GY0A 1JKIA 3GVHA 3ZWCA 3H9EO 1UXIA 5IAAA 2DC1A 3CPSA 3OQ6A 4JBIA 4B4VA 3AM3A 3IP1A 2UUPA 5TT0A 2LDBA 1NFRA 1HDOA 5I8ZA 4QEDA 1PQPA 3TZQA 4CM8B 4Z6KA 1K6XA 1R6DA 1DIAA 4NDNE 3ONFA 1F8GA 3ENKA 2ZYGA 1N1GA 2GGSA 1ARZA 3BMCB 2P9GA 5KVSA 2EGHA 2WEKA 3F1LA 1OMOA 3PRJA 1PSDA 1YL7A 3G1TA 1NBOA 2G0TA 5A9SB 1EVIA 3GUCA 2X0RA 1JW9B 1QMGA 2DKNA 4YT4A 7ADHA 1A72A 4CM3A 4AFNA 3DFUA 4LK3A 2CNBA 1B15A 2C54A 3S2FA 2Q3EA 4KOAA 2PLAA 4XGKA 1TA4A 1E7RA 1T2CA 3GGGA 4I1IA 3GDGA 3EHEA 3HDJA 4F45A 1GAEO 1Z7EA 3GOHA 2G17A 1WXDA 4NU5A
chains in the Genus database with same CATH superfamily
4O3FA 1GQFA 1EK0A 3LKBA 4TKUA 5ENVA 4YP1A 5TX7A 3ZZTA 4YK7A 5K1ZA 5JYCA 1UKBA 2WK1A 3AXTA 3GJTA 1FSZA 3WNZA 5REQB 4I5EA 1EUDA 2Z2XA 5B64A 4QVGA 1OJ7A 2QMEA 3U4HA 3MRVA 3O9ZA 4UD2A 3BUSA 3EXAA 4D8XA 5CNIA 5L3VA 1TO6A 2BPOA 2HXSA 2R8XA 4DA0A 1IUKA 2PT9A 4R5MA 1ZBQA 2X2OA 2Q21A 1GZVA 2XZOA 2BBTA 1FS5A 2AEFA 3GJ8A 5FOTA 1JPJA 1R15A 2WD7B 4MQEB 4CG2A 1XL0A 5BSWA 2QXTA 2A5GA 2FEWB 4X97A 2AUTA 3SYTA 4BC1A 1MU0A 1XTPA 3RNOA 3EDMA 4V1CB 1WRBA 1N3BA 1SPXA 2HCJB 3FE2A 4F3TA 1ZVJA 3IT0A 3FTQA 3T7RA 2FV8A 1D2AA 3ZU2A 2B2NA 2X0KA 4QUEA 4AYXA 2YCLA 4MVJI 3W9BA 3EMVA 4OJNA 2AI1A 4QSHA 2PGOA 4PTZA 3NO4A 4EZIA 2CSXA 2WM9B 4JKOA 4YAFA 3COSA 3BRSA 1YB5A 5CW1A 1JSCA 4RF2A 2HSZA 5JRZA 3ADOA 1T4BA 2HBQA 3P2EA 4JL8A 1AUQA 4RTRA 1E3WB 2VRNA 1QFJA 3ZEIA 3J7AC 3BZBA 1LX7A 3A8TA 3GRCA 3S28A 5LU9A 1XWFA 3UKDA 2UYHA 3BGDA 4JODA 2D0OB 4ZU6X 4O2AF 4MUGA 2JZOA 5CB4A 4HVAA 4ZOLB 4YCSA 3OLYA 2O59A 4P8RA 5CYFA 4NE2A 5I7VA 1P1IA 3CNEA 3GP3A 2JJ1A 3VDNB 3PT5A 3UQYS 4IH1A 1NZDA 3MGCA 4D6XA 1SULA 3AUUA 2WUDA 3STYA 3F3SA 3JVEA 3N5KA 4IG4A 3ZHVA 1UKCA 1SHTX 4IXNA 5LQMA 2NZYA 2D54A 4L7QA 3CINA 4FOPA 4UVHA 4DGQA 1FLVA 3LYLA 4LSGA 3OEHD 1OGYA 3SQDA 3WQHA 4XWTA 2D1YA 2ZAIA 5G3YA 1K4MA 1L7EA 3ELWA 3IJRA 4UKDA 2W90A 4ZYUA 4AY2A 4G65A 1QP4A 2Q5CA 2VF4X 2QWXA 3B9QA 1NONA 3JZIA 3QU9A 3SK0A 4MJLA 1T3LA 1UBEA 4R2MA 2RHGB 3RWMB 2E6KA 3VHRA 2REOA 2JEYA 2AZDA 3LCJA 1JDZA 1B6SA 1WM1A 1XNGA 3DHEA 1S8OA 3OKPA 3OY2A 4QLBA 1M2OB 4Z1OA 3KC2A 4CKEA 3EG5A 3ZD7A 1HNWB 1C5KA 5A4KA 2ZWIA 2RC6A 3NHRA 3OZTA 1R5NA 2EATA 2WHPA 4MVJA 1TGYA 1Z7GA 2HA2A 1XTTA 1U4OA 1HE1C 4L22A 1WVIA 4FS3A 5L95A 1W9HA 1FFDA 1XXLA 4NJEB 3W3AD 4R4JA 4DDKA 1WNFA 2NU7A 4KIJA 4XFJA 4I81A 1OX4A 2NNLD 2PH3A 4X0EA 1V16B 1Z8DA 1MC8A 1N3LA 4JX8A 4JFRA 5HF9A 5BSVA 1FLAA 4RORA 1OUMA 4UMEA 3BQ9A 4IJ5A 3N58A 5IC5A 4UM9D 2YICA 1DUVG 4Y9UA 5AK0A 3C97A 3OEEA 