1SULA

Crystal structure of the apo-ysxc
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
195
structure length
186
Chain Sequence
MKVTKSEIVISAVKPEQYPEGGLPEIALAGRSNVGKSSFINSLINRKNLAQTLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPVIVIATKADKIPKGKWDKHAKVVRQTLNIDPEDELILFSSETKKGKDEAWGAIKKMINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein YsxC
publication title Analysis of the Open and Closed Conformations of the GTP-binding Protein YsxC from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 61
structure length 186
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1sulA00
1EFTA 4LX0A 1VKJA 1KK2A 1X86B 1QBKC 3HU1A 4W5HA 1IY0A 1SKYB 3EWSA 2RHDA 3EPLA 4IVPA 4DEYA 1E2HA 1A4RA 1I4TD 3AKDA 5JSZB 3T1OA 1N6HA 3IQXA 5CDFA 1U9IA 4RKFA 3KJEA 1KI1A 1KK3A 4C0LA 2Z5FA 3LVRE 1Z0KA 4B2LA 1OE0A 5H68A 4RD3A 4RVCA 4F4IA 3OAAD 1SKYE 3AEZA 4NH0A 1IN4A 4LHVA 1LVGA 2HCJB 2QRZA 1TQ6A 1L2TA 1U8ZA 2ZJZA 4FXPA 4LYHA 4Q4JA 5D3MA 5LD2C 4BFTA 1E0AA 2WKQA 4ESHA 3THYB 4KI0A 4D26A 4WW0A 4Z8YA 1ESNA 1KDOA 1Y3AA 3EARA 1DTSA 1SVSA 2B6HA 3PG5A 1DAHA 4XTRA 5CJPA 1W36B 2PZFA 3GLFA 3QXSA 2PEYA 1R5NA 3T1TA 4UNPA 1TF7A 5FTMA 5BN4A 2IEZA 2CNWD 4MH0R 2R6AA 4TYNA 2EFGA 4BFZA 2MMGA 1Z6TA 1AIPA 3O8DA 1GILA 4Q1CA 2CLSA 1D9XA 4B47A 2WBLC 4Q02A 1TADA 4A82A 4AYXA 2JA1A 1JEDA 3O8CA 2FV8A 1LY1A 4JZKA 5CLQA 3KKPA 4PHHA 4QGFA 1JAHA 4MRVA 1KSFX 2ZAMA 2VP4A 4P32A 1W4BA 3WYFA 1I4DD 3T1VA 1E9BA 2R8RA 1PUIA 4LI0A 4LZZA 1GWNA 1KNQA 2ZJBA 4QJ5A 5FUVA 1QVRA 1PV4A 4OI1A 2CK3D 1DEKA 4B2IA 5JWRA 2DWPA 3NKVA 4R2HA 2NGRA 3SOPA 1G9XA 2EYQA 3AVQA 1ZCBA 3HDTA 4QM6A 2JIZD 5FOVA 2W6JD 4TLDA 1G6HA 3CX7A 4PPFA 3QKRA 5AK0A 3ECCA 1DE0A 1LS1A 3C41J 3PCRB 2ZYUX 3MCAA 4C0JA 2FEMA 3QIAA 4B44A 3U4QB 2ODBA 1WBBA 1COWD 1ZRHA 4HEJA 4FWIB 1FUKA 3OHMA 4I1SA 2CLCX 3SDZA 3TE6A 1SVMA 3M4YA 3N5CA 1E2GA 4OJQA 4US0R 4KITB 5J4VA 1FL9A 2QQEA 3R7WA 3BGWA 4L8GA 4R2IA 4QHTA 2PT7A 1WF3A 2CCJA 2RKOA 3BERA 1NBMA 3GP8A 1N5LA 4FW9A 1N6OA 2IW3A 2CHVA 3DZ8A 5C4GB 2IF2A 1SKQA 3KKMA 4M1OA 1FQJA 4NCJA 5DSZA 1W0JA 2CXXA 4A2QA 4D4MA 1CF4A 3I8SA 2OLJA 1VG0B 4O2RA 1YR7A 4EPRA 4ON9A 3LA6A 3X1DA 1S1MA 3LW7A 4PANA 1IOZA 1G8HA 1NRJB 2ZQ5A 2JAQA 3GLGA 4LK2A 1NP6A 1E3MA 2VEDA 3A4LA 5FOTA 2QGZA 3OE7A 3PXGA 1N6KA 4WA7A 3AGPA 5G53C 5A4JA 4XWKA 3CM0A 1VECA 4RFSB 1ZNYA 4A6PA 3UG6A 2ZTSA 3KTAB 3TIFA 4TTQA 3VNUA 3FPAA 2D4HA 4B6EA 4DWJA 1HTWA 1UBGA 4DXAA 2ZJ2A 3VR2A 1ESMA 2GHIA 4GT1A 4IJMA 1OXVA 5G3YA 3FFAA 1VYTA 1BOFA 4D4JA 1OF1A 2ZRGA 4IHQA 2OEPA 2O8EA 4R98A 1OHHA 3ICEA 4OJKA 3HYTA 2F6RA 1MO6A 5KSYA 3SJZA 3UKDA 3ZVLA 1S8FA 4D4LA 1E9RA 3BIFA 3LX8A 4ZDKA 1GIAA 3V9PA 2CVFA 5HPYB 3ADCA 3TSZA 1J2JA 3MJRA 2WJHA 2J0VA 3IPXA 1XP8A 1JJ7A 1SQ5A 1G18A 4TMTA 3RS7A 1F2UA 2RGCA 2YJTD 4C0AC 1JALA 4UXJA 4LBVA 5CK4A 4CW7A 4FCWA 2XZPA 2VP5A 4MRSA 2GVDC 2Z43A 3EPKA 3CPHA 1KKLA 2I4IA 2ZRMA 5F9HA 4FMDF 2XXAB 4B2PA 5TY0A 1XD8A 2O8CA 4CZ2A 5HE9A 4UNSA 3BWDD 3OEHD 5FBWB 3T5DA 2QGNA 2AX4A 3C8UA 1E2NA 3EC1A 4ACAA 2J59A 4LPKA 4NBSA 4GL2A 3BORA 2F1RA 4FMDB 4I1OA 3VR1A 3W6PA 5DNYB 3F8TA 4LSGA 4TWZA 1E9EA 3GQBA 3MD0A 1CS4C 3C14C 4DCNA 1CIPA 5FPKA 2P67A 1LV7A 3TUIC 3A1UA 1TL7C 2GXSA 5CK5A 2FSHA 3WXMA 2FGKA 1J99A 1SXJD 4HATA 2IXGA 4NKRA 2W00A 2RHMA 1FMLA 2CBZA 4KBGA 4BFXA 1NN1A 4XJXA 4AC9A 4GPTA 1S3SA 4R9UC 1T5LA 1DBSA 4K8OA 5FL7A 5FPTA 4TL7A 5JHGB 2GBLA 1GNQA 2H5EA 1JQJC 4PFSA 1OXXK 1VIYA 3SJAA 1TU3A 2X8AA 2BCJQ 1MKYA 3NDPA 2OLKA 3L43A 421PA 4DT1B 1OIVA 1P75A 4KSBA 2Q0HA 4XOIA 3SHFA 2QP9X 3SYNA 2WWXA 3MWYW 3ASZA 1T0JB 2IX3A 4AYWA 4D2IA 2QP4A 3U7FB 1XEWX 2VTKA 4JVLA 1GSIA 3S1AB 4Q4HB 4LY6A 1HEIA 1VG8A 4DLUA 4PZLA 4EPYA 2JJ2A 1U90A 2ZUDA 3VX3A 4Q5IA 1JR6A 1UAAA 2BBTA 4U02A 4B3XA 2ORIA 1JAIA 4F91B 3K09C 2PCJA 1JPNA 1JI0A 4QNRA 3Q72A 3W5IA 1BYUA 1G1MA 4NTZA 2XGJA 3RYTC 4AKHA 1J70A 4ZPXA 2WAXA 4IDOA 2V7QA 1D2NA 1Z08A 1IONA 2W2TA 3W6OA 3U7GA 4HUQA 4ARZA 4E09A 4YMUA 1R4AA 2OSBA 3UWKA 3CUEF 1V5WA 4Q9KA 5HKKA 5L3VA 1AM4D 1NVUQ 4A8JA 3SQWA 1T3HA 3IILA 4XVQA 3WY9A 4BZXA 4HAXA 2A2ZA 3FMFA 4IOKA 2PJRA 2QNRA 3N70A 2PMKA 4WBSA 4TLEA 2IYLD 3FHTA 2JLXA 5FUXA 3RC3A 3LFUA 3NHBA 3RS3A 1E32A 2ZRBA 5EQTA 3CF0A 1IBRA 3K0FB 3LLMA 3MJHA 4A36A 2R6DA 2A5GA 4KU4A 1SXJC 3OIVA 5KDDA 4JLJA 5E95A 5G41A 3D3QA 1XZQA 3HWSA 5C4MA 3KQLA 2CEAA 4Q1AA 3TW4A 1A2KC 3DL0A 1P5ZB 2OCYC 3A1WA 2EWWA 4LHZA 1AN0A 1EFHA 2W6ID 2FDCA 1FZQA 4AKGA 1J8MF 4TYYA 2O0JA 3GJ8A 4BFUA 3MWJA 1MRSA 1W2GA 1UKZA 4BPBA 5K8UA 3DHWC 2O8BB 3GLFB 3WHKA 2BM0A 5KSPA 1G7RA 1NN3A 4QJ4A 4TMWA 4G5SA 3CBQA 4HZIA 1J90A 5FPHA 1HY3A 4DVGA 2ZANA 1IN6A 3SHWA 3SBEA 3QF4A 4A2PA 1ZD8A 1KO7A 3OEED 4TZ0A 1GKUB 1XEWY 4MGKR 4DDUA 1CR4A 2J5XA 1KO4A 4DB2A 3ZQJA 1H8EA 3I61A 2QUZA 2HT6A 1Q22A 1KO5A 3KZ1E 4DDVA 4GDFA 1G4UR 3GLFE 1E2PA 1P6XA 5G40A 4YMWA 1PVOA 4IEIA 1GP2A 3ZH9B 1XD9A 4KVGA 1KJYA 3LWNA 3PR1A 5KUTA 2AR7A 4BLQA 3DPUA 2JCSA 3THYA 4LHWA 2J7PA 1X3SA 1A82A 3HYRA 1UF9A 4TLAA 1LS6A 3W3ZB 2G77B 1OXSC 1QHSA 2OFOA 2Q3HA 1N0VC 3R9XA 1D5CA 1OFUX 4WZAE 3A6PC 2FZLA 1E2IA 1G8PA 1MOZA 4E03A 5BN5A 4LJ4A 4P4UA 4W5WA 1RRCA 4Q7KA 3L0PA 5AUOB 3B1ZA 2ZYVX 4K46A 1W5SA 