1N7HA

Crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
339
structure length
331
Chain Sequence
RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-D-mannose-4,6-dehydratase
publication title The structure of the MUR1 GDP-mannose 4,6-dehydratase from A. thaliana: Implications for ligand binding and specificity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 129
structure length 331
sequence length 339
chains with identical sequence B
ec nomenclature ec 4.2.1.47: GDP-mannose 4,6-dehydratase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n7hA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1n7hA01
4FGWA 4IDDA 4CLEA 3PPIA 4OL9A 4LN1A 2VWPA 3WNQA 1H0KA 4XB2A 1T1RA 1UP4A 4R1NA 1JKFA 2WD7A 3VPHA 2ZJ0A 1XR3A 2Y1DA 3GZ4A 1Y8QA 2A35A 1ONPA 3AM4A 1U3UA 2Z1MA 2B36A 2X0RA 2Y0DA 3RJ9A 1VL0A 2C5EA 3RROA 5CFZA 1LDEA 4B4WA 1XU7A 3ITDA 4AJNA 1L7EA 4FJ2A 4O63O 4BNUA 1U8XX 3U4IA 3C85A 2YHIB 4LK3A 4YAJA 2OOSA 3EMKA 4O0LA 3GF4A 3H9EO 1E1LA 1B7GO 2EKLA 3NV9A 2YJZA 2V6MA 2CNBA 2VYVD 4BKPA 2QYTA 1T2CA 2VYND 3AY3A 1XSEA 4AICA 3E9MA 1ADFA 4ND1A 4GX0A 3I4FA 4CLRA 1EVJA 3JTMA 4PLGA 2CFCA 5EL0A 1PJ4A 3IC5A 3VVBA 4Z6KA 2VWHA 3UUWA 1LU9A 1C14A 2EKPA 1ISFA 2IXBA 1JVSA 3D7LA 4GWKA 4NNJA 3AU8A 3R6DA 4BO2A 3ETEA 4N7RA 1NYTA 4D43A 1QLJA 1CQJA 3V1TC 3Q3CA 4KDFA 3U9LA 3IP3A 1EFLA 3OP4A 2Q4BA 1HDGO 3LC7O 3MWEB 4IGFA 4YJFB 3QV1A 1XHLA 4J43A 3TZ6A 2YV3A 1D4FA 4BGUA 1GR0A 2DU8A 5FF9A 3IUSA 2DFDA 1FDSA 1PGNA 3HDHA 3JQFC 5L9AA 1U3TA 1N7HA 2O4UX 2PK3A 3PJEA 4BNYA 5I8WA 2GYYA 5ITWA 1GCOA 5DCYA 2UAGA 3BMQB 1KYQA 4U8GA 5CDGA 1BSVA 1E3IA 2WE8A 4RVDA 2VHXA 2YDYA 2XPCA 4D7AA 4XDZA 3ROPA 4FFRA 3AUAA 4J3FA 4D3SA 3L07A 1UP6A 3D4PA 3DAGA 1P77A 4MVJD 3ADPA 1VSVA 2O4CA 3MWDB 3I9OA 3CH6A 2J3KA 1U5CA 3RQSA 4IPTA 2BELA 2HMWA 3DBHA 2I67A 2NV6A 4L0QA 4BQRA 4CM1A 3A1NA 4PLTA 2RH8A 3P7MA 2BFAA 2X5OA 4U0KA 1RKXA 5TT1A 3N58A 4YA6A 2PZKA 1Q7BA 1WMAA 4DMLA 1GUZA 3HN7A 5IXYA 1L7DA 1TA4A 3PHJA 2V7PA 4IBOA 2X5KO 5I7EA 5A9SA 3OQ6A 1R6DA 3B1KA 4JP2A 3W8DA 4PG8A 2Y93A 1ONNA 2X6TA 3JYPA 1ZFNA 3RU7A 5ILOA 4UVIA 3NDRA 3R0IA 3RD5A 2AEFA 4Y6PA 2O3SA 3PVZA 5L45A 1HDRA 2GASA 4CV2A 1BVRA 1WP4A 2HSDA 1O0SA 2VHZA 3O26A 1U3WA 3H5AA 1P31A 1X1EA 3VOSA 2OORA 3AUUA 4YT5A 2JD2A 3ZU3A 3H4VA 2H9IA 4IJWA 4RCVA 4J7CA 4FIZA 1P33A 1PSDA 2DQ4A 2R6JA 2CF6A 1MP0A 2BFPA 3DWFA 4YPOA 1N7GA 2OHXA 4J1SA 2RHRA 3RI3A 5A05A 4CQLB 1NXQA 4PG6A 2DC1A 3CMCO 3GVXA 1JWAB 4XQCA 4YJHB 5JC1A 3WYCA 4MOWA 2D5CA 3W8EA 4P38A 1GL3A 4EDFA 2EIHA 2ZJ1A 1LDNA 1YH3A 3NT4A 4FR5A 3V1YA 2AA3A 2H63A 4W7HA 4F6CA 2CVZA 2GZ1A 4AFNA 5JE8A 3U3XA 3DAPA 5HM8A 4B8WA 4UVHA 4MIOA 4ZQGA 3ONFA 1PX0A 4PG5A 1VJ0A 1DLIA 3JYOA 3U0BA 5ENVA 3OJFA 1PJBA 2O3JA 1KVQA 1WXDA 2Y66A 1CRWG 4NU5A 2C54A 3DBRA 4P4NA 4AG3A 4BVAA 2EGGA 4XRGA 3DXFA 2R00A 2O23A 4GSLA 4IY1A 2DBVO 5JBIA 1HYGA 1BXGA 4P4LA 3P19A 3D3WB 4FGSA 4YDRA 3KEOA 3PWZA 1NQAO 2DPHA 1XELA 4JX8A 