1SULA

Crystal structure of the apo-ysxc
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
195
structure length
186
Chain Sequence
MKVTKSEIVISAVKPEQYPEGGLPEIALAGRSNVGKSSFINSLINRKNLAQTLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPVIVIATKADKIPKGKWDKHAKVVRQTLNIDPEDELILFSSETKKGKDEAWGAIKKMINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTP-binding protein YsxC
publication title Analysis of the Open and Closed Conformations of the GTP-binding Protein YsxC from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 61
structure length 186
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1sulA00
4MDEA 1ZM7A 1LB1B 1BOFA 4YMSA 1U99A 4LJ9A 1V5WA 2AN9A 3BERA 2ERXA 3O8BA 4BFXA 3K9NA 2JDIA 1OYYA 2WM9B 2CHVA 2ZYWX 1W2GA 3ZVNA 3FE2A 2XXAA 3NIBA 4TMTA 4D26A 3K0FA 4KVAA 1VYUA 5AWFC 1AQUA 3EZ2A 1GG2A 5KOYA 2NPIA 2FNAA 2BWJA 1E9EA 5E7JA 4EPYA 2HV8A 3ZD6A 4AI6A 3KXKA 1DAIA 3QEOA 1X8KA 4JBXA 5FUVA 5IRCD 2LCFA 4IDOA 3U2QA 1E9FA 4KJZA 2GJAA 4URUR 3AP1A 3QBVA 1QF9A 3VKHA 2EU8A 4C0HA 4ZKDA 1P3JA 1IONA 2QT0A 4L5BA 5CM9C 1E99A 4Q00A 1SZPA 2ZRCA 2R9VA 3I72A 4H1UA 4MRSA 2FOLA 2PBRA 2YWGA 1NY6A 2O8DB 3UWOA 1E2KA 1OF1A 1SXJE 2F7SA 4JBYA 2G0NA 3H2YA 4PC1A 1VECA 3GLFA 4P4UA 3D7MA 2B7CA 1EG7A 4OK6A 4NCIA 3FTQA 1IBRA 4WZ6A 1ZNZA 2P67A 4JT2A 4KO8A 2GCOA 2ZPTX 4GMXA 4E07A 3FKQA 2IL1A 2OLJA 2N1BA 2FU5C 3PQCA 3ZZTA 2XNDA 4PO9A 2EW1A 5DI3A 4PAQA 4IDNA 4QNRA 4BLTA 3MWKA 3VX4A 4D0NA 3GJXC 4CEHA 3SHWA 1BO6A 1T91A 3U7FB 1EESA 1KAOA 4Q4JA 1CRPA 2BVNA 5FI0B 3C4JA 3EA0A 1JR6A 2H8KA 5F3WB 1W0JA 4EJSC 2RGAA 2QAJA 4HAXA 4A8JC 3NVAA 1GNRA 1T0JB 3M4YA 2GETA 4JYBA 3AF1A 4NZYA 4EQ6B 1YR6A 1G3UA 4MRNA 4ZO4A 4E22A 2IS6A 2IT1A 3DMNA 4Z1MA 4OI1A 4M1OA 3OHMA 4O3MA 1I4LD 3PCRB 1GDDA 1FQJA 2CXXA 3CNNA 5FFMA 4BRWA 4EKDA 5FTLA 4XTCS 2EFGA 2IUTA 4BWYA 3RSLA 4GOXA 4LYJA 4D0LB 2XJ9A 4D6PA 4DXAA 1OH8A 2UVQA 4BFZA 1D5CA 4ZDKA 1QBKC 1Z0KA 2I1QA 1KDRA 3EG5A 5FI1B 3WBJA 4G5QA 3Q7QA 3IBYA 2W00A 1G3IA 3ONWA 4JJKA 5JEEA 1LTQA 1B23P 1QRAA 1G8YA 2AWOA 5CYOA 3BK7A 3P26A 3TVTA 2J9RA 1G21E 3PJRA 2QN6A 2R44A 2F6RA 4X8MA 1XB2A 4LPKA 1RW4A 4XD7A 4QHTA 3QNUA 2WV9A 4O0MA 1E2MA 4IOJA 2WWXA 4IFBA 1D8TA 5IK2A 2ODBA 2AXNA 3B1YA 5FL7A 1EFTA 4QHYA 2QM7A 5P21A 1ZD8A 1EFRA 3FHTA 3QPUA 2OFWA 4R9UC 3K0AB 2ASEA 1KSJA 1MT0A 3B1WA 4Q1AA 1DAFA 4CEIB 2ZE7A 3Q3JB 4BUJA 3IIJA 2XGJA 5CIWA 1TPZA 1JJVA 4F38A 2ODEA 2Q3FA 2JCSA 1SVKA 1TNDA 1SVOA 2QY9A 3KKNA 1J99A 1K5GA 1C4OA 1CEEA 1OIXA 2BCJQ 1K8RA 2PL3A 4GT1A 3PUXA 2QMOA 2ZREA 2QU8A 3FKSA 3SFVA 3WXMA 2O8DA 3X1ZA 1UKZA 2VEDA 3NEYA 2QRNA 3QF4B 5A5GA 3FMIA 521PA 1RJ9A 3NH6A 3H4MA 1JEEA 1NBMA 4NCKA 2GEDA 1T8TA 3B8HA 3G5UA 4LHWA 3SJZA 4EPXA 4FI3C 1UFQA 1G3MA 3CONA 2DPXA 1N6KA 4W9MC 2KE5A 2MSCB 3EC1A 5C4GB 2N46A 2XB2A 3GLFE 1BKDR 5JJLA 2DY1A 1P2TA 1YQTA 2CE2X 2CDNA 4W5JA 1OH7A 2X2FA 1GITA 3IILA 5GJVC 4HLQB 3RS0A 3KX2A 3RRMA 4IFEA 1GTVA 1XJQA 2WJIA 2YJTD 2FSIA 3NBZC 3ETLA 2OFOA 1FNMA 3I32A 1F3OA 2RHDA 4AURA 1RC8A 3LA6A 4A0GA 3SYNA 4ZI2A 4KODA 2QUZA 2CHQA 3T12A 4EQ6A 4CGZA 3UPUA 2RHMA 1EX7A 2ZJOA 2R6FA 1R5NA 3HU3A 2GCNA 3CNOA 1IY2A 4LYAA 1VMAA 1I4DD 4DLVA 4W5HA 1LF5A 3I8SA 4QJ4A 3BIFA 4PSVA 1KKMA 3CWQA 1CJTC 2JJ2A 4HUQB 2ZI9A 4ILEA 4FMDB 1MRSA 3AQ4A 4L15A 1ZUIA 2EVWX 2GJSA 821PA 5FTMA 5ANRB 3T35A 1NN1A 2VHUA 1W5SA 2NIPA 1GWNA 2BOVA 3HYRA 4AYTA 4RVCA 4OYHA 3K70B 1UKEA 4XIGS 3CX6A 5CJPA 4C0QC 3AV0B 1KMHB 3IHLA 2GBLA 1II8B 1JJ7A 2DR3A 1NG9A 1MV5A 3A8TA 3B60A 4RZ2A 3EPKA 1AGRA 1E94E 2PT5A 3THOA 4DLSA 2GCPA 2WVJA 4RD1A 2ZSEA 5AUOB 5BW8A 5JSZB 3VNVA 2IYLD 1AIPA 4HB0A 4A9AA 4NYJR 5EZ5A 1SHKA 1UAAA 1T6NA 2IHYA 3EC2A 4Q4LA 3SN6A 1CR1A 4QKQA 2ODWA 5EP4A 4DKXA 3QXCA 1TEXA 3QY0A 1ZD9A 1ZM4A 1L7VC 4IDPA 3S1AB 1TMKA 3IEVA 2J7KA 3CW2A 4P0TA 4CEIA 4FMCB 4AD8A 3AUYA 4KI0A 2PH1A 5TY0A 4UXIA 1GVNB 1FPMA 4OHWA 4P3YA 1COWA 4A4DA 2O0JA 1KSGA 2CVHA 2PCLA 1HTWA 1P5ZB 1FQKA 2FZLA 1XTJA 3BB3A 2A7QA 4GI7A 2G1JA 4M9QA 2PZEA 3IQXA 5J47A 5JBQA 1E69A 3KQHA 2JGNA 2W6JD 3HR8A 4MGKR 1NLYA 4LJYA 3W3AA 1XTSA 2J87A 1XCPA 3QF4A 4EAQA 5LBIA 3PEUA 3GEHA 2PX3A 4YMTA 3PEWA 1TUEA 4MH0R 1SKYE 3T5GA 1DG3A 5JECA 3IBGA 1NL3A 4WIAA 3QOFA 3SHFA 1OXXK 3UG7A 3QUSA 4JZKA 1KDTA 2ZJBA 3P32A 2OLKA 4IVRA 2ZJ2A 4LJ6A 4JLDA 4JSYA 2ZS9A 2WICA 2GXUA 4B2PA 1K6MA 1FP6A 1WXQA 2NO7A 3WP0A 3WMGA 3T1QA 1BMFD 4CZ2A 3UG6A 4ARZB 3D8BA 3G0HA 5FOSA 2RKOA 4ABYA 1XBTA 1KZ7B 2FV8A 3CPJB 4OL0A 1ZYUA 2GKSA 1VHTA 4QRHA 1ZRHA 1TU3A 1XF9A 1XTRA 4KAXA 2F3RA 1N3BA 2D74A 5KDLA 5KPDA 2CMKA 4O25A 4ZPXA 2VBCA 1N0UA 2JEOA 2Z4SA 5EE5B 5BWMA 1XWIA 1UBFA 2XSZA 3ZJYA 3KJIA 1IY1A 3JZAA 4TTRA 5TDHA 2V1UA 2ORVA 2B21A 1DO2A 1NLFA 5JLJA 2CLDX 3CH4B 3THWB 4GOKA 1Z6TA 1E3MA 2ZI7A 5TXGA 4Q7KA 3BD9A 1O3YA 1IXSB 1FOEB 2QGNA 2RGEA 4HUQA 4PR0A 1VDZA 4C0LA 3THYA 1YRAA 1M8PA 2FWRA 1B0UA 1ELOA 2OBMA 3X1XA 4FD2A 4HAWA 4EIWA 1LNZA 1QHIA 2ZUCA 2WKQA 4XTRA 3R8CA 2XZOA 5F2EA 2IXGA 3AB3A 1EFHA 4ZCMA 1LY1A 1AQYA 1II8A 3KKPA 5LD2B 3DL0A 4DLYA 4C4PA 4PX9A 1JR3D 1ZNXA 1Z22A 4WXPA 5CIQA 3T1TA 5JSZA 4Q47A 3TQFA 3CB4A 4OQMA 5G40A 2RGCA 4A2QA 1G20E 1Y63A 2GBLC 1NRJB 4QXAA 2CK3A 3NHBA 2BCGY 3CRMA 