4DNFA

Crystal structure of the cftr inhibitory factor cif with the e153q mutation adducted with the epibromohydrin hydrolysis intermediate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
296
structure length
296
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMQAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative hydrolase
publication title Visualizing the Mechanism of Epoxide Hydrolysis by the Bacterial Virulence Enzyme Cif.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 112
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dnfA01
3JWEA 3I2HA 2WG1A 4AMZA 2WG2A 4J0HA 1UKAA 1W76A 4V2IA 3HXKA 2XE4A 4KYVA 4KEAA 3E0XA 1DT3A 2CKMA 4KRXA 3BJRA 1HDEA 2OPHA 4A16A 5CTAA 1CRLA 3SX4A 2BAGA 4GW3A 4IH1A 1HL7A 1L7AA 2C5GA 1XQXA 4A23A 2FJPA 5ALJA 4DNOA 1CR6A 3GFFA 4X6XA 1A8QA 1EDBA 4FOLA 1DTEA 2H7XA 1TCCA 3H1BA 4FHZA 5AKHA 5AKYA 5ISMA 1DWPA 3LS2A 4BYMA 1THGA 2I78A 4MQMA 2WIKA 2WSLA 3WKBA 4EBBA 3ZLTA 4KE7A 2WFLA 1LPPA 1GPNA 5BOVA 5CXXA 1GGVA 1N1MA 3GROA 3R3YA 5HQ3B 5ALNA 2OLEA 4HRYA 2H7CA 4XIIA 4H7JA 2WIGA 1WB5A 3WKEA 1ODSA 1YA4A 2XUIA 2XMSA 5HF6A 2GYUA 2HIHA 1ZD4A 4B0OA 1QIIA 4AZ0A 4BB0A 1VZ2A 4C01A 4Q3KA 1ISPA 4FNMA 3DL7A 1EDDA 4ZWNA 4XX1A 2FUKA 2OGZA 4J3JA 2Y2VA 5IVDA 3D2BA 2XUJA 2VT7A 4G1FA 4BDTA 2OCIA 2Z3ZA 4IHAA 1B41A 5T4BA 3STYA 1Y7IA 5A6VA 4H0CA 2ZSIA 2BKLA 1FFEA 4H7KA 3SC2A 5JIBA 1XZGA 5FXMA 3CN7A 5AOBA 5C7YA 4YX9A 1A7UA 2EEPA 1LPMA 4Z49A 3V1MA 4TGLA 3QMMA 1CLEA 3KOOA 2VJAA 1X2EA 1UXOA 4M0EA 1B6GA 2OGTA 2RIPA 3HI4A 3E1GA 1HLGA 3PE6A 5EIHA 2ORYA 3M3DA 2PU7A 4CFSA 4B84A 5ALRA 1THTA 5C81A 5DJ5A 3SWWA 2D0DA 1YCDA 1LBSA 3GUUA 5SYNA 3S8YA 2ZVDA 1EB9A 4AX4A 3C5VA 5AI6A 1YB7A 2XUGA 5FV4A 3C6ZA 3EQ7A 1RP1A 5AKKA 3IUQA 4ARAA 1VJ5A 4G8DA 3C6BA 2QZPA 2DSNA 4K2AA 5AK3A 5ALLA 3FYUB 3OG9A 3H2GA 5KWJA 4X85A 4BBZA 1IZ8A 2V9ZA 5HKAA 5AI9A 3D2AA 3C6XA 3B5EA 2HA5A 2BUBA 1CUIA 1G5FA 2Y6UA 3DL4A 5JD5A 3H2KA 4QLAA 1F6WA 3QYJA 5C8XA 1TCBA 1UT6A 4QDXA 2HA0A 3GBSA 4DGQA 2WTNA 3KDAA 4RNCA 4G8CA 1S8OA 5I9IA 2PL5A 3G9XA 1CUUA 2OAEA 4BE4A 4BP9A 5JASA 1AKNA 2WUEA 3KSRA 1AZWA 5EHQA 1YB6A 4X95A 1FSSA 1XRRA 2IITA 2XQJA 3STTA 1CQZA 1ODTC 4J0CA 2QMQA 3WYNA 4UFNA 3JYHA 1DQZA 4WFIA 2GBIA 1DX4A 1LZKA 1LPSA 2B61A 4D9JA 1R4ZA 1P0QA 2WM2A 5ALWA 2JBWA 2O7VA 5AI0A 3FLEA 3FWHA 4C4XA 5ALMA 3B3QA 4BVJA 3A2LA 3H18A 4H77A 1CUGA 5CURA 1U8EA 2R8BA 2PKYX 3WWCA 3K2IA 5FDFA 4GDMA 4F60A 4J0JA 4QDUA 4ZI5A 3T4UA 2B9VA 3DD5A 1HBJA 5K3DA 2IIVA 3G9ZA 1YAHA 5AH0A 3H04A 1ZI8A 5CH8A 3VJLA 1LGYA 1GKKA 4K6HA 4LKOA 2CEKA 3V9AA 3AJAA 2D5LA 4G4IA 5BWCA 1XROA 5HF8A 4X3CA 3WA6A 2Y1KA 4J0DA 4F21A 4U2GA 5AKGA 1W4LA 1X70A 2BGNA 4OB6A 4P92A 4PV7A 3WKAA 1DWQA 1YR2A 4P93A 5A71A 4JYPA 4G9EA 3WL8A 3WYDA 3V1LA 1PJAA 5IVKA 2HU7A 3I6YA 5ALPA 2PSJA 5K5EA 5ALTA 4OYLA 4OU4A 1E66A 4HTAA 3I2KA 3BE8A 4E15A 2JF0A 5AKXA 1AMNA 1AQLA 5FPQA 1XZEA 2OG1A 4G5XA 4CCYA 2HADA 3PI6A 1Y37A 4FNGA 5FPPA 4L3WA 2XUKA 4UBLA 4Q05A 2PPLA 2WHRA 1LZLA 2JGKA 4J0KA 5T4HA 2B20A 1IUPA 1TK3A 2JEYA 1K4YA 2WIJA 1VE7A 2ACKA 4C6HA 3Q8WA 3WK8A 4PSUA 3ESDA 2GZRA 5KBYA 4OB7A 5ALZA 4W1RA 4GWLA 5E4YA 3GZJA 1QIDA 4EB0A 4E14A 4WDRA 4NVRA 3WLAA 2WU4A 2PVSA 1XFDA 4NMWA 4JUIA 1BEEA 4BRSA 4ZV7A 1R9MA 3I1YA 1GXSA 2WU3A 1DWOA 1X2BA 3NUZA 4CG2A 3BDVA 1AGYA 4JYMA 4XVCA 5T4FA 3FNBA 2WUGA 1SFRA 3WQHA 1QOZA 3AILA 2WHPB 2VEOA 1QIFA 2WILA 4DNQA 3TGLA 1WOMA 1FJ2A 3AINA 4KR0A 4K6GA 4CIAA 3HZOA 5ALHA 4KRYA 4UBIA 2LIPA 5ALYA 4L9AA 3A2NA 4DNFA 5K3FA 4YASA 4M0FA 5DYWA 5ESRA 2G5TA 3D4LA 1UK7A 3B12A 5HFNA 4I4CA 2XI4A 4AO7A 1G42A 1XQYA 4H7IA 2XMGA 3STXA 2QM0A 1U65A 5LYYA 3H2JA 1MTZA 1R1DA 4PSCA 4IH4A 3VISA 4BATA 4FLFA 5ALKA 4EA6A 1FFAA 1JFRA 4MWSA 2HU5A 1YSCA 5E4TA 1PV1A 1J1IA 1XQWA 4Q1VA 1VE6A 1MN6A 1JMYA 4DIUA 2CB9A 1I6WA 3BL8A 3C45A 2H7YA 1H2YA 2WIFA 4OD0A 1HQDA 1K6EA 2PUHA 3I1IA 3FYUC 1WPXA 1R88A 1ZIYA 5E2IA 4CG1A 3WK9A 4BRZA 1TCAA 2HA7A 2GBCA 2VJBA 1VLQA 2XUQA 4MJ3A 3PUHA 5DTJA 3KXPA 1CUDA 1E8MA 4AN1A 2C7BA 2Z8XA 5AJHA 2WLSA 4J0GA 5ALGA 1ZICA 4GLBA 4MEBA 4DYHA 2O2HA 4HXEB 1TKRA 4KE6A 3IUMA 4IQ4A 3R41A 5JATA 3WKDA 3ICVA 4YK7A 2BFNA 2Y2UA 4Y2JA 5ALXA 4B6GA 4HXFB 4W1SA 5EI5A 1ZJ5A 4B80A 4F5ZA 4GEGA 2EDAA 1WHTA 4UBJA 3WIBA 2ROQA 1YS2X 4GECA 4PF1A 1J2EA 4CG3A 4EY7A 1JJIA 3R3XA 2QXTA 4MYDA 1LBTA 3S2ZA 1WHSA 2O7RA 2XMRA 5FKJA 5ALEA 1XLUA 3R0VA 4OUKX 2AXEA 1C4XA 4C87A 4QNNA 1BN6A 1H2XA 4B9EA 4U2CA 1RWQA 4M0MA 5FUMA 2BGRA 3I2GA 4QWMA 2QJWA 3W04A 4B81A 4FKBA 5CW2A 1UFOA 3FBWA 3FYTA 4UHCA 1QFMA 1FFBA 5FOQA 1OILA 4EUSA 1VA5A 1EINA 3PFBA 4QZVA 2X76A 4INZA 4QLOA 2WQZA 5HZGA 2XUAA 3TRDA 2QXUA 5DLPA 1MAAA 4UBKA 4G4JA 1W75A 2QTBA 3MUNA 1GQRA 5SYMA 1T4MA 4QDOA 4HVTA 4XJVA 4UHHA 5JAOA 3AIMA 3MGAA 1NX9A 4EY4A 2HL6A 4ROTA 3V48A 2RHWA 2VTVA 3WK6A 5JAUA 1ZD2P 2Q0XA 4FFVA 2AJDA 2J3DA 5EIEA 2C58A 4QDTA 3FLBA 4C4ZA 3I6MA 4GXNA 1K63A 1XZJA 2I3DA 1QIMA 4GHWA 1CUEA 1CUXA 1KEZA 4DSZA 4Y2QA 1NU8A 1TIBA 5AM2A 4BTLA 5I7UA 3RARA 1MNAA 3W9UA 3F96A 2PUJA 1E8NA 4WY8A 1MX9A 3C5WP 4RE6A 5AM1A 1R3DA 3RK4A 1EDEA 3G7NA 1GKLA 1C7JA 2HA4A 3WK4A 3DKRA 3BIWA 1GZ7A 2VATA 4W1PA 5AI8A 3D0KA 1LNSA 