1OKKA 1O87A 4DZZA 1OIWA 1XJCA 2ONJA 1FPMA 4IFEA 5IF9A 1N3BA 4M4SA 4TL6A 1DO0A 1GDDA 4B3FX 2C03A 1E2JA 2JDID 2VPPA 3GJ6A 3R7WB 5KNBA 1OXTA 3CF6R 3PUZA 4KBFA 5FOSA 1R10A 5TXGA 1YZGA 4M1MA 5CITA 1N6RA 2DY1A 4RCZA 2ZI4A 1OFIA 2AHOA 1LFDB 4TZ6A 3PJRA 5JCZA 1VG1A 2IYVA 4YDSA 3P20A 3WMFA 5E7MA 3T61A 1E1RD 4F38A 3MWLA 1U8AA 2GEVA 1W49A 3VKGA 5JEEA 4Q66C 1EFRA 3P32A 1EXMA 2CE7A 4QXAA 4MGZR 4TSFD 1XMIA 4RZUA 4YC7A 3HP1A 5L3RA 4YXWD 2MSDB 3VTKA 4ZV4A 1NBME 1E4VA 1NJGA 2CL6X 4B3DA 1U94A 2ZR0A 1C1YA 2PX3A 4DKXA 3U4QA 1S4QA 4A0GA 1Z0DA 3QKSB 4C4PA 3IEVA 4XVRA 3LO5A 1P2SA 2C2HA 1U0LA 2BMJA 4WVFA 4WZ6A 2RGGA 2VBCA 2ECKA 1XEXA 1MV5A 2JLZA 5HE8A 5EE9A 1AGPA 2BV3A 2IYXA 4LYFA 2XOKA 2E1RA 4LC1A 4TMZA 2D3WA 3DZDA 4A0FA 1NVWQ 2FJUA 2QE7A 5DH9A 4WXRA 4S2EA 4TTRA 1G291 1T5IA 1P9RA 3PUYA 2V4ZA 3P4XA 3K70D 1LB1B 4KO8A 2REXB 4UJ3A 4U7DA 3AKYA 1R0XA 4YMVA 3CRVA 1M34E 1ZCAA 2BIFA 3BRWD 2CL0X 2ZYWX 5C46F 4JYCA 5C1BA 2AKAB 2XSZA 4D81A 3GCGA 3WBKA 4URXR 4RFSA 4DLVA 4JSTA 4UXIA 4EFLA 3KTAA 4XD7D 1XCMA 1T91A 1KZGB 3K0AA 4O2LA 1XB2A 3OAAA 2NPFA 2ZRKA 2FZ4A 4QGAA 3C4JA 3QPUA 4JL5A 2WVJA 3ICQB 1SVOA 5FUWA 1NNEA 1G7SA 4PC7A 1AS2A 1BIFA 3KB2A 2EVWX 2OUKA 4JLVA 1MABB 4R7ZA 3DKVA 2ZITA 2O52A 3Q5DA 2QEQA 1KI3A 4DCSA 4D6PA 3D8BA 1MH1A 4EPWA 4Q01A 3SU8A 3L0OA 3THOA 1CLUA 2OV2A 1DAKA 2ZREA 4URUR 2CNWA 3ZDQA 3AVWA 5C18A 2D06A 5EXSA 1G17A 2IUSA 5GJBA 4PO9A 3AH8A 5KPJA 1OPXA 3FMOB 3I4LA 3PUWA 4PC1A 3NH6A 4LOAA 3B78A 3QXXA 2PLRA 4QJ3A 2XXAA 1ZD9A 1IQPA 4EUNA 5A5GA 2CHQA 1WCV1 5B58C 4MYUA 2W2XA 3TQCA 4EIWA 1EGAA 2PCLA 4HSEA 2JLWA 2FF7A 3EIEA 2FU5C 1E96A 4Z54A 2WJIA 3GJ5A 2DFKB 2FFQA 1GZSA 5LB4A 5BWMA 1NIJA 4LBYA 3RSOA 3KUDA 3AM1A 2J7KA 1YRAA 5BQ5A 3VKHA 5J4KA 1OV4A 2JIZA 2W6JA 3FB4A 1MR3F 1Q44A 2OESA 3TAUA 2HJVA 2ZJYA 1G41A 3AF1A 2A9KA 2FPMA 3I32A 4G5OA 1OJLA 1Q21A 3WYAA 3CH5A 1NJFA 2IS4A 2OAP1 2X19A 1MT0A 2ZSBA 4L9SA 3FWYA 5CIQA 4YLGA 2G6BA 3D7MA 3V4FA 2OBMA 1N5JA 1CJKC 1COWA 2RMKA 2C98A 1XTJA 3K70C 2GWHA 2EW1A 1UKYA 3EZFA 5CM8B 1TMKA 3ZS9A 3FKSD 3CNOA 3GLIA 4DUGD 3AVTA 5AUQA 1A2BA 2DHRA 1G3IA 1KI7A 1E2MA 4V0LA 4DT1A 1PZNA 1OH6A 4QGGA 1Y63A 2ZR9A 3FHCB 1SZPA 3P26A 3ETLA 4URZR 4IDHA 2F9MA 2VH5R 4MKFA 2IS2A 4CT4B 4G0NA 3X1YA 3UANA 2WSSA 4LDJA 2ATXA 3S1AA 4I4LA 4Q4HA 1P9NA 3AVOA 1TEVA 5TARA 1TX4B 3V00A 4NZYA 3EG5A 1JR3D 3PEVA 4TT3D 4Q7MB 5IDVA 3ZVRA 1CR2A 3E1SA 3AP3A 3CR8A 4DCUA 1XXHB 2RGBA 1J7KA 2ZRCA 2O0KA 2XJ4A 4POAA 1BS1A 2WIBA 1GKIA 1Q1ZA 3DKPA 4QHYA 4BQSA 1HH4A 4Z51A 2IF0A 1QF9A 4LJ5A 1AZSC 2V6IA 3GD7A 1CBUA 2CVHA 2A5JA 2OBLA 2BC9A 2F9LA 1S9HA 2IHBA 4Q9HA 3WP0A 4OK6A 1XXHE 1Z28A 4I81A 3EPJA 2GXUA 1KHTA 1P73A 4G3XA 2B8TA 3KQUA 2QP3A 2QT1A 2N42A 3VQTA 4PX9A 2OCBA 4Q00A 1S3GA 4IVRA 2RCNA 3KFXA 5TVKA 5FTLA 2OBNA 3KUCA 1XWIA 1ONBA 4M1TA 2IT1A 5FH9A 5KU1A 1YZLA 1GTVA 2Q21A 4JLMA 4JKIA 4BECA 3I5YA 2C78A 2C5LA 3QEJA 4MRNA 1CRPA 1OIXA 4QOSA 2ZUCA 3QI2A 5FOWA 3K0FA 5EUQB 2IYSA 3QVUA 2WMOB 1KJZA 3UXMA 2OHFA 3QF4B 5LDDC 3QG5A 4BFSA 3ZD7A 2IYRA 4DLYA 1CXZA 5KDOA 1XPOA 3MLEA 1M7BA 3OEHA 2I3BA 3X1WA 1ZUIA 4PZZA 3U60B 1T8TA 3LVQE 2FSGA 3QXCA 2WWGA 4M8NE 1F3OA 3I3SR 1Z0JA 4NCHA 3UK6A 4FN5A 2ATVA 2QMOA 2GILA 2FFBA 2Q6TA 1WQ1R 2QPOA 3ADBA 1LW7A 1GAJA 4JJKA 2ZETA 1E94E 1QHGA 3DMDA 2QTHA 4NYMR 1HT2E 3TSOA 1Z47A 1DG3A 2FNAA 2O8BA 1GG2A 3KXLA 2HJGA 3PUXA 3GFTA 1K5GA 1QRAA 4D4KA 4E07A 2HXSA 3ZZTA 1XZPA 5EXXA 3THWA 3QPWA 3O8RA 1Z83A 2IYZA 4IXNA 1CR1A 4DIDA 3SEAA 3B9PA 3GEEA 3KJHA 5H1YA 5LD2B 2HYDA 2J0UB 3LBNA 3TVTA 2ZE5A 3U3OA 1IN7A 1G64A 2FH5B 1NKTA 2QA5A 2GKSA 5E7IA 3WMGA 2XZOA 3ASYA 1N5IA 3OESA 4DHEA 3BB4A 5JBQA 1VCIA 3WBJA 1ZINA 1T6NA 1Z22A 4B3CA 1OB2A 4NYJQ 3IUYA 1CP2A 3AUYA 4DLRA 1MO4A 2R2AA 2QMUA 1FOEB 3CZQA 2AK2A 3MAAC 4UNRA 2X1VA 4EPTA 5KOYA 2P3SA 1TF5A 1UKVY 4GMXA 2CL7X 4OHVA 4PSVA 1KK1A 3T06B 1HE1C 5FR2A 3EWAA 5IT5A 1P4SA 2OXCA 3Q3JB 4J0QA 2YKGA 1XPUA 2KBFA 3FTQA 5CB8A 3SNHA 4G5RA 5H8WA 4GOXA 2OILA 1MO3A 3LH5A 4MDFA 5JS7A 3TJZA 1U0HC 1U98A 3UWOA 5FUYA 1GVNB 1E79D 4QFMA 1R5BA 2WOJA 5EP1A 2AD5A 4LGMA 2N1BA 1XEXB 4FCTA 4KFTA 3U44B 1S1CA 2B7CA 1KY3A 1HA3A 2JEOA 4Q4LA 3TUJC 4CRWB 4CYMA 3U7HB 2F43B 1VMAA 4XSGA 3NBFA 4OKSA 2D74A 1NVVQ 2WPDD 1G3QA 4PC6A 4RCYA 2YOFA 1DELA 3O47A 4LC0A 5J4HA 3FMIA 3W8NA 5EXPA 2H8KA 1NSFA 4RY2A 5FTKA 2R6GA 4P4SB 1Z8FA 4US2R 1N6IA 3WMEA 3H1TA 1FW6A 3ADDA 4DSNA 3RS5A 1W44A 2FFAA 4HB2A 4JLBA 2NO6A 4L9WA 1FP6A 1NL3A 2H57A 3NWJA 1OH8A 3W90A 1P2UA 4II7A 2NMVA 2ZI3A 2RGNA 2WIAA 3QKSA 3BXZA 4NCKA 3HU3A 4PPNA 2CMKA 2JJ1D 2ZSAA 4M9QA 3K0AB 3TAHA 5SZJA 2FMXA 1VIAA 4CEHB 1ZIOA 3H2YA 3QKUA 2W6IA 2FGJA 3O8BA 2HLDD 1VCMA 4BFVA 2YHSA 4UKDA 1IXRC 2C9YA 1L8QA 2NO9A 2VIIA 1OYWA 1P62B 2J9RA 5KTYA 2V3CC 2BBSA 1NY5A 1DOAA 1E6CA 1RFLA 5EE3A 4CGZA 2ZYTX 4PSKA 4HB3A 5FBQB 3QKTA 3QXJA 2Q9AA 3DMNA 1P3JA 3OEEA 5EP4A 4EKDA 4F4CA 1EWQA 4Q7LA 2O8DB 1Z2CA 2IWRA 821PA 2Q9BA 2GCOB 4MRPA 2YNMA 3B9QA 4M22A 3RAPR 4GP6A 2XJ9A 4LRWA 2YVUA 5JJIA 2NPIA 4OL0A 5DO9A 4FIDA 2IYWA 1AA9A 1ZUNB 2VQSA 4JS0A 1E2DA 5EP2A 4F93B 6Q21A 3LQRA 5J4LA 2J87A 4NDZA 2QAJA 5FBRB 2FEOA 2YWFA 4YMSA 1MABA 3X1XA 1OSNA 3QSYA 3BAFA 2L0XA 