4XYLA

Ca. korarchaeum cryptofilum acd1 in complex with coenzyme a
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
463
structure length
463
Chain Sequence
b'NDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 168
structure length 463
sequence length 463
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xylA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xylA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xylA01
2DT5A 3RU7A 4XZ3A 2SCUA 2H63A 1FDSA 4QECA 1GUZA 1U7TA 1ZKMA 5KKAA 1A27A 2VZ9A 3ZNPA 1B8VA 1MGOA 2VUUA 1ENYA 4RF5A 1DPGA 2VYVA 3RD5A 4IDFA 3MWEB 3FBGA 4KZPA 4A5OA 1NVGA 1ZEJA 3DBRA 4TVBA 1WMBA 2DQ4A 4XB1A 1DFGA 4LN1A 3ZU5A 3PWKA 4QO7A 3RFVA 1J0XO 4IY1A 4GI2A 5MDHA 1Y8QA 1E7SA 1HE2A 3U49A 1C3VA 1E3JA 1PS8A 3OBBA 4YQZA 4DPKA 1NQTA 2Q4EA 4RF4A 4CM4A 2XXBA 3GVIA 3JQGB 3MJTA 4RVUA 3H5RA 4AFNA 2QX7A 3L9XA 1JLLA 1LDEA 4ZU3A 5T64A 3TN7A 1NPTO 2P5UA 1JA9A 1YBVA 4B4OA 3TL2A 4M87A 2JCVA 3RAJA 2NV6A 4CV1A 4BO8A 2GERA 3OSUA 4WE3A 2Y1FA 4S3MA 2EP5A 1JKJA 5C3MA 1WAMA 2RH4A 3Q11A 3QVTA 2JJYA 2O3JA 3W8FA 3V2UA 1FDVA 3DZHA 4GLLA 1OMOA 4Z3DA 2PY6A 3IUSA 3F4BA 1V3VA 3BMNB 2E49A 1KVSA 4Y67A 4RPHA 1ISFA 4NFHA 3TZHA 1WDKA 3EY4A 3QWFA 5C7OO 2A94A 4DLAA 2PWZA 5EINA 4E6PA 4DGSA 1FDWA 4E0BA 1NWHA 2NWQA 3OJOA 1R15A 3F9IA 3WDSA 1PGPA 3UFXA 3DTTA 3UCEA 4P4GA 1X0XA 3DXFA 1KEWA 1T2DA 3KB6A 4JBGA 4J91A 2IXAA 2PH3A 3PDUA 5KJEA 1Y7TA 2PGLA 3A4VA 1P0FA 1VKOA 3QRWA 4BNIA 4EBFA 1V35A 3MWDA 2TMDA 4ALLA 4IZIA 4WCFC 2DBVO 1I0ZA 1O89A 3MZ0A 1QSGA 2CDBA 4RVFA 1OC4A 3E6AA 6ADHA 1Q7GA 3PIIA 1K6XA 3WSVA 3AFNA 4QFCA 1DSSG 5C7IO 4RLHA 1I3NA 4PLZA 3R6DA 2Q49A 4R1NA 1MC5A 4RZIA 4XKJA 5BNIA 3LLSA 1IHXA 5DOZA 1IE3A 2YQ5A 4KTTE 4R41A 3FD8A 5A4DA 5JFOA 1E7MA 3KSDO 2O7QA 4ZQGA 4J43A 5CDSA 3MJEA 3STHA 2P4QA 4Y98A 4N18A 3TZCA 5K6AC 3DZGA 4JBHA 2VYND 1H6BA 3FBTA 2YFQA 1XGKA 1EE9A 3PZRA 3K9QO 4YVFA 4YJHA 9LDTA 2NTVA 3SLKA 1GYPA 4CR8A 2J8ZA 2NQ8A 3R1IA 5AXBA 1R4NB 3W4IA 4FFNA 1RM4A 8ADHA 3CUKA 1ISMA 1BSVA 3GGPA 2ZB4A 3AI3A 2ZB8A 5CHEA 2QIOA 2W2LD 2WWRA 3K2BA 2JFFA 2ZTLA 3PHLA 4IJVA 2W8ZA 1HDYA 1V3UA 2OHXA 4NG5A 3AUSA 3ROMA 1DOHA 1IYZA 1LDNA 4Y6PA 5HS4A 3LZ6A 1UAGA 1TT5A 4IDAA 4YAJA 3U4DA 1DIBA 3VTFA 1CYDA 3F3SA 2OP1A 3ENNA 5CEEA 5JAZA 1EQ2A 4PG4A 3O03A 1NHGA 1XR3A 2FHSA 3OETA 1RM3A 3WX0A 2WE8A 4DQXA 2GSDA 2FOIA 4Z0HO 4DQUA 3WQSB 5COBA 2DU8A 2H5LA 1I3MA 4OYRA 1K5HA 3TOXA 4UULA 3WMWA 1D3AA 2EV9A 1QRRA 2PD3A 4L74A 4R54A 4U8GA 3BMCA 3HE3A 2X6TA 4TZKA 1PJCA 2PNFA 3ZHXA 5DT9A 3DBVO 1ADFA 2WYWA 1VJ1A 5T6BA 4B7XA 3KETA 4Z9XA 3ENKA 5ENVA 2OBYA 4K6FA 4MVJP 4DUPA 1E3IA 3BTOA 4I9UA 3RFXA 4BNWA 2IDZA 4JCOA 4IS3A 4OH1A 3VAZA 1ISGA 2J5RA 4R3NA 4BNYA 3L4SO 1N1EA 2RH8A 2RCYA 3KYCB 3FHLA 4KOAA 3PWSA 4I8XA 1U5AA 1CRWG 5C5IA 1BDBA 4GKVA 4E12A 4MVJG 3MJVA 3IIEA 4KP7A 4OL9A 2EKQA 3F46A 1PJ4A 3BTSA 2C54A 5JAQA 3L6EA 1KYQA 1ZUD1 4DIOA 1S6YA 2GYYA 1BXKA 4ALNA 1A7AA 2P9GA 4UVDA 4YXFA 4OKNA 1U2GA 3ASUA 4ZHSA 4J16A 3AK4A 3AUUA 4YR9A 2AEFA 2I3GA 2RBEA 3TFQA 2D59A 4D42A 4DVJA 4CV0A 1DC4A 4BNVA 4CV3A 1LX6A 4HX5A 1PJ2A 1ADCA 2VT3A 3U4IA 5B12A 1X0VA 3ETGA 3TZQA 1NVMB 2B4TO 3KXDA 4LRSB 3VH1A 4AL4A 3GEGA 1LQUA 3G79A 1ID1A 1QYCA 3M1AA 4YJGA 4IXWA 5CDGA 1R4MB 1IPFA 1G0NA 4EJMA 1HYEA 1ML3A 5JC8A 1YXMA 1OFGA 3JV7A 3KEQA 3JQAA 4PLVA 4CM3A 3BMQA 1HDGO 3F47A 2ZQYA 4YAKA 4FJ1A 4PFJA 1Y9EA 4FIZA 1SB8A 3AU9A 1PZEA 3AY7A 2PK3A 2X23A 2LDBA 1B16A 1Y8RB 1ORRA 3O38A 4KUEA 4BS9A 4TRNA 2C7GA 3EZLA 1O0SA 2P91A 4MKRA 1M76A 2D0IA 2XPCA 3U62A 4AJ2A 2FPPB 3AI1A 3V2GA 5F3RA 3V5NA 1LA2A 4YWJA 3WJAA 4E2YA 4WLOA 3VDQA 1NYTA 5TGDA 1N2SA 4P4LA 2FSSA 3PYXA 4EYEA 1ADGA 1EBFA 1DIAA 1X7HA 2J6IA 2X7HA 3EZYA 3NRCA 4D7AA 2NACA 1ISIA 2FPGA 1FJHA 1QORA 3TWOA 3V2HA 3OA0A 4CODB 4GMGA 1SOWA 5G4KA 3A06A 1S7CA 3FCOA 2NM0A 3JD0A 3OQ1A 4XA8A 1JVSA 4NR0A 4XX0A 2C7VA 3GAFA 3Q1LA 4MVJH 4B7UA 4GWKA 4YT4A 2AG8A 3H5AA 1ISHA 1HE4A 1O95A 5L7TA 3DWFA 1R16A 3GT0A 3JQEA 3GHHA 2I6TA 4K6CA 5A04A 4PVCA 1ULUA 4PLGA 2I99A 4OQYA 4R9RA 1IZ0A 1EE2A 3DZFA 4FCCA 5DBIA 3GOHA 1M6WA 4URFA 2VWQA 1A5ZA 1GV1A 3GRKA 1IULA 2DM6A 2XOXA 1J4AA 2P4HX 2P2SA 2EIHA 2UVDA 3A14A 3AFMA 3BMOB 1GZ4A 3HZZA 3I3OA 4RDIA 3JQFC 4S1VA 4UVIA 4GSLA 5IDWA 1I30A 3E9MA 1ZFNA 3CMCO 3VH4A 3QY9A 3VPGA 1LDBA 5L95A 3D3EA 4RF3A 4YAEA 1TEHA 4MIOA 4P22A 2Y1OA 3VDRA 4FJ0A 2ZTMA 2B0JA 2O3TA 5MGBA 1N5DA 1DEHA 1NP3A 4BL5A 4GQAA 5DOVA 4D45A 3NT2A 4EI2A 5HA5A 1F14A 1NVTA 2PZKA 3RKRA 1NM5A 2VYNA 2HJRA 2I5PO 2VOEA 3EW7A 4CMBA 3ZHYA 3H3JA 4OIMA 1U8FO 2NU9A 1DO8A 3ZW8A 4LSMA 1NFFA 5KVCA 2JHFA 1LDMA 5A9SB 1DBVO 1LI4A 5JAMA 4DBVO 4OO3A 5I9NA 2X5JO 2E48A 4J2HA 1K89A 3MTGA 1ENZA 4MO2A 2W2LA 2VRCA 5KKCA 3GDFA 1YWGO 4WLUA 2NVUB 3FPLA 2BI8A 4CQLA 2VUTA 3LYLA 5JMWA 4KMSA 1ZMOA 4B4WA 3D0OA 1HLPA 2EG9A 2AXQA 3DBHA 3HWRA 4XIJA 2FRDA 3E5RA 4RVDA 3MJCA 5AVOA 2V6BA 3JQ8B 3Q9NA 1GL3A 1N9GB 1E0DA 3CPSA 3HN2A 1RM0A 4ALJA 5IN5A 1KVTA 3AM5A 3FNEA 4PG6A 4H7PA 4WGGA 4DC0A 4BNTA 2O23A 1Q2XA 1A72A 2D3TA 5TNXA 4JGBA 3D4PA 3EK2A 1P74A 2O3UA 3GR6A 3IQDB 3VKVA 2NU7B 2NU6A 2OMEA 3LT2A 2ZYDA 5GMOA 1JU9A 3H4VA 