2D1YA 2GR9A 1XQ6A 2X9NA 5CPFA 4EJ6A 2D8AA 2F00A 3GY0A 4BO3A 1ENPA 3D4NA 3E48A 1M67A 3LC2O 4Q3NA 3GVCA 4WLVA 2HRBA 3TPCA 1BTOA 1U28A 4UUOA 2OO5A 1PL8A 3VZPA 2P91A 3NT5A 2Q2WA 2WYWA 3MTJA 1DIAA 1MG0A 3LZ6A 5LDGA 1E1MA 1YDWA 1SO8A 3ORFA 3QRWA 3ENNA 3UICA 3DAFA 3LT4A 1VL8A 4Z9FA 4NFSA 1FDWA 1QKIA 1SMKA 4IIVA 3JQBC 2Q1WA 4Q3CA 2PR2A 1SZJG 3I3OA 4F3YA 3GZNB 4GX5A 2NACA 4PCVA 4ZA2A 4AJOA 4J0FA 1BMDA 2BGKA 5ENDA 1I01A 4FDAA 1K5HA 3NDJA 4JQCA 4P8RA 5TIIA 5I7FA 1DBVO 1XQ1A 3FD8A 4CL3A 1WWKA 5CEFA 4MVJF 4TVBA 2EKQA 3MJ4A 4UUNA 4DIFA 1EDZA 4DVJA 5L3ZA 1YS4A 4NIMA 2FR0A 5B4VA 4AJJA 1N5DA 2HO5A 4CLOA 1DFIA 2NU8A 1N1GA 1DAOA 2CUKA 5BNFA 2HAEA 3W1VA 1BDBA 1M76A 4I08A 2PD4A 3H3JA 3VHRA 4Y6SA 2R00C 5JDCC 4NBVA 5CG2A 1JQBA 1IB6A 3PYXA 3QWBA 2W2LD 5T64A 2VT2A 1SNYA 1HDZA 3RKUA 4BNFA 2YQ4A 1H9BA 4HFJA 3CTMA 2WSBA 3IJPA 3I6QA 5G0UA 1A71A 3S2FA 1N1EA 4F6LA 3RUFA 1PZGA 2NU9A 1TB4A 3OFSA 3T7EA 1H9AA 4WEOA 5ITVA 1A7AA 2CVQA 3GUYA 1LNQA 4ZQFA 3BZUA 3GNQA 4G81A 4YRAA 2DUUA 1PGJA 3GVHA 4EEXA 4EW6A 1B15A 3PLNA 2I99A 3O8QB 3CEAA 3L0DA 2VRCA 3PI7A 1NPTO 1XLTA 5GZ1A 3CIFA 4JBIA 2NVUA 5T8KA 5GZ3A 2TMDA 4EJ0A 3F1LA 3JCZA 3PQDA 2IYOA 3KOUA 3U4CA 3JQEA 1KOLA 7ADHA 4BIIA 4HFRA 3GEMA 2NVUB 1F17A 5HTOA 3DMYA 1WNTA 1ML3A 1PZHA 4CR6A 2OP0A 3DHNA 5FYDA 4NFYA 1M66A 3E18A 3EY4A 4XZ3A 3PLRA 4W4TA 2AQHA 8LDHA 3JQ7A 4I5DA 1IY8A 1E3WB 1WDKA 2BI7A 1ZUD1 3KYDB 1XDWA 2AEMA 5JO9A 3K92A 1HZZA 1GAEO 3U49A 3UOGA 2D3TA 4FD3A 3GDGA 2OBYA 4MVJM 4RPKA 3L6EA 2JL1A 3IIEA 3VH1A 4ZRNA 3QLJA 4RQTA 4YQZA 2B4TO 2GN9A 3FI9A 4QQRA 2NTNA 3KHUA 1FK8A 1K6JA 4XYLA 4UEOA 4D3DA 1X7GA 4DLAA 3HB4X 4CUZA 4RZIA 1GYPA 3MEQA 3H8VA 1I32A 2Q46A 3OJEA 3K30A 1LSUA 2EV9A 5TGDA 1PJQA 4BMSA 3DMTC 2GF2A 2G5CA 3PWSA 1RJWA 3ANLA 3DTYA 4NJOA 1GZ4A 2QRKA 4XR9A 1TT7A 3HDQA 3QW2A 2YFQA 4WLEA 5K6AC 2DKNA 1JWBB 4OQZA 1Q7CA 1IYZA 2P4HX 1ENYA 4AJHA 1NPDA 3JD0A 1RM3A 4NBTA 4EUFA 2Y0CA 3BYZA 2AQKA 3U62A 4W82A 1KC3A 2CVOA 3GRKA 4FCCA 4EEZA 1HDXA 4PLZA 1QYVA 3O03A 5GZ6A 3JQAB 1UAYA 2JAPA 1KVTA 2P5YA 4WNIA 1NFRA 4CMCA 3LDHA 4FFPA 1NASA 4R41A 5TT0A 2I3AA 2YDXA 3VTZA 5IDWA 1PGQA 1P44A 3CXRA 3W4JA 1LRKA 3IJRA 5AQ1A 2RH4A 2A9FA 2XOXA 1ID1A 2AQIA 2X4GA 1E3LA 2C7VA 1E6WA 5GMOA 1GV0A 1KY5A 1QR6A 2I3GA 4CMKA 4F45A 2IRWA 3JQ8B 5DDIP 2GN6A 2BH9A 4YRDA 3VC7A 4IJUA 5AXAA 4RDHA 3JD4A 3WDSA 5DN9A 3BTVA 1C0KA 2FP4A 4CM4A 3OICA 4U6SA 3ZWNA 5IG2A 3GPIA 3GH3A 2JFHA 2NTJA 4HNHA 1K3TA 1TEHA 3QQPA 1I3NA 4IXTA 3KTDA 5A1TA 3UGKA 3PIDA 3VKUA 4CMIB 3N7UA 3OIFA 3AOEA 2FR1A 1VE9A 2AHRA 2H1SA 3QVTA 2C2XA 5EMHA 1B8PA 1F8GA 4H7PA 3HJAA 3C1AA 5L40A 2C59A 3RU9A 1LX6A 4E2ZA 3NGXA 4H15A 3ZV6A 4WLOA 5KIAA 3OM9A 5FI3A 4BMNA 3RIHA 3H2SA 3ANMA 3ZWWA 3O38A 2NSDA 3EDMA 4NJMB 4WOKA 3JQ9C 5MDHA 2VUUA 3WNVA 3QSGA 4M49A 1MGOA 3ZN2A 1TT5A 3OIDA 3GFGA 1H94A 2C0CA 1Y9AA 3KM0A 2DTEA 5JC8A 3UHAA 1TT5B 2YY7A 3FNGA 4NG5A 1UXGA 2RBEA 2EF1A 1I10A 3PGXA 4Z0PA 3U09A 3FCOA 4HY3A 3WIEA 