5GGYA

X-ray crystal structure of periplasmic desferal binding protein fhud from vibrio cholerae
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
267
Chain Sequence
HMRVVVLNWDLLEQVLELGIQPVGAPELSSYVQWVVQPEVPSSVQDIGTRTEPNLEKIAALKPDVILAAGPQQDLLATLGRIAPVVYLPNFSEQDNAAQVAISHFKTLATLFGKEAVAQQKLEAMYARFSELKASLQHAFGDTLPAVVTLRFANPTSVFLYTENSTPQYVLEQLGLSSALPQPPKEWGIVQKRLSELQHVEQGYVLYFLPFAEEKKVQKSVLWRAMPFVQAGRVNSVRPVWSYGGAMSLRYSAEAITESLLAVAPQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Iron(III) ABC transporter, periplasmic iron-compound-binding
publication title X-ray crystal structure of Periplasmic Desferal binding protein FhuD from Vibrio cholerae
rcsb
source organism Vibrio cholerae
total genus 88
structure length 267
sequence length 267
chains with identical sequence N
ec nomenclature
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5ggyA01
2WI8A 5GGYA 3EIXA 4B8YA 3R5SA 5FLYA 5CX1A 1N2CA 4DBLE 4INPA 2YNMC 5M3BA 2XY4A 2OGWA 3U7QA 5BVHA 5JPDA 1MIOB 4WESB 5BVGB 2ETVA 4OXRA 4UDOA 1ESZA 4WZAA 4WNAB 2RG7A 4HMQA 5HX7A 4PM4A 4TKUA 1M34A 5KOJA 4WN9B 2PRSA 1QH1B 3PSAA 2XQVA 4INOA 3GI1A 3PDIA 1QGUA 4M7OA 1H1LA 4CL2A 2PS0A 3TLKA 1K7SN 4FNAA 4NNOA 2AFIB 4OVKA 3AEKB 4K3VA 3AERB 4G09A 4LS3A 4XPIB 1G20A 3TNYA 3LHSA 3AESA 2Q8QA 2QI9F 1TOAA 4G07A 5JJ5A 2M6LA 2XDQB 3TEFA 1N4DA 2PS9A 3ZK8A 2AFHB 4NNPA 5BVGA 2XH8A 4FKMA 3UJPA 1G21A 4WNAA 3ZK9A 3NU1A 4HN9A 4HMPA 1K2VN 4WN9A 3HH8A 1K0FA 1QH1A 5M29A 3ZK7A 1XVLA 3BE5A 4FILA 4UTPA 4MX8A 3ZKAA 3K1AB 1N2ZA 3AERA 4FI3F 3HJTA 4XPIA 3HXPA 4TKVB 2Q8PA 2XV1A 5CR9A 5GGXA 2XDQA 3EIWA 3U7QB 1MIOA 2AFHA 4WESA 3MD9A 3MWGA 4GICA 4MDYA 1EFDN 1PQ4A 1N4AA 2OV1A 4IRMA 5B58T 5KOHB 2MINB 4H59A 3MINB 5KHLB 1M1YB 2XUZA 1FP4B 1QH8B 4WZBB 4UDNA 4BBPA 3LI2A 2R7AA 3AETB 2M6KA 3ZTTA 2PHZA 3AEUB 3AEQB 3PSHA 4MLZA 4ND8B 5AFSA 1QGUB 3K1AA 1L5HB 3BE6A 3G9QA 5JOQA 1KARA 5I4KA 2O1EA 5M2QA 1M1NB 5M34A 2OSVA 4OXQA 2AFIA 4TKVA 1K75A 3AEKA 2OV3A 5HDQA 1G20B 4N01A 3AESB 5CX1B 1N2CB 4PAGA 3MFQA 5BVHB 5KOHA 3R5TA 2WHYA 2MINA 3MINA 1G21B 1M1YA 3MWFA 1FP4A 1QH8A 4HMOA 4WZBA 3CX3A 5JG7A 4H0FA 4WZAB 3AETA 1KAHA 3AEUA 4LJSA 2PS3A 1M34B 3AEQA 4TKUB 5KOJB 4ND8A 2YNMD 2X4LA 1KAEA 3PDIB 4MO9A 1L5HA 1PSZA 4UTOA 1H1LB 1M1NA 2R79A
chains in the Genus database with same CATH superfamily
2NZJA 2L19A 2MJLA 1KMHB 3L8GA 4WRRA 3U44A 1V25A 4RX1A 5IZCA 4EG5A 5A6VA 4DNXA 1JFSA 5IC6A 3FBGA 1YACA 3OZCA 1ZHOA 4BVHA 1FU7A 3ED5A 4E1AA 1EKXA 1BS1A 3B53X 3LTNC 2I6TA 3FYUC 3IAAA 1VBFA 4LYAA 3ROFA 5B7GA 3WDSA 1UFQA 3IUEA 2IXFA 4LVOA 4RMJA 3NH6A 2PMEA 2BP7B 2VDJA 2ZIZA 3BRCA 1G6HA 3PGXA 2WICA 2JI6A 3CU5A 4TUYB 1Y8ZA 4EUNA 3CGWA 3Q9UA 1P9LA 1QHGA 2QVBA 1XU7A 2AK2A 5EMNA 1MABA 3R5KA 3TFOA 2JGMA 2RH9B 1SELA 4M9ZA 4PS0A 1I4WA 4KR9A 4FVTA 3IEMA 3BXGA 3WNDA 4DJJA 3HRIA 2LV8A 1VJDA 1VYVA 2DQZA 2WRZA 2QVLA 2FYTA 3O94A 4GZLA 4DCMA 1XMQB 3EPJA 1WXWA 2O48X 2PKCA 4L02A 2IXEA 5JS1A 1KOJA 2CNOA 2WD8A 1Q17A 4ETMA 5K20A 2BM9A 3H6GA 4MPRA 4LTNA 3ORFA 2AFHB 1DV2A 1T4BA 2IDKA 2AE2A 1U1DA 1P6XA 3EN0A 4UMVA 4DCUA 4HN9A 1NW6A 3Q87B 3AJ8A 1ESNA 3ZLTA 1T0BA 3A1EA 1E0SA 2Q5QA 5C4MA 1T6XA 2CMFA 2W42A 4ZHQA 5LP6B 1CRZA 3EOAI 1ZMXA 3N05A 4R41A 1KZ7B 5BN5B 5IZCC 1IVNA 5CBPA 1XTZA 4HB3A 3A58B 4TTQA 2QE7A 1GA4A 1FK8A 3QF4B 5KDOA 3MK31 1I30A 3I76A 2WJGA 3O74A 3BGVA 4EA9A 3WB9A 1H2HA 1MRSA 1E2DA 4RVCA 4OJYA 2O5CA 3H4VA 4YJKA 1XRLA 1SXHA 4YLYA 4GXRA 1C29B 5FBZA 5K8IA 1WQ1R 4BPRA 1JSXA 1NOKA 2AXNA 2I1WA 2ZJFA 4ZJYA 1LSSA 4MV1A 4C2TA 3M49A 1P80A 3OHMA 4N54A 1E0JA 4RTKA 1L4YA 3U4HA 1OI3A 1UP6A 3KC2A 1YI0A 2HTEA 3LVFO 1BW9A 4FQ7A 1YR6A 2QGNA 4IIVA 4BGVA 4YT8A 1N78A 1H2AS 3RFUA 4KEAA 3V7UA 3EQ9A 3KUUA 3ZZNA 1L5VA 1VGRA 1I9GA 3GB9A 3AEXA 2OQVA 3R74A 3QV1A 2X1VA 2QMYA 3KR0A 1U8AA 3NKLA 5EP1A 4DDWA 1QCCA 3HDTA 1GAEO 3D7MA 4M1ZA 2VRBA 2WWYA 2VSQA 3JXEA 3AFHA 4ZO9A 4BQRA 3KHTA 5KHAA 2GETA 2WLTA 4CR8A 4EFKA 1RVV1 4AG5A 3ESAA 4PLVA 1KI1A 4C0HA 1X1SA 3EIOA 5IDWA 1L5OA 1NV9A 3ABZA 2KS6A 3VA7A 4OFBA 2BTOA 5HBGA 2XT6A 3VR0A 4RELA 1AXEA 2A5GA 4F4IA 1M0TA 4PXAA 3ENZA 3LFHA 5L53A 3PFNA 2WLSA 4GX5A 2CLMB 1N2HA 3N2KB 2AEEA 3SOZA 2PKEA 3KDPA 2RMKA 3REQA 1LX6A 4M60A 3AHJA 3CLKA 3PDCA 3DVRX 3E82A 1M3SA 2YCBA 4U9IS 2C07A 3ZXYA 3D5EA 1A4UA 1HT0A 3GFRA 1AHHA 5I7SA 1IZZA 4TQGA 3K1YA 2FEKA 5TSDA 2I78A 4AD8A 2FG7C 3ANNA 3K0FB 4IOMA 5DNAA 5IJZA 2WIKA 5AHWA 3O8DA 5BSMA 1PDWA 3DO6A 3OCYA 4B3SB 1E6MA 1H5UA 3AP3A 1Q0RA 1G291 4NAUA 3VPBA 4UBLA 4DIBA 1NQXA 1QIHA 1QE5A 2Y1WA 3DC2A 5KC9A 4ZIRA 4HF7A 3SFTA 3L1VA 5HZKA 4CN9A 4ZEOA 3KL4A 2Y0PA 1XMXA 4C3VA 4LRUA 2PWZA 2C9MA 4GP9A 4DLWA 1SBNE 2RGEA 5FO1A 1MN6A 4DXHA 1H9CA 3EY9A 2ZYHA 1NOJA 5DRYA 3NBZC 4UCFA 6AT1A 1OILA 1Z7BA 2ISQA 2WF5A 3IMGA 3ZCSA 3GELA 1ST2A 5LMZA 1B0PA 1EVKA 1MC4A 4J0KA 3ZHRA 4JLNA 1MQSA 2FEOA 3IV7A 2GS9A 1JU3A 2D0IA 2QE6A 1K7CA 5JD3A 4B3DA 1A8QA 1PKXA 3H5OA 2X6RA 3K31A 3SZRA 4BLOA 1SKMA 1MGOA 2PQMA 4MVJE 1VSVA 5HIJA 5BT8A 1DC5A 1X87A 3HJAA 3T3IA 4PC7A 3HV2A 3WRVA 1CHNA 1V5IA 2W6JD 1W75A 3DDZX 2VOJA 1NHWA 4UD2A 3PWKA 2QTTA 4LWPA 4OOEA 3NM4A 4FFWA 4HDKB 4IDPA 2AOUB 4NZYA 4PG8A 1F2VA 4LZLA 4NESA 3EXG2 2XDAA 4E6PA 