1SULA

Crystal structure of the apo-ysxc
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
195
structure length
186
Chain Sequence
b'MKVTKSEIVISAVKPEQYPEGGLPEIALAGRSNVGKSSFINSLINRKNLAQTLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPVIVIATKADKIPKGKWDKHAKVVRQTLNIDPEDELILFSSETKKGKDEAWGAIKKMINR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein YsxC
publication title Analysis of the Open and Closed Conformations of the GTP-binding Protein YsxC from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 61
structure length 186
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1sulA00
4DLUA 4M1OA 3C5CA 4TLDA 3GCGA 2IHBA 4F91B 3AH8A 3WBKA 3AP1A 2CVHA 2F9LA 5FH9A 1JAIA 3BAFA 3RRMA 2V1UA 1G7TA 2JCSA 4PHHA 5BYKA 4II7A 4E22A 2FGJA 4MKFA 2GJ9A 2FSFA 3NBXX 1IONA 2EYUA 4UNRA 1X6VA 2BKEA 3ZQ6A 3CRW1 4MRNA 2OLKA 2CK3A 2H8KA 3KFVA 2PT7A 2QL6A 1VCNA 2QRNA 4FWIB 4LYJA 3K9NA 4N0DA 2AWNA 1NG1A 3Q7PA 3EA5A 4RD0A 1W49A 3WMGA 3EPHA 2VBCA 2FNAA 4QHSA 1CTQA 4EPVA 4B6FA 2V4ZA 1ZD8A 4FCVA 4NYIR 2Z4RA 3N2EA 2O8DB 1HYQA 1OIWA 2B8WA 5CK5A 5BW8A 2ZRKA 3LVQE 3IUYA 5EXPA 1ZNWA 1E9BA 1LW7A 3K0FB 3K0CC 4K46A 1UEIA 2ERXA 4LC0A 4KFSA 2CJWB 2I3BA 3B78A 4MYTA 3TJZA 3UIEA 2PCLA 1XTKA 5TDHA 2DWOA 1V43A 2DYKA 1N6KA 4G5SA 5DHFA 2PEYA 3BJIC 3KUCA 5C1BA 3T1TA 2O8FB 3QXHA 3U60B 4P4UA 5JS7A 4OQXA 4POAA 4BECA 1U8ZA 2F6RA 3ZS9A 3RS0A 4LV6A 4B3CA 4X8MA 4C0QC 4CEHB 1U9IA 1WRBA 4G5GA 4D6PA 5FBWB 2C77A 2WIBA 1G1MA 1OKKA 4WW0A 3CLVA 3OEED 5EQTA 2TMKA 4C0AC 2ZM5A 2YNMA 1AJEA 3G0HA 3FFBA 1NSTA 2J0SA 3OEHD 4GOKA 4JT2A 3DMNA 5HE9A 1UKYA 1GFIA 2ZYWX 2BBOA 5FOVA 2RHDA 2CEAA 1DAIA 3FWYA 3M0EA 1FNMA 2WMOB 1P2SA 2EFEB 3BS4A 3TUZC 1KSGA 3AKDA 1OJLA 3EWSA 1G16A 4E07A 1ZW6A 2BM0A 4KJZA 4BFTA 1COWA 1JEEA 2VP5A 3U6KA 1F2UA 3VR2A 1KY3A 2GETA 3Q72A 1XTRA 4GT1A 3EPKA 1VYUA 2GNOA 2GCOB 2DFLA 3H2YA 4XVUA 2X1VA 1NSFA 2DY1A 3K0CA 1HTWA 1GKUB 2VLIA 2YINC 3MWLA 4W5HA 2IYQA 4A0HA 2ZROA 3MAAC 3OIUA 4V0ME 1P9WA 4Q66C 5GJVC 5DLQC 1SVOA 1PZNA 1RYHA 1U2RA 2IEYA 2EQBA 3BD9A 3G5UA 4TMKA 4MDFA 1US8A 3KXKA 3IPXA 1KIMA 1JI0A 2CBZA 2PMKA 3EWAA 3THYA 1RRPA 4A6PA 4OQLA 721PA 1G18A 1S4QA 1NKTA 1FP6A 5A5GA 3GLGE 4AURA 3KKNA 2G6BA 3TGPA 4I1UA 5LB4A 4URVR 4LHVA 2F1RA 1SULA 1KJYA 1OXSC 3BB4A 3AGPA 3RYTC 2NTYC 5L3QB 3ZD7A 1T9HA 2BKUA 2J7PD 2QEQA 1CRQA 3IQXA 4JSYA 3R8FA 3A4MA 2J46A 1IN4A 1AGPA 2PLFA 1Z83A 4DLRA 1XJQA 4KYUA 3OAAD 2YC4C 1SQ5A 2W2XA 1R8QA 4OK5A 3BBPA 3FHOA 5CITA 2AXNA 3KXIA 2Z6VA 1YVDA 5DGXA 3GP8A 1ZM4A 1L8QA 5DN6A 1Q1QA 5C4MA 2UVQA 2WKRA 1W4CA 2DFKB 1BYUA 1OH6A 4DIEA 2GCPA 4W9MC 2AR7A 1G64A 1JECA 1G7SA 2J3EA 2KWIA 3NTUA 3KKOA 4LBZA 1E2QA 3CNLA 3T1OA 4BFUA 2W58A 4QXAA 2G1KA 3W5JA 2XB4A 1W46A 2JDIA 3U6BA 3BB1A 3UKDA 3NDBB 4FMDF 2XJ9A 1F2TA 2BMDA 2FFHA 2OO7A 2YWGA 4I99A 2JLVA 1SVMA 2IBMA 2FEOA 3SS8A 1WA5A 3JVUA 3DO6A 3DPUA 5EE0A 1XD9A 1QG2A 2GK6A 5J4LA 4CT4B 3FDIA 4RCYA 4US1R 2ATXA 4PAQA 4RSGA 4C2TA 1H8HA 1X1RA 1OFUX 3PEVA 5K8LA 3A37A 4IVQA 3ZIAA 5LPNA 3WY9A 2QU8A 4PPNA 3GJ7A 4OI4A 4PC2A 4OQFA 2I1VB 1Q1ZA 2NO7A 4A4DA 2HYIC 5JJIA 1MO4A 1FTSA 1OFTA 5DO9A 4RZUA 4S35A 2F1JA 1WE2A 4AYTA 4DLSA 3AF3A 1NLFA 4EAQA 1IAQA 1JJ7A 2QENA 1D2NA 2HEIA 3C41J 2AFIE 4Z8YA 4ZKEA 4HAZA 3A4LA 1X8JA 1TADA 1MRSA 3EXAA 3VU9B 5BXQC 1XPRA 2IS6A 2ATVA 1EXMA 4LBVA 1E2PA 5JS8A 3BK7A 1Z0AA 2R9VA 4MUAA 1OIVA 4QFMA 2XNDD 1DAGA 1RRFA 1K5GA 1N5LA 2GEVA 1NLYA 2PMDA 2QQEA 3ZVLA 1GITA 2B21A 2RGDA 3OE7D 1PV4A 4DJTA 2IXGA 1E79D 2EWVA 2IHYA 4V0MA 5AUPB 2ZAOA 1QHHB 1XEXB 2BDTA 2N1BA 4TLEA 1QVRA 3K0SA 5G53C 2QZ4A 4JZKA 1AS0A 2VSFA 1ELOA 1NP6A 4QJ4A 1XU4A 4JLAA 3TUIC 4AWXA 5JWHA 1T8UA 5H68A 3TQCA 5F9HA 1N5JA 1T3LA 4M1SA 3GLGA 3P20A 1DPFA 5E3HA 5AWFC 1DAEA 2HV8A 3TBKA 1MT0A 1P60A 1T3HA 2ZSAA 2FPMA 2V3CC 1Z47A 5FOTA 2P6NA 4BASA 1FTNA 3QOFA 3OHMA 1KNQA 2I4IA 2KB0A 1WP9A 3RS5A 1G9XA 1GNQA 4QM6A 1P4SA 3LD9A 5FL3A 2X77A 1TMKA 5B2ZA 3UWOA 4ZCIA 4NPHA 3TSZA 4ERNA 3AVOA 1YZGA 1DO2A 3K9HA 1EFTA 4ASUA 3GLFE 2GDJA 4OL0A 4M9QA 2XTMA 4AKGA 2BBSA 2Z43A 5E7JA 1EX7A 5EP3A 5EP1A 1KNXA 2A5FA 5DI3B 2R6AA 4NL4H 4QJ5A 1G3MA 1RJ9B 2GZAA 2PCJA 3RLFA 1W47A 1QHSA 2YJTD 4ESVA 3FMOB 4KFRA 5E95A 4BGDA 5KNDA 1VHLA 4WAUA 2ZR7A 4HZUB 5JZVA 2H17A 1N6NA 4EDHA 1NMXA 1QF9A 3SYNA 2FJUA 2QSYA 2CNWD 3DEFA 2YKGA 1ZUIA 3SE0A 2PJZA 3IO3A 1OSNA 5P21A 1OFIA 2O52A 5AUOB 1HT1E 3T34A 2QAGC 4DT1A 4M2LA 3CPHA 3U3OA 2BM1A 2Q9AA 4N0EA 2IYUA 5E4FA 3ADDA 1OYYA 3IHWA 1XTJA 2WKQA 1RYFA 4LHWA 3O8DA 4W5JA 3O8BA 3T15A 1TPZA 3I3SR 3M1IA 2Y8EA 1R0XA 3C14C 3TKLA 2G0NA 4ZKDA 2JLUA 2Q21A 3HU2A 1VCOA 3B6EA 1TUEA 2FF7A 5KNCA 3L8ZA 4Q4JA 4LYHA 3GLIA 2VO1A 3Q9LA 4IFEA 4XOIA 2WMNB 2W2VA 4NCIA 2XXAA 1GWNA 3OIVA 4XD7D 2ERYA 1H8EA 1N6PA 2WAXA 2ZRFA 4Q9IA 4DRZA 3MCAA 3QXJA 4XVRA 4BZPA 2C8VA 1XEWY 3NKVA 4WZ6A 821PA 1KMQA 2OLJA 1FOEB 1LFDB 2IUUA 3VR5A 1P2VA 5EZ6B 3KB2A 4WXPA 5KUTA 1ZM7A 3PFIA 5L3VA 2ZSEA 2D2EA 4W7SA 2UZ3A 3VR1A 3P4XA 2KI5A 1DAFA 1T0HB 1W1WA 2QMHA 2O8EB 1W0KA 3A8TA 4D4KA 3ND9A 3ZVRA 1A2BA 2VSXA 5B57C 3P32A 1N3BA 4XH9B 4GSYA 4U5XA 1G5RA 4V0NA 4C7OB 1YE8A 4YQFA 5J4KA 1Q44A 4KODA 1W0JA 1D2EA 4LDJA 1AGRA 4L15A 