2ZSHA 5AO9A 4UPDA 4H18A 3LIIA 5A7GA 3EBLA 3CXUA 5I8PA 5ALOA 5CXUA 4QWWA 2OGSA 4KAAA 1ZI6A 2HFJA 3U1TA 2P8SA 2WJ4A 1Q84A 4HS9A 2ZJ6A 2QRUA 2G4LA 2WUFA 4UBOA 4Y7DA 1XRQA 1CUCA 3VVMA 5KWIA 4OCZA 5LZ8A 5ALQA 1O6GA 5D7BA 5D3ZA 2OXEA 3F97A 1H22A 4C4YA 2XDWA 3LIPA 4QDZA 1BRTA 1XZLA 3DOHA 3NOXA 1QZ3A 5AM0A 1GPLA 1IUNA 1SOMA 3IUNA 4I3FA 5JZ9A 3O4IA 3FCXA 2ZJ7A 1CPYA 2VAVA 4AZ3A 2OQIA 5LIPA 1XZMA 1EI9A 1W1IA 4WDQA 4LYDA 1W52X 1QIJA 3VXKA 4Y2SA 4FMPA 4OYYA 4BC0A 3KWFA 4X94A 1MO2A 3VJMA 3O95A 2XMZA 1CUSA 1MT3A 4AXBA 2UZ0A 2XQFA 1EHYA 5LP1A 1E8DA 2DHEA 1GPKA 3H1AA 1ORWA 3BF8A 3OPMA 1DQYA 3P2MA 2JGMA 4FTWA 4UFPA 3V1NA 4X93A 1CIJA 2PX6A 2WKWA 5CH3A 2AJ8A 2JGEA 1K5PA 4DNPA 3DDUA 2WUDA 2HDWA 2Y6VA 3AZQA 4X6UA 5CBKA 5D3KA 3D2CA 1A8SA 4MQLA 5AM4A 4DSAA 5AM3A 5AIAA 5JD6A 3CCCA 3EF3A 5K3CA 3BDIA 1ORVA 3ESBA 3O9VA 1CUZA 2WJ3A 1BROA 1SCKA 1M33A 3CCBA 2GBFA 5AK5A 1H2WA 1Y7HA 3BJMA 4UHFA 1WCYA 4BZZA 3QPDA 4B85A 4PSDA 2J3QA 2ZYIA 5K3EA 1CVLA 2GBGA 4B82A 1TAHA 2ZYHA 4MEAA 1QO7A 4EY8A 1E89A 3WZLA 2VT6A 3WKCA 3O4GA 5JD4A 1YS1X 2NW6A 3FOBA 3PUIA 3ZLUA 3HABA 4N8SA 5ALUA 3IULA 4DMKA 4E11A 1CQWA 1CUAA 1IUOA 1JJBA 1ZGBA 3QPAA 3A70A 1XZDA 5IVHA 4ETWA 4OB8A 4UHDA 2PSDA 4KACA 3M83A 3C70A 2RHTA 5A62A 4TVKA 3QH4A 3QMWA 1QJ4A 5EIAA 1CFJA 5AI5A 1F0PA 1A88A 2GZSA 1WB6A 4N8DA 1U2EA 1DX6A 4CCWA 4WCVA 1QIEA 4PW0A 2DQYA 2H1IA 1DT5A 4HRXA 4MXDA 3QVMA 2G63A 1QTIA 3QZUA 3STVA 3FSGD 4J03A 5FRDA 3HJUA 4IH9A 2QS9A 4X00A 3WL5A 5AKJA 3NWOA 1N5MA 3HC7A 3E4DA 3G0IA 4B7ZA 4CCYB 3LP5A 1R9NA 3W2TA 4UFOA 4PNZA 4WFJA 3VKFA 3WK5A 4RGYA 2DHDA 1ZI9A 3F67A 4HXGA 2IX9A 1EK2A 4NZZA 1BU8A 3HACA 2PSFA 1Q0ZA 4X7BA 3DLTA 2Z3WA 4Y2PA 3OTQA 3K9BA 4X97A 5JALA 3R3ZA 1BCRA 1AUOA 1NU6A 5DNVA 3QM1A 4FLMA 1LPAB 5AP9A 6YASA 5CT8A 3M81A 5AICA 4K5QA 3WJ1A 1CUBA 1EH5A 3HSSA 4J0IA 5JAHA 4P9NA 2QKYA 4S0XA 2VJCA 2C0QA 3ZWQA 1YAJA 3N2ZB 3DEAA 3ED1A 3G8YA 4ZXFA 3IIIA 3W05A 5C8ZA 1MPXA 1E5TA 1SCIA 2ZYSA 4Y9SA 3WI7A 3FCYA 1SC9A 1CUFA 1OXMA 1ZJ4A 2J4FA 1QIKA 2PSHA 1QLWA 3C8DA 1JMKC 5LKAA 2OCLA 4BE9A 2W22A 4EZIA 5LZ2A 5YASA 2VF2A 4N5HX 3IURA 2XMDA 2EDCA 1H2ZA 1LPOA 5JAPA 1ZGCA 3ANSA 3IB3A 5AK6A 4X71A 3E3AA 2XQGA 2BUCA 2JGIA 1U4NA 5K3FB 1N5RA 5CMLA 3I2IA 4UHEA 5HCUA 2XUHA 4BVLA 1MJ5A 5LKRA 5AK4A 2JGLA 4O08A 4Y2RA 1N8SA 1VKHA 1CEXA 4ARBA 1WB4A 2CBGA 3DCNA 4AB1A 3R3WA 2V98A 1E3QA 3ANTA 4QE3A 2HM7A 5HKBA 1UWCA 1W6RA 3OC0A 5J3JA 3OURA 4L72A 2BJHA 1TQHA 3KD2A 4Y2YA 2PM8A 4BCCA 5HF5A 4KJXA 3WWPA 2B4KA 5AM5A 2ONCA 4YPVA 3F98A 4BCDA 2YXPX 2G5PA 2XUFA 3C8HA 2QT9A 5DNWA 3GA7A 3C6YA 4J7AA 5CH5A 3K6KA 1C7IA 3BWXA 1BN7A 2PU5A 4WJLA 3VVLA 4JH0A 1EX9A 4X91A 1XQVA 4HZGA 1VOTA 2VSQA 5EGNA 3BXPA 1P0MA 4MWTA 3UUEA 5E4JA 5AOCA 2DR0A 4DM7A 3PF8A 3VJKA 3BF7A 2O2GA 5EHXA 4H7EA 1Q0RA 5DYYA 2E3JA 4UHBA 2YASA 3AIKA 3W06A 3H19A 4FDMA 1ZD3A 1EVQA 5AKEA 3IDAA 1UKBA 3IVMA 3L1IA 2J4CA 5HQ3A 3STUA 4F0JA 2C4HA 2CMFA 1XZFA 3WJ2A 4GBGA 4B83A 5IH7A 1L7QA 5FP0A 4BC1A 4RE5A 5HK8A 4U2BA 1JI3A 3O9MA 5LZ5A 2JGFA 2HA2A 3QITA 1HPLA 2HRQA 3QPCA 1MX5A 4FWBA 4IO0A 3RKSA 4H7DA 5JADA 1ACLA 4BZWA 2VQ6A 3WMRA 1XZHA 3QBJA 3WWEA 1EB8A 1MU0A 2ACEA 3DYIA 3SK0A 5ALSA 3ICWA 2ECFA 1BE0A 3JW8A 2YH2A 4LIPD 2BCEA 4LHEA 4FFWA 3ZI7A 3X3HA 5F4ZA 3H2IA 4BCBA 1SCQA 3WL6A 3Q0TA 3GELA 1FFDA 3DOIA 3W9BA 2X8BA 4JNCA 3H17A 1GQSA 2WFLB 3RLIA 1XZBA 4TPKA 3TJMA 4EY5A 4ZV9A 1WM1A 4X92A 4FBMA 3T52A 1CUYA 4X90A 1EK1A 4PO3X 2XLCA 2WFMA 1QTRA 1MX1A 3N0TA 4AO8A 4KE9A 1MNQA 4RPCA 4GI1A 3L1HA 2DCMA 3ESCA 1UOOA 4LXHA 2RONA 2ZYRA 5JZSA 2QUBA 4C89A 3QMVA 4ZGBA 1F0NA 1QIHA 2VAXA 5AKLA 2XLBA 2ES4A 1WPRA 1J06A 1BCSA 3ILSA 4Q3OA 5CT6A 1OCEA 1ACJA 1ZD5A 2RI6A 2DFPA 4BVKA 2FX5A 2AJCA 1QE3A 2PSEA 4OSEA 3LCRA 3FYUA 3WK7A 1AC5A 4Q82A 2C5FA 3HLKA 1H23A 2XUPA 5A7FA 3D7RA 4QA9A 1XZAA 1G66A 1CV2A 3D3NA 3STWA 2GYVA 4Q34A 3G0DA 4L0CA 1XRLA 1XLVA 4KAFA 3DJYA 1TRHA 1YA8A 4KAJA 3DKKA 3WIOA 5DTIA 5DWDA 3R3UA 4Y2XA 5DNUA 2I3ZA 2QVBA 1J07A 4U2FA 2QJRA 4AQDA 1XZCA 4BAGA 2XQKA 1LPBB 4ITVA 3D5EA 2V97A 5A2GA 5IVIA 5ALIA 3TEJA 3IA2A 3O4HA 4CI9A 1R50A 5HFAA 2XQIA 3AFIA 1JU4A 2XMCA 1CUJA 1CUVA 3ZLVA 2WG0A 5HF9A 4P08A 5AKZA 4LYEA 5D6OA 1UKCA 4W63A 3YASA 3WA7A 2OCKA 2XB6A 3G0CA 1AURA 3DS8A 3AIOA 1IVYA 1UK9A 2ZJFA 3R3VA 5EHNA 5CT5A 1QIGA 4BAUA 3G0GA 1JJFA 3HYSA 3V1KA 1CUWA 1UOQA 4UBNA 1DU4A 1K8QA 4E46A 1P0IA 2XUDA 3G0BA 3VDXA 4U2EA 2CUTA 2RGUA 1VXOA 3EQ8A 1IMJA 3O4JA 4XWGA 2VJDA 1QGED 3F9CA 4AO6A 3ZPXA 1PFQA 2QR5A 5K3AA 1QONA 4LXIA 1DINA 2OQVA 2FJ0A 1UZAA 5JARA 4OPMA 1A8UA 2Z8ZA 5H3HA 4CIBA 3F8SA 2CZQA 1D07A 1EA5A 4LXGA 5ALFA 1XZIA 1EXWA 2HA3A 1O6FA 1UOPA 5JANA 2XMQA 3OOSA 4Y2TA 4K6KA 3DYVA 3LLCA 1LLFA 3UMJA 1USWA 4KE8A 1G4HA 3PF9A 4BTVA 4G4GA 1BS9A 5LLSA 5KREA 5AHXA 7YASA 2PBLA 2AJLI 2W6CX 1CUHA 4NS4A 4WY5A 5AKIA 4ZREA 1HKHA 2O2IA 2GYWA 2JEZA 1JT2A 3MUOA 1P0PA 1XRMA 1EVEA 3AZOA 2YYSA 3KWJA 2I03A 4G9GA 3OM8A 3I28A 1QFSA 4EHBA 5AI4A 2WTMA 3I6ZA 3MVEA 2OCGA 4HAIA 1XKLA 1RYYA 2WIDA 1VXRA 1Q83A 4DLNA 1KU6A 3NGMA 3RM3A 4W1QA 2DHCA 5ALVA 3R40A 1JKMA 2DQZA 3EQ9A 2WHPA 4H7FA 4B9AA 1BEZA 1UK6A 2XUOA 4N8EA 4AN0A 1ZIXA 2CJPA 1VA4A 2H9YA 2AJBA 