4DNFA

Crystal structure of the cftr inhibitory factor cif with the e153q mutation adducted with the epibromohydrin hydrolysis intermediate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
296
structure length
296
Chain Sequence
b'AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMQAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase
publication title Visualizing the Mechanism of Epoxide Hydrolysis by the Bacterial Virulence Enzyme Cif.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 112
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dnfA01
5HKBA 4BC0A 3KWJA 2CBGA 3H2IA 4J03A 1YB6A 1DQZA 5JD5A 1MN6A 4X92A 4C01A 5DLPA 4DIUA 3R0VA 3I6YA 4WFKA 3L1IA 2XUJA 1MAHA 1R9MA 3DLTA 1P0MA 3WMRA 5CXUA 3JYHA 1VKHA 4QDTA 3WKDA 3W9BA 4X71A 3G9XA 4EBBA 2X8BA 4TGLA 4X85A 1CPYA 1E8NA 2ZJ6A 5ALHA 4XJVA 1XQWA 2PU5A 1MT3A 5ALFA 4WY5A 2ACKA 3TJMA 5FLKA 3ED1A 3EQ9A 1EA5A 2C0QA 4WY8A 3IBTA 5HKAA 1E8MA 4B9AA 5AO9A 3TRDA 1ACJA 1QIGA 4BTLA 3LLCA 1QIKA 3O9VA 4DMHA 4QZVA 5FRDA 1GXSA 2HRQA 1AGYA 1TKRA 4Y2YA 5ALDA 1JKMA 2PVSA 4O08A 3E0XA 1WPRA 3BF8A 4AO7A 2OCIA 3DYIA 3QM1A 4CIAA 2Y1KA 3O4JA 2WFZA 1EXWA 1QFMA 1G4HA 1CUCA 4I3FA 4HXFB 3ZWQA 1JI3A 2WJ6A 1CFJA 4U2EA 4HTAA 5AM2A 1QO9A 2GZRA 3QBJA 2FJPA 4B85A 1SOMA 1Q0RA 4YPVA 2XUOA 3D7RA 2XUGA 5ALJA 1NU6A 5ALSA 1CUFA 4GEGA 4E15A 3QPDA 2GBIA 4FLMA 1IZ7A 1J1IA 4LXHA 3C6BA 4FMPA 4OB8A 4BP9A 5ALPA 3WWEA 3QVMA 5KBYA 5DWDA 4BZZA 1LGYA 3DCNA 2BAGA 3AIKA 2XLCA 5K3FB 1GQSA 4K2AA 3A2LA 2HADA 4HZGA 1QOZA 2QUBA 3ESCA 5CMLA 2JGEA 2CZQA 2EDAA 5IVDA 1CEXA 3I2FA 4JUIA 4AX4A 3OC0A 1EDDA 1QONA 5JAHA 3K2IA 4B84A 4LXIA 4QWWA 3DKRA 3ANSA 3E3AA 2J4CA 2AJCA 1QFSA 2VAXA 2OGZA 3G02A 3GA7A 2HA0A 1CUYA 1PFQA 2RGUA 5FOQA 1UT6A 5DYWA 4AO6A 4QDZA 4B83A 3CN9A 2WILA 2XQJA 4ARBA 4BATA 2YASA 2H7XA 3WZLA 2YXPX 1AURA 4DNOA 3PI6A 1TQHA 3WIOA 4NVRA 1AUOA 3I6MA 5IVIA 5T4FA 1W76A 3IA2A 2WFLB 2VJAA 2VATA 4ZV9A 5FXMA 3BXPA 1A8UA 3KWFA 3M81A 1JJBA 3D59A 3PUHA 5K3AA 4CG2A 5HFNA 2V96A 2HA7A 2OAEA 5HZGA 1F0PA 4GDMA 1TCBA 5CBKA 1XRLA 4HRXA 5AM1A 3QH4A 1DT3A 4EUSA 5EIHA 3FVRA 4W1QA 4F5ZA 3HJUA 1UOQA 4OB7A 4H7EA 5HCUA 1UKCA 4CFSA 2OG1A 5AKJA 4PNZA 1MO2A 1EB9A 1W4LA 2DHEA 5ALTA 3IUQA 3G0IA 2AXEA 3K6KA 4P08A 4H77A 3DKKA 4E46A 1AC5A 2DR0A 4BCCA 5LIPA 4Y2PA 1VOTA 5AHXA 1XLWA 4J0HA 5EI5A 2WUEA 4BAZA 2OLEA 3QMMA 4HVTA 3STYA 3QZUA 5AH0A 4H7KA 5J3JA 3U1TA 3WL5A 3H2HA 4LKOA 4PSUA 3VXKA 2VT7A 3E4DA 1R88A 5EHQA 2I78A 2W22A 1P0IA 5AM4A 3WK7A 5E4TA 2FX5A 4LHEA 1CLEA 4CCYA 3AZOA 1O6FA 4EY4A 1BN6A 4UHEA 3C6ZA 3BJRA 1QE3A 5C8VA 4BRZA 1HL7A 1CUWA 3HEAA 4J3JA 5ALVA 1CRLA 4MYSA 1VXRA 2BKLA 4DYHA 5C7YA 5F4ZA 3K9BA 5K3DA 5EHZA 5E4YA 5CRIA 1IMJA 2Z5GA 2H7YA 4A16A 1DT5A 1LPNA 5DYTA 1QZ3A 5T4HA 2JBWA 4Y2QA 3OG9A 3M83A 5D3KA 4OU5A 4XWGA 2GYUA 2HA2A 1F6WA 5CT8A 3L1JA 4Y7DA 2WIGA 1AX9A 1UK6A 1XZFA 1QIMA 4N8SA 3WWDA 4P93A 4KE8A 4X00A 1W52X 5LKRA 1K6EA 1MJ5A 4N5IX 5DTJA 4KE9A 1W6RA 4BAUA 2PSDA 5CW2A 4BE4A 1R9NA 4L72A 5ESRA 2C5GA 4ITVA 1EB8A 1IZ8A 2J3DA 4MWSA 4K5QA 4S0XA 5CT4A 1FFDA 1RYYA 2XQGA 2WIKA 2CEKA 5BWCA 1ZJ4A 3FYUB 1CUVA 4HS9A 1Y37A 4EZIA 1HBJA 4MQLA 3CN7A 1EDBA 1EVEA 4AZ3A 4GBGA 5AKGA 2ACEA 1C7IA 2Z8XA 1U8EA 4JEIA 5IKXA 5CXXA 1X2BA 2ORYA 1YR2A 2WQZA 2WJ3A 1T4MA 4AZ0A 1W75A 1XZCA 3DS8A 2CKMA 3V1LA 4F60A 1CIJA 4RE5A 1QTRA 1XZMA 2XQIA 2AJBA 4M0MA 4NZZA 5JAPA 2C58A 5JAOA 1QIHA 3HYSA 1DU4A 2C5FA 4H7JA 3AFIA 3KD2A 3L1HA 2OGTA 4B9EA 3FYTA 1YASA 5ALIA 1Q83A 3DEAA 3FSGD 4ZWNA 4LXGA 4DNPA 5K3FA 1IUPA 3BWXA 2B9VA 1WM1A 1TRHA 5C8ZA 3I6ZA 2OQIA 5HK8A 2C4HA 1J06A 4MYDA 5LZ5A 3GELA 3G8YA 1LPPA 5LZ2A 2WKWA 3NUZA 5AOAA 4X94A 1MX1A 3M82A 1S8OA 1YB7A 5IVHA 5ALNA 2XMDA 1A88A 1HQDA 2IX9A 1HPLA 2JEZA 3I2JA 4OCZA 5AKIA 1XFDA 4N5HX 1XZKA 2YH2A 5T4EA 4U2DA 1UWCA 4W63A 3WZMA 3ESDA 4GHWA 5C8XA 1GKLA 3R3YA 4E14A 2Y6UA 3FVTA 3KXPA 1XRMA 1GT6A 4KAFA 6YASA 3KDAA 1R4ZA 2B4KA 1TK3A 5AKKA 2Z8ZA 2ZJFA 1LNSA 2HRRA 2WTNA 3BL8A 4GXNA 4ZI5A 2B20A 3ZLUA 5SYMA 4C87A 3QITA 1VE6A 3DDUA 4BCBA 4EHBA 1MNQA 2R11A 4U2FA 5AK6A 1DQYA 4H35A 1CUUA 2WFLA 3GBSA 3HXKA 3B5EA 1THTA 2WHRA 2BJHA 1VE7A 4PSDA 2O7RA 4G1FA 2G5PA 3AUKA 2FUKA 2RHWA 4QEKA 2Z3ZA 2XI4A 4C4ZA 3WL8A 3F9CA 1L7QA 2J3QA 2R8BA 1FFEA 1A8SA 3UUEA 3AZPA 3WKEA 3EF3A 4Q05A 5ALYA 3EQ7A 2XUKA 4AMYA 3H0CA 1DWPA 4PF1A 4UFOA 1ETHA 4DNFA 3BE8A 4QDXA 5LZ9A 2HFKA 1LPOA 1VLQA 4MQMA 4GLBA 1CUZA 3WK8A 1WHTA 2XUIA 4FWBA 3O4GA 5AJHA 5HF8A 5KREA 3VDXA 1LZLA 3OOSA 1JMKC 4ETWA 3H2JA 4BVKA 2VEOA 2ZYSA 3G0CA 3C70A 5FKJA 1K5PA 5CH3A 3DD5A 4BP8A 1G5FA 2CB9A 2HFJA 1F0NA 5AOBA 1K4YA 1CUEA 4B0OA 3WK6A 3R3XA 1UK8A 5JADA 4ZXFA 4Y2JA 3QMVA 4LIPD 1H2ZA 5JAUA 2DFPA 3LCRA 2I03A 3AIMA 1CQZA 2HA5A 1UKAA 3QMWA 2VJCA 1EI9A 5EGNA 4B6GA 1XZJA 3VVLA 4FHZA 1E5TA 3H2KA 5JZSA 5JZ9A 1JFRA 4GI1A 5T4BA 1ORVA 2GZSA 3G9ZA 3AZQA 1DX6A 3WWPA 4FTWA 5D6OA 1XKLA 4KAAA 1VZ2A 2ROQA 1ZI6A 3H19A 3O4HA 3ESBA 5AM0A 4P9NA 5ALUA 1ZD5A 4MEAA 4QLAA 2WFMA 2BUCA 1YSCA 1XZHA 2VAVA 5K3CA 1CUSA 1EH5A 3T52A 4LYDA 2JGMA 3DYVA 4PV7A 2ZYIA 4QNNA 2VT6A 1WHSA 1AKNA 5CT6A 1U4NA 1WB6A 4BYMA 2ZJ7A 5SYNA 3VJKA 3HSSA 4UBMA 1ZJ5A 