1N7HA

Crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
339
structure length
331
Chain Sequence
RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords GDP-D-mannose-4,6-dehydratase
publication title The structure of the MUR1 GDP-mannose 4,6-dehydratase from A. thaliana: Implications for ligand binding and specificity.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 129
structure length 331
sequence length 339
chains with identical sequence B
ec nomenclature ec 4.2.1.47: GDP-mannose 4,6-dehydratase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n7hA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1n7hA01
5B4VA 2OL4A 3JQ8B 2H9IA 1U3TA 1EUZA 3PVZA 4H3VA 2O3JA 4QECA 3AUAA 2I3AA 4J49A 2AXQA 3UN1A 1LDEA 3AY6A 4BGUA 1ORRA 3DZHA 3LF2A 4YEDA 3EW7A 3VPXA 4YACA 4NPCA 4XRGA 3DZGA 3UVEA 3DHYA 4DWVA 4AJEA 2EJVA 2GD1O 3HWRA 2GZ2A 3IS3A 3FNEA 4GSLA 1AHHA 2E37A 4WASA 4O63O 3SEFA 4CM4A 4DLLA 1XU9A 2ZKLA 4NBTA 4YVFA 1E0DA 4JIGA 1ULUA 4BMSA 3KETA 2GYYA 1EEHA 1GUYA 5IZCA 4Y6PA 3RUEA 3ZV6A 3RBVA 1MC4A 1MXFA 4XQEA 4DREA 2G5CA 4EI2A 2VZ8A 3GAZA 4PLZA 2JAHA 1YB5A 3GVXA 1YONA 5A9RA 4I5FA 1HDCA 1SO8A 3JQBC 3F4LA 4PZEA 3PK0A 1U8XX 2JKVA 5LCXA 4Y6RA 1YJQA 1LJ8A 2I9PA 2PGDA 3AUSA 1LRLA 4OQYA 1G1AA 3K8ZA 4D3DA 4ND3A 2YQ5A 4N5NA 3S55A 3SVTA 3L77A 3E9NA 4L4XA 4N54A 4FJ0A 4A7PA 1Q0LA 3DBLB 1KYQA 1WXDA 3IMFA 4DQUA 1VI2A 2J5KA 4YYZA 1QMGA 4FB5A 5JO0A 1ZK4A 3W8FA 4HV4A 4YBZA 2GO1A 1NWHA 1ONOA 3DOJA 1YE3A 3PXXA 1H2BA 1B7GO 2DFDA 4I1IA 3WGYA 3ZWBA 3D7LA 4PG8A 4QQRA 3LLSA 4F6CA 1EVYA 4NU6A 1ISGA 2AEFA 3CKYA 1W8DA 5AQ1A 4BO7A 4HFJA 3VAZA 5KVCA 4MVJP 1JTVA 2VWGA 3FPCA 1A5ZA 3FBGA 4AFNA 1E1NA 1XHLA 4NQZA 1JWBB 2O3SA 3DC2A 3ETDA 1VJ1A 2O50A 3RU7A 1R12A 2J5QA 2Q1WA 1I2ZA 2D1YA 2XAAA 4BKQA 2P2SA 3L07A 5AOVA 1Y5RA 2P9GA 5T67A 1ADGA 3F4BA 2FY8A 2WE7A 1Y9AA 4P8RA 2O7SA 5ITWA 3P5SA 4BO6A 1ML3A 1L7DA 3WDSA 4DBZA 3OA2A 3JQ7B 4PLVA 2C54A 5C7IO 4CMGA 3A1NA 3OJEA 1LDNA 1HL3A 3L4SO 3O03A 3QY9A 3G17A 5C7LO 5L7TA 1BHSA 3D0OA 1SPXA 4FD3A 3LZ6A 4W99A 3WWZA 5A9TA 3VKUA 2Q49A 1JKIA 4IDCA 5ILOA 4IY1A 4N5MA 1MGOA 3FTNA 3N58A 1O0SA 1QRRA 3IUPA 4U6SA 5FI5A 1GPDG 4CQMD 4CLRB 4B4OA 2WYWA 2O23A 5TRTA 3ONEA 1HSZA 3PHGA 1K89A 3IKTA 1CETA 4WOJA 3RC7A 3EVTA 1FK8A 2O3TA 1PJ2A 3AUTA 3C3XA 3DMTC 2DTXA 3JQDA 4NDNE 3FD8A 1PZEA 4Y9DA 5ER6A 3QJ5A 4D45A 2GN4A 4FJ2A 4BNJA 1UXGA 4I9NA 2GF2A 4P22A 2VYND 3A28A 3RKUA 3OFSA 2C5AA 4KQWA 1HF3A 2QRJA 4QFDA 3U9LA 1KS9A 1DIRA 1N2SA 4R54A 3WX0A 1KERA 3MJ4A 1G0NA 1LA2A 4KUHA 3QVWA 1MP0A 2OHXA 1DFIA 4L74A 4OO3A 5JLAA 5I8ZA 1DFGA 5H82A 3ZH2A 3JYQA 4L4SA 1RWBA 1SEPA 4G5HA 3PWKA 4WLNA 5EERA 5G4LA 5TNXA 2WD7B 1PGPA 4IMRA 3WQRA 2B5VA 1UUFA 1YDWA 2OMEA 4IBOA 3CMCO 4DL9A 4FFOA 2JL1A 4GGOA 3RBZA 2ZYDA 2I3GA 1X0VA 3WS7A 5EESA 5A04A 1K2WA 5U9CA 2OORA 1NYTA 1LLQA 1T2AA 3VHRA 4KWIA 4TZTA 4ZGWA 3HDJA 3ZHBA 4D0SA 2HMSA 3ZWPA 3FRJA 3TL3A 2BI8A 1GV1A 2A94A 5L3ZA 3H2ZA 5IDWA 2Q1TA 4JBGA 3QVXA 3VPHA 2QZ9A 2NTJA 2Q3EA 2CFCA 2OO5A 4J7CA 4QUKA 3RD5A 4BQPA 1EBFA 4CMCA 1SOVA 1EFKA 1O9BA 4DQXA 2ZQZA 2PFGA 4WNCA 5A9SB 1EZ4A 1PGQA 2HRBA 3VZPA 4F46A 4BNFA 3BTSA 2IZ1A 5JAZA 4GX0A 4HX5A 2ZCVA 6LDHA 2B83A 2PZJA 2FSVA 1N7GA 1CJCA 2WEKA 5DDIP 1LRJA 5KVVA 2X0RA 2VRBA 5TLSA 4PN3A 3KYCA 4P4GA 3ZWAA 1H6CA 5ILGA 1KOLA 5CFZA 4II3A 2ET6A 3A4VA 4CM8B 5DOVA 1NQAO 2HQ1A 4MIYA 4PLYA 4L0QA 4RZIA 3KYDB 1LSSA 1NAIA 2Z95A 4NU5A 3RWBA 3ZWMA 4Z0TA 4UAGA 4CMBA 2QYTA 1HDOA 1Z7BA 3LT2A 1C1XB 1PTJA 4M54A 3HG7A 5IXSA 2X86A 3AM5A 3AOEA 1PJCA 2IODA 4GH5A 1GAEO 4CM1A 3SC6A 1ZFNA 4WLVA 4ZRMA 1GU7A 2FR1A 2JD0A 3PWSA 4D41A 3TZ6A 5FI3A 5CEFA 1GUFA 2BH9A 4J9UE 1Y81A 4UVGA 4CV2A 4WOKA 5IN5A 3PI7A 3S2EA 1U5CA 4JBIA 3Q0EA 4TWRA 5TX7A 3PLNA 4NG5A 1P1HA 1UZNA 5GZ6A 3RSHA 4GBJA 3RUCA 4CMJA 3L6OO 3GF4A 3GZNB 3INRA 3E9MA 3RROA 3VVCA 4YAGA 2EHDA 3AM3A 1A9YA 2C82A 3BAZA 4D44A 1LQTA 4XR9A 2ZYAA 5IAAA 1NX6A 4XZ3A 1GEEA 4K26A 1NVTA 3B1FA 4WPGA 2GUGA 1QKIA 1EK6A 2RH8A 4W9NA 3RI3A 4A27A 1A27A 2LDBA 4XB1A 5T64A 3KBOA 2UAGA 1DC4A 3TNLA 1X7DA 4UVEA 2Y0CA 4WCFB 1PZGA 3NDIA 4KQXA 4LK3A 3RJ9A 2HKIA 3KSZO 4U0JA 1VC2A 3WLEA 3JQ8A 1XR3A 3ADPA 1O6ZA 4IJVA 1I5RA 4HUJA 3FBTA 3PJDA 4YB8A 1FMCA 4QO8A 4N5LA 5JCJA 4NNJA 3ROPA 1ONNA 2Y1FA 1MFPA 2JCXA 4PFJA 4B3IA 3DMYA 3ZWYA 1VL0A 5FEUA 3E18A 1GDHA 3WNVA 1LNQA 4TSKA 1R15A 5JAQA 4GLLA 3W8DA 1ISHA 3FCOA 4PIVA 4CUKA 5L4LA 1FDVA 3T7CA 2JFFA 3OEWA 1HE2A 1J5PA 4GAEA 4Z3DA 1ADCA 4Q9NA 2R00C 4KTTE 2YHIB 3R3JA 1N5DA 1TXGA 2EGGA 1QXSA 1DHTA 1F12A 4H16A 4TKLA 5DZSA 5G4KB 4LRSB 2NUAA 1PWXA 5G0TA 1YDEA 2AQ8A 4YQZA 1NASA 3TDKA 1QYDA 3KEQA 2EGHA 4RPKA 4AJOA 1DSSG 2ZQYA 4BNWA 4M87A 2Y67A 4CV1A 2WE8A 4ZVVA 1M76A 5L7YA 4FS3A 1AHIA 1H5QA 1EQUA 3F5SA 1IULA 4U5QA 1UXKA 4L8VA 1RYEA 3HZZA 1I8TA 3UF0A 1T26A 2D0IA 2W98A 5EINA 3AU8A 3D64A 4DBVO 4RLHA 3ZV3A 5EPOA 1E7YA 5DP1A 3DBLA 3PZRA 1GV0A 5EQFA 3ZV4A 1S6YA 5LDGA 4W4TA 2FMUA 3DBRB 1G0OA 2QW8A 1T2EA 5THQA 5U4QA 5EMHA 2WYVA 2DPHA 3WNQA 3X2EA 4CM3A 3B70A 3EZLA 4NFHA 3L6EA 4BO5A 4DMLA 3QE3A 1N9GB 1DJQA 4OL9A 4A03A 3PWZA 4LVUA 2EF1A 3GA0A 1H94A 5T6BA 4BNMA 4CL8A 1K6IA 4XQ9A 