4JFRA

Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoyl phosphate
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
336
structure length
336
Chain Sequence
b'NAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ornithine carbamoyltransferase
molecule tags Transferase
source organism Vibrio vulnificus
publication title Crystal structures and kinetic properties of anabolic ornithine carbamoyltransferase from human pathogens Vibrio vulnificus and Bacillus anthracis
rcsb
total genus 128
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jfrA01
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jfrA02
4ANFA 5G1OA 2H3EA 2EF0A 3AT1A 1D09A 4F04A 4FYWA 4A8PA 1RADA 1RAFA 1TU0A 1RAGA 2QG9A 1ACMA 4WTOA 3LXMA 3D6NB 6AT1A 4AT1A 3KZOA 4IV5A 5AT1A 3KZCA 3L02A 2FG6C 2RGWA 4KGXA 1Q95A 3R7DA 4F2GA 2FG7C 2AT1A 1RABA 1C9YA 1DXHA 4EKNB 4FYVA 1OTHA 4KH1A 1F1BA 2FZGA 1XJWA 2IPOA 1JS1X 3D7SA 2I6UA 4JHXA 1TUGA 3TXXA 1ORTA 3NPMA 3KZNA 3MPUA 1R0BA 4JFRA 1AT1A 2OTCA 3E2PA 3M4JA 8ATCA 1FB5A 2QGFA 2BE7A 1FVOA 3M5DA 1ZA1A 7AT1A 1RAEA 2G7MC 3SDSA 3L04A 2FZKA 3UPDA 2FZCA 3KZMA 5G1PA 3Q98A 1DUVG 2A0FA 4E2FA 1VLVA 2P2GA 1ZA2A 4BJHB 4FYYA 4KH0A 2W37A 1R0CA 1EKXA 3TPFA 4A8HA 1NBEA 4KWTA 1AKMA 1I5OA 1RAAA 1RACA 3GD5A 3M5CA 4AMUA 3R7LA 4KGVA 1TTHA 3KZKA 2BE9A 1PG5A 5G1NA 4OH7A 4NF2A 1RAIA 3L05A 3R7FA 1SKUA 1EZZA 3CSUA 9ATCA 1EP9A 1A1SA 4A8TA 1RAHA 4KGZA 4EP1A 8AT1A 1PVVA 2AIRA 2YFKA 4H31A 2HSEA 3M4NA 4AM8A 4JQOA 5ILQA 3GRFA 2ATCA 1ML4A 4FYXA 3L06A
chains in the Genus database with same CATH superfamily
3E3AA 4DPLA 1EA5A 1CZUA 3IURA 5DHUA 5IDQA 1P5RA 1WZEA 1L7QA 2HF9A 1L3BA 3DV0A 3HKEB 3K9WA 3LZCA 4ZI2A 3BL8A 2D2FA 2V7BA 2QTAA 3OE4A 4E14A 2W7TA 5BOVA 3ZE0B 1F6DA 4NH0A 2RHBA 5IKPA 3FBGA 4N9QA 1VRCA 3GAZA 4RHUA 5BXYA 4URWR 4UEOA 1CTQA 3LG2A 4I4LA 1T9CA 3AY3A 3LVQE 3RG2A 5IF9A 2E4ZA 4FOTA 1HURA 4YLGA 4PWYA 3FNIA 1J70A 4S24A 1NE7A 2RGWA 4ZOEA 2F3UA 1K8RA 1P1CA 5ITZA 4KAFA 3QVWA 4KX3A 2M1XA 1OZHA 2WRZA 1D4AA 3EGXB 1EDBA 1C2TA 1XE3A 1W0CA 1UC4B 4YXWD 2WB4A 1I6LA 1JR2A 1GRNA 4HGYA 3ORHA 3MM4A 1RWWA 5D00A 3ZWMA 3I5YA 2F3QA 5IFLA 1MNAA 2VTDA 2HMYB 4XOUA 3WAGA 2AMVA 2ZRFA 4K3VA 4OBEA 5CBPA 1F3OA 1UDRA 1T4CB 3MPUA 2Q0HA 2GVDC 3AINA 3S2YA 1DX9A 1H1LA 2DCUA 3AJ9A 4IMJB 1HDGO 1HBJA 3JQ7B 2Z6UA 1ZH4A 1ULBA 2FVYA 4AYXA 5JPIA 3KBBA 2VDJA 5ESDA 1OAKA 4YMSA 3WIVA 2O8EA 1E7SA 1QCZA 3SDSA 3SLKA 5F1YA 3AY6A 1RWOA 4HN2A 3L7DA 1W76A 3CO5A 2Q07A 1Z18A 4QUGA 4GNRA 3OU7A 4B3JA 3NXKA 3USES 1QX4A 2OXCA 2YINC 2G1PA 4HP8A 4NCHA 1LXCA 4YC7A 5AJVB 1RZUA 2ZB8A 2J3QA 3KKMA 3FCXA 1GA4A 3CZ5A 4KAXA 3RTAA 1ZMBA 4GZLA 3MIIA 3K0CC 4JUDX 1QP8A 2RHWA 1M7BA 3IVRA 1WUTA 1CZOA 4HDNA 3W7VA 1IUOA 2YJZA 2PJDA 3TR0A 5JBIA 5L3SA 721PA 3L49A 2WUEA 3PRYA 3Q0EA 4ZZ2A 1PL7A 3KZ1E 3T1QA 3E15A 5EJEA 1GKIA 2EEZA 4KWHA 5BSMA 1UPFA 2JDIA 4BUJA 3H83A 2IPNA 2OZVA 3PHJA 3OUTA 4MPJA 2XZLA 1MX1A 2BGJA 4F9EA 5BN5A 2A2ZA 2XNCA 4ZPXA 3SFVA 3O73A 4GZMA 4PEVA 4TM8A 5ICFA 1Q1BA 1IXSB 1IHUA 2EZUA 3ZEIA 5DRYA 1M2NA 1BVHA 1THMA 3P32A 2B8EA 2OCKA 4O2BA 2HBZA 3MWGA 3RLIA 4GI7A 3IHKA 3TW4A 5JDIC 5AJUA 1S0UA 2R97A 5DW3A 4O8ZA 4C88A 4F56A 1Z4IA 4MUIA 2FNAA 4GL2A 2G1UA 3C7AA 3DMGA 4RMGA 3IP5A 3ML1A 2V7WA 2ZS8A 3KYJB 4RZIA 1IZ0A 5D6NA 4HQNA 1AQUA 1KR2A 4KFSA 5TGDA 1CR6A 1GQOA 3NKFA 2PZEA 4ZMRA 4YHHB 4Q9NA 4XIYA 3SEFA 3MLAA 1XVIA 1VJ1A 2XVXA 3U26A 1XZ8A 4BGUA 2P65A 1YJ8A 4OMFG 1CHNA 4Z3KA 4NPCA 5CFRA 5L4NA 3N7TA 4FB4A 2A5FA 2QN7A 2ZI5A 3QOYA 2R0QC 1L4GA 3BMCA 4N9WA 3RHZA 1RQLA 4D3FA 4U7DA 1B0AA 2CLCX 4IHJB 4LC1A 1CERA 5C18A 2QD5A 1J24A 4F3KA 2WZQA 2WWWA 5HFJA 3Q5GA 1D9XA 1DWOA 3EEQA 3MBKA 4K3UA 5IBQA 3KR1A 3V7NA 5C3MA 3G89A 2NVWA 1WXGA 1EFKA 3EXHA 5A3SA 1NDHA 2BHRA 2F48A 4OI4A 4FDMA 3SAJA 1E2FA 2CZQA 3HV2A 4BMCA 2BFBB 3GJ0A 3OBBA 1ARZA 1EUZA 1JSCA 1PKXA 5CJJA 4NBRA 2R1UA 4MULA 2NU6A 3T7AA 5LNK1 2PZ8A 1KI8A 2PZKA 1E20A 1Y34E 4FFOA 2PVPA 4LF7B 5K6RA 1ZL0A 3BXZA 4N8DA 1DX6A 2DOKA 5LMUB 2FDCA 3F46A 4AZ3A 4BNJA 3PFWO 4KQMA 4ZPJA 4D4MA 2WFMA 3BFJA 5KQMA 2JJMA 1W0JA 5SZKB 3RWMB 3Q5EA 2GEFA 4BZZA 4ND8A 3E81A 1ID8A 2PE5A 3Q2OA 4JFRA 4E3ZA 4B8WA 1Q7BA 3D4IA 2W2MA 3LBAA 1BEEA 2V1XA 3H7IA 4IQ8A 4TTVA 4UTZA 2Y2VA 3UJ8A 4DW8A 2JPDA 3PGMA 3RNOA 1F5SA 5A5EA 1A4UA 4BFXA 1YZUA 1PFUA 5IP5A 3TYXA 4UHJA 2AH5A 5DJ5A 3E3OA 2D54A 4G5XA 5EZQA 1QF9A 3IQXA 3V80A 3BZWA 1XIVA 2H4WA 3HU5A 2NXWA 4JK3A 4KXYA 3S2EA 2PS1A 2VP4A 3AETA 3NQ41 2EKBA 3BL6A 4IEIA 3E48A 1SD1A 4G1EB 1X7XA 1BMQA 3IPAA 4FI3C 3L9WA 3BIXA 1GZSA 3ACCA 3KB1A 2FSIA 3RSLA 2OUIA 2WU8A 3FFTA 1WHTA 4MITA 4FFRA 4P7GA 1GPAA 1YZKA 2YV2A 5SYNA 2HOQA 2YYYA 4EZIA 4ZK2A 3L0PA 1WU7A 1NVVQ 1VKNA 1EKXA 1PWEA 2BY4A 3E05A 4TXNA 2OWDA 4M8IA 1E2EA 4RKWA 4AX8A 4NBLA 1NUPA 1VBMA 1DNPA 1YUNA 4GR4A 5BYBA 2O8FB 2VP6A 3JYPA 1H2BA 5CVEA 5SYAA 1XZNA 3NNNA 1POWA 4WW0A 3PX7A 4QYMA 2AG8A 4JB3A 2EP5A 5AOBA 4L02A 1NLUA 4S1TA 3SWWA 5I4CA 3UVEA 1ADBA 4OH7A 1XTQA 3S28A 5B55A 1KI2A 1Z74A 2Q2NA 4HEQA 4QU5A 5DHRA 4R71A 5DNUA 1Y7LA 4J29A 3WV5A 1M8KA 2BGKA 1B2LA 2OHJA 1RP7A 2QI9C 2B1RA 1I3NA 2QENA 1Q3HA 2XBUA 4Y2VA 3GA7A 3DZ8A 1KJWA 1UAYA 