5GGYA

X-ray crystal structure of periplasmic desferal binding protein fhud from vibrio cholerae
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
267
Chain Sequence
b'HMRVVVLNWDLLEQVLELGIQPVGAPELSSYVQWVVQPEVPSSVQDIGTRTEPNLEKIAALKPDVILAAGPQQDLLATLGRIAPVVYLPNFSEQDNAAQVAISHFKTLATLFGKEAVAQQKLEAMYARFSELKASLQHAFGDTLPAVVTLRFANPTSVFLYTENSTPQYVLEQLGLSSALPQPPKEWGIVQKRLSELQHVEQGYVLYFLPFAEEKKVQKSVLWRAMPFVQAGRVNSVRPVWSYGGAMSLRYSAEAITESLLAVAPQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron(III) ABC transporter, periplasmic iron-compound-binding
publication title X-ray crystal structure of Periplasmic Desferal binding protein FhuD from Vibrio cholerae
rcsb
source organism Vibrio cholerae
molecule tags Transport protein
total genus 88
structure length 267
sequence length 267
chains with identical sequence N
ec nomenclature
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5ggyA01
2R7AA 3ZK9A 4TKUB 3MWFA 1N4DA 3AEUB 4UDNA 1EFDN 3HJTA 3K1AA 1QH8B 2OV1A 2XY4A 1KARA 4WNAA 4UTOA 1H1LB 3AERA 2R79A 4OXRA 1N2CA 5M34A 2PHZA 2XDQB 4OVKA 4UTPA 3CX3A 3ZKAA 3LI2A 4WZAB 3U7QB 2Q8PA 5BVHB 1M1YB 1QGUA 2X4LA 1PQ4A 3AEKA 5JPDA 5M29A 4G09A 1K0FA 2RG7A 4PM4A 4TKUA 2WHYA 3ZK7A 3AEUA 4ND8A 2YNMD 2XV1A 2XQVA 3PDIB 4HMOA 4ND8B 3MD9A 1QH8A 3TNYA 2YNMC 5JJ5A 4G07A 5BVGA 4GICA 1H1LA 1TOAA 2XUZA 3EIWA 4XPIB 5BVGB 5M3BA 2MINB 4N01A 4CL2A 4INPA 2XDQA 2M6KA 3AETB 2ETVA 3AESA 1G20B 5M2QA 4WZAA 3U7QA 1M34B 3AESB 5BVHA 1M1YA 4MLZA 4WZBB 5CX1B 1K2VN 3LHSA 3NU1A 4M7OA 4H59A 4HN9A 2OGWA 2WI8A 2XH8A 4PAGA 5KOJA 4H0FA 5KOJB 4LS3A 5AFSA 3PDIA 1ESZA 4NNOA 2PS0A 3TEFA 1K75A 1M1NB 3TLKA 1G21B 4IRMA 4TKVB 4XPIA 4FILA 4B8YA 3ZK8A 5KHLB 1PSZA 2MINA 3HXPA 2O1EA 3MWGA 1QH1B 3BE6A 4LJSA 1MIOB 1KAHA 3G9QA 4WN9B 1N4AA 2PS3A 1FP4B 3AEQB 3AETA 1G20A 1M34A 1KAEA 2OV3A 4MDYA 5I4KA 3R5TA 5KOHB 4OXQA 5B58T 2M6LA 1K7SN 4WZBA 5CX1A 3MINB 2AFIB 3BE5A 4WESB 5JOQA 3MFQA 2OSVA 4K3VA 4MX8A 3EIXA 4HMQA 4DBLE 4NNPA 2PRSA 3R5SA 1M1NA 3K1AB 1G21A 4TKVA 4WNAB 3HH8A 3AERB 5CR9A 1XVLA 4MO9A 1L5HA 1QH1A 4FI3F 1N2CB 3PSAA 4FKMA 1L5HB 1MIOA 4HMPA 4WN9A 2AFHA 3PSHA 1N2ZA 4FNAA 5HDQA 3ZTTA 1FP4A 3AEQA 2AFHB 4UDOA 5FLYA 5GGYA 4INOA 5HX7A 2PS9A 2Q8QA 5GGXA 2QI9F 5KOHA 3UJPA 3MINA 2AFIA 1QGUB 4WESA 3GI1A 3AEKB 5JG7A 4BBPA
chains in the Genus database with same CATH superfamily
1KH3A 3MMNA 1KVTA 3O1IC 3GPLA 1CJKC 1CE8A 1KK3A 1UZNA 1Z0SA 3LWNA 1L4FA 3H4MA 4TTAA 5KYUA 3TXYA 3V1YA 4YV2A 1IHUA 4GD3Q 3NH9A 5FL7A 2GZHA 3DHWC 3G85A 1I1QB 4MVWA 5JS8A 1QM5A 4DUPA 3QQ5A 4C87A 3U44A 3K0CC 3CX8A 5DZSA 1XPOA 3DP9A 1NVVQ 1U90A 4HJRA 3IO3A 2WIJA 3PFIA 4NJEB 3R74A 4AU1A 2PUAA 3CUVA 4PNZA 3DLTA 3HCEA 5K8JB 3P0JA 3U4IA 3HO6A 4W1RA 5SYAA 3TTUA 1D6MA 1NT4A 3CVOA 3SYNA 2FX3A 4N0MA 4E2ZA 5C1DA 1JFSA 2WNSA 3H17A 4L4ZA 4IMPA 1FNBA 1YR2A 2OXIA 1SU8A 4GGMX 2NO9A 2VDRB 3EOBI 3ZWWA 1NRJB 1PVVA 5FJIA 2EJUA 3M9WA 4HTFB 2CHVA 2RFLA 4JEHA 3I04M 3OIFA 3CUUA 1OBCA 3I5XA 1ULHA 2IEYA 2O14A 3GDFA 4L3WA 4S35A 1WPQA 3LPCA 2FJUA 4DWJA 1UEJA 5C4MA 8LDHA 2GR9A 1JAHA 3S44A 5IN4A 2PWZA 3UAXA 1IL0A 1SPXA 3G0GA 1M5UA 5LUBA 3RK0A 3D5EA 1C41A 3UPUA 4N47A 3AVXA 1FMFA 1SUDA 4N76A 1NJGA 3ZE0B 2O1XA 4DTCA 3BL5A 3CMCO 1RC1A 1AKNA 2JIZD 3GN2A 1UJ4A 1EAYA 2Y1DA 3PC7A 3TQSA 3C3KA 3M2PA 1FMCA 3UJ6A 2WVHA 4HEHA 4WZBB 1IYZA 4RS4A 1XB2A 3T1NA 5KCMA 5D6NA 1KHTA 3IEPA 4CG3A 2ZUVA 3F1KA 4DIBA 3MQFA 1UQTA 4D9FA 4G37A 5BW8A 2Y99A 1OFUA 2DY0A 2WT9A 1BGWA 3AHEA 3CUEF 2H5IA 3UQYS 2PBRA 2NIPA 2X22A 1FDOA 1OI7A 1CB7A 1Y4DE 4OHRA 1KDYA 4EGQA 4KQIA 4ECEA 3W6PA 3ESBA 4RHXA 4AT1A 4ZGGA 5CCXA 1Y8ZA 1LKZA 4NZYA 2DQ4A 3AETA 5HFNA 5BQFA 2PKYX 4YX9A 2QSZA 1F60A 1TRHA 1L6RA 3MTQA 5HP4A 4KRYA 5C8YB 2X86A 1SKYB 2BUCA 5FAXA 4W5NA 4HAWA 1FFDA 1NLFA 3WOHA 3HTXA 2BFWA 4Z9BA 2PTHA 4JBYA 5D86A 2QLJA 2I1LA 1P4SA 1M54A 1SHTX 1HPLA 2CCJA 2Y1GA 3HR8A 1TD9A 4IX1A 1RIFA 2E48A 1XDGA 2JEOA 3JAWB 3K32A 4KXQA 2ZRGA 2NO4A 1H69A 1F2UB 3OLYA 2J7PD 3AGQA 4HAUA 4IGFA 4OK6A 1XTTA 4LTMA 2WV7A 3S2YA 1P5HA 5AUQA 1E3TA 2WYHA 3AC0A 1I24A 5B2ZA 2I4IA 3HM2A 4LEIA 4RK0A 2PNJA 2BOVA 4WXYB 1E6WA 2IDKA 2TYSB 4YRLA 1L5HA 2ZJFA 5I8PA 5LQJA 4Q05A 721PA 1E3WB 2QVYX 4HGRA 3OLXA 2FW7A 1K7FB 3GRCA 1ZHHA 2IHUA 5DSTA 2AZTA 4C76A 3B3JA 4DLTA 2HPHA 2VZLA 3PL1A 2X1LA 1SCDA 5THKA 5IFKA 2C7OA 3B6IA 3ZYCA 4ZO9A 1UWKA 1XRMA 4Q21A 1KJJA 2WWHA 3O4JA 4WKNA 2CDCA 1J2EA 4GI5A 4GWKA 1XZLA 2X3YA 4LVOA 4LE2A 3RJ5A 4B76A 4TYWA 3PNOA 1TUBB 3GHHA 4OHFA 5KTTA 3BAFA 1WXQA 3L5OA 4RVSA 2CJWB 4ZQIA 1I13A 3HY3A 3GMTA 3C70A 3KJZA 3SQWA 2NTNA 2X1HA 2QA5A 4OBWA 4PLGA 4D9HA 4C08A 4UEKA 1GHTA 1YFLA 2FKAA 5K09A 1H3EA 3IT1A 2XSZA 2DERA 1KJZA 1IRIA 3EUAA 3HDHA 1VBNA 1TAUA 2NO1A 2VO1A 1T9BA 1GGNA 3NAZA 2ACKA 1YS9A 2FEXA 4EYOA 2H16A 4C06A 4ITRC 2J3EA 2G4VA 4KBGA 4NK4A 3M70A 2PAAA 4OFXA 1E3DA 2RHTA 3KJQA 1XCOA 3K6RA 4G0OA 1RCFA 1Y42X 3ND5A 4MGKR 4ZQEA 5DNUA 1EFLA 3KXPA 1PNOA 3LPNA 1ZGJA 3P5BA 1O95A 4OLBA 2BGMA 1SURA 2CVPA 1RACA 3QGMA 4NJEA 1PZGA 1J70A 3AI2A 3KAKA 4GC9A 5K3EA 1ZGCA 2WKWA 2Q3CA 4FJ1A 4REOA 2FEWB 2HCJB 2BBOA 3Q41A 4P83A 1O77A 3BCUA 4XFKA 1HNXB 3R8CA 2VWQA 4O29A 1G8FA 4BB0A 5IJAA 3ZWBA 2I3BA 