3CF6R 3N2EA 4ZCIA 1T3LA 3DO6A 1KI8A 5TV2A 4DIDA 5KSYA 1P2SA 1FUUA 2KBFA 4XWKA 5EXXA 1TU4A 2BM0A 4AC9A 2AK2A 3O47A 3BB4A 4OHYA 4NCNA 4LJ8A 4PO1A 4CDGA 3WYAA 1G5RA 2FFAA 3BFXA 1UEJA 4DLXA 5FPHA 1VG1A 3GJ3A 1IAQA 3TJZA 4B3XA 4BLRA 2F1RA 4LJ4A 2C8VA 5FL3A 3EW9A 2VTKA 2WBLC 2ZYTX 5UKDA 1L4UA 1TX4B 1XFAA 3EZ7A 4HLUA 1G4AE 5EXSA 5G53C 3AGQA 1YKSA 4AWXA 2FN4A 4NYIR 5G41A 1Z0FA 3GMTA 2KB0A 2I4IA 4BFYA 4QC2A 3KJHA 5F98A 3LAWA 2QROA 4V03A 4G1UC 2WPDD 1P61B 1KKLA 1ZC3A 4TL6A 4PZLA 4GMDA 4QM6A 4KVGA 2EFCB 2V7QA 3RNLA 1G8FA 1TF5A 1KO4A 1E2QA 4MITA 3TIFA 4CT5A 3AVXA 2V6JA 5EXPA 4AKGA 1LFDB 2C5LA 3ZGXA 4HATA 4RKEA 1ZNWA 3WBKA 5CITA 3WYGA 3DMDA 1VYTA 2ZROA 3OFND 5SZIA 4ARZA 5KYKA 4NMMA 3KQKA 1GL6A 2FX3A 2PZFA 2CL0X 1E4YA 1CIPA 4X8HA 1KI9A 5KUTA 3OEHA 4M2LA 3VKWA 4HEJA 2ONJA 2IC5A 4WBSA 2ODNA 1S9DA 2QP9X 3LO5A 4RJLA 5G3ZA 4LI0A 2OXCA 2QM8A 3U7GA 1YR9A 3QQ5A 3VHXA 2AFIE 3BORA 4IVQA 4QOSA 1MR3F 1S2MA 4NCHA 1OYWA 1TTTA 4BZPA 3QXSA 1DAHA 1A2BA 3KFXA 2VF8A 2GTPA 2A30A 2GRJA 3GJ7A 2F43B 1RRCA 2FFHA 4EJSB 4URYR 1XPOA 3NC1C 5KSOA 1W0KA 4HLDA 4RZUA 4B71A 1FMJA 3H0KA 2W83A 4RZXA 4AG6A 5JJKA 2IYRA 4HAVA 4DSOA 3NKVA 1VYVA 1PVOA 4LSGA 3AUXA 2GXSA 3ZH9B 3K70C 3I4LA 4M0LA 1KOFA 3D31A 3DM9B 4TQUS 4QBFA 3BFKA 1OSNA 2RMKA 4BECA 5K8TA 2FDCA 4A6XA 4QBHA 4P4SB 4C2UA 1IY0A 1OHHA 4C0BA 3PG5A 2V54A 4I1UA 4Q19A 2JJ1D 5LB2A 1R10A 3R20A 4FMCF 1OH6A 3SYLA 4M9SA 1R0YA 3P1JA 1Z2CA 2D4HA 4D25A 3TAUA 3ADKA 4BQSA 3L8ZA 1HEIA 2Q3MA 4Q1BA 1WRBA 3ZIAA 2VH5R 2ZU0C 2YC2C 2ZU6A 3VKGA 1IXZA 4XSHA 3G82C 1Q20A 4V0MA 2J3EA 2HYDA 3L43A 4JSTA 4GZMA 3BRWD 1DOAA 3OE7A 2BBSA 4HLUC 2NGRA 4AG5A 4EFLA 4MQBA 4S2EA 2BMEA 4N3NA 4TTQA 1YR8A 1Z5ZA 4HUTA 2H1LA 2GXQA 4I81A 1VG8A 5DISB 3J81k 1Q21A 5FPSA 3KJGA 2OM2A 2RGXA 3MLEA 5FOXA 4GNKA 1SXJD 4E03A 1GILA 4IOLA 2J0UB 4B2LA 5LDDC 4KCGA 4HDCA 3D3QA 4LBVA 5L3SB 3VX3A 2HYIC 4DBLC 1AJEA 3CM0A 1WP9A 4TL9A 3VAAA 2NO1A 1AKYA 1ZNYA 2QE7D 1UADA 2F1IA 2UKDA 1E9AA 2VIIA 4JL8A 3SE0A 2FA9A 4C9BA 3EPLA 4OI2A 5CDFA 1Z07A 1VCOA 4QGHA 1CR4A 3BFVA 2V6IA 2PMKA 3QXJA 4PSKA 5F9FA 1NKSA 4ACAA 3FPAA 3SI7A 1ZP6A 1NKTA 2GEUA 2QORA 2D06A 1E2NA 1GKUB 1HV8A 2B8TA 4IEEA 4QM7A 3NG1A 1G5TA 2XJ4A 4JJZA 3OAAA 1OFUX 4C0KA 1CF4A 2XOKA 4WVFA 3TUZC 1XXHA 2FGJA 3FWYA 3K9LA 1R2QA 3ZQJA 3RS5A 1NVVQ 3EASA 3GEIA 1XDBA 2OESA 4L9WA 4TLDA 3W8NA 2ZR7A 1XEXB 3SQWA 2F43A 4AKIA 4EJSA 4IOKA 1ZU4A 4Q7JB 1HA3A 2QZ4A 2PT7A 3U3JA 4A2WA 1RYHA 4YDSA 3WNCA 3AP3A 1DBSA 1VCMA 1KI3A 2BJVA 4JLBA 1Q1ZA 3IKJA 4WZBE 4RD4A 1M1YE 4O2LA 3NBFA 2H57A 3SOPA 5LD2C 2FSFA 3FYHA 1Z29A 1P72A 2ZRDA 3LX8A 5FUXA 4P4SA 4TMWA 5SZKB 1D2EA 3Q72A 1IN7A 2A3RA 2JASA 2NO9A 4ESHA 1VG0B 1H8EA 1ZD1A 2EYQA 2C03A 2NG1A 3AM1A 3KJEA 2CNWD 4M1MA 3LLUA 2HJVA 4BFVA 5KNCA 1KO8A 1G17A 3U4QB 3UK6A 2JLVA 4II7A 4F4CA 4KFSA 4K8OA 4I1OA 3TUIC 1IN5A 2X8AA 4AKHA 2ZE6A 3RWMB 3B82A 1F5NA 1R0ZA 4OI4A 4P31A 5DO9A 3K9HA 3KZ1E 4M1KA 1Q1EA 2XZPA 2J7PA 4Q48A 2G83A 2A5GA 2P3SA 2ERYA 5HCNA 1E9DA 5DIFA 5C2JB 2BBOA 4XVQA 2O52A 2PEYA 4B3DA 2WHXA 3B85A 4B33A 4B6EA 4BLOA 1SKQA 3N5CA 4MKGA 4TTPA 1XEWY 2JATA 2P0EA 3B9PA 1OW3B 2QQ0A 2VHQA 3OIYA 4AY2A 4L16A 2OG2A 2ZETA 3LLMA 3T1OA 4DHEA 1XD9A 5CK4A 4E5UA 3DVLA 4IDQA 2J0UA 5DN6D 2QSZA 1SGWA 2R8RA 5L3SA 1RRPA 3GLGB 1W4BA 1U2RA 3AP2A 2JLSA 4IHQA 1OJLA 4MKFA 1IM2A 1YE8A 2WSSD 2ZRGA 1ZU5A 3A1SA 4DUGD 2VP4A 2E1RA 2ZAOA 3QVVA 2ZUDA 1A5TA 2ZI4A 4MYTA 4QBIA 1G3QA 2GVDC 1JQJC 3I5XA 1W5TA 4PHHA 4QNMA 3KTAB 3KUCA 3T1VA 3H86A 2O8BB 1Q44A 2AXPA 2W2XA 1ZVQA 4OK5A 1C1YA 5K8IA 5FTJA 1YZQA 3EPHA 2HXYA 3TE6A 3BB1A 1KMQA 4BLQA 2CVFA 1T5IA 2CCGA 3CRRA 1XMSA 1IN4A 2DFTA 1X1RA 3OIVA 4CEJA 3SBDA 1G6HA 1P9NA 1DPFA 2RCNA 3GPLA 5CDFE 3NWJA 4PPGA 3DZ8A 1R7RA 4TLCA 5HPYB 4OHVA 4MYHA 4TL7A 3QVUA 2WWIA 1OKKD 2CL6X 2ZE5A 2A5YB 3WHKA 4DCSA 1E0JA 1OT3A 4G0NA 5H70A 3LVQE 4DDTA 3K1JA 1EXMA 5BQ5A 1U8YA 2JLWA 3OIWA 5FPKA 3GFTA 1K5DA 1FNNA 1KZGB 5KU1A 4M22A 3U60B 2ZI3A 1KJYA 3CPHA 3QEJA 1J7KA 3B2EA 2VA8A 1OLOA 3GFOA 3TSZA 3MUFA 4FIDA 2GHIA 4TL8A 1E6CA 4JVMA 1FZQA 3FHCB 2CJWB 4A36A 1W1WA 3IGFA 4MRPA 1XXHE 3B9QA 5JWHA 2RGDA 3R8FA 5CLLA 2ORIA 2XX3A 5HKKD 2RAPA 5FPYA 5B64A 2W0SA 2O8EA 2IA5A 5D3MB 3TMKA 5BN5A 4DCNA 2H18A 3EZFA 5KNBA 2J0VA 1U0JA 4UNPA 1J8YF 5L3VA 1H8HD 2DWQA 4M4SA 2R65A 1U94A 1G8GA 3A1TA 3SC3A 1U8ZA 4TSFD 3DKVA 2RGGA 3E1SA 1KO5A 3RHFA 3ICQB 2MMGA 5B58C 2IWHA 4M1YA 5C4MA 3LXRA 5D3QA 2VL7A 3U4QA 3TRFA 4KU4A 4QJ3A 2WZQA 3ADCA 3V4RA 221PA 5SZHB 3TKLA 3RANA 1MH1A 2REOA 4HAUA 5HE9A 4UNQA 1G16A 3GP8A 4FCWA 3GFPA 2VP9A 3ZD7A 5IHPA 2AD1A 3QBTA 2IYZA 3UXMA 2IK8A 1AS3A 1W48A 1Q1BA 1Q3HA 4HAZA 2E87A 3BWDD 5KDOA 3CO5A 4X8LA 3KL4A 2O8FB 2A5JA 3BS4A 3K0SA 2FSHA 4A6PA 1NI3A 2WKPA 3LD9A 2Y8EA 4PPFA 4Q1FA 1VG9B 2G1KA 3EPJA 1E2GA 5FH9A 4F4JA 1QHXA 2Q9AA 3MCAA 5CLQA 1OFIA 4LY6A 4FCVA 2XTNA 4HB3A 1IOZA 1N6HA 3KKMA 4KSCA 4I1SA 5EP3A 5KSZA 4KLNA 5DHFA 4K81B 1KK1A 4JLJA 4YONB 3FMOB 1RRFA 3CR7A 4Q02A 3TH5A 2O8BA 3ZVLA 4JLKA 3LRPA 4X8OA 1OFTA 2ZI5A 3R9IA 2FPMA 1KJZA 3U44B 4W7SA 3E70C 4DCUA 2QAGC 5JWRA 1OXUA 2IX3A 1VTKA 2BM1A 2BBTA 3OESA 4OK3A 1II9A 1YZKA 2RGNA 1XTQA 2QNRA 2C2HA 4JLOA 