3WYDA 5AI6A 1O6GA 4RE6A 4X95A 2JGJA 1UFOA 4DMKA 2ES4A 5FP0A 1LZKA 1BCSA 2EDCA 3FWHA 5A7HA 3I1YA 2XUAA 4WJLA 3IDAA 4YASA 3VVMA 4ZV7A 2BCEA 1ZICA 1CUIA 5HQ3B 3STWA 3R3UA 4IO0A 1ZI8A 4H7FA 1PV1A 4V2IA 3W2TA 3FYUA 2Z3WA 2XMCA 3ESAA 1Y7HA 2CJPA 2PSJA 3I2KA 3SX4A 1ZD4A 1I6WA 1OCEA 4BTVA 2PPLA 5AM3A 1YS1X 3ZLTA 3IUMA 2IIVA 2HU7A 3D4LA 5FUMA 2Q0XA 5AP9A 3C43A 4M0EA 3OURA 3LP5A 3QPAA 2QJWA 4EY6A 1XLUA 5K3BA 5LZ8A 1MU0A 1TAHA 2WG0A 3Q0TA 5HFAA 1A7UA 2XUFA 2OXEA 5AI9A 1BCRA 5EFZA 5LYYA 4JNCA 4PSCA 1N5MA 3FLEA 4FKBA 1CUDA 3HI4A 4UBNA 3BF7A 5JATA 5E4JA 1ODTC 5DNVA 5ALZA 4FOLA 4Q3OA 3W05A 3UUFA 3FLAA 3AINA 1E66A 4IH1A 3PDCA 4FNGA 5C81A 4YX9A 3KSRA 1FFAA 1N5RA 4C6HA 3BIXA 2UZ0A 5BV7A 2P8SA 2WUGA 1OXMA 4G4JA 5A6VA 4B80A 3C8HA 3CCCA 2D5LA 4KACA 2QUAA 5AKXA 1K8QA 1WB4A 2AJDA 1UK9A 1MNAA 4C89A 4BDSA 1XRQA 4DTCA 2C0PA 4BVJA 5AM5A 3FBWA 3YASA 2EEPA 4J0KA 4FBMA 5D3ZA 2WUFA 3WWCA 1XQXA 3WJ2A 2G5TA 3QPCA 3V48A 1JMYA 5I9IA 3D2BA 1UOPA 1MAAA 1C7JA 2HDWA 4OPMA 4JH0A 1NU8A 4BAGA 2WHPA 4M0FA 4Y2VA 4DSAA 3C87A 5ALOA 3V1MA 3A2MA 2V9ZA 4G9EA 4K6GA 3A70A 2XQKA 2HU8A 3WK4A 2XUHA 1KU6A 4A23A 5AKEA 4B81A 1BS9A 4H7DA 1GPLA 2AJ8A 2WG1A 2H1IA 2XUQA 5ALMA 2NW6A 3AIOA 1Q84A 4FFVA 2CUTA 1IUOA 1XZGA 1BROA 3FOBA 4QWMA 5D7BA 4AN1A 2QR5A 1E8DA 3E1GA 3AJAA 2K2QB 3MGAA 4U2CA 1J2EA 4KRYA 3DL7A 4ROTA 1SC9A 2WU3A 5EHXA 2PSHA 3G0DA 2PSFA 2VQ6A 3C5VA 5H3HA 5DNWA 1BEEA 3OTQA 4FLEA 4NS4A 5FPPA 4GWLA 5ISMA 4AXBA 3ICWA 1BRTA 2PSEA 1GGVA 1UK7A 2BUAA 5A7FA 3G7NA 3PE6A 3WK9A 2G4LA 1G66A 1H2XA 3O4IA 3M3DA 2Y2UA 1ISPA 4KE7A 3FYUC 4MJ3A 3O95A 3RKSA 3HRHA 3JW8A 4KAJA 5CTAA 3STXA 4H18A 2OCLA 3D0KA 4MXDA 4TPKA 4DSZA 4Y2XA 2ZVDA 2JGLA 2VA9A 2O2HA 4J0CA 2G63A 3GZJA 4ARAA 3G9TA 1GPNA 1MTZA 1B41A 4QDUA 3BDIA 1BEZA 1CQWA 3S2ZA 4Q3LA 4UHFA 5JYCA 1XZBA 4G9GA 1J07A 2JEYA 4X97A 4X3CA 2DQYA 1WCYA 4N8DA 1A8QA 3D2CA 4UFPA 1YA8A 1F8UA 5HF5A 4P92A 3TEJA 5DYYA 4UBJA 4HXGA 3C6YA 1MPXA 3N0TA 4UHDA 1TIBA 3PUIA 4BB0A 1IUNA 3ANTA 3RK4A 2HA3A 1JT2A 3FAKA 2VTVA 4BVLA 4ZGBA 3A2NA 3GUUA 3MUOA 2QKYA 4QA9A 5JD6A 5FDFA 5HQ3A 3B3QA 4EY5A 3I2GA 3O9MA 2WU4A 2BGNA 1UXOA 4UBOA 1DWOA 3DQZA 1RP1A 3IULA 2RIPA 1XRPA 1BU8A 4X90A 4X6XA 2XDWA 3H2GA 1P0QA 4OUKX 5JD4A 1LPSA 2X5XA 3WYNA 2JGFA 4RNCA 4UHCA 4WCVA 4B82A 4Z49A 1E89A 4PO3X 2V97A 4Y9SA 2WTMA 5CT5A 3WWOA 3VJMA 2ECFA 3IB3A 2XMGA 4G4GA 4Y2TA 1VA5A 5AI8A 1FSSA 2ZYRA 3PICA 1XRNA 1QIDA 4L3WA 1XZDA 4W1SA 1X2EA 5AK3A 1JU4A 2WHPB 1ODSA 3DOIA 2I3DA 4KEAA 1QGED 2JGIA 3LS2A 2RONA 3EQ8A 2ZYHA 3BDVA 5DJ5A 2DHCA 3R3WA 5HK9A 3HZOA 5KWJA 3KOOA 3BJMA 4QLOA 5EIEA 1K63A 5JASA 2WJ4A 2HA6A 1ORWA 4D9JA 1THGA 2WSLA 3UMJA 1CUHA 2H9YA 4Q3KA 4OYYA 3CXUA 4U2BA 4WDQA 1LPMA 2HIHA 4WFJA 4W1RA 3P2MA 3F67A 4N8EA 1GZ7A 4UHHA 2GBCA 3PF9A 3HABA 2W6CX 4I4CA 5AIBA 3DNMA 1DWQA 1SCQA 1BE0A 7YASA 4NMWA 4C4YA 1W1IA 1M33A 4BBZA 1LBSA 3HACA 4OD0A 1R50A 5E2IA 3VKFA 3SWWA 1EK1A 4KR0A 3X3HA 3WL7A 1RWQA 1LPAB 4K6KA 1CUJA 4CG3A 3R41A 2Y6VA 1ODCA 5ALWA 3ILSA 4CG1A 2OAGA 2OPHA 5A2GA 2VSQA 4OU4A 2XMRA 2HM7A 1L7AA 5CURA 3B12A 4MWTA 3BIWA 2LIPA 2D0DA 3FLBA 5K3EA 4J0IA 3RARA 4HRYA 1R3DA 3DL4A 3I1IA 4J7AA 4I19A 2XE4A 2OQVA 5AI0A 5LP1A 1JU3A 4AB1A 3SC2A 4CCWA 1QIEA 1Z68A 2XQFA 4UUQA 4KYVA 5LZ4A 1AMNA 4LYEA 4UHBA 2I3ZA 4F0JA 3JWEA 3N2ZB 4Y2RA 1EVQA 3EIOA 5AKHA 2GYWA 1XZEA 2DSNA 1TCAA 3ZI7A 3C5WP 2FJ0A 3ZLVA 4J0DA 4G8CA 1UKBA 1XRRA 4UBIA 1Y7IA 2WLSA 1HLGA 3H18A 4Q34A 4KRXA 1OILA 3S8YA 3V1NA 4DM7A 2OGSA 1QO7A 4C88A 2C7BA 5JZBA 5JIBA 1HDEA 1GPKA 3STUA 5AK4A 3WKBA 3HLKA 1FJ2A 1LLFA 3F96A 2RHTA 3G9UA 2QXUA 3WL6A 2O2GA 3IIIA 2QMQA 5CH5A 3A6ZA 1EHYA 1R1DA 5DTIA 1LPBB 5AKZA 1CR6A 3GFFA 1VXOA 3V9AA 4B7ZA 1XZLA 1N8SA 3OM8A 4EB0A 5HF6A 5CH8A 2CMFA 4UFNA 2ZSHA 4JYPA 2WIDA 3FNBA 2X76A 5EHNA 1ZGCA 2WUDA 3STVA 4DMFA 3WJ1A 1YAJA 4H0CA 1ZOIA 4CI9A 5JALA 4DLNA 1XQYA 1H2WA 2PUJA 5HF9A 1XZIA 1YAHA 2HHAA 2O2IA 1D07A 5ALXA 3W04A 1ZIYA 3RM3A 2VJDA 4X6UA 4TVKA 5LLSA 3VISA 1DINA 3I2HA 2PL5A 1CUGA 4WFIA 4H7IA 5IVKA 1QLWA 2HU5A 4BE9A 1ZD3A 4MEBA 2ZSIA 1AZWA 5ALQA 4AO8A 3R40A 1XKTA 2GYVA 3H1BA 2QVBA 4U2GA 4F21A 3G0BA 2HL6A 3WKAA 4IQ4A 4UPDA 4WDRA 3C6XA 4ZREA 5AOCA 4G4IA 4FFWA 1WB5A 5KWIA 4K6HA 3D2AA 1USWA 3PFCA 1AQLA 4AMZA 2B61A 4RPCA 3QYJA 3NWOA 4DNQA 2E3JA 1GKKA 3WKCA 5I7UA 1DX4A 3WQHA 1NX9A 3H17A 4QE3A 2QT9A 1SCKA 3VJLA 1YA4A 2WIFA 2GBGA 1X70A 4HAIA 4X7BA 4AQDA 4YK7A 1WOMA 1QJ4A 2PU7A 1H22A 1H23A 5BWBA 1Q0ZA 1YS2X 1XZAA 3LIIA 2BGRA 1CVLA 3Q8WA 1CV2A 3F97A 3GROA 2PM8A 1FFCA 3PFBA 4C4XA 3CCBA 4UBLA 4Q82A 3FCXA 4DGQA 1G42A 2QXTA 2XUPA 3C45A 2VJBA 4PQEA 5ALLA 4JYMA 4A5SA 1C4XA 3HC7A 2PUHA 1VA4A 3PF8A 1QIFA 3WI7A 3C8DA 2PKYX 3O0DA 4X91A 3H04A 3LIPA 3RLIA 3ZPXA 3WK5A 4L0CA 1CUAA 5AKYA 4QDOA 3G0GA 2WM2A 1BN7A 5AK5A 1EX9A 2H7CA 1XLVA 5AKLA 4E11A 2QS9A 3OPMA 5JARA 4CIBA 4FDMA 4ZRDA 2XT0A 4OSEA 1WPXA 5ALKA 5DNUA 5AI5A 2BFNA 4EY8A 2JIDA 4W9RA 1T2NA 1CUBA 2DCMA 4KE6A 2WIJA 4BRSA 1ZD2P 1JJFA 2XMQA 3IURA 4G8BA 1VZ3A 2AJLI 1N1MA 3I2IA 5A62A 1YCDA 3D3NA 2PBLA 3WA6A 4BC1A 2QTBA 4PW0A 2QRUA 1MX5A 4FNMA 4GW3A 1JJIA 3MVEA 5CT9A 4BCDA 4OB6A 3W06A 1GQRA 1P0PA 5ALEA 4GECA 4XIIA 2XB6A 