4JFRA

Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoyl phosphate
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
336
structure length
336
Chain Sequence
NAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ornithine carbamoyltransferase
publication title Crystal structures and kinetic properties of anabolic ornithine carbamoyltransferase from human pathogens Vibrio vulnificus and Bacillus anthracis
rcsb
source organism Vibrio vulnificus
total genus 128
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jfrA01
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jfrA02
8AT1A 4KGVA 3R7FA 1DUVG 4BJHB 3M5CA 1FVOA 1PVVA 6AT1A 1RACA 1Q95A 2P2GA 2IPOA 1AT1A 1ML4A 3KZKA 1NBEA 4KH0A 4WTOA 2BE9A 2I6UA 3L05A 4FYYA 5G1PA 1EKXA 2A0FA 2OTCA 4F2GA 1AKMA 3CSUA 4AM8A 4IV5A 3LXMA 1RADA 1VLVA 1RAGA 1OTHA 2AT1A 3AT1A 3KZCA 4A8HA 3SDSA 1RAEA 1JS1X 1EP9A 1PG5A 2H3EA 2AIRA 3L02A 3KZOA 4AMUA 4A8TA 3TXXA 2QG9A 1D09A 2EF0A 4ANFA 1DXHA 1ZA2A 2FG7C 3NPMA 1ACMA 4JHXA 4FYVA 3KZNA 4E2FA 3R7LA 1ZA1A 3D7SA 4EKNB 1ORTA 3L04A 3L06A 1RABA 3MPUA 1R0CA 3E2PA 3KZMA 5G1OA 1SKUA 1RAIA 3M5DA 3M4JA 9ATCA 4KWTA 3GD5A 4KGZA 2ATCA 8ATCA 1TU0A 2G7MC 4EP1A 2FZCA 1TUGA 3Q98A 4KH1A 5AT1A 3M4NA 4F04A 3UPDA 3R7DA 7AT1A 4NF2A 4JFRA 1XJWA 4OH7A 1A1SA 3D6NB 4FYXA 4A8PA 1TTHA 4FYWA 3TPFA 1C9YA 2FG6C 4H31A 1RAHA 2FZKA 4JQOA 5ILQA 1FB5A 4AT1A 3GRFA 1RAFA 2W37A 1RAAA 1I5OA 2RGWA 5G1NA 1EZZA 1F1BA 2HSEA 1R0BA 4KGXA 2YFKA 2QGFA 2BE7A 2FZGA
chains in the Genus database with same CATH superfamily
2ZU6A 1A77A 1B7GO 2EX1A 4GBMA 3SIPA 1R27A 2PX2A 2WHEA 3KPJA 2GQ0A 2X8LA 5H83A 1I4WA 1L8LA 1OWNA 3JQBC 4EYGA 4C2AA 1G20A 1OYVA 1NRWA 3GGGA 3UG6A 4Q34A 4R9NA 5FA8A 2HD4A 3CLUD 1XVLA 2ZWPA 5FFFA 5G1PA 4A0HA 5BVHA 2RI0A 3CRMA 5DNUA 4OVKA 4TYPA 2GA8A 1YL6A 3WLMA 4RD0A 3FNGA 2QN1A 3OE5A 4U7PB 3GIWA 5JVDB 4UZEA 4Z2YA 3SZUA 1L8QA 5EJ8A 3NCTA 2HIMA 1C8VB 4BQPA 3GBPA 1XI2A 2FPWA 4D2IA 3ZCUA 4B6QA 4EA8A 4KDEA 2PUBA 4A16A 1O4VA 1SK9A 1XQXA 4MO9A 4ADSG 4B1FA 5K3BA 3IP5A 1E8NA 3FUTA 3LK6A 3OJ0A 4JJ6A 2NUPA 1C7ZA 4IDBA 4C78A 1GAEO 4CCYB 2VF5X 4M3NA 2Q0QA 3SICE 2NSYA 5D3QA 2DQKA 1R6TA 2AJTA 4WXYB 3ZZUA 1MC8A 3R40A 4RSGA 5LWHA 2B8JA 3NCHA 4JLKA 5ALGA 2H7XA 4X8OA 4V3BA 4NG5A 1DMRA 2VPTA 2PGLA 2JI6A 5T4BA 5HF5A 1W76A 3HR8A 4EKYA 3LD9A 1B6RA 3P9NA 1PKXA 4HUQA 3SSNA 2O0JA 1H1DA 4EPRA 2NZ8A 2W00A 2OD7A 3I0NA 3A2LA 4IIYA 2IKSA 5K05A 1LQUA 4DMFA 5KTOA 2X5KO 4FLFA 1GXSA 1ISSA 4RQUA 2RHGB 1BOFA 3DC2A 1P62B 3G9UA 2R66A 3GLFE 2QMOA 4IV8A 2W4IA 5LXTB 4LFAB 1VBKA 3LY5A 2MYTA 5IUKC 2ODAA 1DRUA 4FNGA 4DPMA 4DW8A 4TVSA 2CVOA 1VA4A 1OBCA 1QZ3A 1O95C 4M0EA 4PY2A 3CF0A 3DULA 1E0AA 4RCVA 3A6EA 5B1YA 3G0GA 5AOBA 2A9FA 4RA6B 1JT2A 1FX0B 3T3GA 2OA0A 2F1KA 5HMLA 4U63A 2XMZA 2ID4A 1FTQA 3C5CA 3EGOA 1MRSA 1A8UA 1CEXA 1GPLA 3KKNA 4I9HA 3UA4A 3ZHBA 2VOJA 5B3LA 5IK2A 3LL7A 2J5RA 4J1QA 5KKAA 3AR3A 4U39A 2NTJA 4YT5A 3AI2A 1QOPB 3CGWA 3KXDA 2JFZA 1G59A 2VUUA 4EDFA 2WICA 5ALHA 2FWIA 4LQCA 5I7FA 4BKRA 4UM8B 5IBQA 1Y3BE 4K9SA 3KKQA 1EDDA 4DOMA 1Y1SA 5A5EA 3SQNA 4C4YA 4V0OA 1NOKA 1DV2A 1RAHA 3TDMA 2I3BA 4LRSB 1LJUA 2ZJFA 4X85A 2JEYA 1TYDE 4QXQA 2DUNA 4YCDA 5ESXA 3A36A 5FFNA 4D97A 2XZPA 1HETA 3WLPA 1ICEA 1CUSA 4CIAA 2A78A 2FFHA 4Q3CA 3AFIA 3WLHA 1LRLA 3AF6A 2Y1LA 4IFBA 1ZN2A 1IN6A 4RE6A 2IUSA 1EBUA 2O07A 4XR4A 4GXTA 1YQWA 1KK0A 5DYNA 4FGLA 2ADFA 1O95D 1S9DA 2OILA 3A6FA 3FOAA 3T7KA 3JAMA 2GM5A 4LF5B 1BE1A 4DDVA 3A6DA 3MD0A 1KMQA 4J6FA 1RT9A 4KN9S 5D85A 5AM0A 3GELA 1SIBE 2E87A 3DMYA 3W3AD 5JIBA 2EQBA 4HWPA 4LJ6A 4XOUA 4YQEA 1RJWA 4PPNA 3V5NA 2C2WA 1QK3A 4HDNB 2AOWA 1CWUA 1EXWA 1JLLA 2Y6VA 4J9UE 3R9XB 1EBFA 3RS2A 1UKYA 1S02A 1VHQA 2QZSA 4N4AA 4D26A 5HJEA 2QTGA 5C7LO 4ZQEA 1E3SA 4DL9A 4PG8A 3VHQA 1WS6A 3BM5A 4WMLA 1D5CA 3NGXA 1J0CA 2Q4EA 4G0PA 4MQLA 1Y3DE 4KDCA 2O5VA 3E8XA 2VHJA 2A5LA 3KB6A 4D0NA 4R1LA 3RKSA 1JPVA 4WJKB 3PFNA 4OG2A 4F4DA 3AV3A 4ENSA 1QR6A 4IW3B 2FHPA 3LIPA 4OJTA 3N0TA 4PWYA 4LI3X 4ZDWA 3E8MA 3E9ZA 2WJIA 3U13A 2GOYA 4OSPA 2GTIA 4YRFA 1ZESA 2J3HA 1ZKDA 5GAJA 2IE8A 3MUFA 1WKBA 2VZ0A 3HCDA 1ADYA 3DZCA 3M8KA 3M34A 3W1WA 4N1AA 4G1UC 3CPEA 5DGDA 2Q3CA 1UPAA 5B3JA 5JAOA 5B53A 3ZDFA 2VSFA 2WNSA 3OWOA 4MHOA 2VJMA 3N86A 5M7EA 4BB0A 3OF3A 2D13A 5FOQA 1AMUA 3RIYA 1VL0A 3DZGA 2PSSA 3A1UA 5SICE 2FNAA 5JVDF 1TQ6A 4D0SA 3A58B 1M3SA 1U2GC 1JKJA 3Q7PA 3A7DA 1U2ZA 3I37X 2GYVA 1SC4A 1ORHA 3H17A 1TU4A 1FU8A 3I4LA 2GXSA 3MC1A 3USES 1ESEA 1S2LA 5FNVB 4MICA 2ZSFA 5A5DA 4BLOA 4B33A 1SVLA 1N2JA 1XCPA 3LPMA 3NBAA 5BQPA 2P1RA 5JNLA 2HCBA 1UFKA 4G5OA 4ZXFA 1VRWA 1DRJA 2CJXA 3IT0A 3F8WA 2AG8A 3TM4A 1CUVA 4Z0NA 4F3YA 1NQXA 2DBQA 4JBYA 3RVSA 2NAPA 1C9NA 2EVWX 1YZ3A 3A9SA 3PLRA 1VIVA 2ETXA 4N01A 4R0NA 1U28A 5CCEA 2CF6A 1WE2A 5BURA 2FRVA 2RD2A 4BY9E 3WE7A 3NH6A 4Z9BA 3DKVA 1ZOIA 1TGYA 1UOEA 4UNNA 3GLIB 3U31A 4C9BA 4YRGA 5B3KA 1T2UA 4FYWA 4ENUA 5IPFA 3K0FA 1K08A 1PUXA 3FSRA 1F4PA 2HU5A 4WXEA 4E88A 1PGPA 1U1EA 3HKDB 3DKRA 3O90A 1ZRSA 5LXTF 3IXLA 4TKVB 3OJCA 5CEJA 5EWMA 3T3HA 1IBRA 4F8EA 3K9FC 4Q4HB 5LDHA 5BXYA 5AM5A 2WZBA 3RTDA 5JHHB 4A4DA 3WAGA 2RGDA 5L95A 