5LZ4A 3O0DA 4OU5A 2HU8A 4QEKA 2QOEA 2HFKA 2RAUA 3BIXA 1XKTA 2X5XA 4N5IX 4H35A 5HK9A 2BUAA 1XRPA 3WWDA 4I19A 5ALDA 4W9RA 3U0VA 5EHZA 3M82A 2K2QB 4MYSA 5IKXA 4A5SA 3UUFA 2HHAA 2OAGA 1AX9A 2R11A 4DMFA 4FLEA 3PICA 4G8BA 5CRIA 3EIOA 1Z68A 3AZPA 5DYTA 3IBTA 1YASA 1ZOIA 5CT4A 2WJ6A 3PDCA 5FLKA 3G02A 5CT9A 1VZ3A 3FLAA 5A7HA 3HEAA 1ODCA 2XMBA 2V96A 4Y2VA 3WL7A 4H7HA 4AMYA 1XLWA 5BWBA 1XRNA 4JEIA 3I2JA 1ETHA 3H2HA 1T2NA 5EFZA 3H0CA 2XT0A 4FBLA 1JU3A 3FAKA 2WHQA 5LZ7A 4BAZA 2QUAA 3A6ZA 3ESAA 5LZ9A 2JGJA 4BP8A 3G9TA 3AUKA 4WFKA 3I2FA 4UBMA 1IZ7A 4DMCA 4Q3LA 3D59A 4BDSA 2HRRA 3HRHA 5T4EA 2WFZA 3DNMA 3FVRA 1XZKA 1UK8A 4X6YA 4DTCA 1KU0A 3PFCA 5K3BA 2C0PA 3L1JA 4B0PA 1MAHA 3C43A 4Y2UA 5C8VA 2HA6A 1QO9A 3C87A 4ZRDA 4UUQA 4PQEA 3FVTA 1GT6A 5BV7A 4U2DA 5AOAA 1LPNA 3IUJA 3ZV7A 1F8UA 4EY6A 3CN9A 1L7RA 4DMHA 3FSGA 2JIDA 3A2MA 5AIBA 4C88A 3DQZA 2VA9A 5JYCA 2Z5GA 3WWOA 3G9UA 5JZBA 1FFCA 3WZMA
chains in the Genus database with same CATH superfamily
3JWEA 2WE8A 4GYWA 1WR8A 4JMLA 4ZC8A 2KJQA 2WP0A 4DV7B 2YWDA 3RC8A 4DF3A 4Z7OB 3SF0A 3CZAA 4P7JA 3G5UA 1LSSA 1W2WB 1C7FA 4NKRA 3C85A 4Y1FA 1C3LA 2AC4A 3G2LA 4AMVA 2Q29A 2IGTA 3L93A 4X20B 3UJBA 1D8TA 1ZH6A 2OBNA 5BQFA 5KTRA 3T3DA 2B8WA 2HU2A 3KZCA 1Z74A 1VIAA 1GT91 4MX8A 3PXGA 1GPMA 1A4UA 3D4IA 3K8QA 4KEAA 4EFMA 1SCUB 2CKMA 4Y1GA 5TE9A 1K7XB 3Q3JB 1ICEA 1WJGA 1GITA 1NHGA 3WLQA 2GPTA 1RYDA 1RIFA 5K0BA 4L8LA 3O7MA 2NU7B 3GJXC 4K6CA 4K7JA 2ZRMA 4IZOA 3FWKA 4WN9B 5BQOA 4BQSA 2IRWA 4GXQA 2XY4A 3IELA 3N0VA 3JQAB 2FPMA 4ZI2A 3P4XA 4NAHA 3U4CA 2XB9A 2CFSA 4P82A 4QQKA 3SVTA 5ERGB 1DBSA 4URHA 2VJMB 5DOVA 4A23A 4XFKA 1LA2A 2ABWA 5IK2A 2M6KA 3X1ZA 3DL2A 4M0LA 2FJPA 4DNOA 4RY2A 3ZV6A 1GA4A 3SZUA 2XOEA 1X8XA 1OROA 1A8QA 3G1WA 4O8ZA 2PGNA 2FPPA 4EG4A 4Q7MB 1IJKA 4TXJA 1E5DA 1SVIA 1J56A 2H7XA 3OLZA 2WWIA 1V5EA 4CF6A 4E13A 4FHZA 3U9SA 4NULA 1YDHA 1TK9A 2HPZA 2V0NA 3JU3A 3P9QA 4E09A 3O73A 4DW8A 3P5BA 3MA0A 1WXXA 4P4SA 3GLRA 5CVEA 2CGEA 3L6UA 1OFUA 4GOND 4KXYA 3BORA 1TJ5A 3ECCA 1DIBA 3ELBA 1KDPA 3Q3GE 1WQ4A 2WSLA 1B23P 4OY3A 3TLGB 2X0RA 1ZPDA 3PFIA 4ZYWA 1KMHB 1X7YA 3ELYA 4HDKB 1N3IA 2C03A 1TEHA 2G72A 4MUYA 4NX2A 4OOEA 2BEKA 5BOVA 3QTBA 1GGVA 2JFGA 2Z2JA 3RUFA 5TMPA 3MLBA 2QROA 3GROA 3MOSA 4RTSA 3C3BA 4M1TA 2CFOA 5J23A 2OLEA 3O75A 3VQTA 1ZUNA 4AL4A 2H7CA 4N0DA 2YVKA 3EVCA 8ABPA 2JCVA 1PJSA 1MGPA 3OZFA 4XIGS 4DXHA 2YNMA 4ESHA 5B3JC 4CUKA 3KRTA 3IDZA 3TW6A 1P4RA 3WKEA 4AULA 4P2GA 4C0BA 1M8JA 2R7LA 2NZWA 4YJGA 3ZJ5A 3QW2A 4G9BA 5DULA 3VH1A 1FIUA 1NUHA 1PE0A 4NXMB 3THWA 5HF6A 4IJWA 3GV0A 4YAJA 5LB2A 3G2HA 3IJ5A 4I5IA 3Q72A 2ATEA 2Q45A 3DKVA 2GYUA 3AOEA 3WRWA 1S2IA 3PJEA 1ZD4A 2BMEA 3ITNA 4QEZA 1JU9A 1QIIA 4UW9A 1QRSA 2JLSA 2NAFA 3TFWA 1ZNQO 1VP3A 2MYUA 1VZ2A 5J40A 3WGQA 3MWDB 4B4UA 3O8RA 4D9BA 1XMPA 2JJ2A 4LRSB 1HA3A 4RF5A 3FCAA 4DFDA 1EFHA 1ADCA 4ZT2A 4O4IF 4KGXA 4BMPB 4YJ3F 4AIIA 2OP1A 1A77A 3TD6A 3ONWA 3GEGA 5JDCA 2GM4A 3ZJVA 4B8ZA 2VUIB 3E8SA 4GI3A 4H1VA 2E4AA 3DEFA 2C7OA 3E5MA 3L41A 5IAOA 4N48A 2JK0A 3BTSA 2Q3HA 3R6DA 5PGMA 2FUKA 3TQFA 4J0FA 3ZIAA 5JCZA 1IEQA 3U1BA 1KPIA 5IVDA 4RZQA 1U0EA 2C4UA 1ONBA 3D2BA 4UZFA 1ZR4A 1PSZA 2XUJA 2I2XB 2VT7A 4RM3A 2OCIA 2GN6A 4EQZA 1YBVA 4Z0NA 1VHTA 4G0NA 3MJEA 4MIEA 4XM1A 1UANA 5T4BA 3FWYA 4DA6A 1KK2A 1VE3A 3STYA 3OZEA 1TT7A 1Y7IA 5A6VA 2BJVA 2AI1A 1GV1A 4H0CA 1IY2A 4IZ6A 4QEDA 4RKEA 1HXHA 3ZUGA 1TKBA 3CZ9A 4BZXA 1Y1SA 1U8AA 3VC1A 3CVUA 2A58A 5LJLA 3FYCA 3G2QA 3TLYA 2QA5A 2QL6A 2DWOA 3EBOA 1VMAA 4QIHA 1PR3A 5EE9A 1VECA 3EF0A 4QSHA 5FXMA 1YHNA 3VNQA 3B3AA 3R3JA 4OQYA 5DBEX 2OBFA 1GDHA 3PPVA 2IHZA 4WNCA 4Z49A 1FU7A 1T3HA 2R4UA 1HQCA 1ZCFA 3QMMA 2BR5A 2HY7A 4E22A 3UMVA 1YMVA 2AEJA 3O47A 1V35A 1XGKA 3CV3A 4RD6A 5L40A 1KSFX 2MSNA 3ID6C 1DTWB 4OK6A 2CUZA 3L77A 4G07A 5DBIA 2D4AA 5I51A 3T3HA 3ZHQA 1DB3A 2V7WA 3NM5A 2IBMA 1GZUA 2YXLA 3F78A 1RHUA 2CL0X 3HI4A 4TKUB 2BTOA 3FUUA 4TVSA 1ZMOA 5JG7A 1Q44A 1XB2A 2D5CA 1LX7A 3Q9NA 1WULS 3K31A 2PU7A 4H16A 5IJ9A 1KFJB 2CF5A 5ALRA 5TNXA 5A2QA 2D0DA 4HV4A 1OPRA 1ZUIA 4BMSA 3I3SR 3I23A 3Q3VA 3GUUA 1LBSA 4U3JB 3M49A 5G41A 5SYNA 5TY0A 1MAWA 1J0XO 3IQFA 4K9OA 2XUZA 3OMXA 1PYDA 5HIKA 3INNA 2D7DA 1MR3F 2GXQA 1B76A 2ZRBA 3GRPA 1L5WA 5IULC 2BMJA 3DLAA 3GOHA 3V7FA 1EB9A 3I9LA 1IJFA 1D5WA 3QUTA 4IDOA 2HPHA 4LHYA 1OIXA 2HNAA 4M88A 1DKMA 3ZH9B 1ZAYA 2BOVA 3BXGA 2IHTA 2W2KA 2XUGA 3HN7A 4TXLA 5EFOA 3ULKA 3VTFA 4Z51A 7REQA 2RGWA 5FV4A 2PH3A 3I2YX 1NP3A 4EUKA 3W90A 3HXTA 1BWRA 4ARAA 1XTUA 4DKXA 1ISSA 2CHQA 2ZYVX 3CLTC 4NU0A 4LMRA 4ECEA 1CKEA 4MA0A 3GQVA 4B3BA 1XTTA 2BONA 3L7NA 5IRCD 5DMXA 1A9PA 2XYRA 1MZVA 3PUJA 3ZZMA 4EMUA 3CGGA 1X1QA 2P2ZA 1OLSB 3OG9A 2PQ0A 1QX4A 1ONOA 8ATCA 2F1HA 3HCPA 4BBZA 1FVHA 1S7GA 2BPOA 2PL9A 2ZJAA 4HH3C 2ZRCA 4CKBB 4AQ7A 4JI4B 1A5SB 4DG8A 4PSKA 4R8VA 4ZVLA 1XN4A 5M7EA 2QSYA 2GEUA 1U0JA 1QC5B 4HPXB 1RM5A 3GH1A 4QOJA 4YAEA 2VOEA 4HBGA 5AI9A 5DBGA 2I6FA 4U4AA 1EE9A 3SYRA 1EQ2A 2VH2A 4FCTA 1DC8A 3GJTA 2XEXA 2IU4A 3CLTD 1E62A 1XSEA 2NTNA 3AUYA 4NAVA 2BUBA 3HJNA 1CUIA 1G5FA 1P2UA 2Y6UA 4ZQGA 4DV0B 2JBHA 4HB2A 3H2KA 3KCQA 1IUKA 2YCLA 4ND4A 3ZW7A 4AXXA 3QYJA 1X1AA 