5G0WA 1VE9A 1ONOA 3RROA 4MP6A 1P1HA 2ZCUA 2J3JA 5IZ4A 5A02A 5FEUA 3NDIA 3RWBA 4R1TA 3WS7A 4EZBA 4DL9A 2NVWA 1IPEA 5IZCC 1PTJA 2GASA 5EQFA 1P45A 5DP1A 3QQPA 4PLCA 2Y67A 1E6EA 3WGYA 3TF5A 3HFGA 1SEVA 4JNKA 2Q1TA 4QXMA 1Q7CA 3GAZA 3QWIA 4MP3A 4ND1A 4B4VA 4CQMB 5L4LA 3E8XA 1UP6A 1SCUA 4HFNA 2HUNA 4TSKA 2X58A 1CERA 2GN8A 4K1LA 2NU8A 1P1IA 1HDRA 2G0TA 1C0KA 4BQPA 4W99A 5G0UA 1SMKA 2Q45A 4RPKA 2X0RA 1D7OA 1XIVA 3HUDA 3RC2A 4ONEA 5DN9A 4QQRA 4RVSA 5KVQA 5A5EA 4IQGA 1YO6A 3LF2A 4R16A 1ARZA 2B4QA 1GEGA 4ILKA 4C7JA 3N7UA 3DMYA 3F5SA 9LDBA 3D5QA 1YONA 4A0SA 5KJCA 3OEWA 4BGVA 1MA0A 1DHTA 1R66A 3RSHA 4WLVA 4JROA 1ENPA 3CSDA 3QWAA 1LDYA 1LRKA 1PWZA 3ADOA 5H83A 4CUJA 4BGEA 4YPOA 1P1KA 2HRZA 4RVGA 1GYRA 2Y0CA 3PPIA 1BRMA 3K73O 4OXNA 4WOKA 4IDEA 4IXTA 3W4JA 2HQ1A 1EUDB 5EESA 4W6ZA 4U0JA 3NTRA 3E48A 3GMSA 4NJMA 5IN4A 2GRAA 3H2ZA 3BA1A 3JQ9A 3KEOA 1QV7A 3KOUA 3NX4A 3F5QA 1MX3A 1DHRA 3ZWPA 4YT8A 1MV8A 1E7RA 1HDXA 4AJKA 1DXYA 1P1JA 1YQGA 4AICA 2O3SA 2P5YA 2FR0A 3KLMX 1HRDA 2B37A 2AQKA 3B1KA 5A9TA 4CM9D 2Y1CA 2PZLA 4II3A 1PL8A 4LSWA 2CDAA 2O48X 3TJRA 5GZ1A 2AHRA 4FGSA 2G76A 2Q1UA 1TB4A 4ZQEA 4GVLA 5CPFA 3QHAA 3LT1A 2WEKA 1B7GO 1EEHA 4KQXA 3H2SA 4JIGA 1E7QA 3M6IA 1I33A 4XRRA 5TLSA 4IS2A 2C2XA 3EMKA 5BSHA 3QIVA 1XSEA 4FJ2A 4GVXA 3UW3A 5I7SA 6LDHA 2CD9A 4CPDA 1LU9A 1B3RA 5IZCA 1PSDA 3WICA 4E4YA 5L4SA 2JCYA 2BGMA 4NBRA 4XCVA 2NVBA 4PCVA 3FR7A 1ZVMA 1LRJA 4DRYA 2IYOA 3NJ4A 1BXGA 4Z0PA 5DF1A 4CR6A 4RCVA 3PXXA 2RHRA 1GD1O 4KDFA 1PGNA 1TT7A 1ZSVA 3KV3O 1VJTA 2R2GA 2VZ8A 1YDWA 4GWGA 2B69A 3FWZA 3ETDA 3M2PA 3VZQA 1K6IA 2C20A 1PJTA 3D3WB 3RUEA 1Z7EA 3ANLA 4N7RA 2P68A 1Z45A 4LW8A 2WD7A 2IZZA 4J0FA 1EFLA 1JWAB 1NR1A 3G1TA 4MOWA 5BNFA 3V1YA 1CQIB 1DRUA 2BRUA 1D1TA 3AOEC 2A9FA 1MG5A 2C29D 4NU5A 3WGTA 3HQ4O 4EEZA 4M86A 1NASA 1O9BA 2XXJA 1H6CA 2CFCA 2PLAA 3DR3A 3QWHA 4JJGA 1GAEO 1DIRA 1KVUA 1Y9AA 4IJKA 4E5MA 4A26A 2Q46A 4OSOA 4DLLA 1QYDA 3OIGA 4Y8VA 2X9GA 4L76A 2IRWA 2CVQA 4FB5A 3OICA 4L0QA 1ONPA 4L75A 5THKA 4OOFA 1LDGA 2BMAA 3G49A 1E3EA 5F5LA 2BFAA 4Y6RA 1T2CA 4NBTA 3GNSA 1P31A 1LRLA 1PJBA 3G1UA 4R68A 5DNAA 1JKFA 2GGSA 3GQVA 2EKLA 3PFWO 4RZHA 3GPIA 3MTJA 4M8SA 4YRBA 4RDHA 1LQTA 3WTCA 4F6LA 2X0IA 2FY8A 1C1DB 1H6DA 4HADA 4Z3KA 5DCUA 3HJAA 3PEFA 4BNFA 2X1HA 5TIIA 1E7YA 5DBFA 1WPQA 1M2WA 3RBVA 3HDHA 3RFTA 1B8UA 4FN4A 3SC6A 4XRGA 1IOLA 3WGHA 1JWBB 2PZMA 2UYYA 4KWIA 4BNMA 4R5HA 4TKLA 1U3WA 4YTEA 1XCBA 4LVUA 4BNNA 4CM5A 2CUKA 4E2XA 4A27A 2OGUA 1H2HA 2AQ8A 5AYVA 1EK6A 3EVNA 2Y1DA 1M75A 1G6KA 2FZEA 1WVGA 2CF5A 3IAHA 1GU7A 2BKAA 2VHXA 1KY5A 2D5AA 2YV2A 3JYPA 1EVJA 1D1SA 2Y0DA 4B4UA 1HL3A 3VZPA 3X2EA 2FP4A 2J3IA 2WDZA 1QV6A 3CZRA 3KSZO 1LLQA 2OOSA 4ZQBA 1UXKA 3K96A 3GZ4A 2UUOA 1U1IA 3FNHA 1UJMA 3AOEA 3AM3A 3DEYX 3JYOA 4Q3DA 4PVDA 1ZJYA 2CDCA 4A73A 3Q2IA 4Y6SA 4BIIA 5L7YA 4HNHA 3KLPX 2CZCA 2I76A 5TJHA 4CLRB 2VTEA 4OHUA 1U4OA 1WDLA 2DTXA 4WCFB 1GZ6A 5JE8A 2EGHA 3DFUA 3E18A 1DFHA 5LDGA 1KEUA 4J1QA 4I5GA 4FFOA 3ZGYA 1UAYA 4F45A 3ROQA 4Z0TA 2VHYA 5ENDA 2A92A 2Q4BA 1G0OA 1OZAA 4BVAA 2ZATA 3B1FA 4E33A 3I9OA 2AEJA 4J2OA 5F5NA 3INGA 2HJSA 4D3DA 2D4AA 1PQPA 3FI9A 3CH6A 1U2DA 4I9NA 4J90A 4WCDA 4B79A 4ZQFA 2GN4A 5FI5A 1QP8A 1GQYA 1X15A 1VI2A 4OKIA 4BKRA 2I66A 4N5LA 3ZV4A 4R4JA 3INRA 3W6UA 1B8PA 3DAGA 4KUHA 4NNJA 4YA6A 1VRWA 3T4EA 1KY4A 3QSGA 1HSZA 5FFFA 3JD1A 3CZMA 4XJSA 1QYWA 3OIDA 4QO8A 2AE2A 4I5EA 4I08A 4XEHA 4CLXA 5A03A 4CM9A 2GUGA 3D7LA 2DLDA 5HWSA 1VPDA 4CLHA 1PQWA 1EUCB 4IPTA 3VPHA 4YT5A 4BO6A 2YDYA 3OJEA 4DWVA 2NUAA 2YHIA 4CV2A 4CMEA 5LC1A 3N58A 2BH9A 4OXKA 3PYLA 2IEBA 4WECA 4CLOA 2FZWA 4O59O 4AJPA 1GYQA 3WGIA 4Q3CA 4HFJA 4J6FA 3H65A 2V6MA 3H9JA 4INAA 2FPIA 3GDGA 5JYEA 1R0KA 1VC2A 2DPHA 2YV3A 4ZGWA 3RIHA 3T7EA 2YDXA 3PHHA 4W4TA 1NFRA 3U5TA 1EUZA 4RPJA 2JFGA 2ZTUA 4CM8B 3T7CA 2VRCD 1MFZA 1WP4A 5EIOA 1IB6A 1XQ1A 3TSCA 4D79A 3I9KA 4YJFA 3G0OA 4RORA 4L4XA 2Q50A 4H3VA 1TLTA 1AGNA 4AG3A 1GV0A 1KETA 3C7AA 3H9GA 3GF4A 4J1TA 3O8QB 3Q3CA 1PEDA 1SNYA 3V1UA 3W1VA 4CMCA 1EDOA 3PHGA 5BT9A 1W6UA 4NDNE 4D41A 2HAEA 3ROKA 3LC7O 1LC0A 3LT4A 4FSHA 4XYLA 1DRVA 1HZJA 4CMHA 1HE5A 1YL5A 8LDHA 2JD2A 3ANMA 3WYCA 2BFPA 1ZH8A 3JQ7B 1GZ3A 5I7EA 1LLCA 2ZTVA 4RV9A 5JCJD 3Q0EA 3AUTA 4HWKA 1F0YA 2X5OA 1QYXA 5JYDA 2AMFA 1K2WA 3ONDA 3CXRA 1V3TA 4E31A 5ES3A 3MWEA 4IDBA 1QKIA 1LJ8A 3DOCA 1LC3A 3NDJA 5TT1A 4CLDA 4A03A 2OFPA 1XU7A 2WMDA 2X8LA 4AJOA 3HB5X 4IM7A 4JJIA 3H3FA 1P44A 3ON5A 4UVEA 4ZN6A 4MIEA 1VSUA 1NFQA 1GPDG 3DAFA 1M6HA 1Z75A 3B1JA 3UF0A 1RYDA 4OXYA 5KOIA 4BNZA 3VC7A 7ADHA 3C1OA 2B83A 3S2IA 3JQGA 3WFIA 1Q7BA 1DC3A 1YL6A 4BNKA 5IAAA 1MG0A 2O50A 1OBFO 2VCYA 1EVYA 4GKBA 3NKLA 3BHMA 3CINA 1XG5A 5FI3A 3R3JA 2GNAA 2O3QA 1E77A 1ZJZA 2OXIA 4KUGA 2BI7A 3JYQA 2ZYGA 4ZJUA 5THQA 3IS3A 2Y05A 1F8GA 3ZWXA 3EGOA 1U28A 1C0LA 1I3KA 1X7GA 1HT0A 3BMNA 3PDJA 4ND2A 3WBFA 4DLBA 3ANNA 2ZQZA 3EUWA 4IBOA 5HS6A 3ETEA 1RM5A 4BO0A 3TFOA 1BGVA 2EW2A 3JD4A 4Z9FA 5ICMA 3WQRA 1BG6A 4CMJA 1BTOA 3OF2A 4XWYA 2C5AA 2IEDA 4U5QA 3D5TA 5DBGA 1ZO8A 3GNQA 4ALKA 1SZJG 3E9NA 3PTZA 1Y81A 3GY0A 1GR0A 4KTVE 4BNHA 5ITWA 3KTDA 1HDZA 3S8MA 