1C1XB 1R9NA 3EA4A 1UP7A 3U39A 4YYEA 3CE6A 2Y1GA 3LHFA 5TJ9A 1T0IA 1CR4A 1SQ5A 1RXYA 4CEJA 1QV7A 2HBZA 3PNVA 2JCXA 3VTFA 1EINA 3Q41A 1LPSA 1T3TA 5EWJB 1WKCA 3M4YA 4M7PA 3U0BA 5AXDA 3S2IA 5A4FS 1DDGA 3M5WA 4US2R 1PQ4A 2KE5A 2Y4OA 3G59A 4PXSA 3WKBA 1K66A 1H1DA 2X9NA 4X3CA 1J39A 3GXOA 3RAGA 2OE2A 3T5MA 4P4SB 3U56A 3SSAA 1QP0A 1XROA 2JJQA 4DCSA 2Q1UA 1QGAA 2WILA 4PWZA 4OI0A 1SUAA 1YZKA 3JD2A 4WX2B 4B7XA 1U8UA 3C0KA 1THMA 4DCNA 3ESYA 3T9EA 4KR3A 4KQCA 3N2GB 4HDAA 1LBSA 4PG6A 4QARA 5TEVA 3WNQA 4MVJP 2A2ZA 1J33A 1CQZA 4WBSA 3VPFA 3HCOA 3TQHA 2ZRJA 4KTVE 1HRDA 4ZCIA 3CUVA 2PKXA 5KYYB 5JARA 5IDQA 3OZXA 3U3MA 2XQJA 3Q5DA 4I9GA 1W36C 4MQMA 1B26A 1QZTA 2BFCA 3LO8A 3F1KA 2ALJA 3L3BA 4M1QA 4P3YA 1TT5B 1ITZA 2WWIA 4N6OA 5B4UA 5FUQA 4F60A 1ZESA 3BA1A 2O8EB 1G19A 1P74A 4ZICA 2HWUA 4UJ3A 2ZFUA 3U4DA 3H2KA 5DTIA 1LDNA 1EFHA 4JOQA 1DC4A 3TRJA 4ZVLA 4DSTA 5DLDA 1Q0SA 5CH8A 4D3FA 2JLXA 4Z8YA 3BE4A 3IUJA 4NBNA 1J0EA 4F5YA 4LEIA 3ZLUA 1YFJA 1VXOA 3ZVNA 1A9RA 1K0UA 1ZONA 2BM8A 3IBSA 3F8WA 2H08A 1EFKA 3OOSA 4BTVA 3OJOA 3RHSA 4M8LA 3WSVA 3VC7A 3WA7A 3UMYA 5F5XA 3DLHA 2RONA 2C20A 1G38A 2V7PA 4UBMA 4KFRA 3P4UA 5C8YF 3EJ6A 4PICA 4LPSA 3TIIA 3W8DA 1KORA 1CQIB 3KP1A 3Q3CA 2VHTA 4HX2A 2B4QA 4LISA 1H2ZA 4MV7A 4PU0A 1N2JA 2B21A 1H3FA 1Q19A 2NYUA 4U6SA 3NXKA 5KDDA 3CO0S 2D0DA 1DQYA 3UQZA 3N76A 2V0GA 4R1MA 2D00A 1P1KA 1PUIA 4G5XA 3G68A 3TAXA 2AG0A 1YK0A 2FSPA 2WD7A 1QGDA 2GXQA 2PT7A 3DOEA 1HSZA 1OHHA 5EERA 4K9KA 4NNOA 4ARSA 1HZZA 2PGAA 3OCCA 3P52A 3TTXA 4ZI7A 2Q3JA 3E8SA 4LECA 3ZDAA 2R3SA 3FZYA 1JDZA 4I5EA 4ND1A 2ONYA 2WA2A 4BLTA 4OHRA 4I1PA 1DVRA 4FM9A 2C2YA 2OHVA 4ZVKA 5K2MA 3F6PA 2BGMA 3PEUA 4R0MA 2G9ZA 5DW3A 5A4DA 3ZD6A 3K6JA 4N4AA 4ZXFA 1OD6A 4I4IA 5AXCA 3ZU5A 4D02A 3P8ZA 4GE3A 1QH1A 5IT4A 1CHDA 2DQKA 4X7BA 5K99A 4YH1A 2YOGA 4PS1A 3BG5A 4F38A 3RBZA 2R6CA 2L17A 5AP9A 1DRJA 1R8JA 4EWLA 4MA5A 1G5RA 2Y1FA 3N2NA 2GNPA 3HUDA 1PF7E 1FP6A 1QHSA 4UVHA 2DFVA 2D13A 2HT6A 2ROQA 4XPIA 2JBHA 3FRJA 4F6CA 2Z2YA 4U9HS 3PQ5A 1JP7A 3KEOA 4MI6A 3WGGA 4Z1MD 2WUFA 1Z5ZA 2O52A 1XIVA 4Y2VA 4UUBA 4UM5A 1QRUA 3OFKA 4WHMA 1DZIA 4FTWA 3V00A 3OLCX 2O57A 1IUPA 1BFUA 2NTYC 1A96A 2C61A 3EC2A 5FFNA 3GLHE 1QLJA 2WY2D 3M0EA 1T8PA 4FN4A 4PYNA 1SAYA 1CY8A 3OE4A 1FNMA 1ZOOA 2QR3A 3NIDB 3ZDRA 1QH8B 3FVTA 2P9TA 3GFOA 4BBPA 3VQTA 1JFRA 2G80A 3CG0A 4B83A 2O0KA 3SMQA 4S1OA 2BF4A 4M88A 3U5ZB 1G21E 3DBHA 1OBFO 2K2WA 3HM2A 3GAAA 2ZS9A 2QP4A 4XGNA 4RIIA 4MS4B 1D7OA 3TB6A 2DC1A 2IBTA 2IQIA 2P2ZA 2WYVA 2ZDHA 1FQWA 5K3BA 3U7JA 1OA0A 1XVIA 3BJEA 2EKLA 4WCVA 3L6OO 5DHTA 4DANA 2R1ZA 3T54A 2VLBA 1VRWA 3RIHA 3STVA 2XNSA 3T5TA 2IS6A 3C5EA 2QD5A 1DKRA 1R4MB 2JGKA 3ECSA 4O2AA 2LWIA 3PX2A 5CURA 5KJCA 1MVNA 3VPSA 1SK8A 4U2FA 4E21A 3AL2A 1B0AA 3GX1A 3ME5A 5A3QA 2HU8A 4LJSA 1ZFNA 1OAKA 5KYGA 2I7CA 2PKQP 4O4HB 4RPKA 4WOKA 5C8DA 2XBMA 1DBPA 3F6YA 1ZH6A 3ELWA 3NT5A 5K0SA 5CA0A 1G5TA 2A3RA 4N0MA 1S9DA 1V5WA 3OQVA 4ENRA 4NJMA 3DZHA 5CVEA 4RACA 1CJCA 4MHTA 4OYHA 1ZJ6A 3UMRA 1ESCA 1WCWA 3A05A 2I5PO 5BOSB 1RAEA 1Z13A 4IS2A 1IY0A 1K7FB 2M6RA 2XUHA 3PT5A 1R74A 4DA7A 3I37X 1K5GA 3AP2A 3RGWS 4YBRA 1RQXA 2IHYA 4GSKA 3UJ6A 2HHLA 4OXRA 5AVRA 4Z3OA 3ZHZA 2AEFA 4YT2A 3IUPA 3SHOA 3A4LA 1L5GB 3KB1A 2VAPA 2FWBA 5KOJA 1PVOA 1J4AA 4Y2PA 3AQ4A 5EOVA 4CKBB 5GIPE 1MDFA 2P6OA 2R5NA 1TPZA 1ZIXA 1Y9JA 1MLDA 3KQYA 1ISHA 5FWNA 1U99A 1QQ5A 4WIAA 3EVNA 4BVLA 2OPBA 4F2DA 5LBTA 3SF8B 3NASA 3UENA 4UTVA 3OUZA 4Q9IA 4UCWA 3P9KA 4YCJA 1WMAA 5HEKA 3VR2D 3ND8A 2FP4B 3K5PA 3UH0A 1Q15A 1RWXA 3I9JA 2J3MA 4U7PB 2XZPA 4I55F 5LQSA 2PTHA 2XE4A 3AG6A 3EBLA 2RKOA 3ETLA 4L6AA 4CMGA 3W9YA 4J9UE 4NMHA 1YTLA 1HEIA 3L7NA 3FHLA 4MQFB 3DD1A 4WNIA 3GIDA 1DIAA 4IKEA 4KE9A 4FI3C 1BXZA 1Q2UA 4BQEA 3T9FA 2J9FB 1MJGA 4XX0A 3R7DA 1E3JA 1TI7A 4EB3A 1KEWA 1R27A 4LZWA 3R7NA 4D9JA 1QWOA 1H2WA 4AM8A 4R1PA 4C30A 1N3YA 1VHTA 4B4DA 5J2TA 1I2ZA 1U2ZA 4NOMA 2NUTA 1TYZA 1W8IA 1LLQA 1SBHA 3GFPA 4L15A 3DDHA 5LQAA 2INGX 2O8BB 1NL3A 1AQLA 2JIQA 1WB5A 1RACA 3FJ1A 2CYCA 1QZUA 2XIQA 3V2IA 3ZGOA 3NBFA 2XDQA 2WMOB 2XQKA 2YXBA 1VDMA 1IG0A 1KI3A 4GZMA 4HCJA 2EDAA 2ZRGA 1T2FA 4CG1A 1WSWA 1UAAA 4LDZA 5KNBH 5A4KA 2VEOA 2L0XA 4RD2A 1GXSA 1JWLA 1NF2A 1HMYA 2NO4A 3QE3A 4HWOA 4U2DA 4ZEMA 4I50B 1M1YB 4Q1AA 1FLNA 3TXAA 4W82A 1CYEA 1P1IA 1QONA 3F5FA 5EIBD 2GN0A 1BD4A 1RI2A 4NS1A 5GWXA 1XV5A 2BVNA 4EJSB 1HRKA 1GZDA 1M2NA 2VDWB 4TXHA 1Z5UA 1QGUB 3IE0A 4TLEA 2J0UA 2WHPB 3RS7A 4PZYA 4DDHA 4ARUA 4DR4B 1KKUA 4W1RA 3KWJA 1OUMA 1EFPA 2OOSA 5GONF 2VT2A 4IO1A 1W0KA 5B7QA 2NT4A 1J9EA 1Z8DA 3D4NA 3H42B 2CSUA 2XZTA 3QWFA 4FJ0A 2C8KA 4KAAA 3SM9A 5L3SA 3S81A 1T1JA 1NIJA 2ZRAA 4U6NA 1OZAA 1QO9A 4XQCA 4QHYA 4CWAA 2XMSA 4MS3A 2BKVA 4IQFA 4QQFA 4XJSA 4GUDA 5I7VA 5B57C 3WIUA 4NPHA 2HMUA 1RBZA 4UEKA 1H2FA 2CVZA 2HPZA 1Z22A 2MINA 3COZA 4TRMA 2HLDA 4A10A 4NZPA 5JBQA 1SEPA 1YCGA 4M99A 1BEEA 4ZT4A 2EYUA 2JJYA 4RUKA 3DOFA 3V4LA 1E77A 3E15A 3UGQA 4WLFA 4C7OB 4MW9A 1GL7A 3E27A 3WOHA 3ZOZA 2YNMD 1XJ0A 1V1JA 1XRRA 1KAEA 2ET6A 2VPYA 1GSHA 3HBMA 4I5DA 1UAGA 3FGPA 2XUIA 4LBVA 4J1QA 3BCUA 4PONA 3W79A 1DI0A 1EI9A 4HGZA 1P5JA 5JNWA 1OX4A 3HKCA 1R6TA 2OMEA 5HCIA 2IHTA 3L6DA 2BUAA 1GTJ1 2OG1A 