4DNFA

Crystal structure of the cftr inhibitory factor cif with the e153q mutation adducted with the epibromohydrin hydrolysis intermediate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
296
structure length
296
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMQAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the Mechanism of Epoxide Hydrolysis by the Bacterial Virulence Enzyme Cif.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Putative hydrolase
total genus 112
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dnfA01
4IH4A 3STUA 3S2ZA 1CUZA 1GKKA 4X3CA 4BVKA 4FBMA 4KE8A 3HYSA 4C4YA 2BUCA 4DIUA 4HS9A 5ALLA 1SC9A 2HU8A 2Z3ZA 1CR6A 4Y9SA 2V97A 4B82A 3U0VA 2VAXA 1WPRA 1N5MA 1N8SA 4DMKA 1QIKA 1UT6A 1R4ZA 2LIPA 3BF7A 4ETWA 5AJHA 1XZGA 4KJXA 4DMCA 1BROA 5AK3A 1FJ2A 3IDAA 1VJ5A 4UBMA 4OYLA 1PV1A 4N8EA 3HXKA 1TCCA 1G4HA 4J0CA 5D3KA 5LZ2A 4QZVA 4X6XA 1WHSA 5AKHA 4M0FA 1JI3A 4PF1A 1XRMA 2WIJA 3PUIA 5A2GA 2OG1A 1F8UA 3I2JA 3IBTA 1SCKA 1E8MA 3IUQA 1LPNA 3R3XA 4DNOA 4QWMA 5KWIA 3ESCA 3G9XA 4J0IA 4AO8A 5AK6A 4X6YA 3V1KA 3SK0A 2AXEA 4WFIA 2I3DA 3OM8A 2VJDA 1Q84A 2O7RA 3DQZA 5ALPA 4DYHA 3IVMA 4I3FA 1OXMA 1CEXA 1H2ZA 2JF0A 5FDFA 4LYEA 4Y2VA 5DJ5A 2EDAA 3S8YA 1HDEA 2J4FA 5DNUA 1H2XA 1CQZA 1R9MA 3C70A 4OU4A 4Q3OA 2OQIA 2RIPA 4AN1A 4C6HA 4FFWA 1DX4A 2OCLA 1ZD4A 3EQ8A 3UUFA 1K4YA 2BFNA 4K6GA 5DNWA 4EY5A 4PNZA 5JAPA 3AJAA 4EY4A 3OPMA 1LGYA 3QPDA 1EINA 4A23A 1FFAA 1LZLA 2WFLB 3DCNA 1WB4A 4BDSA 5C7YA 5JAHA 1CLEA 3B3QA 2EDCA 4KEAA 4H18A 4PO3X 1WPXA 4QLAA 3E3AA 1EH5A 4DGQA 1ZGCA 2VTVA 1VLQA 4F0JA 1JFRA 5AIAA 3CCCA 4W63A 5CW2A 3BE8A 3BXPA 2QUAA 3PICA 4H7JA 3ZWQA 1MAAA 3GROA 1JJFA 4GWLA 3N0TA 2WUEA 5AM0A 1VA5A 3DEAA 2Y1KA 4KE9A 2BUBA 5DWDA 3I2FA 4BVJA 1KU6A 1VE7A 3R40A 3WK5A 4BC1A 4DTCA 1U2EA 2XMBA 3ESBA 1W76A 3UUEA 5ISMA 5HFNA 2DR0A 5CH8A 1MNAA 1Y37A 4OCZA 1S8OA 2XUAA 5AH0A 3H2GA 2PSFA 2D5LA 4KYVA 3I1YA 4B6GA 1X70A 2WIDA 1Z68A 3A6ZA 4GXNA 5JZBA 3ZPXA 4ITVA 4F5ZA 3LCRA 5KREA 3AUKA 4H77A 5CT8A 1ZIYA 3O4GA 4Q34A 4UFPA 2QR5A 4FDMA 1CUXA 4YX9A 3STWA 5AI5A 1YR2A 4UHCA 5K3EA 5ALRA 5BV7A 2K2QB 2E3JA 2PM8A 1RYYA 2HADA 4WFKA 5CMLA 1HBJA 1RP1A 5AI9A 3WK4A 3BDIA 5D6OA 3PI6A 1CUAA 1PFQA 5AIBA 3R3YA 5YASA 1VA4A 4ARBA 5LP1A 3I2KA 1XZLA 4Q05A 3FVRA 3M82A 1JU3A 4QDUA 2VEOA 2QTBA 4QWWA 3ESDA 1EI9A 4QE3A 1GQSA 1SCIA 1TRHA 3AZQA 1TCAA 5A7FA 2W22A 3P2MA 1TAHA 5T4HA 2PX6A 4G8CA 3CCBA 2BGRA 1QOZA 1XZDA 3WLAA 3N2ZB 5CBKA 5A7GA 5AP9A 4L3WA 2OGZA 2WIKA 3FLBA 5E4YA 2FJ0A 4WCVA 3WYDA 5HZGA 1M33A 3WA6A 5AKYA 1ETHA 2VQ6A 4YK7A 5EGNA 1QIJA 3QMMA 2H9YA 4KR0A 5AKGA 3I1IA 5AK5A 4H7DA 5AM1A 3STXA 4C01A 5HCUA 3STVA 1LPSA 3HRHA 3C6ZA 5C8XA 3QH4A 2WIGA 4TPKA 3AIOA 4DSAA 4BP8A 5JD5A 4QNNA 3AZOA 2WG2A 1UK8A 4FOLA 2OAEA 4ZV7A 4UHEA 1LPAB 4A16A 3H2HA 4Y2JA 4H35A 3K6KA 1OILA 1LLFA 3AZPA 3H18A 3JYHA 1XRQA 3L1IA 3DKRA 3STYA 3OURA 1DTEA 1R50A 4L0CA 2DFPA 3O4JA 5CT6A 1K6EA 5LYYA 3TEJA 2PPLA 2J4CA 3TJMA 4PSCA 3MVEA 4X71A 2AJDA 5CRIA 1VXRA 7YASA 3K9BA 1CUFA 3FYUA 2XMQA 5AKJA 5HFAA 3AILA 3EQ7A 4W9RA 1CRLA 4BZWA 5JZSA 1XQVA 4BBZA 4B0OA 5HF6A 3EQ9A 3WIBA 2WILA 5ALKA 1THGA 3STTA 3RM3A 3G0BA 3V1NA 1MPXA 1G5FA 3H0CA 1JJIA 1CUUA 2HDWA 3R0VA 3IB3A 2ZJFA 3E0XA 4AO6A 5LLSA 5KBYA 3G0DA 3BJRA 3E4DA 4B81A 4W1PA 3F98A 3H2JA 3IA2A 1TQHA 1IUOA 1QGED 2GBFA 5CTAA 2QJRA 3IUNA 3QPCA 5F4ZA 4FBLA 1ODCA 4EY7A 5ESRA 4Y2SA 3BDVA 2QRUA 5FKJA 4D9JA 2Z3WA 5FLKA 3F9CA 4OSEA 1A88A 1CIJA 2PUJA 4Q82A 2WHPB 4G8DA 1J06A 4XIIA 5IVKA 4C88A 5AI4A 5HKAA 2RI6A 5FRDA 1YAHA 2G63A 2OGSA 3DKKA 4E15A 2HM7A 4G4IA 3WKDA 4UBLA 2O2HA 2AJCA 1CUJA 3LIIA 3IULA 4QDXA 5AHXA 2V96A 5EFZA 6YASA 3VDXA 5A62A 5ALQA 4ZGBA 1MN6A 1DWOA 3HLKA 4FWBA 4B80A 5AM2A 5FUMA 1D07A 3VJLA 2QXUA 4UBKA 2QXTA 4AN0A 1AMNA 3ZLVA 3D59A 2GBGA 4ZXFA 2XQJA 2PVSA 1UZAA 1XKLA 4N8SA 3D2CA 5LZ7A 2HIHA 2XQGA 1YS2X 5HQ3B 4MQMA 1QJ4A 3SWWA 2JIDA 5EHQA 1IZ8A 5EIAA 3A2NA 1P0IA 3ICWA 3WWPA 4XX1A 2HA0A 2RHWA 2GZSA 4BP9A 3DL4A 3QMVA 3WKCA 2CZQA 1XZCA 5K3BA 5A71A 5JATA 4RNCA 3A2MA 1XZIA 5HQ3A 4AXBA 5AO9A 3M83A 4K6HA 3QM1A 4BDTA 4CCYB 3Q8WA 2PSHA 5C8ZA 1LPPA 1Q0RA 3DL7A 1SCQA 3UMJA 3PE6A 2WLSA 1XFDA 3WK6A 1A8SA 3H2KA 5AI0A 4UHDA 5E2IA 4Y2PA 2Z5GA 4AO7A 1CQWA 2ZVDA 2XMZA 2B61A 2OCIA 2C5FA 2VT6A 4JEIA 1XQYA 1LBTA 2ORYA 1XZEA 2JGJA 2WJ3A 1UKAA 4KACA 3WZLA 5I9IA 4P08A 1CUVA 5AICA 1ZD2P 1UKBA 4TGLA 1WB5A 2BGNA 2IITA 4IO0A 2HA4A 4X91A 3LLCA 4Q3KA 1XLVA 5IKXA 2AJ8A 1ISPA 5DLPA 1XQXA 2WU3A 1XZJA 3O95A 3C8DA 1NU6A 1USWA 3DYIA 3WQHA 3FSGA 3CN7A 3PUHA 4W1QA 1CUHA 3Q0TA 3CXUA 4AX4A 2JEZA 3HEAA 4RGYA 3M3DA 3MUOA 4MJ3A 3NGMA 5CXUA 4BCDA 4QLOA 4G4JA 1FFBA 1H23A 1P0QA 5JZ9A 2WUDA 3BL8A 4MWTA 1L7QA 5JAOA 5LKAA 2XMDA 5ALIA 1F0PA 1ZOIA 4BVLA 4EY6A 2W6CX 1E89A 3QMWA 3IURA 4UPDA 2PUHA 5LZ5A 3GA7A 5FP0A 3QVMA 2WHPA 5AM4A 2H7CA 2VATA 5IVHA 5T4EA 3ED1A 4P92A 1FFDA 4J0HA 4K5QA 2G4LA 4CG3A 1BCSA 4OB6A 5LIPA 3T52A 3I6MA 2C0PA 5JAUA 3R3WA 4BCBA 2QOEA 4H7HA 4HZGA 4UBJA 3H04A 4QA9A 5BOVA 4J7AA 5SYMA 3WIOA 4BE9A 1VE6A 2Z8XA 3KXPA 2WHRA 5BWBA 5ALJA 2VSQA 1MX9A 4FKBA 1DU4A 2GBCA 2ES4A 4X7BA 1XZKA 4YASA 