3SXPA 1V6AA 1AHHA 5I7FA 3WJ7A 3ADPA 3W8DA 1Q1NA 4PZDA 5H81A 2A35A 1PQUA 3HADA 2NLOA 1JDJA 4JJFA 5IJZA 2D8AA 2R6JA 4IMRA 3PIDA 4CMAA 1YKFA 4R51A 2Q99A 4B8WA 4LMRA 4PLPA 5DCWA 3HHPA 1VL8A 3DBLB 1NQOA 2EHDA 5BNTA 1YB1A 3WNVA 2W2KB 4BGUA 2O2SA 2NTJA 1UXIA 4K9DA 3IC5A 4PZEA 3NYWA 5A3VA 4F46A 3IMFA 2AQIA 2V6GA 3EVTA 4WEOA 3ULKA 4GX5A 3U09A 3MOIA 4U6QA 1I24A 1R4NA 4ZA2A 1QG6A 2H9IA 3H9EO 3O9ZA 3I4FA 3VPSA 3DHNA 5I7VA 1N7GA 3K30A 1WNTA 3RC9A 3L9WA 3BHJA 5FWNA 4E5YA 5CP8A 3GA0A 2QYTA 1BHSA 3P2OA 4JK3A 1I2CA 2PD6A 4Y9DA 2DBRA 3I9NA 4TVOA 1JN0A 1HYGA 1VL6A 3GMDA 1YQDA 3H5NA 3WWZA 2E37A 2VHWA 1DJQA 4DC1A 3Q6IA 3MCVA 1UR5A 3PRJA 3WFJA 4QT0A 4WLNA 1NX6A 3E9QA 3PYMA 1LTHR 1KEPA 2OORA 4LCJA 1ZBQA 3TDKA 1NPYA 2PGDA 1DC6A 3E1KA 3QVOA 1ZXLA 4J0EA 3UHAA 1UZMA 3KYDB 3BTVA 4IIUA 1PJSA 1CETA 3PHJA 4E2WA 1PL6A 1X7DA 3A1NA 3KYBA 2Y66A 3DO5A 3LU1A 1E5LA 2D5CA 3ZNQA 5I8WA 2QZ9A 2GCGA 3F1LA 2O4CA 2HCTA 5G4LA 1HYHA 3C7DB 4M54A 5TRTA 3KYCA 4PG5A 1CDOA 2VTDA 1I10A 3JYNA 4DXHA 1KC1A 2C82A 3ZNOA 3D4NA 4XR4A 4L4RA 1HETA 2Z95A 5TSDA 2OP0A 1LBEA 3IOYA 1NAIA 2C0CA 3D4OA 4JBIA 1X14A 2QYSA 4MKZA 4BNXA 1C1XB 1M67A 1GPJA 1UUFA 1T1RA 4BOYA 4XYMA 3FPCA 3ZWWA 1XKQA 5TQVA 4BNUA 1IL0A 4J4BA 1EVZA 4CR7A 5EN4A 3GEMA 3ITKA 1T24A 4R3WA 4CMIB 3QW2A 1RKXA 3L6DA 4DREA 3OM9A 3DZJA 4BMVA 2CMDA 1PJQA 3A28A 3UCFA 2HDHA 4E21A 3ZV6A 2C5EA 4LCEA 3JQ9C 4PIVA 3S2FA 1YBAA 3UICA 1YH3A 4XYGA 1PR9A 1I32A 3ICCA 1H93A 1TXGA 4FFPA 1R4MA 2DBZA 5EQDA 3PK0A 1DLIA 2X9NA 1VKNA 3L4BA 5JLAA 3VH3A 3JQBA 3IP1A 1P3DA 1PIWA 2PV7A 1PL7A 4O63O 4G2NA 4IDCA 3BXXA 2ZIZA 4BNLA 1P1FA 2AE1A 5JCJA 4W9NC 1Y8RA 5AXDA 3PGXA 1GQQA 4FW8A 5DULA 4A7PA 1ADBA 4BKQA 5JXWA 3I9MA 4MPDA 4ZVVA 2W98A 2PZJA 2O7SA 2UV8A 2UUPA 4IGEA 1O8CA 2PGJA 1U3UA 1QLJA 1UDAA 2FPPA 4XQEA 4BO5A 2G17A 4PLHA 4OSPA 1I3LA 5TS3A 3KBOA 3X2FA 4W7IA 3RUHA 1OC2A 4GGOA 2HK9A 3O26A 3PJFA 2HMUA 4DPLA 5CAEB 1BW9B 1YGYA 3C24A 5JBIA 2YFHA 4P8RA 5KJFA 5I8ZA 3C1TA 4I1IA 4P4NA 4R5MA 2B4RO 3CTMA 4F6CA 2EWMA 2Y1EA 2G1UA 5JO0A 4MKXA 2X9VA 1YRLA 4I5FA 3U4HA 1A71A 2BELA 2HSDA 3GUYA 1E1NA 3LC1O 5FF9A 2B5WA 3WR5A 3ZHBA 2EP7A 4M55A 1KEVA 3GVPA 4HFMA 4L4SA 1NTOA 4NH4A 1CQJB 2ZJ0A 3PZBA 4IGFA 4N54A 4CJXA 1Z7BA 1GTMA 4EEXA 3LQFA 1DJNA 1EZ4A 1HWYA 1L1FA 4IJUA 4IJWA 2ZB3A 3DB2A 4CLEA 5L4NA 4CUKA 1MXHA 5ILGA 2R00A 3EHEA 4KQWA 1YOVB 2Y93A 1X13A 2YUTA 2BF7A 2ZJ1A 3ICPA 4BB6A 2CVOA 4TMFA 4TRJA 4EW6A 5L7WA 5KWEA 5TF4A 4QTZA 4XQGA 2G5CA 1A9ZA 3LK7A 1IZ9A 3SBOA 4BO9A 4HBGA 1ZK2A 3M1LA 1PGQA 2BFOA 3BMOA 4MVJI 3K8ZA 5BQFA 3AU8A 3FNGA 3WXBA 1MC4A 2VWPA 1T2AA 3A9WA 2V7PA 3IDSA 5BSGA 1GQ2A 3WLEA 5T8KA 1R12A 4BMSA 4XDYA 3ST7A 1J6UA 3NEPX 3DZKA 1Q0HA 2ET6A 4WASA 3ZV3A 5B4VA 2A4KA 5HRUA 4YCAA 4NK5A 1AUPA 4J4HA 3ZWCA 5L40A 1UP7A 5L53A 1LNQA 2RHCA 1BDMA 2QRLA 5IXSA 3PQEA 1FMCA 1F12A 2SCUB 3ZV5A 1RWBA 4NZ9A 4W9NA 4TQGA 3VPXA 4NBVA 2YZ7A 3NJ8A 5H82A 3JD3A 3WWYA 2GO1A 4QSMA 1MXFA 4RPGA 3RASA 2HK7A 1NHWA 2DFDA 2CNBA 5A3JA 3FSRA 1E5QA 2YQ4A 3LSYA 4DA9A 4F3YA 3GGGA 1WW8A 4HUJA 3GN2A 3SC4A 4YRAA 4BMNA 3DBRB 4J1NA 1LEHA 4M89A 1SC6A 1R37A 1WXDA 4J4TA 4QFDA 3WGZA 1A9YA 2YV1A 1D4FA 1MB4A 1YE3A 1MP0A 4XR9A 1B14A 3RBXA 3ZNNA 4YBZA 1Y8QB 4NU6A 1PX0A 1FF9A 3ASVA 2ZCVA 1HLDA 1YDEA 3UCXA 5JW6A 3FF4A 2I65A 2NVUA 5EMHA 1U4SA 3IJRA 4CM4B 4OAQA 4PG7A 5F1OA 4ROSA 1JLLB 4D0RA 5A06A 2E4AA 3QVWA 4ALIA 1JAYA 2WYVA 1GCUA 2YW9A 4RVHA 4D44A 1ZSYA 3JQ8A 3ABIA 1JW9B 1N9GA 1N92A 2WM3A 5U4QA 5A1TA 4BO2A 1HXHA 3L77A 1JKJB 3W6ZA 3P7MA 5JC1A 2O3RA 5ADHA 2FR1A 2C2YA 2NSDA 4WEQA 2DPGA 1B26A 1K6JA 4NBWA 1UXHA 5U9CA 1X1EA 1L7DA 1OOEA 2NU7A 3I9JA 3OQBA 4GMFA 2HU2A 1H9BA 2JFHA 4FS3A 3R0IA 1NQ5A 2AW5A 4D3FA 2J3KA 3UFXB 3NV9A 4A10A 4BB5A 5KJ6A 3WQQA 3SJ7A 1XELA 4PGFA 4UUPA 1I8TA 4FR5A 4Q3EA 4WPGA 3N74A 3MWDB 3S2GA 4OQZA 5BR7A 3K5PA 3GZNA 5JDCA 1P1RA 3C85A 2IODA 4BKOA 5ILOA 3LT0A 3WYBA 1HSOA 4EJ6A 1H5QA 3JQDA 1O6ZA 1OAAA 2HMTA 3PWZA 3LDHA 4BV9A 1PJLA 5F1KA 5LCXA 3DTYA 4FC6A 5T57A 5KNLA 3ROPA 1XLTA 2HMSA 4K26A 4GH5A 5CG2A 1A7KA 1VSVA 1XA0A 1B3BA 4Q9NA 3ZI0A 4YJHB 4J7CA 3QLJA 1RJWA 1H2BA 2QQ5A 2IZ0A 4L9RA 3GPDG 5COQA 5AOVA 5G0SA 3ZU3A 3GLQA 4A2CA 3SLGA 4WKGA 1EFKA 5F1PA 3UVEA 4DQVA 4ND3A 1YS4A 1XYGA 4LRTB 1T2FA 2WSBA 1ISJA 2VUSA 4OOEA 3AWDA 1H94A 5COAA 1PGOA 3DMTA 4IINA 2UDPA 3KHUA 1MFPA 1WDMA 2Y68A 3NTOA 3WNQA 4B3IA 4EDFA 2EF1A 3INTA 4GX0A 1MLDA 1TT5B 4CMEC 4FFMA 4PLFA 4ZICA 2EJVA 1KBZA 1J49A 5CDTA 3UGKA 2ILTA 1ZMTA 2X0JA 4GLOA 3ZH2A 3BTUA 3VPFA 1DIGA 2GN9A 1YL7A 4K28A 3W8EA 3CE6A 3PGJA 1GEEA 4NFYA 3PVZA 1E6UA 4DBZA 2WTBA 1GUFA 4ZQHA 4IUYA 1XHLA 3BMCB 3LC2O 2JAHA 5KIAA 1KVQA 1CF2O 1FXSA 1DC5A 1PZHA 3ZHZA 3OECA 4EUFA 5C7LO 3IUPA 5IDQA 3FTPA 3MJ4A 5ITVA 2PTGA 3OHSX 4J49A 4BHTA 2XF8A 1WZEA 4BQRA 1AN9A 4H16A 4G81A 5DDIP 4GX1A 2JL1A 4FFRA 2Q3EA 1QMGA 5JSFA 1VJ0A 3H8VA 1XU9A 1DAOA 1NWCA 2ZB7A 4RQUA 2EJWA 5G2OA 4BUCA 3ITDA 1E92A 3WTBA 2VOJA 5JDIA 2Q2WA 4CUZA 3SX2A 3I1JA 3F4LA 1EK5A 4YAGA 2NTNA 1WMAA 5GY7A 1KC3A 3PQFA 3GVXA 2B35A 2HO5A 2POQX 3ZDFA 1E3SA 1QYVA 4JN6B 1QXSA 1EMDA 1XEAA 3D3WA 2I9PA 3ORFA 4XYEA 1L7EA 3GVHA 1V0JA 