1RKBA 3R9XA 4JL5A 2GEVA 2A78A 2IYTA 3CRW1 5F9HA 2OILA 4IEIA 2WSMA 2WJGA 2F3TA 3A6PC 2VHTA 3H1TA 4JS0A 4RFVA 3TGPA 2BDTA 5GADl 2PCJA 3T5DA 1W7AA 5AK0A 1QHHB 3OZXA 1NG1A 3SZRA 2CJWA 1CXZA 4BPBA 1S0UA 4Z54A 4WAUA 1S1CA 1W4RA 1W44A 2H17A 3TW4A 1UDWA 2FPKA 3AVWA 5D3MA 2ZEJA 3K09C 5AUNB 1Q22A 1YZLA 2R6DA 2GNOA 721PA 1OE0A 1EX6A 3PUVA 1E2LA 4HAYA 1G7TA 2HLDD 1DG1G 2FEMA 2HT1A 3RS7A 2YOGA 1KI4A 4TYPA 3A4LA 3HJNA 3LBHA 1AK2A 4TMZA 5C46F 1E1QD 3DKPA 4OQNA 1Q3TA 2ZI6A 1U81A 1TQ6A 1GZSA 1ZINA 4JLAA 1E79D 1E9SA 1GKYA 3R9WA 1UBCA 1X3SA 4JLPA 2Z5FA 4GDFA 2QPOA 2BEKA 3LBIA 4F4IA 1SVIA 3DDCA 2YINC 3BAFA 3NBXX 5JI2E 3GLIB 4LHZA 4Q5IA 3SYKA 4DLRA 3QPWA 5K8LA 1S8FA 1EFUA 1N5LA 4GZLA 4GBMA 2A2ZA 1PUIA 3LVRE 5DE3A 3ASZA 4NCJA 3A58B 2CBZA 1NJFA 4OQLA 3X2SA 4HYYA 1DTSA 2FSGA 5AUQA 2O8FA 1ZM3A 1D9XA 1P75A 2OSBA 5J4LA 5CK5A 1PV4A 2BV3A 2QMUA 1KSFX 1XEWX 3B5JA 4P33A 2XTZA 3K0AA 2ZM5A 3DPUA 1GNPA 4C0JA 1S3GA 4PC3A 4FINA 4NYJQ 4U7DA 2ZTSA 1E1RD 1EK0A 5DYIA 3T15A 1VIYA 3FFAA 4U5XA 3D6TB 2A5DA 1Z83A 3M1IA 4G3XA 2WAXA 4BEJA 1NVXQ 1QVAA 2ZRPA 1WE2A 1DAEA 5DI9A 1G9XA 4TQAA 2QTVB 4PXAA 3BGWA 1OIVA 1WBBA 3PENA 2G0TA 1XX6A 1IXRC 2BKEA 1VCNA 2B8WA 3I73A 3U44A 2XEXA 1KNXA 3K9GA 3TSWA 2R6GA 1N6NA 4NPHA 4QGGA 3LW7A 2QA5A 4A82A 3SFZA 3PEVA 3OEED 2YNMA 2ZIAA 3EAQA 2GJ8A 2JJ8A 4LOAA 1LS6A 1XTIA 1KJWA 2J5XA 3LW8A 3UANA 1T4GA 1NVWQ 2KBEA 3ND9A 3RVBA 3OF5A 2Z0MA 3ZZUA 3PVSA 2HUPA 3E5HA 2BIFA 2RGNC 4PSAA 1MKYA 4RFSB 1NBME 2W58A 1BH2A 2GJKA 1DVRA 3QJYA 4PPQA 4G5RA 4PANA 121PA 3C15C 4U02A 3N2IA 2W6JA 3CKLA 1A1VA 1QHHA 3C16C 1FTSA 2PX0A 5DYGA 3AVTA 5KO2A 2AK3A 2D2EA 2QEQA 1F48A 4V02A 4LWZA 1VCIA 2CE7A 1VHLA 3AVUA 4Q4AB 4P32A 3ND8A 4MKHA 2WIBA 3SJCA 3NTUA 4A15A 1HYQA 1G1MA 4CF7A 2QBYB 3RS4A 4GP7A 1LS1A 1Z2AA 4ASUD 3SDZA 1P62B 2B7BA 2ZUBA 1Q1QA 1BYIA 4NH0A 1HT1E 2IUSA 2MSEB 1WA5A 1G7RA 3GCGA 1Y3AA 2AFHE 5J40A 4DLWA 3RC3A 4B6FA 3GJ6A 4ITRC 1BMFA 2BEJA 4MGYR 1XJ0A 1CR0A 4ON9A 2NMVA 2C95A 4OQXA 2KJQA 2K5UA 1G3RA 1N5KA 1II0A 4TYYA 2G88A 1GL9B 4BEBA 3GLHB 3PUWA 3QKSB 1KMHA 3E2IA 3WMEA 2JIZD 4IDHA 5EUQB 2R6AA 4NU0A 4YQFA 4G5SA 5KTYA 1GFIA 1OB5A 2GESA 1DAGA 4QGFA 2ORWA 3KXLA 1M7BA 5GVRA 3U5ZB 2H7VA 1Z0IA 3PR1A 1YR7A 4IJMA 3KB2A 4HDQB 4LYFA 3B6EA 1G8HA 5JHHB 4DDUA 2ZSBA 4MDFA 2WJVA 1Z6XA 4ZV4A 5JS8A 1KDPA 3S1AA 1TADA 4DRZA 4EFNA 1HUQA 2QQEA 3QKUA 4EPTA 3CRQA 1T3HA 4Q1EA 3U6BA 3M0EA 3AF4A 4DDVA 3EARA 4UXJA 1GRQA 1NIPA 3ZYCA 4DLZA 4LX0A 1P4SA 1E9RA 4Q9IA 4WXRA 2H92A 4GPTA 3VR6A 1WDTA 2F9LA 1AA9A 2IXEA 2VO1A 3RS2A 4RD3A 2DB3A 1R5OA 1E32A 5EUMA 1JR3A 3PIRA 1RVDA 3QXHA 1G6OA 4DSUA 4XSGA 5JWOA 3VU9B 2KI5A 3MGCA 1LV7A 1JAHA 1JBKA 4YMUA 1EFCA 4ERNA 2VQSA 4PC6A 2P5TB 3RC8A 5TB5A 4IKEA 2D62A 3AVYA 4DB4A 4NYIQ 1S4QA 3C5CA 5AJYA 1NN0A 1Q12A 1NJGA 1X8LA 3L0OA 5E7IA 2HEIA 1GP2A 4LHYA 2V4ZA 3P4XA 1L8QA 4F7WA 4RFSA 2XZLA 1YRBA 3MJRA 4LBZA 1BYUA 1H65A 1TL7C 5TVKA 2IYWA 3AGPA 3RAPR 5KDDA 1IJFA 5HCIA 4GRAA 3LH5A 1N25A 1W46A 2EWVA 1KY2A 1N6IA 4LC1A 3I5YA 5H68A 3BE4A 2WPDA 1E2JA 2G77B 2HXSA 3KFVA 2OXRA 2ANCA 4KLZA 4Q4AA 3U61B 4TT3D 3QE0A 1RYFA 1ZAKA 3W6OA 4F91B 2REBA 2QBYA 3KKOA 3TR5A 2AX4A 3QSYA 2YWFA 2QG6A 1E0SA 1SXJB 2KSQA 2VP6A 1A4RA 3K0CA 3X1WA 3THWA 4WA7A 4CIDA 1CTQA 4BLPA 2XTMA 1ZM9A 4C7OB 2GK7A 4R2IA 1F2TB 1L4YA 3TNFA 3IO3A 2ZJ8A 3OFNA 4I1VA 5KPJA 3O8CA 2O5VA 2YKGA 3ZZ0A 4Q1CA 2YOFA 1HQYE 3ICEA 1NY5A 4FMDF 2GZAA 3CF0A 4B74A 1N6OA 4KFUA 1N5JA 1AS2A 4LZZA 2FF7A 3C41J 3GLHA 1XZPA 3VR2A 3QKSA 3PUZA 3L2OB 4LV6A 3GEEA 5FTKA 1GIAA 2ZJYA 3CX8A 1Z8FA 4LBWA 3FOZA 2J45A 1V43A 1PUJA 5AJXA 2ZJAA 1CLUA 4KITB 2IYVA 1S96A 2ZAMA 4DEYA 5E4FA 5JEDA 2BMFA 3HWSA 1ZBDA 4G5GA 3KQNA 2W6ID 1CS4C 1KK0A 3AEZA 4TMXA 3B78A 2IYUA 4PAOA 1AM4D 1CJVC 2HCJB 3AVOA 4JBWA 2IYXA 5JHGB 3KQLA 3TW8B 4Y0AA 4OI0A 2Q9CA 1RE0A 3QPVA 1TF7A 4NHOA 1I4TD 3W34A 5H8WA 2OO7A 1S1MA 2V8OA 2OBNA 2G9NA 5SZJA 3SR0A 1NN5A 4C30A 3KQUA 4H9GA 4A92A 4NONA 1W36B 3MJHA 2IW3A 5DH9A 2GJ9A 3O8DA 2C9CA 3TUJC 2RGBA 3K0EA 1QZXA 2EFHB 3REGA 3VHLB 2RB4A 2R6CA 4LBYA 3AH8A 3RDPA 3HP1A 2ZRNA 5AJVB 3KB1A 1OFHA 2ZSAA 4N0EA 2JJ1A 4KSBA 4RKFA 2DFNA 1W4AA 4ESVA 3Q7PA 1P2UA 4WOPA 4MA4A 4D4JA 1LW7A 2ZXUA 2E9SA 2J0SA 1KY3A 1E2EA 1DE0A 3V9PA 3EX7C 1TQ2A 3L0PA 5EE9A 3UKDA 3RRYA 1HURA 4URXR 2C98A 1A7JA 4V0LA 3SU8A 2C99A 2WWHA 3U3RA 4V0KA 1KI1A 4Q18A 2PJZA 3K0FB 1X8JA 2BC9A 2NO0A 3RWOA 4B75A 3ZDQA 2QAGB 1VKJA 1EWRA 2X77A 2Z43A 4PZZA 4DSNA 1G7CA 2GK6A 4DZZA 1XNJA 3NDBB 2O0KA 1X1SA 1UKYA 2ONKA 4HDOB 1S3SA 1I2DA 1TQ4A 3LY5A 4R98A 4US1R 4FCTA 1JXMA 2YV5A 2IUUA 3C8UA 4Z8XA 3GD7A 1Z6AA 2DWPA 3W8RA 2X1VA 4W5WA 2ZANA 4FMBB 2D2FA 5JI3E 1LF0A 1SXJA 1T9HA 1TF2A 2NZ8A 1E96A 1GAJA 4L4UA 1AZTA 4D4LA 3AKYA 2VLIA 4UNSA 1W4CA 5BXQC 2ZRFA 4C7OA 1F2TA 2X2EA 1NMXA 2AWNA 1FTNA 2HCBA 4DLUA 3K0CC 4TLBA 5FTNA 1P9RA 4LUCA 3F3YA 3C5HA 4ZDWA 4A2PA 2QE7A 4UXHA 1YJ5A 3T06B 1WF3A 2J59A 1ZC4A 2ZQ5A 1US8B 3GLFB 4PQFA 1G5PA 4OQFA 5KHOC 4LJ5A 3U7EB 2WJHA 4BFTA 1W47A 1P6XA 1GNQA 4YXWD 3BXZA 2ZYUX 4FWTA 1J2JA 1KO1A 1FMLA 1XCGB 4LJ7A 2ZYVX 3BH7A 3MFYA 4F93B 4BFUA 1W36D 4TYWA 4G01B 2QPTA 1G41A 3B1VA 4R7ZA 1YHNA 3LQRA 4EUNA 2BHRA 2P5SA 