3GUUA 4N5HX 1XRPA 5EHNA 4LXGA 4C4ZA 4CIAA 2DHDA 2YASA 2YXPX 1DT3A 4LXIA 3ANSA 1OCEA 5AOCA 4H7IA 2HL6A 2X5XA 1BCRA 4B83A 2AJLI 4O08A 3C8HA 2XMCA 1JT2A 1HPLA 2J3QA 4DNQA 2HU7A 2HFKA 1HL7A 3OTQA 5LZ4A 1J07A 3ZLTA 4MXDA 1HQDA 2I3ZA 4BTVA 1EVEA 4WY8A 1L7AA 3OG9A 3FYUB 1YSCA 2XLCA 1YB7A 1QONA 5EHZA 2NW6A 4NZZA 1R3DA 4JNCA 4BC0A 2WU4A 3ZLUA 4UFOA 3VKFA 3LS2A 1YASA 5SYNA 4S0XA 1EX9A 2HA2A 3AIMA 4Q1VA 1K63A 3L1JA 2Y6VA 4FLEA 3D4LA 2B4KA 5AKXA 1W4LA 3NOXA 1FSSA 5ALHA 1EDBA 4FTWA 3C43A 3I6ZA 4BRZA 1DX6A 1XROA 2FJPA 3F67A 4BE4A 3OC0A 5LZ8A 1ODTC 4JUIA 2XDWA 3VXKA 3MGAA 4W1SA 1GPLA 1XLWA 4BRSA 4UFNA 3G9UA 4K2AA 3R3UA 1IZ7A 2JGKA 1G42A 1W6RA 1QLWA 3FAKA 4UBIA 3ICVA 1AX9A 3DNMA 4A5SA 1XZMA 4ZREA 2XLBA 2VAVA 1FFEA 5A6VA 3VVLA 4B9EA 2ZYIA 3FWHA 2WSLA 3FSGD 5LKRA 3SX4A 5K3CA 2OCGA 1BU8A 2VJAA 4MYSA 1P0MA 5FV4A 4TVKA 5DYYA 1LNSA 4HAIA 4RPCA 1TIBA 1LPMA 1LPBB 2CKMA 2C4HA 4LIPD 5AKZA 3IIIA 2ZSIA 2WTMA 3PF9A 4H7FA 1BE0A 4AZ3A 4FHZA 5FXMA 1W52X 4FLFA 2RONA 3F97A 1UXOA 2JBWA 1GPKA 2WHQA 2HA6A 5JANA 4FNMA 5CXXA 4Y2XA 1MTZA 4ZI5A 1WB6A 4IH9A 2QZPA 5JALA 5FPQA 3G0CA 4J0JA 4GECA 2JGFA 3YASA 3FLEA 1H2WA 1G66A 1HLGA 2PSEA 2XUOA 1ORWA 5ALTA 3DYVA 1GQRA 3I28A 1TKRA 2Z8ZA 4PSDA 4FMPA 2PSJA 4CCYA 1Q83A 2H7YA 1IMJA 2C58A 5HK9A 1XZHA 4P9NA 1HKHA 3VJKA 2ZSHA 1ZGBA 5K3FB 3B5EA 5ALUA 1O6GA 5ALVA 1MU0A 5JADA 2V9ZA 3BIWA 4HRXA 3SC2A 2R11A 5K3AA 4ZRDA 5IVIA 1ZD3A 4WDQA 4Y2TA 2IX9A 3DD5A 3R41A 3D5EA 3ZV7A 4HXGA 1MNQA 2O2GA 4X00A 5C8VA 4F60A 3NWOA 4E14A 4G9GA 2OCKA 2GYVA 1I6WA 4AQDA 1VOTA 1UK6A 1XRLA 4U2FA 1KEZA 1U65A 4DLNA 5D7BA 4B7ZA 3I2HA 2WQZA 1K8QA 2D0DA 5J3JA 5ALNA 2XUQA 1QO9A 4AB1A 4H7KA 1RWQA 4DM7A 1QTRA 5C81A 4B85A 2RAUA 2XMRA 4P93A 4E11A 3ZI7A 5CT5A 2DSNA 2HHAA 1GPNA 4FFVA 3R3ZA 1UK7A 4BTLA 2JGLA 5FPPA 1CUEA 2PSDA 5IVDA 2OAGA 3KWJA 4UBNA 1EHYA 4WJLA 1E8NA 1GZ7A 2HRQA 2ZYHA 2XMSA 4RE5A 1BN7A 1IUPA 2WJ6A 1EA5A 5K3FA 2XUHA 4BB0A 2DQYA 4J03A 1ZI8A 2OLEA 3C45A 3QITA 5AOAA 4WDRA 1QIEA 5AM5A 5EIEA 4U2BA 4XWGA 2ECFA 3C6YA 3DJYA 3WJ1A 5EHXA 5DYTA 3HI4A 1LBSA 4NMWA 1XRRA 1MJ5A 1YA4A 3TGLA 4G9EA 1F0NA 2BCEA 5DTIA 4GDMA 1YS1X 4EUSA 2BUAA 3VJMA 4HXFB 4CG1A 2WIFA 3H2IA 3QBJA 4G1FA 2B20A 2OPHA 3AIKA 1EXWA 4INZA 2PBLA 2QMQA 3C6XA 4BAUA 2BJHA 1DQYA 4UHFA 1NX9A 3I6YA 2XUJA 4YPVA 1W75A 4MWSA 4BAZA 3M81A 1KU0A 4QDTA 1CFJA 3K2IA 3O9MA 4G5XA 1TK3A 1UWCA 4H0CA 1ODSA 4OYYA 1A8QA 4FNGA 5ALZA 3AINA 3WL6A 1XKTA 4HXEB 5AKIA 1SFRA 3ESAA 4W1RA 4GHWA 3KWFA 4J0DA 1GXSA 2WKWA 4ZWNA 2XB6A 4J0KA 2ACEA 4EB0A 1X2EA 3WKAA 4Q3LA 1E5TA 3F96A 1ZJ4A 1YB6A 4OB8A 4JYMA 5EI5A 4CFSA 4UHBA 2WFLA 3B12A 4C4XA 4DSZA 3WKBA 3TRDA 3HABA 3R3VA 1AGYA 4DMFA 3O9VA 5ALFA 1EDEA 2Y6UA 3C5VA 2WJ4A 3NUZA 4X92A 3KSRA 2HA7A 2OQVA 2EEPA 5JASA 1B41A 4OUKX 5A7HA 5CH5A 4L72A 1MX5A 1QTIA 5AKLA 1UFOA 1N5RA 4X90A 1CUGA 1IUNA 2XQKA 3F8SA 2ACKA 5AI6A 4M0MA 3V9AA 1H22A 2H1IA 5HF5A 2XE4A 3WJ2A 4LKOA 1CUWA 3FCXA 3KDAA 2XT0A 4V2IA 2C5GA 5HKBA 3WMRA 2XUKA 4GLBA 1FFCA 4BZZA 2PU7A 1QIHA 3PFBA 1JKMA 2JEYA 5HK8A 3DOIA 2GBIA 4OU5A 1T2NA 5DNVA 3WWCA 4CI9A 2Y2UA 5AOBA 2QM0A 1AZWA 3G0GA 5JIBA 2QJWA 5ALYA 3GELA 2O2IA 2VT7A 5T4BA 2WG1A 1CV2A 1Y7HA 1WOMA 4X94A 1Y7IA 5JYCA 3FYUC 3W06A 3X3HA 5JARA 3U1TA 5E4JA 4DNPA 2DHEA 5I7UA 2ROQA 4IH1A 5AKEA 4F21A 3A2LA 2VJCA 1ZI9A 3W9BA 4QDZA 2AJBA 4ROTA 4KE6A 5ALXA 1U4NA 1EK1A 2ONCA 5K3DA 3WKEA 4MEBA 1R1DA 4EZIA 1C7IA 4K6KA 4M0EA 4GBGA 4J0GA 1ZD5A 4EY8A 1WHTA 3RK4A 1DWPA 2XI4A 1P0PA 2WUGA 5ALEA 3QZUA 4GEGA 1ZIXA 2FUKA 3O0DA 2VF2A 3JW8A 3HC7A 3FCYA 3MUNA 5BWCA 2WG0A 5ALDA 1YAJA 1QIDA 5K5EA 1CPYA 4RE6A 2QS9A 2CEKA 3O4HA 1DT5A 2PKYX 3WK7A 1AUOA 3OOSA 3WK8A 5H3HA 2DQZA 2OGTA 5CH3A 4FLMA 3V1MA 3LIPA 1X2BA 2X76A 4CIBA 2XQIA 2XUIA 3HSSA 2XQFA 2FX5A 2G5PA 2XMGA 3LP5A 3WI7A 2WFMA 1UOPA 1EK2A 1J1IA 1TCBA 4G4GA 4CCWA 4U2EA 1CUIA 4ZV9A 2V98A 4WFJA 1JU4A 5ALWA 5CURA 1GGVA 1JMKC 2XUDA 3WWDA 1UOQA 3D0KA 3FOBA 5AKKA 1ZICA 1QIMA 4EHBA 4XJVA 1AURA 1VXOA 4UHHA 2PU5A 3V1LA 1U8EA 4PV7A 1BRTA 4BATA 2H7XA 3D2BA 1JMYA 4Y2RA 3W2TA 4I4CA 4X93A 2PL5A 3I2GA 4AMYA 4N8DA 3EBLA 4OD0A 1WM1A 4N5IX 3WL8A 2QKYA 4KE7A 1YA8A 2IIVA 3RARA 3RLIA 2HFJA 4AZ0A 5FOQA 3W9UA 2BKLA 4GW3A 4X97A 4MYDA 2QT9A 2CBGA 3QYJA 3E1GA 4DNFA 3W04A 3HZOA 5T4FA 3VISA 4MQLA 2OXEA 1EDDA 1N1MA 4Y7DA 1ACJA 3AFIA 2UZ0A 2VJBA 3GBSA 4BYMA 3L1HA 5KWJA 3H17A 2QVBA 3FLAA 4J3JA 3FYTA 3IUJA 4OB7A 5EIHA 4PW0A 3G9ZA 3I2IA 1UK9A 2QUBA 1PJAA 3O4IA 2J3DA 3G0IA 2GZRA 1XQWA 1O6FA 3T4UA 4JYPA 4C89A 3A70A 1EVQA 1LPOA 1GKLA 3DLTA 1CUSA 1ORVA 1H2YA 3WL7A 3WL5A 4I19A 4CG2A 1R9NA 4Z49A 1NU8A 5DTJA 1C7JA 1E3QA 5D3ZA 4X6UA 3C6BA 1QO7A 1VKHA 1EB8A 3D2AA 1XLUA 2WFZA 3CN9A 2WUFA 1MX1A 2WM2A 3C87A 4KRXA 1B6GA 3WYNA 1R88A 1GT6A 2CUTA 1BEZA 1QFMA 2BAGA 5AI8A 2XUFA 3V48A 3PF8A 4LXHA 1QIGA 1C4XA 4L9AA 3D7RA 5JD4A 3D3NA 1W1IA 1QE3A 1AQLA 5ALGA 3BWXA 1XZAA 1MT3A 3KOOA 1UKCA 4MEAA 4EBBA 4GI1A 3HACA 3QPAA 3BF8A 1QFSA 3VVMA 5AM3A 4LYDA 3ANTA 4PQEA 2Y2VA 3PFCA 3W05A 5JD6A 2DCMA 2JGIA 1BS9A 2X8BA 1CVLA 2XUGA 1JJBA 2P8SA 3KD2A 1Q0ZA 3RKSA 3EIOA 3PDCA 2C0QA 1WCYA 3DOHA 1E66A 2CB9A 1A8UA 5I8PA 5IH7A 5ALSA 2I03A 3FNBA 