4EG0A 4HQFA 1BCRB 5TVGA 1JHDA 1NW6A 2WD7A 3A2MA 1MB4A 4L9WA 1NP3A 1OLXB 4TKZA 4XM1A 3BXFA 2X5OA 2XRFA 1KTVA 1JDUA 4KWEA 1CS0B 1QFYA 1TF5A 2OCIA 3W8FA 3VR3D 1V3TA 2OHXA 1KZYC 1U3VA 2QT9A 4IOLA 4OHKA 3EC1A 4RF2A 5LP6B 2LUOA 3TECE 1IEWA 3WLAA 3OTIA 3QTTA 3EMVA 4ID9A 4OLFA 4B3HA 4EUEA 2A0UA 1HTBA 3L82B 4U0JA 1L1RA 2QNIA 3N6XA 1MG0A 3VI4B 2OORA 4L8FA 1Z2PX 2BM0A 5I7EA 4Z4QA 3L7AA 5GJBA 3PPXA 4DKJA 1NHGA 3L84A 4LZPA 1Z0FA 1RWXA 4LV8B 4UASA 5EHNA 2W93A 3PIRA 1KJIA 3P9SA 3QBTA 3B3GA 3V2HA 2ZE6A 3B48A 4YAKA 3PJGA 1VLVA 2F9MA 5EOVA 2PMDA 1TKAA 3EXHA 3T9DA 4IVPA 3VNSA 2OESA 3GP3A 4A5OA 4HT3B 3ANSA 1IYZA 1NVFA 3WK7A 1QZTA 1VG8A 3B1FA 1USIA 4Z0TA 4DHEA 1FFDA 2D59A 1IIRA 4C30A 1E7QA 4YJHB 2NIPA 4TV9B 3GB9A 3U6BA 1BU5A 5TLSA 4ZOCA 5K2MA 1IB6A 3WMEA 1U0EA 5FWDA 2EJCA 2ON6A 2ZDGA 2PLWA 4RF3A 1EP3B 5JSKA 1T1JA 4MIKA 1WDTA 3ZLUA 3IQDB 5JASA 5KOIA 5IJZA 2BT4A 4CM8B 3B85A 1O6ZA 2X2EA 3WQHA 1FL9A 1XMVA 2VPXA 4WBSA 5J59A 2CYCA 4IRXA 5JH7B 5JAHA 3U6KA 1GSAA 2M6KA 2XWBF 5HZGA 1NZDA 2WAMA 4URZR 2AZMA 5AD1A 1NQTA 3DDCA 3GP5A 3IUMA 1WP4A 4TMTA 2BMJA 1GPAA 2VDWA 3EPLA 2QR5A 1PFQA 1YI8A 2X77A 1IHDA 2ZIAA 1SXQA 1V9LA 1CUWA 5IP5A 1YU9A 3FJYA 4EKGA 4D41A 3HBLA 1GDHA 5I4CA 2EFCB 3I58A 4P4SA 1WUKS 3O1JC 3VZRA 1FYVA 3FTPA 3PEWA 4KSCA 4UNPA 2OB2A 1H1TA 3LKBA 4NBKA 1VPTA 5HZMA 1UKEA 1IJBA 3FCOA 4XPIB 5JAUA 1N2HA 4DLXA 1CDDA 3SE0A 3DTVA 1DQPA 1P74A 3DE3X 3PI7A 4OJMX 3TOZA 3VGPA 4BMOB 2UVPB 3SYKA 1EFRD 2OE2A 2FE4A 3ZU4A 3RB8A 2O2ZA 1JE0A 1RKUA 1EK5A 4Z54A 3EJWA 3VVLA 2YXNA 1COWA 2BEKA 4NI5A 2JH8A 1A9QA 2GAAA 2QTFA 1KMHA 5DNVA 5AOVA 5ESWA 1GRQA 4C29A 4AY2A 3C3DA 1OPRA 3C1OA 3L8CA 3E0QA 4UU0A 3DCYA 3FCEA 1SUIA 4WERA 1B8VA 3VDXA 2QJFA 4RZXA 4E6EA 1IRIA 3RFFA 2QN3A 2UYOA 3TR5A 5BOSA 1E9RA 2TMKA 3GT7A 1II8A 2V9PA 4XB1A 2WUWE 5CLGA 1Z4IA 5SV2A 2HXSA 3W77A 4ZJZA 5A4IS 5BWNA 4GOLD 3I0ZA 3OESA 4P2BA 1Y89A 2AD1A 2GDZA 3GLIE 1CNFA 1Y3CE 2EL7A 2OGWA 3WC4A 2IBSA 2Y0CA 1KTIA 4C6TB 2BMEA 2EC5A 2OPBA 3U7QA 3IUQA 3MOGA 3C2QA 2QT0A 1B0PA 3A2KA 4ZEMA 2PEZA 3HJAA 3Q12A 2I4TA 3DW3X 2C61A 5GM1A 2O50A 2H3HA 1KHTA 3AUSA 2OY0A 4JB0A 1HEYA 1J9GA 2BFBB 3IKJA 3QYPA 4G36A 2P2GA 4P31A 1IZ7A 1PWEA 3HADA 1OASA 3OH8A 2BGLA 2ZU0C 4AB1A 2NO6A 1UBTS 2E18A 1PTJC 3AP1A 1JAYA 3D54D 3BWYA 5JTUA 2Y0PA 3TRHA 4F2GA 2WU4A 4P3KA 2WTAA 5KNDD 3CSUA 3IEIA 4R2LA 1TUBB 2AUNA 2CYAA 3W8NA 2PT5A 4IPTA 5FPYA 4YUVA 1T5LA 2LPMA 4HDAA 4CMEA 5BMOA 5BV8A 3G2OA 3RPEA 4BX8A 1U2EA 3U39A 3JWGA 4DREA 4EHAA 5H59A 1J0DA 1KEEA 2CXNA 1P2DA 2KBFA 4MS1B 2B61A 3WAKA 3MFYA 2BH2A 1SUSA 3HNPA 4A0RA 3MYRA 4BU0A 2NV2B 1FP2A 2MTBA 1IXSB 1G8FA 3IP7A 2BI8A 5AKKA 3P71T 1Q3KA 1HPLA 1OMOA 5DTMA 3WNDA 2A4KA 4K2AA 4LQLA 3UTDA 4AMUA 5LP6F 4F6RA 3K7EA 1S4MA 3ZUPA 1CRLA 3BRWD 2QSZA 3IMEA 1N6RA 1L7XA 3UIEA 2QRVB 4KE7A 4P0PB 2LRHA 1JHAA 2PRJA 5EJ9A 2MSCB 1PQ4A 3FI9A 1BWQA 3PXCX 2RJOA 1LLFA 4HHEA 1JU3A 1JEYA 4PIVA 4MHTA 2FFAA 3O3NB 2RBEA 1XTBA 1SKBA 3BZUA 3NORA 5F7ZA 1PZXA 3GCZA 1GN9A 2Q7DA 3ROGA 5KPJA 3HVJA 4G9EA 3U7HB 1LNQA 2BSAA 1M1XB 5IM5A 2P2LA 4CM1A 5K8LA 2CD9A 1Q92A 4BNKA 1QIIA 3DS8A 3E22A 5B5SA 4F93B 4CGYA 2P75A 3ZV5A 1POXA 5LQCA 1ZZEA 2EX4A 2P8JA 2Q6OA 2ZXFA 3W5SA 4F9FA 4CEIB 4EHBA 1TK9A 2ZJ2A 3ET4A 4MIYA 3A8TA 4NMMA 1LVHA 1N8SA 2V1XA 4FOTA 4OQDA 4PC7A 4ZDKA 5JSZA 5JPDA 2NO9A 5IN5A 5B58C 5IHXA 1GLNA 4MVYA 1FTNA 2HMVA 1JDVA 4XLZA 3KXLA 4IHQA 4TV9F 2BBOA 4ZVNA 3NEPX 2WABA 2GO1A 4B2LA 5B1EA 5ED0A 3U37A 4N8DA 3TJZA 3E5MA 1K75A 4RHCA 3JW8A 2MR6A 2X42A 4OX9B 2ZYVX 1RYBA 5TIIA 4DUGD 3QOFA 4TTAA 2J4FA 3ZWWA 3DM5A 4JC4A 4QUHA 3B2NA 3MTBA 2VBGA 1TTHA 1AKUA 1KBQA 4MVJI 5KWJA 1KY4A 1KQFA 3VYSB 4LGCA 1Z0AA 1Z22A 2CNNA 5JH7F 2A5DA 5CTJA 5C3MA 2MSKA 4CG3A 4EMBA 4MKIA 2FUNB 3MT7A 2DU8A 2EZ8A 5FULA 2FQWA 5GONB 1U9CA 3DV0B 1SUCA 1NNSA 2B9VA 4QC2A 1BVRA 2CDCA 1Z7BA 2IV2X 4ARZA 5KHOC 4M88A 1G8JA 4NV1A 2MINB 4XRGA 2WMOB 4NJMB 3WWCA 1H1LA 1M10A 1BRTA 1T0BA 4B74A 2H7VA 2APJA 4W1QA 3FYUA 1OXSC 1GT91 3VHXA 5L9AA 4KI7A 3CM0A 4CV0A 3STTA 4MX8A 3K9NA 1TM3E 2Q28A 3QVMA 1Y8AA 4S1TA 4Q24A 2HA7A 5GOZA 1WZCA 1TM1E 3QXHA 3OCZA 4FYPA 2HCFA 1JSZA 3AMVA 1NU6A 1MVNA 1P0PA 1NQWA 2G3YA 3ESBA 4YI5A 2WMNB 4EB8A 3CW8X 1RXEA 1BO6A 4QE3A 4QG7A 4K46A 4GWGA 3TEFA 1SU7A 4W5JA 3KD3A 3KR9A 4H08A 3E3LA 3VDNB 3ZK8A 3JZIA 4E4YA 1NR5A 2A9JA 4DM4A 2Z2YA 4MUJA 4A2WA 3QFFA 2IV3A 1LVUA 1XO1A 1XC7A 1M7BA 4H18A 4I5FA 4PSDA 1PT8A 5GJCA 2PZLA 2OG1A 4AULA 4LG1A 1BGWA 3CTMA 4JNKA 3SDSA 3BH0A 1YXMA 2A9VA 3TQOA 2UZ1B 2VJOA 1L7RA 4HGNA 3KJXA 3BJZA 1SCKA 3IIIA 3LI2A 3I8OA 1P31A 4XGIA 3KDSE 4MV3A 1YC5A 1BJTA 5E6RA 3SM3A 3U3DA 4LGVA 1DC3A 4FFLA 4Y2QA 2B4QA 2J5KA 1IMOA 3NYQA 4NAVA 4TWRA 3LBFA 5CPFA 1EM6A 2A1UA 1W73A 4P7GA 4US0R 4LYDA 3H3XA 1MX3A 5E3JA 1OREA 2JCXA 4DIEA 1HNXB 3NU1A 3MUNA 1SQ5A 1F0KA 4MV5A 4B3IA 4URVR 2G17A 4WNAA 2CV1A 1NURA 3GQVA 1NBMA 3ECSA 1WV1A 3EK2A 3IQFA 3ROTA 1WQ3A 2QEQA 3DVAA 3L7BA 2OV1A 1KZHA 5BN3B 2ZJYA 3DWIA 5DHRA 5KTMA 4DQVA 5BW4A 3T5BA 2A1IA 4I8DA 1BXRA 2ODEA 4PS0A 2PMKA 4MV7A 3C4QA 3E2PA 4KPUB 2H2IA 4GYWA 1ZD3A 3TEJA 2CFSA 4LOAA 4FMPA 1BWRA 5KYWB 3I9MA 1ECLA 2O8FA 3MIIA 5FTJA 1E9DA 1T36A 