2DFKB 3VZDA 2Z3WA 4O08A 3I62A 1AK9A 5K0NA 3L4EA 2PMDA 2BPOA 5JZVA 5G0TA 4E70A 2NPOA 1B43A 5C32A 1U9CA 4CQLB 2DWPA 2D3TA 4G4SO 1EG7A 3I2YX 1CRQA 5ILQA 4X1IB 3FTPA 1UADA 3WIOA 4ZT5A 4ENUA 1JXMA 2AXEA 1I4TD 5JVDF 4N40A 3LYHA 4D8VA 1B3RA 1N2ZA 2C9ZA 2HHLA 1ZQ1A 3OEWA 3OEHA 4FE7A 4L27A 4YBRA 1QO0A 4YBZA 3UYKA 3G0BA 4JJ4A 2HJRA 4BFUA 4TUYF 2FAXA 3AV3A 4RH3A 2QLTA 5DYNA 3ZVRA 1FBNA 4B85A 3V4SA 4L6AA 2HGZA 1GG8A 5F3DA 4DLVA 5TQVA 3T7KA 4D9NA 5EIXA 8OHMA 3UFXA 3GIDA 2FPPA 5C5CA 2ZTHA 5IT9A 1RADA 2GCGA 3LUPA 4P38A 1JI3A 3T1HB 2XQGA 2PUJA 3NP9A 3HBFA 1B2RA 4MP3A 1CRPA 1U7HA 1CUUA 2NZ2A 2PMKA 3CY6A 5AKZA 1IPEA 1N2XA 5DBOA 5KPJA 3K0AB 2B61A 4UCFA 2H4ZA 1BA2A 1U0JA 2XVAA 2E5WA 1D7AA 3OAAD 4XDHA 621PA 5ADVA 3FKSA 3WA7A 1G8FA 1W4CA 3GJXC 4MOWA 3TO5A 3CB4A 8GPBA 2VF8A 1NMXA 2WV7A 1FFDA 1T15A 3GLKA 1WDKA 2F62A 2JHGA 3BVPA 2RJNA 5A1JA 5KAMA 4EKEA 1YR9A 3R23A 1HYBA 1M1NB 3LDFA 3QMWA 2XB9A 3ER6A 4PQRA 4TL6A 4F4CA 1KIMA 1R37A 1E2DA 1Z2PX 2B8NA 1T10A 1O2DA 2OTCA 3F8TA 3FCAA 5AKHA 3V1YA 2PS0A 2XDAA 3IHWA 4TVSA 5JU6A 3COJA 1PD0A 1R64A 2BGGA 3PKJA 5IN4A 4BP3A 3TIIA 2W8ZA 1O5TA 1MP0A 4F5EA 1EM6A 3TBHA 3EPJA 3P27A 1TUEA 2HQOA 2AZXA 2AC4A 4TTJA 5ESXA 1QIEA 3EZLA 4BFTA 2H59A 4JIGA 4B46A 4CTNA 3U4QB 4IFBA 3I5UA 1CJBA 2UZIR 4IFIA 1FNDA 3X44A 4D0GA 1WXWA 4RTKA 1P62B 3QPDA 3B13B 3CCBA 2EDAA 3WKCA 4B76A 3JAKB 2HMAA 3ZZ0A 5REQA 1S2DA 2Z3ZA 1N1MA 3OPQA 2VHTA 2Y0DA 1US8A 3RK4A 4KXQA 1OIWA 4YRFA 4OJNA 2BRUA 4M49A 4K81B 2J67A 3H9QA 5B7QA 1VIAA 5KYXA 4QKQA 3QWFA 1N7HA 1RCFA 1TTPB 2NG1A 4MJ7A 4GM4A 4GSYA 4ZCSA 1E9FA 5F98A 3HJFA 1Q7EA 4LKRA 2EFJA 4P22A 1Y1KE 3ENQA 3TGPA 1BZYA 4H1UA 3FE2A 3HTXA 1NP3A 4JB2A 1K6JA 4JOBA 2XY4A 5EFZA 1J56A 1JBQA 1MN6A 1AKMA 3EXFA 1ZOLA 3JWJA 2KPOA 3E70C 2IYAA 3P2YA 3P7MA 4IINA 3RVLA 4I55A 2AJLI 1C3LA 3GHHA 2NIPA 1SOAA 2LIVA 3MMSA 1VFNA 4C0JA 1MO6A 5DLPA 1N33B 3BL5A 2AHRA 3IMKA 3GNTA 3FB4A 2PUWA 2YOHA 4BNIA 1F38A 2ICAA 3MK31 1JIVA 3E2MA 1ZIXA 3OJ0A 4WNIA 3C8HA 3IXQA 3C1AA 4PRLA 4EX7A 1TCBA 3W9BA 4RV9A 4E4YA 2XIQA 3L2OB 2CCKA 2OORC 3T12A 5LQAA 3LQ1A 2ZLBA 3DB2A 1WB4A 2W6CX 3GJ7A 2QUKA 2DBZA 3T34A 5MN6A 5FFMA 3IQZA 3FYHA 4DN6A 1XXHE 4JA0A 1NY5A 3DG9A 2XCIA 1B14A 2O7VA 2GN4A 2N75A 4BEJA 4AY5A 3EQ2A 2QT9A 3UY4A 2POQX 3LX8A 3O4IA 1KEZA 3ERCA 1NU8A 3GEPA 2CXSA 5DBHX 4B0PA 3A6GA 2EX1A 2RMKA 1D03A 4OHXA 3Q3JB 4BO2A 3CLUD 4CQJA 4D3YA 4BO1A 2BFNA 5MN4A 1JWAB 3UPUA 5KTPA 3AKEA 1WSAA 3UJ6A 3RRJA 5SY4A 2FCAA 3DVAB 1WP4A 2AEEA 4PYIA 2G63A 4PX3A 5A4IS 1A9XA 2G4LA 2ECFA 3I6ZA 5KYWB 3THWB 1JTVA 4Q19A 5D85A 1ZWLA 3C7DB 5HDBB 3HKCB 4R54A 2QE7A 4D4GA 5TMDA 4PINA 3UJNA 1LCIA 2UKDA 3F4BA 1ZI8A 1XFAA 2MYPA 5AHWA 1ISSA 1JHQA 1L3IA 2RG1A 5GTDA 1ORDA 1IK4A 1CHDA 2XADA 4P86A 3WYNA 2Y93A 3W78A 3PLRA 3QTBA 3SICE 1MO3A 4WCFA 1VG1A 3LLSA 5A4MS 1QX3A 2GXQA 2PKCA 3F6SA 2VYND 3PXUA 3PWTA 2WDZA 4KJXA 4LXIA 4HNQA 1ZOPA 4L85A 3GCZA 2C9OA 3NALA 3DE2X 3UV3A 3VV3A 2TMYA 1Z37A 5JC1A 1JTEA 1QAQA 2Q21A 1PJRA 4L5BA 3TI9A 4YP9A 1L7OA 1B1AA 3BTVA 4NARA 5HZGA 1YI0A 3QHPA 2ONJA 3MCWA 1IVYA 1ODIA 2K2QB 3AHFA 3LKVA 4EB0A 2JZCA 3LXXA 3H7AA 4IQFA 4R8RA 2AVDA 2JFPA 2PSHA 3W3AH 4O4IB 2GJSA 3PDIA 3PEWA 2FHSA 4TMFA 1G20B 1R8YA 1DKOA 1PNVA 3EASA 3N76A 4Q3NA 1I1HA 3T4UA 2W6JD 3VAYA 1EX6A 2FOXA 3SX4A 1KDYA 1P1FA 2I2XB 2WSIA 1L4YA 1UM9B 2MJLA 1FXWF 3FOAA 3MVEA 1XZLA 1A4IA 3M6WA 4CIAA 1JAHA 2DR0A 1Y4ZA 5F4BA 4PSCA 1Z6TA 4FS8A 4L5JA 3NHBA 3Q8WA 4FHCA 5I01A 4DR3B 3U3XA 2JL1A 2QW8A 1M1YE 4PAMA 1J39A 1Q91A 2Y1GA 3EE6A 5TMPA 2A1UB 1UJCA 2H1FA 2H1WA 1ULTA 1HE2A 1M2GA 5CDGA 1YU6A 5KJFA 2BMJA 3BJIC 2XJ9A 1SXJE 4FR0A 5H3HA 3DOFA 3RKSA 1VRWA 5AJZA 5BWOA 1PJLA 3D2LA 3ORRA 4BFVA 2XKAA 3AUXA 3KKPA 4NG5A 1AV7A 1RVDA 1K68A 5B1HA 1YB4A 1Z88A 1GWNA 3L77A 4L8WB 5TE9A 2O2YA 1RR6A 3TSAA 2FJ0A 2R6GA 1O6BA 3BILA 3QX7A 4BMVA 2ZDGA 4DQDA 4UNSA 2RGGA 4MMXB 5EHXA 1JP7A 4MKHA 1USWA 4BDSA 2QMEA 3HXMA 5F64A 4PNZA 1EK1A 4XIGS 3OWOA 3JTEA 3VMMA 4BX8A 4KU4A 5EJ9A 4QICA 1ILEA 1RI1A 2IYNA 4NK4A 2O8CA 4WNAA 4Y8VA 4OOEA 3A4NA 2H1HA 4CN9A 3IHLA 5A03A 1A8UA 1UBKS 3ABRB 3AIMA 2BDEA 3UAYA 1G6Q1 4LZZA 1D6NA 3G0DA 2C0PA 4KNVA 3WOVA 1BHO1 1MENA 1MRNA 2QPLA 3K2EA 4XWTA 3VH3A 1MNQA 5JWRA 1NI3A 3DE4X 3P2EA 3ZY6A 2XXAB 5JISA 4CM4A 5FCDA 1PR1A 3UWOA 3SYNA 3H13A 1JMYA 1GNPA 4J76A 4M0EA 4QXPA 2YJTD 4PQFA 3RKRA 2ZRLA 4JAVC 2V7TA 2YJ5A 1RC8A 4BB5A 1DQNA 5IAAA 1XTRA 4XM2A 4LF9B 1TZ2A 5GGYA 1XMIA 4D4HA 3FHOA 3GRRA 2XNJA 3EBLA 5C80A 3MELA 4YMVA 4UEKA 1BWRA 3DLAA 4GOMD 1D07A 4MQFB 3SBXA 1U0NA 1KERA 1RKXA 2A1TR 4IXTA 5LXTA 3T5DA 3O8OA 1Z5UA 4U2EA 1PD1A 4FDLA 1AMUA 2O52A 4DNXA 5DGXA 1MGOA 4O1IA 4PX2A 4XPIA 3ZNOA 1WNTA 4X91A 5A02A 3UG6A 3NBMA 2W98A 3OJWA 4MMZB 4X90A 1U2RA 2XNDA 5CA0F 1JYFA 1QGZA 2HRRA 4WFIA 1KL7A 4RIHA 4YMGA 4H7KA 5K7SA 5KIAA 3V4FA 3UW1A 3HJGA 1W49A 4OAQA 1SUEA 1XEWY 1W5BA 1BROA 4A6PA 1NSYA 1P5JA 1T2DA 1DMRA 1WUHS 1BS2A 2D2VA 3GLTA 2IPMA 4TSRA 4X84A 1KE1A 1W36B 2VPTA 4I4NA 3D4OA 3N8DA 2JAHA 4QYSA 2CXTA 2XUOA 5K0FA 4V0LA 4P08A 1L9XA 1SHLA 2CSUA 2JAPA 2VTVA 3LLUA 4LMPA 4XWGA 4CPDA 3QEAZ 4LWQA 1EZ4A 4R2HA 2IUSA 3FXAA 1M66A 3BWEA 2G4CA 5JNVA 3VU0A 