3HJUA 1F6WA 5CT4A 2ZJ7A 4BAGA 4E46A 4KRYA 5CT9A 3WA7A 2HA3A 1XZFA 2O7VA 2GYUA 3H1AA 3FVTA 4U2GA 1YCDA 5HF8A 1CUBA 1XRNA 4X95A 4UBOA 3H19A 5DYWA 4AMZA 3BIXA 1DQZA 3G7NA 2GYWA 1ZI6A 3WZMA 3JWEA 1E8DA 1A7UA 4IHAA 4JH0A 1AC5A 1BEEA 4XVCA 2B9VA 5LZ9A 2VA9A 3EF3A 2C7BA 1MAHA 3G02A 3ILSA 4Y2UA 1K5PA 3DDUA 4X85A 3WWOA 4Y2YA 4HVTA 5AK4A 3GZJA 4DMHA 2HA5A 2YYSA 2XUPA 4QEKA 4KAFA 1UOOA 4KAAA 4NS4A 4PSUA 1THTA 4OPMA 3DS8A 3FBWA 4ARAA 2WTNA 2G5TA 3G9TA 1CUDA 2CMFA 1T4MA 4HTAA 1L7RA 4U2DA 1J2EA 2HU5A 1BN6A 3IUMA 4U2CA 5E4TA 1AKNA 3BJMA 2ZJ6A 2ZYRA 2RHTA 1XZBA 3C5WP 3GFFA 2I78A 3H1BA 4BCCA 4EA6A 2Q0XA 2YH2A 2JGEA 4WY5A 4C87A 4QDOA 1QZ3A 4B84A 1IVYA 1MO2A 1QIFA 2ZYSA 2RGUA 4LHEA 4B9AA 1EB9A 2R8BA 1LZKA 1SOMA 4IQ4A 2CJPA 1VZ2A 1DWQA 1QIIA 1CUYA 1DINA 1ZJ5A 5ALMA 3G8YA 5ALOA 3WWEA 1ACLA 1CUCA 4UUQA 4H7EA 4G8BA 2HRRA 1VZ3A 4B0PA 2JGMA 4KAJA 4Y2QA 2DHCA 3WK9A 4NVRA 4HRYA 5HF9A
chains in the Genus database with same CATH superfamily
3MERA 1IK4A 1WF6A 1UXJA 2C96A 2MCFA 1CUZA 5KDOA 4GVXA 5AVKA 2B7LA 1V5FA 4BO6A 3ADDA 3GJ0A 2FWIA 3AVWA 1RQPA 1ZM4A 1U2SA 4Y67A 4C4YA 2QJTA 2BUCA 3E9NA 2DBQA 1XVLA 5CB0A 2OXRA 5DWQA 4JXJA 4DIUA 2YYAA 3HXPA 4I1PA 4YR9A 2BFMA 3DXXA 1KVUA 4LVCA 1MQ8B 1GPBA 4OMUA 4BQIA 4AJKA 2Z3ZA 3IAAA 3LXRA 2IHBA 3WDKA 3L6CA 4XB6B 1YUNA 5G1PA 2V97A 3SZMA 4RVOA 3BG5A 4EJ2A 1QO0A 3A6GA 5EJ2A 4B82A 4KR6A 4WNAB 2C9BA 1UZMA 4H7PA 1RYNA 3FAZA 3ORRA 5A1TA 5B4VA 4PG7A 1CJUC 2EX0A 2WIAA 1WPRA 3A4VA 3G5TA 3OSUA 3RU7A 4HGYA 3HB9A 1N5MA 1E1RD 1RHKA 3UK6A 5B2FA 5JZMA 2Q4EA 5K4HA 2I1LA 2PFGA 3N07A 4OHBA 1YBFA 4TZ6A 3I9V6 4WACA 4MVJG 1RWMA 4AYTA 1Y8RB 3TLBA 2WTEA 3ET5A 3ZH2A 4ENRA 2LIPA 3BF7A 2RGYA 2G0AA 3IP5A 1WEHA 4MUGA 4XSGA 1BOFA 2A7QA 2UUCB 3C1UA 4DR2B 4ZDWA 3A7EA 1UDWA 4DMCA 2VSYA 4C6RA 1AQJA 3K5IA 2W6JD 3G82C 4YJ2B 5AK3A 5C7LO 4A4DA 3KCQA 3E5HA 1VJ5A 4JLBA 3SYRA 4OYLA 5E2BA 3A0RB 2O52A 3BB4A 1CKEA 5LWQA 4EG0A 3A10A 3KO8A 2AVDA 4JNKA 1ULBA 4PIMA 3IBSA 1U7TA 4P54A 1EWRA 3OPNA 4XQEA 3ZJ5A 1M1ZA 1Q1NA 2MSDB 3MT9A 4YWHA 3U37A 3TVDA 1LJUA 3ZE8A 5LP6C 3UIEA 3TL6A 2H2HA 2ZJ0A 4RLSA 1Q44A 3VH2A 3HH8A 1KRXA 1EQAA 2WU8A 3RFXA 1WHSA 3BULA 4ZKEA 1TW3A 4KIWA 4M0FA 1PZXA 4DAOA 2P6PA 2YVUA 4OTZA 3HVHA 1S8FA 3C3CA 1F8UA 1D04A 4XIYA 4YIHA 4KR2A 4D4IA 1GZ3A 1M6VB 2JFVA 5BVHB 4ZEVA 2O8BA 3QY9A 1YJ8A 1BA2A 4URXR 3AEZA 3KM0A 2R751 5ECWA 2FGKA 2NNWB 1ZVMA 4LFAB 5CHEA 1H9CA 2IDJA 2IDMA 1E2GA 3M2PA 4UTNA 4MOWA 1KFBB 3G9XA 4YCNA 1LB1B 5DBIA 4HUJA 3V1KA 2GXUA 3DOJA 3MT7A 2AHOA 2QTVA 3MT8A 4WW0A 4CM8B 2X8JA 4QATA 4K9LA 4PYJA 2HK8A 1I5RA 4HEQA 4TTSA 4HNGA 3OM8A 2D2EA 3U31A 3ZW8A 3ELYA 3OOYA 1ITZA 1O6CA 4KPUB 2J0SA 3AVXA 1KZHA 5I3CA 4OHUA 3R7WB 3PXCX 4XJTA 1KO4A 2I4LA 1A9YA 1C41A 1OFGA 4WOBA 3DUFB 3MLBA 4Y2VA 2CSXA 4CDRA 1HDEA 1X7ZB 2J4FA 3LCJA 3OPQA 3P9ZA 3IV9A 3WB1A 3OT4A 4LJYA 1BIFA 1T36A 3N6VA 1NAIA 1CQZA 1R9MA 1S2LA 3C70A 5CB6A 3QVGA 3EMKA 3O9ZA 2VS1A 3OEHA 3AEXA 2WWXA 3LC2O 2RIPA 5FB3A 4AN1A 4C6HA 2QL6A 4L4ZA 3AI2A 1JQ3A 4IRXA 2UXCB 1EWKA 4FK8A 2ZZKA 4YJGA 3RIHA 4JYBA 2IHZA 1G38A 4YPFA 2ZM6B 3H4MA 4U7WA 2UYOA 2ILTA 3ITNA 1H4VB 1HTBA 2IUEA 3WLKX 2LUOA 2H1CA 9LDTA 4O63O 1EVKA 1C4KA 2HRBA 4PNZA 2HHLA 4RHEA 1Z0AA 1KGSA 5JQGF 5A0TA 2J48A 3CWZA 2Q5JA 3SNKA 2GZDA 4EY4A 2O4UX 2VQ3A 1LGYA 1BWRA 4C7OA 1H66A 4JUAA 4E21A 3C3XA 3ZDCA 1DBRA 3BSYA 4RX1A 2FR0A 4D97A 1DQNA 3BICA 3GRFA 1ZM3A 2FZ5A 5GJVC 3VMFA 1NE7A 2Z8YA 5D3MA 1N5IA 1KZ6A 1WB4A 2ORVA 2EQBA 4ZDJA 3V4LA 1MB2A 1PD1A 3D3KA 2BDUA 1L5YA 4KEAA 3BD8A 4MQ5A 4C0KA 1FMJA 3L1UA 3WB9A 3CG4A 4JB8A 5FHQA 2NSHA 2Y0CA 5BN1A 2RG7A 1S3GA 5A02A 4JT8A 1P4RA 5FTNA 3QEBZ 1RQXA 3JTEA 4MKFA 4D56A 3BS4A 3GMIA 2X7JA 1ES9A 4YDQA 5AW4A 4DR5B 2X2FA 3BGWA 5FBWB 4B3FX 1EH5A 2GD2A 4KSYA 4WZBA 4DXAA 2B98A 4DGQA 1TECE 4MWGA 2VTVA 4MP8A 1VCMA 1ZH2A 1QR2A 2HQSA 4DM4A 4ARCA 3MJHA 3VPXA 4FCVA 3G17A 3B9BA 3LLVA 3QF4B 5DBFA 3SHWA 1E3WA 5J47A 3BXPA 1D4ZA 3HXTA 3PNYA 3SJAA 4BMDA 3R6TA 3HVRA 1KVRA 1ATIA 1Z7EA 2J9YB 3K0CC 4JLMA 3IOCA 4XPZA 5LNK6 3V1YA 1PDVA 1RPAA 3RYHA 3DF9A 1Y98A 1W34A 1MOZA 3K72B 1AF4A 1KZ9A 2WUEA 3NH6A 5IAEA 2UZ1A 3W5CA 3IKTA 4PEVA 1W29A 4NU6A 1BQ3A 4HNVA 3ENWA 3DEAA 4C76A 5I4KA 1KJZA 1YCGA 3TXXA 1VDMA 4IZ6A 5KVQA 9ABPA 5K6AA 2XZLA 2PAAA 4A8JC 4HDCA 1U8FO 1UC8A 4FMBB 1KK0A 2ID4A 3I2FA 4ZVNA 4BVJA 1KU6A 2EFEB 1TZJA 5AESA 1WKCA 4HSEA 1NR5A 2M1XA 2Z1DA 1IBMB 1HDIA 2XITA 3OA2A 2IPXA 4NFHA 2ZU6A 1NMXA 2FMTA 3N86A 4NZMA 4OHWA 3V8VA 3FTQA 5HR5A 2XMBA 1TJ5A 1W76A 3BGVA 4MWEA 5KQLA 9MHTA 1QPGA 3KU1A 2OV2A 2ZRPA 4ZQEA 5MGNA 3GLFB 1QX3A 3KJGA 3T1QA 2BLNA 1QOPB 5DN9A 3P5SA 5CM8B 1T9HA 3JR3A 1MNAA 5T5QA 2VN8A 3FY4A 3NHAA 5GWXA 4EI2A 5AVYA 1Y37A 5JNLA 1AKWA 3O0TA 3CFYA 4R9NA 3AKDA 1IK6A 3ZWYA 3ETLA 2JHGA 3H2GA 1KI3A 5C37A 1U8XX 4EB6B 5EVJA 1MJFA 3VKHA 2A1TS 3FWZA 4PPQA 1L4MA 1SXJC 4CEJB 1WMEA 2I2WA 3CRMA 3L0PA 3TLEA 3OEYA 4ESEA 5JZBA 1M2VB 3ZPXA 4ITVA 1H8HA 3BFPA 4MVWA 3EXIB 3LCRA 3LXXA 1NYRA 4JT2A 1KPHA 1ESDA 1OV6A 3SLGA 4BXOB 4YV2A 1US8B 2QQ0A 2QORA 2W2MA 3AUFA 3VHQA 2G9UA 4WXPA 1TMKA 4FDMA 4GPEA 3PQ5A 2Z5VA 4UFPA 1ZJZA 2AOVA 3Q9SA 4PLTA 1Z63A 3G5LA 4I5EA 5EEHA 