4WDQA 4YRBA 3H84A 2FWRA 5FBZA 1Q1NA 3QVOA 4IIGA 4CQMD 4F4CA 3AXTA 5AVWA 2ZRDA 1VE5A 2CZCA 4HMPA 4YCMA 3AFMA 2Y1WA 3PJEA 4FDAA 1MA3A 4B3GA 5KX5A 4NYMQ 2R8BA 3H11A 4A2QA 2VZ9A 1T26A 4OHBA 1OZFA 1PT7A 4XX1A 1U7XA 5PGMA 4DM3A 2TMGA 4NE9A 1ISMA 4Q4AB 3OA2A 1V2HE 3FNQA 4RVFA 4C0SA 1A1SA 5I3CA 3AHIA 3FYHA 1QJCA 3NWPA 1X9HA 3JQ8B 2Y1FA 2N47A 4MW6A 3T3NA 4MUXA 2C5EA 5DPMA 4ZOEA 4W7SA 1JN0A 4LWPA 1X39A 1UJ5A 2BZSA 5DULA 2ACKA 2PIDA 2BFAA 4QFCA 4E5NA 4Z4CA 1XPOA 3FLBA 2YWFA 4JA0A 3U4QA 3JZMA 3ICQB 3EVGA 2A5FA 3U9LA 4C22A 3CKLA 5FPTA 3U09A 1O5OA 2H31A 2Y6UA 4OV6B 2XBMA 3ONDA 2RJNA 1BMFA 5CK4A 3ACDA 3IAM1 5TEWA 1JXOA 5IX8A 4OXXA 2QT1A 2RMKA 3OJOA 4BMDA 3TLKA 4Y0AA 2QTBA 2R4QA 1EZ1A 5E9QA 4MP3A 5T6BA 1Q22A 4YRKA 2QK4A 2BD0A 4ZV4A 1I3CA 1JSLA 2PMCA 2X0EA 1FJGB 5E2BA 4B3FX 1YBMA 3TRFA 4CU5A 1AUOA 2I2XB 2WJGA 3A14A 3BN3A 4PYQA 3WBFA 4EYEA 5LNK1 1GILA 1D6NA 1RCFA 3ICVA 3SQMA 1DC6A 3R20A 3BORA 4UM9B 1OWPA 1CVRA 2WQZA 1Y63A 2ZT5A 3SP1A 2ZCJA 1THZA 1ORVA 4JFAA 5HR5A 1JHRA 1L4HA 2I6SA 3VX4A 5IUNC 4EY8A 3L43A 4K7JA 2XUGA 3RSLA 2VHVA 2UDPA 4UE6A 1SXIA 2HNKA 3WZ2A 3ZQJA 4BP1A 5FPPA 2BV3A 5FTMA 1U7HA 4TTJA 1XQ1A 2E48A 5G41A 1YZFA 2ZSBA 4QRDA 3A1CA 3HDGA 4EPVA 4ZARA 2CSUA 4WUVA 1CX9B 2D2IA 4HX2A 2PBZA 5EYPA 2O0LA 5DGXA 2H1VA 3TLJA 3L0CA 4B9AA 1QNLA 1CCWA 3OZXA 4WFIA 4FQ5A 4CKCB 5JHGB 1YQTA 4W5NA 4HKTA 1FS6A 2UUPA 3NTUA 4ZV7A 1DBVO 1FTGA 2C00A 3RVDA 4GO1A 3ORQA 5LYJF 4D82A 2NYRA 4YP1A 2QG9A 3VJMA 3EUWA 3JXEA 1SVMA 3LQRA 2YZ7A 4ZAFA 3WX0A 5A6SB 5F3WB 2RCNA 3F1LA 1GGHA 2BTOA 4N3CA 3WGGA 3PWKA 1KAHA 2JI8A 3QF4A 1SA0B 4JLWA 1EB9A 4ISCA 4NRDA 4X94A 4I9UA 3TB6A 3FKSD 2JFXA 2Y66A 3AFGA 1DOZA 3KBBA 4HAXA 2JLZA 1LV8A 2AXQA 5HP4A 4RMGA 4JL6A 4KLRA 3ENNA 4NYIQ 2ZETA 3H5LA 3KS9A 3QVSA 2F62A 2EATA 3AU8A 3ONWA 1T8SA 1DC8A 2B7BA 2WTEA 3L06A 1EFHA 4JBWA 5CLLA 3TRJA 3PG5A 1ZITA 3CUSA 4ZCSA 4UE2A 2Q21A 4EJFA 1HX7A 1QKJA 5KYKA 1JDJA 1H3FA 4CPDA 2NZVG 3KZMA 4HB0A 4GU5A 4PRKA 3N2ZB 1UP4A 4TMXA 3JRWA 2RKBA 1D2MA 2QMEA 3UAOA 4E5KA 2Y92A 4ODIA 4H7FA 3RRFA 1RFGE 2D1RA 5KYVA 1XZKA 1ZSNA 2Q6VA 1H4SA 4RU1A 5EUBA 3LBAA 3EQ6A 5JCJA 3GO4A 4RVNA 3FYCA 4D96A 2ZYGA 3CX8A 4PSAA 1KK1A 1XVAA 4IVRA 3WWEA 1HMYA 3U3XA 3BQMB 4HPJB 1W29A 1M7HA 2V9CA 4DRXA 3RUDA 2V8BA 3IPLA 4MAFA 1KIMA 4NEHB 4NICA 3LT2A 2G06A 3KG2A 2CEKA 2ECFA 2JI7A 4E7PA 4FMCB 4QYTA 1AUQA 3NIBA 2E4YA 3ITNA 3OU6A 4G4GA 2J07A 1MX5A 4V39A 3IIJA 5C80A 2R6HA 4RTLA 3NYRA 1J8DA 4MPJA 1AOXA 4DXHA 4EITA 3W5HA 4O4LA 3O4VA 4X6YA 5E1BA 2ORWA 4QTUB 1KWGA 2BM1A 3CEMA 4HNSA 5BVHB 5DHTA 3KCNA 3AZPA 1YZTA 3UT5A 3VH2A 4JLJA 5JDIA 2WTUA 5JISA 1VA5A 1GHTA 1AXEA 5DK4A 3BDVA 4GPAA 3KUDA 4A1FA 2K2QB 5ITWA 2C7PA 2NGRA 2NU6B 1NYTA 4BLSA 1UDWA 1EK0A 2X3UA 4R01A 2V5AA 1DX4A 3AB8A 4L8LA 2CLFB 1NV8A 1J2JA 2ZI3A 3AVPA 3QKIA 4ALIA 2HQBA 3W1EA 4ZAVA 1W0KD 1XTUA 3FJOA 3ZI7A 3D8HA 1DBRA 3LVRE 4DWOA 2CC2A 2NUPB 4PLFA 4YRZA 1NV9A 4XVHA 3BB4A 3FCUB 3EOZA 1ETUA 3UK6A 1OAOA 1H3NA 3AONB 2ZJ3A 3AWIA 2HBYA 3OIUA 1A27A 1V1MA 1NSYA 3RU7A 1H66A 5M2QA 3PHHA 3GVXA 2WAYA 1AK1A 1IWBB 1DZ3A 1BDIA 1RJDA 4QGBA 3ON5A 4KTVE 4IM7A 1XRRA 1Z13A 1YI0A 2QOEA 4GMDA 2RHHA 2XA1A 1FDIA 2YXBA 2H51A 1SKYB 3IJ5A 4IDNA 4P38A 4YWJA 4WX2B 1NKVA 4TWBA 4O0LA 1K27A 4HBZA 5J4LA 4LWZA 1H2ZA 3INGA 1WOYA 3L6RA 4HWRA 4UM5A 4YP6A 4QT4A 1KQGA 5DLPA 4Q4LA 4AAYA 4C08A 2RARA 1XWIA 4RV9A 1OGYA 1L7NA 4MKGA 2WAAA 1E5XA 2VK2A 2H4ZA 4W8GA 3RRNA 3WL8A 3WYNA 4LXTA 1TC2A 2HF2A 2QZ9A 3HP1A 4IGFA 1E1CB 2P65A 5GM2A 5TB5A 1B14A 1DAEA 1KYVA 1RPTA 1VC2A 1GZSA 4IR7A 4O4HA 2W6QA 4WZAB 4NFSA 3RTGA 5BY2A 1PEAA 1W93A 4IIUA 4NE2A 1GPKA 1RTTA 3OQHA 3I73A 4OQLA 2A59A 2XRYA 4XPZA 3RHSA 3SMVA 4B6PA 4ZHQA 2JLXA 1QTNA 1ESDA 2ES4A 3HA3A 3R7LA 1SCDA 4PVDA 4I1UA 4JEMA 3GFQA 4K87A 3DP9A 4YGYA 3MCUA 1I2BA 2PAAA 4G2NA 4H15A 3W78A 3ZE9A 3TOSA 1EP1B 5HGXA 2RHJA 3PNVA 1MQ8B 2HIAA 2YYAA 3PPIA 1MO4A 4IX9A 4P53A 1VMKA 3STHA 3T6KA 5LCXA 2QAIA 2QUJA 2RH9B 2VSYA 3PGMA 4PG4A 4DILA 4GOOD 5C37A 4HAIA 4XQGA 1UODA 1HWYA 2RAPA 5C4IA 1EGAA 1Q12A 2QQ0A 3M9LA 4WESA 1W9HA 2FW1A 3WJ1A 1M1ZA 1U0GA 1K6XA 1CULC 2ERCA 2IS2A 3PQ3A 2CF5A 1H69A 1JFSA 3OIWA 3P9IA 2V4ZA 4NH0A 5C31A 4FR2A 1W35A 4D4KA 2O2IA 3PDJA 1JHPA 1A4RA 4C03A 5CDFE 2YX1A 4MV9A 3OQMA 4YAJA 3UMGA 4IL5A 2BCGY 2PUTA 1UMDB 2VJAA 1W8DA 2Q6LA 3BZWA 5CG2A 5FWXB 1O5TA 5C1IA 2FJUA 3GDFA 5AVUA 1JLLB 2XMPA 3OTOB 4LTDA 2GBCA 3P0FA 2IS4A 4EI7A 2P9JA 3O8OA 1U8TA 3MJEA 3N8GA 4E09A 4M8SA 3UJCA 4IZIA 2GPSA 4MW5A 1TD1A 5DBIA 4LXQA 4AWXA 5LP1A 3QEOA 2CV2A 3GP8A 2Y0EA 5AKEA 3GAFA 1SBNE 3OMWA 1SOUA 4URYR 2GBGA 1LTQA 2HSEA 1AUXA 2OAEA 4CIBA 2NP6A 1PWHA 1E2DA 5ALOA 5H4GA 5AXAA 1G20E 3B82A 4LFCB 1TYEB 3F46A 1T0IA 4NV3A 3T06B 3IEMA 2K7FA 4DA4A 1IXKA 2Q1UA 2JLQA 1U3UA 1R50A 1N1DA 1Q83A 1P4RA 2O2JA 2B8WA 2XODA 2XIQA 2DYKA 1SIOA 3PXDA 4G67A 4OXIA 3V3KA 3SNKA 1OX5A 4FK8A 1R9JA 4QVGA 2AVNA 1K8XB 4P33A 3DGEC 1Z4PX 3DZ8A 2J6BA 1NOIA 2IDKA 1IXZA 4GI2A 1ZVVA 1NW5A 3BE6A 4UUBA 3QNMA 1XZCA 3G2KA 3KALA 5KINB 1XRQA 3I2GA 2BKVA 3K1TA 1NVTA 3S7ZA 4JBHA 2ZBDA 3P9QA 4JJZA 3AUYA 3FNHA 4TRRA 2FWAA 1KH2A 3WXBA 4RLHA 2YUTA 1EZ4A 3N58A 1AG9A 5G4KA 