3X1YA 2Z4RA 4IW3B 4NYMQ 2UZ3A 2WOOA 2ZS8A 3CR8A 3I61A 5E3HA 4U00A 3IEUA 4JVSB 1ANKA 1FFHA 4EPRA 1CRQA 3N70A 4US0R 2PEZA 2BBWA 1S9HA 3ZVMA 5J5CA 2JDID 1U9IA 2ZSDA 2OZEA 1E2HA 2G6BA 3UWKA 1EGAA 5DGXA 5DHAA 3WNDA 1EWQA 2EFDB 2NO6A 4EFMA 2V9PA 2AKYA 4QJ5A 1T8UA 2FFQA 3V4FA 1YZTA 2I1VB 1WMSA 3ZVRA 2RH5A 1YZNA 4RSGA 1Z06A 1M7GA 1E2DA 4V0ME 4B47A 1UJ2A 1KK3A 2GAOA 3CZQA 3DOEA 5HR5A 1Z47A 3SJAA 2CNWA 4BE7B 2W0MA 4KBFA 1E4VA 2CLSA 1XEFA 4KYIB 3GJ8A 2LKDA 4PHFA 3ZLJA 1OB2A 4ZI3A 3U3MA 3IDQA 5JJIA 2V3CC 2GA8A 2IS1A 4Q9HA 1KI7A 4I99A 1NLZA 2V1XA 3QIAA 2FE4A 4JLVA 4XOIA 3TQCA 2VP0A 1IN8A 2LKCA 4ZCLA 2QAGA 1MRNA 1DAMA 4POAA 1W49A 2D3WA 2FGKA 3LNCA 1Q0UA 4RD6A 2QP4A 4LDJA 2JLRA 4HI0E 4A0HA 3IPXA 2FPLA 1X6VA 1JQLB 1D2MA 4MRRA 5B30A 3FVQA 3Q9LA 3A37A 2C96A 2XNDD 3Q5DA 1AZSC 1G18A 1N6LA 5EE1A 2H5EA 5DN6A 1QHSA 2IYSA 3NXSA 2QPAA 2GZDA 1KNQA 1SKYB 1M7HA 3CBQA 3HPRA 2XAUA 1SXJC 1GRRA 1UPTA 2WSSA 3VR4A 3C14C 3BH6A 3BH0A 3BJIC 3CNLA 4XVRA 1A2KC 2PZGA 4HB4A 4GOJA 1XEXA 3TR0A 4DUGA 4BGDA 3I62A 1W0JD 1VPLA 2I3BA 1US8A 4XWOA 3PV0A 4UNRA 1RJ9B 3WRYC 3K09A 1JPJA 2CEAA 4YMVA 2QTFA 2FG5A 3B1ZA 3MMPA 4URWR 1HH4A 2GF9A 5HE8A 2OAP1 2OFXA 3LV8A 1KDOA 5KSPA 4Z1MD 2ZVPX 4CW7A 4M9XA 4QHSA 1QVRA 3Q5EA 4DVGA 1U8AA 1GSIA 1NN3A 3HR7A 3QKTA 3PUYA 5FOTA 1F60A 1AN0A 5EE3A 5FBWB 1OKKA 4IOMA 1JALA 4GFDA 4AIIA 4BFSA 5JMTA 1G4UR 2OUKA 1R5BA 3IO5A 4O2RA 3UMFA 1J90A 1KAGA 2VSXA 4KV9A 4Z8YA 3PITA 3DOFA 5HKKA 5J4HA 4B44A 2ZRBA 4NTZA 4XD7D 1KIMA 5G3YA 2P6NA 5EP1A 5FUYA 2GAAA 3TBKA 4DLTA 2A9KA 1JAIA 1U9IC 3I1FA 1H8HA 5IK2D 1UF9A 3F0TA 3B7GA 5FL7D 1WBDA 4Q03A 3WY9A 1EFRD 2OT3B 4Q7LA 5LPNA 1W36C 2Q21A 4TSFA 5FOVA 4A1FA 3EWSA 2XITA 1D2NA 2ZRIA 3REFA 2Q6TA 2YOHA 5C18A 4KXFB 4LHVA 3EIQA 4B3CA 2HJGA 3LDAA 3QG5A 2FJUA 1UBGA 5GJWC 1E9CA 3CUEF 3W9YA 3GLGA 5TARA 3PXGA 3QKRB 2DYKA 3W6NA 1VIAA 4ZIRB 4TN1A 2YC4C 3FKSD 4MKIA 4OKSA 2WMOB 5JFGA 4TLAA 4TYQA 4Q9KA 3JVUA 2O8CB 3KTAA 4BLSA 3NHAA 3I8XA 2QTHA 1P9WA 1NBMD 1G8PA 2Z6VA 4WW0A 3SNHA 3WNBA 3A4MA 1CKEA 2ZJZA 3AF0A 2NPFA 3SBEA 2QI9C 1BS1A 1Z3IX 2WKRA 3AKEA 1TEVA 3FGNA 1P7CA 1A82A 2YVUA 4B73A 2Q9BA 4HZIA 1JECA 3RYTC 1E0AA 4PQYA 5JCZA 1YZUA 1TAGA 2J46A 2NQ2C 2QMEA 4D80A 1D6JA 3BOSA 1U90A 2ZRKA 4JIMA 2IEYA 4Q01A 5DSZA 2CCKA 3L8YA 1ESNA 4MGIR 2JLUA 4HSEA 3ADBA 3Q8XB 1OV4A 5GJBA 1TUIA 5L3RA 1ZMXA 3I3SR 2KWIA 5EXTA 4ACBA 3HYTA 2DWOA 2B6HA 2JLQA 4M9ZA 4S35A 3HU1A 4EPWA 2VPPA 1ETUA 2HF9A 1GKIA 1M6NA 3ZQ6A 2WWGA 2YYZA 3NEJA 2GILA 3EXAA 3T61A 1UEIA 1YZGA 3CWZA 4AYWA 2WOJA 4HZUB 2FFBA 2GDJA 3FFBA 3KUDA 4FWIB 3BBPA 1OXSC 1JNYA 5L3QB 4PHGA 2JJ2D 2WJJA 3VR1A 1X86B 2Q0HA 4B34A 4EPVA 4IRUB 4CRWB 2OEPA 1RIFA 5E95A 4A0RA 3ZS9A 4D4MA 2CLCX 3AKCA 4XH9B 1NSTA 1HE8B 2H16A 4TWZA 4UJ5A 4C0SA 4B48A 4B3BA 5JS7A 1ZCBA 2EWWA 3GJ5A 3JZMA 1PLLA 2F1HA 3MWYW 1QG2A 1GM5A 3VQTA 4M1WA 2ZS7A 2VP5A 1NMYA 1L2TA 5EQTA 4OJKA 4DWJA 1HT2E 1FUKA 1P60A 4UJ3A 2HLDA 1ZCAA 2ZRMA 2N42A 5B2ZA 2ZRLA 4V0NA 3TVDA 5GJCA 1SVSA 4B3FX 3THYB 3NBYC 1DARA 3W6PA 1E1QA 8OHMA 3F8TA 1COWD 3EWAA 4AYXA 4OJQA 1E79A 1BIFA 5JRJA 4TZ6A 3TK1A 4A0FA 1E0KA 3FMPB 4MRVA 2OCPA 3W5IA 2B92A 2ZSFA 3QKRA 3TLXA 2JLZA 4TMVA 4ZIRA 2ZVQX 3CX7A 1DO0A 1KO7A 2AD5A 1SVMA 1CJKC 5CJ2A 5J4YA 3CZPA 2O8CA 1RRGA 3K53A 1Z0AA 1KK2A 3GLGE 1J8MF 2F9MA 2CHGA 4B3GA 3FDIA 2IF0A 1R0XA 2IWRA 4NE2A 1NSFA 1ZIPA 3GQBA 3LX5A 4JT4A 1MOZA 2EQBA 1ONBA 1QDEA 4AK9A 1XD2B 2ZITA 3VFDA 3WRXC 1XJCA 1WB9A 2REXB 3A1VA 4C3ZA 4JVLA 2IS2A 1E1RA 4M1TA 3R7WB 3A1WA 2OCAA 4CYMA 4LRWA 1P73A 2GWHA 1UDXA 2C77A 2VYFA 1ZIOA 1DS6A 5AR1A 5BN3A 1XPRA 1SVLA 2OV2A 3RRNA 2CCJA 1E2PA 4I4LA 4FN5A 3NDPA 2VSFA 3V00A 1FL9A 3A1UA 4TLEA 4TMKA 2J0QA 1Z6GA 1JI0A 1JEDA 1F2UB 1G7SA 2XSZD 4K46A 4B35A 5FR2A 4YDHB 1WCV1 4D81A 2ATXA 4JVNA 3OEEA 2QENA 2ZRAA 2EYUA 3EZ9A 4HZUA 4GP6A 2IS4A 3MAAC 2QSYA 5FR1A 4WZAE 2AL7A 2D7DA 5L3QA 3UATA 4OHXA 3BC1A 1NVUQ 4G5OA 3F5FA 2IYQA 4H1VA 2OBLA 4Q1DA 5FOWA 2BMDA 3DM5A 1PLJA 1PJRA 4JMPA 4NBSA 1PLKA 3QI2A 4B43A 3K70D 5AUPB 1OXVA 3IQWA 4LGMA 5C1BA 2DBYA 3CLVA 3GLIA 2D7CA 1Z0JA 1MO5A 4LV8B 2YZ2A 2AKAB 4YLGA 5EP2A 3W5JA 3UIEA 3W90A 1HY3A 5CYPA 3LWNA 4OHZA 2CK3D 2CL7X 4Z51A 3U7HB 1JB1A 3IPYA 4IXNA 1KYIA 3LBNA 2OCBA 1SHZA 3DHWC 4BZXA 4ASUA 2XB4A 4GSYA 2OAQ1 5CM8B 4RD2A 1AKEA 2BJWA 4JKIA 1IHUA 3SEAA 2BMJA 2R2AA 3U3OA 3EZ6A 4QBGB 2WWFA 4Q4HB 1FX0B 2JLYA 2OE2A 1MO6A 1XCMA 3IIMA 3FHOA 1XMVA 2P65A 2A5FA 3SJBA 1JPNA 5HZHA 6Q21A 4D4KA 4CVNA 4XWAA 4PZYA 4GL2A 1OPXA 4MGZR 1NF3A 2FZ4A 2R62A 1ZM2A 2JIZA 1N5IA 1M2OB 4NL4H 3HDTA 1GRNA 2BKUA 5FBVB 1TQDA 3QXXA 1NIJA 1CR2A 1DAKA 4N0DA 1OIWA 1XTKA 1KI6B 5E7MA 1XMIA 2V7QD 4QGAA 1OH5A 3AVPA 3ADDA 4PHTA 3CPEA 3AKDA 5JRZA 5FBLB 3ASYA 1WQ1R 1N0VC 2ZR9A 1KSHA 1XD2A 4FW9A 2PLRA 5FBQB 3L0IB 2AR7A 3P20A 1AGPA 3UMRA 3R7WA 2GZHA 2HF8A 4FXPA 3RSOA 1DADA 4URVR 1IN6A 3EIEA 3NH9A 1Z6YA 4QG7A 5AJZA 1XD8A 4B32A 1N6PA 3A4NA 3OEHD 4QFMA 3IIKA 5DNYB 1RFLA 2HT6A 3PEYA 2GF0A 1ESMA 1XP8A 3WYFA 4UNNA 4N1AA 3EA5A 3MRSA 4J0QA 3SS8A 1CU1A 3LXXA 1F2UA 2IEZA 1CJUC 2G3YA 3RS3A 4B2IA 3UMSA 4LPSA 3RLFA 4KBGA 2QL6A 4OBEA 4BFWA 4US2R 2IXFA 3LQQA 4HB2A 5EZ6B 1R0WA 2OHFA 