3CNEA 4OSPA 3BD9A 3GDGA 5H4GA 1DCTA 3EK2A 4JNCA 4OLAA 3ICCA 1BRMA 3ZHXA 1Y4DE 2RHRA 1T3GA 2Q4BA 1W36C 2UV8A 4ABTA 1VIMA 3LLCA 5IN5A 2GZAA 5T67A 3TZLA 1USVA 2ZSJA 5D3MA 3W5IA 4HFMA 4DTIA 4E6PA 5BW4A 2HRDA 1QOZA 2FK8A 1NASA 4WOCA 1N8KA 1C7FA 4BP9A 3IA2A 4DOMA 1GPH1 1IBSA 4GGMX 4FN5A 4M1OA 3FOEC 1QV9A 1PT5A 2VVTA 3I1JA 3C3JA 3D4NA 3D4LA 3DHWC 1DBPA 2ZS9A 3CLRC 3IIIA 1EK6A 2J08A 2M6RA 4MA4A 3T3IA 1NZDA 1SBHA 2FSVC 1HE4A 3C39A 1BD4A 1MT3A 5KSOA 3NDIA 4UBIA 3GIWA 4ZJUA 4MK4A 1DEHA 2XEDA 2Z8XA 3MUFA 2IU6A 1TT5A 2Z09A 5I6DA 4EVIA 2ZAIA 3KS9A 5CA1F 1EUYA 3G1TA 4J90A 1Q0ZA 2CL5A 2Q46A 3I2GA 2G40A 1FDSA 4ZRNA 3RFCA 1SKAA 3TSZA 4OAOA 4M1TA 3C1OA 1A88A 2AN9A 1VPVA 1NXSA 3AM5A 4ISCA 3TQQA 3RNLA 3MJRA 2XVYA 3K8OE 1W47A 1ODTC 4DANA 1MV5A 1K7EB 3CSSA 2VF2A 3QU9A 2WHPB 2XZTA 4NR0A 4OI2A 5EJIA 2NTEA 4LSMA 1C9JA 1QR6A 2JARA 2VWQA 1V3VA 4RD1A 1XMPA 1GZ7A 1N0WA 4JQOA 2O05A 1E7YA 1JE0A 2EARA 4UVGA 2ZVQX 3BWXA 3TVTA 1KR5A 1IZ7A 5TT1A 1FRVA 4G4SP 3A3YA 4LRWA 1RJEA 1KYQA 1M0WA 3JRNA 4W1QA 3OFNA 4A03A 4P4SA 2IUEA 2WWHA 4G81A 1E0JA 3EBOA 1PFVA 1VYHA 1U0EA 2KHZA 3I4CA 5IYZF 3ZY3A 5ALMA 1Z4QA 4BFWA 3FPLA 5KSYA 4ZAVA 2WICA 2ZUVA 4LBWA 4FYKA 4HR7A 1GVHA 1SCUA 1TGVA 1ZN9A 1D1TA 2JEZA 4FYWA 4MX8A 4F04A 3QVMA 5KQLA 1NXTA 3UMJA 1NX6A 4GXTA 5AHXA 1OFIA 3ESZA 4IPTA 4DZZA 3HA3A 1AXRA 1F6BA 2WUVA 3AHGA 1OXBB 3HCEA 5LIPA 2J3JA 4D2IA 3O84A 3T7EA 1DIBA 4E31A 1K63A 1CUEA 2F9MA 4ZJYA 2GSWA 2EVWX 4YJGB 4M6WA 3AGPA 2D1TA 4RELA 1E1KA 1ETUA 1F8XA 2AUMA 4K9OA 4YQEA 3U4QA 2WUFA 1VL5A 3L0YA 3LKBA 3TR5A 2JCYA 3A9RA 1UBUS 3UJDA 2D5AA 4GP6A 2KMLA 5A4JA 5I51A 3COPA 2OAGA 4M1KA 4DUYB 1CG6A 3KJXA 4QXMA 1GAXA 1MGPA 3UV7A 3CLSC 1G60A 2PEYA 3D54D 5KNDH 4LDAA 3UKDA 3CW8X 2R2GA 5FLKA 1MC4A 2EEPA 2PWAA 4IJUA 4CM5A 4DAOA 3DKVA 3BD6A 4PAQA 4XH9B 3BRQA 2JZNA 4CM9D 1EVLA 1L5NA 2BEKA 5EHNA 2QGZA 2BJWA 5BV2P 2B7LA 2OPBA 3GY0A 3V34A 3AVUA 1AF7A 4IHAA 4I46A 2HRCA 3A05A 4DXHA 2QMQA 3JR7A 4R41A 5TRTA 4UTVA 2IS2A 5G1PA 3ZDFA 1CS0B 1PEDA 3N59A 4MR7B 5IJZA 3HR4A 1IBRA 1IXKA 3AEKA 3E8XA 3A7DA 3ET4A 4EAQA 2HHAA 1ZCAA 1KMNA 5D3MB 4HG2A 2VUUA 4R2JA 4AJJA 1OLUB 1XELA 3CEHA 4M9UA 4QD3A 5B1DA 3ZUGA 2IITA 3MRVA 3N5KA 1JKJA 2R6DA 1CF2O 4LV8B 1BCRB 2OFFA 4BMYA 4DREA 3DZBA 2YWEA 2P69A 1IEWA 1M0TA 1UKZA 2OV2A 1EUCA 4RFLA 4UVHA 1M0EA 3QXSA 1T8PA 3HWRA 1CY0A 3O2JA 1QDEA 3AJ8A 4XYMA 3ZE7A 1N32B 2UVDA 4DR6B 5FPPA 5CFLA 1T34A 1V26A 4IIBA 3UXEA 2CBXA 1CUYA 2YHBA 3CF6R 2HLPA 4RXMA 3ZWWA 5KTSA 5IVIA 1Q3KA 1HR0B 1IBMB 4DB2A 5CK5A 4WZBA 1WBBA 3F73A 3RTDA 3ROKA 3DEKA 4CKWB 2RGEA 3L0OA 3K1TA 1GPJA 1X13A 2ZB2A 1PLKA 2BOVA 3PQEA 5DM70 2VTEA 3OUZA 1DG3A 4KBYA 3QLTA 4RCVA 1PL0A 1QQAA 2ZI4A 2CMHA 5CJPA 3A9VA 2JGIA 2V55B 3PPWA 1FSSA 1A77A 2VAMA 5AW1A 1P8JA 1SBIA 1JHMA 1M34E 1KFCB 3HGMA 3K8ZA 2G9RA 3NC1C 1FPQA 2Q2WA 4J9VA 2R3SA 4LXQA 4NHOA 3WSTA 4DLKA 5JO9A 3VDRA 2QN1A 5AM3A 5JRJA 4Y3UA 4BXOB 2A78A 4XOIA 3WGJA 3CQ9A 1R4NB 1WEHA 1HMYA 2Q3HA 3K31A 1R88A 4DMMA 4RY0A 4Z7OB 3QNWA 1G3RA 2LVBA 1XCPA 1G8PA 4BTEA 2PGXA 2RGAA 4IZ6A 3TGLA 1E2HA 5B3KA 2FUKA 5AKEA 2GB4A 3UNXA 1B23P 3T1VA 2BHTA 1IULA 2YV5A 1VKHA 1J00A 1H42A 2BGIA 3I4LA 1TF2A 1N3IA 3KYCA 4IMPA 2JAQA 1FFEA 1NUSA 1RAGA 4ARIA 2H1OA 1XEXA 3PXXA 2GCIA 1UWLA 3ZWNA 1FTYA 5LP6A 4DV3B 1FNBA 5J4HA 1PW7A 1D2EA 2ZI7A 4AJ2A 1D1SA 3GLQA 3HKDA 5HKLA 3KXPA 3WLJA 3QK7A 4JJAA 4UMEA 4KLNA 5IM4F 2ZETA 4J03A 1SCUB 1YVPA 1U5CA 2RGXA 4HUQA 3BQNB 3V2IA 1NAHA 2DLCX 5F7ZA 2P9FA 2XE6A 2IPOA 2BSXA 4M1SA 4XFJA 4JNKA 1NSTA 4HDMA 3UAOA 1UL1X 4PLPA 4RD6A 3TZCA 3WFIA 1ZR2A 1A76A 3OCXA 5EE3A 5HZHA 5L53A 2FY8A 4YQZA 5G0UA 4ND6A 4P3NA 2CVPA 1AT1A 1XHEA 2W4IA 4C4PA 1KYIA 2CXXA 5F51A 3Q8XB 2QN8A 4PZEA 2I4OA 3JCZA 4J7CA 1W2HA 3KOZA 3ZZMA 4E4TA 4R1LA 1VRVA 1J9ZA 1Z4NA 3OO1A 4E3WA 2DUJA 3JWGA 2B6NA 3U3OA 2MYNA 3P4XA 3SKVA 1QVVA 1MB0A 3GYGA 3OCYA 4IICA 1PJBA 5KHAA 5KSZA 1IM2A 2C57A 2WMDA 3C3DA 5AI0A 1Q0TA 1UFVA 3R7BA 4KRFA 1I7NA 1Z8FA 2VH2A 1L7NA 2XA1A 5DSXA 1MW8X 4FEAA 5CLGA 4QDUA 3AFHA 2B25A 4JR1A 4OO3A 3O3MB 1W34A 4KIFA 2VJQA 3CNLA 5ARCA 3GJ6A 5I45A 1PWZA 1ZK3A 3IUYA 3K73O 2A4MA 4QA9A 2P9EA 2Q8PA 4R4JA 3SJUA 1RRVA 1W29A 3CPHA 2XLCA 1XDUA 3MQ4A 1YK0A 1WKVA 3PDIB 4O4IA 2COKA 2XYGA 4D9HA 2C2KA 1S89A 2NTVA 1U1DA 3E0QA 3NTUA 3GT3A 4LNUB 4IJWA 2ZJZA 5AESA 5JXGA 2G9UA 1AK2A 2AFHE 1I13A 1LH0A 2FFJA 4KUGA 4D9BA 4GR9A 4ZGBA 3BMNB 5EPUA 3KWMA 1THGA 2HCFA 3MHTA 1NAIA 3U6KA 3ZOZA 1DAKA 3LT1A 3CKYA 3HEBA 5JNWA 2EZTA 4B0OA 1PRYA 1UAAA 2HF2A 3D81A 4TUYA 4Y9SA 2VK4A 3C6MA 3I2KA 3UAVA 1VHLA 2DHCA 4J3FA 3KPWA 4PIMA 4D97A 1Q92A 3DBRA 1QG4A 4PIPA 2BFFA 2IZZA 3VOTA 1R8SA 3IEUA 1E4EB 4FCVA 3K6JA 3DC2A 2HWKA 3G0IA 5GIPE 3PNPA 3FIJA 5F5XA 4E22A 1S8FA 2ACVA 3TQSA 1OXMA 2P2LA 1A9XB 4F1KA 2MSLA 3FGPA 2ZRGA 1Y8AA 4Y2GA 1R0XA 4LJ6A 5FOUA 4ZVTA 4ZFNA 5AQ1A 3THXB 1BKSB 4KLAA 3DOOA 3OJEA 3KXDA 4G09A 3H8VA 4K9NA 3S4YA 4EHKA 1XHFA 1ZG3A 2ALJA 1JR3E 4MWOA 4I6JA 2DQKA 4J0IA 2JJQA 2VJKA 4WH0A 2QI9F 4DCSA 3RVNA 4JA2A 2AV6A 4Q15A 1KFBB 2WAMA 1SA0B 3GZ4A 4YRDA 4BKPA 1B15A 1DAIA 4QJ4A 1T25A 4RGQA 4IDQA 2CMFA 5AVRA 4UHFA 1XTPA 4I2NA 2R65A 1KBOA 2W6NA 4EGAA 2HREA 2DPYA 