1SULA

Crystal structure of the apo-ysxc
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
195
structure length
186
Chain Sequence
MKVTKSEIVISAVKPEQYPEGGLPEIALAGRSNVGKSSFINSLINRKNLAQTLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPVIVIATKADKIPKGKWDKHAKVVRQTLNIDPEDELILFSSETKKGKDEAWGAIKKMINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Open and Closed Conformations of the GTP-binding Protein YsxC from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords GTP-binding protein YsxC
total genus 61
structure length 186
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1sulA00
3AVXA 2CK3D 4EPXA 2WWYA 1GM5A 1XTKA 2VHCA 4IHQA 1US8B 2W6ID 1MO6A 4NE2A 4NTZA 4PFSA 2ZE7A 3OFNA 4FCWA 4LGMA 2XSZA 2QP9X 4Q1AA 4GPTA 5LB2A 2FG5A 3MJHA 3PUZA 4TT3A 1N0WA 2I4IA 4LYFA 2DFTA 3UANA 1FTNA 5F9HA 2BKUA 3OEEA 2W83A 4UKDA 5B58C 1OB5A 1NNEA 5CLLA 3EARA 3PXGA 4BRUA 3BH7A 5GJVC 2QY9A 2AX4A 3AKYA 4JYBA 4POAA 1DAKA 1N6HA 4Q02A 2QP3A 1KDPA 2YC4C 4DDUA 1AS2A 2BDTA 4PC6A 1NSTA 2NTYC 3QF4A 4WW0A 3C14C 3HP1A 5SZKB 3CRMA 4GZLA 3GEEA 1G291 2AK3A 1T3LA 1DEKA 3HU1A 2YOGA 1N0VC 4MKGA 4DCTA 1NBMA 1GIAA 4DCVA 5KTYA 3IUYA 2VP6A 4LSGA 5EP1A 2V7QA 5F98A 3LW8A 2F3RA 5AUPB 3AUXA 1GG2A 1GITA 3VQTA 4BRWA 1U98A 1QHXA 4M22A 4C2TA 5G40A 2H8KA 3I61A 3PVSA 1VCNA 2GRJA 1F60A 1GRRA 5KOYA 1CF4A 3CZPA 4NMMA 1BKDR 5FFMA 2QSZA 1ZC3A 3QE0A 3I8XA 2Z0MA 4W9MC 3C5HA 3CPHA 1GTVA 5CYPA 3MGCA 3QEOA 5L3QB 3TQCA 5JWRA 4GOKA 2Z83A 1WBBA 2QA5A 4IFEA 2FGKA 1Z28A 2BM0A 1S9HA 4M0LA 3EASA 2VHTA 3E70C 4NYMR 3CX7A 2LKDA 1E2FA 3C4JA 5TXGA 1E1QD 1RRPA 3QY0A 4Q7JB 2KE5A 1A4RA 1W0KA 2YJTD 4AI6A 4Q66C 4Q4AA 4QNMA 4TYYA 1OYWA 3TSWA 5EXSA 3QKRB 1FP7A 3GJ8A 4PSAA 1DARA 3K53A 2PBRA 3SFZA 1YZTA 2ZE5A 1ONBA 2F43B 4A0GA 4URYR 1JQLB 4A2QA 2BEJA 4D0GA 5M04A 4U7DA 4KCGA 5HZHA 1JB1A 2P0EA 1N5LA 1JAHA 4HLCA 1WB9A 4OK3A 1W7AA 4MKIA 4I1OA 4PO9A 2D7DA 1D9XA 3THWB 2GJAA 1SULA 3CX8A 4KFTA 3KX2A 2BEKA 3P1JA 2EQBA 3FYHA 4LYJA 1G5PA 4ZKDA 5C46F 3AVTA 1TUIA 3DOEA 2GK6A 4G5RA 1BS1A 1G5RA 1L4YA 1E79D 2J59A 4W5HA 4PPFA 5EE5B 1GNRA 4D25A 2PEZA 4GZMA 2PCJA 1VG8A 3LBNA 2VP4A 2UZ3A 3G82C 4KXFB 4DLWA 3K9LA 3D31A 3I62A 2X77A 3AKCA 2V6IA 2WAYA 1WCV1 2OUKA 3TKLA 3MWYW 1NVVR 4A92A 2JASA 3I5XA 1PVOA 2J7PA 1ZJ6A 2JJ8A 1IY1A 1Z06A 1G8PA 2H17A 3G5UA 3RABA 3THYB 1NY6A 3FMPB 1WXQA 4F38A 2PMKA 4I1SA 1JPJA 4OHVA 3TVDA 2WJGA 1WA5A 2A9KA 3AQ4A 1AJEA 4BFWA 1P2VA 4EJSB 3TVTA 2I1QA 3QPVA 4OI2A 4K8OA 3ZJYA 1CULC 2ZI3A 5CK4A 2D74A 1GZSA 2GVZC 3ETLA 3H4MA 5FTNA 4DCNA 2R6CA 1KZ7B 1E94E 1Z0KA 3DM9B 3Q7PA 3KKOA 4PR0A 1QHIA 5FUWA 4PC2A 1FNNA 3TLXA 5DHFA 3U2QA 1HEIA 1GL7A 2FSFA 3DOFA 1KY2A 1YR8A 3QEJA 4TYNA 3CWQA 2QTHA 1EG7A 3MD0A 3P32A 1FUKA 2ZRGA 3K0FB 1IXRC 1N6IA 1W5TA 1UBCA 1G17A 2WKPA 2ZQ5A 3QXJA 4P32A 3C5CA 2PLRA 1ZU5A 4F4CA 1OT3A 1E96A 2IHBA 1R8QA 2CVFA 2DCUA 2KB0A 3B5JA 3JVUA 3O8DA 5EZ5A 4F4JA 3UPUA 4Y0AA 2EFHB 2FZLA 4Z1MD 1ESNA 2QI9C 3ZYCA 2ORIA 1UKZA 3FOZA 5FI0B 4C3ZA 4P3YA 1AGRA 4FIDA 1NI3A 1MOZA 3IIMA 1KSGA 2QN6A 3GD7A 3B1VA 4KFRA 3TAHA 2DY1A 1ZM9A 2IW3A 2BCGY 1N0UA 4RKEA 1F3OA 1AKYA 3ASZA 1A82A 4PX9A 2VP2A 5EE1A 3BERA 2RGAA 1KDRA 1VHTA 2JLUA 3ZZTA 1TF5A 4LK2A 1LS1A 4EPTA 4V03A 1OV4A 4DWJA 5EUMA 1P2TA 4BGDA 1TUEA 1N25A 4HB3A 2D62A 4JVNA 2QT0A 2ZI5A 3IILA 3MCAA 1G4AE 2A5FA 2ZM5A 5EUQB 2OBLA 2ZYUX 2AHOA 1T5LA 4B3XA 1BH2A 3AGQA 3LQQA 1HE1C 1VYUA 2GNOA 1N6PA 1GILA 4D81A 3KFVA 5CDFA 2R6GA 4LI0A 4DCSA 1UM8A 2RAPA 5L3SA 1NVXQ 1DBSA 4UXIA 4E5UA 1NKTA 1YE8A 3CRQA 5DNYB 1OKKA 3LRPA 3PEVA 2W6JD 4H9GA 4GP7A 4CF7A 5J4LA 3FHTA 3UWKA 1A7JA 4ESHA 1Z2AA 4IOLA 5E7IA 4D2IA 3HWSA 2GXUA 3FGNA 1G3QA 4HEJA 3V4FA 3THWA 2CHGA 1H8ED 2HJGA 3C41J 2PX3A 3UG7A 2DR3A 5F2EA 2J7PD 1TU4A 2ZJOA 3B1XA 1BYIA 5D3MB 2IHYA 4HUQA 1Z08A 5JHGB 4M9QA 1II0A 2MSCB 4QXAA 1JEDA 4C7OA 2WPDA 4PHGA 4JS0A 4LJ8A 2XZOA 3RLFA 4J0QA 4FINA 4ACBA 2BHRA 1OIXA 1JR3D 4TTQA 2ZREA 3RNLA 2WOOA 3TK1A 2NZJA 3QUSA 4WZAE 1IN7A 1KNQA 2QMEA 2V8OA 4A8JA 2KBFA 3ASYA 4UJ3A 2C98A 3I5YA 4ZDWA 4AKEA 1Z47A 5KSPA 2IWRA 1QZXA 3Q5EA 4IVPA 4IOKA 1E2NA 4WVFA 3RS5A 3UKDA 1XMJA 1EFCA 4CEHA 1Q21A 3W6OA 1N6LA 2OE2A 3IGFA 5J47A 5L3QA 3GJ4A 4A6XA 1VCIA 1E3MA 1E2HA 2ZRMA 4HDCA 2QE7D 4Q1DA 1OXUA 5BW8A 5CM9C 4JLBA 3VX3A 5J4HA 4IVQA 1LB1B 1W48A 3GMTA 1F5NA 5JHHB 4Q4JA 1FFHA 1JJVA 3QOFA 1Q22A 4M1KA 4DXAA 4TL7A 1Z0AA 4WA7A 3SEAA 2N42A 3HJNA 5K8UA 1SQ5A 2C04A 1GL6A 4QKQA 5AUNB 4CEHB 2CDNA 1L4UA 1DAIA 1Z07A 4QBGB 4TWZA 3KJGA 4KYUA 4DLZA 3V9PA 5TVKA 1YR6A 2B8TA 2RGEA 2AFHE 3SNHA 3OEHA 2OCAA 1J70A 2QT1A 2X8AA 5K8LA 3EC2A 4LJ9A 3RC3A 1ZUNB 3U4QB 2BKEA 2CJWB 3A1VA 2Z4SA 5C1BA 5FBLB 1RPZA 1MO5A 3Q72A 4RFSB 2C2HA 1EFUA 4JLOA 5FTKA 5IK2A 1Z6GA 4NYIR 2GA8A 3D8BA 4BLTA 1G21E 1NMZA 2A3RA 1I2MA 2GDJA 3WNDA 1FL9A 3CZQA 4BUJA 2F1JA 3SE0A 1Z63A 4S35A 4WZBE 4B6EA 3U6BA 4B3CA 1XXHA 1NG1A 4U02A 4QBHA 4TLBA 4O25A 2FSHA 2ZSFA 2J45A 1SHZA 1KDTA 2G83A 3OEED 621PA 2VRWA 1W36C 2IYTA 2MSDB 4ZDIA 3K8YA 4WOPA 5C2JB 4L15A 1EX6A 4DDWA 3FPAA 3CF2A 4C0KA 2XX3A 1SVKA 3RRZA 4KFSA 3VMFA 5JI3E 4CEIB 2AN9A 2J0UA 3KKMA 5G3YA 5EXTA 3LLUA 2QSYA 4LJYA 2Q9AA 3E5HA 4I4LA 