4FGWA 2PH5A 1AXEA 3WB9A 1R0SA 4AJ1A 4BNJA 3RUCA 4YQYA 4BV8A 5F21A 5AXCA 3ZWBA 5EJ2A 1T2EA 2ZYAA 2B36A 4YJGB 1CQIA 1CJCA 2Q1WA 4D0SA 3WIEA 4Q39A 3JQAB 4XD2A 1E6WA 1SOVA 3BMQB 3DHEA 1MUUA 3DDNA 4OGWA 3G3EA 2AQHA 1EDZA 4YJDA 4DTIA 2Y99A 3ZZNA 4PRKA 2OBNA 3OJLA 3NDRA 4GBJA 5L45A 5L3ZA 5TX7A 3OQ6A 4R1SA 4FDAA 1DB3A 2WYUA 3JSAA 4AJHA 4GPD1 1B0AA 3RUDA 3OIFA 1UXJA 4WJZA 3I83A 3WGQA 1LSJA 4HNGA 2EGGA 3RJ9A 4FC7A 1BVUA 3RU9A 4EITA 1E3WA 1YVEI 5I9MA 3QJ5A 3P2YA 5CDUA 2FPGB 4XJTA 5U1PA 5EPOA 5CDYA 1ZEMA 4R9SA 1C14A 2Y1GA 3QP9A 1UH5A 2PR2A 4UVGA 3K6JA 5G4KB 1C1DA 3MJSA 4UUOA 4W82A 2D2IA 4UEKA 2O2YA 3GN1A 2J5QA 5LDHA 1Q0QA 5KJ1A 4FQ8A 3VKUA 4XX0B 5AQ1A 4DMMA 3CEAA 5IF3A 5CPBA 4G5HA 1I01A 2W90A 3C3XA 3FR8A 3WG9A 3AY6A 2X4GA 1PS9A 4BNGA 4NPCA 1ZZEA 3EYWA 4AJNA 3WGGA 5IDXA 2CY0A 1T4BA 3DZIA 4CMGA 1LUAA 2I67A 4E3ZA 1BMDA 1DRWA 4R69A 4CM6A 2BD0A 3GNTA 2GZ1A 2OO5A 3UUWA 5ICSA 2EW8A 3HNPA 4MINA 4XGNA 4ZD6A 3S1LA 1F8FA 4I5DA 2PKRA 5AXAA 1C0IA 1ZXBA 3BAZA 2BFMA 4TZTA 3IKTA 1NNUA 4EJ0A 1NBOA 2QRJA 3ZWNA 2J5KA 2YHUA 3ZWYA 3F1KA 1KIFA 2PFGA 4IDDA 3EDMA 5G0VA 2NNLD 5JMPA 1G1AA 3B70A 3LLVA 4AVYA 4CLRA 1LSSA 3CMMA 4PLTA 4WCFA 1WLYA 3UXYA 3TNLA 3HDQA 4IIVA 3RCBA 1U8XX 4BGIA 4QUKA 3H9UA 4XDZA 2E6UX 3HSKA 2NU9B 3RQSA 4B7CA 4MVJM 1Y6JA 2F1KA 4BKPA 2BGKA 2RIRA 1GDHA 1H0KA 3CKYA 4WLFA 5A9RA 2DUUA 4ND4A 3VOSA 4E13A 3ZU4A 2QHXA 4JX8A 3L0DA 4E32A 5BSFA 4L8VA 4IDGA 5DCYA 4OM8A 4O1MA 2JHGA 3CIFA 3GHYA 5K6AA 3ZCXA 1YB5A 2XAAA 3MOGA 4CQLB 1D8AA 2FSVA 4HY3A 3OH8A 1XWFA 2WJPA 4B3HA 3S55A 2VWHA 4XB2A 1E1MA 3DBHB 3DQPA 5JNLA 1SAYA 2VHVA 4RLSA 4ALMA 2CF6A 3I4CA 4CL3A 3IL2A 3DZBA 3AUAA 3HDJA 5TT0A 3NUGA 4YACA 3GC6A 3QVXA 4ZRMA 1F06A 1ZK1A 1P0CA 3ONFA 4YRDA 5JY6A 5J23A 4E30A 5HTOA 2D1YA 1EUCA 1N8KA 3VVCA 1KOLA 3SVTA 2HRBA 3JTMA 3E5MA 3VTZA 1W73A 2P9CA 2Z1MA 2NU6B 1TVEA 5KTKA 2QG4A 5GZ6A 3GG9A 1KVRA 4NJOA 4DIFA 4MVJF 3TZKA 4Z6KA 5I9LA 4RPLA 1SB9A 4G65A 3D64A 5BSEA 4GAEA 2C07A 4LISA 4WLEA 2Q2VA 3T4XA 2H6EA 3AM4A 2JKVA 1JVBA 2X86A 4LK3A 2X0NA 1JKIA 5JCXA 4CM8A 1SEPA 4XYBA 1I36A 3TL3A 3L4BC 3GRPA 3JQBC 3WYEA 2ZK7A 3E82A 4LVCA 5B4TA 1FDUA 3SJUA 1YQXA 4IZHA 1SCUB 4XIYA 3L6OO 3AJRA 3GK3A 4GX2A 3OFSA 4MVJE 4Z9YA 5T67A 3ZWVA 4D46A 4FD3A 3QV1A 1JQBA 3SEFA 2NU8B 3O8QA 4MDHA 4AJLA 1T25A 3VHRA 2FMUA 3IKVA 3RUFA 2YYYA 3BHIA 2GN6A 3VVBA 3TPCA 3RVDA 4FOSA 4N5NA 4WOJA 5L9AA 3C8MA 1NPDA 1AHIA 1ZIDA 3JQ7A 2IXBA 4WUVA 5TC4A 2Z1NA 5KCZA 4TRRA 3VZSA 3FTNA 4PLYA 5L51A 3QA9A 3GVCA 3PJEA 5JO9A 3DC2A 1B2LA 1KERA 4WNCA 4UEJA 3H9QA 3UN1A 3OMLA 1XQ6A 3TOZA 4RJTA 5JAIA 1Y1PA 3GFBA 4DPMA 2X22A 4TWRA 1I5RA 4NJMB 5CFZA 4FFLA 3BYZA 3DONA 3ONEA 4E5NA 3D1LA 4M49A 1X1TA 2QRKA 2GPTA 1DLJA 3PQDA 4BO7A 4IQ0A 4C7KA 2PD4A 4CQMD 1TI7A 1M66A 3K31A 1UZLA 1Y5MA 2EXXA 2R00C 3UH1A 4ESOA 1YJQA 4H15A 2DKNA 1SO8A 1O94A 2HKIA 1P77A 1WWKA 2DFVA 1HTBA 2EKPA 2JCXA 4J7UA 3G17A 4MVJD 3S2EA 4EUHA 1Y5RA 4O6VA 2QW8A 3Q2KA 4BO1A 5JY1A 3VH2A 3F6YA 2GDZA 4PRLA 1NR7A 4U6SA 1O5IA 5CG1A 4RO0A 3TQHA 3WIDA 1Z73A 3NTQA 2HMVA 3FN4A 3GH3A 3IP3A 4D3SA 2IZ1A 4IQ8A 1HEUA 4UUNA 2C59A 2I3AA 2DTEA 5T8KC 4LGVA 4HFRA 2Z5LA 4FOOA 2B5VA 4KWHA 3EC7A 3RC1A 3JQCA 3V1TC 3AY3A 1BXZA 5B37A 3WSWA 2AEMA 3NAQA 3KUXA 4J3FA 1PU2A 2VQ3A 4CM7A 1LLDA 1E1LA 2FN7A 1I2BA 1B15A 2P9EA 3OEYA 5IXYA 1P9LA 4HP8A 3I9LA 4QEDA 3ZW9A 1PS0A 2GD1O 4FBGA 3GFGA 4NFSA 3U0BA 1E7WA 3DOJA 2ZKLA 2OZPA 3UKOA 1T26A 4YYZA 5KVSA 1BXGB 2VZ0A 1YJ8A 3OJ0A 3RUIA 1QR6A 3FRJA 3HB4X 4JQCA 1SBYA 2FWMX 2E82A 3PJDA 3OA2A 4ITUA 1LXCA 1C0PA 1K3TA 1ZNQO 2VNSA 3H6KA 3NGXA 4XGIA 4RQTA 3LVFO 4RL6A 3AOGA 5JPIA 1NQAO 4JP3A 2JAPA 4BO4A 5HM8A 3DBLA 1UDCA 3PLNA 3ZWMA 3RI3A 2WD7B 4PZCA 1DFIA 1PWXA 3GDOA 4JXKA 2BGLA 2W2KA 1CWUA 1PGJA 5IFLA 1HZZA 5ER6A 5CEJA 3KVOA 4UEOA 2VYVD 3PHIA 1BWSA 4O5OA 7MDHA 1J5PA 4MP8A 3LF1A 1W0CA 1LLUA 2Y0EA 2Q1SA 2DAPA 1ZK0A 4L73A 3JQFA 3E03A 1V8BA 3U3XA 4NMHA 3DHYA 3C7CB 2BLLA 4B8ZA 3JYLA 1GCOA 5C37A 1UXGA 4MIYA 1P33A 1CEQA 4CMKA 4Q3AA 1LSUA 3U4CA 2X5KO 4I9HA 1NAHA 3H7AA 2OL4A 3RUAA 4J1SA 3GZNB 4NHEA 4QX6A 1RPNA 3FWNA 4WNIA 3PP8A 4UAGA 2QZZA 3AI2A 1IHYA 4D43A 4W7HA 1IY8A 4GGPA 4GL4A 2PKQP 3JQ6A 2LDXA 1GADO 4YDRA 1R6DA 3JD2A 3DOOA 1W8DA 3I5MA 1QLHA 1FK8A 4RF2A 4BO3A 1ZCJA 2WD8A 1R0LA 3I6QA 3WGOA 1T4DA 3UOGA 1H6AA 3BIOA 2Q2QA 4P38A 4TRMA 4NQZA 2UAGA 3RJ5A 3KYDA 4C4OA 4HV4A 4M1QA 3KRTA 2VHZA 4E2ZA 1U5CA 1IUKA 3HN7A 4EUEA 1Q0LA 5A5FA 3PFFA 4FPXA 5JDCC 3DL2A 1Z6ZA 5EERA 2OUIA 1GFSA 4NBUA 4XQ9A 5B1YA 4J7XA 3HDYA 1NXQA 1AE1A 4YAIA 3GG2A 4MJLA 1KS9A 1PJ3A 1JAXA 3JCZA 1ENOA 1PZFA 3NT4A 2PKQO 5ER9A 4NI5A 3I6IA 2O4UX 3DAPA 3WBBA 1VLLA 4X54A 5K0ZA 5HBRA 3QE3A 1U3VA 3HFSA 5G0TA 3K2EA 3KO8A 3QVSA 4XGKA 4DYDA 4B3JA 1U3TA 4UVHA 4PLWA 4AJEA 1VL0A 1HF3A 4BKUA 4U0KA 5A9SA 5TJ9A 1HDCA 5GZ3A 1C1XA 2PA3A 1ONNA 4JLWA 3IJPA 1F17A 3KZVA 4U7WA 3RC7A 2AA3A 3NT5A 1DDOA 2HMWA 4TKMA 3DFZA 2DTDA 1UP4A 3B20A 2FP4B 2GZ2A 3KM0A 1YB4A 2FR8A 4CMIA 3RKUA 2DVMA 3K92A 1ZSNA 2YJZA 4ID9A 5KVVA 3DMTC 4Q3BA 1W4ZA 5B4UA 2G82A 2CSUA 3B6ZA 1BVRA 5CEFA 5DP2A 2NQTA 2IYPA 5T5QA 3BZUA 1U7HA 3M2TA 3AW9A 1V9LA 5FYDA 3RBZA 