4BMCA

Crystal structure of s.pombe rad4 brct1,2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
183
structure length
183
Chain Sequence
b'SKPLKGFVICCTSIDLKQRTEISTKATKLGAAYRSDFTKDVTHLIAGDFDTPKYKFAAKSRPDIKIMSSEWIPVLYESWVQGEDLDDGLLVDKHLLPTLFKCRVCLTNIGQPERSRIENYVLKHGGTFCPDLTRDVTHLIAGTSSGRKYEYALKWKINVVCVEWLWQSIQRNAVLEPQYFQLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-M CHECKPOINT CONTROL PROTEIN RAD4
publication title Phosphorylation-Dependent Assembly and Coordination of the DNA Damage Checkpoint Apparatus by Rad4(Topbp1.).
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Replication
total genus 60
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
A PF12738 PTCB-BRCT twin BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4bmcA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4bmcA02
3UEOA 3QVGB 1KZYC 4BU0A 3SHVA 2COEA 4Y18A 1T2VA 4Y2GA 3SQDA 2AZMA 2M2IA 1IMOA 3JVEA 1JNXX 2XNHA 2VXCA 2NTEA 3EF1A 3SHTA 2L42A 2DUNA 2E2WA 1T2UA 2K7FA 3PXBA 3EF0A 2VXBA 1L7BA 3PC6A 4U4AA 1OQAA 1Y98A 4IFIA 4IGKA 3T7KA 3K16A 3U3ZA 3L46A 3OLCX 1IN1A 3SZMA 3PXDA 3HUFA 4BU1A 4XPZA 3I0NA 2ETXA 3L40A 2XNKA 4JLUA 1L0BA 3T7JA 4OFBA 3PC8C 2ADOA 1T29A 5ECGC 2EP8A 3PD7A 1T15A 3UENA 2EBWA 3PA6A 3PC7A 3PXCX 3I0MA 1CDZA 3K0KA 2LE0A 3K05A 3PXAA 1Z56C 2HTFA 3T7IA 2D8MA 3AL3A 1WF6A 3FA2A 4XQ0A 2COUA 4BMCA 3PXEA 3AL2A 3L41A 3QVGA 3K15A 2K6GA 3II6X 4N40A 1N5OX 4ID3A 4BMDA 2EBUA 3KTFA 1GZHB 3COJA 2INGX 2COKA 2R1ZA 3PC8A 3T1NA 3K0HA 2WT8A 3HUEA 2JW5A
chains in the Genus database with same CATH superfamily
4K6FA 4XQGA 5JNWA 5EIBC 2BGTA 1GA4A 3KJQA 1V8DA 3OY7A 2GKGA 2XVZA 5TGDA 5AKHA 1YE5A 3W8EA 2HWUA 1SHUX 2QAIA 3IDZA 1NQWA 1VG8A 3ISJA 1F6DA 3L01A 4BU0A 5B1IA 1U3CA 4D57A 2NU6B 3M4ZA 4IDQA 5IC6A 1ZRHA 3ZDRA 3D4LA 1QBGA 2LCIA 4C5AA 5HZGA 2ZSIA 1ZM3A 2CBXA 3DZJA 2BM1A 1I13A 2H29A 3IH5A 1X80A 5DSTA 2RK6A 2IWRA 4ZV9A 1EIZA 3D0KA 3KJIA 4LQDA 1XJ0A 3OFSA 3MB8A 1EX9A 2DKNA 1PJQA 4JR1A 4YAFA 2XSZD 1T9AA 1ZIPA 3VKUA 3HCNA 4CQMB 3BD8A 4LY0A 1RPTA 4DM3A 2RJOA 3R7LA 1C2TA 3OT1B 4CIAA 2C58A 2G4VA 1SC4A 4I4TA 4MVXA 3OPYA 1SC1A 1HNXB 2YQ4A 1IRXA 4MV0A 1OZ0A 2HJWA 3L4KA 4EB0A 3LSTA 2I4OA 1KJ9A 2QT9A 3Q3GE 4RTQA 1FW8A 4CI9A 1F2TB 5F9HA 4ZT3A 2EYQA 3EUWA 2X4GA 2VT3A 2ILTA 3CINA 3O0TA 4GGMX 2J3LA 3DOCA 1AURA 3HBMA 4MP3A 5GQSA 1ADBA 2HF7A 4V3BA 4TV8F 5AK0A 1DG9A 5IPFA 4Q4AB 2VYVD 2FFBA 3WQRA 2FW0A 3EN0A 3SR0A 2O8DA 1K0FA 2G5TA 3L6RA 3T7EA 5KTOA 2BT4A 3OCUA 1IDOA 3KUDA 3ETLA 5A7FA 4DB4A 1IBMB 3CCCA 5H7XA 4RK1A 5EXSA 4HLQB 1QO7A 2GBCA 4F3YA 4BHTA 4D0SA 3WQQA 4Z4IA 1GGVA 4Z0NA 2FCRA 4IDEA 5D6NA 1SD5A 1W0KD 5DTQA 3RLFA 2ZB7A 3P9NA 5KVQA 1IBRA 2J41A 1E1RD 4DXAA 3P9KA 1NF8A 2D2EA 1DG3A 2WTEA 2QE7D 3P2OA 2JHAA 4WGGA 4OF4A 1V25A 2C7BA 4EG0A 3BDVA 3RABA 1T8RA 3WADA 4B31A 1OB5A 3D0RA 4RF2A 1CT9A 3EEFA 2G7MC 4DF3A 1II8B 4EF6A 3TSWA 1G20E 2RC6A 4N3GA 4NCBA 1ZJ6A 2I4NA 1R9NA 4GOXA 1SM4A 4X6UA 4LWPA 1LPAB 1VYHA 2JGDA 4HKTA 4U2DA 3UJDA 3VYSB 2F9LA 4F5ZA 5FH9A 2QQEA 1ZHOA 3A58B 3QFSA 3PT9A 5JSKA 5ADHA 1GZ3A 1VI6A 4G5OA 2E1RA 1GDTA 3KQYA 2B69A 3QG1A 3THXB 1Y6FA 4IRMA 1AKTA 1YBAA 4XSGA 4HQNA 1XKLA 3TQFA 3G0BA 1MW9X 1R6DA 4YJGA 1WBJB 1MT0A 3T9FA 1OX4A 1KQNA 2LKCA 4OJKA 4MGHA 3HB7A 3JYOA 1J9GA 3E2PA 2GX6A 4UTNA 2FW7A 2CHEA 4NZPA 5AICA 3SQXA 3O3NB 4V39A 1JWBB 3TG2A 4B32A 1ADFA 2Q1TA 2IY9A 5HQTA 3NEYA 3ITDA 1SBZA 1ZWKA 2R11A 5DOVA 2IU3A 3WHIA 5IUNC 5I7WA 1KXZA 3JYLA 1XMOB 1JEYB 4BXOB 3QVGB 2IX3A 2PT9A 2WPNA 1PGJA 1IJEA 1O97C 3IODA 4KNWA 1ZOIA 1EBBA 1UJ6A 2O06A 1A95A 1AB5A 4UHBA 3LYHA 3ZUGA 4D80A 2CDAA 2YFKA 3NDJA 2RHBA 3SC3A 4EHJA 1ACLA 4LRXA 4P3OA 2Q6OA 4GMFA 4MGEA 1QIIA 2YJ6A 1WMBA 3A1UA 4U8HA 1T5TA 4NENA 5HJ2A 3FMVA 4JB8A 2EX1A 3O8OA 2V7QA 3GCWA 4BPRA 3NIDB 4F0JA 2YMPA 4MKRA 4CGYA 3WAKA 1VBNA 3IE1A 3CSUA 4HWGA 3AM3A 1W36C 2A78A 4R69A 1TE2A 1K7FB 4P93A 2QMUA 4TPKA 4JB2A 3ZK8A 2O8BB 3RB8A 3RFCA 4FDLA 4YMVA 1KEZA 4KV7A 4TXMA 2G25A 3S2EA 4KZKA 2J08A 2FEKA 4G8JA 4BQOA 5AVYA 1PV1A 2GLTA 5EMJA 4J0GA 1XA0A 1TO2E 2QAGA 2AT1A 1UDBA 2ACVA 3QLVC 2ODEA 2ZROA 4FOSA 1T9KA 4W99A 2WNIA 1G8MA 5EWLB 3D6FA 3FZEA 5JCPA 4NZYA 1WABA 2CVPA 3QEKA 4MUYA 4QGBA 3TLJA 5B7NA 2DLCX 2NOAA 3DZFA 3C3XA 2N1BA 2GHIA 2Q6LA 4YGXB 3RLIA 4AZ0B 3AOEA 1OLUB 2Q5OA 3PKJA 4JELA 3SZRA 3FROA 5FUQA 2F48A 5EINA 3U3RA 6REQA 4ZARA 1C1YA 4ARIA 3RT1A 3KYDA 3ZY4A 4IFBA 4NCXA 3WP0A 3WLIA 4P84A 5FDFA 4LNUB 4YUWA 4G37A 4GT1A 3NRJA 1P3DA 4ON9A 2BY4A 2QPAA 3GJ3A 3LQ2A 1R5BA 3NBMA 2C2ZA 1RAFA 4GP7A 2FPGA 1E9DA 1DC7A 1ZWLA 3HXTA 1GFZA 3I09A 3S4YA 4A9AA 4BV2A 5B4UA 4FP9A 4HUQA 1LSUA 3CRZA 3K2QA 2AOVA 1O9HA 3TAHA 4Y67A 2F3QA 4PHHA 1D04A 2ZBPA 1UQTA 1RQPA 3G88A 4D4LA 1CTQA 1G9TA 4Y9UA 3SIXA 1M76A 1QPBA 1UPAA 2NIPA 3BJIC 2GVDC 5EIWA 2M1XA 5BSEA 3RIYA 3DXYA 4A26A 3EVAA 1I4OA 3S40A 5FA6A 1PG0A 3CV3A 3K0FB 2VDRB 4RA6B 3LBAA 3A6PC 4M1EA 4IDCA 2OV3A 4HGPA 4RSMA 3UUFA 2H1WA 1TIPA 3ASUA 4UEJA 5AJHA 5LZ7A 3WMGA 3ZHXA 1EP9A 1I4DD 4NJOA 4DM7A 3KSBC 5KDDA 3JWEA 1WBBA 3L41A 5AI8A 1Q15A 3E5RA 4GU5A 4TTRA 4XWOA 4BWGA 3EJWA 2FW9A 4NV1A 2X4IA 4QYIB 4ZK2A 1KVQA 5CFOA 1ZVMA 3IVAA 4QWWA 1AMNA 2V7GA 