3HEMA 5JH7B 5TS3A 3BC1A 2P4HX 3RYIA 3UMJA 2PDAA 4S1WA 1BGWA 4TSKA 4DLXA 3BAFA 3RC8A 3ZHUA 1AM4D 3L8DA 4KFSA 1DEAA 2QZZA 1A5TA 3T3DA 2H2AA 3II6X 4MMYB 3RLIA 2WU8A 4MVJH 2P9FA 4KWCA 4WLOA 1R9GA 3S99A 3U7GA 3CX6A 1IHDA 4J0HA 1UM9A 5BYBA 4C7BA 2ORIA 4KO3S 3HCWA 2QW0X 4B76A 2HLDA 5BWBA 4K2AA 2A4MA 3CYFA 3O8OB 3NUZA 3DLPX 2ZTHA 3VI4B 3V8EA 4CM1A 4GNKA 1QVWA 2PL5A 3SSNA 5LQDA 1A5AB 1OFTA 1XRSB 2FPRA 3FNHA 3K2BA 4LMBA 1RAIA 2GLUA 1NRXA 4MR7A 4ZO9A 3N86A 3KYDA 3QXHA 1E5XA 3IV6A 1PR9A 2IZOA 2I78A 2KW5A 2NXCA 3AEQB 2IIPA 3KEQA 3SKXA 4F8JA 4PN7A 3PQ5A 1GPKA 1WUTA 6YASA 4A0HA 2E4VA 4LYEA 2Y0DA 4Q7JB 4FBMA 3V8PA 2QTHA 2IXGA 2NZJA 4NMXB 4HXEB 1T2AA 1LEHA 3DE1X 1T8UA 2BMJA 1M2VB 1WQ4A 2CL0X 2R48A 1E92A 3OX1A 5LBTA 4B3MB 3L9WA 2FZKA 1JDPA 2APJA 5AKLA 1FSSA 1IHUA 1SELA 2D5IA 2RK3A 3DBRA 3IJEB 4F6LA 1CF4A 5C51B 1FZTA 4ECEA 3AEUB 3Q7IA 1ZNYA 1Z5UA 1ZWKA 3QFSA 4GR9A 4F6CA 1IULA 3PVZA 3A37A 1O58A 2NT3A 2H2DA 4G2NA 1E2PA 2A5FA 1RVV1 4MYTA 4HQOA 4YJFB 5FWNA 1JYFA 1CRQA 4GBMA 5FX2A 5DGXA 4RMJA 1M1ZA 5DXJA 3PTAA 2DULA 4XVRA 2ZYHA 1TRKA 1BQEA 4DQKA 2PSHA 4RK0A 5CYGA 3C5CA 4F1KA 4OGLA 2QYOA 1MW9X 1QGDA 3PDJA 4YPOA 4JXZA 3T3GA 2EFHB 4ZVLA 1E3TA 3NT4A 4YRJA 2YV2A 2H85A 1BQ3A 1X14A 2ZJ8A 2R8YA 3EQ8A 2CKMA 3KKQA 3QEMA 3X1MA 3UMYA 5E3IA 1L5HB 3H4TA 1EWQA 1BHJA 2CNDA 3QKIA 2OZEA 3M4XA 1FVOA 4KLCA 2C58A 2Q5QA 4CEHB 1Y1PA 3F74A 4QE3A 3FG9A 4AJLA 3KYCA 5C80A 4DR3B 5T4HA 3S2GA 2BAGA 1I9CA 1P5JA 1VYHA 2VJNA 3OOYA 3SM9A 1K6EA 3PCXA 2QJFA 1FU4A 3CEMA 3ZBQA 1AGYA 3ONDA 4EFMA 3D1LA 5BVGA 4DR6B 1W29A 2G1JA 1SBCA 2OCIA 3GBPA 1PFQA 3QLJA 5C1PA 1TM7E 3D0OA 1XQVA 2EFJA 2PRSA 4RVCA 4C0AC 2W2QA 5B4VA 4OA8A 4GMDA 1R88A 1TQ8A 1ZLXA 4W9NA 3MT0A 2H4YA 2BKAA 1NR1A 3IP9A 1XPJA 2WIBA 4BVBA 3U48A 4X65B 3WWYA 4IP0A 5DVZA 2YWCA 3HKDA 3IEVA 3FDZB 2CN1A 3N76A 5GZ1A 5F52A 1GTZA 1SQ0A 3S5JA 1AUVA 1H2HA 1AMNA 3HHEA 4HI0E 1M7GA 4UULA 4EGJA 2Z56A 2BMVA 1QLHA 2QQEA 4GPD1 4ZHQF 2CDNA 1EWRA 4MUAA 3AETA 4FIDA 5IANA 5JNWA 5JZOA 3H2YA 5C32A 4BAZA 1FUYB 1Z47A 2GDZA 5JAPA 4GI3A 4BQOA 4R5HA 2UVPB 1KFEB 1FFCA 1L4YA 2QTAA 2XPCA 3HBMA 3K0CA 2V97A 2ZIUB 3WHIA 4G25A 4F3CA 3CVVA 4LVUA 4I9NA 2GT1A 2OAEA 3LLSA 2SCUA 4O2BB 4MIOA 4DCUA 4WFKA 1G21A 1D2MA 2AVNA 4FFWA 4RXTA 3EUWA 3WICA 4BBAA 4ZI3A 2H92A 1W44A 1P3JA 4Z9FA 1MC5A 4ND6A 1VMKA 1S1CA 4R9UC 5EHIA 4YREA 1X1SA 3TXXA 2ZRFA 2NGRA 2FHSA 3UOGA 1HGXA 1GD1O 2QTNA 3C7DB 3T1OA 2RH8A 3I83A 4N5NA 2X9VA 4RPGA 5DWVA 4KPFC 3M6XA 3MJVA 1IUOA 2AC7A 