4XYLA

Ca. korarchaeum cryptofilum acd1 in complex with coenzyme a
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
463
structure length
463
Chain Sequence
NDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
total genus 168
structure length 463
sequence length 463
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xylA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xylA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xylA01
1H5QA 2OFPA 3PLRA 2NVUA 4PG6A 3C1TA 3LVFO 2V6BA 3E82A 3ROKA 5BR7A 1RPNA 1NWCA 3GC6A 1VM6A 1WDKA 4FFPA 4TKMA 5A9RA 3A1NA 2H6EA 3MOGA 1EEHA 1HWYA 3X2FA 1BVRA 2DBRA 1NVTA 1SEPA 4CM9A 4W82A 2FOIA 4II2A 3GFBA 2D0IA 1Y9EA 2PD4A 5L4LA 3RKUA 3LQFA 3MTGA 1N7HA 1EFLA 1DDOA 2A9FA 2E37A 3U9LA 2Q49A 1SCUB 2HK8A 3WOHA 4NJMB 3ZNQA 3CXRA 3FWNA 4HADA 3WJAA 4BNXA 4JCOA 4ALMA 1PGQA 3D4OA 1LXCA 3DTTA 3WBFA 2O7SA 3GAFA 2Q2VA 3Q9NA 5JSFA 4J1SA 2D59A 2CNBA 2YV1A 4JGBA 1ZJYA 3DOCA 1QORA 3GZNB 4FBGA 4RZHA 4MKXA 3SJUA 2YQ5A 2PH3A 1IOLA 1VJ1A 2NU6B 3NUGA 4IXWA 4JBGA 4OQZA 4Z9YA 2P9GA 4WOJA 4GGPA 3FHLA 4NU5A 5EQFA 3DBRA 3A06A 2J6IA 4PLYA 1KY4A 4OIMA 3QQPA 2I3GA 3F1KA 5HTOA 3EY4A 4OKNA 4O6VA 1MUUA 3RBZA 5JXWA 4UULA 2W90A 4BNUA 4XQCA 3BTOA 1CJCA 4BVAA 4L4RA 1HE4A 3H9QA 1EMDA 2FPIA 1DHRA 3ADOA 5LCXA 3TFQA 1SBYA 3VKUA 3VZQA 1KEUA 2Y1EA 2WE7A 3ZHYA 4BKRA 4P4GA 3LZ6A 3WDSA 2PD3A 4B7CA 4ZHSA 3RIHA 5I9LA 2ZQYA 1RYDA 3GVHA 5A3JA 1R16A 4JBHA 2VHYA 4F6LA 1H6CA 5L40A 5TLSA 1DOHA 4TRRA 3GDFA 3PQFA 1YL6A 4E2WA 1H6BA 1OMOA 3GEDA 3GGOA 1ZEJA 4OO3A 1FXSA 4IQ8A 3WYCA 4XA8A 4NDNE 3C8MA 3VPXA 1G0OA 3C1OA 3H3JA 2AMFA 1FF9A 3WSVA 4U0JA 3UOGA 1H6DA 1QYVA 4YDRA 1Z7BA 5ER9A 2QRJA 3VH1A 1WMBA 4FS3A 1BTOA 3I9MA 3JQDA 2C59A 3HDHA 1I8TA 3AOEC 3U0BA 1ZK4A 3RC7A 1NP3A 1UZLA 3SC6A 1QSGA 3RUEA 1TI7A 2NU8B 3JYLA 1NR7A 5L9AA 4U5QA 4D0SA 1MXHA 2IZZA 3KVOA 3ZNPA 1WWKA 1I3NA 4UAGA 1HDYA 3EUWA 3EC7A 3BA1A 1CQJB 4O5OA 4R41A 3W8DA 2QZ9A 4RDHA 1E3WB 5AXAA 1E6WA 3OHSX 3OJ0A 4PLVA 5F1KA 1UJMA 1E7RA 2BRUA 3U4DA 1QG6A 4GH5A 2O3UA 2ZB3A 1GV0A 1WP4A 2D2IA 4R9RA 2Y05A 1BXKA 3ZWPA 1YH3A 4XJTA 1YB1A 3G79A 3N74A 5TQVA 3OJEA 3CSDA 1IUKA 1HEUA 4OXNA 1SB8A 4FGWA 2DM6A 3V2GA 3Q6IA 4M86A 5LC1A 5TNXA 4MVJM 1B3BA 4FW8A 2EV9A 4MKZA 4GX5A 1PJLA 1ML3A 4XIJA 5TC4A 3WTBA 3GFGA 4KQWA 5CAEA 2WTBA 4BMSA 1T4DA 4S1VA 4KUHA 4DMMA 5U9CA 1N1EA 1E77A 2CDBA 4KQXA 3ZNNA 3WGHA 2NNLD 1R4NB 3P2YA 4IDCA 3DMTC 5A9TA 3F9IA 1BMDA 4Z3DA 5CDGA 2JKVA 2JJYA 4PCVA 4CLOB 4J4BA 4YT4A 4Q3DA 3BMNB 1ZVMA 4GGOA 4WEQA 1U9JA 1SC6A 2VYVA 1CWUA 3GVIA 3JQAA 2UUOA 1M67A 3C7DB 1IL0A 1P1FA 4RLSA 4RJTA 1LTHR 3IQDB 1PJTA 4G5HA 5T67A 2Q2WA 4FN4A 3LT1A 4BKUA 4EDFA 1HZJA 1I5RA 2O3SA 4B79A 4MIEA 1KOLA 1P74A 2IODA 1G1AA 1PTJA 1O95A 4NU6A 3E9QA 3VPFA 2X0IA 2J3HA 3NT5A 2IDZA 3IP3A 1YRLA 4AJ1A 1P1IA 5L7YA 2HAEA 2GDZA 2AE2A 5DCUA 1A27A 1E7QA 1UXKA 5CEEA 3MJVA 1GY8A 1UXIA 3UH1A 2C29D 3O8QB 4MVJF 4W7HA 1UAGA 3ENNA 1DFGA 5F5LA 3GN2A 1YVEI 3LLSA 1ZK1A 2GPTA 2Y66A 3IUSA 1J4AA 3RASA 1GAEO 4FJ2A 4KUEA 5AYVA 1DFHA 4AL4A 3TZ6A 2PA3A 5IF3A 1U7TA 2JCVA 3ZU5A 3WFIA 2PK3A 1ZBQA 4FOOA 1DAOA 4CMIB 3IP1A 2BI7A 2IEDA 5C37A 1FDUA 4MOWA 5IXYA 2BKAA 3IL2A 3MJTA 2AEJA 1MG0A 1N1GA 4FB5A 4AJIA 3AOEA 2NQ8A 3DONA 1UR5A 4YJFB 3NTQA 5DBIA 2YFQA 4JN6B 4XQEA 4BO5A 5CDSA 3HSKA 4IY1A 4BO0A 4D79A 4AJKA 1ISGA 2CSUA 4ZQEA 3KETA 1GZ6A 4TVOA 1UZMA 3INRA 5TX7A 1NXQA 4BO7A 2X9NA 1A9YA 3DZBA 3GGPA 1IULA 1CEQA 1Q1NA 3DZHA 1YJ8A 1KEPA 2GZ2A 2EW8A 2NWQA 2O2SA 3K92A 3ZDFA 5AQ1A 3CZRA 1LDBA 1B16A 4BUCA 2ILTA 1FDVA 4DVJA 2AQIA 4RCVA 1L1FA 1Y8QB 1YE3A 4HUJA 4W99A 3RQSA 1SPXA 1P33A 4CL3A 5ENDA 3TQHA 2VHZA 1XQ1A 3ETGA 4J2HA 5I8WA 4EZBA 1LDNA 3GEMA 3RC1A 3ZV6A 4BL5A 2C07A 2NTNA 2O48X 2P2SA 4OJNA 3JQ8B 2DUWA 3RSHA 5IDWA 1VI2A 3DBLB 3KSZO 1J6UA 5DDIP 4NFSA 1LQUA 1O9BA 1ISJA 5JC8A 3ADPA 3VOSA 4W4TA 4Y6RA 4BNYA 1FDTA 4OYRA 4DLAA 3DMTA 2B83A 1U8XX 1W6UA 4OGWA 1CDOA 5I9NA 1UZNA 4O1MA 4F46A 2FR1A 3KV3O 1I3KA 2D5AA 4IJKA 4BHTA 3PQDA 1YB5A 2YDXA 3VTZA 4WLOA 3COSA 3FNHA 4AJLA 1LSUA 4NZ9A 2LDBA 4Y8VA 4DQUA 1ADCA 3Q2KA 1W4ZA 3WWZA 3IKTA 2JHFA 4CUZA 1FMCA 2IRWA 4J49A 1A9ZA 3CMCO 3PZRA 4WLNA 4E3ZA 3ANMA 2ZTUA 1DBVO 4BNKA 2OMEA 1NFFA 2Q46A 3SVTA 1BW9B 3SX2A 2Q4BA 2HDHA 5A9SA 1UAYA 4E2ZA 5JNLA 4ONEA 1NQOA 5JE8A 1KEVA 1NPTO 3QVSA 3GUCA 5GMOA 1T24A 1ZXLA 4HV4A 2TMDA 1YL7A 4ROSA 3S2FA 4D42A 3VVCA 1LX6A 5F1OA 3Q2IA 2EGGA 1O5IA 3W6ZA 3U4CA 4DPLA 3LK7A 1DIHA 3JQAD 1F06A 3NDJA 3OEYA 3IJPA 1PR9A 1T4BA 3AY3A 2QHXA 1E7SA 4AJPA 1O8CA 4DRYA 2RH8A 4PLFA 4TZTA 3KLMX 1VL6A 2Z1NA 1E1LA 3CTMA 3GNSA 5DT9A 1U3VA 4BO9A 2CF6A 1EBFA 3AI3A 1P1KA 2QZZA 3FPCA 4IBOA 4FGSA 4IZIA 3S1LA 1I24A 3WTCA 3RJ5A 3PRJA 4OXYA 1CERA 4PG8A 4PLWA 5U1PA 3PHLA 1H2HA 2Y1GA 2GCGA 1E0DA 1I36A 1C1DB 2PZMA 3FR7A 5ITWA 2OOSA 2P9EA 4CM3A 3TL2A 2Q3EA 4LRSB 2CDAA 1YWGO 1RM0A 5AXDA 1HF3A 4J7CA 5A5FA 4GL4A 5CFZA 4I1IA 1HETA 3DZKA 3V1UA 4DUPA 3GAZA 2YHIB 3KYDA 4H15A 3AUSA 4BV8A 2VN8A 4R01A 2YUTA 1IYZA 3GH3A 1Z74A 4R51A 2RAFA 1HT0A 3Q0EA 4TRNA 2HSDA 1AXEA 1XWFA 2WYWA 2B35A 2HRZA 4MVJI 4ZRMA 1SOWA 3NGLA 5BNTA 2GF2A 1LRKA 2Q50A 