2P4UA 2PMCA 3G9XA 3L1JA 4X3OA 3KVVA 4HH4A 5DBEX 4BB6A 4CKCA 4DIUA 1HNWB 1TL7C 1J23A 2FR8A 3U7QA 5C1DA 1XI2A 3FSRA 1T9AA 1Q1GA 1X1AA 4IDEA 4PRZA 3WS7A 5AHXA 2WKQA 5JWOA 3R3WA 1P2DA 2QRQA 1U0FA 3L40A 2QZPA 1IQUA 5FUVA 1I32A 2G7ZA 2WB2A 3MJHA 4W63A 2FXIA 4OGFA 2FV8A 3G9TA 5AUPB 1BDBA 1ONOA 1EFRD 2AF3C 1NN5A 3E35A 4OXYA 3NHBA 2A59A 5LFAA 3FSEA 3GZNB 5E6RB 1KMIY 2V5VA 2ECOA 3FYCA 3BPSA 1MHTA 1SVUA 1LSOA 1M0SA 2HPVA 3DE4X 5EIOA 3UWOA 1Y80A 2J9RA 4QUDA 4JUAA 2XAUA 1NRWA 1AM4D 2D2FA 2F9LA 5TRTA 1W1IA 2G0TA 4S0ZA 4UKDA 1GL3A 3V46A 5BVGA 5DK4A 1V8OA 1XXLA 1E3WA 4HS9A 4XXHA 4DPLA 3TNFA 1AMNA 2V97A 1N3IA 2ZTUA 2JFXA 1Y7HA 4B3JA 3NWJA 3V5NA 2C2MA 4DLUA 5ICMA 2G4LA 4BYMA 3D9QX 4KPUB 5FFMA 1COWA 5CA1B 1EUYA 2AC2A 1JLSA 4G26A 2IEAA 1UOOA 4WECA 5DASA 3PXGA 3UWPA 3WSTA 4BLWA 3MTDA 2R5WA 2BKXA 3CLUD 4RYLA 5F3RA 1X38A 1TVEA 4QOIA 4A8JA 4K9MA 3DLCA 2G09A 4B46A 4YRGA 3PF9A 1VPDA 1W1UA 4M3NA 4X8OA 3I61A 1KZ9A 4KG7A 4LBZA 3PUZA 3Q3HA 2ZATA 2RSLA 2E21A 2Q5LA 3Q0EA 4X3PA 2Q7OE 1YJAA 4LHWA 1C3OA 4DADA 2MTBA 2W5UA 3DDNA 3E7XA 1SIWA 5BMVB 4UEOA 3UG7A 3Q4GA 1NVXQ 3C3BA 3L77A 3UQYS 3Q2IA 2EBHX 3IERA 1M6NA 1Y3FE 3DV0A 5HGXA 2JKVA 1H8HA 4G0ZA 4YJGA 3QSYA 2N9UA 2Q27A 1Y48E 1UKYA 2DTXA 3J7TA 4U7GA 1BMFA 4HXYA 2BKUA 2QROA 5EHNA 5FOXA 2B7LA 5TMBA 2WU0A 4PLWA 1M0WA 2DUJA 3LHKA 1CETA 3GGGA 2CEKA 4V2IA 3WADA 2VRCD 1VP9A 5JT1A 1U4NA 4PPYA 4ACAA 4FSDA 1ZO8A 3N86A 4RFSA 1ZW1A 4AUMA 3SWWA 8ABPA 1X1CA 4J7CA 4XRRA 2W70A 1KMQA 2ORWA 3T9AA 5CFNA 4MR9B 2ERXA 1JI3A 1WZCA 3TLYA 1QU2A 2QSYA 2VHCA 1G8FA 1IXSB 2WYWA 1X7GA 5IJ0A 3TLGB 1J99A 3W6UA 4G0WA 1PBTA 1RI3A 1RRMA 1S2LA 2NWQA 2PUHA 2QTAA 1OI4A 1Y8CA 2XUOA 2F9FA 3I6ZA 4NHOA 1Z4PX 3K2BA 3M4JA 2JBWA 5LDGA 3BWBA 4UTRA 1XCJA 3PG5A 1R4NA 4AZ3B 3FGZA 3WHLA 5L4SA 3Q11A 3F6RA 5EEHA 3TBFA 1L4HA 5FUXA 3D81A 1PR6A 2X42A 1X42A 4PEVA 2BCJQ 3SZLA 4F9EA 1AUXA 3PX3A 3W7AA 1BMTA 4E88A 3E7WA 3JQ7B 1CTQA 1SVKA 2QUHA 1HUQA 4IEIA 4UBIA 5ILOA 2SBTA 5K05A 1L9KA 3TIGA 2JGRA 4D3YA 1N9ZA 2R11A 1GU7A 3O4VA 4DMMA 1KAMA 2YQ5A 4YR9A 3DCYA 4I1IA 1VKRA 2J3HA 5CIWA 5GM1A 3OCZA 1VZ3A 5HK9A 3OQIA 4BYGA 3F5DA 4GLJA 3WXMA 2REXB 3NGLA 1W49A 2AFHE 1UMBA 2ZS8A 3STHA 4ZZ0A 1KIMA 1ZBDA 8LDHA 2XCIA 3OLQA 3FDXA 5EWMA 3T3NA 3T3HA 2HQ1A 1FB5A 4IIGA 4KHZA 4MQEA 3K5IA 5CVVA 1U2TA 3GQBB 1KI8A 1XZ8A 1YE3A 1RQRA 2NU8B 4CKYA 1E2NA 1EGMB 1P8JA 1UBNA 3HWX1 3IODA 3S99A 1TZBA 2H1LA 3ESBA 1J8QA 1ZWKA 2H29A 2E7ZA 1KPHA 2NTJA 3QKSA 4TV8F 4AKIA 1S3GA 4BNZA 2HJRA 2D5AA 1RRKA 3COYA 1C7JA 1M6VA 2C2OA 3EXIB 3PX7A 4JNKA 5JJBA 1Z9BA 5KYXA 4M49A 4AP9A 2YZNA 1TA0A 2HMTA 3QG1A 1XKXA 5E8JA 3QKRB 3W6PA 2R6HA 3DDUA 1G2PA 1PR1A 2YFYA 4BNDA 1LF0A 4QFCA 4XIGS 3E84A 2IDJA 3CLSD 3Q12A 4R9VA 2E85A 4QBGB 2HUNA 5UKDA 2AWOA 5B5SA 3IPCA 1XDGA 2JI7A 1AQUA 2PX2A 4V0KA 1RWPA 4R3WA 4UPVA 1E3IA 2A0FA 5G3ZA 1TD9A 4HWRA 2VDNB 4Y2TA 3NB0A 1ZCFA 1E6EA 3V8QA 1K3TA 3UJAA 3MGCA 4BNYA 4E5UA 5A1JA 2RHBA 1AMOA 3I9KA 5HZHA 1H6AA 2IZ1A 1U28C 5TF4A 3EVGA 4GHWA 5REQB 5IHPA 2R8XA 1MXFA 3WGYA 1YC5A 4DZRA 1QB8A 2IW3A 1VMEA 4K9QA 4OKIA 3DMPA 1UMCB 2RHRA 3LWNA 3DO5A 2FFBA 2R62A 2ZSKA 3RNOA 4GKVA 4P82A 4KQFA 4UUPA 3FMPB 4M1SA 5DIZA 5G1OA 3VYWA 4DB2A 4J3JA 4YRNA 2E6UX 2OC9A 2R8PA 3D3KA 4G2NA 4WY2A 4OHZA 3BWDD 4DNQA 3PNPA 2B8JA 2I2XB 4LF9B 2COEA 5COBA 4LXXA 1Q0LA 1EZ4A 3T61A 4URUR 2O3UA 4X1IA 3VR6D 3W5SA 3L0CA 3P2EA 3KEGA 1NXSA 3EXHB 3SZGA 1EPUA 1PFUA 5KMGA 1RRCA 5DM2A 4QPCA 4LYJA 1T9HA 3AESB 2HSDA 5L7YA 4TROA 2UAGA 1S6YA 1IONA 3AM4A 3DQZA 3UW3A 1PDVA 4WASA 1BU5A 5HUHA 1DU4A 1HNZB 2XNCA 4Q39A 3U19A 4ALLA 3GUZA 1UJ4A 2OXCA 2FY8A 3FH0A 3IRUA 2ZJ3A 4TKUB 4E70A 1AUOA 3SQXA 3GH3A 3T1TA 4FKZA 1WVMA 3H1EA 2ODQA 3GYBA 4X44A 3DMDA 2BGRA 4I7EA 4MDHA 3C41J 2PQ2A 1KAOA 4KWHA 4W7SA 1UXOA 4M21A 3VZQA 4AULA 3CUYA 2OZLB 1RJEA 1ZGZA 3PQ2A 4EUFA 4GR4A 3FVVA 2O3SA 2V7XA 2R8RA 3INGA 5JSYA 4L51A 2Q0QA 5E4TA 3ZGNA 3MQ2A 3KSZO 3J81A 3EBPA 3BBPA 4WY8A 3O2NA 1JQ5A 2XWQA 1R0LA 2WM2A 3ADOA 3RAPR 2UXBB 5CXSA 1EFAA 4AWXA 3A6KA 5EJ4A 5L95A 4II3A 1VKNA 2CV0A 4FYYA 1A5ZA 1F7UA 3FX2A 4YPVA 2F1JA 3E9CA 1LBQA 1KMMA 1Z4MA 2BFDB 1PL8A 3UAVA 4BX8A 1OR8A 1SPBS 2C03A 2NM0A 1AGYA 4BNWA 3DKKA 2QW0X 3GD5A 3ZHTA 1G8JA 2GGSA 4K3VA 3G5TA 2AZTA 2FFHA 4L5BA 1J2EA 3QFRA 2J6BA 3SR4A 3EW7A 1TKCA 3SEZA 5FL7D 3WMRA 5I7UA 1JVSA 2GLTA 1QU3A 3WMGA 3ROTA 2AUTA 5A3JA 3CR3C 5F2OA 3TEFA 1RBMA 5F7OA 2UYQA 3BMCA 3JZAA 4BP1A 3CRZA 4D9GA 4TTIA 4DV3B 3IB3A 3FTEA 2QTZA 4GXTA 1NNI1 2HMWA 4HAIA 4MIKA 3EC7A 4ZAWA 1X1RA 3ZHXA 3IS3A 2FUG6 4KC0A 4KV9A 5KNBA 1HTBA 1I4OA 2ZSUA 3GIWA 3AHEA 3QENA 1KRWA 4OG2A 4L8FA 2DT8A 1B0ZA 4W4TA 3SBOA 3KAKA 3B1YA 4RF5A 2OO7A 2QRKA 3IP3A 1D04A 1J24A 1K92A 2PQ0A 1A04A 3OD1A 4KWCA 3RBXA 3SC2A 5DCLA 3V4OA 3VGJA 4HQRA 4E2ZA 1IHUA 4YJ2F 3FHOA 4AMVA 4MUXA 1Z7GA 3GPDG 1NBME 1FA9A 4ARBA 1X7XB 3CJRA 2BH9A 2JC3A 3BRQA 4XEUA 3TD2A 4I5FA 1K8XB 5LOVB 4LV5B 2DECA 1ZSVA 3EDYA 3RKRA 2ZJ7A 2QM8A 2Q5IA 4GG1A 4GKAA 1GGNA 4P5EA 1YJCA 1J90A 2IOQA 4NG5A 3QEKA 4RZXA 4S3MA 1MEOA 1TGYA 2C58A 5EMLA 1JVNA 2JA1A 2AJBA 4D4IA 1KRXA 5AOVA 5EIXA 1XP5A 3QLUA 4KAXA 2RGXA 2NZ2A 3ESZA 3UTCA 1XRQA 2PX3A 3G2QA 1B4DA 1FLAA 1QMGA 3H2SA 2HLNA 4JL8A 1IL0A 