3CF2A 2J41A 5HTKA 1KI2A 3THXB 4LV5B 5K8UA 5BN4A 3LFUA 4BASA 1J70A 3OIUA 2QMHA 5DLQC 2YWHA 1G19A 1UBEA 5AJWA 5FUWA 5KNDA 2DHRA 3A36A 2GVZC 4Q7MB 4PTLA 1F6BA 3VNUA 1ZW6A 3PFIA 2FEOA 3KXIA 1W0KD 1MABB 3GJ0A 4M1SA 2IF2A 2JAQA 1MO3A 1KHTA 2ANBA 5FBRB 2WWYA 4AKEA 5M04A 2Q3HA 2C04A 1G64A 621PA 4KFRA 2C9YA 5A0FA 1U0LA 2ZJ5A 3NC0C 1RZ3A 4TT3A 4M8NE 2QP3A 5J4VA 5HZKA 1Z28A 2TMKA 3ZS8A 1ODFA 5BYKA 4R71A 3FMFA 2DFKB 1XRJA 1OHHD 1XXHB 3H84A 3VR3A 3GLIE 2JA1A 4DCVA 1CBUA 4D0GA 3C7KA 1AS0A 1DELA 2ATVA 2VHCA 4C0AC 3K8YA 2QT1A 2LWIA 2VSOA 1FX0A 4HLCA 3CIOA 3Q85A 4PFSA 4Q4HA 4RCYA 4A8JB 2C78A 5IDVA 4JKYA 2OCYC 4URZR 3SQXA 1U98A 1N2CE 4F92B 2NTYC 2QRZA 1T3SA 3ZIAD 4DC9A 2YHSA 3HPQA 4Q66C 2V55B 4LK2A 3WHLA 2ZR0A 1R6BX 2IBMA 3B1XA 3T34A 1IQPA 4Q9LA 1UM8A 3L0SA 2J1LA 4PAMA 5BYJA 5LB4A 3OE7D 3RRZA 2P6RA 4JYCA 4E09A 1QHYA 3MG9A 5L8VA 2Z83A 5ELXA 2IHBA 1Z08A 3VU9A 2MMCA 4C2TA 4UQOA 2QGZA 1KI6A 3L82B 3P27A 4DIEA 1SVWA 1IJEA 1ZUHA 1C9KA 1FW6A 2ECKA 5FOUA 2YWEA 2W6IA 5CB6A 2W2VA 1JR3E 4DT1B 5TMPA 3MSXA 3IUYA 3WP1B 4BZQA 4D82A 5JZVA 4JLMA 1Z0DA 3O8RA 2WJYA 3EIHA 2SHKA 4LCBA 1T0HB 1RPZA 4LC0A 4PQRA 4DSTA 3MWLA 1KGDA 3RABA 2XNSA 4PC2A 5J4KA 1NMZA 3U6KA 4TYNA 1R4AA 2HDNB 4EDHA 1GOTA 1P2VA 1N0WA 1YU9A 2NOAA 2AHOA 4RCZA 2PJRA 2XXAB 4RD0A 3VMFA 4UKDA 1YVDA 2O0HA 3TAHA 4YMWA 1XZQA 1G291 4JLNA 3JVVA 421PA 3CRVA 4LYHA 3P4YA 1D9ZA 1Z63A 3QF7A 4NP6A 4RY2A 3VR5A 1OXTA 1ZUNB 2ZE8A 3THXA 3DZDA 2FMXA 3OAAD 3AVQA 2XOKD 2NZJA 3MD0A 1DEKA 4KYUA 2WMNB 2ZRHA 5IF9A 3QG1A 3KKQA 2GXAA 4PPNA 2DFLA 1XPUA 1N6RA 3ECCA 3B13B 3W3ZB 4D2IA 1MABA 4TQ9A 3HU2A 2PLFA 4M53A 3CH5A 1I2MA 3DEFA 4IVPA 4PC7A 4DJTA 1JXOA 4KFTA 2MSDB 2F1JA 4IXMA 1E98A 4NKRA 1GL7A 4V0OA 1O87A 2VRWA 4JL6A 1M74A 3WMFA 1UKVY 4BRUA 4DDWA 4CEJB 1NVVR 2VHJA 1HE1C 2GCOB 1M34E 1PZNA 4KHZA 5EE0A 1CULC 5A4JA 4DEXA 2P6UA 1E2FA 1H8ED 4Q21A 5DI3B 3AF3A 3GLHE 4MUBA 4XJXA 4MYUA 1E2IA 4YC7A 2FH5B 2WAYA 2PMDA 1R8QA 4CEHB 3M6AA 2W2TA 4M21A 2WTUA 3GJ4A 4L8GA 3X1DA 4A8JA 4ZDJA 4LJAA 3MWJA 4Q4JB 2JLXA 1SQ5A 1NP6A 1QHGA 5CB8A 2L0XA 1Q57A 3QENA 4XVUA 5IT5A 4NYMR 2UZIR 1ZJ6A 4RZ3A 3U3KA 3AVVA 2O8EB 2ZRJA 4CT4B 2J7PD 4QL3A 3AF2A 4YXWA 1XMJA 4MYCA 4TZ0A 1CJMA 4DB2A 1R8SA 1CP2A 2C9OA 5GVSA 2IYYA 1U0HC 1LVGA 1NNEA 4R2HA 5EJEA 1QHNA 2VP2A 1GUAA 3I92A 3FB4A 3KDSE 4L9SA 4NDZA 4B76A 4PO8A 1FP7A 1MO4A 1W2HA 4Y0VA 4P4TA 1QG4A 4Q9JA 2WIAA 4ZKEA 3TSOA 3VTKA 5JCPA 1E9BA 2VF7A 2WWWA 4ZDIA 2F55A 1SULA 4LHXA 2X19A 1HQCA 4DT1A 4DCTA 1XU4A 2P2LA 5B57C 2EFEB 3IHWA 4MUAA 5H1YA 5FPTA 1KTVA 1T5LA 2DCUA
chains in the Genus database with same CATH superfamily
1XG5A 1ZM7A 3JAWA 1HWYA 1JDJA 3KZVA 5I7OA 1N0HA 4HNTA 1E3TA 1V5WA 3KIPA 4RHXA 5FUQA 4MR7B 3SG0A 1XLVA 3QWBA 3CVOA 5TQ2B 5DGIA 2X8JA 4YO7A 3M5DA 2PUCA 3OZTA 5KTOA 4MLCA 2WM9B 1U0GA 5E0OA 2CHVA 2ZYWX 4JXKA 4NCBA 2PSEA 3NIDB 3LCMA 4RH3A 4D26A 5FHQA 3K0FA 1J24A 5LBUA 3LXUX 4RTKA 2UVPB 3IE1A 1GG2A 5KOYA 4IF6A 3DLAA 4D9NA 2BWJA 1WDKA 4GKJB 1E9EA 1EFDN 1CW2B 1WHSB 3OM0A 3UUGA 3PXUA 5HS6A 5I7RA 5ILOA 2M9MA 2OV3A 4UBKA 1OJ7A 3DXFA 2ESRA 4JBXA 3AYXB 1Y8QA 2FQYA 3HXOA 1JHDA 1GU7A 1U2GA 2UYHA 3NDRA 1XZDA 4NCXA 2VPZA 4WE3A 2GJAA 3JYHA 1OX4B 3TXXA 1XHLA 1ADCA 1AHHA 2ZIVB 3CX4A 5EOVA 5EPUA 5HUHA 2EU8A 2P3QA 1IONA 3QI7A 5HCUA 4ABTA 5DCUA 4KO3S 2R9VA 3I72A 5J5AA 1C3OB 1JFLA 3O0TA 4ZC8A 3UK2A 2O8DB 5IT0A 1OF1A 3CYFA 2AF4C 4JBYA 2B94A 3F4LA 4HQOA 4J0HA 3T5CA 1RADA 3WB1A 3ESBA 2EGUA 3OQVA 5AI4A 5EFZA 1A27A 1I24A 1U7UA 2I7XA 2Q99A 1IBRA 2VJPA 4EWLA 3Q7SA 2JLAA 1CUSA 2BMVA 2GCOA 4OX9B 1QRRA 4YCDA 3OOHA 1JPVA 1AO0A 2HQ1A 3FKQA 1EZ4A 4JH0A 1QF7A 1RQXA 4GX0A 3ER9A 1PNVA 5CH8A 3VZDA 2GFIA 1N2EA 3P19A 5CDUA 4PO9A 2EW1A 4IKPA 5AESA 3IERA 2Q50A 2H08A 2C97A 4LXUA 4BLTA 3GXBA 3DFZA 4GWLA 4NCAA 4MW6A 1PDWA 3GL9A 4K40A 3WADA 4D0NA 2HA4A 3SHWA 4CL8A 2OZLA 5BNTA 1HOTA 1EESA 4HVCA 1KAOA 2PKYX 3X44A 1O57A 4UM5A 5I4IA 3EA0A 5KWEA 2X0IA 3AIKA 3UPTA 1D1PA 4L5JA 4ZVSA 2ODTX 2JFXA 2FTKE 4AMBA 4EJSC 5F3WB 4DDMA 3QLJA 5EMKA 1DC7A 3PFNA 2I22A 1GNRA 1T0JB 2HJ9A 4JLWA 1L4KA 1P31A 2Y1GA 4OMFG 2MYPA 3RUAA 1X9GA 4EQ6B 2HO4A 1ZGHA 3JTMA 4E22A 4H7JA 3VU1A 1DC4A 1FYFA 2IT1A 3DT9A 5EZYA 3OCZA 3VYVA 4YCCA 1JDNA 1I4LD 1GDDA 1O9GA 2VA9A 5FTLA 3RSGA 3U1VA 3V1YA 2EFGA 2IUTA 3C6ZA 4XFKA 1AUXA 1T0IA 4XQ0A 5K2MA 3K0KA 5JYCA 2UYOA 3TM5A 3WG9A 2MIIA 1QBKC 2QTLA 1QB7A 3QYFA 3RPEA 4AQDA 1PL8A 4DV4B 1KEVA 2WA2A 4I3HA 2SKCA 1ODSA 4OHOA 3EJ6A 5JEEA 3FRJA 4GHWA 3P2IA 2XYGA 3MPOA 3I9MA 4WCFB 2A0YA 2J5BA 3QVMA 4ZVUA 2H0RA 2NV6A 2G06A 3RVSA 3HFJA 1FPQA 3PJRA 1TKAA 1XDUA 2CVQA 2F6RA 3ZJ4A 1N1MA 5TPZD 4X85A 4XD7A 2P6MA 4C3UA 2QZJA 1OGYA 2G8LA 3JYLA 1FLAA 1Z38A 3GGDA 4XGRA 3EB9A 4CLRB 1V37A 5DU2A 1IMJA 4YJ2A 2HT1A 3GELA 1EFRA 5TE9A 4EUEA 3QPUA 3SC6A 1E1CA 2QX8A 1FVXA 1MT0A 3L92A 2ZE7A 1H9AA 1K0UA 1Z6QA 3F1KA 3LOUA 2I4TA 4GPD1 2GAIA 3CEHA 3H7AA 5REQA 5KJ6A 4U7GA 3VKVA 1TPZA 3TQTA 3P0EA 2ODEA 1G4HA 2Q3FA 4GKAA 1SVKA 1YGYA 4QOJA 1YASA 2WVAA 1LPMA 3A7EA 3KKNA 4L75A 1JXAA 4C0XA 1C0KA 1CEEA 3GPCA 3OD1A 2V9ZA 4XIFA 2BCJQ 5ESDA 4H6WA 3AG6A 3ITEA 4IDDA 1MX9A 3EISA 4J1QA 2MSNA 2OHIA 5BNZA 1YKGA 4RIEA 