1N7HA

Crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
339
structure length
331
Chain Sequence
b'RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-D-mannose-4,6-dehydratase
publication title The structure of the MUR1 GDP-mannose 4,6-dehydratase from A. thaliana: Implications for ligand binding and specificity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 129
structure length 331
sequence length 339
chains with identical sequence B
ec nomenclature ec 4.2.1.47: GDP-mannose 4,6-dehydratase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n7hA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1n7hA01
1KEVA 3GHHA 4NJMA 4AFNA 4BNXA 3K9QO 4J4HA 4R69A 5CDYA 4IMRA 1YQGA 4EUHA 4W6ZA 2Y1OA 3DONA 2ZCUA 3MOIA 3ONFA 1M6WA 3AI3A 1WAMA 1WVGA 2P68A 1TT7A 2IXAA 4DRYA 3DBRA 3ZGYA 2AEMA 1BXGA 1UXJA 1DLJA 1E1MA 4WCFC 1C0LA 1QYDA 3C7DB 4AJ1A 5I8WA 3L07A 1AXEA 4UULA 1JDJA 4E3ZA 5I7FA 3E9QA 5TT0A 3ZHYA 3M6IA 4HFRA 1IY8A 2GPTA 4LW8A 1GYQA 2X4GA 5BR7A 3TL3A 2GF2A 3PQEA 5A9SA 4QEDA 2ZTVA 4DLAA 3UXYA 1E7QA 2PZMA 3MZ0A 4E31A 3RQSA 4AJPA 4EJMA 5U9CA 1LLCA 3HJAA 3O8QB 3MEQA 3CINA 3PEFA 3BMQB 2QRJA 2YDYA 1V6AA 2ZQZA 1X7HA 3E82A 3H3JA 4NMHA 1PGQA 2BI8A 2J5KA 4RPKA 4E33A 4OO3A 5JDIA 1ONNA 5IZCA 3OJLA 3QJ5A 2VHXA 2YW9A 4WK6A 1D1SA 1UDCA 5JXWA 2O23A 5AYVA 3HUDA 3ITDA 1OMOA 1SMKA 2J5RA 1TA4A 3UW3A 3JQEA 4DGSA 2G0TA 1XG5A 2YHUA 1G0NA 3VDQA 1JKIA 3WSWA 3P19A 4NJMB 3GAZA 4JCOA 3H7AA 4YQYA 3WGTA 3MJEA 2O3JA 4JJGA 3GVIA 4QQRA 1WLYA 2ZQYA 2YY7A 5MGBA 1LSSA 5EJ2A 3GEGA 4KTTE 4N5LA 3D4PA 1T4DA 3JYLA 2X5OA 5TF4A 1UDAA 3NAQA 1OC2A 4J6FA 3PHGA 4BV9A 2CF6A 3CXRA 4CMKA 4NBTA 1I36A 3DBRB 3LC7O 3P7MA 4ND3A 4MKRA 2BKAA 3AU9A 1BXGB 5JNLA 5EQFA 4QO7A 1FDVA 1HYEA 2JFHA 2B5VA 5KOIA 3F9IA 4BNNA 1Q7GA 3Q11A 2NWQA 2EV9A 1XYGA 2Y1GA 5TSDA 3UF0A 4XX0A 3VPFA 1OZAA 2HJRA 2NSDA 2X7HA 5A9SB 4YWJA 4GKVA 9LDTA 3HFGA 3Q9UA 3KV3O 1DIBA 1TXGA 3R1IA 2PNFA 4PG6A 4PLZA 1HL3A 3L0DA 3V2UA 4GGOA 4F46A 5B4VA 1RPNA 4BGEA 2NU9A 4ZGWA 4E5KA 3JV7A 1ADFA 2FZWA 3B1KA 1VLLA 1DRWA 2A92A 2WYUA 1R66A 4BO3A 4PG4A 1F8GA 5TIIA 1MX3A 3A06A 3G3EA 4KQXA 2X9NA 3DR3A 2OO5A 3RASA 3FWNA 5A9RA 3PJDA 1I2BA 3TOXA 1YB5A 4FJ1A 3CZMA 1AHHA 5CDUA 4X54A 1V9LA 4D3SA 4XR4A 4DLBA 4L4XA 1U2DA 2PTGA 5EMHA 5EERA 1R0KA 3ROKA 2JL1A 3JQAA 3LZ6A 3N7UA 4WEQA 1E7YA 1KERA 4P4NA 4BKOA 4R5MA 1ZMTA 4FC7A 4W9NC 4KOAA 3Q3CA 3OEYA 1E3EA 1R0LA 3DZJA 3E8XA 4DMLA 2I99A 4IPTA 2B4QA 3H3FA 1NBOA 4BNGA 3A9WA 1K6XA 2D3TA 4ND1A 4CLDA 2PFGA 3T4EA 5FEUA 4WLOA 4CLEA 2OMEA 3EYWA 3TSCA 2GO1A 3ANMA 2F00A 1Z75A 4XYLA 3NKLA 4E5PA 1GZ3A 3SXPA 5BSFA 4TRRA 1D4FA 2C5EA 4WCDA 5L7YA 4XDZA 4CMGA 5G0TA 3W1VA 1ENPA 3K30A 5KIAA 4WASA 3P2OA 1FDSA 1LLQA 5KVVA 3JQ9A 2JHGA 3ZWMA 1NFRA 5ENDA 4J9VA 4Y8VA 4D44A 1SC6A 1DIRA 4RZIA 1X14A 2VOEA 4Q3CA 5ENVA 4BO2A 2IEDA 5LC1A 3HDQA 5JC8A 2Q2VA 2P4HX 3RFXA 4R9RA 1LTHR 1N1GA 4XGNA 4HXYA 3PXXA 5JSFA 3KYCA 3RFVA 4GX1A 5TX7A 4C7KA 5JY1A 4QXMA 3T7EA 3GAFA 3GOHA 1IPEA 1BWSA 3L4BA 4XYBA 3UHAA 3TJRA 1DJNA 2I76A 4WNCA 2P91A 3CE6A 3PLNA 2OZPA 1NM5A 3PYMA 1ZJYA 4WLVA 2FR1A 4OOEA 4MVJM 3PHHA 3VPSA 5DF1A 2OGUA 1Y5RA 1VSUA 3JQAB 1FK8A 2C82A 2E4AA 1ZEMA 3BHMA 1ZSYA 4JP2A 4CMBA 1T2AA 2CDAA 5L4SA 2HMTA 3OJOA 3ZWPA 1BVUA 1N9GA 2D1YA 4IZHA 2QZZA 1NQTA 3EDMA 4HV4A 1BXKA 3IUSA 1PJTA 3PTZA 2P5UA 4RVFA 1Q1NA 1TEHA 2EGGA 4IDAA 2X9GA 4CMCA 8LDHA 3QLJA 3F4LA 3GN2A 1VE9A 2FSSA 2I65A 1YONA 3H65A 5EIOA 3SBOA 4ND5A 3ZU2A 4E2ZA 4ALNA 4Z0PA 1LDMA 1EBUA 4BO9A 4UEOA 4TKLA 3WIDA 4IM7A 2ZTMA 3JQ6A 3RJ9A 4B7CA 4ZU3A 1XU9A 1VC2A 3QQPA 1KY4A 4M89A 5AXAA 1JA9A 3RFTA 4CM6A 3AM3A 1ZW1A 2ZB3A 3DZFA 3FPCA 3NGXA 3OMLA 5COAA 1ISMA 3HDYA 4P38A 3RI3A 3KYCB 1XLTA 4RV9A 1KVTA 1H0KA 2ILTA 4RPLA 2VRCD 5JDIC 5IZCC 1F0YA 1OC4A 1NWHA 4RQUA 4Y9DA 4XJTA 4ZRNA 3VTFA 3ZDFA 5L45A 3L6OO 5JCJD 1M76A 1TLTA 2IZZA 1J49A 1I3LA 2X1HA 5TLSA 4E4YA 1XDWA 3GDFA 4OM8A 3TNLA 4KDFA 4CODB 5KVQA 4XQEA 1PWZA 1T26A 1V3TA 3R3JA 3GFGA 4I9HA 5JAIA 4J7XA 1ULSA 5JBIA 3ASVA 4CQMD 1QR6A 4TSKA 1E1NA 1NHGA 1KS9A 1N9GB 2EERA 4AJNA 4CM9D 3WYCA 5KJ6A 4GVXA 3UKOA 5A5EA 1GZ6A 2VZ0A 2BFOA 1KIFA 1TT5A 2QIOA 4P4GA 3EZLA 1Y7TA 4OQYA 4E6PA 1DC5A 1Y8RA 5L40A 1QLHA 3WDSA 1E7WA 4A03A 3FTNA 1CERA 3C7CB 4ZQFA 1K89A 5CDGA 1A9ZA 2BELA 2HQ1A 4GI2A 2G82A 4CR6A 4EJ0A 1U4OA 2NADA 4RLHA 1BRMA 4E2WA 2QRKA 5T6BA 5L7WA 2I66A 3ADPA 2QHXA 2FRDA 4J4TA 3HNPA 3SJUA 3F47A 4GWGA 3QVWA 3ZHXA 1H94A 1PL6A 5T5QA 1NTOA 5JW6A 5FI5A 1HDXA 5TNXA 2PY6A 2ZIZA 3AUAA 3FD8A 3HB5X 3EY4A 2C7VA 3I9JA 4XJSA 2YZ7A 3PIIA 3KM0A 2C20A 3RU7A 4AJJA 3SVTA 3B1FA 2BGKA 4BNKA 3PJFA 3F3SA 2Y0EA 1V3UA 2AW5A 5EN4A 3UAGA 4CLHA 3PK0A 4NQZA 2W8ZA 3LT1A 2CDBA 2CMDA 2CSUA 1ZZEA 1CETA 2WD7A 3RUIA 2H5LA 2CDCA 2WE8A 1A4IA 1U7HA 1CF2O 3EUWA 4L8VA 1PJ2A 5I8ZA 3GRPA 3IC5A 3TFOA 2V7PA 3ZV4A 3PFFA 2PH3A 2NQ8A 3L6DA 2UUPA 1PU2A 3H6KA 4J2OA 4Q3EA 4YTEA 3AU8A 4OJNA 1OFGA 1Y9AA 4UREA 5K9ZA 4BO8A 4I9NA 2RAFA 2HMVA 1A71A 1ISHA 1PWXA 3QVXA 2X0RA 4UUOA 5FYDA 2OP1A 4FFMA 1PEDA 3IJPA 3LLVA 1X7DA 4FB5A 3H2SA 1TT5B 1HLPA 4DVJA 5DOZA 2BMAA 1PZGA 3BYZA 3DL2A 1Y8RB 3R0IA 3QP9A 3GZNA 4A5OA 2E37A 