1C3XA 5TV2A 4EAQA 3U60B 1JPUA 2YC2C 3PHIA 4MQ5A 4JY7A 1YFJA 5THXA 1XTRA 4FDTA 4KDFA 1GU7A 5HFAA 3GX1A 4NOMA 1Y8CA 1OFUA 4KYIB 5AMXA 1GG5A 1D7AA 2B0CA 2JIZD 4RD1A 4JBNA 3T9AA 2ZWIA 2H11A 3B2QA 1RE0A 4MUHA 3IV6A 1ZVMA 4J75A 4DYHA 1D09A 1SKYE 4G1CA 4B71A 2WIBA 3WK6A 3IAFA 1LW6E 1RR6A 2OM6A 2PXHA 5IBCA 2I4LA 1RHQA 2HCRA 3D4NA 1XCOA 1Q50A 4WN9A 1G3IA 3WBJA 4BB9A 4DEVA 2W6CX 1G5PA 4K81B 2XUZA 3A1VA 4MWGA 4TMFA 1GQYA 3SBDA 4FYVA 4NHEA 1MAVA 3BCSA 3KK0A 4OK5A 3S28A 4GR9A 5K6AA 2QJOA 2Q4TA 1KDTA 3M5PA 1E61A 4B3MB 2EZTA 2A0XA 1NR1A 2I99A 2QMYA 1IBMB 3TEMA 3WP0A 4TV8A 5JQGF 4NENA 1JEQA 2YZMA 3EQ9A 3K0FB 2CJWA 3Q3EA 4FNOA 1F8UA 2X6TA 3VZPA 4DCVA 4PBRA 2A9QA 4AK9A 3M9XA 4LZAA 1E3WA 4D4MA 5A6VA 1EJBA 2PH5A 3QPWA 5AUOB 1C2TA 5AK4A 3SHFA 2FE1A 2O54A 4G23A 3H4IA 4ZVOA 3L0SA 4BBPA 1F9EA 4YTEA 3SSOA 2QJWA 2WD7B 3AETA 4KC0A 2HU2A 1KORA 2X9LA 3H7IA 4E5DA 1YA4A 2GPBA 4A8JA 3CFYA 4PG7A 1MZVA 3OFSA 4MS3A 2BSQA 1S5PA 4I0WB 3PICA 3PR1A 4M8NE 4RACA 4W99A 5JCPA 4GYKA 5FOUA 1PR3A 3OZRA 2CL6X 2I87A 3G3EA 3SYNA 1NC1A 1A72A 1F8YA 1GUYA 2EJTA 4L9AA 3OQVA 3TPFA 3QELA 4AJEA 1P8AA 5IAOA 4PHGA 3T9CA 3LPDA 2HDOA 3PX3A 4QPJC 3P2JA 3BDIA 3QYFA 4YJ2A 3MAJA 1JH8A 2PRZA 2OKCA 1VLJA 4RVDA 3KAJA 5DBEX 3IAUA 1H4VB 5ITZA 4OB6A 3DOCA 3DT8A 4PZUA 2J59A 3EXHB 1FCJA 4AKGA 1NMSA 2CVFA 3IVCA 2IIQA 3PUZA 4IO1A 4FC7A 4X92A 4BMPB 5K0LA 3VNQA 2BE7A 4AIRA 5DN9A 4DYVA 4OKNA 3GPLA 1F7VA 2GPYA 1CDEA 5EMMA 1FMCA 4IWYA 5JS2A 5KC9A 3VNVA 1IJEA 4DARA 1RKQA 4UD2A 1JSXA 1GOTA 1E79A 4IIFA 4MLDA 4O33A 1VYHA 4UEJA 2BF4A 3BQ9A 5A3SA 1Y80A 1PJSA 4TYQA 1DGQA 2AI1A 2HB6A 1J07A 1L4MA 2PWPA 4HB4A 3VR5A 4JOSA 1PZNA 3CRRA 3PR3A 4AG3A 1X7YB 2FRDA 4QLAA 4X3CA 3FTCA 4BMCA 1J00A 1YRHA 3EVDA 4YROA 5DLDA 1YTLA 3DNFA 1DAOA 5IKOA 1BCSB 1GZUA 5SYAA 3WL7A 4H77A 3O1HB 1GGVA 1AVTA 2YWCA 4DBVO 3R6WA 1BH2A 3F7MA 3H83A 3RC2A 3G0IA 3THWA 1Y7HA 6REQB 2D7CA 3B6MA 2OHIA 1FFAA 1QHEA 3SC3A 5JFGA 1KETA 1NNI1 2EKQA 3J80A 3NHMA 3OJXA 5FUXA 5E3IA 1RU3A 2GCOA 2IEIA 2RGNA 2VDWB 2ZAMA 5EQFA 3RU3A 3SEZA 5F51A 3I5UA 1KEPA 3G2QA 5KTTA 5IKMA 3LNCA 1D2NA 1X7HA 1YUMA 2JAXA 3E5HA 2JF0A 1UEIA 2VLIA 4P4SB 3MUOA 2J5BA 4P35A 1W36C 1DT3A 4LOJA 2V96A 2HLNA 3QPCA 4GOKA 5FAKA 4PIPA 3DTVB 2VTBB 4M1SA 3SBOA 3PFCA 1QUFA 3ANTA 4UAVA 3TNYA 3NTQA 3DKIA 5E8JA 5AIBA 3PWTA 5CLFA 1QANA 1JJIA 4AMZA 1XZFA 5BN1A 3GFOA 1OE0A 5IDXA 1YQ9A 1BFKA 1E8DA 1IC6A 1KMHB 2AR7A 3BMCB 4CCAA 3WLSA 1CF9A 2BRUA 4MQ4A 5K1ZA 1M0EA 4E31A 1K7EB 3I6YA 5CDHA 2EIHA 4ETMA 4W5OA 2JFFA 3LSTA 3EA5A 4AQDA 3NHRA 4BGDA 5BOSB 4JDUA 4BASA 1II8B 3LPCA 1NVVQ 3OCJA 4AD8A 3H2HA 2CD7A 1HEIA 2VAMA 4RD2A 5G3YA 3RS8A 3I4CA 1CY1A 2FX2A 4EYKA 1V96A 1P44A 2R60A 3CEPB 2P4HX 4QYWA 5FHRA 3U7QB 1EK2A 1YRQA 4IDGA 2QZZA 1ZJYA 3GLQA 1JPJA 4MGHA 4ARVA 4MPDA 4ZCTA 1R7RA 1WZIA 1W36D 1YS9A 4OYHA 4WL0A 2B34A 4KXLA 3CY6A 3LRXA 1USVA 2I7CA 4NE7A 4UUAA 5CUQA 5CXQA 2XNKA 3FSEA 4Q1VA 1G9TA 3QNWA 3TGPA 3HKEA 2PS0A 2DH5A 3WNCA 3PGA1 1KDZA 4C4AA 5KU1A 2VNIA 3MIZA 1HNNA 2EGHA 4XQEA 5DX8A 2PD3A 4O59O 1Y5LA 3BIFA 5F3RA 1C3OA 1YB7A 2HMYB 4QU5A 3VYUB 4AWAA 5B36A 3NWOA 1FYFA 3BWMA 3MAAC 4EVSA 4EL5A 4H3HB 1GTG1 4QTYA 1GU0A 5L3QA 2DWOA 1HOTA 1KEEB 3UANA 3B1XA 3NHUA 3GPIA 1R0WA 2VZ8A 4P83A 3VZCA 1ZDMA 4K2HA 4MVJG 1JZQA 3E1KA 1AO3A 5EP4A 1COWD 1NP7A 1C1DA 2UUAB 4H27A 4DBZA 2JLBA 3IIEA 3CEHA 3FNEA 2JANA 4GLLA 3IL2A 3UH0A 3ZWQA 1BA2A 1U11A 2O48X 3LMKA 4IFIA 1GNQA 5CB6A 1EM8A 1I2CA 4KH0A 4Y1FA 5DNEA 5IDYA 2ZUEA 4RA9B 4RTSA 1MOZA 1BKYA 4BVLA 1EKXA 4PX2A 3ILHA 4CMCA 3AR7A 1DC7A 5DVZA 3RH0A 3AFHA 4WKOA 1DCKA 3WGMA 2HEGA 3LL4A 1P2SA 2AHRA 4P58A 4EUSA 1H23A 2AOXA 1NN5A 4ON9A 3SXJA 4B7AA 4K9NA 3K0HA 5IWCA 1PZGA 1VP9A 4CTOA 1CR4A 3PIIA 1P9WA 3QE0A 2VTVA 3IKTA 1T5TA 3BVPA 1QXSA 5L3SB 1ZWKA 1QFXA 1NF3A 3E22B 4JOCA 1SD5A 4IJQA 3ZIAD 4NQRA 4CQMB 3ZD7A 4MQFA 4ALKA 1L4FA 1P77A 1DDGA 2XKKA 5HUQA 5JSZB 2QSYA 2C4VA 4CM3A 1THGA 4AUEA 2O8DA 1JBKA 4R8MA 1WTCA 3SXUA 2BMWA 3EGDA 1G17A 3OTHA 4CN9A 3B5IA 4DGSA 1I01A 5C7YA 4ZI5A 4ZZ1A 5K0CA 3T5AA 4DR6B 3LBNA 4LVCA 4F8YA 5ALNA 5HWSA 3TZHA 4ENPA 5JCZA 3O3OB 4PXSA 2W7TA 5H8WA 3U19A 2EXXA 3RJ9A 5MDHA 1G3MA 1KVUA 2IEZA 2OK8A 3JWEA 3F6EX 4QLOA 5LIPA 2QKYA 3QX9A 1I2MA 1ZH6A 3GRVA 4UHFA 1J25A 5T41A 3BS4A 1UZUA 4TTQA 2C83A 2FZLA 5F21A 4FCTA 2GUWA 4HI0E 2AJBA 2FR8A 1O6FA 4Q21A 4Y3UA 4BKQA 3TI7A 3BFVA 2BUAA 1FLDA 2JBHA 1C9MA 2NAFA 2Y71A 4G01B 4HDCA 4Z1MD 5BNIA 2ZRGA 3EPPA 4ARZB 1DKMA 2P6MA 4LYEA 1IPEA 3PA8A 3X3HA 1OTYA 1U2DC 2YV5A 3GUVA 2ZYRA 4ACAA 3MJHA 3V4RA 1Z8HA 4A2CA 1H1LB 4XD7A 2XGGA 1F60A 2W9XA 1KGSA 3DDNA 3VC3A 2I6TA 3QKSA 4IUDS 2D8AA 3FGPA 3G7UA 4MVCA 3VHXB 1I2AA 1SHUX 3ZGYA 2QN9A 3K71B 3O26A 3J7TA 4CTMA 5GGYA 2UV8A 2G0NA 2JATA 1L5GB 4NJOA 3C3AA 1AZSC 4N7BA 4IDQA 4YREA 1A5BB 3IDSA 4P4GA 5JCOA 1T3TA 4OP1A 1ZHHA 4N82A 4POAA 1E2BA 5BYBA 2F4NA 4RELA 4C20A 5BSUA 3S44A 1H0KA 5JARA 2PZJA 3S2UA 3I04M 4CN8A 1Y5MA 4LCBA 2OXRA 1C8LA 2I2WA 4GH5A 2ZG6A 4NL4H 4WZ6A 5COBA 3FYTA 5ESDA 1EEHA 4G8DA 2NTVA 4F2WA 1CERA 4CLEA 3JVDA 1R6XA 3JD3A 2PT9A 4MYUA 4Q39A 3ECAA 2HGZA 4WQMA 5T3UA 5H80A 1FBTA 1JSRA 2Q2WA 1LVGA 4PHTA 1U0TA 3TCNA 