1LDEA 3R7DA 5HIKA 2WHRA 1A4XA 3DP7A 2OV8A 3CB2A 1BGXT 4JKYA 5HYVA 3L8HA 2VNHA 5SY6A 2ZTLA 3NR2A 2C4NA 2R85A 1WVMA 3C3WA 3QX9A 1AH2A 1UQUA 1ST2A 3KPJA 3C85A 1D2MA 3S81A 2GTPA 2PZFA 3V8EA 5DT9A 4OJMX 1K9VF 4MQBA 1GSAA 4I55B 3H8SA 4UREA 2E87A 3TRHA 3I9NA 1MXFA 3OPMA 4G25A 1GSHA 2Q62A 4JBYA 1XDGA 4B3HA 4CYMA 4UNNA 1XDZA 2Q8QA 4DZRA 1P61B 3UT6A 1O95A 4AZSA 3H5NA 2R86A 1TQ6A 2II6A 2QB5A 3HHEA 2GSDA 4QYWA 3F8WA 2GPNA 3AVWA 2H00A 4PO8A 1VPTA 4M86A 1K7YA 4AYTA 4KRXA 2OKCA 2XF2A 5HWSA 2FSVA 2AZ4A 1LPSA 1QFZA 2O57A 1NVAA 2W0SA 3BXPA 1GCIA 1CVRA 1JEDA 1QGDA 2ZAGA 4M0LA 2G3YA 2I22A 2ZAMA 1WVIA 3GA5A 1Z9BA 3CKMA 3GH1A 2FPSA 3IBCA 3B1XA 3VZSA 2EZ4A 3EH2A 4W82A 1WPQA 4UD2A 2I1VB 4K6OA 1T5LA 3GXBA 3K6SA 4DLYA 1HE3A 1GQFA 1QGAA 2FX3A 3DD5A 3M5PA 1BOOA 3I8XA 5DGIA 1R3DA 2FFAA 3AUJB 1OZFA 3HM9A 4TWBA 1JFTA 4HDSB 1R2QA 4HX2A 1B8UA 1YMQA 1FRFS 1XD2A 2QZPA 3KP1A 5C3UA 1JHPA 1YC2A 4I1VA 4J1NA 3LCVB 3TNYA 1MRZA 4YK7A 1SPXA 5F35A 4BXOA 1YL5A 1ZJ6A 1QC5B 1GRRA 3CNHA 1MT0A 4D25A 2FZ5A 3ZNNA 3K5WA 1LNQA 5HRAA 1T2CA 3RF7A 1R18A 3HYRA 4PR3A 3OICA 4BO5A 1U31A 2AD1A 3A1SA 3WWYA 1P0FA 2NTNA 3R7FA 1GIAA 2ZB4A 3B78A 2VHZA 3IIEA 4MEAA 2WWIA 4JLVA 4ZCRA 1HDZA 2Z2IA 1Y33E 3AEUA 4PYJA 2ZPTX 2WG2A 3NDPA 3R3SA 4LQCA 5IRCD 3ESQA 3JQAB 1SXPA 2EFGA 2RK3A 1YZTA 3WLKX 4DB4A 9MHTA 1VB3A 2FPIA 1JT9A 2CYAA 2A5GA 1ONBA 4MUKA 5CDFA 1NJ6A 4XEHA 3ISTA 4FLEA 4IGKA 1DT5A 4HDRB 2OV6A 4KQGA 4R51A 2WHXA 3EXG2 3JX9A 3HBLA 2QDKA 4LXYA 4QL3A 3IAHA 4YCMA 1XZIA 3F7OA 1VJ5A 5ALTA 1DS6A 2H51A 3ZC3A 2ID4A 3NO4A 1FU8A 4K9PA 1PVOA 3LVFO 5FPQA 3L4BC 2IYPA 4L4XA 3KJFA 3OD5A 3PC8C 3RAEC 3MXTA 2R11A 2WHYA 1YZ3A 2C99A 1I2CA 3ZZ1A 4BVBA 4UM9B 1NJ5A 1AQYA 5K0JA 2HHJA 3DFFA 3KFXA 4XXHA 3SSMA 1RC1A 1NVKA 1IEQA 1Z2OX 5CRIA 1E94E 1Z45A 2Z8YA 2NO6A 3C8UA 4L8VA 3A9SA 4M1EA 4HSGA 4NBSA 1TD1A 4ZIRA 5HKAA 3VSDA 1QANA 4YPOA 4OMUA 5FA5A 2LR0A 2DH6A 3NRCA 4INZA 4NQZA 2FJUA 4JI4B 4RGYA 3M6IA 4F84A 2J0VA 2CL0X 3F3SA 2C9CA 4KIUA 2KM1A 3P9NA 4H7EA 4CKEA 1KORA 1Z6AA 1FDVA 1S2LA 3LUKA 5HSGA 3VTFA 4XWKA 3NBXX 1KJIA 1EE1A 1RABA 2DFDA 2I7DA 4H18A 4EKNB 3K05A 3C6BA 2WF5A 3PR1A 3AVYA 4LI0A 4XTCS 1L5ZA 4F4DA 1FYDA 1UBRS 2RI6A 4YCBA 1K3TA 3DUWA 3F5FA 3GRYA 3MQ2A 4HB3A 2GNOA 4JHXA 1E60A 4R6WA 2WQ7A 4Y1FA 4IY1A 1S3GA 1CY1A 1B93A 4OUKX 5MFPA 4W4TA 5ALXA 1LW7A 2AQ8A 5HUJA 1LEHA 2OXRA 4YJHB 1RE0A 4FNMA 3TL6A 4ZK6A 2CLHB 2BVNA 3UAGA 2XQFA 5C8XA 4NQRA 3AIOA 3I53A 1NLYA 1Z08A 2CFSA 4YJGA 3LOPA 4MH0R 4N03A 4QWMA 4KWIA 4TKLA 1NW5A 3HXTA 1WULS 4WD3A 3CW9A 5D51S 1Z75A 2Y76A 1RBQA 3G2NA 5ITVA 3UF0A 2WVGA 2IH5A 2WW8A 3L5KA 4EVQA 5CB6A 1RP1A 1UEIA 2F90A 2NZ8A 4INJA 4BJ5A 5FWYB 4EI9A 4F38A 3GD7A 3DLHA 3B8EA 1X1AA 1GRCA 1PS8A 4Y9TA 4B3TB 2A9FA 2GCNA 3I72A 1N77A 1TUBB 4UM8B 2JLYA 4DR2B 3DAYA 4H27A 1E92A 1JAXA 1QCYA 4Q24A 3W79A 3ZIUA 1KPGA 2B7CA 4MGYR 4QDJA 3HB0A 5M5BA 5LQDA 1LDYA 1EEXB 1VCHA 3ZZUA 4C0KA 4BKMA 3C4JA 3K32A 4HLQB 5FPSA 3QFRA 4PTLA 3WNDA 3QVUA 4RTNA 1D1QA 1UMDA 4FGWA 5AJXA 1TMGE 5LD2B 1C9KA 3EZ2A 4UCQA 2TMKA 3IEKA 2F43A 5I47A 3NGMA 2EF1A 2VTBA 3IT0A 5KQRA 4YJ2A 1RRKA 4UE6A 2ATEA 3VR3A 3W5UA 2NSJA 4PONA 4X6YA 5C1IA 2ORIA 3WGVA 2J7KA 4UTRA 4EM6A 4MQ4A 3ZS9A 4UEQA 4AZ3B 2CUZA 2MINA 3EZ7A 3ZJTA 3OTWA 3RFFA 2GERA 4IWYA 1AE1A 2X3FA 4UU7A 4XLLA 2UYCA 3Q87B 5JANA 4K9SA 3JQRA 4L15A 3OPYA 4LKOA 2Q4OA 3EDCA 5B3LA 4OHVA 2AF3C 4NP6A 1HWYA 1WQ1R 3B20A 3TDMA 4WCDA 1ZJZA 2ZQZA 4DQVA 2WYWA 1TVKA 1YDEA 1ISMA 1DAFA 2QVLA 2Z43A 4HWSA 1H8HD 4JGBA 1KOLA 2VHCA 2GM3A 5A4FS 4OQPA 4BBZA 4BU0A 2MU1A 3FPSA 2H9YA 4D4IA 4FSXA 1ADFA 3PXCX 4ZQFA 4GOJA 4H6XA 3BFPA 1E2BA 2Q2VA 1OXTA 3P4UA 4CCYA 4GYJA 4LRTB 3SZMA 1L5VA 1CC1S 1TO1E 4GDMA 1M1NA 4HS9A 3E9NA 3SHTA 3ZG6A 3CCFA 3UHOA 4HNGA 4HGZA 2Q7DA 1AS0A 4KYUA 1AXEA 4LISA 1Q21A 4B74A 4D3DA 1MABB 2ZRMA 4K9LA 5KYUA 3EISA 1X6VA 4ARBA 1CFJA 5CX1B 1GVNB 3AVPA 2W2LD 1CUDA 4EBFA 2QZJA 1JJFA 4G1FA 1Z0SA 2A7QA 1CLUA 3SMVA 3L0ZA 3GUYA 4OREX 1YQTA 1P1JA 4MW2A 2PX0A 1MAWA 1XYGA 1AQNA 4PNHA 3T7DA 2YY7A 2W43A 3BIWA 2ZRDA 3D8HA 3DAPA 5FUWA 1JYEA 3EJWA 4RPLA 2ZBGA 1MAUA 4BVFA 1KZHA 3AVTA 3K9CA 2O3JA 4BGEA 4H35A 3PXGA 1XO1A 4C3ZA 1B8VA 4AQDA 1DTSA 4LF4B 2ECQA 2VBGA 4BNKA 3CMCO 1CUSA 1JVBA 4KPUA 1TW2A 5FBKA 4OEHA 5AKIA 2ZJ6A 4Q03A 1SHUX 4MRSA 1VGQA 3L4SO 1DG9A 5I7EA 4FPXA 1LRKA 3FPBA 4C6SA 4YV7A 2UYQA 3JVIA 3STYA 3K71B 5F5LA 2WAAA 1LQ2A 1IVNA 1XWWA 2NOAA 4JXJA 1X1DA 5KNDD 3U5ZB 1RJDA 3U7FB 3H8JA 2J41A 4UUBA 1RAEA 1U0SY 3ZE6A 4XIFA 2F1IA 1PFWA 1Z22A 3ILYA 3PFCA 1ZUWA 2BGRA 3HBNA 5ALDA 1R16A 4PGHA 4XFDA 3UPDA 4B09A 1PBTA 2BYTA 3ILVA 5H82A 1YS1X 4KXVA 3BZUA 3L7IA 4NJOA 2ZUEA 1RWKA 4CIVA 3ILXA 2K5UA 4PXSA 2DUMA 4A82A 1J06A 1OZAA 4R1SA 5ALUA 1LBTA 2H7XA 4YRLA 3OWXA 2E2WA 4FYYA 4HPXB 5FOTA 4C4AA 4E1VA 1CUBA 2NXJA 1JAIA 1C4OA 3WAKA 2A88A 3QENA 4BNNA 4UMVA 2P30A 3AUTA 2TYSB 3KT6A 3QTTA 5GONB 3F6EX 4Y6RA 1G38A 4PU0A 4AJNA 4DARA 1H4VB 1VM6A 5AXDA 2Y1WA 3D7LA 2R7AA 3M9WA 3QE2A 3H2YA 3IV6A 4JN6B 3VPSA 4CF5A 5EC8A 3SK0A 1HF3A 4AIIA 1R6UA 1G5PA 5D6OA 3Q7IA 3ITEA 2R1TA 2WOOA 1DJQA 2W6OA 1OPRA 1U0TA 1YZGA 3KXKA 3IR5A 1EP1B 2J7PA 2VT3A 4P7BA 2PQ6A 2I34A 5M3BA 