3FMPB 1D9XA 1LF5A 4CZ2A 3PUVA 3D7MA 1F48A 1G291 4HAYA 3BGWA 4B2PA 2CLDX 3X1ZA 3WHKA 4XWAA 5SZHB 3V9PA 4FIDA 1E9DA 5G41A 1OE0A 2V54A 1OH5A 2VP0A 5K8TA 3K70B 1EX6A 1Z0IA 1JQLB 3J81k 4DHEA 5JCPA 1Q1EA 2FN4A 2AK2A 4NE2A 3GLFA 4DB4A 4G5QA 2Z4SA 4HLQB 2D7CA 1DTSA 3GFPA 4JSTA 4IHQA 4XJXA 1J8YF 1SGWA 3QENA 3T5GA 2IYVA 2V6JA 2W6JD 2GBLA 2ZJOA 2WPDA 1IN5A 1CKEA 1FMJA 3QKRB 3WHLA 3EW9A 4HI0E 4KAXA 4ZV4A 4IXMA 4UKDA 1CULC 4QC2A 2WWHA 2C99A 2R6DA 1Q21A 3L0IB 3V00A 2WKPA 4LV8B 1SXJC 4AK9A 4B3FX 3QXXA 4DCNA 1TUIA 3N70A 4BUJA 5F2EA 3N2IA 4TQUS 4OHYA 1HV8A 2C96A 2QTVB 1E2NA 4LPSA 4TTPA 3PUZA 3L82B 1FQKA 1KOFA 2ZIAA 4K81B 3O8RA 1FMLA 1W2GA 3LVRE 4QHTA 1TQ6A 4IJMA 4RD1A 2FMXA 2WVJA 5TY0A 4DCUA 1AQYA 2O8DA 2CK3D 4X8HA 5D3MB 3UMSA 4B76A 1E3MA 4O0MA 1U0HC 1FNNA 4AKEA 1U8YA 4Q7LA 4PAOA 3W34A 1UFQA 1ZIOA 2VL7A 2VF8A 8OHMA 1VIAA 3UG6A 2CJWA 4HZIA 5EXTA 1KHTA 1GRNA 1QHGA 2ZR0A 2DFNA 2ZUCA 1FUUA 4D0GA 1A7JA 3K0AB 1QHXA 2ZRAA 4TMVA 3SYKA 3ZLJA 3VKGA 2O8FA 4B32A 1WF3A 4FXPA 2P65A 2V6IA 1YU9A 3B8HA 2IYYA 3DM9B 2BBWA 2LKCA 4DDUA 1FX0B 4LJ7A 5JHGB 4A9AA 3NIBA 1XFAA 2R2AA 2OHFA 1JB1A 4CEHA 4JLKA 2K5UA 4ZCMA 2O0HA 1GVNB 2ZJ8A 3TK1A 2V8OA 4Q7JB 3UK6A 3AP3A 1WXQA 4S2EA 2JLQA 4PO9A 3Q85A 1CXZA 3NEYA 3F8TA 2O8BB 1SVKA 1Z22A 3GFOA 1SZPA 1U0LA 1W2HA 3CW2A 3HR8A 5FBVB 1YR6A 2ORWA 3ASZA 4DSNA 1BS1A 1E99A 2JJ8A 4HDOB 1W36B 1II8B 2QI9C 1E9CA 2QP9X 4QOSA 2OILA 1I2MA 3CR7A 3JZAA 4B6EA 2YHSA 1GM5A 2GAAA 1OKKD 4JBXA 4A1FA 1QHNA 5LBIA 1HURA 3K9GA 2XAUA 3L8YA 3AF2A 3AM1A 2ZJ5A 5B30A 3SJAA 2R62A 2J45A 1BH2A 2PZGA 2A3RA 3ZGXA 4O3MA 5JI3E 1ZYUA 3EX7C 2GCOA 2YOHA 1DEKA 4MGZR 2HF9A 5EP2A 2RGEA 4OI2A 2ZJYA 3H1TA 1SVLA 2OM2A 5JBQA 1CF4A 1ZCAA 3VMFA 1COWD 3DZDA 1SKYB 1OPXA 1SVIA 1AKYA 2ZSBA 4D0LB 5DNYB 1VTKA 2ZE7A 2REXB 4BFSA 3BFKA 4AY2A 5A0FA 4UXIA 3RWOA 2QMUA 4R9UC 3P27A 5J40A 2WJJA 1MKYA 4Q4LA 2RAPA 1NF3A 2N42A 1GILA 4Q1DA 1N6IA 2VRWA 4XSHA 2ORIA 2Z0MA 1N6HA 2Q9CA 4TYQA 1Q3TA 1QVAA 1JNYA 4URXR 2DR3A 4TQAA 4A0GA 3R7WB 3FOZA 4JLOA 4C0KA 2ZRIA 4FMDB 1AN0A 5TMPA 2WWYA 3QY0A 4NYJQ 4BEJA 3B9PA 3RDPA 1YZTA 3MG9A 1E0JA 2BJWA 2JEOA 2WAYA 4QBFA 4C30A 5JRJA 4RD4A 1OH8A 4BRUA 4L4UA 4EQ6B 3RS3A 3FFAA 1J8MF 1VCMA 1KO7A 4Q4AA 4D80A 1FUKA 3I8SA 1VKJA 3ZZUA 1XTQA 1BO6A 3PXGA 3CM0A 1HQYE 1BOFA 2ZR9A 1KK2A 4B44A 5FTMA 1I4LD 2VHUA 3T5DA 2FSIA 1E1QA 1XD8A 621PA 1KO5A 1NBME 1KI3A 1KY2A 5DN6D 2JIZA 5CM9C 5FOSA 5ELXA 3PV0A 4MDEA 2ZI4A 4O2RA 3ADCA 2IYSA 1L2TA 5FUVA 2OUKA 1L7VC 4AKIA 3QF7A 3REGA 3T61A 5DE3A 1TNDA 1NI3A 4NCHA 5HTKA 1NVVQ 1F3OA 5CLQA 3KFXA 1M7HA 3G82C 3V4RA 1U98A 1A5TA 2JDID 2XJ4A 3WXMA 2AWOA 4CF7A 1A4RA 2Q6TA 3L0SA 4Y0AA 4FMCF 3ND8A 4JYCA 4B71A 5FOWA 4EPTA 2Q3FA 2ZI3A 5BN3A 2N46A 3BE4A 4GNKA 2R6FA 2ZVPX 4US2R 2ZRJA 3HU1A 1QHYA 1R0ZA 2NIPA 4HAWA 4LJ9A 3WNDA 2XTZA 1AZSC 3NDPA 4OHZA 2WJVA 1E6CA 1T91A 1CR0A 1H8HD 2G9NA 4ARZB 3ZIAD 3IILA 2ONKA 1WCV1 2E1RA 3C16C 3RC8A 1YR9A 4CYMA 4EPWA 3LX5A 2REBA 4MGKR 4BWYA 4YMVA 5KDOA 3P1JA 4RZ3A 2ZRNA 1ZINA 1S96A 3LO5A 5J4YA 4WBSA 5JWOA 1UKZA 2BBTA 1CLUA 3WMEA 3EAQA 2IW3A 1K6MA 4QKQA 5GVSA 2DHRA 3LXXA 2XTNA 1F6BA 1QHHA 1XEXA 3I72A 4OI1A 2BCJQ 1XPUA 1BYIA 2OG2A 1Z06A 2D7DA 1IN8A 3AEZA 4H9GA 5B64A 5JMTA 2HDNB 3M6AA 1XZPA 2B6HA 2IYXA 3LLUA 4DLVA 2C5LA 3DZ8A 3QXCA 4BLPA 4KFTA 5FOUA 2C03A 4DDTA 4F4JA 3I62A 1XZQA 4HAUA 2X2EA 3KL4A 2LKDA 4F7WA 1N6RA 1ZU4A 2PBRA 4IKEA 3THWB 5HZHA 5IT5A 4R7ZA 2XSZA 4KHZA 3TRFA 2R6CA 2ZJZA 3QE0A 4I1VA 1OF1A 1G20E 2Q0HA 3EA0A 1II0A 4HLUC 4PZLA 2IS1A 3ZH9B 2CL6X 3X1YA 3D3QA 1M74A 2OSBA 2RGCA 1E2GA 2GWHA 5KOYA 3Q5EA 1IXSB 3QI2A 4LJ4A 5JSZB 4ZCLA 3P4YA 5KPJA 1G3UA 1KSFX 1D8TA 2FOLA 2VHJA 4PQFA 4EFLA 1RJ9A 3OF5A 1HY3A 4C0LA 4DWJA 3KJEA 5KHOC 2BHRA 2WJIA 4TMWA 3U44B 4ASUD 2QSZA 4HZUA 1SXJB 4DCVA 3NEJA 5LDDC 4Q7KA 1VECA 4W5WA 3PEWA 5TARA 3UMFA 3LBIA 1Z63A 1UBFA 1JPNA 4DLYA 4M1KA 1VG1A 3FB4A 2CE7A 3RAPR 1R6BX 3E70C 1GKIA 1JBKA 1Q3HA 4TTRA 2WJGA 3KKPA 5FTNA 1J7KA 2PEZA 1R0YA 3QF4B 1Q1BA 4MITA 4Q03A 1OLOA 3QG1A 1YZLA 4BFVA 3S1AB 2QA5A 1XF9A 4ZO4A 1XJCA 1XXHB 1KKLA 1XJ0A 2C04A 4G0NA 1KO4A 2WHXA 1KMHB 3ICQB 1R5OA 2R65A 1Z0FA 5CB8A 3K70C 3SJZA 1GUAA 5KSZA 5C4GB 2HF8A 1XMSA 3FVQA 2CLSA 2QTHA 4V03A 2HUPA 4WZBE 3L43A 3AKEA 4HLUA 2WSSA 4TWZA 3TAHA 1GAJA 3W9YA 5CB6A 2GF9A 3AF1A 3ONWA 1EFHA 2UKDA 4R71A 1G3RA 1PUIA 4KVAA 2ZUBA 4MYCA 4IDQA 1I2DA 1EESA 2W6IA 4BFWA 1JQJC 3SOPA 4E5UA 3A1VA 4OQMA 5JCZA 2PH1A 4GBMA 5H1YA 5J47A 1H8ED 2MSEB 2C98A 4OJKA 1Z6XA 4UJ5A 4GL2A 2BMJA 2JGNA 4IW3B 2IL1A 4U7DA 1XP8A 3IBGA 4KFUA 4URZR 1QRAA 2IF0A 5FPHA 2GCNA 1XDBA 4D2IA 4XTRA 5EUQB 3LH5A 2J59A 3A36A 4LJ6A 4NU0A 2NPFA 2JJ2A 2NO9A 3A1TA 4EPRA 1HUQA 1YRBA 5JEEA 4BPBA 3BH0A 2JLRA 2ZXUA 3IO5A 3QEOA 1S1MA 1P5ZB 2ODEA 5F9FA 1GTVA 1W0KD 1FFHA 1T8TA 4HUQB 1XNJA 1E2JA 4F93B 5AK0A 2GZHA 5D3QA 5TB5A 3QJYA 3RRYA 3THOA 1ZIPA 1P62B 5EE5B 3SJCA 4Y0VA 2CCGA 1P9RA 4UXHA 3SN6A 2GXQA 3I73A 5TVKA 1MOZA 1W0JD 1K8RA 2F9MA 2R8RA 1Z2CA 1NN1A 1RKBA 2HT6A 4GZLA 2BC9A 4G1UC 4D4JA 2WWWA 2XX3A 2WZQA 3O47A 1SKYE 3MMPA 2PZFA 1EGAA 3QVVA 3VX4A 1DS6A 3CZQA 4Q1AA 221PA 1A2KC 4R98A 3LQRA 3FE2A 2OFOA 1YRAA 5CDFE 3KTAA 