4BMCA

Crystal structure of s.pombe rad4 brct1,2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
183
structure length
183
Chain Sequence
SKPLKGFVICCTSIDLKQRTEISTKATKLGAAYRSDFTKDVTHLIAGDFDTPKYKFAAKSRPDIKIMSSEWIPVLYESWVQGEDLDDGLLVDKHLLPTLFKCRVCLTNIGQPERSRIENYVLKHGGTFCPDLTRDVTHLIAGTSSGRKYEYALKWKINVVCVEWLWQSIQRNAVLEPQYFQLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords S-M CHECKPOINT CONTROL PROTEIN RAD4
publication title Phosphorylation-Dependent Assembly and Coordination of the DNA Damage Checkpoint Apparatus by Rad4(Topbp1.).
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 60
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
A PF12738 PTCB-BRCT twin BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4bmcA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4bmcA02
1IMOA 3SHTA 3PXCX 2COKA 3HUEA 3K16A 2LE0A 3K05A 3PD7A 4BMCA 3QVGB 2R1ZA 3PXEA 3SQDA 4IGKA 3II6X 3AL3A 3K15A 1OQAA 3PC8C 2ETXA 4XPZA 3U3ZA 4JLUA 3I0NA 1WF6A 3UENA 2EP8A 4BU1A 2EBWA 4ID3A 3L46A 3T7KA 2EBUA 3PA6A 1N5OX 1L0BA 2K6GA 2D8MA 2COEA 1Y98A 3AL2A 4N40A 3KTFA 3OLCX 1T2VA 1CDZA 2M2IA 3I0MA 3K0HA 3T1NA 4BU0A 2VXCA 3L40A 3PC8A 2COUA 1IN1A 4U4AA 4IFIA 3PXAA 1Z56C 1KZYC 2VXBA 1JNXX 4BMDA 2JW5A 3QVGA 3FA2A 3K0KA 3L41A 2INGX 3COJA 2ADOA 3EF0A 5ECGC 4OFBA 3PC6A 1T2UA 3EF1A 2HTFA 3HUFA 2WT8A 2AZMA 3PC7A 2DUNA 4Y18A 4XQ0A 3SHVA 1T15A 2NTEA 2E2WA 3PXBA 3JVEA 2XNHA 1L7BA 2XNKA 2K7FA 1GZHB 3SZMA 3T7IA 2L42A 4Y2GA 3T7JA 3PXDA 3UEOA 1T29A
chains in the Genus database with same CATH superfamily
4OX9Y 2BZ1A 5EJ7A 3NKLA 1XQYA 1UBJS 2GN1A 2I2XB 1LSJA 1Z0KA 4UULA 5KTSA 4KLCA 4R81A 3K7EA 1N6HA 4XCVA 1DDOA 2WTNA 4H6XA 4MYUA 1OY1A 5JRZA 3H0EA 3IPRA 2N0SA 3V8QA 3ZLVA 4AJEA 5IK2A 4F85A 3NBXX 1EFAA 1RM5A 4OI0A 3MB5A 1MZPA 2R47A 4DGQA 2FPIA 2AXPA 1MNQA 3CCFA 5IARA 1VPTA 2OFOA 1W0KA 2X15A 3LBYA 4NABA 5A6VA 2JLBA 2V4ZA 1V8OA 2J5KA 2Y8EA 4JL6A 4B74A 1M0EA 3MWEA 4CV3A 1ZGHA 4KRXA 3T3EA 1MH9A 2BM0A 5C52B 1DC5A 2VDOB 3QENA 1NPTO 2A3RA 3O8NA 2J9RA 4AJNA 2EERA 3OQIB 1YC2A 4YMSA 3DJYA 2B1JA 3IUPA 3EXEB 3QTTA 4MV7A 4R1TA 3RODA 3ZDQA 3ZWMA 2PMKA 1JG6A 2Q4EA 5LA6A 4BNTA 4C6RA 1R0KA 4YJ3B 3CLVA 1YS9A 1POWA 5CM2Z 4ZREA 4OLFA 1UBSB 4FDMA 1K63A 3QHAA 1GR1A 3F90A 3DMTC 3EVFA 3M5WA 4Q4AA 4FHEA 5IM4A 3IEMA 1EVJA 1K97A 3UGTA 1Z74A 1PVVA 5DW0A 3C6BA 3FETA 1Z0SA 2NO5A 1E32A 3FNFA 1YRAA 1RQLA 2FG7C 2HK8A 3OUZA 1X7DA 1NLMA 4LZZA 3MVEA 1N8NA 3ZV4A 1TTTA 3EULA 4HXYA 4WWHA 1U98A 1ULUA 3TB6A 2IYWA 2YBDA 3BIWA 2VPPA 2X9LA 1YJCA 1Q7TA 3FDIA 3WLOA 3VZPA 3HXPA 1Z8HA 3WNBA 3LO5A 1BDMA 1HI9A 2WJ3A 3A36A 9MHTA 1N5IA 2IJGX 4NBKA 5AI8A 4IGIA 4HS9A 3V1TC 3U49A 2Q4OA 3NX4A 4LRSB 3F5MA 4ZO8A 1SCUA 5CEJA 1YT5A 4B76A 3GN1A 1Y5IA 2HMTA 1BS9A 2SCUB 3X2EA 4J0HA 3HU3A 2O19A 4KN5A 2A30A 4C05A 3SQOA 4MS3A 4ZI5A 3KFLA 3O0DA 3OIGA 1V26A 6CHYA 1CDDA 4RHTA 4UOQA 1MB9A 1XK7A 3K6JA 1YQEA 3QM1A 2WY2D 3CU5A 2WUEA 4L7VA 1SH7A 3EEIA 4K8RB 5IUKC 2CNBA 3O94A 4IH4A 3HCRA 5ELXA 2OILA 2GJ4A 1R4NA 1VG9B 4N5IX 5K1ZA 3DPUA 4XDZA 1TQDA 2VOEA 3FNHA 3FYSA 3IQHX 1V5WA 2Y4OA 3AVQA 1J0AA 3ZK9A 5GJBA 1KSJA 3PU6A 5HQ3B 4U6QA 1O95A 2AFRA 2BTQA 4F4FA 2G83A 1Q1NA 2XTMA 1JI0A 2OD9A 3HVHA 3AF0A 3Q8MA 4QARA 2FUG6 5JAMA 1E0KA 4GPZA 1SWVA 5G0TA 3HKEB 1OLOA 4ND8B 5JDIA 3ZQ6A 4PGMA 4F5DA 3A1SA 2CUZA 2XQKA 5MFZA 3F5DA 1EJ2A 1HDYA 1WCXA 1ZGAA 3JSXA 3JYPA 5SZJA 3RK4A 3UK7A 4R01A 4UAUA 3V8VA 3H4VA 3KAKA 4A6DA 4MW6A 4B2YA 3TQQA 1SWWA 4GBGA 5JD5A 4CIAA 4FEEA 3E03A 4PG5A 4FMDF 1P2SA 2WIJA 3WWZA 3U56A 4MHSA 3E7WA 1G7RA 4P7BA 5CB4F 5FYQA 2HZ7A 2CFRA 4WNCA 2IXFA 5EQJB 2JASA 2YJ5A 5I9NA 2QDKA 2COKA 1YFJA 3NKFA 3UCFA 4LZLA 4R7ZA 3WWPA 1ND6A 1U1CA 2VJNA 5IANA 2X2OA 4X54A 4AMZA 3TOCA 1Y8QA 4CR6A 4DZRA 1XDGA 4EGSA 1HE1C 2O3RA 3GBVA 3H16A 4FW9A 5E9AA 4MDFA 2FX5A 1P7WA 3L6BA 4A15A 1WPQA 2YXLA 2ZTUA 3JVUA 2YNMD 4MW9A 1XHFA 1IRXA 2IS2A 1BXZA 1P9RA 4F4CA 1ISFA 3FNGA 4DQ0A 1Q7BA 2C04A 3G82C 4GR5A 4FOSA 3T4PA 2NG1A 1DCMA 2B8NA 3HU2A 4RYDA 1PQPA 3Q7RA 2NMVA 5AKEA 5AM0A 1VG8A 3NASA 4EKIA 2BCGY 5BN4A 3KB8A 3CIFA 1BJKA 3HFGA 1U90A 4ER7A 5F76A 2CY0A 4L5CA 4DDMA 4EMTA 1CY7A 1WSDA 1NJGA 3AUXA 2YJ6A 3HL4A 1Y98A 5F12A 2JI6A 4ALKA 1Z45A 1X7GA 4PO1A 1LPPA 3ZWPA 4DBVO 3HPRA 3GOQA 2XYGA 4Z9BA 1AK1A 4B0PA 4ENSA 2RE8A 4P7FA 1GRQA 2WTMA 3H2IA 4OHVA 2CHGA 3IO3A 3T99A 1GTVA 2NSYA 3LVBA 2PUWA 3IUBA 3IKVA 3NBAA 4RJIA 3SS9X 5H7XA 4HMPA 1FC0A 3UC5A 3B89A 3DAFA 3I8OA 3MRVA 1XF1A 2Z56A 2HQRA 5IVDA 5IAJA 1F12A 3RHTA 4ALLA 5AW2A 1HQDA 5G4KA 4F06A 5CDYA 1Z47A 3C4JA 2ZB4A 2C3UA 2XB2A 1RPZA 2IH5A 5G40A 3UAWA 2ODQA 1G7SA 1GTL1 1S7GA 3OFND 4V0MA 1GNVA 5CDFA 3M2TA 1YL7A 2DC1A 2RB4A 4MO2A 4DR4B 2BV3A 5AJHA 3N3BC 1KL7A 2BMDA 3W79A 1U7PA 4FLMA 2ZJ5A 2BZ0A 1T8TA 1ENYA 3DL4A 3HBAA 3QG1A 3DDNA 1UKAA 4NQZA 4F2DA 4Q3LA 2QY9A 1U99A 4RMIA 4HO1X 1O57A 4YUXA 4OEHA 4FILA 1J1UA 3TQIA 2AXEA 2H1HA 1AK9A 4PLPA 1NOKA 2HJWA 2V7WA 3VXKA 3M33A 1CUAA 2F6RA 2XMSA 2VZ9A 1OWNA 1TEHA 3IAUA 3P94A 4REQB 2OPBA 3QY9A 4M0EA 2XW6A 1E2NA 5D7NA 4BO2A 4CM8A 4F7WA 2WWGA 1CDOA 3H1TA 2X8AA 3H3XA 3QVJA 2J8ZA 4OVKA 1WL8A 4JIGA 3R7SA 3W5BA 1NP6A 1DP4A 1U7UA 5AI4A 4EA8A 