2NZ8A 3SFVA 4ZDIA 3HPRA 2FPLA 2BEKA 4C0KA 2ZRIA 1JBKA 4MDEA 1GNRA 2JATA 1G21E 1QG4A 1TPZA 5DE3A 5EP3A 4BGDA 2WWIA 1NMYA 3ZJYA 1RJ9A 2BMEA 5EZ5A 1Q1EA 2LKDA 2GEUA 3CONA 3JZAA 5JRZA 3M0EA 2HF8A 3W3AA 4TMXA 2ZS9A 5AJYA 4L4UA 4O0MA 3U6KA 1JJVA 3AF3A 5FBLB 2CHGA 3UMFA 3PEWA 2ASEA 5GJWC 3KQHA 3A8TA 3LLUA 521PA 2JDIA 2W83A 4KHZA 1AQUA 1KGDA 4BFWA 2CCGA 2ZU6A 5DIFA 4H1VA 1GUAA 5JWHA 3QENA 3GLIB 1KDPA 3WP1B 1X1SA 1X8JA 5EE5B 3FFBA 2ZSFA 4QC2A 2IK8A 1OW3B 2QENA 1E1RA 4EJSC 2DFLA 2BKUA 4MUBA 2ERYA 3B6EA 4NHOA 3EPHA 2OM2A 4XTCS 4D80A 2DFNA 4HB0A 3GLIE 3A58B 4TSFA 1HT1E 2B8WA 4FI3C 4YXWA 2XB2A 4ZKDA 1P9WA 3FGNA 2C96A 3L2OB 4IEEA 1DAMA 3U3MA 4GSYA 4JVNA 2ZRAA 2VRWA 4PC2A 3VR5A 4B35A 1UKEA 4MA4A 2KJQA 3NH9A 3B1XA 3RRZA 4NPHA 2ZE8A 3B82A 2QAGC 4C2TA 3RRYA 2E9SA 3KKOA 4BZQA 3Q9LA 1Q12A 721PA 2ZRNA 2WV9A 4QRHA 2FSFA 3H4MA 5JI3E 2P5TB 3DM9B 1SGWA 4PQFA 1XDBA 4RZ2A 3QBTA 5HTKA 2GJKA 1MRNA 4PHTA 4UQOA 2CDNA 1TTTA 1CJTC 2LKCA 4MUAA 4QBHA 2BCGY 4MYHA 1RRFA 2VHUA 4JSYA 4HAYA 3RC8A 3P4YA 5JJLA 4GI7A 3IEUA 4LJ8A 1YZKA 2Q9CA 1D8TA 1EFUA 5BYJA 4BLPA 1S9DA 1DG1G 2XAUA 4B43A 5CJ2A 2W2VA 1XXHA 2V9PA 2OFWA 4FWTA 2ZI7A 1KAOA 4OHWA 4ZCLA 2QSZA 2ZM5A 4XD7A 4XVUA 5KO2A 3TVDA 2XZLA 2QT0A 1IY1A 4KLNA 1F5NA 1RIFA 1U9IC 3RS2A 2WJJA 2ZRPA 4ASUA 1GL6A 1L4YA 5BN3A 2E87A 4HLUC 2ORWA 3NC0C 3SBDA 5GJCA 5EJEA 5ANRB 4A0RA 1R5OA 3DOEA 1XTIA 2H18A 1P61B 4Q9JA 5TMPA 2WTUA 3VX4A 4GRAA 1G16A 4Q1EA 1OH7A 2ZEJA 3TKLA 1G7CA 1XTRA 4ESVA 1SXJB 2A3RA 2VHTA 2IBMA 3U2QA 3TH5A 1E2LA 1YZTA 1ZAKA 2ODEA 3DDCA 2R9VA 1W7AA 1ANKA 1P60A 1GRRA 1UBCA 4WOPA 5SZKB 2QROA 3THWB 1FMJA 2F7SA 4C3ZA 1II0A 3QVVA 4MGYR 2MSCB 3QJYA 2ZRDA 4WXPA 3Q5EA 1T4GA 4PSAA 5GVRA 3NDBB 1SXJE 4QM7A 4B33A 2QMEA 2ZU0C 3FVQA 1KI2A 1UEJA 1BMFD 2FG5A 5JLJA 2V6JA 4FMCF 4B34A 3RWOA 3I5XA 4BRUA 1QHNA 3RDPA 1Z3IX 3KXKA 2PEZA 4QHSA 1Q3HA 1Z5ZA 4B75A 4JT4A 4JBYA 1II9A 2DCUA 3RRNA 1H65A 2EWVA 4MGIR 2P6RA 2JLSA 4BE7B 4FMCB 4C2UA 4CEIB 5FFMA 3K0CC 3ZIAD 1GL7A 1PJRA 1YE8A 2H17A 4X8HA 5G3ZA 4KYUA 3EIQA 3OFND 3BB3A 2F1HA 4URVR 1ELOA 2XNDD 2GCNA 5HR5A 2ZRHA 4JJZA 4BEJA 1M74A 3UIEA 3FKSA 4LWZA 2IEYA 1XX6A 2J0UA 4DUGA 4GMDA 1WA5A 1W48A 3ZGXA 2DWOA 2HXYA 4Z8XA 4EQ6A 2BM1A 3ZYCA 4G5GA 2FSIA 3C16C 2WKRA 4OHZA 3REGA 4AURA 4PAMA 5DN6A 2FE4A 3NC1C 1Q20A 4LJ9A 1XPRA 4TL9A 3VKWA 4ABYA 2SHKA 4L5BA 3IQWA 2OZEA 4Q18A 1D9ZA 2JJ8A 3R9IA 2IYQA 4N0DA 2KB0A 4NP6A 1IXZA 5C2JB 1QZXA 4QBFA 2QBYB 2QSYA 1G4AE 4P3YA 3MWKA 1KDRA 2REBA 4IDPA 4TT3A 2ZJAA 1F6BA 3KKNA 2FFHA 2H7VA 5JHHB 4KFRA 4EFMA 3AVXA 1BKDR 3JVUA 2ZR7A 2BMDA 1HE8B 5FL7D 2FX3A 2ZJ8A 2YOHA 3TRFA 2ZJOA 3JZMA 4RZXA 5DISB 4KVAA 1N5KA 2XB4A 5D3QA 3NG1A 1E2FA 1KTVA 4AG6A 4RSGA 1HYQA 1KSJA 3BB1A 2AXNA 4QL3A 1QHHB 5EE1A 3K9NA 3FE2A 1DAIA 1A1VA 3QY0A 3U44A 3ZVNA 4V0NA 1RW4A 4F7WA 2F43A 4Z1MA 1G19A 3AF4A 1YKSA 1WP9A 3KDSE 2O5VA 2VP9A 1SVLA 1IY2A 1QHYA 1UEIA 4ZCMA 1XF9A 3VU9A 3RS4A 4D0GA 2JJ2D 4TQ9A 621PA 4O3MA 4RD4A 4AG5A 1U8YA 2K5UA 2ANBA 3CNLA 3KKQA 4P4SA 1M7HA 4HLCA 5EXTA 2IUUA 4A6XA 5IRCD 4PPQA 1JNYA 5FR1A 4C30A 3EA0A 4DSTA 1R6BX 3QQ5A 2IHYA 2GF9A 3E2IA 1XTKA 4OI4A 2NIPA 3QPVA 1VYUA 1I4LD 2B7BA 1HQCA 3KQNA 4Q1FA 2ZI9A 4CVNA 1DADA 3FHOA 4C0BA 3CPEA 4NONA 2IYTA 1FP7A 2ZXUA 1N6PA 2GK7A 4KLZA 3B8HA 4C0QC 4CEHA 3LX5A 2VSFA 5DLQC 4HI0E 1C9KA 4ZDWA 1IXSB 1CKEA 2GZHA 3PVSA 3CRMA 4M1WA 3RVBA 4BWYA 1WB9A 4G01B 3GJ3A 2W0MA 2MMCA 3D31A 1A7JA 3KJIA 4JT2A 1ZYUA 4KODA 2VF8A 3SI7A 4UXHA 5IHPA 5GADl 1Z6AA 3IIKA 3DOFA 2VF7A 1OYYA 3IHWA 4LBZA 4TN1A 5EUMA 2KI5A 5FI1B 1E0SA 2A5DA 5BW8A 1W47A 5HCNA 1N0UA 3FMPB 3A4MA 1IHUA 1RJ9B 4XH9B 3A1SA 3IO5A 2O8DA 2D2EA 2HF9A 3Q8XB 3U6BA 2GCOA 2RGXA 1KO8A 4GZMA 1YU9A 4ZI3A 4N0EA 1ZNWA 2C9OA 3U61B 1OFHA 2EU8A 2NOAA 3NXSA 4IVQA 4OI0A 4TYQA 2C04A 2GBLC 4WAUA 4JBXA 1R2QA 4Y0VA 1NN5A 3U3JA 3QG1A 5KPDA 4B3GA 1UPTA 1G3RA 2QTVB 3SC3A 5JWOA 1G5PA 2YYZA 2JLQA 1JXOA 3L8YA 2RAPA 4GBMA 4IOMA 5KSOA 2HT1A 2GAAA 2QTFA 4Q9LA 3LV8A 3KL4A 2CK3A 3HR7A 4HAVA 4JKYA 2HCBA 2IWHA 1D6JA 1JECA 3W6NA 4DLTA 5AR1A 3TUZC 3ND8A 3L8ZA 3W9YA 5JFGA 1G3MA 4DDTA 1G3UA 4RJLA 1E2KA 3MUFA 1DAFA 2GAOA 5FPSA 3BH7A 4LBWA 4AY2A 2ONKA 1E9AA 1SHKA 1ZC4A 3ND9A 1W2HA 2ORVA 3KX2A 3AP2A 2JGNA 5IK2D 1JQLB 2AFIE 3WNBA 1HQYE 1AK2A 2EFEB 3Q7PA 2YWEA 3RSLA 5CLLA 3DVLA 2R62A 1UFQA 3LXRA 2G1JA 2AD1A 2ZI5A 4X8OA 5K8IA 2UKDA 2VHJA 4X8MA 1NY6A 4LCBA 5KDLA 1CULC 2WPDA 4PQYA 4E5UA 3SYLA 4LJ6A 1W36D 2EYUA 3G5UA 4M53A 3OIWA 4RD6A 5FPYA 1NLFA 2AK3A 4B73A 1G8YA 1M8PA 4K81B 3W34A 2ZE7A 1Q1BA 2NO1A 2BJWA 1I2MA 4A8JC 4B6FA 5K8TA 1H8HD 1W4RA 1Z6XA 1G7TA 1VCNA 4NYIQ 3K70B 5AJVB 4URWR 4H1UA 2BBOA 2IXFA 3TK1A 2YC2C 4UNNA 4BLSA 3M1IA 3QBVA 2FPKA 3RRMA 5DI3B 2GEDA 3CIOA 3T5GA 1QHIA 2JJ1A 4NCNA 3NTUA 1Z06A 2H1LA 2NQ2C 4PQRA 4B71A 4V0MA 1ZD1A 5B64A 1AS0A 3MRSA 5CIWA 4Q7JB 4ILEA 2VSOA 4TL8A 1K5DA 2WOOA 2VP6A 3OZXA 4LYJA 4MRRA 1OH5A 2YZ2A 2HDNB 4Q4AA 4XWAA 2HLDA 1NKSA 1P72A 1Z0AA 5SZIA 2C9CA 2QMHA 4KSCA 3FYHA 3EXAA 4DSUA 3WNDA 3B85A 1N6LA 5B2ZA 1TQ4A 3RANA 1NLYA 4KXFB 3LAWA 2YOGA 4LJ7A 1ETUA 4PXAA 3LY5A 2QPTA 3UMSA 3AVVA 3VMFA 3EAQA 5L8VA 3I62A 2A7QA 1KAGA 1XFAA 1RYFA 2BEJA 