1I2ZA 4ZHSA 1WP4A 1N8KA 1IYZA 4UVEA 4J1TA 4MPDA 1I30A 1H93A 4J16A 3JQ9C 4BMNA 1IPFA 4CPDA 1I3NA 4TRMA 4BO7A 2B0JA 2XOXA 4YQZA 1DXYA 3C1OA 5JDCC 4CR7A 1JVSA 2Q1UA 4OIMA 3GLQA 1JN0A 3QWFA 4OL9A 3CPSA 2JFFA 4Q3DA 3W4KA 4TVOA 4B3HA 4NH4A 3I5MA 2NU7A 1EBFA 5KJEA 4EEXA 3PJEA 1XEAA 1U3WA 3DFZA 1IOLA 3WGQA 4YAIA 1PS9A 3L4BC 2CFCA 4BNFA 4A7PA 3H8VA 1RM4A 3S2EA 4Q3BA 3I6QA 1NPTO 2WD7B 2BFAA 1DAOA 3HWRA 3GVCA 4PG5A 1P1IA 4D0SA 1ZEJA 1Q0HA 3KTDA 4BOYA 1DOHA 3ZWXA 3JSAA 5HRUA 3AUTA 3QWAA 2C5AA 2GUGA 1LDYA 4R41A 4B4VA 2JHFA 4NU6A 3C3XA 3MJTA 5JMWA 4DPKA 4R1TA 1SZJG 5DCUA 3KUXA 4H16A 4J91A 5KTKA 5AXCA 4B3JA 2OFPA 3N58A 1WWKA 1CIVA 2WJPA 3QVSA 1P0CA 2CF5A 2A9FA 3IKTA 4CR8A 4BKPA 1VL6A 3VOSA 3GZNB 1LC0A 2BGLA 1EK6A 2VYNA 1HYHA 4U7WA 3GUCA 3KSUA 3AI1A 1NQAO 1EE9A 2I9PA 5AQ1A 2CY0A 1HF3A 4Z9XA 4TMFA 5TC4A 3GNTA 3LF1A 1RYEA 4WUVA 4IXWA 4DQUA 4PLCA 2EWMA 2O7SA 4GAEA 4JBHA 3W4JA 2Q1SA 4F6LA 4J0FA 1NFQA 3U09A 2IZ1A 3TWOA 4XQCA 4XYEA 4XR9A 4OKNA 3U9LA 1E1KA 1IL0A 2PD6A 4R1NA 3UGKA 4GX0A 5I9MA 5CPFA 3DFUA 5MDHA 1ZBQA 3JD0A 1EDZA 4HFMA 2TMDA 2YQ4A 2DTEA 5JAZA 1GUFA 3AOGA 3TN7A 2H63A 3GDOA 2O7QA 4R51A 1IE3A 4Y6RA 1D3AA 1IULA 3MTGA 5EINA 1KEUA 5L9AA 4ND4A 1X0VA 3WICA 2RH8A 4ALMA 3PJGA 5U4QA 2NACA 3H5AA 4CM4A 5I7VA 3JCZA 4PGFA 4BO4A 4FGSA 3OJ0A 4CM5A 1B8VA 1MG0A 1DFGA 1MLDA 4I5DA 3BHJA 4BGIA 1WPQA 3H5RA 5A02A 5B37A 1A5ZA 3ANNA 4NBUA 3HB4X 3ZCXA 4WGGA 3IL2A 4Q39A 4I8XA 3QWBA 1F14A 3Q9NA 4MVJI 3FN4A 3GF4A 3NT2A 1MG5A 2UYYA 5KNLA 3GT0A 1HSOA 2Q45A 2VHZA 4BV8A 1QLJA 5IDQA 2PKQO 4PG7A 3H9GA 1MGOA 1K0UA 4ZN6A 4E5MA 2Q50A 3EMKA 3V1TC 3RUEA 3WG9A 1E3IA 1FJHA 3H9UA 3I83A 2GN8A 2Q4EA 5IJZA 3JD4A 1JWAB 5JY6A 3CKYA 4S3MA 3TOZA 5A4DA 1GV0A 2PD4A 4IJWA 4JBGA 3RKRA 1A72A 3WJ7A 1W8DA 2G5CA 3O38A 4N5NA 3ZV6A 1VI2A 2H6EA 2AQHA 3E1KA 3RJ5A 2D5CA 2Z95A 3K92A 3WFIA 4J49A 4EGFA 2YV1A 1BTOA 1PR3A 2VNAA 3BMCA 1SCUA 3FNHA 3KBOA 4PRKA 5F3RA 3W4IA 1P9LA 1E92A 3VVCA 3ZNOA 4J1SA 5L4NA 3PDUA 3NEPX 4HP8A 2ZB4A 1XELA 4NPCA 5A3JA 4ALJA 4CM4B 3C8MA 4D79A 4L74A 1DEHA 3UUWA 4DC1A 3EHEA 1Z7BA 3ZWOA 1L1FA 4D3DA 1HLDA 1WDLA 2R00C 1LDEA 2BHLA 3UICA 3WTCA 4DIFA 3INRA 1SPXA 1ADCA 3OSUA 3MCVA 4KWHA 2LDBA 3UCFA 1UXGA 3GUYA 4FSHA 4KMSA 1YXMA 4RPHA 3NUGA 3OFSA 3S8MA 1FF9A 2B69A 3S2IA 1BSVA 4I1IA 2VOJA 1M6HA 4Y6SA 4ZQGA 3U4HA 4DLLA 3KEQA 1PS8A 2XPCA 3WXBA 1XHLA 2EEZA 2RHCA 5G0SA 4BQRA 1SOVA 3SC6A 4MKXA 4JK3A 3KXDA 1KC3A 1EFLA 5CEJA 2RCYA 1XSEA 4XQGA 4O5OA 3I52A 1TVEA 4IUYA 1SB9A 1R15A 1TB4A 3JQFA 1SEVA 4R5HA 3ZWVA 1VRWA 2I3GA 1WMBA 3DZGA 4DC0A 2GR9A 3A1NA 3ONEA 4QTZA 5G0WA 4BNWA 5IN5A 1EVIA 4BUCA 5THKA 2IDZA 2W2LD 1K2WA 1MC4A 4WLEA 3U0BA 4E5NA 5G4LA 4DQVA 4UEJA 3IDSA 3ENKA 5DP2A 4CLOA 3MJCA 3LQFA 4I5EA 1RKXA 2DQ4A 2NV6A 1P1KA 3WWZA 3BMCB 3TFQA 2DU8A 4GMFA 1VKOA 4R1UA 2I3AA 1LSOA 4CV1A 1BW9A 1N7GA 3Q0EA 4FQ8A 1R4MA 5A3VA 2AHRA 1EVZA 3KYDB 4II3A 2Y67A 3DXFA 3M2TA 3VH4A 4XYMA 2VHWA 3H5NA 2VZ9A 4E2YA 1RYDA 2A94A 2QZ9A 1H2HA 4TZTA 4CLRA 4XA8A 1NNUA 5BNFA 4PLHA 1E77A 1HTBA 1U3UA 3QE3A 4LRTB 3WTBA 5FF9A 5L95A 2HLPA 2IZ0A 3QIVA 3O03A 1T1RA 2O4CA 2P9CA 1HE5A 3OQBA 3K96A 3D3WA 2AE1A 3E5RA 2GLXA 1V35A 1Q0LA 4YBZA 2J3HA 1NXQA 3NTOA 3ZH2A 1XU7A 2IE0A 2YDXA 1ARZA 1HEUA 4U8GA 1QV6A 4PLYA 5U1PA 1GPDG 5ER6A 5HA5A 2X5JO 4CMEA 2FZEA 5DZSA 3FPLA 1CQJA 4BKRA 3VPXA 5B4TA 4RF3A 3WGOA 2B35A 4J1NA 3IKVA 3X2FA 4U6SA 2VYVD 1LDGA 2VTEA 3U5TA 1UDBA 2ZYDA 1PJQA 1T4BA 1NR1A 2GGSA 3LYLA 4AJ4A 1B16A 5JLAA 5JO0A 1LU9A 3PWSA 1YBMA 3BA1A 2YHIA 1HE3A 1QRRA 3GVPA 1DRUA 4OMUA 2ZTUA 3DBHA 3KSDO 4J7UA 3RC7A 2AA3A 3RWBA 4DYVA 2FP4A 3U49A 2DBZA 4J1QA 3D0OA 4OSPA 1GUZA 4CLOB 1I10A 3I4FA 2HK7A 3PFWO 1PTJA 4DIBA 1QKIA 2HO5A 2JCXA 1BW9B 4XRGA 4RPGA 1R4MB 2Q4BA 3G79A 4NBWA 4YRAA 5ILGA 1DAPA 3COSA 4ILKA 4EUEA 4IDFA 2CVQA 1H6AA 2X58A 4CM8A 1ZK4A 2AEFA 3VH3A 4CLRB 3PWKA 4TKMA 3HZZA 5F5LA 1YWGO 4FFNA 3PGXA 3U3XA 3KLMX 1EZ4A 2NTVA 2WEKA 4Z3KA 1I32A 5LDHA 2NLOA 1YE3A 3D3WB 1LDNA 1ZVMA 2OP0A 3SLKA 2YV3A 2X5KO 2Y1FA 1UXKA 3Q2KA 3H2ZA 4MP3A 3SLGA 4Z3DA 5FFFA 2IEBA 3JYQA 4DIOA 4NNJA 1BDMA 2EP5A 2WE7A 3QRWA 1KVQA 3B6ZA 2VHVA 3MTJA 2XF8A 2J3JA 4BL5A 3WOHA 4NFHA 4XB1A 1S6YA 1UAGA 1A7AA 4KDEA 2ZB7A 4RZHA 2FWMX 3LT0A 3GG9A 3OJFA 1B8PA 3EAGA 1AE1A 4HBGA 1MB4A 1YB1A 3BMNA 5EL0A 2PZJA 5THQA 5JDCA 4GSKA 1YDEA 4QFDA 2OBNA 4TROA 2J3IA 1VKNA 4GLLA 3OECA 5TJHA 2YHIB 1E3WB 4Y98A 3L9XA 4MVJE 1S7CA 1YH3A 3DBHB 4HX5A 4NHEA 4OXNA 1U3VA 3H9JA 2EHDA 4XWYA 3ZWAA 1L7EA 1P1FA 1A27A 3B70A 3KB6A 3K31A 1P1JA 4DBVO 2O3QA 2VRCA 2HRBA 3AUSA 4YPOA 3AOEC 2B4RO 1EVJA 1Q7CA 5HM8A 3NTQA 1VM6A 3BTSA 1IHYA 2JKVA 3WLFA 3RIHA 2Q1TA 5KKAA 5JCJA 2JFGA 3DAGA 1MXFA 4A73A 4CM8B 1GUYA 2I67A 2PR2A 1HT0A 3JQBC 4R4JA 1F17A 1T25A 2HJSA 4CQLA 5F5NA 1W0CA 1WMAA 4CQMA 3VZQA 1PGJA 4ZQHA 2EGHA 2YJZA 4KUHA 1N2SA 1KYQA 3S1LA 3OIFA 5G0VA 3HHPA 5I7EA 4CM9A 2QYSA 3WGGA 5DT9A 3QV1A 4CM7A 1PJ4A 1PJ3A 3WWYA 4YA6A 1DHTA 1H2BA 4K6FA 2D59A 4O59O 1UUFA 1ZXLA 5L7TA 5IDYA 1KOLA 3WGZA 1P44A 1PQWA 2V6MA 4YAGA 5C3MA 2O48X 4D46A 3AUUA 1D7OA 1C0PA 1MXHA 4RVHA 2GNAA 4RO0A 4RF2A 1W4ZA 3BMNB 1VJ1A 3PWZA 3JQFC 4JQCA 4E32A 4QSMA 2NVWA 5DN9A 