2X9VA 2IITA 4HTFA 4HKTA 4X6LA 4IMIB 1G0NA 2J0EA 1CP2A 3T7EA 3ITNA 4QQNA 2QTAA 3T3MB 2AN1A 2QD4A 4P08A 1JZSA 2AB0A 4WK2B 5ALMA 3FOWA 4HFJA 4BRWA 1MO2A 1Y9ZA 1AK2A 2RJNA 1TYDE 3QFHA 5U4XA 1XQ9A 5EUMA 1JALA 4Q18A 4MQUA 2E4VA 1Q1ZA 4OJKA 1MW8X 1W0JA 2SKCA 4IDOA 4J76A 1R12A 1RAHA 2AS0A 1UEIA 4G1FA 2VHWA 3QEJA 3ZZTA 1IBCA 1OZFA 3C7TA 2BUAA 1BW9B 1EB8A 2D74A 2VTEA 1A2BA 3CSDA 1R0RE 4HDCA 5DULA 1MQAA 2AFRA 3OPXA 4Q0MA 1M8GA 3E7DA 3C6KA 1A8UA 4A8HA 3C8UA 1DEXA 1U8ZA 4WZBA 4EFLA 2D5CA 2I91A 2IYWA 3AHGA 1CQIB 2IXFA 3G9ZA 1X1DA 4UMVA 5I5GA 3GGDA 4TLAA 1TX4B 3PK0A 4WESB 3GT4A 4UCQA 1MP0A 4KXXA 3TL2A 2I4NA 4F56A 1IULA 2FSVC 3FWKA 3AUFA 3T7CA 5A5FA 3DVQX 4HAVA 3S2EA 6PFKA 1GEEA 1UOEA 1N2GA 5JNUA 2MCFA 1TU0A 2Z3VA 5IBQA 2BM8A 4QQRA 3R4CA 3AKEA 3N8NA 4ZCSA 4WOKA 2XCRB 3SYMA 4GDMA 3WHLA 3M81A 3M9LA 4EHNA 1JQKA 2QD1A 5JZMA 1SVKA 2E6KA 5HX7A 4IBOA 3TZLA 3RUHA 3T9AA 3IODA 1OGIA 1CNEA 3KAJA 4TS9A 2GRUA 1GPLA 2UYGA 4XARA 4DC9A 1YZ3A 4WY2A 1E1CB 1ZX1A 2I2FA 2W4QA 1S2NA 2HDWA 2NTEA 3DZKA 4CM5A 6NULA 3GLVA 2XQJA 2X5KO 3F5FA 4BY9E 1O9HA 1U6JA 1IZZA 2H6EA 1G7SA 1OZHA 1DS6A 1QV9A 2H85A 3JAWA 4J16A 2WRZA 3TAHA 1F2UA 3HV0A 4II2A 3HUTA 4CG1A 3PF9A 1QORA 4FMCB 5DHRA 1OJLA 2B1GA 2VNKA 3MAAC 3RIEA 3UBTA 1RLJA 4LQCA 5EUCA 2M9MA 1Y6JA 1KDVA 3DCJA 4AJEA 1XK7A 5TR9A 1E3WA 4TRMA 2AG6A 1Y6QA 2V9CA 3EFOB 1N2SA 4HX5A 1RAGA 1BVUA 1I5OA 2VSOA 3AFMA 2BLLA 3L5KA 4FFRA 5EKDA 1F2VA 1ZIXA 1U04A 4LHVA 3ZXYA 5CFNA 1BO6A 4QYSA 4IIXA 1JU9A 4EUNA 1Z2DA 4S2UA 1MLDA 2X4LA 3MMZA 2W98A 3LL7A 3QMPA 4FGSA 1B74A 1YNOA 2WHYA 4JLWA 2XQVA 3LK7A 4GNKA 5AO9A 5THXA 1D4OA 1ILWA 1TUBA 2QNBA 1ETUA 2VJAA 4UATA 4OQNA 3VKUA 1V9CA 4OHOA 4MP3A 1JFTA 3ASVA 4KDCA 2CJWA 5SY9A 1TOAA 3DDWA 4YRFA 1XCLA 4BNXA 4PRZA 2Y8EA 2YQZA 3M4NA 1NKTA 2EKQA 4EARA 1ZN2A 4J1QA 4MIOA 4PZDA 3V4VB 4IMJB 5DLYA 2WWVD 5FV4A 1VIYA 2JIQA 4RPLA 3UV7A 1MVOA 3UJBA 3GJ0A 3HHPA 1N78A 4K03A 4G0NA 3SBDA 2RBGA 4IWNA 3VZQA 2A1UB 1Z7BA 2EZ8A 4R1QA 4OHVA 4ZAZA 2X6RA 2W6IA 2CKMA 3CY6A 3OJ0A 4QICA 1Y0BA 4FIDA 4RTOA 2Q5CA 2RBKA 2JFGA 1G8MA 3N7UA 2ZBQA 4JDPA 1KJNA 4N8EA 1QHHB 1NNEA 1SUWA 2QLMA 4MVXA 2ZZNA 3O4HA 2AW5A 2IYSA 2XX3A 1XL1A 1TUGA 1B42A 2PRZA 2REXB 2XEXA 2JGKA 3AWDA 5DBIA 3FOBA 4JGBA 3VH2A 1VG9B 3IT2A 4MR9B 2CXTA 2Y67A 3TTYA 2IZZA 1RP1A 5BMVB 2L69A 5CU7A 4XOUA 2NQ8A 1U65A 4YK7A 4OIFA 1J56A 2D7CA 3LRPA 4H27A 4B3IA 3VNVA 3THXB 1K8ZB 2YWBA 3TW8A 4YHHB 1SC1A 3NAQA 4K9MA 3PIRA 4PG8A 3RVBA 1X77A 3I2GA 3EGWA 4ZCLA 2KW5A 1U7HA 2ATVA 1HE2A 1QRDA 4EA7A 2YRWA 3D3WB 3K70C 1EG7A 3OE7D 3BXFA 4JI7B 2GPWA 3R5SA 4QA9A 4RK5A 5EJGA 2IU0A 1HYEA 3ZJVA 1KDTA 2Y0DA 2KPOA 4HF7A 3TBKA 1QJ4A 2IBTA 3GFGA 2RJOA 3ICQB 5JCOC 2NO0A 4PSCA 2IE8A 1YL5A 5ICSA 4V0QA 4Q4JB 5B6IA 1H2BA 2QN7A 1ONPA 2C03A 2VHJA 2CLHB 4RU1A 4M9RA 2XDAA 4UAUA 5LOVF 1KJIA 1SXGA 4KBFA 4XR9A 4H6PA 4DYDA 2RGUA 2UUCB 3H8SA 1GRQA 2QR2A 3FWHA 3RODA 4JROA 5AK3A 2UXCB 1CPYA 3L82B 2HWXA 4Z51A 1CQIA 3LYUA 5A05A 4B3TB 4NZZA 3OQJA 2C5AA 1BDJA 4TV8B 1M7GA 2UZ0A 5I7RA 2DG2A 2YZNA 4HL6A 1ZIOA 5FF9A 2UZAA 3HJUA 3JQ9C 4WCVA 3TDKA 5IT5A 1Y3HA 1C4KA 5DLDA 5GJBA 4COOA 1ITZA 3TQOA 5LZ8A 3NWJA 2QRJA 5B3JA 2ACEA 4IZOA 3B60A 3W6ZA 5IEBA 1P2FA 1ISIA 3WVNA 3OF2A 1W5TA 1M2GA 1UBLS 1AMUA 4G63A 5FWNA 1GPDG 2B37A 4G89A 1J9ZA 1GP2A 4HCJA 4GQBA 5GONB 2GNPA 4LSMA 4GQIA 1E7QA 5AXAA 4ZCQA 1NONA 1E1CA 1P5ZB 2Q3FA 3ES9A 2VHEA 1NW9B 3BRQA 1GTRA 1SHUX 1I7DA 4DUGD 1UEXC 4HFRA 1QP0A 5JMWA 2WVAA 3LK6A 3RSOA 4DQ0A 3G5MA 1JYFA 4DPMA 1LC0A 2DFNA 2GPJA 3LC0A 4I7EA 4OGWA 2RGRA 1I4DD 2IYPA 1Z35A 3KTDA 5ITVA 4BNUA 3KJFA 4IVPA 4MW6A 1ZXXA 2FR8C 3ELDA 4RV9A 5E6SB 4O4LF 2ATIA 4ZKDA 4Y9RA 5C3UA 3TF5A 3DL2A 3HBFA 4AMZA 2DLCX 3MWDB 2FETA 2XW6A 3CNBA 4B4VA 3EASA 2D1YA 3EFOA 3A1UA 4CQJA 1JDJA 2P2SA 1C8VB 2VKTA 4UTVA 1QPZA 1SXJC 3FD8A 4M0FA 3TEJA 5C51B 2G82A 2JD0A 2E5LB 1II8B 2P2LA 3UK0A 1N57A 1VI2A 2V54A 3OA0A 4BLQA 1S96A 1O57A 5J3JA 2WB2A 1M8KA 2XLCA 3MBKA 3SC4A 2WMDA 4FS8A 4R69A 3N2IA 4HDAA 4WLVA 5JI3E 2HREA 5F4BA 3K15A 1IE3A 1T0HB 7REQB 4L27A 3NCTA 4QPPA 4NOMA 3WHKA 3C8DA 1R9GA 3N2ZB 3HGTA 1V41E 2J46A 3RT7A 3TZKA 4Y1GA 1NYRA 3D0RA 4JI2B 2O57A 3AV0B 3NRBA 1H42A 2A1UA 2QE6A 3SS7X 3VR0A 5GY7A 1COZA 4BVJA 4ZU6X 4EZEA 2CSXA 4NU5A 3UMRA 2ZULA 2GI4A 2QN9A 5KPJA 5EZ5A 1AT1A 2IYYA 1PHPA 5GZ3A 1QHHA 4DCJA 1Z15A 3LPMA 4UUBA 4WH0A 2H31A 5BYAA 1IN7A 1FVFA 1KIFA 4FW8A 4MPDA 2ZR0A 3V46A 1Y3AA 3IP5A 3VR5A 4L72A 3B2NA 2HA0A 1VM6A 4I9UA 3V4PB 4PNEA 1MJHA 3KJEA 3V4ZA 4AKSA 4LYEA 2A14A 4WFIA 3L2OB 3PGLA 2HD4A 5F1YA 4MR9A 3Q3CA 1MJGA 2AMLA 4KCGA 4Q1FA 3TSZA 2EP8A 3BWVA 5BMVA 5HZGA 2GAAA 2RI0A 4LRYA 4JQYA 1GU0A 1E98A 2EFJA 4DQLA 2DETA 2HK7A 2QUJA 4ETNA 3THXA 3SOZA 1PYOA 3GELA 5EIFA 3UT0A 4D43A 1AC5A 4ETWA 1IEXA 4DC0A 5HJ5A 4ZHSA 3BM5A 4QEDA 3D3WA 4BTEA 3LX8A 3WK9A 5JQGF 1V8PA 3AFIA 3ETNA 3V55A 3L49A 1XZGA 3OP4A 4MVCA 1H6AA 3HKBB 5LYJB 4AKIA 1V8ZA 3JPYA 4XB6B 3IBCA 2OKCA 3U7HB 2C4UA 1QO0D 2B5WA 2QUKA 1NWHA 4TMYA 4Q4JA 4JJKA 4QGGA 4BPRA 1KP9A 5C31A 2WJ4A 2OFOA 4MEBA 4AULA 5ER9A 4ZV9A 1QQ7A 1WETA 1FJGB 4BRSA 3WGYA 1RWXA 1TCBA 1TM5E 2V5VA 2UVPB 3QVTA 3Q2KA 1XP5A 5AK0A 2XB9A 5EJ7A 2EW8A 2EG9A 2F1OA 2HPAA 4YALA 5FPYA 2FW9A 