4BMCA

Crystal structure of s.pombe rad4 brct1,2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
183
structure length
183
Chain Sequence
SKPLKGFVICCTSIDLKQRTEISTKATKLGAAYRSDFTKDVTHLIAGDFDTPKYKFAAKSRPDIKIMSSEWIPVLYESWVQGEDLDDGLLVDKHLLPTLFKCRVCLTNIGQPERSRIENYVLKHGGTFCPDLTRDVTHLIAGTSSGRKYEYALKWKINVVCVEWLWQSIQRNAVLEPQYFQLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-M CHECKPOINT CONTROL PROTEIN RAD4
publication title Phosphorylation-Dependent Assembly and Coordination of the DNA Damage Checkpoint Apparatus by Rad4(Topbp1.).
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Replication
total genus 60
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
A PF12738 PTCB-BRCT twin BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4bmcA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4bmcA02
2ETXA 3PXCX 3UENA 3QVGA 4ID3A 2ADOA 4XQ0A 2WT8A 3K0KA 3T7KA 4U4AA 2XNKA 3PC7A 3OLCX 3PXEA 4IGKA 3SHTA 1L7BA 1T2VA 1L0BA 3PD7A 3PXDA 3UEOA 3K15A 2HTFA 2K6GA 3JVEA 1T29A 4XPZA 2XNHA 3L41A 2EBUA 2E2WA 2D8MA 4N40A 4BMCA 3SZMA 3L46A 4Y2GA 3EF1A 2VXBA 2K7FA 3T7JA 2EP8A 2R1ZA 1OQAA 1Y98A 3EF0A 3II6X 3HUFA 3PC8C 3K16A 3PC8A 2M2IA 3PA6A 3COJA 3PXBA 1WF6A 3U3ZA 1Z56C 2COKA 4BMDA 3PXAA 3T7IA 2EBWA 4JLUA 3L40A 1N5OX 1T15A 3AL2A 2JW5A 1GZHB 1T2UA 2AZMA 1CDZA 2DUNA 3HUEA 3AL3A 5ECGC 2LE0A 2NTEA 3QVGB 3K05A 4BU1A 3I0NA 4IFIA 3K0HA 4Y18A 2COUA 3T1NA 1JNXX 1IMOA 1KZYC 2L42A 1IN1A 3KTFA 3SHVA 3SQDA 2INGX 3I0MA 2COEA 4BU0A 2VXCA 4OFBA 3FA2A 3PC6A
chains in the Genus database with same CATH superfamily
3FLEA 2Z4SA 3LCUA 3PNVA 1HDGO 4A2QA 4W5NA 5LP6B 2BP7A 3GJ6A 1N2ZA 5FUWA 3K0CA 5IHPA 2NYRA 3P4UA 2JLAA 4KRYA 1VBNA 3N2EA 1NQAO 2NV0A 5KCZA 3B5EA 4II7A 3CSSA 3OOHA 2PSJA 1CDOA 4K9DA 3L8EA 1VECA 5F5NA 2JJQA 4MYUA 1UWLA 2EZTA 2DGDA 2RHHA 3G88A 4MPPA 5AD1A 2WSIA 2F3PA 3EXEA 3I2HA 3SM3A 3DR3A 1JZTA 3E7XA 1ULBA 3Q2IA 4HLQB 3DYBA 1X80A 2RHMA 4P22A 5KB3A 4HLUA 1SIWA 2O3SA 3AVVA 2HLPA 4GZLA 4HTFB 2GM3A 1UINA 3FNQA 1SZJG 2V3CC 4LE1A 4CKBB 2AFRA 1Y8ZA 1YZGA 1GG9A 5H02A 2GAIA 1EESA 4L8GA 1DCKA 1DLJA 1NUTA 3KTAA 5CAEB 1KI6A 1OMOA 3RV3A 2ZROA 4C78A 3QY9A 1R0LA 5TY0A 2QVLA 1CDDA 5AI5A 3LT2A 1S2DA 3WLTA 1ZP6A 5CB6A 3SJZA 2BSXA 4M1SA 2IBMA 1N3YA 3ENKA 2BISA 4HGRA 5H68A 1GXSA 1KTVA 2GQ0A 4ZMBA 3L4JA 3W5IA 2F2TA 4UAJA 3RIMA 4IHQA 4QL3A 3U26A 4FFDA 4TL9A 1YJ5A 3H2YA 4LZZA 3RC3A 1SXPA 3LBAA 4OI4A 5SYAA 1YRYE 3MK31 4CW7A 2WD8A 1VBFA 3CQ9A 4QPZA 1WQ1R 2D74A 1E1CA 4ZQHA 3RRNA 4CM9D 3O2QB 5A5GA 3T3NA 1MVLA 4R2WA 2ZT7A 3UV7A 4DMHA 1YMUA 1BDBA 1GNSA 1GPMA 3CH4B 3T9BA 2P4UA 3SJUA 3X2SA 4E5NA 5EE5B 5JAMA 1O87A 1KJYA 3NX4A 2Q1XA 5CJ2A 1S96A 3D8SA 3HB5X 3OX4A 4ND7A 3SEAA 2A84A 3JD0A 4ZQBA 4AULA 1YUBA 3V5NA 5BY2A 2QY6A 3JAKA 4NE9A 2VBIA 3PPYA 3TW8A 1THZA 2WTEA 5D85A 3DL4A 1QNLA 2EF0A 2VS1A 1OFUX 4N6OA 1C0EA 3P52A 5GTDA 2C2OA 5KYWA 4ZIRA 1SCJA 4YLEA 4INPA 1SO8A 3P19A 5FOTA 1TIBA 2Q3HA 2V0CA 1N33B 2IWHA 1YR7A 3KPYA 1K6IA 4DDUA 1V45E 1UKAA 2XODA 1KOJA 3IUJA 4L4RA 4HS4A 4X84A 1G20E 1EPUA 2WHXA 4ARAA 1F6DA 4ZT7A 1ZMRA 3C7TA 4RZIA 3ZDRA 2O8CA 2VJBA 4L6AA 1Z7GA 3T3MB 1XVTA 3BWCA 4NPAA 2HJVA 3B9QA 1YH3A 3A1TA 1HYEA 4L4YA 5D1HA 3L8CA 3L8YA 1SBYA 3IIKA 1PL6A 3OIYA 4PTZA 4Q4JA 5KQMA 3A9SA 2Q8PA 1Z6XA 1X1TA 5AI8A 2JLXA 3DUFA 5IKXA 1W47A 4GI1A 3U7FB 1DAEA 1D7AA 1RFGE 5IUNC 4D2IA 1RJ9B 3WQSB 5JDIC 4HAVA 3DD5A 3OX1A 4PO8A 4Y2VA 4N9WA 1OR8A 3AUUA 1PAUA 3MGGA 3Q9UA 3GLGE 1TKAA 1VG0B 1W36C 4GYJA 1X7YB 1XCOA 3KKEA 1KAOA 3QLUA 2PDAA 3AFIA 1IULA 3EGEA 2C2ZA 1F0YA 5FWAA 2DQYA 2GZDA 1EEXB 4QASA 8MHTA 4GKJB 1NI4A 4I9UA 1FFHA 4UTPA 5JBIA 3FPFA 3T5AA 2VNIA 4K9LA 2QL6A 2VHXA 4C3VA 4EZEA 1XT6A 4RGYA 1P9RA 3T3IA 3HU1A 1XDGA 2F48A 3I61A 1Y6ZA 4JBHA 2OD9A 4HXYA 1ZD3A 4LYFA 4UEQA 2ENUA 3ZGLA 4DXDA 3CVXA 2XUAA 3L1UA 2DX7A 3TYXA 4EJ0A 3UJ6A 3FDZB 1JR3E 2IXBA 4PZDA 4JQCA 1JGTA 2ZSEA 5H3HA 3WMGA 3O2SB 1ECLA 2VI5A 5JJIA 1KI8A 2FPGA 1ZCJA 3HB4X 2BOVA 4RQBA 1NBMD 4TROA 2HTEA 3VR6A 1K4KA 5BVGB 4QPNA 1CRPA 4MI6A 2WU1A 3AZQA 5LQMA 3OEED 2MR5A 2DFVA 4ZP1A 1ZSYA 1KARA 3G1TA 5K3FA 4UXHA 3UOGA 1Z38A 2P6OA 4PE5B 5LDHA 1V1RA 4LEIA 2LCQA 4DV0B 4GUDA 4DTCA 2AQ8A 3EN0A 4UBNA 3QKSB 1AMUA 3R7WB 3VPHA 5I6DA 4LJLA 5AW3A 5IABA 1EUCA 3H16A 4L4UA 3OA2A 1C9YA 1TYEB 2I7TA 1FA9A 3P97A 4J03A 2F4VB 2XNDA 4FS8A 4YFYA 2JH3A 4TRJA 4II3A 5HGXA 2UZIR 3TRKA 5K8CA 2QQFA 4BB6A 4YXWA 3BRQA 3USZA 4DNFA 5FBWB 3KUKA 2J0UB 4OHWA 2WY2D 3DDSA 3ROEA 4C0KA 3DCYA 1YHYA 4MGIR 1DJMA 1VHJA 4FW9A 5CCBA 3F6PA 5EYPA 1PFGA 2QT1A 4C4ZA 4C76A 3MQ4A 2OD2A 4BO5A 3THSA 1GR1A 3X3HA 3QKRA 3FR8A 4KAAA 3IXQA 3AJAA 2XOXA 4D9EA 2I4RA 3AL2A 3MWGA 4BTVA 1TT7A 4DSOA 3FWPA 1M2OA 1GSOA 3NU1A 3M4NA 3WK5A 4Z3KA 4J76A 3W5JA 2MSWA 1Y3HA 3ZDZB 4BVHA 4BJHB 2VYCA 3LC1O 4KIGA 1XWFA 2BGWA 4GLLA 1JT9A 1KK0A 1T9DA 3BJRA 4C21A 4D9BA 4WZAA 5JY6A 2PLNA 1E6CA 5LQDA 4P34A 1ZQ1A 3ZI7A 2C3UA 2GN4A 3BE4A 4EVRA 4G4GA 1RLJA 3DE0X 5E7MA 1I9CA 2JZOA 3HXMA 4BRZA 3VDQA 2QLLA 1E58A 2SKCA 5JS8A 4BLUA 4UQLA 1EK0A 2YWFA 4NE7A 3IKTA 5K0TA 5B3AA 1MKYA 4FGJA 2AW3A 1BD4A 1G1MA 2O5VA 1SURA 4NMLA 4OXRA 4NENB 1GTL1 1EK2A 1P0PA 4D41A 3LLVA 3T1QA 1SB9A 