3AILA 1SFRA 3DJYA 3NOXA 4RGYA 4Y2SA 3WIBA 2HA4A 2XMBA 1QIIA 4G8DA 3T4UA 4G5XA 1TCCA 5YASA 4W1PA 1ZI9A 4Q1VA 2JGKA 1XQVA 4BDTA 1SCIA 4UBKA 2XMZA 2RAUA 4INZA 2YYSA 1HKHA 1UZAA 3R3ZA 1KEZA 3IUNA 2JF0A 2XUDA 1H2YA 3STTA 1FFBA 1QIJA 5AI4A 3ZV7A 2DQZA 3I28A 1KU0A 4X6YA 2RI6A 3F8SA 1ACLA 1XROA 2QJRA 5I8PA 3MUNA 4OYLA 3SK0A 2V98A 4H7HA 5AIAA 1L7RA 2VF2A 4DMCA 3DOHA 1DTEA 5EIAA 1EDEA 2O7VA 4EY7A 1LBTA 5A7GA 4X93A 3EBLA 4FLFA 3IUJA 4EA6A 1U65A 4IH4A 4L9AA 2J4FA 5ALRA 4HXEB 3WLAA 4KJXA 1CUXA 3F98A 1U2EA 5BOVA 1UOOA 1EINA 5K5EA 1QTIA 1ZGBA 2IITA 2QOEA 1MX9A 2OCGA 4BZWA 5LKAA 2GBFA 5FV4A 3ICVA 1PJAA 5A71A 3D5EA 2XLBA 3NGMA 4XVCA 1EK2A 2PX6A 4J0JA 4FBLA 2WHQA 1ZIXA 4B0PA 5ALGA 3H1AA 2Y2VA 4J0GA 3FCYA 5LZ7A 4Y2UA 5FPQA 3TGLA 2ONCA 3IVMA 5AICA 2OCKA 2QZPA 4IHAA 5IH7A 5JANA 1B6GA 4AN0A 2WG2A 3R3VA 1VJ5A 1IVYA 3U0VA 2XMSA 4CCYB 3WA7A 2BUBA 3V1KA 1E3QA 2QM0A 3W9UA 3FSGA 4IH9A 2DHDA 4XX1A
chains in the Genus database with same CATH superfamily
1NBWB 5BORA 5HKBA 3GRCA 2NSHA 4R9SA 3Q85A 4CODB 1FJXA 1P29A 2DBYA 2DVMA 3MUFA 3L4KA 2FLWA 2J33A 3L0YA 1KP3A 3ND8A 4LSZA 4MS4A 3RKUA 4ALNA 3PB3A 4S1OA 4ABYA 4CCSA 1P77A 3EMVA 1S4QA 3VH1A 1INLA 5ARDA 1NJFA 3FVVA 3MFQA 5CVEA 1ENZA 4LYJA 3P26A 1TMGE 4MSUA 1MN6A 2QUZA 3RU2A 3T3PB 1YTUA 4ME6A 1Q2XA 3PHJA 2R7AA 3BHNA 4GPIB 1U2GA 4DIUA 2F55A 3R0VA 4BP3A 3I6YA 3N3AC 4A8PA 3UW3A 1X7XB 1Z7EA 3HWX1 1OLSB 1AKYA 1MAHA 1PNTA 2IELA 3FGZA 3L1IA 3DLTA 3M6LA 3N8DA 1T13A 4H6VA 5DBIA 4D9CA 2BHRA 5CXUA 4E6EA 1N9ZA 1VYHA 3AFMA 4QDTA 3WKDA 1PQUA 1FXSA 4X71A 2DH5A 4EBBA 3CKKA 4HN2A 3WAJA 3G8DA 5LJLA 4OXXA 2DEUA 3UWSA 1NXQA 1JXOA 5J2UA 1O9HA 2AE2A 1YI0A 1E8NA 2R66A 1FTQA 2ZJ6A 3GCDA 1U9JA 3TE7A 4JQOA 4AJIA 1GTG1 5CEJA 4XSHA 4E03A 2YIVX 3DW1X 5FPKA 1ELOA 1BA3A 3SDZA 5BMVB 1WXGA 1NMSA 1LBIA 2ACKA 4WY5A 1JHRA 5FLKA 4C06A 4EJSA 5CFLA 4OK6A 4F06A 1NURA 1N1EA 2WWGA 1F2VA 2AA3A 2YHBA 3QG5A 3HYTA 4PO9A 1CQIA 2H3EA 1NJ5A 2IW3A 3DMHA 3L0SA 5CVJA 5F4BA 3WLOA 3IBTA 4B74A 4C0BA 4W5RA 1TOAA 2P0EA 2D6FA 1PD0A 1Q7EA 2DULA 3L8DA 4EMTA 2XB8A 1ULAA 1XMJA 4KODA 4R1SA 4X7MA 5FD8A 4BBJA 5DSTA 2A9FA 1ACJA 3M5CA 3T7CA 4RHFA 3S68A 1AHPA 4BNMA 2OT3B 4W5OA 2IPLA 1QP4A 1XJQA 1KC1A 2FMIA 2ZS9A 2I7CA 1G3QA 5LXTF 1IAQA 1Z4KA 3O8OA 1M83A 2WJPA 4FFNA 3GLFB 3M6WA 5ILQA 4NJEA 1M8FA 3SG0A 3DPIA 3ZGVA 2A0UA 1FYWA 1AGYA 1TKRA 2GPJA 2ZJBA 3LQRA 2YBEA 3PFIA 1RJEA 1YKFA 4GGOA 1QGZA 4J07A 2X2PA 1P81A 1QRAA 3IHWA 1KFKB 2WE8A 3KM0A 3NATA 3LWZA 4GXQA 5J63A 4ATNA 1YMQA 1NPDA 3EUFA 3I4LA 3DP7A 2Q50A 2H4XA 4F3NA 5ITZA 4D3FA 3VPBA 4DEVA 3F71A 4YWJA 2DH6A 3RE1A 2G8NA 4AO7A 2C07A 4DHWA 5K05A 2J5RA 3LI2A 4OUDB 4KQIA 3RJMA 1ZKDA 1O0CA 2RGGA 2VJOA 1B26A 5EZYA 3RYIB 5JFGA 1PT7A 2OM6A 3JQ9C 3SR4A 4CDRA 3OKCA 1TFUA 4G6ZA 4I3FA 1C30B 4AZ3B 2WJ6A 3MS7A 4K46A 3PHCA 1SHTX 2C4NA 3HE3A 4PYQA 2BEUB 1NBME 1SZDA 3ZIAD 4U0JA 2MYPA 3DQQA 2IV2X 4JYBA 4D5GA 1LC0A 3DF7A 4BKOA 2GBLC 3NHFA 5AJWA 4PN7A 2REQB 2OXFA 2J3JA 3L0OA 5TIIA 1S02A 5DGDA 1FDSA 2GESA 4G2NA 1KARA 4O63O 5IBRA 4B85A 1SOMA 1JTVA 4AZ0B 4UUOA 1XZ8A 4YPVA 1I0ZA 3D7RA 2Z8YA 4BQIA 1JX6A 4MQ6A 1Z83A 4HH1A 5DM1A 4QJIA 4B3TB 3TO5A 2XX3A 2FR0A 2NZVG 2AB0A 4PC6A 1XEWY 1XMSA 3OM1A 5IVPA 5DTRA 4FLMA 1VB3A 4IXWA 2BPOA 4EW1A 2D8AA 4LXHA 2V4MA 1SXJA 3UG6A 4DQXA 1RJFA 1IK4A 1DCKA 1MH1A 1LX7A 4HRAA 1II0A 3JQGA 5ALPA 1I3CA 1Y5NA 3QVMA 3WWEA 4UDXX 4FFSA 1T0UA 2EKQA 3CGWA 4RFLA 1BO6A 5FUYA 3FTDA 3U4MA 2BAGA 4CR6A 1IY8A 3AIKA 2G76A 3PFNA 4MV4A 3SZ3A 4B7CA 4YI3A 5K3FB 5BV8A 2QLNA 1GQSA 4K2AA 5ENZA 4YBZA 2R6AA 1R9JA 4D7AA 2A14A 2Z43A 1OLOA 3ADOA 5L3RA 4EJ2A 2PJRA 4V1CA 3MC1A 1ZP6A 2MR5A 3NRJA 1HDZA 1MIOB 3JAWB 1RNLA 2Q21A 2BW0A 2VHTA 2ZI6A 3G3EA 3SMVA 2VUIB 5IVDA 4Z9XA 1TM1E 1YHNA 1RCFA 4MIOA 4R01A 4E7PA 3MWEA 4P7GA 4ZU3A 1LLCA 3OC0A 1I4EB 1XP8A 3MOGA 1SCNE 4B46A 2W6ZA 2O06A 5JAIA 3AF0A 4LOIA 5CXSA 4MPPA 2PL3A 1K8YB 4ZVQA 2TMKA 5L51A 3BC1A 3BH6A 1J5XA 3EG9B 3R24A 1BXGB 4EUKA 2FZVA 2OHFA 5EWMB 4D0NA 2NUAB 2DTXA 3MTQA 5BV0A 4DLXA 4YAGA 2JAUA 2FFAA 2MMGA 2Y1FA 2IW1A 1M5UA 2JNWA 1IBSA 2DFKB 3D8NA 3G02A 4P35A 5K6AC 2IZ6A 3H97A 1YZ3A 3LHIA 2JLQA 3ZHBA 1SK9A 1CUYA 1VLHA 4JL8A 3JASA 4CMEA 3BSSA 4CLOB 3UFBA 2W43A 3SDBA 5IAEA 2H2WA 3DMDA 3E5MA 3LCCA 4WA7A 3T7KA 2EAUA 5REQA 1DGQA 3H1PA 1H2RS 3BEDA 1N6RA 3R2JA 1US8B 5FBWB 5DYWA 4AO6A 4A15A 5LLTA 3V8PA 1XVUA 1QYVA 1YVDA 2YTZA 3TFWA 5HX7A 3JPWA 1SCBA 2PRYA 4JC4A 3AUFA 2IU3A 1DX9A 4QO8A 2CL0X 4UNIA 3EXAA 2XQJA 1C4OA 3PRHA 3M6MD 3IPCA 3LUHA 3W6NA 4ARBA 4C0QC 1W36C 1OV6A 2Y0EA 4RWZA 3RG8A 4O4HB 4YO8A 4CETA 1APBA 1E7MA 2A3NA 2D3WA 5A02A 3PI6A 3KJHA 1TQHA 4INJA 3NIWA 1NQOA 4ER3A 1FZTA 2C2MA 4ZYUA 2JGRA 5A9SA 1FTGA 2UUOA 3IA2A 4J1TA 3PNSA 5HE9A 3TXYA 1V16B 4BV9A 4F97A 1P33A 4C7OA 1TF2A 4CTNA 2VATA 1P4RA 2X8AA 4KG7A 1ORRA 5FXMA 4BPBA 1EGHA 3BXPA 3UK2A 4PLZA 1AVTA 1Z2PX 4B09A 4M2LA 3DJFA 4L07A 1HYQA 2IEIA 3FF4A 4DMUB 1A8UA 3DHNA 2HQSA 4YR9A 2D00A 4N6GA 2X0JA 4Q9IA 3I4FA 3ETCA 1A2OA 4D9FA 1YU6A 4Q01A 4BUZA 1E9FA 1ZDMA 2XE6A 4KWHA 3ADBA 1Z4PX 4XVRA 2V96A 1P19A 2XOKD 3SS9X 1N2SA 5HZGA 3K71B 2AN9A 2GN9A 3MM4A 3OC6A 1M67A 4FGSA 3NBMA 3OUZA 