4JLPA 4E09A 4PZYA 3EIHA 3TVDA 1E9EA 2ZU0C 2IWHA 1RRGA 1W5SA 1VHTA 3E1SA 4ZDJA 3CF2A 4EFMA 1HT2E 4O25A 3EG5A 2X8AA 3MRSA 4LHXA 3PENA 4F4CA 3IPYA 3B9QA 4C0BA 2IS2A 2JLZA 4FINA 4H1UA 1ZM3A 1W36C 2W83A 3RRNA 5CK4A 4J0QA 1B0UA 2FE4A 2XZPA 2ANCA 2WPDD 3EARA 4N1AA 2E9SA 3D31A 4WVFA 3ZDQA 5HKKA 1VG0B 3GLHB 3I5YA 4GOJA 5K8IA 2JJ1A 1CJMA 5CIWA 2IS4A 3WNCA 1E9RA 1M8PA 1G5PA 2ZE6A 2NO0A 4M9XA 2WSMA 2WJYA 3TSOA 1AS2A 4DVGA 1PLLA 1UEJA 2BWJA 1ZCBA 1ZVQA 3K09C 3NHBA 1KSHA 4B43A 2EFHB 1EFRA 2AN9A 4MH0R 3LLMA 1R4AA 1IXZA 5FFMA 3VFDA 4B34A 1XCMA 4GPTA 2CHVA 1Q12A 3QUSA 4OHXA 4IDPA 3CO5A 4EJSC 3THXB 1D5CA 1YZQA 4DEXA 3IIMA 4TN1A 3NBYC 3BRWD 2G83A 4LCBA 4V0OA 4RKFA 1DARA 1BKDR 2HJVA 1M34E 3K0AA 1TTTA 1DAHA 3X1DA 3LBHA 1J99A 3D6TB 1N25A 2QUZA 4A6XA 5JEDA 1NIJA 2R6GA 4BQSA 3NBFA 3NH9A 3CX8A 1XTIA 1Z29A 3O8CA 4DSTA 5G3ZA 5IF9A 5KDLA 4B48A 2JLXA 1MH1A 3WP1B 1VMAA 2H18A 3PCRB 1KI7A 2OT3B 1V5WA 3TSWA 3EC1A 3HYTA 4QRHA 4TSFA 4CGZA 5FR2A 3MSXA 2C78A 3X1XA 2VP9A 1WQ1R 4HLCA 2EYQA 4LYAA 4P4TA 5DH9A 5ANRB 2O8BA 3C4JA 4URUR 4BEBA 2F43B 1U99A 1UDXA 3B1XA 4YMUA 2XZOA 2BJVA 3OIYA 4DSOA 3K53A 5EP4A 4DDVA 4YXWA 4P3YA 2GILA 3U3RA 3MGCA 4TL7A 4DLWA 4DUGA 1AA9A 3CF0A 5JI2E 5BQ5A 3I5XA 2FFBA 4NONA 1LV7A 4WIAA 3BFVA 5FI0B 3AGQA 3UWKA 5BN4A 1RPZA 4KXFB 1JPJA 4Z8XA 4XWOA 1OB2A 5G40A 4JLJA 3QPWA 1NN5A 4MRPA 4CEJB 4JLMA 1ZJ6A 5DYIA 3ZVMA 2PX3A 3FHTA 1TAGA 3CWZA 4DSUA 4TZ6A 4GI7A 1TEVA 1R7RA 2VH5R 3KQHA 2AK3A 2XITA 2NZJA 2OCAA 5H70A 4BFXA 2REOA 1E4YA 4KO8A 3Q3JB 3IKJA 1MABA 4YMSA 1X1SA 4JLVA 3NC1C 4C0HA 2AD1A 2ZITA 2DWQA 2C9CA 2WTUA 2J0UB 5EXSA 1KJWA 2G88A 3LBNA 3VKWA 2OAP1 2CHQA 4N3NA 2B8TA 4LGMA 3BB3A 3WRXC 2GTPA 3FMIA 1Q0UA 2GF0A 3MWJA 4PXAA 5DISB 2XB2A 2BEJA 2QGZA 2E87A 3R7WA 3SDZA 1S3SA 1OV4A 1TU3A 4TQ9A 5KSYA 1GZSA 1MO6A 2OCPA 4EPXA 3MWYW 3VX3A 4Q1FA 2ODNA 1G3QA 4EPYA 4Q18A 1AK2A 2J1LA 3AVUA 4URYR 5CJ2A 2A9KA 4LJ5A 2WWFA 1LS6A 4DLXA 1CJUC 1DOAA 4TL8A 3ZZTA 1FW6A 1HQCA 3PIRA 2JLWA 3KQKA 4BE7B 4TTQA 2MMGA 4EQ6A 3QPUA 4LSGA 1LY1A 1F5NA 4BZQA 2YYZA 4FMCB 3ZD6A 1GL7A 3DVLA 4HB2A 4UXJA 1S9DA 2GEUA 1SXJE 2H92A 1RRCA 4Q19A 1Y3AA 4DXAA 2QAJA 3PUWA 4Z54A 2GZDA 2QAGA 4Q01A 1KJZA 4H1VA 3CF6R 5KSOA 4UNPA 2PX0A 1Z2AA 2VIIA 4IRUB 1O3YA 5SZJA 5IK2A 3SI7A 1IJEA 3A58B 1TX4B 1CR4A 4OKSA 2FZ4A 1UM8A 2QPAA 3UPUA 1KI4A 5FPKA 4P4SA 1OXUA 4QL3A 1IJFA 4IXNA 1Z6AA 5FL7A 4PC1A 1E32A 3Q7QA 4LUCA 3QKSB 1YKSA 1XXHE 3WNBA 1E1QD 1OIXA 1QG4A 2ZYVX 4HB4A 2ZQ5A 2FA9A 4JVMA 4Q00A 4CVNA 2JIZD 2RHMA 2KJQA 3ADKA 2ZETA 4LI0A 1KAOA 3LDAA 3W6NA 3W6OA 1ZC3A 3EIEA 1DE0A 1E2FA 5JWRA 1NIPA 1OXXK 2QPTA 4KSBA 1HEIA 1KI1A 2F3TA 4NTZA 4F38A 3BIFA 4KYIB 3BOSA 1Z07A 2IYZA 4GP6A 4JBYA 4TT3A 1G8FA 2GVDC 2IXEA 3IIJA 4MA4A 2WBLC 4ARZA 1G3IA 2H7VA 2VYFA 1NY6A 1PLKA 4DBLC 1F2TB 3CX6A 4DCSA 3SNHA 1OT3A 3UXMA 3B60A 5E7IA 4DIDA 3K0EA 1YQTA 2QE7A 1YZKA 2VEDA 5H8WA 3EZ7A 2O0KA 1Z6YA 3QKUA 2VHCA 4L9WA 3QSYA 2J5XA 3X1WA 1MV5A 2IYLD 2VPPA 1P75A 4FCTA 4MUBA 1G8PA 2QQ0A 1KI6B 4G01B 1F60A 2C2HA 3UMRA 2FH5B 4KITB 4V02A 4RD2A 1DAKA 1ODFA 3HPQA 1G8GA 4RCZA 4US0R 2J9RA 1ZUNB 1Z5ZA 2IC5A 3MFYA 1P9NA 4CRWB 3K0FA 2VHTA 3UANA 1JR3E 2GAOA 2W2TA 4B33A 4V0LA 4GMDA 4D4LA 2AL7A 1PJRA 3L2OB 3U4QB 1R2QA 4NP6A 3EPLA 4LYFA 1M6NA 1TEXA 5AJWA 2V7QA 3WRYC 4Q4HB 3THWA 4XSGA 1XMVA 1R8SA 3AP2A 4PO1A 4AIIA 1CEEA 1VCIA 4IFBA 4MKHA 1TQ2A 1E0SA 4A15A 4PQRA 1D6JA 3NHAA 1KI9A 3I4LA 4L9SA 1VG8A 1Q20A 4WXRA 5KSPA 4NCNA 4EIWA 2O8CB 2NZ8A 1JXOA 1E2HA 3P26A 2PZEA 1NRJB 1EG7A 1ZC4A 4M4SA 1EFCA 1E9AA 2XSZD 3A6PC 4DLTA 4RFVA 4GRAA 4HAVA 4QNRA 2JLYA 2GA8A 3A1WA 4NMMA 4AYXA 4PHFA 3U44A 2OFXA 1SXJA 1TQ4A 5AUNB 4NYMQ 3FKQA 1VDZA 3GJ6A 4KLNA 2XOKA 2NQ2C 4TYPA 4BFZA 1XRJA 5KDDA 1KGDA 2JLSA 3CPJB 3GFTA 2I1QA 5KNBA 3IGFA 1ZU5A 3GQBA 1D9ZA 3GLHE 1AIPA 5F3WB 4TYNA 5F98A 1XTSA 2OFWA 3QF4A 2ZAMA 4Q47A 2NPIA 4D81A 1GRRA 1E69A 3W3ZB 2AHOA 2OBLA 5LD2C 3S1AA 4BFYA 4QGFA 3CZPA 1XXHA 5DI9A 1KK0A 1RE0A 4QGAA 2QROA 2A2ZA 4C0JA 4LZZA 2FSHA 4EJSB 3VHXA 1KMHA 1D2MA 2OBNA 3CRVA 3AUXA 3QIAA 5AJXA 2H1LA 1C1YA 1Z6GA 2P3SA 2QMEA 1AKEA 2YOFA 1XEWX 2P5SA 2ODBA 3VR6A 3SFZA 3Q8XB 3LXRA 1LNZA 1IM2A 4B47A 4IVRA 1G6OA 3SHFA 3FHCB 5GJBA 2AX4A 2QMOA 3IDQA 4C0SA 3KKMA 4Q9HA 4D82A 1E0KA 2Q3HA 1S9HA 1W4BA 2GJ8A 3MD0A 3DL0A 3VAAA 3LA6A 2FV8A 2G1JA 3DKVA 1WBBA 2FPKA 4TL6A 5GVRA 5L3QA 3L0PA 5AJYA 2ZS8A 1GRQA 2C95A 2WSSD 4E03A 5EZ5A 1UAAA 2AD5A 3CUEF 4FCWA 4JLNA 4LK2A 3KQLA 3JVVA 1ZBDA 2VHQA 1W7AA 4NYJR 1PLJA 1Z28A 5TXGA 2FSGA 1SHKA 5FPYA 2VTKA 4QM7A 3JZMA 1GSIA 2ZRPA 1DELA 3B82A 2D3WA 3PUXA 2FX3A 2W6ID 4ILEA 4NCKA 1UBGA 3M4YA 1G5TA 2KSQA 1L4YA 2RGXA 3GLIB 3EPJA 2GXSA 3TW4A 3TR5A 4B35A 4QGHA 4Q1CA 4KSCA 4A2WA 4B3XA 4DB2A 3RRZA 2BVNA 1OXTA 1JR3A 1W4RA 1VG9B 3HJNA 2RCNA 3SBDA 2J87A 4TYYA 3C15C 4G5RA 3AVYA 3KB1A 1KO8A 2JJ2D 4PFSA 4F92B 1TF5A 4HB3A 3R9WA 4BLRA 2IA5A 4ZIRB 2IWRA 2H5EA 2L0XA 3X2SA 2RGGA 2QPOA 4OHVA 1U0JA 2B92A 3U2QA 4PX9A 2FFQA 1DADA 1KI8A 1G8YA 4LHYA 1NVVR 3BC1A 4OYHA 5CYPA 3V4FA 5GJCA 5KTYA 4B74A 2HYDA 5HCIA 2NGRA 3MJRA 5FTKA 4KLZA 2IYRA 3GJ4A 1E96A 3CX7A 2CXXA 5C2JB 3TLXA 3BH7A 2PLRA 1IN7A 1XWIA 2QNRA 4I4LA 