1CCWA 2QPOA 4J0HA 3PBKA 3RJZA 5IM4F 3VTZA 3BZUA 4GLBA 1JQBA 2VYFA 5JI3E 1X1RA 2CFCA 3LLUA 3OJXA 3RADC 1KEVA 3C3KA 1JSCA 1Y48E 2PSFA 1OVMA 4XD7D 1A9ZA 1QB7A 4NCXA 3RU2A 4MVJI 3X1DA 4NJEA 1U7UA 1WXGA 4L28A 2RAVA 1WQ3A 3V48A 2H8KA 1TVKA 2GT1A 3KZMA 4KIWA 2WT8A 3RGWS 3KKKA 3V80A 1JA9A 2YVKA 3A2NA 4QFCA 3TUJC 3TJRA 1N6NA 4ONEA 2JFPA 3B7WA 4LF5B 3HO1A 3AUAA 1QB8A 4G89A 4Z4EA 4GP6A 1UODA 4XB6B 4BMOB 3ZE8A 3B3QA 2EVWX 2ZATA 4F3KA 4QA9A 4XSVA 5I7HA 3TLZA 3TEFA 2B4RO 3QVSA 3L79A 3KUDA 3SKVA 1FOEB 4HCJA 3VISA 2ZM6B 4W9MC 4F04A 3V4ZA 4DDWA 4YAKA 5DCLA 2JJMA 3WV4A 2IKQA 5JDIA 4MW4A 4CV1A 1U81A 1O3YA 4KJZA 1KP9A 3TDNA 4EARA 3E23A 1VZ3A 1OV6A 1IUOA 3DB2A 1SA0A 4FHEA 4CFSA 1XCMA 3EVCA 1PR0A 2R7MA 2I6XA 5I7VA 1Z39A 1P1FA 3FETA 1YZYA 2Q5FA 3OVMA 2IEAA 2CE2X 3UG6A 2AZ4A 5K51A 4I5FA 1RQ7A 5F51A 3N5CA 4PLYA 1VCNA 1V2GA 1KYYA 1E9VA 3D3WA 3DOOA 3G9XA 3R77A 4MS3B 5TB5A 4DREA 1N0WA 1JQEA 5HZMA 2ECQA 4KQGA 2H4WA 2PNFA 2JEOA 1NUAA 4RIGA 1CY4A 1ZXLA 1F6BA 4AMVA 2P41A 2WTAA 4ACAA 4D96A 3SS7X 4DNXA 5BVHA 4KYUA 2AN1A 1W4RA 3B36A 2NACA 4ZCSA 1MD9A 3ZQJA 4NPHA 3ZIAA 4CGYA 1GVNB 2E4AA 3KXIA 2QG9A 2XAAA 5CK5A 2QRJA 1R4NB 2X4LA 2QTAA 1W88A 1S3IA 2YZNA 1XTJA 4JEHA 3SK0A 4PQRA 3OQBA 3K9GA 1DZIA 3BFVA 3I9FA 4MYDA 5KS2A 1FFGA 3DVLA 1L5NA 5GZ3A 2VA9A 3ANLA 3AR5A 3BZWA 1OJ7A 1WKCA 1AKNA 2Q1SA 1MNQA 3MMSA 4EY5A 4AUNA 2V7BA 3PFNA 4O2LA 4TS9A 4DSUA 2HJ9A 3PE3A 1HE2A 3R0JA 4FGSA 5J2TF 4L9WA 1I6WA 2OBBA 4IDDA 4UNPA 4Y2PA 3RC8A 3GA0A 3UAYA 4ZAXA 3GP5A 5CUQA 3WV5A 2QSZA 3WAKA 4F1WA 1KOFA 2VHVA 3A4IA 2W6QA 1FLAA 2LWIA 1AO3A 2B7BA 2W4QA 2ORED 4BJ3A 2H65A 4QZVA 4J4TA 4HFRA 4EI2A 1EWTA 2A7QA 4ZAZA 4PG8A 1ZIDA 3C5WP 4XGKA 4XOUA 3UN1A 2BF7A 1J20A 2P9CA 1B41A 4GGOA 1NDQA 4HAXA 4OM8A 5B1IA 1M0EA 1SU6A 5E6RB 5FHQA 5BO5A 5A4MS 10MHA 2J5QA 2CLEB 5MFZA 1IPFA 2VFAA 1RNLA 2H0RA 4YJGB 1WRBA 1O77A 2H06A 2D06A 2OAEA 4O2BA 3SLGA 1IXZA 1Q3KA 1F2TB 2X3UA 3IPLA 4ZT5A 2WIDA 3TIXB 3ROTA 1SBTA 1CHNA 4UFNA 1CJSA 2OCYC 1KAMA 3GI1A 4ZTBA 4UCXA 5JC1A 3GNSA 1DQPA 1N7JA 3AP2A 4RCYA 2W0MA 1VE6A 3K0FB 4R7ZA 2IBSA 3RF7A 1GPWB 2A3NA 5EPUA 3NS7A 3OQIA 3CG0A 3QM1A 2DU8A 2J85A 1SQGA 3MW8A 4X94A 3CVUA 3W7AA 3FVWA 1CUJA 2PR2A 2ZRLA 2Q2WA 4LZWA 4N8DA 3IODA 1K68A 2X6QA 1FLVA 3I05A 4EA7A 2ADOA 1JSRA 1Q7RA 1WXEA 2JFFA 4Q66C 5C1IA 1MOQA 2IE0A 1T2DA 1EFCA 2X5XA 3QYFA 1BA3A 5CM8B 1P6UA 2M6LA 2B21A 4OUDB 3NANA 4ZJYA 1OV4A 2FV8A 3C5HA 4ZRDA 4RK1A 3GLRA 1L5SA 2ISSD 2PJDA 1PFWA 3PXEA 2P5SA 3DS8A 3DONA 4PAOA 4DIDA 2GD1O 4C6HA 1U6JA 5DXJA 1EQUA 4UAGA 3R8FA 4KUGA 1ZICA 4R9RA 3P9IA 3R5HA 1ZGHA 2RHGB 2WUFA 3QTBA 3GZTB 4TV8A 3ZCRA 5C3UA 4AU1A 2WD9A 3IAFA 1KO7A 4BZZA 1MXHA 4K6FA 1NUHA 3DDNA 1LW7A 3IAUA 4DM7A 4DDKA 3ZD7A 3LHDA 2CNBA 4KO8A 4XIGS 5TSDA 5LZ2A 1W4LA 5A0VA 1P7PA 2CXRA 4MKHA 1V7ZA 2W6CX 4Q9DA 1UAYA 3I30X 3P20A 4KDFA 3FTCA 3WLKX 2PA3A 4FNAA 4POOA 4Z1OA 3O4IA 2H7XA 3WKBA 4C08A 3B6EA 1E92A 3N87A 2JZNA 1G2QA 1W30A 2P6MA 1XZPA 3T1VA 1V6AA 1SB8A 1D9XA 1XJQA 4JELA 2XGOA 5ITWA 2O7SA 3B1YA 2QUJA 3S2UA 1NXOA 5CCEA 2Q0SA 1NBIA 3LY7A 3P9NA 4UREA 1UBFA 3OJEA 4KI7A 2SKDA 3LOQA 3U4IA 5SV2A 1DTWA 5JNWA 2R4TA 1Q50A 4I3HA 1O97C 1Q12A 4MR7A 5HJ7A 4XRGA 3OCXA 5EIHA 4I1VA 4QREA 1LV8A 1N5KA 1YA6A 1IWBB 3M6UA 1S9DA 1G4HA 2WV9A 3A04A 3G6KA 5BMVA 1RWPA 1F8GA 1DIBA 3CLHA 2ZXUA 4EF5A 5ALJA 4E6PA 1ML3A 2WB4A 3FOWA 3PL5A 4MUIA 1DQZA 2LNDA 1LLQA 1YS9A 3CONA 2XYPA 1MB0A 5BT9A 3ILYA 2WKQA 5BW6B 2AX3A 4M1KA 2O8EB 5CT6A 1L5RA 1NVWQ 1QFJA 4GR4A 2GHQA 3NBYC 3W2TA 1SVSA 2WAMA 3RF6A 4B80A 1V6SA 3GELA 4PHTA 4TYNA 2VWGA 4ALKA 5TVGA 4WBSA 3B1FA 3E7FA 2NU8B 3BTOA 3O8OA 2RK4A 3NW9A 3ZKAA 2HADA 4G1FA 1YQTA 1TX4B 3PUWA 1UBTS 4W5WA 4YBZA 3NVDA 4HNSA 1AUXA 2ZRFA 4DMRA 1OH8A 4FZVA 5AW9A 3IEXA 1EINA 4I99A 4JGIA 1ICEA 5D6NA 4DV7B 1MBZA 3RTBA 3FZQA 1VXRA 2JBAA 4Q9KA 1NBAA 3NJRA 4DCCA 4PYLA 1RBQA 1ZEMA 1R5OA 2VK8A 2X0JA 4MR9B 4LZOA 4J94A 1QTNA 1ZM7A 4ZV4A 3EGDB 1G3MA 1OUMA 1XTIA 4ND3A 4QSMA 4GPD1 1BX0A 5IT9A 3GJ5A 1A95A 2JGKA 1MB4A 2PD4A 4OUKX 1E7RA 3W0LB 5JCPA 5LOVF 2LR0A 2VOJA 4BPBA 3ICEA 1J42A 4OQLA 5JCZA 4M9UA 4WBXC 4BS9A 2I2XB 3TI7A 1YQEA 1FVFA 1PGPA 1U8FO 3GFFA 4K6HA 4PO9A 1EVKA 2GPTA 1A5BB 1N5JA 4KUHA 2FPKA 1ZYUA 4TMVA 3ZWXA 1JWLA 1D2GA 1EFRD 2XZDA 3PUZA 4CXMA 1JMKC 1N5DA 3KBBA 4FHZA 1EG2A 1IB0A 4G26A 4LOJA 3W8FA 5CG2A 4TN5A 3EJ6A 2WVAA 3GDOA 2H9YA 1WP4A 1JEDA 1W4BA 3JWHA 4OK3A 1W0JA 2YHAA 4NZMA 4CF4A 2OB2A 4EJSC 4UOEA 1DO8A 2GFHA 2IWRA 4G0VA 4H7JA 2O2HA 2RD2A 4IJWA 1FNSA 2HMVA 1PTKA 2J41A 4B81A 3A9TA 4ED9A 2FFHA 1IZ8A 4IUCS 3F7OA 4QLOA 4I1SA 4CF5A 2PVCA 5MDHA 1UXOA 1T29A 2YTZA 1AS2A 3M9WA 1Z0JA 4WXHA 1NT2A 5GONF 1NT4A 4HDSA 1AZWA 2RKWA 1YE5A 2IYLD 2ZEJA 5I8WA 4NC9A 1H1TA 3KX2A 3P2IA 4WVFA 2F8TA 1E2EA 4KE9A 5A7GA 1J9GA 1E3QA 3VKFA 3BTVA 1HT1E 4MJ7A 2FUG1 5H16A 1WULS 1J0DA 3KFVA 4KO4S 2G9UA 4IJ5A 4Q4CA 1CS0A 1GAWA 2IOFA 4YCAA 4BWFB 5EXDA 3SHWA 2SKEA 4FMDB 1L4KA 2C4NA 1WMDA 1BOOA 1RHQA 1C9KA 4YVFA 1K4YA 2P9BA 5K8UA 3TEMA 3ZYZA 4QHTA 2C8VA 1QOQB 3NTXA 1R4ZA 1XTSA 2J3KA 3IMKA 4OHRA 1IK6A 1ZONA 2EJCA 3JD4A 3BIFA 4NDZA 2IRWA 5ISMA 3ZVMA 3FWKA 2FWJA 1TT5A 2QM0A 1U1IA 4TRMA 5DEOA 5ALYA 1XTTA 3RG2A 1CQWA 