4OYRA 1W8DA 4KTVE 2P9CA 3E9NA 3E9QA 1P0FA 3WTBA 4WGGA 3QA9A 4XYMA 4K1LA 1R0LA 3FBGA 3ZU4A 3K5PA 4Z0HO 3ZH2A 2HMUA 4JJGA 3G49A 2GO1A 2PH3A 4MJLA 4YJGB 1QLHA 2QRJA 5KCZA 1QP8A 2LDXA 1X7DA 1YBVA 2QQ5A 4MVJE 5JYDA 1GCUA 1SBYA 3I9MA 3RSHA 3NTQA 4MINA 1MG5A 1HEUA 5B1YA 3F1KA 5TX7A 2ZTVA 4FS3A 5JY6A 3LU1A 4CM5A 1YQXA 3ENKA 2PY6A 2XXBA 1YOVB 3HUDA 2CD9A 4GVLA 4JP3A 1DIRA 1NWHA 3OIGA 1QYDA 1V35A 3FBTA 3MJEA 2ZCVA 3Q2IA 2CMDA 3IL2A 3K8ZA 5KJEA 4IQ8A 2O3UA 2EW8A 4IZHA 4HKTA 3AOEC 4P22A 1PS8A 1NVTA 3E1KA 1J6UA 2PD6A 2W4QA 4OM8A 5JAIA 3UFXA 5A03A 1ZKMA 3BMCA 4MO2A 4YAEA 1IZ9A 1EK6A 4ITUA 4G5HA 5G0TA 4Y9DA 1M6WA 4IUYA 2NNLD 1O89A 3M1AA 3DL2A 3M1LA 3F3SA 1AHIA 5CG1A 1BGVA 1LSSA 2B5VA 3OSUA 4PZDA 4A27A 3WOHA 4WOJA 3SC6A 4E32A 1I5RA 3EGOA 4YCAA 2Y67A 3INGA 1VI2A 2GUGA 4TZTA 4KQWA 2QIOA 4IDBA 3TZCA 4PFJA 1IE3A 4XRRA 1E7MA 2X1HA 1F8FA 3F6YA 1LDGA 4G2NA 2BF7A 1B14A 4RVUA 2GRAA 2EEZA 1NVGA 1QYCA 2P9EA 4OSPA 3EZYA 4RPHA 4AJKA 1YO6A 3I52A 5G0SA 3QVWA 5U1PA 2PGLA 4E2XA 3K73O 3PQEA 1HL3A 1JU9A 2RAFA 2G82A 4OQYA 1FJHA 4DQUA 2JCVA 4I5GA 4TMFA 4KOAA 4C7JA 3ZGYA 4ALKA 4CQMA 4YYZA 3RUCA 4II2A 4YR9A 3ZNNA 4DBVO 3INTA 1WZEA 4CQMB 1NM5A 4Q3BA 4CL8A 4PLHA 2J3IA 5C5IA 4BGIA 2O2YA 1LLDA 4HADA 1YJQA 1KS9A 4FFLA 4JK3A 4J4TA 3A06A 3DOJA 3TN7A 2QG4A 4BKOA 4YXFA 3KBOA 4LSMA 2OMEA 3GDFA 4ALMA 1MXHA 1ZK0A 1OC4A 1ZXLA 1WDLA 4DWVA 3GVIA 4MVJH 3AW9A 3EK2A 3TFQA 1VC2A 2HDHA 2O50A 5DULA 4ZQBA 3TZKA 4DC0A 3DZKA 4E31A 3IMFA 4BNLA 5ER6A 1MUUA 3I9JA 2O48X 5COAA 1NBOA 1H2HA 1KVSA 1QSGA 2HK9A 2PTGA 1F12A 1I36A 1B3RA 3UXYA 2Y05A 2Y1GA 1EBFA 3FSRA 2ILTA 1F0YA 1PL7A 3D5TA 5TLSA 3JQFA 1Y8RA 1Q2XA 6LDHA 1CQIA 1JVBA 5AOVA 2GDZA 2VYVA 4S1VA 4BNXA 4GSKA 3VKVA 2VYNA 3ONEA 5JMPA 3GOHA 3LT1A 4NMHA 5A3JA 2J5QA 3HFGA 2WD7B 3KO8A 4Q3AA 1T2EA 3GC6A 3RFVA 1ADCA 3TQHA 1Y8QB 2XAAA 3JQGA 1V8BA 2UUOA 5F3RA 2ZTUA 3IKTA 3NTOA 4NHEA 4NH4A 5I9NA 5L4SA 1TLTA 4Z3DA 3DHYA 2ZTLA 4HBGA 4LCEA 3M6IA 1SEPA 1X0XA 2DUWA 4Y6RA 5BNIA 1X14A 1G0NA 2IZZA 4BKQA 3Q2KA 4CODB 4GLOA 2QHXA 4I9HA 3I1JA 5G4LA 3BMNA 3LLVA 4QT0A 1LLCA 2EP7A 3LF2A 4YACA 4ND3A 4FFNA 3BA1A 4R9SA 3LSYA 1FDVA 1UAGA 3FR8A 3LT0A 3UN1A 2FZWA 4CLRB 1J0XO 2JAHA 2BFOA 4WPGA 2AG5A 3ZHYA 4E5MA 4QO7A 4DA9A 3B6ZA 3ONDA 4Q39A 4WCFC 1X0VA 2Y1EA 1ADBA 3RAJA 3TL3A 5ADHA 3PZBA 2Y99A 3ICCA 2I5PO 2NTVA 2OL4A 3I5MA 4YB8A 1E3EA 1DRVA 5FFFA 4CV0A 3QIVA 2X0IA 3I23A 2YW9A 3H7AA 1R4NA 2H6EA 4ZHSA 1KBZA 1E7SA 3GDOA 3WB9A 1EE2A 1YDEA 3D5QA 1LUAA 1JLLA 4JXKA 2ZCUA 2OP1A 4CM6A 1C0PA 4PLWA 3CMMA 4PG4A 3W4KA 1GUYA 2VQ3A 3PZRA 4TSKA 5I8ZA 1T24A 4N5LA 4D79A 1ZEJA 3L6DA 3GHHA 2O2SA 5L95A 2W90A 1NHGA 1O9BA 1A4UA 4CUJA 2AE1A 3LLSA 5A5EA 4A5OA 5LC1A 2JHGA 4J0EA 2V65A 2G76A 1B3BA 4H16A 4J1NA 3TZQA 3WGZA 4NDNE 2FSSA 2GN4A 1I30A 3JD1A 1SEVA 4XYEA 1GTMA 2GGSA 1LJ8A 5JDIA 1JN0A 2TMGA 4HXYA 5F21A 4OKIA 1AE1A 1TVEA 4OGWA 1AXGA 3G17A 1BHSA 1PQWA 3F5SA 4IJKA 4FQ8A 1DHRA 4DIOA 3KEQA 5F5LA 