5TEWA 4L9WA 1OD6A 2D7DA 5FLYA 2ZR7A 4LYAA 3C39A 3LYUA 3SCZA 2ZVPX 4TS1A 2P2LA 1YTLA 1NVGA 4XPIB 2PD4A 1ESEA 1QYIA 1IPHA 5CMLA 4R9VA 1R9GA 1UINA 4DPKA 2VTDA 3ZDDA 1P7VA 1U0SY 1U0TA 1ZHOA 2QW8A 1R0KA 3Q4GA 4R8VA 5AI9A 4O3FA 2DXIA 4CM9A 2DTEA 3CUSA 1ESZA 1G3MA 3SQOA 3MS2A 5P21A 4F93B 1BGWA 1EG2A 2PIDA 3OQIA 10MHA 1E6MA 3DTTA 3JQAA 3IXMA 3R3YA 1TEVA 2NU9B 4WN3A 3RNLA 1F0YA 7GPBA 2VJPA 4Y2HA 1LJ8A 3I2KA 4K03A 3S5JA 4MHSA 3V42A 1XZLA 3ZLJA 5LQJA 5KWVA 2AFVA 2CZGA 1SCDA 3FVRA 1JU3A 3UHAA 3BK2A 2B99A 2VPQA 2VEOA 4M9RA 4OL9A 4LBVA 4QDUA 2E55A 4Z9XA 3ZWKA 3ZZTA 4QWWA 5KYWA 1I1QB 1ZOPA 4FMDF 5M04A 5JPDA 4KPEC 1JI0A 1PEKE 3KLBA 4N82A 2FFJA 2HCTA 2OR3A 2VBIA 3TIVA 5JVDA 4MRNA 2DERA 3HL4A 2J33A 3KTDA 3OZCA 2Q1TA 3ER9A 4OHOA 4EB3A 3BFJA 1HA3A 4J0EA 5T4HA 1BZYA 1QFYA 2FRVA 2P27A 4KIGA 3LYAA 4HGZA 2OHGA 4RD1A 1E5QA 1RIIA 1X1RA 2V7GA 1GNSA 1UADA 2RHCA 4FYJA 4YYZA 3IAHA 4WNCA 5P8WA 1QOZA 3BD9A 4FR2A 1VHJA 1QDUA 1Z38A 1XZDA 2IY7A 2OM6A 2J3IA 4XCQA 4JWTA 3WLAA 3I9FA 3BSSA 3OIDA 2X5KO 2Q6KA 3VKVA 5EJ6A 3VR2D 3UFXA 1H2BA 2WHXA 1UT5A 2EARA 5AP9A 2HMWA 3UWMA 3MWDB 3KQKA 1FS6A 1O94D 3P27A 2WIKA 1N6PA 2IUUA 2NV0A 1Z6GA 1XK7A 2I6QA 4L22A 3HY4A 2PIAA 5KKAA 4DIDA 3AKZA 4URHA 2P90A 3LO5A 2H4ZA 4F3KA 1JSZA 1KSGA 2IUFA 3T3HA 3B82A 3VNVA 1OH7A 2VLBA 3EXHC 3ZK8A 1K7XB 1VBKA 1ND6A 1MOSA 1UT8A 2I71A 3EC1A 5IVPA 1N6NA 3CWQA 3I05A 1Y4DE 2QTRA 3R20A 4YK7A 4YMIA 5EGNA 1SC6A 2LRHA 1JBQA 4HWKA 1AO0A 5EKTA 1W0KD 4WLVA 2DWQA 5ICMA 1AUPA 2H9YA 2V4ZA 2FNAA 1ZGJA 1XXHB 3MQ2A 2OQ2A 1WZUA 3QSGA 3LUDA 1QZZA 1U8ZA 1ISHA 2X8LA 1Y3DE 2NO7A 2RH4A 4C01A 3TG8A 1G5HA 4IJKA 3EVAA 5HCUA 3STVA 4RKYA 4XDGA 2XRMA 3VPHA 1PEDA 2B21A 2A5DA 2VJMB 4O2AA 3ZR4B 4N3CA 3O8CA 3HN7A 1VLHA 1CWUA 4P1ZA 3DFFA 4WTOA 5JMOA 4ENUA 2LNDA 1YGYA 2PZMA 4O4HB 4HNRA 2MSLA 3P9CA 3GCDA 3A4MA 5I7EA 3L6BA 3VM6A 4LC0A 2ATCA 4GYJA 2ZT5A 2PX0A 4CF6A 2VPYA 1EGAA 5LIRA 3RBXA 2OV8A 2WG2A 2ZFUA 1NMYA 1V41E 4JA0A 3H11A 5KX5B 5KIAA 2P2DA 1UK8A 2YOFA 4P7GA 2OXTA 1HE8B 4EKYA 3BWEA 2FEAA 3V55A 4D99A 1Z7WA 1E20A 3FJYA 1P5RA 2GPWA 3O8OA 3DBHB 3Q10A 1ULTA 3ZV6A 3D02A 3E1KA 2PKWA 3UAXA 3GNQA 1Z7YA 3SHQA 4A16A 3H2HA 1JH8A 1YF3A 4P5DA 4BGIA 1G6KA 4HQFA 2G5CA 1FYVA 2C98A 5FPKA 7MHTA 3G7SA 1TFUA 1XFAA 4D0LB 4M1TA 1LRJA 2Z56A 4G1MB 4X6LA 3JYHA 1GUZA 2GPTA 3V00A 3DPSA 1O03A 5BP7A 4B3RB 4JOCA 1PL8A 3U3DA 4YAIA 1TL7C 4ZMBA 2GR9A 4GBMA 1KJJA 3FPAA 3OURA 1DTEA 3FDFA 4QDJA 4MIOA 2UXDB 4GVPA 1ZVKA 1K6EA 2PKRA 4G3XA 2DE0X 4QC2A 3TEJA 4N9WA 5KMGB 5KTSA 2FSSA 3BQMB 5IXSA 1JXQA 4LJ9A 4PAGA 3OE5A 5L3QA 3W6OA 3N8GA 3HCNA 1T0UA 5AVUA 2HB6A 3MVEA 2H0QA 2XOKD 2XKKA 1GPH1 1IATA 2WJZB 3I5MA 3W3ZB 3QW4B 4DLYA 1VP3A 3RRBA 4CIXA 4PPYA 4FOSA 3QVJA 7YASA 1FQKA 2I8LA 4PYOA 3DHEA 3K31A 1R6VA 1O97D 1AQIA 1ZUNB 5AXBA 5B2EA 3GARA 5AKJA 2NXNA 4KV7A 1O6BA 4TKUA 5EXPA 4OP3A 3F7OA 1E59A 4YT4A 4OHYA 1KJ9A 4LF7B 1Z34A 2PUWA 5DM0A 2PGNA 1UXKA 4C0LA 4XQ9A 4QOFA 5JZSA 1TC1A 4H1TA 1XLTC 2C4WA 2ZS9A 2HF8A 2ZBRA 3BJZA 2BFOA 3EQ9A 2ZXEA 3N5CA 4H3SA 4JWKA 1NP3A 1BCSB 4M1YA 5ALKA 3STTA 3IRUA 2BJWA 1U98A 3KUKA 3LY5A 2GD1O 4QJBA 3G0BA 1T2FA 5G02A 4V3CA 1V7PC 2V7UA 1AKQA 3U40A 1BXGB 1G8FA 1LBIA 4I5DA 2V3WA 4TMFA 3L1VA 1JQBA 2HR1A 1AXRA 2WINI 1W5BA 1JQDA 1TQ4A 3R0VA 4JSRA 4L02A 4S2EA 4ZU6X 3TLZA 4XVQA 3CUKA 2C7VA 3D6NB 5KQPA 2ID9A 2QAGC 5C3MA 4WOCA 1P45A 4G5HA 4KFSA 1FYEA 3W34A 1XELA 3ZV3A 3TECE 1HC7A 2A30A 2IQ5A 2WHYA 2EP5A 3FCCA 3IA2A 1B00A 5CVDA 3T3MB 1M0SA 3FMVA 3HM2A 1NVFA 3PR2B 2IEBA 3ZHUA 3R6GA 4Q7MB 4UCQA 4WINA 2XHZA 1DRVA 3EZFA 2GHQA 3LRTA 2PKQP 4K9NA 1JKXA 1LY1A 2NT3A 2P9TA 3DVLA 2BCJQ 3A37A 2YUIA 3UJBA 4BV3A 3PC8A 4FOPA 3OZ7A 3IT2A 5IN5A 1REQA 5AVZA 4DILA 3DHWC 1DO2A 4K1XA 4NY1A 5B1DA 1AHPA 2H9IA 4H1WA 4Q37A 2F3UA 1XP8A 3PTAA 4N7RA 2A94A 3CO5A 3UWOA 2XB2A 2R6JA 3G0OA 3ZCVA 3GVCA 2RCYA 4ALLA 1MTOA 1SD2A 3O2NA 2VHVA 4M98A 4L6AA 1NUTA 2R47A 3NFYA 3RYIB 3DDZX 3LDUA 4YP6A 3W5VA 4FBLA 3JD2A 2P4EA 4BLOA 1VKZA 4Y2SA 2A5LA 4ZEOA 4B3JA 2ZUBA 4D5EA 3HM9A 4OM7A 2QX9A 3NVAA 5I9LA 1Y4ZA 3K3PA 3PNLA 5L7TA 5FLKA 8ADHA 1NC1A 4YMGA 1JVSA 4X7RA 4Z4CA 3KR9A 2SECE 1U80A 2NWQA 3OWHA 3Q11A 4FXPA 3R4VA 4J07A 4Q1AA 4RF2A 3T0FA 4MV8A 1Z0UA 4Q82A 4PFJA 1HT1E 2C78A 2D1RA 2O06A 1YZFA 3GRVA 4GNKA 4JC8A 4MW0A 4MV5A 2ZG6A 4ZPJA 3UWSA 4ZYWA 5KOJB 3NLLA 4Z4IA 1XVTA 3T1TA 3NHWA 2HY7A 1T1EA 1NN5A 4C88A 1M73E 4EH1A 4MQFB 2YZ2A 4GLJA 2YW9A 3L4BC 4H6WA 4MDHA 4IVRA 2AZ4A 1J7JA 1F8FA 1DAEA 1QNLA 1RPTA 1RTTA 2NO0A 4UEKA 2RBGA 3QVKA 1EQUA 5BQXA 1PTKA 2BDTA 3BSWA 4U5QA 4UOQA 2WSYB 3T4XA 3GMTA 3IA7A 4G4IA 4CMHA 1J20A 4YAKA 1PR0A 1RLJA 1U31A 2O2HA 2AC2A 3CPEA 2YV5A 4MPPA 3T15A 5IDXA 1W2GA 3KVOA 4JIMA 1OLSA 5FL7D 3SDBA 3V4RA 3JXEA 3TQTA 2FSIA 5AHXA 4Q4DA 2RBEA 3Q72A 2HT6A 2FLVA 3HN2A 2INGX 4A7PA 3C6MA 5LP6A 4CNBA 1Z8NA 2YV2A 2ZCUA 1K2WA 1C2YA 4M0LA 5A62A 1QGYA 5K0EA 2O8EB 1MOPA 3MFYA 4MVJF 3MRSA 5HE8A 2W42A 5AW8A 2FKNA 3TL3A 4N0PA 5GJWC 1YS9A 5CB8A 2VDMB 4IFEA 1EK0A 3GDOA 2FXVA 1OU0A 3M4YA 1BE6A 2KS6A 3WGQA 3EMDA 3C4QA 3HP4A 3I09A 3A4YA 1O95D 4J3FA 3H5OA 4ZAZA 1RBZA 1GEGA 1YBAA 3A3OA 4NCHA 2VDLB 1QHEA 3DTVB 3E70C 3GLHB 