4O0LA 3R3SA 2EEZA 2W4QA 3V8BA 5IG2A 2V65A 3WLFA 2IE0A 5K9ZA 1DIHA 3PJGA 5DZSA 3C1AA 4CL8A 2DC1A 2VN8A 1GY8A 4JP2A 1GUYA 4DIBA 3I23A 1ZW1A 2DBQA 4OJNA 2HLPA 3O4RA 3ZWOA 2VRBA 2WE7A 4KDEA 4J9VA 4NK4A 4HKTA 4WK6A 4DYVA 1JTVA 2DUWA 1UZNA 3WMXA 1Z74A 1U9JA 1T1SA 4UREA 2GLXA 3Q9UA 2JD0A 4AJIA 2VWGA 4E5PA 1PZGA 4OMUA 1CIVA 4CM1A 1EVIA 1E1KA 4E5KA 5CAEA 1BW9A 3KSUA 3MEQA 4HXYA 3OJFA 1K0UA 2VNAA 1YBMA 5IDYA 3HG7A 4GSKA 1UDBA 2GZ3A 3ZN2A 4AJJA 1ZK4A 2TMGA 2RAFA 2GF2A 1HKUA 5JS6A 4NIMA 4CQMA 3EAGA 1EBUA 4UUMA 1A4UA 2CVZA 1VM6A 3TZ6A 5JDIC 4R01A 1H9AA 3TRIA 4YEDA 4MVJA 3I52A 3GGOA 3P5SA 1CQJA 1FDTA 4LMPA 4Q3NA 2NUAB 2YHIB 3W4KA 3U9LA 4CLOB 3OP4A 3COSA 4R1UA 1HE3A 4DMLA 4N5MA 1PR3A 5A05A 4YB8A 3FNFA 4AJ4A 3PLRA 1N1GA 4XQCA 1N7HA 4II2A 1YOVA 2FPIB 3GUCA 3L07A 1XDWA 4PG8A 4RGBA 2GR9A 1HDOA 3VZRA 3WOHA 1ULSA 3PI7A 4ZRNA 1I2ZA 2BHLA 2AG5A 1SPXA 2J3HA 5EL0A 3GEDA 3ZWAA 1EQUA 4IMPA 2H1SA 1E3WB 3ZU2A 1WZIA 2F00A 1EUDA 3P19A 1AXGA 4J9UE 1E3LA 2VT2A 4EGFA 1ZK3A 4YT2A 4YJFB 1RYEA 2V6FA 2HK8A 4TROA 3NGLA 2JD1A 2NADA 3QWBA 1Z82A 2EERA 1TA4A 4ND5A 2YY7A 4PN3A 3UAGA 1LSOA 3JQAD 1DAPA 1OI7A 1A4IA
chains in the Genus database with same CATH superfamily
2DT5A 2FG5A 4IV5A 1TD9A 4GR4A 1KBOA 3RU7A 2SCUA 4KWCA 1UC4B 3K9WA 1GUZA 5KKAA 3KQQA 4TQAA 4IJMA 4DJDC 2E21A 3MT9A 1B8VA 3TQQA 3FKSA 4E94A 4OQMA 4BQIA 1DPGA 2YV5A 3FLBA 2PA0A 2CFOA 4DLKA 4FDUA 2CNWD 3KQLA 5CX4A 3HBMA 3P96A 5ABPA 4LJ6A 2R6DA 2ID9A 4BQOA 5J4YA 1DFGA 3L8ZA 3O2QB 1DO2A 3ZU5A 2FDXA 1SURA 1L7NA 1J0XO 2J0UB 2ZSHA 4HYYA 4O4LA 5FNVB 4NAUA 1E7SA 3C3BA 3T35A 1FX0B 2Q3CA 1ODFA 2VR1A 3E9RA 3STUA 3L7OA 3DTVB 4JI8B 3EB9A 3WLLA 5BORA 2BFBA 4X60A 3V6LA 4CM4A 4FKZA 2XXBA 3MJTA 3JQGB 3V4RA 4L0DA 3H5RA 4AFNA 2ODNA 1JLLA 1M34B 5T64A 2P5UA 3G9XA 2OQVA 1WCIB 1A88A 2ZE5A 3II6X 2E89A 3V3TA 4P86A 2X2EA 2I4NA 3OSUA 4UE2A 2GOYA 4JLOA 4LEIA 2XOEA 1E99A 2Y1FA 3KJHA 5AI8A 4EHHA 4AQ7A 2HFJA 1JHDA 1K9VF 3M6LA 3NETA 2Q5JA 5FWYB 3PQ8A 2WU3A 3DF9A 3QVTA 1T36A 1VHDA 3FETA 3VDMA 2PUBA 5FP0A 2HBYA 2JJ1A 1WV0A 3IUSA 5D5HA 1V3VA 2E49A 3WMGA 3BWBA 1PKXA 1ISFA 1TC2A 1RR6A 5C7OO 4UBKA 1K8YB 4U3JA 2AFHA 1QAQA 2OD7A 3HCOA 3N76A 5CK4A 3EGIA 2AVDA 4XCQA 2O5EA 1JPNA 4INJA 4EA7A 2PANA 1WB6A 4QODA 5EJIA 3WDSA 3DTTA 2VDNB 5E6RB 1X0XA 3KB6A 2IIPA 1T2DA 2VDJA 4IYJA 4BEBA 4XGRA 4ZU6X 3AFOA 3P0JA 4K9MA 1CVRA 4N39A 3ZDCA 1BAPA 2PGLA 3PR2B 3A4VA 4DEVA 3ICOA 1AXRA 3EPPA 3KG2A 1V35A 3MWDA 3NHPA 2VDPB 3AERB 1Y3CE 2QVZX 4IZIA 1SRQA 4WXHA 3ETLA 1LS6A 1KA9H 3MZ0A 2PSHA 1W1IA 2R85A 1GPUA 4V0QA 4RLHA 3LLCA 1KFEB 3T99A 4PLZA 2GKOA 4TMWA 4F2WA 2QLJA 4R1NA 4EO7A 5BNIA 2B78A 4EB0A 1S3FA 4DY4A 1A2KC 2Q8NA 5DOZA 5P21A 4IG4A 4EFMA 1S4QA 3KSDO 4G5YA 1M8PA 4ZQGA 4TVKA 1GO2A 1T9GR 2GPNA 5CDSA 1YE5A 4BV2A 3DD5A 3HU3A 1XQ9A 3G02A 3STHA 2ZRQA 4ZVRA 3TAXA 1C81A 3PUHA 4DG9A 1MVOA 4R6XA 4JBHA 3EF3A 1GG8A 2G04A 2YFQA 1XGKA 4EY8A 1EE9A 3O8CA 5F64A 3PZRA 4X90A 4UCXA 3BM5A 4MUJA 3LX5A 4YVFA 3RREA 3UAVA 4YJHA 5MF6A 2O7RA 3ENVA 1U6JA 2JGIA 2J0EA 4BVGA 3L79A 1RE0A 3R1IA 1C7ZA 2GZAA 2GXSA 1RM4A 3I2JA 4IDHA 5FRDA 8ADHA 3BUSA 3EGXA 3LX8A 1ISMA 1IM8A 1ZNWA 1L4FA 2ZB8A 2QIOA 2WWRA 3K2BA 4D3YA 3RS5A 4CW7A 3KLBA 2BJHA 4GUAA 2W8ZA 4XVRA 3PTAA 3PHBE 2I9KA 2CD7A 1HDYA 1V3UA 3TLCA 1QE0A 3AUSA 5G3ZA 4BE7B 5EXEA 3E0QA 5HS4A 3G68A 1ESEA 5E0KB 1UAGA 1J20A 3R3YA 1JYSA 3CIOA 1C9EA 5CIQA 4W6QA 5JQGA 2EBWA 1AKTA 4RK4A 5FPKA 3THRA 1U5BB 5EP3A 3F3SA 2IOQA 4JKIA 3OD1A 2FHSA 1M6YA 3RJZA 5JXGA 1JFFA 4ZZ0A 2EFEB 2GHIA 4HXGA 1Y3AA 3IQGX 3O83A 4NY1A 3JZDA 3ZIAA 4HS4A 3WQSB 1PF7E 2Z4TA 3UA4A 1ABFA 3DP9A 3TOXA 1WM1A 3M6XA 2RKOA 1D3AA 4UULA 2CXRA 2HA4A 3PEEA 1MX5A 4L74A 3C7KA 2OAGA 3U37A 1M2OB 2ZT6A 1XMXA 3BJEA 4U8HA 4IH4A 5DT9A 5E6UB 3H1BA 2DOKA 5KSOA 4B7XA 1AKRA 1U2QA 1ZOPA 3DLIA 4MEAA 2OBYA 1ICEA 2NAFA 2B4YA 4ZJPA 3COVA 1G7CA 4YPVA 4QJ5A 3RFXA 4UC0A 4BNWA 5L3QA 2Y0BA 2YOHA 3VOBA 4R3NA 2VDWB 1D04A 1SHUX 4FONA 4QDOA 4URUR 1FQKA 4EHBA 1BDBA 3G5MA 4RUKA 2B2NA 5CLGA 4M60A 2X8WA 3MJVA 4FK8A 4KP7A 3WK9A 2EKQA 2JI8A 4KLCA 5JD4A 2AN1A 2FEKA 2J0VA 3TMKA 2YIMA 3N8NA 4JMPA 1ZUD1 1FJGB 1D9XA 4CF4A 2WFAA 2NO0A 1IHOA 2QXYA 2XUPA 4YXFA 4OKNA 2YX1A 5AKIA 4IIDA 1PRYA 3ASUA 5CGZA 4QUIA 1PR2A 3DVAB 3AL2A 3AK4A 5KZMB 4OEHA 3C70A 3BOSA 2ETXA 4Z7QB 1ILEA 4F7DA 2D59A 4D42A 4M7WA 3QEMA 4HUQA 2AK2A 5I8PA 1ZNYA 3AILA 1A77A 3RIEA 1MENA 3RRYA 4C0BA 4MJ7A 2J09A 5EEHA 4ZV9A 3QXGA 5BN1A 1N5JA 1YAJA 4KAXA 3T95A 4BJ3A 1O87A 2L82A 2V8OA 4BXOB 4CVNA 1OJLA 2H1WA 1A76A 5EPUA 1VG0B 2IX9A 2RK3A 2OKGA 4ZARA 3VH1A 4AL4A 1SU7A 3GEGA 1V9SA 4EG0A 3D4IA 3ESQA 1QYCA 5IFKA 1BMQA 1XQVA 3HJFA 5FNZA 1HYEA 2Q21A 5JC8A 1E5VA 4LE2A 1OFGA 1E3TA 1RI3A 3ABOB 3VSEA 4EMUA 1DDGA 4OI4A 2VJAA 4MV4A 4CM3A 1N32B 4FEAA 4YAKA 1Y9EA 5ALGA 1PUXA 3HCNA 1DAFA 2H2GA 3B9PA 3AY7A 4N4AA 2ZR9A 3ROTA 1ORRA 4BS9A 2KHZA 5K0EA 3U6KA 1Z8FA 3PDIA 2OFXA 1GGVA 1M76A 3M0EA 2PBRA 4AJ2A 3F5DA 4FN5A 1PNRA 4QATA 4QDJA 4RABA 5F3RA 3O7WA 3WRWA 1OREA 3HFJA 3QEOA 1DKLA 1X1DA 4DVGA 3PYXA 1JU4A 3IE2A 1WCYA 5HZMA 5ICFA 4D7AA 3DEJA 3OOWA 1Y80A 5K3EA 2YWCA 1KEKA 4YX9A 2NACA 4MYSA 