1PL7A 2BRUA 1V9LA 4A0SA 1B8PA 1P33A 2PGJA 4RPJA 5KVSA 4ND5A 1NBOA 2E49A 2TMGA 4HADA 3VDQA 1IHYA 4TZKA 5AXDA 5K6AA 2UUPA 4NHEA 2VT2A 4YT4A 1ZXLA 1R16A 3ON5A 3DBHB 2CVZA 1LLDA 3LC2O 4JNKA 3GAFA 3QV1A 4RVGA 1GQQA 4W82A 3WQSB 3GUYA 2WMDA 3GFBA 4DYDA 2P4QA 3OJ0A 2EV9A 2GR9A 4CV3A 5BNIA 9LDBA 2Q4EA 4CJXA 4IZHA 4XD2A 3WTBA 2PA3A 1HE3A 1I3MA 2AG5A 2HAEA 3BMQB 3HDQA 4ZQFA 5H81A 3G79A 5HRUA 4ZQEA 2C5EA 3PJFA 4DIOA 1WMBA 1P0CA 3JQ7A 3U0BA 1GTMA 2HJRA 1E7WA 2YY7A 4WEOA 4ZQHA 4E2XA 4YT5A 3LF1A 5A4DA 5JS6A 2J6IA 1ZO8A 3MCVA 5ENDA 2EP5A 2B4QA 2VOEA 4R3NA 5T57A 2P9EA 1U3WA 1T2CA 1PJLA 2ZATA 4GWGA 4JJGA 2FPIA 3DHNA 3GNQA 1PGNA 1QYVA 2B4RO 2BLLA 2QX7A 4CLOB 4WGGA 2I6TA 4RPGA 1FDSA 1B8UA 2D3TA 4CLRA 2WSBA 2VZ9A 4L4RA 5DULA 4Q3DA 4TKMA 2GASA 3JQFC 4ND1A 1LI4A 2VQ3A 3QWHA 3B1KA 4PGFA 3VPFA 2G0TA 4BNNA 1RPNA 4YAIA 2RHCA 4XWYA 5C7OO 2VOJA 4BGVA 1C0IA 2WDZA 3CH6A 2X23A 4R16A 4ESOA 4W7HA 4R5MA 4YPOA 3FWZA 1DHRA 4EBFA 9LDTA 4L73A 3SC4A 4RJTA 4EGFA 4GWKA 5IF3A 1M2WA 2YUTA 2NWQA 1DRWA 3I6QA 2Y99A 2QRLA 4P38A 4CM9D 2HK7A 2ZB4A 1UP6A 2Y0DA 3I5MA 3CMMA 1TEHA 4BHTA 3GN1A 4J43A 3LVFO 2EKLA 3DL2A 3GGPA 5JYDA 4I5EA 4J4HA 2HK9A 1JA9A 2EW2A 4NK5A 1KVUA 1B16A 2D2IA 4IQGA 1QYWA 3WYBA 2WD7A 3RUAA 3K30A 2D5CA 4J2OA 2NU8A 3WGHA 2RAFA 3PGXA 4LVCA 3AW9A 2W4QA 3ENKA 4DQVA 2OP0A 1YL6A 1EE9A 5DN9A 2AE2A 5IDYA 4J1QA 4UVHA 3IP1A 5L45A 3PFFA 4R68A 1TT5A 1XG5A 1R4NB 4G81A 3NV9A 4GVXA 5LC1A 4MDHA 1XA0A 4EJMA 1XQ1A 1U3UA 2Q46A 3R6DA 2DC1A 5EIOA 1H6AA 3H8VA 3STHA 4CLXA 1DJNA 4IUYA 4TRMA 3L0DA 3T7EA 4CV0A 1DC3A 3CE6A 4EITA 3KLMX 3U09A 3NJ8A 1NVMB 3C85A 1BW9B 4BO8A 5A9SA 3QSGA 4MVJI 2Y1EA 3JQAA 1OBFO 3RFTA 3RC1A 4XJTA 1NQTA 2BELA 2VHYA 3CZMA 4NIMA 3OJOA 1YO6A 4WLEA 5TIIA 1Z7EA 2E48A 1P74A 4AJHA 2VUUA 4BNVA 4CMHA 3EZYA 2NU6A 1O5IA 1R0KA 2XXBA 3FR8A 3DO5A 3I9LA 3W4JA 4O1MA 1HDYA 3Q2KA 4OXKA 4CM8A 1DIBA 3OM9A 3GMSA 4BO4A 2FZWA 2X5KO 2WYUA 3MWEB 5A5FA 1GZ4A 3KYDA 3O4RA 1Z75A 3DZIA 1XDWA 3BMNB 4YA6A 2B4TO 4RV9A 4Z9FA 2YV2A 2X5OA 1C1XA 3BMCB 4RPLA 5I7SA 3ASVA 5L4SA 2PKQP 3DZFA 1NQOA 3EMKA 4NR0A 4J1SA 4PZCA 4AICA 3B6ZA 3GDOA 2DT5A 1SB8A 1BXKA 3ITDA 3E1KA 4EJ6A 1B2LA 1DXYA 2OBYA 2Q50A 3VZRA 4CMEA 1HXHA 2Q2QA 3HADA 1ZKMA 4YTEA 4FQ8A 3FF4A 3GH3A 2ILTA 5TT1A 2Q4BA 2EEZA 3W4KA 3D4NA 3KSUA 1Z82A 5L51A 2AG8A 5A06A 1R4MB 3DMTA 3GZNA 3NT5A 4II2A 4E0BA 4D0RA 1PSDA 1D7OA 4JX8A 4JROA 1J49A 4RDHA 4TROA 5F1KA 4JJIA 3CINA 2PWZA 2YJZA 3NEPX 2I76A 1YVEI 3UW3A 1H9AA 3ASUA 1PJBA 1KEPA 2BFAA 5JCJD 3JCZA 4J0FA 3BMOB 3PJEA 4XQCA 4YJFB 1PJQA 5JAMA 4WCFA 1WMAA 4BO3A 3M1AA 1N7HA 4GPD1 2FR8A 2V6MA 1X0XA 1QYCA 4GVLA 4K1LA 4AJ2A 3R0IA 3ORFA 1U5AA 4X54A 2DBZA 2I5PO 1HYGA 1YQGA 3K9QO 4LRTB 4P4LA 3ZHXA 3NAQA 5JFOA 2GZ1A 4EZBA 2RIRA 3KEOA 1UXHA 2DBQA 2GN9A 4PLPA 4R01A 1PJ4A 1DAPA 1ISJA 5CDGA 2C7VA 2I99A 3E48A 4RVUA 4BO2A 3DFZA 1DPGA 1BXGB 3O9ZA 4YQYA 4ALIA 4FGWA 1E1KA 1XIVA 3TN7A 1UP4A 3U4DA 2H5LA 1PR9A 4AJJA 1CF2O 1Y6JA 5HM8A 3I4FA 4MP8A 3OIDA 2VHZA 2X9GA 1HE4A 4E4YA 1PIWA 2B35A 2YHIA 1WLYA 1YQXA 2UV8A 4K6FA 4ALNA 5COQA 2P91A 3E9QA 5G4KA 1ZK3A 3HSKA 5G0SA 2C59A 3A9WA 2V6BA 3DOCA 4BS9A 3PHHA 1FF9A 4DLAA 1M67A 2XOXA 2YDYA 3W4IA 1MUUA 2QHXA 2I66A 2VYVA 1P1FA 2PR2A 3E6AA 4OAQA 2P9CA 1XEAA 1YQDA 1B8VA 1E3JA 1D3AA 3I52A 1NM5A 1NTOA 4IS3A 1B3BA 3D4OA 3I6IA 4I08A 2W8ZA 1Y5MA 5CDTA 4E30A 3JQGB 1PQWA 1B3RA 1EDZA 3H3JA 4RF3A 4NI5A 3RKRA 4BGEA 3DB2A 1EFLA 3ICCA 4CLDA 2JFGA 3AJRA 1E1MA 3OF2A 1E77A 2DU8A 3DBRA 3H9QA 5DP2A 1JW9B 4YRBA 4KDEA 4EUHA 2PD3A 1JWAB 4B8WA 3VTFA 3NTRA 4DA9A 2J3JA 5JSFA 1FJHA 1N9GA 2C2YA 1SC6A 4WECA 3L4BA 3AI3A 4L76A 4RPHA 1QORA 1SAYA 3ICPA 1RKXA 3LK7A 3SJUA 1FDUA 1GYRA 4PRLA 1NPDA 3WGIA 4ALLA 4XX0A 4DC1A 2EIHA 1NAHA 5JMWA 3VH3A 1NNUA 1ZK0A 2AQKA 1IPEA 2O4CA 3KLPX 1KEWA 3DBHA 3DZBA 3AWDA 2BFOA 3DFUA 1K6XA 4A10A 4D46A 1PL8A 5TT0A 1ZCJA 4YAEA 1DB3A 5JY1A 3HQ4O 1HTBA 4MVJH 2QG4A 1AXGA 4XYBA 2BFMA 1Q2XA 5TJ9A 1LX6A 3BMQA 2CVQA 3H2SA 1V3TA 1LC3A 1NHWA 1ZEJA 3HJAA 4E2WA 4KWHA 4EYEA 4RF2A 4E5MA 3HFGA 3JD0A 1EUCA 1DLJA 3QWBA 4ITUA 2PKRA 3P2YA 4MOWA 1Q7BA 2VWPA 1N92A 2SCUA 3INTA 3OIFA 4PVCA 2X22A 4CQLB 4JP3A 3P19A 4B3JA 4CLOA 4EW6A 4E21A 3E8XA 1LSJA 2BGLA 3ZU5A 4OSPA 3E82A 1CRWG 4XDZA 4RF5A 2J8ZA 1ADFA 2XF8A 2YW9A 3GY0A 5HWSA 4CMEC 4GMFA 4NK4A 3H7AA 2CVOA 5JAIA 4TVOA 3KUXA 2R00A 4NH4A 4LSMA 4RVFA 3BHIA 1OC4A 1F8GA 2Z5LA 1PS8A 4CM7A 1HEUA 1HZJA 4IMPA 1XU7A 4PG6A 3NTQA 3MJSA 2E82A 4ID9A 4LCEA 2G76A 3C7AA 1KY5A 1Q0QA 5KJEA 4C7KA 2JCVA 2A4KA 2YYYA 5EL0A 4CMIB 1TA4A 5IDQA 1RJWA 1ARZA 1IYZA 4WCFC 1GZ6A 5IDXA 3WJAA 1LRKA 3KHUA 4BNZA 5KJFA 4Y98A 2AQIA 4IS2A 1KEVA 4QFCA 1ZIDA 3DAPA 3OQBA 1E5QA 3WXBA 4ROSA 4QTZA 4ZN6A 4XEHA 5TS3A 2Y1CA 3MZ0A 1E6EA 2YHUA 3GEMA 4ZU3A 2GN8A 4CQMB 2NQ8A 3WFJA 1C14A 4ALMA 1SNYA 4MPDA 4YJGB 3TSCA 4B3HA 3JQAD 1EDOA 1JN0A 1CIVA 1EBUA 1R4NA 1RM5A 1NPTO 3WWYA 1PR3A 1IPFA 1M75A 4XJSA 2C20A 1HDRA 4IJUA 3PQEA 3ZN2A 3OJLA 3ZU2A 5DCYA 4IDFA 1HLPA 4R1SA 4OH1A 4NFYA 1IOLA 4Q39A 1T2FA 2VTDA 4YR9A 3HB4X 1BW9A 2X0NA 4WNIA 1PWZA 4UVIA 3DBVO 3OICA 5KJ6A 3I3OA 3Q9NA 1Q7CA 4J6FA 4R1UA 2AHRA 1BDMA 4MIOA 5F5NA 3DQPA 5DF1A 1EUDA 