5A6SB 3STVA 3WRWA 4DPKA 4DQLA 3T8YA 4RSMA 1A82A 5F2NA 2R751 1ORTA 2R7AA 3BOSA 1LSOA 3IMEA 4BP9A 3JVUA 1CFJA 2PGLA 5CEEA 2UZ1B 1PDWA 3PYMA 4CLOA 1W52X 4R2KA 1SHLA 1FB5A 3QRWA 4HN2A 1POWA 3S40A 3WSWA 4DRYA 1BEUB 1VIVA 2JGNA 3CLUC 2IH2A 2C96A 4YP0A 1P0QA 3B60A 3X44A 1CVRA 2DBRA 3OJ0A 2PMBA 4RVOA 5C1PA 1A88A 3QMWA 3NKLA 3ZK7A 1KDTA 1ZW6A 4JIGA 1N6RA 1S4MA 1XL0A 1IN6A 4JVMA 4FYWA 4R1SA 5IRCD 4ZD6A 4RTRA 3QVTA 4Z9XA 3DWFA 6AT1A 4L74A 2Q0HA 3K9HA 2AFIE 4LYEA 3IVXA 1DOZA 1DINA 1Y1LA 4MHTA 4D4JA 4OA5A 2ERYA 2QGZA 4EENA 5L7WA 2WAXA 2XUOA 4X7MA 1HM5A 2QV7A 3FCAA 4BLPA 1P4AA 2YL2A 4IEEA 4DQKA 1ZBDA 3R9XB 2VF4X 3VPCA 4YJKA 4FFPA 2ZJ1A 3SBEA 1T1IA 3RRBA 1U2RA 2B34A 1CUSA 3UKOA 3IQIX 2OCGA 1SVIA 4X9XA 4BJ5A 5JANA 2WU8A 2V1XA 4ODIA 1W93A 2EEPA 4WXPA 2AG1A 4AJEA 1PV4A 1A7JA 4OI2A 4CL3A 5L3QA 4PFSA 2PL9A 1DKUA 1HNWB 2C94A 1BVHA 2CUKA 4IIFA 3LCMA 3RYHB 2GO1A 4BBJA 4CM7A 1NRXA 1F8XA 4K9PA 1JQDA 1JALA 2CDCA 4OLFA 1IZ0A 3U61B 1DIHA 821PA 5KDOA 1KZHA 1J2UA 2YICA 3P5BA 2QTWB 2PJUA 4CV3A 2XYHA 5LWHA 3S1LA 2PUFA 1N2EA 3T1HB 3D7LA 1QPBA 3LXXA 4AUKA 2RAFA 2P67A 1IN4A 3JATA 3ZOZA 2OHVA 3HMKA 1C1XA 1T5DX 1A9XB 1EDZA 3MRVA 3PDJA 1U2ZA 3E9DA 4FGZA 4QTTB 2ZBGA 4QXRA 1H22A 4R41A 3MB5A 2QN2A 2OXTA 3ZNOA 4ITRC 4L5JA 3D6MA 4QOSA 2JLZA 2IS2A 1PZFA 4IZ6A 4JYMA 4FEAA 4CQLB 2QJOA 3L46A 4CKCA 3UICA 4B6FA 2Z8XA 2NOAA 4Y2JA 4J1QA 3RLFA 3ZIDA 4LIPD 4RESA 2WVJA 2VRCD 4X91A 4BO1A 4J3NA 1OX6A 4NXNB 5U9CA 5JNRA 1IOZA 4TYQA 4WIAA 5CFQA 4QD3A 1IEWA 4R81A 5I7EA 1R8YA 4B4DA 1L4MA 3FCXA 3HCEA 1HOXA 3BRSA 4MTLA 4O4JF 1J0BA 3BDAA 4ZEVA 3N70A 3CNEA 2I2DA 3B9RA 5A4FS 5EKUA 2QN9A 2JLWA 3LL4A 3RUIA 5HM8A 1UC4B 5DT2A 4BAUA 1IQRA 5AFSA 5FLEX 2AJLI 3M4YA 1SJ9A 2G67A 3C6XA 3ZHVA 3GGSA 3RVSA 4OQZA 2FFJA 2Y2VA 3EUFA 2B35A 5ICMA 1BXGA 2H4YA 1SXJE 1PV1A 4B44A 2IS6A 1UBNA 3USES 5JH7A 1XMXA 4J0IA 1I7DA 2B4QA 2JW5A 1YKFA 1T0JB 3WGTA 1IXYA 3RABA 3C15C 4IGFA 4AFNA 4JQYA 1E6WA 4AKSA 5BRJA 5ECGC 2FG5A 4PVDA 4R1QA 1HDOA 3LM8A 4JC8A 4BKPA 4YUWA 3DLBA 1H3EA 1DGQA 4Q5IA 3DFFA 5IEBA 4LSGA 1GRCA 1SELA 2Q5HA 3V7NA 2EX1A 2IEIA 4CKWB 5IJ9B 3DFIA 2FZLA 1Q21A 2WWFA 1SUWA 2RH5A 4HQ0A 4D9IA 1Q20A 3T1YB 4QYXA 4A82A 4NQRA 1DOHA 1NAHA 3THRA 2GTIA 1O5IA 3G0GA 1LC0A 3P9RA 4JR2A 1J24A 3VU9B 4W5OA 5CM9C 4DT1A 5G1OA 5BXQC 1MO2A 4INOA 2CLMB 3NTQA 4WK0B 4J1TA 1U9IC 3Q3IA 2BKVA 5FBLB 4RTQA 3I42A 5IAEA 4P32A 5KSZA 3PVZA 2HIAA 3JAMA 1PT6A 5AVVA 1H93A 3DGEC 1WG8A 1U0LA 4Y2XA 1JDBC 1KO5A 1Q15A 2CVHA 2DYKA 1OFVA 2JI4A 3DE6X 3ESAA 3QXSA 3HKEA 4QJIA 5DNVA 4BNMA 3NHJA 2D5BA 2Q2OA 4JFRA 1MRNA 4B2IA 4ENSA 4YCSA 3EIOA 3A26A 3JRWA 3OECA 3P1JA 1DKMA 5H3LA 3M6FA 3A6LA 3H1EA 1E3SA 1IPHA 1F0KA 4ZEMA 5B7GA 4ZEXA 1PJ8A 1T9AA 4CRWB 1G6Q1 2VVTA 5IC4A 3DHWC 3C7DB 1AHIA 2RGYA 5EIWA 4P4TA 5F3DA 2A1UA 2VT6A 4GF5A 5JYCA 4BLTA 1WNTA 2HCBA 2OCDA 2H8GA 2YXBA 3OJCA 2QIOA 4YROA 1P2SA 1G3QA 3KPVA 3Q15C 3HK2A 1QV7A 2Q8NA 3QVOA 1T2VA 3R7FA 3W1WA 3DJFA 4ENUA 4AKEA 1P3Y1 1SCUB 4AJHA 1G17A 3DTTA 1MDBA 4G8BA 1V48A 2AKAB 1F3LA 4L5CA 4PO1A 4AP6A 4G37A 2O07A 1LI7A 2IU3A 3RNLA 3VR6D 1VJGA 3CH7A 3H97A 1K97A 4N7JA 1JIQA 4BQOA 4M7PA 1TM4E 1KU0A 1QOZA 1KYTA 5AUQA 1Y1KE 4KXYA 3WZMA 2BFBA 4M83A 3WADA 3B78A 4L4SA 4BJ6A 2P8SA 3QITA 1DKLA 3L0DA 3G2QA 3IXMA 3DVSX 3C3PA 4J7XA 2NZ8A 4DJEC 1KVRA 1SXHA 3H1FA 2GHIA 4G0ZA 4XJXA 1ONNA 3JTEA 4LXTA 4QPDA 3BE8A 4BL5A 1T5SA 4XYMA 2BM9A 3S5JA 4F6RB 4R31A 5EKTA 4BKUA 1PJ2A 3IHLA 2XNDD 2BKEA 2FW7A 4FJ2A 3FW1A 4LXYA 4WZ6A 4AXBA 4ESOA 4KXVA 3EMKA 2V7VA 4UCFA 5LIRA 4RV9A 4W1PA 5B6JA 4OYLA 5F35A 4GPBA 3NOQA 2R86A 2XA9A 6PFKA 3ILHA 4LC1A 3T5GA 3AUKA 2XCIA 1FSPA 1XN1A 4JZKA 4NCIA 1GL9B 2H08A 1ZU5A 3KQVA 1XZMA 4CR8A 4UZSA 2KYRA 3SZOA 2L2QA 1DUIA 3UKJA 3P2KA 4RUKA 1FDUA 1W35A 2XQVA 2Y8EA 1JHUA 3DL0A 3JCZA 4IAOA 4PG4A 2YXNA 3QPAA 4CLDA 4LWOA 3ZGZA 1T2UA 2G8LA 1CERA 4GDMA 5IYZF 3A8TA 2HIMA 3HR4A 5M04A 1QPZA 4FQ5A 1PGQA 4QE3A 2RI1A 2WC1A 4IWXA 3PGLA 5AOBA 3WB1A 5BNWA 2HU2A 4Y30A 1UDBA 4Y2HA 3LQ2A 4W9NC 3L4BA 3NBQA 2JHCA 3K1JA 1P73A 1PR3A 4OXKA 3WGYA 1K5HA 2O2CA 1I7QB 1Z25A 4QUEA 4RC9A 1FFEA 4HDNB 1LH0A 1U7OA 1E9FA 4MRPA 4V02A 1I9GA 3Q9LA 3QBDA 2PX5A 5B2ZA 5C34B 3AVQA 3ZBQA 3K92A 5DRYA 5D6OA 4ZCRA 1K6MA 1OKKD 1NMEA 2DG2A 3WS7A 1O4WA 2H9AA 1H3NA 1E3EA 1Z22A 4N8EA 2JARA 4A3SA 2AF4C 1T0IA 2VHUA 1OI2A 4J4HA 4B46A 4EHAA 5DIFA 1XDDA 1FTNA 1H2RS 1OGIA 1VL1A 2BFCB 2BLNA 1GQYA 3A3KA 3A7DA 4X45A 4JYZA 4EO7A 2G07A 3HJFA 3CLSC 5E8RA 1MX5A 1U5CA 1YJAA 5C8DA 4QUBA 2VQEB 1TQ2A 2HWKA 3L0SA 4M9RA 3FOZA 1MH1A 2OD7A 3OWHA 2YVQA 2P2GA 3PXXA 4X3OA 1QK3A 3P2JA 2X6RA 3GEPA 3T4UA 2WM3A 3EGIA 1DBPA 1WS6A 2GA8A 3K9NA 3MJSA 3GLTA 4RSGA 4ZO4A 1YR2A 5CYFA 4HI0E 4B1FA 2PCLA 2X3YA 1L7EA 2GO7A 1VMAA 3AVPA 1TF7A 1Z4QA 4JBXA 5CJPA 5T3UA 4MIOA 5CX1A 5LVAA 3RG8A 2J6CA 2I3AA 4PSAA 4R1PA 1RJDA 2AXNA 4O4HF 3H83A 1W1WA 1J49A 2JI8A 1JEQA 4ZICA 1U9IA 3D0QA 4AN4A 3KBOA 2IIVA 2ZUSA 4IIHA 2D2VA 3V4LA 3PZRA 4C89A 2XDQA 4X5OA 3ROGA 1PR2A 2X15A 1TTTA 2BW0A 5IP5A 2JIPA 2ZSUA 1LSJA 2CB9A 3CINA 4NG4A 3BWVA 3SS9X 3DM5A 4AT1A 3URMA 1E3DA 1W36D 2UU9B 4GOMD 2AA3A 3KV1A 5REQA 4JHLA 2I0FA 4C2BA 2CVOA 2CL7X 1E5DA 4PRLA 2XLCA 3TMKA 3V1TC 3ENZA 