3T3MB 4G0VA 3WXMA 1HFJA 3X1ZA 2J9FB 2IVFA 3OA0A 1UKZA 4CCYA 2VEDA 2PG3A 2FUKA 1U7DA 4RXMA 2TECE 1Z9BA 2EXXA 3USCS 3IVCA 4DZTA 3BSYA 4NCKA 1AGYA 4Z6KA 2HX1A 3G5UA 2XMRA 1QS0A 2G9RA 1C7QA 3Q3HA 5EIWA 4RHFA 4C4RA 4NE7A 3GPLA 3MTIA 4DKJA 2CXPA 1BNCA 1O58A 1LSOA 1ODKA 3KPJA 1U1EA 3OQ1A 4L8WB 4O8ZA 2HQBA 3GLFE 1P2TA 5DBHX 1L5VA 1O6GA 2Q1XA 3PUIA 2X2FA 1U0BB 3I9V6 4H18A 4HLQB 3KX2A 3EF3A 4J7UA 4Q24A 2R84A 1I13A 4A27A 1SCAA 5E4JA 4POOA 4BCDA 1QYRA 2EDCA 5BSTA 4YQYA 2O06A 5D87A 2QLMA 1J8FA 1PFUA 1T35A 3V34A 1JLSA 2XIJA 3DBRB 4MI9A 1GQRA 2A8YA 4OHPA 5GMOA 2XCIA 3GGJA 1F3OA 3QVXA 1P4GA 3Q0IA 1XWFA 1V3TA 1GPNA 1RM5A 1IWOA 1HE2A 2Q2VA 1V1MA 3LA6A 4ZOLB 3PZBA 4KH1A 1T1EA 2CXTA 1KZ1A 2RJNA 3K92A 3UPUA 1QOZA 2ZJOA 2VPQA 4GOMD 5T4HA 2O23A 1EE1A 3K15A 1KMNA 4X1YB 2YN2A 2Z1MA 3BMXA 3I37X 3HU3A 4OYRA 2C82A 4M46A 1IY2A 2AHRA 3RBXA 4IUYA 1ORWA 2C0CA 2IPMA 2IBTA 3I8SA 4G8DA 4IKOA 3A2NA 9LDBA 5JAIA 1CJTC 1CY4A 4ILEA 2VUSA 2JW5A 1WAMA 3A6FA 2DHDA 5ANRB 5FTMA 1W5SA 1GUFA 2QDXA 1GGFA 3N05A 5FWNA 1UKEA 2Q5HA 1VJDA 3CX6A 4UM7A 4XIGS 5CJPA 1NLMA 3SP1A 4WBNA 1KMHB 4E51A 1PQWA 3IHLA 4WJLA 3PHGA 3QE4A 4R1SA 4RY9A 1NZJA 3TRHA 4CLDA 4OHRA 4DLBA 1A9SA 1CQJB 3A8TA 3B60A 1NG9A 2ZWMA 1AGRA 3VC2A 3WGNA 4DLSA 4HQFA 2ZSEA 2JAPA 5AUOB 3VYUB 1L7MA 2VK2A 4A9AA 2P1DA 1G6Q1 4MDYA 1T1SA 3NPAA 1SHKA 1B8PA 1EWTA 1Y4UA 2I7TA 3K6JA 2OGTA 2IHYA 2VXBA 3ONNA 5AHRA 3SN6A 1QCZA 1JR2A 2Y3IA 3QXCA 3ZWDA 2IH5A 5LXTF 2OOKA 2WC1A 3L8DA 4KIJA 3IQGX 4IDPA 3UZUA 4I8DA 2QX6A 3ZK7A 3KT0A 2J7KA 3M2PA 4NFLA 4CEIA 1AOXA 4KWHA 1QIGA 2I99A 2PH1A 1GVNB 1FPMA 4OHWA 3TPFA 1COWA 3EXFB 4R69A 1WXWA 1P5ZB 1IG3A 1L5OA 3LM8A 5K20A 1T6BY 2ECFA 3OCXA 1KP3A 3I01M 4M9QA 1GPAA 5DHSA 4ZXPA 3T4PA 4X44A 1V8BA 2CF6A 2WZDA 4BL5A 1E69A 5J47A 4RULA 3KQHA 3CUTA 4MPPA 3JVIA 4CLXA 1U7ZA 3U80A 4EI8A 4MVJG 1NYLA 4IMIB 4GIBA 2CNLA 1EB8A 1XTSA 1HQDA 1X15A 3IT1A 4ZMRA 1SRRA 3CUSA 3OFJA 1H6AA 1R12A 5CLHA 1UBLS 3L8HA 2P4SA 2BPOA 3T5GA 1POXA 1W75A 5HUQA 5JECA 3IBGA 2XYRA 3ZTYA 1T2EA 2DFDA 4HGPA 3FVVA 4HWOA 2DRIA 3UG7A 3QUSA 4OGGA 4JZKA 2PO7A 2C0PA 2QX4A 3K4QA 3P32A 1EUCB 2OM6A 1OWNA 2ZJ2A 3CZAA 4JLDA 4XYEA 1EAMA 4QG3A 1E7SA 1L3CA 2XA2A 2O7RA 5JR3A 1WXQA 2XYPA 1TAQA 3UJDA 4CZ2A 1GARA 2J33A 2CHEA 2QLNA 1MJFA 2D3TA 3D8BA 4ABYA 2HREA 4ARZB 3GEDA 5AVYA 5JIBA 4OQEA 4OL0A 3CPJB 4XUDA 5HIJA 1WLSA 1A5BB 4I9NA 1TU3A 4ZALA 5JNVA 4M76B 1RC8A 1VL0A 2F3RA 2II6A 1M73E 4KDEA 4PG4A 3SPXA 2QSJA 3BE5A 4U7TB 1N0UA 2A9VA 2XHEA 2Z4SA 2NUBA 2DQZA 5BWMA 1UFRA 3I9FA 5NLLA 3NPMA 3KEMA 3KJIA 5DTJA 3JZAA 2QR3A 3ORYA 3OCYA 4JFRA 4BX2A 3F7NA 4JJFA 2ORVA 2B21A 5LU9A 3THWB 1YI0A 2R1TB 4JELA 3MCWA 2ZI7A 4B6SA 1E3MA 5LLDA 1YL7A 3BD9A 1O3YA 2H4XA 1X70A 3O1LA 1HE3A 2DGDA 3GNTA 3ITKA 3D3WA 3MTAA 4QA9A 4RVFA 1VDZA 1Z2OX 4C0LA 1B0UA 1D4AA 2OBMA 1GR1A 3HYCA 2IUEA 4B82A 5K2OA 1AKUA 1NT2A 1LNZA 1VRCA 1J0CA 4L0CA 1DKLA 3OZFA 3KJZA 2L17A 3MTGA 4XYMA 3LY8A 3IQZA 3UBMA 1EG2A 2IXGA 5HOEA 3H11B 4ZCMA 1WXFA 3E3AA 3QWFA 4Z99A 1JR3D 3BT7A 1JL3A 4KSYA 4WXPA 3A6DA 4Q47A 3WIUA 1XQXA 3OKPA 3UJCA 1J1UA 3U7HB 1ESCA 4YGXB 2GBLC 3KTFA 4MVXA 3O8QA 2CK3A 1WL8A 2R4UA 4IP0A 3LC0A 4K28A 4K9PA 4WCFC 1QBGA 1TVCA 3ON5A 4DIDA 2YIMA 3HU5A 3PGKA 1DXYA 1P2SA 1KPGA 3R9WA 4E1AA 2BUAA 4XWKA 3C1OA 4FXOA 5EXXA 3DC7A 3WZLA 2BM0A 3ZE2B 4ZYZA 5CFPA 4OHYA 1JFVA 4YAGA 3SQNA 1X7YB 4G86A 4FPXA 5JANA 1D0VA 2FFAA 3BFXA 1L7NA 4DLXA 4YV7A 1TM3E 3ICWA 5TMBA 3KYBA 2BSQA 2HLNA 5FIUA 1UJCA 2BGNA 1WIWA 2WBLC 4OY3A 3USZA 3HXKA 2BFDA 1L4UA 1YIOA 2AN5A 1CY1A 4LQDA 4HO1X 3PC6A 1SCKA 2WYVA 3ED5A 5EXSA 3AGQA 3DE1X 3H2JA 4AWXA 2FN4A 3M3PA 4OLAA 1Z0FA 3GA5A 3GMTA 1JG2A 3RT7A 1ZMTA 4CJXA 1JIQA 3LAWA 2RARA 1ZD2P 1C50A 2J9XB 1XWWA 3DE3X 5ALUA 2WPDD 2VQDA 3SSMA 1ZC3A 2ZTLA 4MV8A 1N7GA 1EDDA 1NVDA 3DQQA 2R7MA 3H9UA 4N76A 3DAFA 2IXDA 1UL1X 2M6RA 4Y6RA 2H5JA 1OXMA 4L9AA 2FQ1A 1DIGA 2W37A 1V6AA 1G38A 4FZ5A 3BQ9A 3RAJA 2IP2A 1E2QA 3T3DA 1QGED 1CCWA 4MITA 4CT5A 1P7WA 3LL7A 2RG1A 3D7RA 3FX2A 4H4CA 2I0FA 4P8RA 5B3JC 3HXQA 1RLTA 1ZNWA 3A9VA 4HH0A 1L1RA 3QVLA 3W5UA 4LDAA 1LZKA 4UC0A 3VSDA 1PK8A 1VYTA 5SZIA 4KXQA 2X2PA 1GL6A 5GONF 3UHAA 2JFGA 2CL0X 1E4YA 4N5LA 1CRZA 2B8EA 4D0RA 1XLWA 3VGPA 5DXAA 5KUTA 1ZUD1 4FFVA 1XK7A 4HRYA 4HEJA 4IXTA 2VT3A 3QX8A 4UAUA 5EKSA 5HFNA 1YC5A 1RWXA 4V24A 2ONJA 5M34A 2QP9X 3VR2D 1PWZA 2RIPA 1IEVA 1MX5A 2QK4A 4RJLA 3F2IA 2HU7A 5G3ZA 4LI0A 1ODJA 2OQVA 2OXCA 1DRWA 1L9XA 2C9ZA 3U7GA 2EOAA 4GPIB 1NI5A 1EGVB 4YUWA 1DINA 1HNZB 2P9YA 1TRHA 2GVNA 1W19A 1HT3A 4FT2A 4D4IA 1RM4A 4UQLA 2VPIA 4XSGA 1USGA 1X87A 2XE7A 3FYUA 4F86A 5LU8A 1S5PA 4NCHA 1OYWA 3ANSA 2EARA 2WTEA 3CW8X 4QTZA 1KVUA 4WACA 4G09A 5JNSA 2Q0SA 1AQJA 1KAHA 2FRVA 1A2BA 1PX0A 2QTAA 2VF8A 1E1YA 3G8YA 3I04A 4JGGA 4DIBA 2GTPA 4XJSA 4B87A 1EJ6A 1EXVA 4OAPA 4RWEA 2FPXA 4B7CA 2F43B 3VZRA 2FFHA 3KZCA 5ALXA 4M89A 1RRCA 5CVUA 5B1EA 4MYRA 3A3OA 1XPOA 4K9NA 5KSOA 2Q6IA 1W0KA 4HDNB 5L45A 3NX4A 2ZTVA 4B71A 5LMZA 1FMJA 4F7DA 2KHZA 1ISSA 1RZVA 5T67A 1K75A 2IYRA 4OFXA 3L7BA 5F12A 3ZHTA 1VYVA 3H1BA 4LSGA 3O1HB 1ZGCA 5C8ZA 3PF9A 4E21A 5CFZA 3D8NA 3ZH9B 3RT9A 3I4LA 4M9UA 4M8LA 3VYRB 3GIWA 3DM9B 