4IHJB 4ALJA 5B12A 5KYWA 1KZ4A 1FFWA 1G9XA 1M8KA 2QMEA 2QJRA 3B2NA 2OSVA 3ANXA 3I3SR 3DFMA 1HETA 2VPPA 1VCMA 2QRJA 4NU5A 5KYUA 3A25A 2GA9A 3EY4A 3HU1A 2PZGA 4HX9A 4YK7A 4BKQA 4DLSA 1Z2NX 2BBOA 1PHRA 3RVKA 5H8WA 1Y7LA 4IDOA 4R8LA 5A62A 4C4XA 2C8LA 1F4VA 2V8BA 5EL0A 4IV0A 3IFSA 1XL0A 4ZI7F 1GDDA 2FCRA 1X94A 4IMIB 4Q9AA 3PIRA 2JW5A 1QRDA 3WLSA 5JG7A 4UUAA 5BYJA 1LA2A 3R8FA 2HJVA 3D3WB 3ZS9A 4ICIA 4IH1A 3EMDA 1QK4A 2WOOA 1A2KC 3C5VA 2YWEA 3SC6A 2Z4TA 2W98A 4BQNA 2X8JA 1T1EA 2YY7A 1V11A 2QZ9A 3DE2X 3R0JA 2W8BB 5K0NA 1NUQA 1H9AA 3QA3E 3MGGA 4BX2A 2NNWB 1DKMA 1WQ4A 1IJEA 3ORYA 3F2IA 3N0VA 3D7LA 2PFGA 4LVUA 5CX1A 4CW7A 3GJ4A 2R7MA 2G5GX 4E11A 2NP7A 1US8B 3F6EX 3PFGA 4PSKA 4DT1B 2CUTA 4TKLA 4OQEA 3QLUC 1IATA 3SBDA 4PIVA 1CVIA 1VMKA 5CP8A 5CFRA 3ZGVA 2A33A 3FFAA 4TZ6A 1OQAA 1W19A 2EZ9A 5C8ZA 1O96B 3CXRA 3HB5X 2YWHA 5TGDA 2NZ8A 2PR2A 5IJWA 1H5NA 1PT6A 3AUJB 4ENSA 3GDWA 2VHYA 1BXRA 1NONA 1UDRA 4LNUB 2A5FA 3L0OA 1YA6A 4G8JA 5FQOA 2V3CC 3H2ZA 2CXXA 5AW3A 1NPDA 4CUJA 1UC8A 2GUGA 3SFZA 1GAQA 5KYTA 3RVBA 4MGYR 3SKVA 1B00A 1ZHFA 1U98A 4L6IA 1DO2A 3WLKX 3IIJA 1RPZA 3FWYA 5JCOA 3AVUA 2JLUA 1BXKA 3GT4A 1RC0A 2P9CA 4EX6A 5FF9A 1GJRA 1KQPA 2WYUA 2YRXA 3O26A 4UVEA 4MQ6A 2OV8A 1D2HA 2QPTA 3VAAA 1E79A 1SCJA 4A2CA 4BWYA 2Q45A 5GJCA 4CMAA 1R0SA 2GCEA 3T7DA 2OBMA 1O0CA 1KR5A 1GA1A 3N8IA 3THOA 3RYHB 4O2AF 1PG2A 4AURA 1LI4A 3KELA 3CNHA 1YI1A 4GMXA 4DUYB 3OF3A 5CX4A 1TFRA 3FIUA 1RM3A 4X91A 5ELMA 3WKDA 2PU5A 1PZHA 1ZUIA 2C98A 2QTCA 5EHQA 2YIVX 4UW9A 2H4FA 3FB4A 5L3RA 1VL6A 1R66A 2CXHA 5BURA 2IZ6A 4PHCA 2WJWA 3AZOA 1LLDA 2OHHA 3UF0A 1JE0A 4FI3F 3HO1A 4CMJA 3F6CA 2Q8PA 3I23A 3KLPX 1I3OA 5BNFA 2XV1A 1RFGE 4GM0A 4K6GA 4KXLA 4US1R 3P2KA 5AJHA 1QXSA 1OA1A 3SGLA 3IAFA 2ZJ5A 3PA8A 3QX7A 4XGIA 5B58T 1QYVA 3S68A 3NRBA 1VPLA 2VPWA 4TWRA 2ZQ5A 4YLGA 3E53A 3MINB 4HQOA 3VDNB 4KUGA 1MX5A 3IAS1 1T9DA 4COKA 2FVYA 1XZMA 1PD0A 3L5OA 1PGQA 3OY7A 3RAJA 3VJLA 5A9SB 2FKAA 3AZQA 1U0TA 1QCZA 1USVA 2GDZA 2QVYX 2FW6A 2X0IA 2YWJA 3QHPA 5JCOC 3WE7A 2IGBA 2ZUVA 1L5HB 1MABB 2PXAA 2Z1MA 3CUUA 2ZK7A 1Y0BA 4F1WA 5AIBA 1GFWA 2F3PA 1VKJA 1XSEA 4ZRDA 1N6LA 2DZDA 3QJGA 3KKOA 4MTCA 4BO9A 1WUHS 3SYTA 1CQPA 4FD2A 3W34A 4FR0A 1M8GA 1PX2A 5ESWA 5ALTA 2MYNA 3JQGA 1P60A 5YASA 1PW5A 4KZPA 5DIFA 4M0DA 1C7RA 1FEZA 2Q1XA 4QM7A 5CB8A 4ILKA 4JC0A 5BR4A 3CNBA 4N0QA 1BX1A 1O8CA 1MV8A 3EF0A 5KO2A 2PY6A 2X8AA 4E7OA 1JKFA 3FPBA 2IYTA 4LQCA 1WZ2A 1ZIYA 1GTRA 1I7PA 3AILA 3FTPA 3GCXA 3BK1A 3QHAA 3D6HA 3GVIA 4FIDA 1F60A 4D80A 5E1DA 1RT9A 5DSZA 2FAXA 4EI9A 2MSKA 5K4AA 3OVMA 1WCV1 4P58A 5P8WA 4EW6A 4DY6A 3HUUA 1N7GA 1GLGA 3SIXA 2GCGA 3C8HA 2VK2A 2F6RA 2G9UA 1NQUA 3LDAA 4P5DA 5J2TF 1GU1A 1ZD5A 3S8YA 2F62A 5KU7A 2JLRA 1Z8HA 4Z54A 3FWZA 4RCZA 1XDZA 3MBOA 4PYMA 4RBNA 1AG9A 1A5AB 2W2TA 2W6JA 3L84A 4FEGA 3FDIA 4AZSA 3S2ZA 2HPHA 5DNDA 4M55A 2AX4A 3BGDA 2FB9A 3G2NA 3DVQX 1WW3A 2VH2A 2XB9A 4HBZA 3UKOA 3H11B 2GZSA 2UZIR 4Y9DA 3O3CA 1ISIA 4C22A 2FFRA 3FCUB 5EVJA 1T3HA 1SURA 2CCGA 3PGVA 3U4GA 3UAGA 4F1KA 1YL7A 3K0HA 4WKOA 1OH5A 4A82A 1FTGA 2ZSBA 2N3ZA 3ADPA 1JJVA 3HCEA 4ETIA 1HLGA 1NY5A 2C31A 2VBFA 3DH0A 4EVRA 1JR6A 1AURA 4QBFA 3G1TA 3LZCA 3LT1A 4AU1A 4YP9A 1FFYA 3C6BA 3KOYA 4WPGA 4OLAA 3GXBA 4C4AA 2ZDGA 4OA5A 2DAPA 3OM1A 1INLA 2Z98A 1IN4A 1H5QA 1GIAA 3C87A 3OU6A 3N74A 5FEUA 2H16A 3RJZA 4B75A 4LXTA 1X1EA 1TQDA 4QBTA 5MGBA 1TJYA 2ZI9A 3E03A 1C9NA 1FDOA 2Q9BA 3ZWXA 4V3CA 4XLTA 3ZU3A 1MO2A 3COPA 3Q1LA 2VPIA 5FO0A 4BO7A 3K9LA 1A5SB 4JB0A 3RWOA 1C0LA 1JG2A 1M1YE 2O1SA 4JYBA 4BNIA 1SN7A 1GNPA 5LZ4A 1O54A 3TG8A 2UZ3A 1CDOA 1NUUA 1WF3A 2JGIA 4LBYA 5AK4A 5E6SB 3V33A 5DF1A 4G0PA 2OHGA 2QZZA 3E9NA 1E5VA 3NTQA 5B1SA 5JD5A 1SIOA 3GMDA 3ZDDA 2Y1KA 4K3UA 1XGKA 1RM5A 3MGKA 2VWQA 2XYRA 1WKVA 4HAWA 3T94A 3WKCA 1IN1A 4UM9B 2FNAA 2PXXA 1H85A 4ZIRB 4UDNA 5NULA 2VAWA 2R7AA 1WBJB 4AYWA 1P9WA 2Q0XA 5D3QA 5ENZA 4QZVA 3BIXA 4GUAA 4ATNA 2J67A 4YXFA 1YSCA 1QG6A 3H0KA 4HQLA 3EB9A 4OYLA 5DGTA 5JOQA 3SU8A 1XCBA 3G0DA 4CM8A 1U5AA 2R8EA 4P4TA 3STYA 4RTRA 3EA0A 4TZ0A 1Z74A 4MWEA 4UEQA 3K73O 3OQOA 3NGMA 2GERA 2HTFA 2FJUA 2YN0A 1M2HA 3C45A 3MCVA 4JDPA 4EZIA 5CB0A 1H66A 1Y1LA 1Z26A 2WAYA 2WAAA 4D6PA 1QK3A 1SQFA 1U5CA 2V8OA 2Z2IA 4IIYA 4CGYA 1NF9A 3CEJA 3VSCA 1SXJB 1E2UA 1B43A 3DZDA 4CF4A 4MJXA 3CNOA 3EZLA 3ZY4A 3EFHA 3OBBA 2JK0A 1LK0A 2JIRA 3D5QA 3K72B 3KPWA 3PITA 4U2KA 3T3EA 1M2FA 2FCAA 2B1QA 3RYFA 1LNSA 1W52X 3DB1A 4JKOA 1B8PA 1U4OA 1Z83A 4WT7A 3L8DA 2XCUA 3GL9A 2ZI6A 2I62A 4MKHA 2HCJB 2AJLI 3L6UA 2R79A 3QPVA 3R77A 4LHVA 4AZ0B 5BXYA 5AUOB 1G7RA 3OZAA 3OOJA 3HVRA 3TQQA 4B3MB 1QJCA 5CD9A 3N6VA 3BF8A 1C4XA 2YRWA 3G02A 4MVJD 5ALUA 2WWFA 1KBZA 1X1DA 1NNSA 4IDNA 5IUNC 1SHZA 3CIOA 3KTAA 1N8SA 4IW3B 3T3PB 3ZWWA 3WSWA 3S0JA 4RDXA 4FCCA 1MOZA 1CUFA 2NZYA 1CB0A 1WLSA 3CT6A 3O1JC 1DG3A 4ZOQI 2QU7A 621PA 4OMDA 3OOYA 4BTLA 2GK3A 4HGRA 3CURA 3GLUA 4WBNB 3NIGB 3P9ZA 5DXJA 1Y5RA 3OLZA 4B32A 3PNSA 2R9VA 3ADBA 4MXDA 2I80A 3DFIA 4KWTA 1C0IA 3FMGA 2CJYA 1RJDA 1UFKA 2JDID 3GLQA 4H7DA 3F90A 3OFVA 4B5LA 3DE3X 4JIGA 2WYOA 3OURA 5ALWA 2HHHB 3MS7A 1VCNA 4Q1BA 3KETA 3IXQA 4FMDF 3WLHA 4DJEC 3R3JA 1XKQA 3OIDA 1QPGA 2JS7A 5CXUA 1Z07A 