3VPSA 1NASA 5BQFA 2GR9A 1DO8A 4ID9A 2Z95A 5T8KC 1LSSA 2AE1A 4WK6A 4GQAA 5COAA 1KIFA 4ZD6A 4EJ0A 3V2HA 3HB4X 4HP8A 1X14A 4MJLA 4MP8A 1CRWG 5B4VA 2W2KB 3JQCA 1KVQA 3I9NA 2PGLA 3MJSA 4IS3A 2EKQA 3MOIA 1B8PA 2P4QA 3LT4A 3GPDG 4AG3A 3WNVA 1EVJA 1RWBA 2OGUA 1I2BA 4FFLA 4JX8A 3FR8A 1L7DA 3HG7A 4CM1A 4JQCA 1AUPA 1YB4A 2FR8A 3A4VA 2DBZA 4XGKA 2FY8A 2GGSA 3RBVA 2IXBA 4XJSA 5BSGA 1U4SA 3NYWA 4GSLA 3C7CB 4YTEA 4C7JA 1GL3A 2LDXA 2EWMA 3ZWYA 4YVFA 1K0UA 1PGJA 1H94A 1A71A 5COBA 2GN9A 2P5YA 3D3WB 4J4HA 3M2TA 3OIFA 1YBMA 1YQDA 2D4AA 4PG4A 1P1HA 3RVDA 5CDUA 3ROPA 4K1LA 4K9DA 1C0LA 5IJZA 2AW5A 2AG5A 4HWKA 4HX5A 3GF4A 3JYNA 3FN4A 4YJGB 3ZW8A 4QO7A 2ZB7A 1E1MA 1D3AA 1HDXA 4IDAA 3NX4A 1XQ6A 4HNHA 4DPMA 5IZCC 4B3IA 3K30A 1LI4A 1YOVB 1YQGA 2DU8A 4A7PA 2OXIA 3WFJA 2ZQZA 2VUSA 7MDHA 2VZ9A 4NK4A 3UN1A 5F21A 5I8ZA 3SC4A 3KYCA 2CVQA 4PLCA 4HY3A 1JA9A 2VTDA 4WNIA 3L6OO 4D3SA 3CEAA 4BO3A 2HK9A 3VDQA 4FFMA 4FC6A 5JMWA 1C0PA 3B1JA 4I8XA 5KJEA 3DB2A 2QRLA 3WGTA 1VSUA 4LSWA 4UEJA 3E9MA 5KKAA 2R2GA 1D8AA 5DOVA 4KTVE 1YJQA 1LLUA 5DP1A 1E3LA 5KJ1A 4RF2A 3DZGA 4R1NA 4EBFA 1HDZA 2GRAA 1X1TA 2BFOA 3K6JA 1DHTA 3BMCA 2JFGA 1YDEA 4DMLA 4DQXA 3IKVA 1PZEA 3NV9A 3PJFA 4YAGA 3F46A 3HN2A 1GU7A 4CPDA 3CZMA 1PIWA 1E7WA 3OF2A 3QE3A 4ALLA 4UVDA 4PRLA 1R0LA 3P5SA 4U6SA 4RV9A 3WJ7A 3I5MA 4WNCA 5G2OA 1P1RA 3JQFC 5T8KA 5LDHA 2Y68A 4R69A 1JKJA 1K6JA 1P0FA 2JCYA 1EVIA 4JP3A 1BRMA 1P3DA 1UXGA 2NM0A 2QW8A 3L4BC 4CQMB 1PZGA 4DC0A 5HS4A 2BMAA 3VAZA 4E13A 5A04A 4O63O 1K2WA 1B14A 4U8GA 1EUCA 4FJ0A 4OQYA 4FSHA 4CUKA 5DZSA 4BO6A 5L45A 4L4SA 4UEKA 1NWHA 4WKGA 3DHEA 3W4IA 1GEEA 5G0SA 5ER6A 1U7HA 3PHHA 3WGGA 1PR3A 1ZEMA 2NLOA 3DZFA 3PI7A 2QRKA 3NGXA 1V3VA 3TDKA 5IAAA 2B5VA 3PVZA 1XU7A 2C7GA 3PHJA 2FR0A 1GQQA 1YL5A 4LMPA 1N8KA 4TMFA 5BNIA 1V35A 1TEHA 3ZZNA 1U3WA 4AJ2A 2VWPA 1U3TA 3I6QA 4IQGA 3RAJA 5JBIA 5IN5A 2O3RA 1ZMOA 2NTVA 5GY7A 4CLRA 1B7GO 4DBZA 4FJ1A 3MWEB 3NT4A 1I3LA 1CQIB 2H5LA 4G65A 1T25A 1YS4A 2C0CA 4FOSA 3QW2A 4YRBA 3M1LA 5FFFA 3NAQA 1UUFA 5JAMA 2GSDA 2FZWA 3DWFA 1RM4A 3OA0A 4I08A 4YEDA 3D64A 4Y98A 3I52A 4U7WA 1NQ5A 1OFGA 1XU9A 3ZH2A 2Q1SA 1SAYA 1XELA 1XA0A 4GX1A 4XB1A 4XWYA 4N5NA 2CFCA 2JFFA 2PY6A 4R16A 5IZCA 3A28A 1XG5A 3ONDA 3LLVA 1HE3A 5FWNA 1Y7TA 4JIGA 3I4CA 1SZJG 1ULSA 2PGJA 3BXXA 1I2CA 3JQBC 2D1YA 3L9XA 4BNGA 3UFXB 2WWRA 3R1IA 5TF4A 1VL8A 5L53A 4R9SA 3ZWAA 2IXAA 4IS2A 2O7QA 1Y8RA 3EVNA 4YRAA 1MA0A 2FP4A 3JQ9C 3WGZA 1GPDG 1HSZA 4RGBA 5G0UA 1TLTA 4EI2A 5ILOA 3ZHZA 1BDBA 4KOAA 2ZTVA 3I83A 5TIIA 4RPLA 1PSDA 4E5MA 4WEOA 1T2AA 1ISMA 4CR6A 1DLJA 4BO1A 1R4MA 1Q2XA 1PZHA 1K5HA 3WIDA 1ADGA 2P5UA 3BMOA 5MGBA 4XYMA 3O03A 3QWFA 1QKIA 3JQEA 3GRPA 4RVUA 1K6IA 4AICA 3Q3CA 4CMJA 3JQFA 4FIZA 1EUZA 3KM0A 5ES3A 4J4TA 2X7HA 4CV0A 2AXQA 3GOHA 3EK2A 9LDTA 1XDWA 2PV7A 5JO0A 4JJGA 4R4JA 3OBBA 3L4BA 4QO8A 3INTA 3I9JA 3K2BA 3L0DA 1E3IA 2C20A 3M2PA 4TQGA 1HYGA 2FWMX 5JYDA 3MCVA 4CODB 3P19A 5F5NA 3ON5A 3JQGB 3TFOA 1E7YA 2EERA 1J49A 1U5CA 2GN8A 4BNIA 4LN1A 4M49A 2I3AA 2O23A 4J90A 3ZWXA 3GZ4A 1D4FA 1X7DA 2X0JA 1DAPA 4EUHA 3JYQA 3D4NA 1XR3A 3PEFA 3K8ZA 3DDNA 4RF5A 4A0SA 1RM5A 3FBGA 2EKLA 2YW9A 4XR9A 3HDQA 3H2ZA 3ZWWA 1ZFNA 1SCUA 1FJHA 1R6DA 4YCAA 4NJMA 1D7OA 3CKYA 5AVOA 4BKPA 3JQ7B 1HKUA 1OBFO 3VC7A 1J0XO 3FSRA 1H0KA 4P38A 4ALJA 3R3SA 3HFSA 5BSEA 2NSDA 4J0EA 4DYVA 3GZNA 3UXYA 2ZYDA 4R5HA 1NTOA 4E6PA 2WSBA 1TVEA 1UDAA 2NU6A 4I5EA 2PFGA 1X13A 3MWDB 1EK5A 4CL8A 1L7EA 5EPOA 1CIVA 2X4GA 1LJ8A 4KMSA 4OSPA 1NFRA 1WLYA 5ICMA 3OQ1A 2NTJA 3ASVA 4Y6PA 4A73A 4GLOA 1ORRA 3K31A 4Q9NA 2O3TA 4YWJA 1EUDB 3KTDA 1I0ZA 2VUUA 4M55A 3GG2A 1N2SA 4CR8A 1J5PA 3GNQA 2C5AA 1HYEA 3JQBA 3W6UA 3GN1A 2IZ1A 2VOJA 1BXZA 1MFZA 4UVEA 3V8BA 3OECA 1HYHA 3U4HA 3PWSA 2EF1A 4Z3KA 3I4FA 3OQ6A 2OZPA 4CMHA 3JQ9A 4DREA 4CLHA 3PIIA 5ITVA 2HKIA 3NTOA 2WJPA 3AU8A 1QYWA 4W9NC 3INGA 5K0ZA 4IMRA 3WQQA 2NU9B 4KUGA 1NQTA 2GO1A 3DXFA 4RVSA 4CMBA 4E5YA 1LEHA 4NJOA 3WXBA 4XYLA 1DJQA 5CDTA 1ZH8A 2DAPA 3BHJA 4JK3A 4FC7A 1Q7GA 3K5PA 1UP7A 3W1VA 4LCJA 2FPGB 3PWZA 3QVOA 2HU2A 4IZHA 4PVDA 3F3SA 2IZ0A 1MB4A 2ZCUA 3WGOA 3GMSA 3WG9A 3U49A 2C5EA 3Q11A 1AHIA 5C7OO 3E48A 2A35A 2NU8A 4XGIA 1KVUA 5A02A 4PG7A 2UDPA 3ZWBA 5KVVA 3ZWOA 2BFAA 2EEZA 3F47A 5TJHA 1DIRA 4R1SA 2IE0A 2X23A 1CQJA 4Z6KA 2XPCA 2HO5A 1P44A 5C7LO 4DQVA 1E3WA 4IUYA 1HDRA 3GMDA 4DIOA 1MGOA 4BV9A 4MVJA 3D1LA 3UW3A 3HDYA 3I9KA 2JHGA 4PFJA 1KEWA 3ZU3A 1QV6A 3UVEA 4K26A 2CD9A 3HFGA 1WZEA 3W4KA 1ISHA 1MFPA 4ZQBA 3VZRA 4ZJUA 1NNUA 2CUKA 1IZ9A 4IJUA 4MO2A 2HMWA 1AHHA 5ICSA 2UAGA 4NBTA 1TT5B 4L75A 3NTRA 4Y67A 4FPXA 1B8VA 1LNQA 5KOIA 2X86A 4R5MA 1Q0QA 1EE2A 4TKLA 3OM9A 2AEMA 2NV6A 5L51A 5F1PA 5G0TA 4LW8A 3AY6A 2RH4A 3E1KA 3S55A 3E9NA 2BLLA 2DBQA 2YJZA 1R4NA 2FZEA 3D5TA 2HK7A 4B8ZA 5KJ6A 4CLOA 3GUYA 3VDRA 3BMNA 3AM4A 2CVOA 3ONEA 5C7IO 3UF0A 2AQKA 4WLUA 3GY0A 1CF2O 3ETEA 1HLPA 2B4QA 2NVWA 1DC6A 3DOJA 3PYMA 5AXCA 2RIRA 1P0CA 3AOGA 3DBHB 2XOXA 4DL9A 4DGSA 3ANNA 5JMPA 1PS9A 3O26A 1GADO 1DRUA 1DRWA 3ZV4A 3F5QA 5HWSA 2WE8A 3ZWMA 3ORFA 2BF7A 4LISA 4NQZA 4OSOA 1OC4A 3S2GA 3N58A 2IYOA 3OSUA 5AOVA 4ALNA 5KKCA 3LT0A 