1K6JA 1QV6A 2EW8A 2VHXA 4H7PA 4Y8VA 1IL0A 2D59A 2O3RA 3EHEA 1XGKA 3IQDB 4BNGA 4CR6A 4IDGA 1PQPA 4YXFA 1DC5A 3NTOA 4XYLA 4BKPA 2E6UX 3LSYA 3PTZA 4NBVA 1HRDA 3SJ7A 4BNTA 4DYVA 3TZQA 3OSUA 2JHFA 3BMNA 3QVSA 3BMCA 1MFZA 1SCUA 1KY4A 5C3MA 1VLLA 1KEUA 4INAA 1I3NA 4R9SA 3TRIA 4M86A 4JQCA 2BGMA 4ILKA 1J4AA 2ZYGA 4XIYA 3MTGA 3AY3A 3ANMA 4FFMA 2A9FA 3L4BC 1NFFA 3JQFA 4YT8A 4BNUA 3KOUA 2DTDA 4FPXA 2OFPA 4B4VA 1R4MA 2EKQA 4OXNA 1HDGO 1H93A 2NVUB 1E3LA 2Y66A 1VE9A 4O59O 1HYEA 3ZDFA 1F0YA 3WGQA 1ZNQO 8LDHA 3W1VA 2VRCA 3I9OA 4CPDA 4IGFA 4PRKA 1T4DA 4TRRA 2R2GA 3G0OA 1Q7GA 1WDLA 2XXJA 4HFRA 4E3ZA 5TF4A 2X58A 3BMOA 1JKFA 4M49A 4YJFA 1CQIA 3G49A 2EWMA 5MDHA 1PZFA 1Z45A 3BTVA 4K9DA 3K31A 4N7RA 4NMHA 4BVAA 4FFNA 4PLGA 4BKRA 3GQVA 1LDBA 4MIEA 4E32A 3DR3A 4O5OA 1HDZA 2O48X 4CMAA 5A02A 1VL8A 4BO0A 4YDRA 5KKAA 2E4AA 1EVIA 3FSRA 3LU1A 3C1OA 4CUZA 4DC0A 4HWKA 3GN2A 3VVBA 1BXGA 1NXQA 2IDZA 3E5RA 1ENOA 3UICA 2P5UA 3G3EA 3PFWO 3CPSA 1GYQA 1YBVA 1JU9A 1R37A 3UCEA 1Y1PA 1BMDA 4D79A 3FNFA 4YWJA 3X2FA 5JC8A 1FDWA 4AJNA 3MJVA 4MKRA 1HWYA 3UAGA 2CDBA 3GEGA 4PLTA 3DAGA 5A5EA 3QW2A 1X7GA 2DBVO 2YV3A 3DDNA 1PX0A 3IL2A 4DPLA 3PPIA 2Z1NA 5ICMA 5KNLA 2IXAA 2X7HA 1W0CA 2EKPA 2X1HA 3IKVA 1ZUD1 4C4OA 3PHIA 3QWIA 4GX2A 4OOEA 4WCDA 3DTTA 2FP4A 5KVQA 1IZ9A 1E3SA 5K9ZA 3C7DB 3NYWA 4E5NA 1YB4A 4XQGA 3BHMA 3C1AA 3JQGA 4G65A 4U6QA 1V6AA 3BZUA 3M1LA 2AE1A 1JVBA 2VWHA 2B37A 1U8FO 2H63A 2OOSA 3Q3CA 4MVJE 4Q3EA 1U7TA 5F3RA 3IDSA 4AJIA 4B4WA 4E5YA 1C3VA 1WDMA 1C1DB 1ZEMA 4UUNA 3TQHA 3SBOA 2NV6A 2Q2WA 1EVJA 2Y0EA 3JQ9C 1UH5A 3ZWVA 3KB6A 3I83A 4HP8A 2UYYA 3JQ6A 3JYLA 2HMUA 2Z1MA 3VC7A 1PL6A 2PV7A 3PHJA 3QQPA 1HLDA 4C7JA 2GN6A 3H3FA 4U8GA 3R1IA 2Q99A 3AOGA 4ZRNA 4YAJA 4LMRA 4LGVA 4YJHB 2AEJA 1VKOA 2C2XA 1I32A 3UXYA 1PGJA 3IUSA 1WW8A 1ZXBA 1PJTA 3EK2A 2GGSA 1EE2A 5CG2A 1ZMTA 1B15A 3WQQA 1W4ZA 3H9EO 3HDYA 4PLFA 2A92A 4RORA 3JYOA 3RIHA 3FN4A 1DRUA 4MP6A 3WYCA 4RGBA 2FWMX 4HFNA 1JDJA 2A35A 1PJSA 1Y8QB 3HN2A 5F21A 5CDUA 1AE1A 5GZ1A 2DTEA 4XGNA 1ZSVA 3RFVA 5L53A 3DOOA 2ZTUA 1ZK1A 1D8AA 1VRWA 5KOIA 2VWQA 1XELA 3FWNA 4GLOA 3P2OA 2OXIA 1SZJG 1GCOA 4UULA 3LT1A 3TZKA 4CQLA 5JXWA 3GNSA 4QT0A 3GVHA 3NJ4A 1ADBA 3K2EA 1LLCA 1TVEA 1A4UA 1ZMOA 3P7MA 2UDPA 4EJ0A 4J1NA 5ICSA 3TOXA 2V65A 2I65A 4Y6SA 2J3IA 3IJRA 4E31A 2EXXA 4CUJA 4F6LA 5IJZA 1TB4A 1BWSA 1Z74A 4ONEA 5CDYA 3U4IA 4BNKA 2UUOA 4DPMA 1HDXA 1CYDA 4D43A 3BYZA 4J4BA 4J7XA 3T4EA 2ZB8A 4B7CA 3OQ1A 3DONA 3ZCXA 3PDJA 4L75A 1GL3A 1Y8RB 2Q2VA 5HS6A 2W2KB 4GKBA 3UCXA 3F6YA 4M55A 1UXJA 1GZ3A 4CR8A 1VJTA 2B5WA 4CMIA 4J7UA 4BB5A 5IZ4A 4BQRA 4CODB 5FYDA 2NLOA 3NDRA 4TRNA 1T24A 1PU2A 1YBAA 2BD0A 2WWRA 4RF4A 2JCYA 2P4HX 1DAOA 4WLOA 3GR6A 3M2PA 1EVZA 5BR7A 1HYHA 4RVHA 2X0IA 3L9XA 4KUEA 5A03A 2O3QA 4Z9XA 3PDUA 4OQZA 3GUCA 1IZ0A 1O94A 1PJ3A 3ST7A 2NTNA 1RYDA 5COAA 1U1IA 2QYSA 2GCGA 4ZQBA 4RDIA 3QVOA 4CQMA 3DZJA 5CHEA 3TWOA 3ZW9A 3FNHA 4AJKA 5AXBA 1YRLA 1U2DA 3ZWNA 4YJGA 5HBRA 3ZW8A 5A3VA 4FFRA 5JNLA 2GSDA 1SMKA 2CY0A 3U4CA 3JD4A 4GKVA 4I5DA 4Q3NA 4PG7A 2QQ5A 2D5AA 2BMAA 2I67A 1PEDA 3DHEA 3BIOA 2NVBA 3GT0A 1MX3A 5DCWA 3RUDA 3BTOA 4E5PA 3U62A 4J3FA 4XA8A 3ZNOA 4DLBA 3KM0A 5EN4A 3KTDA 3DTYA 4FSHA 4BB6A 5B37A 4E6PA 1DOHA 3WSVA 2DQ4A 3SLGA 3IJPA 1X14A 2C29D 5EJ2A 3B20A 2GLXA 3OA0A 1MLDA 3KSDO 4JJFA 1M66A 1I3KA 4S3MA 4A26A 2JD2A 3ONDA 2DUUA 4O6VA 4YT2A 1GQ2A 4A2CA 3T4XA 2OZPA 1H0KA 3K6JA 4KP7A 4OM8A 4QSMA 4A73A 2PZMA 4J91A 2Y1GA 1NP3A 2X0JA 1WPQA 4WK6A 4IQ8A 3WGOA 4IJKA 5COBA 3PHLA 3FHLA 4A5OA 3H4VA 5JO9A 1UDCA 2DBRA 2ZK7A 3F5QA 1ONPA 5AXCA 3HN7A 4MKZA 1UP7A 3IOYA 3JQCA 3RCBA 4CLHA 4DUPA 2HJSA 1UDAA 4JXKA 4DRYA 4YRDA 3V1TC 2VRCD 3FPLA 1R6DA 3GDGA 3ZZNA 1E92A 4AJLA 3VH4A 4WLFA 5HA5A 3KVOA 1QLHA 1GFSA 2FR0A 3FNGA 3ZU4A 1W6UA 3A14A 3CZRA 2PH5A 4D7AA 4S1VA 4PVDA 3Q9UA 1A4IA 4NJMB 3HFSA 5ES3A 2C7GA 3INGA 3GVPA 4MP3A 2GPTA 3Q6IA 4IJWA 3U49A 5F1PA 4DGSA 5ER9A 2D8AA 3EC7A 3NKLA 4I9HA 3QA9A 3JD3A 1UR5A 1ZZEA 4R51A 3VOSA 1LUAA 4PLWA 2HU2A 4BNYA 3EGOA 3TFQA 4CM6A 1VJ0A 2B36A 3ANLA 3RBXA 3BTUA 4FJ1A 2O3UA 3TL2A 2NACA 1BGVA 2CNBA 2BGKA 1Y9EA 3ZHZA 2BFPA 4B4UA 1MV8A 1P1KA 3N7UA 2J3KA 3GFGA 3GZ4A 4DPKA 1N1EA 2HUNA 2PNFA 3TZCA 4BO1A 2NU9A 2NVWA 3DWFA 4XKJA 4ALJA 5KJCA 1OAAA 4FC7A 1LC0A 2YQ4A 4ND2A 3VDRA 1YOVB 3JYNA 4KMSA 5BSHA 4MKXA 1QSGA 3OHSX 1OI7A 1XWFA 4UUOA 1H6BA 3OQ6A 3D4PA 3GRPA 3OJFA 2IZZA 1LSUA 1WZEA 2HRZA 2Y1OA 1G6KA 3HB5X 3OMLA 4XIJA 3RU9A 1U4SA 3TOZA 1WWKA 3H9UA 1GD1O 5BSEA 1OC2A 2W2LA 4OKNA 1SOWA 3S8MA 4FGSA 3RC2A 4E2ZA 1LU9A 4TVBA 4IDBA 5JDCA 1E7RA 1PQUA 3ENNA 1T25A 3HE3A 1JAXA 4HY3A 2PGLA 1YJ8A 2PD6A 3LLVA 4RCVA 3ZV5A 1FDTA 1BXZA 3RFXA 5G0UA 3I4CA 3SX2A 3A06A 4CLEA 2IEBA 4MVJA 2GDZA 3F9IA 5C5IA 2V6FA 1PS0A 2VNSA 1D4FA 2ZTMA 1SB9A 1LLUA 3AI1A 4IXTA 4EUEA 1DDOA 1Z6ZA 3WMWA 3F3SA 2ZTVA 4NZ9A 2C07A 3IP3A 4IDDA 4OMUA 2CMDA 1C1DA 3H6KA 1A9ZA 5CP8A 2NQTA 4BL5A 2X6TA 4XYEA 2D4AA 7MDHA 1PGOA 1ZSYA 2YDXA 4MINA 1P44A 1J6UA 1LDMA 3BHJA 4R69A 3E03A 4DIBA 5GZ3A 4NBRA 1JLLA 1P9LA 2CDCA 1BSVA 3WFIA 3ZWWA 4OJNA 3GEDA 4WE3A 1D1SA 3WJ7A 3I9MA 1N8KA 4U7WA 3ETEA 4OGWA 3RAJA 5JDIA 4GX5A 4TMFA 4JP2A 