3C24A 5I3CA 1Y6QA 1F1JA 2PFKA 3IHTA 3OY2A 1MAVA 4G24A 4LX8A 3RUIA 2XB4A 4CFZA 3ZDCA 4GM1A 2OAQ1 4LVNA 2GRUA 3I6IA 4MA4A 5T3YA 2AN4A 3P0FA 4EPRA 3ROKA 1TVKB 3TLMA 5LIRA 4L72A 3DBIA 2YW2A 4FMBB 1GR0A 3PFBA 5JNVA 2D1FA 4L5YA 2AQKA 1QG4A 3DTVA 4RZQA 1I10A 4DIDA 4FZJA 3NWPA 5HM6A 4OI2A 3A11A 1RWQA 1IB6A 2J48A 2Q46A 4U2GA 1SMKA 2GXUA 3JVIA 3DEIA 4AXBA 5I7EA 2ODWA 2NVBA 1Y9DA 1VECA 1I1QB 2CJXA 2N47A 3UGKA 1VJTA 3WLJA 1ZGHA 3PNKA 5JEEA 3ENKA 3BDVA 3INNA 5D8DA 1T4CB 4JHLA 2I71A 3T06B 2BZ1A 5E4JA 4IIJB 1P81A 2XUKA 1PLLA 3EXFB 4B7AA 4ESHA 2Z5FA 5E3HA 1CUYA 4BPBA 1F0NA 1E9SA 2IDZA 3EFEA 1NGSA 2VYND 4RD1A 5KSZA 3VNUA 2CF6A 2W93A 2NVUB 4Q3EA 1XRSB 2H2FA 4G65A 3WVNA 1XE3A 1EK1A 1T9BA 3U2QA 1QBKC 1JHVA 1CUUA 1E1NA 4X6YA 1ZKMA 1ZSNA 4JK3A 2Y27A 2ZPAA 3S5UA 1NQTA 5GJVC 3P2JA 1JHZA 3V34A 3DJFA 5JS7A 4PX2A 2ZRNA 4J4TA 3NBKA 1IHDA 1Q44A 1X7YA 2PEYA 3K9GA 4BEBA 4X1KA 3VU9B 3HKBB 1C30A 2DQSA 4TS1A 1DP4A 1J97A 1DRWA 1V8FA 3RO7A 3GJ8A 3USZA 4B85A 3GPLA 2DPGA 3CZ9A 3OTQA 5D85A 4FDMA 3G5LA 2C04A 3BMQB 1M2OA 3TW8A 1IOLA 3RLFA 3JYOA 4BFSA 3TQCA 1VQ1A 4DLLA 3PLRA 3STWA 4PAQA 2P6RA 3KSDO 4PC3A 2C92A 1X7ZA 2QTVA 3PDIB 1WCIA 4JYCA 4PNHA 4ZAXA 5L4NA 4HYYA 3EZFA 3OMWA 2AN1A 4WAUA 4IKOA 3VR2A 4G85A 1RAGA 4OGLA 1VI6A 1SU7A 3P0JA 4G1FA 3SHFA 2R86A 3LLVA 2I3GA 3QRWA 1D7AA 1JAIA 1TUBB 1QHHB 3R5XA 4D8XA 2GM4A 3MS2A 3TAUA 5DHUA 1HQKA 4A6XA 3LQKA 4CTJA 1LBTA 2D1QA 3UXYA 1VLLA 5EJIA 4GM4A 5L6LB 1NVGA 2JJMA 4LZAA 4RD6A 4A6EA 4F6RA 1O95A 4KQ1A 3QBEA 3T8YA 3ZX4A 5LU9A 2PRSA 4TZTA 2BEVB 2ONJA 2OXIA 3LU1A 3U3KA 4WE3A 2WFZA 3W5BA 1L4NA 1T2EA 2OHIA 3IP5A 4A1OA 2AOVA 3RC7A 4B4KA 1LY1A 1SQGA 1T36A 2KX7A 1BJTA 2QQ0A 1O87A 2HQOA 2FHPA 1NA5A 1NLMA 2JAOA 2HYDA 2LUOA 3KJGA 3IPLA 4N49A 5DGIA 3GLKA 3RHFA 1M73E 2JVJA 4A5OA 3K6SB 1DS6A 3PQFA 3N0TA 1Q1EA 4PNEA 3O4JA 2PBFA 2FXVA 4CQMB 2H5JA 5EZYA 3T5DA 2PT9A 1KFCB 4FKMA 1WMFA 4J0QA 5MN6A 1PYDA 4BFLA 2QUIA 5F1OA 4BMDA 4YQFA 5JZBA 2XD4A 5DM60 3GBVA 1MQ8B 3KCNA 3K1JA 3KB6A 3TW0A 3S1AA 1P7VA 1RJ9A 4RD0A 3DAPA 1XTRA 3KJHA 1KIAA 1HFJA 2DVMA 1XRNA 4FLEA 3RT7A 4DEXA 5CA0B 1IZ0A 3L01A 2BJVA 1ECBA 5LCXA 3FOCA 2UZ1B 1E1CA 2X2PA 1P29A 2HM7A 5BN4B 5DSTA 1WF6A 5TARA 1Y9EA 1P7CA 4LE0A 3G79A 5I9IA 5KYVA 1W6UA 1BCSA 1TCAA 4GKBA 4OEHA 3FTFA 2HZ7A 3O4HA 5IWAB 1Q91A 3OZVA 4QJ5A 1QJ4A 3W8EA 4WXRA 3ZDZB 3FN4A 4LY6A 1XXHB 4OIFA 1Z0IA 2C96A 1JMVA 1T15A 1JSZA 2RBGA 1SCNE 2YNMA 4GEKA 4DZZA 2W83A 3HCDA 2VJLA 2XYQA 1FVFA 4KMSA 5EGSA 2A5YB 1F4LA 1GKUB 2D5BA 3QOYA 2GWRA 1JEEA 5CJPA 2CCJA 3BE6A 4UBJA 4UU7A 1XG5A 3KBBA 4Y6GB 1B15A 1MAWA 1MV5A 2G07A 2O1EA 2H1VA 2OUIA 1I33A 1JDUA 2GD2A 2WJ6A 4FHGA 5CXXA 5TVKA 4JI2B 4EB0A 5BY2A 2X9QA 2ZU0C 5EIBC 1NLUA 2NYAA 2XMQA 2IEIA 4MEBA 1GFZA 3O38A 5GOTA 3WLLA 3M6UA 5A4IS 4DYVA 3MLEA 1YQGA 3W2GA 1Z2DA 4O0MA 3C14C 4CU2A 4Y18A 5TR9A 1ADJA 2I8CA 2DETA 2H4XA 1ISPA 2C5BA 1IHXA 2H11A 2I1LA 2Q5JA 3I2HA 4LJAA 5I8PA 5COAA 1PL6A 2BFMA 2MSLA 5E4YA 2NXJA 4Y1RA 4LK2A 5M04A 4L0MA 4TL8A 4M0UA 2O20A 1JAYA 3I5MA 1ZXBA 4I8XA 2XCTB 1YTUA 1S7GA 1KEEB 1JXOA 4C4YA 3C6KA 1I24A 2XBUA 4PZPA 2QF7A 1N34B 1E62A 1ORWA 3D8UA 2C7BA 2Q9AA 3PD1A 4TTTS 1GVNB 4YQYA 1EQAA 2HD4A 3TUJC 4C0LA 5EXEA 2H48A 3BWYA 5ER9A 1N2CA 1RJFA 2A4KA 2YNMC 4HNAB 4C7BA 1J2YA 4KQKA 5GPBA 3GVHA 2XY4A 1I5EA 1PFVA 3G5MA 3OU7A 1NLFA 2WSYB 3RG8A 1PS0A 1S2IA 4DYHA 4B3RB 5KYKA 3MEQA 3T99A 2NU7A 4YTEA 4BAUA 4P8RA 4PC6A 5TQ0A 4CVNA 1WR8A 3OBIA 4ARIA 2BI4A 2PLWA 3AX6A 5HE8A 3GNLA 3NOQA 3JAKB 2CJWB 1OWPA 1YI8A 3GI1A 3F96A 2O7VA 4L9SA 1KTVA 1P31A 1PQYA 3OQ6A 4QUJA 1D0IA 4A0QA 4AY5A 1E3SA 1CR0A 5CGQB 3RJTA 4A92A 1MCZA 5IEBA 1ZNWA 1C8VB 2A7XA 3TIVA 4NCAA 1XD8A 2AV6A 4PYOA 3UHAA 3T7AA 4EPWA 4EY7A 5B2FA 3L06A 5DN6A 4G09A 2NACA 1HXHA 1V7QA 2Y9MB 3PTAA 2WF6A 4XX1A 1JU9A 5KSYA 4V39A 1SQ0A 2RIRA 3PF8A 2C0QA 4MS3B 1TJ5A 4WACA 4EG7A 1SB8A 5JXWA 4EPTA 1Z4NA 1V4NA 1WMEA 3FKQA 1ZK3A 5CT4A 3X1MA 2GN1A 4MKXA 1AK9A 1WXGA 2F1IA 3A3YA 3JD0A 3R3HA 3CYFA 4KAJA 1HE3A 3NWBA 1DCFA 2AN9A 2GRJA 3Q8XB 4N9QA 4CV2A 5BWBA 2QAJA 4G5QA 3MIIA 2V6JA 5U1PA 1QDLB 1U0GA 3HVKA 4QQ8A 3GEPA 3B36A 2VRCA 4HNSA 4YJHA 3MRSA 1SZJG 2CHUA 4L16A 1HOTA 2XVZA 3DF7A 1KWGA 4UATA 4YB8A 1OX4B 4KJZA 1Z06A 2GCOA 1Z6TA 1QFYA 2WNHA 1ZNYA 3EK2A 3IAM1 4S24A 1Y8RA 3CX8A 1BX0A 5CR9A 3UCFA 1EFTA 4C9BA 1KI7A 3OQNA 3U7QB 4PCLA 2H07A 2J0EA 1U0NA 3DZGA 3Q7EA 4JEUA 4R2WA 3GEHA 4ENUA 4MDFA 1FRFS 3CLUC 1YZLA 1RMQA 2QOEA 4XCVA 1G7TA 1KVQA 3MBKA 3PICA 2GD1O 2EFJA 4YI3A 1IK6A 4E13A 1E6LA 5FWYA 3QU4A 3GCWA 3R20A 2PFSA 3AETB 5CEFA 2CZGA 5EXTA 5FEMA 3RTAA 4AMGA 1IPFA 1GKKA 4PFJA 5BWLA 4G4SO 2AH5A 1HDCA 1X2BA 3GWZA 4TSFD 5F4ZA 2A92A 3OQPA 1A71A 1LVGA 3DEHA 4OHCA 4OUDB 4OXQA 2NPFA 1RLJA 3LBFA 1Y98A 1L7AA 2PA0A 2WFLA 3UAXA 1T43A 5D7NA 5JMWA 3O8RA 3UT5B 4XJVA 4HDNA 3MCWA 3ZN2A 1BFDA 4LKRA 3OWXA 1L5LA 4GXQA 3TTTA 4OREX 3O0DA 4BQPA 1HNXB 1KK0A 1GPMA 3CGGA 4RORA 4MW6A 4YALA 1RRFA 2BCGY 9ABPA 3PQCA 3VC1A 4R9UC 2PH5A 1RWVA 3NZEA 2BGTA 4RAOA 2G1PA 2BAGA 3TW4A 3Q85A 1SXIA 3CRW1 3GJYA 1B6SA 2FQYA 3B8EA 5F5NA 4DJFC 5DPMA 1IXZA 4QGGA 2O5RA 4LMPA 2BJHA 2H4JA 1QC5A 2XODA 1XPUA 1T2VA 2RHMA 3DF9A 2GPNA 3G9UA 5LQKA 3UKDA 3B6JA 2JKYA 1XFAA 