3QLVA 1UZUA 1KEZA 3T52A 4BE9A 4JI4B 3RHSA 5AKZA 4UDYX 5AM2A 5B58T 4BLTA 4CODB 3IODA 1SOWA 1OKKA 4IIXA 4QPPA 1UWLA 2BC9A 2AS0A 3A6KA 4FHZA 2P2DA 4NENB 5LP6C 2FLVA 2JIQA 4RTLA 3OQ1A 2ZVPX 1ECLA 3FPBA 2X7XA 1EVQA 1JVSA 1Y1KE 3U7JA 1PR0A 2QJWA 3WNDA 4NXNB 1X7WA 2E87A 3PCTA 3IURA 4E88A 1XTPA 2C84A 1TFUA 3GRFA 4LHSA 4NE2A 1XI2A 1U90A 2QM7A 3SFVA 1RHMA 4ZVKA 1HE4A 1JSXA 1O95A 3UK2A 3VR5H 3K9HA 3UV7A 5KINB 1XDUA 5C4GB 1PK9A 3GT0A 3L7IA 1Q1GA 3GHHA 4KO4S 5JNVA 5JVDF 5A04A 2BZ1A 4GBGA 2GCEA 2V7TA 3DULA 3LLMA 1VIMA 1N3YA 9MHTA 5A0FA 1KMCA 1FTQA 1OXKB 5AJXA 4BEJA 4ZK6A 1A5ZA 4FCVA 3GRKA 1IULA 1KIAA 4H9GA 3GLGA 2EIHA 2UVDA 3I3OA 4YNBA 4ZAGA 3SBDA 5KYTA 3HCDA 3HZZA 5KTMA 3GLIE 3JQFC 1EUYA 1I2AA 3G0HA 2OLKA 1DO0A 2FMHA 3AC0A 3HKEB 4IRMA 5AK0A 1I30A 3LDFA 3P2MA 4LYAA 1ZFNA 4R84A 4XM1A 2AGVA 4F3RA 1E5XA 2GESA 3SE0A 5FBKA 3LK6A 1LDBA 4DSZA 5AVRA 1Z36A 4HLCA 4Q66C 4QU8A 3O82A 4MGHA 2YXBA 5I7AA 1QQAA 1KP2A 2PYDA 3N05A 2W0MA 2HQSA 2PMEA 1L1EA 3ZOKA 3QMMA 1CUBA 2PLNA 4WBXC 4A3SA 5JWOA 5JNTA 5JS8A 4INOA 3IXLA 4Q4AA 2B0JA 2O3TA 5MGBA 1N5DA 4DR4B 2PDAA 5DYNA 1ULZA 1NP3A 1CY2A 2CHQA 3EYAA 4JLBA 5KSYA 2ARKA 3BKXA 3CLTC 2RGEA 1LPSA 1E9BA 3EA4A 5LQJA 2QD2A 2AXEA 1GNPA 2VOEA 3EW7A 2WKQA 3H3JA 4I55F 4UBNA 3TLGA 2XB9A 1PEYA 1UKVY 4Y9RA 4GI5A 3E27A 3THOA 5K0CA 5B30A 2OCGA 1K7XB 1DBVO 4ZZ3A 2VHEA 2WP8J 3GBSA 1V5GA 2YRWA 1W0JA 2B82A 2QRNA 1FJ2A 3MPOA 4OO3A 4Q7JB 2X5JO 2WFLB 3B6IA 3X0DA 4BP8A 4J2HA 4MHTA 4CM5A 1I6MA 1ENZA 4MO2A 1HL7A 4WOCA 2UZ4A 3OD5A 2GYVA 1NVFA 2QU7A 2VRCA 4GU5A 4NSNA 1DCTA 3GDFA 3KJGA 2ZIVB 3Q9SA 3HXQA 4CEJB 3ZYZA 2X0KA 1DEAA 2C9ZA 2A58A 2I1WA 4DLSA 3ABRB 5JMWA 1Y33E 1J8FA 2XE8A 2ZWPA 3D0OA 2VF2A 2AXQA 2ZPAA 3DBHA 2TS1A 3HWRA 4RVDA 3EEYA 3F90A 3JQQA 2BEWA 3MJCA 5AWFC 4RIIA 1U3DA 3DW3X 5IMBA 1E0DA 2F9FA 2DHEA 1RM0A 4ALJA 1SCDA 2HRDA 2I34A 5FEMA 3ZHSA 5BN3A 1E1DA 3SVLA 4WGGA 4YCCA 4F2DA 4DC0A 2AD5A 4MRAA 4RA6B 2O23A 3RVQA 4HGZA 2RGWA 1Q2XA 2D3TA 3EDQA 2PZGA 2WDPA 3P1JA 3EQ7A 2CLHB 4JGBA 4KLRA 4Q24A 3EK2A 3UOWA 2MSCB 1P74A 2WT9A 3QX7A 3U80A 3UJBA 3VKVA 2C4TA 4K9QA 1YE8A 4I1OA 4XIFA 3LT2A 1K7YA 2FR8C 3H4VA 3FKSD 1X2BA 1VE9A 2JGDA 1XN1A 2HI0A 3QOFA 1ONOA 4GPZA 1KMNA 2IX3A 1T9HA 2LBPA 4MP6A 1TEXA 1P2SA 2ZCUA 4YRRA 2OLJA 3FYHA 3C97A 3ESXA 3R0JA 2GBCA 3UJ3X 5IZ4A 5A02A 1UBLS 3LXMA 3NDIA 5HJ2A 3WSTA 4L0CA 1HFJA 2O2JA 1T9ZA 1KHHA 1YZ3A 2UYOA 4EZBA 3G9TA 4L02A 1ZXXA 2C5SA 4IH1A 1GPNA 4NMWA 3ZD6A 1ZX1A 2LIPA 1JEAA 1PTJA 2I6FA 2GASA 5EQFA 2PT7A 1KR2A 5D8DA 1MZVA 4C04A 4PLCA 1E62A 5IJ9B 3K8OE 1BOOA 3PNYA 1NSYA 3LUPA 1XDBA 1QGOA 1CS0B 3Q0IA 2Q1TA 3QXSA 4B4VA 5L4LA 4FILA 3ONVA 3R0VA 2KM1A 4HFNA 3SHTA 4M1EA 4ECEA 3I01M 1RHJA 1YCFA 3KL2A 5LOVA 1V6SA 2Z2KA 1HDRA 2P3LA 2ZW9A 5KUTA 2FFRA 1BYUA 1DX6A 3L2OB 4J0JA 4X1IA 5MN4A 1Z29A 1ZVJA 3HUDA 1L5ZA 3EFOA 3FG9A 4OV6B 1ARZA 4HEA1 1GEGA 1VBFA 5EIWA 4LZWA 3MM4A 1KXJA 2LKDA 2VSXA 3DMYA 4C7JA 1H85A 1YONA 2HPZA 1FVXA 4JT2A 4A0SA 3AR9A 4FI3C 1HH4A 1F20A 4I2VA 4JC5A 1R66A 4Y0AA 3QHQA 4B46A 5HKAA 2MSKA 5EE9A 1CR6A 3UATA 2QZSA 1VCIA 4LXHA 3BGWA 3V4PB 1ENPA 2ZDHA 2XNDD 1PWZA 3EG5A 5H83A 4CUJA 1BDJA 1AV7A 1TM5E 2AOUA 2HRZA 4RVGA 3HBNA 1LPBB 3ACDA 2ACWA 1T4CB 2ZIUB 4XEUA 5F33A 3OM0A 3FHOA 4IXTA 2H31A 2W8BA 3EGEA 3P26A 1ST2A 4LZJA 4PHFA 2BGNA 3PS9A 4NJMA 2AG0A 2HK6A 3JQ9A 4UZFA 5J2TB 2ID8A 5AW8A 3HXKA 4PYRA 2AJLI 2DKFA 2J7PA 3HEBA 1EESA 4JYZA 2PIDA 1KPIA 1UIMA 2OVFA 3WMRA 2C96A 3JVIA 4YT8A 1E7RA 2HNKA 1QPGA 1JE1A 1USKA 1GGMA 3IVMA 4R40A 1KK3A 2CXOA 4D8VA 4U63A 4ZI7F 1GZDA 1PDWA 1ZD3A 3ONNA 4MRNA 4NZNA 4AUEA 1OLUB 2AQKA 2A3RA 4FGKA 1AK1A 4OTZA 4Z2YA 4JQSA 5A9TA 1ZAKA 2CDAA 4JL6A 1AX9A 5IAKA 4AZSA 4F4UA 2QLLA 2V45A 5TS2A 1ATIA 3BG5A 1Q92A 5ESWA 3SMQA 3V7WA 5BVGA 4G0MA 1SXPA 4RY8A 3EZ6A 1WTAA 4H6XA 5JBQA 4YJKA 4YR7A 2YWEA 4XH9B 2QTTA 1UJCA 3M6IA 5BW8A 3IDAA 1VMAA 1YQQA 2WT4A 3GJYA 3AEXA 4YCJA 5FOTA 4NMLA 3B53X 1XSEA 1V1MA 4NZMA 1AO3A 1IB0A 1SCBA 2JFPA 4EG6A 3NOQA 3MFYA 4KIFA 4NF2A 1RADA 2I7VA 4D25A 4LXGA 1LU9A 4RK0A 4KSBA 1PSDA 3WICA 1D2RA 1P2UA 3FZGA 2JCYA 3MGCA 4NBRA 3ZDDA 1F9AA 4R31A 1P8JA 4FX2A 4G86A 3BL6A 1RZRD 5IF9A 2L0XA 1XE3A 1BH2A 1LRJA 1TTPB 1KHTA 4F5DA 2IYOA 2WW8A 3HV0A 3KR0A 1NJ8A 4I36A 4HS9A 4M3NA 3U9SA 4CR6A 3G8YA 3EGDA 2A0XA 4AZ0B 1N0VC 3WQBA 1GD1O 1ZW6A 2MINB 4KDFA 5B1DA 5IVIA 3B60A 4CQNA 1VJTA 4N65A 3LI2A 4Q82A 2AMYA 2VZ8A 4LY6A 4FMCF 2B0CA 4GWGA 3I73A 1K8RA 4M1SA 1MHTA 4CI9A 1Z7EA 4CKBA 2LVBA 2IUTA 2ZITA 1YJAA 2WD7A 3TRJA 3GX1A 3O9MA 1TIBA 2REQA 1GIAA 3AMVA 1RWNA 3LC0A 5BWCA 1YFLA 4Z54A 4MOWA 5CHYA 2XRYA 3TAHA 3V1YA 2GRJA 3EPKA 4JP5A 1DRUA 3TB4A 1A97A 1D1TA 1YVRA 3O4HA 1YHZA 3ABSB 3AOEC 1BQ4A 2A9FA 3WVNA 1MG5A 1JJ7A 4KFSA 4BVJA 4EG4A 4TYNA 1MW9X 2C29D 3T12A 1MH9A 2JFOA 1U3CA 1SZCA 2HBZA 4D81A 4EMBA 1XTSA 2IBMA 3AP2A 5BSUA 1RPZA 2QV0A 2WB2A 3R8XA 1Y9AA 2UZIR 2ZBEA 3EQZA 3EXEB 4IJKA 4ZO8A 3UYKA 4OLJA 4B80A 2Q46A 3ND6A 4OSOA 3HYCA 3IQXA 4DLLA 1QYDA 1HMYA 3OIGA 4I8IA 2AFIE 2BKXA 3C3EA 4G97A 1S8AA 3RYFB 1FZQA 5HMMA 4L75A 1OYYA 1U7DA 1U7OA 3MWKA 2IXGA 4KXWA 1LDGA 4OOFA 4ZIRA 3U1VA 3B52X 5F5LA 1NI5A 