2P6NA 3K09A 4QBGB 5KNCA 1OLOA 1LNZA 4PO8A 1TQDA 4F92B 3CWQA 2N46A 2VHCA 3P27A 4KCGA 4F4JA 3EZ2A 3SJCA 2G83A 1R0YA 1E99A 2ZS7A 2XTZA 4IDNA 2QL6A 1GKYA 3TBKA 4RD2A 1II8A 1XU4A 2JLUA 2V1XA 3ZZUA 4NE2A 2XOKD 1T3LA 4JLOA 1F2TB 1ZUHA 4I1UA 2DB3A 2QE7D 5FTJA 2GJSA 4D25A 2QG6A 3AVPA 3QE0A 3GEHA 3RLFA 4YONB 4IXMA 4M21A 5AUPB 4JMPA 3CLVA 2HUPA 2ZIAA 4C7OB 1F48A 2IUTA 5TB5A 1YR8A 2HEIA 4S35A 4E22A 5E3HA 1W36C 2CJWB 5AWFC 2XSZD 1G20E 1SXJA 2YWGA 4FD2A 1ZVQA 1GOTA 2KSQA 2GJ9A 2J46A 1E2EA 2GESA 1DAEA 4DEXA 1E2QA 3K1JA 4HLUA 3TR0A 2JLVA 1BO6A 2G88A 4XIGS 1FNMA 2I1QA 3MG9A 4DLWA 3F3YA 2R6CA 1IJEA 2UZ3A 2UVQA 2VP0A 1KI6A 5CM9C 5JEDA 2WJYA 2WSMA 1XJQA 3TLXA 1W4AA 2IA5A 4AD8A 4IOJA 2NG1A 1R8SA 4HAWA 3OIUA 1E9FA 2F1JA 4HZUB 5LPNA 3PQCA 4EQ6B 4OQLA 3RNLA 3ZQ6A 1SVWA 2KBEA 2JLRA 1BH2A 4BLOA 5HZHA 3C15C 1XD2B 5FBVB 4QNMA 2KWIA 1OXUA 1Z2AA 2AFHE 2RGEA 2WWWA 2ZS8A 2G0TA 2BVNA 2ZUBA 1X6VA 2C95A 4M9ZA 4CEIA 2W0SA 5E7JA 3ZS8A 1EWRA 1TEXA 4ERNA 1P2VA 3AQ4A 2JLYA 1ZM2A 2BDTA 2P2LA 1K8RA 2NO0A 4V02A 2PJZA 1EG7A 3K0SA 3LRPA 1RYHA 4DC9A 3AF0A 1Z6GA 3A1TA 2VYFA 1VTKA 2JASA 1KZ7B 3IHLA 5EE0A 3IIMA 1P7CA 2ZRJA 3DM5A 3HPQA 3I8XA 3LW8A 4DLZA 3THXA 4QGHA 1JR3E 1ZC3A 1JPJA 1Z6YA 4ITRC 2GJ8A 4JLAA 5FOUA 1AS3A 2D62A 3AP1A 2RGDA 3WRXC 4A0HA 3K0CA 3VFDA 3WRYC 4DIEA 4TTPA 3DO6A 3VHXA 1FUUA 1Z0IA 2F3RA 1VHTA 4H9GA 3TGPA 1KMHB 1LTQA 2AWNA 3VU9B 2QBYA 1E1QD 1KDTA 1Q3TA 3MMPA 5JS8A 5DHAA 3ZLJA 4OQXA 4NL4H 3CRW1 1OFTA 1KI9A 1KY2A 1XEFA 4RFVA 2FWRA 3BD9A 3QEOA 2GCPA 4L16A 4V0OA 4CDGA 4M1KA 3UG7A 1KOFA 1L7VC 2ANCA 2RH5A 4NYJR 5JMTA 1IAQA 3CX8A 3RWMB 1Z29A 3SZRA 2XTMA 4U5XA 3FOZA 4LV5B 3W8RA 2NO7A 4V0KA 1YR6A 2ODNA 1HV8A 1RRPA 2DYKA 1FX0B 1QHHA 1E0KA 3FKQA 2XITA 1IN8A 3HR8A 4PTLA 1DO2A 3GJ4A 4BZPA 2WSSD 121PA 1UJ2A 2GRJA 5CYPA 1ZM4A 2X77A 3K0EA 2OAQ1 5DYGA 1FTNA 2RB4A 2UZIR 4B48A 1QVAA 2KE5A 2H16A 3ONWA 5GJVC 1B0UA 3KFVA 4CEJB 3SJBA 5F9FA 2F3TA 4UJ5A 2XTNA 4DJTA 1K6MA 4IOLA 2WM9B 3BC1A 3VHLB 4BLRA 3BH6A 1KJWA 3TQFA 5L3SA 2OCPA 2OFXA 4D0NA 1AKYA 2WWYA 2H92A 2F1IA 4P4TA 1NVVR 3ADKA 4QBIA 5F2EA 1RRGA 4MQBA 1N6NA 1XBTA 2P65A 4P0TA 3WHLA 4ACBA 4CT5A 4DBLC 1W0KD 3T1QA 2GVZC 1D2MA 2V8OA 4MYCA 2GK6A 4N3NA 4JLPA 2VSXA 1BMFA 1WBDA 1IN5A 3DEFA 4ZKEA 3VR4A 4AYTA 5M04A 3SR0A 3AGQA 1Z0FA 3PUVA 2Y8EA 5AJWA 5KHOC 4M9XA 4TLCA 2ZSEA 1SHZA 2VLIA 4RKEA 1GM5A 3MGCA 3NBYC 3R8CA 1YJ5A 1M6NA 3EC2A 2P6UA 3ZIAA 2EFHB 4HDCA 4M0LA 1GRNA 5UKDA 2Z4SA 5CB6A 3E5HA 2XNSA 4M1YA 2V55B 3B1YA 3OFNA 1NMZA 5ELXA 1R8QA 3WYGA 2XNDA 2V54A 3MFYA 4W7SA 1TUEA 3R20A 1WE2A 1WXQA 1T3SA 4P33A 3QF7A 5KSZA 1EESA 4EDHA 4M1SA 1C4OA 5TDHA 4ZIRA 1IJFA 2AN9A 1GNPA 3TNFA 4PR0A 5E4FA 1NSTA 1EX6A 2HYIC 3CNNA 3GFPA 4FINA 3EW9A 4Q03A 1O3YA 4A92A 4DCVA 3TR5A 4EPVA 4ZDJA 2WHXA 3LBHA 3NHAA 2EFCB 4PC3A 4M9SA 2D2FA 3EA5A 1VG9B 1Q57A 4WZBE 1TU4A 4PAOA 3CRQA 2OO7A 1IM2A 2YINC 5K8LA 3AVUA 1YZQA 3TSWA 2GZAA 3AVYA 4JLDA 3UATA 1FNNA 2ZVQX 1G8FA 2PMDA 2ZROA 1NN0A 1R7RA 1T9HA 1EFCA 2BMFA 3CF2A 4MYTA 2WWFA 1YZNA 3NIBA 4LV8B 1ZNZA 1YHNA 1UBEA 4G5QA 5J4YA 5JI2E 1PLJA 4GFDA 3CPJB 3GFOA 4IW3B 5J5CA 3BFXA 1KI4A 1PLKA 1RPZA 1B23P 1G6OA 3CB4A 3L0IB 2YWHA 2J3EA 2BBWA 2QORA 2D7DA 2Z6VA 1WDTA 4EJSB 5JCPA 2VL7A 2AKYA 2AXPA 3PV0A 5FI0B 2WAYA 4Q4AB 1OB5A 3PFIA 1AKEA 1ZMXA 2YV5A 3LD9A 2Z0MA 3H84A 2QM7A 2WMNB 1Z63A 2C99A 1V43A 2ERXA 2GNOA 3IKJA 4HLQB 4V0ME 3H0KA 3AKCA 4YMTA 1E9CA 2GXQA 2QI9C 3ZZ0A 4BASA 1AJEA 2QAGB 3A36A 8OHMA 3WNCA 3HU2A 4LYAA 4LJYA 3K53A 1ZM3A 1FTSA 2J41A 2ZE6A 3BOSA 4TQUS 5DI3A 4AKEA 1GITA 1JB1A 4Y0AA 1EX7A 4OYHA 2G1KA 4HDQB 4MKIA 4OBEA 3VAAA 2PL3A 2X2EA 1GRQA 1KYIA 4B32A 2ZSDA 3EZ9A 2O8FA 1II8B 4BRWA 1NBMD 1SULA 3EX7C 1DPFA 3EZ6A 1W1WA 4WIAA 2J0SA 3LQQA 2NTYC 1YVDA 3V4RA 4JYBA 4NMMA 3AUXA 1W0JD 2FOLA 2ZPTX 1XNJA 2QY9A 1US8B 2I1VB 1UM8A 5CYOA 4W9MC 4BFYA 2HV8A 4DCTA 3L0SA 4TMVA 5L3QA 2GTPA 2EQBA 3VR3A 4JVSB 2WKPA 3GLHA 2WJVA 4LV6A 5KNDA 2RGAA 1W46A 3GMTA 4M2LA 4KJZA 1ZW6A 3F5FA 3OE7D 5B30A 1RKBA 2R44A 4MITA 1N2CE 4HB4A 3C5CA 3CW2A 3H86A 1W5TA 3P1JA 4PZYA 3T34A 4URYR 1E69A 5JJKA 1E0JA 4OQNA 1W4CA 2ZAOA 1UADA 5D3MB 1YZUA 1KI6B 4Q4JB 4UNQA 2GXAA 1F2TA 5CDFE 3IIJA 1VHLA 1OHHD 5B57C 3ZVMA 1ZP6A 4JL8A 5A0FA 2IYUA 4TYPA 4DLXA 1VPLA 1KK0A 2A78A 2AWOA 2WJGA 2YC4C 4AI6A 3PIRA 1M7GA 4Q21A 3C7KA 4BUJA 2IL1A 1S0UA 4C7OA 3B7GA 3TW8B 5KYKA 1ZNXA 1X8KA 4A4DA 2IS6A 4ZO4A 1DAGA 5JSZA 4NCIA 3REFA 2CJWA 2CLDX 1PUJA 2ZI6A 1DVRA 3G82C 2BHRA 4MKHA 2EFDB 2IC5A 3NBZC 3BFVA 1XTSA 2AL7A 3GJ7A 3IBYA 2CCKA 1X8LA 2LCFA 3NEYA 1UDWA 5IK2A 3VR6A 3LBIA 4RD0A 5J47A 1E98A 1T8UA 3IDQA 2PBRA 4RZ3A 2PH1A 4EPXA 3B1VA 1S96A 3KXIA 4NU0A 5P21A 4JIMA 4XWOA 1CU1A 1PLLA 4O25A 4C0HA 4HZUA 4DDWA 4QKQA 3THXB 2OG2A 5FOXA 3Q7QA 4A15A 1U0JA 3SE0A 2Z4RA 1QG2A 4AK9A 2X2FA 1RVDA 5FTNA 1XD2A 2XX3A 4A2WA 1H8HA 3QKRB 2QPAA 1L4UA 1QHXA 1JXMA 4KYIB 5JECA 4JLNA 2WWHA 3W5JA 4R71A 3NEJA 1JR3A 2XEXA 4JBWA 2OXRA 4G1UC 2IYYA 5J40A 3K9LA 3UPUA 2DR3A 1XCGB 3TMKA 3BH0A 3VNVA 4PHFA 4GOJA 2MSEB 1N0WA 4IKEA 4Q9IA 3GJXC 1U99A 4GZLA 1UBFA 1ZU5A 2FN4A 4TYWA 4V03A 1NG9A 2RGNC 2PT5A 4AIIA 3SQXA 2LWIA 1ZJ6A 3T15A 2ZVPX 4OQMA 1VCOA 