3KCNA 3SCZA 1OFGA 1U1IA 2PRIA 4NWIA 4M1YA 1C8BA 1NLZA 1NYQA 2CZCA 1CYDA 1U8AA 1TL7C 1CRQA 2WMYA 3ADPA 2PMFA 3QH4A 3TTVA 1DKLA 1XMXA 1OJ7A 2D8MA 4L3VA 4B3GA 1GZ3A 5C8YB 3ZVLA 2RHRA 4W1QA 3H1TA 3PRJA 2PFSA 3BGOS 5FTNA 4F5ZA 2VPWA 3BJIC 4XLZA 3VU8A 4H7EA 5JNTA 1ZW6A 2E4VA 4P98A 2BMJA 4DV6B 1UKCA 3PJRA 2GN0A 3X1XA 4DREA 5K2OA 3V9PA 5AUPB 1RHUA 2WJJA 4G0QA 4GLJA 5HQTA 1DBSA 5AKJA 4PNZA 1USUA 4CU2A 4M8NE 4JLVA 1ABFA 4AQ7A 2B5OA 1W4LA 2Y99A 3ZCVA 2FFQA 3CTPA 1AGRA 3AI7A 2Q3HA 3TR0A 4P53A 5HZMA 4BLQA 4Y1FA 1PJZA 3U4CA 2QPLA 4XYMA 3ZWVA 3K9CA 1B8OA 2ESRA 5JJCA 3JVVA 3GLGB 3W5JA 2DR0A 3SR0A 3KS9A 5ER9A 4Y2PA 5DP2A 4ZEWA 1SU7A 4HG2A 1B73A 1J0DA 3H7IA 1P1RA 2J7PD 4J0HA 4RIGA 3VR2D 4HV4A 2PH3A 3M33A 4RTQA 4HMPA 4M86A 3GLGE 3AMVA 4BAZA 2JCVA 1WF3A 4MS1B 1M1YE 3QMMA 3SKVA 4AU1A 3QEAZ 4PG8A 2VQEB 1YRAA 2EJUA 3QZUA 5AH0A 3WMWA 2LDBA 2VP0A 1PS0A 5AD1A 3RS2A 2P41A 1OD6A 2KW5A 4PSUA 5GINE 2B3TA 2WAMA 1Z75A 2IHZA 4LV5B 4OIMA 4ZCLA 3B3GA 1FNSA 3GJ4A 2HMUA 1QB8A 3OIYA 2P91A 3LWNA 2PUGA 2I78A 3LKZA 3H5TA 2GWRA 3IXQA 2XOEA 4G0NA 1GDDA 4I1OA 4E5VA 1GTZA 4EYOA 3PGXA 5IT4A 3LBFA 4MUFA 4RFSB 4A0QA 1AQNA 3U7HB 3E22A 1Y98A 4Q9AA 3AZOA 1TCUA 5JLJA 2I87A 2IYSA 2Q2WA 3IAXA 2AD1A 4RVDA 3D7MA 4HKTA 3HO6A 4YFVA 1YZGA 3IMEA 4CBVA 3UC9A 2IY9A 1CUWA 2QUKA 4BLOA 4EL0A 4KO8A 4H08A 1XDGA 1WQ1R 3KJEA 3OJFA 5FA5A 3KVRA 5DU2A 4W8HA 5ALVA 1CRLA 3F6EX 3IERA 1EHIA 1YNOA 1VCNA 3HFJA 2O3RA 4PLVA 1FFSA 2FFJA 1FNNA 3NH9A 4F38A 1D2CA 4YXFA 4E33A 5J2UF 4KLNA 2H1VA 3SY8A 6CHYA 1TVMA 2AR9A 4C29A 5BPHA 3E3LA 1JFLA 1E3DA 2BKLA 5EKXA 1M8KA 3KZMA 1H65A 1Q7RA 1T4GA 2Z1DA 4AP5A 1UBKS 5F4ZA 1XVAA 3K9BA 4DYHA 5CFOA 5FBQB 2WE7A 4QPDA 1JYEA 3T06B 4YT2A 4JP2A 5EHZA 2W9XA 1N2OA 4TT3D 5E4YA 1R16A 1X7XA 3GGGA 1H9AA 1OLSA 1UKZA 5JDCC 4EAQA 1JYSA 4IG4A 2AUNA 1ZZGA 1DT5A 2D2EA 4DIKA 4XTRA 2CJXA 1FU7A 1YK0A 5DYTA 5G0TA 1EGAA 3MUEA 3MTJA 4Z2AA 1Y9AA 4ZALA 1M9NA 3MBKA 4FOPA 4I81A 2O59A 3G5AA 3OG9A 3FW1A 3M83A 3ROKA 5H7XA 3O1LA 3T7IA 3I9JA 1OFUX 2GCPA 4ETMA 4OU5A 3P2OA 5SY6A 1A9SA 2BFWA 2FGKA 1ZEJA 2QDXA 4BZPA 1EFUA 2WJAA 2HOQA 3CNNA 2QI9C 1DHTA 4JJEA 3C97A 3R7LA 1TM7E 2V7VA 1V7PC 4UCFA 5CT8A 1AXGA 2YXBA 1KQNA 3AOEA 4CM4B 1PQ4A 3WBBA 5BMVA 2P2GA 4QM7A 3ZDDA 3ADDA 3FOFC 1C3VA 1XZNA 1IDOA 3J7TA 1G41A 2C29D 2I71A 3M5WA 3U4GA 5EYPB 5DO9A 1E7YA 4RAOA 5HM6A 1OROA 1H2BA 1W19A 4HWOA 1QIMA 1ZH4A 3RK1A 4HAWA 3KU1A 1WXXA 1B8PA 3BMCB 3MCUA 4FYYA 4LXUA 1DOAA 4P93A 3DUWA 1HF3A 4TUYB 1IY1A 3O1HB 1RLIA 2NZ8A 3UKJA 1W52X 1CRPA 5IAAA 1Q0SA 2BH9A 2JARA 1L5MA 3DMRA 3ZDQA 3NBZC 3T3NA 4G9BA 5FAXA 4EDHA 1MJ5A 4KPEC 3E9CA 4J91A 1FB5A 3RBAA 1YC5A 3LC2O 3ZE2B 4N5IX 1OAOA 1T91A 4BMOB 5HSGA 2Z6UA 1NRXA 1HX7A 3TZLA 1KETA 4I2VA 2C88A 3HBLA 4XASA 3GLFA 3DEKA 4ZI7B 4LY3A 3LT1A 3WRXA 1L4UA 2C2ZA 3E8SA 3LUBA 1FUUA 2ADFA 4HPWA 3EEBA 1R9NA 1AK9A 2ZWAA 3V8VA 2JDID 3B6EA 2O2CA 4ITVA 4WAUA 4ARCA 2B0JA 3DL2A 2WOOA 3AESB 4J2TA 1P4AA 3DBRB 3UPDA 4MWSA 3ZEAA 3H3XA 1M34B 4EG5A 1C1DB 1U5CA 1HE5A 4OQQA 3RRJA 3ER9A 4C30A 1KP9A 1UDAA 1OY1A 5TRTA 1KH3A 4OUDA 5CR9A 3WDSA 4MVJI 1I4LD 1EGMB 5BWCA 1YFKA 5A6SA 2IPOA 3RYIA 3GT4A 5DT9A 1G5IA 3WBJA 4D9IA 4QVIA 4MGIR 4NNOA 4MAAA 2H31A 2VZ8A 3CN7A 3U7QA 3U9SA 3CG4A 1EDBA 1C30A 1EVEA 1ZSYA 1U94A 2BGLA 3A6HA 4MUEA 4AZ3A 5A4IS 4YWHA 4EB6B 2BEUA 2Q6VA 3GJSA 3I9OA 3NTQA 3I5MA 1JFTA 2ACEA 3RTCA 1KC3A 1GNVA 1DIGA 1XVVA 2IYQA 2XCQA 3AX6A 5F3RA 1E59A 2R8OA 2REQA 3RC7A 3LT4A 4URXR 4RHTA 1Q0TA 3ACBA 3UM9A 3DAYA 3HSYA 4L28A 1VSTA 3HB5X 4ON9A 5G40A 4BEBA 3QVSA 4LRYA 1FP4B 4R1PA 1GL3A 2C95A 2VH1A 2JLAA 4B8YA 2XBLA 1M54A 2P0YA 3LPMA 3PFKA 4AZ0A 4DANA 2J8ZA 1ZMTA 2Y77A 4QFDA 4DBVO 4ZZ0A 3DT9A 1T26A 2X14A 1FRFS 2LP4Y 2GRJA 3TZQA 4CTJA 4F60A 4JLKA 3O75A 1Z9BA 1O5OA 2YYAA 2QK4A 1H8ED 1M2JA 2XQIA 4WWHA 3O82A 4Y2GA 3RUEA 2HLPA 1JAXA 4WBSA 1Z39A 2HSDA 3JD0A 4ND5A 4R3UC 5TC4A 1M6WA 4P3PA 4US2R 2QQEA 3KSZO 3KQLA 4NZZA 5F7ZA 3WIUA 1B42A 2CB0A 3HYSA 1Q1GA 3B51X 1DU4A 4LRTB 1NNSA 3AFIA 1BJRE 3MELA 3ZCPA 3CE6A 1LY1A 4LE0A 3TECE 3KJGA 5ALIA 5DNYB 1JEDA 4DZTA 5C53B 4G0UA 2PKEA 1VBKA 1NSTA 2VHXA 4ZWNA 4HVCA 2VHWA 2BM9A 3OCCA 3O8QB 5K3FA 3LGXA 3BWXA 3PFHA 3P9RA 5T6BA 5B57C 1SEPA 1HE4A 2R751 5I3CA 1K8XB 2F3UA 1CJCA 4F3RA 1TFRA 4O8ZA 4RPLA 4KXQA 1MDBA 3HXTA 2GHRA 2WAYA 3EFEA 2RAFA 2Y4OA 2WKQA 4Y2HA 3WB1A 5GJBA 3ONFA 5LFAA 1TJNA 4ENUA 2DERA 1XLTC 4GR9A 1UJ5A 1OR8A 1NSYA 4P32A 1NTRA 1J06A 1MIOA 2C4HA 3QLUC 3JAWA 3T1OA 1PSWA 3DE1X 1ZCFA 3RW9A 2Z4RA 4F2DA 4J49A 1RWBA 2C1ZA 2IDMA 3LXUX 1RVV1 4KXMA 2P75A 3G8YA 5KI6A 3ZG6A 4B6SA 2DX7A 5LZ2A 1UPXA 3TG2A 4KTTE 4D6PA 1Q16A 1IXZA 1YXMA 1HEIA 3FNQA 1MX1A 1O6CA 1RFGE 1R8SA 5LQUA 4FINA 3CRQA 1KAHA 2XMDA 1TKCA 2H06A 2EKLA 2OORC 3AL3A 3AUJB 1HQDA 3LLMA 2OHHA 4PBTA 4EIWA 3AI3A 4IRXA 5IG2A 3K70B 1ZNYA 5AKIA 4N5HX 1HURA 2BR5A 3EG9A 1BXGA 5JISA 4G89A 5EWMA 3WE7A 2NUAA 3SU8A 1SRQA 2C78A 3QFTA 1BW9B 2AYZA 3CVOA 5EJFA 4W63A 4U8HA 3OJ0A 3L8ZA 4WNYA 2JKVA 3ROMA 4MRAA 2CNOA 2FHPA 3ETHA 3WZMA 1SHZA 1JEQB 2D3TA 2FWMX 3U40A 4C7VA 3KVOA 4I55A 3R3YA 4HGNA 5A03A 5C8XA 3BJEA 3UHFA 4CLOA 2ZSAA 2KB0A 3SKXA 3WBFA 1A8HA 1LX6A 1U9ZA 