3X2EA 3ON5A 3ANLA 3CIFA 2H9IA 1E3JA 1Q7BA 1E6WA 4R9SA 1DRVA 3M1LA 4XB2A 1B0AA 2G17A 5DBFA 5G0UA 4HNHA 4NBVA 3V1YA 4HFJA 5DCYA 4DBZA 3FCOA 1WNTA 4XCVA 1FDTA 2Q3EA 5L4LA 3RAJA 3WS7A 2G76A 1O95A 3KYBA 2Y68A 4XDYA 5FI3A 4URFA 1JQBA 4PIVA 3KSZO 4IY1A 3MWEB 1PQUA 4W7HA 1HDYA 5A05A 4PN3A 2PLAA 2B37A 2DPGA 1JAXA 3M2PA 4LISA 4B7UA 3ASUA 1ZKMA 1ADGA 1MFZA 3ORFA 5IFLA 1XWFA 3NJ8A 3PZRA 3K5PA 3NT4A 5EPOA 4AJIA 1ZNQO 1ONPA 1VJ0A 1YGYA 4H3VA 4JGBA 4YJDA 4CQLB 5IN4A 4CQMB 1IHXA 1VL8A 3DBLA 4KUGA 1ZK3A 4OH1A 5CAEA 5DDIP 1HRDA 1ISJA 3I1JA 4J0EA 1NP3A 5KJ1A 3U4IA 2YV2A 4YT4A 3DO5A 4N18A 2UV8A 4J90A 4BMSA 1LA2A 1YO6A 5CEFA 4CMEC 4FDAA 1NPYA 2C54A 3CZRA 4JN6B 4EBFA 1MFPA 1EQ2A 2WSBA 1DIAA 2I6TA 1GQQA 4CJXA 3GG2A 3C24A 3O26A 4YRDA 4A2CA 3GC6A 3OBBA 3GMDA 1MUUA 3H9QA 3UH1A 2VWPA 1CYDA 1ZUD1 3FHLA 1N5DA 3AFMA 4FN4A 4YXFA 1IUKA 2HK8A 2Q99A 3WQQA 1KBZA 1I33A 3RU9A 7ADHA 5KKCA 1HDZA 1F06A 4FIZA 3AM4A 3ZV3A 5ILOA 1LDBA 2GD1O 4P8RA 4TZKA 4Z9YA 3ICCA 3WMWA 5IXYA 3JD1A 4OAQA 1ENOA 3JYNA 4K26A 1R12A 4W82A 1ADBA 4K28A 2VCYA 3E9MA 4IINA 1QYCA 2I5PO 3DWFA 3AY3A 3W6UA 1M2WA 4UVHA 3B1JA 3AM5A 4Z9FA 4B79A 4FFOA 4BGVA 3KO8A 3ROPA 1E5LA 3E5MA 4FJ0A 4ALIA 4LGVA 4QX6A 2X0IA 4B4UA 5KWEA 1AXGA 2EG9A 1Z82A 4XD2A 2NNLD 4K9DA 1P77A 5ADHA 4ID9A 3DMYA 2UUOA 1YL7A 5F1KA 2R6JA 2ZKLA 4NK5A 4EYEA 3KETA 3I9NA 3DBLB 4UVDA 4BNTA 4IBOA 2R00A 5AXBA 1WDMA 3TQHA 4ESOA 5DP1A 4YT2A 4PG8A 5DBGA 2Q49A 3INGA 3UCXA 4J43A 1YVEI 2A4KA 3CMMA 4FC6A 4FCCA 5BSHA 1JAYA 1ENZA 3D3EA 3GPIA 3W8DA 4PLPA 3LF2A 1FDUA 1H9BA 1N1EA 5TGDA 4MP8A 2Z1NA 1XCBA 4IQGA 3ZWWA 3IIEA 5JS6A 1I3MA 1ZJZA 2E48A 3E9NA 4RORA 2QRLA 1WXDA 4EDFA 8ADHA 3JQGA 5CFZA 5KCZA 6ADHA 5BSEA 4LSWA 5KVSA 3WQRA 3BIOA 3L77A 4IGEA 3DMTA 3DOOA 1IZ9A 3KRTA 4J2HA 3RUAA 2O3UA 3FRJA 4CMJA 2AG8A 4YB8A 3EGOA 3N74A 2W90A 3RUHA 1HDGO 3L9WA 3AY7A 4IS3A 1J0XO 1HDOA 3L6EA 3QWIA 1I24A 3GRKA 3OQ6A 2RIRA 5CPBA 5DNAA 3WR5A 3ZN2A 1A7KA 4XIJA 3LSYA 2GERA 2HRZA 1NVTA 2GYYA 1SO8A 1Z73A 4PLFA 2GDZA 1SNYA 1E7SA 2Y1EA 5ER9A 3VDRA 5B12A 4L4RA 4YCAA 5DULA 4E0BA 4E30A 1PJCA 1IZ0A 1ZMOA 2BI7A 4JROA 4D0RA 1FDWA 3NYWA 3T7CA 2X8LA 1GD1O 5TS3A 3WB9A 1GTMA 1H6CA 4Q9NA 4D45A 1PGNA 1DBVO 3AI2A 2FMUA 5COBA 5J23A 3CMCO 3DTYA 3NTRA 1O6ZA 2JCVA 3DOJA 3BMOA 2VWHA 3RBZA 2DBQA 1R4NA 2VUUA 4XYGA 4PVCA 3VZSA 2D8AA 1L7DA 2JAPA 3C85A 1VL0A 3WFJA 4B8ZA 3AY6A 1YL5A 2F1KA 4DREA 3LC2O 3FTPA 2B83A 1HSZA 2DAPA 1X15A 3HDHA 2C29D 4YJGA 2VT2A 3EC7A 3RBXA 1UZLA 3PLRA 1GR0A 1B3BA 1WW8A 3G49A 3V5NA 3GVHA 1I5RA 3JQGB 4BNUA 1OI7A 1RJWA 1PL8A 2FOIA 2O2YA 4DYDA 1LBEA 2BD0A 3ABIA 1GPJA 5A04A 5LCXA 3V2GA 4N54A 2EKLA 3D4OA 1U9JA 3JD3A 1KEWA 1AUPA 1F12A 1O94A 2FR8A 3WNQA 2POQX 2W2KA 3FNEA 1ML3A 4Q3AA 4CM1A 1LEHA 4HADA 3EVTA 3TRIA 2G1UA 3HDJA 2JJYA 4RVUA 3V2HA 2E6UX 1U1IA 5CDSA 1T2CA 3MJ4A 3ZI0A 5HBRA 4PFJA 5B4UA 4HFNA 2PZKA 4LVCA 1JVBA 4PVDA 5IAAA 3C1AA 4FW8A 4LMPA 3TZ6A 1T2EA 4BO5A 4DPLA 1BMDA 1BG6A 1ZK0A 1HETA 1CRWG 1A4UA 1O89A 1C1DA 2ZATA 4NIMA 4WOJA 5C37A 2AQKA 1KY5A 3FSRA 3DZKA 2JD0A 1SEPA 2OORA 3IAHA 4L4SA 3M1AA 4U0KA 4R68A 4BGUA 1QP8A 1RM3A 1O8CA 4YAEA 4J7CA 3BMOB 5TRTA 3PZBA 3JYOA 1R4NB 4JLWA 4RGBA 2XAAA 6LDHA 5JAQA 3RKUA 1UXHA 4E13A 1GADO 2O3TA 3ST7A 4BKUA 3LDHA 1CWUA 1JKJA 4ITUA 4RF4A 1DB3A 5HS6A 1U3TA 3WIEA 2VQ3A 3PP8A 4YJGB 5K6AA 4I9UA 4MIOA 4O63O 1PJSA 4RVGA 2VNSA 4WJZA 4YRBA 2EP7A 3AFNA 1JW9B 1P74A 1PZEA 3LT2A 4KP7A 4BO1A 1XA0A 4CMAA 4IZIA 5JMPA 3ZU4A 4AJLA 2H1SA 4GPD1 3F4BA 4D3FA 1KETA 2Y99A 4FPXA 4XGIA 5EESA 3JQ8A 4TRNA 3GY0A 4LMRA 5TQVA 2W2LA 3ETGA 3G1UA 2EW2A 2GRAA 2J6IA 2PKQP 4R1SA 5H82A 1JWBB 2RBEA 2W2KB 4YJFA 3Q6IA 1Y6JA 2BF7A 2VTDA 2UAGA 1H5QA 2V6FA 4M87A 3AOEA 4C7JA 2VN8A 3NX4A 1LQUA 3KOUA 4OOFA 4BKQA 1VJTA 1R6DA 1UP6A 1NVMB 2PGLA 3D7LA 1I01A 3B20A 4OYRA 4U6QA 4CUKA 1IB6A 4OGWA 5T8KA 1XGKA 3KYDA 4ZRMA 1NX6A 1D1TA 1E5QA 4MJLA 2EIHA 4ZVVA 2A35A 3QWHA 3AWDA 1C1DB 3ZWBA 5GY7A 1GEEA 4LN1A 2C59A 1XIVA 3ZWCA 3JQBA 4EZBA 2IYPA 3K73O 4OKIA 4AVYA 2JD1A 2NVUA 5GZ1A 4GSLA 3UOGA 3MJVA 3K2BA 3DTTA 3FI9A 2DUUA 4G65A 1HE4A 1ORRA 4YT5A 4XGKA 3S2FA 1QV7A 3DAPA 4DWVA 4W4TA 2OXIA 5ITWA 4GKBA 4Y67A 3HQ4O 1UJMA 5B1YA 1QG6A 3DDNA 3ZWNA 4BB6A 1W6UA 2WDZA 3GH3A 3GNQA 3WNVA 1WZIA 3F1KA 3GGOA 1N92A 3OETA 4RQTA 4MVJF 1I8TA 1J4AA 1DLIA 1EUZA 3EZYA 4IJVA 3WSVA 4I5FA 3L4SO 2VYVA 1DC4A 4FOSA 4YACA 1EDOA 4WPGA 1K6IA 4R16A 3PIDA 3EK2A 1GQYA 1NPDA 3BTUA 4PZEA 3OM9A 1LJ8A 5IG2A 4K1LA 4DQXA 2CZCA 5T57A 1EMDA 2P4QA 3DMTC 4WEOA 4IDGA 3RC2A 2PZLA 2YYYA 3JQ8B 1GZ4A 4U5QA 5H81A 3CTMA 2ZK7A 7MDHA 4QO8A 4QT0A 3EVNA 4JJFA 1DC6A 4YT8A 2DFDA 4PLTA 4YVFA 4YJFB 4IJKA 4RVDA 1O0SA 4FJ2A 1GCOA 2WD8A 2FR0A 3ROMA 3VPGA 4B4OA 4IXTA 1V3VA 3TZQA 1P45A 5JCXA 5I9NA 5CHEA 3HN7A 1GQ2A 2V6BA 1A9YA 1GL3A 5CEEA 1XQ1A 1UP7A 2X23A 2CVOA 1GU7A 1T1SA 1ENYA 5CDTA 1X1TA 2O2SA 4GVLA 2HKIA 4ZJUA 4DTIA 3ZV5A 2NVUB 5ITVA 3PHLA 2Y0CA 1RM5A 4U0JA 2VRBA 1M67A 5IZ4A 4IGFA 3STHA 1ZSNA 1DC3A 3GEDA 1LUAA 1HZJA 1R0SA 5H83A 1QYXA 3PQFA 3WMXA 2VUTA 4NJOA 5JC1A 4GWKA 4JX8A 2AMFA 4O1MA 4M49A 4HY3A 4MVJD 4WNIA 3UCEA 3RC1A 1G0OA 4M86A 3GQVA 3RSHA 5TT1A 3OA0A 3DC2A 4JNKA 1NQ5A 