1P45A 4KP7A 3ULKA 1X0XA 3ICCA 1YGYA 3FPLA 1PQWA 3UKOA 3EZLA 2PNFA 4W9NA 3U09A 3O8QA 2XXBA 1GZ4A 4JBIA 3RROA 5CEFA 4WUVA 5MDHA 1PQPA 4Q3BA 2Q1WA 1XKQA 3DEYX 1UDBA 2ET6A 3WIEA 1SEVA 4B4UA 1IPFA 4ZGWA 3C85A 3GVCA 2P68A 1NQAO 2CDCA 3H9JA 1LDGA 5K6AC 1ISIA 3C7AA 3BMQB 2JFHA 1ZXBA 4CMIA 1EDOA 1PS8A 1F0YA 3GLQA 3AJRA 5JCJD 1PGPA 1Z6ZA 4CLEA 4H16A 3QA9A 3RU9A 4J9VA 4LCEA 3LDHA 5B37A 4YJDA 4BNHA 4PGFA 1R37A 4PZCA 1DEHA 4P22A 3GNTA 3JCZA 1ENPA 4YJFA 1DIBA 3S2EA 3ZV5A 2WM3A 1GR0A 1YONA 1ZZEA 2ZCVA 4MP6A 4RPKA 1QLJA 1YBVA 3FCOA 4ITUA 4Q3CA 3VVBA 1LU9A 4FCCA 3ST7A 4R1TA 4PG5A 3AWDA 4MPDA 3AFNA 3O38A 2NU7B 2I9PA 4XX0B 4J2OA 3WNQA 1Q7BA 2SCUB 3LYLA 3VZPA 5CHEA 1EBUA 4TVBA 1C0IA 1KETA 4UVGA 2P9CA 3AI2A 1GCUA 4IDEA 3OJLA 3OP4A 1PS0A 2WEKA 5CP8A 4E32A 4PN3A 2HJRA 1C14A 2GZ3A 4EEXA 4G2NA 1BHSA 3VPHA 1Y8QA 2EHDA 2QX7A 5ILGA 5HM8A 1PEDA 2O3JA 5DP2A 4OXKA 4Z0HO 1M66A 2FSSA 1I2ZA 3JD3A 3O9ZA 3T4EA 1P31A 3EDMA 3VHRA 1BXGB 3RUDA 3WQRA 4BNTA 2BHLA 2QG4A 2YHUA 3V2UA 4GI2A 1WDMA 3JQ8A 3ZHBA 1XSEA 4R54A 1DC5A 1Y6JA 1T26A 2O4UX 3DBLA 3DQPA 1ZIDA 4W6ZA 4JJIA 1F8GA 4IPTA 3MJ4A 4UVIA 1RM3A 2GD1O 4YA6A 3UICA 3ZI0A 2GZ1A 3RFXA 3P2OA 1LRLA 3PPIA 4CQLB 1TB4A 1AXGA 2DUUA 4MVJD 1SB9A 2ZK7A 3UUWA 2Q45A 4JLWA 4QECA 4ZU3A 1AE1A 3OIGA 4WPGA 1T2FA 5G4KB 2X5OA 2VNAA 2Y0EA 4EITA 3GHYA 2H1SA 3JQ6A 3K96A 3L07A 1NVMB 1XIVA 4RQTA 2OL4A 3H5RA 3KB6A 5EESA 3FI9A 2HMTA 2AQHA 1QLHA 1BGVA 3SEFA 4E5NA 3OEWA 1EQUA 3SXPA 3JV7A 1BW9A 1DIGA 1LDYA 1CYDA 4J3FA 4BGIA 4N18A 4BNWA 2HJSA 3LC7O 1MLDA 5TT1A 4YT5A 1MP0A 3WYEA 1M2WA 3NJ4A 2C2YA 2BELA 5A5EA 2X58A 3DZIA 1U2GA 3K73O 1QR6A 4URFA 1E1NA 4CLDA 5JC1A 4E2YA 1KVSA 2A94A 3PGJA 3X2EA 4MINA 3TNLA 4GKBA 1VSVA 2RCYA 3IOYA 1A4UA 4CV3A 1K6XA 4YR9A 5GZ3A 2I6TA 1JAXA 5K6AA 1N9GB 3HDJA 4M89A 1QV7A 3B1FA 3PWKA 3VZSA 3WS7A 4E5PA 4E31A 1ZNQO 3RUAA 2DPHA 3G1TA 6LDHA 2PLAA 3OETA 4QFCA 5U4QA 1JLLB 3GVPA 4NBUA 1I30A 2PZKA 5KWEA 5JAZA 4XR4A 4F6CA 2YY7A 3I9LA 1LRJA 4P4NA 3H6KA 4E21A 5IG2A 1E1KA 3GT0A 1C1DA 5H82A 3WSWA 4S3MA 4L0QA 1HL3A 3CPSA 3F5SA 1R15A 1E3EA 3KO8A 5J23A 4CLXA 4QUKA 4EUFA 2W98A 2B5WA 4KTTE 4MKRA 2P4HX 1AGNA 1F14A 1OAAA 3F4BA 3LF2A 4A26A 4CM5A 1MC4A 4E30A 2Q1UA 2YHIA 1PL6A 3KUXA 4PLHA 5T57A 3RUFA 4XGNA 1ZUD1 3TOXA 4L9RA 3S2IA 4Z0PA 3BTSA 3QY9A 4MIYA 2BGMA 3H9EO 1EZ4A 1IPEA 4Z0TA 4NI5A 4NR0A 2VTEA 1C1XB 3PDJA 2FPPB 1WAMA 3OJFA 3HWRA 2XAAA 5I7VA 1LSJA 1Z82A 2RHRA 5TT0A 3ABIA 3E18A 4NH4A 4TZKA 5G0VA 2NACA 4LVUA 1Y9AA 4ND1A 4RQUA 8ADHA 4Q3NA 2GUGA 4NK5A 1GFSA 3H9GA 4EYEA 4ZQFA 1Z7EA 3DOOA 3KZVA 4XD2A 2W2KA 1U5AA 3QWHA 3ZNOA 1EVZA 3KSDO 4XYEA 2PH5A 2JD0A 3F6YA 1RYEA 3BTUA 3TN7A 3KSUA 4BMVA 2B4TO 3TZHA 5K9ZA 2DTDA 4NBRA 2ZB8A 7ADHA 4LVCA 3JTMA 2JL1A 2HUNA 4DXHA 4IGFA 2X8LA 4GAEA 4P4LA 3WGQA 4CR7A 5CG2A 3IAHA 3STHA 1E6EA 4NIMA 5TSDA 4I9UA 3IDSA 5EIOA 3E5MA 1NVGA 2GERA 1ZCJA 2W8ZA 1LC0A 4HBGA 3HZZA 1T1RA 4C7KA 3H4VA 3CUKA 4OM8A 3D3WA 4ILKA 2QIOA 5BSHA 1GUYA 1F8FA 5FI5A 5KVCA 6ADHA 4ZICA 4RVFA 4DLBA 4I9NA 4MVJE 4NNJA 3WLEA 2PGDA 3OQBA 1GEGA 3ZV3A 4A5OA 4R1UA 2BGLA 3D0OA 4KWHA 4TSKA 4YJGA 1W73A 4MVJP 4D3DA 4DLLA 4IDDA 3KLPX 4EJMA 3RD5A 2YV3A 1HZZA 3ASUA 4E12A 3QWIA 1KVTA 4BNLA 3PHIA 2AHRA 4L73A 1YOVA 1T2EA 4RDIA 1KYQA 1YXMA 2B37A 2YFHA 2WD7B 3R0IA 3S8MA 2ZYAA 1SMKA 4YYZA 4QX6A 2WYVA 3VH4A 3OJOA 4U6QA 4QSMA 4YACA 5L95A 3V1TC 3H5NA 4XDZA 1I32A 2ZJ0A 3JD1A 3DMYA 5H83A 3IMFA 4J16A 4YAKA 1ENYA 1QYDA 4E33A 5EL0A 2NADA 4J9UE 4YXFA 1TA4A 2E49A 2HMUA 5I7SA 4WECA 4I5DA 1LQTA 4BNZA 4J7UA 2DFVA 1NPYA 2NUAB 1JW9B 1X7GA 4OHUA 2DQ4A 4AJEA 3N7UA 1UH5A 1VKNA 3FBTA 3QRWA 2VWQA 2JCXA 2DC1A 3L6EA 1V0JA 4XQ9A 1LUAA 3DHYA 4CM8B 3QVTA 2HRBA 4CM4B 2ZTMA 1ENOA 5B4UA 1PJ3A 4O0LA 1CETA 1ONPA 3V1YA 1NAIA 3G49A 2QQ5A 3TPCA 1LBEA 4ZQHA 4CV1A 3K2EA 4BQRA 1H9BA 1PWXA 1A7KA 1FDWA 1W8DA 4UUNA 5JPIA 3ZWNA 4CQMA 1GQ2A 3ENKA 1PJQA 3DBVO 2O50A 3FTPA 5EQDA 5TRTA 1ADBA 4YT8A 2EXXA 2WYUA 2EIHA 2I99A 1K89A 4RZIA 1VRWA 2I65A 3FNGA 3E8XA 5HBRA 4WCFB 2DKNA 2Z5LA 2NVUB 3U4IA 3O4RA 4F3YA 1A5ZA 4LK3A 5F3RA 2VRCD 4L74A 3RU7A 4BS9A 2H9IA 4BKOA 1U2DA 5JY6A 4PIVA 5I7FA 1HE5A 3I6IA 4BMNA 3WX0A 4CMAA 5IXSA 1SO8A 1H2BA 4PLZA 5AXBA 4YAIA 5IDQA 5CPBA 4BNFA 2GASA 3KXDA 2EP5A 4RVHA 4ALKA 4E5KA 1LA2A 4N54A 3ANLA 1ONOA 2BGKA 3MWEA 5DCWA 5CG1A 2PKRA 1E7MA 1CQIA 3PFWO 3JD4A 3IJRA 1LLCA 1DIAA 1EVYA 1E6UA 4XYGA 3ZWVA 4P8RA 1HSOA 4HFMA 4J7XA 1ZK0A 5CEJA 3ZU4A 4PLGA 4IJWA 1BSVA 1JAYA 3GG9A 2HLPA 3CIFA 1U4OA 3AK4A 1U8FO 5CPFA 3I1JA 4IIUA 4N5LA 3ZGYA 1B2LA 3GA0A 1PL7A 5GZ6A 5KNLA 4FD3A 4WJZA 3DBRB 4G81A 1M76A 3UFXA 2GYYA 4II3A 3AW9A 1BDMA 1ZKMA 1GZ3A 4GKVA 1MG5A 1DJNA 3L9WA 3U62A 4L8VA 3SJ7A 2EP7A 1C3VA 1JWBB 4Z9FA 2FPIB 2J5RA 4XIYA 3BHIA 4GMFA 4RORA 2C82A 4RO0A 1GYRA 4RPHA 1Q0LA 1VE9A 3BAZA 4OH1A 3NDRA 8LDHA 3PXXA 1WPQA 3HNPA 3GGGA 5KVQA 3NJ8A 1U1IA 1P9LA 3HB5X 3GQVA 1ARZA 1WVGA 3GK3A 3PYXA 1PJ2A 4CMGA 1FK8A 3UCEA 1N5DA 3F1LA 1JQBA 3LT2A 2DVMA 4IQ0A 3A14A 1B3RA 1SNYA 3EW7A 4L76A 5C5IA 5IZ4A 3WBBA 1DFIA 3TOZA 2ZJ1A 3PJGA 4D45A 1WDLA 3SLKA 4C4OA 4I5FA 2XF8A 2J8ZA 2VYND 9LDBA 2B36A 3I9OA 1GTMA 1HDCA 