5D00A 3AO0B 1B0AA 3A6GA 3NYWA 2QW1A 3FJOA 4ZAVA 4QUIA 1Z06A 2WE7A 1M7HA 4XYBA 3MWEA 3K2BA 3Q3EA 3H6KA 3I64A 1KU6A 4WFKA 4QU9A 1S2NA 5KKAA 4WECA 3M1AA 1QDLB 1WOMA 1F2UA 3A1CA 3IHTA 4ZAGA 5M29A 4EG3A 1OBFO 5EJ9A 1PL0A 5EWJA 5SZIA 3ZIAD 1DC5A 1SQFA 4IXTA 1YFLA 4EHJA 1N5MA 4AZTA 1G9SA 1WXQA 3PPXA 1XU4A 3N3BC 4DKJA 2MIIA 3TL6A 2AE2A 3AR8A 4S1PA 5BV8A 1GP2A 1VZ2A 1GGJA 1K3FA 2ZAYA 3HFGA 3JALB 4MDHA 2FNAA 1I6KA 4H17A 1QGOA 1A9TA 4Z9YA 7MDHA 2UKDA 2OXIA 4LZPA 3SXUA 3UTCA 1RMTA 1T2EA 1N3LA 5FOUA 2PV0A 3S2GA 4JV5B 5BSFA 2JVKA 1Z74A 5AKGA 5ERGB 1JDNA 4E5DA 4E31A 2IXTA 2VPZA 5JTUA 4QWMA 3G0IA 1JQKA 3FDFA 4OFXA 3TZKA 4C3OB 5L45A 3LRXA 3TN7A 1DAFA 1CT9A 3EBLA 4DJDC 2L17A 2B20A 1L5HA 3SZLA 3U56A 1X2EA 2PUCA 3FNHA 2J33A 1IMOA 2FQWA 5ILQA 5FULA 4XWWA 1Y82A 1YL5A 2HZ7A 2ILVA 3C74A 3KZ1E 5DASA 2WHQA 2PMWB 3LF2A 4LMAA 1Q11A 2JIQA 3EWSA 2RHBA 4B71A 3ZIUA 1A8IA 2PKCA 1K5PA 3KSAC 3EASA 3OJLA 4P0PB 3NJ8A 1MABA 3NNSA 5CPBA 1UOPA 5D5HA 3NHZA 3AQIA 1TVCA 2QF7A 4MGHA 4KPUB 5JCXA 2X1HA 3EZ9A 2GBLC 2IXDA 3OPXA 1E2GA 4KXUA 1ORWA 1RLOA 1JXQA 3TOCA 3NEYA 2Q3JA 4ZRNA 3F2IA 2OK7A 1KOLA 1NJGA 2YHUA 5DI3B 4W9NA 2DFPA 3BQ9A 4DEVA 5JW6A 5KO2A 3LA6A 2E9SA 2FSHA 1D2AA 3IDFA 1LA2A 2C29D 2YXDA 1QO9A 4REMA 3Q0TA 3V6LA 3CKMA 1ADGA 1S7CA 3IP3A 3WOHA 3GLFA 2ASEA 2WSMA 3GBVA 3FOBA 4Z2AA 2D3WA 3DMYA 2X0IA 2FQXA 3MJVA 2IPXA 4HY3A 3IALA 5CX4A 1E59A 3TK1A 5BWMA 3U7GA 3IP7A 5EJGA 2YV2A 4V0LA 2AG0A 2C5AA 4F45A 4WLVA 3M49A 3D6JA 3BSWA 3C3DA 1JH8A 4D4GA 4DL9A 4XIYA 3RYFB 1TTQB 4DG5A 5KYKA 1ADJA 3H9EO 3MGAA 4YLYA 3LC0A 3IUNA 5BT8A 3GVIA 2LRHA 2D8MA 3BMNA 1X14A 2F43A 3JSAA 5LZ5A 4Z3OA 4UJ3A 4YDRA 4ZALA 3BB1A 4F3RA 5F77A 2IW3A 4TRRA 3SYKA 1H1LB 3EF1A 5A5FA 5CLLA 2OKCA 4DYVA 4CLXA 1LEHA 1VA4A 4HB4A 1K9SA 1NVUQ 8ATCA 4H6XA 1S01A 1USKA 1V7CA 3NIGB 1DEKA 4S1OA 4Q19A 2Y1EA 3X1MA 4E11A 1X8XA 3NPAA 5IJ0A 1GDHA 3MXOA 1LTKA 3Q3VA 5J9FA 2FMUA 2VT7A 4ND8B 1OHHA 1YDEA 1YT5A 3R74A 2OP1A 5A71A 1ZL2A 2CNOA 4I46A 3A6DA 4UVDA 1J5XA 3RK0A 4BLRA 4AF7A 4GQIA 3NAQA 4WOCA 1TMYA 3MD9A 1N0IA 5HA5A 2Z6VA 4IQ4A 1RIIA 1QWOA 3OUZA 3NM6B 4NV3A 4Q34A 1I5EA 1FQKA 1SKYE 4FLFA 3G0DA 1QU3A 3BE5A 5EP3A 3DBLB 4YMUA 4MW6A 2P68A 1RYEA 1W4AA 2VUIB 4OEHA 2PT6A 3L1IA 2BY4A 4FZ5A 4H9GA 1P19A 1P44A 2DT8A 1KNQA 1X7WB 2GTPA 4DCPA 2O8BB 3F90A 2VNSA 1H42A 2H92A 4ICIA 3O8CA 2VHZA 1XAGA 2K2WA 1EBFA 3OG9A 4URVR 5J2TB 3G2JA 4WLFA 4WX2B 5DYYA 2J30A 4I5GA 5HGJA 1VCMA 4NJMB 1PUIA 4C0JA 1E1NA 1F6WA 1XU7A 1SK9A 4NI5A 1XCBA 2R6JA 4WBNF 2D1TA 4IH1A 1NMYA 3J7AC 1KVUA 1X7XA 4EJMA 1B42A 1MH9A 1HDRA 2CLLB 2J5RA 4JL6A 1RPJA 5IWCA 4A03A 3U44A 4A8HA 2RB4A 3OE5A 1BMTA 3ENQA 4IXDA 4IIJB 1NOIA 2BJHA 1G20B 2AXPA 3KB6A 1UJ4A 2Y1XA 4TV9F 3FUCA 1LUAA 4KN8A 2VXYA 4NEGA 1XMJA 5TJHA 1Z16A 1TC1A 2HDNB 2YWDA 2PBLA 1IZ7A 1KDRA 4UE2A 3V4SA 3K1AB 4WNYA 1CRWG 4GEKA 4BASA 1V3UA 1L5QA 1WMBA 2WLSA 1VL6A 2JA1A 1HFEL 2RIRA 1GTJ1 4HNAA 2VK1A 3OE1A 2O05A 2P8JA 4HDKB 3ZVNA 3ICPA 3PG5A 5AWFC 1ATIA 2GZSA 1NXSA 3HEAA 3DEJA 3WIVA 1P74A 4KYVA 1GAEO 3O26A 2PEYA 3WNVA 4MUBA 4OY3A 5HJ5A 1TADA 1IEVA 4GX0A 5FOSA 1PEDA 2WWWA 2Q46A 3QVGA 5CT4A 4C07A 4E46A 1Y7HA 1DQNA 3OEHD 3GLGB 3QEBZ 3GUZA 1PYGA 1RE0A 4PZ0A 5ALTA 3U4QA 2O1XA 4RK6A 3LS2A 1T4MA 3TBHA 3NFYA 2PKEA 5DHAA 3HQ4O 1EAMA 3FOFC 5IVHA 1EFPA 1C5KA 1KP2A 2RK3A 1NKSA 1YTLA 1NU6A 4LFCB 2WFLA 3BD6A 3RYIA 1RYNA 1WPXA 2WD7B 3L82B 4MV0A 4XE5A 1VSQA 2ZI4A 2DXIA 5CFZA 1G19A 3IVGA 2LUOA 1RQLA 2FMTA 4V3CA 3JQRA 1PNVA 4RGVA 1A77A 4QRDA 4LKRA 1I80A 1M6VB 2BD0A 1R8SA 1QDUA 3KHTA 3U7QA 4DGQA 3BH6A 5JTTA 4R6XA 4IF4A 5KYYA 4BO9A 1TEXA 2IIQA 3PNLA 1LVGA 1LW6E 1NUSA 2FUKA 1W76A 3EXG1 4LQLA 4DF3A 3FY4A 5JD4A 3KWLA 2R7KA 3JD1A 2EFGA 4HNHA 5IN4A 3K0EA 1W5EA 4Z0NA 1RQGA 1E1YA 3HNOA 3PUVA 3RT9A 3B6ZA 2VRBA 3SVLA 1SULA 4HB0A 3G0BA 4FB4A 1JTVA 5K9ZA 3N7UA 3U3DA 4H7HA 3SF8A 2RB5A 1BROA 3UAZA 3EVAA 3I39X 1Q77A 1YQGA 4MUNA 4NTZA 4DJAA 5C1OA 3ON5A 2OPHA 1N2CA 3K8YA 5AUNB 4ZQCB 4E2XA 4DCGA 1OLXB 1CC1S 3MCZA 4TWJA 1Y6JA 4X85A 4AMZA 3CC8A 3Q98A 5E6UB 5TRTA 1S3GA 1NUQA 3REFA 2ZB8A 1JAYA 2RGRA 1P7ZA 4FFBA 3JWIA 4Q9LA 3PJRA 4XM0A 2DQKA 3RD5A 3JWPA 1C9NA 1FXSA 3F5SA 1J99A 3FIJA 4HAWA 1Q74A 2C4UA 1TYZA 1ZK0A 2A5FA 1V1MB 1MOPA 4I4LA 1LDNA 4KH0A 4L85A 1P0CA 4M60A 4PQYA 4X60A 3REQB 4AY6A 4B84A 1SC4A 1IDN1 1H3FA 1BX1A 1KGDA 3HB0A 2O7RA 3IVRA 4PGMA 5AR1A 1RXSA 3A9RA 3L7IA 1RYYA 3CSUA 3AF2A 5DP2A 4FMPA 2BHSA 1B26A 4P86A 5DISB 3ULKA 2LIPA 3GT7A 2FZEA 4E15A 5LC1A 4RZQA 2GEVA 1U02A 2CLIB 4RWEA 2ZRGA 4I81A 1P7YA 1XRSB 1MEEA 4DA4A 2XUPA 4LZAA 1GUDA 1UIRA 2Y6UA 1BSVA 4KFUA 3HXQA 1Q22A 3GMDA 2DWQA 1FF9A 5CVTA 721PA 1CE8A 1ISPA 4HMOA 4PNPA 1LF5A 4LRUA 1TDJA 3V4FA 5DJ5A 1UXJA 2BVNA 4CCAA 3JQCA 3VH1A 1A97A 1O97D 2FKAA 2H85A 4P08A 3UO8B 4YYZA 2Q21A 1G7SA 2HC9A 3PSHA 2BI7A 1SCIA 4GD3Q 1AVTA 2DFLA 3KOYA 4NP6A 4DTIA 2ZRQA 1FMCA 1KYQA 4FXPA 1TKRA 4I4TA 1YFKA 2F67A 3P9YA 3LYLA 1RCUA 2WYOA 3AIIA 3DMDA 4NYJR 4M0LA 2WBLC 3ZEIA 1NVMB 3NGLA 1Z5PA 2G40A 2REXB 5TEVA 1T4CA 2QYSA 1NMXA 1FBNA 2AG8A 4MUFA 4CG2A 1YDGA 1I7LA 4PLTA 5FNVA 4PHCA 3PFHA 4IO1A 4PV7A 2HRRA 3QPBA 4DZZA 3OETA 1M83A 4GC5A 4MH0R 3SJ7A 1P1BA 5HF6A 2NYAA 1OAKA 