3MG9A 2YNMA 4G07A 3DHVA 3OE4A 2R3SA 2QG4A 3F6RA 3OVMA 1GL3A 4LXUA 3A1DA 5AVKA 4GQBA 5E6RB 3CF2A 3A1FA 5FJIA 4Z3DA 5LOVB 4XWOA 1CKEA 1Z2EA 4QUAA 1W1IA 4DR1B 3VNAA 4MWSA 3K8QA 1XMXA 5FBWB 4QU0A 4AP5A 3GA0A 3FVRA 5D3KA 4KWHA 4HGOA 1KFJB 4KQIA 3D7LA 4WNAB 1IVSA 1SEVA 3CINA 4RK5A 2WUEA 1GNTA 3DVAB 3IUBA 1VL5A 4NMXB 3LXMA 4ROSA 5F78A 4ZO7A 1TZCA 5KTPA 2WIKA 4ZQIA 2KMLA 3VZSA 1COZA 3PNQA 1PJRA 4I3GA 4X9XA 3UMYA 3N0RA 3NBFA 4CKBA 4Z86A 9MHTA 3ZCRA 2AE1A 2EZ4A 4GNKA 4PZ0A 1PK7A 3QJ5A 1II9A 2CDRA 4LZWA 4P36A 4Y7DA 3RRJA 5AJVB 3WWYA 2RBGA 1KKMA 3CVUA 1BX1A 1OV6A 2V55B 4YV1A 4O4JB 4RWZA 3CO0S 2CHVA 1R8XA 2Q9AA 3N2LA 1HYGA 3QKWA 2C59A 1T36B 1O57A 4LDAA 2EF0A 1P1RA 2P9HA 4HQRA 5C1PA 1ZL2A 2CEAA 1RC0A 3F5QA 2AR0A 4EF5A 3IH5A 1O7JA 3HO1A 1NUSA 2OHHA 3L9WA 3LIIA 5BSGA 2VHTA 3WIVA 1C9DB 2HMSA 5E7JA 3H11B 5HF6A 5KX5B 2ORVA 1Q84A 2PNFA 1ZAKA 3QU5A 4CM9D 3D4PA 1WCWA 3D7RA 2WG0A 1KYIA 2BKXA 4B09A 3ZHVA 3IQXA 3HRKA 2W6IA 5A7HA 1DX6A 3ZK7A 1R12A 1SZJG 3PT9A 1PDVA 2IYLD 3BYZA 4BX0A 5TGTA 3A9UA 3ROFA 2CUNA 4BTEA 2D1QA 1WPQA 5ECWA 3P0EA 5CX1B 3TZBA 5J43A 2J1LA 4EX7A 1HDRA 1YH3A 4HYYA 1P5RA 1K9SA 3U4QB 4RQBA 5TPWA 4DMMA 5KYXA 1GO2A 4P4UA 3BFJA 4Q3LA 4O8CA 4KU4A 4YV0A 3JWPA 2IWHA 2GPTA 2GN4A 4HDRA 1M1UA 3VH4A 1O4WA 1GCIA 1MGOA 2JJ8A 3L4EA 5JAPA 4C43A 4C5BA 5SY4A 4KH1A 1A4IA 1NBMD 2VF4X 2YS6A 2V97A 2JBWA 2DHRA 3IUJA 1TECE 1U98A 1P0FA 3FNRA 3LSYA 4RAOA 3TQRA 2DGDA 3CGGA 4N54A 5K45A 1GZ4A 1Y37A 1IBCA 1M0WA 1YCGA 4QSHA 4FZ5A 1MO5A 3AC0A 1A2OA 1XMPA 5KUTA 1U5CA 2QTLA 3OETA 3R2JA 1I6MA 5DN6A 1R10A 1YE5A 4G5SA 2F3TA 3SHQA 4JVMA 1Z06A 5A7FA 1ABFA 3DSRA 2Q3EA 1X15A 1E9BA 3H9EO 4RUKA 5EYPB 4HEA1 3RS5A 1E6WA 3FUWA 3JQ7A 1CBUA 1MJNA 2Y2VA 1KYYA 3L7MA 4Q9HA 1ISPA 1ZW1A 5H82A 3C41J 3SMQA 3K9GA 1OBOA 5JG7A 1OAAA 1OX4A 5I9IA 1JQJC 1Y0BA 4U4AA 1R74A 1JPNA 3HPRA 4Q3KA 5KKNB 2B1JA 1QHXA 4NCBA 1CUCA 4BZXA 3P7MA 3HACA 4IDPA 3SS7X 4BV8A 1SPBS 3KEFA 3ZEAA 2ZZNA 2N46A 2GUGA 4YJ3A 5K8VA 3DMTA 4M1ZA 3RLIA 3O91A 2ZATA 1BMFD 3OIDA 4KSYA 4DDKA 3GA7A 3LXXA 3NTLA 2CY0A 3KKEA 2IYYA 4A73A 3OHPA 3EZGA 3PGLA 3M3PA 3QLJA 4M0UA 4I66A 1RKXA 2PKCA 5C5CA 2B5OA 3EF3A 3ZOKA 3RRXA 2I8CA 1TAQA 3RREA 2B2XA 3RVNA 1SBYA 1BC5A 2FAXA 4QVKA 3EFBA 2MCFA 1R3UA 5EQDA 2H1WA 5LJLA 1VCHA 4EMUA 1YBHA 1NBME 1X80A 4KQEA 1CQWA 2VPQA 3F6BX 4W63A 4NPCA 2Q1XA 4MV1A 5TQJA 3TVDA 1EG7A 1GG8A 1ZBQA 3PD1A 2DBRA 4OQEA 4ZYLA 4B76A 3DDHA 3AVWA 1VCNA 3WLJA 2ZUBA 3TQCA 4ZZ0A 3ZZ1A 2IYUA 2J6IA 2WILA 5LOVF 1ZH4A 5F1PA 4DRXB 1ZX1A 1O6GA 3VBCA 1AD2A 3GMTA 5LZ5A 3ZIUA 5BWMA 1GQOA 3DG9A 1DDIA 2GBLA 5HNKA 1G2OA 3NKFA 2SCUA 3I5YA 3DLPX 3MGCA 1OUMA 1HKHA 3ELBA 3I52A 4UEQA 3T5GA 3E9DA 2XB2A 2ZVPX 4ZC1A 1RABA 4FX2A 4G41A 1FTWA 1F2TA 3KEQA 2HO4A 5KAMA 4PZ9A 5FHQA 3WGQA 4H6WA 1IOVA 2VTBA 3QVWA 3UT5B 1IQPA 1Y33E 3IVMA 4PRLA 2OAQ1 4C7MA 2PRIA 3WNZA 3A1SA 3DQZA 1L4UA 1AV6A 1T29A 1IWPB 2BSXA 4O4JF 2REBA 3B1VA 3D3QA 3LKDA 3NTRA 4KLAA 3Q2OA 2HI0A 2PKWA 3EZ9A 4LE2A 4Y6QA 4BN4A 5EHZA 4FFDA 1FYEA 1GPMA 2O2DA 1F9AA 1V8BA 4HH3C 4PAQA 4RGVA 8LDHA 2W2XA 4V1CI 3I01M 3T5TA 1L4BA 4KI0A 3SPXA 4EA9A 3DJFA 5KQGA 4B7CA 5KNDH 5CYGA 4JI4B 5IDVA 1B0ZA 3U7RA 3UPUA 3AF3A 2P3QA 4MWOA 1IY8A 3D6NB 4ZOLA 3BGDA 4ALNA 1UBKS 3C3PA 4MZDA 3KHTA 1V1MB 3KQNA 3LVQE 2JG3A 2F90A 2ET6A 4N39A 1ACJA 1PR6A 1RWPA 4UUPA 2J32A 2ZSUA 4Q03A 4TLLB 3RADC 5AW8A 1FFWA 4QA9A 3N2EA 1V5IA 2AK2A 7ABPA 4TMKA 2JJ2A 4TKMA 4UEWA 4YLEA 2RE8A 4RVGA 3FPSA 5JCJD 1JDTA 3PVCA 4L57A 5G1NA 3BA6A 1ONPA 4CNBA 4TZKA 2YOGA 2YJ4A 1UWKA 4N7RA 3HXQA 2JFUA 3GOQA 1U2TA 1JDPA 1I7PA 2X8BA 3HP7A 2H0QA 2PUJA 3DWFA 2PYIA 4GICA 5H3HA 4C05A 2D00A 3R7FA 5AJWA 1T35A 4XW2A 2HYDA 3EWNA 1CU1A 4JBGA 4IV0A 1CDZA 2QTMA 3IIMA 2XCUA 4HWSA 1YVUA 4NDAA 2J9GA 5ALJA 2O8EB 3MTQA 5FLKA 1DG1G 5HIAA 1USUA 4M7PA 4BE4A 2AFHA 3CO5A 4LZJA 3S1LA 5I9LA 5JZBA 1ECGA 2GK3A 3BWCA 1AT1A 4K86A 3W2IA 4LJ8A 4N0DA 3WFJA 3FTFA 2EG5A 2ZE8A 3KCQA 4OMCA 1Y6GA 3PT5A 1QB7A 3ETGA 1LPSA 5I47A 2OBBA 1Q21A 3IT2A 1W88A 3QWAA 5LMCA 3FRHA 5B12A 1TJPB 2FN7A 4JKOA 1HQKA 4GQAA 3TX6A 1OLOA 1QAQA 1FP6A 1L7QA 1TQ8A 3MSXA 1XTVA 1QP4A 1E2UA 1X1EA 5FR1A 4ESOA 3ZGZA 2B1IA 4GHWA 4AX8A 4EA7A 1S96A 4IILA 5DHUA 3PRHA 5JTTA 4S05A 1J4AA 3EZ7A 3HZHA 1RQGA 4PRZA 4LRYA 1KYWA 1Z33A 3GYGA 2QZ4A 3U4AA 4YECA 4GBED 5ADUS 4K6KA 3CUUA 5IVPA 4RX1A 3H2BA 2DR2A 3MWYW 2QRPA 2Z08A 3JRNA 4IEIA 3F9IA 2CVQA 3W6PA 3KE8A 1SQSA 5TF0A 5ISMA 1K7FB 2WTNA 5ES4B 5J9FA 2C4TA 4YJFB 1MG5A 2ZM6B 3LYHA 3DMNA 1OFHA 4LGMA 4RLFA 4RY2A 2JI4A 3OT4A 2WK1A 1TPZA 4KV9A 4M8KA 3KXPA 2E5LB 3MRSA 1W75A 2ILVA 3BH7A 4LISA 2F4VB 2A67A 3A2NA 5LL6P 2WD9A 3FUVA 3UAZA 3FWPA 2W8BB 3O8OB 2BGIA 2GR9A 4XRRA 1L7PA 4W1PA 1QVRA 3ZY5A 2EJBA 1BOOA 2GFIA 3E18A 4URXR 2PV7A 2RHTA 1BU8A 4L73A 3LTEA 3MMNA 2XZTA 5HQ3A 5HZKA 1T3LA 4H7HA 4QGAA 1W4AA 4M86A 3R0XA 4QOFA 1AN9A 1BTOA 3LW7A 4D9BA 3A6KA 2WVHA 2YHSA 1NI5A 2VYFA 1FRNA 4PQEA 2B4RO 5LZ8A 2FN8A 1W5FA 1VFPA 1D07A 3OLWA 3ASUA 1XMSA 1SU4A 3WYEA 3WDMA 5EJGA 5LP6C 1J0XO 3M5WA 1OLSA 2GZAA 2VP0A 3H42B 4GYJA 1G42A 4JLUA 5B37A 3AF4A 4D9CA 4F6LA 4DV4B 1X13A 3UJ8A 1LS1A 1A7UA 4P98A 4WXHA 2KQUA 3MJVA 4ER6A 