2ZATA 2ZKLA 5HRUA 4K6FA 3D3EA 4DWVA 3W8FA 1DC4A 2X5JO 4JXKA 1N7GA 3JQGA 1GCOA 4FFOA 1GV1A 3WYBA 5FYDA 3RUHA 2J5KA 1XLTA 4BKQA 3G1UA 5JCJA 5C3MA 3C1AA 5JFOA 4BB6A 3EGOA 4IDGA 3G17A 4DIFA 5HS6A 1SOVA 1Y81A 1N92A 4MVJG 2Y1CA 1JU9A 1QMGA 3PHGA 2YYYA 2OUIA 1PU2A 1E3JA 5DNAA 2AA3A 3DL2A 2HCTA 3NT2A 3ITKA 4IINA 4RVDA 4E4YA 3JQ7A 1M6HA 3MTJA 2Y0CA 4OL9A 5EERA 4D0RA 1PWZA 4CQMD 3JYOA 1U3UA 3ROQA 1ZSVA 4UEOA 1F17A 4HFJA 1Q0HA 1JTVA 1MX3A 1G0NA 3FNEA 4EW6A 4MIOA 5DOZA 2G17A 3Q9UA 3H7AA 5JYEA 3PLNA 5CAEB 2DFDA 3AFMA 3KBOA 3FF4A 3WMXA 3GDGA 3MWDA 1R12A 4PVCA 1E5LA 3PDUA 3KRTA 2I5PO 4ND3A 4E2XA 2Q4EA 4I9HA 5FI3A 4EUEA 3D4PA 5T5QA 1EUDA 1O89A 1EFKA 3C24A 1WZIA 2PD6A 3JQAB 3LSYA 2PKQP 4L4XA 3PP8A 3WWYA 1X0VA 2POQX 2VQ3A 4BO8A 3BYZA 1KC1A 1MXFA 1V6AA 5KJCA 4OKIA 2Y0DA 2VZ8A 3PZBA 3ZW9A 4D43A 4JNKA 1LLDA 4GX2A 4D44A 3K9QO 5ADHA 1DRVA 4GWKA 1VKOA 3V5NA 3MJCA 4ZQGA 1YO6A 3JD2A 3UHAA 2DTXA 4NMHA 5FF9A 2NU9A 1H6AA 1NHGA 1LLQA 4XDYA 4D46A 1OZAA 1DB3A 1DLIA 2EG9A 4WLEA 5B4TA 1NFQA 4ND4A 4GWGA 3EVTA 4NBVA 2FHSA 3H9UA 4U0KA 5JDIC 2FPGA 3E5RA 3QVWA 1HLDA 2AG8A 1V3TA 4WLFA 3W8EA 4BQPA 5A3VA 2W2LA 4MDHA 1A4IA 2BI8A 5T6BA 2GLXA 4BO2A 3RKRA 2FN7A 5BNFA 5L4NA 2DLDA 4CMKA 1KVRA 2A92A 5TGDA 2JD1A 3LU1A 3DAGA 4CM9D 2WD8A 1IE3A 4XKJA 2B4RO 1GD1O 4LRTB 4M8SA 4FDAA 3LC1O 1VL0A 5GZ1A 1DXYA 3B1KA 1DPGA 3H8VA 4GVXA 4NFYA 2GN6A 3G3EA 3RCBA 1QYCA 4YQYA 1R66A 2G82A 4CJXA 4B8WA 3GPIA 3LF1A 3FTNA 2Q1TA 4MVJH 1LDEA 1B8UA 3B6ZA 3DO5A 4M1QA 1I3MA 1Y1PA 2PWZA 1IHXA 1TXGA 4D7AA 1UP4A 4CMCA 2PTGA 3VH2A 2VHXA 3WMWA 1VPDA 2JAPA 2R00C 2CY0A 1HTBA 3W4JA 3FWZA 1PJCA 5KVSA 4RVGA 4WLVA 4N7RA 3WGYA 5DBGA 3RI3A 4RPJA 2QYSA 1XYGA 3QJ5A 1NAHA 1VJ0A 2B0JA 4A10A 1O6ZA 1XEAA 1JKFA 3MZ0A 4ZN6A 1IY8A 4JROA 2OBNA 4YBZA 3PTZA 3R3JA 2V6MA 1BVUA 1TT5A 5KCZA 1QXSA 2I66A 3EAGA 2Y1OA 2YZ7A 4NFHA 5A05A 1W0CA 1C0KA 1WXDA 4WCDA 4K6CA 4HFNA 1GQYA 3WQSB 4BGUA 4RLHA 4UREA 4J0FA 4ZRNA 3DFUA 4TRMA 1JN0A 2PZLA 3HE3A 3NEPX 2Z1MA 2O2YA 5B12A 3LC2O 1LC3A 4WASA 1HE2A 3MEQA 2E48A 3SLGA 2X0NA 1ZSYA 3WB9A 4ESOA 4JP2A 4CMEC 2X0RA 1EQ2A 3MJEA 1NHWA 4J43A 1X15A 3D7LA 2B69A 4BGVA 3PK0A 4GPD1 4YT2A 2PKQO 2Y1FA 1YKFA 3DBHA 1S7CA 4AJ4A 3HADA 1PGNA 2FSVA 2UYYA 4PLTA 3RC9A 4YAJA 1E3SA 1QYXA 3TZCA 3KHUA 4MP3A 1DSSG 2VWHA 1T1SA 2F00A 1HDGO 4YPOA 1PGOA 3WLFA 3NDIA 1S6YA 4IGEA 1GYPA 1ULUA 3RUIA 3PGXA 1GPJA 3TF5A 1KERA 2OHXA 1K3TA 3E6AA 3QVXA 5THQA 3RUCA 4YAEA 5HA5A 2HQ1A 4J1QA 5DN9A 4B4WA 2Q2QA 1Z45A 2CZCA 2IEBA 4R3NA 3HN7A 3DR3A 5A9SB 3OA2A 2OP1A 1TT7A 5I9MA 1Q7CA 1ZMTA 4UVHA 2VZ0A 4GMGA 2BH9A 2P91A 3TZKA 3C3XA 4BNNA 2ZIZA 1NX6A 4QT0A 3ZCXA 1IHYA 4CM6A 1QP8A 4B7UA 4HFRA 4DTIA 3BMQA 4HXYA 5JDIA 1HRDA 5A4DA 4AVYA 4FFNA 3DAPA 1ADFA 2OO5A 4AJNA 1JDJA 4YB8A 4R68A 2ZB4A 3P7MA 2ZTLA 2YQ4A 1ENZA 2CVZA 2W4QA 2D3TA 1T2DA 2OORA 5H81A 5KIAA 1GDHA 4FR5A 2NU7A 4XX0A 1NBOA 2I67A 2SCUA 4HNGA 5EN4A 2J3KA 1M6WA 2UUPA 2VUTA 4Z9XA 1EE9A 2IYPA 3RFTA 4O59O 5DCYA 5L3ZA 3D5QA 5DBFA 2YV2A 4NHEA 1AN9A 2R00A 3IS3A 3AUAA 3ROMA 3FD8A 2GNAA 2W2LD 3JD0A 5BT9A 3G0OA 3ZU2A 1PX0A 5KTKA 2OP0A 2NVBA 3UGKA 4R3WA 2VYVD 4ALIA 3KEOA 3KYDB 3IC5A 4INAA 3HJAA 2VT3A 4Q3AA 1BXGA 2X9GA 4A2CA 5T64A 2Y99A 4XEHA 1A7AA 3Q1LA 4NPCA 5IFLA 3EZYA 1FDSA 4TROA 5JCXA 4RL6A 2D5CA 3QSGA 4H3VA 3RFVA 3NKLA 1NYTA 5G4LA 2BFMA 4IIVA 3BIOA 5JLAA 2UV8A 2VWGA 4RF4A 4AJHA 1GUZA 4GSKA 3CH6A 4Y9DA 5JAIA 4CV2A 3RJ9A 2AEFA 1OOEA 1A72A 3B20A 3JYPA 4NBWA 3AUTA 4W7IA 4CQLA 5KJFA 4CMEA 3HHPA 1UXHA 4QEDA 3QIVA 3QLJA 2X5KO 3TZQA 5G4KA 4FFRA 5TJ9A 5G0WA 3QWAA 4EGFA 2J3JA 1ZO8A 4AFNA 3E03A 2H63A 4IMPA 3OMLA 4PRKA 3KEQA 5L7TA 4XQGA 2PR2A 4BB5A 4E0BA 2ZYGA 1ZK3A 4CUJA 3GVXA 4ZA2A 4DPKA 5EJ2A 5B1YA 3DZJA 1MV8A 2BD0A 4YQZA 5JW6A 4LMRA 1UP6A 3QP9A 4B7XA 4F45A 2R6JA 4GX0A 1ONNA 3GHHA 4XRGA 4XB2A 4J6FA 1X7HA 3U3XA 1OI7A 1P77A 3IIEA 1WW8A 3QWBA 1I10A 2C54A 5JO9A 3EMKA 5JAQA 1WMAA 2BFPA 2G76A 4YRDA 1B0AA 3PFFA 3AU9A 1MC5A 1H93A 3ONFA 4TWRA 1YQXA 4J91A 1JVSA 1N9GA 1B15A 1D1SA 4BNVA 5I7EA 1F12A 1V8BA 1X1EA 1G6KA 2O4CA 2PZJA 2VRCA 4IM7A 1PZFA 2DTEA 5JDCC 4OOFA 3TJRA 5DF1A 3BZUA 4QXMA 1WNTA 4XCVA 1H9AA 4N5MA 1JLLA 3GEGA 4J1NA 3PJDA 3TRIA 2J5QA 5ENVA 2OBYA 3L4SO 2G1UA 2RHCA 2V65A 1P1JA 2FMUA 4B3HA 1XCBA 3ICPA 4AJOA 1IZ0A 2J3IA 1PL8A 2JAHA 3CINA 1DC3A 3I3OA 3NRCA 3QV1A 4BNMA 3ZN2A 2V7PA 4XZ3A 3DFZA 4KDEA 3OICA 1KC3A 4X54A 3U5TA 3DHNA 3KYCB 5DULA 4CM7A 3TWOA 3DC2A 1RKXA 5JY1A 1O94A 4Q39A 3T4XA 1HDOA 4XRRA 1PQUA 1D1TA 4HKTA 4UUPA 3M1AA 4BOYA 2VHWA 4OAQA 3OIDA 4JJFA 5EINA 1UDCA 1Y5MA 2VHVA 2Y93A 1XGKA 1ZK2A 3B70A 5IDYA 1NPDA 3L6DA 5L7WA 3UCFA 4GBJA 1C1XA 1Z73A 3AI1A 2FPPA 2Q99A 2YDYA 2G5CA 4B4VA 1R0KA 2UVDA 3T7EA 5EMHA 3BMCB 4A03A 2G0TA 1JVBA 2WMDA 2E6UX 1ZW1A 3HQ4O 5IDXA 3DTYA 1ISFA 1VJTA 1U28A 4PZDA 4IJVA 1EK6A 1IB6A 3BTVA 1YBAA 3VTFA 2CF5A 4Y6SA 5COQA 1GYQA 4PZEA 4EJ6A 5A06A 2D8AA 4DIBA 1JKJB 2X6TA 2TMGA 2X22A 4ND5A 5IN4A 2O3QA 1VLLA 2DBVO 1PJSA 3GR6A 4OMUA 3TL3A 4WCFC 4FQ8A 1KBZA 3EYWA 1EDZA 4K28A 4BNJA 4YJHB 3R6DA 5LDGA 1HXHA 4J1TA 4D41A 1EUCB 4M54A 4NG5A 3JSAA 4IXTA 1GUFA 1OC2A 3AM3A 3H5AA 5CDYA 1ZSNA 