4D41A 4CM3A 3KYBA 3RUHA 3DBHB 1PWXA 4HFNA 1B8UA 5T6BA 5TSDA 2VRBA 4JROA 1XWFA 4NK5A 4YVFA 3ZHXA 4B4VA 4EBFA 4XDYA 4YJDA 5ER9A 4IMRA 5FEUA 1BG6A 4BNJA 4W99A 3Q1LA 3AY6A 4XCVA 1QV7A 4KQXA 2GERA 1DO8A 2HQ1A 3JSAA 5JXWA 5BSHA 4XQGA 3FPLA 1PU2A 1PJLA 4URFA 5A9SB 5G0WA 1UXJA 2QW8A 1DOHA 1PJ3A 4D45A 1VRWA 2VCYA 4RGBA 3O4RA 1LTHR 1MC5A 2DTXA 1P1FA 1ZZEA 2DFVA 3JQBA 4CMHA 3QJ5A 4MP8A 4G65A 3S2EA 3WICA 2Q4EA 2B35A 3TZHA 4DPKA 1OI7A 2VZ9A 3RC2A 1DIBA 1N9GA 2EJVA 3DHEA 1A7KA 1ZSVA 1W4ZA 3S2GA 3WYBA 3FNEA 4UEKA 1UXKA 4ALJA 3GRPA 3GLQA 1HLDA 3FWZA 2O7SA 3KLPX 1U5AA 1IHXA 2H5LA 2NU6A 1AN9A 1OBFO 1O8CA 3ROQA 2C2YA 1PTJA 2BD0A 3X2EA 1I33A 2JCYA 5TNXA 1KEWA 3ASUA 3SLKA 4R51A 3HDJA 3VZRA 4OXNA 4YEDA 1IL0A 1P3DA 1DFGA 3GUCA 3WXBA 3SLGA 1G0OA 3O9ZA 4EYEA 4OJNA 4AJPA 1B16A 2UUPA 4CUKA 3F46A 4Q3EA 4A73A 3MJTA 3CINA 3H2ZA 4XQ9A 3JV7A 4N54A 2C20A 4EUHA 4XD2A 1BDMA 1GZ6A 3T4XA 2VZ8A 1PS9A 4Z0TA 1HTBA 4JJFA 4BNZA 5JDIC 3OF2A 3GEDA 4B3HA 5JDCA 3VDQA 4GKBA 3QP9A 3U4DA 3SJ7A 1IOLA 3WBFA 4CM9D 5CDYA 3DBRB 4MVJI 3ULKA 3VTFA 2X58A 3VPSA 5IFLA 6ADHA 2Q1TA 3I9LA 4RF2A 1BXGB 3VZQA 8ADHA 5HBRA 2IODA 3L4SO 4Y67A 3DBVO 2Q50A 1X15A 1MFZA 3PHGA 1I8TA 1YJ8A 1UR5A 3EAGA 4BO9A 4EUEA 1LQUA 1SOWA 3G79A 3GG2A 2ZB4A 4J4BA 5KVQA 1NVMB 3PFFA 1DIHA 4RF5A 1BW9A 4XEHA 5KJFA 2ZQZA 3FNFA 2HCTA 4GVXA 1H6DA 3F4BA 2DPGA 3FWNA 4LCJA 2WTBA 1QXSA 3Q9NA 3WMWA 4AJEA 4R3WA 3BAZA 1V3TA 3BMOA 4I9UA 2GNAA 4BV9A 2WD8A 3TSCA 4MKRA 2VHWA 4A10A 3QWFA 3ZWPA 2OBNA 4BNNA 3WQRA 1ISMA 4ND5A 1HSOA 3EVNA 7MDHA 4N18A 1FF9A 1Y9EA 2JD1A 2OFPA 3LC1O 3CSDA 4AJ2A 1JAYA 1I2BA 2NVBA 4BNVA 1RM5A 1E92A 1BRMA 3RUDA 1NHWA 2PGJA 4YBZA 1WVGA 1Q0LA 4YTEA 1U8FO 4DC1A 2A4KA 3E03A 5AXCA 4OXYA 3GN1A 4NPCA 3ETDA 3H65A 4YQYA 3GAFA 3HADA 4HWKA 2JJYA 4NK4A 5TRTA 5HS6A 2SCUA 2I6TA 3OA2A 4IJVA 5COQA 3UF0A 4BO5A 5C7OO 4ZQHA 4BNIA 1YL6A 4GWGA 3PHHA 1M75A 4FOSA 4IINA 3KSZO 4R68A 2W8ZA 3MZ0A 4J2OA 1PWZA 4WLUA 3GFBA 5F1OA 1DAPA 4TVOA 1XG5A 1HXHA 3C1TA 2IE0A 1TXGA 1C3VA 1ZSYA 3KYCA 4CLOB 2YZ7A 5F1PA 1KEVA 4L4RA 2V6FA 4IQ0A 5JAQA 2Q3EA 3AY7A 3VVCA 1K6XA 4FBGA 1DSSG 2OUIA 5ICSA 4LISA 1PZEA 3AUTA 2B69A 3KB6A 5JY1A 4ZU3A 1HZJA 1GQ2A 3GGOA 3DMTA 5BNTA 3RVDA 1ARZA 5JPIA 1RPNA 1M2WA 2VOJA 3WTCA 5K6AA 3ZW8A 2X86A 5IJZA 2J5RA 3VDRA 1G6KA 2UYYA 5DCWA 2IZ0A 2PV7A 4NU6A 5DF1A 2G0TA 4FFMA 4XJTA 4IZIA 2IEBA 5KJ6A 3WJ7A 3K31A 5AYVA 4FB5A 4UREA 4BO8A 5BQFA 1YONA 1DRUA 4FSHA 3ZWAA 2P9GA 4FJ1A 2J6IA 4KWIA 2E48A 2Q99A 3TFOA 1P0CA 5G4KA 3TOZA 5LDHA 1DEHA 3DEYX 4EITA 4J2HA 2P4QA 2VT3A 3X2FA 1LRLA 3QE3A 4FC7A 2P5UA 1A5ZA 3C7AA 1JA9A 1XYGA 4BB6A 1O94A 3QVXA 4CMGA 3Q6IA 5A04A 5G2OA 1GPDG 3PYLA 2LDBA 4RPGA 1EVZA 1PJTA 2NUAA 2Q49A 3OBBA 4K6FA 5CAEA 2Y0EA 1E1NA 1AHHA 2PNFA 2EG9A 3RCBA 2WMDA 1QV6A 2NQTA 3DZJA 3HG7A 3JQ7B 1RYDA 3S8MA 5JLAA 1E5QA 4ALNA 5JNLA 2HJRA 3SEFA 3FTNA 1XEAA 4J90A 4OSOA 4R3NA 2G17A 4ESOA 2VNSA 2ZK7A 2CZCA 1Y7TA 3HQ4O 1M6HA 3BHMA 1H5QA 2WDZA 