5K4HA 3ADPA 1HDEA 2MYUA 2DF8A 4JVSB 4KQHA 2JG3A 4RF4A 1RM0A 2C4MA 2O4CA 4IIEA 1QR2A 1UBNA 2ZB7A 5L3ZA 3WDMA 2P90A 2A9KA 1V1MB 2ADFA 4AJ9A 1AZTA 2QPOA 3DEFA 4WSOA 3IE1A 3PTZA 4IS3A 2L19A 3H4MA 4EKYA 3GCXA 1M6EX 2QXYA 4BATA 2H2GA 2ZI6A 3D0KA 3QELA 1QRAA 3KR0A 3V8QA 4D9MA 5HPYB 1EUDB 5A5VA 1E1QA 2BFPA 3KXIA 3N6RA 1Q7TA 3ORQA 4Y1RB 5A05A 3IVXA 1YBVA 2V3WA 2HMSA 3E4CA 1NFFA 4FGKA 4K88A 4IQGA 4EHAA 5DGDA 3BFVA 2OBNA 3DMNA 3K9NA 3QLJA 5FPKA 4X60A 6ADHA 4OQ4A 3F97A 2CLLB 3R44A 3GMIA 1H2HA 1I2MA 3O0TA 2H2WA 2FMTA 4DCCA 3SLRA 1ZO8A 3TZQA 7REQA 2C96A 2H1RA 1H2EA 1L7PA 1TO2E 4BN4A 4CMIA 4CDGA 3WHPA 1H1TA 3JQ9A 3EJ6A 3LRTA 4WOPA 3ZIAD 5AVJA 1ICEA 3EFHA 4L6CA 4DR5B 4FOPA 1C50A 4IHJA 4GC5A 4M1YA 1NQAO 2JC3A 4D9GA 4NYMQ 3WNVA 1WD5A 2FRVA 3FCCA 4NS1A 5DGCA 1E62A 2DTXA 3OO0A 3GK3A 2IYSA 2UZ0A 4L4YA 1KOGA 5CH3A 3SR0A 2SECE 4QWWA 4QHSA 4G3XA 3PIDA 4EY6A 3KYDA 2DY0A 2C8JA 1E1LA 2QYHA 3HMKA 4MRNA 1I5EA 1OROA 4Q3DA 3DFUA 3GT7A 5H3CA 2LW7A 3KHSA 3NJRA 3ZHZA 2JCGA 1JLLA 2GAIA 2RB5A 4GI5A 5B6IA 2AJ8A 3U3KA 4Q1AA 4YJHA 1V48A 2BGNA 2CVFA 3IVAA 5EXTA 4UUMA 2YV1A 2NUTB 2W22A 3PQ7A 4HGRA 4OXQA 4OGLA 1VTKA 4O2BF 3K9QO 1R4MA 3A4TA 4AJKA 3EC7A 5LQRA 2XE4A 2NO0A 4RETA 2ROQA 2AYYA 4WX2B 4JGGA 2YIDA 1LJ8A 3E1SA 1CDOA 1AGPA 3K1AA 3KZXA 2NYRA 2PMWB 1N1DA 4M9ZA 1Y3AA 4LDZA 4RSGA 1GQYA 3AV0B 1ZA2A 3WBJA 1NFQA 2IEAA 1EEHA 3CRZA 4QO8A 2OXEA 2JEOA 3BJMA 3EOAI 1L1RA 4QDXA 1MOSA 4RK1A 4NJMA 4BASA 1A7AA 1Y7HA 4M7OA 2QBYA 5IHXA 1DP4A 5FFFA 3CH4B 2FG5A 3DCNA 3EPPA 1YR1A 2X22A 1X2BA 1LC3A 2JF0A 5KNCD 2K87A 3RADC 4B32A 1A1VA 2AZDA 2COUA 4ENRA 3FR8A 1FRQA 5TVKA 3DKRA 2Y6VA 1GU0A 2DKOA 3UJ9A 1NTRA 5JVDB 1EG2A 4NPHA 2WPNA 3PX3A 2C2XA 3DLTA 5JH7B 1XNQB 5ANRB 3RUPA 3NHRA 3AFNA 3DV2A 1GA6A 3PNOA 9ATCA 3IQWA 4WJZA 3IEXA 2G67A 4KE6A 3WYFA 4CQNA 1F9AA 2IHNA 1ZITA 4M0FA 4UHHA 3ZZTA 1GNRA 3R6GA 4E13A 1O08A 5ERGB 1J09A 4WT7A 3DGEC 3WL5A 4MV3A 3BMOB 3E18A 5TC4A 3VZQA 4CMCA 4BKUA 1R6AA 4DLLA 1YSCA 2BFCB 2BGTA 3KNZA 3WRXC 2GF9A 1FP4B 2F2TA 2CNKA 2XT0A 1H1DA 2NUBA 5AM1A 1XZJA 2H1IA 4LUCA 2VHEA 5K0CA 4PCLA 1QG6A 3WQQA 2EGUA 1XCGB 4LOHA 1ZMXA 4KI7A 4NYJR 3AR7A 4ZYLA 4JEUA 4KNWA 4YFVA 3BIJA 3ETDA 1SULA 1QTIA 3B6ZA 3UZUA 5BY2A 2BAGA 4YWHA 4YAUA 2J07A 1ZIPA 4Z4IA 1GKLA 5GZ3A 3G49A 5B3AA 4ESOA 2PGJA 1MEJA 4I3GA 2P9TA 3P2JA 1ABEA 5HXAA 1X42A 4DJEC 3IODA 1EIZA 5ICEA 5KDDA 2Z95A 1XD9A 2GI4A 3WLTA 3KZVA 5J2UB 3K6SB 4RPJA 2GK6A 3ZV4A 2BM1A 3PQ8A 1E5QA 3OJOA 4PLYA 5LU8A 3ESAA 3FHCB 2PBFA 2XLBA 2GO7A 1Q22A 1FFCA 1CQJA 2R44A 3DAOA 2AT1A 2BP7A 3R6LA 1MEEA 2OHFA 2ORYA 1L7VC 3EW9A 4L95C 1ODLA 1VKZA 4N3NA 3WLIA 1DT3A 3LNCA 1X87A 3BDVA 3CPSA 5DMHA 5IAEA 4CEHB 1W9MA 3ABIA 4NYIQ 1TZBA 4QLOA 3QJGA 3SZLA 3WL6A 5BRAA 2JAOA 2BTQA 1PZXA 3QV1A 1GFZA 2VYNA 2X4IA 1VA5A 3IAM1 4QNMA 4WBSA 2VKQA 3W7AA 3WGLA 3EGEA 2A1UA 3IP3A 4LJAA 1U8UA 4O4HF 3BC1A 2XOKA 1GDTA 4RNDB 5DXAA 1TQ8A 1J0BA 5EQTA 1C3XA 2XDQA 1H85A 1KKMA 3M7IA 1JMVA 3TB4A 3WBBA 4EB3A 1YHYA 4ABYA 5JCJD 1JLSA 2H2DA 3AUKA 4HB2A 3RODA 5I7WA 2G77B 3PIRA 1EI9A 1LPAB 4QFMA 3MNFA 4R7ZA 1DRJA 4MCAA 3OZCA 4TS1A 2WJWA 3M0EA 3UJAA 3R9XA 4MUBA 1FTWA 5EMNA 3FMFA 1XYYA 1YDHA 1X94A 2NACA 3VH2A 3IDFA 2GHTA 1GTMA 4NBTA 1IJFA 2J87A 3PXEA 3FMIA 4XD2A 4PZ0A 5CB4A 1Y3CE 2QLLA 1WETA 4C4YA 1NM5C 1XZEA 2YJ3A 4CM9A 3CR3C 5ECGC 3LBIA 1VLQA 2UYGA 2Y05A 3HGQA 3A1NA 4P32A 3BSSA 5FL7D 4B48A 2V0GA 1UFRA 1ZOIA 3MJHA 4O4JB 4RQTA 3IV7A 3U2QA 3U9LA 2AMLA 2XA9A 3JAWB 1VSBA 3PVCA 2P1RA 5TGZA 2FYTA 4L9AA 1L5HB 1P0PA 3BBPA 3D3KA 4MPPA 4MYDA 4QOJA 3AKZA 4DIMA 5F1PA 3ITKA 4P4TA 2BI8A 1VOTA 3KTFA 4TYYA 4HX5A 3SF0A 1F0PA 1QIJA 4C05A 2D2IA 2R60A 3CJQA 4B82A 4FFPA 4U7JA 3PE3A 1HFEL 1T6YA 3ETLA 2H4XA 5FR2A 4L7QA 3NIBA 4H7JA 3K0SA 2YWRA 4M7PA 2NN3C 4NFYA 2ACWA 3HKCA 1SUSA 4DWOA 3TNLA 1P19A 4OJTA 1R66A 2C54A 1OH6A 1IWBB 1E6WA 5K3BA 3DVRX 1WB9A 2D5BA 1U3TA 1X0XA 4FTWA 4UDYX 2QRVB 5HZMA 3KJEA 2XYHA 2BFEA 2JFWA 1X1TA 2WJPA 3FLMA 1XQ9A 5AVUA 3ZVMA 4JI0B 5LZ7A 1V7QA 3H5IA 2QEQA 3R6TA 1A7JA 3KQWA 4RK6A 5FOVA 3ZK8A 3E3MA 1EFTA 2X3YA 3I6YA 1QNFA 4LOJA 4RVNA 2ZUTA 4A0HA 2IU3A 4PPQA 3A4YA 4B4DA 4S1WA 1M83A 4BNMA 2DMRA 2JGFA 3S8YA 2C94A 2CXUA 2YJGA 2Z30A 3O4HA 2H3EA 3Q7TA 1FTQA 5FUQA 1PCXA 1SAYA 1CJTC 3C70A 3KPYA 3H18A 3M34A 3QUCA 3QEOA 4I5EA 5FTMA 4J6FA 4BQSA 2IDMA 4Z49A 1RAFA 1WMDA 2YUIA 3TNJA 1MJHA 3HK2A 1YIAA 3LUDA 3MWEB 1SVIA 2XMGA 1XTBA 2RHHA 4N7JA 4B3RB 4BE4A 4DV2B 1LPMA 1G3IA 1HL3A 1PUIA 2EZ9A 3SHFA 4J16A 3OF5A 5CG1A 4OLFA 2IS4A 3TE7A 3NTXA 1RPJA 3Q7SA 4GPIB 3PA6A 3SSOA 3VNQA 5DBEX 5EE5B 5JD3A 4M1QA 1H6AA 4CMIB 4U7GA 1KYTA 4F91B 5C1OA 1ATZA 4EJ6A 4BGDA 1FDRA 1EE2A 5M29A 3J81A 4A9AA 4MAMA 3T5GA 3MT9A 2BM0A 1I30A 2NVBA 3DHEA 2FE1A 2GCOA 4WQMA 4LMRA 1Q0HA 2P11A 3VKWA 4X8MA 5DTEA 1Q2XA 5C7YA 5C46F 5JYBA 1SZPA 2HEGA 2VRWA 1G5TA 3E58A 5HE8A 4I55F 3VU1A 1X80A 3DJYA 1J8VA 4MGKR 5H83A 2JFGA 5AVQA 2G9NA 3ZVNA 1F0NA 2C1EA 2C3YA 2O06A 2D4AA 2JZOA 4MEBA 5I48A 3GPLA 2PT6A 4DV4B 5LJLA 2AD5A 2OZEA 3Q3HA 1BWSA 1D9ZA 2FA9A 3G2JA 4I50A 4BO8A 5D3ZA 5AFSA 4LYEA 1NURA 2JLUA 5AKGA 2VC2B 1JW9B 1WV0A 4BRZA 2Z5FA 2A0FA 3TVYA 5KO2A 4KR2A 1O0BA 1F48A 