2NUAA 3U4DA 2O3RA 4BNYA 3OICA 3IQDB 1MV8A 1QYVA 3IP3A 3ZW8A 3O9ZA 4IQ0A 5F1OA 2HMSA 4B3IA 3C7AA 2B36A 2FSVA 3G17A 4I5GA 4LVUA 3ETDA 1X7GA 2PV7A 2XXJA 3D5TA 4D43A 1HKUA 1LX6A 4WLNA 1KEPA 2EXXA 2DPHA 5GMOA 1PZFA 2QQ5A 4IJUA 1K5HA 4FGWA 1P1HA 4PZDA 3ZW9A 1ISFA 3VH1A 4XIYA 3S2GA 1EUDA 1E3LA 1E3WA 4IQ8A 2AG5A 3OQ1A 4N7RA 3E48A 2DM6A 4DMMA 9LDBA 4ND2A 1NVGA 1KC1A 5BT9A 4NG5A 1E6EA 1DPGA 1WDKA 4BS9A 2GN6A 4RDIA 4L9RA 1GV1A 2HSDA 2WYVA 3D5QA 1OBFO 2C2YA 3PVZA 4FOOA 1H6BA 1XQ6A 4HUJA 5BQFA 5FWNA 3E03A 3F46A 3KLPX 2C2XA 5IDXA 3GEMA 1E0DA 4BMVA 2C07A 1GCUA 4QECA 4UUPA 3VKUA 3FF4A 4WLUA 5DOVA 4NBRA 3GVXA 4IIUA 4J9UE 4LCEA 4EITA 3OIDA 2Z1MA 3ETEA 3IS3A 3VZPA 1LRJA 4ONEA 2JAHA 5HWSA 4BNLA 2W98A 4AJOA 5COQA 1YBAA 2UDPA 1U4SA 4W7IA 2CNBA 2QYTA 1BHSA 2AEJA 1B2LA 3CUKA 3DEYX 4ALLA 4CM3A 4Z6KA 1Z6ZA 3U4CA 4GBJA 4NU5A 1Z45A 2JCYA 1EUCA 1U8XX 2X9VA 3GK3A 5K6AC 1YRLA 1DDOA 4IDDA 2P5YA 3Q1LA 2C7GA 2HMWA 4OQZA 5KVCA 3PI7A 4AJ2A 4Z0TA 5A06A 1CEQA 1Z74A 1GYPA 3PGJA 1CJCA 4DPMA 2YFQA 2X22A 4FFPA 1C1XA 1YJ8A 3BXXA 4UUNA 2J3KA 3I9MA 4BIIA 4GH5A 1PGOA 2GZ2A 2HU2A 3E18A 3DAFA 3G1TA 5L51A 3NRCA 1K6JA 5JAMA 1U28A 1Y8QA 2BRUA 4G81A 1U7TA 3F5SA 1MC5A 3Q2IA 4GX5A 1E6UA 1LQTA 3ICPA 4YAKA 4N5MA 2P9EA 5IXSA 1ZH8A 2ZJ0A 1JLLA 4YAJA 2FPPA 5HS4A 4JP3A 1ID1A 1LC3A 3VKVA 5EQDA 3SC4A 5T8KC 1U2GA 1LXCA 2PWZA 4ZQEA 1VPDA 1R16A 4GX2A 4BB5A 2NQTA 4PZCA 1QMGA 5JPIA 2JD2A 1EQUA 4OHUA 4AG3A 2QG4A 4GLOA 4DA9A 4WLFA 3JTMA 1LLDA 1DHRA 3INTA 3DZBA 3FWZA 2BLLA 3VAZA 1PJBA 1M75A 1HXHA 2SCUA 5JFOA 4MVJP 1YL6A 3MOGA 4HKTA 4PRLA 2CUKA 4BNIA 1NHWA 3JQAD 1NYTA 5AOVA 2IRWA 3NDIA 2NTJA 1O5IA 1DIGA 4EUFA 1PL7A 1E7RA 1P31A 2CVZA 3WGYA 1I0ZA 3A14A 1B14A 4MP6A 5T67A 1B3RA 5I9LA 4PLGA 2NM0A 2ZYAA 2VHYA 1PJLA 4WKGA 1GDHA 5LDGA 4CUJA 2VWQA 2J8ZA 4UEKA 2IXBA 2YUTA 3TPCA 4DL9A 3GNSA 4B7XA 3TL2A 3TDKA 1HDRA 3UN1A 2HCTA 1PSDA 3HSKA 1C1XB 4FFRA 3VC7A 1B8UA 1HYGA 3OF2A 4KZPA 3NGLA 4H15A 3DHYA 4CMHA 1MP0A 2AQ8A 3I9LA 1U5CA 2BGMA 1XR3A 1LSUA 1Y8QB 2HK9A 3MJSA 5G4KA 5C7OO 3FNGA 3JD2A 3CH6A 4OSOA 1KVSA 1T24A 3FNFA 2X0NA 4XKJA 4FD3A 4XRRA 3W6ZA 5KJCA 4F3YA 4G5HA 2D4AA 2AQIA 3I9KA 3QVTA 1ZK2A 3SJ7A 3BTVA 1BDBA 1YS4A 1NASA 2DFVA 1SB8A 1KVUA 2V6GA 1YDWA 3A4VA 3ZU5A 1X0XA 3P2YA 1V0JA 4WE3A 1GAEO 3UVEA 4OXYA 3VZRA 3GPDG 1T2FA 2XXBA 4E5YA 1JKFA 1YQDA 4AL4A 3R3SA 3DOCA 3PYLA 2E49A 2B4TO 4D41A 4P22A 1G1AA 4RDHA 5AXDA 4ZICA 3OH8A 4IMPA 3WYBA 1ZIDA 2OL4A 5JYDA 1PX0A 2P9GA 3O4RA 2GASA 3HE3A 1P0FA 3K6JA 2AXQA 3QA9A 5A5FA 3KHUA 3PHJA 1JTVA 2GCGA 4L0QA 3FBTA 4E12A 3IP1A 1ISGA 1GY8A 4D7AA 2X86A 4KTVE 4O0LA 1AHIA 4TRJA 2EF1A 4KWIA 3NDRA 4AJKA 3RUDA 4WECA 3RVDA 1YQXA 4BQPA 4BNMA 5ICMA 1QXSA 4CV0A 3JYPA 4CMIA 4P4LA 2RH4A 4MINA 3V8BA 4XQ9A 4DXHA 4M54A 2VZ8A 3WJAA 1RM0A 3PHIA 3KZVA 3I9OA 5CG2A 1YKFA 2FPGA 1R37A 4MIYA 4HNGA 3SEFA 5L53A 3NV9A 3F5QA 4EJ6A 1GFSA 2TMGA 1QYWA 4DUPA 4J4BA 3ZNQA 5I7SA 5ICSA 5GZ6A 2DTXA 5G4KB 3A28A 1KVRA 4CL3A 4CUZA 1P33A 4E21A 2DTDA 4IDEA 1ONOA 4A27A 3OHSX 1B26A 3H9EO 1NFFA 3IOYA 3ZHZA 1K3TA 1DFHA 4BO0A 4YDRA 1BXZA 3VHRA 5IDWA 2UVDA 3QY9A 4E2XA 4A10A 3ULKA 1ISIA 4CLXA 1G6KA 4NK4A 4Y6PA 2FN7A 2WWRA 1SBYA 1EVYA 3HFSA 5K0ZA 4S1VA 1EE2A 1V8BA 3SX2A 1U5AA 3H4VA 4J3FA 5IF3A 1Q0QA 2Q1WA 3ITKA 2DBRA 3LK7A 4ZQBA 3ZNNA 1F8FA 3PRJA 3GGGA 4LRSB 1DFIA 5A9TA 1J5PA 1UZMA 5C5IA 3DZIA 4M55A 2DC1A 4KQWA 3ENNA 4NZ9A 5A1TA 1Y1PA 4Z0HO 4MKZA 3DHNA 4RLSA 3ZNPA 2HAEA 1Z7EA 3ADOA 4HWKA 4R54A 4W99A 4BO6A 4LSMA 1E1LA 3MWDB 1HDCA 1Y5MA 1PGPA 2NU6A 4R3NA 1XKQA 1HE2A 1LRLA 4CMIB 3OA2A 4IIVA 3IJRA 1H6DA 3ZWYA 1NWCA 4ZD6A 4B8WA 2DBVO 1J6UA 1E7MA 3WX0A 3OIGA 1PR9A 2HUNA 1C3VA 4NFYA 1T2DA 4RF5A 1C0KA 4IS2A 4QUKA 1LSJA 5TJ9A 5DBIA 4UVGA 4INAA 1UP4A 2Y05A 1M66A 4WCFA 3ZHBA 3W8EA 3FBGA 4O6VA 2QW8A 1YOVA 2E82A 1P1RA 1DJQA 1Q2XA 4AJEA 1O9BA 4LK3A 3RBVA 4EW6A 4IDCA 1LI4A 3ROQA 2DT5A 1TI7A 2OHXA 4UUMA 1Y81A 2AE2A 1D8AA 2BFMA 4A26A 4F45A 3OEWA 1ZO8A 4BNZA 2Y0DA 4MVJG 5F21A 2GN9A 4MO2A 4AJHA 3PQDA 3BAZA 1X13A 3EW7A 4FR5A 3RD5A 1ULUA 4BNVA 5CG1A 3I3OA 3JQ7A 4UVIA 2X0JA 2NTNA 3D1LA 3F1LA 2RHRA 1CQIA 4OXKA 4A0SA 2Q2WA 2GN4A 3I23A 2B5WA 2ZB8A 1UZNA 2FHSA 4JBIA 3P5SA 4I08A 3NJ4A 1PS0A 2ZTLA 5JO9A 2VT3A 4EEZA 3GZ4A 3GMSA 1FXSA 1ZSVA 5KJFA 1EEHA 2WTBA 4TQGA 2HDHA 4FFLA 2EJVA 4FBGA 1AN9A 2IODA 5JE8A 2HMUA 4Q3NA 5DCWA 4GL4A 2OOSA 1SAYA 3C1TA 1HWYA 1GYRA 3VVBA 2O4UX 4L73A 2DUWA 4XZ3A 4MIEA 1I3KA 2VWGA 1OAAA 1UXIA 5AVOA 2Q2QA 3WBFA 1NAHA 4JXKA 4M8SA 4YJHA 4M1QA 4R3WA 4XEHA 2BFPA 4WCFB 5T64A 3GR6A 4JJIA 4BVAA 1YOVB 3WYEA 4RVSA 1H9AA 1ZFNA 4D42A 1MA0A 3NDJA 1VSVA 2VUSA 4F6CA 2ZJ1A 4B4WA 3PPIA 3R6DA 2BH9A 3NT5A 3VH2A 1WZEA 3HADA 2DKNA 2PK3A 4NDNE 1UAYA 2OUIA 2ET6A 4LCJA 1JU9A 1DO8A 3HG7A 5A03A 2Q46A 2Y66A 1UH5A 4TWRA 3QVOA 2YQ5A 4RCVA 3TZCA 1AGNA 1HZZA 3FR7A 2PGJA 2EKQA 3WGIA 3FR8A 3BTOA 3DBVO 5ES3A 4YEDA 1P3DA 4FS3A 3W8FA 5GZ3A 4ALKA 1LRKA 2EW8A 1Y9EA 1EFKA 2J5QA 2R2GA 3GHYA 3JQ7B 2ZYGA 2D5AA 4MVJH 1ZK1A 1PQPA 3RUCA 2DLDA 3V1UA 3T4XA 3I6IA 3QSGA 4MDHA 2P2SA 3AK4A 2EKPA 1CDOA 3LC1O 3LT4A 4GMGA 2WMDA 2PGDA 3DB2A 2Y1DA 3VTZA 2OBYA 2O3SA 1DIHA 2FPIA 3WQSB 2D2IA 2IYOA 