1SAYA 4D9MA 1WXGA 3IOMA 1B15A 1GQ2A 2G9ZA 2JJ2A 1KSHA 4TV8A 5E0OA 4XGQA 4P32A 4UFNA 3KELA 1Z7GA 4FP9A 4J94A 1RD4A 1YB6A 2H51A 1N6KA 2R4QA 3D2BA 4YUXA 2GD2A 1MPXA 3W05A 4GICA 4GR9A 5J5CA 3SEZA 2IXEA 2QJRA 3CNHA 3ORQA 5BVGB 1NUQA 2IVZA 3DL7A 4IM7A 2B78A 3EXAA 3UHOA 1E8NA 1ZNXA 2F00A 2JKZA 3ED1A 4KPUB 4XTCS 3RTEA 4QVKA 3UMGA 3WHIA 4HV4A 4M1QA 1U7TA 4YRKA 2PGLA 1TGVA 2ORWA 4I4TF 1Z22A 2GFHA 3LL4A 2DTXA 2ZJ8A 3SHOA 2PUCA 1PJQA 1QYWA 4YCMA 4N6NA 5JARA 2X14A 1Q83A 2YFYA 3MJSA 4XIJA 4CT0A 1AB5A 3UXYA 3T3IA 3BH0A 2GKGA 5BSVA 2Q3LA 2DQKA 3OU7A 2PX4A 4QOFA 1P6XA 2XVZA 4XGKA 1PFVA 3DDUA 3DMRA 1TQ4A 4QD3A 5CXXA 4L4SA 3TM5A 4MKXA 1YA8A 4XD2A 2ZRAA 3L6CA 3NV9A 4LNUB 2F7SA 1MX5A 4LXUA 3FZGA 3RIYA 2VWPA 4EZIA 5KVVA 1QRSA 1E3SA 4ER3A 3E3AA 3HDYA 2J9RA 4IGIA 1QJCA 1KYYA 4QZVA 5HUHA 3RDPA 1YI1A 2IW1A 2ILVA 3DMTC 4F91B 3EPJA 3UTDA 2ZOSA 4M9QA 1NXPA 5KO2A 2EBHX 3UC5A 4XM0A 2DUWA 4QGAA 2IYNA 4S1VA 5D7BA 1YB1A 4B1FA 1THZA 2B8JA 1E5LA 1G3IA 3NDJA 2PT6A 4XEUA 5TEVA 1ZO8A 4F92B 1II8A 3FB1A 5IRCD 3HY4A 4N41A 2B4QA 5HW0A 4LF7B 5JXGA 2ZSEA 3VR6H 1OA0A 7AT1A 2ZQZA 4M60A 3MNFA 5NULA 4EYEA 4PCAA 3U60B 1KYWA 1H8HA 1XAGA 2HSJA 3FUUA 1I8TA 3U4AA 2F1HA 1E1QA 4NMWA 1ORDA 3ZE7A 1NFRA 1KBOA 2VYCA 3E81A 2R1UA 3X2EA 1QIGA 2EIHA 4U2KA 4D8TA 4ZVOA 2Z95A 4F71A 5IWAB 4DGSA 2GD1O 5IDXA 4JYCA 3HG7A 5B3JC 4Q4AB 5HZMA 1W0KA 4RULA 3LHIA 1XD9A 3K09A 5GGXA 4OHPA 2G0AA 4FEGA 5E7IA 4MCJA 1ACLA 6YASA 2VBFA 1B7GO 2P3QA 5K9ZA 4F7DA 1ZOOA 4D97A 1T9KA 1TA4A 2A1TS 4KGZA 3WGMA 1NI3A 4JBHA 4J0DA 3C7KA 4MV0A 4YROA 2QAGB 5A4FS 3T7DA 5I8ZA 2ECPA 2XY4A 1NW7A 1V8FA 3PNLA 4RZQA 4YACA 4FYJA 3WBFA 3DAPA 4YRTA 1HYHA 4XWWA 2J5BA 4OXRA 3A4MA 4KP7A 4G65A 2VYQA 1D5CA 4ARZA 3MT0A 3TLBA 2R4UA 1Y81A 5AMXA 3IPXA 2W83A 1UXOA 3QU4A 2L18A 4BU1A 1I2DA 4AN0A 3WO0A 3R24A 3L79A 1C9DB 5B7GA 2A9QA 2YQ5A 3K6JA 1U5BB 5EJ6A 1QB8A 3H2YA 4YXWA 4XH9B 1F06A 1IZ8A 3W4IA 1DEOA 3V1KA 1V0JA 1KA9H 3H5LA 5F7JA 1U8FO 1PKEA 1XZKA 4NH4A 4ND8B 1D9XA 2ECQA 3HKBA 2Q5EA 1IIRA 5E1BA 3LQ2A 5LYJA 3D4PA 4B33A 4BE7B 2XZLA 5EXPA 2OORC 3GRRA 5F64A 1JX6A 3FAKA 5DCWA 2MYUA 1ZMXA 1S3GA 2IU3A 3AP2A 3IA7A 4MTCA 1MVNA 2JK1A 1X8JA 5IK2A 2WM2A 2B83A 1HTBA 1Q7TA 2XZDA 4FNOA 4G01B 5AVVA 1FRNA 2UVPA 4CG2A 1XTSA 3QOXA 1X39A 2COEA 3I28A 1N34B 1JXMA 1H5NA 3R75A 1M72A 3N87A 3E8XA 2C0QA 1BFDA 5IZ4A 1P4GA 4C88A 3U9TA 3UFXB 2CUNA 1CX9B 4ZQBA 4BHTA 3CLRD 4IZHA 5A5GA 3PGXA 3BXXA 1K8QA 3AKCA 4LXGA 5G41A 1KFKB 2I7CA 2ILTA 2NV2B 1P0FA 1UPBA 2EERA 5J4YA 2ADFA 1WQ1R 3BMCB 1GVHA 1Z4OA 3HN2A 3COWA 1HLGA 4YTEA 3MWJA 4GL2A 3LAWA 1EP1B 2KE5A 2O6HA 3GFQA 4KPUA 2JGLA 3BXPA 3HP1A 4H3VA 4Z1OA 2I6TA 1ZESA 1VL6A 2NT3A 4YC7A 4ZV7A 1GUAA 2GERA 5HJ7A 2RCYA 2OZEA 1AZTA 3PLAE 4DIMA 3PX7A 2NYVA 5DTRA 4FGJA 2DTDA 1JMYA 5B1IA 3LQ1A 5I4KA 4FDLA 5JSZB 5LM3A 4C7BA 1C0PA 1NXOA 1P2DA 5I4IA 1VFPA 2GFQA 1U7OA 4HP8A 1QO9A 5DBFA 4YBZA 4R8SA 2CVHA 2OSVA 2Q2NA 3KZMA 4Y18A 4AS2A 3VPCA 4FMBB 4BKOA 4KN8A 3WGTA 1MO5A 2YVKA 3FYTA 3DWIA 3R76A 1U8UA 2XLBA 5EIAA 1XTVA 3WNBA 3DDZX 2XVYA 2F9MA 3DOUA 2FFAA 3HYLA 4WADA 5LKAA 4PLTA 2IFTA 3V3KA 1ODCA 5LBTA 1Z6XA 2DVMA 2GYVA 2YXDA 5ILQA 4UOZA 1USIA 2RC5A 3QPBA 1EA7A 3ND7A 2IGBA 4M37A 1GXSB 1G7RA 4HXGA 1W2HA 3DSRA 4WZ6A 4D6XA 3VNSA 3F74A 4PLPA 3QEKA 3WFIA 4QXPA 1F0KA 4WEOA 4QYXA 3FIUA 1S01A 3HSKA 2ZVJA 1J39A 3WQBA 3NEYA 1HUQA 3OHPA 4DG5A 4F2DA 2ZBPA 3MGKA 2G67A 1CUZA 2BFAA 3ZK9A 4E13A 1RKUA 1TZCA 3OMXA 5CIQA 1ZD8A 2P3LA 3I83A 5J59A 2NACA 4A2PA 3ZLVA 4MQMA 4YXFA 1Z2EA 4CTMA 1LWOA 1LA2A 2ZKLA 2ZRFA 5BV0A 2HC9A 3GMIA 3IQXA 4IW3B 1JHVA 2YZGA 3CUSA 3BB1A 3DVSX 2CXNA 2J3IA 3P2EA 4JCOA 5LXTB 3EARA 4Q3DA 4DLVA 3GDOA 3W6UA 4IDAA 5ERYA 1OXTA 3VAYA 4MQ6A 1BE0A 1G41A 1KC1A 1XHEA 3K0KA 4Q4AA 3B9QA 4I3FA 1XDUA 3KOZA 4DV3B 1A3CA 2HF2A 1GKKA 4XM1A 3R4VA 1M1YB 2BW0A 2GN6A 3DTVD 2F4NA 3OZ7A 4MKFA 2JRLA 3TGWA 1IWBB 5MGNA 4BNFA 3A14A 3A2NA 1G8SA 4ZVMA 1V5WA 3ENQA 3B78A 4AROA 2IPNA 2VPZA 1LRKA 2QAGA 4R51A 3X0DA 5TB5A 2ZXFA 5JH7B 3OZCA 1PGPA 3WL4A 1MAAA 5B7QA 1GUDA 3WK5A 1VOTA 4L1KA 3SFVA 4M1MA 1VSQA 3UJHA 4EQ6B 3HP4A 5DN9A 5CDTA 1VKOA 3J81A 1QS0B 5HJ2A 2BEVB 1I6MA 3RH0A 4DSNA 1T8TA 2BWJA 2JI9A 3R5KA 4FNMA 1A8QA 1MB3A 1OFGA 4IIUA 5A4MS 1W5AA 2PZLA 3P5SA 4HLUA 4MCAA 5TC4A 3WK6A 4BYMA 4CDNA 1CZUA 1NVVR 5DHAA 1U5BA 4P3YA 1U6IA 1L1FA 2CLIB 2WF7A 1HBJA 2EBUA 1QVZA 4M7OA 4TV9F 1W9HA 3W3AH 1RZRA 3KJGA 1GGKA 3RU2A 2IV3A 3ROFA 5JPIA 2Q6VA 4BFTA 1GNSA 2UKDA 1YR1A 3UWSA 1XZIA 4NBKA 4IILA 3UXMA 2F6RA 3E3NA 2B4AA 2AT1A 2O2CA 4IDGA 4JXKA 4BATA 4BNNA 5DXAA 5IYZB 2IDJA 3NWEA 3U13A 2XQIA 5C7OO 4J4BA 2YASA 4F2GA 4PQGA 3VGPA 1PL8A 1QVWA 2C7RA 1KK0A 2ACWA 1A1SA 2BT4A 4PC3A 2HHCA 1Z6YA 5AVUA 3NYRA 1Z5GA 4GKVA 4HLCA 4ZQGA 1I3LA 1EJ0A 1ZH4A 1KE1A 3TFOA 5C52B 3MJHA 1DEHA 3A4YA 1LNSA 4LSWA 3I3OA 3UFXA 2I66A 3HZHA 4LDRA 4WA8A 2YDYA 2ZRIA 3DO5A 5AJYA 5HHTA 1ADJA 3KR0A 5EP2A 1FUKA 1UOPA 4IFIA 4HVTA 2I7DA 3LC7O 4NNPA 3VSAA 3SIRA 1QNLA 5LD2B 2C4TA 2CFTA 3BMCA 2XZTA 1JLSA 4RPJA 4TSKA 1SIOA 1ANKA 3H0EA 5LUAA 5KJEA 1OHHA 3GGGA 3T94A 3D81A 2DFDA 2FK8A 4U63A 2C0PA 1J1ZA 2DPGA 3PXXA 3NX4A 3FPAA 4FHCA 4FHGA 4HD8A 4M54A 4RKRA 3QUBA 4LSZA 5T41A 3D7RA 3ZNPA 3A36A 