3R9WA 4QC2A 1MO4A 2BIFA 4ITRC 4O2LA 2W0MA 3RS2A 2GJ8A 4TTPA 2JLWA 3U44B 4V0KA 1JQJC 1ZM2A 2GEDA 3B1WA 3UG6A 2LCFA 3AKDA 3B7GA 2KI5A 3QG1A 2QMOA 2ZR7A 4LJ4A 4RZXA 3KQKA 2J46A 3LH5A 5AJXA 2FA9A 1NY5A 3ADCA 2YVUA 2WTUA 1W0JA 4AWXA 1CRPA 3VNVA 221PA 4QHSA 1W2HA 4EPYA 1W0JD 2DWPA 4X8MA 4TL8A 4W5WA 4FMDB 1RJ9B 1G1MA 1XD8A 3U3OA 3O8RA 4IXNA 5HR5A 2B92A 1Q12A 1YZKA 2VQSA 2RB4A 2OZEA 1K5GA 2GF9A 2FU5C 4QJ5A 3QBVA 3FTQA 3NBFA 3U3KA 3EX7C 2ZS7A 4ASUA 3PV0A 2R6FA 1SVOA 4TSFA 4GT1A 1B0UA 2W2VA 3MSXA 4RZ3A 4MDFA 5KYKA 3BFKA 2ZIAA 1ETUA 1JR3A 2QROA 4URWR 3WNBA 1AQYA 4LBZA 5AUOB 2F9LA 1TQ2A 4RD0A 4D0NA 2GTPA 4LBYA 5DIFA 721PA 2D3WA 3KB2A 3TR5A 2DBYA 4FWTA 4AKIA 2ZUDA 3OAAD 3EZFA 1M7HA 1JR6A 3AF2A 3ZS9A 4XVRA 3DKPA 1MR3F 1S9DA 4U00A 3TW8B 1T3SA 2IEYA 3ZQ6A 2CMKA 1VYVA 1XWIA 1OFIA 4IDNA 4NU0A 1NVWQ 3WYGA 1OIVA 4M9SA 3E2IA 1MABB 4A1FA 4C0LA 2ZSBA 4O2RA 2FEOA 1U81A 2O0JA 2FPMA 3NDBB 5J4VA 1T0JB 3CX6A 5FR1A 5FPYA 4QHTA 2F1IA 2PJZA 4PAQA 2O8CA 5FH9A 4KITB 4NCHA 4ZCMA 1DE0A 1QHHA 1ZW6A 2CCGA 2VLIA 4I99A 3WMGA 2R2AA 4US2R 4F93B 3NXSA 4HUQB 5JJLA 4LV6A 2VEDA 2O8BB 2NZ8A 2N1BA 5TB5A 1LF5A 1XEXA 2R62A 1MABA 2QP4A 2MMGA 3B9PA 4ZCLA 2ZSEA 4QM7A 1FTSA 1ZCBA 2HT6A 3WYAA 2I1VB 1XP8A 3X1DA 1QG2A 4OI1A 2VPPA 2GAOA 1JBKA 2YNMA 1JNYA 4LCBA 1KI6A 1QHHB 1E2IA 2OBMA 4EFNA 3OIWA 1IN8A 3ZZ0A 1ZP6A 3KKQA 4NHOA 5DGXA 3PR1A 4TYQA 3BB4A 4D80A 4UNNA 5HCNA 4A0HA 2H57A 2J9RA 1S1CA 3UIEA 2ZYVX 5DHAA 4DEYA 3UWOA 2YC2C 4LV5B 3WXMA 4XWOA 3QVVA 1ZM7A 3EWAA 1XEWY 2SHKA 2OFOA 2KSQA 1EFHA 2GK7A 2IF0A 3SI7A 3D6TB 4NKRA 1QRAA 4JT2A 4V02A 4ZPXA 2AD5A 1N6RA 3NEJA 1G8FA 4PANA 4PO8A 2QBYB 2ERXA 1Z3IX 4PO1A 4D4KA 1GNQA 5JMTA 1CR2A 1LW7A 5KNCA 1CR1A 2RGBA 5E3HA 4OI4A 2QU8A 3AVQA 2DFNA 1TADA 2GF0A 3BXZA 3AVOA 5TV2A 2H1LA 1NN5A 3I4LA 4Z51A 4BFYA 2IUUA 2GWHA 4GMXA 1KOFA 3MLEA 3R7WB 1S8FA 3AVVA 4GOXA 4DKXA 4H1VA 2ZJBA 5L3VA 2XTNA 3GJ7A 3LNCA 4RZ2A 1XD9A 1E79A 4Q9KA 5GJWC 3P4YA 4K46A 1P75A 1D2NA 1TQ4A 3CR8A 3KXIA 1PV4A 1K8RA 4RSGA 2YOFA 1U9IC 3L8YA 4LX0A 1DO0A 2JJ2A 2WZQA 3OIYA 4DBLC 4A82A 4TYPA 2JJ2D 2DFKB 4P4SB 4PQRA 1KMQA 1ZVQA 5EXXA 3RWOA 3T61A 4PSVA 3BRWD 5KSYA 2J0UB 5TDHA 1XPUA 4C9BA 2IT1A 3TBKA 3K70D 5DO9A 3TUIC 3K9GA 1JI0A 2NQ2C 4NP6A 2QENA 2H5EA 3W9YA 1YQTA 1TQDA 1CXZA 1Z0IA 2PLFA 2ZR0A 2QPOA 4FCTA 4TLCA 2JGNA 4D4MA 1DAEA 4C4PA 3DDCA 3WHKA 1XTIA 1G9XA 2ORVA 3X1WA 1UKEA 4TMVA 3L0OA 5B30A 5DI3B 2Q0HA 1E4YA 2QL6A 4WAUA 1MV5A 5H1YA 5C4GB 4BLPA 2ODNA 4DB4A 3O47A 1SGWA 4TLDA 1CR4A 4M1YA 3S1AA 1VCMA 4FI3C 4Q4LA 4TMXA 3WRXC 1CEEA 4URXR 2WWHA 4Q9HA 521PA 4IOMA 1ZRHA 2FPKA 2K5UA 4Q4HA 5KDLA 3UMSA 3GLFE 1NN3A 1COWD 1GRQA 4Q19A 4FMCF 3AF3A 5HTKA 4KODA 2ZJ8A 2IYSA 4HUTA 3P26A 4CIDA 4R71A 1Z0JA 1IAQA 3CO5A 3K0CA 2EW1A 2BVNA 2X1VA 5E95A 4DIEA 4OI0A 5HKKD 4Q5IA 3RS3A 2FSGA 2J87A 4FD2A 3BWDD 2WSSA 2PT5A 2Q3MA 1AA9A 3NH9A 4CW7A 1XEWX 1ZUIA 4QJ4A 4JLKA 4DUGD 2FF7A 3GCGA 1GDDA 2IF2A 1OH8A 2C9OA 3WHLA 4UQOA 1EESA 3BORA 3Q7QA 1EWRA 1OXXK 2WJIA 4II7A 2B21A 1G64A 1P73A 1T5IA 4HYYA 3QKSB 3GEHA 4BASA 3D7MA 5DI9A 4FMDF 3IHLA 3SU8A 1WQ1R 1OXVA 2AD1A 1B23P 1Q44A 3VU9B 3DPUA 2ZI9A 3DHWC 2RGCA 2QRZA 1G3RA 1C1YA 1UFQA 1Y63A 2Q3HA 2B7BA 2IYXA 3BH6A 1HQCA 1L8QA 4MRVA 3I8SA 5TY0A 2AXPA 3CNOA 3TMKA 3BOSA 4YMSA 4UJ5A 3GFTA 3EPHA 1YRAA 2VHJA 5EJEA 3NC0C 3EG5A 1RVDA 3REGA 2O8DB 5FPKA 1IJFA 1IN4A 3CIOA 1R5BA 3BB1A 2OLJA 4P31A 3AF0A 4XD7A 4QGAA 4M1MA 2R6DA 4HB0A 4WXRA 4C0AC 1OSNA 4ACAA 4B34A 4B74A 4Z8XA 2V3CC 4JLNA 3I72A 1BYUA 3DL0A 1U8YA 4LY6A 4ARZB 3GLGB 2IUSA 3A37A 5C18A 1X1SA 2NIPA 1PZNA 3WP1B 1HT2E 3RHFA 3HR7A 1MRSA 2GAAA 1YHNA 4BLSA 2HDNB 4N3NA 3GLIA 1KI6B 2C99A 4B32A 3EPLA 4JBYA 5DSZA 2A78A 2ZRAA 2QRNA 2QUZA 3HYRA 4LJ7A 5JZVA 3UK6A 4US0R 4LZZA 5IT5A 3DZ8A 4PSKA 2VIIA 3AP1A 4G01B 3R9XA 1II8A 2ZRDA 1E98A 1JEEA 3KTAB 1DVRA 3N2IA 1VIAA 5LPNA 1NVUQ 2OHFA 1G4UR 4HZUA 3QF7A 1G6OA 5FL3A 3MAAC 4P0TA 4HAYA 3RS0A 4C2UA 2X19A 2JIZA 1SVLA 2I3BA 2JCSA 3FWYA 1PJRA 1RYHA 1XXHE 4JVLA 3BIFA 3IQWA 1R5NA 1R6BX 1G20E 5FBWB 1CTQA 3EPJA 1NF3A 2AKYA 4CEIA 1Q57A 4PAMA 1M74A 2OLKA 4TMKA 4KLZA 3RSLA 4M9XA 5E4FA 4BLQA 1W4AA 3W3ZB 4G0NA 5FUVA 1E2EA 3B60A 4URZR 1Q20A 1OF1A 4M1OA 1FOEB 4DSUA 2QE7A 1N6KA 1SXJC 4B76A 4JKIA 3TR0A 2HJVA 2ODEA 4BFVA 2F1RA 3IDQA 3LA6A 3NTUA 4DDTA 5JRZA 4P4TA 4EDHA 2UKDA 3BGWA 3P27A 2WOJA 3ND9A 3GLHB 5B2ZA 4IKEA 3QKUA 4RFSA 4D4LA 4FW9A 1VG1A 2ZUBA 2IYQA 3T06B 2F55A 2VSOA 3A8TA 3IHWA 2QQEA 4KVGA 4AKHA 1US8A 2OESA 3NHAA 4BLRA 4GOJA 3AVYA 1XZQA 1N5JA 4YDSA 1IONA 1HY3A 1NJGA 1NL3A 3LX8A 4NONA 5FTLA 1U0JA 1R4AA 3AKEA 121PA 1OFUX 3LLMA 3SS8A 4MGZR 2YOHA 1T0HB 2AL7A 3I92A 1Q1ZA 4QL3A 3U3JA 2YV5A 1YKSA 4KBFA 1X1RA 1SVIA 1VTKA 4QHYA 4MH0R 5AR1A 3K0SA 2XAUA 3CONA 2A5DA 1RKBA 3UMRA 1O87A 4I1UA 3LAWA 4B73A 4KAXA 4OJKA 3R8CA 2JLYA 3RS4A 1KGDA 1LF0A 4URUR 4L9SA 3KUCA 4NH0A 1MO3A 3VTKA 4G5QA 4ON9A 4Q7KA 1DO2A 2GEUA 4OYHA 1OE0A 2ZRPA 2QAGC 3QENA 4CGZA 3GFOA 3CM0A 1P4SA 1E1RD 5FUXA 1ZD9A 1NLYA 3OIUA 3WY9A 1CJVC 3BB3A 1HURA 3B8HA 2OFWA 4NZYA 2KBEA 3OAAA 4BPBA 2NO6A 4Q18A 4C0HA 4Z8YA 1RIFA 3ICQB 1Q1BA 1VHLA 1XEFA 3M6AA 3NBXX 1D8TA 3AEZA 4ESVA 5FBRB 