2H8GA 2C97A 1L4EA 2H29A 1M67A 4OATA 5EQJB 3SXJA 2ZSEA 4EYEA 4YUWA 1NYTA 2IVFA 1OH8A 3WNBA 3T3OA 2XUPA 3G0DA 1O95A 3I23A 1SBHA 2YYZA 3ACDA 3TUIC 2AOUB 2JJQA 5P8WA 1X1QA 2RBKA 1G291 1TVKA 2B5VA 1Z7WA 2Q5IA 3LT0A 5JI3E 1KGSA 1TUGA 2Q29A 2R66A 2FRXA 1BSVA 3HO8A 1NXVA 2DR0A 2V7WA 1V1RA 2NO4A 4N5MA 5BSHA 2QN3A 1XUOA 1A9XA 1I0ZA 4CL0A 4R3NA 1K92A 4BMCA 3KLBA 2EKBA 4JUCA 3QF4A 2QRZA 3A2NA 3RFUA 4B4WA 2IF2A 4QDTA 4A2QA 1H1LB 1OASA 2I71A 5A3RA 3QX3A 5EXSA 3MRSA 4DZTA 1U5BA 4OGGA 4PG5A 1JQEA 4RKYA 4DIUA 3CNHA 3K6SB 3M7IA 2V8BA 3NBUA 3OVMA 1GFIA 3T99A 1V71A 2PX6A 1TB4A 5JYBA 3D4LA 4YAJA 1IJFA 1VTKA 3EXHC 1KYXA 3L6EA 1QQ7A 3ABQB 4GX0A 2N47A 5J5AA 4C21A 2BTQB 2C3YA 4KIUA 4RU1A 1I6LA 1WB6A 4KNYA 3AU9A 4F2PA 1DC3A 2ZB7A 1LQUA 3VPFA 2WLTA 2Z3VA 1X38A 1E5TA 3BWYA 3SX0A 4L4ZA 1DG9A 3CQ9A 3UICA 4BO2A 3IR7A 3H16A 1SXHA 1J97A 2VN8A 3DE6X 3ODPA 5JG7A 1H6DA 1I3MA 4MRSA 2WWRA 4NPCA 5TARA 3ROTA 4XE5A 2PZLA 1UJBA 4PLHA 3I0ZA 1NT2A 3HVJA 4FHFA 4TZTA 1WVMA 2OGZA 1W4LA 4Q7LA 4ZPXA 3WXMA 1SEVA 3KAKA 3RTGA 1CQZA 4IM7A 1UOEA 3AU8A 3K1AA 1NY5A 1AC5A 4Q1EA 2VDLB 4MWSA 7MHTA 3LP5A 1U2QA 4BB5A 2HMWA 2GHQA 1H6AA 1JI0A 2QIOA 2Z4TA 3T7DA 2QLJA 4MLPA 1ZVMA 1KYVA 3HY3A 2IZ5A 2JGMA 4Q1BA 4QFCA 3TR5A 3RSZA 5I48A 3OCYA 5DBHX 1VA4A 1B1CA 3EEQA 3GIDA 1LS1A 3RSSA 1XRNA 3BHNA 3ICOA 1G3QA 2RGWA 4P6VF 4WZBE 3W79A 3I61A 5LA6F 4MDEA 2POQX 4B7CA 1U8EA 1XEXB 1PG0A 3BKWA 1X94A 2HSDA 3JQ8B 4NEHB 2FE1A 2IHTA 1NT4A 1N6KA 4R8KA 3AOEC 1A9RA 3B1JA 1NBME 1HYQA 2NVWA 3L4BA 1I7PA 5F7ZA 2IIQA 4F4HA 1K63A 1V8PA 1QTIA 5EXXA 1QF6A 2J32A 1EVYA 4UJ3A 1VCIA 4YCAA 5E6UA 4C7OA 4E70A 4D4JA 5A3VA 1D2CA 3RSCA 3R6LA 4HDAA 4BQNA 1PEKE 4DMHA 1W36B 2VSNA 1JIIA 4YC7A 4O29A 4RHTA 1W2WB 3AL2A 2R8ZA 2EGGA 2NW6A 2GN4A 2GPNA 4ZAYA 2DERA 3U3OA 4CL3A 1MO3A 3QQ5A 5AJTA 4XB2A 2BISA 3ND5A 6ADHA 5EWJA 2IYAA 1ABFA 2AZTA 3G1WA 3FMFA 4F7DA 1CQXA 1IPFA 4L1KA 2MYPA 4OMCA 1EXVA 4BXOA 1ZD1A 2IPAB 4C0SA 4TMFA 5IYZB 3O4IA 3MMXA 3V7UA 4A2WA 3BJMA 1KJJA 2AX4A 1LU9A 3D6VA 4LNHA 4R1QA 3OQMA 3HWX1 5H8WA 1E7QA 3OAAD 4OQPA 1WW2A 3PFNA 1EJ6A 3EVNA 4P7JA 4XEHA 4P31A 4UFOA 4QVIA 1F2TB 1WB9A 2I55A 3VZPA 4AWXA 1Y5IA 5KYVA 4DMFA 4AJKA 3C3EA 3KKKA 3SYLA 4D9MA 3WNQA 2XBMA 5EG5A 2CLKB 3REQA 1GL6A 5CJ2A 1P4GA 4BLTA 4G0UA 1YDHA 3QW4B 5BWLA 4C7JA 2C2GA 5AVKA 2WZDA 2FYTA 4RPHA 5LZ8A 1R1DA 2P5YA 2REQB 1A8HA 2VZ9A 5FCDA 4CGYA 1A8UA 1CIVA 2CXUA 3QEAZ 3UMCA 4OHVA 1N8KA 1KSGA 4HT3B 4N49A 4Z4HA 2FG5A 1KO4A 2BKVA 2PMBA 3B9PA 1XJQA 4LRXA 