3EHDA 1U6KA 4TZ0A 1GQQA 1S2LA 3AEXA 1N0UA 4FBLA 4M1EA 2B7BA 1ONSA 3HBAA 1EK2A 2XTNA 1MD9A 2ROQA 3AXTA 3D6AA 3NVDA 4G0QA 3RLFA 4AP9A 5JWRA 4FSDA 4YHBA 1I0LA 4XYGA 5JSZA 4IJKA 1ZG3A 2Y4OA 2QN1A 2ZM6B 3LP6A 1HT2E 4PQEA 3STVA 3RSFA 4A0SA 1EG2A 3AR5A 2I3GA 4TKUB 4B0OA 2DQZA 4NG4A 3MUNA 1JDBC 3IE0A 1DVRA 3DBLB 3TIXB 5AQ1A 2O54A 2FLWA 4GHWA 4JGGA 4MV8A 2QRUA 3G2HA 1TQ8A 4O8ZA 1PZEA 3QKTA 5GOZA 4RIHA 4EBFA 5KNBD 4KU4A 3TJZA 4KQJA 2DKOA 1GXSA 2R8BA 3TTTA 1LLCA 1W25A 1NN1A 3AFOA 4QXQA 1IHYA 3GZJA 3OTIA 2AI2A 2H92A 3KKEA 5BVHB 4PN7A 1NN3A 3U1VA 2OHVA 3U7RA 2X5JO 3ORSA 4H7HA 3ACCA 4K0RA 4WLNA 4HB4A 2Q7XA 1CHNA 1QZ3A 1RJDA 4B09A 1EM8B 2A7QA 4O0LA 4AUMA 3GUVA 1KZ9A 3SYRA 1VHTA 3LXMA 3QLTA 2NU6A 3BDAA 1S9HA 2XADA 2FWJA 3HZZA 3RC7A 3TPCA 1FE8A 1I0ZA 5H3CA 4PYJA 1NP7A 2PKXA 4N01A 1BH6A 3RUFA 5AW0A 1NJ8A 5LXTA 5EUBA 1IM2A 4LY9A 5IKOA 3DLBA 4JBGA 1NJ1A 4RETA 2WNIA 2H1SA 4KIFA 5TVKA 5CVCA 3P2IA 5K6AC 1QAOA 2V7XA 2EOAA 4C1NA 1KOLA 1C3VA 5EPOA 4CMCA 1M1YA 1PFWA 1G17A 4M8NE 2IHJA 3AY6A 4KO2S 1T2CA 4PAGA 5HK9A 1OLXB 3B52X 3KLNA 5CT5A 3DMNA 2FF5A 2JGFA 3E7WA 2AW3A 4V0LA 3BA6A 3IAXA 5EWJB 4AY3A 5JH7A 1C8KA 2AD5A 2A6PA 2WM8A 3WHPA 2TS1A 3ZU6A 5B3LA 1CS0B 1YBHA 1XZMA 2VF8A 1V6CA 2CWWA 1MJGM 2QW0X 4DR3B 1QS0A 2BEVA 4LX8A 1XTKA 2P3SA 1JHUA 1PFQA 4FW9A 5KQPA 1BVHA 3QKRA 3L46A 3H18A 5HIKA 1TK2A 1ILEA 4HB2A 3ADBA 3OESA 3DYBA 2YXPX 4MUGA 1NDUA 1QR6A 1HFKA 2Z56A 3GBSA 2E9SA 3B36A 3I73A 1I32A 1RU3A 4WK4B 4MICA 3R3JA 3T15A 3W04A 1V45E 3JYNA 1NMEA 3C6YA 4LXQA 4JR1A 3H6KA 4Y6GB 5HS6A 5ECYA 1YL7A 1ZMOA 4I5FA 1RXWA 2CVOA 3V4LA 1I94B 4MTLA 1I9GA 1VFNA 4HEJA 2A92A 1WB9A 1HDZA 1YS4A 2PL3A 3TIFA 5FLXA 2LKDA 3EVZA 3ZCUA 4UNPA 4ZJUA 1CZKA 2HMVA 4RNCA 1Z16A 2GUGA 2YHIB 3L84A 1N8KA 1U99A 1W8DA 1X9GA 1S8FA 3ETDA 3L0SA 2INGX 3OZFA 3X1KA 4KACA 2V4UA 4C6TB 4RS3A 2A94A 3LHFA 3L7AA 2DHCA 3UMVA 3TMAA 4ZK6A 3FSGA 3FRHA 2BCGY 1J97A 1E3LA 1GUFA 3T3DA 1PW7A 4CYMA 3RYCB 3S3TA 3QRWA 4PX9A 5JRDS 2ZTUA 1LK7A 3TNLA 4TX1A 4A73A 2Y05A 3AFHA 1EFDN 1G98A 2VJQA 4X7MA 4EVRA 2YS7A 1YKFA 5F1KA 5CFLA 2OB2A 1OAKA 4TS1A 1QNFA 1AQ6A 2CGEA 2BGUA 3Q11A 4L5IA 4MGHA 5ALOA 4IPTA 4WX2B 2C82A 5TMBA 2D7JA 4IUYA 3WTBA 3UGKA 2QAGC 3K9FC 1NBEA 4EW1A 4DAOA 3IHWA 3GCGA 5B6PA 3I53A 3OFND 4HO1X 5FIUA 2PHZA 1EFTA 3GNQA 3TVYA 4C0XA 3MRVA 1GKIA 3EY4A 1K8YB 4BZPA 2IUTA 1CETA 1I0IA 3OCCA 4PHFA 2HZBA 2W2KB 2PMEA 4D74A 1VG0B 3F6YA 3TLCA 4HLUC 4JSYA 2BDEA 3RLIA 2D0IA 1GITA 4GSLA 5D3ZA 4ZHQB 1CC1S 4BASA 4TKUA 4X00A 4L8YA 5C5CA 4EMTA 3GLIB 2OK8A 2ZIFA 3BWEA 3ETLA 4R8KA 4ATNA 1PWZA 3F90A 1FYXA 4R68A 2HN9A 3TRIA 1HKUA 1T2FA 4FCTA 1M83A 4OHCA 1XEAA 3SK0A 3EZ2A 3KUUA 1EJ6A 1VJ1A 2V0GA 2XBLA 2VG8A 2KYRA 2P65A 3EW7A 2QZ4A 4MV4A 4WXPA 2FWAA 3QUAA 4L8FA 1FPQA 3DNPA 4MOWA 2QRQA 3CH6A 5CW1A 2W0SA 3MZ0A 5DWDA 1THTA 2DCMA 2A5GA 4UBLA 4UNIA 3KQLA 2X0FA 1DEAA 1AQJA 5BVHA 4F12A 2Q5JA 1DWOA 3VPDA 1E4VA 3G23A 1Z8DA 4YQEA 1T9AA 1D8TA 1IBRA 1NV8A 2QIOA 4YRCA 4YN3A 5JJIA 1EM8A 1Q12A 3PQ7A 2GLUA 5GV7A 4FKBA 1GRNA 1UDWA 3ZX4A 8OHMA 1HR0B 5DEIA 5BOSB 1TE2A 2R8PA 1T3TA 2D1QA 4JT4A 5IUKC 1SZCA 4TLMB 2HSEA 2I8AA 1YS7A 5JBNA 2RKBA 3GL9A 5HRCA 1W76A 3GJ8A 1SB8A 1N6IA 3MWGA 4A0HA 4P3OA 1ZJWA 1EFKA 3FMIA 3FLBA 3JQCA 5THQA 3AILA 2F1KA 2Y1KA 2CZQA 4UULA 1SD1A 5TXGA 1RXYA 2AMVA 4FN4A 5BWLA 4QHYA 5ITZB 1PQPA 5BNTA 2Y0PA 1GTZA 1UC8A 4G5YA 4K6GA 3AVOA 4ARCA 3NT2A 1ZRSA 3ETCA 4K5QA 2GFIA 3NM4A 4HATA 4UAVA 5L9AA 1OF1A 1ECLA 8MHTA 4B4DA 3M6IA 4XIGS 1OLXA 3DMYA 5EWJA 4H1HA 5F9FA 2JFWA 2H63A 4CKCA 1EVZA 4DIFA 1NPYA 1QIMA 2QX4A 3CZCA 4B81A 1CS0A 5FBKA 4WCFB 2JIRA 3NGMA 1XVLA 4OOEA 1FJXA 4TSRA 3A4IA 4KC0A 4HZGA 4BVEA 3KQYA 3RF6A 4Z4HA 1WJGA 2GYWA 3WNDA 1P1KA 5AK4A 5IKEA 4DCCA 1QZXA 5ETJA 1Y4UA 4J7AA 1CJBA 4J91A 4WQMA 2F62A 3B8EA 2CNKA 4YJ3F 4KLRA 2J87A 1DKMA 1ZK3A 3RSZA 3CR8A 3SQMA 2P62A 4DANA 1BXKA 2WLSA 1GZ5A 4G5RA 4Q1DA 2COKA 1R27A 4LKRA 1HFEL 1HT3A 5B7NA 2C07A 3F7NA 4G8JA 3VOBA 2R47A 3AF5A 3NBZC 1P29A 2UYOA 3H5WA 2YHIA 4PQFA 5KKCA 3MERA 4X1YA 1KE2A 3K1ZA 3M6WA 3O0DA 4IIHA 2O3JA 2XBMA 3S1AB 3AVTA 4CQMB 2GAJA 2AXEA 4UXJA 4C6TA 2ST1A 4DR1B 2NZJA 3ID6C 5A4KA 4PLVA 3UMFA 2O06A 4HQ6A 1N7JA 2GLXA 5F3DA 5DSZA 2VPPA 2HSZA 3RYCA 3EOZA 1KORA 4Q9LA 5DTJA 4CFZA 1CY6A 3ZV7A 4NAUA 5CXQA 4LOJA 4PPQA 1EEXB 4WACA 3HCDA 3JRWA 5G0WA 3QVXA 5AM5A 3WLRA 2XE6A 2YJZA 2C7BA 1GA6A 3U0VA 2H2DA 2Y0EA 1HE1C 4K9RA 5A06A 1YRBA 2CT8A 4OG2A 5DN6A 2WVJA 5K03A 4G1EB 2Z2JA 5MF6A 4F96A 1H8EA 1H2YA 2F9FA 3AZQA 3LDGA 2PL1A 3E61A 4N9WA 4RXUA 3ZW9A 1ZQ9A 5ALJA 1JVBA 2ODQA 1G20B 1VSVA 1PD0A 2BGJA 2FN9A 4GW3A 4XD7A 5K6TA 4HI0E 3AVVA 3FKSA 5KNDA 1EXWA 4J2OA 4H3SA 4BIMA 4BYGA 4ZHQA 1Z5PA 3HYCA 4X7RA 1E9AA 5DWQA 4CCYB 1M2FA 2VUIB 3UWPA 1F8YA 5F76A 3EZ7A 3SXUB 1UZUA 3GLIA 3RRMA 1BZYA 1L7AA 3DDHA 4JKYA 3EG9A 4RK1A 1GGMA 4AZSA 2WT8A 2Y1LA 1NXVA 1XIVA 5T8KA 4DDWA 1G21B 2JZCA 1TW3A 4RZUA 3MCUA 1O96B 5TNXA 1CUJA 1QK3A 1NOKA 3EEBA 3VBCA 4I5EA 3EQZA 3W9YA 2AXNA 4EUHA 3NXKA 1N2XA 5JAPA 1JLLA 3HDVA 3ICVA 4L2IB 2WKQA 3OEEA 3X1MA 2Q0SA 2QQEA 3DHEA 1IZ9A 2IUYA 2XODA 4TUYF 4J1TC 2PS3A 3C1AA 4Z86A 2X0DA 2VDQB 1NE2A 1CR6A 4PQRA 3N2KA 5EJAA 3N2YA 4YRJA 4AWBA 2GH1A 3ZZ0A 4E3ZA 