2WV9A 1FQJA 3A1WA 2B7CA 3GJ3A 4RKFA 1GP2A 3T15A 2V9PA 4MGYR 3CNLA 3L0SA 2FFQA 4RD1A 3WYFA 4LRWA 1AM4D 3H86A 3PENA 1E9FA 1FX0A 4G5SA 4L4UA 5CYOA 5EE9A 1ESMA 1P7CA 1RZ3A 5CIQA 4DC9A 4XH9B 4CT5A 2DWOA 2VF8A 1KI1A 1SXJE 2RGGA 3F8TA 1ZINA 2J0SA 1OW3B 3CR7A 2CXXA 4TMZA 2UVQA 1KNXA 2YYZA 2V6JA 2O8DA 3W8RA 3K9NA 3PCRB 1FMJA 3AB3A 4DLYA 4JLPA 1Z8FA 4G3XA 2P65A 3K09C 1XNJA 2PZEA 1HTWA 4XTRA 5EXPA 4HAUA 4CYMA 1WBDA 2ANBA 4M4SA 2QTVB 5D3MA 1KO8A 3LQRA 3VFDA 2H16A 2AKAB 1W4CA 4MKHA 3FVQA 3VR4A 5BYKA 4GP6A 3KJIA 4H1UA 1KI8A 3E1SA 4TLAA 4Z54A 4QRHA 1KK1A 2ZAOA 2MMCA 3TQFA 3GJ5A 1ELOA 1W2GA 5LBIA 4AG6A 1E6CA 1YZLA 2O8EA 1GVNB 2EYQA 1ZMXA 4WBSA 1XCGB 3C16C 1C9KA 4UNSA 2OV2A 2W00A 1U2RA 4PZYA 1E0JA 2VHQA 4L8GA 4YMWA 5FL7D 3J81k 3TIFA 4YQFA 2BJVA 5EP4A 4Q1BA 3KL4A 4DT1B 5HE8A 2RCNA 5HKKA 1D6JA 3CH5A 1NRJB 2XJ9A 1LTQA 2BC9A 4JL8A 4C7OB 2W2XA 1OXTA 3PEUA 4YONB 2EWVA 1P60A 3K70B 2XZLA 2ZSDA 3WBKA 4HZUB 2D4HA 3RSOA 1OFTA 1UF9A 2IYWA 4B3GA 1SKYB 1NMYA 1E9EA 2D7CA 1G16A 1N5KA 4AK9A 3LW7A 4JLMA 2WIAA 1E2PA 1F2UB 4Q47A 3KZ1E 2J0VA 4YDHB 5DYGA 4CT4B 4ZV4A 2BV3A 3X1XA 1T91A 2IYYA 1ZM4A 1F2TB 1Z6TA 2XXAA 2NO7A 5IDVA 4JBWA 1S0UA 3GJ6A 2ODWA 3WMFA 4MUBA 1HYQA 5EP3A 2XZPA 5FPHA 1XD2B 3DEFA 1YR9A 2AWNA 1RRFA 2OFXA 5FTMA 3GLGE 1M7BA 2DFLA 3B78A 1ANKA 3ONWA 1OJLA 4MITA 4E09A 4G1UC 1E1RA 4CEJA 2TMKA 3SC3A 4ZI2A 4LHXA 3W5JA 1IJEA 1OXSC 3B6EA 1TX4B 3VNUA 3BFVA 3FHOA 3HU2A 4KLNA 1VMAA 5CB6A 2VP0A 5JS7A 5F3WB 1E2LA 1U90A 2O52A 1U9IA 1OHHA 5DYIA 3IO3A 2AXNA 2GKSA 2AK2A 2IXGA 1NN0A 1TMKA 1FZQA 4G5OA 3DZDA 3O8CA 2V7QD 3SBDA 1AS3A 1NBME 2J7KA 2YWFA 4I1VA 3VX4A 1U99A 5SZIA 1GKUB 4OHWA 1S4QA 4R98A 2KWIA 2QGNA 2BMEA 3THOA 4MRRA 3M1IA 1HQYE 5FPSA 4OQLA 5FOUA 3PUWA 4XTCS 3QVUA 1ZD1A 4AD8A 1E4VA 3U3MA 1KYIA 4EFMA 1XRJA 2NG1A 2ZSAA 5JSZA 4B48A 2ZU0C 1KAOA 5FOWA 1BOFA 1N6OA 3N5CA 2O0HA 4B2PA 5HZKA 1HA3A 3FHCB 3T1OA 4UXJA 4WZ6A 3GJXC 2CCJA 2YWHA 3D3QA 1E32A 3SOPA 1JPNA 2ATVA 3MJRA 3T34A 5JFGA 4LPKA 2J0QA 3CPEA 1F48A 1P9RA 4TTRA 1ZIPA 1E1QA 4DLXA 3KKNA 4MUAA 4I81A 3GLHA 5KHOC 3B9QA 3QSYA 1S3GA 3CW2A 3N2EA 3U6KA 2EFDB 3PJRA 2OILA 2WMNB 4V0LA 5JCZA 5JWOA 1XD2A 1A1VA 4ZIRA 2FWRA 1ZCAA 5JEDA 1KJWA 1YRBA 1CLUA 1Y3AA 1ZM3A 1GAJA 1J99A 3A4LA 2H18A 4PC1A 2ZI7A 3N70A 3KQUA 3THXA 1SZPA 3K0CC 3ZS8A 1XPOA 3FKSD 1JAIA 4TYWA 1HE8B 2ZPTX 1O3YA 3KB1A 3KXLA 4HLUA 5TARA 1X8KA 4OHXA 2FFAA 3VKWA 4IFBA 1RRCA 1U8ZA 2E87A 4EPVA 2UZIR 5E7MA 2YWGA 3C8UA 5JSZB 4PZLA 1AIPA 1KTVA 2JEOA 5EE0A 4L16A 2OG2A 1M7GA 1YVDA 2ERYA 2LKCA 3K0FA 4PAOA 2GCNA 3RWMB 3BK7A 4NDZA 4M1TA 5J4YA 2ZJAA 1P2SA 4M8NE 3W6NA 3ZZUA 4EAQA 1P62B 3LVQE 4Q9LA 1DADA 3U3RA 2P3SA 2GJKA 3PG5A 2QGZA 3LO5A 4DSOA 4YC7A 1OPXA 1XBTA 2PCLA 1LY1A 2GJSA 1DAHA 1SXJD 3SHWA 1X86B 4RCZA 3QXXA 4OQMA 1MRNA 1KO4A 2WWGA 1TF7A 4EFLA 1OH5A 3L8ZA 2D2FA 2QG6A 2IS1A 4KO8A 1NLZA 2FFBA 1EFRA 2JLSA 3A4MA 1KO5A 2A2ZA 3ZVNA 2LWIA 2GHIA 4HI0E 3GLGA 4PQYA 1G7TA 2ZRHA 4Q7MB 1G6HA 2ECKA 1X8LA 2P2LA 4C0QC 1P2UA 4A6PA 1EX7A 4BFXA 2DPXA 4DHEA 3EC1A 3I3SR 4M2LA 3VU9A 2G0NA 4PPGA 2JIZD 2FN4A 3QXSA 3KQHA 1KMHB 1NMXA 4XD7D 3U7EB 1KSJA 4N0EA 1RJ9A 4PPNA 4BFTA 1Z83A 2WIBA 2NO1A 3P4XA 5JEEA 3KKPA 2YWEA 2W2TA 2P5SA 2OM2A 1ZNZA 2XNSA 3AVUA 2ZRJA 2J1LA 3SZRA 1AN0A 1KO1A 1VKJA 1DAGA 2CE7A 3RYTC 2F9MA 2XTZA 3BD9A 1DAMA 3AVPA 2HCBA 5AJVB 3GLIE 2PT7A 3AM1A 4BE7B 2WMOB 3MWKA 4YXWA 2VP5A 5L3SB 1JXOA 3Q5DA 2HF8A 4BFSA 4JKYA 1DELA 4C0SA 1OIWA 2ZUCA 5CJ2A 4B33A 2ZJ2A 3T5GA 4W5JA 2PEYA 2BMDA 4ARZA 4TLEA 1IXSB 2JJ1D 1WP9A 2QNRA 4CVNA 2WSSD 1CJMA 1HV8A 5FOXA 1TQ6A 3CLVA 4A0RA 1CBUA 3AVWA 1OYYA 1W49A 5TMPA 1II9A 2BJWA 3PQCA 5LD2C 4M21A 2G0TA 5FOSA 4BWYA 1GRNA 2IS4A 1N5IA 1QDEA 3TUJC 4IOJA 3SR0A 2QBYA 4LPSA 3IQXA 3Q9LA 5CITA 4JJKA 3GLFA 1UEIA 1J90A 2VHUA 3KJEA 4KV9A 2CEAA 3SJCA 3K0AA 4XVUA 4F92B 3BAFA 1FP6A 4BLOA 2BWJA 4ZI3A 4GMDA 4X8OA 4D82A 3UATA 1E0SA 1UBGA 4UNRA 1S1MA 4DSNA 5H70A 2GEVA 1Q0UA 3VHXA 1KI3A 1P9WA 4GRAA 4JT4A 5GVRA 5JRJA 1IY2A 4MYTA 2XSZD 1Z29A 5AJYA 1UBFA 2GZDA 3VR3A 4BZQA 4F4IA 1ZD8A 3T5DA 5D3QA 2REOA 3CRVA 5B57C 3NG1A 4RY2A 1G3MA 5C4MA 1QHGA 4HSEA 4TQAA 4IDQA 2G77B 2WM9B 4UXHA 2ZITA 4Q4HB 1SVMA 2PL3A 3G0HA 5DI3A 3RAPR 2WVJA 3TRFA 4DRZA 3IBGA 1ZUHA 5G53C 1CKEA 2CL7X 1E9AA 4E07A 3DMDA 4V0OA 5JLJA 4HAZA 4F7WA 4A8JC 1CJTC 1E9RA 1OH7A 2V55B 2VF7A 2HYDA 2D2EA 2CVHA 4QGGA 2IEZA 4MYUA 4XJXA 2FPLA 4EJSA 3TE6A 4Q4JB 3QG5A 3ADBA 2V54A 2ZR9A 4EQ6B 1OKKD 5A5GA 1L2TA 1R10A 1ZNWA 2PMDA 2B6HA 2QORA 4P33A 4PC7A 2EFCB 2HYIC 5FTJA 3MMPA 4NYJQ 4QOSA 5CDFE 3CF6R 1UPTA 4KFUA 5L3RA 1Z6XA 3RRYA 4BZPA 2W58A 4KHZA 1G7CA 2CL6X 2XGJA 1XTRA 4XWAA 4XVQA 3S1AB 2RGNC 4C0JA 3WBJA 4BECA 3A6PC 3AP3A 2QAGA 3EZ9A 2ZRFA 1DG1G 3A1UA 3PFIA 4B44A 5FR2A 3QNUA 3SYLA 4DLVA 4HLDA 1LNZA 3F0TA 3K0AB 1G18A 5K8IA 1KO7A 2WJHA 4HZIA 5BN3A 1YZUA 3NBZC 2WICA 3I1FA 4JSTA 1UAAA 3LFUA 4QM6A 1ODFA 2PJRA 4AY2A 3KUDA 5SZHB 1H65A 2NPIA 1W47A 3WMEA 1Q3TA 1BMFD 3PUXA 1SKQA 4LHZA 3F5FA 1NG9A 2BM1A 3TH5A 1NKSA 2RGXA 3PUVA 2WSMA 5ELXA 1J8MF 3RDPA 2DWQA 4TL9A 3UMFA 2CHVA 2IYUA 4IEIA 2ZXUA 2G6BA 3EIHA 5KO2A 2QMHA 1U94A 1EWQA 3L0IB 5GJCA 4U5XA 1QVRA 2ZI6A 3A4NA 