5DHTA 5K51A 1Y1QA 3DMRA 1BJTA 2V45A 3GVCA 3L0YA 4M2LA 3A7EA 4M8SA 4RVGA 1H4SA 3DKKA 5L9AA 3ZD8A 4KMRA 3LCRA 1PGNA 1E9BA 4OJMX 4U2BA 2CVQA 3VYTB 4CMBA 4TTJA 4JQCA 3DZJA 1BGVA 2YMLA 2PLNA 3IEPA 3IHLA 4KQJA 4DMMA 3RJ5A 4JLAA 4PYLA 4AULA 2XYVA 4BE9A 4PC3A 4NPAA 2NV2B 5B5SA 1BJRE 3ZE6A 3NEYA 4G0MA 4QUJA 4BLWA 1T6YA 3JVDA 1EZ4A 1YJXA 4ISBA 4UM7A 1DBVO 3IAS6 3HU3A 1W0JA 4JHLA 4CQMB 4PYJA 1NNSA 4IRMA 4JYBA 4BMVA 4CG0A 1GRNA 5LNK1 4B6OA 1BVRA 2NUAA 1N33B 2BFAA 3BDAA 2HNBA 5CM8B 4EO9A 5GIOE 3B5JA 3BBLA 3MJTA 4JCOA 1ODJA 4QBGB 2VJOA 1Q3HA 2NV6A 1IHXA 2PX3A 4GI5A 4INJA 5LLSA 2WJWA 4BVKA 3KXDA 3WY9A 4EVSA 1IQUA 4Y1GA 4V0OA 1EFKA 3R7SA 3MUEA 5GMOA 2QVLA 4X1IA 1XSEA 2G6BA 4JXKA 3W77A 3ON5A 5HCNA 4QOHA 5BQ5A 3PD0A 5EZ6B 4XFKA 3PRYA 3C4QA 4BQFA 3TOXA 2PGAA 1AUOA 3D6UA 1LTHR 4Y2QA 1SJ9A 1XGKA 2OD9A 4HD8A 5ALWA 3S70A 5CFNA 2WTAA 4L6AA 4K8RB 4O0MA 3ER9A 4RD4A 4BNHA 4EPWA 2O5RA 3NWEA 3H1EA 3Q9UA 1GA6A 3ZU4A 1NBHA 4ZOEA 4AY3A 4ZRDA 4YJ3B 2XTJA 4U39A 4CCSA 2IP4A 4WGGA 4TVOA 2MR5A 1ID8A 2JVIA 4MW9A 2RHOA 4FUTA 3Q8WA 4OBWA 3L4KA 3BQMB 1NULA 1O94C 2CZQA 2FUG6 2AHOA 3L7DA 4L8GA 2B8NA 5D85A 5K0EA 2IHKA 3JRXA 5FWDA 3WFIA 4BO8A 2JGJA 1E99A 1CDZA 1ZUNB 1E0DA 1RQ7A 4IFIA 1KI7A 3GLFA 4MV8A 5KTMA 3ICQB 4JYMA 5BNFA 5A7FA 3FOCA 4K6MA 4XYBA 3U49A 3TI9A 5HQ3B 2D3TA 2XRFA 3HRHA 5EMJA 2WKWA 2QW8A 4I9UA 3PX7A 1D0SA 1NYQA 2DZDA 4X6XA 2JB9A 2OBYA 1SXJD 1QHIA 1XQWA 3BYZA 1Q7TA 3VJKA 3FZEA 1XL1A 2NUBA 1PK8A 3T5CA 3ZWNA 4ALNA 2YWBA 1XCMA 4AY6A 2IY7A 4MAMA 4HOYA 1EVZA 4H4DA 4GPIB 2OENG 1DEHA 4KXNA 3N8NA 2Q6LA 2ETXA 1VB3A 3CX4A 3QOYA 2X58A 4GMKA 2GSDA 3CSSA 1NQTA 1KEWA 1OWLA 2FWPA 5TLSA 2WD8A 4GPTA 2Q5JA 1YDMA 1WQ1R 4LRQA 1BDIA 2VHQA 5DBIA 1WR8A 1U0GA 1Y34E 1NJFA 2V74B 3IVXA 5BRJA 5HIAA 2YY6A 1FQKA 1G8MA 4CM9A 2ID7A 2PUTA 4U2EA 2EKLA 1C3OB 3C0KA 1XELA 3CS3A 4R2IA 5ERXA 5BV8A 4RYLA 5K3BA 1RHUA 3PQCA 3MIIA 4ZZIA 1XD9A 1LBIA 3OESA 2ACVA 2HLDD 4Y2TA 4MX8A 1MOSA 3S40A 3SJZA 5JVDF 1W36D 2G07A 2VKTA 1W94A 2WVAA 4RGVA 4E6PA 4YDHB 2Q3BA 1Q5PA 4WPGA 3UF0A 1PI3A 3V8NA 2OBBA 2DWUA 3TMYA 3RJMA 4D96A 2PMDA 4J1TA 1ORRA 4QFDA 2YFKA 5HFJA 1ZAYA 2YOGA 3UJPA 3K94A 3R8CA 2DKOA 4TV9F 4OHBA 3CF0A 2VDQB 3L4SO 3BTOA 2HIGA 5AI0A 4Q47A 5E2AA 1G66A 1ZD8A 2GWHA 2CT8A 1LDYA 4QBTA 1WW3A 1TM3E 4PF1A 5D7BA 2BFPA 5AT1A 5KPDA 5I8PA 2Z5VA 4UOEA 2HA6A 2GK3A 2PU7A 3SEZA 3K9BA 5AFSA 3R0QA 2G9ZA 1UDXA 3DC7A 1L9KA 1P91A 3H2ZA 5EJFA 4JEMA 3I45A 1WCIB 3OT4A 1VHWA 4TVBA 3IMGA 4KR6A 4IYRA 4JVNA 3PNMA 