5GGYA

X-ray crystal structure of periplasmic desferal binding protein fhud from vibrio cholerae
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
267
Chain Sequence
HMRVVVLNWDLLEQVLELGIQPVGAPELSSYVQWVVQPEVPSSVQDIGTRTEPNLEKIAALKPDVILAAGPQQDLLATLGRIAPVVYLPNFSEQDNAAQVAISHFKTLATLFGKEAVAQQKLEAMYARFSELKASLQHAFGDTLPAVVTLRFANPTSVFLYTENSTPQYVLEQLGLSSALPQPPKEWGIVQKRLSELQHVEQGYVLYFLPFAEEKKVQKSVLWRAMPFVQAGRVNSVRPVWSYGGAMSLRYSAEAITESLLAVAPQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of Periplasmic Desferal binding protein FhuD from Vibrio cholerae
rcsb
source organism Vibrio cholerae
molecule tags Transport protein
molecule keywords Iron(III) ABC transporter, periplasmic iron-compound-binding
total genus 88
structure length 267
sequence length 267
chains with identical sequence N
ec nomenclature
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5ggyA01
4UDOA 2OV3A 5KOJA 3UJPA 4TKVB 5M2QA 4CL2A 4BBPA 1M1NA 5GGYA 1N2CA 1G21B 4IRMA 4HMPA 4WZAB 3PSHA 4WESB 1M34A 4FILA 5GGXA 1N4AA 1G20B 1ESZA 1M1YA 2RG7A 4FNAA 3MWGA 3R5TA 1MIOB 4DBLE 5KHLB 1QH8A 4PM4A 1KAHA 1K0FA 2XUZA 2AFHB 2Q8PA 3MINA 1K2VN 3K1AB 4WZBA 5FLYA 5M29A 1XVLA 4TKUA 2OV1A 5JPDA 3AEKA 4WNAB 1L5HA 2PS0A 4OXRA 5HDQA 1FP4B 2XY4A 2YNMC 3LHSA 1QGUA 3AESB 4XPIB 5BVGB 5BVHB 1H1LA 3AETA 3NU1A 2QI9F 2R7AA 2XV1A 4ND8B 4PAGA 5B58T 3CX3A 4N01A 2R79A 2PS9A 3ZK8A 5KOHB 3LI2A 1QH1B 4H59A 3U7QA 3BE5A 3AERA 4WN9A 4MLZA 4UTOA 1G20A 4OVKA 4HMOA 1K7SN 1PQ4A 3AEUB 3TNYA 3TEFA 3AEQA 1N2CB 4OXQA 4MO9A 3HJTA 4HMQA 5JOQA 4INOA 1L5HB 4MX8A 5JJ5A 4HN9A 4FKMA 5HX7A 2XDQB 2XQVA 1M1NB 1M1YB 4NNPA 3PDIB 4WZAA 2WHYA 4GICA 5KOHA 1G21A 2MINB 5CX1B 4M7OA 4WESA 1N2ZA 1MIOA 1QGUB 3ZK9A 5AFSA 5BVGA 1N4DA 3EIWA 2XH8A 2PHZA 4ND8A 5M3BA 2AFIB 3HH8A 1QH8B 4G09A 2OGWA 1TOAA 2Q8QA 3MWFA 3TLKA 1M34B 5KOJB 4TKVA 3ZK7A 3AEUA 2AFHA 3U7QB 3ZTTA 2O1EA 1H1LB 3MD9A 3R5SA 4MDYA 2PS3A 3K1AA 4WZBB 3ZKAA 5I4KA 3PSAA 3MINB 3AEKB 3AESA 1K75A 4WNAA 5BVHA 1PSZA 5JG7A 3G9QA 2OSVA 1FP4A 3AEQB 3BE6A 3MFQA 4FI3F 4LJSA 4UTPA 2PRSA 5M34A 2MINA 4TKUB 5CX1A 4WN9B 4K3VA 3EIXA 4B8YA 2WI8A 3AERB 4G07A 3AETB 1EFDN 2AFIA 5CR9A 1KARA 4LS3A 4INPA 3GI1A 2M6KA 2YNMD 3HXPA 2XDQA 1QH1A 1KAEA 2M6LA 2X4LA 2ETVA 4H0FA 4UDNA 4XPIA 3PDIA 4NNOA
chains in the Genus database with same CATH superfamily
3W3AD 1NYTA 1ZIDA 5F3WB 3PCTA 2NUPB 3AY0A 5DWQA 4IKPA 1X1EA 3IQZA 5E3JA 4Z0NA 4E09A 3U7FB 1K4MA 2MIIA 4UUBA 4O2AB 2QQ0A 5JATA 1ILEA 4AJNA 1Y7TA 4I55F 3OCYA 1OR8A 4BO1A 4NU0A 1M6NA 3HXTA 1JVSA 1O95A 4X20A 4DBLE 1DAOA 3GR6A 3OQ1A 3HBMA 5TQJA 2N0SA 4LZJA 4ZXPA 5I7RA 5KWJA 1R5JA 2WHXA 3CWCA 3PXAA 3WL8A 4DAEA 3O1IC 5EA2A 3GLIE 3ET5A 4L07A 4GWLA 4IIJA 5DWVA 2NTYC 2QLJA 4Q05A 3RUPA 1PV1A 1G21E 1ACMA 1JLHA 3MJVA 1RU3A 4URFA 4DQDA 3WGIA 4H0NA 2VHYA 4CEHA 1DBIA 1TUBA 4YCCA 3QLTA 4I8IA 4BP9A 1UFOA 3EVEA 3HZRA 4BNLA 5JPDA 1WXWA 3G88A 4FSDA 5I7OA 3DZJA 4ESOA 4QWMA 1SBNE 2HHLA 2COUA 1JSRA 3Q10A 1DJMA 1RLIA 3AU9A 2WMYA 3B7PA 5L4NA 2Q9UA 1H6DA 4JGBA 3ZUGA 5JISA 3OPVA 1NKSA 5CURA 1W47A 1Y89A 2G0AA 5EIBC 1Z34A 2AJLI 4TXHA 3UHAA 1YJXA 3A58B 4G0PA 4GG1A 3V55A 1RQXA 3DZFA 3OA2A 2DF8A 4FMPA 1JTEA 1TC1A 3RK4A 5DOVA 3MCUA 4LEIA 2IY9A 4EW3A 3ZC3A 2HA4A 1NUSA 5FUWA 2ZB8A 4L75A 1W5SA 5BSRA 3I9LA 4GS5A 5I7SA 3RYCA 1QOQB 2D1YA 4XR4A 3TVDA 4XIYA 3SJ7A 3AVPA 7ABPA 1E4EB 1ZN7A 2G4VA 4Q93A 3COJA 4B17A 2Z56A 1N2OA 4EGAA 1O58A 3EPLA 1DIHA 4DJ5X 1VSTA 1EFCA 1S2IA 1DU4A 3I8SA 4G84A 1YONA 2GZDA 3WRXA 2IUSA 2BMFA 2H29A 3QVOA 1DCTA 4GKKB 2NP7A 1UBMS 2RHCA 2X86A 4C14A 2F59A 2VT6A 4Q03A 4F96A 2OB2A 4N7RA 4CYMA 5KTPA 4QUGA 2Y1DA 4O2RA 1UMCA 2JLWA 2OLKA 4MKXA 1Z7EA 3WBFA 2GJSA 4OUDB 3OLYA 2X7JA 5YASA 1E94E 2ODNA 4TTPA 3J81k 1BVUA 1MRZA 2F1KA 2YN0A 3RC7A 3WO0A 4MUJA 2BFOA 4URUR 4ZAXA 5EKXA 1A0OA 2G5PA 4ANFA 5JHGB 1ZOOA 1YTUA 1DFHA 3ACBA 1FX0B 3LDUA 3NUZA 3ABIA 3ROFA 4AZ3B 2VQ6A 2E18A 1PG2A 2P9JA 2Y1OA 2ZIXB 2UYOA 3AZPA 1EVYA 1NN0A 4GWGA 1E2JA 2FX3A 3BH6A 1ULSA 2WKQA 1IVSA 3EOBI 4H17A 4G07A 2IV3A 4F85A 3PXUA 3PJGA 1YA4A 2R66A 1IHPA 1L5WA 3GJZA 3ZV3A 4G6ZA 4CQLB 4UXIA 1KBZA 1V9LA 3FJ1A 1B6TA 3EVDA 4E4TA 1JEEA 1G20E 4QJ4A 1WJGA 5AW3A 3SI7A 3DG9A 1R5NA 1B74A 3UFXB 3VV2A 3RTAA 4DMLA 2HJGA 5L3SB 3RYFB 1T10A 2FG7C 4D6YA 4JI2B 5LZ4A 4KXFB 1NZFA 2BELA 1X80B 2GCIA 3D8NA 3DZKA 3D1LA 5EXDA 5AUPB 4FS3A 4KE7A 4PLPA 1E7SA 1IJBA 1S9HA 3ZXSA 3P9QA 1AGNA 1VFPA 1FUEA 2ECQA 2HIMA 4M0PA 3LUAA 3HKBB 4JHLA 1N0HA 4N65A 4YDRA 2ATXA 3IR7A 1VXRA 4FFOA 4ZMBA 2W98A 3DP9A 3JCZA 2I2BA 3RQSA 3KYCB 4WKOA 1Z6GA 4GOJA 4Q4HB 4V0QA 4IHJA 4GR4A 3HABA 4ISCA 1OHHA 2FA9A 1N33B 5K0LA 3RV4A 4LSMA 3WC4A 2BEJA 2BFEA 2YHUA 2Q0XA 3LY8A 3QXCA 5REQA 1D03A 3VTZA 4E88A 3V8BA 2QN6A 1BQ3A 2NT4A 3CG4A 2VPXA 1NZDA 5L3QA 2XF8A 2DFVA 2RHOA 2OHJA 1UKYA 3GEEA 4OU4A 1GPYA 1PEDA 3W2TA 2AR7A 4DC0A 5BQ5A 5K2OA 1Q0TA 3HR7A 3GELA 4WXRA 1M2KA 4XQ0A 5G02A 3KOYA 2GF9A 5KDLA 3RUHA 3GYBA 1NU6A 3W2IA 2FSVC 5IDXA 3YASA 4ZVQA 3GPBA 1ID8A 5CRIA 3K9NA 3LUPA 3NC0C 5G4KB 3UMYA 2B7CA 1L5ZA 4XSVA 4UREA 1TMYA 3IDFA 3KEGA 4LV6A 4LTMA 1V8DA 3Q7TA 3UOAB 4H7EA 3V4OA 3QFTA 4ZJUA 5GVSA 5M04A 1NUUA 2ODQA 3GH3A 3QH4A 1G16A 3K4QA 