3K8OE 2JLYA 3MMNA 5BSRA 1KPHA 1POXA 1Z3IX 2HQ1A 2II6A 4RTMA 1VFPA 1SUSA 4FUTA 2G82A 1T9HA 2HRBA 1XQ1A 4QNNA 1JKXA 3DHEA 2VTKA 2JIRA 5AKEA 3T34A 1GUAA 5HYVA 2AEFA 4XEUA 3BJIC 4YMTA 3JARA 1KSFX 1JB1A 3QXJA 4J43A 4HBZA 5HZKA 2A5GA 3OLXA 1R0XA 3LOUA 4FFRA 4AYXA 1NR7A 1D6JA 5EHQA 4Q9AA 4O29A 2HR1A 5DVZA 4XSHA 4IKPA 2FGJA 4IG4A 4AAYA 5A4IS 4MW2A 2FRDC 3F8TA 1AA6A 5A05A 4US1R 1DL5A 1IM5A 2H1LA 1I7NA 3K5PA 1D8AA 2QUZA 4EQ6A 1CR1A 4IHJF 4PF1A 4CEIB 3WFZA 4XFDA 1KYXA 3PWZA 5LBUA 2ODPA 2XLBA 3D3JA 3HDHA 4KOAA 4KV9A 1MGPA 5B4TA 4DAEA 4FHFA 2PO5A 3GT0A 1EFHA 4D3ZA 1GN8A 2AF3C 2GJKA 2OUKA 2QN7A 4I55F 2EBHX 3W3ZB 1EBBA 3L7CA 1EQ2A 4UJ5A 4FFVA 2IF2A 3V8EA 1T4GA 4HEA1 2AQIA 3HA7A 4BFVA 1N8NA 3KLNA 1VBKA 2CCKA 3NORA 1TFUA 3OZIA 4OQEA 1HNXB 2UXCB 2OO5C 2QT0A 3UJDA 1L7RA 2A0UA 2JLSA 3BCHA 3NNNA 1F51E 4O4IA 4AYWA 4KXMA 3RUDA 3FLMA 2CV0A 1E6LA 3PTZA 1BEEA 2EJBA 1DSSG 3L3BA 3CR7A 3IIIA 1QFZA 2HSGA 4QOEA 1PKEA 5FYDA 4RJIA 2Z08A 2CLCX 1UEIA 1DT5A 3MJHA 2HQBA 3M1YA 3WXMA 3AG6A 3D6HA 1HK7A 1D03A 4M7RA 3CF6R 4ZOLB 4U9UA 1UL1X 1CJTC 3UWOA 4XR9A 3LF1A 2WEKA 4GMFA 5JHGB 2FPMA 1ULSA 1AA9A 1M34A 3DE2X 3EBPA 4TMTA 4OJNA 4AJLA 4EPWA 4QJBA 1K08A 1JFRA 4KXWA 3A7EA 3PXUA 2VF7A 3CX8A 4Q3CA 2XDAA 3T9CA 4RO0A 3UAGA 3FR7A 3VYRB 2FWNA 5KI6A 2PWAA 3GAZA 2DY1A 2HBYA 3A4YA 2G5PA 3RVPA 4CZ2A 5HOQA 3DLHA 3C24A 4WEOA 3NIWA 3UGKA 3I5YA 2V1UA 4C7OB 2AOWA 2O2YA 1GPNA 4E4YA 2N1BA 5EEHA 1TRHA 3URKA 3UB4A 3S81A 2WNIA 2I8AA 1D2EA 2PRIA 2NTNA 4LZNA 4OL0A 1PR6A 2ESRA 4W8HA 1HETA 1YV9A 1STOA 3JW8A 3UCFA 3BMCB 3CW9A 3R76A 3AONB 1GGHA 1ZO8A 3EZLA 2AVDA 2BEUB 2D7DA 4LRYA 3G5AA 5AJUA 1DX9A 4WXRA 1OH5A 1HA3A 3ZV6A 3QVLA 1JQ3A 5ULLA 4NBKA 1ZNWA 2GKSA 4X7PA 4E4TA 4AS1A 3I2FA 1QORA 1N36B 1MA3A 3CLUD 1UBHS 3ELUA 4NNOA 1N0VC 2G9RA 4FZRA 4FDVA 3DTVB 2G0TA 4HWOA 2XZOA 3L6BA 5DP1A 3AZPA 5JRDS 1J4AA 3DMRA 3E7WA 3UENA 4DARA 3KB2A 1TL7C 4YDSA 1BFUA 3RVJA 5TGTA 1A0OA 3W04A 1FJGB 4ADSG 3TUIC 3ZDFA 4DIEA 1G5QA 1WMAA 3QSYA 3W5UA 4UQPA 1CUUA 3KKLA 1WETA 3ZQ4A 4JD5A 1C7IA 1VSVA 3DEKA 3QTTA 4M9XA 3FTQA 4Y9UA 3FSRA 5IKOA 1FMLA 3TDMA 4Z86A 1L0BA 4AF6A 4B17A 1FDOA 4ESHA 3CVJA 3WX0A 3WA7A 4OYHA 1J8QA 2KPOA 3TRIA 4ZI2A 2IQ5A 2Z57A 1A9RA 1ORVA 4IIDA 1D09A 3O31A 4Y6SA 1RC0A 3SZRA 2GWHA 3FWYA 3MFYA 1JHZA 1JIIA 3JWGA 1C8LA 4FILA 4LW8A 2R47A 5DTMA 4HN9A 2GBFA 3WWOA 4WQMA 5ADWA 3UBTA 1U7PA 3RS8A 4TYWA 1CF4A 3ABZA 5DYGA 4ZT2A 2RSLA 3I6MA 1NW9B 1RMYA 2YZKA 1UKEA 1X3LA 3DOCA 4Z8YA 5PNTA 1VYVA 3QU5A 4GI2A 1EUDA 1DFGA 2FUG6 2V4UA 2C82A 2IDKA 1G21A 2NSLA 1HH4A 1QHYA 1GZ5A 4KFTA 2YHIB 4MKIA 5EERA 3TNFA 2PRKA 2VBFA 1CY2A 4BWVA 1GLNA 5KNCH 3O5AA 1TUGA 2ERCA 4Z7QB 1QKKA 2ZRIA 3IUMA 4MTCA 3WRXC 1W5AA 1MVNA 4L16A 4BEWA 1CIJA 2I4NA 1PT7A 3NH6A 2WF6A 5HTKA 2OHFA 4J0FA 4D98A 1ZXXA 1YTUA 1FMTA 4GECA 3PEEA 4I9HA 2X0KA 4UTXA 3RVBA 5LMZA 1QBGA 4FYIA 4E1AA 2QZ9A 5AYVA 4KVZA 5HCIA 1D8TA 1CFZA 5HUHA 2XMDA 4FGKA 4X61A 4GBJA 3BCUA 4WLUA 4B9AA 1VDMA 5KDLA 4MV8A 2O4UX 2VNAA 3WMWA 2WSSA 5EFZA 2D1RA 2PQ2A 3NP7A 1T15A 4QBKA 3S0JA 5ALVA 1I32A 3A1NA 3PRKE 5E6SB 2PKYX 3GO4A 3IL2A 3K9CA 1PVVA 3RC7A 2ZB2A 3ZBUA 1XRLA 3JQ9A 5B6IA 3UNXA 4TVBA 4UOZA 2ON6A 2QQ5A 2ZR7A 2P7HA 3GJ7A 2JAHA 1IUPA 3HKCB 4WOBA 2AHRA 3SM9A 3ZD8A 4B48A 4E2YA 4OXNA 1R6BX 1BEZA 4F92B 3WZ2A 1FU8A 2DQZA 2XVZA 3AETA 1GYRA 5G02A 1ZCAA 1YZFA 1J8YF 1II8B 2OO5A 3N2GA 3PQ5A 4FC7A 1VL0A 5ITZA 2AUMA 4EEKA 3CCCA 5ICSA 1SHTX 1P8AA 2QUHA 3HZZA 3L92A 1HMPA 2Y1WA 3QVWA 4I1RA 1A9SA 3RC2A 3SHVA 4UU0A 1CY8A 2Z9CA 3RYCB 5TJ9A 1IUNA 4F21A 4MUGA 3JASA 1QG0A 3OTIA 1H2ZA 4ZAYA 2RDMA 5KSWB 3G0CA 3G59A 2PA0A 3O0DA 3OX2A 4FGUA 4KAXA 1Z4NA 3K2QA 2WA2A 4GPZA 4GW3A 5DM2A 4DLKA 1FQOA 3NYQA 3OTQA 4F5DA 1WKVA 2YV3A 3OFNA 3R24A 4FN4A 4B3TB 5KOJA 4YLGA 3B3AA 3HP1A 1BJKA 5LL6P 2Q9BA 2Q4BA 2HA0A 3B2QA 2IX9A 3QUCA 2E4ZA 4Y2YA 5D7NA 4BB5A 3BH7A 4BLVA 3HSSA 5LPNA 1YIDA 3N2KB 3LTNC 3BHMA 5A2QA 1XJ0A 2ZJBA 3GP3A 1R0YA 3DR5A 2NSDA 2UZ0A 3M1IA 2FFRA 2FF7A 1Y4ZA 2ZZNA 2YWBA 1XLWA 3EZYA 5JJBA 2CF6A 2X41A 4QGGA 1HORA 4UMEA 2UDPA 4XZ3A 1QE3A 1XRPA 4YJ2B 3UJPA 2O5CA 1UOOA 1ZK3A 2C5BA 1FFXA 4ZO8A 2G77B 1RTTA 3DVAA 2QLFA 3GAFA 2X0DA 3QBTA 1GYPA 3DHYA 4YCCA 2B8TA 2C4WA 5ALZA 3I62A 3VR4H 1I3OA 2BONA 3MWDB 1QTRA 3P27A 4P9NA 5B3LA 2XEDA 3LX6A 3ANNA 1RRCA 3HM2A 3LHSA 5I9LA 3QQPA 3R2JA 4RM3A 4DE5A 2A35A 3KQHA 1JZSA 5JNSA 5HFNA 1EEHA 2OR3A 3ZHBA 4NCJA 3KWMA 3HU5A 5EIBC 2FWBA 1SVOA 4I6EA 4H1HA 2CVZA 5G0VA 4KPEC 2YYSA 1OT3A 4NECA 3AEUB 3R0ZA 4LQCA 3PDHA 5L53A 3O3OB 3IT2A 3QXGA 3AIKA 4IKOA 1CB0A 3BVPA 4WLNA 4WKGA 3VJKA 1UP6A 2Z04A 2A67A 5DOZA 2YWXA 1TKCA 5KTYA 1U8YA 3G8AA 8ABPA 5DW0A 2NO9A 3ANTA 4RGBA 3U3MA 2Y1OA 3ZV4A 3DZHA 2COKA 2ATVA 3CF4G 2BRUC 1TUBB 1NE7A 2D1QA 2PH5A 1G5RA 1AUQA 1P2VA 2UVQA 1N3BA 3EY9A 3GUHA 4Y0VA 3SVTA 2J32A 4Y7DA 1ZNQO 4Z7OB 1NW8A 2RMKA 4B79A 1S2MA 2ZWVA 4J16C 1UBGA 4MWOA 1IHPA 4YCDA 3SZGA 2JS7A 2V03A 1B73A 1L4YA 4HYYA 4WMLA 2DCUA 2BFFB 3UH1A 3AVXA 5L8VA 1XTKA 1DELA 1ZA1A 2PGIA 4IILA 4FSXA 3BF7A 4B75A 2WJHA 3DDOA 3FFAA 3GCGA 3L7AA 2D5CA 3KVYA 3R6DA 4LJAA 1JSZA 5IYZB 2MMGA 1NVVQ 2JAQA 1C7JA 1PW7A 3NV9A 3T52A 3D9QX 4RKRA 4DY6A 1ID8A 4H0NA 2P69A 3ZCTA 4G4SO 