2IZ0A 3ZNNA 1KETA 1YKFA 3WTCA 6ADHA 3JTMA 2HMVA 4YJHA 1PS9A 5IXYA 3WB9A 1QP8A 4QO7A 1D1TA 1UAYA 3FI9A 2X9VA 2XPCA 1ZH8A 3D5TA 3V2GA 5AVOA 2R6JA 2EJWA 4HNGA 1L1FA 3C24A 4L9RA 3GHHA 3N74A 4BKUA 3LQFA 3PYXA 2NNLD 4Q3AA 4Z9YA 1Y8QA 1U4OA 1B26A 2O2YA 4F3YA 2BI7A 4N18A 3EVNA 1U2GA 2O2SA 2NADA 2IXBA 5CEJA 1ISIA 1ULSA 3HDHA 1B14A 1IB6A 4ALKA 3MOIA 2YV1A 4ZICA 3F47A 1DLIA 1H2HA 1YWGO 2GNAA 4J0EA 4NBWA 3UGKA 3MEQA 2DPGA 1AGNA 2P5YA 2ZIZA 2FOIA 3PRJA 4W7IA 3PYMA 1HETA 5JPIA 3EAGA 3W8EA 1NVGA 1VL6A 3JQEA 1U7HA 1XCBA 3MWDB 2H1SA 3V8BA 3O26A 5AYVA 1O89A 5F1OA 2AW5A 5BNFA 3S1LA 3K73O 5T8KA 1X7HA 3VTZA 5JY6A 4HKTA 4KTVE 4Z0HO 5TC4A 5TJHA 2PTGA 4J16A 1GUZA 1HSOA 1Y8RA 2VUSA 3MJEA 1C0PA 3D5QA 2W2KA 1RM0A 1CDOA 3TZHA 4W6ZA 3RUFA 1E6UA 1DEHA 2HO5A 4TQGA 3ANNA 1P77A 2FZEA 4RZHA 1BVRA 2AMFA 4FFLA 1A72A 2RCYA 3RVDA 3ZU3A 1XYGA 4OXYA 3GGGA 4KOAA 2NSDA 2NU7A 3DEYX 4BNLA 1R0LA 3GC6A 3GHYA 2BKAA 2Y68A 4DIFA 4GSKA 1F8FA 3WGZA 5G0WA 4B79A 4BV8A 3DZKA 4OHUA 4WLUA 5C37A 1E7MA 3O8QB 1ENZA 1XSEA 4DXHA 4JK3A 4XYGA 3JQ9A 4MVJM 4K6CA 2ZTLA 4ZQGA 5J23A 4J9VA 1XLTA 4XYMA 4D3SA 4TRJA 3F46A 3D3WB 5KKCA 4IXWA 4EEZA 4CR7A 3GRKA 3RQSA 4AL4A 1K5HA 2NM0A 1ENPA 3H9JA 3WLFA 3WSWA 3M6IA 3PIDA 5EQDA 2IRWA 3G1TA 3WR5A 1X1EA 2G17A 2VHWA 4ND4A 1GR0A 2RH4A 1MC5A 4P4NA 3KV3O 3ROMA 3RUHA 1JKJA 1QV7A 2B0JA 2FRDA 4BKOA 1NQ5A 4E13A 4E12A 3ITKA 5JDCC 3UFXA 4UUMA 1OMOA 4LISA 2FHSA 5U1PA 5A3JA 4PLHA 4XB2A 4CM9A 5BQFA 5HTOA 4KDFA 4LCJA 4R5HA 1YS4A 4XDYA 4CM5A 3GMDA 1ID1A 2PZLA 4RLSA 1AXEA 2Y05A 1O8CA 1QR6A 4IGEA 4J90A 3KXDA 4KUGA 3CSDA 1M6WA 2Q1UA 5F5LA 1TT5B 2X5JO 3V5NA 1OOEA 5CPBA 2FPPA 3JSAA 3O38A 3LC7O 4XGKA 2V7PA 5GY7A 4J4TA 3U5TA 4IDEA 5CEEA 4RL6A 4BMVA 4B8ZA 3HNPA 3L6DA 3ONFA 5ITVA 1GY8A 3OIGA 3H5RA 3WMXA 5IG2A 5IZCC 1GPJA 4IIVA 1P1RA 4QX6A 1LSOA 1GQYA 1CERA 2TMDA 3JQAB 4Z6KA 3NDJA 3V1UA 3UKOA 1BVUA 3FTPA 2OP1A 3VZSA 4HFMA 1OZAA 3B1JA 1BG6A 1QG6A 3SXPA 3V2HA 1T2DA 1V3VA 4XR4A 3AFMA 1UDBA 2FN7A 3LT4A 3S2GA 5DT9A 3C1TA 3NT4A 4ZD6A 5JDIC 3HUDA 1I10A 4NJMA 5JCXA 3DXFA 3AY7A 3G1UA 4YRAA 2ZJ1A 1YXMA 4UVDA 1E6WA 3RC9A 3AK4A 2Q1SA 5B4TA 2P68A 4G2NA 4DTIA 2VTEA 1HT0A 4YAKA 1T4BA 1BDBA 2G82A 4WUVA 2POQX 4EDFA 5BNTA 3H9GA 4I9UA 3JV7A 1RM3A 4ZHSA 1AN9A 7ADHA 1ZSNA 1AUPA 1P3DA 2Y93A 3W6UA 3VZQA 4R1TA 3UHAA 3WGGA 2CSUA 1NWCA 3VH2A 2W2LD 1GADO 1W73A 3EY4A 1I2CA 2IYOA 4H15A 3GLQA 2X4GA 4EUFA 1R66A 1YOVA 1BRMA 1IHXA 1NFQA 1R0SA 5B12A 5L95A 4AG3A 3SLKA 2J5RA 3ABIA 1E7SA 3QWFA 1X13A 3WG9A 4R3WA 4BNIA 3QHAA 1ZJYA 3D3EA 3LYLA 4M89A 4AJ1A 3S2IA 1I3LA 1H6DA 4MVJD 2JJYA 1O95A 2OBNA 4MO2A 3Q1LA 3TFOA 1E3WB 5GMOA 1XKQA 4URFA 2B69A 3OH8A 1P45A 1DRVA 4NBUA 2VYVD 4FBGA 4YCAA 4Z0PA 3H65A 4ZJUA 1MG0A 1JQBA 3I9KA 4U0KA 1WNTA 5T8KC 1DC6A 3OBBA 2O4UX 2HDHA 4IZIA 4UEOA 3HHPA 2HK8A 5BSGA 2ZCUA 1LQUA 1WVGA 1HZZA 4GMGA 2HMWA 4OKIA 1DIGA 5DBFA 1P1IA 3RUIA 3KYBA 2CF5A 2WM3A 2YFHA 1XQ6A 1B0AA 4KZPA 5THKA 5CG1A 4M8SA 5MGBA 1C0KA 1TT7A 3WOHA 1I24A 3PEFA 4R9RA 1DIAA 5DBIA 4CM4B 2YFQA 4Q3BA 1GCUA 1NR7A 2EP7A 4WKGA 2O7QA 5HS4A 1N1GA 2IEDA 3IAHA 5CPFA 5I7FA 2WJPA 1F06A 1CWUA 1KVRA 4FCCA 1MG5A 1TI7A 3QP9A 1J0XO 5I9NA 4RVDA 4IDAA 5DCUA 1OFGA 1GEGA 1LBEA 4R4JA 2EERA 2PZKA 1CQJA 3GOHA 3RJ5A 3MJTA 4DMMA 1KC3A 2PD4A 3BA1A 2X8LA 2DFVA 3NRCA 4GGPA 4UEKA 1T1SA 4AJPA 5A05A 1IY8A 2RBEA 1Q0HA 5FF9A 4B7UA 4BIIA 4BUCA 1MA0A 4UUPA 1LEHA 1K0UA 2PK3A 1P1JA 1QYXA 3KO8A 4HXYA 4DVJA 3GK3A 1DBVO 2HMTA 1KVSA 5IN4A 4UREA 3MTJA 3QLJA 4WJZA 2FSSA 2GERA 5DBGA 3ADOA 8ADHA 1I0ZA 3PGJA 3ZHYA 1V35A 3AI2A 4FW8A 1KVQA 4OOFA 1ISMA 5I7EA 1H9BA 1Q1NA 3PLRA 4HNHA 3U4HA 3UH1A 5IFLA 1E5LA 5L4NA 4LN1A 3W6ZA 1UAGA 1F17A 5KIAA 5AXAA 4PZDA 1ZVMA 3ZNQA 1KIFA 3UUWA 1ZJZA 2PH3A 5B4UA 2CD9A 4JGBA 2LDXA 3QRWA 4MVJG 5I9MA 5TSDA 4LW8A 1JVSA 4QEDA 4GL4A 4D42A 3PQFA 1A7KA 2PKQO 5JMPA 1C0LA 4HBGA 3ZWXA 4OSOA 4LSWA 1WP4A 1EK5A 1NFRA 2ZB3A 3I1JA 4GX1A 3RASA 4E5KA 1IUKA 2AEMA 3K92A 3H5NA 1PZHA 1E3IA 4RQUA 2VT3A 5JYEA 3GPDG 1I33A 3LT0A 3UCFA 3TPCA 1VSUA 2Q45A 3K96A 5B1YA 1KVTA 2IYPA 5TGDA 4PLCA 5TQVA 1U3VA 3ZGYA 4BOYA 5H83A 3KRTA 4FR5A 3ZI0A 3MJCA 4JN6B 2DVMA 4FOOA 3MOGA 3GGOA 4BNHA 3VKVA 1MB4A 2JFHA 4FIZA 5G0VA 4BMNA 4NJOA 2VCYA 2PLAA 1VKNA 1DFHA 2CDAA 4K28A 4WEQA 1UJMA 2JAPA 4NFSA 1ENYA 1VM6A 4O0LA 4RO0A 1WZIA 3ZNPA 4Y67A 5K0ZA 3IIEA 2DKNA 4CMKA 1Z73A 1A7AA 1LDYA 2AA3A 3AOEC 4I8XA 5BT9A 1LXCA 1HE5A 4FC6A 3DAFA 2BF7A 4E33A 4RVSA 3WIEA 3E5MA 1DO8A 1V3UA 3R3SA 2F00A 5CAEA 3ETGA 4OIMA 5DOZA 1UZMA 2BHLA 3VH1A 3ROQA 2VHVA 1YBMA 4MJLA 5T5QA 3AFNA 3LDHA 4M1QA 4BO9A 1VSVA 2V6GA 2ZJ0A 1NR1A 1P0FA 3WICA 3O8QA 3CEAA 4AVYA 1UXIA 1LTHR 3JQBA 3OP4A 3F1LA 3D3WA 3PQDA 1LDGA 1QLJA 4W9NC 4IPTA 3VPSA 5L9AA 1M6HA 3Q11A 2DAPA 2DM6A 4JCOA 3EUWA 1MXHA 4D3FA 4EEXA 5L40A 1VPDA 3NT2A 4FDAA 4R41A 2IE0A 3IC5A 3CXRA 3K5PA 3OECA 5ADHA 1I30A 2VYNA 3EDMA 4PCVA 5KCZA 2C0CA 2RHRA 2Y1DA 3CUKA 4MVJF 3I23A 1V0JA 1E7QA 3WGTA 1U9JA 3UOGA 4BGIA 5DNAA 2JHGA 1JAYA 5L7WA 2QIOA 4B7XA 5LDHA 2J3HA 2FPGA 3GNTA 5FWNA 3L9WA 4Z3KA 2OUIA 1S7CA 5JBIA 3C7CB 3LC1O 1X1TA 5KJ1A 3NUGA 1WDKA 3EYWA 3GG9A 3I9JA 5I9LA 4E2YA 4GQAA 1KC1A 2QRKA 4JLWA 