5LUAA 1QV7A 2YUTA 4NMXB 2J8ZA 4TPKA 4JB8A 3RASA 2BM9A 3TFQA 3HJAA 1M1NB 2YRWA 4PVCA 3VBCA 3HZZA 1WCIB 1IJFA 2BEVA 2P4HX 3AIIA 4OXKA 1BJKA 1C9YA 2IIBA 4YGYA 3X2SA 1LPSA 2R1TB 3RKUA 3U3JA 4MLCA 4WV3A 2QRJA 4MLDA 4CEJB 3A6ZA 1AH2A 2YV1A 2BFAA 4CHGA 5DWDA 5IBPA 1Y3BE 3I64A 4LECA 4F56A 4Q9KA 2EZ9A 1PHRA 1NVAA 3ZDAA 1TEHA 1QTQA 1D2RA 1OXUA 1Z8FA 2JIMA 5HR5A 3Q7SA 1YL5A 2VBGA 2XYQA 2IYQA 1W85B 1L5NA 3ZTWA 5KOJB 1IG0A 1U5BA 3RS2A 5AKJA 4QQFA 1VLQA 1XRQA 4IRUB 4UCXA 1SKYE 3F5SA 3HLTA 2WOJA 5EIFA 4B0PA 4HXEB 2H48A 3BFPA 5DJ5A 1QJCA 1KJIA 3HPRA 2RBKA 2O5CA 1E60A 4WUVA 3WGZA 3QW2A 2JJ2D 4B80A 2HMSA 2AW3A 2CB9A 5JXGA 2QE7D 4MV9A 2XE4A 3AIOA 4XXHA 4C1NA 3ZGZA 4IZOA 4OHRA 3GDHA 3TX6A 4ZOCA 1P18A 2OHGA 4ZODA 2NSJA 2PT7A 3ZHXA 1MG0A 3UANA 2DWPA 1O6ZA 5J58A 1D4AA 5JH7F 3ZD7A 4ZPXA 1X1CA 3CR3C 2OORC 3T5GA 2FFQA 2DWCA 4AFNA 4DQXA 5M5BA 5D85A 3D3JA 3O9VA 3W5BA 1JFSA 3C7DB 1WW3A 4JELA 1XKLA 2P6MA 1VMDA 2F43A 3LZDA 5L3ZA 3H1GA 1JDJA 2FG5A 2ZREA 1F6BA 4LYFA 1UJ6A 4EY8A 4H0CA 2A84A 1XQWA 3CE9A 1N75A 3G5TA 5EQJB 1R0BA 3CNLA 3MCTA 3QLUA 4FYXA 4Q9NA 2LUOA 1P1BA 4YDHB 1YZLA 4Y98A 1DJOA 3KVRA 4TQGA 1SU7A 3W8RA 1G7RA 1VHLA 1BQEA 2CFOA 3ILYA 3R6LA 1KVQA 2FXIA 4IG9A 5AI9A 3VX3A 3VR5A 1C7ZA 4MP8A 2YQ5A 4P0PB 4OH7A 1ESZA 2M32A 3UTCA 3MUNA 2XT0A 5JJIA 3KQHA 1LSJA 2FY8A 1SPBS 1ZK1A 5D3MB 4L95C 4E12A 3GC6A 3NM5A 4URYR 3SQMA 1DBPA 3O6VA 3K7EA 5I47A 4URZR 1F0PA 1GSOA 4BO0A 3MWJA 4JR2A 1HE2A 4YT5A 1JDNA 1W8IA 3PHIA 3UJ3X 5C80A 1UINA 2VDMB 3T7TA 1M5RA 3HY4A 3PLRA 1KE1A 2QYHA 4EZBA 3FI9A 1WSBA 1NQAO 3AEKA 4N12A 2D1RA 2ADFA 1R4MA 2D4HA 2JAHA 1C81A 1VHTA 3B51X 3F96A 4LYHA 2OCAA 2KLHA 4KQWA 1F0KA 1LXCA 2A0WA 4K88A 1CYEA 4QX6A 3OX1A 3V3KA 1YUMA 1SA0B 2C0QA 2C8VA 3F5QA 1IY0A 3AW9A 5KYUB 1P5HA 1CUVA 2VRCD 1LTQA 2Z3VA 3IQGX 3KP1A 1KSFX 5HRUA 1XPRA 4G9BA 1MC5A 4RD4A 3V6LA 5JAIA 3A1EA 4CI0B 1R8SA 2DLNA 1YBFA 3HCEA 1WETA 1OA1A 2FMXA 4TVBA 4F8YA 4IQ8A 4L4ZA 1SD1A 2OYSA 1UDWA 4YJDA 2NTVA 5K0EA 3ICQB 3A4MA 2OP1A 1JHOA 4H3VA 4OATA 3CN7A 4G4GA 1I3CA 2Q7DA 5DRTA 4TS9A 4L50A 4XB2A 1KSHA 3DSRA 4OHBA 1II0A 1S2GA 4IEFB 2VR1A 3FLEA 1V4BA 2FPLA 3OWXA 1I8TA 4JX8A 5FOQA 2MINB 3D8BA 5A3QA 1U0EA 3R0QA 4L5AA 2H4ZA 1X14A 2O1SA 5A71A 1GNRA 1YSCA 3C16C 2HSDA 3DOUA 3MS2A 3QF4B 1FMCA 3D5QA 3HEBA 1DUIA 1E0JA 2JD1A 2P9TA 2OPHA 4E14A 2FJ0A 4OM8A 2IS1A 4XFJA 3N5CA 1N6KA 2FQWA 4JCOA 1AKTA 5J2TF 3R7DA 5FI5A 2X1VA 2WUGA 3AHIA 5IVHA 3TZCA 3ZU2A 1ZAYA 2X2PA 3BMQA 2O3JA 4IWNA 1V25A 3AILA 1R6UA 3HY6A 4IUDS 4LRTB 2PD3A 4QYXA 1UK8A 4QBTA 2YWRA 3VTKA 4CXMA 4DPLA 5DBHX 4KYVA 4QJ3A 3EGXA 2Q50A 4C7XA 821PA 4GGPA 2IYEA 5HF9A 5C18A 3GD7A 4K3VA 1SPXA 1XTBA 2E0IA 2QUJA 3H5LA 3WBJA 1T43A 5FI1B 1MC4A 1YR2A 3ESBA 5DTEA 4LV5B 3ZE7A 3S2UA 3BRSA 5BXQC 2P78A 3RADC 1GFZA 2ABWA 1ZL2A 2Q4DA 1T8RA 3GQBA 3QW4B 3GI1A 4LS3A 3FFAA 4AULA 5BMOA 9LDBA 1N78A 2NXJA 5DLYA 1JNXX 2VIIA 4GZLA 1SXJA 2C9YA 1G5IA 2MDTA 3CG0A 1KDOA 2FRDC 3MWEA 4RHXA 1U7HA 5D3QA 1REQA 1UXHA 4DGQA 3K9FC 4A36A 3W4JA 2I1WA 1NFQA 4G1MB 4DUGD 1W1IA 4XUGB 2RE8A 4UM5A 3BE8A 2P4UA 4JN6B 5MGBA 1VE9A 3KWLA 4BLPA 2OCDA 1K89A 5IAKA 4MUEA 1AY0A 1K8YB 1QGAA 1Z16A 2YJTD 4LMRA 2I2FA 5TT1A 2CJWA 3RDPA 4WESB 1JZSA 5EKUA 2B3DA 2QV7A 2QJRA 3EG9A 3GFOA 3IJ5A 4RPCA 2PZEA 1D8AA 4O1HA 1B76A 1D0SA 1FS4A 4YBZA 5BRJA 1M8JA 4RKYA 5B3AA 2QUKA 4EX7A 3I6MA 3LU1A 3CKYA 3LXUX 2JIBA 3UYKA 4G2TA 4L7QA 7MHTA 2QMZA 3WDKA 2ZI9A 3B1FA 1Y7LA 2B1RA 1T2NA 2E1PA 3SNKA 1DQRA 3KZ1E 4GQIA 2PAAA 4K6HA 4C7BA 1KRXA 5FTJA 2PD4A 2F1RA 4EI2A 3R0IA 1GTRA 4IX1A 3BTOA 4JVOA 4UEKA 3QOWA 1EFTA 1VLMA 3AR3A 1V3UA 1FS5A 2JFGA 4MS1B 3AG5A 2VSXA 3IAM6 4QHYA 6ABPA 1SUFA 4HXYA 4NEQA 3ZXXA 2FUG6 4I36A 1NE7A 4BFCA 2R48A 1UZMA 4ZDKA 1ZGAA 4RELA 4YRAA 3LWNA 5E1DA 2H4YA 3KLOA 3TQSA 3BXFA 3I92A 2DYKA 2PKRA 4C04A 2ZSBA 1EK2A 3C3EA 3IQEA 1N7IA 4MUHA 4TKMA 3JQ7A 2UVPB 2VL7A 4HRVA 4MS3A 4BBAA 1ZUD1 2YMLA 1KI6A 2NYVA 4ZU6X 3WSTA 3O0TA 1KZYC 1IEQA 3GGCA 1GWNA 1JIQA 1GV1A 2WKPA 3OAAA 1R0XA 3PICA 1R88A 3KNZA 4IYRA 9ATCA 1P8JA 1VIDA 2F4NA 3BH0A 3U4AA 4M8NE 4FGWA 5JWRA 1BXGA 4OOEA 1AQUA 2ZIVB 1VE6A 5IBCA 4HD8A 2VLBA 5A4JA 1RYFA 2C2GA 1AN0A 1TD9A 3ELDA 1W19A 2PGIA 2VAWA 4TWZA 4ON9A 4HLDA 2ODPA 4C7KA 5B3JC 3Q7QA 3K9WA 4NNPA 3NFRA 1JQAA 3GEPA 4YAUA 4TYMA 1TF7A 2OQRA 1U4SA 5JXJA 4AXXA 3HXQA 4MIEA 4XX0A 3EW7A 1UBKS 2AQIA 3GUHA 3WGLA 2ZCJA 1AT1A 3TLZA 2BUAA 4LGCA 2NVBA 5B36A 3IELA 3VOTA 4A2PA 3RT7A 3ZK9A 3JQAA 5A4FS 4ZAFA 5AFSA 1NYQA 2I54A 3GLFA 1F7VA 4G5FA 4A8TA 4YRRA 3PQCA 3WL6A 1RI1A 1IBCA 2HCTA 3K0KA 1Q19A 1Z26A 2A9FA 2X4GA 4K6KA 4D56A 5IARA 3VNRA 1GHTA 5BV0A 3TLMA 3B2EA 5K0CA 1PCXA 2ZBUA 4XCXA 3O4HA 3TQIA 5MHTA 3DFMA 2XYHA 1V47A 5IANA 1FB5A 5DN6A 4ETIA 3SQWA 3ZKAA 2O2ZA 2PKWA 4PW0A 4YUXA 3K9LA 3BFKA 2O8FA 2YHBA 1YRAA 4KQKA 4RHFA 4ABYA 2RAFA 3E82A 1C3XA 1CK4A 2PUHA 1NXXA 4QGSA 1BH2A 2JLRA 5JNSA 2B25A 1RLTA 1YI0A 1I4LD 1Z8NA 2AK2A 5IYZA 3ABSB 3AERB 3ETGA 2YXPX 4BO3A 2BN4A 4MMZB 1NOJA 4KLZA 4PO1A 4HOYA 3WYGA 1QPGA 2JGIA 5G4KA 1M75A 5JNRA 3WK9A 1LV7A 4HDMA 4UKDA 2YKGA 2HHHB 3PNYA 4KUHA 2EKQA 2J9FA 2J48A 1N6OA 1ECFA 4L4RA 2WAMA 4E5NA 3OQOA 5F33A 1M76A 1CF4A 4FIDA 4CFZA 1L8XA 3EFHA 1HUQA 4IP0A 