1U2RA 4IV5A 4BNGA 2XXAB 1GRQA 1UT6A 1NJ6A 4QDXA 4EKNB 5G1NA 2ASEA 5DCYA 5ECGC 4COOA 5F23A 4GC5A 1ZJYA 4XWAA 3JAWB 4OQFA 3KDAA 4G4SP 8OHMA 5M5BA 2VBCA 3AJ8A 1KDYA 3RFCA 2GI4A 1KNXA 2H11A 2W2LD 4OP2A 1Q50A 4H17A 2WWWA 3SQWA 4RH1A 4EHJA 2G5CA 2JI9A 4G2NA 4H27A 4MS4B 4G8CA 4L73A 5I9IA 3TZCA 1WWKA 2RCNA 4GPBA 2XODA 1GRVA 4Z7JA 1HWYA 1Q21A 4BE4A 4YHHB 1AKNA 3KSRA 3RS5A 1SHJA 5CLJA 1CF9A 4PICA 2JAOA 2BEUB 2YN4A 2R5FA 3SD7A 4NBSA 1MABA 1CD5A 1RW4A 1WW2A 5IDQA 5IYZA 2Q3BA 2H4YA 5BNWA 1YDGA 5K01A 3DOFA 4QX6A 5I7VA 1EFPA 3STTA 1ODTC 5TQ2A 5CCEA 4RGVA 2VRWA 4MCAA 1NQTA 1MJHA 2VP0A 3AR2A 4YT2A 3SEZA 3VC7A 1NVAA 2NO6A 2W0MA 2IXTA 5LB4A 1BXKA 3FB1A 2ACVA 4TT3A 1D8AA 2C9ZA 3JYHA 4WFIA 1RS0A 1ZH4A 2REBA 1E1LA 4M1EA 4Q03A 3EIWA 4FNOA 1J90A 1LZKA 3E82A 1Q0PA 1F8GA 4CG0A 1TGVA 4GP7A 3IO3A 5EQFA 3NHYA 5CM9C 4QM7A 2REXB 4ZYVA 4F12A 1P0QA 1GPBA 3L4KA 1GG2A 4LTMA 1V26A 3PDHA 1P2GA 4EZEA 4QTUB 3DSRA 3S8MA 1JQJC 2WZBA 3FOZA 4OI4A 1IBMB 2DUJA 5AI0A 2IYUA 5F2EA 3FLEA 3FWHA 2CNDA 2I1VB 3B2QA 1N2CA 2AWNA 4GX2A 5T6BA 1DSSG 1QRUA 4DDHA 2P69A 2P3SA 5L6MB 1QAOA 1I8TA 2PWBA 3VZCA 1HNWB 2DLDA 5IJ0B 4UXJA 1Z6XA 1GEGA 3KTDA 4JC8A 1JBQA 2A1IA 4K40A 3A14A 4E33A 3DVAB 4KI0A 4XDHA 1XTJA 3OUZA 5AXCA 4CUJA 1PWHA 3DBRA 3ZWDA 2FCAA 3F5QA 4JBNA 1FMLA 2BJWA 4G67A 2JJ1D 2PJRA 1IE3A 5CJJA 2PKYX 4PO8A 5FDFA 1RXVA 2DU8A 2UYCA 3PJRA 4J0JA 4QDUA 2P90A 3MGBA 2GK6A 4C08A 2CDRA 3LQ4A 1JA9A 1KBOA 1N3BA 3PQEA 1XJQA 3KUKA 4XUEA 5CK5A 1GTMA 4YO8A 1L5NA 5JJCA 1YAHA 4DCJA 2C96A 2D06A 2VRCA 4P86A 1F4PA 2YMPA 5HRCA 1JDBB 3SKVA 4GS5A 1RYZA 1ENOA 2O54A 2I80A 2IEAA 1RQPA 4K6HA 2CEKA 1UZLA 2F43A 3D3WB 4F3CA 1V3QE 2FEMA 2J9GA 4DA7A 2Q5OA 4RJKA 4EVRA 2D5LA 5EP4A 3VHQA 5ITSA 1RHKA 2JVJA 4MWCA 1F8XA 2V6JA 3H3FA 3LQFA 2ECPA 1VPTA 4INPA 3QNMA 3UT6A 1E3WB 3E48A 2E7ZA 5K2OA 4FE7A 5CEEA 3NYQA 1T9CA 4X3CA 2GKSA 2XWSA 3MOGA 1ZR2A 1OW3B 1R0ZA 1M6HA 4G1EB 4IIHA 4B8WA 3D6FA 4AD8A 3HPQA 2Z4RA 1W4LA 2QMUA 3BCRA 3K7EA 3OQPA 4NFHA 3PVCA 3L4BA 3AR6A 3RYHB 4O2AF 2Q9AA 1L3BA 4IVNA 4ZD6A 1Q1EA 5HJ7A 5JDIA 3L7YA 5C0OE 1VI5A 4P6VF 2ERCA 1SY7A 3W5JA 3U40A 4F8EA 1MB4A 3CKMA 1J2JA 4K1LA 1LJLA 1MIOB 2C9YA 3DHEA 3MJTA 5I5GA 1W0JA 5DF1A 1EM6A 3WRXC 2MHCA 3LT2A 3WKAA 1HE3A 2CDCA 3LPNA 5K03A 4I1IA 2PUEA 2VAPA 3BH0A 2X41A 3G5MA 1PZMA 1ZVKA 1C1XA 4MUHA 4P93A 2GO1A 3NM4A 3FSJX 2HLNA 1GFZA 1YS9A 4RTKA 1PL6A 3DXYA 3P9IA 1Y4ZA 3AKEA 3PT9A 4DV6B 3P45A 3TL2A 3D5TA 4DQKA 5IAAA 2BKUA 2FMFA 1BD3A 3FNHA 2VDOB 1PJAA 1HF3A 3V1LA 2NUPB 3VPSA 3WDLA 2VS1A 2WZQA 4D43A 2Q6VA 3I6YA 2H1RA 1Y8QB 4U7DA 4Y0NA 3KQNA 2KPOA 1SIBE 2PMFA 2W6ZA 3C1TA 3NGXA 1FW8A 1IBCA 4OU4A 2H8GA 2XZPA 3A10A 5AVXA 3IRVA 2QG6A 2P6MA 3RJMA 5JCJD 1E1RA 1AMNA 3QSGA 3TWOA 1Z07A 5JNTA 4YYZA 4JR1A 1EFVB 4RSGA 2QHXA 2FLKA 5FPQA 1KYWA 3LP8A 4XVUA 3HYRA 2O52A 2JD0A 2RG7A 1XZEA 2BFBA 4BJ5A 5CDFE 4G5XA 1RI1A 2QPLA 3PI6A 3BMNA 3VHXA 2Z9BA 2JCSA 4A2WA 1UJMA 4UEWA 4Z54A 5GONB 2WNHA 1HSZA 1QB7A 2YOHA 5JMOA 5AVKA 1NNSA 1EZZA 4RFSA 4OXRA 1PEDA 4Q05A 3TSZA 1E5QA 1DHRA 4IJKA 3BWDD 3UICA 1FNBA 4NP6A 4NU8X 3UFXA 1HE1C 3LK6A 3LW7A 1LKZA 1Z29A 4J0KA 3I8SA 3ZQKA 5T4HA 4CDRA 3A9CA 4RHCA 1IUPA 1TK3A 2ZEJA 4LSGA 1JEYA 1EZ4A 1ULZA 1Y6GA 5EC8A 4L78A 1PWEA 1IBSA 2WIJA 4CR7A 4HUJA 2ACKA 2JGRA 2WA2A 2CK3A 4H4DA 4NF2A 4KPEC 1GPDG 1GU1A 3OX3A 3NP7A 3WC4A 3ZVNA 3ZZUA 4EFDA 3PRJA 1WZUA 4ZU6X 4MP3A 2UVPB 2JJ8A 3ZWOA 5MGBA 3ESDA 2JL1A 4TYNA 4IHKA 4JVOA 3UWOA 2IYOA 1WVIA 2GJSA 1WKBA 3PR2B 3DV2A 2AE2A 4GWLA 5CDYA 1RZRA 3UAWA 2O07A 1YRQA 4OXQA 5BQ3A 3GZJA 3SVLA 4C0HA 4WZZA 4A8JA 2WYWA 3K09C 3D2LA 3QFFA 3A9SA 4NVRA 2E1RA 2HB6A 4LRUA 4OHRA 4R69A 3IBGA 4MLPA 1WE2A 3WLAA 5IHPA 1YRYE 1ODJA 1PUIA 3UZUA 1L7VC 1ZN8A 2GRUA 2P1ZA 3GZ4A 3L1VA 4XPIB 1PWXA 1E2GA 1E4YA 2D2VA 3CUSA 4R1OA 4TMVA 3KHTA 1F3OA 2VP3A 5CDTA 2O4UX 3VNAA 3Q7QA 4FC6A 4EQ6A 2X7HA 1EFRA 1QPGA 3LSTA 4PLVA 1QFYA 2D1RA 3H2SA 3BMOB 3UH0A 5JLJA 1FXSA 3MYYA 1AGYA 2REQB 3BDVA 3SSMA 1CQJA 2NXCA 4XVCA 3LA6A 2ZB3A 3FNBA 3H4TA 1SFRA 2HZ7A 4N7JA 1NBEA 2F9FA 4GNRA 3AILA 1O97C 1VCMA 2HRCA 4ZQFA 1Z4JA 3SOPA 1Y9JA 1AKMA 3B89A 1WMSA 3KNZA 3JQ8B 4R9RA 3B5IA 2VEOA 1V16B 2P9HA 4N18A 3UYKA 1CNFA 1UJ6A 1AHIA 5FA6A 3U60B 2E6UX 4PYIA 1GTZA 1FJ2A 1WOMA 5GM1A 1J8VA 2XWQA 4WECA 4HEJA 1H6DA 4X8HA 4DQXA 1K6IA 1AUVA 2VPXA 2Y1CA 4E03A 1GZ4A 3BA6A 3LWDA 2GF0A 2PZAA 4ZGBA 1CS0B 2B94A 5KSZA 3C41J 1RMYA 3IQWA 2WDZA 2V74B 3VU8A 1Z3IX 1TF7A 3DXXA 3HWX1 3L7MA 4CI0B 3GPDG 4UBIA 4GI2A 3KSBC 3BKXA 1X39A 3ZVRA 3EDYA 4W9NC 1SHKA 1HDRA 2VQFB 4JI1B 4DNFA 3ND8A 2ZLBA 1A4IA 1B14A 3ETGA 2NOAA 1G5QA 2QZJA 3T9EA 3E22B 3VI4B 4Q6BA 2BH9A 3D4LA 1KORA 4FHGA 2W43A 2RGNA 3AHCA 3DZDA 1UKEA 3NEAA 4XVHA 4NCBA 4XYBA 5HFNA 1BVYF 2P3OA 2Q07A 3SBDA 3N8KA 1ATZA 4AO7A 4ZOLA 1G42A 1SUCA 4V02A 3EAQA 1W85B 1OWOA 1QDEA 3JAKA 4G1MB 1VHJA 1AHHA 2WTBA 1YB2A 4H1UA 4EA9A 1PYOA 4DUGA 3C24A 1FF9A 4MRNA 3RVRA 2FWMX 4A03A 3H0EA 3LVBA 3VDMA 4IIJB 2R1UA 1AS0A 2HUNA 1S1CA 3KC2A 3O4RA 4R1PA 5E3JA 5EZ6B 3U44A 1HT1E 2MT9A 3E1KA 1GIAA 2Y0EA 4I6GA 4Q47A 1FSZA 2ID7A 3V6LA 3RVOA 4BWYA 1YRLA 2ZKIA 4OYRA 2VJYA 2H2FA 4X8OA 2XNHA 1IXRC 3WLRA 5KEIA 1P4JA 