3NDPA 5UKDA 2L0XA 2JAQA 3ADKA 4MDEA 1COWA 2B8WA 2EYUA 2CNWD 4Q21A 5SZJA 4KYIB 3BC1A 1GKYA 1XJQA 2WHXA 1VPLA 2OEPA 3QIAA 3QJYA 4IVRA 2VSXA 1GL9B 2RKOA 5BXQC 3OIVA 2NOAA 2BOVA 4AYTA 2NO0A 1GNPA 4HLQB 3I73A 5EZ6B 2G3YA 4O0MA 1QHYA 4B35A 1E0AA 1NSFA 4GFDA 3ZDQA 5JWHA 4YMUA 2N46A 1NJFA 1QHSA 1YR7A 1N3BA 2OSBA 3NHBA 4KBGA 4NYMQ 3SN6A 2W6JA 4E03A 1II8B 3OEHD 3QQ5A 4A2PA 3C15C 4N1AA 3TUZC 4ERNA 1W46A 2EFEB 2VA8A 4TQ9A 2ZYWX 3GLIB 4PTLA 4Q1EA 4JLJA 5BWMA 1XMVA 1P9NA 3EWSA 4BZXA 3LVRE 5KNBA 3PEWA 3X1YA 2IS2A 3K0EA 4KSBA 3BS4A 1T8TA 1XJCA 2QZ4A 1OLOA 4FN5A 2HF9A 1DOAA 2CLCX 2ZJYA 2O8CB 4IJMA 4JVSB 4YMVA 2F3TA 3U5ZB 3LBHA 1LV7A 3ZH9B 4RD6A 3QPUA 5J40A 2O5VA 1KJYA 1S96A 1YJ5A 1E2QA 4N0DA 4CDGA 4EKDA 1HH4A 1LS6A 3LXXA 4LWZA 2H92A 1QVAA 1PLJA 1UKVY 1YZQA 4QNRA 3SJZA 1J7KA 1IOZA 1RFLA 1UKYA 3GLFB 5G3ZA 4OQNA 5DH9A 4TQUS 4X8LA 2ORWA 2IK8A 3VR1A 3CPJB 3KQNA 2ZRCA 3EW9A 3MFYA 1AKEA 2C8VA 2GZAA 3AF1A 3CUEF 2IBMA 2OBNA 4ILEA 2GBLC 1A2KC 1UDXA 2NGRA 1CR0A 3QKRA 4TN1A 2FE4A 2FOLA 4JLVA 5E7JA 5AUQA 3ZVRA 3AF4A 4QFMA 5JECA 1NN1A 4LHVA 1KK3A 4LDJA 2A5JA 5JCPA 4LV8B 3V4RA 3U7FB 3BFXA 4S2EA 2V1UA 2ZEJA 1XTQA 2OCYC 4MRSA 3W5IA 1RE0A 3RVBA 4JZKA 4B2IA 2ZS8A 4IRUB 1E2MA 1NIJA 4RCYA 3B13B 4MYHA 2GZHA 1TNDA 2VP9A 3R20A 1V5WA 2A7QA 2BBOA 1PLLA 3L0PA 1KMHA 4CZ2A 5HPYB 5KDDA 3U4QA 2ASEA 2IYZA 4WIAA 3TAUA 3RRMA 1VG0B 2JA1A 2WAXA 5JI2E 4JMPA 2CK3A 4R2HA 1VECA 3EIEA 5KSZA 1P61B 3PIRA 2EFGA 2AFIE 4QJ3A 4EIWA 3CH4B 1FNMA 2F43A 2G88A 3DM5A 1QF9A 5FBVB 2FJUA 3WP0A 4A2WA 1GKIA 3NIBA 3LD9A 1G7RA 4ASUD 1L7VC 2P6NA 1KAGA 3B82A 2CBZA 1YU9A 1X8JA 2J5XA 2Q9CA 2O8FB 1XPRA 1XJ0A 5F9FA 4B6FA 3H84A 4R9UC 1W0KD 3H1TA 4TMWA 4NCJA 4LYAA 2FMXA 1DS6A 1Q3HA 4RD2A 2CLSA 4ZDKA 1NLFA 3GP8A 5CLQA 3CWZA 2IYVA 1E2KA 1G8YA 3A36A 3QF4B 4C30A 3AP2A 4XOIA 4D26A 1IHUA 1DTSA 1I4TD 1Z5ZA 4F91B 2ZVPX 1GOTA 4MQBA 4CEJB 5AWFC 3AGPA 4IEEA 3U44A 3PUYA 4IDPA 2C95A 3FKSA 4LYHA 2ZJZA 5A0FA 2GXAA 4DT1A 3IEUA 1XDBA 1KI9A 2FDCA 2OXCA 1CU1A 1XB2A 5KNDA 1G7SA 1DG3A 1KDOA 1BO6A 2D06A 2ZJ5A 4IDHA 3QBTA 3TSZA 3ECCA 2BMJA 1A2BA 1T8UA 2DB3A 1XCPA 2BCJQ 1G5TA 2QM8A 4JYCA 3HPRA 4P4SA 2IL1A 1JECA 1T9HA 4AKGA 1UDWA 1QHNA 3T1VA 3FKQA 5CB8A 4OBEA 1P72A 2G9NA 5KUTA 4YMTA 1H8EA 3IO5A 4D4JA 1XTSA 3FB4A 4A36A 5AK0A 5LDDC 1R0YA 1XF9A 2XOKD 3H2YA 5H8WA 1U8AA 4M1WA 3NKVA 4BEBA 2GCOB 2V4ZA 2QPAA 4EUNA 2C9YA 2OCPA 4PHHA 5DN6D 2C96A 1EFRD 4TT3D 4HAVA 4V0NA 4OQXA 4HLUC 4NBSA 1AS0A 1FUUA 1ZC4A 3CKLA 4TL6A 4PXAA 2CJWA 2RGDA 3IEVA 5EQTA 4FWIB 3IIKA 1J8YF 4PHTA 4RD3A 3GPLA 2OXRA 6Q21A 4TZ6A 3B85A 1FQKA 2P6RA 2ZTSA 4DJTA 1XZPA 2QM7A 2JLQA 2QQ0A 3MRSA 4QG7A 3T35A 3W3AA 2VTKA 3SHFA 1IN6A 4XWKA 1FPMA 3OF5A 2P5TB 2IC5A 2KJQA 1S2MA 2IXEA 3KDSE 3LDAA 3LBIA 3FMIA 3L43A 3ZQJA 4R7ZA 2XB2A 1CP2A 1M2OB 4URVR 1Z2CA 2CE2X 4XIGS 5DLQC 3KFXA 3W34A 5GADl 2WJJA 1AQUA 3IKJA 3RS7A 3CB4A 2GESA 1JALA 3A58B 2AWOA 2FX3A 3B2EA 4YLGA 3I32A 1X3SA 4KI0A 2ATXA 3VAAA 1Z22A 1DAFA 1UBEA 4D6PA 1UEJA 3EIQA 3NEYA 1Q1EA 4NPHA 4JBXA 1D5CA 4B3DA 2REBA 5A4JA 5J4KA 2ZAMA 2IA5A 3FFBA 3M0EA 1SVSA 4B3FX 2JLVA 2R8RA 2GETA 2ZVQX 4G5GA 1R7RA 2JJ1A 3FMFA 4AYWA 3IPXA 1E2DA 2QAJA 3BJIC 2A5YB 1TEVA 3FMOB 4KJZA 4AURA 3TW4A 3RC8A 1K6MA 3W6PA 4FXPA 2FZ4A 4HB4A 4PC3A 4LHWA 4NL4H 1CRQA 2Z4RA 2CL0X 3SFVA 2JLZA 1I2DA 4RZUA 3Q85A 3U7HB 5J5CA 3NBYC 2FSIA 3KXKA 1KI2A 1WE2A 3Q3JB 1M8PA 3ZIAA 4HATA 3V00A 4AYXA 2PH1A 3C7KA 2IX3A 1MH1A 1XMSA 2XJ4A 2F7SA 5CJPA 1VYTA 2HXYA 4NYIQ 3ZIAD 5IK2D 2WWXA 3QKTA 4Q1FA 1D2EA 4D0LB 4GBMA 4O3MA 1TEXA 1P6XA 4OHYA 1ZNXA 5JS8A 3THXB 2WBLC 3SJAA 1QG4A 4PQFA 4DLUA 3LX5A 3KQLA 2MSEB 3BBPA 1ZIOA 1TTTA 4LJ6A 4DB2A 2FNAA 2F6RA 3LY5A 4OHZA 2CNWA 4Q1CA 3ZLJA 4HDOB 1XX6A 1W4RA 4RVCA 4LOAA 4C0BA 4MKFA 2C5LA 1G8HA 421PA 2C03A 4ZDJA 1KK2A 1M1YE 3OHMA 1WRBA 4KSCA 3VKGA 4HAXA 1IQPA 4M1SA 4DIDA 2R65A 2HEIA 2XB4A 2XEXA 3SBEA 1WDTA 2GXSA 3K1JA 1E9DA 2Q21A 4PHFA 4TMTA 1VIYA 5KPJA 3CRRA 1HT1E 4BFZA 1ZYUA 3DKVA 4ZCIA 3HYTA 2WWFA 2RMKA 4JVMA 2YZ2A 3PEYA 4HB2A 5GJBA 3M4YA 3NWJA 2IYRA 3EXAA 2WWIA 1RRGA 2O8EB 3NC1C 1UADA 2ZYTX 4KU4A 5FOVA 5JJIA 1P5ZB 2C78A 2JDIA 4DVGA 3EPKA 2H7VA 1PLKA 3EAQA 3T1TA 1X6VA 1CIPA 2J3EA 4LJ5A 5BN5A 3SJBA 1R0WA 5KPDA 1GSIA 3L2OB 1E9SA 5DE3A 2CLDX 4AG5A 4Q01A 1WF3A 1WMSA 4GNKA 1XFAA 1D2MA 4PPQA 3SYKA 4R2IA 2REXB 1SKYE 2GCPA 4GI7A 2IXFA 2FH5B 2YKGA 1IN5A 2P67A 5KU1A 2HCJB 5FOTA 3SQXA 3AV0B 1M6NA 1R8SA 3K70C 4LBVA 5L8VA 3DO6A 2GILA 1RW4A 1EXMA 8OHMA 2IUTA 1EFTA 1KKLA 1W4BA 1E99A 2C77A 4EJSC 1D9ZA 4BQSA 4XSHA 1H8HD 5IRCD 1OHHD 2DYKA 3ZVMA 4QGHA 4AC9A 1OH6A 1H8HA 3VKHA 4OL0A 5ANRB 2ZROA 4LC0A 1HUQA 1NBMD 2HV8A 5LD2B 1G41A 5IF9A 4QBIA 2GXQA 1CJUC 2E9SA 2QPTA 2ZU6A 3ZVLA 2EU8A 1XTJA 2WWWA 4WXPA 1SXJA 1Z0DA 4K81B 3AUYA 3CRW1 4B2LA 3OE7A 1TL7C 2RGNA 1EK0A 2CCKA 3GJ0A 4JIMA 1G3UA 1K5DA 3R7WA 2XITA 2ANCA 1UJ2A 4RFVA 1IBRA 2ZRNA 1IY0A 1Z0FA 5LB4A 3SDZA 1YZGA 5EP2A 1KSHA 1TAGA 3GLHE 3VR5A 2JLRA 3T12A 3REFA 4NCKA 2HT1A 3IIJA 4BFUA 3JZAA 4IDOA 3QI2A 2JATA 1AZSC 4Q9IA 4LJAA 1VG9B 1KKMA 4FCVA 1JJ7A 4B47A 3ZD6A 1T6NA 5EE3A 3SYNA 2ZS9A 1G8GA 3LWNA 3THYA 1FW6A 5IHPA 2HLDD 1I4DD 2BBTA 2OT3B 