1NPYA 3AI2A 1E1KA 4XWYA 5C37A 5U9CA 3QHAA 1OFGA 4L9RA 2C7GA 4R4JA 3FHLA 2VRCD 3JQ9A 3N74A 3W4IA 3GAZA 3WGYA 1ZCJA 3GGPA 4BO1A 4R16A 4E5KA 3GG9A 2GCGA 2BKAA 3U4HA 1LC0A 3DC2A 3ZNQA 4YAKA 3F47A 3H6KA 4NFHA 5KKAA 3UCEA 4YT2A 1LEHA 1YE3A 1P74A 3A4VA 4H3VA 3C3XA 2EJWA 4LMRA 3ZWVA 3WSVA 2WJPA 2NWQA 5COBA 2HMSA 3ROKA 1NP3A 4GQAA 4ZQEA 3PEFA 2VOEA 4B3JA 4IDAA 2FN7A 4R1TA 3LT2A 1UXHA 3RUEA 4CR7A 4E12A 3EZLA 1Z82A 2FZEA 3V1UA 1Y6JA 5BT9A 1NNUA 2ZIZA 1R12A 1NR7A 1EDOA 4BB5A 3CZMA 5ICMA 1HE4A 1SB8A 4BNMA 5G0VA 4GX1A 4I8XA 4J4HA 1YL5A 4A0SA 5KVSA 3WGIA 3RKRA 4N5NA 3PJFA 1P1IA 1HE5A 3QVSA 2VNAA 3MJSA 3ZCXA 2DTDA 1R4MA 4JCOA 3V2GA 3NYWA 1UZNA 2GN8A 1D7OA 2AQ8A 4ID9A 3NAQA 4GLLA 5L7WA 3RBVA 4CMEC 3DOCA 1R4MB 3AFNA 4OOFA 1Q1NA 2B83A 4PG7A 4K6CA 4CM4B 1SAYA 1ZBQA 3DQPA 4RVFA 2GLXA 5IN5A 4F46A 2D4AA 3OQ1A 1CIVA 1NR1A 4N5MA 1GDHA 2FPGA 4JLWA 1GYRA 3NRCA 1Z6ZA 1S7CA 2VHYA 4XYGA 4ZN6A 3IP1A 5T5QA 3Q11A 4KP7A 3JQAD 1B26A 1U3VA 1Z75A 2C29D 2IYPA 2ZB8A 1YBAA 1YB1A 3K9QO 3EVTA 1EVIA 1H6AA 4DBZA 1K6IA 4GMFA 1ZK4A 3M2PA 4BOYA 1YVEI 3SX2A 1C1XA 1CWUA 2HMVA 4HX5A 1SB9A 2NLOA 3F9IA 4WNCA 2Z95A 2BGMA 1E7RA 1U7HA 2PZJA 3F4LA 3W8FA 4BV8A 4RQUA 1HE3A 1P9LA 5T57A 5JCJD 4K9DA 4JJIA 4L74A 5L7YA 1TI7A 3WSWA 9LDBA 1E3JA 2C07A 2PFGA 4D46A 4QSMA 1T2FA 4DPMA 1WDMA 1T2AA 1K0UA 3HWRA 4MDHA 2W2KA 3NTRA 4IDEA 1NAHA 3GNSA 5DZSA 1CERA 3R3JA 1WLYA 1LSOA 1GU7A 3DZHA 1ISJA 4IQGA 5ES3A 2W2KB 2YHUA 5K9ZA 2GZ3A 1HSZA 3E5MA 2QRLA 3H9JA 4L4SA 4GX2A 4NR0A 4O1MA 4CPDA 3DB2A 5KJ1A 2OZPA 4WEQA 1YQDA 2X0JA 4L73A 4W9NA 4I5FA 1VL6A 5U4QA 3RC7A 4YT4A 4EZBA 1F14A 3GNTA 5TC4A 2BMAA 3KRTA 3L9WA 1C1DA 3ZWCA 4QXMA 4RPJA 3VPFA 5IZCC 3ZI0A 4B4OA 1KC1A 3AM3A 4TKMA 4LRTB 4JN6B 5B12A 4KDEA 1R66A 2HK8A 1VLLA 5TJ9A 1U1IA 1ZK2A 2R2GA 2ZB3A 4BHTA 3BHJA 5IZ4A 3NEPX 3PRJA 1LDYA 5J23A 3ABIA 1HDCA 2GD1O 4O6VA 3D0OA 3BHIA 4QUKA 4M87A 5AXBA 2ZKLA 1JKIA 2X23A 1PJ2A 3GN2A 4BNWA 3ZV3A 1V3UA 4A03A 3RASA 2PH5A 3BMCB 4U0JA 4CMAA 1O95A 5DP1A 1PR3A 1YL7A 4CLDA 1D3AA 4QFDA 1UDCA 5JAMA 4QO8A 2CDBA 2PKQO 4O5OA 3OETA 4WASA 2RHCA 3ZWXA 2DAPA 2NM0A 3EHEA 4IGEA 4RO0A 1D8AA 4I1IA 4L76A 5JAZA 1N8KA 1O6ZA 2P2SA 3EUWA 3OJ0A 2DBZA 4J16A 3VH3A 3LYLA 4K26A 4PRLA 4GI2A 5DBGA 1HDYA 4NBWA 4XR4A 2J3JA 3IQDB 3ZWMA 4LW8A 4RVSA 3DFUA 3G1TA 4RVHA 5THKA 5JMWA 2FRDA 4PZEA 1YWGO 2BFMA 4PVDA 1Y1PA 4GKVA 4XIYA 3T7CA 3C8MA 4UUMA 5C7IO 4TROA 1NFQA 3JD3A 2X9VA 4R5HA 4IDFA 4PZCA 3IDSA 3D64A 5DCUA 1HYHA 4MKXA 4B7CA 4W9NC 4RLHA 1ZW1A 2J3HA 1RWBA 3MJCA 1C0LA 3S1LA 1P1RA 4BKRA 5HRUA 3NT2A 3FTPA 1A9YA 1GD1O 1GY8A 2POQX 4GGPA 1YGYA 4XYBA 1KETA 1D1TA 1PIWA 4OH1A 1GYQA 2HUNA 4HUJA 4YAIA 5I9LA 5TS3A 4PRKA 5CDUA 4NBRA 4C7KA 4FFOA 3WFIA 2QZ9A 3IKVA 4WCFA 3DZFA 4TKLA 9LDTA 2ZATA 1EMDA 4UVEA 1UJMA 2AMFA 1UUFA 4L8VA 3ZV5A 5I7VA 4L75A 2QYSA 4RL6A 2Z5LA 1WPQA 4WLNA 2D59A 4J9VA 1K2WA 3I9NA 4LGVA 2FMUA 4ALIA 1A72A 1XGKA 1I24A 2O3TA 3PYMA 4PGFA 3PJGA 3WQSB 4DYDA 1DC3A 