4NBTA 4Y6RA 4O4HF 1U8CB 4LZNA 2G77B 4RACA 4MUNA 5AI6A 5HIIA 1V5IA 3CH4B 5DNAA 3ZW7A 1OAOA 2QN7A 1ORIA 3ME5A 4B3TB 3PFWO 1U2DC 3PUZA 4RZHA 4R71A 2ERCA 4IOLA 5MFPA 4OP3A 3VR1A 2RH5A 5TVKA 3WISA 4YRBA 5MN6A 3HCWA 4RDHA 1Z37A 5HTKA 3U3MA 2PQ6A 2PJZA 1Z22A 4KMMA 3FCXA 1XEXB 3CEJA 3OO1A 4B71A 2ZT7A 4RTPA 1NXVA 1EXDA 1VCNA 1AV6A 1GVHA 1C7FA 4B6RA 3UB3A 2FF7A 4HNRA 1C1DB 2JNWA 1H6DA 6PFKA 4DLXA 1FBTA 1ZD9A 2P0AA 2VPTA 3D59A 3FYSA 3K7EA 4ZO6A 4A1FA 5BUQA 4ASUA 3ZCSA 1A9OA 4RWZA 2EQAA 2VSQA 4FSXA 3T38A 3MHTA 3KAPA 1REQA 3DG9A 3SC6A 3I2IA 4FN4A 3NGMA 3UUFA 4YP5A 3NBKA 4LBWA 4E07A 2I22A 4Y1FA 2WVAA 2HJGA 4KWIA 5ALZA 1YR9A 1QS0B 4PZZA 4RA9A 4BJHB 4CDNA 1GGKA 4ZREA 4DIEA 4YAUA 2I8CA 3SK0A 3U6BA 1P5ZB 3BD9A 1XCBA 3HC7A 1H2WA 5DEOA 1P4HA 1DL5A 2CUKA 2DX7A 2OB2A 2WHYA 3OU2A 4G0YA 3D8SA 1H2HA 1Z0SA 4L51A 4U5XA 1M1UA 2WSMA 2B1RA 1EK6A 2I7XA 3O8NA 3R8FA 1JEDA 1FU7A 1JYFA 2Y1DA 2FN4A 4ZT6A 1WVGA 2Y2UA 3IAHA 3ZXSA 5FPSA 2VHXA 1V8PA 2D5AA 2YV2A 3BB3A 2OCIA 3WE7A 1YZLA 2VG8A 4KK3A 2DWOA 1HL3A 4MKHA 1UDXA 3M6UA 2WDZA 3PDHA 3X2EA 1MABB 1QHHB 3JYHA 4EF6A 3CLSC 5HYVA 1UXKA 3CKMA 3AJDA 4DLRA 1X1CA 2AK3A 1KZYC 3JQPA 5IBCA 3QNMA 4N0MA 3I1YA 3W77A 3DEYX 1UM8A 3JYOA 3FOWA 2D7DA 4AS1A 1XJ5A 1BH6A 4DR5B 4BQFA 4Y6SA 4BIIA 4X6YA 5BRNA 2CZCA 2I76A 4CLRB 3KR2A 2O2GA 1JHYA 1H66A 3W3AH 2O8NA 3PE3A 1U4OA 1WY5A 3PXEA 1FLVA 1B4DA 4AQDA 2J1LA 4I4LA 3E18A 2O6HA 5HCNA 5LDGA 3WBBA 5K5EA 1PG5A 2IV7A 1QYRA 2WIDA 2DPXA 4I5GA 4FYHA 1T9KA 2PZEA 4AO7A 5IVHA 2GEBA 2VHYA 1WUHS 2P6NA 2OQIA 4GD3Q 4JEHA 5ENDA 1HNWB 3DZDA 1XVIA 3GGCA 3MMSA 4YMGA 1QGYA 4A92A 2O2CA 2ZATA 3B1FA 4MQLA 3KT0A 4E33A 1X7ZB 3INGA 2FZVA 3CWZA 2HJSA 4NAHA 2XUZA 4KVGA 2BISA 2GM5A 3TUZC 4HNSA 4F2GA 3NRBA 1FYFA 1R88A 4I9NA 1EXNA 1WXHA 1GRVA 4J90A 2SNIE 3EG9A 4XD7A 5FI5A 4FXOA 4MMYB 1X15A 4JYMA 3CF4G 3G0CA 3TIVA 4ZYXA 1ZR2A 4KG7A 3AR8A 1B8PA 3DAHA 2QQGA 4KIUA 4DOMA 1MORA 1SUSA 1UBTS 1N2BA 2ZJ8A 4KUHA 3WO0A 1VRWA 2GK4A 3CWQA 1QANA 2ILVA 5TPWA 3I61A 2I6SA 3NQ41 3JD1A 4Y2XA 5DHQA 1Y0BA 4W5HA 4B09A 1PL0A 3PGA1 4I5EA 4TV9B 4C3VA 2FX5A 3W3AD 1U2GC 2Q8PA 3MINA 1XTVA 1WHTA 4AP9A 1JLMA 4RTKA 3NIDB 1TLFA 4S1OA 1EUCB 1SBZA 5E1OA 4YDRA 2EG5A 2QYHA 2YDYA 3N58A 3PTLA 4OXKA 1B43A 2IEBA 3S70A 1YTUA 4KQ9A 2FZWA 4UMFA 4AJPA 3WB2A 1A8SA 1CJTC 4UKDA 2AF4C 4HFJA 5LOVF 4P58A 1PX2A 1LF0A 3PC6A 2DUJA 4YO7A 3KPWA 3NAZA 1ODJA 4H7IA 2VUIB 3GDGA 2EQBA 5AHXA 1M0TA 1TK9A 2YNMA 4F4IA 4ZGWA 3OTWA 4IFBA 2ZTSA 3SEAA 4Q01A 3WHLA 3JPYA 2EJUA 4U7JA 4W4TA 13PKA 3OPVA 2Q3HA 4D4HA 1UM9B 4DLNA 3MA0A 2VRCD 2GZHA 2Q41A 3SLRA 4GOLD 3K35A 1TTQB 4MKFA 4OQNA 2WMNB 1KL7A 4D79A 5CA1F 3I9KA 2EL7A 1GNTA 1RXEA 3PT5A 4RORA 4U6NA 1AUXA 2FFQA 1AGNA 3KCQA 1GV0A 1O9HA 3BJIC 3M1YA 3HJBA 3RTCA 2OD2A 3KUDA 8GPBA 1YC2A 2QA5A 3H9GA 1O4WA 5TMEA 1IXRC 3GF4A 4K8RB 4J1TA 4RK6A 4CDRA 3RFCA 5F1YA 2HLDA 4JVSB 2IYUA 3PHGA 3NC4A 3HNOA 3TRHA 3HVIA 4IL5A 5C3UA 4HWRA 5BNZA 1X8LA 1T5OA 2HAEA 3ROKA 4UOEA 2JKYA 2V4MA 1DQSA 3LC7O 1Z4LA 3LT4A 1PTKA 4FSHA 4E7OA 4RFLA 3M6VA 1YL5A 3KKMA 5K01A 1WKCA 2WG2A 1NVDA 1LLCA 2ZTVA 3HSSA 5KKNB 3OJXA 1OWOA 3ROXA 2QR5A 1O1YA 2V7XA 2AMFA 1P2TA 2V7QD 3ONDA 1BEUB 1SHJA 1V3TA 3PF9A 4FDLA 5AVJA 2I91A 2XCTB 1FTGA 1LJ8A 2JIPA 4TYMA 3UB4A 4DR2B 3EH1A 4G5RA 2GWRA 4EHKA 1XMPA 2X8LA 2H18A 3DB1A 1NN0A 2GBIA 3EPHA 4C87A 1NT2A 5B12A 1VMKA 3H3FA 4L6AA 3ON5A 2J0UA 5FNVA 1LK7A 2P9BA 5FLEX 3CPJB 3Q15C 1E2HA 1FX0A 1NFQA 2JJ8A 3DAFA 2QVLA 4FFSA 3B1JA 2WQZA 4LMAA 3C4JA 4ZDIA 5C5CA 3OIWA 3DTVA 3K4HA 5KHLB 4BNZA 1SUWA 7ADHA 2WU4A 3C1OA 4TGLA 2B6NA 3JQGA 4HDMB 2Z3VA 5CIWA 1Q7BA 3RT1A 4MUIA 3A25A 4YC7A 1PFVA 1M34A 1MG0A 2UVPB 2IUYA 4CHGA 2O50A 4Q1VA 1XZLA 1WCIA 3HM2A 5E9AA 1A50B 3CZAA 3HSYA 2OV6A 1TGVA 3BHMA 3NKLA 3D7MA 3Q41A 4FX5A 3EVGA 3R5FA 5IHXA 1XL0A 1SC9A 4EMTA 2GNAA 1T0BA 2HWWA 2P9YA 5FWYA 2B8EA 3KFVA 1RU3A 1Z6AA 1NURA 3KE8A 1CHDA 4C3OB 5DGXA 2OORC 3GJ3A 3TIXB 1ZUHA 6REQB 3FJOA 1C0LA 2WQ7A 3R3ZA 4KI7A 3H16A 1V4VA 3WBFA 1CZLA 5E3JA 3A1SA 4OXQA 3EUWA 2XJ9A 4IBOA 4I81A 3GJ5A 1Y6RA 4YP0A 4QSHA 1IQ0A 1P5HA 3W1WA 4BO0A 2WG0A 3IPRA 5KNCA 3TFOA 3K0SA 5KO2A 3B36A 4H1HA 1XO1A 3QKUA 4TWAA 4L9WA 3LHFA 5ALJA 3T34A 4CMJA 4OU5A 3IELA 4KE9A 5E6RA 4U5QA 3D5TA 2IBSA 3PGLA 1WKBA 2FPWA 3GNQA 1SZJG 3RHTA 1QZ3A 3E9NA 5ITWA 3GY0A 1V8OA 2UYGA 4RYDA 5K6RA 3LUBA 3T0IA 3AERA 2F59A 3SVZA 5I7FA 4H35A 2Q3DA 4DZZA 3ADPA 3OZRA 1SG6A 2HU7A 5B3KA 2XTJA 5LP6B 2BGWA 1PVVA 3WV5A 3KOZA 5K0JA 2C9BA 2I4MA 1O97C 4KN9S 4KITB 2GI4A 2HPHA 2I2FA 2NLOA 2X0FA 4NBKA 4C29A 1N1DA 3GJ7A 2GN0A 2D8AA 2P9ZA 2R6JA 1KI9A 2YN0A 4G1BA 5AUQA 4PPNA 1IZ7A 1JJBA 2IY7A 2QTNA 3FLAA 3HLYA 4OREX 7AT1A 4YDSA 3WYFA 2PGOA 1CK4A 1NI3A 3HHPA 1RRMA 5HMLA 5IM4F 1P5RA 1NQOA 1Q5PA 2VAMA 3OE5A 3X1ZA 1EAMA 4UU0A 3WNVA 2W2KB 5G41A 4JENA 1YCHA 4U2BA 2R7LA 5BUZA 4I14A 4F8EA 1KJWA 4FQ5A 4ERNA 5PNTA 4EKGA 1EDBA 1NLMA 3IC5A 1ZITA 4F46A 2HSEA 1KYIA 3GUHA 4C20A 2BMFA 2BM0A 1W4AA 2V6GA 4WEOA 3QNUA 2FWAA 3MOIA 4U6QA 3ULKA 4JI2B 4ZA2A 3MERA 3RANA 1K7EB 3H9EO 4Y9SA 4QVIA 1RHRA 1WB5A 3DLBA 3DBOB 2YN4A 1A7JA 4IOJA 3SR0A 2O14A 4YLYA 3L9WA 5FWNA 