2VNHA 4LMPA 2QORA 2IYWA 4XWGA 2GUGA 1GILA 1VCNA 4MV7A 2W98A 1I32A 1ADFA 1RHRA 2PY6A 3EB9A 2ZS9A 3M82A 2QGFA 3E22B 1YQ9A 3C6XA 4XIFA 3SC6A 2ZLBA 1X1RA 1I6KA 3FIJA 4IJUA 5KYYA 1N36B 4DBLE 2DECA 4FT2A 4RHXA 3OJCA 2F1HA 3QIAA 5IJAA 3SIPA 3MSCA 4NQRA 4D4LA 3F49S 1UOQA 2YC2C 3FNRA 4IINA 1CQPA 5F4ZA 1U1IA 4N5LA 3ZJTA 1C7JA 4F5DA 4YMGA 1S6YA 3EEOA 2UUAB 1HZZA 3EMBA 1Q77A 2JEZA 3CLHA 3W4KA 4K9PA 2NZWA 1WKVA 4MS4B 3UPTA 5D84A 1A82A 3HM9A 3NTVA 1C7RA 2QUJA 5FUYA 1T6XA 3WI7A 2ZE7A 4F9GA 2P77A 1QHGA 2OORA 3A9UA 3DDSA 1EINA 3AHIA 4KGXA 4UDNA 4WY8A 2WJVA 3RVRA 2CV2A 5BN4A 5I9TA 3R7DA 3TW8B 1L5FA 2NO7A 3GRZA 3NTRA 4YH1A 2K2QB 2HRZA 3UAWA 1GCAA 5EMNA 1YBHA 5TQ2B 4MQBA 4KQIA 3GRUA 5BW8A 3PUJA 2HHJA 2ZJFA 2O2ZA 2GEJA 3NHMA 1V96A 4JBYA 1XK6A 1LQ2A 4K6FA 4RHEA 5AJUA 4CCYB 4JP3A 2VEOA 1E3MA 3DDWA 3EAFA 2JLCA 4DMRA 2REQA 4BKUA 1B8OA 2PL3A 3D5TA 3KK0A 2R7AA 2VYVA 2BMEA 3BK2A 3SQOA 4DIFA 4JLNA 1JX6A 3P9CA 3ZWAA 2EP5A 2JGFA 4OQFA 5TRTA 3Q3CA 1ZQ1A 3TD2A 1REQB 1XEWX 3T3HA 3U1TA 1CR1A 2WPDD 5EHGA 1KDPA 5TQVA 1Y81A 2I1WA 3B5EA 5DNWA 1XZIA 3ZCTA 3GJSA 1SVKA 3N6VA 1BYUA 1EP9A 2CDBA 4QYSA 3PIRA 5TPWA 3EOBI 1CVLA 4R8SA 1ZRSA 3B3GA 3RGGA 1GTMA 4KFCA 4A73A 3FNIA 4PPNA 5FNZA 3WWDA 3ZW8A 4IDNA 3FCUB 4D98A 2RGNC 3DBIA 3VKHA 1RYNA 2VCYA 4HGQA 3WJAA 3DHYA 3D3WB 4H15A 2V6FA 3CX7A 2FMIA 1F38A 1PJQA 3PDIB 4D9EA 1GPAA 2GXSA 1JHYA 4BFWA 1KEEB 2HW8A 2W4IA 2V7XA 2DWPA 3LGAA 4MGKR 3C1AA 4PC7A 5F9MA 1E7SA 3QVTA 2PHZA 3DVAA 1KKUA 3E53A 2J7PA 3QMPA 4QG7A 4QQNA 5CR9A 3L5KA 1BW9A 3KETA 1BH6A 1UADA 1ESMA 1PLJA 1VJDA 3IT3A 4OLAA 4F04A 4UBIA 2HJVA 2BHRA 5KQRA 1KQFA 1TCUA 2FSSA 4ZARA 4KQ6A 3OLVA 2BUAA 5F2KA 4YMLA 3GG2A 1CQWA 1TCBA 3U3ZA 1XPUA 5LQCA 2RG7A 5JJ5A 5F98A 2Q3CA 4NV1A 1CS4C 2IU6A 1D8AA 1RYFA 1H05A 2FPKA 2WT8A 4ILKA 3VKUA 3NRCA 4HDNA 1S2IA 3RJ9A 3S1LA 1L5SA 3SNKA 3UQZA 4BU0A 1GPLA 1Y7PA 1OZFA 3GLHA 5JYDA 2HSWA 2PM8A 3KV1A 1KEZA 3Q0TA 4XSVA 2GFIA 4G0YA 2PYZA 2GJAA 3GLGB 3ETNA 5EC8A 4FLEA 2IEZA 5HR5A 1YZNA 1OYOA 4BNLA 1TKAA 4QNMA 3C7AA 1GG5A 5FYDA 4UTVA 3F9RA 2C5SA 3TDNA 1J07A 2GUWA 3RIGA 1DAEA 3WWEA 3IA2A 5DYTA 1OREA 2WW8A 2EFYA 2XT6A 3B78A 4CE6A 3HXMA 5JVDA 2Q45A 3OETA 2IUUA 5DF1A 4LJRA 5ICCA 3GCWA 5DYGA 2EHDA 2FQ1A 3UMVA 3G9UA 1CNEA 3ETLA 3NB0A 5FTNA 4B73A 3QU2A 3KAJA 3CX3A 4ZQFA 2Z4RA 4DADA 4HNGA 2BD0A 3Q7SA 3ZGLA 8ABPA 1X7ZB 5C3MA 2VT6A 2FCAA 4PPFA 2WYWA 1MGOA 1LLDA 2ZJOA 1VJRA 5DM0A 3T5DA 3OLXA 4QHSA 5FUVA 3VBCA 4FDUA 3I9V1 3RAJA 1EFHA 1EK1A 4MR7B 3ZNOA 