3CB2A 4PIPA 1P3Y1 3MRTA 2UXCB 2OXFA 1E6UA 1PR9A 1Z34A 3FCCA 3QE2A 2QW8A 4G0ZA 5ILQA 4IUYA 3L8EA 3CX3A 4JUCA 4R0VA 3IEPA 2BFEA 3GVPA 4XFDA 1JQAA 2ZDGA 2BZGA 4JJIA 5E4TA 1L9XA 3V1TC 1QHFA 3LLSA 4JX9A 3AM3A 3L07A 2QN2A 3ESZA 1JILA 3OFJA 3R24A 3WLKX 1QTQA 1EVLA 1N3YA 5CIWA 4DWJA 2NUAB 1KOJA 1R0SA 3S6JA 2YHSA 3T3GA 4ENVA 4RJJA 4IIGA 3U3MA 1FYFA 5F9MA 1YFKA 1B26A 1JZSA 2DPYA 1JIJA 5A0FA 5HZHA 4DAOA 5J2UA 1VKZA 3RBVA 2XYHA 3B7PA 3H2YA 4KJZA 1V96A 2FW9A 2H1HA 1SWWA 2YY5A 4N7MA 4LMPA 3UJ6A 2SBTA 4U7GA 3AH8A 2ZKLA 5J5CA 3PE3A 3KB1A 3TIVA 3NLLA 5IUKC 3WHKA 5JFOA 4BXOA 1XXHE 3TJZA 4QVKA 1BYUA 1H2YA 2V7GA 2WIFA 1S1MA 1VJ1A 3GN2A 3K94A 4QC2A 3OBBA 5JISA 4OD0A 2EC5A 3GFGA 5K6AC 2YFYA 4TTVA 5IT9A 4MV6A 3RW9A 3EUAA 3RT9A 4CFZA 1YQTA 2I87A 2PUHA 2RGGA 3HCAA 1R9GA 2H2WA 5B64A 3BEDA 1NPYA 3GP3A 1QKKA 1ZIYA 2J8ZA 3PGJA 1F2DA 1PZFA 2YJGA 2ODPA 3C0KA 3WK9A 3SXPA 3ERCA 1TCAA 2GB4A 2A7XA 3G2KA 3HA7A 4Q18A 4Y9TA 2ZATA 4ZVMA 1V5FA 4G24A 4ZYUA 4N5LA 1IHDA 1NI5A 1JJAA 2OV1A 1ADFA 2FP4A 1SAYA 3PB3A 5SV2A 5KQLA 2NMVA 5CIYA 1ODFA 1SUPA 2PBZA 3H5LA 3EGWA 4LSZA 3KXPA 3B82A 4IIVA 1FFHA 4AF6A 3AG5A 3N39C 4ZVRA 3RODA 5T57A 2ERXA 2Z8XA 5AJHA 1X77A 2PUDA 1VSTA 3CNHA 5DWQA 4ZIRA 1ZICA 3RRMA 3P9PA 9MHTA 4C6SA 1JAZA 4XD7A 2OOKA 1JQKA 2O57A 5E0OA 1M6YA 1NYRA 3N6XA 3OTHA 5CLGA 1TKRA 5CITA 3GVXA 4D45A 2VF4X 4ZRMA 2K87A 5B1IA 5I01A 2Q9UA 2WSSD 4WSOA 5GVRA 3SICE 3Q2KA 3S2EA 2RIRA 1UQTA 3TH5A 4MI3A 1NXOA 3L1UA 4DIFA 2DBZA 3Q7EA 1Q91A 2COUA 4IW3B 4ZCRA 1SKMA 2XZOA 1JTEA 3PHGA 2P7HA 3K8ZA 3KUCA 4GMGA 1I4OA 1LFAA 1R00A 1PJQA 2B5VA 2Y2UA 3GARA 4YCCA 1LRLA 2HEGA 2FZGA 2QJOA 4RMGA 4HXFB 2VDKB 2X3UA 2JB9A 1ZJ5A 5EJ5A 1T3SA 4F5ZA 3TR6A 2GRJA 3A27A 4FWIB 1SZPA 3KSMA 1XU9A 4XVQA 3DKPA 3TMAA 4UBJA 4NQZA 3D02A 3WQQA 3CRMA 1T5IA 3H0KA 3UXMA 5KJ6A 4GECA 3WIUA 4PF1A 3JWGA 2F1OA 3HVUA 1P33A 2WU8A 1KIFA 2XKBA 2OHXA 4CG3A 2H3HA 2DRIA 1CHDA 1JJIA 4GOLD 2NPFA 1U80A 1CDZA 1IOVA 1XG5A 3CR7A 3LOUA 4MYDA 4PLYA 4R1TA 4BKQA 5JJKA 5IKPA 4NBUA 3CO0S 1BWQA 2FMHA 2XE7A 4HD8A 4RK5A 4O4LF 1G98A 2QAJA 2O7RA 3EXFA 4QPNA 4J07A 2VK8A 3CR3C 2C1XA 5ALEA 4D2IA 1ZU4A 2IGBA 5K45A 4PFQA 4BKUA 3AM1A 2Q3MA 3R9WA 1WZIA 3ETCA 4BFLA 2H8KA 2X7XA 2PUAA 3DMDA 1W8DA 4BQEA 4U2CA 3W2FA 1XUOA 1KO7A 1RWQA 2ATVA 3KR2A 3TTWA 2R8PA 3NWPA 3TM5A 1C3XA 3WDKA 5AHRA 2NT3A 1GCUA 4RHTA 5G0SA 4WERA 4CU5A 4CLDA 3D81A 3VKHA 4DCSA 3QVGB 4HGPA 4B45A 4DT1B 4UUNA 1SVSA 4FCWA 1P9RA 3FYTA 4OF4A 3ZY6A 5B58C 3C7CB 1QANA 3DWFA 3MZ0A 1FS4A 3AY3A 4TZ6A 3K0FA 3BJEA 1WXWA 3NIWA 1XP5A 4B3TB 1UBJS 2FMUA 2X1HA 1EQAA 4MQEB 4P0TA 1VA5A 4IRMA 4YYEA 1EINA 2VLBA 5CA0B 3D4NA 1CVRA 4UUOA 1NG9A 2J9RA 3R0XA 1UM9A 3FI9A 4GZ3A 3U56A 2ZJ2A 4KXQA 4PO1A 4YQZA 3RFXA 3BD6A 3EW7A 4Q4DA 4QLOA 1KHTA 1IZ0A 1EWVA 2W2MA 3ZN2A 2AX3A 2BMWA 4MVJI 4P83A 1F9AA 5JQGB 1M0WA 1Y5IA 1PJZA 4EO4A 1MAAA 2X2FA 2BHSA 4TRNA 3RRZA 1N0UA 1W75A 3BXFA 3MUNA 1GQRA 2X3FA 4RADA 5JCXA 1Z5PA 4ER7A 5K8UA 5C32A 3DFZA 5KVAA 1ZP6A 2Z1MA 1T6NA 3UTCA 2NACA 2F3TA 2WM3A 4PLCA 1RC8A 3EEQA 2G4CA 2G7ZA 3NNDA 3MGAA 1YZHA 3HKCB 1T4GA 2Q4EA 1ZY2A 2C4MA 2QVXX 1BU5A 3FSRA 3IPCA 3LF2A 4L74A 4QGHA 4EY4A 4Z5XA 1U2SA 4KVFA 1AS2A 1NQWA 3C4JA 4BQFA 4MZDA 4BV9A 1OF1A 3BRCA 1QYXA 4MV1A 1GZDA 1GG5A 4GYYA 5JAUA 1S7CA 4BN4A 2GCOB 2Q0XA 3RYFA 3KYBA 1M2JA 3PPIA 4L4YA 3H42B 1GZHB 1UBNA 3ENZA 3EOBI 4QHYA 4WLEA 3A4NA 3IVCA 1E0JA 4TL8A 1NPDA 1QH8A 4X1IB 1X7XA 1L5HB 3HJRA 3L79A 3MOIA 4M36A 4G5OA 3EGEA 2AR7A 2J7PD 3WB2A 1I0IA 1NUUA 1W5AA 1Q7GA 1T1RA 4HDQB 1SUWA 2YWXA 1JAHA 1HRKA 1AK1A 1K63A 4TLLB 1E32A 3E84A 1KZHA 3VOBA 3DZJA 3OBIA 1QIMA 1SH7A 2PKQO 3AQ4A 4MO2A 1QLHA 3ZU3A 3JQ7A 4UU1A 4EFKA 1Y8RA 2QY9A 4J29A 1LLCA 4EG5A 3ZU5A 4Z0HO 1I3LA 4S2EA 5AM2A 1M0EA 5JEEA 1PX0A 3RARA 4WH0A 5I7UA 3W9UA 3F96A 5TV2A 1AN9A 4YGXB 1CZRA 3CHYA 3KHSA 2AD1A 2PUJA 3N2KA 2JGDA 5EJGA 4LRWA 3RR2A 2FXIA 4JP3A 3URMA 2VTEA 1QQBA 5AM1A 2EZ8A 5EG5A 2ID8A 3PC2A 7GPBA 4MICA 4K86A 3ZHTA 2JARA 3ODPA 3QMPA 4Q4HB 5ITWA 2HA4A 3SBEA 3WK4A 4D3FA 3OQOA 1IQ0A 1TKAA 3NTOA 3TTUA 3BIWA 3SM3A 1JFFA 1Q14A 2DQ4A 1IXYA 1HTBA 3DPUA 4IJMA 1JE1A 1GZ7A 4YP9A 2D8MA 4L4SA 2X9VA 4HDRB 2BHLA 3M6VA 2O0LA 4ZYZA 1BAPA 2HMTA 5KNCD 3JQPA 4PYQA 2HK6A 5EJ8A 3B7GA 5I7SA 3N2GA 3ONFA 2QNRA 3WR5A 3DAPA 3HHEA 3PIRA 1E61A 1UBRS 3LPDA 4FN5A 2ONKA 1DWUA 2AUTA 3LUDA 4YMUA 2R97A 1PT6A 2FFBA 5HIMA 4A73A 3UK0A 4WLNA 3NPMA 4LJ4A 5KTYA 2R8EA 5CM8B 3RBAA 1AZTA 3VYRB 3ZU4A 1XNQB 2QE7A 4F3KA 3IEVA 1N2BA 4TV8B 4LMBA 3EGDA 2IU0A 3TFQA 2A0KA 1M1UA 1C30B 5DLEA 5BMVA 3MWFA 3DD1A 4REMA 1XVVA 3COSA 3DVQX 1TMYA 3A1UA 2HMAA 2I4TA 3CXUA 4Q4JB 4ZTBA 1QP0A 1XHEA 1C3OB 3PSAA 2YYYA 4QWWA 2QTTA 1DBVO 2WIBA 2IVFA 2NZJA 1ZI6A 2HXYA 3G5AA 3HY4A 1KL7A 1SKYE 2WLTA 1HZZC 1U2QA 1T36A 2UU9B 5ENZA 2QE6A 4WBNA 4CIYA 2HAEA 2HLDD 3AHJA 4NFSA 4YP7A 1NYTA 1XDBA 2NT4A 3AOGA 1I2BA 1U11A 2AUMA 2WJ4A 1Z4NA 2YDXA 1RABA 3BIOA 3JRWA 4M38A 1Q84A 3RVMA 1JGTA 4F5WA 3VU9A 1UMCB 3QU2A 1HETA 2YIDA 3IIMA 2GAFA 5CB4B 3TQQA 2ZJ6A 2QAGB 3N3BC 3CX6A 3T3NA 4YRRA 3UWMA 2RGXA 1S96A 5BNTA 5E6SA 1U0LA 2WUFA 2ZAIA 4MVJD 4MUEA 4B4KA 3FPEA 4Y7DA 3DF7A 1E94E 5CFMA 2YWJA 