4HY3A 1N7JA 3FUVA 4NU5A 3V4ZA 1U0RA 3GARA 4TTQA 2BEJA 1U5BB 2EW2A 1EZ4A 2CYBA 2V7UA 2W6JA 4EB0A 3HU1A 1OU0A 5D51S 4EHIA 2B5OA 2XRMA 3C3YA 1E1NA 3JYQA 3QJGA 1U5CA 3RCBA 1E1LA 1M6VA 2P3SA 2ZAYA 3N87A 1R0XA 4H77A 4PHFA 3BXOA 3PKJA 1D2GA 2Q4TA 5CB4B 2PX2A 2IFTA 3G2IA 3T9CA 2PGDA 4BNWA 2AFHB 4I4NA 3VU0A 2A5DA 1ORVA 4DQKA 5I7VA 1DJPA 3FUWA 4LV8B 2K5UA 3PGKA 3BYZA 3DLPX 1RYNA 1XEWX 1JSZA 1XKTA 3OX1A 2MMCA 1POXA 4KGDA 5IMBA 3RS9A 2YVAA 1JEYA 5J5VA 1C8BA 3B51X 3UMFA 2BZGA 2ERXA 2YUIA 4NZNA 3VNRA 3K15A 5GIOE 1SBHA 1BE1A 2Q07A 3C8UA 3A31A 1CY4A 3IV6A 4ND1A 3F71A 1SOWA 3LT4A 4RMJA 5GONF 5CTJA 2QB5A 3FKSA 4LNHA 3KCQA 1KP2A 4IIXA 4MXDA 5JPDA 2B25A 4DDTA 2OZKA 4PSAA 4YA6A 3BVPA 4MDHA 3LJKA 4LRUA 2I9PA 2JFPA 1YU9A 3PP8A 4G8CA 1JMYA 2DYKA 4J75A 4W5JA 3ZE7A 2P9JA 9ABPA 4UASA 3K70B 1IUKA 3W2HA 3UXMA 1DUIA 1X77A 3OEYA 4EOGA 2HBZA 2OXCA 1KMQA 3RT1A 1U0LA 1AN9A 2B61A 2GRAA 4F71A 1FJGB 4AU1A 2ZIGA 2FQ1A 3ADBA 4L6AA 2QX6A 3TO5A 1WSWA 2YWEA 3QE4A 1IH8A 4KO3S 4OXNA 2AKAB 1MJFA 4Q1DA 4RESA 4JC5A 4H0FA 2IF0A 3SAJA 1PLJA 3UTCA 3G2KA 3DAOA 3E7XA 4UVDA 3EPKA 1E1CA 1XUOA 2BFDA 1S2NA 2LDXA 2PGNA 4ZOAA 3VI3B 4M6WA 3SD7A 4F5ZA 5IYZA 1E58A 3ZCTA 5EWLA 4Y6PA 4IMIB 2FSPA 1H2FA 1J8DA 1DS6A 4H6PA 3TW4A 1T5BA 2Y05A 4KP7A 4QYMA 4Q4HB 3K09A 1HDCA 1LBHA 1JFLA 2P3OA 2CLDX 3T1HB 3F5FA 4RD4A 1XN4A 4BKUA 1CUBA 2YICA 4QNRA 2P62A 2Q1UA 2R7MA 5H16A 4DIBA 3COJA 2CBGA 4Q9KA 1GQOA 3U19A 1JKJA 3GHHA 1YQQA 1JDJA 5I6DA 2ZU0C 1EWYA 5FWYB 1E89A 2QUHA 4WNYA 4BQQA 3TQCA 4D8UA 3SJAA 3DZFA 2C03A 3SMQA 4D9NA 1NVBA 4L4SA 1A88A 3MTQA 2WJZB 4D3ZA 2I91A 5EYPA 3ROPA 4Z4CA 1N77A 2VATA 3HHPA 4OHZA 3FDZB 5AQ1A 1MA0A 3BMOB 4UCQA 3AR3A 3C70A 4G26A 3PNKA 2VRBA 1HR0B 2DT8A 3RI3A 4MARA 4EJSB 2GMWA 3H1FA 3MSCA 1ZA2A 1GQQA 3LX8A 2OM6A 2QRZA 5REQB 3ZVKA 4B3HA 3WBFA 1QKKA 1ZKMA 3K0SA 2RONA 4FR5A 4P1ZA 1K3UB 1HMYA 3NOVA 1RYEA 4MKXA 4CMEA 4CTKA 4B32A 2WA2A 1IPEA 3OE7D 3GRKA 1W6RA 5HR5A 3C98A 4YLYA 1FMTA 1U3GA 4JZKA 2ET6A 3VPGA 1X8LA 1E5DA 3AIKA 4HMQA 4PZEA 3CG0A 3EQ7A 3BF8A 2PYIA 4XH9B 2GFQA 4R6WA 1D8TA 1QO0D 1W1WA 4GR9A 2ZUVA 1GARA 1SUEA 2B8JA 4FSHA 4JBHA 4YXWA 3E1KA 4WVLA 2ZUTA 2PPLA 1DKQA 4UVIA 3ZTWA 3WGOA 4KUHA 4DEXA 2G1PA 1V1MB 1E7RA 1H8HA 1VRVA 2GPSA 2PKXA 2Z8YM 4X7MA 2H2HA 2BGRA 4JVMA 2ENWA 5AW6A 4FFBA 4MMXB 1LB1B 1OGJA 2KLHA 2F59A 4JD5A 1JLLA 2FRXA 3OO0A 2CYCA 4MVJG 3ZE0B 1SRQA 4BJ3A 2JF0A 5BSEA 5ICMA 1FXUA 3T95A 4OA8A 5HX7A 3L6OO 5FA8A 4EQZA 2CFIA 2JJ1D 4N6GA 5EIBD 2QN3A 3U3ZA 1C3VA 4EMSA 1A3CA 3H5TA 3A37A 1FZTA 5FDFA 2PLWA 1ES9A 4CFSA 4XJSA 4BQNA 1KAQA 1L2TA 3K5HA 2OYRA 1PZGA 3IUJA 4CTMA 4G41A 4HCJA 2ZJAA 4QNNA 1LI5A 4D46A 2O6HA 2ZI3A 2YVKA 3TBKA 4MRPA 4C2TA 2O20A 3N8HA 2W8BA 4Y0AA 3RGWS 4IO1A 4WOBA 5J2TA 2GZ3A 1NURA 3LX4A 4UTVA 2O2ZA 4KRGA 5DMHA 5DX0A 3L40A 4K6CA 1H6DA 5I3ZA 2GJAA 1L5KA 1J9EA 4JA2A 2II6A 3I83A 3VNUA 4XB1A 3P2YA 4CKEB 4E5PA 3LYHA 1IE3A 4C07A 4Z3OA 4G85A 1ZH0A 3EAGA 2IV3A 3JQ7B 3BWCA 4PZ9A 4EHJA 3ZCUA 1XR3A 4M9XA 5EA2A 3UQZA 3E7PA 2VPZA 3NTLA 2JIZD 4AX4A 3ND6A 4TWBA 1AOXA 3BTSA 5KNBD 1TKCA 3S2YA 5FEMA 4JT2A 2P65A 5CX1B 4ZO9A 2AW3A 2H1RA 1G98A 3HA2A 4BNZA 2UXBB 4YRJA 3FIUA 4OOFA 4OHPA 3U1TA 3R7LA 3N2EA 3K9FC 4BLUA 3THWB 1O94A 3AI3A 5DLYA 5T57A 7MDHA 3ZNQA 2DBVO 2P0AA 1EFVB 1D2HA 3AC0A 1H2RS 4IILA 2ZCJA 2HA3A 1NI3A 3BJMA 1IN5A 1C7RA 1UMKA 2B34A 3GFSA 4U7DA 1E8MA 3P0JA 3DQZA 2P9ZA 5KCZA 3DTYA 3I2YX 4FLEA 2AYZA 3D3KA 3GZ4A 2HFKA 1QHNA 3K5WA 2R6FA 5D8DA 5E9WA 5F3DA 1O03A 3R7AA 3ZVLA 2M32A 4BFSA 1M6WA 2LR0A 3IAM1 2ZWOA 3WLIA 1M2JA 1RLUA 4AD8A 4W9NC 3PUKA 4JKYA 1AV7A 1NVVQ 1WV0A 4M83A 2HT1A 4TXJA 2FPWA 4B9EA 1FMFA 2OCPA 5DNVA 1EP1B 5EKTA 2E2WA 4V39A 2QUBA 3L82B 1AB6A 1O89A 3ZGOA 4PGFA 2GA8A 2R6HA 5JD4A 2WR8A 2QBYB 4BUCA 4FE7A 3SS7X 4JQSA 4MWTA 5M2QA 4KAFA 4ZPJA 4YT5A 4K9LA 5KNDD 2GLUA 4WFIA 2WSLA 2VZEA 4LDAA 4ZEVA 2BBSA 3QFSA 4HSGA 1CEEA 1YAHA 3B36A 4QGHA 1W59A 5FUXA 4B3SB 2Q1YA 2PWAA 1SZJG 2XVZA 1R6DA 3ANMA 4DXAA 4HNAB 5A3VA 3TQFA 5IAKA 4U63A 2ZRKA 2HJRA 1UOPA 3G5TA 3G2NA 3RRNA 3IJRA 4I9GA 1E2HA 1XCLA 1U2GC 3GP5A 3B5IA 4HJXA 4UM9D 5IK2D 5J4YA 5CBPA 5E9QA 2PKEA 3ZLJA 2OHFA 2G1UA 2YWJA 1R8JA 4OQLA 4P2GA 4RW0A 3UTDA 4KPFC 1KO5A 3NM4A 1PLKA 5ALUA 4RVDA 1Z73A 1XAIA 2EZTA 2H1OA 1I0LA 2I03A 1WVMA 3U4IA 3FVVA 3OOSA 1WZEA 4P4SB 3G1UA 1FFGA 4L28A 4YHHB 4IDOA 2H5LA 2HBRA 1V4BA 1Y63A 1Z0AA 4WZAB 1PGNA 1QDEA 3AX6A 3K9HA 3I6MA 4MICA 3SR0A 4DA6A 3RBZA 2RHRA 2Y1LA 4K6HA 4KTVE 5U4XA 2JBWA 4Z99A 2F3PA 1HTBA 4BU1A 1NMEA 3VR5H 2E3JA 4JGGA 1U9ZA 1Y4DE 3DAPA 3ZLBA 4GD3Q 4GDFA 3EG5A 2FSGA 5HDQA 5FBLB 2FFAA 3HVUA 1E63A 3WGKA 3K2QA 4I8IA 3QUSA 4PO9A 1ZVQA 1FL9A 3RYFA 1W4LA 1L5FA 4C0XA 4UKDA 5GV7A 4DQXA 1UT6A 3QPBA 3VHLB 4U2EA 4MAMA 1P6UA 4HWSA 4D4IA 1HGXA 3FKQA 5EZQA 1MQAA 3FI0A 4KOAA 4Y6LA 3SI7A 3ILHA 1JHAA 3U31A 4LRTB 2C54A 1E2PA 1I4OA 2IHBA 1MVOA 2RSLA 3VX4A 5KVSA 3GLQA 5CNIA 1X1EA 3E9QA 3KLBA 4R6XA 4TWIA 4URYR 1RLIA 3A6HA 3W5HA 1A2QA 3EC2A 2HA5A 4YRLA 1LDNA 3CNOA 3B6EA 3CNNA 2IOFA 1XG5A 3TEJA 1DI0A 2OLKA 3DFMA 2P0YA 5FWNA 1M34A 5K45A 1HOTA 1C4KA 1I32A 1YA8A 2XMDA 3I2HA 3QKWA 1Z4OA 2XWJI 3JR3A 4LQ4A 4RPIA 4BFTA 4Q5IA 5LIRA 3SHQA 3A1NA 3PLNA 