1WQ4A 1D2CA 3P0EA 3H2IA 5TF4A 4MLCA 2E4UA 4MQUA 2JJ2A 2VZEA 3HWSA 4PX5A 2FZVA 4WOJA 4X7BA 1YU6A 3HB9A 1UKYA 2EJTA 3E6AA 2AFIB 2X8JB 4WNIA 4ZV7A 4DJFC 5L51A 4CNQA 3OKCA 5JAZA 2JH8A 1GITA 3DKIA 4MS1A 5AHXA 1UFQA 4EY3A 1SUCA 5F78A 4JBLA 2XE8A 2NQ2C 3QYPA 5F64A 1LPSA 5K3BA 3MGBA 2HMWA 5H70A 4B09A 2NAPA 3PPVA 2Q7OE 3TOVA 3O74A 5I7SA 1YZQA 3B85A 3BIOA 4O1HA 5FUQA 2I3BA 3EOAI 3BIXA 4ZCPA 2B1QA 5DHTA 1E4EB 1ZKDA 3K1TA 2Q7DA 1ICIA 4F9FA 1JR6A 3E1SA 5FLXA 3P9ZA 5JCJA 2ZAGA 3S29A 3MWLA 2ZYRA 2XNKA 1OZAA 4GEGA 4K9NA 1FBTA 1H8EA 1AKTA 1UPUA 3TVYA 3JRXA 1F12A 4M9QA 5EZQA 5JZBA 3KOUA 4NZNA 3B48A 3EGWA 4UDNA 2PBZA 3LFHA 1T8PA 5FL7D 5JQGB 2DPXA 1FFAA 1T6ZA 3TE6A 3WE7A 4BKMA 4O4HB 3ZWOA 4TT8A 4GR9A 4DNQA 1EX7A 1QYXA 1U9ZA 4FTWA 1EHYA 1HDIA 1TB4A 2G36A 3CLSD 3EEFA 4RMGA 1LDEA 3I8SA 4LTDA 1TRKA 4N12A 2DH6A 2W2PA 3HBFA 2R6FA 1LFAA 4J0KA 2A5DA 2OA0A 4XOIA 1G7TA 3L5OA 2ZUBA 3F5MA 3BMQA 3HCPA 5DPMA 4JXZA 4EOGA 1WHSB 1S8NA 1L5FA 2AC2A 5IULC 4KO3S 4M4SA 4G4SP 4XRRA 1IHUA 1ZAKA 3HN2A 2PXHA 4KGXA 5K7SA 4LF8B 2QM7A 4CQMB 2BCJQ 4OBWA 4FBGA 5FX2A 5HVNA 3ZJUA 4NBRA 3MRTA 4JP1A 3LUDA 3UMJA 2UUOA 1OHHD 2W43A 1JVNA 1IRXA 2JLVA 3CNOA 4BVJA 1E94E 1UJMA 3I4LA 4FOTA 1WDMA 2QG4A 1UBEA 1VSUA 3HVJA 4Q7MB 2W42A 2IEDA 5B2FA 4PZZA 2ZTVA 4LF7B 2ZSJA 1GG2A 4GZMA 4LE2A 4Q00A 4PZUA 2J3IA 2HBZA 1NXVA 3RBAA 3W9UA 1OA1A 3J7TA 4G23A 5CMLA 5IMSA 2D1FA 3N86A 3UMCA 4ALNA 2AGVA 5HX7A 3V00A 3PHBE 3AVOA 1THGA 3PT5A 1HO3A 1EWRA 1F06A 2G9ZA 3FHJA 4WKBA 1UDAA 3BULA 5CLHA 1KQGA 5AHKA 1SXJB 3V1NA 2P9ZA 2WHPB 5CYPA 3I28A 4MB2A 1ORDA 3VOTA 3H0KA 3OOEA 4B3BA 1X87A 2X23A 5LB4A 4OLJA 5D1NA 3VDRA 5F52A 2GSDA 1JDTA 1ODSA 2BZSA 3KYIB 1GUYA 1QK5A 3IOYA 3NDPA 2EZ9A 4NHOA 2ZSBA 3VX4A 4X66B 3WIOA 4EGFA 2ACEA 3AFNA 4DCJA 2I6GA 3V1LA 1CETA 2JANA 2QPAA 2QR3A 2IHVA 4JUDX 1UK8A 2VK4A 1C80A 4OGLA 4XLZA 3RRZA 3RU7A 4FR5A 5BSEA 3I5XA 4M6WB 2A1IA 2JGDA 3GHYA 3TJZA 1ZJJA 2X14A 2W8BB 4Q1FA 2ZFUA 3WK7A 1E9BA 3VR0A 3WGLA 4YS6A 4GU5A 4EGJA 4ITUA 3JZAA 4DV5B 4NU5A 2BHLA 4P5PA 1PJ4A 3C5EA 2RHOA 3IULA 1E63A 1ZEJA 4HMPA 3QIAA 2YFHA 4REQB 5TQJA 3TCNA 2IYRA 1ZD5A 2B8WA 2IHUA 2LP4Y 2NZYA 3MA0A 4UNSA 2NU6B 2RE8A 3FN4A 2FX5A 2X42A 1OU4A 1Z8FA 1LPPA 1R5JA 3ZN2A 4FB5A 1XFDA 3VYUB 2XCRB 4EEZA 3K0KA 5A0TA 2F1HA 1LU9A 3N53A 5H83A 4LJRA 4N18A 1U9CA 1W44A 3F7MA 5B6PA 2DR2A 3NEPX 4IIYA 3MQ2A 2CBGA 1MB2A 1BIFA 3D1VA 4MW7A 5DO9A 2IPOA 4Q7JB 3SHTA 4CDRA 4OAQA 4F12A 4RE5A 5AVQA 4F84A 2YV1A 3NAMA 2J9ZB 1BWSA 1RE1A 3GWGA 3M6XA 1TCBA 1GNPA 1JJVA 2EL7A 3QTLA 4QICA 3VR2A 3FBWA 4Q02A 3DD1A 3CURA 4D5GA 2VQFB 1U6KA 2O23A 3K2EA 3TSCA 2OLKA 3C6MA 3HC7A 3VU1A 3WP0A 4WE3A 2Q4OA 2WNSA 1U2SA 2Y1LA 3QWFA 3MXTA 3G2KA 4BEVA 3BB3A 1OX4B 2HMAA 3L1VA 5LNK1 4QFBA 5ICFA 3D5TA 3ZXYA 1P1JA 2IUFA 2I34A 2G1PA 1ZNZA 1U2PA 1FMFA 3FUWA 3PI6A 1ETUA 3KJXA 2BMEA 4EX7A 5AESA 2A14A 4PC1A 1EUQA 3A10A 4XUEA 2DFKB 4FLEA 1C0KA 3U7RA 1FUKA 2GYWA 4KNVA 5EXSA 2QJFA 4NZPA 3PC8A 1VE7A 1QGYA 2QAJA 5KVQA 4IHKA 3I01M 3Q7QA 2FLWA 2WHRA 3KZXA 5IVDA 2G5TA 4UBLA 3OOWA 2FYTA 4I7EA 4CI0B 1DBRA 1WXDA 1Y1TA 2UYQA 1QGAA 1LB1B 3EW7A 3W5SA 4EHNA 3D5EA 3EBOA 3N75A 4ZQGA 3W6PA 4D99A 4DR7B 4GDFA 1N2IA 4TPKA 3ZWKA 5B30A 3NASA 5LYJA 2G7MC 3QXCA 2FRVA 1OX5A 3WIBA 1FUUA 2CMKA 3OT1A 1JDBB 1XRMA 3VO9A 3QKUA 5BWLA 2QP3A 3T5DA 2DUJA 2W2MA 5FJIA 3WYEA 1QHGA 2H57A 4Y2QA 1KFJB 5SYMA 5CNIA 3O75A 1PSWA 4RK4A 1DAPA 2QDKA 4O2BF 4S2EA 3TIVA 5LQKA 1C30B 1ZUHA 1OE0A 1DZ3A 5AM4A 1D5CA 3SR3A 4WK4B 3DBHA 2QTVB 3OZ7A 1OLSA 4NHEA 4ZOLF 3ZDDA 4M8LA 3BPSA 2H17A 2QS9A 4U7JA 1Q0SA 3H42B 4CVNA 2AYYA 2NUAA 4CU5A 4ENRA 4G86A 4FGWA 3ZWDA 3H2KA 2J0VA 3BF8A 1ZIOA 1IJBA 1NP6A 1WPGA 2HF9A 3AEYA 4H1VA 4WBNB 1DG1G 1XVVA 4K87A 1RAHA 2Q5EA 4AWXA 1J23A 1JLLB 5K99A 4DLWA 1T9CA 3GFGA 2JD2A 3TZCA 1RAGA 5HF9A 4QEKA 4PAMA 4JXJA 4IDEA 1T24A 1C9MA 5I3CA 2JBHA 1A8UA 5TPZD 3RFTA 1TMOA 1YBFA 1P80A 3OZEA 4BNIA 1M2EA 2Q6VA 1NJ5A 4AW9A 2AI3A 3L1KA 2WKPA 4TTPA 5DT9A 1O8BA 2PZMA 3C6ZA 4KN9S 4AJ2A 4AZ3A 4B34A 1R0ZA 5H59A 1KR2A 5LJIA 1NUPA 2ZB3A 5JDCA 2GYYA 2BGLA 2RGUA 1FNNA 2WABA 2VG8A 3HADA 2VCEA 4JYBA 4J7AA 4WL0A 1RAIA 3D8BA 3EGXA 3H9QA 3LSTA 4TV8F 1C9JA 2JFOA 3CEPB 3OM8A 3U3JA 1JIXA 2AUTA 4F9GA 4B31A 3R20A 4P54A 1GPYA 1PDOA 2H07A 1G0NA 2MSDB 5CLJA 2GKOA 1R8XA 3MOGA 5LCXA 5E2IA 4PNZA 3GOQA 5U4QA 4YRKA 1AIPA 4GL2A 2GVZC 3PD7A 3I23A 1GNQA 4YWHA 4LMBA 3GUVA 1V9LA 4LHSA 3DQPA 3NBFA 4LFAB 4MRNA 4K40A 5KAMA 1V35A 4C5BA 3F1KA 1A5ZA 4MRVA 1XLUA 3R41A 5THQA 3VVLA 2RHLA 3CEAA 1KYIA 1AN9A 1QIIA 4OIFA 1X8JA 3DL2A 3N0TA 3L93A 1DMRA 3Q4GA 1TOAA 4TYYA 1ISIA 4BY9E 3F9RA 3C2QA 4G3XA 4P3XA 4EHFA 4BZWA 1GNVA 1BCRB 2ZJ2A 3AI2A 3DEAA 1JEOA 3AEXA 2P1DA 3GEBA 1I3NA 1NNEA 4ND1A 1KP3A 2CZQA 1WJGA 4C2AA 4V1CA 5ICGA 3FSEA 4Y0NA 5IAOA 2GDJA 4X6UA 1N7HA 2WFZA 4I8XA 3RS2A 3HUFA 5KINB 1Y1RA 4CYMA 5BMVF 2G6TA 4YDQA 1RZRD 3W4KA 5FWXB 1JAXA 3KVNA 3H17A 4WY2A 2Z6AA 2HQRA 4F4UA 1NWHA 3SYLA 2REBA 1PR5A 1TUEA 3E2IA 3VJLA 4ZI3A 1DBSA 1W5TA 4Y8VA 5LXTA 2RCYA 3BKXA 3HY3A 1KVSA 1SY7A 1U7ZA 2OFXA 3C7KA 5LQCA 4YRSA 1ZK4A 2R66A 2B2XA 4CMIA 1I51A 2VJAA 5BN4B 3GLIB 4JOCA 2AG5A 4R83A 3CO5A 1KF0A 1H2YA 3GUUA 2QX7A 2A2ZA 2GAOA 