3D8BA 4UM7A 2UUAB 2RH4A 5ADHA 1M8PA 2OBBA 5DNWA 1DRVA 4OXNA 3HCWA 2QRHA 3U19A 2BCEA 1C7IA 1FYWA 1MQ8B 4MI1A 2EQ5A 2PX4A 2JEYA 3EG5A 3BD7A 1O6FA 4Z7QB 4A92A 1PDVA 5J63A 1MF7A 3QKTA 4OLBA 3BMCB 4G67A 2AOUA 3T6KA 2VT2A 4WL0A 5E4TA 1P29A 1TJ3A 1XTSA 2DFPA 2DLDA 2O20A 4GIBA 3JZMA 4YUYA 3QBJA 3IBGA 1JBKA 2B1GA 3F5MA 3F67A 3RSGA 2C2BA 1NI5A 3WZMA 1R0YA 2QSZA 1VLZA 1CUCA 3SFZA 2P7IA 1FFBA 1RYEA 1JKFA 3TPZA 3ICEA 3ZEAA 3CH5A 3M6AA 1BGVA 2J3KA 1I1NA 1SUBA 1XFDA 3A6EA 4LHEA 2Y27A 4V02A 3TS1A 3A1EA 3SJBA 4B6JA 2R6FA 1BX0A 3BE8A 4U6NA 1TTQB 4KGZA 4OBWA 3PA8A 1X86B 2OBFA 2R8XA 4QUBA 4DNQA 3KKEA 1JEJA 3V2GA 2B20A 5CVUA 1VJCA 2FETA 2REQA 3M2PA 3WKAA 1OA1A 4YAEA 2Q9CA 4ONEA 1YACA 5D8DA 2JD0A 4X8LA 4F2PA 1T6BY 3A3PA 5J2TA 3OIGA 2P67A 5DLYA 4BQFA 2HR1A 3GEHA 1BCSA 4JJGA 2DR3A 3E22A 3ND5A 1YBAA 3L18A 5GGXA 1R6XA 1LBHA 1ISIA 3ETJA 5IX8A 4UUPA 4DYHA 2P6NA 4JP5A 2OAQ1 1GR1A 2QUZA 1JR3A 1W1UA 4F6CA 1LPPA 2V1UA 1WNFA 4IRUB 4KZKA 1OLSB 2HK7A 1WSBA 1AKTA 1ZI6A 3M83A 4CIXA 1O4VA 5BV7A 1FQWA 1UBGA 1MB9A 1YB6A 2DBQA 4KIWA 1WW8A 6AT1A 5TIIA 1EUCB 1SHKA 3QKWA 3BORA 4RDXA 1GNLA 2JCSA 5HKOA 1C1XA 3ZI4A 4J16C 5D3QA 1AURA 1UXIA 4LE0A 4LBZA 2W2KA 4XM1A 1JX6A 2VEOA 4RF2A 821PA 1E79D 1ECGA 2ZJ5A 1E61A 3QFCA 3R0IA 1WZUA 3EVBA 4LHYA 4BGIA 3ZLJA 1CB7A 1GV1A 2ZYUX 4ER6A 1GPDG 1EJBA 1IL0A 2YZ2A 4K6GA 4M54A 3W2HA 3OI7A 2GN9A 2PX3A 4FQ7A 1TM1E 3VVMA 3FD8A 1YJCA 5CBPB 5E2BA 1Y4UA 4EY3A 2CDAA 1M76A 1NN0A 1M5TA 3EOZA 4KN9S 4KO1S 5TS2A 2CKDA 5AK0A 5AHRA 4GLOA 1CJMA 4ZVRA 2RKOA 1YASA 2HZBA 2CV1A 1UDBA 1I7DA 3KE8A 4YAFA 5KMGB 3AETB 1S9DA 3KWLA 3WDKA 3ESYA 4MR8A 4B75A 4BVGA 3DLBA 3ZJVA 3BF7A 4E6EA 1WHSA 2IYUA 3K6RA 3UJBA 1Z36A 2BBWA 2WJZB 1X38A 2WJJA 2DPXA 1VCMA 3PHBE 4I50B 1V7CA 2EW2A 2XW6A 3GAMA 2E55A 3MS2A 2XUAA 4LNHA 5HX7A 1GNVA 3G8YA 1I7SB 1U6JA 2CHQA 1K4KA 3FTDA 5AKXA 1RCTE 2HBRA 3OX3A 3GEDA 3T1OA 4RMNA 5JNSA 3A2KA 3AUUA 5FHRA 4B7ZA 1AQ6A 4HDQB 1G6KA 3FWYA 3VNUA 3W2EA 3OLYA 2F6RA 4IQ4A 1NQ5A 3WYGA 1O9GA 4G4GA 1SCNE 3WK8A 5JWOA 5T6BA 3C4QA 5TQ2A 1UIMA 1ZS9A 2ZWOA 1Z4LA 4M22A 4ZZIA 1AHPA 1MR3F 1O97C 3EHDA 3EQ9A 5LLDA 2CWDA 3N0WA 1XRNA 3OCVA 5DYIA 4LYDA 1IHXA 4EGSA 5AVVA 1P45A 1AZWA 5T3UA 2IXBA 5GVRA 2HA0A 2ZYIA 1QFYA 5EWLA 1SUAA 1Y42X 4D7AA 1KPHA 2EP7A 1O0CA 2P7HA 3GDFA 1CQIA 4JL5A 4LRQA 3CT4A 3OA2A 5JY1A 2I6FA 4TN5A 3UOAB 2NXEA 4CODB 4MWDA 2GKOA 1LJLA 2GO1A 2R6HA 1IUPA 4O4LF 4OVKA 4XQCA 2WZBA 4QAJA 2OOKA 1EQAA 1O6ZA 3QKRB 5CW1A 3TJRA 3TQIA 1J99A 1RE1A 1JIJA 1V5GA 2N47A 2FPGA 2GXUA 2OB1A 4H3KB 1KO7A 5EEGA 3ZY5A 2YZKA 5L8VA 3DZGA 1W30A 1E4VA 1QAMA 2A86A 4PVDA 4IDHA 5ED0A 1TYDE 3G02A 2XDYA 4UD6A 1P3Y1 3KWJA 4X6LA 1D4FA 4ANFA 1BIFA 2GUGA 3ND9A 3JY6A 4FZVA 1ID1A 4BZPA 2WJGA 2ORWA 2ZCJA 5JW6A 1W1IA 4LOLA 5HF6A 1HDXA 3DPSA 3GLUA 3BH6A 4Y67A 3O95A 4Y9RA 3TCKA 4A16A 2FSHA 4AROA 4EPRA 2OL4A 1DKQA 1SEVA 1M3SA 3AEZA 3TE6A 3I9FA 1YZFA 5HF9A 5GONF 3IPXA 5FO0A 2ILTA 4W5RA 3JVEA 3KYBA 3FHLA 4DQXA 3EAFA 1QO0D 3WIDA 1GCUA 3QPUA 4MVJM 2QD1A 4Q16A 1SUCA 4LE1A 1I2AA 1E89A 3WO1A 3QSYA 1CS4C 4Q4HA 2A4KA 3RT1A 1MA0A 1PT9A 4KIJA 2G1JA 3WNCA 2J31A 4RABA 3GH3A 1A0OA 1H0RA 2VDQB 4DT1B 2VYVA 4DFDA 4RMJA 5DK4A 4DM3A 1VYUA 2JCVA 1VBKA 3U5TA 2XGJA 4ZOLA 1A04A 2GT1A 3HCPA 3LUJA 3HUDA 4ZN6A 4JD5A 3HL4A 5CVDA 3NHKA 1CY6A 4CE6A 4AG6A 3NANA 1GL7A 3ELWA 3MGCA 3Q7EA 5ER9A 1N2BA 4P7FA 3OAAA 4Y6PA 4PYQA 2TECE 4HZUA 1Z0KA 2PXHA 4Q4LA 4CFZA 5CB4B 3WB0A 2J3LA 1XZDA 4TMKA 2YWJA 5IARA 2P2YA 4B6EA 1ECPA 5CB4F 1RYFA 2QL7A 3BGIA 5EN4A 5ALPA 2I2FA 2J3EA 3KLBA 2IV7A 1FF9A 3I39X 1UBEA 1SKBA 2AJCA 2B30A 5KINB 4JLDA 2VFAA 3TRJA 1RWVA 3C8MA 3VC7A 4CM1A 5H4HA 2GLTA 3PENA 1JA9A 1QJ4A 1YMUA 2QLNA 2JKZA 1W85A 1R0CA 1ADYA 3NEYA 2OD9A 1N2OA 3VC2A 3CVOA 1I7QB 1NBEA 4JDPA 4EL5A 1K2WA 2FDXA 2I9KA 4PC6A 2JHPA 4OI0A 3R7LA 4EATA 1YQ9A 2YW2A 3U7HB 4TGLA 1CF4A 1MFPA 3TEMA 1I0ZA 4CF7A 2DWQA 4X5OA 5CBKA 2B35A 2XCSB 5DP1A 1TJYA 3GQBA 2JI9A 2OLEA 4KQ9A 4W63A 2VI5A 1NWHA 1Z4MA 2V6MA 4W1SA 3HYSA 1WOMA 4KNYA 1MDFA 4QFDA 1RJGA 1FDIA 1TYBE 1KI6B 2ZYDA 3FOCA 1NJ2A 2A9QA 1J8FA 2WF6A 3CF0A 4R1TA 2AFIA 3ZBTA 2P2DA 4A8TA 4EI2A 4ZTZB 1FMFA 1GZ5A 4Q82A 1GLGA 3H1BA 4W1RA 1UWVA 5LFAA 4U2DA 1S7CA 1KMHB 1TF5A 2X19A 4OSOA 1UZUA 1F9EA 4F4IA 4NCJA 1MJNA 2PZGA 5IBPA 4HT3B 4H1HA 2C2GA 3KD3A 4X1OA 5T5QA 3ZW8A 5HKKA 1FY2A 1INLA 3TN7A 3WLQA 4PAWA 4AY2A 4F86A 5DWQA 2PLFA 3SJCA 3EDOA 4TV9B 2QZ4A 4GLLA 2P8SA 3ELDA 2B36A 2FQYA 8ATCA 3DNMA 3ZDQA 5FDFA 4F3RA 4A2QA 4YP5A 3I01M 2PWBA 4GLFA 1N6RA 2GUWA 4QTTB 1VMKA 3ANYB 3DMTC 1HQDA 1RWQA 2GN2A 3K96A 3F6BX 5KI6A 1U11A 3HVHA 5D5PA 1OUMA 4TROA 3I61A 4EO9A 1WR8A 1TA4A 1XN1A 2IBMA 3ANLA 1PNTA 2IDKA 3HN6A 4RZSA 3MF4A 5J9FA 4HH4A 4CMJA 1V7PC 3NATA 1UKYA 3OH8A 1XK6A 4LXGA 4RVUA 1K6EA 1U7ZA 3DGFC 4Z4FA 3OIYA 4DIDA 3CJRA 4I9NA 5I8WA 1GGEA 3NOVA 5K99A 1JG7A 4LTNA 1NRXA 2DG2A 1Y5LA 3AG6A 4HRAA 5FJIA 1H9CA 4G5RA 1NT4A 2ZIVB 3CWQA 3EW7A 1P2GA 2OO7A 3DMRA 4N6GA 1B8PA 1VE7A 3X2FA 1R8QA 3HI4A 1FLVA 2V9CA 2W83A 1XPJA 2P9CA 1UBSB 4LCJA 2AN1A 3BICA 2PPLA 4Z9AA 1OZGA 1E5LA 1HI9A 3JZIA 3QLEA 4G5QA 1QLWA 1BS9A 5DTIA 3IP8A 1FRZA 2BFEB 4YMWA 2NZWA 3PL5A 