3Q40A 1O03A 1YQXA 3OKFA 3RCBA 3AYXB 1VCMA 4JJGA 4O5OA 4D8UA 3QV2A 4P54A 5EN4A 5E6SB 3AUKA 4PLHA 1PR2A 4UHCA 4EECA 4EI9A 1M0TA 2GASA 1UKVY 2HBZA 2QG6A 3PFFA 1IQUA 1T6XA 2IDZA 3M81A 4GLOA 3VZQA 4OQMA 3X1KA 2NO5A 4LZLA 4PNZA 1TXGA 4C7KA 1YS4A 4LSGA 4Q3NA 3C8HA 3H2IA 3F78A 4XGNA 2FETA 4NABA 2YHBA 4R7TA 1YK1A 2QRJA 1ODJA 4L15A 2HMAA 4ZZ3A 1AF7A 1SOVA 4HDSA 1XFDA 4J0QA 2VKTA 4XVUA 5E9AA 1RXWA 1M6YA 1UMKA 3OZTA 1E99A 1V71A 2J3MA 1TU3A 4GE0A 4WLOA 3TQTA 3X1MA 1ZI8A 4PFKA 1V8PA 1J7KA 3ZV4A 2YY6A 4IWNA 4FDMA 4Q7QA 2B6HA 3AFOA 4WN9B 3NFYA 5CP8A 1GPDG 2C9YA 4QBIA 2P7IA 2QYHA 5CD1A 3ZDZB 3KXKA 3BWEA 3CRNA 2QRUA 1G8SA 2ZRIA 3H99A 3LQ1A 3H2KA 3NBXX 4AJNA 3HKCA 2ZI5A 2XNDD 3F7NA 1OB2A 1QQ7A 3N2IA 4FZRA 5K8IA 1B23P 1DWQA 4LRQA 4WUTA 3TAXA 4CLOA 1TO2E 4HY3A 2ISQA 4GM0A 3WYGA 4G81A 5IZCC 4TV8B 2X9NA 3WKBA 2R8OA 4BHTA 1JEQB 1NX6A 1G5RA 3I5AA 2BTQB 1C29B 2CJWB 4FXOA 1HDOA 5JQWA 2D1FA 1XUOA 3IX7A 3ODPA 4HH4A 4GKVA 4TLMB 2Z2KA 3I9FA 2HQ1A 2C5SA 3RYIA 9GPBA 4CETA 1QRUA 1BA3A 2JAWA 1PG5A 1E3WB 1S2GA 1AB5A 2D1TA 2GXUA 2J7PA 2QUHA 2RG1A 2FSHA 3D4LA 3NWBA 4NWIA 3TFWA 3HYNA 3ELDA 3X2SA 2C77A 3F73A 3DFMA 3IEPA 3UXEA 2BFNA 1WLYA 1RS0A 3A6PC 2FW0A 4G24A 1E5VA 3AETB 4JCCA 3FDXA 3EOAI 3F90A 4S12A 1ACMA 4Z49A 1XZIA 3UVEA 3W5DA 1PNRA 2FMKA 3HDYA 1GAJA 4A8JB 5KWIA 1ZNQO 1WVMA 5DZSA 4RYDA 4MS3B 3DXZA 3HVUA 2O52A 1YQEA 2VSQA 2C31A 5AQ1A 4P7KA 4OXKA 1KFEB 3KPYA 5A4KA 4S3MA 3CVYA 2GPJA 5EIWA 2DULA 3QELB 2Z5VA 4H3SA 3LQQA 4UDYX 4UVGA 3ZJ4A 5TDHA 3DE4X 3WLFA 2ZJ6A 3EC2A 3VU0A 4BNGA 1E59A 2QGNA 2RFLA 2ZDQA 1YAHA 4I2NA 4TN1A 4CEHA 1VJGA 3BSWA 4L78A 3UWDA 1RHUA 1YR9A 3B2EA 2HWXA 1G2IA 5ITZB 3GJYA 1BW9A 2C9CA 2K5UA 5FYQA 3PE6A 221PA 3EZFA 1S1CA 1SBHA 2ZVQX 1UOQA 2R00A 4GM1A 4TTIA 4XYEA 3UCXA 1QVZA 4I4CA 1YKSA 1NJ5A 2CWDA 3DB2A 4Q7EA 5DSXA 3ROPA 2PUFA 1CZKA 3I2KA 4RIIA 4FKMA 4BO3A 1N6LA 1M73E 2PUAA 5IKXA 2PR2A 3QW4B 3V2GA 3VU8A 3PXGA 1ZS9A 1OWLA 1HZZA 5HBGA 1E4OA 4YC7A 4ZQBA 4I1PA 3MXOA 1U8AA 2Q27A 2AFIB 1KXJA 1KOGA 2V7TA 4EPYA 2IK8A 5L7TA 1NW3A 3JWIA 5E9JA 2ZBQA 1Q57A 5T8KC 1ZO8A 2Z9DA 1Z5OA 1GM5A 3QKRA 2EIXA 1JXQA 2RHLA 4KMOA 4GXRA 4WBNA 4RL6A 1X2EA 1HFWA 3ZWNA 4RHUA 3LOUA 3LQ4A 4RCZA 4ZI7B 7GPBA 2IHJA 5K0BA 4BNWA 1IM8A 5ALXA 3T4UA 4OHWA 4EY5A 4RTKA 1CEQA 3DEIA 3THWB 3QU9A 5JJKA 2X76A 3NS7A 2IHKA 1NI4A 2B78A 1BS1A 3HRHA 1QGAA 2I3ZA 1E58A 2WIGA 3C7AA 3HV2A 4EJMA 2GCOB 4KWCA 5AICA 3UM9A 1TAUA 2GBPA 4KR3A 2X8WA 4TS4A 5HF8A 4GPTA 2XBLA 4OUKX 3LV8A 5IUJC 1XYYA 4EUFA 1QWSA 2ZRPA 1WD5A 2PPVA 2EP5A 3QXJA 3R5KA 5GGXA 3MRVA 1THTA 4DLVA 4FZJA 1UBRS 3WQQA 3V8PA 1O58A 2IC5A 3PU6A 2I2AA 3VR4A 1JIIA 2ECPA 1GKYA 4DS3A 3QE3A 2V0GA 5FO1A 5FPSA 1KSFX 2X4DA 1TJYA 4NLLA 4MYRA 5E3HA 4WACA 3RUFA 4YMVA 4HTFA 1YDHA 4I4IA 1ZCZA 2P3SA 4L7QA 4DTCA 2O2SA 2F8TA 3I04A 1SC6A 3Q2KA 2BGWA 1W7AA 1G0OA 4GI5A 1CNMA 2IEYA 3IQWA 4O2AA 4QYIA 3RHFA 5FH9A 2RAFA 2NWQA 1DLJA 3H6HA 3OHMA 1W2WB 1P7WA 2O2EA 3KDAA 1JQ5A 4CG1A 3BD7A 4GLFA 2D1SA 4BOYA 1KO5A 3Q11A 2C9OA 2G9UA 3QMWA 3E03A 4QPNA 2WSLA 4YQZA 1OVMA 1E79D 2FB9A 2ATXA 4XIJA 1GZDA 2Y9MB 3AOEC 3RS7A 1PQPA 1PD1A 2WMYA 5E4FA 5CB4B 2GRJA 1UXHA 2I8AA 4TM7A 1C14A 1TA9A 4YDSA 3T7EA 1KZGB 4KHZA 3L77A 4V0LA 1HYHA 4ZAXA 1CUDA 3I9JA 3EASA 3PHGA 4D9HA 3AVXA 1FDVA 1NUUA 3AEUB 3IP1A 4UUQA 3K4PA 1E69A 4MDEA 4OX9Y 2WIDA 3R5JA 4WEOA 3RTCA 2R97A 2RGGA 3UQYS 1B74A 4EJSA 3SF0A 4ARUA 4IIJF 3E4CA 3HDHA 4RKWA 1XTIA 1G9XA 5C46F 1KJYA 1ST3A 1ZWLA 2EKZA 2GEVA 3EGIA 4EHLA 4YAUA 3ZVKA 1TVMA 4TKUA 2AC7A 3HKEB 3WGVA 2X1HA 3NIGB 1HLGA 1RWBA 2OQVA 2Q7XA 4BATA 1XZAA 1YULA 4PX5A 1CB0A 1I51A 4EWLA 4TV8F 3ISJA 1K5GA 3QSYA 2IU4A 1KVQA 1SN7A 3BRQA 3CONA 4B6OA 2OXFA 3MAGA 3UJPA 2FQXA 2VSXA 4RHFA 4Q3DA 5H0IA 4C0JA 4WLEA 4ZO4A 1VJDA 4DN6A 4CTJA 2II6A 4AL4A 4U2BA 1SVNA 2X8JA 3W5IA 2Q1TA 1LPAB 4HQ6A 1M8KA 3HXTA 5L3QB 3IAHA 1RQNA 1EVKA 4R2XA 3ZUGA 2AJCA 3PQ8A 2RGCA 4H1TA 2ZEJA 4LNHA 1UXGA 3B8HA 3DMRA 3BJEA 1QE0A 1A5ZA 3MTAA 4MS4A 2JJYA 1Q2XA 4NQZA 3TVYA 4D92A 3GNQA 5FBVB 1C1DB 3FMOB 4OB7A 1EK6A 4OGWA 3AW9A 5B2EA 2YVQA 5KTRA 3M3DA 5KWEA 4LRUA 4K3VA 4GUAA 4UPDA 1JQAA 3VU1A 5CFNA 4R68A 2I4OA 1OOEA 2GRAA 1YI1A 3H5AA 4ZGGA 1A76A 1ZXXA 2HMUA 2QVXX 4PQGA 1Z68A 1OGIA 2PA3A 1T8TA 2Z1DA 1US8B 1F1BA 1K4YA 1L9KA 3LYLA 3IBYA 4Y1EA 2YWBA 3OPVA 2NP7A 4P3XA 5EHQA 5I45A 1DAMA 1D2GA 3PI6A 3NHBA 2W4QA 3O38A 5EVCA 4AO7A 2WU8A 4F11A 2EFDB 2VF7A 4MQFB 5HUJA 5J4VA 1ORDA 1AH2A 2YMQA 2W6MA 5AW0A 1Q0TA 5IVHA 2PWYA 3EGDB 4P86A 1Z56C 3S5JA 1QP0A 2HIGA 2OBLA 2UU9B 1N2IA 3IBCA 3RLFA 1GZ6A 2NO1A 3DPIA 1ZOOA 4GFDA 3D2LA 2PLNA 2PH3A 2OZKA 4MW0A 2OBYA 3NKLA 5L3ZA 3NBKA 3ZW8A 4TLAA 2QMUA 3VUFA 1KK3A 3ZBQA 2I6GA 3K1AB 1UBNA 5BXQC 1MQSA 2OO5A 2YJ6A 4X93A 5ALFA 1QOZA 1S9HA 3JD4A 2F64A 1V7ZA 1U4NA 2AB0A 3I3SR 1KQ3A 1S8NA 3PYXA 3SYLA 4CLRA 3SKYA 2NYUA 2AR9A 4EZIA 4WZBA 3S5UA 3STWA 4P92A 4C7VA 4ZI7F 5HRCA 2IHVA 4EO4A 2GN6A 1MXHA 3NQ41 2OZPA 3E35A 1ZQ9A 3CVJA 3C6XA 3R3JA 3A32A 4YACA 3VO2A 2EKPA 4B4UA 1CF4A 3MBKA 1C4OA 1FYDA 2BJWA 3D8RA 4HQKA 4LBZA 3IA7A 4ZVUA 1FFSA 3Q7EA 3RO7A 3ZD6A 1H2FA 2AJDA 1KH3A 2Q07A 4EJ2A 3VSEA 3WLQA 2VRCA 1LBTA 1T9GR 4G8CA 1B6TA 