4HLDA 4GOOD 4DEYA 5K03A 4WQMA 2C7QA 4LGYA 4ZZ0A 1M8GA 2ON6A 4EKGA 3H2JA 4C7BA 1UM9A 2IC5A 3GUCA 3NHPA 2Q41A 1KY5A 2HIGA 4KIFA 3URMA 1EUZA 4AZ3B 2EKZA 3F7MA 4R0NA 3NDIA 2ODEA 4O1IA 2A0UA 4H7IA 4P7GA 5EZYB 1Q95A 4IQ0A 3U3RA 4Y6GB 5BV7A 1ACLA 3ZY4A 1F8FA 1AUXA 4YY3B 4B7CA 1H05A 1U65A 1FYEA 2BDTA 1O95D 4FSXA 3CVOA 5P8WA 5C8YF 2W98A 5ALNA 5AT1A 1J7KA 3HA7A 1NDHA 1U0SY 1ZBQA 3D6FA 4UEOA 1SA0B 5A05A 3M4YA 4PC3A 3CPHA 1BSVA 4MRVA 3PFBA 4BCCA 1M2VA 3NALA 3EZNA 3O5AA 4GE0A 4I50F 1UK8A 2WWXA 1JI3A 1XWWA 4NFLA 4A1FA 2Z8YA 2YVQA 1UC8A 3I1FA 4MQ5A 4PLWA 4PRKA 5DN6A 3T5CA 2CE7A 3ZLUA 3NWBA 2YYYA 5EQFA 1TKBA 4I6EA 1XKLA 1ECGA 3UM9A 1RE0A 5I45A 3UJAA 1EEHA 1SOVA 2Q3MA 3D2CA 2C2WA 1DC7A 5LP1A 2PUEA 5KPDA 1QLWA 4P3NA 3AR8A 3N3AC 4KJZA 1GKKA 1EX1A 3K9NA 1YQTA 3VTZA 1Q7GA 5JNRA 5JSKA 3OCXA 4FOOA 4PG8A 3D6TB 5AK4A 1AHNA 1OBCA 2P6UA 1G20A 3T0GA 4DJAA 1FEZA 5D85A 1CF4A 4G5XA 1VPEA 3GPLA 4Q3CA 2QTAA 3PE3A 5EE9A 5LKAA 2Q5FA 4DC9A 1PFWA 3DVAB 4LECA 3TW6A 4IDPA 3AHCA 5EXPA 4UVHA 3GLIE 1Q17A 5LMUB 5EIHA 2CCGA 2JIOA 4F45A 3HY6A 1FRVA 1AUOA 1UOEA 3EZYA 3IQEA 4FMBB 4K46A 3P8ZA 1PV2A 2W70A 1P4HA 2AHRA 4X1KB 2GNAA 4MUKA 5GMOA 1YZ3A 1ZJ4A 4LFBB 3PQ5A 1ZD2P 4NYMQ 4LYJA 1IQ0A 1X87A 5KVQA 1HT1E 4KQ2A 1A9XB 4FUTA 2RDMA 1Y9DA 2HHCA 2P9YA 4L6CA 4RHYA 2ILTA 3SDSA 4E4TA 3EVEA 3C8HA 4FJ2A 1PSZA 4IDEA 4YMLA 5IMSA 4LI0A 5K6TA 4Q1CA 1IG0A 2JGNA 1K06A 5IP5A 4IHKA 4ZRDA 2HFJA 1GUZA 4Q48A 1MEJA 4YWJA 1D0IA 1N8TA 2PU7A 3EY4A 4LJLA 4M9QA 3RTBA 5TMPA 4ZTUB 4EB8A 3F1KA 1AT1A 1JVBA 3H8SA 5IZCC 1F6DA 2OY0A 2CB0A 2VDJA 2XR1A 3KYCA 1V41E 2NW6A 1VKRA 1NSYA 3M34A 4ZU1X 3B8EA 3CRMA 1RXEA 2D6FA 1MQSA 4RSHA 3Q12A 5DT9A 5H70A 2W43A 3MIZA 4S2EA 2I8CA 3K6KA 1Z4QA 2FPUA 1D2EA 2B3TA 1DELA 4HZGA 3SFVA 1TKAA 1W4CA 5EJIA 3WKBA 4HT3B 4UPDA 3ZTYA 3LY9A 4DV7B 1NXVA 4GT1A 4JI5B 3FD8A 3V7FA 3P0FA 1G4AE 3O8CA 2RIPA 3IXQA 5BOVA 2RKBA 1CW2B 3IELA 3C6QA 3MTEA 4XYBA 3RK1A 4HQNA 3T3GA 1NU6A 2GCPA 1MV5A 1YGYA 3WGHA 1G19A 1R27A 1ZN9A 2I7XA 3QU5A 2OXIA 4F12A 1AGNA 1YRWA 3TKAA 2PBRA 4JSRA 1I3LA 2VK2A 2ZE7A 4RMNA 4RHUA 3M6XA 2AA3A 2QSZA 4RQTA 5FUWA 5E1OA 1HE5A 4Y2JA 5AUOB 3NQ41 5L3VA 2QX9A 1AIPA 2G7MC 2K87A 5BV2P 1AKNA 2I3GA 1NIPA 3DOJA 3NBFA 4JR1A 4AF7A 3EMKA 2DHEA 3ZKAA 3KYIB 4EW6A 4ECAA 1B3BA 3HVKA 2CDRA 1TAQA 2PYZA 4ZOEA 5IT0A 2BM9A 4RZUA 1XPOA 1A98A 4EGFA 2H4YA 5L51A 1IJEA 1BTOA 4LWPA 2W6JD 4L74A 3WYGA 2BTEA 5GY7A 1R6TA 4EL0A 4XFKA 3KUKA 1WD5A 3VI4B 1DHRA 1JU9A 2VAVA 3M5PA 2B30A 1HFWA 1DBRA 3CZCA 3P4YA 3AINA 4N0DA 1ADCA 3LU1A 4P5DA 4X1IA 4LY0A 1B42A 2GKGA 1ETHA 3W5IA 4DADA 1UXGA 3OKAA 2XMGA 3FNBA 1MOPA 2FSUA 3BWDD 1X7XB 3IUQA 5HRAA 2JPDA 4YI5A 2ZRFA 3R6DA 1UDWA 4XTCS 4HZIA 5ARCA 2NUPB 3K9WA 3HC7A 3WTBA 1FFHA 1KEEA 4JZYA 2W42A 2QL7A 3HSSA 2OBNA 4HAZA 3TUIC 4DNOA 3S2EA 1EDDA 1KYXA 3KEMA 1TIBA 8AT1A 4Z8YA 3PE6A 4CUZA 1SGWA 4P0PB 1V5EA 1E9DA 4PPQA 4C6TB 4ECEA 3D31A 3OF3A 1N5KA 1SPXA 3STUA 2ZDGA 3AL3A 4ZAYA 3OETA 2C2KA 1H2WA 3FKSD 4KIGA 2IDKA 4ML3A 5AVXA 3C5VA 3RFFA 3TGPA 1PDOA 4KV9A 2QXTA 5ALLA 2UUAB 1N5RA 2XLBA 3SN6A 2O0JA 1E3WB 3F6BX 4HAVA 1W96A 2Q62A 3N28A 5EVJA 3I0NA 3DOOA 5JWHA 3TIXB 5KYTA 1ZH4A 1H0RA 1EFPB 1UBRS 4BJ1A 1VIYA 2PVCA 2X0DA 1RWOA 1WSAA 3LPMA 3R6LA 4R8MA 4JXZA 2PRJA 5CJ2A 3MCWA 4DMUB 4DCOA 2DQ4A 4QLAA 5JWRA 3GLGA 1RJFA 1VLQA 4K6OA 3BIFA 3ETJA 1RJWA 1CP2A 2HDHA 4RTPA 2FZKA 2AJBA 2B5VA 3E3MA 1JZQA 3MS4A 2C31A 4AZ0A 1XDDA 4RABA 4WNAB 5BQ3A 4IKPA 3QMVA 2PXCA 4BKQA 5GVSA 1MN6A 3WIUA 4BU0A 1D1QA 1WUYA 2AFVA 5JO0A 1L1RA 1ZVMA 2Q9BA 1Z0JA 3G17A 3W9SA 4CDGA 4NOLA 4F72A 3D1LA 5H5JA 1NRJB 3MXOA 3F8WA 5L3SB 1R0YA 2HDNB 1DIGA 1GITA 3V4RA 1JW9B 4BJ5A 1C0PA 1OI2A 3IBYA 4DANA 4KR6A 1AB5A 1VB5A 4EHDA 4QRIA 4U2GA 1ESCA 1N7GA 4D0NA 1IEWA 2I76A 5E6UB 3ITDA 3CLTD 1KP3A 2P6PA 3QE2A 4O4LF 4YROA 2C4MA 1B73A 3IMGA 4UD2A 1JEEA 1W30A 3B2QA 5FTKA 2GBIA 2DY1A 2Y3IA 5K8JB 1Z75A 2QTHA 5EPUA 1QH8B 2Z2JA 3SVZA 5THQA 4NARA 4UE3S 5BR8B 3OJOA 3CZMA 4LJKA 3WNCA 2BGGA 1KI7A 5DHTA 5HILA 5HWSA 4HTFA 4UEQA 1NLFA 2G71A 1MR3F 3IUMA 3O26A 3CJTA 4LRQA 5IH3A 3SIRA 3U1BA 3PLAE 4RQAA 1NJSA 1IONA 1E77A 1JPJA 2WIAA 5AKIA 3UK1A 2JBAA 5JJLA 4B81A 3EXHC 3KQNA 4HNVA 2KI5A 2ZUEA 3FBWA 4ZK2A 1EBBA 1QWOA 1WDLA 1XRQA 1VE7A 2YJ3A 2WT4A 4IRUB 3PXBA 3TBFA 4B48A 3VPCA 1RTKA 1A2BA 1G8SA 1ZCBA 2F1HA 2JAWA 3A6LA 2D5AA 3DW1X 3FZYA 1KZ4A 3BULA 3HXKA 1UUFA 4A6XA 4BO6A 4KPEC 2QU7A 3EVNA 1FYXA 1JDSA 1V71A 4DCCA 3LWDA 4AFNA 1U28C 2ZBRA 2Q4RA 3PFWO 4ZQHA 4KGVA 3SVLA 1RCUA 4TLBA 1ATZA 4YXWD 3M1AA 4B6RA 1YB6A 5DLEA 5HJEA 1PJ2A 4AKIA 1G5IA 2BGTA 4HB2A 5CAEA 1Q44A 5KJ6A 1H8HD 1PRYA 1OLSB 5LQKA 1HNWB 5G4LA 2XLCA 2BKLA 2OO3A 2V4MA 2W2OA 1SC4A 5ADHA 4ZI3A 3HO1A 2CD7A 2FMHA 2WC1A 4TV8F 1IULA 2AN1A 4KLNA 2HEGA 1FFCA 2PUJA 5FH9A 3EIOA 3I6YA 3V1YA 1VLZA 4EHHA 2KE5A 4B7XA 6REQA 2ZPTX 3ABIA 5FEUA 5IJ9A 5KTKA 5CU7A 2PRIA 3SE7A 1EK0A 1H93A 3BKXA 3QEMA 5A4FS 4HGOA 3SJBA 3L5OA 3PV0A 2XQVA 4JJ4A 1GU0A 3PXGA 3QA3E 5HCNA 5EJAA 4HLUA 3ZI7A 2PSHA 5B53A 2OGTA 5DF1A 4YAJA 1VIMA 5JWOA 5BRNA 2GZRA 3OEHA 2FW8A 3KEQA 4QQRA 1QHHA 4KQMA 2EF0A 4UXIA 1JYFA 1HL3A 3PTAA 5IWAB 4XDGA 3E9ZA 2PAAA 2HK7A 1GNQA 2G9QA 3NWOA 1T1SA 4ZZ2A 