1KFKB 2C92A 2VBGA 5KWIA 4B7CA 3RJTA 5K3SA 2E18A 3B60A 3CH5A 3VYSB 3AEZA 5ALQA 3RHFA 1A4XA 1MENA 2ZCJA 1VL1A 1L5MA 2BE9A 3EWNA 2OXEA 2J0UA 4QNMA 2QRVA 3L0BA 1E3MA 5EXXA 2CXUA 4LE1A 1FS6A 1MQ8B 3IOCA 2E82A 4KBYA 4ER3A 2C3YA 1MB0A 4P3OA 4G8JA 5JTTA 1J7JA 4N7BA 2AKAB 3OF3A 3WSTA 1U90A 4JP1A 5BNZA 3CZCA 3HO8A 4KK3A 3ZHYA 2KI5A 4OQPA 5KVCA 1XJ5A 5L8VA 3WGKA 3R7LA 1BXRA 1RBQA 4KPUB 3U3KA 1NVUQ 3KKKA 5GIOE 4I3FA 1SOMA 5THQA 4E4RA 4C0XA 1DQSA 5A5DA 2GCGA 4TM8A 2XD9A 4WVFA 5KYTA 4PTLA 5CNMA 1IHPA 3P0EA 3DZFA 2Q6KA 2QMOA 3L9XA 3OPYB 2OB1A 5BXQC 4QXOA 5C34B 3T5DA 2RC5A 4LV6A 3R77A 4CMIA 5MHTA 1UC8A 4PGGA 3WFJA 5IWAB 1KI3A 1W52X 1IHYA 1WU8A 4JR2A 4M0UA 5IT4A 2FEOA 3IS3A 3QVKA 5I7HA 1N2CE 2Y1EA 4PPYA 2D2XA 3D54D 3LHSA 4FIZA 3RYCB 4FMPA 2P8JA 4AURA 1JIVA 4HHEA 5HA5A 5DM1A 5B1YA 4URUR 3I3OA 5CA1B 4ARIA 3ZCVA 3DULA 4IJ6A 2XMZA 5KTSA 4ENWA 1CUSA 2EJVA 3IAAA 1DKQA 2JI8A 4J8PA 3I5AA 1EHYA 2HJWA 4RL4A 3RVNA 1KY5A 4HWGA 1I94B 1DDIA 3IQHX 1JA1A 1E8DA 1H6AA 3AEUB 3OT1B 3OX4A 5E9JA 4V0LA 4MR9A 3CVOA 2B7CA 4ZT4A 3VHRA 4H31A 2G1PA 2BBOA 3T1HB 1TT5B 2WMNB 5LVAA 2CLOB 1KEEB 3OCVA 1DQYA 1U0BB 2JGMA 2JHPA 3AVPA 4KO3S 4PX9A 4WZAA 3V1NA 2WKWA 4UFPA 1PJ8A 5IJXA 5C7IO 1K5PA 1ONNA 1V41E 1WMDA 1I7LA 5A1JA 2B9EA 2WUDA 1UFVA 2V7XA 4BQPA 3OPNA 4GXTA 1WV1A 1VC2A 3B38A 2QG4A 1VBNA 3PIDA 2VQ3A 4C0JA 2C7VA 3GWZA 3S2SA 1R0YA 4L5AA 3B1KA 2HBZA 5D3KA 1DMRA 4JEHA 3EZNA 1RJFA 2XCUA 3V8VA 2FWRA 1TMKA 2R9VA 1SA0A 4MQLA 5AM4A 3HCEA 3D9QX 3HXMA 4DSAA 3NVKI 1STOA 3F8WA 4PZPA 3U17A 5AM3A 2QQEA 3CCCA 5K0GA 1RJGA 3B2NA 3E9QA 4AJPA 4Q9DA 3C7AA 4O2RA 3SQOA 2GAJA 3PNYA 3AYXB 3ZCPA 1GTSA 5K3CA 4B75A 1K3FA 2OPBA 2P9YA 3WADA 3PSHA 1JZQA 4TLBA 4XFJA 5JBQA 4AN4A 2O2ZA 2WJ3A 3CEJA 3E8XA 5DTMA 1SCKA 3PUKA 1M33A 2ZUSA 3ZHUA 3NWBA 4QU5A 4DCNA 4AJ4A 3FMOB 4AWAA 3IDFA 1C14A 3B48A 4RF3A 4G0UA 4OLHA 2GBFA 5AK5A 1M34A 3M2TA 4U5XA 1Y7HA 4IQGA 4N01A 3R8XA 5IAGA 1WCYA 4TKZA 3L0PA 4L5CA 1D6SA 2UUOA 3SIPA 4B85A 2ZXUA 4DPMA 4URVR 5C5EA 4FGZA 4MGZR 5JTUA 3S70A 4QQRA 2IUYA 1ZGJA 1H8ED 3Q3CA 2ZYIA 5F77A 4YAUA 2OFFA 4EHLA 1F2UA 1TAHA 2W83A 1HO3A 2ZYHA 5DEOA 2I62A 3JRXA 3FTEA 4BX0A 3M4JA 1BW9A 1KARA 4EMSA 2O3RA 1QO7A 4W8HA 1GZ6A 2HQRA 3ZV3A 2C95A 4EL0A 2GJ9A 3QLTA 4GVLA 3WZLA 1HFKA 2J5RA 1QVRA 1WF3A 3ZWBA 2F1RA 2VT6A 2FR1A 3WKCA 4EHHA 2Z04A 2IZ7A 3IOEA 2I6SA 5JD4A 4R5HA 1Z22A 2WWFA 2E4UA 2WUWE 3U1VA 5DI9A 4BNKA 3F90A 5DN6D 1NXXA 3LH5A 2PJDA 4MRPA 5ALUA 4HUQA 2BFCB 3IULA 2ATCA 3CPJB 2PV0A 3D31A 4FZRA 3PUVA 5JOQA 4YN3A 3KV3O 4JB3A 4XVRA 3N75A 5IVHA 3RV4A 3N05A 2ZVPX 4FD2A 3ZHOA 4KW7A 4ETWA 4OB8A 2KYRA 1G8GA 4KAXA 2PSDA 2NX2A 4KACA 4MGYR 3AEQA 3RUIA 2Z9CA 2O8FA 2NZYA 2ZUWA 1CEQA 2EAUA 6REQA 2A3NA 3VSCA 4EP1A 1V3TA 3CVXA 4G63A 3INRA 3SEAA 3O92A 4JBWA 3NIGB 4CL3A 3BTVA 2JC3A 4LRTB 2GA8A 4I4TA 4QOEA 5IW8A 1ZN2A 3R5HA 3VX3A 2QM7A 4CMKA 4XE5A 4AY5A 2Z2IA 2AHOA 1N2HA 2DPMA 2GZSA 2J5QA 1DIAA 5EYPA 3PHCA 4ER0A 3WLOA 1XE3A 4AG5A 3OPQA 1DEAA 4Y1RA 5JMTA 1C9KA 2PBRA 3GH3A 4IDNA 3FKSD 3HN6A 1J23A 1OXXK 4WCVA 3I5MA 3IOMA 2IZ1A 3MQ2A 1G8PA 3ROFA 2UYQA 1NSTA 2FRDA 3SBXA 2DPXA 4DY4A 4CGZA 4DM4A 3VSDA 1E96A 2ZQ5A 3UOAB 1XEWX 1QTIA 2G63A 4K6MA 1SXHA 3Q2IA 1M66A 2AE1A 2FR0A 4UNQA 5LMNB 1BJTA 3X2SA 4CLOA 5FRDA 3HJUA 1UEIA 2QQFA 5CLFA 4ZZIA 3LYUA 4LRYA 4X64B 1QQ6A 4L9WA 1GRNA 3N07A 1W88A 2ZQZA 4X84A 3VAYA 3SC3A 3E81A 4FBGA 3TPZA 3RE1A 2EJBA 4WCFB 3UWSA 1BMDA 1R4MA 3CEMA 4N82A 5FJJA 2IEGA 3NATA 4ZA2A 5T3UA 3HKBB 2B83A 3E53A 2R8OA 4GR4A 4JEMA 4NPAA 5JSYA 3WZ2A 4TLEA 3I45A 1CR4A 5CJ2A 1KNQA 1OT3A 3DPIA 4EHDA 4ZJZA 4Q02A 5JPIA 4S1OA 4UFOA 1OGJA 1QU2A 2QTMA 5DGCA 4PNZA 3GLVA 4Q9JA 5H80A 2XVYA 2ZRAA 3I0NA 3KJFA 4L6CA 5DLYA 3RFTA 3UG7A 3WK5A 1E1QA 3F67A 1EK2A 1RI2A 1F9EA 4V0NA 5F3DA 1AB6A 1RZ3A 2HJSA 1T9HA 2Z8YM 3VO8A 1JDUA 3KAQA 4OJKA 2B4TO 1FRNA 4Q1EA 1E2IA 1E63A 2Z3WA 3FROA 1U0OC 1JQ3A 4MRAA 1OBHA 1T6BY 1RPZA 2R47A 1Q3HA 5JHGB 2H1LA 1G2QA 2FYTA 2I2CA 3EXEA 2EP8A 3M9LA 1M2FA 3LPAA 3EASA 5K1ZA 3H5IA 1JVSA 1XTKA 2ZYWX 1ECGA 1GSIA 1NU6A 1G1MA 3IPLA 1QB8A 5EMMA 4AU1A 5G02A 1VMIA 1PQ4A 2O59A 5JUWA 3M81A 3DE1X 3KL2A 4Q7KA 1OWPA 1JT9A 1CUBA 1NQUA 1ODLA 1V1JA 4LJSA 4EHKA 4C2TA 2FZCA 2AG0A 3R1IA 5JWHA 2LCIA 3PE4A 4PAWA 3EPKA 2YVQA 2R65A 2KHZA 4JLBA 4NZOA 3SHWA 3ZXXA 2ZG6A 3AUJB 2C0QA 1LU9A 4E5DA 1DC4A 4Z99A 2C82A 4XQEA 4CT0A 3B8EA 4LV8B 2DP4E 3PQDA 2DLCX 1IMOA 3RH0A 3DEAA 4O33A 4EF4A 1P1KA 3WBFA 1LTQA 4AAYA 1PT7A 4TZ0A 3UHPA 1RLTA 2EATA 2ADMA 2E4YA 2VJOA 1BH6A 3IIIA 2W9XA 2FEKA 1I13A 5C9ZA 2JLXA 1RC0A 5C8ZA 3UK1A 2NM0A 3H6HA 3R7NA 4MRRA 3UW3A 4DR6B 3LRXA 4RX1A 3LHKA 1Y8CA 3B3GA 3TZBA 3WI7A 4NCAA 4JYAB 2R25B 2OCXA 1N2JA 2CN1A 1SHTX 1C4WA 1WVGA 2VDRB 3B5JA 3DG9A 4ZI3A 2A0UA 1EX6A 5KPJA 1ZJ4A 3SXUB 1YBAA 2JFQA 4DRYA 4G0MA 1QIKA 3C15C 1JSXA 4C7BA 3EZ9A 3LDGA 2AMFA 1F20A 2AIRA 4R1SA 3KFLA 3ZNOA 3MD9A 1E1DA 3D7SA 2ZAOA 1H0KA 4EZIA 1KQGA 1Z4LA 1MORA 1Q6ZA 2GJAA 1N2IA 2AQKA 4AUKA 4HR7A 1Z37A 4QECA 1GADO 4N5HX 4R2HA 2EDCA 3NVAA 4FD3A 2EFYA 1LPOA 5EZYA 3IB3A 4BMYA 5JAPA 4Z53A 2E6KA 2G9QA 5AK6A 3P2EA 5KVVA 1EJ0A 3ZGXA 3THXB 3GLFB 5CR9A 3ZKWA 2QUHA 1RJ9A 4ETNA 