5FV4A 1XL1A 2N1BA 3VR6H 4NE2A 4EARA 3MERA 4IYJA 2A58A 1M2WA 5KTTA 1AC5A 2IHJA 1SOUA 3LLVA 1QM5A 2IEYA 1AB5A 3RFVA 5FOXA 3IQFA 3VJMA 5DX1A 3WA6A 1I1QB 1Z73A 4UPEA 2ACEA 2IA5A 4EG7A 3TJZA 3Q12A 3L1UA 3C4VA 4YMTA 1MRSA 4ZT6A 4WCFB 2IYTA 1FQJA 3QFFA 3ZHTA 4UNRA 2FEXA 4Q7JB 3VR4A 1E5VA 3VVBA 4PWZA 1TK9A 4UNQA 3BAFA 4JP8A 1L5HA 2ADMA 1VE1A 3FYUB 4IEFB 4YH1A 2PKRA 2WMOB 3IERA 3LKDA 4MQUA 3RIMA 4AX4A 4Z4CA 3HJTA 5H9VA 1V71A 3GWZA 2AMJA 2XMZA 3IAXA 3VOSA 4C0WA 2L82A 1ISFA 1OQAA 3CU5A 3KHUA 4HNAB 4PW0A 4AMUA 4FWBA 1U98A 3DHYA 2LDXA 4BLRA 4AJ1A 2WMNB 3V8BA 4BFZA 1E6MA 4E03A 1W4ZA 2WEKA 3IMEA 2DUNA 3D7MA 1N75A 3M1LA 3REFA 5JATA 2AL7A 4WKGA 3A4LA 3MT7A 4AQYB 1UEXC 3IKJA 4TLAA 4I4TB 3STUA 4LFBB 1L5RA 3HP1A 4HH1A 5LKRA 3GAFA 2IUFA 1IATA 4JVOA 3I8OA 3CBGA 3R09A 1IY2A 3KETA 1RWPA 3AKCA 2AS0A 4LGMA 4WK2B 4CUZA 2PKWA 3VR6D 1JYSA 3LCMA 4DKXA 4WESB 2YVQA 2PXCA 3F6YA 2W8BA 5EWLB 2ESRA 5KPDA 2FUG1 4WEOA 4IFTA 3WKBA 1QYWA 1NU6A 4KVGA 2EBUA 5ALZA 3RSZA 1BXGB 2B94A 2JA2A 3M6MD 4C3UA 1NRIA 2F3RA 4ZCTA 4O2AA 4KI0A 3T9EA 5JLJA 4P7KA 3LBYA 2YHIB 1LGYA 4UFPA 5LVAA 4I50F 1T8YA 1YVDA 3E5RA 4IZIA 4DDKA 5JSQA 5G41A 1N6LA 3MTBA 4J6EA 2NUPA 1AX9A 2Q5JA 3JWEA 1X9IA 1QP4A 1AS3A 1KF0A 1UKAA 4J75A 3M3PA 1WXHA 1JMKC 2HPHA 4EEXA 2O59A 1ZCZA 7GPBA 1F12A 5DNDA 3SOPA 4EOGA 1L8OA 3V6MA 3VNRA 2I7CA 4HDAA 4QSMA 1S2MA 3UT0A 4L5IA 4E1AA 1ZD2P 1PFGA 1PHPA 2CXPA 3EVGA 3G8AA 1XA3A 2D0PB 4BRSA 3CC8A 1OF1A 4Z2AA 3B2EA 2IVZA 1DWUA 2LCIA 3EZYA 2JI6A 3NHUA 3NNDA 5HQTA 2BZSA 4QQKA 3CR7A 2JH8A 4A36A 5ALKA 3SS7X 5ALGA 5DX8A 3GJ8A 4QC2A 2Q7OE 4ZYUA 1VMEA 5G0SA 4WASA 1NP6A 2QLFA 2BFDA 2XGOA 3QJ5A 4ZEWA 2OGSA 3D2BA 2BUCA 2VSOA 3GFGA 4G1UC 1NUTA 1US8B 3BWCA 4RO0A 5JZBA 1WY5A 2P6OA 3I28A 4MPRA 3S8MA 4BJ3A 1XOIA 4DGSA 2NZUG 3ADOA 1RDFA 3JAKA 1OFVA 3RVSA 3HDGA 4S1NA 3DWIA 3AJEA 3IKLA 1ULAA 3A6JA 1YCFA 3MGKA 1WMSA 4RQAA 2BMVA 3C5WP 3LT0A 4NEHB 1A8PA 1Y7TA 4AK9A 1WKCA 3UT5B 4O5OA 5EZYA 2QQEA 2X8AA 2WWFA 3ELYA 2HQRA 3O1LA 4DIBA 4DMCA 4BX0A 1Z8HA 3TLBA 3PCXA 5IANA 1IN5A 3EUEA 3QXHA 4E2ZA 8MHTA 1GPKA 2OC9A 1V4VA 2Q9AA 2XPCA 4I8DA 3OSUA 1VIDA 4RDCA 2CW5A 1Q14A 4D57A 1RHJA 4X0EA 2A9OA 5DGHA 2XCRB 2I3ZA 1ACJA 2GWHA 2J45A 5J47A 1JJIA 1I3LA 3T9FA 4EQ6B 1QF7A 2YXDA 3AEYA 3LCCA 3R75A 3D6TB 1JWLA 1VHWA 5TJ9A 3AFGA 4J94A 3ONNA 2I1LA 3D8UA 4YT4A 4KSCA 1ZL2A 1MX3A 4DA0A 3C3PA 5KNLA 1AOXA 1Y8QB 1RLTA 1LY1A 3CBQA 2YRXA 3ANXA 2GBGA 5C1PA 1RAAA 1P2TA 2QQ0A 4LVNA 4DIEA 5KWEA 1G17A 4CT4B 2ZCVA 4FJ2A 4EMSA 1VECA 4NYIR 5AWFC 3WWEA 2E9SA 2W70A 2AC2A 1AJEA 2BE9A 3B53X 4KPUB 6LDHA 1WB6A 2PAFA 1G9SA 1Z29A 1JFVA 2P4QA 2PMCA 4HCJA 4ON9A 4Z99A 3ZV5A 1NUUA 4XFKA 4B8YA 5IZCC 3I12A 1QIFA 1QHGA 5FNVA 2CXRA 3K4QA 1Z2DA 1Q0RA 1SC6A 4LI3X 4PC7A 1XDBA 4AWBA 4QM7A 5JAZA 4QNRA 1MW9X 2C5HA 1YGYA 1Z83A 3K7EA 1E7RA 4P3KA 1TM7E 1KH1A 3FDFA 4Y9UA 1CK4A 5KCZA 3VA7A 5MN5A 1HT1E 3IOYA 4UZFA 4LX0A 3SGLA 1IQPA 3OQJA 3CN7A 2PTHA 4Q7EA 4CM3A 4RTPA 3NH9A 4EHHA 4BRWA 4YRAA 1DWQA 2QJTA 1BMFA 3ASZA 3UQZA 4H7PA 1IZZA 1GPNA 3A14A 3QPCA 4URUR 2P2NA 4P6VF 1ISJA 1XF9A 3PTLA 2NQTA 4YT5A 4IG4A 4UAUA 2I62A 1REQB 4M76B 1WA5A 1ZD8A 1BXRB 4CLHA 3ZS8A 2GNAA 3RS4A 1X14A 3IVMA 4CJXA 4EJSB 2Z83A 3CXRA 4FNGA 3SKXA 4C7VA 4K1LA 3MCZA 3AR2A 4Z0TA 2C4KA 1OT5A 2VUHB 3HRHA 2XAUA 4RSHA 2G08A 4OXKA 3ZX4A 5BWNA 3QXCA 1EVIA 4R3UC 2DP4E 1JQDA 3DB1A 3O1IC 2XQKA 4FOOA 4ZEXA 4C2TA 3IALA 3FCEA 2IY8A 4X6XA 4IJQA 5I9IA 5CW2A 3KZCA 4JYAB 3N75A 2VH5R 2OHHA 3WTCA 2HWXA 1NIJA 1II8B 3U3JA 2Z2ZA 3R0ZA 5FUYA 5FEUA 3HCRA 1HDCA 1C9YA 2QPTA 3HJNA 3NH6A 3S1AB 1V3TA 1ZHFA 3GJZA 1Q0QA 3OOSA 5DN6D 4MWGA 4QOEA 2B4YA 3TH5A 1GKUB 1DHTA 4I14A 2QT1A 3ADKA 1IOLA 3DVQX 3ZTYA 3TXXA 3GU3A 2X9LA 4JBIA 3P5SA 2ZTVA 1SCAA 3SSAA 3VDMA 1DC4A 2AE1A 3BKWA 4TTSA 1K0FA 2K6GA 4LX8A 5FUVA 4JHLA 1WXIA 5E4YA 2IGBA 1WMFA 1ZN2A 1GCGA 1SVLA 5BQXA 1HK7A 3IP6A 4ES6A 3N07A 1RI2A 4FMDB 5CFPA 2OLKA 3SS9X 1VPLA 2Q27A 3ZVKA 1Y9AA 2GPYA 3E9EA 4DCNA 1OB2A 3GDWA 4PV7A 3DUFB 3L6UA 3EDRA 4XR4A 2FMUA 3NFRA 3OY2A 3H2ZA 4QJBA 5H5JA 4F3NA 2DU8A 3UPTA 1EFCA 1O1YA 1S8OA 1U1IA 3IDZA 4KXFB 3H3JA 5BQOA 1LU9A 2P3QA 3K92A 2G5GX 1OLXA 3LQFA 5ELLA 3UGQA 3UHPA 1KI9A 1SY7A 1UDXA 3BBLA 3FWKA 1KMCA 1IDN1 1QOQB 1T2FA 3KDSE 5K3EA 1PO7A 1YQWA 4Y7DA 3L7OA 3K5HA 1RYHA 4HDKA 4LFCB 4QLBA 3EODA 4D1YA 1T9GR 3WMWA 3ESCA 2BISA 3QP9A 5E4JA 1JLRA 3WP1B 3GYBA 1RC0A 5A2GA 4DF3A 4NWIA 3KUDA 1OX4A 4WVFA 4B45A 4R1MA 4EELA 4PO1A 3PJDA 2VYCA 4BQEA 1C29B 3OE7D 4HAYA 4YCLA 1WDWB 2WR8A 1NUQA 5FR1A 1LC0A 4R1QA 2AFRA 3OX4A 2RHLA 2IOYA 4I5FA 4QUHA 4QX6A 4FB5A 2IL1A 3BB3A 5C52B 5YASA 4I4CA 2J5BA 3U1BA 1WMAA 3QBDA 1XMQB 4JJ7A 3ZKAA 4AC9A 3HYLA 2QD4A 1GQRA 4JQZA 5KC9A 4Z3OA 1H93A 1GYRA 1M7GA 4R8LA 3FOBA 3LSYA 2HMUA 3TINA 3WYAA 2WAYA 1XQWA 3GNSA 3LTEA 1SQSA 3GFSA 3KOYA 3W2TA 1PFYA 1DFGA 4Q05A 4E5YA 4ZIRB 2WNHA 3ED1A 1ZCJA 2QJOA 4NEGA 4EEZA 4HLUA 4NRDA 1FP1D 1Y3FE 1U6IA 3DWFA 5AICA 3H1GA 4P84A 1YQGA 3P0RA 5FF9A 3TQCA 3UMYA 2EJCA 3EA0A 1FTSA 1IN7A 2RKWA 1G6HA 1TW3A 4RCYA 1QP7A 2CDCA 2ZWMA 2Y1XA 5HJ5A 1CYDA 3NV9A 2WFAA 1PJ8A 1U1CA 5DV9A 1DKMA 2RJOA 1UBTS 3G2OA 1RLJA 2F3TA 1H5QA 4MQ6A 4KODA 