4MPPA 3SYRA 4EYOA 5B4UA 5CB4A 1B8VA 1B8PA 4JNCA 5HVNA 3TECE 4Q5IA 3V9AA 4M89A 5K3AA 3HB0A 1OASA 3I5AA 2OUKA 1YA6A 5BQ3A 1QGED 1HTWA 5J2TA 4ZTUB 1G21B 1YHNA 5G0SA 5JZSA 1W5TA 4LDQA 3V48A 1JL3A 1M34A 1U1EA 2EJBA 1EWVA 1S7CA 3FROA 3MWDB 3PEEA 1S0UA 1SHZA 1GZDA 1ZGBA 2ODBA 3IKMB 1XF1A 2ADMA 1C7FA 2G63A 1U8EA 3K96A 3PJEA 4CTNA 4CIWA 2UU9B 4RGYA 4RACA 4H4CA 4NDNE 2DEUA 1AKYA 1M2GA 4LJKA 4NG4A 1ISRA 1KI7A 2Z2JA 3DO6A 2V45A 2JCSA 3QLVC 2MWMA 3B6IA 3GBPA 4QIHA 3VDXA 3KWMA 3FE2A 1XPOA 1JT2A 3WIBA 2HRCA 2RONA 5G3YA 2AMYA 5GM2A 5KNCD 4HEHA 4OF4A 4XIJA 4A27A 5AM3A 2XNJA 2P6OA 5A02A 2XB6A 3QVVA 4MYSA 2YV5A 4JOSA 3IULA 2DBZA 4ENRA 5BNFA 3KT3A 4L8WB 3LI2A 4J1QA 3R7BA 1CJSA 4HLNA 1WD7A 2AN5A 4M7WA 5DM70 2Z08A 4YMHA 2FVYA 1AUVA 4C0SA 5AI8A 1K8RA 4R1SA 4MYUA 4IOKA 3PEFA 4O2AF 4EY4A 5E9AA 5COBA 1RJDA 4HDSA 1ESEA 1JIKA 3MAGA 4J3NA 2GBLA 4Y2QA 4RVNA 1JLMA 4HQKA 2RHTA 2CKDA 4Q9IA 3CRMA 1OFUX 3UWPA 4UBIA 5I4CA 1YOBA 3OQHA 3OA0A 3TB6A 1PT5A 2D1QA 2PZGA 1GN9A 4HGNA 4BNKA 3QHPA 1JU4A 1YQGA 3UWKA 1Y9EA 2X13A 3Q3GE 5F21A 8MHTA 3IV9A 4HL6A 1WNFA 3FLMA 2FEPA 1X94A 1NPYA 3T4EA 3G3EA 3NNDA 3G59A 1MOPA 1AKMA 2IK8A 1QPZA 4A0SA 2ZLBA 3OOJA 2EBHX 4OHKA 2E87A 2GM4A 3T1OA 3W9BA 4D3SA 4NG5A 5M3BA 3RJ9A 5CXXA 1RE1A 2OB1A 3M4XA 4OL9A 3I6YA 2SICE 5CK5A 5JV5A 1S4QA 2VBIA 3INNA 4LJ9A 4XSGA 1AK9A 3LMKA 3DGEC 2FE1A 2X2OA 1KMHB 2F90A 5AJHA 3F7NA 5BN5B 1G5RA 5A5GA 1RRCA 3FOBA 5K3FB 3GJ0A 1K6MA 1VL2A 2LR0A 2OK8A 4QBIA 5A4AA 3ME5A 3ROPA 3VAAA 4BKUA 3KSUA 1QZTA 5LQKA 1MDFA 4DSOA 2V7BA 4GXQA 3N7UA 3TNFA 1E4OA 3FYTA 2GA8A 1J23A 1E3WB 5FOUA 1XP5A 4C4YA 3L1VA 1J9EA 4KQXA 4Q3KA 2YJ3A 3E9DA 3FR7A 4FQ5A 3HRKA 2BEWA 3U81A 3CF4A 2ACVA 5AVYA 5FOVA 1OXKB 1Y8AA 1ZIOA 2RGBA 3CNNA 5EZQA 4PRYA 2BZSA 4BNWA 3TFOA 2BR4A 5SZJA 3HJGA 1KJ9A 2IDZA 4LW8A 1PYDA 5IAEA 2ZVDA 3EZXA 3FRJA 1NVVR 4R69A 5ECDA 5CT6A 3VQTA 3QWAA 5JDIC 3CMCO 3TOCA 1HK7A 1UXJA 3AFIA 3KETA 2HPZA 4RS4A 4JC5A 4FOOA 1QFMA 2PWPA 3G0HA 1R6VA 4Y0VA 1G8KA 2CXHA 3RYTC 1QQ7A 4KVZA 4AMGA 2VJAA 3LOQA 2C98A 3PGJA 5AVXA 3ZD6A 3JYQA 3ZXUB 1LGYA 1E5TA 3QXHA 2WA1A 4PCAA 2L19A 3KUUA 4PLVA 4G0WA 3GPCA 5FOXA 1KZ9A 1YQXA 3A6DA 1NSTA 1KYVA 4FC7A 4HLUA 3M49A 3L0SA 3TQQA 5KIAA 3KPWA 1ZKDA 4UMEA 2VP2A 4QFDA 1VYUA 3C1OA 3CPJB 4M0EA 1H94A 1CE8B 1U2DC 3L7DA 1OYOA 4XCQA 1DSSG 1X9HA 3VZRA 3DQPA 2R1VB 1MRNA 1N5MA 1NQUA 2PS0A 4AYXA 2K2QB 2X58A 2QGNA 2P7HA 3JQBA 3TSYA 4CQJA 4ZIRB 4CKZA 4ZAZA 3HJRA 3HU5A 2BP7A 4QREA 2VLIA 4TL6A 3GBVA 4BQPA 2GYWA 2GAIA 1XV5A 4CR7A 2VPQA 1ECGA 4HNGA 4PR3A 2JHGA 5CFMA 4RZQA 1PO7A 2ODWA 3PL5A 3U7QA 1FU8A 3VHRA 5K8CA 2V7VA 4KI0A 3FMOB 3H19A 4N3BA 3TK1A 1AN9A 5AICA 3UMSA 3RUDA 2XW6A 1Z3IX 3DO5A 4QASA 3O4GA 2BGTA 1TM2A 3HJTA 3KUXA 5AXCA 1BS1A 4R8MA 2VKTA 3KXIA 3MTIA 2ZJ3A 3S81A 1KPGA 1NUTA 1YQWA 4PSAA 3NIGB 2EX4A 3PG5A 4YQFA 1K4YA 1SD5A 1TZCA 2XNSA 1HSOA 1WVGA 2RH8A 3KS9A 1XCBA 4B9EA 1DIBA 2DFKB 3SFTA 4N9WA 3QMWA 1PEAA 4ER3A 3AF1A 4X6XA 4HBGA 3IKVA 1J8FA 3KZXA 4LJRA 1EA7A 2NU9A 2E55A 4E70A 4RYDA 4P5EA 1FNBA 5AXDA 4EBFA 1XDWA 4JSYA 3TD9A 4EPVA 1ZQ1A 2IDKA 3PD1A 4HQRA 3S1SA 4U2EA 3CO5A 3IXMA 4QGAA 1GARA 2HHJA 3K2BA 3OAAD 4V2IA 1M66A 2SKDA 3BC1A 2QNIA 1CQXA 4G0XA 4NU5A 5TQ0B 1Y1QA 1K0UA 2V8BA 3BQMB 3R76A 3PU6A 1TO2E 1BIFA 1F1JA 2O2YA 4Z7QB 3JWPA 1P5JA 3TOZA 4BZZA 4EBBA 3RTEA 3FWNA 2Y0EA 3KK0A 4B3HA 1TCCA 2UZIR 5LNK6 1UK6A 3JZDA 2IEDA 4ZOBA 5HEKA 5F9HA 1Y42X 2HNAA 4QU8A 1EXNA 2AQKA 2DFTA 2XUFA 4WN9B 1WXHA 4LY9A 3HXLA 3MBKA 5JECA 1HETA 2HGZA 4NFHA 3TLKA 2WQ6A 3C6KA 4WEQA 4BB6A 2QW0X 5F1PA 4LNUB 1GGJA 4OG2A 4I55B 3SF8B 2GAAA 2XUPA 4B2IA 2XJ4A 2AOTB 4C4TA 5LQJA 3FHTA 1T35A 3DV9A 2PR2A 2XAUA 3KEQA 4I4IA 4Z9AA 2VTBB 1YR8A 1ZWLA 5ALEA 2ZSUA 5KOYA 5J43A 1S6YA 1DARA 3H3JA 3WFZA 1JA9A 5KYXA 2X2FA 1SIUA 4WNIA 2VTEA 1JYFA 2IRWA 1TYZA 3THXB 4FLEA 4NKRA 3SFVA 2OAP1 3VPCA 3WK7A 3DV0A 4BO7A 3SGLA 4EYKA 3QWBA 2GNPA 4IV0A 4RJJA 4EAQA 3BSYA 4CF3A 3QKUA 3SDBA 3D7MA 4EPRA 5JRJA 1XTZA 5LQRA 5LJLA 1RXSA 2CK3A 2VK2A 1B0UA 4HDAA 4XYEA 4HB2A 4B83A 1Y9ZA 3MOGA 3I76A 1KKLA 3KZMA 1RPAA 4Z4QA 5FUQA 4Y2JA 3TQOA 1Q15A 3N0XA 3NVMB 1JDTA 1AKNA 1IH8A 3OC6A 4OMFG 2VOEA 3WDSA 1O94D 1QRDA 2QLBA 3KSMA 3LPMA 1FVHA 3NTRA 2VUTA 3PC8C 3T4XA 1SM4A 1U9YA 4LAFA 2W8BA 4U2KA 1USGA 4HYTA 2GVZC 3FFXA 3D7LA 4E5VA 4FMDB 4CMKA 1GQOA 4C03A 3SSOA 2LTAA 4G4SP 1T15A 2XY4A 1E6EA 4J0GA 2HLPA 5P8WA 2GCGA 5BW5A 8ATCA 2B35A 3FF4A 5KUTA 3TMKA 1J9ZA 3KV1A 3QEMB 1CIVA 1DKUA 4GLLA 1TXGA 2P90A 4JB2A 4QDJA 4WK2B 4MV7A 2GNAA 3BAFA 3DONA 1C9NA 3M6FA 1QQ5A 5DN9A 1K7XB 2PU5A 3FOCA 1T5SA 2IU6A 2EJCA 2P0YA 3I39X 4KU4A 3AINA 4B45A 2JL1A 5J47A 1ZY2A 2YVUA 2QL7A 3DUFB 1Q84A 3FZGA 3ONDA 3NNSA 1NVDA 1UCFA 3PFWO 4LGMA 3KJZA 3NASA 4RA9A 5K6TA 3O73A 4JJGA 3RABA 1MTZA 4A9AA 5IF3A 3FF1A 5ERYA 5LP6F 2DQKA 1N36B 3ZH9B 1K86A 3CYFA 4LC1A 4RH1A 1P2DA 1A7KA 1RVDA 2OGZA 1YVRA 1RRKA 3EH2A 3FJYA 3PR1A 4O25A 5CUQA 3E61A 3D6NB 5B37A 2XTNA 5IVDA 3W5VA 4L3WA 4XWTA 3TQHA 4ENVA 3BFXA 3KVVA 2DCUA 3IT2A 3P2JA 4IFEA 3V3TA 2EL9A 4TWBA 1GD1O 2ZIEA 2B9EA 5E0KB 4LX8A 4KSCA 4V38A 2NU8B 2GH1A 4ARVA 3JVVA 2YWJA 5BWLA 1ZVMA 4JXKA 5A3RA 2Q2QA 3B1KA 5AHXA 5DIFA 2OGWA 3UCEA 3I9JA 2J3LA 5AP9A 