3K2EA 3L4BC 3LVFO 4LVCA 1IPFA 1CDOA 5EIOA 3I4CA 2X5JO 3LF1A 4GAEA 4E2WA 5KWEA 4TWRA 1VSUA 2ET6A 2I65A 1WMBA 1H6BA 2JKVA 4IIUA 5C7LO 4RV9A 3ITKA 4CQMD 1Y8RB 1ULSA 3SBOA 4IMPA 1Z7EA 1LC3A 5KOIA 1EUDA 4PLYA 1ISIA 3W6ZA 3GA0A 3R3SA 5MGBA 1KVRA 4DIBA 2DLDA 2B37A 1WAMA 4EGFA 2D2IA 1SCUA 3G1UA 1QORA 3JQGB 1ZJZA 1HETA 3IS3A 1BXKA 2FWMX 4BNTA 1GEEA 5L51A 2HMTA 3VZSA 2UDPA 1LLUA 1GV1A 5A9RA 2JFGA 5EQFA 2JHFA 5EERA 5A4DA 1N92A 4DXHA 1U4OA 1U9JA 4QTZA 4R01A 4NQZA 1MC4A 4LSWA 3RC1A 2E4AA 2PD3A 3FF4A 1GQYA 3KUXA 4BS9A 1GQQA 4AJLA 2YHIA 3B20A 3FRJA 5CEJA 3IAHA 3DTTA 1YBMA 1IUKA 3BMNB 4JBHA 1E3SA 4KTTE 3C1OA 4ZD6A 2NADA 1LDBA 3WGTA 3OA0A 3NGLA 1PGOA 4KUHA 4QX6A 3CUKA 4KUEA 4UAGA 4BKUA 1U4SA 3ST7A 3L9XA 4MIYA 3HNPA 4WKGA 2X0NA 4DTIA 1DDOA 1OOEA 4DGSA 1VKNA 3ETGA 4E5PA 2VN8A 1ISGA 3VH2A 1W73A 5GY7A 3AU9A 4DMMA 4W6ZA 4XGIA 1E6EA 5BR7A 4ONEA 3G3EA 4MVJA 4BO7A 3I83A 5K0ZA 2PGDA 1ISHA 4BO0A 5JS6A 3PDUA 3IUPA 4M8SA 5IDXA 2W98A 1R4NB 3PQFA 2I9PA 3WGOA 3L77A 3DR3A 3SJUA 1NQTA 4YJFA 4AL4A 1Y81A 3P2YA 1PZFA 4MIEA 4CLHA 3AFMA 3OEYA 3ZWYA 1V6AA 3UKOA 4RVGA 2Q2VA 4QFCA 1IZ0A 3PP8A 2HLPA 2FSVA 3INRA 3B1JA 2FHSA 2ZYAA 5L4NA 2X8LA 4D3FA 1QMGA 5JO0A 2HRZA 3D4OA 1PQPA 3BMQA 3TRIA 3KSDO 1KIFA 4BNKA 4GPD1 4U6QA 1DXYA 2O7QA 3GQVA 3ZDFA 5DBIA 4BQPA 5THQA 1R37A 4XKJA 3RC9A 2CDAA 5CEEA 3PFWO 4Q9NA 3LQFA 4XGNA 4RPLA 2V6GA 3DZGA 1MB4A 1MFPA 3WIDA 4UVGA 4U7WA 4IM7A 3I9KA 3DBLA 4B8ZA 3ASVA 4UUPA 4ALLA 4ROSA 4DLLA 3PJDA 1V9LA 1U2DA 1K89A 1GADO 1EUZA 3DBLB 2EXXA 1EVYA 4R1SA 3ROMA 4GMGA 3WGGA 1P1KA 4B7UA 4AJIA 1CYDA 5I9MA 4TQGA 2VTDA 3BTUA 1E77A 1JW9B 4YWJA 1DRWA 1B8VA 1RYEA 5KVVA 3ANNA 2JFFA 4U5QA 4X54A 3EC7A 1S6YA 4BL5A 4QECA 4A7PA 2IZ1A 2AEJA 3MOIA 2B4QA 5LCXA 1EEHA 1T25A 1I2CA 2I76A 5FWNA 2EERA 1N9GB 3V8BA 5IDQA 5CP8A 5L53A 4CM9A 2UVDA 1P1HA 3I6IA 1Y5RA 4R5MA 3K2BA 2VUSA 2BI8A 1O5IA 1JDJA 3KLMX 4CV3A 1HF3A 1JTVA 4YT8A 2WWRA 2IXAA 2V6BA 2GZ2A 2Q1SA 2AXQA 2FPPA 2DM6A 2PKQP 4OXKA 2F1KA 1YXMA 4NI5A 4EI2A 1V3VA 4CQLA 2ZB7A 5F1KA 2WYVA 2WM3A 3DZBA 3K6JA 4I5EA 5DOZA 3JQDA 4CMBA 3JYNA 2ZTMA 3PHIA 4YJHA 3TF5A 3WQQA 2ZYDA 3M2TA 1I2ZA 2YQ5A 3AOGA 1LI4A 3RUAA 4E30A 1T1SA 4LMPA 2XXJA 4IDGA 1LQTA 4MP3A 3WX0A 1PR9A 2E37A 3FR7A 4HNGA 3CKYA 3V2UA 1YQGA 1DJNA 1HRDA 1R0KA 4PN3A 2RCYA 3RBXA 1JKJA 2DT5A 3WWZA 2Y1FA 5IN4A 1HKUA 1PS0A 4M1QA 1P45A 5EN4A 3UVEA 2Q45A 1UZLA 4BGEA 1NX6A 3H5NA 5TQVA 3MCVA 1MX3A 3KXDA 3JD2A 2VTEA 4HFMA 1Q0QA 3DFZA 2CF5A 3D3WA 3H9GA 3PXXA 1VJTA 4ZRMA 3WGQA 2A92A 4RJTA 2AG8A 3ZHBA 5H83A 1Q0HA 4LVUA 1BW9B 2ZYGA 3E5RA 4Y8VA 1EK5A 1EBUA 4J1TA 4HV4A 2FOIA 4E2YA 3PGJA 2X7HA 3QVOA 3BMOB 4J91A 1CJCA 3PHLA 2CY0A 3DONA 3WG9A 1G1AA 1ENOA 1LXCA 2YYYA 1LLQA 2PZMA 1IULA 4ZJUA 4INAA 4PLVA 1AXEA 3Q9UA 2C82A 2VWGA 1YB5A 4WLFA 3GPDG 4IXWA 2W2LA 3BTSA 4PLFA 4CLXA 4E4YA 4XQEA 4W7IA 4RF3A 2WEKA 3GZNA 3AI3A 1GPJA 3VPGA 3WWYA 4MVJP 4B3IA 1E7YA 5A06A 3ZU5A 4UVDA 3ZW9A 1E0DA 3HB5X 4NBUA 