1UBCA 1W44A 4AD8A 4OK6A 1S8FA 2RGNC 2P0EA 2Q9BA 4D4MA 3KKQA 2H16A 3IEVA 4MGIR 4IOKA 3FGNA 1EWRA 2HCBA 2ZREA 3B1VA 1NKSA 3DKPA 2ZRHA 5DHAA 3I92A 3HYRA 3PR1A 4LC1A 5C46F 2IXFA 3U7EB 2CDNA 3LNCA 3BFXA 3GLHA 3VU9A 1CP2A 2O0JA 3T06B 2RGBA 3H4MA 4ZDIA 1KZ7B 2P5TB 5EE1A 1JXMA 4K8OA 1TU4A 1M7GA 3D8BA 1TQDA 2D62A 4X8OA 2IUSA 4A8JB 1U9IC 2P67A 5HKKD 2QY9A 4PANA 3CR8A 4RZXA 3GMTA 3BH6A 2JJ1D 1ZRHA 3ECCA 1AS3A 1UJ2A 4OQNA 4QHYA 1Z0KA 2EWWA 4NZYA 3THXA 4DEYA 2PT5A 1KKMA 2QT0A 3QKTA 2RKOA 3WMFA 4IDNA 1EFRD 4MKGA 1CBUA 2HJGA 4GP7A 4UJ3A 3KJHA 1M7BA 1NMZA 4PQYA 4Q1BA 1PVOA 2D74A 3I8XA 3DM5A 2BOVA 4UNNA 3W8NA 1XCGB 4ZI2A 4JL8A 4F4IA 1LB1B 2NMVA 5EXXA 3PVSA 4TMTA 4QJ3A 1RVDA 5HR5A 2ZRGA 1ZP6A 1VIYA 3NBZC 1KI2A 4FD2A 4WZAE 2ZVQX 1CJTC 4QBIA 3I61A 5JJLA 3SHWA 4IOLA 3AVWA 4NYIQ 5E7MA 4FMBB 2ZRDA 1G7CA 1Z0JA 3HDTA 1G41A 2WICA 2A30A 4CW7A 4UNSA 1TF2A 3NC0C 2RGNA 2WOJA 2F43A 3ADBA 4NDZA 1QBKC 4RVCA 5DI3A 2ZANA 1RZ3A 2LCFA 4TSFD 2EFGA 5HPYB 1UDWA 4GFDA 4X8LA 5JECA 1J70A 1X8KA 4YLGA 3HP1A 2ZSFA 4UNQA 4CEIB 1W36D 4PTLA 1ZD1A 4CEJA 3RNLA 4YXWD 3SQXA 1TF7A 1XD2B 1NBMA 4JJKA 3W6PA 1CS4C 4DUGD 5CJPA 421PA 3CKLA 2BV3A 2OXCA 3DOFA 5JJKA 4IEIA 4KBGA 1IBRA 2C9OA 2WIAA 3CPEA 4UQOA 3AF0A 3GJ3A 3CIOA 2DPXA 4MGYR 5BYJA 2QM7A 1E2KA 4M1YA 4M9SA 4TLBA 4LV5B 3RHFA 3C8UA 4BLTA 1LVGA 4D26A 1EFUA 2JATA 1E2EA 1DO0A 2OE2A 3EZ6A 4M1TA 3VQTA 2QBYB 2ZSDA 3EC2A 2J0UA 2JAQA 4Z1MA 2ONJA 2ZRLA 4B73A 1CRPA 1E1RA 1KYIA 4PZZA 1DAMA 4B75A 3IBYA 3OFNA 4KBFA 4TLAA 4Q48A 5FI1B 1N6OA 2NG1A 1EK0A 3RS7A 1MO3A 1WBDA 5J5CA 3LW7A 2SHKA 1L4UA 4ZDWA 3OIWA 4GDFA 3CB4A 3CH5A 4AI6A 3OZXA 2X19A 3BWDD 4HDCA 3SEAA 1NJFA 5KPDA 3RS2A 4ACAA 2A5YB 2QP3A 3N5CA 4MQBA 2MSDB 1X3SA 3ASYA 2AFHE 4C2UA 2BMEA 4HB0A 2BMFA 2FEMA 2FWRA 3SYLA 1FL9A 2ZRMA 2X2FA 4WOPA 1XCPA 3ETLA 3ZZ0A 3B85A 3AKYA 5CIQA 3R9IA 4PC7A 2O8EA 1T0JB 3B13B 4LX0A 2F55A 3HU3A 4P32A 4C4PA 3RSLA 1G8HA 3F0TA 4JL6A 1S2MA 4TZ0A 3CBQA 3FKSA 3CNOA 5FTJA 4XWKA 1N0WA 3EZ9A 4C7OA 3WYGA 4I81A 4AC9A 3LWNA 3B5JA 2EFCB 4PO8A 4BLOA 2HLDA 4EKDA 3QPVA 2ZU6A 4D0NA 1WMSA 5FUYA 4ESHA 5LD2B 1CU1A 1EWQA 2FPLA 1IN6A 3RSOA 3AF4A 4HAXA 1J90A 4RZ2A 1ZM9A 3VHLB 1E2MA 1NJGA 5L8VA 1KDPA 5UKDA 3U7GA 3QKSA 3BERA 4RKEA 2HXYA 5AR1A 1OB5A 2XEXA 4IOMA 3H84A 4B3DA 5L3SB 3GD7A 2J41A 1YHNA 4PPFA 1OW3B 2MMCA 5IK2D 4PC6A 2NOAA 4Q4AB 1W4AA 3ZYCA 5JFGA 2WJHA 2ZI6A 4R2HA 4URWR 5FL7D 2ZI5A 2IX3A 2J7KA 4Q9KA 3QG5A 2GEDA 3AVVA 2IEZA 2D4HA 4JVSB 3QKRA 1UPTA 1AZTA 4KV9A 4LPKA 4RFSB 1IOZA 2ZUDA 3W8RA 3PJRA 1AM4D 1BMFA 1LTQA 5SZIA 1HE8B 4QBHA 2GXUA 3FPAA 5G3YA 3U61B 2O5VA 5IDVA 5JRZA 1OHHA 2GKSA 1NMYA 4JKYA 4QG7A 2IF2A 1IHUA 3GEIA 2DWPA 2AKAB 4HSEA 1GIAA 2BCGY 1CJVC 4OJQA 2QP4A 4TT3D 5J4VA 1ZNZA 1ZD9A 3EASA 5FPTA 1FQJA 2OBMA 2BIFA 4DDWA 4CT5A 1KI6A 4Q7MB 5FUWA 4C9BA 5D3MA 4V0KA 1J2JA 1OFHA 2ODWA 2FDCA 3GLIE 4LBWA 2QE7D 4A92A 2XZLA 2ZYUX 1OXVA 2VP6A 3U7FB 3T12A 3QXSA 2A5GA 4M53A 4A36A 3A1SA 5IHPA 1G4UR 3KQNA 5DSZA 1KK3A 3QBVA 3U4QA 4IDHA 2VP2A 2G77B 2YV5A 4HLDA 3NXSA 3RC3A 1GOTA 4Q4HA 4RD3A 3I1FA 5M04A 4ZPXA 4NCJA 5BWMA 1E2DA 5AJVB 2P6RA 5EUMA 2ANBA 4MRRA 4DC9A 4MRVA 1FX0A 1DVRA 1QDEA 1AQUA 1UADA 4XIGS 1P2TA 5B58C 3AQ4A 4L16A 1RIFA 4TMXA 121PA 3LW8A 1GKYA 1QHIA 4D25A 2O8CA 2JA1A 1KK1A 2V7QD 3HPRA 1M1YE 4HDQB 4PR0A 4TMZA 1XPOA 2ECKA 1W5TA 1KAGA 2YZ2A 4U02A 5DIFA 2GXAA 2ZE5A 4Q5IA 1U94A 4B2IA 3CWQA 3H0KA 4FW9A 4M21A 2CMKA 1I4TD 3IQWA 1MO5A 1NLZA 2OXRA 1II8A 5EE3A 3CONA 4YMTA 1ETUA 2ZPTX 2MSCB 2UZIR 1ZAKA 4BRWA 3GPLA 1IXRC 1UBEA 4TLCA 3RVBA 3GJXC 3KQUA 3OEEA 1NG9A 1WDTA 4BZXA 4FN5A 6Q21A 4JVLA 2OEPA 3K09A 4QBGB 5FOXA 1SXJD 2EU8A 4PAMA 1WB9A 3OESA 4R2IA 2F1IA 4DCTA 5JHHB 2XOKD 3OEHA 1NVXQ 4XTCS 4EUNA 1SHZA 1S0UA 4HEJA 1G6HA 3E2IA 3TVTA 2KBFA 2YWHA 1G19A 3A4NA 4EJSA 1YJ5A 3TW8B 4L5BA 2CHGA 1P72A 2YC2C 3SFVA 3K8YA 4LJ8A 4IVPA 3TMKA 1Q22A 2AXPA 4JYBA 1NVWQ 3NG1A 2RGAA 4AKHA 2OV2A 2PL3A 2GK7A 1YR7A 5CDFA 1IY0A 2QTFA 4LRWA 2BEKA 1KDOA 2DFTA 2F1HA 1Z08A 1KDTA 1YZNA 4Q9JA 4DKXA 2WWIA 2XGJA 1C9KA 1PUJA 5L3RA 3AUYA 4GMXA 1KDRA 1XB2A 2V9PA 1P7CA 2CCJA 4PHGA 1T5LA 1F2UB 1U81A 1P61B 3B1WA 4JBWA 4M1WA 3WYFA 3BXZA 4OHWA 1GNRA 1JEDA 2WV9A 1NN0A 4DLZA 1VPLA 2YWFA 2CE2X 1N0UA 2ZRBA 3FTQA 2GJKA 3PQCA 1ZUHA 4L8GA 3LQQA 1I4DD 2YOGA 3E5HA 3AVXA 1US8B 4NHOA 4M9ZA 2B7BA 2ZEJA 4Q9LA 2J7PA 1UKVY 2GHIA 2ZS9A 3THYB 4Q02A 5SZKB 2HCJB 2IYTA 2CVFA 3SZRA 3T1QA 4DZZA 1GG2A 3H86A 4WA7A 1JAHA 4OI0A 4RY2A 1N5IA 4A8JC 1N2CE 1ONBA 1NNEA 3DHWC 1T6NA 2GBLC 2DBYA 2V55B 3AB3A 3OAAA 3WBJA 1MRNA 1CR2A 2RH5A 3IHLA 5CLLA 5FBLB 2A5DA 3NVAA 1E94E 1KTVA 1ZNYA 3TNFA 4ZIRA 2NO6A 4A2PA 4PHTA 3KX2A 4PSAA 4KCGA 4AYWA 1JR3D 3QNUA 3VNVA 1MR3F 4KI0A 3KUDA 4TYWA 2GRJA 2ORVA 3K9LA 4KVGA 1YR8A 3R20A 3KDSE 5AUQA 2IT1A 2W00A 1OH7A 5A4JA 4LY6A 5FR1A 1G7RA 4P0TA 5CYOA 2WWXA 2VF7A 2ZE8A 1JJVA 3IEUA 4JVNA 3EZFA 4LOAA 3ZJYA 4HUTA 4XVQA 2H57A 3TIFA 2CLCX 1GNPA 5HE8A 2FGKA 2QN6A 1RC8A 1HE1C 4JLBA 4GZMA 4LJAA 1Z8FA 4ZDKA 1IQPA 4OK3A 1ESMA 2V1XA 1VYTA 3MLEA 3QVUA 4JL5A 3EZ2A 3ZQJA 5AJZA 4KU4A 1RW4A 3AV0B 3F5FA 1K5DA 4YC7A 2HT1A 4QNMA 2W0MA 1JR6A 5J4HA 2DCUA 1O87A 1T4GA 3W90A 