1SBYA 1NPYA 1T1RA 3I9NA 1L7EA 4Q3CA 3U3XA 4XCVA 2HCTA 3WBFA 4BNXA 5BSFA 1F14A 3D1LA 3FR7A 2CF6A 5G2OA 2H6EA 5ENVA 4XGIA 3GPIA 1TLTA 3NGXA 1U28A 4PG4A 4J2HA 3H5AA 5JE8A 4YJDA 2HSDA 5JW6A 5I8WA 4RQTA 2GZ3A 2W90A 2X9NA 3PP8A 2UVDA 3QIVA 1EQ2A 3WBBA 4UEJA 5FFFA 3TF5A 1BTOA 3NX4A 1FXSA 2OGUA 2PY6A 4IIUA 3TJRA 1YGYA 1I2BA 3WIDA 3KYCB 3QVTA 3JD2A 3PIIA 3WYEA 1ZBQA 4OYRA 4AJ4A 3ZWOA 3VPGA 1EMDA 3F1KA 3K2BA 2NVUA 3OETA 4J1TA 1NHGA 1UZLA 1I36A 2HLPA 4IINA 1YL7A 4IQ0A 3NGLA 4LMPA 1ZK2A 1Y7TA 1RM4A 4JBHA 1P31A 3AU9A 2WD8A 3V1YA 3AUUA 1X15A 5CDSA 4F45A 1SEVA 1KBZA 3ULKA 4FOSA 3QWAA 3ROKA 1A71A 2ZB7A 1GYPA 1HKUA 1YL5A 5I7VA 1CEQA 2AQHA 3S2FA 1DIHA 2EG9A 4FFPA 3C8MA 2VNAA 2VUTA 3OEYA 2NTVA 1ISFA 3JYPA 5KTKA 2JD1A 3PZBA 4FN4A 1E1LA 4PG5A 5K6AC 5KWEA 3BXXA 2DUWA 4XRRA 4QXMA 1ZW1A 2QZZA 4GI2A 1K3TA 3KZVA 3AM4A 3GVCA 1IE3A 1V8BA 3CIFA 4ZA2A 5A1TA 3CTMA 4I5GA 2G1UA 3Q2IA 2CUKA 5JC1A 4CL3A 3PYLA 1YH3A 3M2TA 2VZ0A 3GDFA 4IM7A 1YB1A 3GVIA 2CZCA 3PJGA 1E3WA 2WTBA 4R1NA 2YZ7A 3ZWCA 2VN8A 3GG2A 2F1KA 3COSA 3JD1A 2GRAA 1WAMA 1I01A 3V2UA 1E3EA 4BV9A 2DLDA
chains in the Genus database with same CATH superfamily
3L7LA 2G5PA 4FFBA 1N4AA 5IJAA 5B4VA 1EUZA 2YZGA 4KI0A 3OEED 2HXYA 4H3VA 4QECA 5LWHA 2RGNC 1NVVQ 5I9SA 3L6CA 1PQYA 5FNVF 3R4CA 2JFPA 3R4VA 4UHJA 4BGUA 1E5DA 1N8NA 4AIIA 1I2MA 2OHVA 3H99A 4YMHA 2GARA 3QLVC 5AJHA 3QJYA 3AVYA 4EVRA 3LDAA 3MCTA 2ZPAA 1EJBA 1UWLA 3K1JA 1QVRA 1UKVY 5EWJB 4O63O 2CDNA 1QJ4A 4MQMA 1C7ZA 2GN1A 1QIHA 4V38A 3MTEA 2VSQA 3C8HA 1VE3A 1WMFA 1QDEA 2QBYB 3MWYW 1RYYA 3KETA 2GYYA 3RBVA 4DA4A 3G7SA 1G4UR 4C6TA 3UKDA 4XQEA 5C32A 3TQTA 4EI2A 2WF6A 4PLZA 2PSJA 4QOIA 4KLAA 5IUNC 4XVHA 3D0RA 3TDMA 3EVDA 3UAYA 1AKMA 4I5FA 1HDCA 2SECE 3IP6A 4R8SA 4H4CA 3HC7A 5LKRA 3F4LA 4MV5A 3UT6A 3PK0A 1D2CA 5I7OA 3UPUA 4YP7A 3H1FA 2JKVA 4M76B 5DGCA 3CYFA 4LJAA 5HMLA 4YNBA 3WKDA 4D3YA 2FMFA 4E1BA 2J0SA 1UFVA 1B76A 2ZJ4A 1LY1A 4NXNB 3HJCA 1K5DA 1LRLA 2HGSA 1FBNA 4P3NA 3SBDA 4DJEC 3CVYA 3K8ZA 5T3YA 1JR4A 1Z6GA 2BGRA 2EU8A 3S55A 3SF0A 1YUNA 3SVTA 1DZIA 4JB2A 3E9NA 4UAVA 4AWBA 4C78A 4OBEA 1GA6A 1FRFS 4FJ0A 4A7PA 1MIHA 1KYQA 1WXDA 3IMFA 4NYJR 2J5KA 5FWYB 1Y8ZA 1OB2A 1G5HA 1WSBA 3D3QA 4PNEA 3AINA 5LLSA 1KO4A 5JO0A 4I8IA 1JHYA 1ZK4A 5CBPA 5HXAA 3BWDD 3LX8A 3JVIA 4RK6A 1DWUA 3S0JA 3DOJA 1YHNA 4RA6B 4BATA 2A1UB 1UINA 2BBOA 5JVDF 3ZWBA 2FPXA 2HNKA 3IQFA 3LLSA 4F6CA 1EVYA 3RABA 4UBIA 1YE5A 4UC0A 1NZFA 3G68A 2OY0A 3AEQB 1W8DA 2A1IA 4ZMRA 4X1YB 2ECOA 1KEEB 4KR2A 4B83A 2BUCA 1THZA 1VSBA 4MI9A 4OIFA 3FPCA 4AFNA 1F1BA 2PT7A 2XMPA 3EGXB 3FBGA 3N6XA 3AKEA 1UC5B 5FWXA 3WK5A 1UBLS 1JWBB 2R96A 3O8BA 1AV6A 1ONSA 3IPRA 4YN3A 3SYMA 4B9AA 1XRJA 3PCXA 2F4NA 2IUEA 2J5QA 2YWEA 2XAAA 3Q3JB 3CZ9A 1GPMA 3AIIA 2P2SA 3L07A 2EFJA 1ULTA 2XMBA 1T0JB 1ZC4A 1M8FA 2IPAB 3BGIA 4OB6A 4REMA 3RFCA 2CVFA 4A8JA 4C20A 2O8FA 4B1FA 3GRCA 1P4GA 3B2EA 1EGVB 2R1ZA 4P8RA 3UNXA 3B13B 3CIOA 2FN3A 2JLSA 4RS4A 2O7SA 1WKCA 5ITWA 1HNZB 3GI1A 3VUFA 2BUBA 2G77B 5JH7B 3I62A 1SHTX 1F5NA 4NULA 1PL0A 2X5NA 4GG1A 4PLVA 2J9YB 4IX9A 2XA1A 2QA5A 3WDSA 4CMGA 3A1NA 3ORRA 4H7KA 4HPWA 3U6KA 3O03A 4G1FA 2PRSA 2I2CA 2BCGY 2XUKA 3NIFB 4YC7A 3UBMA 1SPXA 2QJFA 4W99A 5A9TA 3IDAA 3VKUA 1JKIA 4ERNA 4LNUA 3AVVA 1E58A 2PCJA 4I1OA 1S5PA 4IY1A 4N5MA 4QYXA 4C4XA 1E1CB 5BWLA 4OP1A 3O8NA 3CKKA 4U6SA 1O4WA 1SU4A 3N5CA 5J47A 5DLPA 2RK4A 1ISPA 1HSZA 3I2JA 2ZROA 3GJZA 4N6GA 4K9NA 4IDOA 2YY6A 1XEWY 4O4LB 1EM8B 4XLTA 3TSZA 1MB9A 2J4DA 1Z5PA 1RHRA 3ECAA 2CNLA 4FXOA 3UEOA 1WMDA 2O3TA 3RGGA 3EXEA 4LRQA 2ORYA 1RTTA 4HOYA 4DUZB 3CRVA 3A3YA 4I2VA 4Y9DA 1H9CA 3QJ5A 4D45A 2GN4A 4FJ2A 4BNJA 2C9OA 1JSLA 4I9NA 2IS1A 3MXOA 1U90A 1N5JA 2XNCA 1M6VB 2PAAA 4KQ1A 2BSQA 3PGVA 4KSCA 4AN0A 1TKBA 1ZVKA 2FFQA 3UW1A 4G9BA 1G5QA 4BY9E 2QLNA 3OFSA 4JL8A 4B5KA 4LXIA 2IF0A 4X94A 1DIRA 1N2SA 4GM4A 4R54A 4ABTA 4DWJA 4O25A 4WD3A 1ZA2A 4JBYA 3LBIA 3PQ8A 4ZI3A 1GG8A 4GMXA 4OGLA 5KOYA 3QVWA 3AG6A 1K97A 2XBUA 1MP0A 1NMXA 4P82A 2YMPA 3VR4H 5KNBH 1MVNA 2EIXA 4IX1A 5JLAA 5KYYA 3ILVA 2B8NA 3SEZA 1ABEA 4WDRA 1KAHA 3PWKA 4G5HA 4WLNA 4IWYA 3TEFA 1KPGA 2EJTA 1PGPA 1NMSA 3QKTA 4U2BA 2B5VA 1YDWA 4IBOA 3O1LA 1PFQA 4TXHA 4H18A 1SXJE 1N2ZA 2BMJA 4LCBA 3DFIA 4MRVA 4W8HA 4RIIA 4J3NA 3IHWA 5GVSA 3Q8LA 4HLUA 4OXRA 1OI2A 2E55A 3AEUB 4EARA 5HKLA 2C7BA 5EESA 5U9CA 1LLQA 3RH0A 4KWIA 1TC1A 4TZTA 2JC3A 3R7WB 5BSVA 2HMSA 3IVAA 1XMOB 4D9GA 3FRJA 3TL3A 1XA3A 1NBEA 1E79D 4BLWA 5IKPA 1BVHA 1A2QA 3C5EA 2A94A 1XZBA 3VKWA 4ZAGA 2Q1TA 2HCFA 4HPXB 4M88A 2R84A 3CWCA 1QTNA 1FLVA 2QD1A 2NTJA 2Q3EA 3BERA 1IK4A 2CXOA 1EA5A 3RD5A 1N3IA 3OE1A 4JXXA 1SOVA 1ACMA 1FW6A 3E15A 1EXWA 7MHTA 3FNQA 5A9SB 2QIPA 1WTAA 1J09A 3BTSA 2A5GA 1U2PA 1JDBB 1AKYA 3LCCA 1TF7A 2ZCVA 4N0PA 3QHQA 2DYKA 1CJCA 3B8EA 3GCXA 3QVKA 5DDIP 5KVVA 2E5WA 3MFYA 2X0RA 4JASB 1WD7A 1H8HA 3H5OA 2JASA 4IXDA 5IC4A 3ZWAA 4YQEA 2JGEA 2PVSA 2Q21A 3FH0A 5GOZA 3F7NA 1DCTA 5LYJB 3U7EB 2ILVA 2H00A 2ZYUX 4GR4A 1HEIA 2W42A 5HF6A 2CK3D 1F4VA 4L0QA 3SG0A 1JDSA 2GETA 4QRHA 4C3ZA 3MGBA 3QPCA 4UAGA 4YLGA 2PRZA 2YFKA 4M54A 2G63A 3KQTA 1PTJA 3LJKA 5IXSA 4NCBA 1DKUA 2IODA 5KNDH 1JYEA 1PT8A 