2CF5A 2XVAA 3JTEA 2FWMX 3DDCA 3QE3A 2NXCA 2XECA 5CH5A 2P62A 2YOGA 1YFLA 2H4JA 1T34A 4WZBB 2JLCA 2CVZA 3HBNA 4JSTA 1E99A 5JCXA 4HXFB 3THWA 3DXZA 1CQIA 1QIFA 1X7YA 2AXNA 1EPUA 3TNLA 1Z22A 2C54A 1GPBA 2XQKA 4FDUA 1IM2A 2CNLA 5E2BA 4YMVA 3G02A 2BMEA 5JNVA 1UK7A 2WIJA 3K0EA 4M0MA 4UEOA 3KYIB 1UC9A 4MUAA 5FTWA 2BD0A 1SHJA 3EW9A 3I5XA 1QIMA 3G7UA 3MMXA 1J8YF 5ERXA 1GA4A 1W5EA 1SB9A 4IV5A 2W6IA 4RTNA 3UHOA 1FK8A 2I4LA 4OQEA 4WOPA 4EHKA 2GESA 3FMIA 3IUNA 1SEPA 4PG6A 3KOMA 4IFTA 2AG8A 4BJ5A 4QPJC 1ZHOA 5EL0A 2YY5A 1QH1A 4DIMA 4URHA 4M53A 3OKAA 4B6FA 2ZULA 3ANSA 4B6SA 1WPXA 2M6SA 2BOVA 1AZSC 1FE8A 2IZ7A 4FGLA 3UMBA 1KYTA 2O2HA 3EAQA 1JPVA 1ABFA 4ZMSA 4CL2A 1RQ2A 3W1VA 1DELA 3BWXA 1WL8A 1QFZA 2ES4A 4HQFA 2X0DA 4EKGA 1GGNA 1KI2A 3USCS 1A71A 1OAOC 3KWJA 2WG2A 4AF8A 2QB5A 2J3EA 5IW8A 1FTWA 4KX5A 1R8XA 4DLVA 4NZ9A 2VATA 8ADHA 1J07A 2G5GX 2ZRDA 1Y1PA 1RXVA 1PGNA 2JFVA 5FYDA 2NSHA 1HZJA 4HLQB 1IJKA 4NK4A 4EVQA 2YZNA 2XTZA 1LCIA 1E2DA 3ILHA 3N0WA 5H81A 1QP7A 1R66A 3VPGA 5D3ZA 2HA5A 1RACA 2D5CA 3BKWA 1G7TA 1ZONA 3K71B 4MW2A 4JQCA 5BRNA 1E1QD 1EDDA 1STOA 2M6RA 2BFMA 3WKAA 3AJRA 1XN4A 2YYYA 1SCJA 2K4MA 2NSLA 3AI7A 3MJFA 3K6SB 3DDUA 3UV6A 1R4NA 4MCAA 4LXXA 1JLLA 2C3YA 3TTTA 2HREA 2ON6A 4DLAA 2Z9CA 2AI2A 2REBA 4Z9BA 4DA9A 2AFRA 3OEHD 3PENA 4R3WA 2ZKIA 4R05A 4HT3B 1GT6A 1OH6A 3G7SA 3WLSA 1FFXB 4LF5B 2AOVA 1ILWA 1L7VC 2ACEA 3DL4A 4AZ0B 4MAFA 3Q5EA 5KTMA 1NW6A 3PQFA 5CHEA 1XCLA 1T8UA 4ZYTA 3NDRA 4FGZA 4JUDX 4QTXA 2ZJBA 2D3WA 4H18A 4JLWA 1WPRA 3DDNA 4CM9A 5JYDA 1XCGB 3HM2A 1JQKA 1V6CA 2B1GA 2BJWA 1WUHS 1E9AA 3V2HA 4HTAA 5F2KA 4ZREA 5HUHA 2QTFA 4DA0A 3C3KA 1JR6A 1E3TA 1SFRA 2FU5C 2PANA 2ZUTA 1TO6A 2P9YA 4Y2PA 1L3IA 3PYLA 3PDWA 3Q6MA 3SIRA 4QAQA 2R8EA 3RFCA 4EITA 4RETA 2WYWA 2DR2A 4M46A 1XFDA 4KNWA 1YE3A 2PZKA 1T3TA 1L5MA 1R9GA 4FNOA 4G5YA 4M1SA 4MKIA 1J1UA 4KQ2A 4MV6A 2BBSA 3DEAA 1IY9A 2G36A 2MSDB 2H5EA 5AM0A 5JZVA 4CTMA 4IS2A 1DOHA 3ZY5A 2JCYA 1A7UA 2GNOA 2DT8A 2WLSA 4US1R 4ZCSA 3CLKA 1UK9A 1DBWA 3BHNA 2CVOA 5LP6A 3RGGA 4GMHA 1I2DA 2VDKB 3K6SA 4JZYA 2HV9A 3HBLA 2VPIA 1T5IA 5LZ8A 4D6PA 2WIAA 1MC1A 1ESDA 1VE3A 2GN4A 3T7CA 4P4GA 5F1KA 3NOQA 4P6VF 3L3BA 1MB0A 4DZRA 1Q0ZA 3BORA 3UG7A 1S7GA 3KUDA 1GLGA 2QLMA 4RTKA 4GKVA 4XIIA 1F48A 2AFIA 2GPSA 2J3MA 3E03A 4IM7A 1FSSA 3GMDA 4QQKA 4EEXA 4GECA 1DG9A 2QP4A 2PNJA 2QZ9A 2JKYA 4B40A 1R6BX 2WF9A 2WHPA 2ZIUB 2AVDA 3DZBA 3QVMA 4MW0A 3W5UA 1W2WB 4LJ7A 5I7VA 1E98A 3MRSA 4P31A 1QKIA 3K09A 4AECA 4ZRNA 4KR3A 1ZZGA 1RBQA 2ZTMA 3EZNA 3MSXA 2Y8EA 1DVRA 1JLKA 2R60A 4NAUA 4WXEA 1V3VA 2HJRA 2QAIA 2QTVB 1J0DA 2VWQA 3EHDA 3HJCA 3L8EA 1IHYA 3LT5A 3QLJA 1N6LA 1NQTA 2EC5A 4CTKA 3WQHA 2YJ4A 5T4BA 5ED0A 2JATA 3H4IA 4RFSB 2XCTB 3AQIA 4TTTS 3EXAA 1MA3A 2ZU0C 1PX0A 2XCUA 4IUBS 5EXXA 2Z2XA 4L74A 5CU7A 2VH5R 3S1AB 3SBOA 4FNAA 3ZU6A 4K9NA 4MWBA 2VJQA 5HKOA 4E5DA 4DSZA 5C8YB 1L7OA 3CINA 3VSBA 3ESYA 4WOBA 4BNUA 5AWFC 4IVQA 4B0OA 1GA1A 3DMYA 1FYXA 3BERA 1W5BA 1XPUA 3BOSA 2G07A 2HUPA 2PH5A 4ZCIA 4MI3A 2PBFA 3WFIA 2GM5A 1LI7A 4QUHA 2QTBA 4PPQA 4QG7A 1SH7A 4WXYB 5L4LA 1P9OA 4FFVA 1UADA 5H16A 4C08A 2PE5A 2GOYA 4N6GA 1J97A 3DXXA 4KWEA 3IOCA 1Z4OA 4QEKA 2D0OB 1DTSA 3C5HA 1A77A 4RX1A 1BHO1 2R97A 4BN0A 4CKBB 1ORIA 4C29A 1IWOA 2B78A 4QEDA 1H69A 3RE1A 1U0HC 3AI2A 5EZYF 3SP1A 1JR3D 2GARA 4M37A 3QBTA 2YH2A 5LDGA 2UV8A 1QRRA 1VQ1A 4DLZA 3ANLA 1RAIA 3I2FA 4P3PA 4NXMB 4HYEA 2Y4OA 1Y3DE 2A0FA 4OVKA 3IFSA 3M5WA 1DC5A 2NUTA 4MXDA 1G60A 4O2BF 5JW6A 4MVJI 1ZPDA 3WGHA 2HTFA 4Y6QA 4HNVA 1YR1A 1M7GA 1KEZA 1J2UA 4YONB 3QVTA 4ZGGA 5EIOA 3OEED 2Z4TA 4IFIA 5A04A 4HTFA 2KB0A 2IZ6A 4W4TA 2HMUA 1TUGA 1L9KA 4PICA 4RDHA 3FPLA 1AUXA 2EZUA 4IBOA 5ALRA 4O08A 3W79A 5IMSA 5KU1A 4AKGA 4FYMA 4HVAA 1TTHA 3GGOA 3BWEA 5KJEA 5AVQA 4DABA 1V8PA 3DL0A 5C37A 1AGYA 2ZP1A 3FUXA 1YB5A 1IXKA 1G5HA 1QGUB 4W1QA 1RAGA 2O52A 4OGWA 2PHZA 1M67A 1OLXB 5A5VA 1T1SA 1BRMA 3HY3A 3SN6A 4FHFA 3HDJA 5DGTA 4C30A 2O1WA 3EMDA 2ODTX 5JXWA 2JKZA 3IBSA 4LG1A 1LPAB 3RAJA 1P1CA 1OB5A 4TLMB 1YVUA 3BJMA 2FSPA 3B6ZA 3RSGA 1A4XA 1CY1A 2OOKA 4L9AA 3WGTA 1Z5OA 3NAZA 1CJKC 2JGJA 3OZEA 4DPKA 1Z7BA 2BFWA 1D2HA 3A1UA 1DAIA 3KHKA 3BAZA 2JFBA 3KSZO 1ZJ4A 2PRSA 3ETCA 4M87A 5FFFA 4AY3A 1C3JA 2N3ZA 3GCGA 1SKYB 4PIMA 3L0YA 5T4EA 5B6PA 4M49A 1OV4A 4GPBA 4PN7A 3F6SA 4WKGA 3E9ZA 1Q44A 3OCJA 1NKTA 1PZEA 3NTQA 5TMPA 4MQFB 1Y82A 2FB9A 4AVYA 3GDWA 1K8XB 1E62A 3DDHA 3GF4A 2X0NA 3I34X 1NUHA 3NWEA 3FAZA 2QT0A 3KT8A 1AJEA 2C94A 2PMBA 1WTCA 6Q21A 4U2FA 4ADSG 2JFOA 2XMGA 5AUQA 2I6QA 3HS3A 1NVVQ 3O9MA 1M1NA 2OM2A 3X2EA 5A5DA 2BJVA 2Z09A 3DFIA 3KO8A 3QA9A 3ZZTA 2AKYA 2C4MA 1E2LA 4RVDA 4TXMA 3NHLA 1ZMXA 4R2IA 4J3FA 1ZZEA 5DNUA 1EVZA 5JMTA 4RIEA 3LVBA 5FWXA 5EMJA 1OX5A 5SYMA 3KM0A 1QZUA 2O9JA 1EM8A 4BNDB 4TTRA 3W5HA 3F1KA 3NBFA 5BN5A 4X45A 1XLTC 3PCRB 4U2CA 5IM4A 1D07A 1LA2A 2JFUA 3P26A 4C21A 3G9TA 4IGKA 1G0NA 2EHDA 4DUGA 2EL7A 1AB5A 3QV1A 3ZHQA 4KSBA 1FP6A 1EA5A 3FYCA 2FQXA 3GEIA 1UPAA 4OQFA 4PR0A 5A05A 3TXXA 5M29A 1GFWA 1RPTA 1L7RA 3A7EA 4BRZA 4F93B 5CFLA 3ULKA 3ADDA 1TJNA 2VYVA 3GHYA 1USWA 1CU1A 2E6UX 2FW7A 4ZC8A 4URVR 4GIBA 1SZDA 2L18A 5LNK1 1NXSA 1N6HA 2WJ4A 3H1FA 4TV8B 1OH5A 4Z54A 2BCGY 