2A78A 4YMWA 4MYUA 1XMIA 1P6XA 1ZMXA 2IYWA 2HXSA 3WP0A 3U3JA 2G0TA 3DOEA 3TR0A 4YONB 3U3MA 2P6UA 1SVWA 4M22A 3QBTA 4FWTA 2QG6A 1Z6TA 3B2EA 2C9YA 1ESNA 1P3JA 3K1JA 3GJ0A 3KTAB 2EFDB 1NVUQ 4BLQA 1Z3IX 4A8JA 4JT4A 3LFUA 1ANKA 2J0QA 1G17A 2VA8A 1E2IA 1CIPA 4NBSA 3SR0A 1GDDA 3HWSA 4B2LA 1OYWA 2FFAA 4FI3C 5KU1A 2VQSA 1R10A 3LRPA 1N0VC 2F3RA 3ZS8A 1II9A 2W0SA 4JKIA 2XNDA 2J0VA 4CDGA 4JMPA 1GL6A 3F3YA 3B7GA 3OE7A 1E79A 1H65A 1VYVA 2F7SA 2JASA 4LWZA 5BN5A 3PEYA 1U8AA 3PEUA 3SJBA 4A2QA 2OZEA 4ON9A 4JJZA 5KYKA 4I1SA 4PSKA 3CRQA 1UKEA 1N5KA 1Z0DA 3LX8A 3PUYA 4P33A 1G21E 1FPMA 1E9FA 2ZJBA 3SC3A 4A0RA 4IEEA 3VTKA 2ZJ2A 3DDCA 4U00A 1DG3A 3GJ8A 4TL9A 4OBEA 1DG1G 4G5OA 3KXLA 4ACBA 3GJ5A 1KO1A 5JSZA 3T1VA 3TAUA 3W3AA 1RFLA 2KBEA 4PPGA 5DYGA 1HA3A 3IIKA 2A5JA 2IUTA 5CM8B 1IY2A 1LF0A 4LHZA 1XMJA 3GLGB 5EJEA 3VKHA 4NYMR 1ZM2A 3C7KA 1A82A 3ICEA 3L0OA 1QZXA 3CRRA 4ITRC 4CEIA 3SBEA 2P2LA 2CCKA 4QGGA 5C18A 3CH4B 4YDHB 1Q57A 1XD2A 3FMFA 3REFA 5KO2A 5FPSA 4ZI3A 2KE5A 2Z5FA 1XX6A 2ZTSA 4C3ZA 2WOOA 2Z83A 1N6LA 1GL9B 1NY5A 3LV8A 4PPQA 1G4AE 3TE6A 2WM9B 5FTLA 2LWIA 4PC3A 3KJIA 3CRMA 4YDSA 3R9XA 1S3GA 2D06A 3AVPA 3QEJA 4A0FA 1E0AA 4NH0A 1LS1A 1NBMD 3KZ1E 3T35A 1W48A 2QRZA 4CIDA 4NKRA 2OAQ1 2CNWA 1E2LA 2QBYA 1NL3A 2GESA 1XBTA 2ZI9A 4JS0A 2QORA 2IK8A 1E4VA 3AVQA 3TH5A 1SKQA 4O2LA 4MRSA 1BIFA 1Y63A 1R0WA 2FU5C 3B1ZA 3TQFA 4MYHA 3AVTA 3TUJC 4Z1MD 5K8UA 3Q5DA 1E1RD 1X86B 2GJSA 3AKCA 3RWMB 4DT1B 3U7HB 1M2OB 3OFND 1CR1A 4M1MA 1DBSA 4GOXA 3PG5A 2ZYTX 2AKYA 5HZKA 1NN3A 5TV2A 1XEFA 3RANA 5FBRB 4A82A 1P2UA 3BORA 4Q21A 1KZGB 1MABB 1SVSA 2QGNA 4XD7A 1FZQA 4AG5A 2EW1A 1UF9A 2ZI7A 3UG7A 4M8NE 1YZUA 4HYYA 4Q4JB 3R8CA 3I32A 2VP4A 2WWGA 1GP2A 3FYHA 2XXAB 3MUFA 2A7QA 1TL7C 2XNSA 4IDOA 2OCYC 1R5BA 4ABYA 4HUQA 2ZS7A 5HCNA 2DB3A 3VNUA 2D2FA 4B3GA 3FKSD 1E98A 2GJAA 4RD6A 3MJHA 3UATA 2CL7X 1IY1A 1CJKC 4B3BA 2RMKA 2QT1A 4G3XA 3NH6A 5LB2A 4LJYA 2VSOA 1KSJA 2ZRCA 2HLDD 2ZJAA 3NWJA 5L3SA 3U3KA 1C4OA 4Z51A 4IOJA 3RABA 5GADl 3DMDA 3VR4A 2QM8A 2YVUA 4BLSA 3SU8A 3U5ZB 1R5NA 2YWEA 4PSVA 3ZVNA 2B7CA 4AG6A 1HH4A 2GVZC 5EE9A 1B23P 5IRCD 4M0LA 3K70D 4RFSA 2QAGB 5GJWC 4JLDA 1U90A 3C5HA 4RJLA 1FP7A 4HATA 1T3SA 3MWKA 2NO1A 1ZNXA 3GEHA 3RS4A 1P73A 4I1OA 2Q3MA 3VR3A 2RB4A 4EFNA 4Q1EA 4LBYA 5FBQB 3W5IA 4P31A 4P4SB 5JLJA 3B1YA 3EIQA 2PJRA 2FG5A 3PITA 4JIMA 2CL0X 3SQWA 1X8LA 1A1VA 1T5IA 3CNNA 2W6JA 2EVWX 3KJGA 2FZLA 1BMFD 3LAWA 3GEEA 3LY5A 1JALA 2G3YA 2OESA 1E9SA 521PA 2OCBA 3HR7A 4MKIA 3QQ5A 3GLFB 3WYAA 5FUXA 1OHHD 2R44A 3A1UA 1S1CA 2ASEA
chains in the Genus database with same CATH superfamily
3RHTA 4TLDA 3DV0B 2IHBA 4I7EA 1QR6A 2CD7A 3WBKA 3N5KA 4C3UA 2I2XB 1KPHA 3HCOA 4H7HA 3BAFA 1CW2B 3QITA 1G7TA 1ZL2A 4BOYA 3KOXA 2JCSA 3HADA 4PHHA 1BCRB 2G71A 5TQ0B 2EQAA 1V16B 2YVKA 1P0FA 2G17A 2WFLA 1NONA 1IM8A 2OWDA 1T9AA 2XNJA 5HM6A 4U6QA 3IL2A 1FS4A 5ILQA 3GBVA 1R6XA 3C87A 3ICOA 4EHDA 3WSVA 4MRNA 4BX0A 3EUWA 2PT7A 4EJ6A 2QL6A 3KD3A 2QRNA 2G80A 3G2PA 3WR5A 2IHTA 1P7VA 3E2MA 1ZOIA 3Q7PA 2MJLA 3BPSA 4RD0A 3EPHA 4NBNA 3JQ8B 2CFCA 4MVJA 4YPFA 1GGVA 1HK7A 4FC6A 4ARIA 1RM4A 3MLAA 2VRCD 1CTQA 3N6VA 4LHEA 1DIAA 5HIKA 1ENYA 3UK7A 3RVOA 1I0LA 1OA1A 4OEHA 4HNUA 4NICA 2O8DB 2HJRA 1DTWA 1HYQA 5CK5A 2B8WA 2VJNA 2MSWA 3CLUD 1ULZA 2A6PA 3E6AA 3LVQE 4H0FA 4MQ5A 4YP9A 5LZ7A 3GT3A 4IM7A 4QYXA 1O5TA 4INPA 1IJKA 3VV2A 3KTDA 3GYBA 4FYPA 5LOVA 1ZNWA 4Q9NA 3N0VA 1VLQA 3OJEA 2SCUB 4QTTB 4D8UA 4IDCA 4H4CA 4FDUA 4MYTA 2PCLA 3O4RA 4OKNA 3F6EX 2DWOA 2QE6A 3LHSA 3P2EA 4R9VA 1I5EA 1RR6A 5JH7F 3R3SA 1OTHA 1TK2A 1LNQA 4UBJA 3D59A 4AKSA 3H3FA 3FPSA 2VXBA 4P4UA 3SQLA 2FMUA 1O58A 3P9KA 4HQKA 3IT1A 4POAA 4J6EA 3I53A 3QWHA 4D8YA 3LUGA 5ARBA 1PJSA 2Q0SA 1CB7A 3W9BA 4MJ7A 3C1OA 2ZWOA 3R6DA 2ROQA 3PWZA 3GMSA 1Z8DA 1DWOA 4LV6A 4UHEA 4X8MA 4G5GA 5DFAA 3HB9A 13PKA 1VLMA 3OIFA 4PS1A 5FORA 4TS9A 4WW0A 3TLBA 4B3TB 1C5KA 1CQJA 3OEED 4K9QA 4PRYA 1LPSA 3MS4A 1UBKS 2G7MC 3PEFA 2OXEA 4J75A 1EB9A 3FNIA 1P8JA 1WHTB 3MHPA 3ZC3A 2BHNA 1JKJB 2A35A 4C76A 3HMQA 3GQVA 1I4EB 1GFIA 3TZHA 2GYWA 2BBOA 3DL4A 1FJGB 2J3IA 2E3JA 1EVLA 4NJOA 1MNAA 1QP8A 4OGLA 1D4FA 1U0BB 3C6MA 4EEZA 3TUZC 3CC8A 3LCRA 3Q0IA 1KSGA 1EIWA 1G16A 4E07A 4JB8A 3UM9A 1I7PA 4EY4A 1R6AA 3U6KA 1JTFA 2YTZA 1FC0A 2RCYA 3Q72A 4GT1A 5G0TA 1VYUA 2GNOA 3EPKA 4OBXA 1V7CA 5MN5A 2EF0A 2BKLA 1EM8A 3IR6A 3FFTA 2X76A 1U8XX 3P9RA 2X1VA 1NSFA 4V39A 1SCBA 4MWGA 4N6GA 1PIWA 4OSEA 3GGCA 4IDDA 4W5HA 3W7AA 2JKVA 4JZYA 5EWMA 2QYTA 4ZVTA 1UMKA 4R8LA 5DLQC 4E15A 1RYHA 3IQZA 3HM9A 3H2JA 4DG8A 1P0PA 4E2ZA 1JHXA 2FQQA 2IVFA 1US8A 4U2GA 3S99A 3IPXA 2RFLA 2CBZA 1G2QA 5LJLA 1NTOA 3EWAA 4HTFB 5TE9A 4O2BA 3F8SA 1RRPA 4MAAA 4KE6A 4CLHA 1IMJA 1NUSA 1G18A 1S4QA 2E0IA 2ZP1A 3FB1A 4OQLA 4HV4A 1K7YA 1M0TA 2J8ZA 3VHRA 3ITDA 3RVNA 3CLSC 2CXNA 3F4KA 3T9DA 5I01A 2WM3A 4HYEA 3KV1A 2CB0A 4LHVA 1O0SA 4ARVA 3ICPA 1LBIA 3FW1A 3O82A 5JW6A 3IE1A 5IZCA 4BB0A 2IOFK 2J7PD 3K0HA 2JIBA 4BS9A 1ODKA 3ETHA 2VNIA 2AN5A 3UAWA 4A8HA 4HQFA 1F8UA 2I87A 4K7JA 3GCXA 1Q1GA 3KJZA 1KJQA 3WOVA 1EVIA 2BFWA 3ILVA 2YC4C 1ULSA 3KOMA 2O1XA 1R8QA 2W2XA 4AUKA 3FHOA 3UTDA 3VJLA 2OM6A 1PQ4A 