5EPEA 3CF6R 5E0OA 2PLNA 5HP4A 1II8A 3ILHA 4XSVA 4RY9A 4OQZA 3S8MA 1IUKA 2HXGA 3H2ZA 3IKJA 5SY6A 2R66A 3ZU2A 2XNJA 5LDDC 2J9FB 1NXWA 2I62A 1WIWA 2HIHA 4WLEA 4AY4A 3LD9A 2G3YA 2G83A 3ZHCA 4G0WA 3BEDA 4CLOA 1YS2X 4I4NA 3EIWA 3AI1A 2VZ0A 3UBTA 1BMTA 5JWOA 3Q8MA 3LW8A 4XLLA 4MKGA 1U4OA 3SWWA 1XU7A 2O2YA 3PFFA 3UAOA 3A2NA 3OMLA 4YRLA 3BMOA 3JYPA 4AMGA 4P0PB 1CVRA 2G0NA 4UUMA 2RHWA 4LF5B 1VB5A 5EE9A 1YB5A 1XALA 2GZSA 2F9LA 3FUVA 2J9ZB 4QOJA 3RAFC 2QHXA 1UAYA 4R9RA 4XCXA 1JH9A 1TVCA 1CQPA 2D2IA 2ZJ4A 1HZJA 3DL4A 2C07A 4P3NA 3WKCA 3VU9B 2B8JA 5K3BA 2EVWX 1LBQA 3O8LA 4YONB 2XIJA 1C1DA 1F7UA 1C4WA 3HUTA 4UDNA 3GQBA 2FQWA 5DHFA 2IH2A 3ISVA 4K6HA 3RHSA 3R1IA 2BONA 3UOWA 4BDTA 5JQGB 2OHJA 3PUWA 4PAMA 4RDHA 4IXDA 3IPCA 4JODA 3ZY4A 5NLLA 2FDCA 4NICA 2RARA 1KETA 1U28A 3P1JA 3UMJA 1DX9A 4K8OA 3M6LA 1KNXA 3Q6IA 4QSMA 1FSGA 4G0NA 2D8MA 3W79A 4MIEA 3WK6A 5KHLB 1WDTA 4DRXA 4JMPA 1CNFA 1I1HA 4RVHA 4O4IF 5E2IA 4LYHA 2XCOA 5E9JA 5ER9A 2BELA 4LHWA 1CRWG 4CKYA 3GLGB 2ZJ2A 3CH5A 2X9LA 3P52A 3T95A 3E5RA 3TLMA 4C7JA 4KR7A 1H0SA 5IBPA 3S2EA 2P7IA 3WBKA 4DCUA 1JHZA 1QGUB 5CNJA 1A4IA 3VPFA 3IVAA 3FHJA 1XQYA 3IP9A 1N2CB 4GOXA 4P4UA 1ZXXA 1LBTA 1HH4A 2ORYA 2ZIGA 4NEHB 1XZEA 3CWCA 4KACA 1UKAA 3QVLA 2RK6A 2FFHA 3WNCA 4FE7A 5IDQA 2FFAA 2CUKA 1CUVA 3I73A 4N5MA 2MINA 4QPNA 5AICA 1NSYA 4RVNA 3I92A 1OFHA 1L5SA 4CWAA 1WR8A 1H2AS 1XZ8A 3VNBA 3FFXA 2XRZA 4F5YA 3PDUA 1WB5A 1KI8A 4RY8A 1ZHHA 3AP3A 3WTBA 1J8YF 3HFGA 4MH0R 4R6XA 2HA4A 2WMDA 4GO1A 2OHOA 2YWDA 2RBKA 4PCAA 3LL4A 1U8CB 1GLNA 1JR2A 3SE0A 5DNDA 2VTEA 3U16A 1ZZGA 4MQFA 1NQXA 4Q3KA 4DKXA 1V1MA 5EP4A 2X7HA 3AR6A 3GGDA 4HFJA 5KTOA 3EA0A 2QM8A 1DIGA 1ISPA 1D6MA 2DGDA 1LK0A 1S3FA 1G9XA 3RIMA 1X8KA 3MJDA 2EAUA 2PLWA 1N34B 5DSZA 1P29A 2NSYA 1JN0A 1EUCA 1K6MA 5J63A 1GZSA 1C1XA 5GGXA 4OKIA 2D59A 1AK1A 3EZLA 1BKSB 3IR6A 3VU1A 2OUKA 3H8WA 5EIFA 1R4MA 5CAEB 2IHVA 2GN1A 3GFTA 3FSGA 3WQHA 5I5EA 4O2BB 6REQA 3QPBA 4XEHA 2PUEA 4NCAA 4LHXA 3TIGA 1CUHA 4M83A 5H0IA 1GV0A 3F78A 4UZEA 1W49A 3L1KA 4AX4A 1EM8A 1XVAA 1T0BA 2LV8A 1I2ZA 1MAUA 4QUKA 1OBCA 2FV8A 4LQ4A 2R2AA 3MUOA 5C5CA 1Q50A 4D0NA 1RC1A 5A04A 4MJ3A 5DEOA 3WWZA 3U4GA 4L3VA 3OC6A 5JECA 3UENA 2IU4A 1V11A 4NBTA 4Q12A 4CMEC 1AD2A 1PWZA 1P0QA 3PHCA 3VO2A 3ZZUA 5JZ9A 2FGJA 4LBWA 2RB4A 4PNPA 3JZAA 4DA7A 4HK4A 2W8BB 3GUCA 1WPGA 4ME6A 1VL6A 5IAJA 5TPWA 2P3OA 3SEAA 1ZOIA 4BLVA 4BVLA 3LY9A 4YCMA 2GM4A 4GP6A 1SHKA 1E89A 5JJBA 4E31A 1CULC 1W5FA 1A9RA 4EF5A 4F6RA 2YFHA 1Q1QA 2PUHA 1KAQA 3SLKA 4A1OA 4ALMA 4NG4A 2BHSA 2F00A 4IJ6A 3HGMA 1F8XA 1IONA 1NXXA 2H7CA 3GEBA 4WZAE 1CDZA 3JTMA 3L7CA 2YHAA 4JXZA 2V6JA 2ZRIA 4P92A 4Q19A 4R81A 5C18A 3DUWA 2IHJA 4TWAA 4J16A 2W4IA 2BFWA 2ONJA 3PEYA 2VQSA 4MICA 3SHOA 2CHFA 1YJAA 3RC1A 3PENA 4BV2A 3C7AA 3Q7RA 2OBFA 3FUCA 4OFBA 3H9JA 4OA8A 4JITA 2JGDB 5BSGA 2Z4SA 4CM4A 1UC9A 1BCSA 1A9XB 1E6UA 3N3AC 3I6MA 1K92A 1N4AA 3R3WA 1QGOA 3PQ6A 4YC7A 5GP1A 1JNXX 4IGEA 1U3FA 2ADFA 1M2WA 1Q0QA 1YOBA 1K75A 1TADA 2DKFA 1ZN8A 2HOQA 4MGEA 3MTIA 5F1KA 2NUAB 3GF4A 3OAAD 5KS2A 3EGXA 4ZAVA 2CNKA 1A77A 3BRCA 4I1OA 2NAPA 521PA 2WDZA 1VJGA 3QELA 1RMYA 3M5CA 4FHDA 3FUTA 2H2WA 2QNIA 2WHRA 4V1CA 1KERA 5CM9C 1DZIA 3QLJA 5BWBA 3PZBA 5ALJA 1NUUA 2LGJA 3HLTA 1MX9A 4GX0A 4E1BA 4UOZA 3W8RA 4ZQBA 1KSJA 4OHFA 2H29A 2F17A 2RB5A 4POAA 4EMTA 3LF2A 1FNMA 4FKBA 3E9DA 3H5TA 2I1QA 2F4VB 2LP4Y 3DEKA 2CWDA 5MHTA 4I2NA 1F17A 3JQ6A 4O1MA 3RQSA 3D3WA 4M9QA 2K7FA 3EVDA 5ES4B 4QUBA 3RVDA 4YASA 1DARA 4WN9B 5A3RA 1OTYA 3DAOA 2QZ9A 4N12A 1OX4A 3EPRA 4CM4B 4DMMA 2Q3EA 4LXGA 2Y1GA 2DCUA 2C4MA 1F48A 1MXHA 4PQGA 3ZQ6A 3N0XA 4QECA 4KGXA 5FOWA 3NVKI 1D09A 5FOSA 4XLTA 1PYDA 2H5JA 2BN4A 4HEA1 2OLKA 3BB3A 4LE2A 1APBA 3ANSA 2HJHA 2P9BA 2ZU0C 1XT6A 1KE2A 2WB4A 2Y27A 4RD6A 2I29A 2X5XA 2UYQA 3D8TA 1VPDA 1KQNA 4E4YA 2F3QA 2FP3A 1BCRA 3D8HA 4GICA 1EAMA 1K27A 4URFA 4PLFA 1P1BA 4YCBA 4AY6A 4XOIA 2BFAA 2AJLI 3AU9A 4ZT2A 5FF9A 3TD2A 4O08A 3VI4B 3TUZC 4P36A 3SEQA 4V1CB 1WMAA 2OHIA 3LPNA 3M5PA 4EKEA 1OV4A 1Y7TA 2REQB 2HU7A 4WY2A 2HFKA 5B12A 5JNSA 4JXXA 4MUIA 5B6JA 3OTQA 4LHZA 4MXDA 5DW3A 3U17A 1JQAA 4RZ2A 2AN3A 3IJPA 3IDQA 2XTAA 1HQDA 3UK2A 1L7XA 3ELUA 1AO3A 2EKDA 3WTCA 1EESA 1FFHA 3PPIA 1H2HA 4E3WA 4Z7JA 1L7AA 3FPGA 3R2JA 3FYUB 3CRZA 3BRWD 3ZGVA 2GAIA 1UMBB 3CZ4A 1L4LA 3NCTA 1YB7A 1QONA 3NTVA 4RENA 2CV1A 5EHZA 1EBFA 5K6AC 4NZZA 1IHUA 1Q77A 4BNMA 2AQ8A 2YWFA 2AYYA 2Y4NA 1D4FA 1U7HA 4IZHA 1KZYC 5ADUS 1SELA 4KAXA 2XZPA 1EVZA 3LTNC 2W2LA 2Z5LA 1IEQA 1AKTA 3LXUX 3H0KA 3KOWA 3UJ9A 3V4ZA 1JFTA 2HA2A 4LXTA 1T3LA 3H8SA 3ILVA 4JI4B 4F6RB 4E30A 3HUEA 3GJ7A 3RJZA 2QE7A 1EA7A 3O8NA 2HMTA 5FCDA 5F3RA 2JHPA 3KJXA 3ONDA 3S28A 4AG3A 4DUGA 4OI2A 2PQMA 5GV7A 3KT0A 4LMPA 5ALHA 1C30A 2QUHA 3C43A 4L9RA 4TN5A 1DX6A 3ZHTA 4JV5B 4D3SA 1KOGA 3QF4A 4TMWA 5F9FA 3P96A 1ZCJA 3PE4A 5DRYA 2FJPA 2ZPAA 2BGWA 1SXHA 1V37A 3ZY6A 3EXG1 3TPCA 2WIBA 3KTOA 1BH2A 4U00A 2BMFA 3W7VA 4PINA 4JUIA 1PJLA 3HUFA 1GPLA 4O02B 3TUJC 1JFFB 1QC5A 1LTHR 1LEHA 3GVIA 4FGUA 4E5SA 4EGFA 2OFXA 1CS4C 4UFNA 2OHFA 1YKSA 3QGMA 1KP9A 6AT1A 1JTEA 1E0JA 1G5IA 1H9BA 1S89A 2BGLA 4FFOA 5E6RB 4NC9A 1S7CA 