1C9JA 1V5IA 1Z22A 1VBMA 4TZKA 5TJHA 5CP8A 2Q3DA 1EFRA 4UPVA 4QXOA 4Z5XA 3RV3A 2Q7DA 4FC7A 4KW7A 1P17A 2ZJZA 3WZLA 4BGEA 2C5GA 1W5SA 3QFTA 4IW3B 4LXTA 5H59A 4CEIA 5GGXA 2DUUA 3FSRA 1L5FA 3WDSA 4EYEA 4ZYUA 2PMDA 1DBQA 3C39A 2DRIA 1SVKA 3DE4X 3FLAA 2HNAA 2GEJA 4DLPA 5ALTA 5CB8A 2PIDA 3CLRC 5C8XA 4JJFA 2O3JA 3OLXA 3OE4A 5AM2A 1E63A 2OGSA 4DIFA 4ZT5A 3UB4A 5JSYA 3C8DA 2OXIA 3STTA 5BR1A 1ZGAA 3UAOA 1MLDA 3IB6A 3CN9A 2VIIA 3H84A 1OFTA 1H2WA 4H7HA 2VRWA 4JHXA 4JUIA 1Z0FA 5GONB 1D1SA 5CAEB 1PEYA 4BC1A 1ANKA 5EPOA 3HYNA 5KYWB 1QE0A 2EGUA 1COZA 1D9XA 2I7XA 3WC4A 1L7BA 4EKNB 5K8JB 4JR2A 1X7YB 3FF1A 1EVZA 2JBWA 1N6IA 2Q2QA 3PNOA 5EJFA 1C3EA 3UUGA 2VJMA 3Q7SA 1Y1RA 3QNMA 1OILA 2JAPA 4GOMD 4JMLA 2NNLD 4HF7A 4O8ZA 2JGIA 3RU3A 2R6CA 2HA7A 2BH9A 3SYTA 5K4AA 4FONA 2OVBA 4ZVTA 2W2KB 4OQLA 3ITNA 2YHIB 2V6MA 5IHPA 2B30A 1JDVA 4INJA 3STVA 1YWGO 5HW0A 2BRUA 3N0TA 3F73A 4UASA 3O8RA 1EDOA 2JRLA 3FMOB 3EIXA 3ZGYA 1JG2A 2GA9A 4HQFA 4ZICA 1PJ2A 3J81A 1E61A 3F71A 3ZIAD 3IA2A 4HQRA 4I5IA 3VXKA 1V8PA 1SELA 2FV8A 4NH0A 1NJ2A 2YXBA 4TS4A 1T1SA 2JI4A 3ND8A 3WYFA 5JPDA 5C8ZA 4UCWA 1ICEA 3ZXYA 3D31A 2ATVA 1DFHA 5EJMA 2PZJA 4ERXA 2G36A 1Y7LA 1CCWA 3O6VA 3OWOA 4OV6B 1IZ8A 1ZX1A 4I55B 3TIFA 4O1MA 2FWAA 3MJDA 4NQRA 4Y9SA 4OQQA 3V8VA 1EFPB 4BQEA 1O0SA 1ODCA 4J94A 4FZ3A 1Z6ZA 4GECA 4RK5A 1G5QA 3DHEA 4CDRA 3OTGA 821PA 3IAFA 1I2CA 1XOIA 2AOTA 3HNOA 4ZZ0A 4KHPB 4Y30A 3GT7A 4I14A 1N2GA 3TKLA 5ELMA 4O59O 3ANLA 3COZA 4IM7A 3PRYA 4AJOA 2FSGA 2VC2B 3JZAA 4NYJR 5ELLA 1HT2E 4A8TA 1CQJB 3LXRA 1KJJA 4KKVA 2JLQA 5J63A 1E6MA 1XTJA 3NM6B 1GXSA 5F35A 2X5XA 5BPFA 2JHGA 2HSWA 1N5OX 3Q0IA 2WKPA 3GBPA 5D6OA 1T8WA 4B7AA 2FPIA 1YQWA 3P4YA 3UH0A 5LSAA 1G2QA 3UPTA 2UYHA 3ETDA 4LI3X 2Q6IA 3WTCA 3GGOA 3IPCA 1BEEA 1QU3A 4X45A 4WNCA 1YB1A 3KKNA 1U8YA 2I65A 1SZDA 2FUG1 5KNCH 1O97D 3QUCA 3B2QA 1KI8A 2ZUSA 1YJAA 3HKDA 4WAUA 1RC8A 2IYSA 2WUWE 1KI1A 3EUFA 4HO1X 4Z53A 3RJZA 3FG9A 1S6YA 4B6FA 5AVVA 1VI2A 4XA8A 3SHVA 4XFJA 1XMXA 2I4RA 4F4FA 2QRMA 2WPDA 3KQQA 4QXQA 3LC1O 4WD3A 1UBHS 1ZC3A 3DBLA 3D81A 1X7XA 3H3JA 1WDMA 5CVDA 4G26A 1VMDA 3ED5A 3PUKA 4ECAA 1BKYA 2GZRA 3N8NA 4H7DA 2W4QA 4FPXA 5HIAA 1W36D 3K09C 3MD0A 1XU9A 2QOEA 4R8RA 1E1DA 2NPOA 2H1HA 2J46A 4N7JA 3GAFA 5GY7A 3UAWA 4PPFA 4ZOLF 4NK5A 4EJFA 1I3CA 4G5GA 4EW2A 4NAVA 5JO9A 4EA7A 2Z43A 3VR2D 2VRCD 3AO0B 4XYEA 1XTVA 1Z7EA 3FYUA 3V34A 4RPIA 4JVNA 1QVZA 2A5GA 3HP7A 4CV0A 1ZI6A 3RUPA 5I9LA 4FNAA 4C14A 3C5WP 2YYYA 4ED9A 3IPLA 2HA2A 5T57A 3A4LA 1DAKA 4A0QA 4MUHA 4XYBA 3FVQA 2PWYA 4NBWA 4EJSB 4EJMA 3IALA 4EYSA 1TM2A 3MW8A 4DR3B 3CTPA 3AIIA 2E4UA 2PZAA 1IXRC 4N82A 5HOEA 1A0OA 2EAUA 3REGA 2J4CA 4AW9A 3FTEA 1Q0PA 2H2FA 2J07A 1R8YA 3G59A 1T9ZA 1YL6A 4HGRA 1QIDA 4F3NA 4IDDA 4JIMA 3GCDA 4OB8A 4QUDA 1WNTA 1VDZA 4R7ZA 1VMAA 3KYJB 1Z37A 5EJ2A 2EV9A 4OQMA 4QTZA 3G1WA 2XQFA 4O4JF 3C4QA 4OAQA 4FEGA 2CJYA 4FGSA 3IXQA 1FLAA 4CDNA 4FFRA 2BZSA 4C5BA 3F7NA 4XB1A 4DLTA 2Z04A 1DXHA 3R8XA 2QU7A 4V1CB 3KZKA 4QG7A 4Q66C 2C7OA 1NXTA 4KDFA 1BD4A 5L3ZA 4MW0A 3AKZA 2ZPUA 2DHRA 1G3RA 2QLMA 4YQEA 2CXTA 5E0KB 3Q11A 1NATA 1XMIA 3UENA 5BW6B 2YH2A 1C7EA 4HJXA 3KQVA 3CLUC 1ULAA 1XBTA 4FDTA 4K9QA 4TGLA 2WJJA 1CDOA 5TRTA 3INRA 3FTPA 4IDOA 2APJA 3OIVA 3PXAA 4CIBA 1P4JA 3Q7TA 1V47A 4QHTA 1Z0SA 2GN1A 2AZXA 2KS6A 1KVSA 4V0ME 1U7WA 3HK2A 2C7QA 2VO1A 3W8DA 1UT8A 4GXTA 1CZLA 2BTQB 4DRXB 4PX2A 3K92A 3O75A 2W6MA 3UZUA 1J0BA 1ULBA 1AK1A 4OU4A 4MRMA 3DDCA 4UVGA 4E31A 3RYTC 4F5DA 2C78A 5SY4A 1ONBA 3R6GA 1OH5A 3ZX4A 1QRAA 1B8UA 3ESQA 4RHCA 3BDAA 4M53A 4F4UA 3JSXA 4LE0A 3ZWDA 3QSYA 3EWSA 2HADA 2GOYA 3H1PA 4ASUA 4NYIQ 5I6DA 1TJYA 2D7CA 5I8WA 4RVNA 4O2BA 2FMXA 3OQVA 3U4QA 1O03A 3NDPA 3PI6A 4D43A 1F2DA 5AHOA 1DCMA 4D42A 1J0AA 4MWEA 4AF6A 4TKMA 4N0DA 3WYNA 4KGDA 1JB9A 1JI3A 3GJ0A 2Z3VA 3ROFA 3HDHA 3VSEA 5JH7B 1BNCA 4H59A 1D2AA 3C6XA 4WZBA 1QGUB 4QATA 2RARA 2ACKA 4IJ6A 3UJ7A 4XW2A 4Q82A 1KP9A 1KOJA 3TMKA 5BV1A 5CCBA 3GL9A 3ZY6A 4JJIA 2Y71A 1FXUA 1NZJA 2DLDA 4Q9IA 2XH8A 2NSYA 3DE0X 3TQCA 4JKYA 3EYWA 5B7QA 4TKZA 1P1HA 2O3SA 4LHSA 2HT6A 3KXKA 4U7FA 1F3OA 4YFVA 5K2MA 3PLNA 5DM2A 4FMDB 4J0EA 4IR7A 4AJ9A 4DYVA 2E82A 1E7SA 1U2DA 2QM0A 4FD2A 3ZQUA 4Q4HB 4ES6A 5HCNA 4FZVA 2PU7A 1LVGA 2WI8A 3W0LB 1ESMA 3EEOA 1BS9A 4ZQGA 4RTSA 3EXIA 3T5GA 4ZRDA 1DFGA 3UM9A 4B3MB 3E7FA 5AKXA 3WB1A 2IXEA 3JD4A 1Q0HA 2HPHA 1OQAA 3KS9A 4G5YA 4BP3A 1AH2A 3KKPA 4FDAA 5B7PA 1BEUB 1PK8A 1L5YA 3ZQKA 3K16A 4YBZA 2ZTMA 4QDXA 2P27A 2JVJA 4KX3A 3ERCA 3FJ1A 4PS0A 4EEZA 3CZAA 4AQYB 1KMCA 1FYWA 2WA1A 4AMUA 4P31A 1WA5A 1OROA 1FDSA 2N42A 2PFGA 4J03A 5CA0B 3R5FA 3ZWQA 1TM5E 3UW3A 4DILA 3NNSA 3A04A 1GRCA 3OZCA 3U49A 1NM5A 1SUCA 2P5YA 1IU9A 1EFKA 4L5AA 2FRXA 1EGVB 1QHXA 3M5WA 5YASA 4E51A 4KO3S 3IRVA 1WR8A 4YAEA 5CNMA 2C00A 1WKCA 5BQPA 3H0CA 4LXIA 2BDEA 2SICE 4L6IA 5CVVA 1N2ZA 3JQAD 5HX7A 4ZYXA 1OTHA 3LUCA 1P6UA 3I0MA 3OY2A 2CLCX 4Y2VA 4TWIA 1U7DA 1DXQA 3L7IA 1X7DA 3KUCA 3L0SA 4L9SA 3WJ2A 4TUYF 4N7MA 5E3JA 5EP3A 1NT4A 2DGDA 4OQ4A 3I9FA 4TLLB 5HTKA 3GWGA 3LBIA 3DV2A 3NXSA 2XSZA 1Z33A 1UWKA 3PD0A 4ZALA 3BZBA 1PFWA 1WD7A 5BW8A 1N0VC 1WF6A 3UICA 2ZWOA 5EMMA 2F64A 4I6EA 1J33A 1QQ5A 1GUBA 3TAXA 1ZD5A 