4Q3AA 1OWOA 1HEUA 3C3EA 4J9UE 4PAMA 1TFUA 3PP8A 4CPDA 3OCYA 2WUDA 3QEOA 1Y8CA 1AO3A 4JNKA 3V2IA 4B6FA 5C1PA 5F7XA 4P53A 3OQHA 3LDAA 3K70D 1WXHA 1Z5VA 4P38A 1NSTA 5BOSA 4WINA 1L4GA 3AFGA 2ZXUA 1TMKA 3H2SA 4ACBA 3WWZA 4L9WA 1N75A 4S05A 1E3JA 3DFKA 5DXFA 1JG1A 3TZQA 1JPNA 4C6HA 2ANCA 3HJFA 3UVEA 3OFSA 3PENA 4L6CA 2XTJA 3DEAA 4G4JA 4I1SA 4RSMA 2OHHA 1FSFA 3IDOA 5HIJA 3TKAA 5I7EA 2IEIA 2VCYA 4G3XA 3M8KA 2X0RA 1A72A 3SLGA 5GGYA 3AX6A 3H87A 2OQRA 4IO0A 1UQUA 3K0FB 4QDOA 3A4LA 5FORA 2J3JA 1HE3A 4M83A 4UAJA 3WKBA 4BE9A 1M2NA 3AF2A 4HDKB 4HNSA 4BB6A 1KFBB 3F5MA 1DAGA 4IIFA 4POAA 4F3TA 5JE8A 3U4MA 1G9TA 3WWEA 3A6DA 1WQ3A 4JKIA 1F7UA 2HTEA 1SGWA 3OUZA 3TN7A 3X1YA 2PUTA 3H7AA 4QPJC 3P26A 3B5IA 4EKDA 4LOHA 3U7EB 1OWLA 2YCLA 3LP5A 1NL3A 4OJNA 2DR2A 2GKSA 4O2AF 5SYNA 4B6OA 2FWBA 3SEFA 2AQHA 1PFUA 1IEWA 1JR3D 3LUGA 1NATA 4QO8A 5E2AA 3IL2A 2QUZA 1DBRA 1EK5A 1UM8A 4WDQA 4IQ4A 2IVFA 3ZHSA 2P0AA 4M0MA 4IL5A 2EG5A 4ZAVA 4ZXFA 3QJYA 4AMUA 4HYEA 4XUCA 4CLXA 2JLZA 2FFHA 2DBYA 3DZDA 4JU8A 3FWPA 3I64A 3T3NA 4BAGA 1R8XA 2MIIA 3MT7A 3DB2A 4II3A 4NI5A 4BWYA 1KY5A 1CVIA 3OFVA 3QZUA 4FFPA 4M99A 5LQSA 3RAPR 3RW9A 4D8XA 2NTJA 2EKDA 3PPYA 4OBBA 4KPYA 4FT2A 1GAXA 1B2LA 2XTAA 5AT1A 2WZBA 1E9SA 2VH2A 4WPGA 2QBYB 2B92A 3KVOA 3QF7A 1NG9A 5C7IO 3WMGA 4NDAA 2DM6A 4KYTA 5DBOA 2O8FA 3HN7A 3RIMA 2REQB 2YHUA 1XLTA 3ER9A 1ZD9A 1M6HA 3SHTA 2CC2A 2W2NA 3W8RA 3K4HA 2EJTA 5CEFA 1CBUA 1HLFA 1EDDA 1Y1KE 3C6BA 1YUBA 3GFBA 1SXJD 3WFJA 5JZOA 3S1AA 4HRYA 4CQMA 2JFHA 2GZ2A 2XNDA 4RY0A 3D8TA 5AI4A 4Q66C 4GPZA 4PZ9A 4NZOA 1BHSA 4IFBA 3ZHBA 1E1KA 1GPBA 1TZJA 3HCRA 4Y2RA 3EIFA 1VL1A 1P5RA 3LCUA 4BQIA 2Y3IA 3CH5A 3MQ2A 3PZBA 4QQFA 1K92A 2J4DA 2P2NA 4C4OA 5BSKA 4C0BA 1UKBA 4BO5A 1T9DA 4MV5A 2VCEA 2YDXA 1KI6B 1MUUA 3QWIA 4R54A 3EVCA 4PLWA 1Q19A 3R3XA 2QNIA 3WYNA 3TR0A 1TYBE 1Y7LA 1U1EA 3CM0A 3ED5A 4HAOA 3WIBA 4MRRA 4CM9D 1RRCA 2NPFA 1DP4A 1Z6PA 3MRXA 2XWJI 1JGTA 1XLVA 2MOKA 3R3YA 1HLPA 4IMRA 5LCXA 2UVQA 4BKMA 1G20A 4FMPA 4BJ3A 1SKAA 4FDAA 5A02A 4A36A 2C2HA 3OWXA 3DLAA 4YJFB 5JMPA 3S28A 3HVUA 4H7DA 2ZBUA 1M7HA 1TCAA 2Z3ZA 4LBZA 3W5JA 1INLA 2QL9A 1F2DA 2D6FA 1JDSA 1YQTA 4CCYA 1JHPA 3H1EA 1JAXA 3NIGB 2OVFA 4NPCA 2OXEA 2IU4A 4YJDA 5DT2A 3W77A 3G8AA 1Z88A 4LJ5A 4QU0A 1X3LA 4C4AA 4DZRA 1G21A 4W8OA 1Y8QA 4JQSA 3UJAA 1O96A 2PX6A 2PYZA 5TJ9A 4HVCA 4HAIA 4DCUA 4ESHA 1JSLA 2X6QA 3N2EA 4KO1S 5K8LA 4TYYA 4L2IA 3FLEA 3UOGA 3VDQA 4KXUA 3WP0A 4IHKA 2HCFA 3DL4A 3DPUA 3IURA 4K46A 3ZBQA 2WZDA 3P19A 5EZSA 4FB4A 1K27A 3LO5A 3QUSA 5B7PA 4INOA 3B2EA 1O0CA 4P0PB 5C7LO 4J1NA 5HKAA 1QFJA 2RHOA 2ZGVA 3KVYA 1E9EA 5AJVB 1K3UB 5T67A 5JNLA 3MOIA 1E3EA 4RANA 3NTLA 4BECA 4U2DA 4XDGA 4EVIA 2Z57A 4L5CA 1NN0A 4LRWA 4V1CI 3TKLA 5FQOA 2W2PA 3V4SA 4NR0A 1I36A 1R50A 1YZHA 2IW3A 3L0ZA 5LQNA 2Z2IA 1AGNA 4NBLA 2QMHA 2D8MA 2XMGA 4KR0A 4OHXA 5C8YF 1GG9A 2FN3A 2HOQA 4O3FA 1Z83A 3Q1KA 4BVKA 2N1BA 5C1BA 5J23A 4POOA 2W90A 2Q1UA 1UAGA 2O20A 5DNYB 4BUJA 4FDVA 2FQWA 5A5EA 2O3QA 3K30A 4E5YA 3IKTA 3K0FA 5TPZA 3C1UA 5HCNA 2V8OA 4O4HB 5DV9A 3EN0A 4HDKA 1A9TA 1R8YA 5E2BA 3RYHB 1A9QA 3ESDA 4OQDA 1GN9A 1CF2O 3H5OA 1BOFA 1UT5A 3QUTA 3O8QB 1NW5A 1IM8A 1BFKA 3HVHA 5MN5A 2BFNA 3LT1A 3ER8A 4U2GA 2Q6KA 3TI9A 4CQLB 5JNRA 4QXMA 1HX7A 4XAQA 1VSUA 3IQGX 1ACMA 3IUSA 1C7ZA 4M76B 3WE7A 2JLYA 2XF2A 3G13A 5JFOA 1KNQA 1SWVA 2ZI4A 3NWPA 4IWXA 3UK1A 4I55B 5KBYA 1L5ZA 2HPVA 2JIPA 1ZSNA 5K51A 4LQLA 4NONA 2C5FA 1T34A 2VP9A 3QEMB 5EZYB 4PO9A 1D1SA 4GF5A 4M87A 2VNAA 4Q9KA 1CF4A 3ONVA 3EPKA 2C78A 1KKUA 2ES4A 2YC2C 3MBOA 1UJ6A 1XVTA 2PYDA 3JYHA 5TRTA 4KUEA 4N4AA 2ICAA 3AR6A 2BFDB 1K6JA 2IQ5A 2WBLC 3IVXA 4Q34A 2QBYA 1AKMA 1QDUA 1Z0UA 2H18A 4RZ3A 4XXHA 4D42A 3DV0B 4MUBA 3X1XA 1QYXA 4F5YA 3H19A 1XJQA 2MSLA 5FOWA 1WBBA 4DCGA 2QTVA 3GLGE 4RK6A 5DOZA 5IC5A 2REQA 1XU4A 2F2TA 3W1WA 5EY5B 3LNTA 1EINA 1G4UR 4I6EA 4GOND 1NQOA 3BCHA 1H0RA 5L4NA 2QQGA 4Z53A 2CLMB 3N0RA 5C7YA 2J4CA 3GUZA 2V7QA 4EYGA 2F3UA 4OQQA 4WFJA 1XKXA 1U9CA 4DWVA 5EJ4A 1UMKA 1PNRA 2MSWA 4GLJA 2JCVA 3IS3A 2FQYA 2ZREA 3JVUA 3OEHA 4K3VA 5E9QA 3KB1A 2PMBA 3HGQA 1TTHA 1CUWA 1PJCA 3EVFA 4ACAA 1KI6A 1MQ8B 1Z29A 4G1UC 2IL1A 1GDHA 2ONZA 3KWMA 3IP3A 1Y1RA 2WYWA 4RDIA 4ZO7A 4AQYB 3ANSA 2PT5A 1PZHA 2YIDA 4YRZA 2LP4Y 1VSBA 1G2OA 4Q39A 4PR3A 1UBKS 1EFRD 4V3CA 5IAGA 3VV3A 5T4HA 1AS0A 1UBHS 3DONA 4WCFC 3DE1X 2HT6A 2XA2A 3GJRA 4KH0A 3GRFA 3UZUA 3U16A 1H2XA 1LGYA 4BJHB 4P7JA 1LH0A 4YP0A 2OCIA 3ZHRA 4G5QA 1WTCA 5CJJA 4YJFA 5DM4A 3ZH9B 3ILSA 3AEKB 1TC1A 2MSEB 3KT0A 4WKOA 1U02A 2BH2A 2WMOB 1MRNA 4MYTA 2QM8A 1XMXA 1HQYE 2BM1A 3MWFA 3RI3A 2G9VA 3UG6A 3W90A 1DC3A 2WLTA 1MG0A 3KU1A 3QVGB 3ZU5A 4HH1A 2QLNA 3AH8A 3U1BA 2GXSA 5BSRA 2O7VA 2I2AA 1Q7BA 2HBYA 2D4AA 2NXCA 3JQAD 4X62B 1V5IA 1L8AA 1A5SB 2W48A 5A71A 4O02B 4M53A 3ROEA 4MNTA 3VOAA 5I48A 5LR6A 1XLTC 4OP3A 2GMWA 1GG5A 5DLPA 2VAWA 2FZ5A 3TINA 1BHQ1 1LPAB 4KRGA 1WB5A 4QRDA 3A8TA 1LQUA 1CYEA 4HZIA 4CUJA 2DFLA 1RYEA 1DRJA 1NF9A 1PEAA 3I2KA 4CE6A 4UTNA 1K4MA 2Q5QA 4I1PA 4XB1A 3ADCA 2FG7C 3R6GA 1BWQA 3LF1A 4Q3BA 4X9XA 3TCNA 3VPFA 4Z7OB 5E1DA 1HDOA 2VAVA 4X44A 3W0LB 4QO7A 1YJ5A 2BDUA 3B85A 2ON6A 3V4RA 1LPPA 1TAHA 4DMHA 2F3RA 2PZJA 3R7WB 