3WLEA 3JQCA 2GZ3A 3RROA 1U8FO 4RJTA 4R01A 3KVOA 4QFCA 1GEGA 3HN2A 4CV3A 4BHTA 2ZCVA 4W9NA 2GZ1A 3JQDA 1W73A 4GGPA 4YYZA 4UAGA 1RWBA 1PZHA 3I4CA 5C7IO 1QSGA 1DSSG 1UR5A 2PH5A 4MOWA 2C0CA 1OOEA 3ZU3A 2WM3A 5BSGA 3WGHA 5G2OA 2W4QA 3RCBA 4YJHB 4EI2A 3D64A 1E3SA 4GQAA 3VPHA 3TZKA 3K2EA 1FMCA 3TF5A 1ZXBA 3AW9A 2VYND 3LVFO 4NI5A 4JIGA 1LNQA 4AICA 4YR9A 3F6YA 3KEOA 3LU1A 4PLWA 2PD3A 5CP8A 3ZZNA 1YBVA 3RC9A 2PA3A 3QHAA 1C0IA 2X6TA 1YB4A 2GSDA 3PDJA 1BGVA 5BNIA 2WYWA 4BNJA 3BHIA 1N7HA 4L76A 4RL6A 2DVMA 4II2A 1X1EA 2Z5LA 4NFSA 3AJRA 2EJWA 2QX7A 5F1PA 2PKRA 4IDBA 1SOWA 3IMFA 2Y1CA 1ZCJA 4CV2A 5BNTA 3ONDA 2V65A 3BZUA 3O8QA 4NR0A 3G0OA 3K8ZA 3TZHA 4TVBA 1PIWA 4PLVA 3UFXA 3OJEA 4RPJA 3BMQA 4WOKA 3QW2A 4CL8A 4L75A 2NVBA 4PCVA 4H7PA 3GGPA 3DZHA 2YFHA 2CD9A 3DQPA 1EK5A 3GA0A 2LDXA 1NAIA 3OP4A 1C14A 1BVRA 1LLUA 3DHEA 3LLSA 3PYXA 3RUFA 3S55A 3GDGA 4G2NA 5L3ZA 2NU8A 1B7GO 1YJQA 2Y93A 3GFBA 4BNHA 3E6AA 1I2CA 4C4OA 1NQOA 3U62A 2D0IA 3CSDA 4ZA2A 1B15A 1QORA 3GN1A 2FY8A 4K6CA 3IUPA 3D4NA 4MVJA 5HTOA 5C7LO 4ROSA 3WBBA 4KUEA 1NR7A 5JYEA 2O50A 3CEAA
chains in the Genus database with same CATH superfamily
4RY0A 1KEVA 2AZ4A 3GHHA 4NJMA 2C3UA 4M9QA 2ZI4A 4J4HA 4DMGA 4YV2A 1Q91A 3R40A 4IMRA 2IGBA 1SU8A 4AY4A 2CFOA 3V8QA 4PN7A 4HQFA 2EHJA 4W6ZA 2XYVA 2Y1OA 3DONA 2DLNA 2VXYA 3ZLBA 4E08A 3ONFA 3CCFA 3CW2A 4JFRA 4YP6A 1JHPA 3BM5A 1WVGA 3EMBA 1E9SA 4QARA 2VJLA 4ZVPA 5DV9A 2HGSA 3DVLA 1KMHA 1TCAA 4HNAB 4FIDA 4HEA1 5H8WA 1QOQB 2GJ9A 3AYZB 3CTPA 2ORED 3LGSA 1OXSC 4BMDA 3U7QB 5I8WA 1C0LA 2XQJA 3C7DB 1VIYA 3B5IA 3EIQA 4E3ZA 2ORVA 2DQZA 1OE0A 2K5UA 1RC8A 5T4BA 3WV4A 1GPMA 3E9QA 4EG6A 1SHTX 3N05A 5TT0A 1MEOA 3M6IA 4J1TC 4HFRA 1W36C 3DNFA 5JBNA 3IR5A 1XZHA 1GYQA 3L43A 5BR7A 1W34A 2FG7C 3G9TA 3ZWKA 3PLAE 1AQIA 3GI1A 3PQEA 4U7FA 3RS7A 1P17A 1PT6A 3N0WA 1XCGB 2QT0A 2F8TA 4AJPA 1YQWA 4JH0A 3PGVA 4LYYA 5IJXA 1JHXA 2HRDA 3BRQA 3T3EA 3BFKA 3DL7A 1H9CA 1WPGA 3DCNA 3C6MA 2R65A 3BMQB 2QZ4A 3VX3A 2J08A 4CCYA 1X7HA 4R40A 3OM8A 3TDNA 2WFZA 1KRHA 1WMSA 2HH9A 2PXXA 2W8BA 4RPKA 1XN1A 1R6TA 5LZ2A 3NHZA 1AKRA 4OO3A 3ABOB 1SWVA 2B8TA 5KUTA 4QGGA 1ZMRA 2FOLA 1K97A 1RWKA 2E6KA 4FQ5A 2Q3LA 3GFFA 5BMOA 1A9XB 3BJZA 4DA7A 5IJ0B 5E7QA 4G9GA 3ZHOA 1H3NA 3MXOA 4DGSA 1VYUA 4AN4A 4JASB 2G0TA 1U0SY 3EZGA 2X1VA 4ZI2A 1IDOA 1G0NA 3P19A 1P2SA 3CKKA 1IATA 4NJMB 3CN9A 3VR2A 1PNOA 3HN6A 3NG1A 3UG7A 2FW9A 2ZSJA 4I4CA 3IILA 4MQMA 3EXEA 4NV0A 3TIVA 2FZGA 4ZGBA 5ED4A 2QM7A 3OPYI 3SDBA 2JCGA 2PTHA 1Y3CE 2XHEA 5JMOA 1Q14A 4HUQA 4B3SB 1K66A 2R1ZA 3BG5A 5DWQA 3KBBA 4B48A 1GKUB 4ZHQF 1FY2A 3K1YA 3IQHX 4YNBA 3RVMA 1A77A 1RRKA 3FDZA 4ZANA 1UDAA 2P9TA 3NAQA 3CZQA 2CF6A 4AX4A 4QWWA 1KMHB 1IQUA 3P7MA 1WXFA 4ND3A 3LO8A 4LECA 3AU9A 4FR0A 5HVNA 5JNLA 3SSOA 1UAAA 4QO7A 2WUGA 4AYXA 1S2MA 3DKVA 2B5VA 4KYVA 4EPVA 3U17A 5KOIA 3IBCA 2GHRA 1GHTA 1ESNA 3KQSA 4FX5A 5DCLA 1XD9A 3QEBZ 5EXPA 1XYGA 5GIPE 4QYMA 3AW8A 2P9ZA 3ACBA 3UZUA 1FCJA 2Y1GA 4BASA 4HRVA 3UF0A 4XX0A 5EVJA 2JAOA 4IVQA 2P2DA 4TMZA 1CY7A 3DKPA 2XWPA 3W9SA 1S01A 5KTKA 4GPBA 2H4JA 2NW6A 3I4LA 3AB7A 9LDTA 1E2QA 5BWBA 4LNUA 4HN9A 4CF7A 2QU7A 3A6PC 2HJVA 2GESA 3OZAA 4RS3A 3V2UA 4G4GA 4F46A 1HZZC 4BZXA 3MQ2A 4P2BA 4BGEA 5E3HA 3T4UA 1TUIA 2D0PB 3L84A 2WP8J 3B1KA 1VLLA 1DRWA 2D3WA 2WYUA 3EWIA 3M6XA 4CCYB 1PI3A 2FV8A 2JATA 3HCEA 3WGNA 2BTEA 2CHQA 2ESRA 2W8BB 3KV1A 4COKA 4WFKA 1SFRA 1JIQA 3DR3A 2DQYA 4MSUA 1XZAA 3WO0A 5J4YA 2ZRIA 2WF6A 3ZS8A 1NVFA 4HUTA 5J5AA 1FVOA 5ALRA 1WY5A 4IV8A 5CDUA 1G6Q1 4L50A 3QKRA 4GXTA 1VE6A 4D3SA 2HRRA 4POAA 4ENRA 4AZ0A 1MB0A 4LRXA 4U2BA 5AW3A 3CEMA 4U2KA 1R0KA 2JL1A 1HG0A 2ZSIA 4FMBB 4JENA 3W2TA 2H2AA 3L4EA 3E35A 4H77A 2Z0MA 5EA2A 2Z4TA 3H42B 1C7ZA 1IRIA 3QQ5A 3BKWA 1TU0A 3DD5A 1NF8A 4RGYA 4BKOA 3PPVA 1WXGA 4FC7A 4U2EA 5CLFA 3EXEB 1DX9A 3B3GA 2V7QA 3Q3CA 1E3EA 1R0LA 1NF9A 3GYGA 4XFDA 1Q7RA 4KE6A 3SQLA 1JJFA 2I1LA 4G07A 3A9WA 1K6XA 2D3TA 4HUQB 4CLDA 2PFGA 4MUFA 1AA9A 1WF6A 5B1DA 2OMEA 4CLEA 1FFSA 4MRPA 4DOMA 4JUAA 3D2LA 1Z0SA 2GO1A 3FDZB 4RHUA 5I9TA 1A8IA 4JVOA 4XYLA 3NKLA 1N2ZA 3T06B 2O2HA 4PAQA 2FSPA 4E5PA 1F6WA 2WD9A 2W6ZA 2JNWA 1GZ3A 5LQRA 5EY5B 5BSFA 3OUTA 4CMGA 4MW5A 4WCDA 1KP2A 2FGKA 3R5SA 1SXQA 2XYGA 3WDKA 3K30A 1Z0KA 4FSXA 4Q37A 4WKCA 3ILVA 5BP7A 3EWNA 1I0IA 3P2OA 3LQ4A 4UHHA 4EKIA 4CYMA 2R6HA 4J29A 4XX0B 3ZWMA 1ADYA 2QMEA 3II6X 3LPCA 5ENDA 3VMMA 3KP1A 1BXRA 1XLUA 4Y8VA 1TE2A 4PPYA 3UAOA 1SC6A 2CNWD 3OU2A 4D44A 4RZIA 4LNUB 3BJEA 3HDQA 4LDQA 2VPPA 3EUAA 5JC8A 2Q2VA 4OMFG 3UY4A 3KAJA 1I13A 1KFJB 3KYIB 1XVVA 1N1GA 3BH7A 4P86A 1GQFA 1ZYUA 3A1WA 2ROQA 1XQ9A 1W5AA 4C7KA 4CG2A 3CF0A 1GJRA 3OT5A 4KR9A 3GOHA 1BWSA 1NLYA 4UFOA 4WERA 3ETCA 5CNJA 2VDOB 2EYUA 2I76A 3DEFA 3NJRA 4G0ZA 4IKOA 5BQPA 3AETA 2OZPA 3PYMA 3UWOA 4HDQB 3HWX1 2J3QA 1JDPA 3RH0A 4M6WA 3QKRB 1BCRB 4IIHA 4MCJA 3KQHA 3PHHA 3VPSA 4AZ0B 3UO8B 1L7MA 4BY9E 3BCSA 1Y5RA 4UAVA 1FK8A 1NOJA 2DF8A 1BU5A 2C82A 2J33A 3SN6A 1PV2A 1RPTA 2OD9A 2P0YA 4DF3A 4RDXA 4X7RA 4F93B 1QQTA 2EKZA 3MBKA 3OF3A 2CDAA 2QTVA 3GZTB 3OX3A 3DEHA 1GG8A 2C94A 1HQDA 1BA2A 1OA1A 4IZHA 4UBOA 5ALGA 1IONA 1JH9A 2CUZA 2QZZA 4N9QA 3ZCUA 