5C34B 2V5UA 1TPZA 4ZI7B 4MVJF 2OAQ1 5LJIA 4JLDA 3DKKA 4CTOA 4OLAA 1Q19A 2HK8A 1XTKA 3F7OA 4R2MA 3TLEA 3GIDA 3I45A 3OJWA 3FOFC 2AZTA 1DIGA 1UP4A 1Z7GA 5CYPA 1NJ8A 2A3NA 4XQEA 3C3AA 1VPWA 3ANTA 4MPTA 4K8OA 3TKYA 2W8BB 2GAAA 1FNMA 2QRLA 2FWBA 4O4HA 1XZJA 5IABA 1NUQA 4CMBA 3GLSA 3K0HA 3RJ5A 4EP1A 1I1HA 3I32A 1YZVA 3M4JA 4CV2A 3UCFA 3WA6A 1X80B 5CGQB 3ZCUA 4OI1A 1HC7A 1RDFA 1W0KA 2JAQA 2XYGA 1P7CA 2C5FA 1KFKB 4EYGA 2G04A 1EM6A 2ECPA 5FADA 3LYUA 1V1JA 5SY6A 3BEOA 1I5OA 3IBCA 3MOGA 3D7NA 1T8SA 1VFPA 2AE1A 2OWDA 2WYVA 3PNPA 3EX7C 1PZMA 3IDFA 2DE0X 4XD7A 2XTAA 1JTVA 4DJDC 4TRMA 2HU5A 2CLIB 1JI0A 1P7VA 3NKFA 4J3JA 3B82A 3I73A 4KWTA 4P1ZA 5H8WA 3EBLA 4Q7MB 5K6AA 1IZZA 1K6MA 2ZQYA 4I4TB 3OPYB 2VN8A 3T54A 4NECA 2R00C 2OZPA 4LOHA 2YIMA 2BR4A 4L7QA 3JQEA 4PGMA 3DP9A 4CT0A 2OK7A 1IQUA 1E3TA 1XX6A 3CKMA 2NUAA 4Y6SA 2QL9A 1EK5A 1NHWA 5F64A 4BP9A 2QM7A 3JQDA 4JH0A 4NBRA 2BUCA 2GBFA 3BZUA 1Y89A 2Z9CA 4WW0A 4AG3A 4YPOA 2CHUA 4QPCA 1H65A 1NXVA 2K2WA 3DKPA 3U5TA 2O8DB 1XCBA 4D3YA 3ACDA 4MMYB 1EGAA 1YL5A 4HNHA 2FSVC 2G83A 4O4IA 3THWA 2EW8A 1IHOA 2PANA 4P3XA 1IONA 1EG7A 4ZVLA 5B3KA 4N54A 3KOZA 4GOKA 3K9HA 5L4NA 3M5CA 3M6FA 1M0SA 3S70A 3CT6A 1QOPB 2GBLC 3HJTA 4MQ4A 1ZK0A 4FK8A 2B9EA 4Q9JA 3T7TA 2PGXA 3AXTA 3D8NA 3GCZA 1NWHA 3QBEA 1CUGA 4G56A 5E4JA 4D9IA 5IT9A 3ICVA 2X1MA 5HK8A 5BP7A 2Q4OA 1MJFA 5KQLA 2Y3IA 1NMYA 4DEXA 2JS7A 1EVYA 4LJ6A 4UU0A 1A50B 2WWRA 4BN5A 2HLHA 1C29B 1UEXC 4Y9DA 5ECGC 5GZ3A 1SAYA 2XYHA 3NYIA 2IUUA 1T4MA 4MVWA 4LXHA 1Y37A 5EE3A 2PGOA 2ZSDA 1WO8A 1A9SA 5CGZA 5KVSA 2F3TA 2NO4A 2JGDB 3PA6A 3PF8A 4LZZA 3W2HA 3WLQA 1LKZA 1TJ3A 5ALHA 2JK0A 4XTCS 1T3LA 3RREA 1L3IA 3HZOA 3PLRA 3D02A 1Z12A 2XEDA 4EHHA 2XBLA 3SKYA 3C4VA 3D7LA 3BK2A 2P3LA 1Z56C 2NT3A 4IV5A 2V58A 2E4AA 2FPKA 3PU6A 5EYPA 5LP6A 3RSGA 2F9FA 5GWXA 1WUHS 4X5OA 4YJGB 3A3YA 1OX4B 2WM2A 2FYTA 4B75A 1DBRA 3PJDA 5TQJA 1I0ZA 1KFBB 2WJIA 1L4KA 4QT4A 1DOZA 4DSTA 1RC0A 5DVZA 5IXYA 3WL6A 4MTCA 1SIWA 4OL9A 3FI0A 3NDRA 2LXNA 4XUGB 2KPOA 3PXEA 2EFCB 2YIDA 4MV1A 3G7SA 4NESA 3ZE1B 1NNUA 1ILEA 2A2ZA 4UBIA 2YJ3A 4I5GA 1XNHA 1YK0A 2J9RA 2XLBA 2ZI4A 2RD2A 4F93B 4NBUA 2CMHA 2FJUA 2J0SA 3QWBA 3R0ZA 5EXDA 1HDIA 4EPVA 1DAHA 4F12A 1AGRA 4UCXA 3AR7A 1YF3A 4TYWA 2PSHA 3LKBA 3RS7A 1NW8A 2GNAA 4L78A 3AB3A 4M1YA 1SOAA 4G8DA 4UE3S 4UMFA 4MV5A 1MAVA 2F00A 2Y1KA 2DPMA 1IG0A 2O50A 3CRVA 3T9AA 5JSFA 4QM6A 1NL3A 1QH9A 1KA9H 3C74A 5G4KB 3F78A 1R6XA 2XCTB 1E99A 2MJLA 4EHIA 1ODJA 4R1QA 2QMHA 4J76A 4NENB 3BIXA 5F2NA 4EG5A 2Q1UA 3O8OB 3QWAA 3RARA 5LFAA 5LDGA 3BHMA 2IHJA 2JFWA 2QTRA 3O9MA 1N2XA 2XODA 1RM3A 2IIPA 3GH3A 4UM9D 3ZCRA 4MPPA 4LZLA 4ZZIA 2JCVA 1PWYE 4E09A 4UAJA 3F7TA 4LDNA 5BYBA 5C53B 1SB9A 3UUWA 2QLNA 4NXMB 4JI1B 1XLTA 1E8MA 1QG0A 4PCLA 2QAGB 2Z6UA 4P0QB 1QORA 1WW3A 3H87A 2E2WA 3ZZ1A 5KTYA 4TROA 3L6DA 4KR3A 4LF4B 2H2HA 4EI7A 2FWPA 2PHZA 2FVYA 2FG5A 2W8ZA 3G23A 3EUEA 1R15A 4XCXA 1XDZA 1Y3IA 4HB2A 1K7SN 1WD5A 4G5SA 1M54A 3LY8A 1OGJA 3M2TA 4KNVA 4XLTA 4RVHA 3SLRA 1DQRA 4PAGA 4YI3A 1M6EX 2YWDA 5LA6F 2VDMB 1HDEA 4C6SA 2NGRA 3T7DA 4JFAA 3KYDB 4MJ3A 2W4IA 1G19A 2X19A 3GB9A 2PMKA 2PUTA 2I33A 3QPAA 2LKDA 4E2ZA 2CLOB 5IC4A 4DG5A 4LZWA 3B48A 5DLPA 2FPGB 2Q3HA 3F8WA 4XUDA 1CUVA 1PDWA 4WX2B 3EGDA 1T0IA 1X77A 1XJWA 4FSDA 3DBRB 4F06A 4QLOA 1C3JA 2YJGA 5EIHA 4AU1A 1H23A 1VXRA 1YQDA 1TVEA 3MJVA 5FYQA 4B5LA 4AKHA 3GCGA 4XKJA 2JFQA 3PIRA 5J4YA 4Q3OA 5FI3A 1YRQA 2PMEA 4NCIA 3S5UA 4IHJA 2CD7A 5FTLA 1B14A 1E1QA 5GJWC 5HDQA 2A0WA 2E4ZA 2JFNA 3H1BA 5IFLA 1M8KA 3HVHA 3TSOA 4C1BA 5KS2A 1UOEA 1M67A 3C87A 4PYRA 3TQRA 2ZSAA 5KYVA 4BZPA 3ZZ0A 3QVJA 1SMKA 4W8OA 1A1VA 1PSDA 2RHCA 3M5PA 4F9FA 2NZ2A 3TCKA 2WP0A 3O4RA 2WTUA 4B74A 1X8JA 2YZMA 1SPXA 2FWMX 2QX4A 2YMLA 3WDLA 2IU4A 2XB4A 4PAWA 1UFVA 2Z8ZA 1XC7A 5D86A 2Q41A 3UB3A 1GFIA 5EJ8A 10MHA 2VWGA 3MHPA 4A23A 2QMQA 4D3ZA 3C7CB 3LVQE 1JSRA 4EFMA 4HAUA 2BBTA 4EO9A 1BMQA 2IDJA 2XI4A 1AXRA 3HY3A 4POOA 5IT4A 5DLDA 4BX8A 4IF6A 3SX0A 3GT0A 1EHCA 4NF2A 1OB2A 4PZEA 1CIJA 1N1EA 1UEIA 3ASYA 3O95A 1VMIA 2A67A 1DSSG 2F1OA 2WWVD 3ZIAA 3AB7A 4KQFA 1J2RA 4OLJA 2I3ZA 4G2NA 2CUKA 2C4KA 2R7AA 4QUHA 3TXYA 1XDUA 3OOEA 3VR6H 1CZRA 2VS1A 4HFRA 2A9KA 3I30X 4C2BA 4DNQA 4NZNA 4P2BA 1Z4MA 4FEYA 4ZYTA 4XWAA 1NW4A 1ISPA 1U3FA 2G72A 3QZUA 2I7CA 2LV8A 3BTOA 3VZRA 4UNIA 1G3MA 3JW8A 3M6MD 3NYRA 4NEHB 5FV4A 4P3NA 4WWHA 3GZNA 1Y8QA 4MYDA 4MUKA 3WK9A 1N9GA 1XZBA 4CMAA 3BXXA 3P4UA 3HUDA 4Q1VA 1T1RA 3T4EA 4F85A 1J23A 1NYQA 1ZMXA 2CCKA 2IYXA 4U7TB 3SYLA 4D92A 5IVIA 1PR2A 4RIGA 4D6YA 1Z06A 2VJMB 5EQFA 1XYGA 1YCFA 2ZBRA 1KEEA 1RMQA 3KQKA 4K03A 1FRVA 5FWYA 3CVUA 1O77A 2AHOA 5BWOA 1NUSA 1P1FA 3K2BA 2OYCA 3WNBA 2X0EA 7ADHA 3W5BA 1NUHA 1W6UA 5LVAA 4A1OA 3AQIA 1HT1E 1JW9B 1RBQA 2HZ7A 1IY1A 2ZEJA 3MCUA 1CJUC 5LYJA 3VM6A 2YWFA 3QVXA 3KHKA 3ER6A 3T3NA 1SUDA 4CIXA 1C4OA 1E2JA 3O4VA 5C5IA 4RVUA 3RSCA 1ZD2P 5KNCA 1L7QA 4GS5A 5UKDA 4B9EA 2Z4SA 5JDCA 4JI8B 1SJ9A 5BN1A 2DY0A 1I1QB 1XTQA 3KE9A 2DQ4A 2P5SA 3F6BX 2HU7A 2ZIFA 3FWZA 3BFVA 3RSZA 4EYOA 3KDAA 4F38A 2OR3A 4BBPA 5H16A 2D59A 4FT4A 3N6VA 4QULA 5D2CA 2H1RA 4WI1A 1O95C 3QSGA 4JLKA 5KDLA 3UFXB 2PTHA 2I6XA 4IOKA 4XJSA 3ESYA 4I4IA 