1DB3A 1P2UA 3W7VA 3UZUA 3K0BA 5CB4B 3QJGA 3GXBA 3TFQA 2IHJA 3KDAA 5AKKA 4QGBA 6YASA 1KNXA 4XIFA 1LNSA 4WUTA 1AB5A 4G97A 3RS9A 4F6RA 2V7TA 1UBFA 5K45A 4LF5B 4QM6A 4B73A 1L4HA 4GXNA 4ZI5A 1FX1A 4XIGS 2AMVA 2NUBA 3N8KA 4PHHA 3TIFA 1JJAA 1N0WA 3VH3A 3GFSA 4JP8A 1OZGA 3TI9A 2I2AA 3S2YA 1Z33A 4DA6A 3IBYA 5F9FA 1KZYC 2GDZA 3Q5EA 4P3OA 1CDOA 3RBVA 4U2FA 5AK6A 1X1TA 1Z6PA 1D2NA 3QVUA 4F04A 5JXJA 3MOSA 5B1YA 1B6RA 1TMOA 3Q9SA 2L19A 4AI6A 2I6QA 1T4BA 3LW7A 2PX5A 2DECA 1NZDA 3I3SR 4JT4A 4TLMB 3SQXA 2VPIA 1P9LA 1EXVA 5CX1B 2WHRA 2C3MA 4DUYB 1PR1A 4YCLA 1GRQA 2P67A 2QTZA 5KYTA 4I8XA 3BIJA 3DE4X 5AVYA 3OQMA 2GJSA 2BJHA 2B7LA 2QNRA 3K9HA 1SUEA 2YVUA 3L2OB 1AUQA 4Q47A 3JV7A 1GKUB 2FUG6 4G1FA 5MHTA 1X80B 4HOYA 1JFSA 2F17A 3IDOA 1M1ZA 4YRQA 3FR8A 2X4LA 2R7MA 2Z3ZA 2XI4A 5L7WA 4KIGA 2G06A 2C97A 4J0EA 1PJLA 3ER8A 1DQSA 1L7QA 3HNRA 4G4SO 4K26A 1Y1TA 1FFEA 4EG1A 1A8SA 1T0BA 4C20A 3QXXA 2BISA 3PE3A 3FZEA 5AXCA 3ZJYA 1LS1A 1SXGA 1YRWA 1ZOOA 3EF3A 4EFDA 4EY3A 3C3PA 2QV0A 5C8YA 3RS4A 3EQ7A 4V0LA 3P71T 3HM2A 2OTCA 4F7WA 5KO2A 5B36A 1YCFA 3H9GA 2NXWA 1J24A 5F33A 4PF1A 3E5NA 1DP4A 3PXDA 4G63A 4ZICA 4DNFA 1EIZA 3BE8A 3IT2A 1UZLA 4QDXA 3S29A 3TR5A 2L42A 3K15A 2YFYA 1TMKA 2FPXA 3ZZMA 4O4IB 1LPOA 2PD4A 3I9KA 2Y76A 5KJ6A 1PSZA 4MQMA 1AM4D 5JH7B 2PT5A 1SXJD 4GLBA 3R7WB 1T3LA 3WK8A 1XAGA 2F2TA 3C1UA 3KYDB 3LHSA 2X6TA 4GQAA 1PDWA 1TD9A 1RWVA 5KQRA 1G9SA 2FW0A 1OWOA 4FWBA 3LCVB 3N1UA 3RFVA 1H8HD 2A67A 3LQKA 3GZ4A 2ZRHA 1LZLA 1NUTA 4RK5A 1T43A 4RGVA 2OP0A 4Y6OA 1EFPA 1QZTA 3LUGA 3NIDB 3KV3O 4HNUA 3E53A 1JMKC 2LVBA 2YN2A 5U1PA 3TRKA 3GLGA 3PG5A 1W5BA 3DOCA 2HJWA 2WJYA 2HSZA 5MGNA 5D7NA 4CR8A 3C70A 3PC2A 3RRMA 2DE0X 5FKJA 5B2EA 1JTEA 1WZNA 2E4YA 3DD5A 1G5FA 1BG6A 1VPDA 4I1IA 3VSBA 1ZR2A 3EFOB 4EKYA 4IWYA 5JXIA 2VHUA 3ZC3A 2Y27A 1OBFO 2NU6A 4ZEXA 4RENA 3Q6NA 2GBPA 2G83A 3A6JA 3VZSA 1H5QA 4LRUA 1W4ZA 1I80A 1U8TA 4LJ6A 1FX0B 3WYEA 3RKRA 5DI9A 2C4UA 5B3JC 2VIIA 5FJJA 2FE1A 2SECE 4GRDA 4B4OA 1DPFA 3I12A 3R3XA 3KQUA 2I8CA 2WIAA 3LWBA 2AZ4A 5JAUA 2VRNA 1C9DB 4MVJF 5BQOA 5J4VA 3O9ZA 3SXJA 3LVBA 4EJ6A 3AIMA 1QF7A 3ICCA 1DJLA 4NBTA 4CF4A 3BMNB 4RFSA 2PD6A 3FKQA 4RNDB 5CM9C 5DYNA 1OA0A 2V7UA 4G0ZA 4EO9A 3DM5A 1T8TA 3CSDA 1VRVA 1YJ8A 4LY6A 4ZVSA 4CMKA 5L95A 3JQPA 2CXNA 2I80A 2ZSEA 4NYJR 3AVQA 3GEMA 1HTBA 1M0SA 1DRKA 2VOEA 2R8PA 1IBLB 3AUAA 3LECA 1MB2A 3CH4B 2LKDA 1P1FA 4LBZA 5HBRA 5JZ9A 3DLIA 1ULBA 2XBMA 4F4CA 1STOA 4LDPA 1OWLA 2A92A 2BY4A 2IHBA 5DLYA 4BLPA 2QEQA 2AEJA 3G9ZA 4CFZA 3WC4A 2DAPA 2W6NA 2G28A 1DAMA 3FETA 5D6OA 3SZLA 2FDXA 3DBHB 1I7QB 1V8BA 2VRCA 4RPHA 5KSOA 3NHKA 2XCLA 1U7HA 1IFXA 2ROQA 3UV7A 2VA8A 1SO8A 5KVVA 1PBTA 3H19A 3O4HA 4LQLA 2C00A 3S0JA 3G89A 1KAEA 4UM5A 1W4BA 2FUCA 2QTLA 1WVMA 2X13A 1PF7E 1KDYA 4P9NA 5ALUA 1B1CA 4L95C 5B7NA 1W7AA 2X8LA 4MEAA 4OY3A 5H81A 3CZRA 2BUCA 1YSCA 2OZEA 2BJWA 5HIAA 3KZXA 2E4ZA 3FIUA 3GNLA 1RPAA 3LRXA 1KYQA 3PIDA 1WVGA 5CDGA 6ADHA 5BXQC 3RS8A 4LF6B 3IEPA 4OQDA 3ZVNA 1UBCA 2B2NA 3A4LA 1Q6YA 4P86A 4QOFA 4YALA 4QPPA 3GGJA 2DLDA 4JXZA 2AW3A 4IFBA 1VBFA 2VF5X 5EYPA 1J4AA 4BZQA 3CZ5A 1XU4A 3N75A 2JZOA 3VR4A 4FZVA 4KQKA 4YAUA 1QB7A 5MN6A 1U4NA 3BMCA 2A8YA 1ZVKA 2IUSA 3V8RA 5IABA 1QYCA 1N5JA 1PZFA 3J80A 4BNHA 1SUDA 3CXRA 3T1HB 5SYNA 1G0OA 5H02A 4UU8A 1EE2A 3VJKA 3S1SA 3ZBPA 4TUYA 3TQIA 5NLLA 4D9EA 4OM7A 1EE1A 1Y8CA 4MRRA 1ZJ5A 2IZ5A 4KQ1A 1E2HA 3OFKA 4UBMA 4P84A 5AI6A 4RE6A 4X95A 1NE2A 3TX6A 2ZR8A 4MW2A 1RXUA 4AF8A 1LV7A 2WYUA 1XF1A 2O5VA 4DMKA 1A9XB 3LPAA 4ZTBA 3EOAI 1TM4E 3OKAA 3ZZ0A 4GSLA 4Q24A 1MJFA 1OX5A 2ES4A 1F4VA 3V7NA 5FP0A 2IX3A 1WG8A 3UNXA 4KK4A 5LD2C 4R5HA 5DBFA 3B6KA 4F1KA 3T9BA 3FWHA 5A7HA 2ZQZA 2O0HA 3OWXA 4G1UC 4G56A 2VCYA 4K9PA 4MW9A 1YMUA 2JA1A 4WJLA 3RHSA 3OO0A 2PUBA 1VPVA 1L8XA 3AESA 3VVMA 3FCOA 1PR0A 3DBRA 5IF3A 5C4IA 4KNVA 5ENVA 5IDWA 1M34A 2MYTA 1CEQA 1C1DA 3GEHA 2A94A 2I1VB 3R5XA 1Z2NX 4OH1A 4ZYXA 4YB8A 3HCCA 3NHRA 3IKLA 3R3UA 4P54A 4P8RA 4YT5A 3STWA 5LIRA 4H7FA 1SEVA 4MHOA 1SU8A 4BPRA 5G1PA 4LPSA 1DRJA 1JL3A 3RRFA 1O9GA 2HBYA 5JS1A 3FHOA 3ZU3A 2Z3WA 2FTKE 3U9TA 5DTMA 5E9WA 4HP8A 4TLDA 3TW6A 3IJ5A 2XMCA 1OU0A 3ESAA 3ZOZA 1JJ7A 2QZSA 2Q3MA 4LGMA 4BIMA 3TNDA 1EG7A 2HLDA 4EB6A 3BWMA 3N0RA 3I2KA 1FDIA 3JD1A 5KCMA 1OCEA 4ICIA 4KQ2A 2E4AA 4YJKA 3UMBA 2Q6LA 1E2DA 2PPLA 3SC3A 2G08A 4TTJA 3ZWYA 1DAFA 2XA9A 4B6RA 2G07A 1TD1A 5K3SA 3REOA 3VKWA 1C2TA 1M75A 4UD2A 3RODA 1JBEA 2EWWA 3BRQA 3T7DA 1PWXA 1XQ9A 1PYDA 3DFZA 4AJ2A 1FP4A 3GAMA 5JZOA 4IXMA 3EASA 4HNRA 2A1IA 4KXYA 3D4LA 1OXXK 1W6UA 3BH7A 4BGVA 4C0XA 2CLDX 3CKYA 5AP9A 1A27A 2ZETA 5U4QA 4IXDA 3OVMA 3VHQA 4O2AF 2CLMB 4Z3DA 3QWAA 3R09A 1Z4IA 1U99A 4XDZA 5E0KB 4M0EA 2NG1A 4J0QA 3WGKA 2ZUFA 3NX4A 2FPGB 4OK5A 3LP5A 5HUJA 3KYIB 4GKAA 1DVRA 4QU9A 3AWDA 3A1FA 3ECAA 1X3SA 4N0MA 1Z7WA 4RTKA 2GPNA 1H2EA 4IGKA 3AEYA 5CYPA 1ZCAA 2XVAA 1U80A 3I2YX 3IO3A 1U9IC 3Q9NA 3SBOA 4YRJA 2A9KA 2OQ2A 1TAHA 2WG0A 1KE1A 1CZRA 4ZQBA 4FWTA 4JA0A 2XUFA 2ZWIA 3R1IA 2ZRLA 3ZY3A 1QLHA 1XCMA 1K7YA 1BTOA 5IMBA 5AFSA 2IOFK 2AG6A 3KTFA 3E9RA 4JUAA 2O2YA 2PZAA 3U7RA 1C9NA 3CX7A 2Z2IA 2YV5A 5HMLA 1TUIA 3SHFA 3GFVA 4I55F 4YC7A 