2JGIA 1D7OA 2JFXA 1PIWA 3LUFA 4TTSA 4BFTA 1C1DB 2G9UA 2V4MA 2BE7A 2Q2VA 4B3DA 4YONB 4YUYA 3IRUA 3I2IA 2IPNA 3K73O 1G2PA 1LFDB 1T2VA 1PGQA 5KWSA 2QSJA 3W8FA 2OM2A 5AK4A 4DCMA 1G7SA 5M29A 1MOQA 4BLQA 1IM2A 2IHKA 1XPUA 5DHAA 3VH3A 4EDFA 1H3FA 2CBGA 2JLCA 1E3QA 4LTNA 4LZWA 1UJNA 4R0NA 2HM7A 2SCUA 4K3UA 1TE2A 3FNRA 1DELA 3RSOA 4D4HA 2HGSA 5HKBA 1GUAA 1W6RA 3RWBA 2D2IA 3PLNA 4BO7A 2WJPA 2JKZA 3SIXA 4L0MA 3ZCTA 2BJHA 3N8IA 4UREA 1TQHA 5HIIA 3K53A 4MVJM 5LXTA 2J0EA 4O4IB 2GN8A 1YNOA 4GE3A 4YJ3B 3Q40A 2DECA 4BCCA 5LR6A 1SUAA 2EBWA 3L1KA 2B4KA 4JNKA 5JMPA 4OHFA 4P5EA 3TVTA 1JKFA 1U2GA 2H3EA 4OKSA 1YWGO 4U9IS 1YZYA 5G3YA 3C97A 5ELLA 3VSBA 4D56A 1AT1A 1SEVA 3L84A 4GSKA 4QFCA 4XGKA 4F06A 4HLUC 4GBJA 3I09A 3BMCB 1JDZA 2J09A 4P1ZA 5EXSA 1JH9A 1ID1A 2YXPX 4YLEA 5HPYB 1P2VA 2G5PA 2OZKA 3PNVA 4LSMA 5TS3A 4CETA 4QU8A 1U8FO 1T35A 4TKMA 5KU1A 5TJHA 5JCPA 4QUJA 4CCAA 4QPZA 5CH5A 3TRJA 4YREA 3T38A 3PUWA 1NC3A 5HWSA 1BN7A 1Q2UA 4RY0A 4U0KA 1QG4A 4X20A 4BEWA 1ZXLA 5FPTA 4Q0MA 4FZVA 4LDNA 3HBFA 5TDHA 4C6TB 4CEIA 4D99A 3QLVA 5J59A 4MVJF 1SCUA 4L3VA 1OFVA 1E2LA 3U5TA 3O38A 5DEIA 4M21A 3O0TA 4EGCB 4EO7A 1JYEA 4HZGA 1VOTA 1IK4A 1OIVA 2JLWA 1PT9A 1YE3A 2NU7A 4QHTA 3BXPA 4RVGA 4YP6A 2PVCA 1U4OA 2XEDA 4WN9A 2NYAA 1UZNA 1ECFA 1KJYA 3JQAA 5B2FA 4KR9A 1QS0B 2ZIAA 4F5DA 2GUGA 2JBAB 5CHYA 5MGNA 1UADA 1YT5A 2DUUA 2VJMA 4WX2B 4D4GA 4KSYA 1CVIA 2IUFA 4DM7A 3PNPA 2JFWA 3JV7A 3BF7A 3KQSA 4KRFA 3AUUA 1E1CB 3KQQA 2BM1A 3AVWA 3S40A 2BGJA 4MIYA 1O7JA 1KXZA 4HN4B 1VSQA 2DLNA 5DYYA 4AW9A 2YASA 3AIKA 4GEKA 2I33A 1KZ7B 3PRKE 3QX8A 1UZUA 3BTOA 3FGOA 5KNDD 3JZDA 4LZOA 4MP6A 4Q4AA 5ELMA 2H92A 4EB8A 1KETA 5FQOA 4HLCA 2Z1DA 3TLGA 1Z5UA 3AR9A 1KMHA 1TFUA 4HDKA 5E0KB 5LQMA 1DFGA 1ZRSA 3MRVA 3U48A 1NXSA 4B34A 3TXYA 3JQBA 4ZZ3A 5KDLA 1G5PA 1UKBA 4DUZB 2EGUA 1VRWA 2QPTA 4BMCA 3IXQA 2J6BA 2F00A 1PKEA 3AFHA 2VYND 2VYCA 3HFJA 3LDFA 5EESA 3STUA 3FKQA 2YV1A 4IINA 5DM0A 2C4HA 4YLGA 4ER5A 1KA9H 3IQXA 3KPVA 3RQIA 4GBGA 4IXMA 4PYLA 2FW1A 5HK8A 1E2UA 3ZGYA 1E5XA 2RB4A 1JI3A 2Y1FA 2ZT5A 2ISQA 4R84A 1WDTA 5LZ5A 3SJZA 3TTTA 3QKRB 1OFUX 4OJQA 3KR0A 3MD0A 1I0ZA 1ZHOA 2QQ5A 2XVAA 1PJCA 1ZWLA 2PS0A 2ZRJA 2ZWPA 3A9UA 5GZ3A 2WYVA 3OFVA 4HNAB 5JADA 3EN0A 1G19A 5KYKA 3TJRA 4BZWA 1GUYA 3A1CA 3AHIA 4HVAA 3GRZA 2VP2A 2EBUA 2VQ6A 2P9BA 4U7PB 1LW7A 3DT6A 4M2LA 1M1XB 3O4FA 4Y8VA 4AKTA 2J9ZB 3TM4A 1IDOA 3ZDCA 2ACEA 1MU0A 1UPXA 1ZH2A 2WF5A 5JFGA 1EZ1A 2C9OA 2Q3EA 1RM4A 3N9IA 4U6NA 4TSFD 4BOYA 2O5CA 4S1WA 3Q5EA 3WLLA 1V5WA 4URXR 5AXDA 1KQOA 4Y6RA 4GKAA 4PYMA 2XA1A 1QQTA 3RKUA 5DSTA 1WY7A 1Z2AA 2JJQA 2QDXA 4FFWA 2FVYA 2HT6A 5IXYA 4ABTA 1VJRA 3WVNA 2D13A 3NI2A 4DLAA 4TQGA 1T29A 5F4ZA 2IS2A 1N0HA 3ZH2A 2PWZA 4DDUA 4DILA 3WL6A 1O08A 3U3XA 3RSHA 3EH1A 3EVTA 3PD1A 4CM6A 1G3MA 1H4QA 1A50B 2J5XA 3ZGOA 3CE9A 4RACA 1YKSA 2Q49A 1M5UA 2DOKA 3RT7A 1E3TA 2GPJA 3ZUPA 5I45A 1Y6FA 3BA1A 5CVUA 5F5NA 3TJMA 4BLUA 4DIKA 4YCMA 1WM1A 1U5BB 2QMYA 1PJ2A 2HIAA 2VTDA 3I4FA 3JXEA 1NBAA 1Q1AA 2VDNB 1DO0A 5LP6B 1CF4A 3QK7A 1KFEB 3RC1A 5CFOA 4EPVA 4RZHA 3OP1A 3Q5GA 4N47A 3N0TA 4QUGA 4QU0A 2OKGA 3OOEA 4H1TA 5T6MA 2B3TA 4KZPA 5I5EA 5BT8A 1S2NA 2VTKA 1KMQA 1FXUA 1PJLA 4UM5A 1DEKA 1DTWA 1M6VB 2D5AA 1C0LA 1WLYA 3LQ2A 4EMBA 5BOSB 3TF5A 3DTTA 4TKUA 5ITZA 2KM1A 1U1CA 4JX8A 3O8CA 2ZYRA 4QXQA 4I0WB 3EC1A 3PC7A 4C89A 1T5DX 2P9ZA 4ZPJA 1RMTA 3SAJA 1GFIA 4QYWA 5H1YA 2PKCA 3SFZA 3KX2A 1T6ZA 2VAXA 3I83A 3IV6A 3PC8A 5AKLA 3UFBA 1PR4A 5BR1A 4AQYB 3COJA 1KYIA 2ES4A 2C1ZA 2XCQA 3L18A 3CZ4A 3PFKA 3TOSA 2WWHA 2WD7B 4NONA 4J9VA 3IP8A 1TU3A 4KRGA 4RLQA 5FUVA 2R3SA 1RRVA 3U6BA 1XD9A 1Y1TA 1TZCA 3AFOA 3ILSA 2WWYA 1W30A 4JHLA 3DZHA 5L7WA 1LX6A 1ZEJA 5JJ5A 1LNZA 1SCJA 3AEXA 4N5DA 4IFBA 4BNMA 2G40A 1WA5A 3TB4A 1HNNA 4UTNA 4QUEA 4P5PA 1VJTA 1OCEA 4XJXA 3WGMA 1X7WB 2QYSA 2B0CA 3QFTA 4UDOA 1HNZB 1ZD5A 2GPSA 1UWKA 5E1DA 4UNIA 1P73A 1TKCA 1VLLA 2DWPA 3D64A 2HGZA 3GFOA 3OY7A 4JJZA 3DMFA 3QJGA 1VL5A 3RBZA 1X7ZB 4EB3A 3IQDB 1VTKA 4HDNB 3RC7A 5IFLA 2AJCA 5KDDA 2R6R1 5AYVA 5TSDA 4JT4A 1POWA 4DR3B 1KYQA 1ZVQA 4D26A 3VOAA 1NTOA 1M1NB 2JCXA 4O2BF 4YDHB 5AW3A 4Z4QA 4W5RA 4WZBE 3EEOA 2YW2A 4CKBA 1U2PA 3HY3A 3BXEA 2HOQA 3CLRC 3HB9A 3OJLA 4WINA 4X3PA 5JCOC 2V55B 3D7RA 1DIOB 4QA9A 3TLAA 3V2GA 1G66A 2W6NA 2XPCA 3E7XA 2VP4A 1OYWA 1QC5A 1V71A 2C8KA 3SFTA 4Q34A 1XVAA 5AW9A 2FR8C 3AG6A 2X0IA 2WTUA 2XIJA 2QLMA 4HPJB 4M1KA 3DJYA 3U61B 1E9BA 4S1VA 2PHZA 3HBMA 3QELB 4Y6OA 1QV7A 4DXAA 5EKUA 4F4CA 1EJ2A 2ILVA 2VTBB 3EEFA 3RRXA 2ZAMA 3G23A 4ZQBA 3VFDA 3UHOA 1H2FA 4O2LA 2AFRA 2RHHA 2EJWA 2XXAA 1MEJA 3OESA 3AR4A 1EBFA 2CF6A 5FNVA 2QT1A 2IV7A 3V9PA 4HOYA 5DWDA 5C51B 1MOSA 1YVPA 3CLRD 4E88A 3H13A 3R3UA 4Y2XA 2O5EA 2O9JA 3JAWA 5DNUA 4JA0A 3NV7A 5FWAA 1XXLA 1OKKD 2QVBA 2QTGA 5EE3A 3GA0A 4AUEA 1RFLA 2QN3A 4MS4A 3EX7C 4AQDA 1XZCA 1NT4A 2J85A 2XYQA 2BMFA 2YRFA 3CLSC 1O6CA 3KOYA 5ESXA 3I64A 4F4HA 5MN5A 4KLZA 1P9LA 4PQRA 3X44A 5HYVA 2WDPA 4FDTA 2OC4A 1E79A 5ALIA 3IA2A 2WI8A 3HB7A 2BEUA 4E4YA 3AESB 3O4HA 3VTZA 1HQYE 2IJGX 4YJ2A 2Y0BA 2YYAA 3GEDA 4FT2A 3AFIA 4C20A 1JU4A 3WOHA 3UOWA 3NDRA 1IONA 4RQAA 4EI2A 5J4HA 3MS2A 4LV5B 