1Z2PX 4BMNA 1U0RA 1GSHA 2K5UA 1IY8A 2AOTB 4GOJA 1ZL2A 2NVUA 4KLNA 2ZYTX 1DE0A 4R0MA 4D0RA 1NDUA 3AEUA 2AKYA 3KK0A 3U7QA 1F8YA 3IR5A 2Q45A 2QXYA 4C5CA 7ABPA 3BRQA 4L6AA 5LZ5A 1SKUA 4RMNA 3TINA 2O2SA 1Q1QA 2C5EA 3VDQA 3HXOA 2WKQA 4OPMA 3UHPA 1D3AA 3P2KA 5DASA 3RVLA 1G4AE 1I2ZA 1EX7A 1GXSB 1QIHA 2R97A 3SQNA 3ZVLA 5JZ9A 1AZWA 3N05A 4JXJA 3JRWA 5KVAA 5EY5B 1T2FA 2PO7A 1XK6A 4EHKA 2FPIB 3QLVA 4X41A 4PC2A 3CNEA 2GF2A 2IU0A 3S8MA 3WLTA 3TGLA 2D4HA 4MO9A 2PA0A 4PNZA 5FBHA 3LX5A 2ZUTA 1CSEE 4K26A 5H4GA 5JY6A 4MYRA 4TLMB 3LWBA 1IJFA 2YWCA 4I55F 3RSSA 4V0QA 4DA6A 3SX4A 2ATCA 5B4TA 4F3CA 3T35A 4JBHA 2A94A 2ZRGA 1VIYA 3G79A 3Q1KA 4B3IA 4FN5A 4EA6A 1WDTA 2D8AA 2CY0A 3SZ3A 4OL0A 4RBNA 1NLYA 1OH7A 3BZWA 2RB5A 1SURA 5DCUA 1TZJA 1X7XB 3NIGB 3PJRA 2RGWA 1PGQA 5JTTA 2WWGA 1U3WA 5EPEA 3KKOA 1PVOA 1SBNE 3MIIA 1HETA 3MMPA 1V39A 3HO8A 1BWPA 2E48A 4R8KA 3S1LA 5K8TA 1U3VA 4J3FA 2GZDA 1W1WA 2QPOA 4HPXB 5ICEA 4KQ2A 1B4DA 3P45A 3KM0A 4RKQA 1F48A 1B7GO 2FTKE 4J1SA 4TL6A 2DB3A 2PYIA 3VC7A 2IXGA 5KKNB 1P60A 3FYUB 2G9QA 1N6OA 3KHSA 5AVRA 1CEQA 3WOVA 4B2YA 5IVHA 3INYA 1HTBA 1HKHA 4O6VA 1H2AS 4UM8B 1BKSB 3SAJA 3TIXB 2PNFA 2FZ4A 4HVAA 1Z07A 1F20A 1LZKA 4G1CA 1RZVA 1JFSA 4B6GA 1BX1A 3ENKA 3QOFA 3NWJA 4YRMA 5KC8A 2JDIA 2GPNA 2RI1A 3ZBTA 5AK4A 4HNVA 4RXMA 3VMFA 1HNWB 4IIVA 3AM5A 3E61A 4D9HA 4MW9A 1OE0A 3IOBA 5DM1A 3HXMA 3PQ6A 1FJGB 2RHJA 1RCUA 3JX9A 3G2KA 1XDDA 1MOQA 2YRWA 3DL7A 5AO9A 3DVAA 1MENA 3BKWA 4BO4A 2V7PA 5GP1A 3EVNA 4HLUC 3ZEAA 1HOTA 1KZ6A 3BIJA 3PXDA 4UQOA 2HDWA 2CHVA 3N28A 4AJ4A 5H9WA 4R9NA 1E6KA 4R54A 1MJNA 1YQTA 3I5XA 1Z6PA 1G8KA 2YN4A 2R84A 4CUJA 2W6ID 4QBTA 4BB0A 1Q2UA 2OBNA 2P6PA 3KV1A 1YJ8A 3IIEA 4U8GA 4DC0A 5CXXA 1Z5NA 1N6HA 3T3HA 2Q9BA 1ECLA 1N7HA 2D06A 4HX9A 2IOFK 4OYLA 3HWWA 2BSQA 4U6NA 4LCJA 8AT1A 1PL7A 4J0HA 3WFJA 1ZVKA 3Q0TA 2OORC 1QTQA 4DM4A 4YUVA 5K7SA 2EBHX 5DHQA 4HLDA 1UXJA 3EIUA 5EUMA 4IGIA 2B2XA 3RTCA 1SRQA 1FNBA 1K7EB 2QKYA 4A91A 3VGPA 4Q3LA 3L77A 2LE0A 4BQRA 4HPWA 5IM4A 3RHZA 3HJFA 4W8HA 3PICA 3AGPA 4MRMB 2ZYVX 4EUFA 4LPKA 4PR0A 4JI2B 1KFJB 3CRMA 1E2HA 4R7TA 2D8MA 4NTZA 3GJ7A 5DI9A 5IBPA 4JKIA 2Y1OA 2TMKA 4PZLA 4D8UA 3RIEA 4YAJA 1S2NA 4ROTA 2VUHB 4C4OA 4KZPA 4PTZA 4LNAA 2BM9A 2GZAA 3DOJA 1ZS9A 4K81B 1JFLA 2DTXA 5CTAA 4O2BB 1PTJC 4YTEA 3SS7X 2CSXA 3U4QB 4D9BA 5KWJA 1UCFA 5TPWB 1L3BA 2EKPA 2JANA 3HJGA 3IEPA 4O25A 3KLPX 2W0SA 1LJLA 4NLLA 3TM5A 2KHZA 3B78A 4TM8A 3CHYA 1OT3A 4L3WA 4LGMA 4MA0A 2Q5EA 3W9YA 3ZE9A 4Y1FA 4XIJA 2ZI3A 2X8BA 3F5SA 4NICA 4WZBB 4M0FA 2QUJA 1ST3A 5CVJA 1U9IC 3WGZA 1XEXA 1Z5PA 2LDXA 1FTSA 3ESRA 3T0GA 3TVTA 4Z6KA 1GPUA 3UC9A 3GJQA 2RKOA 2R1TA 3R5HA 4TOIA 3G8DA 4UHEA 1DS6A 2C9BA 3C1TA 2EJCA 2R4TA 5LD2C 1QB8A 1NBAA 3CX6A 4B4DA 5DSZA 4X63A 1K2VN 3X2SA 2HJ9A 4AYWA 3HR4A 5TMDA 2OCKA 2P9QA 4YP9A 3JQAA 1OAOC 5IKOA 3Q3VA 4QPNA 2YN2A 4WLEA 4UHDA 2GM9A 4BJ3A 1CR6A 1VGQA 4YROA 3HR8A 3THYB 3H04A 1IXSB 3DL0A 5GVRA 3VUEA 2HT1A 1IQRA 2MDTA 4OXKA 3EXIB 4RXTA 4M49A 3PNVA 1N9KA 4QLBA 2Z8YA 4M0PA 4NMXB 3KWFA 2CMFA 4BFSA 5JANA 3W79A 1T3SA 3QUTA 5CPFA 3FSEA 5JH7F 2Z1NA 2GETA 1NAIA 4PFSA 4M1TA 1XMJA 4P53A 1X7GA 3EVBA 1PG5A 4YRZA 1Q2XA 5MN5A 4Q4JA 4IS2A 3CEMA 4B17A 1HLPA 1M2VA 2L0XA 4IHAA 2XUDA 5JTUA 4Y0NA 2R7KA 2DVMA 4AI6A 3HY6A 2QZSA 1D1PA 1MEJA 1Q44A 1W47A 4ENSA 2Q3EA 4KFRA 4TV9A 2UVDA 4QARA 1CR2A 1O95D 2FLVA 2FP4B 2J1LA 2I4MA 2RGAA 2C4WA 3WIEA 3IDAA 1GGHA 2JJ1D 4IIXA 1TTQB 2K2QB 4FOLA 1XQWA 3OIYA 1F8FA 3PWKA 2I2FA 3QUAA 4KRGA 3X44A 2BFFA 1ZGHA 3ME5A 2YFQA 3CZCA 4LHWA 2V9PA 5CH3A 1ZK2A 3GRPA 1D2EA 3BORA 2IBTA 1HDOA 1REQA 2EJWA 4FXOA 2LNDA 1DEOA 2Q3CA 4GM4A 1U9JA 3OQMA 3K09A 4JB3A 3VOBA 4JLPA 2ARKA 2CHFA 2X9GA 3IV7A 3GXBA 3ND6A 3NYWA 3Q3EA 2VJYA 1KDZA 3WGQA 3QBDA 4LOKA 3NGMA 2YJZA 2WT9A 5EI5A 3WIVA 1Z5WA 2BJHA 1UXHA 3EQ7A 4LV6A 4CDMA 2JIPA 5AKKA 5BN3A 4F92B 3EWIA 4M2LA 4FOOA 4MV8A 2J7KA 3WQSB 4DLXA 1DJPA 4DLVA 2NQTA 3NHYA 4BIMA 3DEJA 3ORYA 1TYAE 1FFDA 1HTWA 1Q7BA 5D8DA 5EJGA 3S55A 1JQ5A 3K9FC 2VAVA 4FW9A 1MJHA 4R9RA 3MRVA 3OX2A 5A6VA 3R3UA 5EP4A 1L6IA 4L5CA 4DLBA 1X1BA 2BE7A 3E2IA 4O4HB 2MSCB 4F6LA 2RHTA 3AZQA 2BR3A 4UFNA 4WN3A 5C18A 1PIWA 1K6IA 2B6HA 2WHPA 2ZTUA 3A1TA 1HFKA 4Y6RA 1F2VA 1R64A 1XVLA 1QRUA 4HWOA 3VH1A 1OF1A 3BK7A 3ZV6A 2O4CA 3PDIA 4RWEA 3RF7A 3CJTA 2FMIA 4FYPA 2YXLA 2B61A 2ZJBA 3UK1A 1XZKA 4DMLA 1Z0JA 2XGMA 5TB5A 2IHKA 3WB0A 4S2EA 1UT5A 1ZCAA 4GYYA 5A9TA 1JYSA 4M8LA 3O82A 4BO3A 3A1FA 1B3BA 4REMA 1LY1A 1J2TA 1PEKE 1H0KA 3DWGA 1AQJA 2ZYWX 3GJ6A 1NJGA 1LRJA 4MW5A 1O57A 3KHUA 4JC8A 4H15A 5EKXA 1XF9A 3G9XA 2DUMA 1V4BA 3BMQA 3D6HA 3PL1A 2PT7A 3MMXA 3QU9A 2H3EA 4YAKA 4JOCA 1YZ3A 1PJRA 3LFUA 4GVLA 4AG6A 5TMPA 1TVMA 2EIHA 2YVLA 3QX9A 4R4JA 5FBZA 1G41A 2Y1EA 3A1NA 3THWB 1KMHA 3OD5A 1WZEA 4O4IB 3JRXA 3FPJA 4KIWA 4HZGA 3GLGA 2JEOA 4AN4A 2J4FA 4FMBB 2VJLA 1F4LA 3K1JA 2IV3A 2YVKA 5BQOA 4CMJA 2ZRBA 2F67A 1QRRA 2HNBA 2I9PA 2XUFA 1SVLA 5JZBA 5LJLA 4PHGA 2JJ8A 5DM0A 4HNTA 1BVYF 3SMQA 3IBFA 4B40A 4C3VA 4TWAA 3LHKA 1R6BX 2GRUA 3OBIA 4KE9A 2A5DA 5CBPA 3X43A 3PJFA 1F7VA 1GP2A 2YOFA 2XZOA 5J4KA 1PT9A 3D9QX 2NXJA 1S7CA 2WTMA 3N2KA 4B0PA 4LWZA 2ETXA 3JU3A 3TGPA 2ACEA 1CLUA 4F6CA 1MTZA 