2ZDGA 1ORIA 3H9EO 5HE9A 3MRSA 3FPSA 3JD0A 1JIKA 3BXEA 1P0IA 2FWPA 4X7BA 2DPLA 2ZRKA 1Y9DA 2HA2A 2XD4A 4TMZA 5G0SA 3R5JA 2C8LA 2VDVE 1DRVA 1DSSG 4FMCF 4O4HA 4M0PA 3RAGA 3W8FA 3ZQ4A 4JITA 4ZXPA 3KZXA 4M36A 2V96A 2VSYA 1HL3A 1RMTA 3RYHA 1I2ZA 3T95A 3E70C 3AIMA 4TXJA 1TYCA 4MQ5A 2C31A 4MJLA 1KQFA 3AV3A 3OHSX 2XH8A 3F9RA 5AYVA 2PPLA 4NYMQ 3VR2D 3F9CA 1BS9A 4QUIA 5CVDA 3TTXA 1UBUS 1UWVA 2DJ5A 2NUTB 3DO6A 3G68A 1VLLA 1XMSA 4M98A 4BMVA 4CQLA 4KR2A 4ZTZB 2RHGB 3RRZA 1CY7A 1PR0A 2AD1A 2DPXA 3CX6A 3E4DA 4DLBA 1V3UA 1L8LA 2O1EA 4B7CA 1JFRA 4H6XA 2WTXA 1GRRA 3DZBA 1E92A 4W82A 4AP5A 4I55A 3EVNA 5IJ0B 2VUSA 5H82A 1D2CA 1UJMA 2OPBA 3GCZA 5G1NA 3E4CA 4JD5A 3UK6A 4CT4B 5EZYA 1MH9A 4AF7A 2CJFA 1J33A 2BGIA 3U4QB 2OD2A 2Z9CA 3CNNA 4MWBA 3LFUA 2ZR8A 3TGPA 2J45A 2WM9B 4XGIA 1KAOA 1U7ZA 3OA2A 1AKVA 2BFDA 3JASB 3NJ8A 5H7XA 3T7TA 3INRA 3MB8A 5IK2D 3PJGA 3BTOA 1V8OA 1JQDA 4WKCA 5AM4A 3QUQA 5BNFA 3DV0A 3ZX5A 4Q03A 4PYNA 1Q0SA 2QK4A 4TWJA 1RHMA 1V9SA 3OZUA 2Q9BA 4BMPB 2DFPA 1ZINA 1FTYA 1Z08A 1E2FA 3A10A 2EL7A 4X20B 1ABBA 3PCXA 3FNBA 4RM3A 4E5SA 3E15A 3I92A 1GCUA 1JZQA 5ALDA 4P3PA 2Q8QA 4B87A 4PYRA 3V1LA 3TW6A 2YYAA 4C0SA 1B2RA 1GNLA 3LHDA 1YCFA 3BD6A 1RABA 1W29A 4R9NA 5ALIA 4I1VA 4JT9A 3O38A 3EDMA 4O59O 3QNUA 4DLNA 2FSFA 5DMXA 1YO6A 1KZ1A 1DXHA 3WL5A 4D4HA 1B8OA 1ZIPA 5GP1A 4RTNA 5ESRA 1GAQA 5CBKA 1WZIA 1A27A 3PQEA 1QZZA 4QBFA 3I5MA 1PSDA 3FSJX 3PQ8A 2PKQO 1JR3E 4Q82A 2WJZB 3ZE9A 3RV3A 1U0TA 3AXSA 4MS4B 4DT1B 1WWKA 2ESRA 5LZ5A 4BNIA 1EUCB 1Y63A 1GN8A 3OE4A 1X7XB 2X5XA 2ZSUA 1KSFX 4I08A 4NMLA 5EGNA 2IOFA 2NU9B 3T3GA 1VJ5A 1NV9A 1TJNA 1H65A 3PXCX 1QGOA 3BOSA 4HH4A 1GFIA 1L7EA 4TZ6A 2WYUA 1GV1A 3FETA 3SX4A 5CFZA 3LBIA 3AEKA 3CF4G 5P8WA 2WW8A 3W34A 2X9LA 1G63A 3LGAA 4A23A 2VTBA 1MOQA 2ZJ4A 1S3FA 3KKPA 2NSYA 1R0XA 3IC5A 3QVGA 4C2AA 3KQHA 1AGRA 4JLMA 5ALXA 3P9QA 5D6OA 4BNTA 3K6KA 3U3XA 1XRJA 4GFDA 1UXGA 1W73A 3C5EA 1AXGA 2ZUCA 4B82A 4JDUA 1XP8A 1G5FA 3FY4A 3GT3A 3W6NA 1UFOA 5JYDA 3MJVA 1OIWA 1JNXX 1WIWA 4C30A 3ZV6A 4B2IA 4ER7A 1G1AA 2G08A 4PAQA 2CXRA 3VHQA 5IAJA 2BJHA 2QG4A 3RRBA 2AVDA 1A7UA 4NECA 4C4YA 2OC9A 4A8JB 1UPUA 1XQVA 1JFVA 1NVBA 2DPYA 3ONEA 5ABPA 4B3HA 2GHRA 1RQLA 1CIPA 2FG6C 3GUHA 3O95A 2BYTA 3FI9A 5LQRA 1I7SB 2CZGA 1NDHA 1SKQA 3QSGA 1SVLA 3F3YA 1TCVA 4ZOCA 5J2TB 1UK6A 1XJ5A 1R18A 1CNFA 4O2BB 5GONF 3HLKA 3H1AA 1R88A 3EMDA 2HTFA 4UVDA 1VI5A 2HI0A 3RS4A 4JV5B 3R7WA 4LV5B 3RSHA 2MYNA 3HXPA 3VMFA 1V4BA 4JYPA 1E7MA 3PVZA 3ESZA 3L8FA 1KMCA 1H23A 1J22A 4AJNA 3LW8A 5JI2E 3IBGA 1L4UA 3DNFA 3FMGA 4AZTA 3FXAA 1MT0A 1MA3A 4D2IA 1GL9B 1T2UA 4OFWA 5K0SA 4BFLA 3HJHA 3IIMA 2HLDD 3MSXA 4K2AA 5EE9A 3SIWA 1Z4PX 3LYHA 4CFYA 1SKYE 2B1QA 2ZT7A 1GRCA 5K3OA 3D4LA 3AM4A 1G16A 1PG0A 3Q2IA 4L02A 1EXMA 1GPWB 5HK8A 4H7KA 5CYGA 4EP1A 4ERXA 3HDTA 4F3YA 3TSYA 2DH5A 4FFNA 3SJBA 4YV0A 4ZJYA 2WFMA 3KKMA 2H2AA 1XDWA 3PRHA 2NUTA 1EDZA 3WI7A 5LA6B 5IVHA 4PZZA 2YINC 3P27A 2VH1A 3P2YA 4FE7A 4JLNA 4JI8B 4OJQA 4DJTA 3LLSA 1WZCA 1XVIA 1XOIA 2CF5A 3E53A 2WSLA 3JWGA 1ZUNB 4MO9A 5CW2A 5DE3A 5TQJA 5C9ZA 1KYIA 5CXUA 3IXLA 2H9AA 2B4YA 1DWUA 2O2HA 5IJ0A 2QD2A 2B25A 4IF4A 2PFSA 3EH1A 5FLYA 4MQBA 4P33A 4HS4A 3BDVA 4OSOA 2OECA 2REBA 2YFHA 3IJPA 3WYFA 5HZKA 4JL6A 4QFDA 3IBSA 3VSCA 5JISA 2VI5A 2H07A 3GG2A 1KRHA 3H83A 3QU5A 3DWEX 3JASA 5KOIA 3P9ZA 5EZ6B 4HX9A 1Z4JA 5K0EA 1R64A 1I80A 3EIEA 1FDSA 3L02A 2ZUFA 5DGXA 3IEKA 2EFGA 2ZIZA 2OV1A 3AG6A 3AHCA 3GEEA 2FRVA 1GPH1 3SIXA 1L7VC 2VP4A 5NLLA 1JDUA 5A1TA 1UL1X 2HNKA 3EGOA 1TVKB 2PLNA 4PGAA 4MWSA 1M67A 4I9FA 1HEIA 3N5KA 4X20A 3UWKA 4C5AA 1EX9A 1QU3A 4AVYA 2YYYA 4OVKA 4RHTA 1H2ZA 1IVYA 2W6JD 4JAVC 3D3QA 3KO8A 2G72A 3H2GA 4BWGA 1NX9A 16PKA 1JA9A 3W4KA 4OI4A 4J29A 5L7WA 4ZVSA 3LNCA 5KI6A 4YI3A 1JBEA 1WS6A 1ZA2A 1GGEA 1OCEA 1VE5A 4V0NA 5FKJA 2J0UB 3O9ZA 5KU1A 5KX5F 1ZBDA 3P0IA 3COZA 4HQOA 4MB2A 3TQCA 3MTGA 4JWKA 2E4YA 2OY0A 2FZLA 3EVGA 1WUYA 5IBRA 4TVBA 3LKDA 2B1JA 4DOMA 5EA2A 5A9SB 1L4BA 2B21A 4MULA 4TXHA 3NWBA 3M5PA 2OO3A 1UDCA 5CM2Z 2XUIA 4GT1A 4BNDB 3BT7A 3CW2A 3SLRA 4F6LA 4RORA 3OM8A 4QODA 1R6VA 1EUCA 1XRNA 4KREA 1X7XA 4J4HA 5L3SA 1O8BA 2NU9A 1YZVA 4RA9B 1APBA 4YJKA 4NXMB 2II6A 1ZD4A 4KNWA 3PFNA 2C9MA 2Z4TA 1RWBA 1C9NA 3L0YA 4W6QA 4M8LA 5LDHA 1UPFA 3DS8A 2I67A 4LNAA 4DFDA 2Y1FA 5IDYA 4K9NA 1I3NA 1BXGB 5KQSA 1EWYA 5JAUA 4YP9A 3RRFA 1TAQA 1YR9A 5LQUA 1M6VB 3GH1A 4IH9A 3MF4A 1H4SA 2NAPA 3P32A 1WXXA 3RKRA 3L0DA 4AWXA 4PC1A 2G36A 2WHPB 2BGKA 3OZRA 1B8UA 5E8RA 4YP1A 4YV1A 2HYIC 1XVVA 3KC2A 1KQPA 4WVFA 4AZ0A 3DDSA 1U7XA 3EVBA 2BZGA 4LRUA 2QRKA 2EP5A 3OMWA 3ISTA 4PG7A 4REQB 5CA1F 3VR1A 3DOJA 1A2QA 1C7FA 3D5TA 3GARA 4GOJA 1I3CA 4KGXA 3T5AA 3HM9A 4ZAXA 5CVJA 4B6JA 1ZPDA 3UA3A 3GC6A 4RD1A 1HOTA 2F1RA 2NXWA 1FF9A 1EVLA 1SFRA 3HYNA 3IV9A 5EKSA 2GNAA 4A8JA 3HLYA 2BKXA 2D3TA 3E35A 5K8UA 1HRKA 1SKUA 2V7TA 4J0FA 1OFVA 4IEIA 2WYIA 4BLUA 3MTIA 5CNMA 2QW1A 5J2TA 2ZAMA 2FEOA 3UA4A 1M2OB 4O2BA 1NW6A 1NE7A 2AXPA 1EHYA 1SG0A 3PEFA 2DQSA 3D02A 4GBED 1PK9A 4C2TA 2CLLB 1QTRA 1M1XB 1P0QA 3P4UA 3E9YA 5EINA 4IKOA 2HQOA 2O3UA 4DM4A 3PGVA 1JHOA 2WKRA 4Z1MA 4N5HX 5CDUA 1DX6A 2V6IA 2Q4BA 1E5TA 3UXEA 1KU6A 4BMNA 3KUXA 3IBTA 1MV5A 3EEOA 4J7CA 