2JAPA 4G1BA 3L8ZA 2QROA 3A4TA 2CL7X 2FP4B 2A3RA 1ORHA 2P1ZA 3CH6A 3EDMA 4G3XA 4J1TA 4N3AA 4O59O 1R0CA 4FHDA 5KZMB 3MGAA 3GN1A 4GYYA 3OZDA 4C43A 1VCMA 1JJIA 2Z0MA 3BB3A 5DYGA 2IYUA 2EX1A 2J4FA 3CJTA 3UV3A 5AXBA 4PX9A 3MF4A 4MVJE 1SQ0A 1CX9B 3QKSA 2ZG6A 5AK3A 1RWPA 1EMDA 1JJFA 2Z8YM 3QVSA 3NTOA 2FZKA 3DWFA 4XM2A 3QBVA 1ZUIA 3QK7A 2YHSA 3LRXA 5MDHA 1INLA 2OCLA 3EQZA 1JEQB 4YT2A 1L5OA 1QP8A 1X8JA 3TDKA 3VVCA 2A4MA 2G76A 3DLIA 2QTHA 1I1QB 3C1UA 3KCQA 521PA 2DLCX 2JS7A 2O8NA 4AUEA 5BW8A 4P53A 3ZHOA 1OLUB 1VXOA 3UC9A 4QT0A 1TUBB 1XSEA 2B92A 3B1ZA 4KSYA 3S6JA 1PLJA 4P3KA 1FSZA 2JJYA 3D6TB 4NWIA 5EMNA 1KNXA 1AM4D 1OBHA 2G04A 3UM9A 5JRDS 3T5MA 1W76A 4NARA 5I6DA 2C4WA 1GQ2A 3TLBA 1IZYA 4BNXA 3OEHA 6NULA 5ILOA 2OSBA 2W6CX 4E21A 4LHVA 4K9QA 4O2BA 3W9UA 4AO6A 1RRFA 4RD6A 2FOLA 1QK3A 3VVMA 4Q48A 3O8CA 4FHCA 1VKOA 3PXEA 2N9UA 4FIZA 2PFKA 4GZ5A 4IJUA 5CX1A 4YMGA 2Q6IA 3GDOA 4G24A 3DB1A 2I4TA 4AG6A 2VRCA 3WYCA 1U6JA 2VHTA 5DDIP 2NX2A 1E1QA 5KO2A 2P0AA 3FHLA 3LBNA 1IYZA 3FGOA 2GEKA 3OHSX 1KK0A 3BJRA 3H9JA 4HRXA 1Z7WA 2RCNA 2ZCVA 4CIVA 2LDXA 3L6OO 5A62A 1PD0A 1XFAA 2QRVA 4JQYA 1Y37A 4NR0A 5LZ7A 1R9MA 3HBJA 2Q3MA 1JMVA 2JLBA 4ALLA 4HEJA 1D5CA 3MPUA 3NIBA 5AKLA 5TPZA 3WIUA 3R9IA 3G79A 2LIVA 4MRAA 1TVEA 2QTCA 1SXGA 2IELA 3ZZMA 3PP8A 4O4IB 1Y4DE 2NACA 3H5TA 1ECLA 1X7HA 3WHLA 2FI1A 4IQ0A 4B3MB 2LWIA 3DD1A 3LVFO 1Y6JA 4HDKB 1DG1G 1Q7BA 3P9ZA 1N4AA 4CDRA 4PX5A 1M1YA 1Z73A 3JAWB 2EVWX 1RRPA 3UHPA 1IBLB 3HCCA 4L4SA 2GD6A 3LTNC 3QEBZ 1JE1A 2AFHB 3L1KA 2PK3A 3L1HA 4JJ6A 4PC2A 3PUYA 2NU6B 3WLKX 1YS7A 5BR7A 2OBYA 3JASA 3RH0A 1QZ3A 5JYEA 3O8QB 2ZPUA 1EDZA 1ND5A 5H82A 3IMCA 1FSGA 4H3KB 4JI3B 4W7IA 3OOSA 3PIIA 3THWB 1TU0A 1EJ6A 3LIPA 3NFYA 5KWEA 1H2FA 1OI2A 5B7PA 1WE2A 3EFEA 4WERA 1E64A 3L2OB 4GR5A 3R7NA 4R7GA 4ZCLA 2XYVA 4KFSA 4F5EA 5KJ1A 1QIIA 3K70C 3KB2A 1AF4A 4ERNA 5LM3A 3MIZA 1C30B 1E20A 4YNBA 4AT1A 4ENSA 1OIVA 5D5HA 3FGZA 5IK2A 4B3GA 4HY3A 4QUIA 1MOZA 4F04A 5KX5F 2WT4A 4U2DA 3IIEA 2HF7A 3O92A 4C3OB 4MB0A 1SUDA 3TE7A 4BKQA 1IIBA 3IUYA 4EFMA 3H86A 2KHZA 1TCAA 1C41A 1S2MA 2QL9A 3THYA 2GD1O 3IX7A 2VSNA 1PZMA 4IMRA 2P6NA 3L01A 4KFCA 4NAHA 3TFWA 3VAYA 2PAFA 2J3DA 3K5PA 5BQPA 1VPEA 4JUBA 1R10A 2NTJA 3FUUA 2AN4A 3KE9A 4MYHA 1SUAA 3FTQA 3VKWA 1T9DA 3WMGA 4EG7A 1NATA 2D2XA 4P7GA 2VDUE 2C95A 1J00A 1QLWA 4RTJA 1E1RD 4HWPA 3C98A 3BH7A 3GG9A 2F8TA 4MUFA 4QODA 2RBEA 1MKYA 3QTLA 3PRHA 1IM8A 1SU6A 1F8GA 1PWXA 4YAOA 4YAJA 2WK1A 5DI3A 5IT0A 2FK8A 2V7WA 4CF5A 3GPDG 5HOEA 1R1DA 2QSUA 4G1CA 2FR8A 4KODA 2C82A 3G2NA 3BICA 3D3KA 3Q8MA 3HSSA 1FEZA 4XYLA 4FHEA 2V5UA 3IQIX 1G5TA 4F71A 2FZVA 3STYA 3PSAA 5ILGA 2WM2A 2HAEA 2R1UA 5IDVA 1VIAA 1U5CA 3I01A 1EE1A 4J6FA 4TMVA 2FPPA 4F5WA 3JS5A 4C0KA 3AZOA 1C9MA 3OOEA 2O2XA 3BEDA 4MB6A 5C46F 2HM7A 2A0XA 2FK7A 2XKBA 4PY2A 4ACBA 1HQCA 1F4VA 1VRVA 4JSRA 1JDUA 1TDJA 4JUAA 1P2BA 3SC2A 1WVIA 4BXOA 5DMXA 4DRZA 1H05A 4B4KA 1YB7A 5K8VA 3S0JA 2Z9BA 1YV9A 4XX0B 3ZIAA 2GK7A 1I3LA 1KDTA 1WW8A 2O0MA 2CK3D 2XUJA 4L08A 3PPVA 4U7PB 5CCDA 4C1BA 1D1QA 1KZ6A 2C7QA 3LGSA 1VMAA 3SEAA 3QYJA 4YR9A 2JB9A 4V0KA 3V8RA 2VDNB 1FLAA 1NMXA 4P92A 1A9QA 1X7GA 2P4EA 1CIPA 3MWGA 1JJAA 3FGPA 1BJRE 3L7AA 4BE9A 1EK0A 3PPIA 3O3NB 2C9DA 2V6JA 2UZ1B 1DKMA 4FPXA 2G72A 4FSXA 1DBRA 1BEZA 3PFNA 4A0FA 4KE6A 2MJLA 2DJ5A 3WWZA 1ZH8A 1E2GA 1T0UA 2B4KA 1XTJA 4OO3A 4XEHA 4BS9A 5I8PA 3C3JA 4OHUA 1E2IA 2HDOA 2NMVA 1JNYA 2CXUA 2J0UB 1QS0B 1JHUA 3CUYA 4OYLA 3ECSA 3K0FB 2FCRA 4KB5A 1IRIA 3A36A 4MAMA 2XAAA 2XGSA 3ZEIA 1GQFA 2I4NA 3IT1A 3REQB 1PV2A 1K5DA 2NXNA 2PS9A 3WJ7A 3HVRA 4ZHSA 4E7PA 4EYQA 4NBVA 3C8MA 4UE3S 4CM8B 2X7HA 3NJ8A 4K81B 1T6ZA 4Q3LA 2C5SA 2EIHA 2GXQA 4QRHA 2ODEA 1D2CA 3ELWA 3P7MA 4JBHA 5F5XA 1H65A 4DMMA 4RD2A 1WY5A 1KOFA 1GL3A 1J20A 1ZS9A 3E9RA 1P74A 2PIDA 3MJRA 4FFNA 4C05A 1P45A 5C1IA 2YZ7A 2FZCA 4JNKA 2ZSFA 3NJRA 3DNPA 1MF7A 2ONKA 3OJFA 1W75A 4AL4A 1OLSB 3GHHA 1JLRA 1RW4A 4Q02A 4C2AA 1E3SA 1WSWA 1WHSA 4D43A 1ZH2A 5KTTA 3THXA 1M1YB 3EDCA 3AJAA 4I1UA 2TYSB 3MILA 5ALSA 1U7PA 2I2CA 1O03A 5TVKA 1CHDA 4LJ6A 5JNWA 4FGUA 5DZSA 1XTPA 4ZGWA 4QJ5A 3RU2A 1HPLA 2OFXA 1K1EA 4N3NA 4IXMA 5JHHB 2ZBRA 1N3YA 1UBGA 2JDID 4ND8A 1QVAA 4QTTB 1UQRA 4DCMA 1G64A 1GTG1 2RJNA 4I08A 4Z2YA 3QFFA 3B38A 1NC3A 3BRWA 3DFZA 1PUJA 1R6XA 1N57A 4J2TA 3QJYA 1RRMA 3H2GA 3A0RB 4KBYA 4GGMX 3MJDA 5EG5A 3RANA 4ES6A 1DAFA 3HXMA 1QRUA 2VOJA 4DJDC 4HN2A 1M1ZA 3Q8LA 4HUQA 1T25A 4RM3A 3OE7A 2HBYA 1XA3A 1YZQA 2WBLC 4FFDA 1Y5MA 1T24A 2G09A 2EJUA 3PRJA 4X61A 1IXZA 2R25B 2FETA 1DWUA 3CLRC 1QUEA 2VDQB 3DQZA 3QPCA 4MGKR 1QJ4A 3IAM1 3TUJC 2P3QA 3SZMA 4UOQA 1LK5A 3V4RA 4IIJB 4QXQA 4EG0A 5F76A 4BJ1A 5K01A 2B9VA 5B3KA 2Y4NA 3KG2A 1TGVA 1X8KA 3DFFA 3RRYA 1VCHA 1ICIA 4IX9A 4A6PA 4HUTA 4DXAA 2NU9B 3P4XA 4NQRA 5DSTA 3T94A 3U9TA 3FW1A 4UUMA 4X90A 5KSZA 4DUZB 3KR2A 3BCSA 4GEKA 4DW8A 2XWSA 4R9SA 1H42A 1NW5A 4YRTA 2QTNA 3PFFA 2O0KA 5FORA 3AF4A 3A1SA 3MD0A 3CEPB 1OXTA 4Y9TA 1L1FA 3W06A 4Z1MD 3GJ7A 2J3JA 1FA9A 4ID3A 1P4AA 3BRCA 2XGOA 4UZEA 4US2R 3WY9A 3M6MD 3UPUA 1DL5A 2QRHA 3H9CA 2O06A 1KAQA 1LNQA 1ISGA 2FKAA 3F3SA 3M81A 4D0GA 1JVNA 2VPZA 1L5YA 4UBOA 4A3SA 3OX4A 4ZI7A 1IRXA 3HG7A 3GT4A 1BKDR 