1R0CA 4BYMA 1KI3A 5D1HA 4HV4A 1BXKA 5ALLA 2BTOA 2PRYA 2RAPA 2B7LA 4QAJA 4PXYA 1Q21A 3DE7X 3NNDA 3W8RA 1Q1NA 1TEHA 1SOMA 2NO6A 3PEUA 2I7VA 3D4BA 4IDAA 4FX2A 1J23A 1YK1A 2X9GA 5FBQB 3N2IA 1QP0A 4JHXA 2PQ6A 2DFLA 4CFSA 3E7DA 5LA6A 1VE9A 2I65A 3OX1A 5K20A 4ND5A 1WVIA 3JQQA 3NP9A 3LS2A 1AF7A 5LLDA 1G3UA 1M2JA 2LZ0A 3PDIA 1FRVA 4FLMA 4I4IA 5ANRB 1BXRB 1PAUA 1ZM4A 1A1SA 1NRJB 3KB8A 2RMKA 5AXAA 4ZVLA 1CUEA 2EZ8A 2QZPA 2Z3VA 4W5HA 5LQJA 2OXTA 1EUYA 4NFLA 3FPCA 2HQRA 1W0JA 4UW9A 2IYFA 1P61B 1II9A 5LBIA 5C1OA 2PRKA 3T7RA 2XUKA 4P38A 1H85A 4GIBA 1KVTA 5CLLA 4KITB 1QX4A 5AI4A 1COZA 4EF6A 5DGTA 2UUAB 2BM9A 4BTEA 1M2OA 4RPLA 4KQFA 1XTVA 3OIUA 4Q12A 3WKAA 1AK1A 3AETB 3CGGA 2DWQA 1XB2A 1OC4A 1NWHA 3E53A 1PR0A 3NWJA 5AUQA 4M6WB 4RTSA 4GMXA 2IPAB 1FQOA 5JCJD 1M76A 1TLTA 1DT3A 4GOOD 1XDWA 3GDFA 3TNLA 4JT9A 3TQQA 2AOVA 4CODB 1K06A 3PFKA 1PWZA 2AR9A 1SCJA 4HT3B 3FGNA 4ILEA 1ULSA 3ZIAA 2Z9DA 1C8KA 4L8YA 1JMKC 2I80A 2QTVB 3P9CA 3N7TA 2R2AA 2OGTA 1RPJA 2OQVA 1S9HA 1E1NA 1NHGA 2NXEA 3O93A 1FLDA 3NAMA 3R77A 4QBTA 4QEZA 5IKPA 1IN8A 3VHQA 4LOKA 2XAUA 3R0XA 2FFRA 3WYCA 1VMEA 3I09A 1F3OA 3ANXA 1AKYA 4ZRDA 4B3GA 5A5EA 2C3PA 3RYFA 5CXUA 3FGZA 5CX4A 3ROGA 1TF7A 3KKMA 1HORA 4V1CA 2BFOA 3HMQA 1GZUA 4P4GA 3BSYA 2A2ZA 2YNMA 2GILA 2OTCA 1DC5A 1SCBA 4Y1FA 3RB8A 2AK2A 4ENVA 2PLNA 3WDSA 4R1OA 2VNKA 3H84A 5LA6B 1CERA 4N7BA 3SJAA 3C7CB 3T52A 4A03A 3HJBA 1YD7A 1W52X 2HQ1A 1RAEA 1SC9A 3CEHA 3NETA 4KI7A 5ALMA 2N1BA 2PWPA 1BRMA 2C83A 3MAGA 5JI3E 3PDIB 2OZVA 3VJLA 5M34A 1U1DA 1YA4A 5L7WA 3ADPA 3K5IA 4JJ6A 1BHQ1 4G8JA 3R4VA 2M6KA 5AW6A 4KLAA 3HNPA 5E0OA 5SY9A 1KE1A 2G5GX 4GM4A 2ZE7A 3O94A 3SJUA 4EFMA 4BDSA 5T5QA 3X1ZA 4F9FA 1Z4JA 3P0EA 5FI5A 1JKMA 4NOMA 3DEIA 1GTVA 3RNLA 1MAWA 2PX8A 3PT9A 2N47A 3AUAA 2P7IA 4XJSA 3EY4A 4GZ3A 4YP1A 4B6GA 2VQFB 4IOKA 1TKBA 4JYBA 4ZQIA 4L5BA 5IFKA 2MU1A 1NW4A 4RFLA 1S8FA 2GF9A 2XCIA 5JJ5A 4B32A 1O95D 4HWTA 4NECA 1D4OA 4G5RA 1CVLA 4BNKA 1UANA 2Y0EA 2P0AA 1SBNE 2XUIA 1QS0B 3VBCA 1T91A 3RJTA 1NUPA 3NTXA 3JAWA 4HO1X 5CGZA 2JAWA 1U0GA 2OT3B 1SC4A 5E7MA 1R6AA 1XZKA 2WE8A 4Q7KA 1A4IA 2Y8EA 4AKIA 3AR9A 1V37A 4BEJA 4L8VA 3JWJA 3LBAA 5K0BA 2I6GA 3KEGA 1B8NA 3ZV4A 4Q1CA 1Z06A 2OILA 3ZH9B 4BLPA 2E89A 1RACA 4J2OA 5KNBH 5C2JB 1NVWQ 4MB6A 1OFGA 3AP1A 2NZYA 2GEKA 4M9XA 4UREA 5G41A 3ILXA 3ZWDA 2A0WA 4B0OA 5B6JA 1BZYA 2RAFA 1Y4ZA 3K9WA 2QPTA 4A1FA 2X0RA 2ZVJA 1MAVA 2YN0A 3RYFB 4FFMA 1H1DA 3Q3EA 4J0IA 1C80A 2VRNA 1X7DA 3FAZA 4V1CB 3PDCA 3RODA 5D00A 5EJIA 1ZRHA 4KXWA 2BMAA 1IVYA 1FRZA 2XTZA 3CVOA 3EH2A 1Y8AA 1NY6A 3QP9A 1TQHA 2XGGA 4A5OA 4ZHSA 2C97A 1I2ZA 5AIBA 2QW1A 1SVNA 5CRIA 3S7TA 1CP3A 5FOXA 4NX2A 1N8KA 5KYKA 2WJAA 1RKVA 2JLYA 2Q28A 5F9FA 4MPDA 1R2QA 4Z1OA 2OAEA 2H8GA 4MYCA 4PNZA 5DSZA 2CXTA 5F52A 3ZDZB 2HD4A 4POOA 1JHRA 3EVBA 3WHKA 1E2JA 4D99A 4QICA 2XOXA 4XUEA 2P35A 3VYWA 5JDCC 1MORA 2G71A 5HJ7A 4X66B 2C2ZA 3L3BA 1AS3A 3QU9A 4CBVA 1VE7A 4OIMA 1Q1AA 3ILSA 1CUZA 1W35A 1XZCA 1TUBB 2JGNA 2RGCA 3K15A 3QWFA 1IEWA 3ZHVA 4I55A 4V0RA 3CPSA 2JFFA 3D6AA 4Q3DA 1MMFB 4NEGA 3WMEA 4I2VA 4NH4A 2VDRB 1XLVA 4B3HA 5HUJA 2PT9A 2ZI7A 1MAUA 5EWJA 3RV3A 2YWDA 2QRMA 3Q8WA 2OKGA 1TYZA 1Z08A 2PH1A 1QDUA 3K0FA 1PS9A 4JY7A 4BNFA 4KFCA 1Z0IA 1PW7A 3C6KA 1R64A 1K4YA 1NF3A 2J32A 3V4RA 3PUVA 3PR3A 3QFCA 5TPZA 3F6CA 1K6EA 3RLFA 4NESA 3JAWB 2Z98A 3PKZA 3QK7A 4PGAA 3D8RA 4RXMA 4ZVQA 3Q8LA 5K3DA 3EZFA 5IMSA 2VI5A 3G8DA 4F4IA 3C8UA 1S3IA 4D0SA 1ZEJA 3D8BA 3KTDA 4YALA 4ZAYA 4JQZA 3I5XA 2P3LA 5E4FA 3ORYA 4HSEA 2HMYB 2ZM6B 3QWAA 3RW9A 2C5AA 4P3KA 4BFTA 2GUGA 4PC3A 1LDYA 3HPRA 3MPUA 3H5VA 4R2IA 4R41A 3AP3A 1YKGA 1JDVA 4ARUA 4G85A 5DBHX 3PL5A 1IB0A 1WUJS 2PZGA 2VTKA 4OU4A 5AKEA 4RHYA 4J91A 4OSEA 4HMOA 4B3JA 4A15A 1X1QA 5FDFA 2WWYA 1BAPA 3C16C 1CIVA 5AVUA 5FJJA 3WKEA 5LQUA 3FPSA 3FZQA 3LVQE 1X2BA 4ZCMA 2IZ5A 1XEFA 5TV2A 3WWOA 3VI3B 1VL6A 2XQVA 2XSZA 4HDKA 4NZOA 5FPYA 4A0GA 4H1UA 4JLVA 1EK6A 2P6RA 1UWVA 5AK0A 1HYHA 1K0FA 2JGIA 4FDUA 4UJ3A 2C2GA 5BW4A 1XNRB 2XY4A 4DAOA 3AERA 3A36A 4X61A 5M04A 2B2CA 3ES9A 4WADA 1XC7A 3AXSA 3SU8A 3VBEA 3F74A 3W79A 4L51A 4QNMA 4AXXA 2I9PA 3ZVNA 1FFGA 1MB2A 3DF7A 1MIOA 3GNTA 4M1OA 2DUJA 4IXWA 5CJPA 5FEMA 2EWMA 2VLBA 3AF3A 1K5DA 1NVUQ 1HTWA 4LJKA 5KNCD 2OG2A 3HBJA 1LH0A 3DOEA 3EXAA 3KPUA 3SHQA 4K88A 1NFQA 3DMPA 3PC6A 5B30A 3SNHA 4I55B 1EFCA 2ZUBA 2JGAA 1Y3HA 2IZ1A 3TWOA 3GQBA 3ZE0B 4XYEA 1VJ5A 1G4AE 3Q5EA 4JJEA 4LHWA 4OKNA 3EBOA 5LYYA 4AIRA 1IL0A 2PD6A 5EWJB 2GCPA 2B20A 4R1NA 1DBIA 2ZKIA 3AC0A 3IBGA 5CPFA 2EQBA 1KAEA 5MDHA 4OGLA 2DGDA 1EGHA 4QODA 5TPZD 4EUSA 3TS1A 2RI0A 2Y1KA 5ALQA 2V7GA 3W8NA 5DNDA 3ZW7A 1GNVA 1ZJ6A 2O7QA 3L7BA 4RANA 1Y7PA 4Y6RA 3PQ7A 1KEUA 3OHPA 3L46A 1Q3KA 5L9AA 3WICA 1X0VA 3P9YA 4HDRB 1RIFA 3SAJA 3VNSA 1N8NA 3H5AA 4CM4A 1GRNA 4EF5A 3JCZA 3B3QA 4BFYA 2WTUA 1U0RA 2QTTA 2O8FA 3VKHA 3A6LA 1DFGA 1GPAA 1ST2A 4HMQA 1PR5A 3LP5A 2BFEA 2OHIA 4UUQA 4YXWA 1QQAA 1FMFA 4UCFA 3BHJA 1WPQA 1IBRA 3H5RA 1VLQA 4G1BA 5C5EA 2DPXA 1A5ZA 3ANNA 3CF4G 1P2GA 2F7SA 4B2PA 2YFKA 3IVRA 1A5BB 2R8RA 1D2CA 5EJ8A 1NF2A 2FUCA 1F14A 1C9DB 2ZRDA 2VA9A 3BK2A 3PNOA 3QFFA 5E0KB 3SEZA 3TQTA 3GF4A 4H1WA 