1ST3A 3OI7A 2D1FA 3EXG1 2HT6A 5FLEX 1QNFA 1VHQA 1NQVA 2HC9A 3LLVA 4UXHA 5L3SB 1CUJA 4ITRC 1UZUA 2HU8A 3E5MA 4H1UA 4W5JA 2K7FA 4D80A 3ESYA 2VHUA 5FADA 1PLLA 1EH5A 2EOAA 3OCCA 3PV0A 1O9GA 4OM8A 4W5NA 1KRHA 1JHQA 3KSRA 4PANA 1TZBA 3ZYZA 1EUQA 4RTLA 3S2SA 1MJGA 2VPYA 1S0UA 2ZBRA 2HIMA 2JKVA 1PL0A 4HKTA 1ZK0A 2G28A 5IVHA 1R64A 5CH8A 4C0WA 3TZ6A 3A14A 3WJ2A 3AONB 1LNQA 1NURA 5ALVA 1OU4A 2JHPA 4JUBA 3EXIA 4IBOA 3L0DA 1A2QA 5LYJF 2D6FA 3A27A 2N46A 1IY2A 2FA9A 1YE3A 1GAJA 4N5IX 4D45A 3C8DA 4YECA 5FBQB 1OBVA 1SUDA 3NIBA 4ND4A 5SICE 4ASUA 1SOWA 3AHHA 3JAKA 4JP8A 1JF8A 1NVTA 1OWOA 3RR2A 3VISA 2X2FA 3AB7A 1YS2X 3TAXA 4ZMRA 1RZVA 1C9MA 2EFGA 3F5SA 3RKUA 1EM8A 3LD9A 1YFLA 4P1ZA 3TINA 4CNBA 3GRKA 3GPDG 2X2EA 1W5EA 1ESZA 3KBBA 3F1KA 3U09A 5G1PA 3Q5GA 4CF7A 2P69A 3AESA 1N2EA 1WZUA 4FS8A 4I1RA 4QPCA 3SU8A 3LBNA 4RCVA 4E5SA 2CHQA 4ETMA 4HVCA 1DMRA 2ZS7A 2UZIR 3KALA 1Z39A 4L6IA 4ZEWA 4EKNB 1B8UA 4I1PA 3LFTA 3R41A 3BWMA 4FDLA 1PZEA 4C3ZA 4LHZA 2BIFA 5JAHA 3K8QA 2Z3WA 4B81A 2H5EA 2AYYA 2JIZD 2XE6A 4ZT7A 5HCIA 2KQUA 4FKMA 4Q9JA 2EL7A 3BIXA 3HQ4O 1IE3A 5CT5A 3HVHA 4HDKB 4N9QA 4YRQA 2OWEA 1QIEA 1YJQA 4OG2A 5DM1A 2ZI3A 4BJ5A 4EFLA 4WAUA 2WWIA 2XZTA 4I50B 3VDMA 4H3SA 4BN4A 5FP0A 3BA1A 5BRNA 2CNOA 5HWSA 1BWRA 3FW1A 4F4CA 3P2YA 3CO5A 3WLNA 5K03A 1GUAA 2BFMA 5KJEA 5EEGA 1D4FA 4F2GA 1EMDA 1O95C 3OLWA 1N9GB 3AR2A 1V0JA 3G02A 1NUPA 5IKXA 5JD5A 1GTG1 1OR8A 2KSQA 3AUKA 2JS7A 4UBMA 2LCFA 1VIYA 4QDUA 5EZYA 4E21A 4EF6A 1M2EA 4G86A 3DMYA 3BMOB 3EFBA 2C7GA 1L1FA 4QOSA 3DJFA 1A4UA 2BR3A 2MSWA 2YDYA 3DTYA 2ZQZA 3W2IA 5CITA 4V1CA 5JV5A 4A9AA 1ZONA 3I28A 3IULA 3NAQA 1JSZA 3GJ3A 2BCJQ 2HLPA 3DAFA 3WYFA 2ODPA 3LHDA 4OJYA 3STWA 4ZCRA 1Z4JA 1F8UA 4QGFA 5D3QA 1LDMA 2R1TA 3SXUA 3WQSB 2EQ5A 5DSTA 2RAPA 2Z95A 2Z6QA 2G5PA 2PZAA 5I4CA 1DKRA 4CDNA 4NBSA 1KZ1A 1SHKA 4RSHA 3VOAA 4CLEA 1J33A 3C5HA 4BPBA 4DJJA 4EUSA 3TFOA 4BCCA 3MB5A 4C2BA 2I1VB 2E5WA 4YAGA 1OWPA 2QUIA 5IVDA 3CWQA 3IKLA 1K0UA 1A1VA 3A4YA 1QCYA 2ONCA 3PB3A 4GXRA 4REMA 4HAZA 1E9FA 2Z08A 3SC2A 4JXJA 1P1FA 2MYNA 2ERCA 1VSTA 2NLOA 3K96A 1M5UA 4AICA 3IVMA 3U9TA 4BQRA 2FSVA 3GPLA 1E2FA 2HADA 3ZY3A 3P9YA 2VTBA 2XJ9A 4B47A 1JXMA 4GPBA 4IXWA 4B6EA 1LK7A 3HB1A 3CKMA 4QJ3A 4NCJA 1K08A 1O3YA 4PAGA 4DM7A 3C16C 1CHDA 2O1SA 1ZINA 2YVKA 4UQOA 2WJGA 3A1EA 2C98A 4XD2A 2QLTA 1KNXA 4AN0A 3TKLA 2FG7C 3AKCA 4EHAA 5F21A 4C07A 1E2JA 5LDHA 1OD6A 4BKOA 4B4DA 1ZK4A 3KYDB 2QB5A 1L3IA 3CZ9A 4L6CA 5CXXA 4FXOA 1W76A 2W6NA 1WMSA 