4MCHA 4PSCA 2IOFK 4O2RA 3WGHA 2P78A 4RLHA 4XAQA 5AKXA 1MEJA 5DTMA 2R6FA 3RJ9A 1C2YA 3ZIAD 1T8WA 2F00A 2X14A 1FSGA 3ON5A 4MMZB 2GH1A 3TKLA 4P54A 4EMBA 4D9NA 3FMFA 3GZ4A 4DV4B 4X5OA 1OLSB 3HA7A 5D51S 5JFTA 3F8TA 2C82A 1U2DC 4INZA 1M34A 2NX2A 4QGAA 3ROMA 4WN9B 5KTNA 4H3HB 4E5SA 3GDGA 3NKFA 2UUAB 3B6ZA 4D4GA 4EJMA 3F1LA 1AK1A 5ALMA 4B73A 3C5CA 1T5BA 2P35A 1ZMRA 4CLOA 3STTA 3ASUA 1G8HA 4XR9A 3J81k 1OXXK 2Q5HA 3U13A 2PPLA 3AL0C 1TZ2A 2RE8A 4RSHA 3AINA 2FZVA 1UT6A 5BRNA 1VHDA 1R7RA 4FGZA 5JWHA 1LFDB 1Y4ZA 4A3SA 3E9ZA 4EHFA 4WKNA 3QEJA 1ADBA 2FWPA 5IABA 1Q0TA 3ZE7A 2DB3A 1F0KA 3DDCA 3E1SA 3ED1A 3WLOA 5IRCD 1Y1SA 4AT1A 4OI4A 3WLEA 4XVHA 4O4LA 2W2KA 5BWOA 3W9SA 1A2OA 1XTUA 4QEDA 3W2IA 5IG2A 3EGDB 2XHZA 3B3AA 1JJFA 5TXGA 5I9LA 1PQWA 3DEFA 3H9UA 3VSAA 5EHZA 3OHPA 1N3BA 3GEGA 2F8LA 1MO3A 3K0CA 2RJOA 1Y4SA 4M4SA 1MB4A 4MR8B 3VR6A 4F8YA 2H5IA 2ZLBA 2ZOSA 3GFBA 3L8YA 3T35A 3K53A 1GAXA 1FNBA 1V9LA 3LL7A 5C80A 3NCTA 2BHSA 1EK2A 1TYDE 2ZXFA 1RHUA 3UWSA 2IL1A 2ZJ4A 5LL6P 2ZAOA 1CS4C 3CLSC 5ADUS 3EIWA 4LDRA 3QVWA 3H6HA 1IPEA 2CJFA 1X0VA 2QAGA 1D2AA 3PCRB 5A5EA 1B3BA 4PQYA 2O8FB 1RIFA 2FWRA 3DNMA 3ENQA 1CQJA 1I36A 2J9GA 1RRVA 4IDDA 2VYQA 3L8EA 4Y7CA 5FTLA 3LI2A 5K4GA 3D1JA 1OIXA 1GZSA 1KXJA 1UMBB 1WPGA 2XECA 5BV7A 5JQGF 2LD4A 2BMFA 1NN0A 1XDWA 1UT8A 3I04M 4CRWB 4ZMRA 4QTTB 4FHFA 3DWGA 2F43A 3ABRB 3UW1A 1DFHA 4ZK6A 3B78A 1GYQA 3O7WA 4MQEB 3DQQA 4OLJA 5JTTA 3EEIA 2HV8A 3BRSA 4DDUA 4ZYLA 1M2VB 3U7RA 1SHLA 1G64A 4KCGA 3NNSA 5DZSA 2H0RA 1VMAA 1N0HA 5BNZA 1B8VA 1IQRA 1E1DA 1H0KA 3Q7QA 2YDYA 2IYRA 4NPCA 2J32A 3K0CC 4A1FA 5BW8A 3RCBA 4KVAA 1ZSYA 4XD7D 1K3FA 3K5WA 1X86B 2NT3A 3AUAA 3AR2A 4MUHA 5BPHA 1ZCZA 3K35A 1PJZA 1ZZEA 2X0DA 4LV6A 3K1TA 3CSDA 1E5LA 1R37A 1C81A 1XWIA 3GH1A 4NTZA 3UA3A 1NQWA 1E1MA 4CQJA 1NX6A 2EBFX 3IRVA 2E4WA 4GBJA 4C01A 7YASA 1BXGB 3MAAC 3MCAA 4KDCA 4Y1FA 3PP8A 4XM2A 3F4LA 1ADCA 2QAGC 2QUZA 4JLUA 2NAFA 4X00A 2CL5A 1OLUB 1XCLA 4RNDB 2BT4A 1GUZA 2EXXA 3G2KA 4HQ6A 4LIPD 3Q7IA 3SLRA 3AI3A 4WZZA 4X8MA 1XP8A 2K4MA 2WVAA 3IL2A 2L42A 1A77A 2WHEA 5JI3E 5HTOA 5AJWA 1XB2A 1XQ9A 4FR5A 2FR0A 4KX5A 4W6QA 4DG8A 1XPRA 2NZVG 1SZDA 2CLEB 3GFQA 3A36A 3L6RA 4L7QA 3L49A 4RW0A 1CEYA 4L78A 1II9A 3V7YA 5KSWB 4LCEA 3TINA 4D26A 1MB2A 4WEQA 1SHTX 1IMOA 1Y6JA 2HH9A 4IX9A 4MWGA 1TB4A 2AMVA 3C3CA 2ID4A 1NXVA 3NONA 5IAJA 3V7FA 1JX6A 3INRA 4CE6A 3K5HA 5KMGB 1NVVR 1SD5A 3W5HA 3JTEA 5I8WA 2NUBA 1EE1A 2G71A 5AW0A 4YRRA 2IH4A 2GN2A 3DV2A 1T1SA 2PIAA 5K3CA 2OQ2A 2BGLA 1P7PA 3S2UA 1WXXA 2W6ID 4LYDA 5CW1A 3UGTA 2WUWE 1P2GA 3CZ4A 3ISJA 2VBGA 4BLQA 3ZLJA 3JPWA 3JD4A 4AX4A 2GBGA 3KKNA 2VAMA 3WRYA 4C5BA 1OXUA 2VS1A 1DEHA 1U65A 1DJOA 1KOLA 2YIJA 3M2TA 3I9OA 3ROXA 4UNNA 1C3JA 4C7XA 3G8AA 3M6LA 4V0LA 2E4XA 3SIWA 3IMKA 5I4CA 2YR0A 2JHFA 4ZHSA 2PJDA 3BF7A 2ZYDA 1QFJA 3GP5A 4JLMA 2QEQA 4KQMA 4ON9A 2BDEA 5JI2E 4ESVA 5AJXA 2RI1A 2ZBFA 3CKMA 4JLAA 5FOSA 4XFDA 4YMHA 4NEQA 2B3TA 4MJ3A 1V2GA 1ML4A 4C7KA 3HU5A 4UHFA 3AF1A 4UE6A 1LDGA 3T1NA 1OF1A 1JLMA 2GRAA 5KAMA 1YL6A 1SXJE 4Q1EA 4G0YA 2HU2A 5K09A 3PUVA 1AHPA 4P3NA 3D54D 4M6WB 4PSVA 1WAMA 3AHFA 4U8GA 4OQQA 4RVNA 5TGZA 2AN5A 3VBCA 2J7PA 4DILA 2P9EA 3ZIDA 3W2TA 4BAZA 4KFTA 1FFXA 4GO1A 1BKSB 1CWUA 4R68A 4CYMA 2RGUA 2V1XA 3DEJA 3VJMA 5IK2A 1O9BA 3FLEA 3M1LA 1YHNA 4UE2A 1XVTA 2YZGA 4INAA 2QX6A 1LPAB 3BMCB 3WBJA 1EFVA 4DAOA 2IUYA 1C7EA 1S7CA 1VLHA 5DLQC 3W4IA 5C5IA 2ZYVX 3G2OA 3JPYA 5CT9A 4AJJA 2YWRA 4BLPA 3FUUA 4NFLA 2QIPA 4ZCLA 1AKWA 1EHYA 1V3QE 2EWWA 2R68A 3ANMA 1JQLB 3KJQA 4FS8A 1ZX1A 3ZNQA 4DV2B 1JIUA 1CZHA 2R6JA 3DR3A 1DOZA 3GZTB 1ZK4A 5JLJA 4RS4A 2V3VA 1CUCA 1G1MA 2GYYA 1N6HA 3FDZB 3EXEB 3W8RA 2E2WA 4EBFA 2VUTA 3D59A 1Z2AA 1DUSA 4RL6A 3VX3A 4MGIR 4Z3KA 1JBEA 4EY4A 2ZWVA 3U7GA 3A4MA 3ND9A 3TOSA 4N1AA 1VBMA 3V2UA 1UDXA 1XJCA 2NO7A 1FRVA 4KQ2A 4QM6A 5FI3A 4ZJPA 3O3MB 4XKJA 1V1MB 1SUFA 1JR4A 2J7KA 4B9AA 5G1NA 3GLGA 3DKRA 5JV5A 4Z4FA 5IUJC 2OWDA 3CZRA 3RC2A 1B2RA 4PYIA 1TF5A 1G0NA 1H1LA 1D9XA 1WVGA 4I3FA 3OE5A 4K9SA 3EFOB 4ZQEA 5FUYA 4K6MA 1TEVA 1V8BA 1OREA 1U3CA 3MLAA 4H3VA 2PWBA 3GJ0A 3I9FA 3OIFA 1OX6A 2B0JA 2H1IA 3Q2KA 5AK0A 4YONB 3U0VA 1J22A 5AM3A 3QEOA 1YHYA 2O4UX 4AY2A 3TL2A 1EHIA 3OCUA 4G8BA 1HE2A 1P77A 2C1XA 2YV5A 2LBPA 3H05A 3NHZA 3QPCA 1TCBA 3JW8A 2Q28A 2OZVA 4GMKA 3LX6A 1ZD2P 1F0PA 3FVWA 1TKRA 1VA5A 1Z82A 4MW2A 3HDHA 1Z2CA 3MPUA 4J3FA 4QPPA 1Z2PX 2JH3A 1QP4A 3C6YA 4P3XA 2G0NA 1J1IA 1VE9A 3OA0A 3TZKA 2DGDA 1U3VA 2P6MA 1CS0A 1P5HA 2FW7A 1THTA 2IP4A 3PC8A 4CBVA 1BKDR 3NHAA 5CU7A 3A2NA 1LC3A 2CFTA 5KQRA 5C8VA 4P86A 5CDFE 1IEWA 1VL0A 2WU1A 3EGOA 2A9VA 4MP3A 4XZ3A 2J41A 4TQ9A 4O3FA 2AG1A 1KSJA 1V6SA 2X0KA 4JB2A 4MKIA 4Q7MB 1WY7A 4EPXA 3RQSA 2DPYA 5LKAA 4DMUB 1ZI9A 3QPBA 3AIKA 1P3JA 1W4BA 5JAQA 3L7YA 1A5BB 1C3EA 2PUTA 2ECQA 3PZRA 3B7PA 3EW9A 1NC3A 5DNVA 5K8JB 4IMJB 4ER0A 5K51A 2YQ4A 1QIDA 4QXAA 4R2JA 5FBQB 2FDRA 2GPSA 4AX8A 4BKRA 1AQJA 1YRQA 2AW3A 2HJHA 3OZIA 2XCLA 1DJLA 1SCIA 1E59A 4MVJI 1PBNA 5F52A 3ZE6A 4U7HA 4BO4A 3JWEA 2HCTA 1NFFA 4MKFA 4PBSA 2Z8YM 2OOKA 4IJVA 2ORVA 1YB6A 2ZM5A 5HRAA 4DNFA 2YW9A 3OA2A 4EKNB 3TIXB 4XSGA 4UHHA 3SSOA 4X94A 4Q18A 3TK1A 1N5IA 1NVUQ 3OTGA 4DLYA 4XW2A 