2GN9A 3S3TA 1BAPA 1M2EA 5EKUA 4R2JA 3QKSB 4IDOA 1EFDN 2QVZX 4EX6A 2R6GA 2GNPA 4KSBA 1L1FA 4ZYUA 1U1CA 1ZH0A 4G5XA 1VYUA 4Z9AA 2N0SA 2QRQA 5AI0A 4WCVA 4B79A 4Q4CA 4CQJA 2O6LA 2Q7OE 3PXEA 4GQIA 3T41A 2CCKA 4H1UA 1KU6A 1YMUA 4XARA 1WF6A 4PLWA 5CVCA 5E4YA 2VPZA 2BP7A 3HWWA 2JASA 2FEAA 2P2DA 1QE5A 1ZEJA 2QLLA 4QXMA 4UVDA 4B5LA 2IUEA 1VHTA 2XUPA 4ZYVA 1GADO 4CYMA 2QF7A 1QB8A 2GCNA 2JVJA 4JK3A 1P61B 3PE4A 5ENDA 4U6SA 1K7YA 2A0WA 1P0MA 1ZGGA 2FPLA 1Z6XA 4J2HA 4J1TC 4MQUA 3RTBA 4EFLA 4MB0A 5CB4F 3R74A 1UPUA 4B4VA 1TLTA 3AXSA 2JFNA 2ZRJA 3O1IC 3ENWA 3DD1A 4KO2S 2PS9A 3O4IA 1CUYA 1U7ZA 3AM1A 3OIYA 5EHIA 4S2UA 4R2MA 3OD5A 4ZQGA 5SZKB 1WZ2A 1GGJA 4OH7A 1Q3TA 4AUMA 4DIDA 3RT7A 5HKKA 2R6R1 4DR5B 3HP4A 1QCDA 1UAYA 2I71A 4HL6A 5K99A 2JGMA 3PXAA 2IY7A 3R5TA 2QXYA 3LBIA 4ITVA 3OFNA 3J7AC 4JQOA 4E5MA 4EFDA 3A4LA 1L9XA 4ZT6A 3QLVA 3QXCA 3P2KA 1VHWA 4CIWA 4QEZA 5BSKA 3PVZA 3N7TA 5CX4A 1T1RA 1PLKA 3IUNA 2FSIA 4JVOA 4XD7D 1ZK4A 2IP2A 3PNPA 2PX5A 3DVRX 4HDMA 3HZRA 1T3HA 4JGIA 4FZVA 1UBUS 2CNKA 1KKLA 4LXGA 5LBUA 4BLUA 1HE5A 3GIDA 4RV4A 4DSZA 3UB3A 3DHWC 3F8TA 4BECA 2SKDA 4CKBB 1PHRA 3H0KA 1XAHA 3I01A 1KK2A 4PPFA 3PTAA 3CIOA 2DHQA 4DNXA 1EVQA 4LDNA 1LU9A 3O3CA 3EIXA 3GAMA 4JYZA 1QF9A 1QCCA 1X3SA 4KNYA 3R5SA 4CMGA 3ELUA 4HK4A 1PWXA 5AXBA 4LBWA 3QJYA 4L6CA 4U2CA 2IF2A 3S2EA 3ETHA 3W8RA 3WGOA 4ERXA 3MSCA 1DIRA 4KO3S 4DCMA 3Q7SA 3MQFA 3L8GA 1T9AA 4JBIA 4RJJA 2AVDA 2BEJA 3OQIA 4NDNE 3M4ZA 5CURA 1TQ2A 3GQBA 3JWHA 4LC0A 4ZKEA 3BT7A 2LCIA 2ZJ5A 1GGEA 1X38A 3ZV3A 1TADA 3OQ1A 2QWXA 3A4IA 1G98A 1WR8A 4H1VA 4DQUA 4Q4DA 1NG1A 3TRKA 1NQAO 5H81A 5A0TA 4CF3A 2R86A 2PZKA 1L7BA 2JGRA 2P3LA 3I9OA 2CHQA 5EXSA 2YNMD 1HE4A 1L7DA 5ALEA 2A57A 1ZG3A 3CLSC 2DFPA 4ND8A 5HTOA 1J1UA 1UAAA 4JJIA 2BGTA 3DQQA 3VKUA 1XT6A 4E5SA 3NFRA 4PF1A 1G5IA 5TPWB 4BKPA 2DG2A 3HCPA 3KEOA 4N0EA 4L02A 4UJ3A 1P6UA 3V8EA 4F7WA 5KYXB 2FSSA 3GRRA 1KARA 4G1VA 4HDRB 5HMMA 2H4FA 2HIHA 2OL4A 1JJ7A 1OWMA 2O7SA 4Z51A 3P0IA 1UANA 1Y6RA 3IDOA 1HOXA 3WK9A 3ZWVA 4OPMA 5FORA 2PQ2A 4HQ0A 2CFOA 4DLBA 1IMJA 4KIJA 5AI4A 5LQKA 2V6JA 2YWEA 7YASA 1UC9A 3HXPA 1N3LA 1NM5A 1JDNA 1GDTA 3VVCA 3ELYA 3V1UA 3GLKA 1XMQB 2CXQA 1MPTA 3KIPA 4PSUA 2NU9B 1E62A 2O8BB 4OREX 3G89A 4I8XA 1M2HA 1T2CA 5DF1A 1WMAA 3GEHA 3OQBA 3ROMA 2R0QC 1GTVA 3ZDQA 2PS1A 4HF7A 1TRKA 2EWWA 2DPXA 3OHSX 5EZ6B 1DO2A 2Y76A 4ISBA 1VGRA 1DHRA 2BIFA 5AHKA 2N9UA 2GCIA 3O9ZA 3PNKA 1A9PA 1AQUA 1DCTA 1ZOSA 2G0AA 5CB0A 1XDDA 4G3XA 2WHPA 3DV2A 1MBZA 1VLLA 3SJCA 2VP3A 5JLJA 1SR8A 5KBYA 2YYYA 2FP4A 4D3SA 3KO8A 1U0RA 3QTBA 2PX0A 2QAGA 2XTJA 4F3RA 2I0FA 1DKLA 1FTSA 1R9NA 4Q02A 4UD6A 2OV3A 3QHAA 4LHWA 1ZMBA 4TWZA 1PT5A 4AVYA 2QD5A 3DBRA 1ZM4A 3DEHA 4N40A 1P4GA 1T4MA 3ZZNA 4D43A 3G2IA 1LS6A 1V5GA 1E64A 1NVAA 4YJ3B 1SZDA 1U5BA 5L51A 3ZNOA 5TGZA 1JQKA 2BDEA 5C5DA 4X6XA 3K31A 4KLNA 1XJ0A 1W49A 3W34A 2ZVJA 3F96A 1ZP6A 3U7GA 1X70A 3ZDXB 2JGDB 3AIKA 3HCEA 1T5IA 3MWFA 1DKRA 3BMOB 4LQDA 4F46A 4B8YA 3EQ8A 3HUTA 3TKAA 4M7WA 4BN5A 4D9EA 2ACVA 2D2EA 2PRSA 3V34A 1CQPA 1QMPA 1F06A 3ZY2A 5KJ6A 3DO5A 4XWAA 1YQGA 5KVCA 3CH4B 3KOYA 1WEHA 4MGKR 3H86A 3ZDYB 4DR7B 4OFXA 3MBOA 2XUAA 1X80B 4HEJA 2CXPA 1U7PA 3PEEA 4ZVPA 3ZW7A 2G1KA 4QYMA 2HWYA 2G5CA 2ZTSA 1NLMA 4DQLA 3VA7A 4TRNA 4OLBA 1XDGA 3BHIA 4P0TA 2PKQO 3IJRA 4HCJA 3V2IA 1JKIA 2XITA 2B1RA 3K0KA 4JB8A 1H0HA 1SXJB 2JHGA 2BCJQ 4IXTA 5HKOA 1O77A 3ZJ5A 2QRKA 2CKDA 2VYNA 3WMFA 1DQRA 2DPLA 2SCUB 5TMDA 2TSYB 3OZEA 3R8FA 3PKZA 2NO7A 3I64A 3KVVA 1FS4A 2ZYSA 4BN0A 1F2TB 3UK0A 1TVCA 5CLIA 1QYIA 3HXLA 4MW9A 3ZGOA 5ED4A 1ECCA 3CVXA 2QX6A 2CL7X 4WXRA 3KPUA 3DZJA 3VISA 5A04A 4LMRA 4U9HS 3VR1A 4DCGA 4TYYA 1PNQA 1W59A 2RAUA 1I5EA 1EGHA 2W6ZA 1N2ZA 3EDRA 3LH5A 2A14A 4RFLA 4TT3D 3K70B 2GJAA 5CFRA 3K0BA 4G65A 4PLGA 4MI1A 5CM9C 4P8RA 4YP5A 3LT5A 5M29A 4IYJA 3RWOA 4JJ7A 3DD5A 4LRTB 3V8NA 3VU3A 4EF6A 3WRYA 4D6YA 1FXWA 1WV0A 5J1SB 1IB0A 2O3TA 4OMUA 4ZOLB 2QU7A 1L7VC 3CR8A 3OD1A 4JP3A 1Z5VA 1XDUA 3LCMA 3Q5EA 4M55A 3V4PB 4CLDA 1HDZA 1UM9A 2WLTA 1AE1A 1XZ8A 1GD1O 1ZVQA 2FVXA 3E7WA 4K3UA 4PC6A 3ZXXA 2ZRKA 2XXAA 3OF5A 1RYNA 1G5TA 1TK2A 2J9FA 2PZEA 4DMGA 1KKUA 1N5RA 2FCAA 2QM0A 2WSSD 3EW7A 3MGKA 2G9QA 3FFAA 4QSMA 4RL4A 1L5OA 5T4FA 4BLRA 3JYPA 5CG1A 2YXDA 4HNTA 1XXLA 1E2EA 1BEEA 2X19A 5JAMA 1WPXA 4BQOA 3ZY3A 2XADA 5GV8A 1MRZA 2C0CA 1RXCA 4K6MA 1F2UA 4RZIA 4WCFA 3T9FA 4U2KA 4B6GA 3NHSA 2FP3A 3BD9A 4QPPA 3JYOA 2LIVA 2I22A 5FBHA 4DSAA 3KBOA 1ZRHA 3ANNA 3KSUA 1O54A 1J2EA 2WYHA 1CZRA 4QGHA 3DHYA 2PTHA 2AFHB 2NUAB 3FPKA 2EWMA 2G28A 1YZHA 1FRVA 1XWFA 3C4VA 3JX9A 4RPKA 4TXMA 5IN4A 3G0BA 5B3JC 5JXGA 4HGQA 1NP6A 4MK4A 3QPVA 4YIKA 5DYIA 1XQYA 2FFBA 3LQFA 1Y4ZA 2G09A 4DCOA 1PL7A 1VYTA 1RAFA 2LR0A 4LJ9A 5A4AA 1L7EA 1T43A 1XU4A 2FFQA 2IYVA 4AIIA 4HN9A 1XZGA 3CZ5A 3PQ4A 4WWHA 1B73A 3IFSA 4ZD6A 3MHPA 2IXTA 4KXNA 3EG9A 1T5SA 1W8IA 3HJRA 2QY9A 4DPKA 5HM8A 3I23A 3T1HB 4B4KA 4XWKA 2Q3LA 3TUIC 5DNDA 2H2GA 2V6FA 4POOA 5CXUA 1T6NA 3ZX5A 3K30A 2RGXA 2C5FA 4OQXA 3REQA 3WB1A 2XQKA 2GM9A 2J41A 2Q1WA 5E0OA 3VAYA 4OJNA 3HVKA 5EWJA 3BAZA 1HLDA 3HUUA 4JGBA 2XGJA 4BV2A 2P4UA 3JALA 2VFAA 4F5EA 3GFBA 4FS8A 4HNAA 