2J0EA 2GD0A 3SS8A 2ISQA 5CT4A 3TW8B 3SXJA 2WYHA 1S2IA 3QXSA 4HQOA 4WLVA 4ZRMA 2HF9A 3T3OA 1D4AA 2NYAA 2FR1A 2JD0A 2IHBA 3P0EA 3PWSA 4FK8A 3TZ6A 4Z9BA 4B4KA 4D41A 1FNBA 1TLFA 4OQNA 4G0OA 4KR0A 1RAHA 3G9UA 3V48A 4JBIA 4LA4A 3PLNA 4KV7A 4WCVA 1GNRA 5GZ6A 4GBJA 2LRHA 5ENZA 2E4UA 4HVCA 4JNCA 3RROA 3TD9A 3E9MA 3PD7A 3VVCA 4DJTA 1CLEA 1Z4NA 2C82A 2L0XA 1KBOA 2ZRLA 3MTBA 5HE8A 5BUZA 1LQTA 2FW7A 2ZYAA 2O20A 2Q5CA 3WGNA 4KRGA 1M7BA 3IEXA 4XUDA 3B1FA 3HACA 1EK6A 3DHVA 4QUGA 1IBMB 2G5GX 2ZJBA 3HM2A 3KUUA 3RI3A 5EHXA 3N2GB 4PHGA 1RRCA 3K0FA 1FUIA 4GOMD 4XB1A 1U9CA 3KBOA 2UAGA 4UVEA 3LCRA 5JALA 5T4EA 5CXSA 1J2TA 4MZDA 4OHYA 3NDIA 2H2GA 4KQXA 4LK3A 4US2R 4U02A 4HNTA 4DG8A 1TYBE 1VC2A 5B1IA 4WOCA 1TUGA 4US0R 5EGNA 1QIDA 4F8JA 3FBTA 1FMCA 2O8CB 4TXJA 2ERXA 5JCJA 3E22B 2I6GA 4K9OA 1RPJA 2Z4SA 2Q5HA 4PFJA 1P1CA 4WXHA 2QQGA 3EAFA 5F2KA 4HWPA 3SGLA 2Z5VA 2CVPA 3MA0A 1LNQA 3PX3A 4OUDB 4TSKA 4DMKA 3NPAA 3W5AA 4NWIA 2K4MA 3FG9A 4EA8A 2QMQA 1TYCA 4B80A 5JBQA 3FCOA 1IZ7A 1WCIB 1Y1SA 3OCJA 2ZJ2A 1DU4A 4K81B 4YRRA 5L4LA 1TNDA 2O0JA 2JFFA 1E32A 4Q9NA 2CMGA 4R7GA 1TXGA 3QXJA 2EGGA 4Q01A 4ER3A 3GLUA 3PLAE 1VQ1A 1JQ3A 2V7QA 3S4YA 4H16A 1EA7A 4LE2A 3WHLA 1Z62A 3BD9A 1VCOA 4BX8A 3KVYA 3LIIA 2QY9A 1A50B 2V0GA 4G0PA 5IM4F 5CFNA 3ZIDA 3GAAA 3FYUB 3OCUA 3TSYA 1QYDA 1HBJA 3ZGZA 3M5WA 4PYIA 5LU8A 3WMGA 4AJOA 2QLLA 4M87A 5CJPA 5JXHA 1EB9A 4WZAE 4ZVQA 3G5TA 5BP7A 2HI0A 3D4LA 1ZNYA 4FS3A 1AHIA 2MJLA 1EQUA 3R6WA 1AO3A 5EG5A 1UC8A 4PSCA 3WAJA 3W3ZB 4TOIA 2R8EA 4ZTBA 5D3MA 3R6GA 3F78A 4ZPJA 3HZZA 1I8TA 1Z5OA 2ATCA 3CW2A 3ROZA 3TXYA 3C5WP 1IAVA 4JDUA 1EESA 1EP1B 5EINA 4OHXA 3RS4A 4CWAA 1E7YA 1ZONA 2QN7A 1SOAA 1GV0A 1YZTA 4MQBA 1X8XA 5LDGA 2QUJA 5FQOA 4W4TA 1L4NA 3DBRB 2QW8A 1VBNA 3FNRA 5D84A 4JAVC 2WYVA 3P32A 5EMHA 4YXWA 3X2EA 3EISA 1QM5A 3T5DA 1WVIA 3L6EA 3BWCA 4DMLA 3EH1A 1OA0A 4A03A 1PLKA 3IVGA 2RGRA 4P84A 1QZTA 3ZBQA 4F38A 5LOVA 3F7OA 3GA0A 1TO1E 5T6BA 1JG7A 1K6IA 2VYQA 4JLSA 3FYSA 2BRUA 4IQ4A 1FW8A 2PV0A 2PUWA 3MINB 4DCJA 1NYRA 2I80A 1LZKA 2C77A 1M2KA 3RYIA 3TIFA 2YOFA 5MGNA 1GGJA 4XX0B 3HBMA 3KPUA 1IHYA 3UGJA 4MEAA 4V0MA 5K6AA 2UUPA 3L3BA 2O54A 1ZD8A 2OXFA 2XXAA 3ON5A 4R40A 2IUFA 4BEJA 1ZS9A 1RR6A 1NI5A 3LC2O 2J09A 4JNKA 1G21A 4MYHA 4PFKA 5TMDA 2ERYA 2HIHA 1CJMA 4IHAA 1P4RA 3CJTA 4A23A 4RVGA 1Z8FA 1SCIA 5I9TA 3WQSB 1SZCA 2YZNA 4RD0A 2PTHA 3PDIB 1IQ0A 3TKYA 5LQMA 2P4QA 3ENQA 3KELA 3NEAA 2ZRKA 3EDOA 3HU3A 1GTVA 3NFRA 5DI3A 4AY6A 4NYMQ 4GUDA 3FYTA 2R1TB 3BMQB 5KSOA 4TYYA 3LP8A 2ZXEA 5E0OA 1XLWA 2QRUA 4ZQEA 1OV4A 2GPYA 1UOQA 3BZBA 4I3HA 4DIOA 5C80A 621PA 4IHJF 4ZI2A 3GRZA 3QE9Y 1L7VC 2XNDD 1GTMA 2NZJA 2YY7A 4E2XA 1DVRA 4KITB 5CM9C 5A4DA 2Q0SA 1EX6A 4GPEA 2K7FA 3AR2A 4C04A 2B2NA 2L69A 5C1BA 3E9ZA 4UUAA 4B7AA 4JP1A 5AH0A 2HM7A 4YRZA 3LUGA 1OQAA 3UH0A 4MS3A 4OYYA 4DUPA 1T2CA 3R5HA 3RFUA 1RCTE 1PJLA 4BTEA 3K5HA 1F48A 1JEAA 1PBNA 1QHNA 2Y77A 2ZUVA 3DHNA 1KFCB 3OKPA 4K9MA 4PS1A 4ZXPA 3RF7A 1A0OA 1Z8NA 5L6MB 3EW9A 3QXCA 1Q91A 1B8UA 3S2SA 2GXSA 2VAMA 2WSBA 2DR0A 3EGDA 2RJNA 5EE5B 4NAVA 1F3OA 4L8WB 4HH1A 4HLQB 1J2RA 2DHCA 3GJ0A 2GASA 3OFKA 4ZJZA 3VPFA 1LI4A 2VQ3A 4PGFA 2YS7A 1ZGBA 2BZ0A 1R0ZA 1Z4IA 2RHCA 5C7OO 4Q4CA 4ZCIA 1Y1QA 3ZX4A 2ZYHA 3CH6A 3WWCA 5ITZA 1KK0A 2HO4A 2CLFB 2VP2A 2X23A 5BORA 4BP8A 3HM9A 2KWIA 5LQUA 4MKHA 1SOMA 4IW3B 5CFMA 1Z08A 4KZKA 4E1AA 1M2WA 2VDPB 1E59A 2VH5R 3FLEA 1JR2A 3QITA 2NWQA 4J0JA 1LBSA 3I6QA 3UANA 2Q3MA 4CM9D 2ZB4A 4K86A 1SXJA 1A96A 4FBMA 3A1CA 1KORA 5FOXA 3GN1A 1IH8A 3VR2D 3ADKA 4J43A 2WU1A 4M0FA 1OXVA 3GGPA 3UTDA 4DRZA 5JYDA 3FUXA 1NQXA 2B1JA 2XGMA 1KJWA 1NUQA 1JE1A 1OX4B 4QPNA 2GCNA 1I51A 1YGPA 3W2TA 3RUAA 3K30A 4L0DA 1V5GA 2QUBA 2NU8A 3WGHA 4F4FA 2UUCB 4AC9A 1DX9A 1L7PA 1JQLB 4YUZA 3AW9A 3ELYA 3ENKA 3OESA 1L9XA 1O97D 2OP0A 1EE9A 4M36A 1SK8A 4MZXA 3R3YA 5DN9A 2OAQ1 3T8YA 4ZALA 4LNAA 5FOQA 4JNGA 5IDYA 3QPUA 2ORIA 1J1UA 2B9EA 2Q7DA 5K05A 4HWRA 1M34A 5ADWA 4LYJA 4UVHA 4FS8A 3CLHA 2LPMA 5L45A 1KTIA 1XG5A 4EYGA 3BWMA 1CIPA 3ETHA 3LPMA 3OZ7A 4G81A 3PG5A 4QXRA 5CNJA 3STTA 3IV9A 2PNJA 2HPHA 3KAQA 1SWVA 1ZGGA 1BMFD 4H1HA 4BTLA 5A4KA 1XQ1A 2Q46A 5C4IA 2WWVD 5AVSA 1W59A 3BXGA 2GJ4A 3STHA 5I48A 3RT9A 2OZVA 5I7RA 2ZUSA 4TS9A 1ESZA 4QYIA 1IBKB 1B23P 4INPA 4MROA 2C7OA 1DJNA 4DM3A 4IUYA 3T7EA 1Y5LA 3KK0A 4M46A 4DILA 3DKPA 4CCYA 2V8BA 3NJ8A 3KU1A 4OQQA 4AO6A 1CQXA 4DJFC 4NRDA 4MVJI 2Y1EA 4K6OA 1OBFO 1TCVA 5B1HA 3NBYC 4TMTA 3RC1A 3KHTA 4K9RA 1SA0A 3ZQ4A 3OJOA 1YO6A 5TIIA 1YS2X 2E48A 4AJHA 4CIXA 5JVDB 3T3DA 3PC6A 1JE0A 3K6SB 1GSIA 1R0KA 2G7MC 5DM70 4UU8A 4G4IA 4V1CB 1XZDA 5HCUA 2C8LA 5T4FA 5JQGB 4JP5A 4JS0A 2PEYA 2P69A 4MQ5A 4UASA 5H4HA 5JCOC 2BGWA 3GMSA 1H4QA 4RULA 4DMFA 4F3RA 3QX9A 4K2HA 1P4SA 1CYEA 2A9JA 2Q5FA 2Z8ZA 3U4QB 2JCBA 4HDCA 2B4TO 3NOXA 3R0ZA 1YSCA 2OV2A 2YV2A 2X5OA 1C1XA 3H1PA 3PC2A 4RE5A 4RPLA 4YONB 3EIFA 2MYNA 2PKQP 2VIIA 1KPHA 3CEJA 4LXUA 4MARA 4OHRA 3B6ZA 2DHDA 3GDOA 1VJCA 3GRUA 1GIAA 3ITDA 3UOAB 3THXA 3E1KA 4EJ6A 4PC2A 4Q1AA 3VZRA 3BHNA 1HXHA 4O2BA 3W5VA 4CMEA 2AK3A 4DSUA 2H4HA 3EGCA 1G63A 2GYWA 4WXRA 2QVLA 3GW8A 1TL7C 3EVBA 2IEYA 1R6AA 4P93A 4H3SA 2P2LA 