2RH5A 4KVAA 2G1KA 3QXCA 2PX0A 1E69A 4ABYA 4DLTA 1VCOA 3K9HA 4OK5A 2NPFA 2O0KA 2Z43A 4V0MA 5CIWA 4A8JB 1KHTA 4FMBB 3U7GA 2JLXA 5P21A 3CNNA 2O8BA 2RHDA 2ZETA 4HAWA 1XEXB 3JVVA 2QEQA 1N2CE 1R0ZA 2VBCA 4JL5A 2CHQA 2IS6A 3OZXA 4FMCB 4PZZA 3IBYA 3L82B 2A30A 5AJWA 4Q9JA 3TSOA 4QGFA 2FGJA 3DVLA 1RYFA 2PZFA 5CK5A 2AR7A 3GFPA 3JZMA 4E22A 5GVSA 4Z1MA 2A5GA 3W8NA 4Q4AB 1Z6AA 4LBWA 3X1ZA 2FV8A 3X2SA 2EWWA 1F2TA 1I4LD 2XXAB 3CBQA 4US1R 1ZAKA 3CF0A 4OJQA 1E9BA 1G19A 1PUJA 2Z5FA 5FUYA 4DUGA 1SHKA 3UXMA 4NCIA 2WKRA 5B64A 4UNQA 4DEXA 4Y0VA 4AIIA 1NP6A 2Q9BA 2OCBA 3HU3A 1XU4A 1Q1QA 2OO7A 1TPZA 3HDTA 3ZGXA 1AZTA 1LVGA 4Q00A 1FX0B 2ZRKA 4DSTA 3EZ7A 1F6BA 2P6UA 3TJZA 4TZ0A 1OFHA 2ONKA 3B1YA 2O8FA 4BEJA 4DZZA 1Z6YA 1JXMA 2VO1A 1LFDB 3FE2A 4A15A 2BBWA 1DPFA 1V43A 2W6IA 3LXRA 1RC8A 1U0LA 1EGAA 1IXZA 4OK6A 3EA5A 3MWJA 1SVWA 2R6AA 1R0XA 4XSGA 2F1HA 3ND8A 4JSYA 3FDIA 3VHLB 2ZANA 1G3IA 3O8BA 2EVWX 4M53A 3QKSA 3ICEA 4EPRA 2BBSA 3OESA 2GBLA 3MG9A 1TU3A 3EZ2A 3DMNA 4UNPA 1W1WA 4L9WA 1OB2A 1R5OA 3H0KA 2FEMA 2GVDC 2ZRBA 4GSYA 4A9AA 4DCUA 1F2UA 2VYFA 1YZNA 3T1QA 1AK2A 4GL2A 3GEIA 2HLDA 5FBQB 2QTFA 2V1XA 3MWLA 4DLSA 1TF2A 3VR6A 3WNCA 2J41A 1T3HA 2Z6VA 1KY3A 2ZE8A 4MGIR 5FPTA 2XNDA 4MYCA 4LHYA 5CM8B 3R9IA 3A1SA 5AJZA 1AGPA 4IXMA 2Q3FA 2XNDD 4Q48A 3RRNA 4GDFA 1KIMA 2WJYA 1C4OA 4A0FA 1KK0A 1QBKC 2GJ9A 1KI7A 1ZNYA 3LV8A 4JLDA 3A1TA 2VL7A 5G41A 3OE7D 2E1RA 1CJKC 2YHSA 4ZKEA 2G1JA 1S3SA 1U0HC 4B75A 1VDZA 4NYJR 1E9CA 2YINC 1MKYA 4Q03A 1N6NA 1E2GA 3BE4A 1W36D 2OAQ1 3QPWA 1IM2A 1XCMA 1ZBDA 3OFND 5HCIA 2ZE6A 1KJZA 3ADDA 2WPDD 2WJVA 5KDOA 1NIPA 1KZGB 2IWHA 4ZIRB 2HUPA 3MUFA 5FI1B 4B71A 4Q7LA 2PZGA 4MRNA 2C9CA 3RANA 2BMFA 3QXHA 4EPWA 4RJLA 3FFAA 1GUAA 4L5BA 1JR3E 2IYLD 4JLAA 3P20A 3BH0A 1A5TA 1XXHB 2WKQA 2W0SA 4TSFD 3TNFA 3U61B 5KSOA 1BMFA 1E2JA 2Y8EA 1T4GA 2X2EA 3EZ6A 4W7SA 2NMVA 1MT0A 4MGKR 2QMUA 3B1ZA 5HE9A 4A4DA 3GQBA 2DHRA 2XOKA 3TGPA 3KTAA 2QAGB 2Q6TA 3R8FA 3U60B 3VR2A 5H68A 1W5SA 1PUIA 2VH5R 4IW3B 2ONJA 4DDVA 3NVAA 2OAP1 1GWNA 2VSFA 5DN6A 2R9VA 2ZI4A 2FFHA 4B43A 5BQ5A 1KI4A 4EQ6A 3AH8A 3EA0A 3F3YA 3WRYC 5BYJA 5JJKA 4HDQB 2HXSA 1SXJB 4OKSA 4YXWD 1M34E 1NVVQ 2R44A 4ZO4A 5FL7A 4B3BA 1J2JA 2ZRIA 1KSFX 4CRWB 4NCNA 2X2FA 4JJZA 1GFIA 3NH6A 4DLRA 4JL6A 5BN4A 1R2QA 5K8TA 5JBQA 3PITA 3Q8XB 3HPQA 1W36B 4RD4A 4MRPA 1ZU4A 4P4UA 4MA4A 3HR8A 5DISB 821PA 2GCOA 4LC1A 3SQWA 3IPYA 1XMIA 4OQFA 1E0KA 1P3JA 2ZRLA 4QBFA 2RHMA 1FMLA 2XTMA 2ODBA 1BIFA 3K09A 3KJHA 3W90A 1W44A 4LUCA 3ZD7A 2JDID 2NO9A 4M9ZA 4V0ME 4X8HA 1CS4C
chains in the Genus database with same CATH superfamily
4J0JA 2ET6A 3I6BA 3PXUA 2WWYA 4NF2A 3UPTA 3WIVA 5JISA 1MO6A 2OL4A 2JKVA 2M32A 3EAGA 4FCWA 4LGMA 2XSZA 4BQQA 1PGQA 3ED5A 4Q1AA 2IV7A 2QYSA 3N9IA 3V32A 2FAXA 4GPTA 5LB2A 1NVFA 1JVSA 1YIOA 4TT3A 2I4IA 2PAFA 4LYFA 2EWMA 1WV1A 4JASB 3KETA 5F9HA 1V2GA 1OB5A 3PX3A 3IUMA 1ST2A 2JGJA 2V65A 1N2SA 3U39A 1BU8A 3BILA 1XKLA 1E7SA 1C4XA 3CINA 1E5QA 3KQVA 5FLEX 4LMBA 4Z7OB 1DAKA 1N6HA 1JHYA 1I4OA 2YHAA 2C9BA 4O8CA 1UH5A 4DA0A 4E4YA 5JDCA 4TXHA 1C50A 2FPSA 2ZJ1A 3R40A 1PFVA 2WB2A 1Y5MA 2Z1NA 4MQUA 5L7YA 1I13A 3ZEIA 3HP1A 3GHYA 5B7PA 2WWTA 1V3UA 3NTQA 1T3LA 5JYBA 2H1HA 4DCTA 1KP9A 3C6BA 3GY0A 4A16A 1CNMA 1ZHOA 1OAKA 3IUYA 4LSGA 3RF7A 1QIEA 4NSNA 4EJ2A 2F3RA 4IIBA 4L51A 2NU6A 4QFCA 3K92A 1FEZA 3UA3A 2HRQA 5E9QA 4M22A 1XZAA 1A3CA 2VC2B 1J09A 5JCXA 4C2TA 3KU4A 1VMKA 5JANA 3I61A 4YTEA 2GRJA 4N9WA 2HRBA 4PG6A 3KKKA 3RRJA 5KOYA 1MG5A 3CYFA 3E0QA 4G24A 3A9TA 4MWZA 4NU6A 4KWTA 3QE0A 3GZTB 3WK7A 3I8XA 1T9AA 1B3BA 1SPXA 4RLFA 1GTVA 3S6JA 5KWVA 1K86A 1TEHA 1Z8DA 3O1JC 4CL3A 5L3QB 3TQCA 2L82A 5AW0A 2XCOA 4GOKA 4TXLA 5A6SA 2ES4A 3WGQA 1DDIA 4IFEA 2FGKA 2BM0A 4QYIB 2XB6A 4RQBA 1PDOA 3AK4A 4WXEA 4YI5A 1QX3A 3EASA 3LRTA 3E70C 3M4ZA 4NYMR 2YN4A 3CX7A 1H4TA 1C1XB 1LRJA 3T7TA 2ACWA 4HN9A 3ANYB 2JW5A 3AONB 4OB6A 1VJTA 4CKWA 4Q7JB 3ABOB 3EDCA 2QTWB 4FKMA 3JZFA 3OOSA 4CFZA 1P5HA 2YJTD 5JAPA 1A8UA 5I8ZA 2OQVA 3E81A 1L5OA 3T4PA 3EGOA 1GPAA 1PW7A 3EIWA 3M5DA 5LQDA 1RJEA 3CKMA 3QKRB 4PSAA 3GJ8A 3GIDA 3WGHA 3K53A 3TRKA 1TLFA 3SFZA 2O23A 5LZ2A 1YQUA 3LA8A 3H5IA 4YRSA 2ZB2A 1G8JA 4HFRA 1ONBA 4NPAA 4A2QA 4D0GA 1JQLB 3EEFA 2UYHA 4ETNA 1CUYA 4O4LB 3QTBA 3HDVA 4I14A 3PRJA 3DMTC 5HZHA 4M6WB 1EM6A 1PT7A 3RVOA 3WRWA 3OWOA 5AK3A 4ALNA 3N59A 2K87A 5T4EA 3H1FA 3U4MA 3P5SA 4MKIA 4O4HB 4WGGA 4PO9A 3ED1A 1CJCA 3ZUGA 1SKMA 2GUGA 2WYUA 3G7SA 1MHTA 1L5MA 3VTFA 3JWGA 3ZU2A 1USIA 3P9KA 3P1JA 4LYJA 4ZKDA 5A5VA 5C46F 5LYJB 3AVTA 1Y0BA 1ADYA 4JELA 1LC3A 2C4MA 4DF3A 1G5FA 1SIOA 4IJUA 1HSZA 1Q17A 1E79D 3S1LA 2H08A 2EL9A 4RJKA 1S2NA 1I3OA 1A88A 1IBCA 2OKCA 1GNRA 3DEYX 5IN5A 4D25A 1D4ZA 2P4EA 2ZJ7A 1RWPA 2F8SA 3IAFA 1IEVA 3G82C 2UZ3A 1ISHA 2Q3CA 3AEUB 3K30A 4JJ6A 1CFJA 1RRKA 3VSBA 1P6UA 2X77A 4G9BA 4QU5A 1C29B 5CLHA 2WAYA 1NVVR 3E18A 1PQYA 4FPXA 1LNSA 1BGXT 3I5XA 2NV0A 2PZBA 4WN9B 4Y98A 1A8QA 4YI3A 2OBFA 2PGNA 3HBJA 5JT1A 4TKLA 2AOWA 5C5DA 4X92A 1RWOA 2GEBA 4KIJA 3BYZA 3CZAA 4I1SA 4MW2A 1CRZA 2IU3A 4QLOA 2WJGA 3OG9A 2JJYA 4QUDA 3R9KA 3TVDA 3UNXA 5A0VA 3IAS6 1EE2A 1PZMA 1CEQA 2LVBA 4JT8A 1R0KA 4RVDA 