4KDFA 2VT2A 2V6FA 4OOEA 3HUDA 2QYTA 1R0SA 3VKVA 3UCXA 1PJBA 4TRJA 4KZPA 3UAGA 3H2SA 4AJJA 2RBEA 1I33A 3ITDA 3H3FA 2E4AA 2VYNA 1JKIA 2CMDA 1XHLA 1YDWA 1NM5A 3T7CA 2VCYA 5A03A 3RBXA 3GRKA 3M6IA 2GN4A 2EKPA 4A27A 4CLRB 1PJ4A 3I23A 3WGIA 4BGEA 1JWAB 3FRJA 4I5GA 4LSMA 4D3FA 2VNSA 4QTZA 1VC2A 3A9WA 4RPGA 4GVLA 4B3JA 1Z75A 4H7PA 3TSCA 2AQ8A 4YJHA 5JDCA 3DAFA 3ETDA 2EW2A 1E5QA 1NR1A 4DYDA 4BIIA 2WD7A 1V9LA 5BSFA 3FNFA 5JS6A 1RJWA 3ZHXA 3CMMA 3ZWCA 2JD2A 2DPGA 1I01A 2F1KA 4B4OA 2NQTA 3VH3A 3VPGA 5L4SA 4ZVVA 3KOUA 1KY5A 4KWIA 1LSOA 1M75A 4DA9A 2A4KA 1E92A 4LGVA 2I76A 3BHMA 3L77A 1Y8RB 1O0SA 3OFSA 2FP4B 2HMVA 3IUPA 3QHAA 5TS3A 2XXJA 3EHEA 4Q3EA 2WDZA 2NUAA 4IDBA 2E82A 3PQEA 2V6GA 3KYBA 3AM5A 1BG6A 4PLPA 2X9VA 4QQRA 4QFDA 2C7VA 4CM8A 1LDMA 4ND2A 3RC2A 1QRRA 4CM4A 1BWSA 3OH8A 2VOEA 3PIDA 4M87A 4WGGA 1ZJZA 1R4MB 4BO4A 3RWBA 4UUMA 3WICA 2Y67A 3AUUA 4WE3A 2FRDA 3H65A 4GLLA 4DBVO 3BMOB 2HMSA 1B26A 1T2CA 1UXJA 2DT5A 3F4LA 1Y5RA 2EJVA 4EEZA 4XYBA 4DC1A 5FEUA 3SBOA 2X1HA 1ID1A 1V3UA 3PJEA 3CE6A 1KS9A 5THKA 4RF3A 4UUOA 3AY7A 3PYLA 5A1TA 4IDFA 3WR5A 2VRBA 4WOKA 2EJWA 2Y1DA 3GDOA 2C2XA 2EGHA 4WCFA
chains in the Genus database with same CATH superfamily
1BD3A 1H5QA 3OUTA 2OFPA 1Y8AA 2HJHA 2QM0A 3TUZC 2L18A 2IH5A 4NYIQ 3E82A 2QN1A 3I32A 4JBNA 5BR7A 2HT6A 2R65A 5K0BA 3CCCA 3T1TA 1HX7A 4MKFA 2OCLA 1E64A 1NBWB 3UV6A 2HSGA 4DFDA 4JDUA 4B40A 4WXEA 2PNJA 1EFPB 1LQ2A 2W2OA 4K0KB 1NVTA 1JECA 3HC7A 4B4KA 1SEPA 2ODWA 4K0RA 4II2A 3UUFA 4BBAA 1YKSA 2F67A 5DLDA 2PD4A 2PLFA 3PQ6A 1JKMA 3GEPA 1NC3A 5B3LA 1UJBA 4MZXA 4EH1A 1DU4A 2A9FA 2BGWA 1WEKA 2WWGA 2E37A 3WQBA 1QB7A 3B85A 5ALDA 3R6WA 2B8JA 2OB2A 2SHKA 1S2MA 2VIIA 3DEIA 3DDWA 3L46A 4HADA 4JCOA 2WWYA 1RVV1 3CF0A 4FMPA 1T0JB 1UCFA 2O7SA 3VUFA 3Q9NA 1G5QA 1Z39A 2G36A 2Z83A 3CH5A 4FD2A 4B6GA 4F4FA 2YV1A 3EVFA 4O4HB 4F1WA 3ZZ0A 4N49A 1NX9A 4WBNF 1CTQA 3VR2A 1UM9A 3DOCA 3MUFA 4HI0E 3R0QA 1DCKA 4MKXA 1DO2A 4Q02A 1N0HA 2PH3A 1IOLA 3JTEA 2C2GA 2NU6B 4AZWA 2A0YA 2P9GA 3ER8A 1T35A 3NXKA 3FHLA 1V6CA 3IO3A 3A06A 3ASZA 3IBTA 1A8HA 2BBWA 1GPMA 3K1JA 3Q7RA 2XMRA 3GFRA 2C92A 3BE6A 3ZVKA 1EINA 4CKCB 1BCSB 3HY3A 3F1KA 3RABA 1NUUA 3EY4A 1MUUA 1IB0A 1KAQA 3C48A 1ZHFA 3FBWA 4XQCA 4BNUA 2JH3A 5B7PA 1ZGGA 1PTJC 1VA5A 2PR7A 3MWFA 2IV7A 1EMDA 5EUMA 1DHRA 3TFQA 4Z4QA 1SBYA 1COZA 1Z4IA 4IEIA 4KQHA 3VKUA 1RXVA 1DAIA 3WDSA 1Y8ZA 1EHCA 3KU4A 1RHRA 2PD3A 3T12A 3WNZA 3C3CA 1KI2A 4B7CA 5DYYA 3DUFB 1L7RA 1MRZA 2ZQYA 5DN6D 5ELMA 3GVHA 3PA6A 3FOEC 4CF3A 2OHVA 4IYRA 1R16A 2ZYTX 4ZVUA 4FWIB 4F6LA 4L8GA 3HI6A 3PDIB 4F2WA 5L40A 2NUTB 3V34A 2FOXA 4TRRA 3GDFA 4IX1A 5EOVA 3QOFA 4QVGA 5JZMA 1H6BA 1XTJA 1BWRA 4IVNA 3R9XA 3A10A 3FDZB 3EG5A 5KSOA 5FDFA 2XUKA 4DANA 1WCWA 1FXSA 3EQ6A 3A6KA 3C15C 4NDNE 1QP4A 1GAWA 1G0OA 2JFWA 2GZDA 2RGCA 3UEOA 3H3JA 4UFNA 4X8MA 2OC4A 1FF9A 2ZB2A 3GJTA 3HP1A 4XJXA 4U0JA 3Q41A 2AR0A 4NESA 1QYVA 4YDRA 5ER9A 3UOGA 4LXQA 4EUNA 1P7ZA 4FS3A 1GLGA 1TJ4A 2RHJA 1SQFA 1LH0A 1EAMA 1GKIA 1OA1A 3GFFA 1I7LA 4XCXA 5FOSA 5H0IA 4KFTA 3U0BA 5CD1A 1ZK4A 2IYFA 4NYJR 2PLNA 2YJ4A 1QSGA 4QEKA 3IO5A 4BRWA 1EA5A 1AB5A 2P67A 1NR7A 3JYLA 4UMVA 4LIPD 3FVWA 5H70A 3S0JA 3EGXA 2FW6A 2PRZA 5JH7B 2W8BA 1GVNB 1WX1A 3AVOA 1HFKA 3AESB 3HXMA 2XGJA 4RXTA 1WZ2A 4UQPA 5ELLA 3P5BA 3MLBA 5LQRA 3WAJA 1WMEA 2DH5A 3ZGOA 3LNCA 4JX9A 1WWKA 3HKDB 1I3NA 1VJDA 1UT5A 1CJTC 2RBGA 3BA1A 3SEZA 1WPRA 2H1IA 3R3HA 5LUAA 3K70C 2N1MA 2QZ9A 2K4MA 1E3WB 2WKQA 2JRLA 3N2GB 5F1KA 3OHSX 5BWBA 1IATA 2QP9X 1KO4A 2JK0A 1J1IA 5A3RA 1U0TA 1GPAA 3W9SA 3TQSA 4AURA 1NBHA 2RC5A 1J0BA 5ALNA 3N74A 3R7AA 2C4VA 4CF7A 4KXYA 5FORA 1FFWA 5I4KA 3WRVA 1HEUA 2YH2A 1D1QA 1SB8A 3T38A 2BMWA 1M5RA 3V2GA 3IXLA 5BV1A 3E22B 2VQ6A 4HUQB 3U7QA 5CYGA 4UQOA 5K3DA 2P77A 4XIJA 2D1RA 3H6GA 2AN1A 3GFGA 5A1JA 1A2KC 1M2OB 1PR1A 1SHLA 4UHEA 2C2OA 4QHSA 2WTBA 4BMSA 2QLLA 4LECA 3V8RA 1M2KA 2QJOA 5E4JA 4DMMA 1E77A 3H2IA 4EF4A 4UEQA 3P2YA 2JIZA 3O3OB 4MWSA 3F9IA 5A9TA 4NOLA 5ANRB 4UOEA 2JJYA 3L18A 4CLOB 4YT4A 5IMBA 4IHJF 3BMNB 2R7KA 4BCCA 1ZVMA 3EXG2 4WEQA 4WUTA 3ZY2A 3R20A 2CK3D 3N8DA 1A8PA 4N0EA 3ZTYA 1CWUA 1TIKA 2P6NA 3NHYA 4RYDA 2G1AA 3F7OA 2BAGA 2AFHE 5JHGB 1ZXXA 2VAVA 1W6RA 4NV1A 1D7AA 1Y42X 2FFQA 2Q3LA 1T34A 1CD5A 4R6XA 4ZPJA 5KHLB 1EK1A 3BKXA 3LT1A 1K8YB 4G24A 3L8HA 4B44A 2O3SA 4D2IA 3WMFA 2H57A 1XA4A 1VIMA 2BISA 3MT9A 4EHBA 1O95A 4LDQA 5ALXA 2FAXA 3E9QA 1D0VA 2CLHB 2B34A 3VPFA 1FQWA 1ZONA 5U4XA 3KPYA 3RVOA 1MTZA 3AR8A 3IEUA 2X0IA 5KMGB 3CPJB 3HVUA 1VE7A 4BZXA 4D25A 5KX5A 4ZV4A 3R3WA 3HFRA 3PDWA 1OX5A 1A27A 1JJVA 3M70A 1M2VB 5D1HA 5D5QA 1NVAA 5T3YA 3RH0A 4BRZA 1GY8A 1ZA2A 3SG0A 1E6CA 2Z30A 4X8HA 5BNWA 4X44A 2IS2A 4CHGA 1Q1GA 4UU8A 4QBGB 4EAAA 1NN0A 4I14A 2GPTA 3H83A 5JAPA 4EP1A 1FRVA 4C0BA 1UM8A 4GOLD 3TLEA 4KPGA 4Z9AA 4KUEA 1WV1A 4AL4A 1H85A 1UZUA 1AKQA 1IG0A 2CGEA 2GRJA 2Q0SA 3OC6A 3KR1A 3N8GA 1OBVA 3O7WA 4RHTA 4FS8A 3RAGA 4UOQA 5MN5A 1T0UA 4FOOA 5BV2P 4GSYA 5JI2E 1I4DD 1L4MA 5EJGA 5T4EA 1SIBE 2IEDA 1QRTA 2C42A 1R5OA 1K4YA 4MOWA 1KWKA 3SICE 4DSNA 1Y7HA 1ZBDA 3I5YA 5GTDA 4CN9A 3FWYA 4FNAA 4PZ0A 1GZHB 1UR5A 