1NYTA 4OQYA 3O75A 1V8PA 1T3SA 3GA5A 1IZ7A 5EWLA 3ZCXA 2ZWIA 3HGQA 2FB9A 3HMQA 4KZKA 3HP1A 1QLWA 5HILA 1YJXA 1MW9X 2OENG 2CFTA 2Q9CA 4NBNA 3SJZA 4M3NA 4CCAA 2PT7A 5CCXA 5TQ0A 1CP3A 5K8VA 1AX9A 2QVGA 3RAPR 2AS0A 3RWMB 1JHRA 2RHLA 4MLZA 1I7QB 1ONBA 4ZREA 2A5GA 4PZPA 1TU4A 4AZWA 1FFXA 3DT8A 1YR8A 3KYIB 1WVIA 5LYJA 1ORHA 5EL0A 5JI2E 1UOEA 3FGOA 3UKOA 4AS2A 4GH5A 2IWRA 3FSGD 1HOXA 3A1CA 3O7MA 4C7VA 4YRQA 5LKRA 5KPDA 4X45A 4JI1B 2OCGA 5LQKA 4A8JA 1KO8A 2AMYA 2HV8A 4QODA 3AG5A 1NBHA 4V0ME 4FDLA 3FBTA 4OREX 3RSHA 2GSDA 4HG2A 4BNGA 4DLXA 4ZO7A 5EZYF 4ZCLA 3CLUD 4WLUA 1GL7A 2R5WA 4ESVA 4HXYA 3ZBPA 1NKVA 1OI2A 1L3IA 1KMMA 1E2IA 3DCIA 3NANA 4HAIA 3QWIA 1PNTA 2A6PA 1TIBA 1HE5A 1MZVA 4HFNA 4EYQA 1HZZA 2ADMA 1LPBB 3LA8A 4CTJA 4N40A 4C0AC 4NF2A 9GPBA 1VC2A 2WSSD 4BVBA 2HCFA 5AW6A 1EXMA 5JW6A 2I8CA 3MINA 2YOHA 2WTMA 2YBDA 2O8VA 3OM0A 4OXQA 2A5FA 4TWJA 1WV0A 3EEBA 4H7FA 5NULA 1BE0A 4FHZA 3U7QA 5CJ2A 3EGXB 2XUZA 1RRCA 5FPSA 3DFUA 1X7XB 4CTOA 2ZSEA 1T13A 3O1LA 1F20A 2HA6A 5JANA 4FNMA 3KOZA 1X14A 3MJTA 5HKKD 1IM8A 5DTMA 2ZJ3A 3I42A 2WWHA 2H2IA 5GZ6A 1PBNA 1WUJS 1WB6A 4GC5A 3IEKA 3PZRA 3DWEX 4MKXA 4UEQA 1K9SA 5FPQA 1ZD9A 2AFIB 4BLPA 2H00A 2WZCA 2Z2KA 4J0JA 2P4QA 4P84A 3TMAA 3ZDBA 3T5MA 4X20B 4GECA 3SIPA 5J4LA 4CGZA 2YDXA 3OPYB 4YUVA 3L8ZA 5L8VA 1X80B 3PD0A 5BQPA 3SC6A 4BKRA 4ZICA 1M6VA 4D8VA 1JR6A 1G4UR 5C80A 2IXFA 2VBFA 2PV7A 5ALTA 1XMPA 4CTNA 3RPEA 1SG0A 2DAPA 3DYVA 1S2GA 5IDYA 1K08A 4CTKA 2QN8A 1QMGA 1TKRA 3LC0A 4QPPA 1FDUA 4QU8A 4RLHA 1L5HA 4JKIA 2A1TR 1FU7A 4WK2B 3KC2A 4LXYA 4QOHA 2QVXX 1RQRA 4FD2A 5CVCA 4D9CA 1Q83A 3ETGA 2PNJA 4LDQA 3RVKA 5KO2A 3ZU4A 3ZY2A 4GYYA 4UTXA 4BLSA 2PUTA 1ADFA 1ZBDA 1TTQB 3QI7A 1CE8A 1KYIA 1V35A 2I1VB 3L0ZA 3QOYA 4QU0A 4ZC8A 4C2TA 1ZM7A 4IGFA 3FI0A 1L7VC 2NYRA 4FNOA 4R0VA 3RVPA 2FUEA 2CLLB 1A4XA 2QG6A 5AXCA 3FOFC 4TTJA 2ZSBA 4R40A 2PZEA 1R5NA 4BN0A 4BNKA 1E3DA 1TD1A 2WUVA 4DG8A 5DNCA 1EFTA 2QROA 1ZD1A 1B16A 4XFJA 1ACMA 3VNRA 1U0LA 3HPRA 4EKGA 4TSRA 1F2UA 4RYLA 4EITA 2V9ZA 1E32A 4I1UA 2HF9A 1DJQA 4PGMA 3SC2A 4RY0A 4IW3B 1KDRA 2ZRKA 5K3AA 4F4JA 1IHDA 3EISA 3E23A 4KNYA 2DUNA 3E7DA 1N2SA 2G6BA 5DCUA 1E5VA 2VRCD 4LQLA 2RHMA 1RTKA 3VDNB 4DT1B 3DD5A 2XKBA 2H1VA 1VLLA 2OD7A 5GMOA 1JL3A 4DS3A 3W6NA 1DWUA 4IV8A 1DZ3A 1NMZA 1E7MA 1VPTA 1NVVQ 2F59A 1P44A 1SWVA 2O8EA 2M98A 1P74A 1MNQA 4JBYA 3IAS6 4JMLA 3LUFA 4OI1A 4DT1A 1AM4D 4E14A 1Z3CA 4PTYA 3ROGA 3T5PA 4V0NA 2ZRLA 5GVRA 3EULA 4R5HA 1I36A 2PNFA 1A2OA 2YS7A 3BZWA 3C5CA 1KZ4A 3GRYA 4WH0A 5CTJA 4GQAA 5I3ZA 2XF8A 4RZIA 3WRVA 1OLSB 3L6EA 4HYQA 3MTGA 2XKJE 1Z12A 5AWFC 4FHEA 1X3LA 4JQYA 4QULA 1O5OA 1ZGGA 3EPLA 1VECA 3IUSA 4ODIA 3V4OA 3B3FA 4U2FA 5DIFA 1WAMA 3V5NA 3UCFA 2FQ1A 4DQVA 1PR9A 1HQYE 1JR3E 1M76A 3IBYA 4K26A 1RRFA 5FNVF 3AB7A 3C8ZA 4I50F 3NG1A 1DG3A 3KJQA 4LSWA 1Q6YA 1ZC3A 5D7BA 4B7ZA 4DXDA 2O9JA 4F91B 1IBKB 4R16A 5KYUB 1QFZA 1XMIA 1CSEE 1JLMA 2H31A 1RQ2A 2J87A 4X5OA 3I8XA 3MRVA 2Q4BA 1MV8A 3QIVA 1YQQA 2ZIEA 4K8RB 2ODPA 3HJHA 5ALNA 2XUQA 1EFAA 4DEXA 4NXMB 3CLUC 4MAFA 1U8AA 2DULA 3ETHA 1DKRA 1JEQB 4A0QA 1KAOA 4RCVA 1Z2OX 2YIVX 3RV4A 1R15A 1X7ZA 1V8BA 5KJFA 1UJMA 1RWQA 1RRMA 3MNFA 1QH1A 4L4XA 3PJFA 1AUXA 4F12A 2PN1A 2QVZX 4MVJH 3U3XA 4IJVA 4HNAB 1Q6ZA 4D9EA 1C3LA 1P9WA 3RRNA 1FTGA 3GDWA 3OM1A 1DAFA 2C0CA 5JDIC 4WBXC 2PX5A 2XMRA 4RBNA 2R44A 1C2TA 3S1AB 1FDSA 5H81A 3GH1A 2GXSA 1QH9A 3ZI7A 4L16A 4LWPA 3OIGA 1ZRSA 2W6QA 2Q5FA 5F3DA 1TZKA 1N1EA 2BI4A 2VXBA 2L2QA 1AKYA 4C4OA 4US2R 1Z4MA 2M2IA 1QQTA 1GPNA 5DRTA 5J1TB 1Q16A 1OHHA 4UNSA 3D6JA 4N18A 1Q1GA 4BTLA 4QG3A 1XQ1A 3DH0A 1SVIA 4MV1A 3D4OA 2ZIFA 5FPPA 1OTXA 2CL7X 3F5FA 2OAGA 3C8UA 2B4AA 5JNTA 5L4SA 1DOAA 4BFWA 3GP8A 3L0SA 2C92A 2IPOA 1LNZA 4UBNA 1EHYA 3H5RA 5JYBA 4ZZ1A 4QARA 4XX0A 1RKUA 4RC9A 1N0HA 2HRQA 1U7XA 1AIPA 1TIPA 2XMSA 3NOVA 4YQYA 4GDFA 3DMTA 2FPLA 2I87A 3ZBUA 3AVVA 5EZYA 2IE8A 4IDGA 4WE3A 3PNSA 3CUEF 4HWRA 3TCXB 1FMLA 2NVBA 4FW8A 2C9YA 5G0UA 2YJ6A 2Q50A 2OLEA 2PZ8A 4OGGA 1XU9A 2WJYA 3H9BA 1SN7A 3TIXB 4EW1A 4QYWA 5AOAA 1CJSA 4WDRA 3ZZ1A 1QCDA 1QIEA 2D1YA 3H13A 4BMNA 3KVVA 4R8RA 4ZJYA 3ADBA 1N0VC 3RW9A 1JXAA 2CVZA 4OQMA 5EIEA 2FSGA 2OXFA 3K5WA 4R84A 2O50A 2AUNA 5LQUA 2QENA 3LPDA 4JJ7A 2ECFA 1ECLA 1E7WA 4GIBA 1JEYB 4H1HA 3SP1A 1AV7A 2WM3A 4UD2A 1Q0HA 2FW6A 3DJYA 4BNWA 4PRYA 1OBFO 3DDCA 2R6ZA 3I9NA 4H4EA 4AJ1A 3UPTA 3UMYA 4KU4A 1SQ5A 3NWEA 5JPIA 2JAUA 4KQHA 3K0HA 2WJVA 1KZ1A 2WFAA 2IODA 4OAQA 4XGNA 4C1NA 2O1WA 5DTIA 2BCEA 4CYMA 2D6FA 1UBMS 3KZCA 1TJ3A 3BHJA 4P32A 1M2GA 1YS1X 4MARA 2BUAA 1LTQA 1FDRA 1MMFB 3WISA 5AMXA 3VJMA 1TOAA 2GPAA 1E3JA 1E9EA 2K4MA 4FONA 4RUKA 4XXHA 2JCBA 5EKDA 3U13A 3ZIUA 2IELA 1HEIA 3E8XA 3IDOA 3UXEA 2PXHA 4J8PA 4EFLA 1EXWA 2FU5C 5IDWA 4MW2A 2PBLA 2O5EA 4BRWA 4OX9Y 2BJHA 1PS0A 2VK4A 3OUZA 1X7WB 2O2SA 3HWX1 3T7TA 1PZFA 3RVJA 1NVKA 2XUJA 2GLUA 1YI1A 3OKPA 4RHXA 1DRWA 2W6NA 5BW8A 1XPOA 3AONB 4JFRA 5HW0A 1OB2A 1Z26A 4DV1B 4CLDA 3HDHA 3NBKA 2L18A 2PFSA 4BMXA 1WF3A 2RKOA 2QK4A 1EJ0A 4WK4B 5JBQA 1XJCA 3VRHA 4DLSA 4C7MA 3WL6A 3HYTA 3H84A 3I39X 3QFRA 4HMQA 4AJ9A 3RJMA 1OWMA 5LQAA 1QBKC 1XKTA 1G3QA 3IQGX 3C3YA 4LJ8A 