2VBIA 3QY0A 2O50A 1FCJA 4Y6SA 4RKEA 1EQUA 5HMMA 3CUYA 3IV6A 2WHEA 4J0KA 3HO1A 1HL7A 4UMFA 4LY3A 1QMGA 1JU3A 2WWWA 1PBNA 3AY7A 3O3CA 1Y33E 3PUWA 1EK0A 1TO2E 1OLSB 4U7GA 1D9ZA 3B1FA 4A0QA 4AI6A 5K8CA 3BFJA 4C4XA 1XZBA 4R2XA 1X87A 4K9KA 1KL7A 4M0CA 3RGWS 1ZYUA 4C5BA 1CY4A 3QPUA 1A4RA 4NP6A 3JD3A 4XTRA 3S2ZA 3N2GB 1Z73A 3RARA 3TSWA 4F04A 1JEEA 1E79A 1WU8A 4XYMA 4XWYA 2VPWA 2XJ4A 4N0EA 4N0PA 1NW8A 1E6CA 1Z0AA 2CWDA 2N46A 1ESCA 2RGGA 2G1UA 3COVA 3ZCXA 1NW4A 1BNCA 1WXEA 2A2ZA 4D4GA 4CUKA 1MABB 4JJAA 3AVWA 4WCDA 3R6DA 2VK2A 4QG7A 4BMCA 1FPMA 1UDXA 4NSNA 1QH9A 3WTCA 2J3DA 2Y0CA 1OGJA 5DHSA 4XIYA 2MSNA 2L2QA 3CYFA 2C2XA 5GMOA 1A82A 1XF1A 1U2EA 3F9IA 4H2DA 1KMHB 3PUHA 3L6RA 3FW1A 3CW8X 2EEPA 3WKEA 5JYBA 3IDAA 4D6YA 4X54A 1WMEA 4U2FA 4CM8B 2DWUA 3EFEA 1GNRA 2P68A 3CONA 1D1TA 3ZWYA 5MGBA 4WNYA 2BE7A 1ENPA 1FUYB 2Y71A 4GOOD 4L50A 4FZ3A 4QXOA 5KB3A 2QM7A 1MVLA 1T9HA 1TVKA 1ZQ1A 3VO8A 1W85B 3BK7A 2WJYA 4LPSA 2GPBA 5BWBA 1Y80A 3KIPA 3DLCA 4R2LA 4HX2A 4Q6BA 1W19A 1R00A 4FMDF 4JOQA 2JJ8A 1A5AB 1VGVA 2XYHA 5BP7A 2QY6A 4Z49A 1DCFA 1XN4A 3ZDFA 3O75A 5A0FA 1XHFA 4KLNA 1QOZA 5GAJA 2BR3A 1XA0A 2CNWA 3F1LA 3BREA 3PXEA 3OC0A 4QVGA 4PTLA 4XVHA 2XUPA 5CGQB 3SF8A 5KJ1A 2FSHA 3ZVRA 3BTSA 5C5IA 2J0UA 5KOJA 4BQOA 3HU1A 1DUSA 1EU1A 2WTMA 1B4DA 4PXYA 3FYDA 4ZEWA 2LPMA 3C3PA 3HEBA 3FKQA 4BNHA 4EQZA 4I9GA 4ZI7F 2NXNA 2PV7A 3EIQA 2NSJA 1IZ7A 2G83A 2C9YA 3Q98A 4M1KA 1LS1A 1TMYA 3QTTA 4C29A 5LFAA 1KWKA 5T5QA 4KQEA 4UEJA 3OIGA 2ZUDA 4PGGA 4ZOBA 3KFVA 2Y93A 1SBYA 4P93A 5DNEA 2BFFB 2J6CA 3WS7A 2F4VB 3FTEA 1T6YA 1YWGO 3EZLA 3BIFA 4KUGA 4G1BA 4CMIB 1U28A 1B76A 2X2PA 4RA9A 1BDMA 1FFSA 2HJRA 1G60A 3JSXA 3O8CA 3S27A 2LDXA 4R1UA 1N7GA 2AC4A 3MT8A 2IHNA 2QAJA 3GP5A 2WU4A 3VC1A 4BVHA 1NXTA 1C3XA 3N70A 2NPIA 2EIXA 4DAEA 4GM1A 4JENA 4PY2A 3W7VA 1A9PA 1QONA 1M6VA 3RC1A 1XNJA 4QT4A 2R2GA 5K0FA 2HHJA 4ND6A 4D9GA 3NV7A 3BJRA 2GN1A 1P77A 2MDTA 2ZZKA 3QX8A 4Y2GA 1KSJA 3SF0A 4A9AA 1HXHA 1XTRA 2HRBA 3FNGA 4REQA 1CYDA 2XMCA 1Q91A 1ZKDA 4GEGA 2Q6TA 2VHYA 5B2EA 2XMRA 5BSGA 4XJTA 1GLNA 4BQQA 1S8AA 4B34A 1JEYB 1HOXA 2RGCA 4BJ6A 1XTJA 3SM3A 3FLMA 4QM6A 1FTGA 2FUKA 5ARDA 4P3KA 1NVFA 3PUJA 2ZB2A 3HADA 1CR2A 3WBBA 2VHTA 3VQTA 2BHNA 1KVUA 1MDBA 5IU6A 5A0TA 4HBGA 1M2OA 1CLUA 2H1WA 3CB2A 3CS3A 4DKJA 5HQTA 3LX4A 3IJEB 3OOEA 4P54A 1H3FA 4KFSA 4E51A 3P94A 1L4LA 4MQEB 3U4HA 3PEEA 2O8DB 3ZJTA 3DOFA 4V0ME 1BGXT 4CLOB 1QP7A 5IASA 1N9GB 1PIWA 2ZRBA 3QFSA 3DEKA 3GEGA 1X74A 1WCWA 4D9KA 5FBWB 4PG4A 2V6BA 4S0XA 4PF1A 2VNIA 3SJUA 5G3ZA 1CDEA 3PC3A 1RZ3A 3RSGA 2BC9A 1OYOA 1UIRA 3T4UA 1E6MA 5KNDH 2HX1A 1RW4A 2EYQA 2PZBA 2DX7A 1OZ0A 3IDFA 1KEEB 1OBOA 1FLAA 3WLLA 5I7VA 4D0RA 1WHTB 2YXLA 2FMKA 2PX5A 3ZHYA 4ZDJA 5D1NA 3HR7A 4QJIA 3U3KA 2OP1A 4B6QA 2V9ZA 4RENA 3OQOA 4O0MA 4FWBA 3ZWXA 4XIFA 3C41J 4RO0A 4L76A 1RQ7A 2FRDA 1GL7A 2I2CA 4BKRA 1D2GA 3HNRA 1VIMA 4ZDWA 1BCRA 1KBQA 2ZRJA 3EWAA 4EPRA 4NX2A 3TCXB 3WGZA 2OB1A 2BEUB 4YIHA 1QHEA 1BWSA 3QLEA 2OV8A 2QB5A 3KKZA 5BORA 4OCZA 5GJWC 5LBUA 2ZM5A 4MS1A 3UATA 4RHEA 1X1RA 4H16A 4DV1B 1O89A 1X38A 3VVCA 221PA 4R7ZA 1JA1A 3ANTA 2VRWA 1KMHA 2O7SA 3QLVC 4WTOA 5KDLA 3VO2A 2ZUEA 2XA9A 3FPHA 4FEAA 4FI3C 5FTMA 2QQ5A 2VIIA 4CM8A 3G2PA 4RBNA 4D8VA 2EKPA 4XW2A 3ZHQA 4KIJA 1LF5A 1D6JA 3AHFA 1C7JA 2WIBA 2Z1MA 3PWZA 1NWCA 3QWFA 1B3RA 1RBZA 3FYCA 1W85A 4BRZA 1AVTA 1QYCA 5IC4A 2RAUA 1YE5A 2ZB7A 3ZE2B 2XVXA 3EQ2A 3OT1B 3TR6A 3Q72A 1R8SA 4KAAA 2J3KA 1TZKA 5JH7F 4DDHA 4G2NA 1LXCA 1Z56C 1ADYA 4NE2A 5CK5A 3RC2A 4YCLA 4RH1A 3SC6A 4NJMB 2PXCA 1DT3A 4XCQA 4ZVRA 5BNZA 3CLKA 1JSCA 4CMBA 4YT8A 3BGOS 3A9SA 4JLDA 1QFMA 3LBYA 3S40A 1LCIA 3ZPXA 2ONCA 1NAIA 2HO4A 3DDOA 5E1MA 4B6EA 1QV6A 1Z5OA 4UPDA 1YJQA 1XZEA 2B98A 2CZCA 5FA6A 5FR2A 2Y6UA 1QF6A 3UG7A 2IRWA 1I30A 1BS1A 1TQ6A 1VG1A 2C2OA 2GD6A 2JRCA 3AERB 2BFFA 3BRSA 3F6PA 4XUDA 1RLUA 3LSTA 2ZANA 4N7RA 4C6RA 3L7DA 3F8WA 1B1AA 3QP9A 4CMEA 1BHO1 4CMIA 3KQUA 4EG1A 1H2FA 1GL3A 4YASA 5AVXA 5DI3A 3HWSA 3L7YA 4DJ5X 4L75A 3FZNA 3HR4A 5IYZF 4QDJA 2BMDA 4PSKA 2EFCB 4XQEA 2WFLB 3A1DA 4PCUA 4JEIA 4WJKB 4C14A 5D01A 2IYXA 5L3RA 1WPGA 2JLAA 3KE9A 4GXQA 5LB4A 1AOXA 1TJ3A 2QMEA 3TOSA 1SC9A 1YKSA 4UZFA 4P4NA 2O8BA 4XDYA 4QXAA 5B3KA 4QDKA 4E7OA 4MWGA 4Q9DA 3L18A 4NHOA 3I52A 4DGQA 3BIOA 1EUQA 3WAGA 3SXJA 3SXPA 2C3MA 2L17A 1DAEA 5A6SB 4NENB 3OECA 3TOVA 5K1ZA 5A03A 5J4VA 3KXLA 1JEYA 1ZOLA 1FRZA 1MAHA 1T2AA 2WTAA 2ZIVB 1KVSA 2ABWA 2CMGA 3Q7TA 5AJTA 2M32A 1J0BA 3SHFA 2FVXA 4FM9A 2GWHA 2GDZA 2YXEA 1DG3A 2UYYA 3V6MA 1IPEA 4URXR 1MIHA 5AKIA 4DIKA 3DH0A 3S6JA 2VPYA 5F2EA 4P84A 1VMDA 3NIWA 3W9BA 4EO4A 3EJWA 4WK0B 1K8RA 1EGQA 1GZ7A 1N3YA 2FJPA 2PX0A 2ZBDA 3NORA 3NBAA 4MYDA 4PXSA 3WWCA 1YOBA 2ANBA 1BMQA 3JQFA 4MQEA 2O8DA 5A7FA 1GZDA 1KK1A 2FP4B 3JD2A 4L73A 3VR4D 4O08A 4CLOA 5JECA 4PAWA 1UF9A 4AM8A 1XJCA 1N9GA 1U0HC 3VR6D 2YTZA 3C5WP 4DEYA 4RVNA 3U9LA 2OM2A 4DCMA 4WBNF 3ZI7A 1UKZA 5P21A 4AJJA 3C4QA 4EZBA 1P7YA 2C4MA 5AJUA 2I62A 4JMLA 1M8FA 2A8YA 1ISRA 2ECFA 1KEEA 4IQGA 4G0PA 1MA0A 1SXHA 1CP3A 1WHTA 3BK2A 3PE3A 4EYQA 2JCSA 2UZ4A 5CD9A 2RJ3A 4RGQA 4S2EA 2RB5A 4LXTA 1B26A 1QIKA 1GEGA 4BC0A 2BEJA 2D1RA 1N6RA 3DAOA 2XEDA 1LB1B 3EDQA 2WP8J 