1OT3A 3RS0A 4OQFA 3T12A 4TQAA 3OF5A 3BFKA 3KJGA 1XMJA 3N2EA 2DPXA 4DB4A 3J81k 3I92A 1J8YF 3I73A 3LNCA 4CF7A 4JLKA 1Q0UA 3K9HA 4D0LB 1KSHA 1VDZA 4MKGA 1KMHA 4HDOB 2A30A 4PPGA 4OK5A 3UMRA 2GDJA 3B1WA 2PLFA 3GLGB 1KI8A 1M1YE 1VYVA 4I99A 5AJZA 2B21A 1KSGA 5BYKA 1HURA 1ZBDA 3R8FA 3KB1A 1LF5A 4KV9A 2O0HA 1GL9B 2BOVA 4OK3A 5DYIA 4B74A 3FDIA 3EIHA 1SVKA 4Q1BA 3GEIA 3PENA 5L3SB 1S2MA 1E9SA 4X8LA 3GLGE 2FA9A 4IRUB 2OE2A 4C9BA 2V7QD 1FX0A 1NG1A 2GA8A 3GPLA 1XMVA 2O8EB 3QXHA 4HAUA 3F0TA 1A5TA 3AB3A 3ZD6A 4KFUA 1ODFA 1KO1A 5HKKD 5F98A 1HUQA 2VA8A 3AV0B 4QG7A 3R9WA 4XSHA 2GJAA 1R0ZA 1G5TA 2GETA 5FL3A 4KFSA 3I1FA 3NVAA 1N25A 1KIMA 3IO3A 4CEJA 1ZU4A 1JEEA 1CRQA 1RE0A 3T35A 5DHFA 2G3YA 2R6FA 1F2UB 5AUNB 4HYYA 2BJVA 3PEUA 3Q85A 4Q48A 3A37A 2PX0A 4BEBA 3PITA 5EZ6B 1Z07A 3KQKA 4JL6A 3CH4B 2J0QA 2G0NA 2WZQA 2O8CB 1U81A 1AZTA 4ASUD 1QDEA 1BYIA 4DSOA 3CR7A 4AWXA 4HUTA 4PHGA 4B3BA 4ZIRB 1DARA 2C8VA 2P5SA 2C77A 1CR0A 3MSXA 3C5HA 1FQKA 1RZ3A 2B92A 1UDXA 1NVXQ 3U7EB 1XCPA 3CRRA 2OCAA 3A1VA 3U3RA 2G9NA 1D2EA 4ZCIA 3AKEA 1WMSA 1AQYA 2ODWA 1LF0A 4CIDA 2BWJA 2WICA 3JVVA 3BK7A 3NBXX 2QZ4A 4OI2A 3SS8A 2P0EA 3CWZA 4GP7A 3SFZA 2A5FA 4IDQA 3BJIC 1Q1QA 2IXEA 2DWQA 3B13B 2PZEA 4TLBA 4A1FA 3B60A 1F60A 2GF0A 3CO5A 3E70C 4EAQA 2GZDA 3CKLA 1H8ED 2ZRLA 2F55A 3QNUA 3BBPA 3I72A 1XMSA 3SN6A 2D7CA 3K8YA 221PA 2QU8A 4LHXA 4A9AA 4HLDA 1R0WA 1NMXA 3IGFA 4P31A 2J45A 1E79A 1E4YA 3PEYA 4PO1A 2OT3B 2PZGA 1XRJA 2Q3MA 5H70A 5TV2A 1TAGA 4Q47A 4JVMA 1E9DA 5LB2A 2J7PD 3N2IA 1CJMA 3K9GA 2QRNA 3QUSA 3EZ7A 3RHFA 3LXXA 4Q19A 3EASA 2DFTA 1T0HB 1E1QA 3OIYA 4LUCA 4EFNA 1KMQA 4GNKA 4IFBA 3LDAA 2IS1A 3QOFA 4AKIA 3AF2A 1KNXA 2QN6A 2BKEA 3D6TB 2V1UA 4PAQA 1NI3A 3HJNA 4FMBB 5DI9A 1MO5A 4OHYA 5HZKA 1EK0A 2REOA 3GJ0A 5BXQC 5SZHB 1OKKD 4DRZA 4L15A 1RC8A 1G8GA 1YR9A 1ZM9A 3CZPA 1AGRA 1SVIA 5JZVA 1NF3A 1G5RA 5LBIA 1YQTA 4B76A 5DN6D 3SYKA 3U5ZB 5GVSA 3IBGA 4YDHB 3RABA 4HUQB 4Q1DA 4ARZB 4DLSA 1KKMA 4EJSA 1CJUC 4RD1A 1DS6A 1X1RA 2VP2A 2O8FB 4KAXA 1CJVC 3G0HA 4A8JB 3B2EA 2QQ0A 4LPSA 1FFHA 3BS4A 1TNDA 2ZRFA 2TMKA 5HCIA 1WRBA 1EFRD 3BE4A 4GOKA 4OHXA 5DGXA 3X2SA 4YQFA 2Z83A 4BLTA 4TMKA 4ZI2A 1XJ0A 5L3QB 3B5JA 2NZJA 1CTQA 2QAGA 4FCVA 1I2DA 3IPYA 2W58A 3GLHB 1ZIPA 3L82B 3X1ZA 1P2TA 5AJXA 4NYMQ 1NIPA 3U3KA 1TUIA 4LJAA 1W0KA 4C0SA 4N1AA 2VHQA 2ZJ5A 1GFIA 2QM8A 1NLZA 1M2OB 4W5JA 1CEEA 4I1VA 1ZM7A 2DBYA 2A5YB 4U00A 3A4NA 4Z1MD 3GLHE 1TQ2A 3M6AA 1XTQA 4NYIR 5F3WB 1YRBA 4LHYA 1U2RA 2Q3FA 4D82A 4US1R 2R65A 2CE2X 4HAZA 1TF2A 5JRJA 2VO1A 3CX6A 2J1LA 1US8A
chains in the Genus database with same CATH superfamily
2PX4A 2Q46A 3E7WA 1N2CA 4LX0A 3GDOA 1AKTA 1W5EA 3EIOA 4F45A 2HPHA 2JIMA 4Y2YA 2IY8A 1T2DA 4JUFA 1NQUA 1CYDA 1QBKC 1SZCA 1X86B 2XVZA 3HU1A 2EGGA 3PIDA 4L8VA 1SKYB 5EQFA 2PYZA 3F78A 4OQDA 3WIBA 5G0TA 3UFBA 1E2HA 3HK2A 1I4TD 1PTKA 3DTYA 1DHRA 2I6XA 5BSHA 5LM3A 2VDKB 2QLLA 3K2EA 2PUDA 4N65A 1WUJS 4RKFA 1V16B 1PQYA 3QEMA 5EG5A 1XZAA 3TLBA 1HFJA 4RD3A 5H68A 1B8OA 3VDMA 5AOBA 2Y0BA 4DV6B 3AEZA 3B9RA 1R66A 4NH0A 1IN4A 1MG0A 3H87A 2DLCX 4L4XA 1L2TA 5TJHA 3A9RA 4I7EA 4Q4JA 3IVRA 1IAVA 1DC5A 3I2HA 3MPUA 1PNTA 2WKQA 9LDBA 1U5CA 5U4QA 1P5RA 3IDSA 5HJ2A 1Z4IA 1RPAA 3EFBA 2QXYA 4MAMA 5EMMA 5AI5A 4YAIA 3PG5A 3EARA 1DAHA 1K4MA 2EBHX 2PZFA 3WWPA 3D6UA 4X7BA 3W0LB 1R5NA 3ZGNA 4ZYWA 3T1TA 2XMPA 3HCDA 3WLQA 3KLBA 2GEBA 1MAVA 4RMNA 1O94A 2XUAA 3RUDA 3H1GA 2EFGA 4U0KA 4JJIA 1AIPA 2IYEA 5EJGA 2JFGA 1F4LA 3N05A 3O6VA 4OXRA 1F2DA 1H1LB 3TLYA 3WGKA 2CXTA 4OLAA 4L5IA 3I01A 1K7YA 1PFGA 4B47A 2WBLC 2E3JA 3ZCPA 4A82A 2JA1A 2VF2A 4FT4A 2E21A 2VSYA 3Q10A 4JZKA 1SKMA 3WGHA 3VYSB 1KSFX 4AX4A 3HKCB 4X00A 1XAJA 3WLLA 2OQIA 2PUVA 3HB9A 4QT0A 3WYFA 5KTMA 1GTL1 5COBA 2EP8A 4LI0A 4KGXA 2ETVA 3OJ0A 4UTPA 4QWMA 1YD7A 1NRIA 1RKXA 2NNWB 4ZQEA 3TTUA 2OFFA 5FFFA 1TQ8A 2OCGA 2NZ2A 3DKIA 2NGRA 3ZE6A 1H93A 4C2BA 3HDTA 2PUAA 2RIRA 3ZY2A 1E61A 3JYPA 3ZQUA 4EA9A 5ALVA 3PX2A 5JVDF 5IN4A 2IS4A 2JF0A 1D2AA 1SXGA 1L5LA 3CWCA 3QKRA 4WINA 1ABBA 3OKPA 1EHCA 2M9MA 1PUXA 5DLEA 3PCRB 1N2GA 1Z75A 1KBOA 2HLHA 4DIKA 3O0TA 2ZYUX 3BMNB 1Z9BA 2IELA 4K8RB 2B94A 4C0JA 4B44A 2PKCA 4GECA 5JVDB 5G0SA 3OPYB 2UDPA 4FWIB 1C9NA 3OHMA 3SDZA 4GVLA 1I94B 1QHEA 2P8SA 1Q0RA 4OUKX 3KXPA 5J4VA 3R24A 3GFGA 2QQEA 1KPHA 3NHZA 3EISA 3R7WA 3L92A 1DKPA 5JZMA 3QE4A 4L0CA 4TPKA 1IWBB 2PT7A 3E9RA 3JD0A 1TYBE 2CCJA 3K7EA 4FYIA 5K03A 4HWRA 3W8FA 3GP8A 4NBLA 1YGYA 4IFTA 1QH9A 4WXYB 3ZGOA 5JNUA 3BG5A 2H1SA 2FPWA 4KE8A 4M1OA 4F06A 3GZ4A 4O02B 1PJSA 3I8SA 4QYIA 3O1HB 4Z0TA 4EPRA 1YA8A 4JU8A 1XDDA 1U31A 3NYQA 2BGRA 4NPCA 2EL9A 3NFYA 3L8FA 1IOZA 1G8HA 1I80A 1LPPA 1P4AA 2CKDA 2JAQA 4P4GA 1CY2A 5ITZB 5T6MA 3DZJA 3H5NA 2RBGA 3F3KA 2H2GA 1KYZA 3JTEA 3GVPA 3OHPA 1JUDA 2VEDA 3A4LA 3I05A 4MV7A 2EJTA 3PXGA 2DPHA 2RH9B 4INPA 1QNLA 1N6KA 1CZLA 2X0KA 3C3CA 3UHAA 3CVYA 1TVCA 3HEMA 1HRKA 2O9JA 3KTAB 4JWKA 4X63A 3QVKA 1NW5A 2R79A 3HN6A 2D4HA 1SPXA 1KR2A 1O6GA 2GN0A 4B6EA 4DCCA 4MWZA 2DHEA 3NFRA 2ZJ2A 4YV1A 2A4KA 1ZH6A 3BD6A 3C3YA 3EEOA 4IJMA 1VYTA 4GKBA 2HJ9A 3NASA 1RHJA 4IHQA 2O8EA 4R2WA 2HRBA 5IH3A 1J2EA 5EPOA 4OJKA 5F52A 2K6GA 4O1MA 