5AKIA 3UZUA 3JQPA 1SFRA 2V5AA 2D74A 2VNSA 4TL6A 5LA6F 3RUFA 3WQBA 2F7SA 2O8FB 1Q92A 4LRTB 4MITA 1CZOA 1O1YA 1VJCA 4G81A 5F76A 1G7CA 3K4HA 1J2UA 1I3KA 2GD6A 2ACEA 1NQAO 2IEGA 3KD3A 3O3CA 4G4SO 4B1FA 1E5DA 5EINA 1YDEA 5A5VA 1UJNA 1Y82A 4JGBA 1A72A 4DBZA 1F1BA 3TW4A 1XCGB 4PIVA 5HOEA 2B1IA 1WL8A 4ISCA 1ADYA 1N4DA 5HJ2A 4AIRA 5KYGA 3NWBA 1GTL1 3GV0A 3F8TA 4Q3LA 1TU0A 1PYGA 1ZJ4A 1LC0A 2XE6A 3PR1A 4FSDA 4LBYA 3JALB 4WV3A 3K32A 1WSAA 5EI5A 4CFSA 3IPYA 5IJ9A 4D3FA 4D3ZA 2PEZA 1KJNA 4UHBA 5FTMA 5K09A 3T12A 1AN9A 3OAAA 3QUSA 1JEJA 2JLQA 2QMZA 1DIRA 1E2LA 1E62A 3JQDA 3ZWXA 3O6VA 1GGKA 3PQ8A 3TQCA 3UXMA 4R3WA 1AMUA 4V0OA 3PEWA 1AGYA 1DAGA 1EDEA 4HADA 4M9CA 4R0NA 3W9SA 2W48A 4YFYA 1OYWA 2ZI5A 1KOJA 1LQ2A 3USZA 4TXLA 1C0EA 4HUQA 3HEBA 2WJ4A 2Q9AA 4ER5A 3OSZA 3KSRA 3R7SA 4BU1A 1Y8ZA 5IT0A 1FW6A 2V1UA 4A3SA 3RH0A 4MRRA 1QGZA 3EVNA 3IDSA 1V3VA 4QQNA 3HHEA 1OX6A 2GJ9A 2P69A 2Y93A 1ABEA 2WQ6A 1ZD8A 2XVAA 3F2IA 3O4VA 3IQWA 4E5DA 3EYWA 2E4AA 5TB5A 2X6RA 1TDJA 1DBVO 2WOJA 1XAJA 2QRLA 1ZH4A 3BQNB 3PVCA 3T3GA 1N5RA 4X90A 3TTTA 4RHCA 1EFVA 1R6XA 2DWPA 3TKYA 4GL4A 1P4HA 5AQ1A 3HV0A 2VK1A 5F2KA 1SHJA 1XTPA 3WLQA 4FEYA 2DUWA 4M1WA 1T6YA 4WLNA 5IJ0A 5T7BA 1YK0A 2I54A 4FGLA 1BD4A 3VNAA 2QTAA 3WYAA 2XJ4A 1VI6A 1KO5A 3OQIB 4M7WA 1W0KA 4ZCTA 4LKOA 4W5JA 3UXYA 2A14A 1CUWA 5I45A 1GJRA 2B92A 3M3HA 3EBOA 2PLRA 3GUHA 3KDAA 4KLZA 1RKBA 3IP1A 4RQAA 3KZXA 4QYIB 4TYQA 1H8ED 1WQ1R 2RAVA 4GE3A 2CW5A 4KXXA 4LYYA 4RWEA 3KUCA 5HKBA 3W4IA 4DIFA 4A2QA 4FLFA 2IS1A 3TQIA 4HWGA 4BZZA 3OEEA 4W9NA 4NESA 4XSHA 3ZU3A 3PFBA 3Q8KA 1JKMA 2QY9A 3HU2A 1E9RA 1E5XA 3KTAB 5KNBD 2QLFA 3PEUA 2Z1MA 4HB4A 5B3AA 3VUEA 4GYWA 5IXJA 3DOIA 2GBIA 3LGSA 4OU5A 2CCGA 4RTKA 5KNDH 3LBAA 4CI9A 4KUGA 2Y2UA 2VDQB 4KWIA 4Q7KA 4F72A 4B40A 1GM5A 3FFBA 1M2KA 2QM0A 4UNNA 3IMGA 2C31A 2XA9A 5LL6P 3KE9A 2GN6A 1W5SA 3KRTA 2NPOA 5B36A 5L53A 5KNLA 3A3PA 2NADA 2NU9A 4L8WB 1YZUA 4TQGA 1GDTA 1W1UA 4I55A 4ZU1X 3LUJA 4DCTA 4EIWA 1CV2A 5JDIA 4JR1A 3K5PA 5IAKA 1I3OA 1PWHA 1SXGA 2OCXA 1WOMA 3KQMA 4N5NA 3V7NA 4XWOA 2QGZA 2PVPA 2HCRA 1I2DA 1OFIA 1Y7IA 2C4UA 4JVOA 5JYCA 1Y33E 4A03A 3W06A 2EKZA 3DE0X 1A9XA 5JSUA 3PDHA 5KOHB 4LOAA 2X9QA 4DDMA 1UMDB 1C0PA 3HU1A 4OBBA 4RHTA 3SD7A 3U1TA 1P9LA 5F7ZA 2R9VA 3NGXA 3NIWA 5SYAA 2BEVA 1FUEA 1MPTA 4GPBA 1XNQB 2QX7A 4ZVRA 3IPXA 1THZA 4NZNA 1G64A 4F21A 4YDSA 4FEAA 1IHOA 5D6NA 1LDNA 4KSCA 3SFTA 5DGHA 5AW9A 2FWRA 1VMIA 3N2EA 1U0FA 3LWZA 5FEMA 1ZI9A 2A35A 4HR7A 3QE9Y 3EWAA 4M53A 2XNKA 4U9UA 1FOEB 3AFNA 2AJBA 3E27A 1QUEA 2EP8A 3P9YA 5FI0B 1JHOA 1OXBB 4C08A 3M34A 3DKIA 1SUAA 1EK1A 4LWZA 4TMYA 2SKEA 4YRZA 3FMFA 2IYTA 3L06A 2HQOA 2VDKB 2ATEA 2Z95A 1KI6A 3UJAA 4HX5A 3B3JA 1ZGZA 5C1PA 1C7IA 5JO9A 1I51A 1QS0B 4KQIA 1WMSA 4K6KA 1WSBA 3IPAA 5HIIA 1W8DA 3KZ1E 3CLVA 4GBGA 3VZSA 4L51A 2DFKB 2P4SA 2EF1A 1EMDA 4LBZA 3MMSA 1KTIA 1WHTA 1GN9A 3GLFA 4PU0A 4EO9A 3RK4A 2YCLA 3IAM1 4WRRA 5EXDA 3UWPA 1EM8B 4HATA 5IM4A 3FSJX 3SX2A 4OX9B 3VSBA 4CNQA 2BGGA 3L0CA 1MIHA 2O8NA 3BIFA 1FVXA 3IXLA 2BE7A 2EKLA 1X94A 3ELBA 2QQGA 5DULA 2JZNA 5JPCA 3DLCA 2XTMA 4MDEA 2QR3A 2DY1A 1KY5A 2FUNB 3EFOA 4AJLA 2ZXUA 3A1EA 4FFRA 1JNYA 3UPDA 3KJEA 3AK4A 1BS2A 1XTBA 4HQNA 4PLVA 1O77A 3SEZA 5EHIA 3VYTB 721PA 3OCUA 2BOVA 1EUCB 2C29D 2EHJA 2VBGA 3PYXA 3E9CA 1XSEA 3JW8A 3ZD7A 1KFEB 2Q2WA 3DMHA 2QW1A 3MUNA 3MILA 3MJCA 1AS0A 3M2TA 2IJGX 1S96A 1CQJA 1ZM9A 4QQRA 4D41A 1YUBA 3N1UA 3ERCA 3LC1O 1YAJA 3EGOA 2QS9A 3ULKA 2XBMA 3HEMA 1YDHA 4HMPA 1RKXA 4MVYA 5FWXB 2YWXA 1IWBB 1NR1A 1W25A 3O4HA 3K1ZA 4PAQA 2WRZA 4EA7A 3OZRA 5K0GA 3K0AA 1RYZA 2RHJA 5H80A 5KMGA 1GFWA 4HN2A 1DQPA 5JS8A 3PQCA 3IC5A 3GN1A 3OOSA 3OY2A 1NFRA 2Z2JA 2W6MA 2XRFA 3UA3A 1VE9A 4PLYA 3OEWA 4DIMA 1RPZA 3HJRA 4D5GA 1P0FA 4DSNA 1BXRA 2IYUA 4BKMA 2FSFA 2OO7A 5TQVA 3TRHA 3TW8B 1F2DA 4V0SA 4RKEA 3M33A 3E53A 4FLMA 4JD5A 5KYYA 2UUBB 2V45A 3KBBA 1P61B 2BWJA 2VRNA 3A3KA 3WDLA 2A0UA 1T9AA 2IPLA 1AGRA 3IP3A 5EIXA 2BSQA 3HB7A 1PN3A 1X2BA 2X76A 3CJQA 4ATNA 4DCJA 4DAEA 2XQIA 4CIBA 2Q0QA 1U1EA 1AQ6A 2AHRA 1RHJA 2AKYA 2XUIA 3DOUA 4S1OA 5K1ZA 1FQJA 3HCFA 3E2MA 1DEKA 3IAFA 1GZ6A 4NYJQ 3RBAA 3VZPA 2XQFA 3KUXA 2K6GA 2O5CA 4MPDA 2KMLA 2V7XA 1RACA 3LL7A 2G5PA 3QHQA 3RK0A 1QJCA 3DHNA 5GM2A 5KWEA 1YZKA 1EK2A 1YQTA 1N9GB 5M3BA 2FN7A 1U2PA 1ZOOA 3D4BA 4G5OA 4A9AA 2IZ1A 2W2LD 5K45A 4RZQA 1MJGM 3TN7A 5M5BA 2YOGA 4OXYA 4HPWA 1BC5A 2R25B 4CCWA 4W99A 4EWLA 4WVLA 4YEDA 1ZWKA 2G8NA 1BNCA 1K7CA 2VNHA 2ZJBA 3KQOA 1G21A 3PGLA 1EFDN 1SWWA 4I9UA 3KG2A 4II3A 4POOA 4AZ3B 1GGVA 2XUDA 4ZOBA 3SE7A 3WWDA 4R01A 2D7JA 4L76A 1D2MA 1UOQA 3D0KA 4FGSA 4TV9B 5HPYB 1C9YA 3AJEA 4A92A 1QIMA 1XVVA 1C0IA 1ZQ9A 4IHJA 2BGUA 2EG5A 2NU6B 3CF4A 4BYGA 1FVOA 3B1FA 1A97A 2F1HA 2ZYUX 4NQZA 2F8SA 3U3MA 5L3ZA 5BQFA 2PCLA 2OMEA 4X54A 2AF3C 1ESCA 2JGNA 2PHZA 3BFKA 1JG3A 3CBGA 3F6YA 3PB3A 5EESA 4ABYA 4IVQA 1U8EA 1BRTA 1JECA 3ZTWA 3HVIA 3K9QO 3JAKB 3AMVA 2XYVA 5FPTA 1Z2NX 2H7XA 1U1CA 4Y2RA 3H5WA 1WUHS 5HKLA 4WLFA 5IPFA 3EZ2A 3KQVA 1M34B 1ADCA 3AR7A 3NB0A 4FE4A 2VWQA 5JNUA 1G16A 2BH9A 2YL2A 3I2GA 3JR7A 4CL3A 5KCMA 3PVZA 4GKAA 4OD0A 5JT1A 2B2XA 1RU3A 1RYBA 1YMQA 