3FROA 2QA5A 1EWTA 1T9DA 3M5DA 3DQPA 4ZDKA 3TLCA 3TZHA 3OZXA 4CRWB 1ULAA 1QE3A 4UTRA 3B20A 1WWKA 1TJ5A 3ENVA 4LI0A 1QH0A 3E23A 3OZFA 3IOYA 3JQQA 3ZOZA 3B1KA 5KC9A 1QV9A 3FXAA 2VSQA 4XWKA 2ZTVA 4TV9A 4EY6A 2BR4A 2MR6A 2BKLA 2IY8A 5J2TA 1QU3A 4M86A 2PQ0A 3A1NA 4WMLA 3CV3A 1W48A 1LRKA 1U0TA 3QVGB 5AJXA 3G0HA 3VVBA 3LA6A 4WZZA 3ZE8A 1P9OA 1QG4A 3HYRA 2D5AA 2KS6A 4Q1VA 2QR2A 2ZCUA 1Q57A 2WWVD 3P8ZA 1VC2A 4ESVA 3PCTA 2JW5A 4JWKA 3OJXA 3ECCA 4CHGA 1IQPA 2X0NA 2C0QA 2ZWOA 5IC6A 1TCAA 2W6JA 5DHQA 3AKYA 3R5HA 2R6GA 3CRMA 3EMDA 3WGHA 3WRVA 3FD8A 3AJRA 3KL4A 4K0KB 4AJJA 1DJNA 3QV1A 1PUJA 4HQNA 3N87A 1L1RA 3UB4A 1UBOS 1MXHA 4AYWA 1SXPA 1W36C 1NW9B 1Z0ZA 2FW7A 1K89A 3GAZA 1OSNA 2HU5A 3LQQA 1Q1NA 1R0ZA 2FZGA 3PWTA 4AJEA 2Z5FA 4EPYA 3H19A 2AK3A 2H2WA 2PS3A 3Q7QA 1GDTA 4B3SB 1B2RA 3JQ8A 4RVFA 1E9RA 2PO5A 1ZUIA 3H4MA 1MCZA 2AK2A 4HZGA 2FMFA 4R05A 5AOAA 4FPXA 5EGSA 3GFFA 1U2GA 4Q3BA 1R5BA 4XX0A 4BRZA 2IYEA 2GPYA 3SZ3A 1K06A 1SNYA 2VZ8A 4O4LA 1YNSA 4RIHA 1PZGA 3QE2A 4XARA 4CU2A 1NVMB 2Q2VA 1M9NA 2WYHA 3LDAA 4Q05A 5LNK6 1V26A 1WBJB 1XLWA 2C2HA 4WNIA 3CT6A 2EFEB 2GPSA 3FVWA 3Q5EA 2Z9CA 2ZJAA 3JQCA 4UEQA 1ADGA 2ZAYA 3MRTA 2HCBA 2CYCA 3I3OA 4YX9A 5CB0A 2W5UA 2O8FA 2WIKA 3O90A 5ER9A 5CDFA 5IEBA 1RZUA 3TECE 3IESA 1LBQA 1PFWA 2X9GA 3FVRA 3JYHA 3V6LA 3K70C 4YLEA 1T34A 2TMKA 2JJ2D 4FHZA 1T9BA 5I9BA 4JLVA 4X85A 1FXWF 4NCNA 2RJ3A 2B8TA 5KOIA 4ABTA 2WJIA 3GZTB 1R00A 5IAOA 5L40A 4EKIA 4EQ6B 1MX9A 4HLCA 4O59O 2HNAA 1A77A 1R5OA 4MUKA 1PYDA 1VI6A 2AB0A 4CBVA 4DN6A 2EIXA 4QAJA 4XWOA 3NW9A 2ZKIA 3A4MA 5DBOA 2V5AA 2D00A 3BA6A 3EXG2 1RLUA 2CMKA 4CMCA 3RVDA 1CXZA 1YS1X 4NZZA 4DREA 5F2NA 3T15A 3EVAA 4WY2A 1N57A 1TO1E 3W04A 4BQEA 4H17A 3T8YA 4C89A 2BUBA 4G1UC 5LIPA 3AY3A 2A7QA 3CLUD 4FFSA 4H27A 3WKDA 3GQBB 5JD6A 2P6MA 3RI3A 4NTZA 4FONA 4ISCA 3WDSA 1JG4A 4LXGA 1YT5A 3R3XA 1IXSB 3OSUA 4IDEA 2IBTA 2BLNA 4QQRA 4MLCA 4PGFA 2RG1A 4Q4CA 2CK3A 2HD4A 2HYDA 3M6WA 2MINA 2ORVA 1QTQA 3RH0A 4NCKA 1YCHA 2QYHA 3M49A 3QXXA 2J85A 4II7A 2YVLA 5K8CA 1WPRA 1L7BA 5IBRA 2GFQA 4RVUA 2BGKA 2G4LA 1PQWA 3CWCA 2J3MA 4P4NA 5HZHA 3U26A 3GYGA 2HWXA 2IBMA 1AXEA 4MVJD 3LT5A 3OP4A 1IK6A 1VG1A 1JHRA 3TOVA 3U62A 3ET4A 4FTWA 3E1KA 3IV7A 3O7MA 1EFRA 5CD1A 4EF4A 2ZAMA 4Z0PA 1K7FB 2A0UA 4RIFA 4A36A 3R5FA 1HK7A 3RS9A 4DY6A 4I50A 5BVGB 4B3BA 1GZ4A 3DM9B 1TTPB 2SHKA 2WWGA 3VOTA 2HDNB 4XJSA 3ROGA 2FSIA 1Z6TA 4L9SA 4AL4A 5EIFA 2DBRA 1YONA 1IY1A 1U7WA 3GEPA 5T7BA 1Y1LA 5KAMA 2WAOA 2IOYA 4R98A 1CB0A 