5KQRA 5KSYA 1FU4A 2D0DA 2Q3EA 4TLMB 2DH6A 4Q1VA 5KKAA 2HRDA 3G6KA 3DR5A 1FRFS 1COZA 1Y48E 1YBAA 1JZQA 3BIFA 3KQMA 4FEAA 5D6NA 3ADCA 4NCAA 1Y33E 1HDGO 2QZSA 3PYLA 3TNYA 3IPXA 2J0VA 2JFVA 1XP8A 4ZAZA 1QH8A 3D5QA 4ESOA 1G18A 2EL7A 4C0AC 1F2UA 1YBVA 2RGCA 5DP1A 4MARA 3ROQA 2CXQA 4CW7A 4ZA2A 4FCWA 2QAIA 2VP5A 4V38A 2GVDC 3HJHA 1KKLA 4R3NA 2PE5A 4B2PA 3R7NA 3KM0A 1N7IA 1OASA 1ADYA 1Z4NA 2AXQA 3L7IA 5AKZA 1J1UA 2NSHA 1WUKS 2GD0A 2NXEA 3TG8A 1N8KA 1NVTA 2PS9A 3AIMA 1Y5LA 2HX1A 2AX4A 3BWDD 5FBWB 4ZI5A 1E2NA 3T5DA 3TLMA 2UUBB 3B36A 1E3MA 5A3SA 1C0PA 2YBEA 3IJEB 3HGQA 4H0NA 2IXTA 4I1OA 3VR1A 3ZD9A 3HM2A 2ABWA 4ND6A 4MLDA 4PZCA 4YCMA 3STXA 1RI3A 2EEPA 4G24A 3GQBA 3OQIB 5A1TA 4MS1A 5LZ5A 4JQZA 3DMTA 3F3MA 1QQ7A 2P67A 1HZZA 2PLAA 1F06A 3O95A 1TL7C 1OX5A 3JPWA 4GXQA 3TUIC 1J99A 2VA9A 4HATA 3IUQA 4HDMB 5DLDA 3WQRA 2RHMA 3K5HA 4P7FA 1MAAA 5K0TA 5IFLA 3S1LA 1FMLA 4KBGA 1KMNA 4TM8A 1X13A 1H85A 2NQTA 3LFHA 5C0OE 4RPGA 3N87A 1MJNA 4AC9A 3URMA 1OBFO 4ZZIA 4XEHA 5HZGA 5BVHA 1GAWA 1DBSA 1T5LA 4GPZA 5T4BA 4CF4A 2H2FA 4KQ9A 4BFCA 1M2HA 3UUWA 1UT8A 4WBNA 2DM6A 1GNQA 2GI4A 5GP1A 1JQJC 1WW2A 2AYXA 4YGXB 5REQB 2WNSA 5CLFA 3AIOA 3ZI7A 5DMXA 1OXXK 1VIYA 3SJAA 3TTSA 4QREA 1UPBA 1B2LA 2IYNA 1DCMA 2XB9A 1OIVA 4DT1B 5GONF 3FPSA 4F3CA 1QC5A 3FLBA 3ADPA 2WWXA 3MWYW 3ASZA 4MCAA 2IX3A 5AESA 2H2AA 1V47A 4G4SP 4BNZA 5TQJA 4ITUA 3E5MA 1CUIA 3GUHA 1OI7A 1ECPA 3DT8A 1GSIA 2D5BA 5GONB 1Y6GA 2QTTA 1HEIA 3CLUD 1W88A 3MTBA 4KGVA 2JJ2A 2P9BA 1U90A 4KLRA 1FY2A 3DQPA 1FBTA 2F4NA 3WICA 2X1HA 5EWJA 3BCHA 1WY5A 4W1RA 5TE9A 5HXAA 1K3FA 1JBQA 3DMRA 4FGWA 5ELLA 2NYVA 4CMBA 3AUFA 4LJLA 4F91B 2I2BA 3HBMA 3CUVA 2PCJA 4QECA 2C5AA 3KLNA 5G0VA 3ZGZA 1HL7A 4ZVLA 1HNWB 4EA8A 1R00A 1MN6A 5MFZA 3RYTC 3GMSA 1CDDA 1U8TA 4TS9A 1RD4A 2V7QA 1Z08A 1MIHA 5K45A 4BQQA 3W6OA 3W5HA 3WL5A 5IVHA 3ZKWB 2DGDA 5EKSA 3PUHA 2I4MA 4N5HX 4B6QA 1KDVA 3RG8A 3FUVA 3A25A 3CUEF 4FK8A 3JATA 2P27A 3U81A 1NP3A 3ZUPA 3HB0A 5T3UA 1T3HA 3QX3A 5ALRA 4C2AA 1QKJA 1RYZA 3FMFA 5DTQA 2QNRA 3D5EA 2YN0A 3EFOB 1DQPA 3FLAA 1SC9A 1TKCA 2FPGB 2IYLD 2YHIA 3IQHX 3KQVA 4FN4A 4MUGA 3RJZA 4EG8A 1C7IA 5KS2A 3IUMA 2WM3A 4MP6A 1K7CA 2AQIA 5EQTA 4G85A 1KYVA 1C1XB 1W5FA 2VZ0A 1IBRA 3CF0A 1RWBA 2CXHA 2FK8A 1OAAA 3NB0A 4G36A 4I19A 4J0EA 3VC1A 4A36A 5DBIA 1UIRA 3U1BA 2C4TA 2A14A 1I8TA 1YNSA 3H9JA 1WIWA 3G5LA 4HDRB 4NV1A 2IVZA 3WLMA 2FW1A 5G41A 2NUTA 2WYIA 5EJ9A 5JC1A 3D3QA 4KTTE 2CEKA 3T52A 3QMWA 5BPFA 3HWSA 2R85A 4OL9A 3TRJA 4F3YA 3F7MA 4ESEA 4TTSA 5AW5A 4E13A 2FLVA 5DU2A 5TGDA 2OGSA 3LKZA 3U09A 3PNPA 1RRKA 1T6XA 1JHPA 1I1QB 1SB9A 3O4VA 1AN0A 4I4NA 1EFHA 2FR8C 1MOPA 2W6ID 3OOHA 2WF8A 1JSRA 2O0JA 4BFUA 1MRSA 4RHTA 4ZYLA 1U0OC 4OSPA 1WDLA 4NC9A 1QG6A 4AVYA 2D6FA 2J3KA 1AGYA 2IE8A 3AL2A 4YLYA 4YASA 5CEJA 1NXPA 2FX5A 5K20A 4RJJA 2NWQA 2QX6A 2MDTA 4RVHA 1JEYA 3S8EA 3DHWC 4K9DA 3QX7A 1NYTA 2FRDA 1XP5A 2PLNA 4RHYA 2BM0A 3WHKA 5KSPA 5JYEA 3PHHA 1NN3A 1RP1A 4QJ4A 4ZQGA 3KVVA 5KSZA 5BN4A 1J90A 3IKVA 4C04A 3H18A 1ZGJA 2OBBA 3A2NA 4L72A 1YJBA 1ZD8A 3OEED 1KXJA 1NNUA 2RGWA 2HFJA 5LYJF 1HSZA 4MGKR 3CLUC 4DDUA 5DPMA 5J1TB 5GTDA 1E60A 4OJMX 1H8EA 3LHIA 3GELA 3OPQA 3R3YA 3N8DA 4I3FA 2HT6A 2BCEA 3C3EA 3I61A 4LF6B 2B9EA 2VYVD 2X5XA 3L7AA 4M0FA 4YMWA 1PVOA 4OREX 2IH2A 1TFUA 3E7PA 3E3LA 1VLMA 5LYJB 1TLFA 1C1HA 2DKNA 3S7ZA 2EZTA 4OHBA 1ZH8A 1KJYA 2AF3C 3IA7A 3PR1A 5KYUA 4BLQA 2WFLA 4JZYA 5KUTA 3E9CA 3THYA 2G04A 2QV0A 1EE1A 1SIWA 2R3SA 1ZIXA 4AJLA 4CLEA 5IJ9A 3NHMA 3R9KA 4EY7A 2ECOA 1A82A 3I0MA 4O2BA 4L8FA 1J0BA 1LS6A 2WYOA 4QYTA 1OXSC 2W6PA 5F1PA 4AJJA 2HWKA 5SY6A 3R9XA 4WKNA 4LSWA 1IG0A 3U3DA 2E6KA 3DEIA 4J1SA 1EFVA 1E2IA 3QW4B 3NBKA 5FWYB 4E03A 4JX9A 1ADFA 4KKVA 4XLZA 1Q1GA 2HA4A 1AUOA 4AECA 1RRCA 3L0PA 4YTEA 5AUOB 5JTUA 4FFVA 3W3AD 1OKKA 5TC4A 3QMPA 3EULA 3ED1A 2W2NA 5C1OA 2JGDB 2LTAA 3KJNA 1JXAA 2ONJA 1RM3A 5JXJA 1GT91 2P2NA 1GDDA 4ISCA 2ON6A 4KLCA 4OJTA 1E2UA 2LW7A 1S8NA 1QIEA 2C03A 3CSSA 3D6AA 4UE6A 2GUGA 1L5HB 3GXBA 3WDMA 4BGIA 3NC4A 1E2JA 4K9KA 4OXIA 1FJHA 5KNBA 3FHJA 2XVXA 3HJRA 4RF3A 1VYHA 4KBFA 2BRUC 4KXLA 3KCNA 2JFHA 5TXGA 3O84A 5EJAA 1N6RA 3S44A 3PLAE 3PC8A 1E7MA 4RCZA 3R6TA 7GPBA 1YCDA 3EGEA 5LA6A 1GFWA 2QRVB 5KYXB 3B6IA 2Y6VA 4BB0A 5JU6A 1B6SA 2J6BA 1W49A 4H2DA 4XGKA 4A2CA 3VKGA 1ULSA 2P2YA 3OZAA 4Q66C 5CXQA 4QXAA 2CE7A 4LC9A 4AF8A 3G2KA 3O1LA 2QJOA 4LYYA 2J9FA 4MGZR 5L3RA 4CMJA 1PJ4A 1MC4A 3AXSA 4W5NA 2O2JA 2VDLB 4G37A 4EG1A 1J97A 1E4VA 4EZIA 1JYFA 1E20A 3O2NA 3G6WA 4DKXA 1QU3A 4L4YA 1C3JA 3BJEA 3D1JA 3DVSX 3QKSB 1N7HA 4XVRA 4A0GA 1CQXA 3LO5A 4C4PA 4ZICA 4P0QB 2JFPA 2VAPA 5EY5B 1DBPA 1QYDA 2RGGA 5TEVA 2VBCA 1I36A 3FYDA 4GX5A 5KHLB 2GPAA 3JWHA 2QTNA 3TO5A 4LMAA 4QE3A 5F35A 2CXPA 4NU5A 1C3EA 3GWGA 2OCIA 4BATA 4DABA 1E7RA 4L5CA 1ADGA 1AGPA 3H19A 4ZEMA 1DEOA 4IWNA 5AXDA 4JB0A 2EP7A 1RBYA 4HMQA 1VFNA 2O1SA 2WYWA 3SZOA 4UBLA 2QMYA 1QO7A 3T1NA 4LC1A 4TMZA 2D3WA 4GGPA 1R6DA 1MTOA 1MH9A 1IM8A 3PJEA 4FX2A 4J4BA 5HILA 2BR5A 3T7DA 1IBKB 3CCBA 1Z62A 3AB7A 3OECA 4RHEA 3PQ5A 1BMDA 1QGUA 1R1DA 4I9NA 4E51A 1NQOA 3W2HA 1P9RA 3E23A 3OM1A 3PWKA 4WPGA 2BFEA 2G5GX 2REXB 3C85A 1TZKA 