4LXGA 5E8JA 1GPMA 1OQAA 1S8NA 2R1VB 1G5QA 2PXCA 1PX2A 4ZJZA 2FDCA 5CNMA 4C22A 4QBHA 4KL8S 4OGLA 4P4SB 1RD4A 1ZDMA 3AXSA 1XU7A 3FUCA 1CX9B 1IY0A 1TIPA 1JZQA 2VDPB 3ST7A 3W06A 1F8YA 1OHHA 4C0BA 3P5BA 3PS9A 1FP4B 1I1NA 3A6EA 2Q29A 2V54A 4I1UA 2JJ1D 5IUNC 4CQNA 1TI7A 5IVKA 1YQUA 3HJBA 3U7IA 1G66A 3IP7A 1R0YA 2ATIA 1MJHA 3A2MA 1MOQA 1Z2CA 2E37A 4KQGA 4V3BA 4JXZA 3UV7A 4CT0A 3NALA 1FXSA 3U1BA 3L8ZA 1HEIA 1L5YA 2ON6A 1U28C 2YIDA 2YC2C 5CBKA 4XSHA 1NPDA 3PJDA 4G5YA 4CNBA 2HYDA 4Q15A 1BQ3A 1OVGA 3BRWD 1RCTE 3SK0A 1OBOA 1MCZA 2VNJA 3CE9A 4HLUC 5DNUA 3FYDA 5E0KB 5LUAA 1XA4A 3K0HA 3ZHZA 4HUTA 1YR3A 3L1KA 3HGQA 3JQ9C 3FDJA 2GXQA 3MAGA 4QFBA 4DJEC 1PEYA 3LK6A 3ND5A 4I81A 2DHQA 1QIFA 4FHEA 1NBWB 2VNIA 5AOBA 4HWTA 4D74A 4NEQA 5AW2A 1ZFNA 4MV1A 2VXOA 2ZDQA 1P0MA 3OLQA 2IQ5A 3G17A 3OZBA 5FPSA 2Z5LA 3O4IA 4F45A 4IOLA 4L5AA 1VE1A 1MV8A 3NHWA 2JAUA 2CXUA 2B99A 4HDCA 5L3SB 4NH4A 1UR5A 4K6OA 3ZGVA 1WSBA 2PANA 1ZEJA 2HYIC 4DBLC 4Y9RA 2G82A 4ZRMA 3ZH2A 4CDRA 3CM0A 1WP9A 4JODA 3BQMB 4H35A 2QE7D 4M3NA 2F1IA 2UKDA 3KE8A 3UICA 5IAJA 4JL8A 2JEZA 2OLEA 2FA9A 3S3TA 1E1KA 2CFCA 3N8NA 2AC4A 2CVZA 5CDFA 3LRXA 1Z07A 4UD2A 4QUAA 2HNKA 4QLOA 4IH1A 2FZCA 4O5AA 4BKRA 3GAMA 3QXJA 4L50A 1GAWA 5C8YF 3EAGA 1EKXA 4RFLA 1ZCFA 2CN1A 4UZSA 5L7YA 5LN1A 3F8WA 2QORA 4C7MA 3QV1A 2W2LA 1L6RA 1JJFA 1E2NA 1O1YA 1P1CA 2Y92A 1HV8A 4HDRA 5ADHA 4IEEA 2WUVA 2RI0A 3JAKA 5IDWA 1E59A 4QGSA 3M83A 2XJ4A 3CXUA 4JJZA 1F8FA 3ANMA 4YAJA 1QO9A 2A9JA 2XOKA 4WVFA 1NHGA 4MA0A 3TUZC 2PFGA 1P81A 1R2QA 1V5EA 1IZZA 2GYYA 1NVVQ 3A1CA 3K9LA 4HNQA 4B79A 2ZSKA 3GG9A 4DADA 3W2FA 4K05A 2MYUA 1XDBA 4YT8A 5F23A 3W8NA 2ZR7A 1XEXB 1Y1TA 4AKIA 1KS2A 2FZKA 4N7JA 4EJSA 2PFKA 3PL5A 1DQNA 2QZ4A 2PT7A 4ROTA 1RYHA 3FAKA 3OQ6A 4YDSA 3NKLA 2D2IA 3PNKA 4GMGA 1PYDA 1M0TA 2D1SA 1H2WA 1SMKA 2QDKA 3AESA 2X13A 4EP1A 1VCMA 2QVGA 2DEUA 2BJVA 3BXOA 3R0IA 1QR6A 2PGOA 3IKJA 4WZBE 3O7MA 4XGNA 2R47A 3K1ZA 4FGLA 4LOJA 3NBFA 2BGGA 3AFNA 2HHJA 1ABFA 4H4EA 2NU8B 4EENA 2CT8A 1XNRB 3EGVA 4ZEWA 2FJPA 3OPYB 4GPEA 3H99A 2ZRDA 2ZYSA 4AUMA 3LX8A 2GFQA 4U2EA 5ESRA 4YQZA 5FUXA 5I8ZA 5I3ZA 3IP1A 1NUTA 1IN7A 2A1TR 2NO9A 2ZW9A 3IE0A 2LRHA 2EYQA 1WU8A 1MZVA 1CZNA 4AG3A 3DYBA 3M4JA 1VHWA 1YB4A 3WGTA 4C6TB 1IY8A 5LKAA 3AM1A 4NFYA 2JJMA 2HJVA 2JIQA 1RBQA 5T8KC 4QT0A 5BYBA 4RK5A 4U39A 4ZVTA 3ICOA 3EXEB 4AN1A 3R3XA 2Q62A 1PWXA 4OSPA 1NJ2A 2E6UX 1T1IA 3HZRA 4J0CA 4MDHA 3F6RA 1JWAB 1CVIA 3QZUA 3HBMA 4MQ5A 4OI4A 4K7JA 1AV6A 4PO3X 3KZ1E 4BO5A 1Q1EA 2IPXA 3LT5A 5JATA 3L7NA 3GFFA 3V8EA 2GGSA 1PR6A 4PLTA 3GPDG 1E9DA 1RJFA 3OPQA 5BWBA 4NJEA 1YV9A 3BGOS 3FIUA 1EDOA 5AVQA 3E1GA 4JP8A 5IAGA 1KZHA 1BDMA 3P2EA 4B6EA 1ATZA 1RKVA 1SKQA 3AYZB 3IPAA 4G5XA 4K9SA 3RFCA 4BLVA 2HR1A 1U63A 4NC9A 5AOVA 1XEWY 2I62A 4CQMA 3B9PA 3GA0A 2QQ0A 1Z37A 3KBBA 4RDXA 3HWRA 5AM1A 3ORSA 2P40A 2AW5A 1QYDA 3GDOA 4GL4A 5EXDA 2GD1O 5ULLA 2REQA 5BSEA 3ICPA 4NENB 2EIXA 3GBPA 1WHTA 3G49A 1UUFA 1MFZA 2AOUA 2IDJA 1U2RA 3NHLA 1U1FA 3AP2A 2FVYA 3LCCA 1IM2A 4RMGA 5LOVF 2WM3A 4DPLA 1X7DA 3DMGA 1GZ6A 2VP4A 3TKAA 3D54D 1A5TA 3BIJA 3IIIA 5BMVB 3BWXA 4QNMA 2WR8A 4RTMA 2UYGA 3HK2A 1Q11A 1ZVQA 2PMEA 1F2DA 2XDQB 2P75A 1MO2A 4BLQA 1KMQA 2D5LA 2CVFA 3I1JA 1T5IA 1SHLA 5EJFA 1QH9A 2QOEA 5K8CA 3CRRA 1XMSA 4KR7A 2DFTA 3TZHA 3OIVA 2ZWPA 5IKPA 2VN8A 1TLTA 3K8OE 1G6HA 1ZR2A 3OQIB 1DPFA 4RPGA 1KYTA 1E3DA 3B5EA 1HORA 1OWLA 3IVGA 1JAXA 2DUWA 3CKYA 3NWJA 5PNTA 3H13A 2XKBA 4HXEB 4TLCA 3SF8A 4QYWA 5C31A 1P7PA 4TL7A 2GKOA 1DL5A 1OYVA 1OKKD 2Q8PA 2WWIA 2A5YB 1ECBA 3QVUA 1E0JA 2Y1OA 1Q3KA 4MKRA 1PUXA 3RROA 2UYYA 3IRUA 5KU1A 4WNAB 5DZSA 1T8RA 1Z68A 3T7SA 4G0YA 4DMKA 2DPHA 3H5TA 3B2EA 2VA8A 3GFOA 3I4FA 3MUFA 3P4UA 3W8EA 3CS3A 4K9MA 4C1BA 1O5TA 4A36A 2V7GA 3IGFA 5E9QA 4YBZA 2RGDA 3SR4A 3R8FA 1MX1A 2XX3A 3OOSA 4HQKA 5EIAA 3N0WA 4E31A 5A9RA 3G6KA 5FPYA 5FLEX 3ORRA 1HDCA 5BN5A 3DZFA 4F1KA 2YN0A 1OX6A 2JANA 2H4JA 1JLRA 3VKUA 4ALLA 2VTBA 5FWDA 1QVZA 1ZD4A 3BD7A 2YQ4A 1RAAA 1LK0A 1A8QA 4MO9A 4K6HA 4QU8A 5ALNA 3K20A 4IIFA 4RJ2A 1JFFA 1WXXA 1RJGA 2R65A 4XRRA 3HM9A 5JYEA 3ZBUA 3SC3A 4LZAA 4TSFD 4R1MA 3TGWA 3DKVA 4DQLA 4F2DA 4ALKA 2XNJA 2YBEA 3E1SA 4RESA 2VPXA 3K96A 1I9CA 4PVDA 2MMGA 4LWPA 5B58C 4OAOA 1W85B 2CB0A 1EGHA 3TRFA 3R4VA 1F6WA 1F0KA 3O83A 4RXUA 4BVKA 3ZU3A 2WZQA 3KLNA 4D5GA 1BE8A 1ZSNA 3ADCA 1R0RE 1PJCA 1XVLA 3AR7A 5FNVA 3GT7A 3IALA 1PZXA 3G3EA 3EULA 4PM4A 4NICA 1QV9A 1UPAA 3N0RA 3F6YA 4FCWA 4UEJA 5EYPB 1RAEA 4HEHA 2C2ZA 2GZ3A 1O6BA 2VQFB 2IK8A 1W48A 4MI1A 1Q1BA 2KW5A 1M1UA 3BMCB 5KDOA 4TRRA 4TZTA 1TYBE 4WK4B 4X8LA 5AHXA 2JD1A 2VSNA 3CGWA 3DA8A 3WSVA 2AW3A 2JVIA 3K0SA 5BR4A 4MQ4A 4ZK2A 4J9VA 1GQQA 3JQ8B 2J3LA 2WKPA 3LD9A 2Y8EA 1W25A 4Q1FA 2EHJA 3EPJA 2J3HA 2Y0EA 2I2DA 3DDNA 4F4JA 5FH9A 5CFOA 4HBGA 3DLTA 3K6SA 2B9EA 3C97A 5E9JA 1Q0SA 4AXXA 2XTNA 1WUKS 4H7FA 5E6SB 5K0LA 2XNHA 5AW0A 1KP2A 4KSCA 1JB9A 3WLSA 3VPCA 1OX4A 2V0NA 3LDUA 5DYNA 1CUIA 3D8TA 5K0CA 1Z39A 2CJPA 2C7OA 4KLNA 2AR9A 3EUEA 4JLJA 4YONB 4ZJUA 2QLLA 5ALSA 4ER5A 1XF1A 1YE5A 3RUFA 4TMYA 4F97A 4FSXA 4EB6B 4IJWA 4JLKA 3A3YA 2ZI5A 2FPMA 1JJAA 1KJZA 1GPJA 1JR4A 4DCUA 4BYMA 1JFSA 1SHTX 