1SPXA 3VH4A 5B37A 1ZSNA 3FN4A 3QY9A 4I9NA 4OAQA 1R15A 5EQDA 4Q3DA 2XF8A 2X22A 4BGVA 1RM0A 3D1LA 1E7QA 4CR8A 3UCFA 1AGNA 2QZZA 4XIJA 1KY4A 3PWKA 2UV8A 4MVJG 4TZKA 3Q0EA 2OGUA 1DJQA 5KTKA 4OHUA 4WCDA 5A3VA 1PQUA 1T4DA 4XGKA 4ND2A 3TNLA 3V5NA 1PGPA 5CHEA 4HP8A 3MTGA 3COSA 2PZLA 3KYCB 1FDUA 5I7SA 4P4GA 1C0IA 2E49A 1T4BA 2YV2A 2WYUA 5T67A 1WW8A 3P5SA 1DB3A 3D3EA 1MXFA 3HDYA 4MKZA 4NZ9A 1LDMA 3HZZA 2PKRA 4E5NA 5KKCA 2E6UX 4RZHA 4R1UA 4GBJA 4M89A 3B70A 3GR6A 5KJCA 1NFFA 1EUCA 3OQBA 4J7XA 2DVMA 5KNLA 1R16A 1I3LA 2IDZA 2C5AA 1D1SA 1DLJA 3ZV4A 4XA8A 1WZIA 5A02A 1ZMOA 1UH5A 3C24A 3GHYA 3TJRA 1VKOA 5DOVA 3C7DB 1QRRA 1GEGA 4M55A 2NVWA 5EINA 1CETA 1OZAA 4ZGWA 3EYWA 4J7UA 3ON5A 1A27A 5TF4A 3VPXA 5IF3A 1UXIA 1ONOA 3O8QA 4MP6A 4E13A 1HE2A 3E6AA 1E7WA 1FDTA 4AJ1A 3PIIA 3KVOA 3NJ8A 1KEUA 3OEWA 5G4KB 3WYEA 4YAGA 1L1FA 1UDBA 4WJZA 3ZNPA 2RIRA 1ZIDA 3QWIA 2YV1A 1I3MA 4AJ4A 3JQCA 4BNGA 4CMEA 3TDKA 3E82A 1PL6A 3NDIA 1ZEMA 3HSKA 1H6CA 1BVUA 4WUVA 3UW3A 1ORRA 4E21A 4J6FA 1RM4A 1E3WA 2WE7A 3T4EA 2YUTA 3BIOA 3KYDA 5TJHA 3KZVA 4Z3KA 3AM5A 5L7TA 3R1IA 3WJAA 3S55A 3RFXA 2CSUA 3HE3A 2AW5A 3NUGA 4TRMA 1HDOA 4ILKA 4A26A 5BSEA 2JCXA 3ZHZA 1ZXBA 2D0IA 4PLPA 1AUPA 1HT0A 1Z45A 1PEDA 1Z74A 1KEPA 3HFSA 3WS7A 3VAZA 4IS3A 1E5LA 2D5AA 3P2OA 2PA3A 2J8ZA 4BNHA 2IEDA 3WLEA 5DNAA 2EP5A 2HK7A 3DO5A 3BXXA 1NAIA 3ADOA 4JGBA 3EW7A 2Y1CA 2Q1UA 3CPSA 2DBRA 5A5FA 1ZNQO 1GUFA 1SC6A 3GGGA 4DPLA 5IXSA 2J5KA 1H2BA 5B4TA 3OMLA 4JNKA 1XKQA 3OECA 4E3ZA 4CV1A 4M86A 4TRJA 4R69A 2Y1OA 4FN4A 3RBZA 4OIMA 3RJ5A 3JYQA 3TWOA 1ZVMA 1J5PA 1F06A 3GVPA 1ZO8A 2PWZA 4K28A 3JQAA 2A94A 3SVTA 2O3RA 4R9RA 4C4OA 3CE6A 4OOEA 4DYVA 5HS4A 1XU9A 4BO4A 4TRRA 5IZCA 3WLFA 1NWCA 4S3MA 3UH1A 3H9QA 4CM8A 3DOOA 1J49A 5T8KC 1HYEA 1LA2A 5DP2A 4GH5A 3QWHA 2QX7A 4RLSA 5BSFA 1J4AA 5JCJA 3JQ8A 4CM8B 1X1TA 1FXSA 3V2HA 1BXZA 1YRLA 1EZ4A 3MJVA 2EW2A 3OHSX 4FOOA 2FPIA 4E33A 2VHVA 5JFOA 4ZVVA 1LSJA 1NQOA 3AJRA 1GFSA 4J49A 3H5RA 4CJXA 5IAAA 1VJ1A 4D44A 1XA0A 4CMIA 5DT9A 1JAXA 3GEGA 2Q2QA 2O3QA 3QWAA 1IPEA 4RF4A 4KZPA 4XB1A 1UDAA 4II3A 4MPDA 1Z7BA 2B0JA 3L6OO 5FI5A 1DIGA 3FPCA 3IOYA 3LK7A 3ZWBA 1OMOA 3ZNOA 4PIVA 3KSUA 2B5WA 1DHTA 2G1UA 4E6PA 1C1XB 4J1QA 4DLBA 2PLAA 1DC5A 4B79A 3E8XA 2FY8A 3PTZA 2BRUA 1A9ZA 4NJMA 4B4UA 3GMSA 5AVOA 3UCXA 3C7CB 3HN2A 4BO6A 1X13A 3A28A 1MLDA 4Y98A 4E0BA 5CDTA 1U7TA 3TL2A 2NQ8A 1VPDA 3KV3O 2JD0A 3ZZNA 3UAGA 3WBBA 3GK3A 1I0ZA 5DBFA 3DDNA 1XIVA 3AWDA 1HLPA 5ILGA 5A9TA 1ADGA 3AI1A 3HHPA 1ZH8A 2I66A 1HWYA 1Y5MA 4FJ0A 2GSDA 2Y68A 4LRSB 4WE3A 3SC4A 4E5YA 2ZQYA 4AVYA 1P1JA 1V0JA 5H81A 1KVUA 4YJGA 4DUPA 4FC6A 1LBEA 1ZMTA 4GGOA 3TOXA 2HKIA 3JYLA 3PDJA 1C1DB 2YFHA 3CZRA 3MOGA 4CM7A 4D0RA 1VM6A 4DQXA 4ND4A 3ZU2A 5B4UA 4RDIA 2BGLA 4OKNA 3W6UA 5CPBA 4DREA 5JW6A 1CEQA 1I3KA 3A9WA 2AE2A 3WR5A 1ZK1A 1PJSA 1Z73A 4UEJA 5CDSA 1EQ2A 1YOVA 1DC6A 4TRNA 4Z9XA 3ZWOA 5HWSA 5KVCA 3U5TA 3H9UA 4WECA 2DBQA 5BSGA 3WGHA 3OJOA 3RUIA 