The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
128
|
sequence length |
336
|
structure length |
336
|
Chain Sequence |
NAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structures and kinetic properties of anabolic ornithine carbamoyltransferase from human pathogens Vibrio vulnificus and Bacillus anthracis
rcsb |
molecule keywords |
Ornithine carbamoyltransferase
|
molecule tags |
Transferase
|
source organism |
Vibrio vulnificus
|
total genus |
128
|
structure length |
336
|
sequence length |
336
|
chains with identical sequence |
B, C
|
ec nomenclature |
ec
2.1.3.3: Ornithine carbamoyltransferase. |
pdb deposition date | 2013-02-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00185 | OTCace | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
A | PF02729 | OTCace_N | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Aspartate/ornithine carbamoyltransferase | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Aspartate/ornithine carbamoyltransferase |