4L6CA 1HE2A 4EGSA 1CUDA 3HI4A 4XEHA 5EIOA 1P6QA 3L7CA 5JATA 2XIJA 4U7PB 3PQ5A 1MR3F 1ODTC 1K4KA 4JR1A 3KOMA 1KXJA 1NFFA 2ABWA 4CL0A 1J5EB 4UPVA 1IQUA 2R8XA 2VSOA 2ACVA 1XV5A 3KHKA 1ZSNA 3UUFA 3GL9A 4W8GA 4WOJA 5JPDA 4D4KA 1A9OA 1ISSA 3HADA 3SEQA 3CUYA 1E66A 4JI0B 1T0JB 4IH1A 3R76A 1QFZA 3COPA 3Q7PA 2PDAA 4FNGA 2XE8A 4OHYA 1V48A 5C81A 4YX9A 3C3MA 1BW9A 1SJ9A 2QMYA 2UYYA 4C6HA 2VTBB 3DAFA 1LQ2A 2X5JO 3ZGOA 2WUGA 1RWPA 2VYVA 5CDHA 2YVAA 3PQCA 1JDTA 4IEFB 2FZCA 4OA5A 3E7FA 3IOMA 2D1YA 2EG5A 1GAQA 3LKVA 3OQIB 4FYKA 4TROA 4LSGA 4ER0A 4KQXA 4XOUA 2NTNA 3BAFA 2NP6A 4AJPA 5HG0A 4J4HA 5K0JA 2FB9A 1IQ0A 3E82A 1GZVA 1OX4B 4ZAVA 2OXTA 2W71A 2AJDA 1GA1A 2F59A 1KK3A 2ZAIA 3UENA 2YMLA 3W5AA 2OHXA 3JVIA 1ZVQA 3SIXA 3EY9A 3QNMA 2A1UB 2E18A 2GXQA 1KI4A 1D4ZA 1E64A 1OXVA 2JJ8A 4LMBA 1BQEA 2GKSA 1DO0A 1Z4LA 1ZBDA 2X4IA 4RZIA 5AM5A 2O0MA 4MR8B 3TIVA 1Q57A 1OXTA 4F2PA 1UZMA 1TM2A 2BR3A 2ZE5A 2FN4A 1U7OA 2CLOB 1AK1A 3DXYA 4FBMA 5IJ0B 5JW6A 2CWDA 5I7SA 3HDVA 4N82A 3HXOA 1SRRA 3GAAA 3GJTA 4MRVA 4QU8A 5JJ5A 1E99A 3L4BC 2D13A 3IR6A 1D2EA 1KE2A 1EBFA 3U61B 3QPCA 1OU4A 1YUMA 3UPTA 1V39A 4CW7A 2QLLA 1I6MA 1T4CA 2QTFA 1JNXX 3PUKA 4XFJA 3ZD9A 3EA0A 3O94A 3A1TA 4B3DA 2POCA 2CDCA 5DM70 5CX1A 1N9GB 5E3HA 5IASA 2O2JA 1A5ZA 2FMXA 3QX9A 3F6SA 4ZYTA 5I9MA 3M2TA 4M0FA 4I1PA 4PPQA 1NKVA 4NJMB 1I1NA 2YJZA 5EQFA 4D45A 1KK2A 1P7ZA 1UEIA 3P19A 4YA6A 4FHCA 5C2JB 1X80A 3O3MB 3OD1A 4QJ3A 4X7RA 5B7PA 4KWIA 4DB4A 1IQRA 2A4KA 2ZTLA 3CPHA 2IGBA 3OECA 4NV1A 4QICA 4U5QA 5HRUA 1B43A 2PRJA 2V9ZA 4MUYA 4GX5A 4BQPA 1KAQA 2FYTA 3A70A 3MNFA 3EGDB 5DHQA 2RGEA 1KF0A 4JGBA 2HU8A 3ZK8A 1UBUS 5GMOA 3IHLA 1C3JA 4U7FA 5A4AA 5ELXA 5JU6A 4H7DA 4CRWB 3L01A 3VQTA 2WYVA 3AR2A 2Q7XA 2UXBB 5HRAA 3NNSA 3VPFA 4XGRA 2C82A 2NW6A 2ZYVX 4UUNA 3LYAA 2VEDA 1L4FA 1Q84A 2IYZA 2UZ1B 4GT1A 4EPWA 2R97A 2IEBA 4L1KA 3SX2A 4J29A 2XF2A 4QEZA 5E95A 5JH7A 2FWRA 4JU8A 4XR4A 1W1WA 4QWMA 3HQ4O 2XGJA 5D7BA 2CNNA 4AN1A 3QTLA 4BFSA 4Q19A 1FRZA 1U0JA 1ULUA 4OYRA 3EWNA 4S1NA 2Z04A 3SYLA 1N8NA 3WR5A 3ZNPA 1MW9X 3O8RA 1CVIA 4LWOA 2SKEA 2PLRA 3CRVA 4QBFA 4YRGA 2M6LA 3TIGA 3KNZA 5KQMA 4RK0A 4MO2A 3A7EA 2Z5VA 3N5CA 3Q7TA 1EIWA 2H0RA 4FX5A 1KDZA 3UGQA 3X1MA 1SC9A 2ATXA 4OJKA 2NXCA 1QPGA 4PQGA 1TQ6A 3G0DA 5E7IA 5B3KA 2YVQA 1Z2AA 2ILTA 4QT0A 2C7VA 3CNBA 3OZTA 2BBWA 1IEXA 1VGQA 1G8GA 3P45A 2B4AA 4FLEA 4P2GA 3UGTA 2YFKA 3VM6A 3AF6A 1FUEA 2ZB7A 3T15A 1QQAA 2H4YA 3FNGA 3MN1A 2IS4A 2JIPA 2UZIR 4J6FA 4NP6A 4INOA 4B7ZA 1ZMRA 1FX0A 3MAAC 4FN5A 4JWTA 4BV2A 4CTOA 5ISMA 2QTVB 3R9IA 2Y4NA 4YDSA 4IAOA 1V7QA 1ZD8A 2PSEA 4EYEA 1TKAA 4IS3A 1JEYB 2EP8A 1LFAA 2ODNA 3MT7A 1V95A 1GGVA 1G3RA 3DH0A 4C14A 1Z6QA 4P33A 2O3SA 4ZO8A 4EGQA 3A6DA 5A7FA 1IWPB 1RCTE 2IKSA 2VHCA 3PE6A 3WK9A 5CEEA 1S7GA 2NZYA 2P2NA 3BMNA 4Q12A 3HVRA 3RF7A 3RYHB 4WX2B 2ZIFA 2ZUBA 3O4IA 5EXEA 3UC5A 3DMGA 4D3XA 1FQOA 1NT2A 4BNWA 1SG9A 2JAWA 2Y2UA 5AW1A 4TL9A 2D1SA 3LY7A 4JEMA 2K87A 3HJTA 3NHUA 1KY5A 3L6RA 2DSTA 4MKIA 2NO0A 3RRNA 1SG6A 1O0BA 1Y5RA 1PX0A 4PPYA 1T0HB 1BZYA 3JW8A 3EC7A 4BKUA 1S2OA 1V5IA 2I9PA 2HJSA 2OCLA 3D0KA 4AMBA 4AG5A 3U4IA 2O8BB 2SICE 2J6BA 4Y2XA 3BK1A 1KZ7B 2ZVDA 2LR0A 4MR7B 4WK2B 2PO5A 2VA9A 5GVSA 3DBHA 4C1NA 4Z53A 4BU1A 3GZJA 2R6R1 3O8LA 4EI2A 2HQ1A 3CBGA 1JEOA 2BKXA 1WOYA 3DULA 3L6BA 4Q9HA 3VKHA 1FFYA 4U7HA 2NTEA 2ZYTX 3ASYA 2VAPA 4CV0A 4D25A 3Q15C 3INGA 3S2ZA 4Q3LA 4R1TA 1JZQA 3FB4A 2I7VA 4L0MA 3HO1A 2IDKA 2VPPA 4UHFA 1E1YA 1XZBA 2DBZA 3PXEA 4G9GA 3ZCQA 2V8OA 2EJWA 4E2YA 3RIHA 3P9PA 1GUFA 1CETA 1V0JA 4X3CA 3N86A 1WCYA 3PDUA 3IEMA 5M7EA 1L9KA 1RWXA 3PDHA 4HFMA 4HAVA 3HS3A 1K92A 2FX2A 1BMFD 1UFVA 5HIMA 1F8UA 3GUZA 3EVDA 4ZT3A 4ARVA 1LSSA 4AYTA 2HZBA 4MP8A 3KLNA 3AJ8A 4RZ2A 5FFNA 3VI4B 4EPTA 3FOZA 4UBJA 1BYIA 4HXGA 3PJDA 1Z6GA 3LX6A 4KUHA 5K8TA 4FDTA 3FX2A 3TLGB 4EEZA 4YCBA 5H83A 4DC9A 1DAGA 1E3JA 2ZWVA 1I1OA 4XSGA 1IAVA 4WXRA 3ABOB 2HF9A 4WKGA 4Y9RA 4YO7A 1Z13A 5FWYB 4FUTA 5GIPE 1CS0B 2VKQA 3NTUA 2X0RA 1KZ1A 4PZPA 1D09A 3SEFA 4HFJA 4ND8B 1E98A 3SHOA 1RWMA 1XTKA 4IDOA 5TT1A 3URMA 3DUFA 2YJTD 3TLMA 1T8YA 5MDHA 1HH4A 3GWZA 4JXXA 1RJ9B 2DBQA 2P35A 2VDUE 3R0JA 4TWJA 1KZ6A 1A9XA 3ANTA 4IDPA 4MLDA 2IXGA 1ZGAA 5FTLA 2R5NA 4J1SA 1PR5A 2VTVA 3B70A 2BWJA 4I4IA 5JC8A 1QRTA 3IFSA 3NJ4A 2OFPA 2HV9A 2WUVA 4FNOA 4UULA 3WWYA 4KITB 4RDIA 4YAEA 2ILVA 4QODA 3MUOA 1T3HA 1CY8A 4AWXA 4NE2A 3MMNA 4Q1FA 3TOZA 1KJIA 4K9KA 4A92A 4KMSA 5HQ3A 4NU5A 1QGUB 3B3QA 1DC5A 1PU2A 1S96A 2A88A 1X1CA 1TVEA 3OX2A 4H6XA 4ES6A 1XAHA 3RCBA 1RZUA 3O9MA 5D5HA 5ADUS 4ITRC 2O0JA 2WU4A 2IYTA 3LO8A 1UXOA 4FJ1A 4TRRA 2AIRA 2OHJA 1Y7LA 3OBBA 5LDHA 1ISRA 4W9NC 2A59A 3WFZA 1IPEA 1T0PA 2PGLA 3B5JA 1EM8B 2RIPA 1IHYA 1XRPA 4R2WA 1P5ZB 4UTZA 2ZSFA 4QPNA 3T35A 4IVRA 1BU8A 1KMNA 4NCBA 5K0EA 2XGSA 4H59A 5K0ZA 3RNLA 1R8XA 4OUKX 4AT1A 5CNJA 2X5XA 4LVUA 1YVPA 2EZTA 3CZQA 3M6XA 1N9KA 3WYNA 4FD3A 1NC1A 1QV7A 1TO2E 1XYGA 4UDYX 4EP1A 4QJBA 4WCVA 1HXHA 4FT4A 4B82A 4Z49A 2OLJA 4JV5B 1I4OA 1W46A 1ILEA 5LWHA 4Y9SA 1C3XA 4F4HA 1E1NA 3I64A 4IXNA 2R4TA 2F4NA 1J7KA 1F1BA 3AHJA 3GLQA 3F3YA 4M87A 4NBUA 4G4GA 4KQMA 4R8LA 5CGQB 1K7CA 2CMGA 3VR1A 