2XXBA 1V3VA 2V59A 3F5MA 5BNTA 3IAS6 1RP7A 1ISGA 3IJPA 1D3AA 1XTZA 3R4CA 1XPRA 1NIPA 1NY6A 1X7ZA 1LRJA 2WTXA 1PEYA 4MUNA 4AM8A 5E6UB 3P4UA 4YJ3F 4XUDA 1RYEA 4JD5A 4QATA 3LDGA 1ULHA 2UYQA 2YWDA 3AHFA 1YK0A 5ALKA 1G55A 4KK4A 1EK1A 1ZUD1 2X8AA 3BE5A 4NC9A 1MTOA 3AW8A 4LN1A 4PHFA 4D79A 1CY2A 3JTEA 3K0EA 1CJVC 2C2HA 3CNEA 1JX6A 1UPXA 3QU2A 4IVNA 4DZTA 3ULKA 1UXKA 3L6EA 1YB2A 4ITRC 5HQ3B 3ACCA 2PLRA 5FJJA 2AUTA 5E4JA 1U8CB 4DJFC 1NVUQ 2CXUA 2QTTA 4EG1A 1ZA2A 1IJFA 1OHHD 3CUKA 5HCIA 3J81A 2C78A 1C4KA 4C5AA 1MQ9A 1SCBA 4IQ8A 1X7WA 3SC6A 1BN6A 3K5PA 2XCTB 1GNSA 1IHUA 1G8KA 2FJ0A 1BMQA 3HDVA 2ZVDA 2GESA 1FBNA 2Q0XA 2PKYX 3AJAA 3GAAA 2ZAOA 1GCGA 3TE7A 1FSGA 1TQ4A 2OORC 3GJ4A 2AH5A 5K0TA 3EQZA 1CR6A 4UQLA 4DB4A 3H13A 3FN4A 5CR9A 1OPXA 3FR8A 1U6IA 3N70A 3AERB 3OOHA 2G76A 5L4LA 2Q3DA 3G2PA 4OHFA 3A1EA 4RGYA 1L6IA 2VCEA 2X9QA 3FKQA 4R84A 4ZO8A 4LX0A 2Q2NA 2VPWA 2RAVA 1A88A 4D98A 2ATCA 3EXHC 1Z4QA 3ZHRA 1TJ4A 3WLNA 1C8KA 3C0KA 3SZRA 3ZGNA 5F5NA 2ICAA 4QVIA 1HDXA 1QIMA 4I55A 4Z7NB 2PMWB 1QOQB 3G13A 4IF6A 4LYJA 1G8AA 2OCBA 2MYUA 1WCV1 1AURA 1C9EA 4HDSB 4A36A 3MCTA 1VGQA 2FR1A 2XUKA 1N2CE 2ZJ4A 4WADA 3U49A 1W5BA 2EDAA 4NF2A 5KZMB 5J2UA 4OFBA 2A84A 4INPA 2ZZMA 2P67A 4EL0A 3DB1A 4KN6A 4QUEA 1YCFA 5F7XA 1WW8A 2FG6C 5TE9A 2JH9A 4ZOLF 5K01A 4E46A 3QE9Y 5IT5A 3AU9A 2Y77A 2VNHA 2XDAA 2CLSA 2GHQA 2PD4A 1TA0A 1OWOA 3HKCB 4FW9A 4GMHA 3HWRA 2H18A 4OQ4A 3CKMA 4EHDA 1GY8A 2ORED 4M4SA 1KA9H 1RAAA 3IVAA 3SK0A 2RGWA 3NASA 2PJZA 4L6AA 1Y34E 1H0RA 2AFHE 4GS5A 5JALA 1TEVA 1QGUA 3ZDAA 4R9RA 1NF8A 3TNFA 1BXZA 1M2JA 4LC1A 2G5TA 3QE4A 3K6SA 4RLSA 5KMGB 4R8KA 2HJRA 1DUVG 2ZR0A 3F7TA 4ENQA 1SBQA 3NXSA 3RYIB 1YU6A 2W2KA 4M83A 1NRXA 1TMOA 4EAAA 3EPHA 3C7CB 4FKZA 4FKBA 4C3VA 3P2YA 5TX7A 4BGIA 4U2FA 4D99A 5LVAA 1R4MA 1V6AA 5EMNA 2QV7A 3NEYA 1FNMA 4J3JA 3PF8A 4PYKA 4YRDA 4MPPA 2FEPA 3GGSA 3KYBA 4TXJA 1T5OA 1K88A 4L3WA 1G64A 4KQCA 1A5TA 4GWKA 5FBLB 2DQYA 1JTFA 4B44A 4NYMR 3A9VA 3T52A 1ADFA 3KFVA 5HRUA 1EFAA 1BQ4A 3W6OA 1F12A 1MNAA 4OU4A 3HCNA 5E4TA 3D2BA 1ESCA 1HORA 1K4MA 3DEAA 1DAHA 1M9NA 2I1VB 1I4EB 3NAZA 1KSHA 3G02A 2OV4A 4HFMA 3V4SA 5JROA 1KFBB 4CEHB 1ARZA 4U9UA 3KT6A 5AW1A 3DO6A 3INTA 3OJLA 4N5DA 1JL3A 5B1DA 4QFMA 5BSEA 4LF9B 1BW9B 4XKJA 4KREA 1DARA 3P1JA 2NVWA 3NIDB 1ZJZA 2A7QA 3GGCA 3FDZA 4QUDA 3GCWA 1GZHB 4P9NA 4M21A 3FZYA 4BVKA 5E9WA 3HI6A 4R1TA 1T2DA 1JYFA 4EO9A 1NG9A 2H16A 3BMNA 4CKZA 1SPXA 2ONCA 3K0CC 2QX8A 4BLQA 4QJIA 1KAMA 1MU0A 3IOCA 2O1WA 4KAAA 4KIWA 3ED1A 4ERNA 1GZ7A 4ZT2A 621PA 3ZD9A 1RBMA 3E2IA 4HVTA 4MR7B 5CT9A 4KOEC 2V8OA 4TSFA 4BQNA 1ODLA 5KVVA 1GRVA 1NFQA 1YRYE 2J7KA 5EL0A 2J7PD 5DHFA 2NU7A 5FRDA 3P94A 4OI1A 1K98A 1WXDA 3QKRB 4IJVA 4QOEA 2FN9A 2C07A 4WBNB 5J40A 1T9ZA 4CMEC 1N5LA 3V48A 4B8WA 1CS4C 3GLHA 1F6DA 4RKFA 1K3TA 4PC1A 2YJ5A 1LI5A 5D5HA 2XYVA 3PRYA 1TVKA 1VXOA 3GRZA 3RM3A 5EXPA 4X90A 3QUAA 4Q9JA 3EQ7A 2O14A 3GFRA 4I2VA 4PLTA 3K73O 3RVKA 2HW8A 2JCSA 1A9RA 2IGBA 1AF4A 1NXTA 5KWSA 4FUQA 1ONSA 1Y9JA 3WRXC 5ALSA 3IOEA 5SYNA 3VQTA 2CLLB 4TVOA 2Q0HA 4W6QA 4FHDA 1V9SA 4A9AA 3HXKA 1RRVA 1FQJA 5DTJA 3R7WA 6ABPA 3P27A 3UKJA 3RWBA 2QVGA 4P32A 5C1OA 1W5SA 2AG6A 2FGKA 1A97A 1VJTA 3QM1A 2DP4E 3KHKA 5EMHA 2PNJA 5JD6A 1J22A 3LDFA 4B3BA 3LUFA 2KLBA 2ZYHA 2GXQA 4LECA 3RANA 3TBHA 4KMMA 1OXXK 3G2JA 4HTFB 1Z4KA 1V1JA 2HA0A 3S8MA 3QUTA 1IU9A 4BU1A 2W42A 2JNWA 2IEBA 1FQOA 1Y6QA 1VE9A 1FLVA 4O2AB 4QYIB 4JT8A 3TD6A 5DM4A 3O74A 1JYSA 1TZBA 1PQYA 4AQ7A 1RLMA 3R44A 3O4GA 2HSJA 1YT5A 2W4MA 1KZ6A 2CXXA 3EAQA 3H8JA 5EUCA 4BVGA 3ZE1B 4TWJA 1OFTA 2HNAA 4BDSA 3GT4A 3M5CA 1GQQA 4UATA 3ND7A 3DMDA 1JIJA 2B0JA 2DZDA 3L6BA 1U6KA 1CE8A 1UZNA 4UU1A 3VJRA 1ZJWA 2VRWA 4QKQA 2P69A 1OY1A 4GMXA 2BHTA 1KI3A 2JRCA 3THRA 3UMCA 2IELA 4RJTA 3AG5A 4JSTA 1N6PA 1TC1A 2W71A 4HVCA 5AVQA 3KYDA 4DNQA 2BBWA 2ISSD 2FCRA 1OIXA 1G6OA 3OZFA 4RK4A 4EKIA 1B16A 3W5CA 2D5BA 4IV5A 4K5QA 4QTXA 3KVYA 3W6ZA 1DJLA 4F71A 1TLFA 4NG4A 1N1GA 1NDHA 4TKUB 4XR9A 1IZYA 2FLKA 5ADWA 4OHYA 1J90A 1JG4A 1BEUB 3RAEC 2HBQA 2XB6A 3IE0A 3KM0A 1JJBA 1H85A 2ZYWX 1E5QA 1E0KA 2HA2A 1MV5A 4RPGA 3SLRA 5DYGA 4BV9A 1EXMA 1OKKD 1EAMA 2Z5LA 3AX6A 4DIFA 4UHDA 3MB5A 4C2UA 4OMFG 1U1FA 1VPEA 1BXGB 2Y99A 1EUCA 1WDMA 2QLNA 2X8JB 3I72A 3RRYA 1G6KA 2F3SA 4HQNA 5I5GA 1GWNA 1Y82A 4IDAA 5CVJA 5EJMA 2WI8A 3LCUA 2YHAA 2WOOA 4AZWA 5EE0A 1G6HA 2PWBA 1U7OA 4FFMA 2IUTA 4MS4B 4IJUA 3SYRA 4X91A 4BLWA 2IYAA 4MO2A 4V2UA 4I5DA 2CNWD 2OEPA 1CJUC 3WRWA 2ZJ7A 3W2EA 2OHOA 1L5MA 5GVRA 4QDXA 5DSTA 2K6GA 1E7RA 4AZTA 2Y9PB 3HFJA 3GPBA 3HJUA 2Z2XA 1LJLA 4HEHA 1PTKA 1T0PA 3KVNA 1D03A 1JI0A 1OF1A 2FW7A 2GBIA 4REOA 2PO7A 2HJHA 4ZPJA 1QDUA 4QBKA 4XASA 3L1IA 1DTWB 2FMUA 1YOBA 2FPIA 2BHRA 2L42A 3BCHA 3HCAA 3KYCA 1W6UA 4YBRA 4J4TA 1XIVA 4WVFA 1A98A 2E82A 2GF0A 4URFA 3WQSB 3TG8A 3VXKA 3IJEB 1EFVA 1F17A 2MWMA 1X1CA 1H5NA 1P33A 4NNJA 1UBSB 4LOIA 2N1MA 2YQ4A 2G4LA 3N3BC 1HFEL 1AKVA 4FWBA 2WBLC 1IM2A 3RW9A 2ZYUX 1FJXA 3I1IA 4DLZA 1F6WA 2TS1A 1I7DA 1P4HA 2HDHA 1HL7A 1YAJA 2MIIA 3FLMA 5D1NA 2AEJA 4DCPA 1TT7A 2D7DA 2VPPA 1BYIA 1XP5A 2J6HA 4LHVA 4FYXA 1JHOA 4EUHA 4G84A 1CP3A 1XCBA 4PFQA 1USWA