3E7XA 3QSGA 3MGGA 2BF4A 2CDCA 3UJHA 2OXFA 3AF6A 1KFCB 2GZSA 1NBME 3SAJA 1RKVA 3W3AA 1Y8RB 4MPJA 3F67A 1U8FO 2G25A 5T5QA 1DKPA 2H1WA 2P69A 4Z99A 2Q3EA 1XQXA 1MJFA 3EGXB 3QELA 1QRSA 3PFBA 3I9MA 2K6GA 4CFSA 3F7OA 5C7LO 3DVAB 3QP9A 4P80A 5JCPA 3E05A 1ODFA 4YJ3A 4FUTA 4KK3A 4LCBA 1C1XA 1P7YA 4Q4DA 1AK1A 2H2DA 4EJFA 1SO8A 3F74A 4L8FA 5JSUA 4UULA 3WNCA 4LXHA 1BA3A 4LFCB 3SX2A 4EELA 1POXA 3IXQA 4E1BA 1IC6A 3WIVA 1W46A 2BKAA 2QENA 1NBHA 2IXFA 2R6FA 2ILVA 3LK6A 2PRZA 3NYWA 4ISBA 4PINA 3NWJA 4G5XA 4R83A 3RRXA 3FSJX 2HQSA 1V45E 1GITA 4MIOA 2GEDA 2AL7A 2HBRA 2HYIC 5TQ0A 1KY3A 1OBVA 5KTRA 1LY1A 1THZA 2AFIE 2GWRA 3EQ2A 4KYTA 4KXXA 4ENQA 5CDGA 3WQQA 2LRHA 3KT6A 4B6RA 3EGEA 4EVRA 5A2QA 5J4VA 1NLUA 1SN7A 2ORED 4BX2A 2NVUA 1CB7A 3QX9A 4NYJQ 3ZCXA 2C97A 1NW4A 4MV5A 4ARUA 1CKEA 1JXAA 3CX6A 2TMYA 4IJWA 1K92A 3KIPA 3R77A 2PMEA 4YDQA 4BEJA 4MVJD 4D2IA 2OHFA 1UMDB 1J22A 1KFBB 1EB8A 1QC5A 3IMKA 3PYMA 3ZGXA 4QM6A 4G85A 2L82A 3C74A 3NRBA 3VPXA 5LZ2A 2H1IA 4GMKA 2O1EA 1CC1S 3TZHA 3HDYA 5BWOA 3S5UA 2XWPA 5CDYA 4CKEA 2GB4A 5DW0A 5CCBA 3CY6A 3PB3A 4MTCA 1CVRA 4NECA 3LDFA 4PO3X 2OAQ1 4GW3A 4RLFA 1L4LA 2GLXA 3JQBC 3JAKA 3DBRB 4PFSA 2B4AA 3WADA 3P9PA 3NONA 3KCNA 5B4VA 3ICPA 1GQSA 1NJ8A 2JZCA 1JJVA 4U0JA 5KNCA 3ZDEA 2OV4A 2WU4A 3T9CA 4IF6A 3UMCA 4KDRA 4HNUA 1KU0A 4P4NA 1A76A 3E9YA 1TKRA 2ZJ6A 2MSEB 5E8RA 1PZXA 2F00A 2X9GA 3KJQA 4JQSA 1PLLA 4Y1GA 2QQFA 2FQYA 1PHPA 2PMKA 4X41A 1QYWA 2WJHA 2H4FA 3VDQA 1X7XB 1PNOA 2PX5A 3JZMA 4BGIA 1I5OA 3PQDA 4I4TB 3DP7A 1C29B 2NVUB 5EXTA 2PO7A 3H1EA 4D82A 3I30X 5JNUA 1FNCA 3A31A 1S02A 3PE4A 4FDTA 2QI9C 3JTMA 3ER6A 3L7CA 5H83A 1GKUB 1RZRD 3KD2A 3DVLA 1JR2A 2KJQA 4GXNA 4KXVA 4M1EA 4UDYX 3TPFA 4CKWB 2X9VA 2VNKA 4G37A 2H2IA 1RI2A 2CW5A 1K5GA 1GGEA 3IEIA 3OY2A 5E2IA 5FOWA 4Z4CA 3GN2A 5BV1A 3RWOA 1B41A 1VE1A 3F7TA 2W42A 5I9IA 2GRAA 3G13A 1AXRA 1M8KA 2AJBA 2C99A 1ICEA 3P9XA 4GMFA 4LHXA 5SZKB 4ATNA 1ACLA 3RNLA 4XQEA 2X14A 2FPSA 3MTDA 3OMWA 4FR2A 2UYGA 1WQ1R 5LIRA 4M8SA 2FZGA 4FCCA 5TR9A 5E9QA 3UCFA 4HDRA 4XYBA 3A3OA 2Q29A 2ZRAA 1HNNA 3VR1A 3WJ1A 1HORA 5HS4A 2W6OA 3EVCA 4XLTA 2UYHA 2WZBA 2AG0A 3BTSA 2XRYA 5TS3A 5DXFA 2QWXA 4X92A 3AHGA 1FRVA 4B43A 2HLDA 2FPWA 3FA2A 4M9SA 1U6KA 2FSHA 3PJDA 4JA2A 4KQ1A 1V7ZA 1CY7A 1HYEA 1BGXT 5KQMA 1ZNXA 3A6HA 4YECA 1AS0A 5DX8A 3IBYA 4LXUA 4ZQGA 4HNTA 3COVA 2OGSA 4NCNA 1L7EA 5KYWA 1YL7A 3BPSA 4WCVA 1FVOA 1C7IA 1XZEA 2FZ4A 2CLLB 4HLUC 1KO1A 2DY0A 3AEQA 1XC7A 4OKSA 3U0BA 5GZ3A 4BXOB 1IL0A 3AFNA 1GCUA 1OQAA 5IKMA 4JEIA 1L7AA 4J3JA 1EFHA 5EJ4A 3CCCA 4X9XA 3U19A 4EB6B 2ATVA 1KGSA 4C3VA 3K4HA 1ZO8A 3BIOA 3TJRA 4RFSA 3NEAA 1N5IA 5EIBD 1T0IA 1U1FA 4KPUA 4Y2RA 2FEAA 3IHKA 4OHXA 3IOMA 3SEFA 1HKUA 2ZW9A 1SVMA 2XH8A 4KVAA 4XWKA 2IP4A 4JI1B 2G1KA 2I4RA 4U8HA 4CQLA 1LEHA 4QXAA 1OWOA 4RKFA 4B3IA 4E5KA 1UDAA 2Y27A 3P9SA 5H3LA 3W6OA 4UM7A 4E1VA 1Z13A 4G97A 3R5SA 3A25A 1DGQA 2QM3A 3L5KA 3WAGA 2ID8A 4EFKA 1TK3A 3AJ9A 5T41A 4DE5A 3TTWA 1HLGA 1XNRB 2WSSD 4ZCPA 2O54A 4JCCA 1S2NA 2RG1A 3IQHX 2JK0A 2QV0A 3RIMA 3U1VA 1Y4AE 3PXCX 3W5IA 5EJ7A 4HGYA 4GT1A 3OQMA 2C03A 1ETHA 2HBZA 2WPNA 1VJGA 3OZ7A 1U28A 2JA1A 5JFOA 4ENUA 1W36C 1GZ5A 4UD6A 5C34B 5A7HA 3M1LA 2ZM6B 1C2YA 3F7MA 2WLTA 4NAVA 5D7BA 3AKCA 5F7XA 5AKZA 1O96B 2A1UA 3M2PA 4LRQA 1CE8A 3RAEC 1KC3A 3DUFA 1OYVA 1XHEA 2JF0A 1T36A 2YJZA 3A9WA 2BV3A 1V1RA 1ENOA 4IHJB 2FFAA 4PONA 5FKJA 2WP8J 1ZUNA 1GTJ1 1MD9A 1N25A 4NE9A 4F2GA 4ZDIA 5IN4A 2ZJ1A 2YXLA 3OJ0A 4E2ZA 1IN6A 2A5YB 2GETA 2WUEA 2BCJQ 3JQ9C 4HNQA 4DMGA 5KJ6A 5K3CA 2DUJA 2B37A 2FJPA 2V54A 3H2BA 5AW0A 3U9LA 4AO7A 3I1FA 4FCVA 4QYWA 2YWXA 1D1PA 4P35A 1XMSA 3RBVA 2V0NA 2BHTA 3KZKA 5HPYB 2I7CA 4YHHB 5L40A 2E1RA 3RSQA 4YUVA 4RJKA 4PGHA 2J0SA 1UEIA 4FN5A 4WACA 2FSFA 4KAXA 4N3GA 4RV9A 4D9IA 4N48A 5AUOB 1ZJ6A 3R7FA 2IQ5A 3STUA 2UXBB 4GL4A 5KYKA 1XKXA 1B6GA 1K2VN 4BTEA 4ZICA 2IEZA 3Q8WA 5DNVA 3JALB 3GIWA 1R8QA 5C2JB 2R2GA 2WAYA 1W48A 3NHWA 2LCQA 4JXZA 2ZI6A 4EMSA 2WQ7A 3USZA 4MWGA 4CIXA 3OJOA 3CGGA 2JBHA 4RVUA 3RS9A 1L8AA 4PQYA 4AJ1A 2D0DA 2YJGA 1Q91A 1B1AA 5I3CA 1F5NA 1U2GA 1C7EA 3MQ2A 4V0OA 1USVA 5INTA 4MQEB 3ZBPA 1LPNA 4PC7A 1JHRA 4WFKA 2WF5A 3ZWYA 2G1AA 4BVGA 4DFDA 4QM7A 2WICA 1CY4A 3V8VA 2YCLA 2YWGA 4LSGA 2OO5A 1ZUWA 1AKVA 3X1ZA 1HG0A 3SBXA 4WLVA 2QRVB 3KX2A 5AT1A 4NV0A 1SJ9A 4N6OA 4OHCA 4G89A 2WUWE 4RMIA 1JB1A 2HQ1A 3BWVA 1E2PA 5HK9A 3VBEA 2BDTA 1ZSNA 4QXPA 1W6RA 2GHIA 1DRUA 4UAUA 2R8PA 3E9NA 3KYDA 2NIPA 1EVIA 2C88A 1DT3A 5EUCA 5KAMA 3D4IA 4PBRA 3CURA 4NZOA 1FYDA 4TQAA 1U4NA 2EP7A 2VQFB 2PXXA 1XKQA 4OJMX 2PT5A 4L6CA 4L4UA 1C1DA 4NBRA 1J99A 2OWEA 4XIFA 3FOZA 4QFCA 5TVGA 3AONB 3OIDA 1J8DA 2OXRA 3QIAA 4MVJH 1I30A 1RBZA 3KYBA 3JPYA 1KEEA 3L07A 4QVKA 5JEDA 1ND6A 2X5NA 1KETA 4JKOA 4DZZA 4XFDA 3JALA 1E0DA 1U81A 5FLKA 4CR8A 1X0VA 3GFPA 4MYRA 4FXPA 1Y8QB 4FFMA 3T0IA 3R0VA 4UC0A 4JVNA 1HG1A 3IILA 1X77A 1UODA 3CXRA 3HQ4O 4K7JA 2HK9A 2YDYA 1SCBA 5EP2A 3LE8A 2EKLA 3T0GA 4WJKB 5FAKA 5EINA 2GUWA 2PH7A 5KQSA 4G0YA 3K92A 4I6GA 4ZQBA 4RADA 3RVJA 4DMCA 1O94C 5KJCA 4IDQA 1U7DA 3ILXA 3AR8A 3MLAA 1GTMA 2P75A 3GRKA 1H2BA 1KA9H 2OORA 4G1FA 2R6R1 1QVZA 4CHTA 5J1TB 1CG6A 1D3AA 3PZBA 4TM8A 2PQ6A 2R6ZA 2QDKA 