1F0NA 3FHLA 4J16C 5EMHA 3A6HA 4YB8A 4FZ5A 1WZUA 4JU9A 5CK4A 4Z4EA 2ERCA 1KQPA 2BMVA 3O8OB 2R6CA 4CQMB 4F5WA 3CN7A 7GPBA 1N2CA 2GFQA 1N9GA 1M2JA 3DFMA 1G0OA 3KKOA 3Q7PA 3M1YA 4PHCA 4PR0A 1QDLB 2A9PA 4NBKA 1EFVA 5DHFA 4ARAA 4EA8A 1QO7A 5PGMA 4Q3BA 3NCHA 1KY2A 1YR8A 2XZTA 4FDVA 3CWQA 3N0TA 1YSCA 3O21A 2VUIB 5FRDA 5I51A 1UBTS 3SDBA 1O9BA 3KYBA 4XM2A 1WETA 2ZRGA 3VU3A 3KVYA 1IXRC 2ACKA 3LTNC 1W5TA 4KO4S 1KZ1A 3QXJA 1PRYA 2AMJA 2WNIA 4ETIA 4BVHA 3IX7A 3RROA 3C5CA 1RZRA 2PLRA 2HL6A 3TJRA 2BD0A 1ZU5A 4RTKA 4F45A 1MB3A 2EG9A 3ECSA 1OT3A 2Q2OA 3MUNA 5SV2A 2QYHA 3S2UA 1R8QA 2CVFA 3O8DA 4BV2A 4FCCA 1R8JA 4IKPA 4Y0AA 2IHVA 2OUIA 1LDBA 2EFHB 2FZLA 4L0CA 4XQEA 2OGZA 2A9JA 2I3AA 3CTPA 3PHGA 4QBTA 3R5SA 1C4KA 4G07A 1UKZA 3ESCA 2BEUA 3ZDFA 1U9YA 4ZZIA 4TZ6A 4BV9A 4MI6A 4BP9A 1RM5A 4C3ZA 1BHQ1 1SC6A 3II6X 4CR8A 1L1QA 2JLBA 1MOZA 1KJJA 3FLMA 1P2GA 4Q12A 2ILVA 4DHWA 4F4FA 2SKEA 4ZOBA 2DY1A 5A02A 2A0YA 4KE8A 1UKCA 4RQAA 4JLUA 1TVMA 4PGAA 1WHTA 2IW3A 2NNWB 3DDWA 3DLPX 2BCGY 2ABWA 3N3BC 4DLAA 2XNKA 4N8DA 4QDKA 1N0UA 1OTXA 4BO4A 1F3OA 3JAMA 1QR6A 1AKYA 3OUUA 3OPYB 4RDCA 4JX8A 5C0OE 5EE1A 3BERA 1IWOA 2LRHA 1XZKA 3GT4A 1AURA 4IV5A 4U2KA 3PPVA 2DGDA 1WZIA 1OV4A 1P80A 3K8ZA 4P83A 4DMLA 4DY4A 5E6UB 4OX9Y 1U3TA 3DT6A 3FZYA 3LGAA 2UUBB 3PA8A 4J9VA 3VR3D 4V1CA 5AOBA 5DBEX 3NT5A 4O1MA 1PDVA 4N7MA 4QLBA 1QC5B 5JJ5A 4JVNA 2FN9A 2QT0A 2Z1MA 3MCAA 4D97A 5BOSB 2ZM5A 3DQZA 2B5VA 3BWBA 4XUCA 4AY6A 3G2PA 2ZYUX 3IAM1 1Z62A 3R4CA 1T5LA 5ALMA 2WMDA 1JEJA 2HZ7A 3O4VA 4HO1X 4B3XA 4IGKA 1BFDA 2XLCA 1TCVA 2HK8A 3ELWA 1HRKA 4CETA 3C1AA 5T6MA 5CDFA 2D0IA 3HA3A 2R6GA 4LI0A 5L3SA 1P5RA 4ZEXA 4BWFB 3RADC 4RVHA 4MV3A 4FLMA 4BMPB 5K3EA 4CM8B 5I7FA 1V9LA 1PYGA 4U6QA 1YE8A 2QGFA 3AY7A 5AJHA 1ISMA 3CRQA 1OUMA 1KQNA 4E31A 1QKKA 4KMMA 3GLKA 4UBIA 3U56A 3KALA 2BP7A 1ZVKA 4H9GA 4KXWA 3RCBA 3U4CA 3UAWA 3UWKA 5BMVA 3M3HA 1XLWA 3VJKA 4QNNA 3FSGA 1JP7A 4IOLA 3O4JA 3IV6A 2GRAA 4LOJA 4L73A 3FGNA 5CFNA 5K6AC 2ZT8A 4FMPA 3L4JA 3THWA 2VPXA 1PJQA 3CLSD 2ASVA 1EGHA 2DUNA 1TU4A 4R2MA 4EEKA 3SXJA 1OASA 1I3CA 5EIWA 5F1OA 3MD9A 1RXYA 1NATA 3FPKA 2PO7A 3OFVA 2P5YA 3VU8A 2AH5A 4IGAA 4MP6A 4WUVA 1FVFA 3SZOA 4BV8A 1FUIA 4M1ZA 4UZEA 3VR5D 3ZGZA 3G2NA 4R0VA 4PHGA 4RV9A 2G76A 3UICA 1RTTA 2I65A 2D59A 1PQUA 1NYTA 1HQKA 2OCKA 3SYMA 3RLFA 4J0QA 4M60A 2QRQA 5ALRA 4TWIA 3HB4X 4FINA 1TYEB 5DMXA 3UAZA 1I7SB 2ZREA 4R7GA 5I9SA 3RNLA 1UODA 2FDXA 3HFJA 2H48A 2EFYA 5IT9A 2CSXA 3P71T 4A8JA 3D7SA 2CHEA 2I8LA 3HRKA 3ASYA 3KM0A 4UJ3A 4YAUA 1J5XA 3L6DA 1QTIA 2Y92A 3MW8A 4E11A 1WSWA 1OI2A 2JJQA 4BNLA 1XMJA 2RK4A 2X1MA 5E4YA 1C8KA 1J21A 5JQWA 1CQXA 1Q21A 3RGGA 5J47A 1JR4A 1K7SN 3G8BA 1V7PC 2VPZA 3ETNA 4BQIA 1TZBA 2N75A 1H6AA 3DEKA 2CT8A 4AQDA 2ZRMA 2IUFA 4HDCA 5AW9A 5BW8A 3OTQA 1RKUA 3QV2A 4NJOA 5CM9C 1UWKA 1JA1A 3HO6A 5J4HA 1W48A 3AEQB 4DUGD 1YA8A 3ITNA 3I3OA 4DIUA 1SKBA 3SM3A 1H42A 2CZCA 5DGCA 2OA0A 1DKUA 1Q22A 4M1KA 4N8SA 3F7MA 1HLGA 2JZOA 1Z0AA 4UUBA 3I0ZA 4WA7A 4NV0A 4DG9A 4EYQA 5KQRA 1AT1A 1DBQA 2Z3VA 4OXXA 5DP2A 1SQ5A 3V80A 3RTGA 4QKQA 5HNKA 4CEHB 1T6YA 1DAIA 1Z07A 2G7MC 2Z04A 3KJGA 4G1MB 4DNFA 2XCUA 2VH1A 3EMBA 3T3DA 1P31A 5B2EA 1H2AS 1SFRA 1T5DX 4NBWA 4LXYA 5FPQA 5A4AA 2RGEA 1E4EB 5JSKA 3K1TA 3SNHA 3OEHA 1BE8A 3BQ9A 5JS1A 1JZQA 2QT1A 3WL7A 4REQA 3EC2A 3HKCB 4K9SA 1WUKS 3RC3A 1CUCA 4HGPA 4OSPA 5BSWA 2CJWB 5JXWA 5KIAA 4X64B 4I50A 5C1BA 1RPZA 3LNTA 4HH4A 3ZJUA 4BJ5A 3OM1A 2JFZA 2C2HA 3M6MD 1EFUA 2AOVA 4JLOA 3RYHA 5AVTA 2C94A 2UVPB 1V2HE 4DCJA 2GA8A 5I7VA 1OWMA 1G21E 3E1GA 1Q0ZA 4Z1OA 2DQZA 1N2OA 2QUBA 1WXXA 3CQ9A 5H0IA 2F1JA 4BUJA 1XRRA 4DW8A 5FWNA 3HUDA 1UMBA 4G1BA 1Z63A 3D4IA 4JT9A 1KU0A 5A3VA 2VJKA 3DEJA 3OT4A 4LNUB 4CCAA 1XXHA 4EM6A 3FPCA 3TIVA 3UYKA 4TLBA 5HQTA 1SCJA 2QUKA 4EUSA 4OMCA 3SS7X 1SHZA 2JIMA 1TOAA 3LQ1A 3Q8MA 4HJRA 3FMVA 2QL5A 4ZRNA 4ZDIA 2WYHA 5C2JB 2QW1A 3TX6A 4L74A 2WT8A 3WWDA 3FPAA 3CF2A 4C0KA 2XX3A 2QLTA 2QSJA 5HILA 2O2EA 2P40A 2ZRQA 1AF7A 4M8KA 1GFSA 1T2CA 2AN9A 2RBEA 1V25A 3KKMA 5G3YA 1TO1E 5THKA 3ZWBA 1QB8A 4I0WB 5K3FB 5JADA 3E5HA 4N5DA 4NOLA 5BV7A 1RYEA 1E64A 1FRVA 4LNUA 1MO4A 1QFXA 3GFFA 1FFGA 2W0MA 2NYVA 1X80A 1Y5LA 3U44B 3D4NA 3OUTA 2GEDA 2E89A 1MENA 3B1WA 3G0BA 3RM3A 1LPPA 3COJA 5AH0A 4NBRA 4WACA 3ER8A 1L5LA 2VH2A 1EXDA 1NJ6A 2NZWA 1B76A 2KI5A 2M98A 1TKAA 3NHPA 3ZHTA 3P9IA 2R5NA 1ECFA 1NVMB 4MLZA 3FCEA 5AJXA 1NY5A 1XZCA 2VHXA 2YVUA 1W0JA 1FSGA 3M33A 3N8GA 2Q46A 3FPBA 1SBYA 3EFBA 3BWCA 1YB2A 4XCXA 1PS9A 4EPYA 1W0JD 4IYRA 3ZKWB 1NAHA 4UPEA 5CDYA 4AUNA 4FMDB 2P1DA 3SCZA 1RJ9B 3PC8A 2PMWB 3TZQA 2AZXA 3U9LA 1I51A 4ER5A 2CF5A 2B92A 5I4CA 1O96B 1E5LA 2OZEA 4G1VA 4CN9A 1W93A 4LKOA 3R3JA 5CDHA 2BHLA 3U3KA 3VNAA 5A4IS 2E18A 3H5WA 4M0UA 5JDCC 1WDMA 1LLUA 4JP8A 1ISJA 4GVPA 3FCOA 3MSXA 1JPVA 5TMEA 1V5EA 3AUUA 3BFKA 3YASA 1XJ5A 5D51S 3WNBA 1Z36A 1JIQA 1L3CA 4LBZA 3UGKA 1L5NA 2RAFA 1TQ2A 3BTVA 1YK0A 5NULA 5B3KA 721PA 2B25A 1JEAA 2RHGB 2JLAA 1QVVA 3R75A 3DBHA 3TIGA 3WRVA 5B7QA 1NFFA 2P3QA 1N2GA 2RI6A 2ZUDA 1RI4A 1WXWA 1M7HA 5K3BA 3RVLA 3WV5A 2DSTA 4K40A 3T54A 4MS1A 2A67A 3T38A 3ZS9A 3LY8A 2B3TA 4G81A 1T3SA 2IEYA 3H9CA 