1JKJB 1ECCA 4KLRA 4R2XA 4M98A 3M33A 5C7LO 1JDPA 4MUEA 2SNIE 4O5AA 1DOZA 1IB0A 4PYOA 3FOZA 3UWKA 1VL6A 1Y7PA 4C76A 1QTRA 2RGNC 3Q85A 5LC1A 1X77A 1JDUA 2X14A 4TQUS 4JWKA 3NDRA 4UU1A 2H63A 4TL9A 4ARZA 2PO5A 4OHZA 1QQ5A 3UT5A 3VJRA 1E3SA 4K0KB 3MSCA 4NAHA 1ECFA 2QUIA 3D3WA 3MWDA 3DMYA 1Y3HA 2WIKA 5K3OA 3S5UA 3CVXA 4A15A 4XM0A 3ZY2A 3AEXA 4Z1MD 3JWIA 3AP3A 3EAQA 1Z0IA 1BD3A 1K1EA 3I64A 3Q1KA 3TQOA 3X1KA 3DBHA 3F5SA 1KMIY 4UOQA 2VDNB 4WERA 1TM2A 2SBTA 4RENA 5KSPA 4QYIB 2DHDA 2OORA 3HBAA 4N8SA 2Y0PA 4YNBA 1DKLA 2HFKA 2R6R1 4JLMA 2C77A 2PLRA 4LHSA 4RORA 4WOBA 5TQJA 5DYGA 1N2SA 3UIEA 2LE0A 1ZIOA 4B47A 4NBNA 3VSCA 4ZICA 1SXIA 3JS5A 4C6RA 3WK6A 1CBUA 2ZIGA 2YHSA 3MILA 3T0FA 4AZ0B 1Y48E 3SZUA 3ROFA 1ZUD1 4IOMA 1YF3A 2O1WA 5H3LA 4WLUA 2PSSA 1QYRA 2VRNA 3RFTA 4CR7A 1J9EA 2XXAA 1LZLA 2PN1A 5JMTA 4BC1A 4B2YA 1UXHA 1VA4A 1IHOA 3EZ6A 1YB2A 4GKJB 1SH7A 4FT4A 4UTOA 2DWOA 3PEEA 4ND4A 3I9V1 5GOTA 1D2GA 4UDNA 3VR4D 2V4UA 3QWAA 2VQ6A 3DYIA 1CZRA 4YTEA 3LCJA 3DOCA 4ZU3A 1DTWB 3A32A 4JELA 5CT6A 3K70B 3PZRA 1RQXA 1KO8A 2ZE5A 1M72A 2F43B 3LH5A 5KDOA 4XRRA 1PGQA 2FPLA 1NV8A 1BXGA 4MARA 4B6SA 3B7PA 2BBOA 3JQGA 1RACA 3DA8A 2DVMA 2C7VA 1E3WA 1L4LA 3P19A 1SN7A 5JJLA 1Z0DA 2RBKA 3GVCA 1A8QA 1B8OA 2HX1A 3OLVA 3IA7A 5K3AA 3TLJA 4HNUA 2NO1A 1EVQA 4KKVA 4NMMA 4EHNA 1KVQA 3IAUA 3BAZA 4YMLA 4Q3CA 4Q3LA 1C7RA 4AKEA 4UBJA 5BRNA 1RZRA 1AA9A 4U3JB 3C1UA 1ZIDA 4MKIA 3HZOA 3VXKA 3S8EA 1XK7A 4FFLA 3D1LA 1CFZA 3GC6A 3FSRA 3IBYA 3KO8A 4PSAA 3IILA 4LF6B 4MRMB 2A5LA 1C9MA 3KEMA 4MS3A 1UODA 1BDBA 3MHPA 1UKVY 4ZI7B 1EK5A 5KJEA 3LBNA 4AM8A 5K45A 1HG1A 3QVLA 4N3CA 3KRTA 4YDQA 2HM7A 2W93A 4ITRC 3CRQA 3JD0A 3KSBC 4H60A 1SG9A 1U28A 1YJ5A 2WYUA 4Z7JA 3FHTA 3DDSA 2VZ0A 3CEPB 5AJTA 4C0LA 4E21A 1TX4B 5K8IA 3W04A 4JSTA 1I3CA 5LB4A 2BZ0A 5BQ5A 4GXRA 4EIWA 3CZ4A 5EL0A 5I3ZA 1OIVA 3NVAA 4HWTA 1Z34A 1NWCA 1YFJA 2XSZD 4KQ6A 2BI4A 2C42A 1ADGA 4AURA 4JLNA 1ZM7A 2WE8A 3FAZA 1J21A 1G20E 1MG5A 3IRVA 3OOYA 4PYMA 3HKBB 1U0HC 1A9TA 3RUCA 2JS7A 3V8VA 5CCXA 1JL3A 5KUTA 1KVSA 3DEYX 1Q20A 3CGWA 3T7IA 2XCOA 3WGOA 3ZCVA 5DYYA 5ABPA 5B4TA 5C5EA 2V3CC 1N9ZA 2Y1LA 3FNBA 1FXSA 5E6UB 2Q6IA 3T3DA 3IOBA 2WAOA 1ZNZA 2ERYA 3GBPA 3FPAA 1PT8A 2R25B 4LECA 2A8YA 4DCGA 4EB6A 4PN3A 3PCRB 3W8RA 3SZRA 3PNLA 5B6PA 1EHIA 4JOSA 1Q57A 2E89A 4P53A 3SF8B 3QKUA 2WWRA 4V38A 2B8JA 2L69A 3K9BA 4LTMA 2C3OA 3H5RA 5IM4A 2X4LA 3KKKA 2EIXA 3A0UA 4PFJA 4XSVA 4YCJA 5EWJA 1QJCA 2CFCA 1X19A 1RI4A 4UPDA 2HTFA 1EFRD 1RTKA 4NY1A 1O03A 1CR0A 2C2HA 2XD4A 4G07A 4KN6A 4R6XA 4YGXB 3EY9A 1GU1A 2OP0A 3ASYA 3NASA 1FXUA 4GVPA 4Y0NA 3STHA 5KNBA 2JIQA 3MGAA 4QDKA 2HA2A 2IPLA 4OHBA 5T57A 2CT8A 2GAAA 2NPIA 2NZJA 5K9ZA 2ZVJA 3RBVA 4GGOA 3AEUB 3W9YA 3ENWA 1RKVA 3BA6A 2XCTB 5CLJA 1QZXA 3F9RA 4RFVA 5LQSA 4MS4A 4C6TA 4FR2A 5HBRA 4COKA 1ORVA 3U13A 2C8LA 4EUKA 3G79A 3WLAA 3KKOA 5FOQA 5D1NA 5A4AA 3S1SA 1C3EA 3AP2A 1XKTA 3O92A 3RVQA 4ZOAA 4LDQA 2FR8C 2Q29A 4IDDA 5FT9A 2AK3A 3TZKA 3ZQKA 5KYGA 4HYTA 5F52A 1E0SA 2PMFA 4EO4A 5BNWA 4LHXA 1HM5A 2D1RA 2KB0A 4IIYA 1GR0A 1CIPA 2GBPA 3KSDO 3N2KB 2VQSA 2BMWA 4E5VA 1GL9B 1OKKA 1KY2A 2G9QA 2UYOA 2GM4A 4CEIA 5HIMA 1R27A 4UHKA 3ZDYB 1T26A 1JILA 4DAEA 1PYGA 2ZE8A 5AW7A 3C45A 5LZ4A 2Z9DA 4Q6WA 4KW7A 1X7WB 1IZYA 3ST7A 2FW9A 3LU1A 1CUJA 2B4RO 2FEMA 1MX5A 1EJ6A 1ZK4A 2Q4RA 1ZGGA 2FQQA 4MIEA 4Y2JA 1RRPA 1EGQA 1KEPA 1ZESA 4RD0A 3VKVA 1QCDA 2H7VA 4PGFA 4KDRA 1T9BA 4AFNA 4DSNA 4IEEA 3CE9A 4URXR 3JZDA 2ODWA 3CWZA 4FHDA 4IJ5A 1JQEA 1QMGA 5E7QA 4HYQA 3V4LA 1FU4A 4RVCA 3TLYA 2I4IA 3PGKA 2QL5A 2EW8A 2IS1A 2IHVA 1NBME 1E7WA 1GAQA 4GI2A 3WAJA 3H2KA 4X3OA 1GU7A 3N05A 1QPZA 2B6HA 2DWUA 3G9XA 5L6LB 2OE2A 4ZVPA 4RFSB 3MCVA 3KD2A 4LNAA 3AR9A 3H5VA 5ENZA 1VG0B 1BJRE 1D2AA 2JK1A 4GMDA 4EG4A 1DLIA 1H6BA 1N9KA 2ZULA 4I9FA 2KYRA 4YRPA 1RQRA 2ZJ8A 4JQCA 1T1JA 3RTEA 1TGYA 3DE5X 2A67A 1T43A 3PHLA 3RUHA 4YYZA 2X2OA 4ZZ0A 4AKHA 1Q7RA 3DVLA 1G42A 2GFHA 1XEFA 4E5PA 2Q6VA 4YALA 1L4EA 4K28A 3RC9A 1GJRA 2GZMA 3RVJA 5CG2A 3J81k 2FLWA 2YHAA 2XSZA 2NQ8A 4JT2A 3CUSA 1TCAA 2HIGA 5IHPA 4EUFA 4JIMA 1U0LA 1QZZA 2RK4A 3DKPA 4MS4B 4C6TB 1FJHA 4IJKA 3FCSB 2Z2JA 1BN6A 1E9DA 1TA0A 3GOHA 3AUSA 3ISVA 5CA0B 1W87A 4O8CA 2PA0A 3G8CA 3OESA 3GJQA 4EVRA 5JQGB 2EJBA 3IQIX 3IQHX 1RBZA 3F8SA 3INNA 3N2NA 3TD6A 4EW2A 3AJAA 3WDLA 4TRRA 3VNSA 5ALIA 4KRYA 5BORA 4ZV4A 1C9DB 1W0KA 3AESA 3DHVA 1ZM4A 4PZCA 1LLCA 2Y0BA 3TRDA 4E5MA 1FFXA 3OM0A 4B7XA 2ZIZA 3M6LA 5EHZA 1SCIA 5A6SB 2ZIEA 3FDJA 1WUKS 1G2QA 1ECJA 2O0JA 1Y6JA 2O2EA 2C84A 3IR6A 3BXEA 2VHQA 4J0EA 3O4JA 4JSYA 3D8RA 3RB8A 2CDRA 2Y9PB 5E1OA 1JHUA 3EZNA 1SBTA 2OCDA 3GZJA 2BIFA 1H6DA 3WQRA 3T3NA 1ZWKA 1EWTA 4A8JB 5HVNA 1LSJA 5T4EA 4DYVA 5J1TB 4BQQA 1KOFA 1DTEA 2E4YA 2Y0CA 3MOGA 4LF8B 5CPBA 4ZALA 1GL3A 3D59A 2WJYA 2CDBA 1JIXA 4Z53A 2M6SA 1QUEA 5A2QA 5AXAA 3H6GA 3ZWVA 4A1OA 3ZR4B 3AIKA 6YASA 1E2GA 1IMJA 3Q7QA 1QB8A 3KSRA 5B53A 3U4MA 4GQAA 2B8TA 4URVR 2RHTA 3H5LA 5H68A 3BMNA 1ZMTA 2YW9A 4A8JC 4MV7A 4TQGA 4A23A 1JHYA 3A0RB 1VDMA 2HO5A 3NWJA 4GOLD 2EBFX 1Z16A 1B6TA 4PBSA 4IILA 4N7MA 2FOLA 2GEKA 4D9KA 2OECA 2ZQYA 4EYGA 3QKRA 1YMVA 3Q6MA 1EESA 4HLNA 3NRBA 4JLBA