1FTWA 1OH6A 4ARUA 3JY6A 2VQ3A 2P9JA 5BSWA 4M76B 1LTHR 3VNRA 3OO1A 4MI1A 1AGPA 3ETCA 3SQNA 3SYRA 1P60A 2DEUA 1WHTB 5DGHA 2X9NA 2Z83A 5HPYB 4GL4A 4IMPA 3CCBA 3AOEC 1GT91 2B2CA 1VIDA 4GM4A 5IN5A 3IUBA 3T1NA 5HQ3A 3N8HA 4X6YA 1GFIA 1CUHA 2X4IA 4NBTA 1JDZA 3QW2A 4LNUA 4DRXA 5T3YA 4NULA 4PHFA 1QQBA 5IF3A 1SUEA 4JS0A 1SVWA 3FSGD 2R87A 4FHGA 3THWA 1T1GA 1ZVVA 2H5LA 1TJNA 3SS8A 1U3TA 1G8SA 1HE5A 1L6RA 1JR2A 2Y67A 1RKXA 1GGFA 3GFSA 2YASA 3L01A 4UHCA 2XOEA 2ZS9A 4QIHA 2QENA 2COEA 4OM7A 2H59A 2BHNA 2X7XA 3ZY4A 4CV2A 4WWHA 2O59A 2EFDB 1JFLA 3GLSA 4B3FX 3GF4A 2KLHA 2ZVPX 2XI4A 3QZUA 3DP9A 4FDAA 3OLQA 2WJJA 3OF3A 3AKZA 1KTIA 3UHOA 1GTVA 2OZVA 5T67A 4QOGA 2I4IA 2WI8A 4OHZA 4JYCA 3K9LA 3ENNA 2ENWA 2WJIA 4DCSA 3M5PA 1LF0A 1NY5A 4XQ0A 9MHTA 5HKKA 1I13A 4JLDA 3K6KA 4ME6A 4CLEA 3DO8A 5K0ZA 2B9VA 2OZLB 3RVMA 2IDZA 2HA6A 2O8FB 3FG9A 2YS6A 4F85A 4A0RA 4FMCB 1EDBA 3ZLUA 2OHJA 1VLJA 1C4KA 3GRPA 1YJXA 3KQMA 4QXAA 5ALOA 3SMQA 3PQ6A 5JATA 2WMDA 2R8YA 3WICA 1KJZA 1EMDA 2G06A 2PXCA 3D8UA 1GUBA 4YP1A 5BYBA 3WHLA 2GXQA 2KM1A 2NN3C 2PGJA 2R6GA 4HDMA 4ZQIA 5DTQA 5DM0A 1PWHA 3CLTC 1XD2A 5A5DA 3VKWA 3LX4A 1FQWA 1NVFA 2AEEA 3DFKA 1VHWA 1M54A 1QIJA 5K0GA 1QO7A 4JC0A 1AUVA 1KY2A 2GILA 4OMCA 3O7WA 4BMYA 4UM9B 3S1SA 3HP7A 1UFVA 3IMGA 1KJJA 5E7IA 4GXNA 3EUWA 4AS3A 3L7BA 1PHRA 1TCAA 3W6ZA 2HPVA 4KI0A 4MEBA 3TO5A 5HIKA 4BNJA 1UF9A 3WJ1A 1H0KA 3EZXA 1EFVA 2EP8A 3Q87B 3TIIA 2QX9A 4BXOA 2HDWA 1XPJA 2QMUA 3LDHA 4G67A 3O0TA 4OMUA 4MVJH 4X6LA 2P90A 2VHWA 4YTEA 5TEWA 3UMMA 3QU9A 4PYJA 1CUGA 1II9A 1PJBA 2BDUA 5JASA 1T10A 4FT2A 3NVAA 4H3SA 1NDHA 1Z07A 2V4ZA 2QTGA 1TCCA 3VTKA 3TRDA 4R71A 4ZDJA 4Z54A 3DP7A 3ZKWA 2BKAA 3G2LA 1JIJA 1PR4A 4YRGA 2QW8A 1UK9A 1XTPA 4W5TA 3OC0A 2XSZA 1NA5A 5G1NA 4ZOQI 1DJPA 1S6YA 4EKYA 1T2NA 1DXOA 3ADKA 3PXAA 2FN3A 2KX7A 4L08A 3ZLBA 3KOWA 4MV6A 3INTA 3KNZA 5DLPA 1HLGA 2WSSD 5EHXA 3R3YA 2IGBA 4TWBA 3UV3A 1VMEA 4P1ZA 1ZRHA 2Z4RA 3HP4A 4JH0A 2B8EA 2R6DA 3LQYA 1XDBA 5KBYA 1GL3A 1J7KA 5DWVA 3GPLA 5K0EA 4K6KA 1YS1X 2WJ3A 4JI2B 3EEOA 2JATA 1HI9A 1UR5A 1VSTA 2NXCA 3LCVB 4C04A 3VNBA 4BU1A 3OCUA 3SEFA 2OBLA 3D6TB 5L40A 1APBA 3NUGA 2XMBA 3LD9A 2R6ZA 3OC6A 1LKZA 3NHLA 1PQPA 4OK5A 1QLHA 4OD0A 4XUDA 1H2FA 2WDPA 2P6RA 4TXMA 1KH3A 2J6BA 3EVNA 1N6KA 4EUNA 4IJQA 4O0LA 1A2BA 1JYSA 2O5RA 3OT5A 4P4LA 2I4LA 4R8VA 1E2MA 1I5OA 2IZ1A 4RL4A 4B3RB 1DHTA 1FX0A 1X8KA 1U0HC 2ZCJA 1QF7A 3GQVA 4YUVA 3TFWA 2ZVJA 3C3AA 3I0MA 2VNKA 4V24A 1S8FA 5CH3A 3IT0A 4H6PA 4ISCA 3WGIA 2EP7A 1H0SA 3KOZA 2HMTA 1A69A 3HUUA 2HIHA 2X13A 4ZVOA 2HO4A 3B1WA 4GPTA 4W8GA 5GIPE 2HPHA 2Y1KA 1AB6A 4DG8A 2JHFA 1WXIA 4HK4A 2AMFA 3OFND 3B1JA 2I5PO 5EHGA 3ZHXA 4DSTA 1JG2A 1KGSA 4QYIB 1AZSC 1OI7A 2Q0XA 4MGEA 1V16B 4CL0A 1K89A 1TVMA 3AOEA 4MIKA 2G25A 3WK4A 3EUAA 3C3WA 1J25A 1FNMA 1N57A 3IT3A 4LRXA 1AGNA 2ZREA 4HNRA 3V32A 1AKQA 4WHMA 5EWMA 1A04A 4OKNA 4LHWA 1IOWA 2AMYA 4QDXA 4P7KA 4BKQA 3W6UA 2VP0A 3PTAA 1GTG1 3UMRA 3BT7A 3R3SA 4MCHA 1Z2AA 3MTGA 4U6NA 5I9SA 3UFXA 2PQ6A 1E7MA 5L3VA 2XE4A 1Y3FE 3OP1A 1L7BA 2ZUTA 4LQDA 5G4KB 4KRGA 3R8XA 1ESMA 4I0WB 5FTNA 3BXEA 1ZD8A 3KFLA 4F2PA 5CDSA 1UM9A 2NU7B 3DF7A 3FB1A 5FTJA 4CM4A 1ST3A 4UTZA 3UHFA 2NZJA 2Q3CA 4PSDA 3BIWA 2PUHA 3QE9Y 2Q3MA 1HRDA 1RRGA 2EBUA 4QNRA 4RA6A 2B69A 4TMKA 1VJDA 2ZR8A 3OIGA 3JD3A 4GSKA 5JLAA 1I2ZA 1C3VA 4BQNA 2J9FA 2FW1A 3LRTA 4AQDA 4D81A 1T1JA 1AKEA 4RY9A 3GWZA 2P4QA 2DKFA 4FFLA 5EEGA 3TQFA 4AG5A 2ZAMA 3BC1A 4ARZB 5HHTA 2WPNA 1GAQA 4HGPA 4YJFB 3AV3A 4MYCA 4EF6A 4I1OA 3STTA 4M9ZA 5H80A 3UHJA 1SEPA 4MGKR 1G66A 3IGFA 2GBIA 4X1IA 5JH7F 3I6ZA 2E87A 2OG2A 4BNLA 2OM6A 3W5AA 5JADA 1U8UA 1JA0A 3ND8A 2W2KB 3L0CA 1OYVA 1TO2E 4AMYA 1J06A 4EELA 1E64A 1VKRA 1IAVA 5LFAA 4RZ2A 5LM3A 1UIMA 3FBGA 2EDCA 1WF6A 2D0OB 3ADDA 1KFCB 3F6SA 4M1MA 4QU0A 4LI0A 1KEZA 3K71B 2XXAB 4CCYA 4ZI7B 3TQIA 1EE1A 2FG7C 2MYNA 4BGDA 2ZRAA 4OQQA 2QLBA 4OFZA 4CMEC 3X1JA 5JXWA 5AI6A 3GLUA 1RRKA 2FR8A 2CZGA 2QNRA 3TBFA 4YWJA 4H1WA 2QNBA 2OHHA 2XRMA 3I9NA 4QGAA 3ROXA 4BGUA 3FTNA 2OESA 1ZKMA 5FTKA 4D92A 3GUYA 1V25A 5AVRA 5I9NA 3G8BA 3C87A 4B8WA 3AEQB 3IIJA 1L5OA 2WA1A 5DGDA 5E3IA 5FEMA 5BV2P 4J29A 5FBQB 1B8OA 5LJLA 2DERA 1L5KA 4CT0A 1NJSA 2A0XA 2HXSA 2ZTUA 2IYEA 3E4DA 3L1HA 4JKYA 1U8AA 3KYBA 1J9EA 1SD5A 4PPFA 5BN3B 3DPSA 1H5QA 4HZUB 4ER0A 3QEMB 2HRZA 2R00C 4MMZB 2GXSA 1I2MA 4RU1A 3EC7A 2FOIA 2ZZKA 1T6NA 5CU7A 5K3DA 5J43A 2ZXEA 3DV0B 1QFSA 2JJ2D 4KC0A 4DC9A 5CVJA 4HOYA 4AI6A 3O93A 2XNCA 2MDTA 3KYDB 3IR7A 3GRRA 3DBOB 1JL3A 4JSTA 3OPYB 4RY8A 3H1TA 3CPHA 1N9KA 1U7DA 1UMCA 4TN1A 1PGNA 1FMJA 2BUAA 3ETLA 4S1TA 4RK7A 1SU7A 4TL7A 1WVMA 3EAGA 2I87A 3SC4A 4D8UA 1SK8A 2R1VA 4KU4A 4ZVLA 1KAGA 5U4XA 3MCTA 1XPRA 1NQXA 1IHDA 2VUSA 1JILA 1OLOA 4JB8A 2O2ZA 4ENWA 2C9YA 1DTSA 1O7JA 2WHYA 4COKA 2G3YA 3ETGA 1U1DA 3G5MA 3EXEB 5EWLA 4CG1A 1ODKA 1MCZA 5LP6C 5JCJD 1OCEA 5JS2A 1X80B 2YJ5A 3UPDA 4A8JA 3ZD9A 3L0PA 1XAHA 2RGGA 5J58A 3F1LA 2C5GA 3I4CA 3HHEA 2V9CA 1XF9A 3OESA 5JNUA 5C5DA 1A5TA 1JSXA 3N8KA 4UTNA 2GHRA 1ZUNB 2ES4A 1I7SB 1NZDA 2KSQA 16PKA 3L05A 3ROKA 3UK7A 6GPBA 1F1BA 2FETA 2PL5A 3VR5H 1JDPA 1G1AA 1WZCA 3LHIA 5IDVA 1UC8A 2D0PB 4PLPA 2C3OA 2QBYA 1DIOB 1WB6A 