4P0TA 1OFUA 1R10A 5HFNA 2YRFA 2K4MA 2ZZKA 3RAPR 3QY0A 4DPMA 2ZRLA 1NG9A 1GAEO 3S2FA 3EIEA 3O84A 3AJRA 4PCAA 1GEEA 1V41E 3NAMA 4I1YA 1X1QA 3S6JA 3FX2A 4OH1A 3TMYA 3N2EA 3PC7A 3KQWA 4BCDA 2VNJA 1NN0A 1MVLA 4XEUA 4LF8B 4RVCA 3GH1A 4U5XA 4D2IA 2NWQA 4P3YA 1X8XA 2FN8A 1ZITA 2VUTA 2CNWD 3I28A 5TMEA 5A3QA 1THTA 1WVIA 3J81k 3CZQA 2ZYUX 2G1AA 4D9CA 1T8UA 1FDIA 1MEOA 5BSFA 5T64A 4AMBA 1QIFA 3VNAA 5FNVF 2UXDB 1I0LA 3QKRA 2VP9A 5KJEA 4ZO6A 1T9GR 5AKZA 2WB4A 4JLAA 5TF4A 5L3RA 2H8KA 3Q3IA 3BGVA 3AI7A 3RK1A 1L8OA 2P4HX 1OAAA 1H8HD 1MFZA 2VHZA 3GAZA 5ALPA 3UV7A 2J6BA 1BE6A 1QQ7A 2WF6A 1U2GC 2WYWA 2XY4A 2CC2A 3LC7O 3N86A 1UJMA 4MGYR 2C2BA 3KLMX 1XWWA 2GTHA 3MOIA 2ZCUA 4P35A 4WTOA 5ULLA 4ZVOA 4E46A 4YHHB 3OCZA 2VG8A 2OT3B 2B1GA 1WWKA 2IEAA 4YEDA 1PD1A 1WZCA 3MJHA 2Z6VA 3M6WA 4GBJA 1ZU5A 1CK4A 5KEIA 4MMZB 4EI9A 4Z9FA 1E7YA 1IVNA 4ZDJA 3HU2A 2VWQA 1ZK1A 1VJTA 3DMGA 5KQGA 5EIXA 2IHZA 1UJ2A 4G6ZA 5DHPA 5IF3A 2J9YB 4FNOA 1LS1A 1JBKA 3K9WA 3MWGA 1W76A 2I4TA 5ALYA 4RTMA 1U8ZA 3IHLA 2YNMD 3SSOA 1QIKA 2QUZA 2H5LA 3BA1A 1W5TA 2ZOSA 4JBYA 4F4DA 2ASVA 3JQ8A 2WLTA 4HNUA 1QH1A 1FFBA 2V7TA 1PYDA 3QF4A 4DV3B 2EKZA 5AH0A 1KMNA 1AQUA 3F49S 1DJNA 2O52A 3CRNA 2WYIA 3H2IA 1WW2A 3QKSB 3QXGA 4FIDA 5CMLA 5FPPA 3V7WA 4BVLA 1M1XB 4IKPA 4CKCA 4QZVA 4WN9B 4WFIA 1MW8X 4WV3A 3L1JA 3M4XA 2QRJA 4NCKA 2O8EB 3U7JA 2AQHA 2R25B 1MAWA 4J16C 4R9UC 3RK4A 4H9GA 3Q5DA 3TRFA 3VTAA 2YQZA 4HXYA 3GJRA 4JLOA 4V2UA 4IJMA 3ORSA 1FZQA 3CS3A 1CJBA 1GPJA 4O2AF 3DQPA 3UMSA 2C9YA 3LTEA 1IG3A 2PD4A 3SDBA 2O8FA 3RS0A 4M9ZA 1RYHA 1Q91A 3PGKA 5DCWA 3HI4A 3MCTA 1TADA 2Y92A 2HMYB 2GRAA 2ZWPA 2WIGA 3AG6A 5G1PA 4ER5A 2I6GA 1YC5A 2ZT5A 4IZIA 1YOVA 1UIRA 2VQFB 2FW8A 3PFFA 2B82A 2I66A 4Q9DA 3EZ6A 3FPCA 3G6WA 3A32A 2WHQA 2FZLA 1FMCA 2N3ZA 2R8XA 2PKWA 3FSJX 3QEOA 4UBLA 3EGDB 3AEYA 1KDTA 1OWPA 1NJ5A 5HS6A 5GIOE 1JB1A 4C4SA 4N6NA 3HYTA 2FN9A 5JHHB 4YHBA 3NP7A 4LVUA 3VR6A 3UGJA 1MORA 4ZOQI 3CCBA 5GM1A 3CZMA 4GVXA 4UUMA 2WMDA 2IZOA 3H1FA 4MAFA 1JIKA 1NI5A 1SEPA 3QP9A 1VHWA 4IHJB 4MQMA 2HQ1A 4YCDA 3CZ5A 4CV1A 2O5CA 1L5OA 3ET4A 4MYCA 4UZFA 4HYTA 1OSNA 4DZZA 5A7HA 3H9BA 1YB5A 1HFEL 4KUHA 4RELA 2QIPA 4X95A 2P0EA 5CDTA 5I45A 2ZZMA 1MNAA 2ID9A 2FN7A 1K89A 2V0GA 2QORA 2FPOA 2OBLA 4GF5A 3MTAA 4R9SA 3ADKA 4QEZA 2WUDA 3NVKI 1NVGA 4FINA 4EG7A 4YXFA 5E3IA 1P3JA 1SBQA 3IULA 3PUZA 3CR3C 3GARA 4G0XA 1J90A 1FRZA 5SICE 5SYMA 2SKCA 2W2MA 3H8VA 2Q0SA 3UYKA 1M5UA 1T5BA 3BHNA 2IVFA 4OQNA 5I5GA 1FDUA 4OHZA 5F78A 3MMNA 4CEJA 2XEXA 1J8MF 2FSVA 1Y9ZA 2CLFB 4RW0A 2E0IA 1Q11A 3AONB 4ZOAA 2E37A 4Z0HO 2GBLA 3I8SA 4I5FA 1JAYA 2K6GA 4DE5A 1FXSA 5ICSA 3ICCA 1ZZEA 1WMFA 5T8KC 1UC8A 2HWXA 4MH0R 1XPUA 3QOWA 5J4VA 1HURA 1YRWA 3JQGB 1OWMA 3BG5A 3QHAA 3VSAA 2D7JA 4OHVA 4R1PA 1NI3A 5TGZA 3RS2A 3HXQA 3BERA 2FWJA 2OQIA 2ZIUB 4LDZA 3G9ZA 3T1OA 1YDFA 4MICA 2CVZA 3VU3A 1DTEA 2KSQA 2YYSA 1OXXK 4F7DA 1F9EA 4POAA 2H4ZA 3GZNB 3NB0A 3RRZA 5A4JA 2WJVA 3JZFA 3TLBA 1N9GB 3PGMA 1X6VA 1JLSA 3NXKA 4I1PA 2PBFA 1U7TA 1AB6A 1SCNE 4XGQA 4W4TA 1N32B 1O94D 3AFOA 1UBEA 4I3GA 2V3CC 4EJ0A 4UEWA 2AZMA 1Z5UA 4DSNA 1SXJD 2WHYA 1UDAA 1DTWB 1KEEB 2C0PA 3ILXA 3PFHA 3L1UA 5FWYB 1A8IA 4V0NA 4OI0A 4X24A 4C2AA 2XCOA 3M70A 3MG9A 4ZO4A 5L95A 1AMUA 4UAGA 1Z35A 2ICAA 1P80A 1YZYA 1ISFA 2YTZA 4ND7A 4I66A 2JASA 1RQRA 3K30A 3LRTA 4HL6A 4KFTA 3CFYA 3MUFA 4W63A 5INTA 4BBJA 5JHGB 5LYJB 3HTXA 3HVJA 5HFJA 4M1SA 3TCNA 5DHUA 4R31A 2RGNC 2WHRA 4HY3A 4FZJA 2FMTA 1AF4A 1HDZA 3EASA 4GLJA 2JFPA 2AUNA 4F91B 3T6KA 4PHTA 3IMCA 4WADA 4UTZA 3H19A 3U6BA 1VJ1A 2CEAA 3H4VA 2POQX 3L93A 1QONA 4EHFA 3FSGD 2E55A 4YGYA 5EE9A 3ZTTA 2CB9A 4JBIA 4K5QA 2WP8J 3E7PA 3IVCA 5HQJA 3QVOA 1B15A 3ML1A 1KFEB 4DC9A 1BMTA 3LT0A 4MRRA 1GWNA 3P9IA 3SC2A 5HKKD 4RZQA 3R8CA 2O05A 3RYHA 4Q12A 4ZKEA 2PZKA 1YT5A 3QLUC 4BQPA 1JQAA 1A4XA 3K0CC 1P29A 2IUYA 2D0OB 1UMKA 2QVGA 2CXNA 4LBVA 2ASEA 4TTSA 1W48A 3V4VB 1U1EA 1TIBA 2ZE7A 1A7KA 3B9PA 4CKZA 1PGPA 2CXRA 3V1TC 1GZVA 2PGLA 4JLUA 2NVUB 3ZJ4A 4KK3A 5AW3A 2P6RA 1BJRE 1RWVA 4IJUA 5L7YA 9ATCA 1U65A 3AEUB 3R3JA 1YCGA 4U02A 4E30A 4YR9A 4GYWA 3U7QB 3GEHA 1SG9A 2I6UA 2OESA 3GNTA 4DV5B 1W36B 1NTRA 2J0EA 3P2IA 3QXCA 4MIKA 1YQ9A 5I7HA 2BKUA 3FFBA 3LY9A 4NU5A 2W58A 3A4YA 3HCAA 2E5WA 3CLVA 4KG7A 4BRZA 1AGPA 4MSUA 1PLLA 5K3OA 3HJUA 3L7OA 2UDPA 2FXVA 5HXAA 4WACA 2B2CA 4N6GA 1PYOA 2CB0A 4D9EA 2HM7A 3FR8A 5DI3A 3S99A 4QM7A 4A92A 2OXCA 3B1FA 2IXBA 2NV0A 4W1RA 3GUVA 1JS1X 1QYCA 4U39A 3HNRA 3KXIA 2P8JA 4RORA 4UU1A 2J45A 3VR0A 1Q0LA 1FFWA 1V3QE 3GV0A 4RH1A 1X1CA 4XDHA 4EOGA 1NE7A 1P39A 2OFXA 2BGRA 1OXUA 2X6TA 1Z5ZA 2AXNA 5U4QA 4ZPJA 2JJ2D 1L5VA 4KYUA 3UKJA 1OXMA 4MVJM 1P33A 1SQFA 2E18A 3E2MA 3OJXA 3ZI7A 5K03A 3WZ2A 3I1YA 4W82A 4E5NA 1ULSA 3JPWA 3WBBA 3BMCB 3R5SA 1NOKA 3P7MA 4KLCA 1QYRA 4PG8A 1M7BA 3CH7A 2JLWA 4ZODA 1OZAA 2PLRA 2XHEA 3AZPA 3L4JA 2VQSA 3CT4A 4HRAA 1DFIA 3SFTA 1XAGA 4GKBA 4ID9A 3TQTA 3G0CA 1DWPA 1KDOA 1U0JA 4QGAA 3B60A 2XQIA 4RV5A 2G6TA 4PW0A 3EDOA 3EBOA 2W6IA 3CLHA 3IA7A 5IHXA 2DJIA 3RFUA 4BVEA 2W00A 4HDNA 3RG2A 2OECA 5REQB 4MK4A 2XKBA 4HYYA 4KWIA 4MI1A 2GWRA 2I67A 3WNZA 3T95A 3W6ZA 3NBKA 4D8XA 3M1YA 5AXBA 2GN9A 5TEVA 5J4LA 2VI5A 