4AWAA 2WNSA 4E3ZA 3NBQA 2QN9A 3R24A 3GDOA 1MX1A 4L75A 3MWLA 4WMLA 1ZN7A 2GCIA 2BBWA 1CZOA 2J3LA 2R4QA 2WTUA 2VKQA 2WJJA 3HNOA 2QQ5A 1HDZA 3VR4H 3HUTA 3M7IA 1R16A 4R9RA 2ZZNA 1O94A 2DTEA 3C1OA 1KPGA 1O58A 1TQ6A 3DL4A 3X1ZA 2FRXA 3U1TA 3HXMA 2QD2A 1CP2A 4N7MA 1P1BA 4TL7A 1CDZA 1XOIA 1NWHA 2AKYA 2B98A 2P2GA 4D8UA 1KQGA 5AW2A 1B1AA 3G0GA 5DLYA 2XGGA 4QOSA 4X61A 1GG9A 1FP7A 2IX9A 4ZVOA 2CHEA 3BXFA 5HCNA 4N5MA 2RHLA 5EEGA 3T5PA 4XWKA 3HY3A 1GRRA 4J4BA 1BE0A 4ND4A 4Q1VA 5JJCA 1U63A 5BQXA 1P73A 4LRQA 3USES 4B34A 1HYHA 2FWNA 3GEIA 4JP5A 5CNKA 5GM2A 1A69A 4YUZA 1QANA 4Y8VA 4KRFA 3B5JA 3IQZA 4TYYA 2J3QA 3A0UA 5FLKA 4KQEA 2GPWA 2IHNA 4RJ2A 2VDUE 5A71A 4FCWA 1YZGA 4MZXA 2OBLA 3GUYA 2P5SA 2HR1A 1NFQA 4E5MA 2UZ0A 1S01A 4OO3A 3TQFA 3QWHA 3AZPA 4CDNA 2GK6A 3B9QA 3UO8B 1JJAA 4NS4A 3QEBZ 1HT1E 2D2VA 3NR2A 4ZVUA 5F77A 3E5HA 4CMBA 4JLOA 1RD4A 1DAFA 1L1RA 3G7SA 4HWGA 2H1OA 1HWYA 1NXTA 4JP8A 1ND5A 4KN8A 3ROQA 5L45A 2RGAA 3H1PA 5A05A 2A30A 1J5EB 1HORA 1G4HA 3WIOA 4BVKA 1N5RA 3T12A 1RPNA 4NMWA 2M6LA 2J4DA 4DMKA 1E9RA 1EWYA 2HAEA 2XQGA 3EULA 3H9JA 1TTQB 3LYAA 4FT2A 4OQLA 3VM6A 1I7DA 1R2QA 2A1TR 3NEAA 3FF4A 3W9BA 4D4MA 3U4MA 3AR9A 1W25A 4B76A 4HFJA 1VIYA 2HU5A 3AJAA 3EPRA 5JZ9A 3X1WA 1Z36A 1KVTA 1XXHE 3H9BA 1MPXA 4HTFB 4LZZA 4AMUA 1SKQA 1MT3A 1V9SA 2B0CA 2BZGA 3S27A 4BNGA 2VAXA 4JH0A 3K2EA 4FYHA 3UWDA 1XZNA 3ZH2A 1VJGA 3DKPA 5L3VA 3K30A 2G1KA 1XMJA 2E4YA 3KO8A 4RGQA 5EFZA 4CKWA 1YR2A 3TR6A 5B2ZA 3V1LA 3WWCA 5GGXA 4W5HA 3GLFB 2D1RA 2NMVA 2YHBA 1KQ3A 2LPMA 3DPSA 1EK6A 2OBBA 1C1DA 3DUWA 1P9RA 3TI7A 5IJ9A 1KS2A 5IU6A 2ASEA 3PUWA 1F2UB 1QZXA 4ZT2A 4DRXA 1TIBA 5K8VA 1NF8A 1W4CA 1E5QA 2O3QA 1BWPA 4RTQA 2P2SA 1U0BB 1UIMA 1KC1A 5BWNA 4Q19A 5H02A 5A7HA 3R7SA 1QYCA 2WTMA 2X0EA 3G8YA 4F3RA 4OJTA 3ACBA 3H17A 1R10A 4XDZA 4G0MA 3FJOA 2OB1A 2YC4C 4YLEA 5HS6A 5HFAA 2PNJA 3JQAD 1I2MA 1FUKA 1VJRA 1KZ1A 2RK6A 1YUNA 2WE7A 1CUGA 2GZ1A 4Y98A 4MVJA 3M81A 4OQFA 2A9OA 1YV9A 2AFIA 1WX1A 1NQOA 1G8YA 1Q21A 2I55A 4MHOA 4RK7A 5DI3A 3RT1A 1Q1ZA 1U11A 3A3OA 1R8QA 3FRIA 1EVQA 1WXIA 4ANFA 2CLHB 2XF2A 3A9WA 2XB8A 5DRTA 4ZVPA 1M5UA 1U9JA 3OPYA 5H3LA 2JH8A 3A1WA 4P53A 3EQ2A 2BGNA 2H4WA 2IE8A 1QGED 2AT1A 2ZITA 3WYFA 3F6SA 1Y8QA 4GOXA 2NZXA 4K88A 2GZ2A 2WJAA 4WZAB 3VR1A 4D9KA 5KX5A 4JT9A 3H13A 3UV7A 3KPVA 2EGHA 3LQ4A 4BL5A 4IBOA 2ZWOA 3LL4A 4G0OA 1OTXA 1WDMA 5E6UB 5FA8A 3WK6A 5GVSA 3EBOA 4LFAB 2HK6A 1KFBB 2RAUA 1NUSA 2VJYA 5HIIA 2C97A 4XWOA 1DQNA 1E0KA 2PGJA 3ITNA 1TU0A 2P2CA 2WKWA 2REOA 4RCYA 3RWBA 2R1TB 3W2FA 1QFXA 3ICWA 3GFVA 5TT1A 5F9HA 5F7ZA 2IDMA 3O4FA 1PYGA 4CLDA 2QRVA 5AXBA 1SNYA 5JSHA 2GK4A 5HKKD 3IBCA 4LRTB 5B7PA 2EX1A 2Z6QA 5D01A 3GUCA 4CKXA 3VHXA 2FQQA 5AOBA 4PM4A 4EFNA 1NT4A 4EHNA 2EEZA 1QQAA 1YS2X 2F3QA 3EVCA 5F2EA 3HBNA 3BWCA 2YWXA 4JLKA 1LS1A 1Y5MA 3CLVA 1GTL1 3HBAA 3ZLVA 4B09A 1WBBA 5FP0A 2YQZA 2EBUA 1X7DA 3NHWA 4OP3A 1IBCA 2I4IA 2OUKA 3WYDA 2XA2A 2C2KA 4YNBA 4EY5A 4ABTA 4IXDA 1NMZA 5EGNA 1QM5A 3F9CA 5I7WA 3NMUF 2HA5A 4HFRA 3PUKA 1GZHB 4IVRA 4UQPA 4DLKA 1KWKA 3D02A 1ONPA 1QO0D 2ODTX 1ADFA 1AS3A 3BK2A 2R8BA 1Y8AA 2H0AA 1AKTA 2ZRKA 3R0QA 1XJQA 1V1RB 1Y33E 3A4TA 4CT4B 3LVBA 5JTUA 4B33A 1W2WB 2VYNA 5JNRA 1T2UA 2HRCA 3FMIA 5T6MA 3TSYA 1CW2B 3PQDA 2QI9C 3P5BA 3SJBA 4CGZA 4N41A 1J25A 4FYKA 1LW6E 3PNOA 4GVXA 4U1RA 4UTNA 1NZDA 2YUIA 3FZQA 4DWVA 3BT7A 2JZCA 3SQWA 2APJA 3D0RA 1FRQA 1UXIA 1A5TA 1REQB 1USIA 1L7XA 4BZZA 2PLRA 1NASA 2XDYA 3BORA 2CDRA 3MTEA 2NQTA 4C43A 1Z5OA 3EEBA 1MIOA 4RWEA 4PCAA 4HUQB 4PPFA 1WA5A 1J8FA 2BYTA 3KTAB 4B48A 1NBWB 1MP0A 2UYGA 1KJIA 2QS9A 3GJ3A 1DQSA 3OSUA 3CX6A 4HEA1 1PJ4A 3HNRA 3KHSA 4MUJA 4QXRA 4YN3A 4AUNA 3GCDA 3RYCA 2WZDA 2HA0A 3PB3A 3KXKA 3O4RA 4UCXA 3KDSE 2O4CA 1IDOA 2M9MA 2GFIA 4ZARA 5A3SA 2PHZA 4YJDA 3KOUA 2E3JA 4CQNA 3ND6A 1BVRA 4G86A 1PK8A 3QJ5A 3JVVA 3JQCA 3SEFA 4RJIA 2FZEA 2ZRQA 2ZWIA 4DABA 1VHJA 1E2PA 2BEUB 5BQFA 4PZEA 5JWRA 3PWTA 4N82A 3IDSA 4S04A 4CDGA 1I94B 4IF6A 1DQZA 1MH9A 3C6MA 4GC5A 4HGNA 1QRSA 2J5KA 4IUCS 4KSCA 1JMKC 1ZM3A 2CXUA 5MF6A 5AW9A 2VNAA 2QJFA 3SICE 1RCUA 4TMXA 1FS5A 2IS1A 2P2DA 3KALA 5B55A 4TOIA 1GGEA 2W2VA 1FYXA 1OKKD 1CJKC 3C5HA 4JX9A 2EHJA 2A9RA 4O4LF 1OIVA 3NC0C 3I9MA 1GV1A 2FUEA 4B3BA 1KJ9A 1PT7A 4JT2A 5H70A 3NW9A 4L8VA 2X1MA 3UFXB 1OMOA 3FOFC 4G0VA 2QAIA 1DO0A 4F84A 3L6BA 4N65A 3GN2A 4ZZ2A 4DG5A 2VPXA 5BRAA 5GINE 3IBTA 5FOWA 1NJ5A 1GGFA 5A0TA 1CF4A 4JBWA 2RHDA 4JUDX 2JGEA 3WFZA 5KVCA 3V7NA 3ZDXB 3V8BA 5JH7A 3AGQA 1T25A 1K88A 2A67A 3VOSA 3C85A 4XDYA 3UJ9A 1QHEA 4OQXA 1OOEA 1HGXA 3JD1A 1Y63A 5E8RA 3TNDA 3MJEA 1PNTA 3CUTA 1W5TA 3Q6MA 4AG6A 1JPNA 4Q16A 5LLSA 1W9MA 2BM1A 1DIHA 3OQJA 2AHOA 1JMYA 4J1NA 5DGDA 5FPHA 2REQA 2X9VA 2QD1A 5J1TB 5IAGA 1M10A 3ZI4A 3VU1A 2W71A 1HDXA 3L0DA 1BH2A 3O4GA 4WDRA 4FSXA 3L07A 1FDUA 2OCXA 2W00A 4MAAA 2H51A 2J3DA 1IN6A 4I4CA 4IUDS 5E2BA 3U81A 1A9QA 3QKUA 4WH0A 5EQJB 2BFFA 4YCNA 1X7YB 2ZW9A 2ZBGA 3EYAA 4UMDA 1OFHA 3ERCA 2FQWA 2VCYA 1UMKA 3PLAE 4UVDA 1Q7TA 2WU8A 2OBYA 3FPKA 3I6YA 2JLWA 3QVTA 1E20A 4R51A 5GVRA 2JFBA 1GTG1 1YBFA 1WD7A 3EVFA 3WKEA 2B5WA 2A0KA 3KT6A 1KO1A 1XPOA 1RQLA 2O23A 3DT9A 1L7NA 3FW1A 3ZD7A 2XITA 1GWNA 2R48A 1DBVO 3KQTA 2F7SA 