1IAVA 2YNMC 4HDKB 3X0DA 5KNLA 3A32A 2AOXA 3TH5A 4E4RA 4WXRA 2Q45A 2VHZA 4TYMA 2PKQO 1V1JA 4PWZA 5F7ZA 4CKYA 3AERB 3FMIA 1EDBA 1FQKA 1KSFX 1SVUA 1W4AA 4MO9A 3HKBA 2V0NA 1KYXA 4TGLA 4Y1EA 3V1TC 3VR1A 1LF0A 2EGUA 5C1BA 1FJHA 1F51E 2E85A 2WVAA 4MYUA 1I6WA 3SBXA 3SF8A 1E0SA 1VQ1A 3L0CA 4IV5A 3BT7A 1YZUA 4MUAA 1JWAB 2XYQA 4MQEA 1XZQA 3CKYA 4S3MA 4EF4A 3AIIA 1NSFA 4I66A 4JBGA 2PWYA 4I1UA 1PR4A 1B0ZA 4K9NA 2CE2X 4NL4H 3GQBB 4DT1A 3QNMA 2YN2A 2DPLA 3IPXA 1LBIA 5AT1A 4EHLA 3H2JA 3RJ5A 1Q57A 2DBYA 4LMAA 5CH5A 2WM8A 1G291 5JG7A 1VZ3A 1LS1A 3QEAZ 2XTJA 4GWLA 3OIVA 1I4OA 3N2YA 4ZARA 4QG7A 1MJ5A 4F3RA 2EKBA 1PR3A 4KREA 1SCUA 3D2CA 2Y0BA 3G1WA 4N6NA 4X84A 1N4DA 1P9LA 1E92A 4M7OA 3VVCA 2JI7A 1EPUA 2LKCA 3PDUA 1XF9A 5MN4A 3QITA 1FSGA 5T4HA 2BSQA 2R7KA 4NPCA 3SQOA 4GUAA 3W5DA 4CM4B 4HB4A 3A1UA 3TKYA 4P0PB 2I8LA 4Z54A 1AY0A 3V8NA 5JZ9A 2O8FB 4G1CA 2C8LA 2BFEB 3SZRA 1L8XA 2QP4A 1PQ4A 2QRPA 3FFWA 5B53A 1P4HA 1LDEA 2BHLA 2N42A 2XGMA 1RFLA 3RC3A 1G8MA 4YMUA 1M9NA 2IZOA 3OWOA 3UCFA 5LDDC 3OQHA 2OPHA 4WNYA 3S8YA 2EFCB 4FSHA 4KMSA 1YXMA 1GRCA 4RPHA 1UK7A 3R9IA 2P9FA 3Q6NA 1I6MA 4Y9TA 1XRJA 5EZSA 3BWMA 1FF9A 4FHDA 1E79A 2F9MA 4HGRA 1G2QA 4X8LA 3RF6A 3ZVMA 3B51X 3I62A 4Y6SA 3TL6A 1ECGA 2NX2A 4BQRA 1SOVA 4LWQA 3FGPA 4WD3A 3HKBB 4MKXA 3KXDA 4DIFA 2IKQA 3R0QA 3B6MA 4MCIA 1EFLA 1UXOA 2TMYA 2RCYA 3DCIA 1RCUA 5HKBA 1RWOA 3FSGA 2HIAA 1RI5A 3K9HA 4O5OA 4PC7A 3SF8B 4F92B 1XL1A 3J81k 4GYKA 1UEIA 4EABA 4KQGA 1J39A 1BFDA 3K2QA 4MQEB 1GNQA 4ND8A 2V74B 3NQ41 2AT1A 3FE2A 4QTZA 5G0WA 4YMVA 1TAHA 2PKXA 2VYCA 5IN5A 4EHFA 3RAGA 4ACBA 4GI3A 4DT1B 2IDZA 2A14A 2F90A 4QTTB 5KB3A 1K2WA 2O6HA 3JXEA 5JV5A 1FX1A 1QG4A 3BZBA 4G0XA 4DQVA 2NYVA 3GMTA 3ZHQA 5DP2A 4G1EB 4A2WA 1H3EA 2EAUA 4QC2A 1SWWA 1T4CA 3WWZA 2UYOA 3C4VA 4FKZA 3TCKA 1SCUB 3TFQA 1DADA 4AKTA 4GMFA 1N5MA 4I50A 1Z7GA 4CV1A 1ABEA 1BW9A 1U98A 2VSFA 3LP8A 3OO1A 4D4MA 2AHRA 5EP3A 2O8VA 4II3A 1GAWA 2B4KA 3HDTA 2VZ9A 4ARAA 4E2YA 3VRHA 3RNOA 1XVAA 4YCNA 2A94A 2QZ9A 5H3LA 3MS2A 5KHAA 4DNPA 4S24A 1H2HA 1V8FA 3VU3A 1Z6QA 4YBRA 3FLBA 3V7NA 2A78A 2ZSKA 1APBA 4QBKA 4CNBA 1NVVQ 3K71B 1HTBA 3WLIA 5KTMA 3ZD6A 3H4IA 2KJQA 4RXTA 2YV4A 3UJPA 5DK4A 4DSTA 3OKFA 2B82A 3ENVA 3FJOA 3O03A 4DCNA 2O4CA 1HE5A 5TVGA 3OQBA 2CK3A 2IQIA 1WKVA 3TQRA 4BTVA 5ECDA 1D5CA 2Q2OA 4BN0A 2FQQA 4X60A 2WIKA 4FOTA 3A6KA 3E3AA 5E8RA 3A6FA 3L04A 3ZH2A 4ZAVA 1JFFA 3TVYA 1EIWA 2EKDA 3V6MA 1DNPA 1JQ3A 1SHZA 2QM0A 2ZROA 2W2MA 2R5NA 2FUKA 4MUYA 2FFBA 2FW1A 2JB9A 4U8GA 4DA8A 1GPDG 5AO9A 5LUAA 3BA6A 5HA5A 1LBQA 3GLIE 2VP4A 4OMCA 3K0BA 4JBLA 1Z2EA 4OJKA 3IMCA 5J1SB 4BKRA 1UPAA 3KALA 1TEZA 3WIOA 1DAMA 4IHJA 3WLHA 4RF3A 3WGOA 2B35A 1P7CA 1TK2A 4JZYA 3X2FA 2QQGA 2CJXA 3MWJA 3MTEA 5A62A 2FSFA 1D4ZA 2V59A 2ZYDA 4G5GA 4MW9A 1WUIS 2C3OA 1NLZA 2Q6KA 3DPSA 4ND8B 2GGSA 3LYLA 2XOKD 3DGEC 4BMPB 4EECA 5KWSA 2AVDA 5LQNA 2PMEA 5JLAA 1E0KA 3UKJA 5JO0A 1XK6A 2IUYA 3KFVA 2RB4A 1YBMA 3N75A 4L3WA 2C2KA 3GVPA 3AR7A 2ZTUA 4J7UA 2Z2XA 2AA3A 3BK7A 3LGAA 3R6WA 2R1UA 4MUKA 4Z4FA 2FP4A 3D0OA 4RKRA 2A5GA 1QYRA 3SJCA 1NKSA 3WA7A 4QPNA 1WY7A 2HK7A 1T4CB 3FWYA 4L1KA 1KAOA 1RAFA 3KWJA 1YFKA 4LBZA 1I94B 4IGKA 4B5LA 3QBDA 5ALDA 4I50B 1V26A 1T2UA 2ATVA 2HF7A 2JCXA 2JIQA 2QLMA 2YCLA 3LZCA 1BW9B 2PQ0A 3R5JA 4RPGA 4ZO9A 4XRGA 1XQXA 1QF6A 5K7SA 5A1JA 4TOIA 2VQ6A 3SKVA 2QTRA 4N3NA 4BFCA 4D9GA 3HY4A 3IIIA 3ZXYA 3PVSA 2X58A 3FTCA 4J03A 1EVEA 3VH3A 1EXDA 4V38A 4HEA6 1W6RA 2MT9A 2DQKA 3S2SA 5JD4A 2VP5A 1YWGO 5KQGA 3A6ZA 2LV8A 2W6OA 1UK9A 3KLMX 4F3TA 1EZ4A 2NTVA 1W19A 3CLTC 5AKXA 1D1QA 5LDHA 4EHBA 1R5JA 1ZVMA 3M9LA 1L8QA 3SLKA 4EX7A 2QLFA 3SMVA 5AUOB 3TLMA 3V1LA 3FSJX 4P34A 4BLRA 2ODTX 1FQJA 1G2PA 3VV2A 2UUBB 1JFFB 3ZDCA 4PU0A 3MGCA 1CQPA 4D9BA 4KPFC 3KS9A 2RDMA 4IJ5A 3DXYA 3VAAA 2PN1A 4ETIA 5A5GA 1JLHA 1UMBB 3N2KB 4J2TA 1MJGM 2P41A 4ZKEA 1FXWF 1J8DA 2OLJA 3QBVA 4LJLA 2YVAA 3K0AA 4RZHA 2Q5FA 3UPDA 3LPLA 3ZVLA 2FWMX 3AR5A 3KXPA 2IA5A 3LT0A 3MJRA 4IHJB 2FTKE 4CCSA 2ZDGA 1Z6TA 5B6PA 1RWXA 1UMCA 3MERA 3MS7A 4HQRA 1JHUA 4ZVSA 4LF5B 5B7GA 3G2IA 4DY6A 1C2YA 4DDTA 1WU8A 4C0HA 1EINA 2JFZA 2PZJA 2WIAA 4GSKA 3NTLA 5HZHA 2OBNA 4TROA 4ZYWA 4YUAA 4G0PA 4ZT2A 5TJHA 1P5ZB 3DFMA 5DH9A 3WL8A 1SKQA 1WTAA 2WIJA 2JFQA 4NHEA 3VFDA 1U3VA 1SHJA 1P4RA 2FP4B 3U3ZA 5CCEA 2AFHE 4QXAA 1L7EA 1E1QA 1BJKA 1P1FA 1A27A 3CUTA 1L8AA 1UKEA 1J0AA 2II6A 3N07A 1QVAA 3NONA 5EFZA 4N82A 1BA3A 1CFJA 3EEYA 2P65A 3EEBA 4I1RA 1TJ4A 4YPOA 4IYRA 5AVZA 4EKGA 4DDUA 3WGKA 4BVKA 4C3OB 3NTQA 3QU4A 4Y7DA 4LBVA 4XB6B 1YRWA 2IF2A 3BTSA 4U2FA 1IHYA 3WLFA 4MS1B 4DMRA 1NOIA 3DAGA 3FJ1A 3N3AC 4G9BA 3IKLA 4EK9A 3VM6A 1Q22A 3O75A 2ZR8A 1WU7A 1RYHA 4ASUD 5FPTA 1QV9A 2XDAA 3M81A 3CNNA 4KFUA 5A3QA 4YRMA 3B8EA 5SV2A 1CUGA 1T25A 4P32A 4LJ9A 4ZPJA 4C0BA 4DIUA 9MHTA 1N5OX 3FUCA 3CNOA 3L1JA 3RRYA 1QU3A 1DUSA 1IOWA 4PPNA 4RMNA 4QOHA 3VZQA 1PGJA 4ZQHA 3R6GA 5HG0A 2EGHA 3OLYA 1TPZA 5I7EA 4K0RA 5G0VA 1XK7A 3I5AA 4W8HA 4CM9A 1JFSA 2C9CA 5DT9A 4CM7A 1KEZA 5EXXA 4PANA 4K6FA 1JYEA 2R1TB 3GU3A 4BPRA 1XP8A 2XTAA 5CVJA 4RPCA 3NOVA 2KS6A 3NHKA 2J5XA 1ZXLA 1CY6A 5L7TA 4TZ6A 4F96A 3RC2A 3K0AB 1UT8A 4XGQA 3AUUA 