3BGVA 2L17A 2NSLA 3WYGA 2JGKA 1D1TA 1GNPA 4KQCA 5CEEA 3OQPA 3MCAA 3CF4A 1MQAA 4M7PA 3AR6A 5KTNA 4NYMR 2OQRA 3NT2A 1AS0A 3FTEA 4ZVQA 1M6VA 4FSDA 1Z06A 2W6ZA 3GW8A 3KWLA 1WHSA 4WKCA 5FBHA 1MTZA 5IMBA 2CEAA 2WWFA 1OX5A 2EX1A 4NV3A 3LUBA 2ATIA 1JHPA 4MJ3A 2C9MA 3WK8A 1OC2A 3ZD6A 1C0KA 2EFDB 2PVSA 1J25A 3AHCA 3DWFA 3D4PA 2OO7A 3ECSA 4PX2A 4K28A 3TM5A 5IM4A 1G6OA 3DMFA 3KQPA 2EFCB 1E3JA 3ONEA 4XD7A 1VHJA 3OO1A 4IIBA 4O1MA 4BO1A 3MA0A 3UW1A 4BFTA 3SP1A 3QHPA 3E82A 5ITZB 3EF1A 2DT5A 1UAYA 2JFNA 3ABRB 4GLBA 1YK1A 2PWAA 4Y6SA 2FQYA 5H59A 3VOBA 1RXEA 1II8B 1G8AA 2B21A 1IN6A 1E1NA 2PJUA 4R68A 3JPWA 2PV7A 1E5DA 1VJCA 3UHPA 2G4VA 4WEQA 3SLGA 2VC2B 4RQTA 2WF5A 3WK9A 2R6DA 1B41A 1DHRA 4S2UA 3FPCA 5CW2A 4D6PA 3FBGA 5CEFA 3JVUA 1FTWA 1U4NA 2I29A 2H9AA 2IP2A 4JN6B 3JCZA 4DB2A 4A82A 1XOIA 1YHNA 1ZH4A 4PLCA 5A5EA 5DNCA 2BCGY 1XD8A 2BY4A 2J0EA 2P6UA 2Q3FA 1E60A 2P1RA 2R87A 2DSTA 1XZQA 2R8OA 1W75A 1P3Y1 2P2SA 3BIOA 3P0JA 2C2BA 2H9YA 4I4TA 5L4NA 1ISHA 3PI6A 4C20A 2IFTA 4ZU3A 5TNXA 4P38A 2JLXA 4RE5A 2G4CA 1NW4A 4D74A 4HLUC 1USWA 2LWIA 5EJ5A 1U2ZA 4QJIA 2QV7A 3M8KA 4O25A 2P7IA 2B61A 2JD0A 1PL7A 3AB8A 1LA2A 2XR1A 4FDAA 5E6SB 3ZVNA 2YHSA 1Q11A 5ILQA 4OLBA 1TQHA 4KRXA 2H2GA 3JV7A 3ZDZB 1NNUA 1U2RA 4MVJM 3FCAA 4MP6A 1ZFNA 2DU8A 1YK0A 2FRDA 1CJMA 4KAFA 1GOTA 4ZODA 3UB2A 4DZZA 4EW1A 1VKOA 3BXOA 1BHSA 5CFQA 1OH5A 3O92A 2BMFA 2Y1WA 4LJ8A 3WGMA 3L7OA 5JFOA 4TWAA 5T57A 3FHTA 1MB4A 2ZK7A 1SC3A 5NLLA 4QT0A 1YA6A 1R27A 2PZ8A 1QHXA 3VNVA 3ABZA 2B83A 4FCWA 3TQTA 1H42A 3FDIA 3GUVA 5LZ2A 4XLZA 2FFBA 5F4BA 2RHCA 1XVTA 4LZZA 1PJTA 1MGPA 1CQJB 1FDUA 4RKRA 4BTEA 5BV1A 5LWHA 2G67A 3C15C 1LDEA 2F59A 1D9XA 4AY5A 4D79A 1BDBA 3AFHA 1DCTA 3L04A 3ZTTA 2OLEA 3NATA 5T3UA 2AG6A 5FYQA 4KPUA 3VC1A 3IPAA 1ISGA 4TM7A 5HZKA 3VR6D 5F5LA 1ZJWA 4WGFA 1OH6A 3TR0A 4GGPA 3LUHA 1Z4IA 1P17A 3FKJA 5CP8A 2PKWA 3NIFB 1TO2E 3IPLA 5AK6A 1OXVA 2XXBA 3WOVA 3I34X 2AV6A 4YMIA 1PT7A 2AZMA 5F9HA 3WAJA 2JARA 4M0UA 3OCXA 1TCCA 3X1XA 1Q19A 2PJZA 2XQIA 3EIQA 4ME6A 3BE6A 3REGA 4J3FA 5KQSA 4TKLA 3A7DA 3QSGA 2I6UA 6ABPA 1TK2A 3R40A 4LSZA 3ADKA 2A9VA 2ZEJA 3C70A 2AR0A 4LE1A 2D74A 1MP0A 4HDQB 4HO1X 1GGHA 3DDHA 4LWPA 3CLSC 4CLDA 5JXGA 1VDMA 2IPXA 2EZ8A 2J9GA 2HSEA 3ILVA 4QPPA 3VA7A 3UOAB 4FYMA 4TL7A 5FPTA 3O75A 1SXGA 4DC0A 4ZXFA 1SUWA 1T0BA 2H1HA 1LV8A 3N1UA 4J7UA 4U7PB 5BVHB 3JYOA 1USVA 4URWR 5A7HA 4EJ2A 2VR1A 4C06A 2Y0EA 1X70A 3CNQS 3MWYW 2PKCA 3ZXIA 2PJDA 4GYKA 1GZ3A 4IGAA 2FFQA 2C57A 2R1VB 4K3VA