4D4HA 1TADA 3UVEA 3KQSA 5A4JA 5I48A 5DO9A 1DAPA 4GX0A 4YCDA 1GSOA 1LPMA 2BM0A 2W0SA 5B6IA 5TQJA 4TTVA 2AJCA 4ID3A 5LNK6 5T4HA 2LDXA 3CPHA 4LC1A 4P9NA 3RTBA 3MMSA 1V3VA 4H31A 2XCRB 4ZI5A 1YOBA 2AOTB 3IEXA 4MNTA 1EX9A 5KOHB 2J3EA 2VDKB 4G9BA 4BKPA 4MKRA 4OUKX 2WG1A 4C1BA 2HI0A 3F74A 4CMIA 5K9ZA 1DTWA 1WNFA 1ZN8A 4HAOA 4O33A 5AICA 2BMEA 5CBKA 2ZSJA 3F7NA 3EF1A 3VTKA 4Y30A 1WWKA 3VNQA 4ZEXA 2OD2A 4HAXA 2GEVA 1T36B 2GVZC 2QLJA 1C3LA 3V2HA 4R71A 2V96A 4RSRA 3ZU6A 1ZOPA 3TDKA 5TGTA 2OFWA 4DOMA 1AKNA 1NJ2A 3ZTYA 4E07A 5AKYA 1OXMA 3FZNA 1A7JA 2XTNA 3AU8A 1SO8A 3DZIA 3MM4A 2Q4RA 4LAFA 4L3OA 3D4PA 3NYWA 4YRLA 4QULA 5IN4A 2V5AA 2IPOA 1QHXA 2OO5A 2W4MA 2R87A 2QX4A 2CUKA 3PD7A 4XM1A 3T52A 4G0QA 4JSTA 2GSDA 5K6TA 1KAHA 4CLRA 4PG4A 2PUBA 2Q3DA 3PPXA 2OV2A 2YICA 3S1AB 1RJ9B 4NMLA 2YVQA 4Y0VA 5LB2A 3ZWDA 2E82A 4WA8A 4JYMA 4PQEA 4F56A 3KOMA 3CW2A 2IIVA 1Y4UA 2Q3BA 2WIJA 3I2YX 5HF5A 3BTOA 3UUWA 5DJ5A 3TLEA 2QMZA 2R8OA 2YWBA 3OPXA 4QJIA 4N39A 4G37A 2NOAA 2RCNA 3O03A 4IUBS 1MC1A 1S2NA 1XWWA 1I9CA 1PGJA 1FFGA 1CCWA 2ETVA 1L4LA 3PRJA 1U4SA 1JHAA 3PR3A 4HMQA 2O2HA 5FJIA 2E6KA 3WYGA 2A9FA 2C8VA 1E92A 1P1RA 2LXNA 4KE7A 1NTOA 2WMDA 1ZEMA 1KJJA 1N5KA 2NSLA 5LXTF 4ER3A 2ZRIA 3HWWA 4P4UA 1Y7IA 1R5OA 4Z2AA 2Z2KA 1E66A 1EG7A 5H4HA 3VNSA 4AKSA 4Y0NA 3L4JA 1YA8A 5ALSA 4HJRA 2A8YA 2JZOA 1ZRMA 4B6OA 1E64A 2OO5C 3GJ7A 4G5SA 4GYKA 4LHYA 3ASYA 4MKZA 2O3RA 2IITA 3FNGA 3I01M 2PUJA 1C14A 1GZ6A 2I2CA 3I42A 4POAA 3WXBA 4O4JB 3BVPA 5EE0A 1VSUA 5A06A 4ES6A 5IM4A 2PS9A 1JEQB 4WLVA 1G60A 3VBEA 4QSHA 3HADA 2OZEA 4FFBB 2VJDA 3I5UA 1T2AA 3K2IA 3BTSA 2CJPA 2MSCB 5JZSA 4TSFA 1VIAA 4DPMA 3FJYA 2GTIA 5J59A 4Y2UA 3FE2A 3KSBC 3VVMA 4GMFA 4R9SA 4BJHB 5IDYA 4W99A 1ZM9A 4R1TA 2YJNA 1DEKA 1XA4A 1V37A 4XJXA 2PV0A 3N7TA 3PENA 4QDUA 4P1ZA 3WK8A 1ID8A 2KJQA 4BFYA 3H5VA 1R4AA 1J7JA 3KOWA 1GR1A 2JLAA 5CHYA 5J4YA 3O3NB 5F4BA 5C2JB 2EP8A 4HDMB 2ZYTX 4C04A 3RTEA 3WGJA 3ZWMA 3HP1A 4ALKA 4YXWD 5AI4A 4PVCA 4W5JA 3HBFA 4MDYA 5AW4A 5JXJA 5L4LA 1AC5A 2GPTA 2NU7B 2QP9X 4DQVA 2IKQA 4GLBA 2NUAB 4EEZA 3CUKA 1ARZA 2XTMA 4ZALA 4RTLA 3UGJA 1RSZA 3GOQA 2HBQA 4RMHA 4DCPA 4X95A 2GN8A 4Q05A 3OLVA 1PO7A 2AWNA 3FR7A 1K7YA 3JARB 1SBQA 4V3BA 3WHKA 3TQSA 1IIBA 2XYVA 4YUWA 4BATA 4FZ3A 1T3SA 3HDQA 4PZZA 4RZ3A 1XZFA 3ELDA 3ZE1B 4EHDA 3A6FA 4ZCRA 3KT8A 4UULA 2C9BA 2J9XB 3ZIAA 2QM7A 2O19A 2VNIA 4UAUA 4MWSA 1F6BA 2TS1A 4U8HA 5LMUB 3PVCA 2EERA 1L5MA 2ZE5A 2HQBA 1TZMA 3KU4A 3OF2A 1L1QA 4R5MA 1C7ZA 4PGGA 5A6SB 1ILWA 4ZVNA 3H5WA 1KMCA 4M9RA 1GP2A 1K6XA 3U7FB 1OXTA 3C3YA 1UL1X 4FK8A 2QXYA 1I2AA 1ZN2A 4KVZA 4Q5IA 3ZWAA 3A7DA 1LLFA 1Q83A 1F17A 2FR1A 1VCOA 3I1FA 3IQDB 3PDUA 1UPCA 4CL3A 5BUQA 1L5ZA 1OFVA 1TU3A 3LUJA 3RDPA 1LUAA 2ZJOA 2WINI 2WT4A 3FTNA 4NQZA 5LB4A 4A36A 3R9IA 3S2SA 1ENYA 3EARA 3IA2A 3T7KA 4A16A 2FPGA 4BUJA 3RYCB 4IIFA 2IOYA 4R98A 2AK3A 1C4WA 1TRKA 1XC7A 2VN8A 3AJDA 3HZRA 1YOVB 2PUDA 3KG2A 4J2OA 3ICQB 2I3BA 1XZJA 4Q34A 3ESDA 1NQ5A 1PUJA 2OK8A 1GHTA 1VFNA 2BCEA 2VCHA 4WNAB 5FWYB 1EA7A 3OZ7A 2Z83A 3W5AA 1AF4A 5KDLA 3ABQB 1E96A 1ORDA 3AOGA 4GR5A 2IYQA 2Z0MA 4UJ5A 5TPZA 4GPZA 4RYDA 3AVWA 2J0SA 1U8EA 1EGQA 3HDJA 3L8ZA 1CY1A 2Q5EA 2FRVA 2HWWA 3HEBA 4MRRA 4MRAA 4YCLA 3RU2A 1KMHA 1FF9A 1E7QA 4I5IA 4K28A 2J3IA 2D1TA 3U3OA 1P2VA 3K92A 1BHQ1 3BILA 3LHSA 4ZPJA 1HH4A 2I99A 3E1GA 3EFBA 2BD0A 3GD7A 3K9HA 2WV9A 3G13A 5ECDA 1AB5A 1ZM2A 3HKEB 3IVXA 4JSYA 3U3XA 2IHBA 1J6UA 1U1EA 1G8GA 4Q4JB 2FPWA 4LHEA 4FOPA 3GLIB 1V39A 4I4TB 2BP7A 3JVEA 3R0IA 4RL4A 4QGSA 1JILA 5F21A 3WL6A 1D6MA 2PRYA 4TUYA 2ISSD 2PEZA 3I8OA 4CV3A 1Q7GA 2HJ9A 3L4BA 3OFND 5AVJA 2V6GA 5BQ3A 1J8YF 1EBBA 3W6OA 2IUEA 2H2GA 2H2AA 1DCKA 1QPZA 4Q37A 3L7CA 1QC5B 1EIWA 1R6BX 3WNCA 2OYSA 3KPYA 1TYBE 4Y2XA 1GOTA 5JDCA 5CCBA 2CDCA 2RHJA 4P38A 1JU4A 3VPXA 4AYTA 3LX4A 3AR5A 4V0RA 2UZAA 2AFHA 4X90A 5K6AA 3E7FA 1U3GA 4RPIA 4XD7A 5E7JA 4DXDA 2F1RA 2P0EA 2IA5A 2YWDA 2PZBA 3DHEA 3OAAD 2VHQA 4FX5A 4F8EA 2XUQA 2EQ5A 1XK7A 2IXDA 5C7IO 4EY6A 1KXZA 5DWVA 5LP6A 4RABA 2Z5LA 3HJHA 4I3HA 4PZAA 4ZYWA 4V0MA 5BN5A 3GVXA 2OGTA 1E1LA 1LVHA 3JY6A 5D3MB 3QF4A 4C6SA 3UJHA 4X6XA 1FX0B 4M9UA 1YZVA 3RSQA 2OO3A 3Q5EA 4B6SA 2YXEA 4N9WA 3WL3A 4ZTZB 5KNDD 3F47A 4D2IA 3GY0A 3ZWCA 4ZRMA 3L4BC 3VOAA 1NXQA 1SG6A 4NRDA 3C1UA 3IHKA 4K9PA 4DF3A 3ZBPA 3ORHA 4HMOA 2XMPA 4LQLA 4G4SP 5EE5B 4EBBA 3B48A 1FYDA 1ORIA 3QNUA 2Z3ZA 5LPNA 4NQRA 3RSLA 5K8CA 4IJUA 1S2GA 4DJ5X 1XA0A 1IBRA 4D96A 3AB8A 5JDCC 3RS0A 1PJRA 1LPPA 1EP1B 1SPXA 2HA7A 1L8AA 2Q3CA 4GI7A 1AE1A 3KQQA 3NYQA 1IHOA 4YJ2B 4ZO6A 4RS3A 3VOBA 1ULSA 2P68A 4DR1B 2QV7A 2P62A 4F3YA 1G7CA 2I2AA 1AKMA 3AFMA 1WHSB 4TVOA 1FNNA 1ZOLA 3CMMA 2OLJA 4D41A 2JD2A 3IDOA 3Q7PA 1M33A 1KJWA 3JQ9A 5LP6C 4QU8A 3LKZA 3ZZTA 4M83A 5KKNB 4YDQA 1RXVA 5COQA 1PCXA 1XZLA 3UTDA 1TM5E 3H0EA 4UE3S 2PPVA 4PO1A 1AX9A 3DFKA 4L5IA 3N2KA 2PRIA 4RV4A 1FXUA 2GBIA 3KZVA 5BSTA 4QHTA 4INOA 3H5IA 1GA6A 4RM3A 2HK7A 4MB6A 4BJ3A 4ZOLB 3T1OA 1EM6A 2J09A 3ZU2A 3EMKA 3GA7A 3O1LA 2O06A 6NULA 3ICPA 4WD3A 4GI2A 4ODIA 2XLCA 3PFKA 3AF5A 3QI2A 1ZI8A 1D4AA 1MAHA 4NMXB 2NXCA 3ELUA 4H1UA 3K0FA 4GAEA 4R31A 4JI1B 2WNIA 4MVJF 4J0CA 1J2JA 4IOJA 4ZOEA 4ZCPA 3RYIB 1E60A 4KODA