4U7DA 4QQRA 3NU1A 2BIFA 3BRWD 4JFAA 4ZU3A 4ZJUA 4W5OA 4JYCA 5C1BA 2QN7A 2XSZA 2RKBA 1K75A 3WBKA 1QV6A 3COJA 2H1VA 4URXR 4JSTA 4WNCA 5KINB 1PS0A 4EFLA 4XD7D 1T91A 1WPGA 2QOEA 3K0AA 3WLPA 1BHO1 1XB2A 1Y3BE 1BXZA 4YYZA 2ZRKA 5DXFA 1QZ3A 4QGAA 4FYJA 1VHJA 2Q9UA 1KS2A 3QPUA 4GI2A 2WVJA 4JL5A 4OAPA 1SVOA 4S1PA 5FUWA 1EBFA 1G7SA 4N48A 2D5CA 1GUBA 4N47A 1YCGA 5KYWA 1XSEA 1MABB 4RTNA 1RBQA 3Q5DA 1XZGA 1J06A 2QEQA 1KI3A 4D6PA 3ONVA 3M89A 4OH1A 1CZUA 4B4VA 3L0OA 3THOA 2OXTA 1DAKA 4OG2A 1NNLA 2ZREA 3T95A 1ZH4A 2D4AA 3ZY6A 2CNWA 2CNOA 3ZDQA 5C18A 3AVWA 3EXHA 4TS1A 2ZB4A 2P6OA 3E18A 3KEGA 3SG0A 2V45A 1GQSA 4CFSA 1DEAA 4PE5B 4YP7A 4NQZA 4G26A 4QPZA 3NH6A 2AZXA 4ZRNA 2HL6A 1XYYA 4QJ3A 4GNRA 4HH0A 1ZD9A 5A5GA 2J9GA 5B58C 1SIOA 4AQDA 4DMUB 4I8XA 3TLZA 3A31A 1UT6A 1EGAA 4G67A 2ADOA 4XQEA 2VQEB 1EVYA 1TK3A 3MRTA 4PINA 2XDQB 3G02A 2WJIA 2ZB2A 2HA5A 5KHAA 4E3WA 4LJRA 1WUTA 1CUEA 3C45A 5LB4A 3LUBA 3EY4A 4WL0A 1NIJA 3I5AA 1WCWA 3KUDA 4O59O 3RSOA 4CIBA 5LXTA 4UHEA 5B2EA 3E7FA 2DEUA 2A1TS 3KUXA 2PSHA 3W78A 1M6EX 1NSYA 1OYVA 2I6SA 2W6JA 2XMCA 2ZYRA 3LC2O 3LYHA 1AO3A 5J9FA 4MLZA 1ECLA 3ZWYA 3WNZA 1YVPA 3AG6A 1RXSA 2C31A 5BSFA 5DULA 4G5OA 1OJLA 2QN3A 3LQ1A 3WYAA 1E3DA 1U7WA 3PPIA 3M81A 1MT0A 1PR5A 4L9SA 1TLLA 1G6KA 3FWYA 4YLGA 3V4FA 1QFSA 2GM9A 1W1UA 4UFNA 3T7CA 5JMWA 1NXWA 1K06A 1KEPA 1ZI8A 1ODTC 5I7FA 2MIIA 1RBZA 2JS7A 3EZFA 5DTRA 4FC6A 1TMKA 3ZS9A 4LY3A 4FPXA 1IBSA 3KKKA 5F78A 4G07A 4DUGD 5HQJA 1NVEA 2X58A 2Q2VA 4EMBA 2AC2A 1A7KA 2X3UA 3I0NA 1T5OA 1RZRA 1KVRA 3MGBA 1PZNA 4B40A 1OH6A 1KJJA 4QGGA 1KS9A 3SZ3A 3TD6A 3ETLA 2ZJ1A 5K1ZA 1FYEA 4GM1A 4IDHA 2F9MA 1Z16A 2VH5R 4RK6A 2XA2A 3S2IA 3X1YA 3H11A 5IUJC 3H3JA 2DTEA 1XZDA 3I6IA 4J0FA 4ZO8A 3O8QA 5TARA 1NP7A 2NXWA 3E5NA 4M0UA 4TT3D 3ZVRA 1FVHA 3VNQA 4M55A 3AHHA 2NQ8A 4WTOA 3B6KA 2NADA 3E1SA 2DQKA 3CR8A 2CHFA 1WVIA 2O0KA 2XJ4A 1KEWA 4JP3A 1I6LA 3FR8A 4CCAA 1Q1ZA 1XFDA 3WWDA 4RS3A 1X87A 4X1KA 4P3XA 5K51A 4Z51A 2IF0A 3STUA 1JG2A 2RI6A 4LJ5A 1AZSC 1UZLA 2V6IA 3U0VA 3AUAA 1YCHA 2K4MA 1YDMA 2BISA 5JAUA 2C7QA 1S9HA 3P19A 1ZVKA 3WP0A 2WQ6A 2G07A 1XXHE 2FOIA 2VNIA 1IVNA 4M0PA 3WV5A 1F4PA 1GA1A 1PQ4A 4K1XA 1GN8A 3FFWA 1KHTA 5IDYA 3EPJA 4N76A 4G3XA 4OGLA 1NURA 1Y4ZA 2OCBA 2SKDA 4NZPA 4AMYA 2XODA 1WCYA 1GL3A 2RCNA 4TZKA 2J5KA 1SM4A 3WA7A 1XWIA 5MF6A 3CG0A 1I0LA 2IT1A 4FWBA 1FLVA 1GTVA 4YDRA 2P91A 1IUNA 5DSXA 1X7WA 1PFUA 3OSUA 2C5LA 2LDBA 4HFMA 2E4VA 4QOSA 1ZO8A 3QI2A 6PFKA 2AX3A 5EUQB 3QVUA 1LX6A 4QGSA 2OHFA 1TJNA 2N47A 3BFPA 3JV7A 3PQDA 2HQ1A 4KN9S 1P0FA 5DCWA 1B2RA 1C3LA 4L02A 4RMHA 5CVDA 4IY1A 1RAHA 4M60A 4BFSA 3ANSA 5D7BA 1FNDA 3H0EA 4DLYA 3ZD7A 3MLEA 3BXXA 5JTTA 2GD6A 3R0QA 1R9NA 4HO1X 4BX3A 3RYCA 1KP3A 1MF7A 2SECE 1I6MA 1DEHA 2FSGA 2DMRA 1GFSA 3QXCA 4IJKA 5TF0A 4ZCRA 3I3SR 2KW5A 4YUZA 2Q0QA 2X9NA 2VTVA 2VNHA 4HGRA 4Z4EA 4NCHA 3RFUA 1G5FA 4CG0A 1Y37A 1J0AA 2PMWB 2QN8A 3O9MA 3G7SA 2QPOA 3ADBA 4LDNA 3EIUA 4UMVA 4LZWA 5SICE 2QRKA 2QTHA 1ZMBA 4LDQA 1Z47A 2C61A 3CLSC 1U3UA 3V8BA 2XUHA 2FNAA 1UK7A 1GG2A 2DPYA 2ZPAA 5FWNA 2DWCA 4C3OB 3GFTA 3EMVA 2H51A 3OCJA 3OA2A 2AXEA 4AL4A 2R7AA 4COOA 4ZHSA 1ZZEA 4MW6A 2FVXA 2W8BA 4Y9DA 5AKGA 1VSBA 3HO8A 4IBOA 2IPAB 1MP0A 3QPWA 3O8RA 1WHTA 1T5BA 2VTEA 1D8AA 4IXNA 4AMGA 1YHYA 2YW9A 3B9PA 4PZ0A 2B78A 4H31A 2PRJA 3AM5A 2HR1A 1OUMA 1MAUA 3SM3A 3EGVA 3U3OA 1IN7A 4K40A 5HWSA 3GY0A 1N5IA 4RTSA 1V71A 1LBEA 2JGIA 1PT9A 3VVBA 3FH0A 5FUMA 1FRVA 5JSUA 1OB2A 3H5TA 2W22A 3AUYA 3LP6A 5CTJA 4A8TA 5F1KA 1DIGA 2WI8A 2YVKA 4RQAA 2QMUA 4NY1A 4A6EA 4UNRA 2AK2A 4P7BA 5CD9A 1ZK3A 5L45A 3HVRA 2X1VA 4EPTA 5HA5A 2SICE 4JNKA 4BLVA 5KOYA 4GMXA 4WLUA 2CL7X 1D2RA 4YWHA 1L4HA 4PSVA 3R6LA 4EATA 1FJXA 1HE1C 2OKCA 3IB6A 4I5DA 4AMUA 3EWAA 4BJ3A 4N8EA 4I5IA 5HM8A 4MWSA 1Z34A 3Q3JB 5FXMA 1I5RA 4J0QA 1NFFA 2YKGA 1SKBA 2J31A 2XVAA 3WWCA 3IERA 3SNHA 2ODQA 5FTWA 3LOPA 2EGHA 2I5PO 3MUEA 3DOIA 3HJBA 3DHYA 3NBAA 1ORVA 1MO3A 1P3DA 2YIDA 4MDFA 2PWBA 1ZLYA 4W9NA 4JB8A 3OFSA 1U98A 4BNJA 1BWPA 3OT1A 2WKSA 4BS9A 4XYGA 8ATCA 4J75A 2YXLA 1M76A 1GVNB 2WUFA 1E79D 3OJCA 1R5BA 5G4KA 2R8EA 2WOJA 3QU2A 5C9ZA 2QUHA 3WZ2A 2F1OA 1MD9A 2N1BA 1AMNA 1AXGA 4FJ2A 3I2FA 4CRWB 2X5KO 1USWA 5LQSA 4CYMA 3U7HB 2F43B 1VMAA 1SCDA 4XSGA 4Y6OA 5CFMA 2O4UX 2VT2A 2I6TA 2WPDD 1G3QA 3CTMA 2YCBA 2YOFA 4FZJA 4PC6A 1WOYA 1YZHA 3EXIB 3LPCA 3W8NA 3WLTA 4AJ2A 1OXKB 5IJ0B 3QFSA 1PV2A 4UU7A 4YUAA 4WI1A 3I9V6 4MOWA 3RJ5A 2G63A 2R6GA 4YP6A 4IO0A 4YR7A 4US2R 3WMEA 1P81A 5ECDA 1U0NA 1W44A 1CJBA 2FFAA 1KWKA 4U2BA 3NWJA 4J91A 2H57A 1T9CA 1QIDA 2IIPA 5EQDA 1GHTA 2YFQA 3ETDA 1Q91A 5EJ5A 2HDOA 2XBMA 3C7AA 2WY2D 5CFOA 4WBXC 2EC5A 2QN2A 1W73A 3CR3C 2V7BA 4J2TA 4QPCA 3INGA 3HU3A 3LL4A 3GPCA 3RKSA 1UOEA 2ALJA 3CF4A 1VHWA 2I7CA 5LWQA 2ZBGA 3W6UA 4NF2A 5ALGA 1UK8A 4MPJA 3JQ9A 3VYUB 2JPDA 2DFPA 1NR1A 3QFTA 4QLAA 5BRNA 4NESA 1JHDA 3H2YA 4WSOA 1C9JA 3OQJA 2H0AA 3GDGA 1YULA 3P9IA 1M34A 3PC6A 2C4VA 3TOSA 1NC1A 3QIVA 3BD7A 2FQWA 4U5QA 3S0JA 2Y0CA 5EHZA 3GRFA 1W93A 3MWDB 4K6OA 1L5ZA 5TSDA 3T9CA 3DTVA 2Q7DA 1OYWA 3FLMA 4JOCA 3P5SA 1HLDA 4JJ4A 4MUYA 4V1CA 3ORSA 2ZIXB 3RFCA 1DOAA 3PR2B 1E6CA 4FDVA 3EXFB 4EHJA 