1F8YA 1R6XA 1PR9A 3H4TA 5D5PA 1JYEA 3OLCX 2J3MA 2HHHB 5CH5A 5JNWA 1HLPA 2GKOA 3VZSA 1S3GA 3KLNA 4A36A 1YCGA 2Q1TA 1RP1A 1JGTA 4X61A 1M6HA 1N7HA 2R8OA 5JCZA 1EE2A 4HEJA 1OXUA 2LTAA 1NG9A 4HYYA 4O3FA 5TQ2A 3TE7A 1W87A 2HJ9A 1DJOA 3AEKB 3AHIA 4PYNA 2F00A 2QRVA 3IH5A 2FOLA 4MAFA 4CCSA 1T1RA 4A5SA 4MRSA 4LNUB 4KQ1A 4RIGA 1I3KA 2J09A 1MJHA 2QL5A 2OZLA 3AXSA 2GNPA 2HR1A 3A9SA 1K5GA 3SIXA 1ZMOA 3DVSX 1WPXA 1HSZA 4QUIA 4U00A 2GGSA 4CT5A 1O94D 1PWZA 4N3AA 4N01A 5E9JA 2LV8A 2IUTA 4HQFA 4PLYA 1GEGA 5D1HA 5ER9A 3X1YA 4D8VA 3INTA 1VE3A 4C0HA 3F0TA 4AY3A 1G4UR 1ISRA 2EGHA 1M1YB 2V9PA 1YZVA 2J4DA 3FYTA 3R8CA 1T3ZA 4FE4A 4CIVA 2EFDB 1OX4A 1UZUA 1M7HA 1G3RA 2BMVA 3E9YA 4IYJA 5HKLA 1CF9A 2WJAA 4TM7A 3AF1A 2XI4A 3L4BC 1BXGA 3W2TA 4G9GA 2QG4A 3BD8A 3QLUA 2R8RA 2NU8A 3F97A 4RU1A 4I9HA 5CLLA 2WRZA 4BTLA 2AEJA 4KHPB 1N6PA 2H2WA 4U9HS 1Y4UA 2C8VA 2A0YA 4MVWA 4G84A 5JAQA 2EJCA 2QE7A 1RWBA 3G1WA 2PU5A 3RYIB 2FFBA 4LVCA 3RSSA 3STVA 3W2FA 2HSEA 2QN1A 2X19A 1P9WA 1NN0A 2CXNA 2WG1A 4NYJR 4O4JF 5CVCA 3SBEA 1AKTA 1D6NA 1NBMD 2WF6A 3GLVA 3SGLA 1UEXC 1Z26A 3DKVA 3T7IA 3DFKA 1GDDA 3DR5A 5AKZA 5JE8A 5K8LA 4P4TA 1LQTA 3D8TA 5LN1A 4RIFA 2PKCA 3KFXA 5ERYA 4F38A 3T3OA 5JCPA 2Z58A 1VCOA 4KZPA 1BEZA 4MAAA 2BBTA 2P1ZA 3SBDA 3TRIA 4N5HX 4CF5A 4AKGA 4H18A 1GAWA 3PJFA 5BQFA 3V4FA 5DM60 4K1LA 2GF9A 2VPTA 3BXHA 1KEPA 1TLTA 4MVJF 3L7YA 4L8YA 1M1NA 5FPSA 2Q1XA 3MWDB 1P3JA 1LV8A 4GSKA 2G1JA 1EGQA 3K4PA 2O6LA 1G42A 3PIIA 1XT6A 4FWIB 4IL5A 4M9RA 5IC4A 1PBNA 3CZAA 1YZTA 5H82A 1TC1A 2V4UA 2JH9A 5K8CA 1KYWA 1EFKA 3BHNA 4RVUA 3AVWA 3IAFA 1PTKA 3FRHA 5EHIA 4K3UA 3JQQA 2VQFB 4MWSA 1ESZA 2I7CA 4ZI7B 3S8YA 4HZUB 2WE8A 2YWRA 1Y3IA 1ZUD1 1FRZA 2O3JA 2PEYA 1XDBA 2XTZA 3HCEA 4H6VA 2QKYA 4L5AA 4Q1BA 4UHFA 1LH0A 4QO7A 1B8VA 1LVUA 3L46A 3UY4A 4RVGA 1NA5A 4WCFB 5KNDH 2GK7A 2V96A 4LBVA 5DASA 2Y1XA 3SQLA 2XDAA 1C9EA 2CMGA 4HNQA 4IJMA 3V46A 2FYTA 3SM3A 4CKBB 4YB8A 4FDUA 1RW4A 1S1CA 3AGQA 1IB0A 1NRWA 5HTKA 1CY0A 4ZEOA 3LV8A 3L8CA 2I6QA 3KOUA 2IL1A 4HN4B 1MD9A 3ZJUA 4UVEA 3M83A 4O0MA 1Z6YA 3SBXA 2VSNA 2MTBA 3L9XA 3TH5A 3QGMA 4A2CA 3J80A 4U7TB 3M4ZA 2Y6VA 2Y77A 3PDWA 3EA0A 2GWHA 5HS6A 3KQLA 3FTNA 5L3RA 1GGMA 3K3PA 3ABSB 3IBSA 1FNSA 1M2OB 3H97A 1V3TA 4O2AF 4D57A 2JHGA 3A1TA 3ABOB 4I3GA 4MWZA 1IN6A 5B1IA 5B55A 4QA9A 4EY8A 5HZGA 1YZFA 3N2ZB 4QELA 2J9ZB 1PR0A 4K9RA 2FXIA 3N1UA 4PONA 2ONKA 2XYVA 3C5CA 2ZP1A 3I92A 4AZ3A 1K5HA 3IAM6 3LH5A 2C2OA 2YL2A 3DP7A 1ZOIA 2CDNA 5EKUA 5LMZA 4XUCA 1T10A 4OJKA 4AXXA 3L8EA 3ZCVA 3D7LA 5MFPA 3R40A 3DTTA 2BSXA 2O7SA 1J20A 3I5MA 2UZ1A 3R0ZA 4ZODA 2K2QB 2W6MA 1EHIA 2HPHA 3CZ5A 4E12A 2L69A 2IU6A 3AVTA 3TLAA 1G5RA 1V48A 2JCSA 4XJXA 1XTTA 5LLDA 4NH4A 4RZHA 1UDCA 3UH0A 4F11A 4BQIA 1H9CA 4XEHA 4U7PB 5BQPA 4F3TA 2QUKA 3DDSA 5INTA 1BX0A 2BZSA 2F3RA 4YCNA 1ZAYA 1SUAA 5H1YA 3EAQA 2P1DA 2PS0A 3NUQA 5DM70 5DN6D 3B1KA 4O4JB 1Q7EA 1I7LA 1OXMA 1YR2A 3R3VA 1CUIA 3W4KA 1GQYA 2ZJYA 3G2QA 5TLSA 2XMCA 5ELLA 1D6SA 2RC5A 1XGKA 4OHMA 4DQDA 4KFSA 4OXYA 8ADHA 4L9AA 3RHFA 2Q29A 3IEPA 5B12A 1X8KA 1XTBA 4LWZA 4JGIA 3OQNA 3EWIA 3I1YA 2YOGA 2OPHA 4RQUA 4F5YA 3TQSA 2Q49A 4PGGA 4NH0A 5C9ZA 2X7HA 2OD2A 2XSZA 4M9ZA 1WCWA 4Z0TA 1ZWKA 1PDWA 2H3EA 3HI4A 3RSGA 5IAOA 1J5PA 3KVYA 3I6QA 4MTCA 5H83A 1LS1A 2PH3A 4HH0A 4I3FA 1N2IA 1NVUQ 4OMFG 5DWVA 4ZVPA 3TB4A 5KNCD 1P5HA 3OMXA 1GKYA 1XROA 3MN1A 4LV6A 5TE9A 3ZDXB 1Z8DA 2O7RA 4QSHA 1RACA 2AG0A 3AF4A 3B9QA 1ESEA 3LWZA 4J0CA 4JI6B 3ZCRA 1YV9A 2I8LA 3VDQA 2F8MA 2QQEA 3W5AA 2VHCA 2W6QA 3OUUA 2ZI5A 4M8NE 3PICA 4RY2A 4E2XA 3R0VA 3NHJA 1THZA 4GDMA 5F3RA 2CB9A 4ZOLA 2WWWA 2IXBA 2IU3A 5B1DA 3PEWA 1RMTA 1KS2A 3TVDA 1YTUA 2PAFA 1XN1A 2XITA 2E4ZA 5ALZA 3OZEA 4Z1OA 5FV4A 1EA5A 4D26A 1ULTA 2VUHB 2QA5A 3INGA 3DOHA 1UBOS 5IJZA 5G0UA 1KH1A 1VLJA 2NYUA 3NIWA 2ATCA 3NWJA 4GBJA 1XEAA 5FL7A 1ZM2A 3ZKWA 4A8PA 4F97A 5BV0A 4JV5B 5IVHA 5KOIA 3I0MA 1GY8A 1LC0A 1VIVA 2FEPA 1XJCA 2I78A 2P9QA 2ZRAA 2ZITA 1YCDA 3QWBA 2XADA 2ZDHA 2ZRDA 3S70A 4TWZA 1RE1A 2WIBA 5EWMA 1UPAA 2ZJ3A 4O2BA 3TBHA 3H86A 2UKDA 3GIWA 2J1LA 4DB4A 2RFLA 1J99A 3PCRB 1DSSG 3FDFA 2QRQA 3QVTA 1WU8A 2VDNB 4ZYUA 4LHVA 5EMJA 2RG7A 1NDUA 3NC4A 1ST3A 1T9CA 1Z33A 4RVFA 3WMXA 4A2QA 2Q6LA 3WLFA 2JD0A 4NBLA 2CEAA 4YJFB 2R0QC 3N0RA 1RKXA 3AJ8A 5E2AA 3WP1B 1ACJA 4PM4A 3MWFA 3AEUB 4HWGA 4Q9HA 3NI2A 1IIBA 2G0TA 3QELB 1YB2A 3QLTA 4EB6B 4ESEA 4LHSA 1CJVC 1JHXA 4X7RA 4MRMB 2QJTA 2FJPA 3SDZA 5AK5A 3T6KA 3AFGA 4PF1A 3UG6A 3TMAA 4LKOA 1YR9A 3B1FA 3B1JA 4XQGA 4CKCA 4TUYF 3HNRA 2XVAA 2RG1A 4Z9YA 2QLFA 1GGVA 4KXNA 3DO5A 2JGMA 3H9GA 4NECA 4V0LA 2FZEA 3JWIA 1E9VA 3BJEA 5HS4A 3HWX1 5K0CA 2A58A 4QTTB 1VMEA 1N6IA 3LKVA 1MDBA 2WMYA 1KFEB 1HFJA 1E5TA 1GQSA 1E66A 1QIDA 2HB6A 3C3KA 1PJ3A 1T24A 2OCKA 3MWLA 3UBTA 3K0FB 3HLYA 4B85A 5ES3A 4JYZA 2DLDA 5KSPA 1I7PA 1N9ZA 5BYJA 1ZR4A 2QMQA 3DHVA 1IUNA 3QFRA 1W85A 3K5IA 4UEJA 4UM7A 2IUYA 1IVYA 3ENWA 5F64A 1CR6A 3TKYA 4A26A 2ORIA 4ADSG 1XRMA 3KHKA 1CERA 4W7IA 4NATA 3RUFA 4OOEA 3DDCA 1YRYE 4R2IA 2IZ0A 2GAAA 2HNKA 4II2A 5A4DA 3E1GA 5G41A 2MR6A 2MT9A 4DSTA 2EFGA 3ENKA 3T7TA 2QPTA 4QBFA 1DTSA 1GPJA 4Q1AA 3JYOA 4LBZA 3CJQA 2MSWA 2FUCA 1HYQA 4MUXA 1SXGA 4WFKA 1J8QA 