3ITKA 3E9NA 1JZSA 3HDYA 4L50A 4RD2A 3ZN2A 2DFDA 2WHXA 4MYTA 2FPGA 1OREA 3UAWA 3V33A 3VZPA 4DSOA 2JLUA 1ZMXA 1E2EA 1GQOA 1O77A 2R1UA 1EP9A 3BD6A 3F6CA 4A0FA 4YCJA 5BW6B 3C6KA 1TZMA 2II6A 1XAIA 4ITUA 1SVMA 4O3FA 4O2BF 5AK3A 4ZVMA 1JU4A 2Q4BA 1UFRA 2SHKA 1E3LA 2ZRPA 3H4TA 1VPEA 5IYZB 1RAIA 3AV0B 1XJWA 1A4UA 1WSWA 4N01A 4XA8A 4GR4A 1V8ZA 2MSKA 4M9XA 4A4DA 2G72A 3T99A 4QOSA 1FL9A 4TN1A 4EF6A 4YUAA 2VNJA 1QGED 1YL7A 2ZIVB 5BOSB 5I47A 4I7EA 2N42A 1BMQA 3VR4H 4GSKA 5GJWC 1E9EA 5AVTA 2RC5A 5K6AA 3I0MA 3OLCX 4HFRA 4M37A 1QE5A 5DJ5A 5KU1A 1M6NA 2DHCA 5EIBC 4QXQA 4DZZA 3UJAA 1QGYA 1YDFA 5HK9A 2VRCD 3L02A 2CL6X 1CJTC 4KMRA 5KTRA 2FK8A 1UKVY 4DAOA 3KOOA 2ZM6B 2B99A 3ELWA 3COWA 5HQ3B 4DCNA 1YF3A 3CUUA 3IVGA 1FJGB 2AI3A 3T1QA 2QG9A 4QLOA 5TS3A 4EOGA 5EIEA 4WACA 4AP6A 1ISFA 2AE1A 2VK8A 5I45A 1NUUA 1OTHA 3DC7A 3NTXA 3VH4A 1FMFA 4RD1A 2H16A 3ORRA 4D0GA 4DXDA 3NYRA 4JODA 3M4ZA 4BGDA 2WYHA 5E3IA 3OQJA 1KHHA 1R64A 1KIMA 3OIWA 3QJYA 4OQLA 1R6XA 3U6BA 1JVNA 2HAEA 4K05A 5TLSA 3WMEA 1URPA 1WMEA 3UMJA 3TLCA 1WBBA 2VTBA 2RJOA 4G23A 2H2HA 3VOSA 4RHXA 3TSOA 1N78A 1WMSA 4KQ9A 4M3NA 2J0UA 1FPQA 4KMMA 3TDKA 1SU6A 3OO1A 3VTKA 2QBYB 4X7PA 4KR2A 1H4VB 2VSYA 4EI7A 5M34A 4WFJA 5GONF 5JBIA 3GP8A 5IK2A 4ZODA 3UWMA 3VR4D 5BNIA 1ZX1A 2HLNA 1JR3A 3NXSA 4FFRA 4URHA 4D4HA 1A3CA 1ZITA 4MKRA 3VO1A 3F67A 3PT5A 4BMNA 2R6FA 3A28A 3H11B 4RKFA 3RFFA 1OXSC 2YOFA 4Z86A 2CVFA 4MUHA 1O6BA 2A1UA 4UHHA 3RB8A 1E18A 2VDPB 4LJ7A 3RC3A 3NBXX 3PF9A 4JSRA 4MR8A 2OOSA 3A3PA 4ZAFA 2IDZA 1EUYA 4I4CA 5IJ0A 3OOEA 3BPSA 3ISVA 4ABTA 2DMRA 4I0WB 4UM8B 1ZM3A 4AL4A 3Q4GA 2EWVA 2I4RA 3M5DA 1Z06A 1BE0A 3I5YA 5KOIA 3QFCA 4MJLA 4KH1A 4MPDA 7YASA 2I9KA 4QSHA 3L4EA 1OBOA 3IEIA 4EEKA 1UKEA 4LMPA 4M21A 4P4LA 4CMIB 5B58T 1FEZA 1W0KD 4ZJYA 4PRLA 3LY9A 4LOAA 3G2PA 1N7HA 3G17A 2XXJA 1WPQA 4W4TA 1AA6A 1N9GA 3QV2A 3ZDAA 4OD0A 1DNPA 2IUFA 4GI2A 2GT1A 1VRCA 4A7PA 4BP1A 4H3VA 1R50A 2C2HA 2FOXA 3AYZB 3TZKA 3U13A 3VKFA 3U3RA 3CZCA 4NJMA 3D1LA 5IJXA 4JB3A 3RV4A 3VAYA 3QBVA 1A72A 1L7DA 1JRLA 2AWNA 3WL7A 4LDJA 1RWQA 1NN5A 1J22A 1OPRA 1QFYA 1QCZA 1COZA 2GD1O 3FJOA 1K8ZB 3ZTWA 4NZNA 3VKVA 3H1GA 1PRYA 2HLDD 4Q7LA 4WRRA 2GEJA 2C61A 4TL8A 5ALWA 2YICA 3ILSA 4BBAA 4CG1A 1G6HA 1L4LA 1MB9A 1S2IA 4MV6A 4MPJA 4X9XA 2OAGA 4DSTA 3H5IA 2BC9A 4ZKDA 1W0JD 2IUTA 2Q1YA 2WMDA 2JFHA 3L0IB 3NIFB 4L7QA 3EGDA 4S1TA 2VSQA 1Q5PA 4TTIA 3T7EA 5CDTA 1IEVA 4MA4A 3H3JA 2NWQA 2HM7A 2R6CA 1JPVA 4L6IA 2I2CA 1L7AA 1ABEA 4XZ3A 1YDMA 2I22A 2AEFA 4PG7A 1NP3A 4OAPA 4JJKA 3PQ4A 4RSRA 4Z9FA 4Q5IA 5JO0A 3WLLA 2LW7A 1JLKA 1W9HA 4N3CA 3TLKA 2CFIA 1EEHA 5E4FA 2RK6A 1R3DA 3B78A 3F9IA 3KVVA 2FU5C 1E79A 4R8MA 2UZ1A 4KRGA 3KOWA 3DL4A 4ZQCB 5T67A 1MGOA 4MEJA 4V0QA 3VHLB 5AVVA 5CK5A 4E1AA 5A4DA 4TTSA 5EMHA 4D8TA 4A2CA 1O4VA 3ETNA 3TM4A 2PRZA 3H84A 1RHMA 2XE4A 5AI0A 2OQVA 3WHPA 3V2IA 4RJTA 3LRPA 4TV9B 4HEJA 4QYXA 3RVDA 3EX7C 5ARCA 2JB9A 3A4YA 1XMIA 3WG9A 4CCWA 1C3EA 4ARUA 5I4CA 2DETA 2VJMB 1Z68A 2DY0A 4FZRA 5JHHB 3QVTA 4UUQA 2VUTA 2FG5A 3MA0A 1GRCA 4KYVA 4PTYA 3RAPR 2R85A 3QQ5A 4LYEA 1KJZA 1THMA 2P9BA 1JPUA 3F9RA 3QP9A 2C03A 4PRYA 4R16A 3ZWAA 2ZJ4A 2Q5HA 4F0JA 3A4NA 2HDOA 2FFRA 3GP3A 4QRHA 1BQ3A 4Q4JB 4WSOA 3WB9A 3EIOA 4MHSA 4EHJA 1AV7A 5KSPA 1GNRA 3FE2A 4K9SA 5AKHA 3T7JA 4BV8A 1UH5A 5E6SB 4F6CA 1L7MA 3BWBA 1NJ2A 4FDVA 4WIAA 3PNBA 5FTJA 2BKVA 4YV0A 2XZTA 4J43A 2CJFA 2X6RA 1PL6A 4X45A 5EZ5A 4YLYA 4LFBB 1JEYA 4P5EA 2QN2A 3WLNA 1TECE 1UKBA 2CYBA 3A11A 1K2VN 1NDQA 1P5HA 3IP1A 4QHYA 4XB1A 2JIQA 4B47A 4PR0A 5JV5A 3K70D 3FMIA 3CKLA 3GK3A 4E2ZA 5IULC 1Y7IA 4RKQA 2R1TB 1A4RA 4MQBA 4KO4S 1PI3A 4BQNA 3RYHA 2GRUA 1H6BA 3SPXA 1OJLA 1B6TA 3CLSD 1OBVA 1Q0UA 2QB5A 4Z1OA 2C2GA 2VYVD 1WDLA 3V1NA 3BTOA 3FD8A 2A9JA 3D8RA 1ACMA 1QO7A 2HMYB 4C88A 3ZW9A 1N6LA 1YOBA 4G84A 4YQEA 4A03A 1JR2A 2QYHA 4FGUA 1K5DA 5JIBA 1TM3E 3HWSA 3RS3A 1A97A 3N07A 4YLGA 1RPZA 4JB0A 2O8BA 1YIDA 1BFUA 5AK4A 5A2QA 2G9QA 2IHTA 3MMSA 1TAUA 2VT2A 1FJ2A 2VNHA 3EY4A 1D2RA 4MR7A 5EJMA 1I14A 4G5FA 5A06A 1U0EA 2W6MA 5LU9A 4RHEA 1WPGA 3GJZA 3G9UA 4I4TA 1YUNA 3C16C 2MSLA 5DNAA 1FS6A 5F1OA 4WXMA 1X0VA 2FY8A 1SC4A 4ZCPA 2PMBA 1H05A 2CL7X 1K7FB 1JWAB 1SHLA 1LW6E 4YY3B 3IOCA 1WZUA 2R00C 1Y6ZA 3AM3A 3QELB 4W7SA 4D79A 1LPBB 3SF8B 2C9BA 2KX7A 4DAEA 3GRFA 3WBKA 1PP4A 4Q4AB 2O1EA 9ATCA 1YQEA 2G9VA 3QBTA 4OJMX 2YZNA 5CM8B 3TMKA 3TTXA 1X7ZA 1J99A 1E1MA 3BQNB 1BHJA 4QVKA 2X9NA 3IR5A 1KEVA 3OZBA 4RVFA 3UOGA 3ZWBA 3ET5A 1BVHA 3FTPA 3BK7A 4EB0A 1GUYA 3GT0A 2XOXA 8ATCA 3DZIA 3I5AA 4Y3UA 4UOZA 3PNKA 5BNTA 1YBMA 2AKYA 4UFNA 2ZSHA 4ZQEA 4AS1A 3KUXA 3EZXA 2HDNB 1JYFA 4OGFA 1RRFA 5AMXA 2GLXA 4MIKA 4ZJPA 3HCDA 4QBGB 1LTKA 3K4HA 3LX4A 1CJVC 3PT9A 1YAJA 2E9SA 2EATA 3TLGA 2GK4A 4GS5A 1M72A 3CRNA 2GCGA 3PQ8A 3O03A 2O9JA 1WE2A 4JDUA 3THOA 3WGQA 1ZOIA 5JALA 3IMKA 4A6EA 3W4IA 2H4HA 3PVZA 4BKRA 1CS0A 2F1RA 5HKKA 3W0LB 4DLNA 3L7IA 5TPZA 4ND8A 4QLBA 1JG4A 1HT0A 3GRAA 2RB5A 3V7FA 2PUJA 3H8VA 4X3OA 4F8EA 1AA9A 3AJRA 1XNRB 1OYVA 1VTKA 3HN2A 4KYUA 2AYXA 3F3MA 3ACCA 1RJ9A 4P22A 1D2MA 3LSTA 4HQ0A 4CLXA 2QW1A 1GTL1 3H4VA 4ENRA 5BV1A 5HDQA 4K1XA 2A5LA 5ALXA 1Z6AA 3W04A 