2O3UA 5T4FA 4RTPA 1KAMA 3TLAA 3PEVA 8MHTA 3A3KA 2ZTVA 1ONSA 5IVDA 4D9JA 1W5FA 1VL6A 4O0LA 2PSFA 4MW4A 3W3ZB 1C80A 1Q50A 2FX5A 5JXGA 3R7NA 5KIAA 5EIAA 5F21A 2JI8A 4L0QA 5EP2A 4J2OA 1FBTA 3RTDA 4JYZA 2V03A 1NV8A 4ILKA 2O5VA 1PSWA 1Q0ZA 3WGTA 4DLZA 3R0VA 1PV2A 3H9UA 2HA6A 1D2RA 1G6Q1 1UOOA 3NOXA 2DECA 4WASA 1P1KA 3E8XA 5KWIA 3RJTA 3WJ1A 5JY1A 2GCIA 1WHSA 4X1YA 1S96A 2QVYX 2B36A 3DVAB 4GZ6A 3QA3E 2CDBA 5FT9A 1JQBA 5CLGA 1CX9B 4PZCA 1K9VF 1H2BA 3EXG2 4IUYA 3OZGA 2XWJI 5F5NA 1Z28A 3BSSA 1GY8A 5FFFA 5U9CA 4FCTA 3FW1A 4XARA 3OQOA 2PPVA 4MRNA 3G2MA 1JKIA 1IAVA 5H70A 4IFEA 3T61A 4CETA 4KK4A 1K97A 5H0IA 3CVXA 3D8RA 3JZDA 3DBHA 4ZDKA 1JU4A 1UBKS 2CNOA 4LEIA 4EUSA 1DBVO 4IKOA 3EH2A 4PX5A 1NE2A 1NNI1 4B4WA 1QK4A 2BUAA 2PRZA 4QDZA 1UC5B 2J3DA 2JD2A 2O6LA 5CK5A 1SKMA 1AT1A 1VA5A 3TW6A 4A6DA 4HVCA 3BSFA 2PZLA 2VHTA 4ALLA 5AW1A 1CEXA 4BWYA 2QVCA 4URYR 3SMVA 3UMMA 1RACA 4F4JA 4HNRA 2JJYA 1K8XB 2JAUA 2QN9A 2NO6A 5E8RA 4KREA 3THRA 1DJMA 4G89A 1JNYA 1POXA 4IH9A 1T4GA 4PNEA 3W7VA 5KYGA 5BWNA 3FJOA 3LXUX 4P8RA 4HAXA 4PG4A 2F8TA 3LRXA 4M9SA 1SKYE 3R5XA 2OA0A 3GLFE 2Z5LA 4X61A 2IXFA 2NO7A 3HCOA 4O1HA 1OFVA 4R1NA 2WUVA 4EF5A 3ICQB 1GPBA 3TXAA 3MEQA 2ZUBA 3MLEA 4NBVA 2GPJA 5AKLA 3BICA 5BNTA 1ENZA 5IT5A 1GAQA 4ESEA 2R60A 1FP2A 2QTNA 1QFJA 1SXIA 3I5AA 3SJAA 2PL1A 2JAOA 4QDOA 2QN1A 1TA4A 2AFRA 1A8SA 1YIAA 2Z2ZA 4AKEA 4BNUA 2VSQA 1B6SA 2QWXA 4LXYA 5JCXA 2QQ0A 1VGRA 2G09A 4G3XA 1BQEA 2BKEA 1GNTA 4BNFA 3VPHA 4J0QA 1FTQA 2C2MA 3A1VA 3LLVA 2PUBA 3W9UA 1F5SA 1RAHA 3O93A 3TJRA 3HCDA 2R1TB 1GU1A 4MVJE 3SKVA 2MIIA 2CFRA 1MAHA 3KZMA 2BONA 3DOFA 4IRUB 2EERA 4EF4A 1HI9A 3IX7A 5DP1A 2B1QA 2JLRA 4W5TA 1TLTA 4IDFA 1O95A 1FTWA 1A76A 3OZXA 3JQAB 2X76A 1TK9A 2BOVA 3BCSA 4RF4A 1NBIA 3C5CA 5D3QA 3RAJA 3WLAA 5CDYA 4C20A 8LDHA 5L8VA 3OLVA 3LGSA 3LY5A 4BQIA 4OJNA 2IX9A 3SJZA 4YQZA 5FF9A 3IEKA 2E3JA 2WQ7A 2GKSA 4W5JA 5F52A 2JVIA 4QTUB 5EP1A 3A37A 3GLIE 3S8EA 2C4UA 1QZXA 4JBWA 2AI3A 5DCLA 1TOAA 2GAJA 3OZSA 3FGOA 1N8SA 1XLUA 1CZOA 3NBFA 1A7UA 3E05A 4FGLA 1LBIA 4GQBA 2WA2A 1IOLA 1JHMA 4MW1A 1KSGA 1RJWA 3U31A 3VHXB 3VYRB 5AW2A 5IT0A 4AUKA 1UAAA 2ZAGA 4YRDA 2HDOA 2HCTA 3DC7A 2X14A 2BTOA 3EF1A 3IQEA 4GX2A 3UCEA 2X6QA 1O1YA 5ED4A 2PLWA 1RLIA 4C4AA 1M2VB 2QLTA 3OHMA 1EDEA 2RG1A 1YQUA 3D6UA 3T9DA 4JSYA 5IWAB 2ZXEA 2XB2A 1QHNA 4DCOA 1X3SA 3RU9A 5LP1A 1CIVA 1GN8A 5MHTA 1CUFA 4AF8A 4R83A 2G9UA 3C70A 4IUDS 4WFQA 2NZUG 1FX0A 3EGXA 4U7HA 3C41J 3EVGA 4TV9B 1KJYA 4XEHA 4B87A 5HGXA 1NLUA 1T35A 1BW9A 2A4KA 5BT9A 3LUJA 1E9EA 2FB9A 4TQUS 3IBYA 1BX3A 1T0UA 1XFAA 2AJTA 4R0VA 1TX4B 1VLVA 4G4SP 2OCGA 2ODNA 2WHEA 3LL7A 1BVHA 1J4AA 1KU6A 1SKBA 4HGOA 3LM8A 4FZ5A 4NU0A 4HQOA 5A0FA 4X1IA 3SFVA 2BFFB 4JOQA 4AO6A 5K20A 3R5JA 2C2YA 3TRJA 2NG1A 1XNRB 5DGHA 3BTVA 5G1NA 2G1JA 1E9CA 1EHYA 1FS5A 1REQB 1W1IA 5HF6A 3ROZA 3UMGA 2QRHA 2ZVDA 4U6SA 2D2FA 1WMEA 1PLKA 2O1WA 1RCTE 2QX7A 2I0FA 3DAHA 3ZNNA 4AJLA 2OHIA 4MLCA 4K2AA 1IXZA 4I1IA 3FGNA 1L5HA 3U5ZB 2XB6A 2YVAA 5EUCA 1YGYA 2N1MA 4QQFA 3UFBA 621PA 3OOWA 5HUJA 5DN6D 4IMIB 4F1WA 1T3ZA 1YNSA 1F0KA 4AJEA 3K5PA 3FCXA 4FTWA 3W34A 1G16A 2OD7A 3LUDA 3VO8A 2EL7A 4MEAA 4EZEA 2Y4NA 1R7RA 1IJBA 5I4IA 5HHTA 1G8JA 4PTYA 1JQJC 4WSOA 4YXWD 4EQ6A 1DARA 5DSXA 1RZRD 1MX5A 1JGTA 2IIBA 4IIJF 3ZIDA 3MJEA 2FWNA 2PWPA 3SHOA 2WHPB 5JJLA 1TUIA 2LIVA 2XNDD 3BWVA 5FBRB 3U9TA 4ESVA 2RGUA 3BWBA 4NMWA 5C8YA 5BSGA 5FWXA 2H9YA 4P2GA 1E3SA 1MV8A 4CE6A 2WAAA 1WUKS 4L9RA 4MW6A 2I1WA 2FE4A 2GK7A 3OECA 3PDIB 2RHLA 1YKFA 3DR3A 4NFLA 4JP8A 4O08A 4HLUA 3URMA 2PGNA 2Q62A 3ZW7A 2XGSA 4I1VA 4Z51A 1RPZA 4BX2A 2O8CA 1LF5A 2PS3A 2GD2A 3UQZA 2C2GA 3FFTA 3PB3A 4J4TA 1CJSA 4FGZA 4EY8A 4UTRA 1R8JA 4KO1S 3TLGB 1OFHA 2OORA 3L7LA 3RSHA 5BN4A 2Y67A 3BMQB 3IIMA 2YW9A 1E6LA 1AKRA 2EF1A 3IUNA 3LIIA 4WBXC 1GUYA 3V4ZA 1ZICA 5IK2D 1J6UA 4YK7A 1CUSA 1K2WA 2VP3A 2W71A 1AKYA 3RQIA 3T94A 4KR6A 1AV7A 1UZAA 2C04A 3FTNA 1SIUA 4GOOD 1NDHA 3OOJA 4PLCA 4E5KA 1E0AA 4F72A 2XXBA 3C8UA 1KMHB 4U9UA 3GDOA 4RV9A 2M1ZA 1Z6GA 4PHFA 4WESA 1P45A 2D5AA 1TO1E 3GLHA 4L0MA 4AYTA 3U4MA 2J7PD 3EY4A 2PLAA 4ZO9A 3MTJA 1XZGA 3OOSA 5AXDA 4J90A 5JNVA 1Z7WA 1JJBA 4L5BA 1HRDA 4TT3D 3COWA 2XYQA 3HCEA 3ODGA 4BV3A 1SC3A 5KWSA 2QTGA 2C5BA 1NUAA 5CBPB 4KXMA 3QPBA 2AXEA 3ZE8A 1B0AA 1HXHA 1TW3A 1AUQA 3R4VA 3CZPA 4Y2SA 4YJHA 3LLMA 3O91A 3D0OA 1LC0A 5AOCA 4QXRA 5FLYA 1TXGA 3BUSA 3N2KB 5EZYB 4HH1A 5DDIP 5DGIA 1G1AA 2XTJA 1WMSA 4EUEA 1CUZA 5L9AA 1M2EA 1U9IA 3PUYA 5H3HA 2NZJA 1L3CA 3I2IA 3LFHA 1RPAA 1U28A 1YRYE 5CJ2A 4ZI3A 1VPEA 3HVUA 2GVNA 1D8TA 2G77B 4YDSA 2IXDA 3G0HA 3C3MA 4JOBA 1Y6QA 4O4IF 4JC4A 2JFGA 5CNJA 3TCXB 4YRGA 1RYMA 2PX4A 2CXUA 5CYFA 4UM9B 1BROA 4HX2A 2O2YA 1OAOA 4LSWA 4O2LA 721PA 2WTXA 1U11A 1EE9A 2H9IA 4FUTA 4L7VA 4S0XA 4IDGA 4BFVA 5ALRA 1JG7A 3O2QB 2WHXA 2ZT6A 4Y7CA 1JH8A 1H6CA 3DC2A 1IBLB 5ALNA 4XM1A 4DRZA 1OFGA 3GLKA 1TKAA 5A71A 4NMMA 3RNLA 3WWYA 3QKRB 4EMUA 5J2TA 1UMBA 4QU5A 2HY7A 1DX9A 3RSFA 4KDEA 5CT4A 4LJ7A 4H17A 3TZ6A 1ZC4A 5CG1A 5GIPE 2C3UA 2I6TA 2PS1A 2PE5A 2OBMA 2A9RA 1AHHA 4JI5B 3BJEA 1LLUA 4LOAA 4QQNA 4HEQA 1X9IA 1E3DA 2V3WA 1Y3AA 3LYLA 3MJRA 5GJVC 3EIQA 1N3BA 5CB6A 1DINA 1RD4A 1MX3A 