1KWGA 3KVOA 4IMJB 2CMKA 1VYVA 3HEAA 4QASA 4QZVA 2XA2A 5GPBA 3S7TA 1PJSA 2DLCX 3E2IA 4XDHA 1MABB 4A1FA 4C0LA 1ZZGA 2VWPA 3G88A 3NHLA 5F64A 4O2RA 3B12A 3ZCUA 1T8WA 3E58A 3U13A 5CA1B 3HYSA 3USES 4WOKA 3NDBB 1FVXA 2YBDA 1GTZA 3CX6A 2YV3A 4QHTA 4A8PA 2FLWA 4HFMA 5FH9A 3RUPA 2I7VA 5ECGC 1RABA 4NCHA 2GAIA 4KITB 3HWWA 4P3XA 1QHHA 2PUJA 2FRDA 2VLIA 2XMZA 4L5IA 4WI1A 1QQAA 5HMMA 3C6QA 3NUQA 4R2XA 4HUQB 4DUZB 3BCSA 2VN8A 5JJLA 2AZTA 2N1BA 2Y0CA 2Y66A 2R62A 3O4HA 1MABA 2QMQA 4ZCLA 3VU0A 2NXNA 1FTSA 3ABQB 1ZCBA 3KWJA 4JZYA 3NTRA 2I1VB 4QGBA 1ZRMA 1U80A 3I53A 3WQSB 3RE1A 5I4IA 4OI1A 4UU1A 5HDQA 2HO5A 3UYLA 2P4SA 4YIKA 1NW8A 1N34B 1H1DA 1UBUS 4KLRA 1UXGA 3A1FA 4OGGA 4J6EA 5KYVA 3KD3A 3EVFA 2EX4A 5BSUA 2DBZA 3UOAB 5TIIA 4UW9A 1GNLA 3BIJA 3P9YA 2ZTVA 2AI1A 5HCNA 2JAUA 1JSXA 4OAPA 4A0HA 4DEYA 2F8TA 1EX9A 1RACA 1BKYA 3NBQA 3NOVA 1GKLA 4PCAA 4AO6A 1K89A 1K4KA 1QK3A 1AO0A 3W2TA 3D5QA 5HP4A 1KJ9A 2YQZA 2AFRA 1D2HA 3OLWA 4JT2A 2GCIA 4MWCA 3TDMA 3UF0A 1G8FA 2QBYB 2CNBA 1KFJB 2JCGA 3ME5A 4PO1A 5A1JA 5JMTA 3WC4A 1JTVA 1CR1A 2QU8A 4B6RA 1JUDA 5JCOA 1YI1A 4K1XA 2R00A 3BD8A 3OZVA 4Q24A 2VHZA 4Z51A 5K0BA 3KWMA 3OUZA 4GMXA 4ZICA 2ZUEA 1A72A 3SHVA 4G5XA 1W581 4ZHQA 1GN8A 4JC0A 2HWKA 4BKRA 4BHTA 3GRCA 4GOXA 4UPDA 1N4DA 4RFLA 3DOHA 3KJZA 2B1QA 4R01A 4H4EA 3T5GA 1DI0A 4WZBB 4CKEB 5HF5A 1Z33A 4K6GA 2FCAA 2DBQA 3RU7A 2P9YA 1U9IC 4NPCA 5AW5A 4MDHA 4U39A 4LX0A 3NASA 2VQFB 1DO0A 4DBLC 3OJOA 4A82A 3CN9A 4TYPA 4BZWA 1DU4A 1QANA 2GAFA 2QXTA 4HC4A 4TTJA 2FW8A 3JX9A 4Q3NA 5EXXA 2OQRA 3EK2A 5CCXA 2B5OA 2D2XA 2VPTA 1I32A 1TUGA 1QNFA 3HN6A 3NIFB 2E5LB 1CNFA 5KSYA 5KX5B 1LD3A 2FEWB 3FWNA 4HEHA 2WTEA 4EGJA 3K70D 3F4LA 1TJ5A 4U7PB 5HRUA 3EA4A 3IIEA 3JRWA 1WWKA 4PZEA 3OZEA 1R15A 3EEIA 1CXZA 1IBSA 1Z0IA 3CNQS 2JGNA 2JGRA 3F90A 4Q9DA 4EZEA 4MX8A 1NC3A 2EV9A 2AYYA 1PL8A 1PJ2A 2XHEA 1QAQA 2OMEA 3OTHA 4HSGA 3NUZA 3QW2A 3AY3A 2IHUA 4OVKA 1PNTA 4AP6A 1HNWB 5ARBA 1VLZA 3NT2A 1UKEA 2FWMX 1NX9A 4MJLA 4RWZA 3IL2A 1RQXA 1PF7E 2Q0HA 2QL6A 2OGUA 3P96A 3EFEA 1Z2DA 4M88A 1X3LA 5H1YA 4JI6B 4WKCA 4BLPA 1GT91 3R0ZA 4XDGA 4DB4A 5DCUA 3GZNB 1PHPA 1CR4A 2Q6VA 3JYNA 3ILXA 4KK3A 5G0SA 5TC4A 4G0VA 1PT5A 1Q11A 3K1AA 1V1RA 4G5YA 3S1AA 4B4VA 2HSGA 6GPBA 1PR4A 1ENPA 3WRXC 1SBTA 1MB9A 4URXR 1UMDA 2GLTA 4FLFA 4YRFA 2FPKA 2K5UA 4C4XA 3GLFE 2PQ6A 1PJZA 3P2EA 4UPVA 3CVYA 4FMCF 1N75A 3AF3A 4NBVA 4ARSA 3ND6A 3C3XA 3QE2A 3WZLA 5HTKA 3W9BA 4JBHA 2ZJ8A 4HVLA 3N7TA 2H1OA 2E4AA 2R5WA 2DT8A 1DDOA 3G9XA 3P2JA 3P26A 1Z0JA 4KXVA 4R71A 2O06A 3FVTA 3TRHA 4CLRA 2I1LA 2HC9A 3VDMA 1C8VB 2BVNA 1RI1A 4DR4B 3WKCA 3ZCQA 2WYIA 1KFKB 5A2QA 5D6NA 5GAJA 5FA6A 2PT5A 1S2IA 5KKCA 1XIVA 1VDMA 3KWLA 1JHVA 3GCGA 1NT4A 4MEBA 1GZHB 1VRVA 4BJ3A 3WHLA 4UQOA 1EESA 1EWRA 4J76A 2CEKA 4KW7A 1M10A 3ROZA 4EF5A 1WBJB 2B3DA 3BDVA 1GZVA 4FOLA 2BISA 1EFPB 4GXRA 2W6CX 4IHJA 3D7MA 3DTVA 3DVRX 1K9SA 1E92A 1U0OC 4H6PA 2DPYA 1RLJA 1MJGA 4U7GA 1QCZA 2AD1A 1Q44A 3VU9B 3M34A 4NCAA 5JNLA 1UFQA 1C1YA 1VI2A 3KFLA 3UT5B 5MN4A 2CYCA 2DFDA 2P2SA 3DEAA 4BP1A 3FDZB 4MRVA 5TY0A 3TMKA 3CNOA 3GEPA 3KHKA 4YMSA 4JBNA 5FQOA 3GFTA 1BG6A 3EPHA 1TU0A 1FYXA 3DQQA 5EJEA 4DUYB 1C81A 3REGA 4WEOA 2HCTA 3W2GA 2VTBB 3GX1A 2TRSB 1IJFA 1PFWA 1IN4A 4NFYA 1R5BA 3BB1A 3CVJA 4O2BF 2ACVA 3WGLA 2OLJA 2BFMA 2ICAA 4BX9A 1UBLS 4XD7A 4M1MA 4XB1A 5C31A 4HB0A 3TLGA 1T5OA 4C0AC 2HCRA 1R4MB 2OBYA 4MSUA 1H4QA 2YMQA 3WISA 4OUDA 2C9ZA 2C2XA 5EHNA 5EIHA 3UJ8A 1BDBA 4YACA 3QU4A 2FMUA 2Y93A 5JR3A 2JEYA 3LP6A 3IOCA 4LY6A 3GLGB 2UV8A 2H63A 4BOYA 1DKRA 3N2GA 4CGYA 3WO0A 3GAMA 1NQWA 1X1SA 5K6AA 5IVHA 5DLEA 1YTUA 1A95A 5COBA 4N7RA 2IH4A 5B3JA 2OD7A 2YZ7A 3RHFA 3ZK9A 4NMWA 1TCUA 4DCOA 2ARKA 4UM8B 4CTMA 4F9TA 4HNTA 3NVDA 4BLSA 4LC9A 3GLIA 1OD6A 1KI6B 4B32A 2R8OA 5D7BA 3EPLA 5DSZA 2ZRAA 1Y9ZA 3UFXB 3RJTA 4QDUA 2B7LA 3HVKA 1E0DA 3C8HA 5JZVA 3UK6A 3GARA 5AK5A 1ZK0A 2VIIA 3R0QA 1N32B 3I45A 4G01B 4AMYA 2JGDB 5HOQA 3GLTA 5K0NA 2ZRDA 4J91A 2D8AA 1KBOA 3CU5A 3WLIA 2BM9A 2D00A 3FOAA 3UB3A 4HVAA 3WHPA 4BX3A 5HX7A 1RXEA 1FNDA 2CXPA 5MGBA 2IY8A 3NFRA 4XCQA 4BMOB 1G6OA 2QLFA 3V1NA 2V9ZA 1HDZA 1BN7A 3HEBA 2E85A 4HPJB 3PPYA 1XQYA 3TQHA 2OZPA 5E2IA 1EB9A 1ZLYA 3EH2A 3GLIB 2MJLA 3MERA 1Z18A 2H5LA 1RYHA 2P9EA 3G02A 5DF1A 4I5GA 5FBWB 2O1SA 1CTQA 4J3NA 3EPJA 4JROA 3O0DA 3INRA 1NF3A 3LOUA 3INGA 1MCZA 4CEIA 1ZMOA 1Q57A 1FU8A 4WOCA 4YCJA 2VT3A 2OLKA 4BMDA 3RSLA 4AZTA 1ZY2A 2C83A 3KKLA 3QBEA 1R66A 2JPDA 4KXQA 1JS1X 1Q20A 5CVVA 1OF1A 3VNSA 3O82A 5IJZA 2HW8A 1GZ5A 2Q5QA 5FHQA 4QX6A 4DSUA 3A4VA 1OREA 2FK7A 3A3NA 3TQTA 1SXJC 2QVZX 3KSBC 4I19A 2VYND 3ZI4A 4OLAA 3HUEA 3CSSA 1G6KA 2PWAA 4CBVA 1X92A 5JD5A 4DDTA 3WK8A 2YRWA 4O4IA 2DTDA 1B6RA 3DOOA 1U8FO 2PRSA 3KLOA 3ETDA 2X7HA 1D6NA 4ARBA 4EDHA 1KOGA 3W3AD 2I2AA 4FW9A 2ZDHA 4IJ6A 2F55A 1YO6A 1DLIA 1R64A 2D54A 3LQ2A 1G6Q1 3D4PA 4AKHA 4IJ5A 4CMCA 3WNZA 4JYPA 2Z2JA 2FUKA 1XZQA 2ZBRA 4KWEA 3W5HA 5J2UF 4M49A 4R69A 5FTLA 2G6TA 4NDNE 5C1OA 4PX3A 1CJBA 121PA 2FW0A 3LLMA 4RY9A 5AFSA 1OTYA 1UXKA 7YASA 4MVYA 5AJUA 4BBZA 4RO0A 5CA0B 3HP7A 1GDHA 1ZESA 1Q95A 1UPXA 2AMFA 4M0CA 1GTSA 2P4HX 2YOHA 4AKSA 5K0FA 3QVSA 2PD6A 