1KMQA 4ISCA 4NHOA 4BQNA 4QPJC 2QYTA 1W5FA 3VZBA 2E4YA 3MCUA 4JK3A 4L5CA 4MPRA 5DI3B 4GI7A 1MDFA 2PD6A 2G9RA 16PKA 2DBRA 3V46A 3I9NA 2CXNA 3JAMA 3WWZA 2ZSFA 2XMZA 1OA0A 1ORVA 1KDTA 1AUVA 2E37A 1DJQA 1WBJB 3BWMA 3GLHB 4FCWA 5DI9A 1IVSA 5ALEA 2BKUA 3QOYA 1N4DA 4URVR 3MCVA 1FEZA 1U5BA 1UR5A 4S2EA 5CIYA 1MJNA 3TIGA 1NX6A 2XUGA 4ID3A 1JPUA 4UU7A 2COUA 4X44A 3PYMA 3LNTA 2O8FB 1F51E 1LTHR 4N3BA 2CL7X 1ZBQA 4B3SB 4RZUA 4XVQA 2PGDA 2XUKA 1AGXA 4OVKA 1ZN8A 1ZXLA 2GD2A 2P7HA 2GDJA 1SXIA 3E7FA 4J0EA 3CZCA 1M2OA 3BTVA 3OUZA 5I5EA 3OE1A 4IIUA 5E6UA 1CETA 2XCLA 3PHJA 2WHPB 1PL6A 1WEKA 2Z3ZA 1QHFA 3TTTA 1UANA 4LOLA 4DLTA 1Z4NA 1EH5A 2ZROA 2ODAA 5I8WA 1QGDA 3CLKA 5AW1A 1EM6A 3USCS 4LI3X 1U8EA 2A33A 2CUTA 3K2IA 4M54A 2VDWA 4AKTA 1XZ8A 5G1NA 1J2TA 4BE4A 1TO6A 2VC2B 4FNAA 4MWDA 1CDOA 1SIOA 3AB7A 4TXHA 3CX4A 3E3AA 3QI2A 4TQUS 1X74A 4G5OA 3NWJA 3IO5A 2I4OA 2P8JA 1GDDA 1CUWA 1GJRA 2C78A 2WY2D 4L4RA 3FF1A 3DGEC 1A8PA 1Z28A 4N5DA 1NAIA 4JEMA 3VV2A 3LJKA 4EB3A 1Z6YA 2Z6AA 1X14A 4IIYA 5B6JA 1MT0A 1W93A 2CNLA 1K66A 2IP1A 4MV7A 3DVAA 5B7PA 1B23P 1GPJA 2D6FA 5FOSA 2DG2A 2FG7C 5FULA 3MBOA 2R4QA 3FPCA 4G0WA 4G0UA 3ZWWA 5TQVA 1IN1A 4OK3A 1EVZA 1QRAA 3R7BA 3V8VA 3ITKA 1WXQA 2BEVB 3NNSA 4M0LA 1RKXA 4R3WA 1XAGA 1I14A 1DCFA 1M83A 1UC9A 1VA5A 2CMDA 3A28A 3CRMA 4G6ZA 4IV8A 2F1OA 3AJEA 2A1UB 5BYAA 5BW6B 4EBBA 2OFWA 3S2FA 4XWWA 1YBAA 3JALB 4K9KA 2DHCA 4XYGA 1EP1B 2OSVA 3LSTA 1NW9B 4ASUD 1H93A 4MWEA 2JGLA 3DV2A 2RKWA 3LQQA 5CCEA 2CDRA 3QG5A 1L5SA 1PLJA 3DFMA 3WYAA 5KWIA 2Q7OE 5JLAA 1GU1A 3JQBA 3IP1A 1U0OC 3H3XA 1BIFA 4KXUA 1PIWA 2BCEA 3TO5A 5HQTA 1BMTA 4PYQA 4O63O 3T1YB 1ZJJA 3MXTA 1SUEA 4PO8A 2IH2A 1QF9A 3CEHA 3H6HA 4Q18A 4BNLA 4QQKA 1A7UA 4PTYA 2QM8A 3D6VA 2AE1A 5JCJA 1LV8A 5K3BA 1NC3A 3TLMA 1SVSA 4NE7A 1F48A 3PGXA 1VCMA 2BHTA 4FW8A 3V80A 3WRXA 4A7PA 2D3WA 3CH5A 4BX3A 1XMOB 4ZVVA 4MPDA 2CBXA 3IMCA 2O7SA 5EWMB 3FDZB 2UUPA 1WB4A 5ALFA 1U3UA 3H1FA 4GXNA 4M8KA 4KQ6A 3DMPA 4OLAA 2G17A 1X39A 2ZSKA 2ZWVA 3COPA 2TRSB 1KDPA 1WUYA 1WMFA 3AHIA 4BLRA 1I3LA 5ALPA 3M1IA 4XUDA 4WNYA 3RUHA 1OC2A 3HXPA 3W3ZB 3O26A 4YV2A 2BV3A 5TGZA 3W90A 5B7GA 1BW9B 5CAEB 4NWIA 4P34A 2ZDQA 4TKUB 4BO3A 1R9GA 3WYNA 5F7OA 2B4RO 3VPBA 4F6CA 4ARSA 2AFHE 2EWMA 2Y1EA 3COYA 3G8BA 4PBTA 4QXOA 5JO0A 1C50A 1YRLA 3Q10A 5H0IA 3ZHTA 3U4HA 1A71A 3DAOA 2HSDA 4HI0E 1E1NA 2B5WA 2RGBA 3AV0B 3VVLA 4YALA 4M55A 4NENA 3NP9A 5CR9A 4Z4GA 4L4SA 4E4RA 1NTOA 1J97A 1I5EA 4KBYA 1OTHA 1CQJB 2HLHA 1M72A 4IGFA 3HVRA 5SICE 2XQVA 2JIZD 1L1FA 1HWYA 2FW8A 2A59A 4DA4A 4G85A 2QTLA 3NP7A 2JBWA 4DV2B 2R00A 5B1IA 4KQWA 2RHOA 4NESA 1YOVB 4Y9UA 1X13A 2C9MA 2BF7A 1P4SA 2ZJ1A 4BB6A 5FPQA 4TMFA 1CUSA 4TRJA 5GM1A 2V8BA 2P6MA 1KMHB 3PC4A 3UYLA 5KWEA 4RTJA 1JA0A 1NT4A 1F38A 3NVKI 2G5CA 1A9ZA 4Q3OA 3LK7A 1BOFA 1IZ9A 2Q3LA 2YN2A 4XD7D 1XV5A 4LZZA 3WZMA 4AC9A 1WD7A 2JBAB 3L5KA 3M1LA 4RHTA 3WL5A 1HE8B 5IBPA 1I80A 5BQFA 1MMFB 3AU8A 3FNGA 2QDXA 3H1AA 1L3BA 2WIBA 1T2AA 3HKEA 2V7PA 1Q6YA 1ZWLA 1XKXA 4D8XA 5AIBA 4R2XA 1MDBA 2VF7A 4LF6B 1R12A 3MQFA 3TW8B 2PH1A 3FWYA 4B83A 4XDYA 4IX9A 3DZKA 4OHPA 4RPCA 3W2IA 2ET6A 5AQEA 3R9XB 1O08A 2QE6A 3M70A 1NJ1A 1A9PA 4JVOA 2A4KA 1RXSA 1SGWA 3AZPA 4L95C 4OP2A 1RWWA 1NBEA 5HRUA 3SKVA 2WFMA 2XA2A 1XCMA 4J4HA 2YFKA 4AF6A 1LNQA 3MSXA 2XYHA 3PICA 4Z3OA 2QRLA 4IEIA 3RK4A 5M34A 3PQEA 2SBTA 2XSZA 1FMCA 1W5EA 4S2UA 1ZOOA 5LL6P 5C32A 5BNTA 2O0LA 4DJ5X 4L3OA 3JD3A 1TKAA 4RXMA 5D00A 4QSMA 1MXFA 1AUQA 4N6NA 3TTYA 1PAUA 1CUYA 3RWMB 1JILA 5K0TA 2CNBA 1KZ7B 3CSSA 3FSRA 1XLTC 2JJ2A 2QRHA 4DA9A 2ZSAA 4OHCA 2ERYA 3ILSA 1UPXA 2H0RA 3PXGA 3SC4A 5AOCA 2IYQA 1MB9A 1LTQA 4J1NA 4M53A 4RW0A 4DUGA 4M89A 4EHNA 1O0BA 2YBDA 2OXCA 4CCYB 4ZTBA 3WJ1A 2YV1A 1V16B 2RAUA 1M8FA 2RBKA 3WP1B 1TYAE 2ZRDA 2WFLA 1CX9B 3ZYCA 2A9KA 3RBXA 4EUSA 1QKJA 1JPJA 5CLJA 1Y8QB 2G0NA 2AMJA 4NU6A 5DTQA 3VPCA 3ASVA 4QPDA 3IKMB 3KSMA 3ZZTA 5AVYA 2CJWB 3KXLA 1N8TA 1NTRA 2O0MA 3L0YA 4ZT5A 2I65A 4TT8A 3SBEA 4ER3A 5IVKA 4K87A 5EMHA 3CT4A 4MEBA 3HVJA 4JL8A 1RZVA 4KPYA 3KOXA 3ICVA 1KRXA 2QI9C 5AMXA 4Y6LA 4FFVA 1M1YE 4PX2A 2C5GA 3COZA 4ROSA 1Q14A 3AEQB 4JT9A 3QVWA 4JI5B 4D0RA 4F06A 1Q0TA 2ZR7A 3L8HA 3HDGA 3CISA 4HL6A 4PQEA 4ZC1A 2VJNA 5CB0A 2WM3A 1BX3A 4J0GA 5A1TA 4BO2A 5BW4A 1JKJB 4JLSA 3P7MA 4YMHA 5JC1A 1Z8HA 2NSDA 4RA6A 2DQSA 1B26A 2QL9A 2YOFA 4U7FA 5CW2A 5NLLA 4NBWA 3UMYA 3NPMA 1R18A 1NOIA 4AZ3B 3BIFA 4XM2A 1ZNZA 1PLKA 3I9JA 3WRYC 1T6XA 3KQTA 4REQA 3BGIA 2HIGA 3UFBA 1JLSA 2QX8A 2YFYA 3FAZA 4EY3A 3DFKA 2AW5A 1OT3A 3U5ZB 1KH3A 4M7OA 1PN3A 1Z7GA 3RVOA 2FSPA 5FTLA 1T9GS 4A10A 3WQQA 2PZAA 4MQUA 5CLIA 3AFGA 2QLBA 2VZLA 5C18A 2DJ5A 3ETHA 1VKJA 1QO0D 2F8MA 4A15A 1UEJA 4RJLA 4AK9A 5AD1A 3K0BA 3VXKA 1O58A 3OCCA 5D84A 3FUVA 1JIVA 1PBNA 2H9AA 2Q29A 3ZWQA 5IJ9A 5ADWA 3AI7A 1J8DA 2J3EA 1CS0A 4TWIA 2FZLA 2QUKA 3GZNA 4X6LA 5J40A 4QREA 1N7IA 5JDCA 3EIQA 3C85A 2PUCA 5ILOA 1RAHA 5FFMA 5FLXA 2JLVA 1QHEA 1F6BA 4FGLA 1QRUA 3KDPA 2OOKA 2IVZA 4HH0A 3JQDA 4ARCA 1O6ZA 3EQ6A 4HXEB 4LZOA 1OAAA 4B9EA 1QF6A 3PWZA 3LDHA 4NCXA 8ATCA 4H7FA 4OP1A 5ALWA 4YCNA 3DTYA 1OPRA 3ROPA 5KNLA 4K26A 3DVRX 4GNKA