1YS4A 4AIRA 3HVIA 4EGFA 3WISA 2VHEA 1XAHA 2L18A 4NU5A 4KPYA 1BHSA 2RGNA 3UJ9A 5ERGB 4XVCA 2NYRA 1XTQA 4WLFA 4ICIA 1RKBA 4HBZA 3DULA 5A4AA 3IAXA 2GEVA 3B1KA 3TNLA 4A73A 4P98A 2C5FA 1RBMA 4IEIA 3D3EA 1V5IA 3UQYS 2JC3A 2IOFA 2JGDB 4D9GA 3H1TA 1EGQA 4LRQA 6ABPA 1D0IA 1M2JA 3TGPA 4L3OA 5CDTA 3QV2A 2P9FA 3IKMB 1G8JA 3T5DA 5CG1A 5JCJA 4DV2B 3SKXA 2QJWA 1QP8A 2RG7A 3TM4A 4MTLA 1DTWB 1W29A 2V6BA 5AXAA 1JJIA 3QWIA 2R5NA 5EWMB 2OHVA 1W4RA 5CX1A 3T5PA 5D3MA 1KC1A 3K09C 4IXWA 1MA3A 3IPLA 2HWYA 1YZLA 4OGKA 2GNOA 3BPSA 4EAAA 721PA 2O2CA 3HLYA 3PUVA 3H5OA 4JC0A 3RAGA 2O3SA 4HAYA 2PPLA 2HLDD 3R1IA 1GGJA 1BVHA 5C5DA 3ITDA 2PWZA 1DG1G 2FEMA 1WMAA 3O03A 4ONEA 4O63O 4RW0A 3HJNA 2O1SA 3LBHA 1AK2A 1IDOA 1NU8A 2OVBA 2PNFA 4TMZA 5BMOA 4REOA 5CVDA 3H5LA 1BGWA 1Q3TA 2C7QA 2Q4RA 4JLAA 1SUFA 2IV3A 4RK4A 2C31A 3ZGZA 1UBCA 3AL0C 2Z5FA 2QPOA 4Y6SA 1K6EA 2Y9MB 4UPEA 1V71A 4QDXA 4D02A 2B61A 5H3HA 1WZCA 3SYKA 2YUIA 3HUTA 1DEHA 1YQGA 1EFUA 1N5LA 2O57A 3LHKA 3LPNA 3PTLA 3FM9A 2BD0A 4GZLA 2WKSA 1I10A 5A0TA 1W8IA 8ADHA 3HKEB 1E7YA 1ZJYA 2MSLA 5EGNA 5BR8B 5E1OA 3WX0A 4QYTA 5DBEX 1JFRA 1CJSA 4HYYA 1DTSA 5BV7A 4UUBA 3FZGA 2AYZA 4A10A 1KGSA 2YW2A 2O8FA 2OYRA 1ZM3A 1WULS 2ECPA 3LHDA 5CDHA 4B46A 1USKA 2DWUA 3DPIA 1R88A 1SKAA 1C4WA 5CK5A 3W9BA 2XNCA 4GI5A 5HJ2A 1SKMA 2BV3A 4ENVA 1ZICA 3BXFA 4GX5A 1ONOA 1U31A 4JI3B 2ZM5A 1LDMA 3OA2A 2ZIXB 3WYBA 1S3GA 3GEPA 2CWDA 1PNRA 4NIMA 1QVVA 2Z9CA 4JU8A 1E1RD 1LBIA 1T24A 1TMGE 1KBZA 3MB5A 5C3UA 1B8NA 2Y0BA 3T15A 5AVXA 1T4BA 1A3CA 1Z83A 4GYJA 1E18A 2WAXA 4BEJA 1ZONA 1QVAA 1UP4A 2ZBRA 3ABQB 4JENA 3A9RA 5DI9A 1Y3HA 1L5WA 1ZGZA 3PHBE 4GOLD 2X0RA 1EYZA 2QTVB 1DWQA 1TIKA 3GRZA 3LMKA 3LDHA 1IIRA 1OIVA 2W43A 4GQBA 3PENA 4YRMA 3HJRA 3VA7A 4HRAA 3OZVA 1MNQA 2B8WA 3VH1A 4A8TA 3K9GA 2JGJA 3FFWA 1OILA 2O0MA 3FD8A 4S1VA 4A82A 3ANTA 1PSZA 3MWEB 3PEVA 4U2DA 2X8LA 1ABEA 4J4HA 2Z9BA 2BKVA 3GLKA 1O6FA 1MH9A 3EAQA 4RTLA 1NDUA 1XTIA 1KJWA 1XZHA 1RZRD 1T4GA 1VHQA 2PGAA 4ZTZB 5E3IA 2MTBA 1I5OA 3E9YA 4QIHA 3ZZUA 4AZ0B 2Z0MA 2HJWA 3L05A 4GYYA 4PQEA 3ROZA 2HUPA 3F6SA 2H4YA 1MKYA 4W1PA 1GGMA 3H0EA 1ISPA 5A6SB 3A1DA 1BH2A 1UFOA 2CMFA 1DVRA 3IOEA 1JG7A 1H3FA 2X6TA 3STUA 4CM4A 1A8PA 5A03A 4U02A 3T3PB 4UTNA 2YDXA 4O4IF 1A1VA 1T2VA 1JKIA 4OLJA 2PLNA 2DFVA 3H2SA 2PX0A 3HBJA 1GG5A 5DYGA 3AVTA 5CBPA 2D2EA 3NETA 5ELMA 3PE6A 1KAMA 1F48A 4V02A 4LWZA 2CE7A 3OKAA 3PU6A 1TIBA 1QE5A 3HDJA 4R51A 2Y1EA 4Q4AB 2QQ5A 4P32A 3ND8A 4MJLA 2V5AA 5CLJA 3NTUA 4A15A 1HYQA 4IUDS 1K7YA 4B6RA 2P9QA 3IKTA 2HXGA 5EPOA 4C4SA 1V95A 4U3JB 4FYKA 1LS1A 4GX1A 2GPTA 2HIHA 3M89A 4MIOA 2VJBA 2H52A 1U7OA 3CY6A 2Y77A 5FA8A 4TKVA 2ZUBA 4NH0A 2FP4A 1XZ8A 4O4LA 5THXA 1HT1E 1PJBA 1G7RA 1Y3AA 2AFHE 3RC3A 3GJ6A 1IHOA 1BMFA 3LE8A 2ZIGA 4IO0A 4MGYR 1NJ5A 8AT1A 3I5AA 4KAFA 3HI6A 1I6KA 1IWPB 2C95A 2KJQA 2P2NA 2K5UA 3BJZA 4MWSA 1II0A 5E1MA 4I5IA 2LDXA 4LOLA 3WLRA 4ZMSA 5JTUA 5J23A 1T3GA 3F90A 3PHJA 1QG6A 4QPPA 1KMHA 5EUQB 4FQ8A 3BAZA 2NV2B 2FKAA 2C7VA 1CQJA 4G5SA 3AL3A 4QDZA 1GFIA 4UEOA 2GESA 1P8JA 4IZOA 4QGFA 2WSLA 4QPCA 2AMVA 4LTNA 2ORWA 3CEMA 4GU5A 4XFJA 1M7BA 2B34A 4YJKA 4QJBA 2H7VA 4YRKA 1N2CA 4CR8A 3W7VA 3AFGA 4EG4A 1BD3A 3TTWA 1R9GA 1YRHA 4LYFA 2GF2A 1IH8A 4DDUA 2WJAA 3KQPA 4K0KB 1UC4B 2HA0A 3VISA 5T64A 1D2CA 3IPRA 2IV7A 1RC1A 3F78A 1HQKA 3LIIA 5BY2A 5F73A 2QQEA 4EFNA 3SKYA 4Q1EA 3DDUA 4ZREA 4BO0A 3I01A 1E8MA 3W4KA 3U6BA 4BMXA 3AF4A 2KYRA 3ISTA 4RVDA 2NV0A 2OO3A 3L8CA 1UXJA 2A5LA 1NIPA 4Q82A 3WLQA 4DY6A 5AM3A 1YB5A 1P4SA 4KOEC 1E9RA 4WXRA 3L7KA 3HA2A 3N1UA 4DDKA 1WDTA 2IXEA 3MGKA 3R3YA 5DKFA 3RS2A 4D8VA 4EEKA 1HZJA 1PSWA 2XA1A 5JG7A 3NNNA 1R5OA 3JWIA 3RIEA 3TXYA 4GXTA 2D0OB 2H1CA 5HFJA 1MEJA 2JFYA 3VU9B 5KTPA 2KI5A 3PPWA 3WBFA 3JQ9A 1TRKA 1NVAA 1O0CA 1WPGA 3CVWA 1UAGA 2VQSA 3IEXA 4PC6A 4OHCA 4AMGA 1YCDA 1JHPA 2FW7A 2GTHA 3R5JA 4G89A 4ITVA 4O4HF 4ZQFA 1G0OA 1SC4A 1SN7A 4NYIQ 5C53B 1SCDA 4P2BA 5A05A 4DB4A 1U5BA 1HT0A 1U0EA 2IFTA 4HAIA 5AJYA 1NJGA 3EHDA 5E7IA 4ZAFA 1KMIY 2BFCA 1GP2A 4OXNA 3AU9A 1PS8A 5H80A 4ZGBA 5A4KA 2YNMC 2V4ZA 4BAZA 4CDMA 5MF6A 4ZAVA 2XZLA 1Q83A 1R4NA 2G63A 3PPYA 3MJRA 1ZH4A 1N7IA 2P1ZA 1BYUA 1TL7C 3WO1A 4G65A 3T9AA 3VTZA 2GX6A 3AGPA 3Q98A 1Q6YA 4P92A 1IJFA 3S68A 5HCIA 2O6LA 1RAGA 2ZIEA 3FPKA 2WHQA 3K9BA 2RH4A 4GRAA 2VJKA 1U1GA 3DR5A 1S2IA 1CB0A 4FUTA 2FUCA 2G5GX 1NJSA 3BE4A 1E2JA 2G77B 3KFVA 2OXRA 4FKBA 4FYJA 4J03A 1PKXA 1WUTA 4TT3D 1Q7GA 5K3CA 2WB4A 4QU0A 3R3SA 2X9NA 4G8CA 4X5OA 4Y6OA 1A5ZA 1ZXXA 3ZU5A 3W6OA 3MHPA 3KCQA 5HKLA 2Y1WA 1BJKA 2HSDA 3A28A 4G4JA 2YWFA 3NP9A 2QG6A 3VR3D 1MC8A 5AK3A 3RAFC 1E0SA 4R81A 2GZRA 3ZE8A 4P0PB 4HQNA 3THWA 5HFAA 4BLPA 1SK8A 3WL8A 5BW5A 2AYYA 2R1ZA 1SCUB 4MWZA 4O3FA 3GF4A 4YJGB 2ZJ8A 3A6LA 3UW3A 1W8DA 2O5VA 3ZZ0A 3G5MA 5A2GA 2YOFA 1HQYE 1SZJG 2DT5A 1L4HA 3H1GA 2AV6A 3HJFA 3LHFA 1G8MA 3MS2A 3UAOA 4CR7A 1QFZA 1B1AA 4ZICA 4MQFB 4Y1FA 1VJTA 1ZGJA 2BZGA 3IOYA 4JNCA 3KNZA 4MLDA 2WUEA 3H11A 1WR8A 4Q9NA 5ILGA 4IZHA 4KG7A 1Z15A 4OHUA 4RPKA 5ALIA 1CUBA 4UTRA 2JFNA 1QRDA 4BNDA 2EDAA 2TMYA 5EI5A 4WFKA 4KITB 1ZRNA 3U3DA 2PXXA 4ND8A 3U0VA 4UTPA 1QC5B 2I4MA 2G7ZA 2BMFA 3HWSA 2G8NA 2PGLA