3GRZA 4YRPA 5LJLA 1YQGA 2ZPAA 2ZUWA 3QVVA 3HYLA 2W6OA 1GT91 4M54A 1OVGA 3LXMA 2O2YA 4BZPA 3OTOB 3ER9A 3HGMA 4B35A 2G07A 1WUHS 1U6JA 1MAWA 3HKCB 3MTGA 2G8NA 4KV7A 4KFCA 3OFKA 2BKXA 3EBPA 1EKXA 4CIYA 4NDNE 3QMMA 3PGVA 4TV9B 3GLRA 2R5NA 3KSDO 3S1AA 3T1TA 2EFEB 1BD4A 3BFPA 3EVGA 3V7WA 2Z95A 1TJPB 2O3SA 2IU4A 3CLUD 4FFVA 3TUZC 2CVQA 3DBRA 4V1CA 1T9KA 2R68A 3USES 3B7WA 3DEAA 4NBWA 4OH1A 5FLKA 4ZC8A 3RQSA 3WDLA 2ZJ0A 5IDXA 1L4YA 3I9KA 2HD4A 4ZXPA 4KSCA 2HSWA 2CHFA 2QYHA 2ZYVX 3HBMA 3KE8A 4RF4A 3ZQUA 4XKJA 4BXOB 2QT9A 1K2VN 3VVLA 4DCUA 2PUAA 5BR7A 3FMPB 3QIVA 5L95A 1IY1A 1VFNA 1LK5A 3VYTB 2QORA 4G5GA 4X20A 3SZUA 3HO6A 3LQFA 1PQYA 5FHQA 4W9RA 1Z4IA 1FP7A 1PUIA 2ZSIA 2RI1A 1ZVKA 4GAEA 1K88A 1YAJA 4B3JA 4D99A 5DGCA 2V7GA 2Q8NA 4HFJA 1EXDA 3HRKA 1ADBA 1VP9A 2ECKA 3PQFA 1L4KA 3IUEA 1DL5A 4US1R 2MYPA 5P21A 4DBLC 4XWKA 2GH1A 3NHSA 3HDHA 1O58A 4TWRA 3F74A 2GVZC 5KTYA 3CWQA 3WZLA 4CL2A 2YC4C 3FHJA 3A3PA 1AHPA 4RHCA 1MA3A 3K72B 4UCWA 2NNLD 2YZKA 6Q21A 2EZ8A 4AMGA 4NMWA 2W2KB 3UOGA 3GRCA 1RWKA 5BO5A 4I4LA 3QBVA 4ZJZA 7GPBA 1J7JA 5CDUA 1I36A 1P4JA 2I0FA 2Z83A 4DQVA 4KE9A 2XE6A 5B58T 1UBUS 5MN6A 2VJQA 2X86A 1H2BA 2I6UA 4EPRA 3GC6A 4KWTA 4TUYB 3HVIA 1I10A 3QSGA 5DRTA 5ILOA 1FNBA 2VYQA 3GEGA 1QGAA 4GKBA 4CEIB 2AKYA 4DSZA 4HXFB 3F46A 4ARIA 3DZGA 3HDJA 3ANSA 4OSOA 4Y2QA 1QHSA 4LRWA 5FBWB 2IITA 1I6LA 3H18A 1I0ZA 1RBYA 1PFUA 1RCTE 2PYDA 2YWDA 3OQIA 2E4WA 1ZW1A 2GHRA 3THOA 5K09A 2V98A 3EXEA 5DDIP 3ONWA 4Q00A 3RTAA 4GZLA 1C0EA 1EVEA 4X3PA 1EINA 2HA4A 2PSFA 5I7HA 1U3TA 1OR8A 4P08A 4YJ3A 1DX6A 4H60A 5HF9A 3D4PA 1IQUA 4OBEA 1WEHA 5C5DA 1WNTA 5JR3A 3DUWA 2OFFA 4QQNA 3VO2A 1A8PA 4Y1RB 3JASB 1UFKA 3L49A 1A04A 2JZOA 4C89A 1OLUB 1U1FA 4LJ4A 3OEWA 1BAPA 2CF5A 2DWUA 2PN1A 2OCYC 4KXYA 3F78A 1T26A 4X00A 3V8PA 2PO7A 4Q7LA 1SAYA 4QWMA 2R5FA 1BC5A 3CGWA 2JLRA 2IF2A 1JR3A 1NXWA 3HR7A 2VPXA 3HYSA 2CZQA 4JCCA 4U0JA 2C8JA 3CF4G 5BMOA 1HDRA 3PHJA 2H07A 3AHGA 4CHTA 4KPYA 1FYVA 1LLDA 4PNPA 4CODB 3U4CA 1KVUA 2JEYA 2WQ6A 1UOOA 2CF6A 1SM4A 1YHNA 4MYDA 4Y9UA 2GLTA 1SCNE 2HMYB 3GEHA 3WMGA 2IYAA 3ZWCA 3WKAA 4BWFB 1GAXA 1T2NA 2CW5A 4DLRA 3V7UA 2XKKA 4B80A 3B9BA 5BNWA 3AUYA 4G5SA 4B79A 1R5NA 2N47A 1HZZC 2SCUA 2ZJ2A 5K0ZA 2R1VB 3ICWA 3SVTA 1QHGA 1RQ2A 3V48A 4RKRA 1NXQA 3OZ7A 4FLFA 1KSGA 4HX2A 3HH8A 1IN4A 1XVVA 3PC8C 2QE6A 3E22B 4IXTA 1JQLB 1QFMA 2ONZA 2BRUC 1MIOB 5BMVB 3E23A 1MNAA 2C61A 1XQ6A 2AS0A 2VIIA 1SC9A 4GMFA 2FDRA 3OEHD 4BN0A 1C80A 1UJ6A 1MT0A 2D62A 4WXYB 2AL7A 4HBGA 5BSMA 1EWTA 1F17A 3VHQA 5HQ3A 2BT4A 1QU2A 5C8ZA 3BWEA 1HUQA 2I4MA 5HQJA 2H59A 2C83A 3ZGVA 2EP5A 4KH1A 2BHSA 2O2IA 1N9GB 4L7QA 4ZT3A 4RK5A 4EFLA 3TDKA 1W5EA 4MZXA 5IVPA 3L7AA 2FN7A 4G37A 3PI6A 3HKEA 4IDNA 4B7UA 4K9PA 1J2TA 1JLRA 4ND8A 1YKSA 2W8ZA 5EUMA 2CFOA 1PZFA 4KACA 1H65A 2A7XA 1KZ6A 2ODWA 2XV1A 3K0HA 2X2FA 4H2DA 3UMVA 4DWJA 3JCZA 1CJCA 3BFVA 3V3KA 2SECE 3ZH2A 4D6PA 1Z5UA 2VT6A 3FOZA 5TSDA 3DB1A 3L79A 2ZJ7A 2O48X 5T3YA 1Z34A 3PEUA 3BC1A 3UMGA 2BGLA 1AU9A 4IWYA 1NQXA 3N2LA 2IX3A 2WNIA 3WTCA 4OH7A 3H7AA 5C5EA 2WJPA 1OYVA 4EVQA 2UVDA 4JJGA 3CPEA 2LDBA 1NV9A 1RHKA 3OUTA 3OPMA 2QZSA 1CEQA 2FPPB 3B12A 4AWBA 3MSXA 2NQ8A 4EUNA 4UU8A 1D4ZA 3RWOA 1X80B 1ZUWA 1IHUA 3HJNA 4RV5A 3WB0A 2C4KA 3I30X 3PEVA 1AQJA 2H5JA 1YS6A 2ZI9A 3CCCA 3PD1A 3RYTC 1FQWA 1JTEA 3Q4GA 2C7BA 3DLBA 1JV2B 1MAVA 2DFVA 1TJ3A 3G3EA 1H4VB 1VJRA 2EYQA 3U80A 1KI2A 3BMXA 3LQRA 4XXHA 4XA8A 2YJZA 2IQ5A 4LOHA 3EH2A 4M21A 3HGTA 3U0BA 3BGIA 5FUMA 4ZD6A 3FPKA 1B16A 2W2LA 4OXIA 4TTJA 2IUFA 4L02A 2GN2A 1F6WA 1FLVA 1G2PA 4N5DA 4E2FA 3SYKA 1JTFA 4U2BA 2HUPA 5DWQA 1WMBA 1N8SA 3F7NA 1Z39A 5A3SA 1L4HA 4O1MA 2QE7D 1CVIA 4W5RA 2XCRB 5CD1A 4DDUA 3A6PC 1RPJA 5FBVB 3WGJA 3OTQA 2XOEA 3C7CB 1QHFA 3QKRB 4E21A 1NYQA 1NQVA 5ERGB 2Q9UA 1KNQA 3LF1A 1MB0A 1GUYA 1J97A 2Z5VA 4X93A 4Q05A 1CR2A 3QFTA 2ASVA 3DG9A 1W6UA 4GGPA 5K0LA 3TIGA 2GRJA 5ER6A 3OD5A 4UTPA 5KWJA 4NCAA 3KKNA 1IXZA 3BE6A 1D6JA 1TE2A 3AWDA 5HBGA 2G8LA 1E5VA 4MKFA 1TTQB 3IQXA 1NNEA 2WFZA 4P4NA 4CNBA 2PWPA 1IBCA 2JK0A 1YMUA 3EFBA 3JD2A 5F9HA 5EXDA 3CN9A 1QIKA 5DVZA 4YJHA 3EE6A 1T1EA 4X1OA 4GI1A 4ZT7A 3ICOA 3I12A 3DDWA 3QVLA 4FHGA 4YV1A 1X42A 3B85A 1M8KA 2HQSA 3DBHA 3M81A 3Q3EA 1EH5A 2XKBA 5ENVA 3ZN2A 2OCDA 4DMFA 1M7BA 5KOHB 4KSBA 5HSGA 4M8LA 2IXDA 1WW2A 3C3PA 3G8BA 4E5KA 2C59A 4D9KA 5GADl 4LKRA 1OQAA 2AR0A 2P9TA 1CB7A 3OM8A 1MGOA 5ALIA 1P2BA 2GCGA 2ESRA 4DR3B 2EARA 1RYDA 2PUVA 4A5OA 3O84A 1C4WA 3GH1A 4YDQA 1XYYA 1L5GB 2BKUA 5C8DA 1L7OA 1TD1A 1Y6RA 3JW8A 3JWEA 1ODCA 4B8YA 4BX9A 3KXIA 3ZE9A 2A5YB 1H6CA 4WKGA 4C03A 3C5WP 2FGJA 1OMOA 2ZQZA 5HF5A 2ZRPA 5H3CA 1RPTA 4FN4A 4DL9A 2IS4A 1R74A 1DAFA 3GVHA 3TJMA 4BBJA 3FTCA 4RS4A 2B6NA 1FY2A 4X3CA 5I7EA 1E64A 3KTFA 4OGLA 3TIFA 2CSUA 4ACBA 2PY6A 1OWPA 1B74A 3BWXA 1SB9A 4ZN6A 3C5HA 3ICEA 2BFOA 4D8WA 3A58B 4I55B 4UEWA 3KTDA 1WX1A 3WL3A 3CX7A 2AFHA 4IFIA 5B7QA 4N3BA 1ZVVA 2FCRA 5CVUA 2X2EA 4CCWA 1XEXB 4KCGA 3LX6A 1C1YA 1HYHA 4OQNA 3KQTA 4PVDA 5L7YA 4PTYA 4ZIRB 3L6RA 2ZS8A 4FFLA 3ZOZA 5EMHA 3BXFA 1FF9A 1A77A 4GZ5A 1V3VA 1IRIA 2ZIZA 3FOAA 3OLZA 5KYWB 3ZHUA 4ZVKA 4C3OB 2NYRA 4HXEB 2D7DA 1JMVA 1ZWLA 1K6XA 2X9NA 3MTAA 3Q8XB 