2CXPA 4TS1A 2HA0A 4YGYA 4JVMA 2V1UA 4DQLA 4TLLB 1DXQA 3S8EA 1MXHA 1JB9A 1UMCB 2J4DA 2GNAA 2JGKA 3JWIA 3OLVA 3P94A 3LUGA 3NM4A 4QDKA 3RC8A 2ZIAA 4CFYA 2A0XA 3KR0A 1NSTA 3V97A 1N0IA 3PWZA 4NXMB 3I2JA 4MGYR 3NHWA 1N2CA 3ON5A 2J3EA 4DLKA 5IF9A 1XDDA 3GEIA 4Q4AA 4RWEA 1E3JA 1Q7BA 1MKYA 3DWIA 3FX2A 3JY6A 3PNVA 3QUCA 2SKEA 4C9BA 1K68A 1DRVA 2C42A 4DEXA 5DBFA 1V8PA 1Y4SA 3L7JA 5DCYA 5E38A 4DBZA 1WNTA 5K8IA 4XCVA 3L7MA 3P52A 2GZAA 1EFTA 3T12A 5L4LA 1Z5PA 2R4QA 3V8RA 1E89A 2G76A 2W2TA 3GCWA 3TR5A 4PHHA 1AD2A 4URFA 4W7HA 1BN6A 1R5BA 1RAHA 4E7PA 5AVWA 2JLCA 1XOIA 4M1WA 4PN3A 5B7QA 4JYAB 1OIVA 4OCZA 4RK7A 3FVRA 4B7UA 3K16A 4QULA 3ASUA 5LBUA 1PDOA 3CVVA 2YMQA 4KHPB 2O8DA 3EQ6A 4G56A 1IG0A 1L4MA 5IX8A 3ZDBA 1N3LA 4P7FA 3NT4A 4R2MA 5EPOA 2PNJA 3ZOKA 4D6PA 4EG1A 7ABPA 5E4JA 2FFHA 4M7PA 3GCZA 1VJ0A 4QUAA 3ABZA 1L8OA 1PJZA 4KPGA 5LQAA 2DMRA 1JS1X 1MZPA 5GOZA 3FETA 1ZK3A 1S5PA 4OH1A 3C6QA 3C5WP 1HRDA 1KJZA 1QZUA 2MSEB 5AI8A 3WLPA 1QFJA 4D4HA 1GVHA 1NP3A 4J0EA 4KRFA 3I37X 2XCTB 3AR6A 4XXHA 2YV2A 2E87A 4C22A 2ZUFA 3RYHA 4LTMA 2VDUE 2UV8A 4D9HA 4UDNA 2NSJA 1EXVA 1E8NA 4JJKA 5AIAA 4YPFA 3V1KA 1V96A 1UPUA 5F7JA 4LF4B 1RYNA 2PMKA 1UEJA 1P7VA 2OCGA 2PFSA 4L72A 2JRCA 1KMIY 4Q4CA 3D6UA 3HC7A 4FDAA 3MUFA 1NPYA 2PHZA 4YMWA 2WSBA 4RETA 4Y7CA 5KNCH 3MUOA 1OX6A 2YBEA 3C24A 4GO1A 1UT6A 4YRDA 3P9QA 2W2OA 1EP9A 3W9YA 2YRWA 3OBBA 3QVVA 3D0KA 3ZKWA 4F71A 4K03A 4LQCA 3L8HA 1R3UA 2Z2YA 2I6FA 2VWPA 4OGKA 4UPDA 2J48A 1ZUD1 3CA8A 5KDOA 1BWPA 5H9WA 4YXFA 2OSVA 4HDSA 1GTRA 4DLUA 1HNNA 4Q4AB 4EHIA 2HFKA 2Z04A 1CLUA 1I33A 1JSRA 1TZKA 2H2FA 2O5RA 3JYHA 4R2HA 3RU9A 3LBYA 3V80A 5KKCA 1FFWA 1LJLA 1U2QA 2GEUA 2WHEA 3MRVA 1ZOIA 2QQEA 3MTDA 4V0MA 5EPEA 5ILOA 1LDBA 1FFYA 2GD1O 3IOMA 2WWXA 5E4TA 5HE8A 2Y6VA 3O1JC 3DZ8A 4QYXA 1WXEA 4NMXB 1AH2A 2G63A 2R4TA 1KA9H 3AY3A 1D2AA 1N5IA 2HCFA 1Z5VA 5AVVA 3BVPA 1FFXA 4FVTA 5DO9A 5AUPB 4UVHA 3B1JA 3KAQA 4J0CA 1UPTA 2E1PA 3KO8A 5IVIA 2O8DB 1XMVA 3VTKA 4DB2A 3DW1X 3MLEA 3WL7A 4WKBA 1G55A 1T5OA 2CFSA 2NXNA 2X0IA 3CLVA 3CQ9A 4QX6A 2CJFA 1TTTA 4YUVA 5K05A 1N6IA 4OJMX 1UIMA 3KLOA 4HNTA 4GP7A 1P77A 1YRYE 1AUXA 4L5CA 1GPH1 3CLRC 3DMYA 3EQ2A 3NWOA 4O02B 1RXYA 5F1KA 5A5DA 4MX8A 4EYEA 3PBKA 1CC1S 3EFEA 2I6QA 3SM3A 3MINA 1E4YA 2FF7A 5AXBA 2AF4C 2AMLA 1FNBA 1WDMA 3TQHA 1XDBA 5HSGA 2OHOA 2KQUA 4RPIA 2MWMA 2OSBA 3RYHB 4MQ5A 2Q49A 3GJYA 3INGA 5F1YA 2UXBB 2PT7A 4J43A 4O4IF 3U37A 1AZTA 3SPXA 2YVQA 2A4KA 4IHKA 4MPRA 4ZO7A 4DDVA 1I1QB 2ZIVB 2FWBA 3Q87B 5BYKA 1QTNA 3RBAA 2IV3A 4RY2A 3GA5A 2OXFA 2CLEB 5C8YB 3HKEA 1FDUA 2G88A 3N2LA 5CB8A 1SXIA 5KQRA 3U2QA 1QHIA 2CXRA 2XKJE 2MSLA 2QRQA 4TQUS 4XM0A 1OU0A 1XCBA 1XO1A 2XMGA 3WRXA 3ZKWB 3AIKA 1I3MA 2E48A 3FWHA 4RORA 1F7UA 1A8HA 1QH8A 3HZOA 4HNVA 4YCDA 2Q4TA 4ARZA 4FE7A 4BBJA 5BSEA 6ADHA 4LSWA 3QE9Y 1BFKA 2AJTA 4ZI5A 4OX9Y 3ORSA 1Z0ZA 4NYMQ 4MMXB 3ZY4A 5JRJA 3KYJB 3DOOA 5AKIA 2Z5VA 3EGIA 2XRFA 3IE2A 3QEKA 2NSYA 2PO7A 4M0DA 3RUAA 4YB8A 3TIFA 4H35A 3N74A 2W90A 1HDGO 5DTQA 5HDBB 1S8NA 4QOEA 3TTXA 5BN5A 4IS3A 1C9NA 1J0XO 3L6EA 1TZJA 1I24A 3GRKA 3KXKA 2I4TA 1IUNA 1IM8A 1XZ8A 2I7CA 5DNAA 5EIFA 3ZN2A 1A7KA 3EPKA 3LECA 3LSYA 2GERA 2HRZA 2OFFA 2CYAA 2ZJAA 1FFEA 1ZGGA 3ZHTA 2GB4A 3IP5A 2GDZA 3L2OB 1URPA 2Y1EA 5B12A 5IJ9A 2JVIA 2B1GA 2ZAGA 4PGGA 2FK7A 2DEUA 4GMHA 1PJCA 2CWWA 4TL6A 4AECA 1NW9B 5A4AA 4Q1FA 4QE3A 3NIDB 4AW9A 1MO5A 1ODSA 2R66A 3R3WA 1A9SA 1FDWA 1PFYA 3NYWA 3T7CA 1QJCA 3WGLA 3NVKI 2FZ5A 1RAIA 1PGNA 3EOAI 2HM7A 2YYSA 3ISJA 3MINB 2OESA 3Q3HA 1JYSA 1LBHA 1V7PC 5J23A 4LHZA 2QNRA 3O8RA 1JHOA 2PUVA 3QX9A 3P2IA 5K3FA 3AZQA 3B38A 4V3CA 3IPYA 3RHZA 5JXIA 1PNVA 4PVCA 4EI8A 1C7FA 1H2YA 5KNBA 2WNSA 4C2AA 4GFDA 4GS5A 2JAPA 3C85A 2FUG6 3CRRA 1G7RA 4UJ5A 4RTMA 4DV7B 2PSDA 2WUWE 2QR5A 3P71T 1F8XA 3QUQA 3FOAA 1U7UA 1CTQA 1YL5A 5BWOA 4DWWA 3IUNA 2BM8A 2I1VB 3HKEB 4PGHA 4AZVA 4PHTA 4AZTA 1W1UA 3NPMA 5IK2D 4L78A 2X1LA 3PU6A 3C3EA 1WXIA 1KY3A 2P7HA 2I8AA 2PS3A 3QG5A 1YJAA 4G26A 4E07A 5GV7A 3TCXB 4FYXA 1E9CA 1QH8B 2XB8A 5K3CA 5AHWA 1V47A 4ARZB 2G1PA 2ZUVA 4B73A 2AMVA 3K8QA 3OEHA 4BLSA 5HFNA 3UK0A 3LX6A 2WU3A 3R7WA 4DG9A 1YZKA 3NYIA 1HKHA 1IG3A 1FS6A 2I1QA 3Q40A 3E9RA 2AOWA 2TECE 3PXCX 4HAIA 1KR5A 1E1YA 3PNBA 1NNEA 2QRGA 4GMKA 1JECA 3ESBA 3JD3A 3MRSA 1Y5NA 1XAJA 3B5JA 3QXJA 4G4SP 4LE2A 4MWBA 1GAJA 1AUPA 4U9IS 4UCQA 2WSIA 5BN5B 3WNQA 4BZWA 3F5MA 3FNEA 3AHJA 1ECFA 2V6IA 2Z30A 1LEHA 1E9EA 2YJ4A 4HADA 2G1UA 2XGOA 3HDJA 3V2HA 3DLHA 2E6UX 1RLTA 1U1IA 4TSFA 3WJ2A 5CDSA 3ZK7A 1T2CA 3ZOZA 4JI0B 3AL0C 5GADl 4PFJA 4HFNA 2R7AA 1P60A 3W5IA 5IAAA 3C1AA 4FW8A 1J1ZA 1JXQA 4MZDA 5FHQA 5IJ9B 1ZGJA 3MT8A 4RK1A 3LX4A 1TKCA 1HETA 1CRWG 1B6RA 2HBQA 2AQKA 4JKYA 1KY5A 1VKZA 3ZI7A 3FSRA 4CF6A 1QPGA 2OORA 1B73A 4L4SA 3PUZA 4MWTA 4EOGA 4R68A 3W77A 3BWXA 2NSLA 3C98A 5THXA 4J7CA 1L3CA 1JSZA 2ECPA 3NOQA 3AUXA 4LFCB 5TRTA 4RGBA 3E5HA 2XAAA 3SCZA 3X1WA 3LUCA 1WDTA 3AYXB 3RKUA 2JRLA 4DM4A 3IP9A 3AM1A 1JA0A 1VYVA 4D0NA 3UAYA 1XZBA 5BQOA 3KE8A 5JR3A 4YCBA 3K35A 3HSYA 5K3AA 3U80A 2WIBA 3EEOA 3CX6A 3ST7A 4KFTA 4CFZA 4BKUA 3C3WA 1JKJA 4RF4A 1DB3A 1YUNA 3F7MA 5DXJA 3LQYA 4XGRA 5IT5A 1TW2A