4LOKA 3KXIA 1CZHA 1Y48E 1X19A 4D0RA 4CMCA 1M6HA 1XTPA 2FW6A 2B5OA 3OU2A 1L8QA 2X0IA 4X7RA 5DGXA 5DNVA 4QUAA 5DN6A 3UOGA 3L4BC 5IBCA 3LXUX 4FEGA 4R40A 3HXMA 1Y4SA 4OOEA 2DFKB 4E3ZA 4JBLA 3CNEA 1QE0A 4HMOA 4DIEA 1Y6JA 1WABA 2QLBA 3GEDA 4OP2A 1P80A 1G7SA 2J3EA 3K73O 5ENDA 4MINA 3RJMA 2OB2A 1E2QA 4Y9SA 1MNQA 2R00A 3LU1A 4CTMA 1PT5A 2PD4A 2G1KA 2XB4A 7REQA 1W46A 2JDIA 1FS5A 4QUKA 3ZHCA 2BH9A 2C4TA 2R85A 1KTIA 3NATA 1GU1A 2F67A 4FMDF 1T8PA 1F2TA 2BMDA 2OO7A 4HJRA 5IN5A 2FZCA 1XC7A 2EBWA 2PWYA 3IAFA 4GDMA 5FO1A 5J5VA 2DKOA 1GGMA 1NTRA 1L4GA 2FEOA 2PKQP 3JVUA 4Q3EA 4WL0A 3SS8A 3TVYA 3AY3A 1FMTA 3W1WA 4AZ0B 3M4NA 5EE0A 2JBAA 1QG2A 4EMUA 5CYGA 4TUYB 2P7IA 4CT4B 1M83A 1YJCA 3FDIA 3NPMA 4MB0A 4US1R 4PAQA 2EBHX 4TWBA 3W5VA 1OFUX 3PEVA 1TUBB 4QQKA 3LCCA 5DTMA 3U26A 4A5OA 4AUMA 2WEKA 3DFIA 1IOLA 4I4CA 4OKIA 1GAEO 3G5TA 3GJ7A 4RTLA 1RJGA 4BNIA 1MOQA 1Q1ZA 4EUEA 4A4DA 2O8VA 1I7SB 1MO4A 3L6BA 1FTSA 5AXAA 1E2BA 4M0MA 4RHCA 1SPBS 4WXYB 1YS7A 3QX8A 1UINA 1JMKC 5A3RA 2F1JA 3OPMA 4EAQA 4OHKA 3AF3A 1CUJA 1NLFA 1M66A 1XTVA 1JJ7A 4Z8YA 1D2NA 2HEIA 3C41J 4XPIA 4ZKEA 2NSDA 3UK0A 1YNSA 1ZXBA 1PFKA 4HAZA 3DLAA 1TADA 4H60A 1UFVA 2ZQYA 3ANSA 3CBGA 4CKZA 4AB1A 5DBOA 1E2PA 4XRGA 4IMIB 5BUQA 3NR2A 5JS8A 1Z0AA 5CXUA 1H05A 2YWCA 3BM5A 2H2GA 3V34A 1Z8HA 3SPXA 3UAZA 5BMVB 2WB2A 3C3AA 4KQJA 5F9MA 3PNVA 4MROA 4K5QA 1EK5A 1NE2A 1SHUX 2DUWA 2HX1A 2ZDQA 3PF9A 2H0AA 2VDWB 4LDPA 5KS2A 2B21A 2RGDA 4DJTA 3EXEB 3KEOA 4V0MA 5AUPB 4CT0A 4BTLA 3JQAA 4TLEA 1XCJA 5FB3A 3OTWA 5G53C 4ARAA 1E3IA 1P3DA 1AS0A 1RLMA 2VXOA 3PWSA 1FDUA 4FFLA 4EGFA 1NP6A 2ZATA 4YR7A 4JXXA 4GVLA 3PUKA 2V8BA 3OQBA 4UUAA 5ALPA 1DJQA 3T7EA 3TUIC 2XMZA 3ASUA 3TTVA 1IHYA 3AFMA 3HEBA 4F3YA 2Q1XA 4M1SA 3L93A 3FPLA 1DPFA 4L5AA 1H2WA 3QUQA 5AWFC 1WKBA 2HV8A 3TBKA 1TD9A 2PYIA 4LISA 2ZSAA 2VJOA 2PSHA 4O4JA 5JYDA 5DCUA 5FOTA 1BA3A 2P6NA 3H1AA 4BASA 3U0VA 2MSLA 1T6XA 4QXQA 4RNDB 2C7GA 2XRYA 1RWMA 1YB7A 4F56A 3RS5A 1I3CA 3DB1A 1ABEA 4IIHA 2JH9A 1TMKA 3FCCA 4UUMA 4IGKA 5LYJF 1UK6A 2DTDA 3AZQA 3KE8A 3BULA 5M2QA 3HG7A 3K9HA 4CKYA 3C8MA 2GDJA 5D85A 3OPYI 4M9QA 2UUAB 5E2BA 1YZVA 2P62A 3ZLUA 4TS4A 3LKDA 5JBIA 2DXIA 2FDXA 5EP3A 5EP1A 1J0EA 3BGSA 4OLFA 5DGIA 1KQGA 1SUEA 3WQHA 4HAIA 1ZH2A 2FMTA 2VOEA 3AO0B 4U0JA 3DFKA 1GUDA 1Q16A 3D8SA 1C81A 2GAFA 2PCJA 4ESVA 2I7VA 4BO4A 4BGDA 2EGGA 4MDYA 5E95A 3ZHOA 5I7RA 1VHLA 4WAUA 4CG1A 4KPYA 2QRUA 3IPCA 4RXUA 5JZVA 3O73A 4RMGA 3GDFA 5CX1A 1IU9A 3O92A 4AZ3A 2D1QA 3TDMA 1JGTA 5F1PA 2LBPA 3ROTA 3BL5A 2J5QA 2IY7A 3MT9A 3PIDA 1IXYA 3SE0A 3ROQA 3WGMA 5DSXA 5A3QA 4FZJA 1F4LA 1M2OA 3V1YA 3OJFA 4EG3A 2FPUA 2Q9AA 2ZJ1A 3F8WA 1X7ZA 5E4FA 1TI7A 3P2MA 1HYGA 1PJ3A 3NGXA 5LVAA 3KSZO 4UD2A 3TN7A 2PQ0A 2VFAA 1XTJA 2WKQA 1NNUA 3WQBA 3O8DA 4W5JA 3ZU6A 1E3WB 5EFZA 4F3KA 2H0RA 3DWFA 3BK2A 4RKYA 3F9CA 1REQB 3B6KA 3TKLA 4EY8A 4NU5A 3NIFB 5AVXA 1A96A 1MN6A 1NQWA 2Q21A 1PHPA 3HU2A 1VCOA 3QWAA 4MKZA 1TUEA 4KR6A 1LJUA 1MD9A 4Q4JA 3R5HA 1GSAA 2XZDA 2VO1A 3PHLA 5FULA 2PU5A 1N7HA 2X6RA 3ENKA 4M0UA 4Y3UA 3ZWOA 1I7QB 4CTNA 4NCIA 2ZUVA 4RH1A 2PGAA 4RL6A 2D5AA 2ERYA 1J22A 4FIZA 3R75A 1GZ4A 3H42B 1H2EA 3DVSX 1JKMA 1M2FA 4Q9IA 3RAFC 3Q8LA 3QXJA 3PYXA 4XVRA 3COJA 2C8VA 1FDRA 5GP1A 1EFDN 821PA 4O8ZA 4OLJA 1RJDA 2OLJA 1LFDB 1KPGA 4H7IA 3VR5A 3GRYA 1D3AA 2QUBA 4I9NA 4F5YA 5KUTA 1YQ9A 4YYEA 3KJXA 1LPMA 4OYYA 4W7SA 1FMCA 3H4TA 4MUGA 2JCVA 2WJAA 1QCYA 2ZIXB 2IKSA 3AETB 1Z4OA 1G8SA 3PF8A 4NIMA 4WV3A 5D01A 5FYQA 2HQRA 1PG5A 5JAOA 2C88A 2HCFA 3IYLW 4ITUA 3A8TA 4D4KA 1GQOA 4Y6RA 1A2BA 1E5DA 1GFSA 1K5PA 3H5IA 5T6MA 4L4SA 3TRIA 4GSYA 4U5XA 2DBVO 4JP8A 3NVKI 1Z25A 2I66A 5CP8A 1OLXA 5EWLA 1P0QA 4M0CA 1R66A 1AGRA 1JT9A 3KFLA 1U6IA 3CU5A 1MFZA 3BCHA 3KHKA 2SNIE 3DVRX 4CZ2A 5HGXA 1Q7GA 1OWOA 1MBZA 3SNKA 3OSUA 4ZAVA 3X1ZA 4F2WA 2I6XA 4M99A 2EL9A 3WHKA 3V9PA 2OA0A 1ZIDA 1T3ZA 2V54A 1OH5A 1MOSA 2Y9PB 4DTCA 1GUZA 2P1RA 3ZGOA 4DQKA 5JADA 5LM3A 3EYWA 5JCPA 4U4AA 1Q1EA 4NE2A 3AFGA 2FZGA 3VO2A 1J7JA 3F3MA 3NHMA 4GXQA 2WKSA 3QV2A 1GZDA 2P8JA 3GFPA 4GPBA 4JSTA 1XAJA 1WB9A 1YGYA 3I9NA 4XJXA 1J8YF 3QENA 1MO2A 1ZN7A 4U7JA 2XBMA 5HP4A 3RODA 3U4CA 3MN1A 5TGDA 3F2VA 3T38A 4MUXA 2NZXA 2WPDA 2ZTUA 3FH0A 4AUEA 2IH2A 1W0CA 1J42A 1O94D 1XA3A 1SC4A 1XVLA 2ILTA 1J0AA 2OPBA 4A26A 1ZAYA 1MJGA 3V7WA 5JH7B 1PGJA 2WWHA 3FR8A 2BZ0A 2C99A 3RIGA 3TRKA 2F3UA 3L0IB 3L7YA 3V00A 4LV8B 3EGCA 4N3AA 4PSDA 3VBCA 1H69A 3GLUA 2GBCA 3COSA 1USWA 1WMEA 3EY9A 1DBVO 3N70A 4GLOA 1XHLA 4TQUS 5COAA 4BUJA 1BE8A 2YMQA 3A2KA 4QQ8A 2QTVB 5IAEA 3W5CA 1DRUA 3PUZA 4HBZA 1F51E 4C06A 4GGMX 4ND5A 3LVRE 1GR0A 1TQ6A 4RPIA 5TY0A 3FLMA 4MO9A 3TAXA 3NNNA 1RHRA 2CK3D 1H2FA 2WG0A 3AUAA 3GEMA 1NXQA 4O0MA 4YB8A 3UMSA 3USCS 4GX1A 4KQWA 1RBMA 4NAHA 1NRXA 1MORA 2GOYA 1U8YA 4EY5A 8AT1A 4QAQA 5JNTA 1UFQA 2RHBA 4RYLA 5FP0A 3OF2A 4G5FA 4YNBA 1QYRA 1LRJA 1ZIOA 1U1DA 3NP7A 3H1EA 1QS0B 1GQQA 1VIAA 3UG6A 1T1GA 3SSAA 3WWOA 4DILA 5KWIA 4Z4IA 2ZBFA 4HZIA 3B89A 5EHZA 1GRNA 1OOEA 5LDGA 3K2BA 1TTQB 2J4FA 3D4OA 3DL2A 4JP2A 4WZBB 2KPOA 4MUEA 1GUFA 3I0MA 4TMVA 2ZUEA 5CW1A 2O8FA 4B32A 1C30B 2K4MA 3HM2A 4XX0B 2P65A 5FFFA 4BJ5A 3B8HA 3D6NB 