4R8MA 3B51X 4CGZA 1D7AA 4L57A 3DF7A 4IV5A 2VBFA 5KBYA 2WM8A 2R1VB 3D6FA 5AM5A 2XD4A 1YQDA 2AHRA 2O2DA 1YJAA 1QONA 1P3JA 2L69A 3DMNA 4M0CA 3FSGD 3SHOA 4EKDA 4ZHQF 1BDBA 1Z2CA 2IWRA 4S1TA 4ZYVA 2GCOB 2SNIE 1G4HA 3B9QA 3MJTA 1EWTA 4CV0A 2PD6A 1T13A 4LRWA 3BMQB 1FJGB 3QBDA 3V8RA 4PYJA 1MMFB 5DO9A 3EMDA 1ZUNB 1GQ2A 1Q7TA 1U1DA 3HP7A 4IIDA 4ZHQB 1TC1A 4WEQA 1XQ1A 5KJ6A 3DPIA 1XTZA 3M49A 4NDZA 5CHEA 5LU8A 3DF9A 2FEOA 1H5NA 4YAWA 5JNRA 2A9QA 1XE3A 5AIAA 2BR3A 3OF3A 3X1XA 4UDYX 2OQVA 3QSYA 4IGEA 2L0XA 1T8RA 4ZDIA 3HPRA 1O95D 2FPLA 4G86A 4MAAA 4ME6A 5EJ4A 1XCLA 3HWWA 1JBKA 2GFHA 1TC2A 2DUNA 2H5IA 1UPAA 4R8KA 1ENZA 4I46A 5B4VA 2RC5A 3BWVA 1TPZA 3HCCA 4G1BA 4EGQA 4AJPA 4JELA 1A9SA 1RJ9A 3TJMA 1Q1EA 2Q3JA 2J67A 4GQBA 3CONA 3OIDA 2XE6A 4ND4A 2HF8A 4MS3A 4YRBA 4TMXA 1O1YA 1MORA 1SG6A 4R01A 1X2BA 4Y6PA 2R66A 2FHSA 3V7FA 1JJVA 4WY5A 5CLJA 1KEEA 3OMXA 3AYXB 3JAKB 4BXOA 4LZOA 3QVWA 5AP9A 3W6ZA 5AQ1A 4A26A 3Q6IA 1D0SA 2OV4A 3KAKA 1TK2A 3LLUA 2W83A 3GBVA 1AQUA 3ELBA 3A4IA 5JCOA 4BFWA 5I3CA 4KN6A 4H1VA 1ETHA 2A86A 1L4MA 3OU2A 5BRJA 4YHBA 3MTIA 4W1PA 4S1OA 3QI7A 4CKZA 3V42A 4WCDA 2FMHA 3NV7A 3ESQA 2XOEA 4EG5A 4F5WA 1OW3B 2P4EA 4ED9A 4MUBA 2OM2A 4D80A 4F2PA 4F7DA 1EFLA 1ZA2A 2VEOA 4HB0A 3GLIE 2B8WA 4YXWA 1WOMA 1WXFA 4U0JA 1SO8A 2C96A 3L2OB 5ERYA 3H6KA 4Y8VA 3DE6X 1QE3A 3PU6A 3FPCA 4HMPA 5FBKA 1U1GA 1B3RA 1JE1A 2Q8PA 3G0IA 5LQNA 1UBOS 3B1XA 1KYXA 1Z7BA 4JXXA 4JQCA 4C2TA 2PR2A 4I3GA 4QRIA 1KH3A 4MVCA 3KU4A 1BHSA 4EG3A 1W9HA 3RT9A 4Q0MA 2WWVD 4D1YA 5JSYA 1NVFA 3SQOA 5JNSA 1WDMA 5CNJA 4BMNA 2ZRNA 2BZ1A 1H2BA 4LRYA 5JI3E 3DM9B 2C3OA 4PQFA 5AM2A 4XB2A 1YUMA 4MWOA 4QXQA 5EFZA 3QBTA 4G0YA 1Y98A 5KNLA 4UQOA 2ZATA 4QKQA 1V6SA 5IKXA 5GY7A 5D86A 1CJTC 1PD0A 2LKCA 2QIOA 1V4BA 2R60A 2W6QA 3DEJA 2Q4DA 3M1LA 4QPNA 3L0BA 4GX0A 2D1TA 5BW6B 1H94A 1M1UA 5AOCA 3U3XA 2VHUA 3SZGA 5JZSA 3P4YA 3TDMA 3HJGA 1HNNA 3IEUA 5LZ8A 4KE9A 5IF3A 3EB9A 1KQ3A 3ZQKA 3ZWDA 1WPQA 1E1KA 1S9DA 2WF5A 3D6JA 3HDJA 4QTYA 5A6SA 5CJ2A 4YT8A 2V9PA 2Z8ZA 3EZYA 2YJ3A 1KAOA 4H16A 3RJ9A 1G5HA 2QE6A 4NBWA 2EJCA 5DEIA 1JLKA 1SXPA 1JL3A 1PL8A 5IVIA 4PVDA 3Q0IA 4DKJA 2XZLA 4KLNA 4A73A 1RIFA 4RMIA 4DLPA 1D4FA 1ZUWA 4WV3A 1EVZA 2WJJA 2PL5A 1ACJA 2A9PA 3HS3A 3GT4A 2CBXA 3KT0A 2D5IA 1M2FA 2PKYX 4WXHA 1QFJA 4ZAGA 4KMOA 3UV3A 4RACA 1RXYA 2VLBA 3H5IA 4QAJA 1I7DA 3FNEA 1UMBB 3FNQA 1VE5A 1T9DA 3UGKA 2OB1A 1CUCA 1B3BA 1O89A 2H18A 3OU7A 3IXQA 4QNNA 4Q9JA 5K6AA 1G16A 3NKFA 4E12A 4JJ7A 1XVTA 4R40A 2Z56A 2WMDA 4YGYA 1RFGE 4OSOA 3ZCUA 1OWNA 1SXJB 4U2FA 4ESVA 1FDSA 1E2LA 2X4IA 4Z3DA 3DDCA 3WO0A 5EIWA 2HGZA 1ANKA 1J8QA 4Y67A 1UBCA 1VL8A 4FGKA 4YCJA 4CTJA 2QROA 3ZHVA 1NTOA 5B1YA 1T1IA 2F7SA 2OC4A 3JYNA 4QBKA 4XA8A 2PBLA 4ZVPA 4C3ZA 3H2IA 3QVVA 2X7XA 2ZUUA 2MSCB 3QJYA 1Z2EA 1ES9A 3Q5EA 5EKUA 1PGJA 2JJQA 2O6LA 3HDGA 1LLUA 1VZ2A 1TM1E 1XO1A 2ZBDA 3HC7A 4XGNA 5LNK1 4CT0A 2KS6A 1UEJA 1HDEA 4RE6A 3OMWA 5GZ1A 5BSGA 1FTQA 4DLAA 2FG5A 3WLNA 2WJAA 5JLJA 2V6JA 4L3OA 2AZTA 1UMDA 1MPTA 2BFOA 1Y5NA 3G2NA 3KAPA 1H0KA 1T2EA 2C9MA 2WAMA 3NAMA 1NW4A 2C29D 1QHNA 4OPMA 2UZ4A 1YK0A 2WHPA 2QVBA 3KXKA 5E0KB 3V8NA 1Z5ZA 3LSYA 2WAOA 3AFHA 3I3OA 4ZTZB 1F2VA 1QF7A 2EWVA 1L4FA 2I4LA 2E4AA 4MGIR 5AI0A 5BSRA 1USKA 4BO7A 5BSVA 4C2UA 3L4EA 1XHLA 4GPEA 3SF8A 4L8WB 4ZO6A 4GOLD 4E0BA 3IL2A 2NP7A 1XVLA 2Y93A 1CJSA 4L74A 3OQOA 4DJEC 2FUNB 3EIQA 3TL3A 5KTPA 1N5DA 1NMEA 2V7VA 3OFND 3BB3A 3PK0A 4HTFB 2CJYA 4ZVVA 1N2JA 5P8WA 1ELOA 4G8CA 3GB9A 1EBBA 1R4NA 4P5DA 1MB2A 1M74A 4CLXA 4LWZA 3C8HA 3DHNA 4PLHA 5I9MA 3WISA 3ZJUA 3STHA 3SHQA 4KDRA 4ZPJA 4BRZA 2DWOA 2HXYA 3P9XA 2BM1A 3ZYCA 2BEUA 4G5GA 3C16C 1Z45A 2WKRA 4OHZA 4K9SA 3IIIA 4C78A 3MWGA 2XQGA 4UBOA 3N1UA 2XCUA 4LKOA 3VKWA 2XDAA 4OFBA 5ADUS 1QRUA 4X45A 1KAQA 3BWCA 3QZUA 4L5BA 2OZEA 1D9ZA 3VHXB 4IZHA 3R9IA 4B85A 2IE0A 1XAHA 2EKBA 2QS9A 2FZCA 2KB0A 3JY6A 4N0DA 4NP6A 5B12A 1KDRA 3I4FA 1F6BA 3KKNA 4E2YA 3NTQA 1P1BA 4KFRA 5FOQA 4I1YA 1BKDR 4KR2A 3FXAA 1E63A 3DLBA 2BMDA 1QMPA 1UL1X 4BKUA 3WNVA 1JIKA 4LF5B 5L6MB 3DBIA 2OOKA 4DG5A 4KVAA 3G8YA 4U1RA 5IAKA 4EO7A 2O5CA 3LWBA 3E1KA 3UHFA 1H22A 6ADHA 2IYAA 4ZRMA 2RAUA 3GNSA 4QL3A 2V7GA 1FVXA 1J7JA 1Q92A 1A1VA 1ISFA 3G8DA 2W48A 4OXKA 5EIBC 3AK4A 4F7WA 4X65B 2PH3A 4C6SA 2Z1NA 4PHCA 3O91A 4FOSA 1IQUA 2VP9A 3ZD8A 1DUSA 1QHYA 3EY9A 3IEMA 1RCUA 3FLEA 2Y9PB 3QK7A 1HDXA 4RD4A 1X94A 2HJRA 4QXMA 1K63A 2OR3A 2BSAA 3HLYA 5EWMA 2IUUA 5IRCD 3QVLA 5I4KA 2I03A 4PPQA 5ER6A 4PAWA 3PDWA 4AZVA 2IUYA 4U7WA 3RUIA 1EGQA 4BC1A 1NRWA 3B7PA 1UMCA 2KHZA 3WBBA 4ATNA 3BHNA 2BFBB 5F12A 4EB3A 5ES3A 1RPTA 2IHYA 2GF9A 3VO8A 4W5RA 5AKLA 3B53X 3Q12A 3QPVA 1VYUA 1HQCA 4GIBA 3I9V1 1S8AA 4EGFA 4L08A 4QWWA 3JQFC 3ZBUA 3ACCA 1DADA 3FHOA 4XD2A 1VKNA 2O7SA 5EXEA 4DA7A 1ZVVA 1WULS 2AMYA 2IYTA 5E4JA 1E1CB 1FP7A 2DQ4A 5F23A 3KVOA 5L4SA 2ZXUA 1O9GA 2DLDA 4KLZA 1I30A 4WMLA 3LZCA 4LY9A 2UXCB 2HXGA 4HVAA 1KVTA 1X1TA 4IIBA 3NIWA 4CETA 1RP7A 2B9VA 1B16A 3RVBA 1B76A 3GJ3A 2VT3A 2W0MA 3I76A 1QIMA 2EF1A 1A7JA 3SI7A 5GADl 1OYYA 4LBZA 2QKYA 5EUMA 1JSXA 4J76A 2HK8A 2KI5A 4BYMA 2IGBA 1BE1A 3CEHA 1OGIA 3FHLA 1JHYA 4MUNA 1DUVG 3K1AA 1E0SA 1RLIA