3WYEA 1A7UA 1H0HA 2VP9A 3OX2A 4GOMD 3TFOA 3I5XA 1YI0A 3OE4A 4YO8A 2QVBA 3G9XA 1Q1BA 2QLNA 1IK4A 3FCXA 1RXWA 4J16A 1R6UA 4HAIA 1FTNA 4KMOA 1IDN1 3UIEA 2FLVA 5KKNB 1NNI1 4X0EA 3J81k 3TINA 2OBFA 4OFBA 1XJ5A 4AS1A 2EJBA 2NUBA 5CIYA 3FVTA 4EI9A 4PZ0A 5EIOA 5DO9A 5BN5B 3G02A 4EFKA 2HJVA 4DJJA 5L4LA 1UPXA 3PS9A 2W2TA 1HRKA 1HDZA 2HCBA 2I2DA 1QF9A 5J4LA 2Y1GA 4EKNB 4DREA 3D7MA 1KQNA 2YXEA 4HAUA 3BBPA 4E03A 4KW7A 3DP9A 4DA9A 3JQCA 4CETA 3IQWA 2JLAA 4L8WB 4F2WA 3ETGA 1KA9H 3M89A 3G8DA 1PFQA 2X13A 4GI3A 4B31A 1E3MA 1VJ5A 2J0SA 4MRAA 2IA5A 5TJHA 1TL7C 5JMOA 2GBLA 4E7PA 5HA5A 5BY2A 4NAHA 3GEIA 3LGSA 1NHGA 3H9QA 3WDSA 3PLRA 2FSHA 5FOUA 3T3HA 3KSRA 5DTRA 4GX1A 5IX8A 2Y6UA 2OWEA 5JHHB 2E49A 4ND6A 3DTVD 2X5KO 4YUWA 5K3AA 1D5CA 1GVNB 2X4GA 4BLSA 3ZNNA 1TM1E 1TPZA 3GJ7A 4ZQFA 2AXQA 2QJRA 1ONOA 3LZCA 3TGLA 2OFPA 4OI4A 4F8EA 2CNKA 3BUSA 4B33A 2OC4A 4BVKA 3CR3C 2BR3A 5E1DA 6NULA 1DQNA 3I3OA 4M89A 4U9IS 3I64A 3FNIA 2Z8XA 3OPVA 4ZQGA 3U1VA 5FOTA 1NJ2A 3BQ9A 3GDWA 4YT4A 4KITB 1YRQA 3PQ8A 3TYXA 5K0NA 2WZDA 3WJ2A 4E5MA 4YV0A 3G2HA 2H7VA 3ABZA 4R5HA 4MHTA 3S5UA 4HH4A 2XCIA 4FQ8A 2R4TA 1D2RA 3X2SA 4CQLB 5GZ3A 2YZGA 3DO6A 1E3DA 4KO8A 4MIEA 5ISMA 3FHTA 3BMOA 5C1OA 1PX0A 2WV7A 2NX2A 2I87A 4JT9A 4ENUA 4AC9A 4E5NA 3DEKA 2I6FA 4FFDA 4EJSA 1HE2A 4GIBA 5REQA 2RHTA 4NESA 3BFJA 4II3A 2HU5A 1HQKA 3U37A 1VJDA 3BQNB 5BV8A 1RLOA 5FL7D 2COEA 1B0ZA 1TVKB 1NF9A 1G8PA 4GGMX 3WMFA 2X23A 3JQGA 4U3JA 1SQ6A 2OBLA 5JYDA 2IYXA 1QYDA 2N3ZA 1JB9A 3PE4A 4E33A 1C9KA 4RVNA 4TT3D 1NVTA 4OL0A 3WK5A 1N2HA 3NGXA 3R9WA 4CNQA 1WB5A 2BFAA 5CCEA 3P0RA 4EA9A 2G4CA 1GZVA 1OC2A 4H3VA 1BQEA 1T4DA 1N1EA 3KD2A 3L7BA 1C1XB 4IF4A 4OM7A 4B83A 2C99A 3CFYA 5KNCH 3KKOA 5B3JC 3E9DA 5HUHA 4OAQA 2YV3A 1V1MA 3GA7A 3LP8A 3P9YA 4MS1B 5J1TB 2XUJA 4MUMA 4Q18A 1QP4A 4F6LA 4FNMA 4TYWA 4QXRA 3ZD6A 1R0BA 3NONA 3HLKA 4PFKA 1JSLA 4PICA 4UUBA 4DC1A 3W3AD 1PV4A 3L06A 3L8YA 1PJCA 1ORTA 4MA4A 4CR7A 4R5MA 1Q83A 2J3EA 3HJBA 4RKWA 5JJ5A 3KL4A 1G21E 1R9NA 4HNHA 2GBGA 3STHA 1XLWA 5CD9A 4QODA 1GL9B 2BIFA 4A2PA 3ZDCA 4FBMA 1R6AA 1D2CA 1O6ZA 3IPCA 1LPBB 4J1TC 5B3KA 1GQ2A 5F5NA 1A5AB 2X7JA 4UQLA 3IJPA 3FNRA 3CPSA 3LY7A 4K3VA 5KC8A 2O5CA 5J4HA 1HE8B 1YS7A 3PT9A 3GLSA 4GE3A 1YKGA 3D6AA 5JOQA 5H3LA 2I3BA 4WIAA 3BK1A 1BVYF 2XHEA 3EUWA 3E9RA 5FKJA 2QN2A 3GMTA 2EZ9A 1QNLA 3JALB 1RKVA 3GLTA 3R4VA 4FYIA 4MV0A 4EI7A 2LW7A 2VNSA 3RFVA 2AT1A 3IHWA 3ER6A 1QANA 5EKXA 4PYIA 1YQUA 4WSOA 3JWGA 3P96A 2WTBA 3Q9UA 3T34A 4Q34A 4JFAA 2JCVA 3B2EA 4XVHA 1U2SA 5FR2A 4CKEA 3GJ3A 4EW3A 3C1OA 3TLBA 4NBRA 2L42A 4OQMA 1DE0A 2AHOA 3W7AA 1YXMA 1NM5A 1RXYA 2Q0XA 1XCOA 2PT6A 3JQ7A 2BEUB 1T5TA 4LNAA 4PIPA 4QQFA 3WDKA 1UWVA 1TUBB 1XZLA 2XPCA 3CRRA 1Z16A 4GP7A 4C0WA 4F6CA 4LYGA 5K3OA 3AKDA 3WOHA 2W0MA 1JQKA 1OI7A 2C2ZA 4QULA 1ZSNA 5EY5B 4IEIA 5FIUA 4I8DA 1EX9A 1U3VA 1IB6A 5DZSA 4DSNA 4BO9A 2D59A 3H9BA 3KAPA 4AN1A 3THWA 2CXTA 3PUYA 1KVQA 1TQ4A 5A9RA 3TDNA 4I1SA 4BP8A 2MDTA 2WNHA 1K0FA 3DBIA 4HD8A 1BQ3A 1EFVA 3NGMA 621PA 4M1YA 1BMDA 1V4NA 4GSYA 4KZKA 3CVVA 1GT6A 2YJ4A 1BWRA 4LXUA 4C08A 1DV2A 3WSWA 1R18A 1YJ8A 1SXJD 2IYQA 4ID9A 1AZWA 4O4HA 4TRRA 4BV8A 3JQRA 4D97A 1XB2A 1GTJ1 2QWXA 3B13B 3AERB 1BQ4A 1K4KA 1IPHA 4AY6A 1BRTA 4R2XA 4CZ2A 1DKLA 5BYAA 2XWSA 3DFIA 4ITUA 2R85A 4WK0B 4YRBA 1PG2A 1IZYA 3BE8A 2BY4A 3NC0C 3ECSA 4JHXA 3C45A 2QBYA 4TLCA 1BMFA 2YV2A 3G8CA 4GICA 4AM8A 3K94A 5SZIA 4BNDB 3ASYA 4EZIA 4OHYA 4PE5B 1JBKA 3N6RA 3IS3A 3GDHA 1JVNA 3SC2B 2QN9A 4WFQA 1JQ5A 2IE8A 3UWMA 1P60A 1OOEA 5LQSA 3UXYA 3WI7A 4FFSA 1RXSA 2VHWA 3AY0A 4MV9A 3E7DA 2HIHA 3FGZA 4DXDA 1BOOA 4J0GA 1KDVA 4Q9JA 4TTIA 1WHSB 5B30A 1FJHA 4ZT2A 1JFFB 4G0VA 2CV2A 4AXBA 1U8AA 5HF6A 1UWKA 4M46A 2YHAA 3GJYA 1QCCA 3CE6A 4LE0A 3VYWA 1Q3KA 5C1DA 1RFGE 2DG2A 2I6XA 2MSNA 3A3YA 3SC6A 4FDVA 4P4SA 5TPWB 1ZC4A 3PQDA 3MCZA 4QAJA 4GMKA 4YQEA 4YQFA 2WF8A 2POQX 1I3MA 1RJ9B 3IVAA 4UHJA 2UAGA 1YIAA 3RRFA 5CLJA 1L7XA 3M4JA 2CHVA 3NVAA 1ISMA 5JPIA 2NUTA 2GTIA 3UB2A 3MQFA 2PX4A 1CNMA 4TQUS 2GN0A 3KZMA 4C7OB 5LB2A 3RU9A 2L17A 4E09A 1FTSA 4PYOA 4R40A 1TA0A 4LZNA 4ZDJA 2QNRA 1LVGA 3IIKA 1NONA 3SQNA 3BXXA 2O9JA 1KC3A 5FV7A 3SC4A 2XUIA 1AHHA 2X1HA 3FHOA 7AT1A 4GYJA 1XHEA 3CW2A 4DCJA 2XOKA 3RS0A 3TSWA 4PTZA 3OX4A 1PWXA 4B4OA 1RVV1 4OJTA 1L7BA 5EVCA 4DJTA 3QYPA 2VJBA 5LZ9A 3SX0A 2IDJA 1BIFA 1PK9A 2QN6A 5HG0A 2IV2X 4C0BA 5HZKA 1XLTC 1P1KA 1PGJA 5JQGB 1HRDA 3EPJA 2W2MA 3OU6A 5JANA 4OQ4A 5LSAA 1IZ7A 3Q88A 2H92A 1M66A 3PDUA 1J4AA 2IBTA 3QKSB 1EDEA 3TRKA 3VO1A 3EZ6A 3CX6A 1O97C 1VLMA 1P72A 4B9AA 4D92A 5BORA 5JAHA 1C1DB 2WZQA 4PAWA 1PTJC 4CKXA 1VTKA 2EOAA 1I80A 3A0RB 1SVOA 3T9EA 3KX2A 2GUWA 4UARA 4D8XA 4F3YA 2EW1A 3O4HA 3PBKA 1VSBA 1TO1E 2EBHX 3FJOA 4KR9A 1GG2A 4JJKA 2CUKA 5IUNC 4A03A 1XC7A 2OD7A 4PZYA 1TFUA 2FN9A 3WX0A 2WYVA 2UV8A 1I6MA 4WACA 1FFDA 1EUDB 3DE5X 4B45A 3RTEA 4IDFA 4K87A 3DXZA 5EZYA 2R44A 3G89A 2B99A 3ENVA 3H87A 2ZJ6A 3OJCA 1RXUA 1MTOA 1ZMBA 5BRJA 4HDMB 3BRSA 3BDAA 4E13A 5K6AA 1WF6A 2RAPA 4GGOA 2WA1A 1SA0A 3ESQA 5TGTA 2WWIA 4GFDA 4JENA 1S6YA 4PNHA 4U2DA 4E22A 2GK3A 3OZWA 1SCKA 1I6WA 3DE7X 2J9FB 1QQ6A 4PX5A 1J33A 2FZLA 2JFNA 3S68A 2R66A 4CLOB 1GGEA 2XTNA 