4MKGA 2AG8A 4FYHA 3TPZA 3DMTA 2NZYA 2PA0A 4CKWB 4E0BA 1TVCA 2RGYA 1R6XA 4WJKB 3EWAA 5HCNA 4JX8A 1I6KA 1J49A 1TZ2A 2BPOA 4JROA 5JS1A 1P2SA 4WFJA 4TROA 3NBUA 3ITNA 1SCJA 3NEPX 1L5ZA 4MHSA 1U9IA 1FC0A 1SUIA 4N1AA 5FWDA 1WXFA 4ZYUA 2VDNB 4Z86A 2BFAA 1KEPA 2GQ0A 3AG5A 4YAUA 2JLYA 2FEAA 4O4HB 4Z2AA 5DYWA 1AMOA 1U1CA 2W6QA 2WOOA 4FGKA 4WCFA 5AI8A 4ARZB 3FYDA 1BQ4A 1EP9A 4GPD1 4PFQA 1S8OA 4J0GA 2FR8A 3Q3GE 4QLAA 2M6KA 2C2ZA 5LDDC 3COYA 2FCAA 3CUUA 1EKXA 4N9QA 3C48A 5ALYA 4E5SA 4F1JA 3OTGA 1KEKA 2JVKA 3NM5A 1W49A 1Z6QA 3NTUA 3ORFA 2I5PO 2DPXA 4X54A 4BZWA 1N78A 1AU9A 1I1NA 3K9QO 4I55B 1YAJA 2W93A 3KS9A 3UJ8A 3AXSA 1W29A 1LPMA 2QB5A 3RAFC 4RVNA 1D07A 2GZ1A 2DFPA 1NBMA 1U3GA 2R7NA 4ZODA 3ONVA 4PLPA 1AA6A 4ILEA 1DKOA 5CDGA 4FYKA 3WGVA 1RJ9A 4ARIA 2I99A 1P2GA 3E48A 3X1KA 1YKSA 3T7TA 2B8EA 1DPGA 3GJ3A 4YQYA 1N2OA 4ALIA 4ZT7A 3UPDA 4BRWA 4CF3A 3U4DA 4AZ0A 1PR9A 1PF7E 3R5FA 2WF8A 3UJHA 1OAOC 2ZUCA 5EVCA 3SCZA 2P1ZA 4E4YA 1J97A 1DTWB 2XE4A 2YHIA 3CCCA 2WWTA 1DMRA 1YQXA 3ENZA 3OD5A 3ZCVA 2B2XA 5COQA 2XJ9A 2P91A 3DVAB 4UM5A 1NDUA 4JR0A 2WT8A 4I19A 3HSKA 5G0SA 3A9WA 4BHHB 2YC4C 3PHHA 2GPAA 2ZR8A 3PRHA 4PNPA 1CUHA 1UBNA 4AMVA 1ZJJA 3BILA 1LF5A 3W4IA 3ZXIA 1MUUA 1Y8AA 4FYJA 4JC8A 4B0PA 3MJRA 1HURA 2KSQA 2QHXA 2I66A 1QRAA 3E6AA 2G9ZA 3FPJA 5UKDA 4JUAA 2MHCA 1A97A 1JJBA 4QRIA 2P9CA 2ZOSA 2D3WA 1K9SA 2R7MA 3IEIA 1B8VA 4AG6A 1P2BA 1T2UA 3TLCA 2BFBB 1TLLA 1B3BA 1XJ5A 3EGVA 4I08A 2H8KA 1W4RA 2XVZA 4OLHA 5CDTA 3JWEA 3JQGB 1PQWA 1B3RA 4RF3A 4YCCA 1L4EA 4U7FA 1T5OA 4KVFA 1EFLA 4JJEA 4ZI5A 3TRKA 2JFGA 5KDDA 2LR0A 1DEOA 1E77A 2DU8A 3H9QA 2X6RA 2CUNA 3BEDA 1F4PA 4K5QA 4R83A 4ZU1X 4YRBA 3E7XA 5DW3A 4B8WA 3NTRA 5C7YA 1C8VB 1XKTA 3CGWA 3OT1A 1II8A 3DFKA 5JSFA 4JJ8A 4U39A 1F7UA 1N9GA 2C2YA 4II7A 2LTAA 3E4DA 1U2DC 2PVPA 3MCWA 4YLEA 4KPYA 4BLVA 5HYVA 3A4TA 4HQ6A 3L4BA 4WECA 4Z2YA 3S6JA 3AI3A 1M2NA 2PZGA 5LB4A 3KT3A 3R9IA 1QORA 1KAMA 1SAYA 1RKXA 3B1YA 3KKLA 4CF7A 5HNKA 1FDUA 1GYRA 1Z3IX 1I94B 4AULA 5BYAA 3SJCA 4YHBA 1ZH6A 3IKMB 1YR7A 1NAHA 1VP3A 2BTQA 3IBYA 4J7AA 1NNUA 3H8WA 2QYOA 1ZK0A 1LGYA 3WSTA 3WHIA 1VKHA 3DBHA 4EX7A 2OFXA 1NNEA 2H31A 1AKRA 4JD5A 1M0EA 4A10A 1DS6A 4EWLA 3ASZA 1XV5A 5I7AA 3ESRA 4QARA 4RMJA 4YAEA 1MD9A 3DMFA 5TT0A 1AC5A 2FQWA 3R3VA 4BC1A 5JY1A 5MF6A 3HBJA 1JSXA 4MGKR 4QBTA 2KLBA 4LXXA 2V7GA 1NKSA 2ZSJA 3NC1C 3PC8A 1JDBC 4IHKA 4V3CA 2APJA 5AR1A 4CBVA 4IV5A 4YECA 3IAS6 2GWRA 5GJWC 3T7RA 1HL7A 1HV8A 2CVQA 2OBLA 2PUTA 1G66A 4BXOB 3HCRA 2BHNA 4RWZA 4UDNA 3FNBA 3DD1A 5FBLB 1DQRA 1ZUNB 4B6PA 1D6SA 3I30X 4RF2A 5C5DA 3WK4A 4U3JB 3GFPA 5C1OA 2EEPA 1JIQA 1BU8A 3PC4A 3P2YA 1KXZA 2QXYA 3HVHA 4JZKA 4PVCA 4L02A 3NUQA 1KY3A 1IIBA 4I6EA 1H2ZA 3RYFB 3E0QA 4XAQA 1TC2A 5AHKA 4DLUA 2I7TA 2RD2A 3ZVKA 2BH2A 3DTVA 1ZUHA 3MAGA 2BGLA 4FMDB 4WKBA 3ZU5A 4F21A 2ZRJA 2G40A 3E82A 4F1KA 1I4WA 3HYLA 4RF5A 4RIFA 2DR3A 4XDZA 2ZSBA 2PMCA 3GBVA 1AB6A 3PFGA 1ESDA 1IDN1 4M1SA 1ZM4A 2C0PA 4GMFA 1UT8A 5JASA 1GRQA 2XVMA 3R7SA 3VPAA 1T8SA 1T9DA 5JAIA 1U0RA 4PO3X 1L3BA 4I4IA 2GEJA 4MSUA 4CDNA 5BW8A 2AC2A 1OC4A 1T2NA 3EBOA 1R7RA 5DXJA 5I8PA 3BT7A 1S4MA 1W35A 1FTGA 1WW2A 1JBEA 2IV2X 1HEUA 1HZJA 4IMPA 1TTHA 1XU7A 3JVVA 3DKVA 1UKYA 2VQ6A 4PG6A 5AW5A 3OWXA 3H5IA 3H18A 3KALA 4NCAA 1OXUA 4O2AB 4YP9A 1H2AS 2FB9A 2NSJA 3QFFA 2RGEA 3QPAA 4D5EA 2BC9A 2NPIA 1UBEA 1Q0QA 1MAUA 2H1HA 4KXVA 4QTTB 4C7KA 2AMJA 2VSFA 1E2LA 1N5MA 4R6WA 1DL5A 2HRQA 2IY9A 5IDQA 2RHOA 2HWXA 1RJWA 3OIVA 5F23A 3NIGB 1Z2EA 2N9UA 4Q1EA 5G3YA 1TF5A 3OCZA 3PL1A 4UW9A 4D8XA 1N32B 3R76A 3JATA 3KVVA 4FT2A 3KHUA 5KJFA 1EUYA 4QXPA 3EX7C 2RAVA 1A5TA 4QFCA 2PUGA 1T3GA 4WIAA 1KMIY 1ZZGA 1M1YA 4FZ5A 1ZL2A 4G5RA 4ROSA 4UBMA 3WXBA 2WC1A 2Y1CA 3MZ0A 3OKCA 1ZYUA 1RXYA 5KNDA 4MWZA 4X65B 5JJIA 1D5CA 2GHQA 3IELA 3DP9A 4D96A 4CQMB 1G8GA 5CT8A 4CHGA 1DEXA 4EQZA 2V96A 1M1XB 3CWZA 3KDPA 4Q9IA 4AMUA 3N07A 1JRLA 2H57A 1M0WA 5I3CA 1MHPA 2ZUDA 2F8SA 1PDWA 2WSIA 1XZPA 2XCUA 2XE7A 2HF2A 3CNNA 3JQAD 1JN0A 3K4QA 4P7JA 5DGIA 4ZT3A 3SZMA 4XW2A 1RM5A 3LCUA 4R1MA 1XZIA 1QH8B 1OLSA 1LV8A 1NVUQ 4LI3X 1K8QA 1L7QA 4L8FA 5FL7A 1M75A 2IYZA 1HDRA 3RSSA 3EN0A 4LRYA 5K0JA 2P6MA 3PQEA 3HY4A 4DKJA 3NGMA 2F64A 3SVLA 1Y82A 4IDFA 3N0RA 4Y2TA 2BWJA 1LTQA 2SNIE 4UUBA 3ZDRA 1COZA 3BWYA 3SR0A 3ZKAA 1WM1A 3OQVA 4N41A 1T2FA 3EXAA 1SH7A 4HB0A 1BW9A 5ED4A 5GP1A 4WNIA 3PRKE 1T1GA 2CCKA 3OICA 5KJ6A 4RD6A 3FRHA 2AHRA 1BDMA 3I9V1 4MIOA 1GLVA 1CB0A 3DQPA 2TYSB 3FYUC 2WP8J 3BIXA 1JPJA 4MPPA 4S0XA 3SYRA 2PGXA 4QUJA 5DF1A 1EUDA 3KOMA 4E51A 1PYGA 1GU0A 1V7ZA 1C4OA 4B47A 5BMOA 1N6RA 3NKVA 4HN9A 4HRAA 3ZEIA 3HVRA 5IJ9B 1X8LA 3SNKA 1XGKA 2C78A 3TS1A 1AS2A 4JUFA 2FEPA 1PQPA 3I2IA 3MF4A 3ROEA 4LK2A 1SUAA 4YXFA 1PEAA 1VHQA 2WUDA 5DLQC 4XYLA 3THYA 2BMDA 5JZVA 2NO9A 4NBVA 3T9AA 3A70A 1GUBA 3KZMA 4LQDA 4ROTA 5DLYA 3SJ7A 3V55A 4DYVA 2IS2A 1CS0B 3UBTA 2G25A 2BE7A 3HKCA 1C41A 5JUWA 4RHYA 5HM6A 4RK7A 4QG7A 3L7MA 1E98A 1SCUA 2OCLA 1XZEA 4GPZA 4NZYA 2NZ8A 1OU4A 1QBGA 1VLLA 1FXUA 3T5AA 1JU3A 4INAA 3UJ3X 4MKFA 2GZHA 3TRIA 2FPSA 2EKZA 3BXPA 4JQCA 4AMZA 1K3FA 3F7TA 3FZYA 5IHXA 4XIYA 4AQ7A 3MTGA 3AY3A 3DCIA 1JA1A 3ANMA 5IARA 