4JH0A 2BBWA 4H7KA 4L57A 1GV0A 2B83A 1FX0B 5JHGB 4CXMA 4A9AA 1XFAA 5DYYA 3WLQA 2FHPA 4YJ3F 5DT2A 1EVYA 4B3HA 4CEHA 1BZYA 4Z3DA 4ZCMA 1CFJA 2HJSA 2O0HA 2VT2A 4G5HA 3CLTD 1GVNB 2CV0A 2ZJ8A 2V8OA 3GJYA 5AHOA 3UK6A 1WXQA 1COZA 2QTAA 1ODIA 5F2KA 4RTPA 3ES9A 1GZ6A 4PO9A 4AVYA 3PD1A 3NEYA 1T10A 1XQYA 1PNVA 4DR6B 3FZNA 1SZPA 5EUBA 5FBVB 2GNPA 4O5OA 3D8NA 2YQ4A 5F7OA 3ASZA 4DSNA 5GM2A 1BS1A 4KXYA 5C8VA 1B4DA 2D1FA 2XYPA 1YOVA 3O5AA 2RIRA 1E9CA 4QVKA 4UVDA 5TR9A 3AHFA 1T8YA 1Z12A 1DT5A 1JIUA 1W88A 1UFOA 1F1JA 3U3ZA 1MRZA 4J1TC 4QICA 4A1FA 4MI9A 1ZVVA 3WLAA 3UH1A 2WYUA 4TKVB 1T6ZA 1U7UA 5A05A 5BN4B 3HVJA 2R8EA 1XNHA 3HJGA 3L79A 2J08A 5CH8A 4EENA 4RMJA 1YVRA 2PZGA 4YO8A 4HNVA 4MS4A 3E22B 1ZDMA 3FNGA 1ZYUA 2FKAA 4PGGA 5DULA 4Q93A 3ZX4A 5B7QA 6REQB 5LMZA 2P9ZA 4DSZA 4JUFA 2YOHA 1DEKA 1B0AA 4JXKA 4X7BA 5LCXA 5IABA 2BSXA 3H1TA 3BA6A 1KMNA 4CFYA 1H1DA 1S2GA 1TYZA 3VMFA 2VWHA 3ZHVA 1NVEA 5A71A 3W5BA 1CF4A 1XVAA 1L7EA 1COWD 1SKYB 2JFPA 4FN4A 4ZGWA 2AA3A 2O5EA 3VR2D 1VTKA 2ACVA 2CB9A 3LO8A 2B61A 2DHEA 5AKXA 1LI5A 1MGOA 3RBAA 4BFSA 1L8AA 4AY2A 3OBIA 2RHLA 3RWOA 1BXRA 1NKVA 4MUJA 3STUA 5LQAA 1KEZA 2PVPA 2DJ5A 1QB7A 2HQOA 2CN1A 3P27A 1T34A 2W2KA 4BMXA 1MKYA 1S7CA 1T9BA 5FAXA 4C2UA 1NF3A 1O5OA 2Z1NA 1JS1X 1N34B 3EDQA 4Q1DA 3WK8A 2ORIA 2QD1A 3R3JA 1S2OA 5AOAA 3UV6A 4MAMA 1Q3TA 4WLOA 3LUDA 3NLLA 1QVAA 3HABA 4UM7A 4EZIA 3EF3A 2ERCA 4Z7QB 1JKIA 2IHJA 2OZPA 3OZCA 3R7WB 4WKGA 5REQB 2QUIA 4FMDB 5LQDA 5D7BA 5TMPA 4JP3A 4B6PA 2PL5A 3DP7A 4R16A 2OFFA 4D0SA 2IIVA 3ZUPA 3RDPA 2OQVA 5ICGA 5DEIA 4CBVA 1E0JA 1B2LA 1RLOA 3QTLA 3IKVA 4GP9A 3DZFA 2PXXA 3JTMA 4QBFA 3OM9A 4EW3A 4FDVA 2QF7A 5BQ3A 3KO8A 1NQTA 4W82A 4RD4A 1GZ7A 3COYA 1I2CA 4MUHA 4PZ9A 1TA0A 3P9XA 5LQJA 4D74A 4WY8A 1BFUA 1RHMA 4REQA 4FPXA 3WWZA 4FNOA 1SIWA 2CFOA 1F06A 2JD2A 4EMTA 1Y8RA 3DP9A 3EF1A 1BO6A 3PXGA 3HNOA 3NWEA 2FLKA 2ZBPA 5FTMA 2VJLA 5JC8A 1A9ZA 2VHUA 2PXHA 2FSIA 4GZ5A 1E1QA 1XD8A 4MQLA 5F78A 4BEWA 2I80A 4HEQA 4Q6BA 4FYXA 5FI5A 4HDKB 3F97A 1UZLA 1PK8A 2VZ0A 4KXLA 2NT4A 1QPBA 1MHPA 1R3UA 3PV0A 4QZVA 1ST3A 1TEZA 1O96B 4JBNA 4LTNA 4JGGA 5JANA 1E1YA 4ZVNA 1TGVA 4INOA 1ZHHA 5IWCA 1OV6A 2OUKA 3NYIA 5FUVA 1L7VC 3G6WA 3QF7A 4KPEC 1HQKA 1MU0A 3NM5A 3QKWA 4RLHA 1YHYA 3KFXA 3MCWA 4I9HA 4YV7A 1U98A 4HT3B 5CFZA 5GOTA 3WGIA 1KDYA 3L7OA 4NBTA 1U2TA 2P27A 3H9JA 3T6KA 2JD1A 2IIPA 1ADCA 3WQSB 3ND8A 1U8EA 4JYCA 4IIEA 1LPBB 5DHRA 4ZCSA 1DJPA 4LZOA 3T9FA 2N46A 3C3BA 4DUYB 2R6FA 3OOYA 2ZVPX 1XYYA 4QUHA 3HU1A 2HRQA 4GE3A 5JR3A 1R0ZA 2NIPA 3BXPA 3TNJA 3S2SA 4MS3A 2G9NA 1H8HD 3QE4A 1DBRA 4HBGA 1V0JA 4GM0A 3ZIAD 4BLWA 4GPD1 2ONKA 5LWHA 2C7RA 1RAIA 3GFBA 5D7NA 2E1RA 1U28C 5IC6A 5I7SA 3Q9SA 4CYMA 3LX5A 1LVUA 4JUBA 1ORWA 1DLIA 5AKYA 3DBVO 4UM9B 1EP2B 2ZRNA 4P3OA 3RUEA 1XU9A 5CR9A 4WBSA 2Y4OA 2E4YA 3FF1A 4JC4A 1N1MA 1C41A 1CZOA 4NQRA 1V3TA 2PL1A 3KKLA 2DHRA 4QREA 2XTNA 4XLZA 3WKAA 4CPDA 4CKEA 2R7AA 1XEXA 3GL9A 3FYCA 1B2RA 1BYIA 1XA0A 4MR7B 4E5KA 3G9UA 3O4IA 3OZVA 3OLZA 3DWEX 1EK2A 3WWYA 1XKLA 3QXCA 2MINB 4MI6A 1S8OA 1KFCB 4KFTA 4BLPA 3BSFA 5FOUA 2AJDA 3NASA 2CHUA 4BBJA 2GARA 1ZI8A 1QK4A 1YMUA 1ZR2A 4HAUA 3WZMA 3KL4A 4YJ2A 3UPTA 3AUUA 2QX8A 4L8YA 2Y1CA 5KAMA 1T26A 4TXJA 5HZHA 3KPUA 3LDHA 2BGGA 2R6CA 5GIOE 3FNEA 1ZGGA 1OF1A 4HLUC 2IS1A 3OLXA 1II0A 3N39C 1KQPA 3NVMB 4C03A 1V5IA 1SIOA 1TKBA 3KXPA 3X1YA 5CVCA 1YONA 3D3QA 1AHNA 5CDGA 1J0DA 2GWHA 1SFRA 2HAEA 3TDKA 3Q5EA 1VJ1A 4LJ4A 5DM60 1G2IA 4NI5A 5ALIA 2JFNA 4ALMA 1IBLB 1G3UA 2DM6A 4R84A 1D8TA 2VHJA 3EOAI 4RDXA 2R1TB 3HCAA 4LWQA 3AEUA 2I6UA 3D7KA 4KVZA 4TMWA 1M75A 1TQHA 1GPBA 2C3OA 2XUAA 4RV5A 3TJMA 4B4OA 3GZ4A 2QSZA 3DUFB 2FW9A 1SXJB 2GSDA 1XTBA 2QD2A 4HS4A 4YIHA 5LDDC 3T3IA 4JJ4A 2QQ5A 1W9MA 1JQDA 4KK4A 4UAJA 4WJKB 4BNNA 2D5CA 4M1KA 1VG1A 3FB4A 4D44A 3HHPA 3JQBC 4LF6B 1R6BX 2H65A 5DV9A 1QSGA 2Q8PA 1WKCA 2CLIB 2R1VA 3COWA 4HPXB 5KEIA 4RHYA 1I1QB 2VVTA 3EH2A 4MO2A 1IZ8A 5DXFA 4MITA 3WWPA 2FSSA 1OLOA 1KEEA 1Y1RA 2VYVA 2WD7A 4WOKA 3TEJA 5CT9A 2QA5A 1UBOS 1XXHB 3U19A 3UJNA 5CT5A 2EZ4A 1RSZA 4ZOCA 1YQQA 2ZTMA 1KO4A 1G2OA 3O9VA 3V1KA 1UQTA 2QNBA 3P4UA 3ZCUA 2OLEA 3M5WA 4R2LA 4F2DA 3TS1A 1MJHA 2EZUA 3LHFA 2IY8A 3WI7A 3K70C 1L7DA 4AX4A 4YAWA 2HF8A 1NFQA 3VI4B 2E4WA 1VLHA 1QYIA 1VJ5A 2CLSA 3AXSA 4KPUA 3UFBA 5C51B 4WZBE 2JIRA 3TAHA 1NJ2A 4O4JF 5AHKA 4DKJA 2X9NA 3DAHA 3EJWA 4RHUA 1I6WA 3HCDA 3UY4A 2UKDA 4FSDA 3CTPA 2Q1TA 1GL3A 1E6KA 1QHFA 1Z2OX 4E94A 4MUMA 4QJIA 2NM0A 4S2UA 1NXPA 3PR2B 4EHAA 3DEHA 4IDQA 4UQPA 2PQ2A 4QUEA 4YJGB 1MOPA 5IJAA 2W6IA 5F73A 3SOPA 2Y0DA 5F1YA 2BZGA 2ONCA 3DBHB 3KVNA 3FPBA 3ZKAA 3JATA 1SMKA 1XLUA 4YRBA 4K3UA 1C9EA 4UJ5A 3I52A 4PIMA 3EW7A 3QU7A 1Z3CA 2FPGB 4IW3B 1UWKA 5JNSA 3IBGA 1B0PA 4C14A 1GLNA 3RSFA 3B12A 4MV3A 1XDBA 3NWOA 5BQOA 3RJZA 4KDRA 4XTRA 3TXAA 4ES6A 2V7UA 2FPWA 4JJFA 4M9RA 2J59A 5TGTA 3K96A 1JQ3A 4K40A 4N18A 1BJTA 2JJ2A 4NU0A 5KQMA 1RKVA 1AD2A 4MK4A 4BQOA 4EPRA 1O95C 2JL1A 4WH0A 3RC2A 5IYZA 4L0QA 5DX0A 2DG2A 2ZXUA 3A25A 1XOIA 4DQDA 1B26A 2XE4A 3K8QA 1P5ZB 2ODEA 2PX4A 5I3ZA 1W0KD 4KMOA 5K0TA 2I2WA 1VMKA 2ZM6B 3ER9A 1LQ2A 1QGUA 1Q7EA 4P7GA 1L5FA 3OEWA 1NYTA 2GZHA 2P8SA 