2ZP1A 2PL3A 3KJXA 2JGFA 3P2EA 4AJNA 4RTJA 3ED1A 1CY0A 1G64A 2FN4A 4G41A 4IGFA 3TTUA 4D81A 4LYFA 4J1TC 2QTMA 5EUQB 5LP6F 2WWTA 2PZEA 1NSTA 2AOWA 1KZ1A 5AM0A 5ENZA 5BV7A 1H2HA 4K9SA 4MS1A 1S5PA 3GUUA 4EDFA 4PPGA 2C92A 4BZWA 3RYFA 3ICEA 5E6UB 2ZJAA 4MUJA 5TARA 2NSDA 1P2BA 3UK0A 5KYYA 4JYAB 3KSAC 1QHYA 5JW6A 4NCJA 3RC8A 2A0FA 3JQ8B 1N1GA 2MOKA 1IC6A 3HM9A 3QF4B 5AVZA 2CJFA 1PDVA 3UBTA 2BW0A 4UTVA 4OLHA 3IUQA 3IAHA 3SS9X 1KQPA 4KAXA 2ENUA 1GNVA 1RRKA 2Z83A 3DWFA 4WKOA 2WW8A 3E4CA 4X44A 1OXVA 3LPMA 3A14A 3VPBA 5AJXA 1BN6A 5LMUB 1EA5A 3IT1A 1WULS 4HT3B 2W2OA 2IOFA 1VE7A 1DXOA 1EWYA 3RJ9A 4I0WB 3KTAA 2E6KA 4R7GA 2PX0A 2GN4A 3TRHA 5A0TA 1GQSA 3UWSA 5JADA 1XZLA 3DTTA 3UIEA 1T6BY 2DWCA 2ZB3A 1WUYA 1E98A 3O0DA 4IDAA 4QDTA 4U3JA 2O3RA 2V1UA 1M6VB 3B6EA 2RHRA 3UN1A 1PWXA 2OCBA 3IPAA 3RT7A 1U90A 1DP4A 2ORYA 4B4OA 3OFVA 2BGWA 2ZUEA 3WRYC 3WP1B 4UHHA 3TQOA 1V48A 1YOVB 1ZN7A 2DBVO 1YB2A 2GCEA 2P77A 4OFZA 1P19A 2GT1A 3KSRA 4KO8A 2XNSA 2AYYA 3HSSA 1TLFA 1RVDA 4Y2YA 5HA5A 1X74A 1I33A 4LJYA 2C1XA 1VG1A 2H06A 1UP6A 2HQSA 3OZAA 1Y4ZA 2FX3A 4UOQA 4OX9Y 3EODA 3KVNA 1IBSA 1QHSA 1IN5A 1T0JB 1UOPA 2XQJA 4ZO8A 5ALXA 3AKCA 1Z0ZA 3PX3A 4E32A 3QE9Y 4M0MA 2GD1O 5ANRB 4C7VA 1C14A 4XYMA 1BVRA 1OY1A 1X1AA 3PP8A 4WBSA 3WMXA 4DSOA 5HK9A 5I7VA 4YV7A 1KC3A 1Q0TA 3IEVA 3AI1A 1P74A 1K68A 4WXRA 2QPLA 1W52X 1BC5A 1KDYA 4AJPA 3ORFA 3VVLA 4I19A 4AZ3A 3DOHA 2MHCA 3OKAA 5DX8A 2PRYA 7REQB 4OOEA 2H1OA 2OD2A 1WV1A 2WJ3A 4R01A 5EZ5A 2HFKA 3A6DA 3K1YA 1IYZA 2Y1XA 1RKBA 3QVMA 4FIZA 5AJZA 1T29A 1X0XA 5EGSA 2HO5A 1BFDA 1L5RA 4B71A 4EY4A 2XADA 2FZEA 1ESDA 3N87A 2ZRKA 4XFKA 3TQHA 3WICA 1VG9B 2MT9A 4JSTA 3MVEA 2Q8PA 1VJ5A 1VZ3A 3A4VA 4CCSA 3TW8A 1WU7A 2CHGA 5BR4A 2X2FA 1YZQA 2IYPA 4J07A 4HTFA 3DDNA 3IBSA 2RE8A 2UYGA 3H5WA 4TMFA 3PIDA 4AJHA 4BYMA 4RF5A 3EK2A 3H5TA 4FE4A 1U9ZA 5KB3A 2GPTA 4G0WA 2OCIA 3DTVD 2NYAA 1ZH6A 3KXDA 4JQCA 3TTWA 4MX8A 4DIKA 4LSGA 1D4ZA 4KPFC 1E4OA 3R40A 4IYJA 5BT8A 2FP3A 3VU0A 4BMOB 5IWCA 1H2RS 3CIFA 1EXVA 1TQ6A 5C80A 1BQ3A 5L7WA 4DR1B 3LGAA 2VZEA 1JDNA 2AW5A 1RZ3A 2P1RA 2DMRA 2H17A 1CUHA 3K5IA 4PQFA 1L5LA 4GP6A 1YL7A 3UXMA 3F47A 5HKKA 3HO1A 5BUSA 3K73O 1MGOA 3JALA 1IM2A 1ID1A 1ODIA 2HSEA 3LPNA 3DM5A 3RHFA 3WYAA 7YASA 1SU4A 3V4LA 3MA0A 2C0CA 1F0YA 1YDHA 1JAXA 1EVKA 2AD1A 3FNFA 3LT2A 4MPDA 1QF7A 4X6YA 3V1YA 4BE4A 4P5DA 4GSYA 5HVNA 4N76A 3V80A 4N03A 5FOVA 1P0MA 3ODPA 1TMGE 1Z4KA 3AQ4A 4RPHA 3KEMA 1R4NA 1XCJA 3AL0C 2YZ2A 1D1TA 3BYZA 3D2LA 4RLSA 4D8TA 1QU2A 4RVGA 3N6RA 4E21A 1EA7A 1FRNA 3JZIA 3UJBA 4F4CA 2ZT8A 4TWJA 4O4LA 3EPJA 4H7PA 5F98A 2R4UA 3L1IA 3Q8XB 3SQDA 3I6QA 4UUPA 4KODA 2IQ5A 4YUAA 1WDWB 3LVRE 1QP4A 3A6GA 3PQDA 2BEKA 1C7IA 4R8MA 4DSZA 1E6EA 5I7SA 1QV6A 1F9AA 2IXAA 2PUCA 1YRBA 3A6LA 3T1YB 5EKTA 1F06A 3TUIC 2XPCA 3AV0B 1KSHA 1Y5LA 1BE8A 1SD2A 4J91A 3VAAA 2PSEA 4RD4A 2IIVA 3HWX1 2WABA 4MKIA 3P32A 1X7WA 4W5HA 4J0JA 4DV2B 1UXKA 4YMTA 4LJRA 3H99A 4H7KA 5I9NA 4M83A 2QVXX 3FVRA 1LW7A 2XIJA 2IELA 4OQPA 5T3YA 1UK7A 1U2GA 5KX5F 3MUEA 1U0LA 1Z82A 3I6MA 3SC2B 3RYHB 1C0PA 3SHFA 4DIUA 4EGQA 3VI3B 3QXSA 4KVZA 5IJXA 3PQ8A 1JWLA 3Q4GA 1QH0A 3Q41A 1XYYA 1AOXA 1XF1A 2MWMA 3DGFC 2EKQA 4KBYA 5BSHA 3S81A 2WIDA 4R1SA 2R47A 1DV1A 3F5FA 3I05A 3WGMA 1MBZA 1EDBA 2UUOA 5TS3A 1E69A 1ZK4A 3DB1A 2Y0EA 4A6EA 3IQWA 1FU4A 1XZHA 3AKYA 3WSWA 4LRUA 2VNSA 3MWEA 2EFGA 1EFUA 1L7MA 4FYJA 4RLFA 2I71A 1IY0A 3NHWA 3PDJA 4HXGA 3ABSB 3F46A 2JL1A 5EEHA 3T3MB 5EPUA 1VZ2A 4CM8A 5LYJF 3EXHC 2IPAB 4PINA 1PGOA 3GFTA 3JQ9C 3SZUA 1X7ZA 3DLAA 5IP5A 3RW9A 5CH8A 4CQLA 4D9FA 1EB9A 2FG7C 1YUBA 4H16A 2CLEB 5EKSA 1WTAA 2OHJA 4MQ6A 3BXEA 5DI3B 3GR6A 1NY5A 5C3UA 5JVDA 4K86A 1QSGA 3Q3CA 2WMYA 5KWVA 2V9CA 4ZQFA 4ZQCB 2I7TA 2AD5A 3H9EO 1M2KA 4J16A 2GVZC 4CR7A 3OAAD 1EU1A 2W5UA 3LBYA 4LIPD 1XTSA 1P44A 1RBYA 1ESNA 1UZMA 3EXEA 4L02A 3S2IA 3E1KA 2PMBA 3F4KA 3FPSA 1X14A 4GR4A 4N7BA 4NPAA 4CF4A 1AK2A 4CUKA 3FZGA 2WFLA 3OKPA 1DAGA 1ZVQA 5CLQA 2HTFA 1N75A 2QJWA 3TPFA 5K0ZA 1G55A 2PUGA 3KJFA 3I6BA 4GI7A 4AMYA 1RRCA 5H83A 1M2HA 2P7IA 5LNK6 2OSBA 4TWBA 5KTPA 2M32A 4O3MA 3WSTA 1Y5IA 4R5MA 1A7AA 1RFGE 2AF4C 2Y1WA 5EJIA 2VT2A 1N0IA 4XQCA 1RJEA 3EXAA 3QTLA 2GYYA 2D0DA 3A9RA 1MN6A 2BFDA 2Y1GA 4UKDA 4DG9A 1H5UA 4RZXA 2R8ZA 3DAFA 2X8JA 1VIMA 2B34A 1RRGA 2GDJA 2W48A 1EVIA 4IGAA 4Y9TA 3CH5A 4HDNB 5K01A 1NN5A 3B3GA 2BMVA 4OJTA 2PXXA 3GRAA 2F1RA 1EXWA 1B8PA 1EK6A 1PDOA 1RHRA 3CF4G 1BGXT 3W5SA 4YJFA 2RONA 3VAZA 5JEEA 3DBVO 1DQPA 1R5JA 5AXAA 4ZAVA 2H07A 1Z38A 1RSZA 4G25A 1XZNA 1E9BA 1MP0A 2NW6A 1OU0A 3KD3A 3LUGA 3BC1A 5B30A 1IRIA 2Y66A 4BN4A 1GJRA 2P75A 5D51S 2BZ0A 4QHYA 2PKRA 5BYJA 1N8KA 4IIGA 1DAIA 3MIZA 2Q4EA 2ZBDA 4GHWA 2EKBA 1DWOA 4RH3A 5JE8A 2I1VB 3IUPA 2C95A 1RYDA 1SUBA 4KWHA 5T7BA 1RBZA 2PH3A 3FRHA 3GF4A 5AHRA 3OZBA 2FA9A 2G06A 2NT4A 1EWVA 4M37A 1WHSB 2WUEA 4X1YB 1FFYA 2Q4DA 5JAOA 3T1TA 4AX8A 3HLYA 1VPLA 3ROXA 2ZE5A 3AR5A 2CL7X 1G21E 1CFZA 2GEKA 3QKIA 2YCLA 5LBTA 1DG1G 4RHTA 1I7QB 3KEOA 3QLTA 1GTRA 4WK4B 1QVAA 4DY6A 1OJ7A 3MGBA 1U2RA 4CT4B 1ZN8A 4FILA 2XA2A 4OQXA 2F1JA 5D5QA 4GD3Q 3ZJ5A 3E4DA 4ZRMA 2XB8A 2Q9UA 3VZCA 4YCJA 4BQSA 1SK8A 4NSNA 5AW4A 3DBHB 5T8KA 4XWKA 3U2QA 