1J1ZA 3BF7A 2HUNA 2C1EA 3Q3CA 2Y1CA 4AP5A 4QOJA 4OXIA 3PXDA 5AR1A 5B1HA 4EABA 2QY6A 2XAUA 1RKBA 4CNBA 4A03A 4I1UA 1HFWA 3LAWA 1EP3B 2VRCD 5DULA 1LPBB 1KGDA 3BKXA 4JC5A 4I3HA 4NH0A 5ESXA 1B16A 3EY9A 1DXYA 3HI4A 4PGGA 1R9GA 2E4WA 4KMOA 2YCLA 4AJ1A 5CFOA 1P39A 4FFOA 1OE0A 2ZRPA 3MJEA 4W1SA 4BNVA 3CM0A 3UJ9A 1P4SA 3H1BA 4F3YA 5LQRA 5M34A 3HRHA 1K0UA 1JDNA 2G08A 3C3WA 2DKFA 1BDJA 4NV1A 1Y48E 3SKVA 3U62A 3ZN2A 2F64A 2KBEA 3A1NA 2B36A 5H7XA 3KQTA 3ZGNA 4BPBA 2DLNA 3CJTA 2GS9A 4J0IA 1P19A 3T94A 3PFCA 1CSEE 1YRWA 1ZL0A 4C0HA 2CXSA 4LWOA 4Z4CA 2EJTA 5BWLA 3JY6A 3FOFC 1VHLA 3ZUPA 5ER6A 2ATIA 4D8XA 5JMPA 2Q7OE 3RC9A 2HU5A 5U9CA 1T36A 2XUJA 1NVGA 1Z35A 2X8JA 2FZGA 4XI9A 1YBVA 1EFAA 4EG6A 4AJJA 3C1TA 1XU7A 3PF8A 4RKFA 1SA0B 3T15A 5AVKA 2AA3A 1EWYA 3L0SA 4ZYXA 3WYFA 2JD2A 4DREA 4UM9B 3AESB 1VJ0A 3FSRA 3W9SA 1AM4D 1JYFA 4W9RA 2QG9A 3B8EA 2IUYA 2I62A 5IH3A 2CJPA 4X20A 2VDLB 5CYOA 3UKJA 2F48A 2G63A 3THSA 4CQLA 2GJ4A 4PZ9A 2DWOA 1KYTA 2VF8A 1ZINA 3AFIA 3OPMA 3CR7A 4J2OA 3SJUA 1Y8QB 4JFAA 2OK7A 1AKRA 3DXFA 2YYZA 3PNLA 5MFPA 2O8DA 4DDKA 3K9NA 3AB3A 4JLPA 1BD4A 1W88B 4G3XA 4U8HA 4YYZA 3DPSA 1XNJA 1NJ1A 1YZVA 1KMCA 5LMZA 2WWRA 2PZEA 1KFBB 2Z9DA 1JQAA 2XQIA 3CHYA 2HA4A 2R5FA 1GLVA 2GD6A 2ANBA 1YRQA 2JGLA 5KWEA 2QTVB 1B6SA 2SCUB 3IV9A 2XIJA 2IE8A 3ANTA 1KO8A 2CVQA 2G82A 3LQRA 3QNMA 4JJEA 1OYOA 2XR1A 4PLCA 4QYTA 4WT7A 4Z7JA 4JI8B 4BDSA 3T3IA 1KXJA 1KOJA 3VR4A 1YB7A 1SG0A 3P5BA 3TDNA 4GP6A 3VUEA 3KJIA 1HDYA 1U1EA 3VNQA 2Y1XA 8ABPA 3C3KA 1D2CA 2I7XA 1TEZA 3TQFA 3Q11A 4W7HA 4GLFA 1DEHA 5F7ZA 4J2HA 3E05A 3WLOA 4AG6A 2YJ6A 3H5AA 3H87A 2EJUA 1Y7LA 3NBAA 5ILOA 1LK7A 2EF0A 3C8DA 1PR9A 3ER9A 4MQFA 3DT9A 4YPVA 2O7NA 2W00A 4PZYA 3G6WA 2ZIEA 4KX3A 5K3OA 3ZY3A 3J81k 3ERCA 2X0JA 5L51A 2BJVA 3LCVB 1WTAA 5EP4A 1GXSA 4DT1B 4V3CA 2BUBA 2H8GA 1C3EA 4C20A 4MRMA 1MOSA 4JL8A 3AR5A 4C7OB 1NT2A 2EEPA 4YONB 3SVTA 1HFJA 5JDIC 4YS6A 3K70B 3WBKA 4YUXA 2D4HA 4FILA 4H7EA 1ESDA 4NZ9A 3H8WA 5EHGA 5JPIA 4A8TA 4DSZA 2IHNA 4B3GA 1SKYB 2ZUTA 1NMYA 1HZJA 3WGNA 1Y7HA 2O3TA 2Z2KA 4JUAA 1RZVA 2PTGA 5ALPA 4CUJA 4HZGA 1N5KA 4A23A 5KQPA 2V7PA 1XYYA 3LW7A 3ONEA 5KYNA 2WIAA 1F2UB 3BXHA 3DV0A 3A2NA 1QYVA 1RP7A 4LF4B 2IYYA 5ALWA 5FD8A 1ZM4A 1V7ZA 1XUOA 2ZSIA 5DX1A 2AI2A 2XXAA 2NO7A 5IDVA 4ZQGA 4C14A 2J4DA 4YDQA 5F2NA 1S0UA 1VP9A 3TEJA 4EYSA 1UC5B 2AQIA 4KV7A 2AXEA 1LCIA 5G1OA 4EYKA 4QUEA 5JCOC 4FZVA 3GLGE 4RACA 1N77A 5TPWA 3K94A 3GA0A 1OJLA 1L8LA 1NTOA 4R2LA 4CEJA 3NS7A 4R3NA 2XZDA 2N47A 3JU3A 1OI4A 3JTEA 5K9ZA 1G5QA 1SC9A 1IJEA 5F73A 4PWZA 3VNUA 3TW8A 4JI3B 2JFPA 4KLNA 2HA5A 3PR2B 2IKSA 1QHEA 4DQKA 3KVRA 5JS7A 3UJCA 5LMCA 2BFPA 4Z4QA 2O52A 1V8DA 3U81A 1L1RA 1U9IA 3IO3A 3LC1O 3G8AA 2AXNA 3ZE1B 4D9BA 4PN3A 3ICCA 1NZFA 3NGLA 1NN0A 1FLDA 3JVEA 4TM7A 4LW8A 2JVIA 3QOXA 4ZJZA 5LLTA 4B9AA 1WHSB 3SBDA 4HXYA 4HGNA 5A7HA 4CODB 1V8FA 3CTMA 1BVRA 1WG8A 3DUFB 1D0VA 3FDJA 5DCYA 3SLKA 4FFBB 2GBIA 4RTQA 2OPBA 5CVTA 1U99A 1L4BA 2Q2WA 1GKUB 2WTAA 3KEFA 4R3UC 4FZJA 1AGXA 2QGNA 2JCVA 1Z7EA 1KYWA 2LW7A 5DWDA 4G63A 1IIRA 2AB0A 3H8VA 3MINB 4OQLA 3HI6A 3K8OE 5EXEA 4XTCS 5FPSA 1MTZA 4EMBA 3EW7A 2IY7A 1JSLA 3VYRB 1JGTA 5CIYA 1KYIA 3HV0A 4IIGA 4EFMA 4X65B 4NC9A 5HGJA 3WK5A 5JSZA 2JGEA 4LSZA 3V1YA 1MH9A 1HFKA 3A2MA 1KJQA 4DCPA 3DDSA 1HA3A 3FHCB 3K5IA 4EFKA 5I5GA 3S2SA 3K9BA 2XNHA 4DA8A 1UWVA 1KERA 3JSXA 4U9IS 1JPNA 1PEYA 1RXVA 1VSUA 3SIRA 3MJRA 3R7AA 4PCUA 2IZ6A 3ZHZA 3CPEA 2GNAA 1F48A 1P9RA 4BMXA 3GJSA 2OYCA 1VA4A 3DPIA 3ULKA 2Q29A 4ATNA 1T2NA 4R1SA 4D56A 1QIHA 1Z6PA 4I50F 4DNPA 1VIMA 3IOEA 3L84A 3NNNA 3PB3A 3BEOA 3GLHA 4I81A 4QATA 5BQOA 5ALOA 3RR2A 3N2EA 1CY4A 1USWA 4L22A 5JSYA 2QVYX 4BO3A 4JJAA 1GDTA 3VSDA 1A1VA 3TSCA 2AT1A 3AHFA 4ZIRA 4P4TA 1EP9A 1P33A 2QD1A 1Y3AA 3EUWA 1PJTA 1E89A 1V8OA 3IMKA 4LOHA 1Q7EA 3WGVA 1YQQA 1Z4QA 2ZULA 1D2RA 3TL2A 1Q7GA 3N70A 1I6WA 4IFTA 4PC1A 3K0CC 3ZS8A 9GPBA 2PA3A 2EKDA 2JAPA 5CG2A 2YN2A 4OHOA 5KNCD 1ZGJA 3I9V1 3RWBA 2MIIA 1E7WA 1TK3A 2PD4A 2ZPTX 5D3ZA 4UOEA 3RYCB 1X8KA 4OHXA 4YJFA 3VKWA 5G02A 3H04A 2JCBA 2E87A 4EPVA 4JENA 1CUWA 1C2YA 2PTHA 2PYZA 2YWGA 3RLIA 1W4ZA 2IEDA 3HDYA 4PSDA 4PZLA 1ZXLA 4AN4A 3JVIA 2C3YA 2VDUE 5EE0A 1E3WA 1A9SA 2ERYA 4JMLA 4ND2A 4PAOA 3OM0A 4DDWA 1XN4A 1M1YB 1JT2A 1OAOA 1R16A 4L07A 4WASA 4NDZA 2I03A 2FUCA 1IYZA 1QRRA 2P9BA 5J4YA 1DBVO 3HY3A 1BE0A 3LVQE 3O03A 4G84A 4Q9LA 5ES4B 4F96A 5HIAA 3WV4A 2W42A 2AMYA 1P1FA 1X9HA 2Q0XA 2QGZA 3ACDA 2CC2A 4ZC1A 4DSOA 3S1SA 1MU0A 1XBTA 5FADA 2J67A 1LY1A 1T3GA 2GJSA 3EXEB 4MQLA 4TMYA 4JYAB 1I6KA 1W73A 1I8TA 2VDKB 3ZGOA 5GV7A 3QXXA 4P5PA 1SBQA 2EZ4A 2XV1A 1HF3A 3ROEA 4XUDA 5LU8A 3ZIDA 1Z7WA 4EFLA 5HTOA 4OMUA 3IUJA 4K5QA 4WBNA 4D9JA 2V4MA 1TZ2A 2QW8A 4C88A 1ZJWA 3EWNA 2CBGA 5LQKA 3QLTA 2PZJA 1X80B 1KO5A 2ETXA 2FMTA 4AJNA 1OT5A 3ZVNA 4A6EA 1BS2A 3A05A 1JSZA 3EUAA 4DR1B 3L0ZA 1T1SA 4YA6A 1G7TA 2G06A 1LX6A 5CTAA 1G6HA 4UDOA 3W0LB 1GSOA 4EY3A 3O3MB 1EX7A 1QTRA 1U2GA 3F4KA 4R51A 4A6PA 1W85A 2AE2A 4ICIA 2W93A 3R4VA 4TWJA 1M2WA 3I3SR 1JLMA 4YROA 3O3CA 5TMDA 2G0NA 3R1IA 4PPGA 3DLBA 4HADA 1ZGBA 3KQHA 2HHHB 1KMHB 1R9NA 4B09A 4DMCA 5FWXA 3H4IA 3L4BA 1SUIA <