2VYCA 3HCCA 4UUOA 1BRTA 3QJYA 3RRYA 1UL1X 3W5SA 1EZ1A 1RXSA 1Z0UA 3SXUA 1PHRA 1DEHA 3BIXA 2A1IA 3BSYA 4OSOA 4P4LA 4RZSA 3SBOA 3HLYA 4BKQA 3L9WA 4ZZ1A 4YIKA 4M36A 2B1RA 4C43A 1W0JD 1CY2A 4O1HA 3HXOA 3JASA 5JJ5A 2BC9A 2W22A 3E4DA 4G0OA 4RWZA 3D2AA 1DMRA 3NEAA 4L72A 4OSPA 3AJ9A 3O47A 1SKYE 3S1SA 4L95C 2PZFA 1EGAA 2I9PA 2Z4TA 3CWCA 3CZQA 3FSGA 4CIAA 3SF8B 1A2KC 2A84A 1J1IA 1EFLA 2VZEA 1YBHA 4NZ9A 5F5XA 3DT8A 4G1FA 1J1UA 1R3DA 3A2MA 4HH4A 1T9GR 3TVDA 1E9EA 4DR1B 2IWHA 1E3QA 3FKJA 4GHWA 3F96A 5LZ5A 2HJHA 3E1KA 4F4HA 4MVJM 5CLFA 4I6GA 1YRQA 2D2XA 2Q2OA 3JQDA 3MRSA 4L75A 2C7PA 1OAOA 3B9QA 5KYVA 1Y1TA 1F1BA 3H17A 4ZOEA 4LZJA 4MQFB 2JLZA 1P3Y1 2JC3A 1D1PA 3FAZA 1RYEA 2H11A 3EVTA 3FVRA 4UZEA 4W1PA 3V8QA 3HWRA 4D9FA 4GM1A 4J0QA 2XZPA 5HK9A 1C3VA 1IB6A 4J4HA 4N1AA 4AY4A 4BL5A 1BQEA 2ARKA 5L51A 5KZMB 1R8JA 2YIMA 2F1KA 2JJ1A 4MR9A 2WSBA 1NVBA 1M8PA 4YJ3B 1ZUWA 3U56A 1G5PA 3BIOA 3EOBI 1TD1A 4YAJA 4EGCB 2WUDA 5CRIA 1X42A 1PLLA 4JCOA 4IDFA 1YJXA 3IMEA 3M6MD 3NHBA 3N3AC 3L4BA 4MH0R 4H18A 2R8BA 1QIGA 2XCUA 4CKWA 4H1HA 3WSTA 2DVMA 2N47A 4K6OA 1UDRA 1VA4A 2IV7A 1QM5A 1T8SA 1A27A 1B0ZA 4IDPA 3M49A 4EJSC 4WFJA 2WFLB 1QG6A 3O03A 4DEXA 1NQUA 1T29A 2H0QA 4RJ2A 2HMSA 3VZCA 1DGQA 2IY9A 4V0OA 1C1HA 4GICA 3DTVD 4XVCA 4BKRA 4PNZA 3IMGA 1DAHA 3C6BA 3PFCA 2O54A 3PTZA 1UCFA 4DIMA 3BILA 5IVIA 1X94A 2C5EA 4G4JA 2AQ8A 1JMVA 1X1AA 4NFSA 3VZDA 3PHGA 2QVLA 3W2TA 4ND6A 2LUOA 4LQDA 4CF6A 3A6KA 1GN9A 5G3ZA 4HXEB 3I37X 1F7VA 4RLFA 4B48A 4PWZA 2PPVA 1QC5A 1DRVA 1VP9A 1S2IA 2CVOA 1U0OC 3PCRB 1JLLA 1YZ3A 2Y05A 2X9GA 3FCXA 2VJPA 1WIWA 4TSFA 4CM5A 4D3SA 3PC2A 4DWOA 3N76A 3GRFA 3OP4A 2AKEA 1JLSA 3X1XA 2VP9A 2BL4A 3QUCA 1I3LA 4V38A 5DH9A 2A88A 1E4EA 4A3SA 1N2JA 5ANRB 4RVHA 4URUR 2JLVA 1EGVB 1I2ZA 1J8VA 5IAKA 4ANFA 4EGSA 2PWZA 2IGTA 5B55A 4DQLA 1ISPA 2CZGA 4OPMA 1CUSA 2BJVA 4TXMA 4BMDA 3KR1A 2Z9DA 3K53A 2BFEA 3PHBE 1M9NA 3MRVA 1TJPB 1QANA 2WZCA 1ZJZA 4UTVA 1KEVA 3PXDA 3VZSA 3ZNQA 4ARUA 1ORHA 1U7DA 5C1OA 2GSWA 5KNBH 2P5YA 3SM9A 4NONA 4NBVA 2I71A 2VSYA 5FI0B 4C4SA 10MHA 4MV5A 2AC2A 4XWOA 2IV2X 2C0CA 1OB2A 3ZJTA 1NN5A 2XVAA 3PE6A 3Q6MA 1GRCA 2H7YA 3CIFA 4G8DA 1N57A 2C9ZA 2WHRA 4DMGA 2XB8A 2B4RO 1TAGA 2VNKA 4TZ6A 4DMUB 3BE5A 4M7OA 2Q9UA 2WU3A 2Z3ZA 4LWPA 2RARA 4P7KA 4D98A 5JSUA 4OAPA 4Y7CA 1K7SN 4KYVA 4FTWA 4WA8A 2REOA 1E4YA 1P4JA 3Q3JB 4JJEA 1KYYA 4UBOA 4X24A 1JB9A 4M9CA 4LSZA 2C8JA 2ZVJA 5SV2A 1X15A 4C0HA 3DFZA 5JYEA 3FBGA 2AD1A 2DWQA 2H5LA 4BGEA 1Z5GA 2JHFA 4JP5A 2J0UB 2XUQA 4OFXA 3G9QA 3ADOA 2WM2A 2YZ7A 2PS9A 1NUPA 2CHQA 3K32A 5DBGA 5M7EA 4LF4B 1R8XA 5CH3A 3UMJA 3FYDA 2O7SA 2W48A 4KX5A 3TMYA 1N1EA 4DGSA 1J21A 1U9JA 3KIPA 3OQMA 4N12A 2XB2A 2A57A 3BMOA 4DDMA 1T9GS 4Q3AA 3WKBA 3VU8A 3EGDA 8MHTA 2F17A 3UWPA 1EM8B 1EBFA 1IRXA 1MO6A 3CCBA 3JARA 4FFMA 1U9CA 4FI3F 4JQSA 4EPXA 2QRLA 5SICE 3LT1A 3TZCA 1G3QA 4KZPA 4LXTA 1R6TA 3AVUA 5CJ2A 3NBUA 2A9KA 3AIKA 1J2UA 2WWFA 1FW6A 1BHJA 3KSUA 4NZOA 2WJZB 4CIWA 5K0CA 1L1FA 1C3OA 1K5HA 1RKXA 3Q3GE 1BXGA 4Y2JA 4XGNA 1FEZA 4ZC8A 4BZQA 2YYZA 4WE3A 3H9UA 3TINA 1PJAA 2TMYA 4FBGA 5C34B 2WAAA 1S9DA 2GEUA 2IU0A 1SXJE 1QGDA 2CJYA 4M1EA 4JC8A 2H92A 4XXHA 1R0CA 3T94A 2IU3A 2KW5A 3MTQA 2QAJA 4DXAA 5A2QA 4DLAA 1TM3E 2GZDA 5BRJA 4H1VA 3QNMA 3CKKA 5KSOA 4QOGA 4NV0A 4A73A 3BQMB 4IRUB 3FMVA 2C3UA 3C5VA 5SZJA 1FSPA 1KFJB 2H9YA 3B51X 2Q7DA 1DIBA 3TXYA 1DQNA 1TX4B 3A58B 1CR4A 4KLRA 4OKSA 3UYKA 4O4IF 4GKBA 2QPAA 3UPUA 3F3KA 2PUCA 2A0XA 1OROA 3FDZB 3HB1A 4WLUA 2ZWIA 4EO9A 1IY8A 4FJ2A 3RYIB 5FL7A 4GSLA 3QKSB 1XXHE 3WNBA 1FDSA 4AF6A 1JQAA 1I8TA 2ZYVX 3QHQA 4BFLA 4N7JA 2ZQ5A 3O3MB 3OTGA 3SFTA 2MOKA 1NVTA 5H80A 4A8PA 1M6YA 2IEIA 2RHMA 4RHTA 5K1ZA 5IH3A 4CN9A 3RAEC 4AY6A 1LBSA 2BPOA 3LDAA 1B76A 3VSBA 1EXVA 4EMSA 4I19A 1ZHFA 1XA4A 1DE0A 1E2FA 1GLGA 3M4JA 4RQAA 4XQGA 3D3NA 4N5MA 1NW6A 5JWRA 1YS6A 1XVIA 5U9CA 2I8AA 4KYIB 4E46A 5LYJB 3BOSA 4L2IA 1LQTA 1Z07A 2WB4A 3DPIA 4BWVA 4YO7A 5K05A 1JFFB 2WJ3A 4ARZA 4XM0A 3EZXA 4HGPA 1RWNA 1CUIA 1G3IA 3KE9A 7REQB 2WTNA 2VDMB 5CU7A 1LEHA 3AXTA 1PLKA 1F2TB 1V71A 2PRKA 4YCBA 4C22A 4EVRA 1EVJA 5K2OA 4ETIA 2WRZA 3JX9A 2JHGA 3VH1A 4J3FA 4LZLA 5AVTA 4XDHA 4DIDA 1PE0A 3HCRA 4HWRA 3ODPA 2CHEA 2QE7A 1YZKA 2VEDA 4WKPA 4MW4A 4E2FA 3EZ7A 1Z6YA 3QKUA 2VHCA 1V47A 4HN4B 3SDSA 4G5YA 4LZPA 3YASA 4CF5A 1JDSA 4MPPA 5THXA 3IEIA 2VPPA 3EQ9A 4MUBA 4MQEA 2PMEA 2DTXA 1KI6B 3B1FA 4OOFA 3WDKA 4EG7A 2C2HA 3Q1LA 4R1QA 4RIHA 5KCMA 3ITKA 4CR7A 5LLTA 2C0PA 2VP3A 3FFXA 3ZI7A 4RCZA 4QD3A 4P54A 5JISA 3RARA 1XR3A 1Z5ZA 2IC5A 3MFYA 4GWLA 4YK7A 2E5FA 4BO1A 5KTKA 2ENWA 1FTWA 1V8BA 2QS9A 3D3JA 3K0FA 3CA8A 5U1PA 1EK1A 1PFWA 1WTAA 2PRZA 4JIGA 1JR3E 4GMDA 3BMNA 3HY6A 2AL7A 4OHMA 1SU4A 1YVUA 3ZN2A 3HC7A 4QLAA 4MTLA 2L69A 5CGQB 4PYOA 3QFSA 2Q6KA 2AZXA 1VCIA 2FSVC 4IFBA 1CEEA 2QXYA 4O4HA 4JR0A 3NV7A 1V5GA 1TZCA 3KLMX 3L02A 2BP7A 1D6JA 4JJ6A 4DRXA 1CQXA 4I4NA 4BAGA 1VG8A 2ORED 1W1IA 4OQ4A 1RDFA 5ALQA 1JXOA 1E2HA 3UCEA 2PZEA 3N2ZB 3HMKA 4S0ZA 1GGFA 1E9AA 3TLMA 4YI5A 3FUWA 4H0NA 5DOVA 3G7SA 1LDEA 2NO4A 4OHOA 3UGJA 4N0MA 5FF9A 5D8DA 3PXCX 5CPFA 1KY5A 2V6GA 3QLJA 3FZYA 5J2UF 3U44A 1XMQB 2J85A 2ADMA