4GP9A 3WBJA 3R6GA 1ETUA 4DIEA 4ESVA 2CJXA 4X9XA 2QY6A 4KFRA 2QLTA 2RARA 1U9IA 5HF9A 3QE9Y 1M75A 5LDDC 2H6EA 1Z47A 1SBCA 1WUJS 4R8KA 5AKZA 4TTAA 4D80A 1DRWA 3Q2OA 1E3EA 1P61B 4LYEA 4C4SA 4ENUA 3P0HA 3A6FA 1G7RA 1M2EA 2CLKB 5FIUA 3AVTA 2GAAA 5D6OA 5HMLA 4MUJA 4DSNA 3BZUA 1YFZA 2MR5A 1YC5A 1Q1BA 4QJ5A 3RU9A 1I4LD 2ACWA 4LNHA 1PV4A 5BW8A 1OAOC 1FDRA 2OCKA 2XB6A 4TV9F 3G0CA 1A9RA 3WYFA 4B74A 3CSSA 1JFVA 3DS8A 5IJ0A 3U7FB 5IMSA 1IVYA 5CVVA 3O91A 4OQNA 4XKJA 4YUAA 1LI7A 2OZLB 2VKTA 2CHFA 4MRMB 3RAFC 2ZJFA 1OUMA 4TLAA 4KQ1A 4OGLA 4ZOAA 2XV1A 3AR7A 3K0CC 3PLRA 3BCHA 4OVKA 3Q5DA 3G0GA 1HG0A 4A0GA 3TCNA 3E03A 1F3LA 5CB0A 3KVRA 1G8SA 4DPKA 2AR9A 4G65A 1ZK1A 1N7JA 3L46A 3V1KA 4UM8B 5FO0A 4FDUA 4R6WA 1FW6A 1FJGB 3GDOA 1UOQA 1YB1A 4L8YA 3C3PA 2B4YA 4JQZA 4JOCA 4G81A 4XB2A 1IH8A 4NENA 2HCFA 3VDXA 4U2EA 2PNJA 2RGUA 1VB5A 5KOHA 2D0PB 4ZO8A 1NF3A 4E3WA 2ODTX 4DLPA 1TAGA 4LOHA 1JQ5A 4OXXA 2BZ0A 3HU1A 2AOTA 3JTMA 4KWTA 3ESRA 1S89A 3TKLA 1E3WA 4KFUA 1J0AA 2AEMA 1ZNWA 2G88A 3W2HA 4AO6A 2GS9A 2IELA 3E18A 3J7TA 3ND5A 3JQFA 2H1FA 3Q9LA 2UUCB 3IKLA 4MVYA 3AY6A 3WLNA 3G59A 3RYHA 1DINA 2VSXA 2FJ0A 2ZRDA 3NW9A 3PD7A 3L5OA 2OQVA 2C3PA 3WAJA 4Z3OA 1A96A 3WLIA 1WDMA 3DONA 1OIWA 2G3YA 4RD1A 1JW9B 2CNWA 5JBNA 1XMVA 1MIOA 4PZ0A 4GYJA 1UPAA 4NEQA 1ST2A 1BE8A 4OPMA 5E2BA 2OWDA 1KO1A 4QASA 3UCEA 3ZS9A 5HCIA 3DZGA 4FFPA 4WJKB 3EZ2A 1BFUA 3ZBUA 2FLVA 3LTNC 4JOQA 1P29A 1TK2A 2GD6A 4I55F 5H3HA 1U63A 2X8AA 4ENTA 3F8SA 3FW1A 1CZNA 1K2WA 4G2TA 4NYIR 3VO1A 4R31A 1NKSA 3A4VA 2CYBA 2QX8A 5DMHA 5ALFA 3OI7A 4JKYA 2PPVA 3KKQA 2FSVC 1BMFD 1YK1A 1XZIA 1FDUA 1PK9A 1QDUA 2NUPA 2P0AA 3Q10A 1V6CA 1EXWA 1HI9A 4G0OA 5DSXA 1PNOA 4RL6A 1IM8A 3VZPA 1RWMA 2B4AA 1UOPA 1Y8QA 2AMLA 2OORA 1X86B 1FEZA 3OFND 4MKFA 5CNKA 5P21A 2ZVQX 3P9CA 4A0QA 2HDNB 3LUAA 3N8GA 1PK8A 4IDBA 3J7AC 4RHYA 2G77B 2Z56A 2RI1A 5KSYA 2LRHA 2UKDA 4OSOA 1DNPA 4JI8B 4KOAA 1LLFA 3EWSA 1SPBS 4ZCIA 4GX5A 3TX6A 4BLRA 1USWA 3ADBA 3P52A 4ND6A 1EFVA 5IH7A 1D4AA 4EG0A 3QVXA 5KYUB 1NBHA 3DWEX 3PFGA 2NUBA 2J6IA 2QWXA 4J9UE 4OFBA 4YMWA 3UQYS 1XMSA 3QOXA 5A3QA 3N2NA 2R00A 4QHSA 4F85A 2WAMA 5KREA 1OD6A 5AHXA 3TUZC 3CXRA 4MCJA 7YASA 4I4NA 2QT0A 2XKJE 2PBLA 4M54A 5GONA 2AJLI 1E7QA 5TVGA 4JYZA 5A3VA 2Y0DA 3PWSA 3L7JA 4DCCA 3ZDDA 2P65A 3NRCA 3LDUA 3DMTC 2R6GA 4X5OA 1CUHA 2X8JB 4WY5A 2OG2A 5BNFA 2IBTA 2G8NA 3LO5A 2VYVD 4ES6A 4NU6A 2ZYTX 2YL2A 3KYDB 4PCLA 4TQ9A 2OA0A 4AMUA 1DBIA 3VDQA 1ZWKA 2A1TR 1UAGA 1WCXA 3MBIA 1Y3HA 3VR2D 4ENRA 2FGKA 2KWIA 1UBLS 1Q95A 3AR3A 3CJRA 4UDXX 4X8LA 4JITA 3TSCA 3Q8LA 3V7WA 2W98A 3NJ8A 1SOVA 2AN9A 1U8UA 2RFLA 1DC6A 3DR5A 2YHBA 3EY9A 2Q1WA 3HCBA 3OQ1A 3WICA 4KP7A 3O2NA 4HB3A 2W4QA 1RWOA 4CLRA 5EPEA 4OXNA 1ULAA 3QWFA 3CKLA 3IP9A 1BQEA 1EGVB 4I1VA 3ZZNA 1KRWA 3I04M 2ISCA 1TZBA 4G9GA 1JFLA 2PZBA 1NJ5A 3AF4A 3OM8A 1JWBB 1KO5A 2XKKA 1N8NA 2ZJ5A 1UBGA 1LF5A 5L95A 5GZ1A 1N6LA 4BPBA 4E6EA 2EVWX 1ZA2A 2FF5A 3H83A 4XPIA 4IMPA 1L5SA 1VHLA 3NJ4A 1FMFA 2QL5A 2WTMA 4KLNA 2WRZA 1X7DA 3MVEA 2LZ0A 3LKDA 1NP7A 1XKLA 2P27A 3ETNA 3TNYA 2B8TA 3NTXA 1SD5A 2YV3A 1RYYA 6NULA 1PLLA 3BMOA 2J1LA 2EHJA 4MDYA 2REQA 3T5CA 3MTQA 1NUAA 4RDXA 4CQLB 3ASVA 1KU6A 4W1QA 1XEWY 4FS3A 1Z28A 4RPJA 3MTDA 4RVSA 2XTZA 5ALVA 1OX4A 2A3RA 2IYXA 3Q3HA 1UCFA 2GK7A 3CY6A 3MGKA 5EUMA 3JQ8A 3A36A 4QO7A 1KP9A 3SHOA 1HEYA 4H7FA 4B9AA 5HSGA 4Q9HA 1NMZA 5SZKB 1OB2A 4MHOA 2XUOA 3JSXA 1CW2B 4AN0A 2DYKA 4PZ9A 1ZIXA 3JASA 4MYUA 1NUTA 1GV0A 4Q3DA 3H2ZA 2O14A 1E2EA 1VE9A 1Z75A 3K8OE 3RG2A 3ZW9A 4TWZA 3SYKA 1CS0A 3L0CA 3UKJA 5LZ4A 3NOQA 4PGAA 3UKDA 3O0DA 1AV6A 2HU8A 3BZBA 1L4LA 2V6IA 3W7BA 3RRFA 3PDIB 3T7RA 1BDIA 4F45A 2O2JA 4Q1CA 4B6SA 3BIXA 4UATA 1TCVA 5KB3A 2W2OA 2PEYA 3AUSA 2PEZA 3BGIA 3GT7A 4BMVA 5K20A 2G67A 4M89A 3KETA 2VP5A 1YS6A 1RYHA 3ELDA 3PQ5A 3T9FA 3E22A 1Q7CA 1EP1B 1FP2A 1NV8A 1OHHD 3DOJA 3L01A 1VJ0A 1B1AA 4I19A 2UV8A 5IK2D 3SLRA 3F2IA 1KP2A 2VNAA 3LY5A 3V2IA 3ZBPA 3DB1A 4NESA 4FHCA 1WKVA 2R5WA 4Q48A 4EJFA 4BRUA 1MV5A 1K2VN 2EJUA 3PXBA 2K2QB 4NYJR 1W85A 4NCHA 3U0VA 4A5SA 3OE5A 4AY4A 3NWEA 3OSZA 1RE1A 4EKGA 3EZ6A 3L05A 4K9DA 5CXSA 2JLRA 2D1FA 3THYA 4DMFA 2V3CC 1E64A 4LJRA 1XDUA 4IP0A 1AZSC 3EZFA 3LCJA 4ZAFA 2RK3A 2A0YA 3D8BA 3EGOA 5A04A 1WRBA 3SEQA 4RVFA 1MG5A 1OLUB 4WKOA 2PXAA 4D5EA 3EIOA 1Z68A 1QGOA 4GMDA 3PPYA 2J45A 4ENPA 5DYTA 5KNLA 3IBTA 4YWJA 4NBVA 1GXSB 1WD5A 3HZRA 4IIBA 4OK3A 1ZOIA 1N4DA 4CTMA 4G36A 1XU4A 1Z2CA 4Q1BA 1WQ1R 3GT0A 1OGYA 1BKSB 4O4LB 821PA 4XOIA 4EJSA 3MT7A 1IATA 2O2XA 1B2RA 3VAZA 4PM4A 2JAPA 3I9OA 4FCVA 3WJ7A 5C4IA 5IUJC 1VZ3A 5A3JA 1B6SA 5FWXB 3R2JA 2NQ8A 2I76A 2CNNA 3EVEA 4V0ME 4XUDA 5TXGA 4XUGB 1CY6A 1ODCA 1M9NA 2Y4OA 5K8VA 1JF8A 3REQA 1AA6A 1UODA 1Y98A 2WT8A 5FFNA 1J24A 1QR2A 2NUAA 1F7UA 1RWKA 1GCGA 3SJ7A 5C52B 1F12A 1Q7BA 5IZCA 5H8WA 2LGJA 3SS7X 3UUWA 3LBFA 1XLWA 4K6OA 3WG9A 1XRNA 4JEIA 4AMYA 5BWBA 4B4VA 2PG3A 4CF3A 1XK7A 2IPMA 3D4BA 3UAYA 4TN5A 3H2HA 2XYGA 4UCFA 4EFLA 3A1VA 5LQUA 2I65A 4FBLA 4Q00A 4YMVA 1QM5A 1XA3A 4HMOA 3ZWAA 5CCBA 2XHEA 3KSAC 2ZRQA 2BI7A 3RT1A 4EEXA 5TT0A 4QJ3A 4C6RA 6PFKA 3FAKA 4JR0A 4NBTA 1XJCA 5LZ7A 2QL9A 2QUAA 1NQAO