4ND7A 3TLMA 5BW6B 2EZTA 4Q15A 3HSKA 4GOKA 1Y6FA 1Z5PA 3VX4A 2CSUA 3O8RA 4DA6A 4RMGA 3GJXC 2P1ZA 2VK1A 3KETA 1N9ZA 3D6NB 3HB9A 4FR2A 1EFRD 3B5IA 4TVOA 1WABA 3INRA 2QRHA 3TSZA 3BJMA 1DKLA 3S1AA 3OCVA 3ZD8A 2C03A 3FOAA 4Y7CA 3QPUA 1NMQA 3SYMA 1PEAA 1IULA 2IU3A 1OKKA 4M88A 3DZHA 1P6QA 1F0NA 1KDOA 1YJ8A 3MHPA 1KEPA 4FBLA 2O1EA 4PO8A 5DTEA 1EP1B 2AVDA 3GB9A 1UEIA 3K92A 3SMQA 2HWKA 3F0TA 1NUQA 1QTNA 2WJIA 1B16A 4P32A 4Z86A 1X92A 2QRVB 1ORIA 4MWBA 1H1LA 4DVJA 2XXAB 4U3JB 4G09A 4V1CB 1TNDA 3M9LA 1YE3A 4HUJA 1JTEA 4JB3A 4RSRA 1H5NA 2WILA 4WERA 3TLAA 1SPXA 3KSBC 2WJWA 1Z7GA 1W2WB 2GJ8A 4O2AB 5JS2A 3ETGA 4NHOA 2JZNA 2VPWA 1KFEB 1TPZA 3NBFA 4EZBA 1LDNA 3A1FA 1M73E 1Q7EA 5T41A 3ZE6A 1CS0B 4AYTA 2C07A 3L0IB 2AUMA 3ELYA 2O57A 4AY5A 4DRZA 3RSHA 1L4FA 5IDWA 4L16A 4ZT5A 5DDIP 1JR3A 4LYJA 4XQ0A 3VSEA 4DCOA 2HIHA 5LMUB 4UPDA 3JZAA 1P7CA 1M1YA 1TUBB 2FYTA 3LK6A 3DZCA 3LY9A 3OX2A 4HB3A 1L8LA 2FPWA 2QW1A 4U2GA 2GFIA 4OYHA 5JISA 1VE1A 1FDTA 4GC5A 2C31A 5KTNA 1RCFA 1TL7C 2J3LA 2OMKA 1FS5A 2V7EA 3LY7A 4UE3S 3UA4A 3VU3A 4YRLA 3B1VA 1P4JA 3PC7A 5BV0A 1U8XX 1W6UA 2OHFA 4OGWA 3T94A 1UZNA 4O1MA 4TS4A 2FWJA 5DWQA 4F46A 2XA1A 3H1GA 2CCGA 4LE0A 2HREA 3KV3O 1CXZA 2D5AA 2Q3CA 3Q87B 4QQKA 2FQ1A 3PQDA 4UUQA 3D8BA 4C05A 3NOXA 1SKMA 2HHCA 1NNLA 1ORWA 1SIOA 5D5HA 3R3UA 5MF6A 3VNUA 2AZTA 4P3KA 3EVCA 2AXEA 2FR8C 4Y8VA 4Z99A 1Z2PX 2JLCA 1W4ZA 2EQBA 3WWZA 3IKTA 1CK4A 3I1FA 4J49A 1UBGA 1YDHA 2P2LA 4LOAA 2QI9F 1DBVO 1T0PA 2PVSA 2YMPA 1VG9B 2WFZA 4Q9JA 3SBXA 4BP9A 4UNRA 3SVTA 3COJA 5A9SA 1TW2A 1U2EA 4EBBA 4C20A 2I03A 1QF7A 1NQOA 1T43A 4LHWA 2AOWA 1QQ6A 3GUCA 4HV4A 1Z5UA 1WP9A 1YZQA 2VJNA 4K8OA 1FJGB 1XKXA 2GI4A 5KYGA 4D42A 2GO7A 1JT2A 4EHKA 5FPQA 1K9VF 3DVQX 3ETHA 1W1IA 2MU1A 3NHFA 1YNOA 2JJ1D 2QNRA 3LK7A 3OEYA 1NDUA 1F06A 3JQAD 3FETA 4UHHA 5IFKA 3DM9B 4D4IA 1E7SA 1KDVA 3WY9A 1YDMA 5J1SB 3BD8A 4KI7A 4X7BA 5E4YA 1L0BA 3GNSA 4BO9A 1U3VA 5AVZA 1YCDA 3C7TA 3FFWA 5JCPA 2CF6A 2VSFA 4IBOA 2CV2A 5GQSA 4BMDA 3T9FA 4FGSA 2ZTHA 3S1LA 2Q6OA 5BOVA 4G5GA 1H2FA 1I24A 1W75A 2IEAA 4YS6A 3RJ5A 3PA8A 5FPHA 3T3EA 3WTCA 1XHFA 2GBPA 3E15A 4RTNA 1B1CA 1C9JA 1P7YA 1SUCA 2Q3BA 2ZVJA 3R40A 3TGLA 3PHLA 3JWIA 2PWBA 1H2HA 2C83A 1AM4D 3OCWA 5AVKA 3ZS9A 3VYTB 2Y1GA 3T3GA 2F55A 1CG6A 2H5IA 2HD4A 4PAMA 3WRXA 2PZMA 2JFUA 3FR7A 2VP5A 1QFZA 1NI4B 5AJZA 4D92A 5ITWA 1OREA 3DA8A 2OBBA 2BV3A 3NOQA 3LO5A 5CITA 5JV5A 3TL2A 2RHGB 4QJ5A 5DGHA 3E3OA 2HGZA 4OH7A 1T3SA 1ZHHA 2CDAA 2O2GA 3DE3X 5FI1B 1O3YA 3K15A 1PF7E 1HF3A 2O5VA 2ONZA 3BE8A 2O5CA 3I5AA 5CFZA 1XTUA 3H2YA 4GP9A 2QN6A 5AVWA 4C2BA 5K0CA 1S02A 1UKCA 2JARA 3DT9A 3I8OA 1ZM3A 1UBTS 1ZG3A 4DS3A 2I6XA 4EL5A 4QPCA 3ZD9A 5LQAA 1Z74A 1WIWA 2C7BA 4R51A 1XLUA 4W7SA 4C0JA 2RE8A 4M0FA 1K7CA 3SKVA 1XWFA 4YHBA 1SQ5A 2AC2A 2JHCA 3H8WA 5GVRA 4EZIA 4ZRMA 1SOWA 1W29A 3ZJUA 1CHNA 2OCDA 2ZZKA 3BWBA 5D87A 2Q50A 5FV7A 4BMXA 2A5GA 4O4IB 3OIUA 3LWZA 3T5CA 1NASA 2GR9A 4G4SO 5T8KC 3U81A 1T2NA 2NZVG 4GQAA 4WK6A 3ZY3A 4F3CA 1U63A 1EDEA 1UT8A 2I55A 1DZIA 4AZ3A 3I37X 5C5CA 1F38A 4HZGA 3TTUA 3H4TA 4MWDA 3IVMA 4R9NA 3CLRC 5ALQA 2W70A 4TL6A 2Y6VA 5DSZA 3UHAA 4GFDA 3BZWA 5B4VA 2W2KB 5I7OA 1KVQA 3I9NA 4A2WA 3P9KA 4CKZA 3NW9A 2R6FA 1DIOB 1RR6A 1FC0A 1JIVA 1UDRA 1HC7A 3CBQA 3MOIA 4LRQA 3RIYA 1B8PA 2WU4A 1F4PA 5FQOA 4E88A 1EDBA 2WTXA 1C7FA 4AG3A 1IM8A 1EVJA 3IYLW 2QRGA 4JX8A 1X1RA 2O5RA 4U7GA 3HG7A 1I4WA 1VPVA 4I55A 1OAOC 4JQCA 5CVEA 3TBKA 1Z0FA 5DBOA 3RSQA 5KC9A 3QU7A 3UB3A 3T1NA 2DBZA 2B61A 2VDNB 1Y7IA 2GGSA 2VXBA 5BSGA 4REOA 4BVBA 5HJ7A 4BXOB 4PTLA 5JBNA 4GSLA 1ZD5A 3OQHA 4YTEA 1A8QA 4I1UA 3EXHC 4Z51A 4KN5A 2OXRA 4YVFA 2ORYA 3KJFA 3I61A 3A9RA 1PGJA 1Z8DA 2ABWA 3AIIA 3GU3A 4HPJB 1V47A 4UU7A 3IP6A 4KIJA 1GKUB 1KORA 2P5YA 4QYIA 1BFKA 2ISCA 4AS1A 2V58A 1THGA 3CZPA 3QNWA 4L57A 3SPXA 3OIFA 1YBMA 4PG4A 2QAGB 4LVNA 3EZ6A 2JGFA 3PXAA 4D80A 1XTBA 4EG6A 5CDUA 4MS3A 3ROPA 1ZS9A 1GSHA 3FVVA 1L4HA 3D5EA 1C0LA 3UAZA 3D6JA 2AW5A 4HZIA 3IPLA 4MMYB 5TF0A 2VUHB 2CBGA 3S44A 2E89A 3FN4A 3OCZA 4OI2A 4U7FA 1XCJA 1K7FB 3GFPA 2Q2NA 3WIUA 1YRWA 4MNTA 4KN8A 3FIUA 3NX4A 5LU9A 1XQ6A 1U80A 2XLCA 4HNHA 4MLDA 4DPMA 1XZIA 2QLTA 5G1PA 4RK0A 1Z6YA 4IXMA 1VL1A 2C2MA 1HQKA 1YQGA 4LDAA 4OQQA 3E0QA 2ZCJA 1RI4A 1GZUA 2ZQZA 1A2QA 2VUSA 4JYBA 4PCAA 4B82A 7MDHA 2I2WA 3UJ3X 1H3NA 2VZ9A 4B31A 1XCLA 3UN1A 4HDAA 4M98A 1D6JA 4PZAA 1KQGA 4ZOCA 3SC4A 5HBGA 1IEVA 3VI4B 3I76A 3R9KA 3AONB 4H7HA 2VTDA 3U13A 4K03A 4D3SA 3AERA 3VDQA 2PXHA 2Z9CA 3LBHA 5JCOC 3PFGA 2JFYA 3AZQA 2WJ3A 4LSWA 4UEJA 2HDNB 2IOHA 4QWMA 4QGBA 3T9DA 1V5EA 2OBXA 3P0JA 1YJQA 4PSVA 4GYKA 1K8ZB 1LLUA 3L7KA 3ICEA 4WNAB 3DZGA 1F3OA 1X1TA 2BFOA 2WJHA 1N8NA 1DHTA 1UMCB 1G8AA 1M8JA 3IA7A 4L02A 4NE2A 1LW7A 1YDEA 4UXHA 2VZEA 2FEAA 3NO4A 3DEJA 4G0OA 4D41A 2VP3A 1UIRA 3D6AA 1H69A 4YAGA 5DB4A 3Q0IA 4CDNA 2G9UA 2WNIA 1J09A 3HN2A 1GU7A 4HYTA 2OBFA 3SIXA 1ZM9A 4E4TA 4GRDA 3FAKA 3SS7X 4UM5A 4PRLA 1HNNA 1R0LA 3P5SA 3PR3A 4U6SA 4D4GA 3I5MA 4JL5A 3TOVA 5G2OA 3LP5A 4NQRA 3TTYA 2HTFA 3WGUA 2Y68A 3IDAA 2PMCA 4U2FA 4X8LA 1A50B 5DH9A 1FFXB 1K6JA 1P0FA 2G77B 3FUTA 4KBGA 2HQOA 2NSHA 4HJRA 