2M6KA 2I87A 4HZIA 1ZAKA 1J7JA 1XX6A 2IUTA 3QXSA 2CE7A 4JQOA 3TAUA 5EZSA 4ALJA 2BFDB 1EP3B 1T1IA 2X0EA 2H8KA 3WLLA 3DC2A 3JYOA 5HCUA 4BO4A 1J0XO 2X0IA 1QG6A 5TMEA 4Q34A 3AH8A 1OWNA 1L5SA 3CRQA 3LUBA 3O82A 3OTOB 2P5SA 3SZGA 1BCRA 4KGZA 3FVWA 1FIUA 3A2MA 2BFNA 2E21A 2I76A 3BXPA 1PE0A 2Z6UA 5FBWB 4ZQHA 2C5HA 4QT4A 3M4NA 4K9SA 3G2MA 1G8HA 2R1TA 4TV9B 3TW6A 2RGYA 3AI1A 4BX8A 3DMFA 1XVTA 2V0CA 3Q9NA 2ZROA 3DL7A 2DECA 4HR7A 4Z51A 3LX5A 4EO4A 1PJBA 2QN9A 4F2DA 1XA0A 1P2GA 4MRSA 4PZ0A 3I58A 5FV4A 1GIAA 2UVQA 1XP8A 4N5HX 2BM1A 3NOXA 2SCUB 1SWVA 1ZNYA 2A86A 1HO3A 5EJ8A 2XOXA 1IU9A 2O48X 1MB4A 1PFKA 2JEOA 3K05A 2WZCA 3RYHB 3TRDA 2H6EA 2JGDA 2R6GA 4PHFA 5FD8A 3LNTA 4DEXA 1CUWA 1URPA 5JNLA 2VJNA 2XDAA 5FQNA 2GPWA 3NEPX 3WVNA 4O5AA 1X92A 1ZD3A 4DCPA 3E22A 5G3ZA 3I62A 3ID6C 5GJWC 1W2HA 2VNHA 3PNMA 3WLOA 1OAOA 3DDSA 3IQFA 2O7SA 4AMVA 4EG1A 5CDUA 4U5XA 4DV1B 1ZIXA 1N2EA 3GLRA 2PKQO 1TW3A 2BGGA 2CXRA 1BNCA 1EWYA 3FHOA 4IRXA 3ON5A 1Z0IA 4MROA 3S7TA 1EG2A 4ZQFA 1AS3A 3ZBQA 5KHOC 2DFLA 3NDBB 4GKJB 1KZ7B 4QBKA 5JVDB 2ZAYA 3TRKA 1TI7A 2BBTA 2BI4A 3O1JC 4MW4A 4OHWA 4ECEA 1Q7RA 2VPTA 3BE4A 4JBXA 4QUDA 4EO9A 3BGWA 4OCZA 3G2OA 5EQFA 1IY1A 5FR2A 3DEFA 2RH9B 1DKOA 3DEYX 2PBRA 1CUGA 4OAQA 5CB0A 1IIRA 5F5NA 3J7TA 3F6EX 2HMWA 2ETXA 2WNSA 3C14C 4L0CA 5EESA 2RK3A 3UWMA 3UW3A 2AR9A 2Q5FA 1WXIA 2H16A 3DVQX 3IA2A 1JTFA 4F21A 3RFTA 4EJ2A 5JTTA 4EW6A 2PRKA 5IJWA 2N1MA 5LDDC 5CXQA 1P2SA 2ZS9A 3F5DA 4BRUA 2KS6A 4F38A 1G6OA 1GZVA 3DE7X 3LO5A 1DFIA 1S1CA 1T9ZA 3KLPX 3EUEA 2GAOA 3X2FA 4G1EB 2ZIFA 1CUXA 3FOFC 3ICOA 1UP6A 1Z39A 4INZA 2AEJA 3W2EA 1RVV1 2FPGB 3DVSX 5K8IA 3EXHA 1NAHA 1F4LA 2WHEA 4NYJR 5CLLA 5LBTA 1J42A 3U2QA 3UJ7A 3ZWVA 3QITA 3REQA 3UK6A 4R6WA 4WNAA 4V0NA 3FPKA 2OVFA 1R7RA 2QR2A 2VWPA 1UWCA 13PKA 3JQ7B 4MS3B 4TN5A 5TRTA 2D7DA 3O90A 3G1TA 3EFOB 1MT3A 2HUNA 5K20A 1E5DA 3NI2A 4R1PA 2EARA 1D7AA 2JBAB 2PH3A 3EIXA 4XEUA 1UBCA 3CRNA 4BNMA 4OFWA 3LLSA 4FOPA 4YJKA 3TNJA 3T7KA 2PKQP 3OU6A 1PS9A 4OSOA 2VJCA 5HSGA 3NJ4A 4EARA 1Y6ZA 2QX9A 2RFLA 5JVDA 2XDQA 3LQ1A 1WMAA 4RTSA 3ENZA 3L93A 3VNQA 3HC7A 1PJCA 4S1TA 2ETVA 4DA6A 4GD3Q 4MICA 1RFLA 3FDJA 2A7XA 2ODAA 1K7FB 2ZTVA 3KQTA 4UHDA 5C5CA 2ZZMA 1GUYA 1ZOIA 2R86A 3ETJA 3JQQA 3V4VB 2ZIWB 1CBUA 2H51A 2I8LA 1YIAA 2PSJA 3FYUB 3HUTA 4HFJA 4R0NA 5IAGA 4HZGA 4QOIA 3PWSA 3GFVA 1EQAA 5FBVB 2RGXA 2UUOA 1EX9A 4JYZA 3DE2X 1CJTC 1F20A 2P9HA 1LUAA 1DLJA 3DR5A 4JX9A 1Z9BA 2HU2A 3AV3A 3PV0A 5B1DA 1U0TA 3E81A 4F5YA 2CL6X 1AQ6A 4YB8A 2W6JA 3N2LA 5KYNA 4RPGA 3BXXA 2ANBA 3IP3A 5LOVF 1OTXA 1XZIA 1Z18A 3A28A 4NIMA 3RFXA 2O59A 3LH5A 1EESA 4GOLD 4BNIA 4KPFC 4MRPA 4KAFA 5LU9A 3GP3A 1RKUA 2BMVA 3IOEA 4YCJA 3WFJA 2OY0A 1WPGA 2RGUA 3I23A 4BZXA 3B70A 3TWOA 3ZE8A 5BXYA 1BD4A 3L79A 2VRBA 1T8YA 2OBFA 4WNAB 3QVUA 1FP4B 4YJGA 1Q22A 3T5BA 5B1EA 4XVRA 5JMWA 1GKIA 1H1LA 1P4SA 3V8EA 2CT8A 3TTUA 2HIAA 4I1OA 4MPRA 1KSJA 3B9QA 1Z2AA 2H9YA 4EA9A 4HFMA 4DDUA 1ZD9A 5HUJA 2AEMA 1T2VA 1GADO 1TLLA 2J9FB 1O89A 1RSZA 1S9DA 1SC3A 4J1TC 4EYEA 4F5DA 1BX3A 1IK6A 4I5FA 3KFXA 1Z0SA 1SNYA 2EKZA 2PUTA 4PV7A 1PQYA 1VGQA 1RM5A 1E2FA 3NOVA 4OP2A 3EC2A 5DBEX 1RMTA 3PKIA 4OK5A 3NWBA 2H1CA 4LUCA 4ZVVA 1N0UA 3FNEA 4AMUA 1XKTA 4YLGA 2ESRA 3I4CA 2DR0A 3NHYA 4BIIA 3DCYA 4A91A 1ID1A 1P72A 2Q1YA 4WASA 2LZ0A 4EATA 3JASB 4IL5A 1BTOA 3V6MA 3WMWA 3SXUB 5FADA 4CEIA 1ZRSA 1R0KA 2AQHA 5CBPB 4D9MA 4UM9B 2E4XA 3CPHA 1JE0A 4MYTA 4W5HA 3B7WA 4WESA 4NONA 2V74B 2G9ZA 1DZ3A 2J3IA 4LVNA 3CR8A 1QF6A 2LGJA 4QTZA 3SQDA 2B1QA 4TLBA 3CUWA 3CF4G 4B2LA 1DJLA 1Z0FA 4A73A 5GADl 3PR3A 4AMYA 4AAYA 3D43A 3IDZA 3N8IA 3PYXA 4YV0A 3DVAA 1ATZA 1O4WA 3FUCA 3K1AA 2EYQA 4R0VA 1MX3A 3C7AA 2RARA 2DRIA 2DZDA 1P19A 1T29A 3QELB 2YASA 2X0RA 3G0DA 3PDUA 1L8QA 1IUKA 3P9NA 5ICCA 2O8BA 1Z8HA 4DIUA 3I09A 3MM4A 3THOA 1ZNQO 4IMPA 1TF5A 2J5RA 2QIPA 2XEXA 4EUSA 5BWNA 1RQNA 3RRNA 5CVJA 4HDSB 5BT9A 3O3MB 3SLKA 3RAFC 3DL2A 1U90A 2NYUA 1HOTA 2ZZKA 1EJ0A 1ZK3A 2QPAA 3BMNB 1HLFA 1E5QA 1KI6B 3L41A 3Q3HA 4K8RB 4K6MA 4QOSA 4E11A 4E2FA 3HMKA 3UA4A 4CI9A 3LHIA 4DCUA 4TVSA 1DDGA 3T1YB 1AQLA 3IVGA 4DUPA 4EF5A 2Q5HA 1NN3A 5HKBA 4AI6A 1VSQA 3AGQA 1L0BA 2F1OA 3DLTA 3OT5A 2WSMA 4HG2A 5JSYA 5CA0B 2H85A 3NO4A 3ZXYA 3H83A 5HKKD 4YUZA 4KQ6A 5IG2A 1GR1A 5ENDA 5E1BA 4COOA 2PSHA 1NWCA 3CUSA 3JQRA 3H9GA 5CFRA 3C3WA 3MZ0A 1XTTA 2R4UA 3RNOA 3EWNA 1DTWA 4HI0E 4DTIA 5FH9A 1GPH1 4BPBA 1V5EA 1Y33E 4CUZA 1WEHA 5LQSA 3AXTA 2GPTA 2UKDA 2DX7A 2FN9A 4R1QA 3ZWOA 2AMVA 3D64A 2HU5A 2NUTB 4TS4A 5ALDA 3RU3A 1KTIA 1OGYA 1EZZA 3HL0A 1PQUA 4C7VA 2ZWAA 1IWPB 1V1MA 2IYPA 3ZWCA 1RXEA 5IJ0A 3NOOA 2PZAA 4PLTA 3DMTC 3BMOB 5JLJA 2YW2A 3BBPA 2X19A 3CLTD 4JENA 4KMSA 3L7KA 1UJMA 4C0XA 2IVFA 5KNBD 4HQ0A 1RQ7A 5SZIA 5TARA 4WCDA 3S7ZA 2VT2A 1KYYA 3VR3A 4DIOA 5ALPA 1MFZA 1GL6A 3LFUA 4LFBB 1Q3HA 4NCHA 1U3TA 1E3WA 3MTEA 3B1JA 1QGUA 3UGKA 4XPIB 2V5AA 3A27A 2I22A 4GF5A 2XMRA 2FOXA 1CRZA 5DBIA 5GQSA 4GOMD 4N8SA 4N01A 1EAYA 4REOA 5T4FA 4EG5A 5BWBA 2QIOA 1NJFA 1ITZA 1QE3A 5CHYA 4LNHA 5JJLA 1WSDA 1QH1B 2AOWA 1R50A 3COPA 4HGQA 5DX0A 1QR2A 2RAPA 5FUXA 2A0UA 1D2EA 3NP7A 4NS4A 3ODGA 3QF7A 3NGLA 4PX2A 5AR1A 3RC1A 4AJOA 3EAGA 3LKBA 5HG0A 1M6VB 1XZFA 3RF6A 