5C34B 1NXXA 1XZQA 4G5OA 3LFTA 2AC7A 4LECA 1M7HA 2I62A 2NPOA 4ED9A 2QKYA 4HK4A 1GTZA 3IRUA 2IDJA 4IHJB 1KIMA 1N77A 1H93A 1HYBA 1ECCA 2EZ8A 1N3BA 2WBLC 4FCTA 3A6GA 1UKAA 3P9IA 5EQJB 4D1YA 1HYEA 3C6QA 3N8KA 1NI4B 2YRWA 1Z6PA 3KT8A 3JR3A 1VLZA 3EY9A 1ETUA 3I9OA 2RHWA 3PUKA 1DARA 1UM9A 1T4DA 2YWBA 1LTKA 1H2RS 2A78A 1QPGA 1WDLA 3D43A 3N2ZB 2OGTA 4PV7A 5AW0A 4BGPA 1OV6A 2X58A 1U8UA 2XYQA 5JZ9A 2FQXA 3I34X 1GGHA 3NKFA 1IHPA 4Z53A 3G49A 4RFVA 3TNDA 4DMCA 2EWMA 2RK3A 1PZFA 1QWSA 2C03A 2ETVA 5FUVA 5D00A 4DNQA 4FZ3A 4ZV9A 4EKGA 4YRGA 3UQZA 4PLGA 4CCWA 4AIRA 3TIGA 5FTWA 4HXFB 4LDQA 2NU9B 1S0UA 2W00A 4O5OA 1C2YA 1FXWF 2B98A 1U9YA 1XCPA 5FJIA 1BX1A 2SKDA 2X8WA 3HYNA 1LFDB 4CMAA 2DKOA 4MW6A 4YO7A 3MJHA 3FPHA 3SYTA 2ZYWX 4BO0A 5G41A 2VC2B 3DB1A 3IDFA 1VGRA 1NRXA 4Q9KA 2W6IA 5EOVA 3T1QA 1I6MA 3IQIX 4C22A 3ZLUA 4QODA 4YRPA 2IP1A 3X1YA 4CUZA 1KI7A 3EOAI 4HEJA 1KE1A 2IDZA 1NXQA 5CURA 1ENOA 3UICA 4DLKA 2P5UA 3I5YA 4RL4A 1FA9A 3VAAA 3D59A 5GINE 4MO9A 1S3SA 3CPSA 4WW0A 1GYQA 4EDHA 3EEFA 5IAGA 4HG2A 4GZMA 4OHPA 3ZDEA 4JGIA 4D79A 4HAZA 1VPVA 2R6R1 1MJGA 2IX3A 2IYLD 1S3GA 3KQKA 4OD0A 2DUJA 1RW4A 4CXMA 2ECKA 1QTRA 1XD2B 3BJEA 3TOVA 2Z2KA 2CDBA 3GEGA 2VLBA 5ALSA 4B35A 4PLTA 4X6LA 1P6UA 1T8TA 4QIHA 5B57C 1ZCZA 3QW2A 1E60A 1X7GA 4MAFA 1ZHFA 4OGKA 2YNMA 2WIBA 3HBFA 3DMGA 3B7PA 2WUWE 4DPLA 2Z1NA 3IEKA 8ABPA 3FWYA 3FWPA 5C52B 1J5EB 2OGSA 2YVQA 4BYGA 3K1AA 2P9JA 4PBTA 3GLTA 5T7BA 2ZWOA 4PC3A 5BW4A 5T3UA 2X3UA 5KVQA 1H5UA 4IEFB 1XTVA 4G23A 3C7DB 4E5NA 1G3UA 1YB4A 3HBAA 3DLCA 3LPNA 4J75A 1SCKA 4FOLA 4MPTA 1RXSA 4G65A 2IGBA 2Q3LA 3I39X 1FQOA 4K9PA 5DMHA 3TLJA 3ZE0B 2AW3A 4IYRA 4ARVA 1JVBA 3IHLA 2B8TA 2B37A 2VWHA 2ZDGA 3Q3CA 1S2OA 4ZVMA 1YZQA 5THXA 2ICAA 5FI1B 1KP9A 1WMSA 3EEIA 4JIMA 2ZP1A 1WDMA 3AEKA 1CUZA 2WD9A 5F12A 3LUAA 4E5YA 1A82A 3UMVA 1C50A 1P5HA 2J5XA 1RHQA 1XNGA 3SZRA 1W85A 2IIQA 5K3FB 1PBTA 1QP4A 3NIBA 5M2QA 3UV6A 3QLUA 1Q0UA 1JECA 1LQ2A 1UJNA 1XLTC 2XTAA 3EBPA 4IRXA 4Y2HA 2HMUA 2GSWA 2OC9A 4HRXA 5DYYA 5LB2A 1VYVA 5REQA 4IVNA 3I09A 4FEAA 1IFXA 3F6SA 4GZLA 1UK6A 1DXOA 4HUQB 1L3IA 2BL4A 4GMHA 3PUJA 5FL3A 3VR3D 1P6QA 1KOFA 3KKOA 4V0NA 3DCNA 3W7BA 5HRCA 4C7OA 1HLDA 5LQNA 4CG1A 4MV4A 1GNTA 4WTOA 4C7JA 4GVPA 5HKBA 4H31A 3GLHA 3AOGA 5ALNA 3RPEA 2R65A 1QKJA 4LMRA 1MQ8B 2WRZA 4YJHB 2NQ2C 2P0YA 4RTLA 5KTMA 2CL0X 2FDCA 4Q6BA 2AXPA 4KIGA 2NUPB 3FCUB 5EJ4A 5JI3E 2VP5A 1PWEA 2WUGA 5IBQA 3IUSA 3EK2A 9MHTA 2GGSA 3I6YA 1UMKA 3AERB 2ZVJA 5I4CA 4REQA 3K9FC 4Q9AA 2R68A 3JX9A 1NOKA 1RAEA 4P5EA 2WZQA 4RORA 5K0NA 3SOPA 4UD6A 1JHRA 3P4XA 2PS0A 1DRUA 2H4YA 2F1JA 1XQVA 2IYYA 5DM0A 2D6FA 1H2EA 4HFNA 4X5OA 4LYAA 2A35A 1Y8QB 1YI0A 4F9EA 3DVSX 3RSHA 1YIDA 5DHTA 5A4FS 4XARA 4KH0A 4XGNA 2IHVA 3Q8XB 1JXAA 1Y3BE 2F43A 4DLVA 1ZSVA 4LF5B 2B25A 1BMQA 2A1TS 2H2WA 3DOOA 3IIIA 2WAYA 3L0IB 5I5GA 2NW6A 1D8AA 5C4GB 4BQOA 2Y1LA 2VH1A 4I4LA 4CZ2A 3FWNA 3COWA 4YUAA 2LE0A 5D86A 1X8JA 3OTQA 1Z16A 4WZBB 3S5UA 3ZE2B 5ABPA 2IEGA 1J1ZA 3GNSA 3GVHA 1ADBA 1FNSA 4V3BA 4UCFA 2RI6A 3RAEC 1K7CA 1SY7A 1A4UA 3H2YA 4KPUA 5E6SB 5EZYF 1EVLA 5IK2A 4EOGA 3P7MA 2ALJA 3FAKA 5BQPA 4EJ0A 1NDHA 1G41A 4WXYB 2YJ5A 2AX4A 1F1JA 3EOBI 1YQTA 1D4ZA 5BN5A 2JAXA 2Z2YA 4E31A 5LP6A 1QP0A 3FVQA 1Y1RA 1FSFA 5IJZA 4LE1A 1W88A 2UZ1A 4PHTA 2HQSA 2ISCA 1BWSA 1MDBA 1RNLA 4TTIA 4ONEA 4ANFA 5CDYA 4D9IA 4EO9A 3GELA 3OIYA 5EPEA 1A4RA 3VOAA 1USKA 1V48A 1BEEA 3CUVA 4J7XA 5EGSA 1LK7A 3OP1A 4MMZB 4ZAWA 3C70A 4B7CA 4BZPA 3ZCXA 5MN4A 4XWTA 1ZWLA 3AVTA 4RD3A 5AHRA 3TB4A 1GZ5A 4V2UA 5LN1A 2OAGA 1KQFA 5ALMA 2JDIA 5HS6A 2IY7A 3PQ3A 4BNDA 1WCYA 1XRPA 3A4IA 3F6YA 3ICOA 2X0FA 2GLUA 4CMIA 4J7UA 4BB5A 4LDAA 3ER6A 5IP5A 4CODB 5FYDA 3ND7A 4F91B 2R7LA 3NDRA 1WBDA 3V3KA 5AKHA 3SPXA 3D7SA 1QDUA 221PA 4HWOA 3WRVA 4Z54A 1YBAA 1IXYA 4G56A 3ZIAD 2G09A 1HDEA 5L3QB 4WLOA 3LKDA 1Z4MA 2CJWA 4CKZA 3BQNB 4RVHA 1ZD9A 1MJGM 1HTWA 2WHYA 3AIKA 4OFWA 4Z9XA 5KYKA 4EMTA 1J0AA 4TS1A 3S40A 1VJDA 3SYKA 2H2FA 5BVGB 1PJ3A 5ICCA 4UCWA 3SQWA 2JEYA 2F7SA 2FOLA 2NTNA 1U1IA 2GCGA 2PX2A 4ZQBA 2X8BA 1DELA 1CY7A 5H68A 1UJCA 2B1GA 3DZJA 4JT2A 4P32A 3ZW9A 2NVOA 1CR2A 5EAIA 1QIGA 2BBWA 2OXEA 4JXJA 3DJFA 5AXBA 1MOPA 1YUBA 5KQSA 1ZIXA 3P2KA 4LHWA 1TQ4A 5HBRA 4OX9Y 3E5HA 2FW1A 1MH1A 4F60A 3NHWA 4MCHA 4O4JA 1O95C 4ZEWA 5A3VA 2I8LA 4G0MA 4L5IA 1T9HA 4UPEA 3GZTB 1Z4OA 2CD7A 3BXFA 3VTKA 4JI1B 2A1TR 2B1RA 1OX5A 5JSQA 5AI5A 3A4NA 3QF4A 1WHTB 2VJPA 3GT0A 1ZMBA 3OOHA 4XA8A 3ZNOA 3IP9A 3KM0A 3KTDA 4FSHA 4S1WA 5B37A 4BBJA 4FR2A 5TARA 5F4ZA 4F4HA 5KOHA 3ZDBA 4RMIA 1HQDA 2Y1WA 3B20A 5E6UA 1K08A 5LBTA 1MOZA 5DNWA 3DEAA 4IFEA 3B2QA 4JJFA 4P4TA 4A26A 3UZUA 2VNHA 3B12A 3EWNA 1TD1A 1ZHHA 2FPPB 3KR9A 4A2CA 3JWIA 1D2GA 5LQKA 2OZPA 1H0KA 2YC2C 3BRWD 4MWSA 4OM8A 4QSMA 1DOAA 2IYQA 2PZMA 2RB4A 2Y1GA 4HGNA 4UHFA 4A73A 1WPQA 4OAPA 4WK6A 3PWTA 1X6VA 3NBKA 4IQ8A 3WGOA 4IJKA 4DQ0A 2PAFA 1QU2A 1YZFA 1OYYA 3EDCA 3FHLA 3SC2A 4Y7DA 1SUSA 4H3KB 2QGZA 4WKPA 5JO9A 4DBLE 1JEYA 2ZK7A 1H0HA 4KVAA 1TJPB 3RRXA 2BEJA 1TEVA 3QU7A 1E3DA 2HNBA 3HN7A 5CVDA 4ZCLA 4QAQA 1TCCA 4ZEXA 5JTUA 4PX9A 3JQCA 1B42A 2LGJA 3RCBA 2E4ZA 5CDHA 1VGVA 2VPWA 5KSWB 2ADOA