3SSOA 4FU0A 4TKVB 5G53C 3TRKA 2CFIA 4AY2A 1QAQA 2JASA 2Q9CA 2Y76A 5I47A 1X0VA 2JANA 4FIZA 1DTEA 1PLJA 1NBMD 2H65A 2P8SA 2QRGA 2PV0A 3CRNA 3H2BA 4II7A 4NWIA 2VN8A 3D6TB 2P78A 1FTNA 3QXHA 2BEUA 3WKAA 1WB6A 2VRNA 3E5MA 1C4XA 2YIVX 3HDQA 4B6SA 4K05A 4BQEA 3AL2A 3W06A 1JHXA 5IM4F 3LQKA 1XPUA 2P75A 3LIIA 3CSSA 2FGKA 4H08A 1JR6A 3BE5A 4ARSA 2P3OA 1TLLA 3F4BA 4KE6A 4KN9S 4LBYA 1V16B 5T3UA 3VVMA 3VUEA 4DADA 3L6BA 4DJDC 1T1JA 2BGRA 1MC8A 1PZMA 4IH1A 3QKWA 3KD2A 2V58A 5GJCA 4AJHA 1KQGA 2PKEA 1S4QA 3Q3GE 4KR9A 2F8TA 3EIOA 1EE1A 2JI7A 1SC4A 1VC2A 2V65A 4KE7A 3WMEA 2EP7A 1JXOA 2WM3A 4V02A 2CN1A 4W7IA 2FZWA 1PQWA 5C1OA 2PL5A 5CVUA 4C1BA 4HGYA 5AD1A 1YVDA 2GILA 4PBSA 1RQ2A 5KCZA 1QRAA 2GTPA 1U2QA 5BWNA 1Q74A 1WW8A 3PXAA 3SE7A 3ZU4A 4ON9A 4NJMA 3ITEA 4D9BA 3PHLA 5GIPE 3R6WA 1J8DA 1ZH2A 1DBIA 3DGFC 3C6ZA 4WMLA 1JG6A 5A7GA 1LTHR 3LLCA 4JC5A 4NYIQ 2QM3A 4JR2A 1N6LA 1FBTA 2Q0HA 3G9XA 3H9GA 5B1DA 1MGPA 1BJKA 3TYXA 4NU8X 2CLOB 4BV3A 3ACBA 3O0TA 3B6EA 3BWCA 3L7LA 5ALSA 3RUPA 3AERA 2RGBA 4JBIA 2Z09A 5C8XA 1TZ2A 3U6KA 2M6RA 1JYSA 3BRCA 2PY6A 1YI0A 1JXQA 3ZHTA 1F8XA 4INAA 4KIWA 3EAGA 2PLAA 2NW6A 3M6MD 3BGSA 3P2JA 3RS7A 2P0YA 4GKJB 1QHYA 3LCJA 4AYWA 3S81A 4JQCA 1B43A 1QTIA 5L6LB 3FGNA 2E18A 1LTQA 1M8JA 2I2WA 5GJVC 4PYMA 1N0VC 3U09A 3UH0A 1Y5LA 5FJJA 4MROA 2WFLA 3T5BA 5CYOA 4DQUA 3LKZA 2BMVA 2YN4A 3PU6A 5IS2A 1S8OA 4J7UA 4YUVA 5JV5A 3TNFA 4HK4A 4L5JA 1VXOA 2WT4A 4RMHA 3K92A 1TEVA 4F9GA 4I46A 2H4ZA 2VYVD 2ECOA 4A26A 2W6NA 1DQRA 2IKQA 2ENUA 2YVAA 1D2NA 3LPAA 4N7MA 3ZHVA 4HFNA 4DXDA 4EJ6A 1U0BB 2X8AA 4KLAA 3PR2B 3WP1B 3VISA 4NBRA 3WY9A 5A6SA 2JIZA 3LM8A 4G86A 4NENA 1CZNA 3T1TA 4MSUA 3IERA 1OD6A 1JL3A 3ETHA 4XA8A 1EWQA 4JQOA 5CIYA 3B5EA 2R97A 5E6UB 1Z4QA 1M2JA 1T6XA 4WZAE 4IWYA 2PFKA 5E4TA 5AP9A 5KJFA 1DQSA 4LF6B 4DG9A 3A4VA 3ZLJA 1WX1A 3KOMA 3IDQA 3ZZMA 4EHFA 2DUJA 3KSBC 3N8KA 4NCHA 2AKEA 4GX5A 1PF7E 2A5YB 1L5FA 4NE7A 2FP4A 3PGJA 2VRCD 2FPPB 4YO7A 2IZ0A 1C2YA 2FV8A 2LKCA 4AMBA 4IJ6A 2EBWA 4BX3A 3L6UA 5JD6A 4PG6A 3AGPA 4AIIA 5C3MA 2IE0A 3DB1A 2CLDX 3LWBA 1TVMA 4GVPA 2C7PA 3WSTA 1A0OA 4MAFA 4BVBA 4HEQA 1W59A 1XD8A 3QYFA 2A9KA 2FX5A 2NPOA 4FHZA 2ADMA 3K9GA 3COJA 2HMUA 4S1WA 1LRJA 3IFSA 2IHBA 1TO1E 1FTQA 2ZU0C 3LYAA 4M0UA 4TL8A 1M74A 4TS4A 1L6IA 2G7ZA 1Z4MA 3IAAA 3MPUA 4N7JA 5KSWB 2BAGA 3F6SA 4DCVA 2J7PA 4ZD6A 2YXBA 3T9EA 4AXBA 4WLEA 4BO9A 1IZYA 2GSWA 4IOMA 3EQ6A 4TYQA 1L4HA 4TKVA 1QBKC 1T3HA 3AB7A 1F20A 1T9CA 3HBJA 5AKGA 3C5CA 4J3NA 5KINB 2QP9X 4NYMR 5AHOA 3SDSA 3CLHA 5AKKA 3GJXC 5LLSA 5EVCA 2CXOA 1AKEA 1JJ7A 3EHEA 2JA2A 3KQOA 2FUG1 2LCIA 5F7OA 2ZZMA 3FHCB 3KLOA 2GA9A 3S99A 4D92A 4CR7A 1GJRA 2RAPA 4X64B 4DG8A 4GP7A 4M9ZA 4I1YA 3RG8A 4HSEA 4F6CA 2R48A 4J4TA 3HZOA 4N5LA 3C3DA 3Q7QA 3R2JA 2PIDA 2G1KA 4G24A 4TZTA 4ROTA 3T0FA 5JXJA 1NM5C 2HGZA 3CBQA 3BTUA 2JG3A 4YAIA 3WV4A 1UAAA 1X15A 3B1VA 2B94A 3SSMA 3QJGA 4F72A 1MO6A 5IT0A 1KZ7B 1U0JA 1C9JA 1BKYA 1ECFA 1SCUB 1BA2A 1NI5A 4P81A 4TTPA 3D2LA 10MHA 3ULKA 3EAFA 3U1TA 4WLOA 5CLFA 1ZK4A 2GVDC 3DA8A 1VJDA 3FWZA 1RP7A 3A6HA 4R9UC 4UCFA 3SQLA 4UNRA 9ATCA 1Y4SA 3LLUA 2FSPA 3LI2A 4BC1A 3WJ1A 1B8NA 1V37A 2O5EA 1M1YE 3PR1A 1U7DA 4HUTA 2OKGA 5AQEA 3EEIA 4AUEA 3E8MA 3TXAA 3EGCA 1F7VA 1V1JA 1JHQA 2ACVA 2WSMA 3RNLA 4IV0A 2MMCA 3KQTA 1EGHA 2HT1A 1BKSB 5LOVB 3OLQA 2ID4A 3NATA 1CB0A 2IPOA 4L9SA 4LYAA 5LP6C 4MV7A 2OG2A 1PU2A 2QN6A 3L7JA 1SBQA 2H0QA 3NGLA 1P1IA 2NUPB 3TM4A 2JAWA 4PNHA 1SRRA 3THYB 4TL6A 5AVWA 1FMJA 2B8WA 3HKCB 3MLEA 4E1AA 1FU8A 4GLOA 2IYUA 1C7IA 3JQBA 4K6MA 1I10A 3JQQA 4HQNA 3ELBA 2FEAA 4URHA 4ZOQI 2PJUA 4QATA 2R7MA 4FKZA 1U2RA 3OCUA 4UOEA 1FU7A 5TQ0B 1EX1A 1EKXA 1G19A 4EF5A 5KTKA 3HXLA 4U7HA 1U31A 3GR6A 4CM1A 4OX9Y 3RWMB 3KU4A 3L4KA 5TQ2B 4IKPA 4FB5A 4B4WA 3PNKA 1W5FA 4LVUA 1FQKA 5FH9A 5JDCC 3C8HA 5IULC 5BSFA 4BFWA 4W99A 2OCKA 2HDHA 2I2XB 1ICIA 2BFEA 2WJJA 3ANNA 4ZPJA 1FFXB 5EHNA 5EQDA 3SFZA 3WLMA 3GD5A 1NY5A 3U3OA 2OBMA 4KJZA 4CGZA 1WF6A 3JQ7B 1ZGZA 2I80A 4X95A 1VIVA 3OX2A 4G36A 5E6UA 1QOPB 2IEBA 4Q9NA 4R7TA 3A6PC 3EXHB 4XIIA 1EYZA 4OYHA 3TSCA 2QDKA 4JLAA 2IHKA 1ATZA 1J6UA 2IYLD 3F6CA 1MPTA 1FFAA 3MMSA 4IQFA 3FF4A 4N65A 2A1TR 2QG9A 3OQIB 5DXJA 1RWQA 4HY3A 4AICA 2N1MA 1YSCA 5DJ5A 3IHTA 3C3BA 4PLCA 2W11A 5JS7A 2HAEA 3H65A 3DE3X 3SHVA 3EEYA 4JKOA 2ZIWB 3PEUA 1UM9B 2AFHB 5EHGA 2O59A 4BP8A 1C1HA 5CLQA 1GR0A 2B7LA 4OQMA 1U0LA 1VMIA 3RFVA 5FUQA 1L7RA 2F17A 2RHBA 1HRDA 2C5HA 2G6TA 5J4LA 5H16A 1KGSA 2PH1A 2PT7A 4MUAA 4WI1A 1SUEA 1LPOA 1OZGA 1B6GA 4US2R 2PUFA 1N3BA 3HNOA 1XD2B 4MHOA 3KDPA 3OQ1A 1M0EA 2V7GA 1Q5PA 1QIHA 4MV9A 1GUYA 1ZEMA 1N0IA 3L0BA 1AQLA 3PHBE 2AJBA 2W0MA 1VZ3A 3WQRA 3CZRA 4F6RB 1RWVA 3K2BA 5G2OA 4XPZA 4KO8A 4B3BA 3F8TA 2A5FA 4DR6B 3KX2A 4LQDA 4JZKA 1ARZA 4UE2A 1TO6A 2D1FA 3K9NA 4V24A 4G6ZA 2QRZA 1JTEA 3U62A 3V42A 2H29A 2P6UA 2FE4A 4F38A 1UT8A 2AHRA 2ZB4A 1KEUA 3GDHA 3I05A 1TW2A 4L4XA 1E1RD 2EDAA 1E96A 1HZJA 5ALRA 3PV0A 4NABA 2FMHA 3HMKA 1AO0A 3QWAA 2OZVA 3A06A 5J4HA 1JLMA 3FVRA 3CEHA 4J75A 4OF4A 4XUGB 2LE0A 2B8EA 1CRWG 4Z7NB 1SCUA 4OGKA 4V03A 1FYEA 2FUCA 1Q20A 2O7RA 2YIMA 3WJ7A 5K3SA 2O07A 3B1ZA 4LKOA 3LBFA 1WM1A 1U8EA 3C1OA 1UBEA 4DQVA 4ZRMA 1WP4A 1DX4A 1GQOA