3OU2A 1ZIYA 1YR6A 3MJEA 3RM3A 4M0UA 4NU0A 1EDOA 1BDBA 1KR5A 5EXSA 1SBZA 1SM4A 2IP2A 1PEDA 1NY5A 2I99A 2Z3VA 3BK2A 1YU9A 2EX4A 2GQ0A 3IAFA 3I2HA 2OV8A 2HCRA 3OD5A 2PL5A 1CUGA 4H7IA 3D6NB 3HKDA 4DF3A 2ZBPA 1JIXA 1QLWA 1J23A 2CUNA 3QYPA 3R44A 1OLUB 1VJ1A 4PICA 1QGUA 1PJCA 3BS4A 3KT0A 2O5CA 3BAZA 5CA0F 1IU9A 1I3KA 1W94A 4MQUA 3VZRA 1Y8QB 4AO8A 4OOEA 4KKVA 3H05A 2GYVA 4N6NA 1LLDA 4N9WA 2P4UA 5LYJA 4ISCA 4F21A 1G7TA 1SH7A 3S6JA 2I7XA 2PJZA 1LRJA 4TXLA 4BKQA 3WKAA 4F4UA 4IQ4A 2OO5C 3H9JA 1HTTA 2PMDA 3G5UA 3FN4A 3S5UA 1O97D 3GJYA 4Y0AA 3FKJA 3W79A 5BVHB 1ECCA 3UF0A 4PS0A 3K0CA 1O9BA 3D2AA 1IC6A 4AZVA 3DHVA 1RLTA 1S8AA 3K7EA 3KXKA 5JPCA 4CM9A 1DBWA 4GE3A 5EJ5A 2B61A 1K4MA 3UKDA 1H4SA 5KHOC 1M5TA 4TMZA 5C52B 1BKSB 4XE5A 2CMHA 4RPCA 4UMDA 2QMZA 5AYVA 3KQKA 3SYTA 1GGHA 1EP3B 4UOEA 5E9JA 4BNGA 1O89A 4YJ2B 1MRZA 1SUWA 2E3JA 5KUTA 3P97A 4EJSC 1EUDB 5CK4A 4Z7QB 1QP0A 3F4LA 2FMUA 4EL5A 2ZRFA 4WADA 4D9BA 1J7JA 5I7UA 3PFGA 5C3UA 2EIXA 1CE8B 1SUCA 2HXSA 3SE0A 3L6CA 5MN5A 3GLSA 3H17A 4QE3A 4LZZA 3UN1A 4K9OA 1T1JA 4RLHA 4CPDA 3NEJA 3VJLA 4BQQA 3NBKA 2C2KA 2HSWA 3I53A 2WIFA 2GLTA 1ZNXA 3GGSA 3OFJA 5ED0A 2GBGA 3L46A 2FUG1 4YGXB 3K5PA 3RIYA 3SLKA 5IYZA 3X2EA 3AFGA 1X0XA 5KWEA 4B3MB 4X7BA 4L2IB 4JLMA 3HU1A 1T34A 1X1AA 2E6KA 3PWZA 1WOMA 1WS6A 3TG8A 3VPGA 1NM5A 1W4CA 2M6RA 3DDNA 4XIJA 3SC6A 4D0SA 5BOSA 3W7AA 3NAMA 1Q0ZA 3OLXA 3TS1A 1N0VC 1YS2X 4O1HA 2ZT7A 5IN5A 5C1IA 1F7VA 1VG9B 1YB2A 2FUEA 2P5SA 3DB2A 3ISJA 3LFUA 4PZEA 3WNVA 4D02A 2XB2A 3KQOA 1OSNA 3AG5A 3TB6A 2RGWA 1G8JA 1PK9A 1KYIA 1Z8HA 2ZE6A 3NS7A 4X3PA 3HJFA 3GROA 1E0AA 1FS4A 3HEMA 3II6X 1X39A 4YRBA 2HO4A 3CEAA 1EFVA 2DBVO 3EZGA 5EE0A 4B3JA 1EX6A 3DOUA 5DCLA 5EFOA 1WDWB 4ZQFA 3ZDXB 1K06A 3MGGA 3FCXA 1RP7A 3UH0A 1T8PA 2FP3A 3WAKA 1M73E 1NAIA 1RQRA 1QYXA 2DHRA 2GEFA 2QXTA 2ZIAA 1SUPA 3A04A 3AL2A 4IXTA 1ODJA 1T35A 4R9NA 4ALMA 5FLEX 1LF0A 5FI0B 4JYMA 3PNVA 1U6IA 3UMRA 3HC7A 2C9MA 2EW8A 4OATA 1SR8A 4QRIA 3U6KA 3NFYA 3KJIA 1LB1B 4ND7A 1OB2A 2HHCA 4II2A 2ANCA 3UMMA 4TSRA 2NAFA 3ESRA 2OBLA 1HZJA 3HEBA 2QBYA 3ROEA 3GRYA 3UJDA 1GGEA 2R68A 2GXAA 1JILA 1CY6A 4YP9A 3RLIA 3C7KA 1N57A 1VCIA 3ZPXA 2OY0A 2QRZA 1V6SA 3K32A 3QYFA 4RH3A 3LM8A 3FOAA 4PQYA 1CUAA 1ZXLA 5L6LB 3H11A 5AHRA 2BBTA 4EQ6B 2GNOA 4PTZA 4FMBB 3S70A 4HWTA 4R9UC 3H9UA 4OHRA 5I7HA 3LW8A 1Z6ZA 1RRPA 2I65A 2Q5FA 3LJKA 2PY6A 4RZ3A 8ADHA 4R2HA 4PZDA 4PG5A 4HLUC 1GT91 1M34E 3VPHA 4KC0A 2HXGA 1GNSA 1SHJA 3Q72A 2X8WA 2ADMA 2XWBF 4P80A 2H1SA 4Z51A 5JARA 4CIBA 3GT3A 3OZFA 1RQ2A 3ENQA 1ZH0A 4FDMA 5F77A 1WPXA 1YQGA 2ZIWB 3FA2A 4CMIA 1P7CA 3FPGA 3QEMA 1M2KA 1XCOA 3PJEA 1A76A 4LTNA 2V7WA 3NG1A 4JENA 1W93A 5FI5A 5B64A 4EG6A 2IHNA 5ICSA 2JIDA 3K8ZA 4IWNA 1IN6A 1QDEA 4U9UA 4W9RA 5JD6A 1TQDA 5G0VA 1DEKA 1IN7A 1E62A 1O7JA 2JI4A 5BO5A 1HLDA 4K86A 3ZDBA 2QU7A 4C6TB 5C1BA 4CIVA 3L82B 2I2DA 3QU4A 4FQ8A 5CD9A 2ZZNA 3BOSA 3ENNA 4IL5A 3INYA 5A5DA 1S3SA 5A4KA 2QTHA 4F91B 1E2UA 3O4RA 4PG6A 1ZJYA 3L0ZA 3I2IA 4E88A 5MF6A 5AXAA 1UMDB 2GEVA 5A62A 4LJRA 3LCUA 1AQUA 2JAPA 5JLAA 1E3EA 1QBGA 2ZRMA 5KJEA 3E5HA 2QTBA 3MCTA 3CNHA 2J0VA 4Y6PA 1Z8DA 2BF7A 1L5ZA 2QRUA 4Q7KA 3RUAA 3QPWA 4BNFA 2FKNA 1ZJZA 2P9GA 3QU5A 2QRPA 5A1TA 3ZQJA 1JJIA 3MEQA 4FX2A 3QLJA 4L4ZA 3A0RB 4HQNA 1A9TA 4QUEA 5KKNB 3GVIA 3Q11A 5HZKA 1JIIA 5LDGA 2C8VA 1GUDA 2N9UA 3KAJA 5A5VA 1UC4B 4QBTA 3EA4A 3W06A 1GQRA 3DWFA 3NEYA 4F85A 4BOYA 2CNWA 1ZGHA 3QLEA 5AVRA 2YV3A 4LJ4A 3SZUA 3BVPA 5E0OA 1ZRHA 4OFZA 2NV0A 3DZDA 1F06A 2IYNA 2RARA 4TMTA 1USGA 4EUEA 1SFRA 3CISA 3NOXA 1Y6RA 4KIFA 2XMBA 3AJDA 4G8DA 4HADA 4G5XA 5YASA 4IBOA 3TKAA 1ZI9A 1GPDG 1D8AA 4DIEA 4TV9A 1JHOA 2PZBA 1XQVA 3CH6A 2FEXA 4BDTA 3OT4A 1X1EA 4HNAB 4M76B 2QROA 4ZO9A 2GBLA 3SYRA 2VJMA 2R6ZA 3QGMA 1VLLA 4E5UA 1XL0A 3AY0A 1MVLA 2XMZA 4JJ4A 1TUBB 5ECYA 3CRW1 4X62B 4DG8A 2YYSA 3DLAA 4R84A 5BV2P 2RAVA 1HKHA 2XXAB 1ETUA 2O1SA 1UZAA 3FHCB 4IHJF 4FGLA 1T3ZA 3IUNA 4LFCB 3UATA 2DUMA 2JF0A 3REQB 2XUDA 3RSCA 5EJEA 1MA3A 1CDDA 1I8TA 1E9SA 2IYUA 3KT8A 4EHAA 4U1RA 4XWWA 3ID6C 3N53A 5FPTA 4J1TC 1KU0A 4M7PA 4RA9A 1NWHA 3HA3A 2OAP1 3PWKA 3RH0A 1T2AA 2QJRA 2PUFA 2EL7A 3RWOA 3QY9A 1SQGA 1V9SA 3MUNA 3SK0A 4E3WA 1U7TA 5K2MA 5FYDA 1Q3KA 1L7RA 5KVQA 3FFXA 1DLIA 3ZBTA 5JS7A 4FXOA 2YKGA 4IIJF 4ZOLF 4I4TF 1DKPA 1Z12A 2B8JA 4TYQA 4K6OA 1NW9B 1X9IA 2CLLB 4WW0A 3M70A 3D6MA 3TJRA 1JHVA 4EVSA 4HGRA 1KI3A 4ILKA 3WY9A 4D81A 1EESA 3IUJA 4OJNA 2D62A 2GD2A 3SBXA 1ID1A 3OQNA 3ZNOA 3BMOA 2W4IA 3QKRB 3HA2A 1Y4DE 2CHUA 1U65A 4BMSA 4PX2A 4EG4A 2P77A 3EIEA 1MO4A 4LJAA 1DKNA 2H85A 3GXOA 4I9FA 1TJ3A 2ZBQA 2IU6A 3NEPX 4KMOA 1VB5A 5IK2D 2PLNA 2QT1A 4LECA 5KYWB 1JR3D 3F98A 1IN8A 1U2EA 3L92A 4PSKA 5G53C 1HORA 3LC0A 4FCVA 1QCCA 3FNRA 3VPDA 2PEYA 2ZK7A 1ZGBA 2IITA 4PNHA 3SNKA 4KN9S 2YJ3A 3EAQA 2AG5A 5LKAA 2GM3A 2DT5A 3PEUA 2XGMA 4RD3A 1AGXA 2OPBA 3SF0A 3UAZA 3AIIA 4OQ4A 3DOOA 3GNQA 2BTEA 1ZZEA 2CHQA 1MRSA 3KL4A 3M6VA 5AW9A 4FFBB 4FI3F 4OSPA 5DVZA 4MCIA 5A71A 1RT9A 2OK7A 3SF8A 4KYTA 4Q4AA 3G2IA 3HR4A 4AUEA 5AQ1A 1KRXA 1WDMA 4ZARA 3PXXA 4XVCA 5KKCA 2H51A 4Q7MB 3DEIA 5LSAA 2YCBA 5EPOA 1X7HA 2WHQA 1M76A 1ULHA 2NU7B 4HN4B 4TT8A