4YDSA 3MWKA 3IMFA 4B3XA 1SN7A 2ABWA 3ENZA 3IAS1 1XTPA 2EGGA 4COKA 4CGYA 3KYJB 1IWOA 1EFUA 1UWCA 1T6ZA 1EWRA 3PSHA 5LQJA 2C95A 2QN7A 4C4TA 5B7GA 3K0CC 2IYRA 2ZU6A 1XX6A 3CH7A 3N5KA 4UTXA 1E4YA 5BRAA 1I4LD 2QGNA 1E9CA 4A16A 1SD1A 2YXPX 3PX3A 1QKJA 3PA8A 4QXOA 3S0JA 1VYHA 1X38A 2ORYA 1NUPA 4ZQIA 5TPZA 4D3XA 5L3QB 3V2IA 3SY8A 2Q3FA 3FA2A 2MSEB 3GRVA 3LT1A 1LJ8A 2ODTX 2J4CA 4DA8A 3AEYA 5K0SA 1QSGA 3PC3A 5J3JA 3DVAA 4PX3A 3NXKA 3WG9A 3WICA 2AC4A 4Z7QB 4MULA 3F98A 3FDJA 5IH7A 2GTPA 3EFOA 3GY0A 2I2FA 4IY1A 4JH0A 3ZIAA 3VOBA 4RA6B 2WMNB 3AETB 4PYRA 1ISSA 2JAUA 4IFBA 2W2LD 4INZA 5AXCA 4AMBA 1A9XA 3RRBA 4G0OA 1PYOA 4OAPA 3I9OA 2B98A 3FB4A 4OV6B 3C6ZA 2VNJA 3PHLA 5GGYA 1NVAA 2ZR9A 3DZHA 5F33A 3ZYZA 4C06A 4F7DA 3CZ4A 2ZB3A 4FGSA 4D45A 1K8YB 2OV6A 2OV8A 3GUVA 3K8QA 4IIJB 1YB1A 5EIWA 1T9HA 4GXRA 4EG1A 3AEZA 1P5RA 2Z3ZA 4YMIA 5FUQA 1F60A 3OCYA 1OYWA 1USVA 4A8JC 3RAEC 1DDIA 3EXHB 1Q3HA 3RIYA 4NDAA 3GT4A 2TRSB 4GEKA 5BSRA 4FZJA 4JNKA 1JF8A 1VSVA 1JMKC 2G3YA 3KT3A 4TTAA 3T1VA 4EG5A 4K0RA 1LLQA 1B6SA 1GZHB 1L6IA 1PG5A 1ID1A 1RWWA 1CUZA 1YASA 2GDZA 1E1DA 2UUCB 5AFSA 1DUVG 5JAPA 1ZM9A 3SZRA 2FLKA 4UOEA 5AM3A 3UWKA 3OI7A 1P77A 4XLZA 3Q72A 1IHYA 3FZGA 1G38A 2VUSA 3A4LA 3OLYA 2XVMA 3G59A 1NXTA 3GP8A 2Z9BA 5JC8A 4ZHQF 2ZIWB 5DXJA 1KFCB 4G0QA 2FPGA 1OWMA 1GSIA 1VL0A 4OXRA 4DT1B 5EPEA 2WU1A 2ZUCA 5CFOA 3K53A 1JJAA 4JCOA 4Q7EA 5JSYA 3L7LA 2WILA 4YCLA 3HEBA 3TRJA 1XCMA 3JPYA 5B4UA 4LX8A 1P4GA 4NULA 3BA6A 4BECA 2VQEB 2Y9MB 3WNQA 3BK7A 4PXYA 2PXXA 3NEAA 2PH1A 3NEYA 2AZXA 3KZCA 5H4GA 5U1PA 4JLUA 3WSTA 4YX9A 1TAUA 4HJRA 3Q2OA 1B7GO 1Y1KE 2X58A 3B82A 2BHNA 1B0AA 1SBZA 2O07A 1UWLA 2OHGA 1U8ZA 3HCBA 4IDBA 4MGIR 3FOEC 5DI3B 4IGEA 2V7QD 2QVYX 1YUNA 3O1IC 1SBTA 3INNA 5BWMA 5IKPA 3JRXA 1YVDA 3V00A 3QU4A 3QV1A 5JH7B 1KU0A 1O54A 1ECJA 1BKYA 3LCJA 4JI0B 4GYWA 1M2WA 1DIHA 2C29D 4MHOA 2E4AA 3DOCA 3TRDA 3AM4A 3H8VA 3DFFA 1JJFA 1X7XA 3AEXA 2PX0A 1PZEA 3SJ7A 1U2DA 2X22A 3ZHCA 1VMAA 4GI2A 4RVSA 4FZVA 2NUPA 5HUQA 5KU1A 3NLLA 4QDUA 4F9GA 4FXPA 4XM1A 2F4VB 4B8ZA 1IWPB 4QU5A 1PSDA 2OM2A 2AJLI 3H19A 2UYCA 1JQAA 3CUVA 3VHXA 1DKOA 5CW2A 3G0HA 5JSUA 5JNUA 5K3DA 2EW8A 1IXKA 3PNBA 1Y6ZA 1YK0A 1P4SA 4C6TA 3A2LA 1GO2A 4MQFB 4UJ5A 2DLCX 3O6VA 3Q9NA 3LFTA 3BTUA 2ZZKA 1KO8A 3NVMB 1II0A 1Z6GA 1Z5ZA 2G1KA 4L1KA 2B9EA 3NOXA 3WQQA 1E4EB 2I71A 2FF7A 1ISPA 3QVSA 2GF2A 4TMYA 1DJLA 2IYOA 1ORHA 3G6KA 1RXVA 2VJDA 4IDHA 2H54A 1E3WA 1FNCA 2PJDA 3BB3A 3B3GA 1E2FA 1XIVA 2AFIE 2Q6OA 3P9QA 4MQLA 3K70D 4A73A 2QEQA 1EFPA 4CFYA 2ZJZA 4AO6A 1KH3A 1YIOA 1NGSA 1U7XA 2FR8A 2H65A 1I0IA 3WLSA 1M10A 1VYUA 5DX8A 4KMMA 1FDTA 4EA6A 1NUHA 3K6RA 3WYAA 4QJBA 4DIEA 2HW8A 3MUEA 4JI4B 4BQFA 4CL3A 2G6TA 1VSTA 1YZUA 4C0SA 4D0RA 5B7PA 4DVGA 1P91A 1E60A 1Q92A 5ESRA 1BE6A 2EHJA 4RGQA 3UYKA 1DINA 1ZEJA 3V4VB 1ZD8A 1UC9A 2AR7A 4HFMA 3UAXA 5SZKB 1O9HA 2DUJA 2E21A 2HIMA 2HLPA 2ZE6A 3UJ6A 3F6EX 3OT1B 4YRKA 4UAJA 2PLAA 4FKZA 3TLCA 3S27A 1SMKA 3IJEB 2AN9A 1J39A 2OGUA 3N0WA 3WIDA 1JSRA 4OP2A 5KX5F 4E32A 1FNDA 1YBMA 3UNXA 5JS8A 1L4BA 2ZUDA 2NO1A 1GDTA 4OHRA 4C0QC 2FPSA 2FPOA 3Q10A 3WB9A 5E6UA 3ND8A 4YMGA 1W8IA 2JD1A 3ISTA 4J6EA 3BWBA 5DGDA 4AF6A 3UGQA 3BEDA 5ITSA 1G9XA 3PD7A 3KSZO 2OK8A 4JT8A 2PWYA 1JPNA 3NBMA 1R3DA 3I9V6 3V4SA 1QH8A 2Q27A 5ALEA 1O6BA 4F04A 4BJHB 3KKLA 5CLQA 4G0PA 3S2FA 4MGEA 4UFOA 4OLHA 3PUIA 2QVGA 1F1JA 1YR3A 2EC5A 2PS1A 2CL7X 1Z7GA 1I7DA 1WMAA 2JKYA 1OGYA 3DM5A 3LT5A 3ONEA 2C7PA 4MPRA 4ZOCA 1XMPA 2EAUA 1J07A 5LFAA 1MJGA 2QIOA 1CX9B 3B3FA 3ROXA 4FHFA 2QOEA 4P36A 2HZBA 4W8OA 1NV8A 1PT5A 2CZCA 2ZUFA 2GCNA 3TOZA 3KSUA 3FWPA 4KFTA 2XCSB 1LF0A 4LX0A 3NO4A 4G4IA 1ZITA 4G5QA 3WLMA 2XGJA 3BGDA 2ZWIA 3THYB 4H1WA 1UANA 1TO2E 1TUGA 2VTDA 2IUUA 1DRJA 1F2VA 1NN1A 3AU8A 4AWAA 4X3OA 2XD9A 1KRXA 4DV0B 4QBHA 3LYAA 4PS1A 1GWNA 1YQWA 3KZXA 2PRYA 3CS3A 2C98A 2PJUA 2H7XA 3EBLA 3IDSA 4BHTA 1JHQA 4J4BA 4Q1FA 1MAHA 3VYSB 5IJWA 4EGAA 5F98A 3WGUA 2XZPA 3UXEA 1ZK4A 1OLSA 2A5FA 5ELMA 1QAQA 3M6FA 5IDWA 4PLFA 4OLAA 2VPQA 2WHRA 4C01A 5JXWA 1RI4A 3A7DA 3TR5A 1P0QA 3DHWC 3VYRB 2Y9PB 1F6BA 3V1UA 2YWGA 4Q7QA 2DEUA 1QQBA 1ADFA 1EQ2A 1Q57A 5BPHA 3KQQA 3SKYA 4AJIA 3U4MA 4FMPA 1FSSA 3R9KA 5LL6P 1FDUA 4V1CI 2R25B 4F2PA 1G41A 2DJ5A 4D74A 4ETMA 4PG7A 1ZK3A 1BDBA 3P7MA 3Q3CA 1JLMA 2HF9A 3R4CA 5ILQA 2ATVA 2HBQA 3QOWA 3SICE 2E7ZA 4IXMA 4I14A 3FPCA 3NYRA 3UUGA 4CIBA 2J08A 5C1PA 4GC5A 4DB2A 1TB4A 5HRUA 1ZUNB 4NV3A 2XA1A 4YJKA 1DFHA 2AC2A 2HHJA 2X1VA 3UAVA 1UP4A 3ZW8A 1EM8B 3H6GA 1LFAA 2PL9A 2GZDA 5DX1A 3TNYA 4BNMA 3QLEA 4R9VA 1AHIA 1E8NA 3LIIA 1IQRA 1VGVA 3LBAA 3N0XA 2ECFA 1LRKA 1RPAA 3RVDA 2CVZA 1WW8A 3MERA 4MDYA 2NSDA 4IOJA 1DBSA 3N7AA 2JHPA 2GO7A 3KLOA 3O2QB 5LBTA 4NX2A 4DY4A 2FUKA 5JS7A 4DV2B 1ISIA 1VQ1A 3HK2A 1CP3A 1ZXXA 4Y6QA 1INLA 3AJRA 2CKDA 3W5CA 5ESXA 1YHZA 2HO5A 1SXPA 3BMNB 8LDHA 5ALFA 3AEKA 2V59A 4BBZA 3A1EA 3BJIC 2GXUA 3L0DA 1P44A 1U3DA 4GPAA 4R1QA 4W5WA 1ORWA 3QPWA 4LNUA 3U3JA 3H2KA 4RTRA 2PD3A 1MKYA 2WKQA 4EFNA 3EJ6A 3AR2A 1KMMA 5M5BA 1E3EA 1CG6A 2WHYA 3BCRA 8GPBA 2J59A 5JC1A 2P6MA 3NHYA 3B70A 1A5TA 1DT3A 2OZPA 2O2GA 2V65A 5BN1A 1D2MA 3ZHSA 5JD6A 4LSWA 2CNNA 1RWXA 1Y5MA 3UH1A 1Y6GA 