2QVZX 3GDWA 5B57C 4WASA 1FUEA 1ULTA 3PV0A 5ER9A 1UT6A 4NBSA 5FXMA 2C2KA 2J8ZA 3GVPA 4P98A 3PHCA 1M8JA 1QVZA 3G2MA 1DS6A 4OJMX 2XBMA 4O08A 2AOTA 3ZW7A 3AESA 1W9HA 4BO7A 4CV0A 4ZTUB 4YHBA 3KKPA 4MUMA 4QLBA 2F55A 2YCLA 4RKEA 1B4DA 1DX6A 3CVOA 1O08A 1OYOA 4BNDB 3G5UA 4PO3X 1M0TA 1K75A 1LLDA 2WJAA 2X5JO 2ZYDA 3JZIA 5E0KB 1QP7A 1NR1A 1U8EA 2WNHA 1X1EA 5DBIA 4D0LB 2PBFA 1Z3CA 3E82A 3ZS9A 3TW8B 2IEBA 3JAKB 2LTAA 4DR3B 1VIMA 1AG9A 2C95A 2VTEA 1JBKA 1OWLA 3GEIA 3SHOA 2PD3A 1BKDR 3IQHX 1F4PA 3QLVA 4M1ZA 5INTA 2VWQA 5I9IA 3MEQA 3VMMA 4W1QA 4XARA 1JIKA 1QHHB 4KP7A 3PK0A 3HI4A 3S44A 2C9CA 4A1OA 3X1YA 1RP7A 3DC7A 5L3SB 4RHXA 3SOZA 1OYWA 3NWBA 2ZBPA 1QUFA 3Q1KA 4L2IB 1GQRA 3DVQX 5DCUA 2QTHA 2UV8A 3H2ZA 5FWDA 5CXSA 3VPDA 4EO9A 1DKQA 2HK6A 2HN9A 4QGSA 1KDPA 3FNIA 3MWYW 1YVDA 3EAQA 3HA5A 4I50B 5C32A 3QBEA 3PVCA 4EB6A 2NXJA 1M1YE 1XE3A 1PZEA 2XD4A 1TZKA 1YD7A 2J6HA 3EIUA 1L5ZA 4US0R 1FIUA 1A4XA 4J0DA 4RQTA 3ZY5A 2YQ4A 3TPCA 2IT1A 5G0UA 2FN4A 2I7DA 1S2GA 1N8KA 4B2LA 3TQRA 5AKZA 4QG3A 4N49A 4YB8A 4YV2A 3GU3A 2NO7A 3IILA 1VSBA 3H13A 1L7OA 2N1MA 2PJZA 1XZEA 4AROA 3GZNA 1USWA 4EB3A 3W2GA 2ZM5A 5CXUA 1P62B 1XYGA 1Z73A 1P45A 4FSHA 1VB3A 2V7XA 5HXAA 1MQAA 1M7BA 4BMXA 3UAWA 1V5EA 2ODNA 5BURA 1AH2A 2J9XB 4UUBA 2V7PA 1L5YA 3AJ8A 2WKWA 3SBXA 3OAAD 4QUGA 4RNCA 2GPSA 5CBPA 4PBRA 3A2KA 3N8IA 2EIXA 2Q4TA 3QELA 4YRLA 1MJ5A 4UZEA 4ZT4A 1M66A 3ED1A 4OL9A 2R00A 3K0AA 3IBYA 4HNTA 4OGKA 1J1UA 5FJJA 4CIVA 1PDVA 2VNHA 1FP4A 1U2GC 2LV8A 1JKJA 1AUOA 3OURA 4KODA 4Q48A 5LA6B 4EZIA 1E2UA 4C0HA 1A27A 4L1KA 5CB4A 3NBUA 2PM8A 3E9MA 3D7KA 4ILEA 5K1ZA 2G72A 4U6SA 1M6NA 3N0WA 4C9BA 3LP5A 4M8SA 1D9ZA 1V1RB 2CKDA 5JUWA 1VRWA 3DZCA 4LXXA 3STHA 3FUTA 3PEVA 3WNBA 2FQQA 3TTSA 3HU3A 4CKYA 3A6KA 4RMHA 3SZMA 1EUCB 2IYWA 5IUKC 2O8DB 2VHJA 3BA1A 1NX9A 3ZXIA 1QIKA 2AK3A 3BWXA 2WPDA 2ATXA 3ISJA 1TLFA 2ZI5A 3KJQA 4M0UA 5LP6A 5JQWA 5B58C 2J1LA 4K6OA 5HIMA 3VC3A 2BM8A 3NIFB 4EFDA 2IFTA 1M2VB 2AXQA 1NPTO 3HXTA 1MLDA 3AQ4A 3KYJB 2DR3A 5F9MA 4C88A 2CUNA 1LDGA 2Z8ZA 3TR0A 2HXYA 1UK7A 2PX8A 5T8KC 4M1EA 1EVJA 4MWSA 3ROQA 2UYHA 1RYZA 4F5ZA 3F2VA 4KXQA 3E9YA 1GNLA 1W46A 2B25A 1DAGA 2ZAIA 1ETHA 3JQAA 3ZYCA 1M2OB 4LX8A 2KMLA 3DCNA 4J9VA 3S5UA 2FPXA 2O3UA 3ZWAA 4HTFA 3VO1A 3HCCA 5BORA 2R2GA 3AL0C 1MT3A 4RS3A 4DMFA 2D2XA 4CKBA 3T7AA 1T3GA 1OSNA 3MFQA 2Y76A 1G60A 1NVKA 4EH1A 2G1KA 3BS4A 4MEJA 3FYUC 3TLGB 4WDRA 4J4BA 1OB5A 3IB3A 3MSCA 4Q6WA 5EJ7A 3RUHA 4MVXA 2OOKA 2NTEA 1XAIA 3HDYA 4KG7A 1TAGA 1BHO1 2IYZA 4OB7A 1V9SA 3IURA 3M70A 3H8SA 2YXPX 4LYAA 4X8HA 1IM2A 3H1AA 1E2KA 3NC0C 4OOEA 4YA6A 4BIMA 1G6OA 5SY9A 4KE7A 1K8RA 4KR9A 4W63A 5I51A 1QYIA 3K4QA 2DHDA 3PTLA 1GTSA 2ECOA 1IBLB 3RANA 4WA7A 3TMYA 3SQDA 2Y0PA 1U9JA 3GJ8A 3ZGOA 4BCDA 1B8NA 4U00A 2IC5A 1VJTA 1I6MA 2ECKA 4R4JA 2IHKA 3MLAA 1NM5A 1P9WA 3H2HA 4YRQA 4KDRA 3TAHA 4GRAA 3VHLB 5HKBA 1CZHA 2DF8A 1BOFA 3TLCA 4EPTA 2N0SA 2GK3A 1XKTA 2Z3WA 5BRNA 5J47A 1UFOA 3H9JA 3RSSA 4O2AB 3TRJA 2X58A 2VIIA 4JLOA 4RLFA 1CQZA 2WUVA 3EDYA 4DB4A 2O5EA 2QMOA 5KSPA 1GA4A 4HGNA 3RAPR 4G0YA 4YYEA 4JY7A 2BFAA 2GF2A 4R3UC 1RW4A 3L7JA 4KO1S 4BUCA 2OCIA 1A4RA 3Q12A 4MITA 1MU0A 3VRHA 5EG5A 1GWNA 2ZBVA 5F73A 2DUMA 1XK6A 3O91A 3PT9A 5DNCA 1Q0TA 4OBBA 1NVEA 1G6KA 4R2XA 2HQOA 3G02A 1NQWA 1XD9A 1IQUA 1CNEA 4X24A 5JJCA 4LGMA 4CMAA 3T0IA 3OE4A 5DCYA 1VPEA 2X8LA 3PXGA 4KVAA 5J4LA 5K0SA 3ORFA 1DEXA 2HMYB 1AOXA 2NVOA 2P35A 2PUTA 3NZEA 4MSUA 4RD2A 3GJ4A 4LMPA 4IMIB 1XZIA 2CVFA 4IFBA 2IV3A 4BNTA 3U4HA 1NW7A 4WCVA 4KV7A 2EZUA 3A27A 3LKDA 1OZ0A 4DA8A 1W75A 4GWGA 4YV7A 3BXZA 4K9RA 4RF3A 4D82A 3RGGA 3VHRA 1FRZA 1NWCA 1X7YA 5HCUA 3FCOA 2H7YA 3CW2A 2H1OA 2YWEA 3ID6C 4DDTA 4Y9RA 1UZAA 1KC1A 1HDZA 4Y6OA 1J9ZA 1U0JA 4IW3B 3H7AA 5CCDA 4AZSA 4D79A 5KU1A 2HX1A 1JYEA 4DDMA 4DM4A 2DTEA 1U2GA 4YASA 4C0SA 1A96A 1NW5A 4BNWA 3EDCA 2C3YA 4OHCA 1GRRA 1GV0A 5EGSA 1X42A 1AKRA 2D62A 3TLEA 1M34E 2HFKA 1P1KA 1YB7A 2VCHA 2NTYC 5KMGB 1BE1A 5IDQA 1NGSA 1ZA2A 3FDZA 3LA8A 4IX9A 5KHAA 3IIEA 3H8WA 3K2IA 1VM6A 4WPGA 1AKUA 5ALEA 3P0JA 2W4IA 3LRPA 3OJWA 1JG6A 3JWJA 1V5WA 2I55A 3CHYA 5BVGA 1ZIPA 4ABYA 1CDZA 1ZJZA 2PSHA 4TTQA 3V8NA 1OXSC 1PBTA 2W4MA 2PRJA 3HG7A 3O95A 1QR6A 3A58B 4U3JB 2V54A 5ARDA 3M6LA 4LY0A 3T3DA 4KBFA 3GLHB 5SY4A 3WIUA 3QKSA 2DECA 2APJA 3R7WA 3E70C 1TLLA 3HGMA 1IBCA 1PO7A 3PI7A 2C5SA 3ECSA 3QF4A 4UCQA 4AN0A 4DBVO 2EWMA 1PQ4A 4JT9A 1MX9A 2L18A 4F4HA 3RKRA 2OPBA 5E8JA 5JZ9A 1KI1A 3AI7A 1T5TA 1L6IA 3DWIA 2VHTA 3MILA 3HXOA 2WFMA 2NPOA 3M34A 4K7JA 1PZHA 1SKQA 1EXMA 2J0UA 1ZN7A 5DGXA 3WBJA 3OQIB 1C0IA 3PGMA 1LK5A 1USGA 1P7CA 3O8BA 3D4NA 4G09A 4G63A 4N0PA 2FN7A 4NMHA 4IHAA 4QUDA 3TXAA 4DABA 1J8DA 3VSBA 3B3GA 3VNUA 1E7QA 1NVBA 4IL5A 4LYYA 3RVDA 5LU8A 1XTVA 1CHDA 1PZGA 5C3MA 4OQDA 2H1FA 1FVHA 1VBMA 1R64A 2FCAA 4OXYA 1KVTA 3E27A 1V6CA 2NMVA 1JVBA 2RGXA 2GEJA 5EHZA 1NAIA 2ZRNA 1N25A 1TZBA 2FHPA 4BFYA 3NBKA 3R23A 1FTYA 1DG9A 1T9GR 2DOKA 3EEIA 4WSOA 4F2GA 4BUZA 1TC2A 3K5WA 3EGCA 2G71A 2IU0A 1EWKA 2FPPA 1VMIA 2YQ5A 2MR6A 3QKTA 3T3PB 3TTXA 5HKKD 3OQJA 4HAUA 5T4HA 3G9UA 1PK9A 4A0GA 1OU0A 4I8DA 1RPNA 3CFYA 3EXFB 2YYZA 5EUQB 4A6EA 2XW6A 2QRNA 1Q0ZA 3H7IA 2EU8A 2KE5A 3PR1A