3M89A 1CUXA 4E4TA 1LK0A 5HIIA 3U3ZA 4IXMA 3CH6A 4AY6A 2IPMA 3DLHA 1P18A 4DUGD 3B38A 5CFLA 1SCQA 5JALA 4LRSB 1LX7A 3AT1A 1AS2A 4YDHB 1PT5A 1XXHA 1FLNA 3AFNA 3NO4A 4XAQA 1P81A 3C5VA 2CFSA 2FHPA 2NV6A 3STUA 3W7BA 5C1IA 3K8QA 1AG9A 1AUPA 3G7NA 2GI4A 3BGWA 1LU9A 4UW9A 3N1UA 1JF8A 2RKBA 4TL8A 5CIQA 1VRCA 2DQZA 3OETA 1NBHA 4S1VA 2JI6A 4FQ5A 3WIUA 1LPBB 5LDHA 1KQ3A 4FYVA 1H2ZA 4YRIA 5EUBA 3VH4A 4FI3C 2Z9BA 1D03A 4JEMA 1V8FA 4HP8A 1U0HC 1VLJA 2H57A 3CLSD 4R1OA 1KY3A 3VTFA 2X41A 1AN9A 1N3LA 1NVXQ 3NKVA 4YRLA 3GPCA 4LWOA 3PGXA 1U81A 3WGKA 3LK7A 5HKBA 1HZJA 3ZWAA 1US8A 5EE5B 4E1AA 4AN0A 2RGNA 4MA4A 4AZSA 2OCDA 2IF0A 3MJTA 1RXSA 3OF3A 2A6PA 1MUUA 1UP7A 3AMVA 3KQOA 4YO7A 1G20A 1KI3A 2QN7A 2ZJ0A 3L07A 4NZZA 5IM4F 4GR9A 1HH4A 4Q1BA 1L4HA 1VPTA 2Q1XA 4XVQA 2ZRAA 5LLDA 3K96A 3OEEA 3JATA 3M5DA 3MMZA 1ZXLA 1V2HE 5L3SA 4KQIA 3S68A 4DB2A 3QLUA 1LGYA 2DF8A 3AI2A 3SJUA 2EVWX 1B16A 2WZBA 5MFPA 5CIYA 1GZHB 5KHOC 2ZFUA 3QEMA 1HL3A 4NZ9A 3RC9A 3CLTC 2J30A 3B6MA 1KERA 3HVKA 3ICWA 4QUKA 2J3JA 2N9UA 3HRIA 4HAZA 1ZGGA 1EFDN 1FA9A 3ZTWA 3ZUPA 1JT2A 1J8QA 4JX9A 5IJZA 2OQVA 1R5OA 3UXYA 1SHLA 2I80A 3GFGA 3N3BC 3BTSA 3N70A 4Z2YA 1V26A 3BSWA 2GNPA 3MSCA 1G18A 1HT0A 2QZPA 3RTAA 1EK0A 1DZ3A 2WIFA 4OD0A 4HFMA 3O1HB 3OMLA 3ELYA 4O1IA 4Y6QA 5DN6A 3W5CA 3IEXA 1DEHA 3E18A 1X9HA 2JI9A 2WJHA 1YBFA 2QGNA 4TVOA 3IUJA 2JKZA 4LYEA 2WFMA 1U3DA 1WLYA 4CLEA 5B3LA 1NPDA 1Z2CA 4XCQA 1NXXA 1T9HA 4D0GA 2D5IA 1AS0A 5K45A 5FO0A 1CQPA 2N0SA 3KFLA 5KVVA 1MHTA 5BORA 1Q3KA 5G0TA 4YXWA 4B5KA 2R9VA 1RZRA 3EGXB 1FX0B 5C7OO 1GL9B 3NGLA 1J00A 4KTTE 4MV7A 2DTEA 1G8SA 1RTTA 1AKWA 1F51E 1BW9B 5JNTA 2XZPA 2P9ZA 3AIKA 1IHDA 1SBYA 2HMVA 1CR4A 3AR8A 3TW4A 4BLVA 2VXBA 4D6XA 3D7KA 2LTAA 3R0IA 5JZOA 1VYTA 1V5GA 1NQTA 1Q1GA 3P9YA 4WJKB 3W4IA 4X1IB 3L0OA 3P26A 3LNCA 2P2SA 4Q9NA 3ZW8A 5JNRA 5ALKA 5CXSA 1AX9A 4PYNA 3I83A 5H82A 2AOUA 4GRDA 2ZRQA 1NU8A 4IRXA 1DC5A 3ZXIA 1U7UA 3R74A 3W2GA 3UAVA 2RAUA 1EFTA 1L5HB 2NXCA 3LT1A 3GFFA 4RD0A 3ONWA 4EHNA 3H3XA 2VJQA 4RIFA 4MWGA 1Q7TA 4BFTA 1MB9A 5CBKA 3D59A 1J0XO 2PKXA 2YY7A 3ST7A 1KK0A 1TUEA 4R2XA 1XWFA 2PWZA 1FFXA 2R6AA 3PC8C 1X1SA 5IK2A 3PGJA 1D09A 1NDQA 2PV0A 1C4XA 2XR1A 4KRYA 3R9KA 1HLGA 3ETCA 3OQHA 2AEEA 1FPQA 3JQBC 2IYTA 4IEFB 4QU9A 1T0BA 3F6EX 2Z3WA 1T15A 5JXHA 5G0UA 3OZWA 5DCYA 3CVYA 4LW8A 2EFYA 3ZD6A 1TQDA 2PUVA 3RS9A 1Z0IA 3QVVA 5C8YB 4P9NA 1YKSA 5DBIA 5FWXB 5C5CA 3VX3A 3PE3A 1NV9A 1P5RA 1TAGA 1UXOA 1V5FA 2C31A 2H3HA 1YC2A 2WTNA 3PV0A 4Y98A 4DG8A 3WI7A 4RF3A 1HDGO 1XR3A 1PKXA 4BX0A 4A5OA 2MU1A 3V4FA 2CZCA 5DZSA 3A06A 1DO0A 2WEKA 1RWXA 2NTJA 4IDHA 5F12A 4E07A 2O8CB 2VEDA 4BNJA 1E3MA 3BGOS 3WRXC 1USGA 3LPLA 1G8GA 2AWOA 1TKRA 1YUNA 3WBFA 3FOBA 4BMPB 1LLFA 1V9CA 2R2GA 4J9VA 3K6SA 4WZZA 2UAGA 2CHQA 4TSFA 3COJA 3AUFA 1WOMA 5BN4B 2O0LA 3IS3A 4ERNA 4P4GA 3IEMA 2QJOA 3OLWA 2OLKA 2QJFA 4A0RA 1SOWA 1QH8A 4LC1A 1CD5A 1U2PA 1E2DA 4KH1A 2P9GA 2OAEA 1NVUQ 2FR8C 4LE2A 3ESAA 2RGEA 4UUAA 4DFDA 5LKAA 2WVAA 3AYXB 2ZAYA 3M49A 4WXYB 1V7CA 4JLSA 2IHYA 1T8PA 3BE8A 4TVKA 3GFSA 3K5HA 1VLHA 5A3VA 3FMFA 4PN3A 3H1TA 3TLKA 2P91A 3C3PA 1Y3CE 4J29A 3L49A 2HCRA 4Z2AA 3IEIA 4WESB 1C9NA 3GLHB 4O3FA 2LW7A 1ENYA 1SCUA 2PZBA 1QLJA 3BL5A 4YMWA 1Y8CA 4AWAA 3CO0S 1ZG3A 3R24A 1EGMB 1JTEA 2X5KO 4IG4A 4NBSA 4BRUA 5A1TA 4KMRA 1J39A 2F4VB 3PQCA 1G6OA 1MQ8B 3EGIA 2BEJA 4ARZA 2O2ZA 4GWLA 2A7XA 1FSFA 3M4NA 4IIHA 3OO0A 4IWXA 3DMTC 3DAOA 1KFCB 4LZNA 4RCZA 1IAQA 3WYGA 4ZWNA 4L16A 4PXYA 1GDDA 3TSYA 4C7OA 2XUHA 3HKEA 3DH0A 4D25A 1DU4A 4R2HA 3WG9A 3U09A 4F8EA 5JBNA 1A8HA 2MMGA 4JJEA 4P6VF 1V95A 4XRGA 4MR8B 1QHEA 1L4FA 4BOYA 4DAOA 3PUWA 1N2BA 1JWAB 2A0KA 4XGKA 1JVBA 2VFAA 5LD2B 1Z13A 3LWNA 1SPBS 4P5EA 4EAAA 2YJNA 2QTFA 3DDSA 2WF5A 3JWJA 2O1XA 3PFWO 4KC0A 3ON5A 4ACBA 2RHHA 1DBWA 1KIMA 3QYJA 5JRZA 3F6SA 2J5XA 2ERCA 3K35A 3KLNA 5HF5A 3ND9A 4HMPA 4ETMA 5JS7A 4B48A 4B3TB 1Q17A 1YJBA 2I78A 3MTIA 3TWOA 1JIUA 4CF7A 1Z36A 4WY5A 4CL2A 3CNOA 3HN2A 1P4AA 2HMWA 4A1FA 1CRPA 1FP6A 2Q1YA 5DNUA 2JFHA 1G8AA 1QHIA 2BL4A 2QQ5A 3W8RA 4EO7A 5C9ZA 1JZQA 2J5BA 3PX2A 4GLOA 5J2TB 3BWCA 1NF3A 1UMBB 4JHLA 1BMFA 3VKFA 1AHPA 1FFCA 2OCPA 3CH4B 2ZIWB 2GHTA 3QITA 3O83A 2VAWA 5IC5A 3CO5A 3ZJYA 1JFTA 1JR6A 3ZY5A 3ETEA 1OI2A 4WEQA 2GZSA 4UDYX 4E22A 2H0RA 1N7IA 3CPHA 3IAS1 1D4FA 4G9EA 1ZM7A 4PVDA 5LQSA 4IMPA 1UC9A 1MZPA 4DCPA 2HKIA 3C7DB 3HYRA 1UFKA 4CVNA 1D2CA 2GN2A 2JIDA 4GXQA 1JBQA 3EQ9A 4QUEA 1TGVA 4CU5A 4FFBA 1XA4A 1Y6JA 5FOSA 4CLDA 1ZVVA 4MS1B 5KTMA 1XZDA 5C1PA 3WK5A 4R3WA 1ZSYA 3KEQA 3RYFB 2P5TB 2FPMA 2MMCA 3E9DA 4IXNA 1Q0SA 3OM0A 1EP1B 2G1UA 3PXGA 1DEAA 3VDRA 3ZDAA 1JXQA 1HBJA 1RQLA 2VHJA 3I2FA 3KYBA 1UKYA 3PZBA 5EKUA 3VI4B 5AW5A 2R85A 1TYEB 4J4HA 4MQFA 5FTWA 5CG2A 5LIPA 5F1KA 5ARDA 3RIMA 1MABA 4L3VA 4CI0B 2Q6VA 3DAGA 2WD9A 2P79A 4LDQA 3AU8A 2YQ5A 3B3AA 1XZ8A 2GO1A 2CXXA 2X6RA 2P68A 5HF9A 2QQGA 1R66A 1H1DA 2SKEA 2EXXA 1QNLA 2Y0DA 3QE0A 4MJ7A 5BQ5A 2RGRA 4CLRB 4X7RA 3AR3A 4MJXA 3U7GA 4A2WA 1UM8A 3TUJC 3VQTA 5KPJA 1G1MA 4U3JB 3UKOA 1QLHA 1BYUA 3AR9A 1Z5VA 1GCGA 5E2AA 2WVGA 2PUDA 5SYNA 4GGPA 2PD6A 2AG0A 2A9PA 1D4AA 2VJOA 1SULA 3AFIA 1C4KA 2IZ1A 2WYHA 1JA0A 4MLPA 4IL5A 3EDQA 1OLXA