1Q95A 1UXGA 3DP7A 3MS2A 9ABPA 3L4BC 4Z54A 1NSYA 2YX1A 4UZSA 4DC0A 5HS4A 3VAZA 1VDZA 3NVDA 2RGUA 2ZDQA 4ILEA 1FTNA 3KKLA 3VO2A 1K2WA 2RB4A 4LYEA 4EGCB 1QNFA 1EUCA 2NXNA 3T34A 2OBLA 4CUKA 2PUFA 2CHFA 5DEIA 1KNQA 5HUQA 3IT0A 2QV0A 5DZSA 4FYMA 4UEKA 3T7DA 5CDFA 4WKGA 1JHRA 1H42A 2AK3A 2OTCA 4W5JA 2DQSA 1GEEA 4YMIA 5G0SA 3SE0A 3W4IA 5LR6A 1M34E 2G07A 1WMFA 3V32A 2NLOA 4JBYA 1ZIOA 3NGXA 2RGAA 4KREA 2C7GA 3BXEA 5KQPA 4Q4LA 4BTEA 1KR5A 2G88A 3CKKA 4LMPA 5DW3A 4EVQA 1BQEA 1UWVA 4DMRA 1T5HX 1GHTA 2E4XA 2YVQA 3QG1A 2NO0A 3FOZA 2I22A 3LL7A 4BB0A 4MKIA 4PAGA 5HCUA 5IN5A 4D9NA 4L0MA 4OQNA 1I80A 2RGWA 3LUJA 4ZARA 3VZCA 1V11A 4FJ1A 3ZY5A 3EIEA 4W5TA 4M4SA 3IR7A 3IUYA 4BZWA 3WHKA 2ZS7A 5ESRA 3FXAA 4FOSA 4LJYA 1AKMA 3QW2A 4YRBA 3UWOA 3M1LA 2R6ZA 3CZ4A 1UK6A 5FFFA 2C5SA 3NAQA 3BGSA 1Z68A 4IO0A 3DWFA 4G3XA 1SKBA 2ZXFA 4MUFA 4DLSA 4R7ZA 1RM4A 1Q2UA 2A7QA 1P7PA 1Q44A 3OA0A 3PDHA 4YEDA 5HKBA 3H87A 1PK9A 1Y33E 3C70A 3NQ41 3UO8B 1QM5A 3O91A 3RIMA 3WGKA 3G2NA 1YJXA 3FYUC 1XMVA 2PXAA 3VTAA 5K03A 4KR7A 4XOIA 4IUDS 4ETIA 3WKBA 2WZCA 1XG5A 3A28A 3ONDA 2Z8ZA 1E63A 1P0IA 5SYAA 3ZIUA 1DBQA 3HRHA 1MZVA 1ULSA 2HZ7A 2PGJA 1EM8B 6Q21A 3GCGA 2ZI5A 3L9XA 5F52A 2PGXA 3UFXB 4C6RA 3LSTA 1DEAA 4ND8B 5TF4A 5EHXA 1TTTA 1QFSA 1VL8A 4KNWA 2C8KA 2IXAA 1RJ9A 3OO1A 3TMYA 2YN2A 1R1DA 4B2YA 3EVNA 1JH8A 4UHFA 2FKNA 4MO9A 3M6AA 3QPDA 1DG1G 2XYPA 3KIPA 4KGVA 2WFMA 3E2PA 3IBFA 3QLTA 4OD0A 1GPDG 2N42A 5B3KA 1V7CA 1ZD9A 2WI8A 3QMVA 4EO4A 1PFUA 1AV7A 3HYTA 3TVTA 4KOAA 1JLMA 4MCHA 2OV6A 3R9IA 1ZY2A 1R9MA 2ZPAA 3QYJA 3THXA 1KP2A 2H0QA 1G6HA 1PSDA 1ZD1A 2XUHA 3D7RA 1S3GA 4IGIA 4WBNA 3T1HB 3C43A 3ZDBA 4KGZA 4CR6A 3HS3A 1QDLB 1LTKA 1OTXA 2UVPB 1R4MA 4AZTA 3LQYA 4AZ0B 1VBMA 1USUA 5DM1A 2B4AA 2PL3A 3LHKA 5K6RA 4F6RB 2CDNA 1UQTA 2WHEA 3D6MA 3RF6A 5MGBA 1A82A 1ZD3A 2ZWAA 2AN3A 2C4TA 1XZLA 1KMQA 1A1SA 2H65A 3I28A 3KSMA 4NENB 4KXFB 1VMKA 3ZE0B 1WF6A 2JBAB 1VI6A 4RVUA 5ICFA 2ZRCA 3HEBA 4P86A 1T1JA 3OZDA 3Q3CA 3PB3A 4FIZA 1EUZA 2H18A 2ZM5A 2AJTA 2AUNA 4KQIA 1N1MA 1X1AA 1Y1KE 4KSYA 1EGQA 1WF3A 1XRRA 3GOHA 8MHTA 2PV7A 5JO0A 4JJGA 2PX5A 1NF8A 2DOKA 2XADA 1CR4A 2Z98A 2W6JD 3AO0B 4QPJC 2FDCA 2OCYC 2OCGA 2YC2C 3GL9A 5E0OA 3Q9LA 3W90A 3CCFA 1L4EA 4A1FA 1YZNA 5HKAA 3TFOA 3ON5A 3ND5A 4JA0A 4K9RA 4AXXA 2F43B 5I3ZA 1CUEA 4ZTBA 1N6OA 4HT3B 1REQB 2I71A 4WN3A 4HMQA 3ZWXA 1W93A 4UZEA 1YR8A 4R7TA 4KR9A 9LDTA 3F90A 5LFAA 4F8YA 3K1AB 4LVOA 5HF9A 5KDLA 5TPWA 3SKXA 4Y6GB 4CG2A 3HDTA 4ZGBA 5M5BA 1PDVA 1O95C 2HU7A 2EU8A 4TLBA 4A0SA 4RF5A 1Z2NX 1CEXA 1RM5A 3A8TA 3FBGA 4X63A 3HDQA 1JG3A 3Q3EA 1QBKC 4LY9A 3ZWWA 1PG2A 3B7GA 5L3SA 2ZJZA 4NZNA 3VNBA 1RT9A 3AFGA 3MAGA 4EI9A 3V7FA 5EXXA 3SZ3A 1T13A 4FDUA 3M82A 3ZQ6A 2O2JA 4WZBA 2GAAA 1ATZA 2FG7C 4WFKA 1IHUA 4ALJA 5AK6A 3R3SA 3UGJA 1UDWA 2Q5OA 5T4FA 2NSDA 1Z2OX 3I73A 3RANA 4KJZA 3G5UA 3QXGA 4HB0A 2XNSA 4LOIA 4E1AA 4DY6A 3P32A 2WSBA 3FUVA 4JJ7A 4UHKA 4ZT6A 2VH2A 2BZGA 2R97A 3EPKA 4NV3A 1IWPB 2JAQA 2O8DB 5EPOA 1CIVA 2QL9A 2O05A 5HXAA 4IP0A 4EKGA 1ORRA 4HPXB 3KTDA 2YJ3A 2JFOA 2VUUA 5KYWB 4C2TA 3AVYA 3GG2A 4PSDA 1J5PA 5BQ5A 3TEJA 1FP7A 2VPZA 2C5AA 2QX8A 1J9ZA 1R5BA 2W48A 2KB0A 2IEZA 5LZ5A 2IZ1A 3TRDA 3WL3A 1P8JA 3D2CA 4UVEA 1HYHA 1L5FA 3PWSA 3W8RA 3MVEA 3I4FA 3IAFA 2P11A 4DUYB 1QC5B 4DREA 5ITVA 1UK8A 2O20A 1FMLA 2BTQA 2C1EA 4K5QA 2L19A 4L9AA 2WJPA 1XALA 4C4SA 4DF3A 2BFCA 3AU8A 3VMFA 4CQNA 1QYWA 4L15A 2ZYIA 3RS2A 4LXTA 4IMRA 2ZBGA 2CZQA 2NU9B 3TR5A 4BU1A 4YGYA 2FZKA 5DASA 2GO1A 4KN6A 1MT3A 3AEXA 1LEHA 1QHFA 1QK4A 5KQSA 4MJ3A 4NJOA 2HT1A 1DJQA 4NONA 3KEGA 3UOAB 4XYLA 2IPOA 2C78A 2CE7A 3I04A 3ONNA 4KVGA 4QLAA 2JVIA 2ZUSA 1Q7GA 2OQRA 4IHJA 4DLTA 3TX6A 4S04A 3IUBA 2V0GA 3D3JA 4WI1A 3EA0A 2BH2A 4IZHA 4M7OA 2XEDA 4PVDA 3AFOA 4YRQA 4AROA 3VSBA 3D59A 1USGA 2P40A 5LP6C 2FU5C 1UOPA 1ZRHA 3CWCA 3HLTA 3QH4A 3WGOA 4DJEC 5BPFA 3U49A 3V55A 1KOJA 1TYZA 2C5EA 3K0FB 5K8UA 1AHIA 5LYJB 1ECJA 1DAGA 5BR4A 2DMRA 3UJ8A 2MSLA 3YASA 1WXXA 2X0DA 2ZBFA 1T8RA 3CRQA 3NYQA 5I9SA 3UWPA 2H2DA 4B34A 3OO0A 2V7VA 2UDPA 3EMBA 3AL2A 3MS7A 1T1GA 5F3WB 3ZWBA 5KVVA 3ZWOA 5D86A 5HFNA 4RY0A 5TJHA 2H52A 4B3GA 2FX2A 1NXWA 3UIEA 4XWKA 1MRNA 2XPCA 3C41J 1AHPA 1ITZA 4IUYA 3U3RA 5KBYA 4U7TB 1G4UR 3DE2X 4DIOA 5JTUA 2JCGA 2WQ6A 1U8YA 1DBRA 2N47A 1KEWA 3ND7A 3GUUA 3WGIA 3UVEA 1GTVA 2C94A 4JVLA 4JI8B 1WZEA 5KHOC 1MFPA 3C87A 1VLZA 1ZI9A 1YVUA 4BN5A 4C3OB 4IJ5A 2CUKA 1T1EA 2HJGA 3IHTA 5TR9A 2E21A 2R7MA 3FNQA 1RKQA 1AHHA 3EQ2A 4NBTA 1U8ZA 3HR4A 1N6NA 3NTRA 2GM9A 1T0BA 4Y67A 4FPXA 4R3UC 1B6RA 1ZU5A 4BN4A 1B8VA 3UXMA 5KOIA 2XUAA 3JATA 2B82A 4MCIA 3IEXA 4R5MA 1Q0QA 3SJZA 1FTYA 3AEUA 5EZ5A 1EE2A 3SYNA 3WI7A 1GTSA 3TZEA 5BV8A 3TVDA 1L5QA 1XCPA 2ZAMA 5FIUA 2RI0A 2ALJA 4Z1OA 2RH4A 5K3FA 2BLLA 2WNSA 4GZ3A 2J7PD 1G16A 4AWAA 2VR1A 3EDCA 4TTPA 3D5TA 2Q6TA 2ICAA 5KJ6A 1XZEA 4BDTA 2O8EB 5KTRA 5H9WA 3PNVA 1T9AA 2CVOA 3ONEA 4YJ2B 3UF0A 5EHNA 5C7IO 3QMPA 4GPEA 4AUNA 3W5JA 4I8IA 2B4QA 3PYMA 2VBCA 3CW9A 4F3KA 1DPFA 5AXCA 4B3RB 4QUBA 1Q6YA 3AJ9A 3DLIA 3AOGA 3O4HA 3OM0A 3STVA 1E8MA 4G84A 2CXTA 2VK4A 1WCV1 4DR6B 3KZMA 5HMLA 1RZRD 4URZR 