1RHJA 2GCPA 5AKKA 4BATA 3KPYA 4HH3C 3NKFA 4NABA 1NVXQ 1QTIA 1JQ5A 2A6PA 3ASUA 3HYTA 1M1YE 3MNFA 4X1OA 3SHQA 4UOEA 3ISVA 4PZUA 4RUKA 4MQ6A 2J9ZB 1OWMA 1PW7A 2Q5JA 5A9TA 2PUWA 4RA6B 1N6NA 2CVHA 2CUKA 2QD2A 2V7UA 4XD7D 3RFVA 2EFJA 4Y18A 2OCIA 1G21A 2IHTA 3IE1A 3F2IA 5IC5A 5HXAA 5TGZA 3WK4A 4BWFB 3PQ8A 4NBSA 5FNVB 5DHQA 3S2ZA 3N2GB 3K0FA 1N5RA 1HWYA 4QHTA 3ZX5A 1IE3A 2Y77A 3V4PB 1DWOA 4DSTA 2A9RA 1VI2A 5JDIA 2YWDA 4NU8X 4IICA 3GRZA 3ZBUA 1EWQA 4PZ9A 1YCGA 2P91A 3ENNA 4Z4FA 1T2UA 1NJ1A 2JGDB 4M38A 2CBGA 2OE2A 1TMGE 1MOQA 3SZUA 4EHFA 1EHIA 3D5EA 4U02A 1JIXA 3FLAA 5T4HA 4ENPA 1EJBA 1S3FA 1SXJE 3OQPA 5JAMA 3Q7PA 2D1FA 2MR6A 2QPTA 2TMGA 1WBJB 4FKZA 4LJAA 4UZSA 4AZWA 3B1XA 2V59A 4FZ5A 1SXQA 2VUIB 1OWLA 1YRQA 1QHNA 2FEOA 1T0HB 2JHCA 2Q0SA 2VDRB 1Y7PA 3K73O 3OPYI 2IHKA 4NEGA 2WSLA 3U39A 2EFCB 3PT5A 3THYB 1EIWA 2HRBA 1AKEA 3IGFA 4YYEA 2JI7A 1XCMA 1B0ZA 2ID9A 1K7EB 3KAKA 4CM6A 1OV6A 2PWZA 2A9VA 4H77A 4MVJP 4REQB 1S4MA 1FDOA 4YRKA 3IEMA 2OQ2A 4KEAA 3KOZA 3UMJA 4BNZA 5HZHA 2BPOA 2O50A 2VNJA 1CS0B 2H3HA 3TZKA 3F98A 1IOLA 1RAFA 3QNMA 1W5FA 4E13A 2WTNA 4BEVA 5IU6A 4PRKA 4BMYA 1TQ2A 3CWZA 2WWRA 4IV8A 2MMGA 1N6RA 2L69A 3OJXA 4FILA 5IYZB 4N0PA 4KPUB 1W7AA 1L2TA 1TECE 3MJEA 3DXFA 1ZNWA 2Z04A 1CRQA 3LY9A 4EIWA 1R4AA 4O4HA 1GG8A 4AY2A 4HCJA 3HFSA 3HDGA 2X5OA 1Q20A 4IIUA 4BTLA 1NWHA 1PR5A 4HDOB 4RTPA 1J1ZA 1OZ0A 5A5EA 3OI7A 2H9AA 1RJEA 1AF7A 1KPHA 3EJWA 2YYSA 3IJEB 2BEVB 4J7AA 4WKCA 2IFTA 1BEEA 1CIJA 2C42A 4TKZA 3OJCA 4PFQA 3HCBA 4X7MA 5HYVA 2AMLA 1KXJA 4BGEA 1NKVA 4OGGA 1JQEA 3DE1X 4C7MA 4TWRA 4IILA 1EGMB 2ZB3A 1OW3B 1GAJA 4J75A 4KRXA 1J09A 2MSWA 1P1HA 3JU3A 5SV2A 4B3SB 1Z25A 2VQEB 4YI3A 2XMSA 3H8JA 1PNVA 1PI3A 2VXYA 1XROA 2XE7A 4PQRA 3WV5A 2XHZA 1OLXA 1GUBA 2HSEA 5PGMA 4F72A 1AA9A 3AJ8A 1LQ2A 1K3TA 4PCUA 1FU4A 5M7EA 2OESA 1FBNA 3RVBA 1NFFA 2CCKA 4P54A 5K0JA 1PR2A 4LOLA 1ZSVA 1NLYA 1RI4A 1ZL0A 4FDAA 5FI0B 4F6CA 5EPEA 3MXTA 4P58A 1P7VA 3V2GA 2W6NA 2P77A 3D2LA 4WRRA 3A14A 4MV1A 5EE0A 3TKAA 3PLAE 2YICA 4UCWA 3KVOA 1DEOA 3O3CA 1FP7A 2WJAA 3DW1X 4G1UC 1KIAA 4F6RA 4CGYA 1FQJA 5L3VA 1BO6A 2DWQA 3HFRA 5ICFA 3I2GA 4AJLA 3WGNA 2UDPA 1L6IA 3PK0A 1KGDA 4V0RA 1ZUHA 1SIBE 2F3RA 2IY8A 3WB0A 5BSEA 3VYWA 1PV4A 3OZVA 1JB9A 3BIWA 1Z29A 3BIFA 4PLWA 3RVDA 1Y9DA 1TYAE 2GKGA 3RYFA 3GPLA 4G81A 3T1QA 4MGZR 4B48A 2B1JA 2ACKA 4QICA 3NORA 1B73A 3JYHA 1RJWA 3KQPA 1XWWA 3GVPA 2QX4A 3U1BA 3FWKA 4TZ0A 4DT1A 3L6CA 4O8CA 3N70A 1VA5A 3NM4A 3C8HA 1GG2A 5BVHA 3IDOA 3BMCA 4WSOA 3F47A 1V8BA 3UMFA 5D3KA 3LNCA 4D9CA 2D06A 5ETJA 1Q1GA 1XDBA 3DF9A 3T41A 5HQ3A 3OHPA 3ISTA 3OE5A 2HJSA 1NV8A 3BIXA 1UWLA 4JITA 1M6VA 2V5VA 3HNRA 3BD7A 3IUJA 1VYTA 1IXRC 4ASUA 4JODA 5FYQA 1EDOA 4I1VA 1GNLA 2EZ8A 4Y30A 4CMEC 4GBMA 3C1TA 1IK4A 3JQDA 3FZQA 5JXIA 2AKEA 3PEUA 3K9GA 5A1JA 4BKRA 2P2NA 2RCYA 3KR9A 2J46A 3F6CA 2OXIA 4FLFA 2C1XA 2O4CA 2X0KA 4K6OA 2OV3A 4PIPA 1B23P 4YMIA 5IKOA 1LK7A 5K4AA 1JHXA 3IYLW 3WA6A 4LXTA 4YCDA 3C8UA 1MVOA 1S3SA 4R1LA 1FVFA 3W90A 1DQYA 2ISCA 3S70A 4BAZA 2BKXA 3OHMA 4ARBA 2VP3A 2PL9A 4JD5A 5IAAA 1PS0A 2D8MA 1NULA 2HRZA 2V7QD 2I7XA 4QWWA 5B55A 4CF7A 4PXYA 3ZLJA 5G1NA 1CD5A 3T1TA 3AT1A 3ZDXB 3CW2A 3OZFA 4GLJA 4BCDA 2Q8NA 1CETA 2JAXA 3FJOA 2C9CA 3IUMA 5DBFA 2FGJA 3DBHB 3ES9A 4AUMA 2YV3A 3ZVNA 4GOND 2NQ8A 2K5UA 1AVTA 1XDGA 3PD0A 5DXAA 4B8ZA 2RB5A 2B0CA 1HTTA 3CSUA 4ZYWA 4G0UA 3AVVA 1DV2A 4NV3A 3U3OA 4AURA 4K0KB 3B6KA 4OQZA 5DTRA 5T8KC 2AXEA 3H8SA 1KFJB 1MBZA 4A2QA 1V95A 1EB9A 3GA7A 3KXPA 3UGTA 4MW9A 4D98A 1Q0UA 2HPVA 1W4CA 1AZTA 5BVGB 1G4AE 4G2NA 1TYEB 1VLLA 4YLYA 4EQZA 2YN2A 3ZDYB 4BFWA 1NNSA 3LSTA 1SC9A 1WP4A 2VDPB 4RXTA 4EA8A 5AKYA 1AMOA 4PF1A 5A7FA 1BWPA 3TAHA 2A1TR 3FCUB 1I2MA 4TYWA 4QATA 3LYAA 1B43A 1OLUA 2QOEA 3RIYA 3BMNA 1ZOPA 3G2QA 3G1WA 4ZVSA 2XSZD 3DO8A 1ZM2A 2H7CA 5SICE 3U0VA 2OR3A 3OMLA 1U7WA 1KKMA 1Z6AA 2XRFA 4NV1A 3E5RA 3RCBA 3OIYA 5J59A 4K28A 4J4HA 4CCSA 4JYCA 1K2WA 3O2NA 4ZV9A 2H1HA 4F4FA 2DHRA 2YBDA 4COKA 2G3YA 4QPNA 3R7LA 4TTQA 3E5MA 1SCUB 2VHUA 4RV4A 1S8NA 4YCLA 1DS6A 1CRLA 3H75A 3ZU4A 3NBZC 1P7PA 5HIMA 3T4PA 2O8EB 1YUBA 1L4NA 1OSNA 3QVJA 4WNYA 3A06A 4BFXA 1V8FA 2MYUA 2BP7B 3WLQA 1I1OA 2V1XA 3Q9SA 3ZNNA 1BMDA 3Q5GA 1L4FA 2BI8A 2PZBA 1Z0ZA 3NGMA 4B73A 1UKCA 4M2LA 2XJ9A 1ISSA 4J07A 1VKHA 1TZMA 2C3MA 1UJ4A 2BL4A 2OBBA 1XMQB 3GRYA 1BVYF 2DHQA 1BHJA 4RIIA 4IJ6A 2JAWA 4CE6A 2GCEA 3SQOA 3Q98A 3NHFA 3GFSA 1BDJA 5EJ2A 3BL6A 2CNWA 1OXSC 3CCFA 4KQCA 4Y6OA 4HJRA 4HGOA 5E3IA 1E1NA 2XTAA 3BFJA 1ZU5A 3LG2A 1JA0A 3QENA 5JCOA 1WNTA 1B1CA 1NT4A 4CKYA 1I33A 2Q4TA 3UUEA 3T5AA 2D4AA 1CUJA 2OD7A 4F5ZA 1FQOA 4TTSA 1NUPA 4OJNA 2PX4A 3WO1A 3HTXA 2JGNA 2F6RA 3RT9A 2QZPA 2VZ0A 1WDWB 5JQWA 2V03A 3CSDA 3A2NA 1ZCZA 4K6GA 3QI7A 4OHPA 3KLNA 2DT5A 4YTEA 2E89A 5DYTA 2Y6VA 3OPQA 4HDQB 1KOGA 1CJUC 1PF7E 1VC2A 4NCXA 3NV9A 3SEQA 2ZJFA 4ZZ0A 5BYAA 4XSHA 1H5NA 5JU6A 4DZTA 3IHLA 1H8EA 3H7AA 4I4NA 3KAQA 2ZUWA 3D3NA 4OK6A 4BWYA 4Q7QA 2HR1A 2ZJ4A 3KQNA 4V2UA 2DMRA 2IYZA 3M6VA 3V1TC 3GV0A 4CG0A 5BN4B 3D1JA 5K3EA 1PR1A 2W83A 4XI9A 4OHMA 1GQRA 3PX2A 2DG2A 4XWYA 4AJKA 3WLEA 4FOSA 1Y1TA 2CYBA 2X41A 1L8OA 3QLEA 4Y1RB 1WHSB 2XVXA 3QG5A 2YNMA 3G5UA 1XCJA 3GRVA 4WCFC