4J49A 2QKYA 5K9ZA 2V1XA 4YJ2A 4UMVA 4ZVTA 1X6VA 5EXXA 3GLGA 2X0NA 1JTFA 4BO2A 3RWBA 3DEYX 3RARA 2Q1YA 2HFJA 1PEYA 3IOBA 2JI7A 5D85A 5HOQA 3PUZA 3U5ZB 1MGPA 4AZ0A 3KEMA 2YQ5A 3DMFA 3G49A 4HDKB 3SZLA 2HBRA 3W9UA 3REQB 1FTWA 2NO6A 4MUAA 2V7EA 1I30A 2AFIE 3QE3A 5ETJA 3SKVA 4X97A 2QX4A 4MYDA 2YFKA 3OCXA 3A7DA 2GCOB 5AVJA 2QJOA 1NTOA 1EDOA 3QYJA 3E1GA 1KWGA 2X3YA 1RM4A 1WHSB 3HZOA 3KP1A 4IDBA 1N8NA 3W04A 4ER0A 5IAOA 1W93A 4BKOA 1GTSA 3L41A 4MI1A 4MQLA 2EEZA 4MYRA 4E3ZA 3GD5A 1BMFA 2OXEA 2W0SA 3E81A 3JAWA 3UAGA 3WYCA 5JXJA 1ST2A 1FXWA 2BI8A 2B4TO 5DN6A 1DEHA 4G41A 1FMCA 4Y7DA 4B7UA 2G7ZA 3WGZA 2P65A 1LF5A 2H7VA 4R4JA 1C0KA 1S7GA 2OGUA 2I3GA 2VJBA 2ZTVA 4ISBA 4RLFA 2FZLA 4B35A 4BYMA 2NU7B 1PBTA 2GJAA 3H17A 2DLCX 5FYQA 1NLUA 2J6IA 4YN3A 1C7ZA 2AN5A 2UKDA 3BMOB 3PTLA 4WESA 4QICA 3OQMA 2C7OA 3AYZB 3R7BA 2I7CA 5J2TA 5EKUA 1QHNA 4PW0A 3PUYA 4OFXA 4Q9LA 1YA6A 3QBTA 1X9GA 2Q1UA 2IYRA 3DV2A 2JFPA 3QKSA 4IKEA 1KMQA 2YINC 2QUBA 2WOOA 1X7DA 2ZKIA 4R51A 4E70A 2AFRA 3LSYA 2ODNA 2YZNA 5SZHB 4S3MA 5TC4A 4MPTA 5I48A 1W5AA 2DP4E 3CX7A 3EVZA 2E4VA 4ZVQA 3A70A 1Q7GA 4NYMR 1CJVC 3SIXA 3HZHA 2B2CA 3KR0A 4CM7A 2OK8A 3GVXA 3D5TA 1BFUA 1EVQA 1VSTA 2XSZA 3WGVA 1XHFA 2XA1A 4JBGA 3NC4A 2B0CA 1XD2A 4BNYA 4DB2A 1PZGA 4FKMA 1KEKA 3AKCA 1RC0A 1CNEA 2V7QD 1CUSA 4CKEA 3WLHA 1H2YA 2IOFK 2JDIA 4UDXX 5IC5A 5BW5A 3LY7A 2FSVC 5DI9A 5JNRA 3R7LA 2ZB7A 3MJEA 4BO8A 5IXYA 5IZ4A 4CG2A 3ETEA 1E3IA 1LCIA 4WUVA 4C78A 2ATXA 1ZA2A 4KX3A 1K6XA 2G88A 5TMPA 1ICIA 2IPNA 3GJYA 1NU8A 3DWFA 3EGWA 3JATB 3NALA 2QRGA 1E3QA 3BVPA 2C00A 1RCFA 3F7NA 4FCTA 5D3ZA 1QP8A 5JSKA 4ALJA 2PMCA 3SR0A 4BFYA 1RWWA 5J4KA 4O4LF 3QW2A 1TKAA 2GKGA 3EH1A 1EB8A 4EQZA 3D2AA 1K5HA 1RAEA 5CLGA 4UTVA 1I7PA 1EE2A 1XZNA 1XLUA 3CZQA 4G67A 2WUFA 2CXUA 2P2ZA 4KRXA 1B6GA 4YBZA 2RGAA 2A1UA 3P94A 1YC5A 4LE1A 2Y3IA 2W6PA 2IKQA 2OPBA 1GT6A 1O4VA 2CUTA 1WXEA 2AI3A 2OO5A 1R16A 3PDIA 1JFLA 4DLZA 5E1DA 2BAGA 3MAGA 5JJCA 3TSAA 4K0KB 4JN6B 1QIGA 4L4SA 4L9AA 3SXUA 1ONOA 1BE8A 3U80A 4UW9A 5E9WA 1EGMB 5JBIA 3D3NA 1JSRA 4MMXB 3R9IA 2UUPA 1R0YA 4AY5A 2BMJA 4ARZA 1H2EA 2IXTA 4NCKA 5C8YB 4V2UA 3CISA 4QEZA 3RO7A 1C9MA 3O1JC 4QYTA 5CIQA 1FLVA 2Q3BA 4DBLE 4IY1A 4F3CA 3KVYA 4UTPA 5ESXA 4GAEA 1UKCA 4D4HA 1AGNA 1T26A 3BAFA 3HVKA 4CDMA 1MZPA 1X1AA 2RGDA 1QB8A 1JYSA 3ZWOA 1NW3A 2GZAA 3STHA 3T4PA 1GADO 4CG0A 3UMMA 1TMOA 3WMGA 5CEFA 4L8VA 3TO5A 2Y99A 1Y5LA 1BO6A 1EX6A 2CDBA 3H42B 1X1SA 2Z1NA 3KJIA 1G7SA 4LK2A 3VVMA 5ARCA 1KPGA 3EHDA 4EHDA 3D6AA 2VP3A 1CY0A 1NGSA 3X1YA 1JEYA 1TQ2A 1G9SA 4BO1A 1VFNA 3KL4A 3T99A 4CV0A 5JD6A 4NIMA 3LP6A 3RC2A 5K20A 2BFCB 2O05A 2ZLBA 2XB9A 4NYIQ 5HJEA 3KQTA 4MUMA 4IR7A 3TS1A 1I0IA 1P7YA 4PX9A 4F86A 3JQAD 4R1MA 5SZIA 4AD8A 3FGPA 2G9QA 3SMVA 2XMPA 4G89A 2HZ7A 2WA2A 3PYLA 4OOEA 1Y4UA 4XDYA 1JLSA 2O6HA 1TYEB 2P8SA 3PG5A 2NVUB 1WXFA 4KDFA 4B8ZA 2M6SA 4YAFA 3RKSA 2JBHA 3PDCA 2XOXA 4HB2A 1O96A 1Q1BA 4GNRA 3M8KA 4C2BA 1OJLA 2C0QA 3BWCA 5LJLA 3DOHA 1E66A 4GGPA 2QAGA 1XRJA 4LMRA 1YR6A 4QJ5A 1GQOA 1E2KA 1Z22A 1KRHA 1V16A 2CFOA 2ZM5A 1I8TA 3QPUA 2EJTA 1ZK4A 1YDFA 3UMRA 1QDEA 3SQNA 3J7AC 3WYGA 1JPUA 1P17A 1IOWA 2AG5A 2Q0HA 1YU6A 3M7IA 3TIFA 2ZJ7A 5IWCA 4W5OA 3T3OA 3ORSA 2QD3A 4E46A 4EG1A 4CPDA 4O33A 5E8RA 3RFUA 5L51A 4K9SA 4CDNA 2G1JA 1F12A 4L7QA 3Q7IA 1WUTA 2M6RA 1KEEB 4MCAA 3M9WA 1NUHA 1DC4A 3TNFA 2JLBA 3HSKA 5HJ5A 1CLUA 1E61A 3IMCA 5U1PA 4L5JA 4JQZA 3TFQA 4HB0A 4CKZA 2HQ1A 2B1JA 1O94C 2ZAIA 1A82A 1YCDA 3BCHA 4U2GA 1FNSA 2GD0A 4O1HA 5LBIA 3ROZA 2R1VB 4EI9A 2P75A 3U6BA 2A67A 1W4BA 4C04A 3Q3JB 1FU8A 4YGXB 2BGTA 4B4WA 5EJ4A 5TJHA 2XZTA 4FCCA 2VJYA 2VTBB 1EVJA 4F2HA 3HK2A 3I5AA 2DZDA 4DLTA 2ZBUA 4AMZA 3LP8A 3G7NA 3K4QA 1WZIA 1O0BA 2FI1A 2GYWA 2HZBA 4RFVA 2HSZA 3P97A 4B3GA 2IXEA 1ZN2A 2WSSA 4MYHA 3FHTA 2QRKA 5KYUA 1HNNA 3P9RA 1A7UA 4GZ6A 3ZHZA 3AFHA 2ARKA 3I0ZA 4KK4A 1AC5A 3PK0A 5FA5A 5I9MA 3ZDYB 1EHIA 3M6FA 2Z43A 5ENVA 2HJGA 2E4XA 2NT4A 3EDRA 3B2QA 2A4MA 3GRAA 3ORYA 4L07A 2R86A 2HRZA 3EF3A 3L5OA 3UK7A 1E96A 4A2WA 3GRUA 5CP8A 4B8WA 2PANA 4QLBA 2HYIC 3WJAA 3KB1A 3N0WA 1NPDA 4DLUA 1G3RA 2BZ1A 1SRQA 4QGAA 1B2LA 4B32A 2FEWB 2ZI6A 1XVIA 3DDUA 3OJ0A 3ROPA 1SKYB 5HCIA 3CPJB 3WB0A 3M9LA 3VC3A 2W6OA 1EFLA 1YC2A 3OD1A 4GOKA 1O57A 4HAZA 5BT9A 2HA5A 3KFLA 5KOJA 3ZH9B 1QAMA 5HQJA 4B5KA 2LKCA 2LCQA 1SHLA 2Z4TA 3GPDG 3WNQA 2VNIA 3FM9A 2BFBB 3H6KA 3FWPA 4JX8A 4NULA 1ZYUA 4EPYA 621PA 1I3MA 1LKZA 1V9LA 4FR5A 4OJKA 4D4MA 2YC2C 5B53A 4HTAA 2QLLA 3VBEA 1RZRA 1J2EA 2W5UA 3DMTC 3DW3X 1EVYA 3RT9A 3IUMA 4U2CA 2E4WA 3AF0A 3EDMA 2WPDD 4PTLA 4V39A 1KJYA 3I4CA 2W2NA 5E4TA 4D79A 2DFVA 2BF7A 2GF2A 4GXQA 4YI5A 5BVGA 4X0EA 3WV4A 3C5WP 2RHTA 4FQ8A 4DLBA 4MQ4A 3L0OA 4LZLA 1UBSB 3A4TA 3I04M 4TRJA 2DY0A 4BNHA 4EX7A 1SD1A 2IYSA 2X0KA 2JGEA 4C87A 4NE2A 2CNDA 4KI7A 5JAZA 2CLIB 1RWOA 4YMVA 4KXMA 3UF0A 3ZWDA 2R4TA 1E9CA 2HJ9A 4UU0A 3H05A 4B84A 1WABA 4WZ6A 1MO2A 1T9GR 2RGUA 4D0SA 3FFTA 1N57A 4NAUA 1S01A 2QUKA 2VF5X 4BMZA 5FX2A 4GZ5A 3M4ZA 4UEOA 1KS9A 1NG9A 4S05A 2GDZA 5C53B 1T24A 5T8KC 2BM1A 1E5LA 3H2YA 4RY2A 1QIIA 4I36A 1XF1A 4YTEA 1R18A 5ALMA 2FPWA 1L4EA 4CFYA 3G8YA 3HXQA 1DXYA