1MH1A 3GLIB 4RDIA 1M1YA 5HEKA 1OCEA 1R6BX 4P5PA 3ZIDA 2WJJA 2XE7A 4WN3A 3LP6A 2JGFA 2Y76A 3C3DA 5T8KA 1Q20A 1MABB 1YRHA 3WL5A 2HX1A 1BVUA 3COPA 1QF6A 2EDAA 4PPGA 4E07A 3FCOA 1Z2OX 2VVTA 5CIQA 3BH6A 1Y34E 4BMZA 1V16B 2EG5A 5GOZA 2EP7A 3FMVA 2PZFA 2WUDA 4JP3A 4WN9B 5TNXA 4OGKA 1Z12A 1BMFD 3RYIA 3VDNB 5JI2E 3OIVA 5CFZA 4I9FA 3N8KA 2OCBA 4ZQBA 5I8WA 4GUDA 5H68A 3Q6MA 1TT5B 1VI5A 3I1IA 1RR6A 2YZNA 3P9SA 4M99A 3GAMA 1FUUA 2IPLA 4G0ZA 4IDCA 4F1WA 4G0MA 2J6CA 2Q3CA 3VMMA 5E4TA 3KQKA 1X19A 5JALA 5K2OA 5LOVB 3U7RA 1G60A 3CF2A 1NMYA 4R05A 3DEHA 3H9EO 2P1RA 1MJ5A 4JVSB 1L4UA 3EX7C 4HOYA 1YJ5A 1G9SA 4J91A 5CJPA 3RVPA 3O4VA 5JSFA 1ZOSA 3EGCA 1QU3A 3MWDA 4IG9A 2VJAA 4Q3EA 1TC2A 1NKVA 1YR7A 4UNRA 1LV7A 2ZRNA 4F3RA 4JJFA 4MEJA 5DEOA 1QORA 3PQ6A 5MHTA 1U1IA 5K0EA 5CM9C 9LDBA 2IOHA 3WZMA 4B7ZA 1JALA 4BP9A 2IZZA 4ZI7A 4HZUA 1XP5A 2JFFA 5JDIC 4J1SA 2ZQ5A 2PGLA 1YE3A 2WV9A 2BFMA 3L7JA 1EWVA 3NHZA 4ZOBA 3BRCA 3RJZA 3GPDG 1Y0BA 5B2EA 2WD7B 2BE9A 4ZJPA 3PYMA 4DYDA 1PW5A 2PX6A 1XVTA 4HYTA 1T9DA 1SY7A 3VR3A 1W94A 3K31A 3VOSA 2HCJB 2F8LA 4PAQA 4NENA 5BSFA 3OJ0A 2XOKD 1QGUB 5AXBA 3SHVA 2G9VA 3K5PA 1CU1A 2YW9A 4MRNA 1L9XA 2GCIA 2VAMA 3IC5A 4BN4A 3M70A 1ST2A 1OU4A 5PGMA 2D06A 2I7DA 2YJNA 3TE6A 5FTLA 4HRYA 1IG3A 3Q6IA 4DR2B 3AYXB 2C77A 2ORVA 3RFTA 4EW1A 2DETA 2GB4A 2B4KA 2DX7A 1CQPA 4FZ5A 3UJPA 4URXR 1CUCA 1WABA 2JAPA 3UCXA 1JAHA 5CLGA 2IYEA 2SBTA 1FVHA 1U7HA 5BWOA 2QZJA 3WGTA 1WRBA 1F51E 5LXTF 1Y80A 3ZZNA 1SBYA 1G6HA 1RBQA 2ZVPX 3BWYA 4N65A 2VS1A 1XQXA 3HO8A 2G5GX 3RVJA 5B57C 5IULC 3TLGB 3L77A 4ZTZB 3K96A 2V7TA 3UJCA 3A05A 1Q0SA 1U9YA 4R1OA 4BS9A 3GGOA 3E1SA 1GZUA 1NPYA 1WB4A 1WXDA 4Y3UA 2JFVA 2VEDA 1NQTA 4BMPB 2DPLA 5T41A 2C5SA 3I2JA 1E6KA 4F84A 5EI5A 4N8SA 3G7UA 2VCEA 4G24A 3BCUA 2H31A 4PZDA 2QTVB 4U2FA 5DTQA 3ANXA 3OP1A 4MJ3A 1B0PA 3KHSA 3GGPA 3L7MA 4XFDA 2DFNA 4B1FA 3QP9A 4RPKA 1F06A 3KUXA 3GELA 3SWWA 4B5KA 1FTWA 2Q5HA 3N6VA 4D4JA 5G1NA 1BX1A 4IOMA 4TL7A 3W8DA 3V8BA 1KXJA 1SOAA 2XMQA 3M6VA 4HB3A 4LMBA 4YV7A 5IJAA 1Q0HA 4IYRA 1A2KC 4B34A 1I01A 3ONFA 5ECDA 4MDEA 2ZYGA 4EO7A 1L5QA 3LKDA 3F3MA 1C9NA 4XJVA 1RVDA 1UBTS 2X8BA 3ZGNA 1J5EB 1EE9A 2Q2VA 3IAHA 4UAGA 4KR2A 4KX3A 2WWFA 1YF3A 3CLRD 2O0MA 1ZMRA 3GVPA 3Q5EA 5TT1A 5JMPA 2HRCA 5EE3A 3LBNA 2VWPA 4DMGA 2FSIA 4YAFA 1TDJA 4G1VA 4FGUA 3FX2A 4S0XA 1GG5A 4PU0A 3VPFA 5DP1A 5TPZD 4ER3A 1F2TB 1JRLA 4KNVA 3KK0A 4YONB 1T3SA 1GFWA 4YLGA 1SQSA 1ML3A 3T9BA 1ONBA 1FLNA 2VTBB 2FMTA 3H0KA 4BMVA 1KARA 4L9WA 3WNDA 1I8TA 4JQOA 4TWJA 4HRVA 3UOWA 1VRWA 1E4OA 1FS5A 3L2OB 5E8JA 2DTXA 4LYDA 5JRJA 1DRVA 5JZBA 2F3SA 4PFJA 3O8QB 4DR6B 1OPXA 2BF7A 3LBFA 4Q01A 2QSJA 3SK0A 1G6Q1 1JAIA 3SZOA 1L6RA 3ZIAD 3EODA 2HMUA 5CA1B 1DAIA 3GCZA 3AHDA 4JLBA 3NHRA 4P93A 4L5JA 1A95A 2DPGA 3EXFB 1FW6A 2WP0A 3ZU5A 4XWYA 1LPNA 3NHMA 4NFYA 3ZDEA 4W6ZA 4ED9A 2FMXA 3IPAA 5I9BA 4AZVA 4BAGA 5ALVA 1RQ7A 3H5AA 4NZMA 1I4DD 3B60A 1K68A 2F55A 1H2XA 3LQKA 2RH5A 1WBJB 3UMRA 4DN6A 4XUDA 3D4IA 4J0DA 5CYGA 3VMFA 3N2NA 5A3RA 2RGDA 1LUAA 2H6EA 1MX5A 2GA9A 3UF0A 1ZJJA 1Y9AA 1F38A 2XVXA 4MJXA 1JXAA 2EU8A 4PSVA 4XX0B 1OI3A 4OQEA 1GPBA 2JAQA 1CIVA 4DTIA 3VKVA 2Y93A 3WL6A 3LUBA 3VKHA 4H7KA 4FC7A 4JB2A 1GUDA 1IAQA 4MV5A 2YS7A 2VHEA 4OSEA 1Z6AA 1U8FO 3JRWA 1PYGA 2P35A 4XTRA 1Y3CE 2PSSA 4YJFA 2AX4A 2P75A 3PNQA 3MJ4A 1B6TA 1RC0A 4EPYA 4OGFA 4PCUA 2A7QA 3QELA 1KAMA 3KC2A 4EB6A 2P9FA 1TF5A 4MRMA 2P9GA 4DQUA 2VA9A 3GFTA 4BAZA 1FXSA 5JAOA 4WXEA 1T8PA 1CUWA 1QGOA 5TVGA 4EI2A 1T43A 1K6IA 4J7XA 2NU9B 4XLLA 4Z5XA 1WWKA 2O3QA 2M9MA 3AWIA 3TTYA 3G0GA 3LT2A 4HX9A 1Q3TA 4O2LA 3OQOA 1SUFA 4DMLA 3R5HA 1RQPA 3HBLA 1H94A 2JFUA 4WUVA 2PBLA 5EZ5A 2ZWMA 3M6AA 3G68A 3IAAA 1JAXA 3ZDFA 3TL6A 4BDTA 4FYKA 1W5AA 1ENZA 1QBKC 1XA4A 3E27A 3K0FA 3A4TA 1M5TA 4FHCA 3HHEA 4F2GA 5EHXA 2WJ4A 2XDWA 2ZTVA 4W1SA 4QDZA 2O5EA 1GV1A 5BPFA 1CUXA 4Y1GA 2R7LA 2XWPA 3OTHA 5DFAA 3S40A 2JFGA 2IPXA 1V7PC 3A1CA 3EGIA 3ULKA 4BFVA 3B9RA 3GO4A 4YT2A 4RV4A 2ALJA 3DKIA 3M4XA 4AUEA 2FVXA 4G36A 4KQCA 2WKRA 4YAEA 2EKBA 5H81A 4BBPA 5ICEA 1OGIA 3K9CA 3VJRA 2Z04A 5BSWA 4QT4A 2QAIA 1BCSB 5CG2A 4WZBE 1Z6PA 4AICA 2KBFA 3SP1A 2D3WA 5FJJA 1AUVA 3S55A 2O3UA 3V4PB 1IYZA 2VHZA 1V39A 1KNXA 5CHYA 5ALHA 4ZA2A 3D4NA 1M1UA 2FZ4A 1D5WA 2OBYA 4ETIA 1T0BA 3IKLA 3VVCA 2NM0A 2O2HA 1D8AA 4CVNA 3HJFA 3V7NA 4EKEA 3HKDA 1PS8A 2CE2X 2OV3A 2RGYA 1OH7A 4LYYA 5AJUA 2ATXA 2D1FA 4LTDA 5CVEA 2VI5A 1C8LA 4TV9A 1GRRA 2GI4A 2OVFA 4DCSA 3VOAA 2QPLA 4CMEC 1TZMA 2VUIB 3DOUA 1TW3A 3JXEA 2HIAA 3MT9A 1NX6A 2ZROA 4GZMA 4IQ4A 3ZWXA 1Z5VA 1ZNQO 1YB7A 4BVGA 3D6VA 1OH5A 3JD1A 5DIZA 1ORIA 3T52A 4FOPA 4OFZA 1SKQA 3DMPA 2P5SA 4JLPA 4RZXA 3RDPA 2W6PA 2UDPA 2ORED 5B1HA 2H2AA 1SQ0A 4NYIQ 2YZ7A 4BXOA 1TVCA 1U4OA 4CM1A 4KNWA 3GLGE 2GFIA 3PEYA 1A9RA 1TZJA 3H8JA 4BKOA 4ER0A 3OOJA 3U7IA 4FPXA 5A7GA 4H3KB 4TLMB 1I30A 1XXHA 2YOFA 4LISA 1EQUA 5DJ5A 3O75A 3D02A 3GFGA 3CBGA 3FKJA 4I66A 5ESWA 1SEPA 1Z3IX 3PCTA 4LDZA 2XMZA 3EXG1 3OTGA 4XWGA 1PNOA 1QQ5A 3S2GA 3G2LA 5J23A 3PRYA 3YASA 4MQUA 3OIFA 4R3NA 3UV7A 2CJWB 1LW7A 1J5XA 4Y2VA 2G9RA 4IZHA 1FYDA 1EVYA 5AVZA 4TS9A 2WFMA 1HKHA 3QBTA 4Y2GA 5FUVA 3N8NA 3CWZA 3PHHA 3QUAA 4XQEA 1NR7A<