3S3TA 1KDPA 3JRWA 2C2BA 3HO6A 1BXRA 3NANA 5ECDA 1RQXA 5C0OE 1SVNA 1ZJ5A 2YXNA 4NQZA 4R40A 5E3IA 3SMVA 3T35A 1CE8B 5JD5A 4NOMA 4GZLA 3OZEA 4AKHA 2Y9PB 4MA0A 4R31A 1Q1BA 1KEEA 3OQNA 3KE8A 1K8RA 3OSUA 5JJCA 2QVGA 2XVXA 5KKCA 2F9MA 1NYQA 3CU5A 1C4WA 4KP7A 1NYRA 3E58A 3NATA 3ULKA 3V1MA 3AF2A 2ID8A 5FPKA 3TLZA 2IUUA 4UCWA 3D8RA 3EJ6A 4C04A 4ZEWA 2FVXA 3IUEA 1NY5A 2WF7A 3UKOA 2Z8XA 2PNFA 1B6GA 1DBIA 1K98A 2OK7A 3O8QA 2XXBA 1GZ4A 2X4DA 3PD7A 2VC2B 1U2RA 3OKAA 4P5EA 3AWIA 3VV2A 5MDHA 1PQPA 1OH8A 3FCUB 2Q1WA 1EKXA 3AUXA 2G6BA 3DEYX 1FFCA 1UDBA 3EQ7A 3GCWA 3GRZA 1EVQA 4YRZA 1SEVA 1UWCA 4G1BA 5K0EA 2FZVA 5F78A 4B4UA 4MRAA 4ZGWA 3TSYA 1ZWLA 4RK7A 1SFRA 1PD0A 3KZCA 1LDGA 4HAUA 1XEXA 3K6SA 2BIFA 3GPBA 3U5ZB 1U8UA 1ZXBA 3QPCA 1UJ6A 4D3ZA 4HGYA 3AJRA 3B6IA 4M9RA 2ZJYA 1PGPA 2VP0A 3HGTA 3IBSA 4H16A 4TMVA 3Q6NA 4OK5A 4LCEA 4RGVA 3LDHA 5F23A 4YJDA 4RKQA 3HV0A 5J1TB 3P0IA 3O82A 3S2EA 2H5EA 3CRZA 4YJFA 3VHQA 1YONA 4MICA 1D2MA 4BTLA 3DOUA 2R6DA 1QNLA 2ZIAA 3ND9A 4MP6A 4AMUA 4Q3CA 4WKOA 4ZYTA 1GPBA 1AS2A 1DKMA 3C1UA 2KYRA 3SZMA 2PX8A 4NMWA 1XTKA 2B1QA 3C98A 4CI9A 3HVRA 4J2OA 2HYDA 2OV1A 3VU1A 1E2PA 3P0EA 3VZPA 4AJ9A 4EGJA 2OK8A 4JQOA 4IVQA 4X90A 5BO5A 3DKVA 2ZR7A 3V33A 5AIBA 1KETA 3CURA 2JLSA 3OE7D 4KYVA 3TPZA 2XB6A 3FYCA 5HK8A 3EA5A 3VXKA 1Y82A 1E0JA 1U94A 2WU8A 2ZUTA 3OP4A 4JGIA 1HR0B 2W0SA 3MTEA 3ZE7A 2HJRA 1MIOB 1F9EA 2ZPTX 3EOAI 3I9V6 4Q93A 4EEXA 4QOHA 4D8UA 4ZC1A 5TY0A 2J9GA 1V39A 2QX7A 3L8EA 1PEDA 2O3JA 2C2ZA 2ETVA 1GPNA 3ENZA 2A14A 1JTFA 5CLJA 1KFKB 4IZ6A 4BTVA 2O8CB 4JYCA 3NHAA 3K1ZA 3WQRA 5JI3E 3E7DA 1DOZA 2HRCA 4FHCA 4DSOA 1UF9A 3JQ8A 4OP3A 1XSEA 3ZHBA 2BFDA 5BUQA 5CH3A 1Q50A 2NZUG 2XYHA 1T26A 1T8UA 1OCEA 3DBLA 5LM3A 3GQBA 1ZIDA 4S1PA 3COWA 1DTSA 1XCOA 1FSSA 5DIFA 1SXQA 2V0CA 5AVRA 1OROA 3KPVA 4UVIA 1RM3A 1HK7A 1YULA 4DCSA 2ZUFA 3ZQJA 3PC8C 3RFXA 1J20A 2MCFA 1WUJS 3Q6MA 4MRRA 1OASA 5K7SA 3G7NA 4LZJA 3SX4A 4C87A 2JLZA 4ZWNA 2PUCA 2DUUA 4MWOA 5LZ8A 3THYA 3UUWA 5EIEA 2Q45A 4ZI2A 4ZU3A 3KJNA 2YCBA 3OIGA 4ZVNA 2RARA 2X5OA 3CF6R 1ODLA 1DQYA 5FLYA 4EITA 3JAWA 4EHFA 6REQA 3TQRA 3JQ6A 1OZGA 1U02A 3BX1A 4JOCA 2A86A 5K2MA 4ARZB 1JB1A 5H4GA 4N7MA 3OCCA 1AG9A 5DE3A 1GO2A 4JV5B 2DH6A 1ZISA 3HUEA 4YK7A 2ATIA 3LXXA 3SEFA 3L2OB 1ESZA 1MX9A 1B2RA 4E5NA 5HNKA 3TIVA 3OEWA 1EQUA 3BRWA 2FE1A 3JV7A 4JBWA 4X41A 1LDYA 1CYDA 3EG9A 1YR3A 3E27A 3SIWA 3V1LA 3NWJA 4DXDA 4B6EA 1EU1A 4MI3A 3N6RA 2PO5A 1NZFA 3OE5A 3O9MA 5CB6A 5AUNB 3NJ4A 2Q6VA 2C2YA 3FUXA 1K3FA 2BUAA 3IHLA 4OQXA 4QU5A 2NZ2A 4HR7A 3V4LA 1QR6A 4URFA 5JD4A 5KSZA 4KNYA 4YLEA 3IDZA 1BHO1 1KVSA 4TT8A 2ODTX 3FGZA 4MINA 1C50A 4C0HA 5C8ZA 2GARA 1DJLA 1JAHA 2JJ2A 4P80A 5CBKA 3BFXA 1F60A 4MRSA 5DLPA 3CB4A 3MINA 2JAWA 3ZQKA 2PEYA 2AVNA 1TIBA 2ZRAA 5GOZA 2AFIB 1CHDA 1ORVA 1E61A 1T8YA 2VF4X 1F1BA 3CUTA 4HN9A 1SXGA 4OLAA 1N9GB 3HDJA 5PGMA 3E1GA 1G64A 1QV7A 4F04A 1G9SA 3WO0A 3PEYA 4RABA 3IAEA 1YUMA 1ZNQO 3RUAA 2GXUA 3G1TA 4IMJB 4XIIA 1UPAA 4MA5A 3X1MA 1GPYA 2JGMA 2PUJA 2WF8A 2Z4SA 1QS0B 4DDUA 1G66A 4NBUA 1I30A 3CISA 3GLHE 4H0NA 2AC4A 4D26A 3GLGA 3ZCPA 4MRNA 5KWEA 4LRWA 5JAZA 1QE3A 1M0WA 2XE6A 2PUHA 2XD4A 3N0XA 4XR4A 2A5DA 1KDTA 1P0PA 2JIBA 4OGLA 1E1KA 1C1DA 2V1XA 4Z1MA 2ON6A 4K6GA 1FJ2A 1ZWKA 1PT8A 4DV6B 4PHGA 3BH0A 2KS6A 4E09A 5CX4A 2HADA 3H0CA 1J8YF 3QVGB 4K9QA 5FBZA 5H02A 4CLXA 5LVAA 3F73A 1E1CA 2W98A 4YDHB 4X3OA 1KPIA 2XGMA 4G6ZA 5GONF 3WQHA 4HRVA 5UKDA 1AGNA 1F14A 2B1RA 3HUUA 4A26A 4KQFA 2F1JA 1D8TA 2VCHA 3HA2A 2GWRA 4PSUA 2XRMA 5K0SA 4OX9B 1N57A 1PL6A 3I2KA 2R8ZA 4PLHA 1XZKA 5T57A 3KJHA 5K6TA 3RUFA 1FP4B 4IG9A 2UZ0A 3S2IA 1X80B 4Z0PA 1P60A 4FI3C 4P54A 4N3NA 1IPEA 1QK5A 4TQUS 1LBHA 2K6GA 1JJ7A 4L8WB 1W9MA 5LOVB 1IVYA 1JYEA 2FPPB 3OOYA 1XF9A 1UPCA 3SQDA 4DUZB 4EY4A 2WG0A 3BJZA 3UPDA 1Z82A 3ADKA 1R6UA 3S5UA 2HMYB 1X7ZB 4GMXA 3V4OA 1UMKA 1LI7A 3F8TA 5ITZA 4NH4A 3FVRA 3U9SA 2PPVA 2P2CA 1GCIA 3PEVA 2ZIUB 4H7KA 3WRYA 4CNBA 1YZ3A 2WB4A 1T9CA 4Q4AB 5CT9A 1N2CE 1QTIA 3BWYA 3TBFA 4XD2A 3WL5A 1Y9JA 4AF7A 3QWHA 3LZCA 1EVZA 1CNMA 2VDOB 3ETCA 3NWPA 3KSDO 4KBYA 2Y0BA 1DAMA 2RBKA 2AYYA 1QO9A 3REQA 5AJHA 3KXIA 1SCBA 3E9EA 2V8BA 2WUVA 3WV5A 1RYEA 2ZXUA 4OB8A 3BTUA 4MV1A 2OVBA 1DKPA 4REQB 4UM9D 2B4TO 5FEMA 4ZMRA 1AV6A 1FW8A 1KI9A 3CUSA 1N6LA 2F2TA 4MVWA 1XPOA 3JTMA 5E7QA 2JL1A 5TEVA 2IEIA 4MV5A 1AQ6A 3WL4A 4DXHA 2X8LA 5LQDA 3WGQA 1KDRA 3IEIA 1BYUA 4M0LA 1BU5A 3BVPA 3CEHA 3MWGA 1QGUB 3OFKA 4I9UA 5ALIA 3T7RA 1CEYA 2OG1A 3OSZA 4HQRA 4LTDA 5EIOA 3E5MA 2DJ5A 3N8IA 2BSXA 5J5AA 3OZIA 3PI6A 5CXSA 1LC0A 1W88B 1YR9A 5EYPA 2IP2A 3QXHA 2HBRA 3H4VA 4NYMQ 4TXNA 2ATVA 4W1SA 5J2TF 1ZHOA 4FGUA 2H1LA 4ZANA 5BSHA 1F8FA 3T1VA 6ADHA 1KKLA 2PX4A 3FSGA 5FLEX 2V7BA 1J90A 4LY3A 2N9UA 3HEAA 3OPMA 4Y2QA 3WLEA 5H8WA 1KFCB 4R1UA 2R7LA 2ZYRA 1FZTA 1W9HA 4TSKA 4YJGA 1W73A 2QYOA 2Z3VA 4KQ2A 4M1EA 2M2IA 5EFOA 1CZKA 3FDIA 5F1YA 3O4GA 2ZM6B 1DI0A 4EJMA 4LNUB 4QRIA 1G20A 3U60B 1QDEA 4JLMA 2HRQA 3QNMA 1M0SA 4DSUA 4EG8A 1HZZA 3FWHA 4DLPA 1ZRSA 3FHJA 1OBOA 5DM70 3ZDCA 2AHRA 4JJ4A 4U7HA 3GP8A 4A0QA 1F5NA 1KYQA 1R8YA 1YXMA 2P9BA 2PBRA 2YFHA 4G0YA 3O84A 1H66A