5JYEA 3OJLA 3NJ4A 4KUGA 4FPXA 1A4IA 3AUSA 1QG6A 1UP7A 1X7HA 3L4BA 4FW8A 4D42A 1ENZA 4JIGA 4PLCA 1T26A 2HU2A 2NU7A 4XJSA 2X9GA 3S2IA 1Q7GA 1YKFA 1EFKA 4DRYA 2B4RO 2BLLA 1GZ3A 2HJSA 3A14A 1T2DA 4QEDA 1H93A 1N2SA 1SOVA 3NKLA 3K96A 4GL4A 2OXIA 4BMVA 1E6UA 5HA5A 2EGHA 2EWMA 4KMSA 4Z9YA 1NQ5A 4YRBA 1NTOA 3F5QA 1U2GA 4IS2A 4D0SA 3WMXA 3DZIA 1ULUA 3FNHA 1CF2O 2Z1NA 4M54A 3OH8A 4O59O 3SXPA 3BTOA 4B7XA 2BHLA 4IDCA 1EE9A 1YB4A 1EQUA 1W6UA 2FR8A 3JQ6A 5L4LA 3PK0A 4R54A 5AXDA 3AK4A 1BWSA 1ZJYA 4EJMA 2EHDA 5EJ2A 1MA0A 4KWHA 1DC4A 5JCXA 3GT0A 2VUTA 1OC2A 5H82A 4JBGA 2VWQA 5C3MA 2P68A 3GMDA 3G0OA 1QYXA 1ZK3A 3B1FA 4DL9A 3WFJA 4ZICA 4J9UE 1MV8A 2E82A 1PJCA 1W0CA 4RORA 1FMCA 4WCFB 1UZMA 1B2LA 3NX4A 4XX0A 1KERA 4OO3A 4OMUA 1B0AA 1DPGA 4L4XA 5EESA 4BUCA 4PVCA 4DQVA 5JSFA 5EPOA 3RWBA 1IHYA 3KETA 1XCBA 3STHA 1R0SA 4WK6A 1DFHA 3H3FA 1QYWA 4A2CA 2VZ0A 5IDYA 5F5NA 4CMJA 3RFTA 1OAAA 4UULA 3ICPA 1LRJA 2CDCA 2GPTA
chains in the Genus database with same CATH superfamily
1XTTA 1T5DX 1WKVA 3PPIA 4YLEA 4OL9A 2YY6A 2VWPA 2P7HA 3UHJA 3UAWA 2BGGA 4HNQA 1K75A 1JEOA 1RYZA 2O0KA 4XB2A 1XCLA 1U2GC 4I1PA 3ZGZA 3OOHA 1KRWA 2ZJ0A 1L5SA 1BO6A 1B2RA 2VS1A 4MARA 4IP0A 3AM4A 1C80A 1UBJS 2XE8A 5GIOE 1G21E 3AKZA 3IAEA 2G1KA 2WD9A 3PXCX 4NP6A 5CT5A 5D2CA 1VECA 2ZRAA 2YWCA 4EMBA 3VO9A 1PDOA 3RJ9A 1VL0A 4YCJA 1LDEA 2YMMA 1OLXA 1FFYA 2V1XA 3ZZMA 4ZEOA 2IHJA 4HLUA 4PAWA 3FOWA 5IYZA 1B73A 1YUMA 1XAGA 2AJCA 4TLAA 2PV0A 1L7EA 2X8JB 3BH0A 1QBKC 5CLQA 3VRHA 1E3MA 5AHOA 1WCWA 4BFZA 3IRUA 1U8XX 1OXSC 1WQ1R 3U4IA 2GB4A 2YHIB 5IYZB 2OSBA 2ZYVX 1YIOA 2FE1A 2G7MC 2PS3A 2ORYA 4U02A 4RBNA 2HHLA 2YZ2A 5KQPA 1TRKA 1YS9A 2SBTA 4H60A 3U5ZB 1QQBA 2R85A 3BFXA 4BKOA 1SUFA 4JLBA 3HVIA 4HEJA 2NZYA 3AY3A 3HJNA 4EHIA 2VH5R 1W5EA 2VBIA 2OC4A 4GX0A 4HPJB 5I4KA 1THTA 4PLGA 5EL0A 4O4JA 3W6OA 3BT7A 4GRDA 3LZCA 3W3AD 3P94A 2V3WA 4H18A 3S5JA 1R3UA 4F4JA 5MF6A 2VWHA 2BFFB 4MQFA 3EC2A 1USVA 2I4LA 4NNJA 2C42A 3BKXA 3RRYA 1YB2A 2WTUA 4G23A 4BO2A 3WK6A 5JPDA 3EQ9A 2DHCA 4D43A 3AHEA 2B2NA 5AKKA 1CQJA 3IFSA 4NMMA 3RC8A 3Q3CA 2FW0A 5ALMA 1STOA 4KDFA 3IP3A 1EFLA 2I2CA 3PEUA 3MMNA 4XARA 3OP4A 2VAPA 2G9RA 1HDGO 3C6XA 3FUVA 1RRCA 3E9ZA 4DCUA 1WMSA 2FZ5A 3M6FA 3MWEB 2XUGA 1D8TA 3MLBA 4J43A 4EHHA 3ELUA 1JH8A 3OTHA 5I7RA 4MUNA 1D2NA 1ZUNA 5KREA 4F2GA 1QRDA 1GR0A 2C1EA 2R6CA 3G8YA 2WWIA 3CYFA 4HMPA 4IW3B 4Q34A 2JBAB 3ILHA 2QRZA 4CKYA 3DKKA 2JLZA 3T5GA 3JWIA 1I4EB 1Z2AA 1ZRHA 2P4UA 4JH0A 4P08A 3KZOA 1O08A 4GQBA 4R1QA 3F71A 5DI3A 2VDVE 3KJGA 4D8YA 3KOWA 4BFXA 4BNYA 1DDIA 4NS4A 5J2UF 5KYXA 3ZBPA 1KYQA 5CT4A 3FTCA 1IRIA 3AVPA 3SKVA 1DT3A 3OPMA 2WE8A 1E3IA 4JT4A 2QX4A 2XPCA 2OC9A 3ENZA 1Z25A 4D7AA 2AFIE 3WP0A 4ZAGA 3MHPA 4XM2A 3E23A 5MFZA 1UP6A 2D5BA 2P9YA 3KAKA 3PC8C 1E9VA 3ADPA 3KPUA 3MCAA 5BY2A 1TK9A 1UQRA 2F1IA 4NY1A 3TAXA 3ADDA 1L3CA 2JGIA 3T0GA 5J4KA 1WXQA 1P8AA 1YQ9A 2VDRB 1PV2A 2HOQA 3QI7A 1RLUA 1V96A 2C04A 2SICE 4N4AA 2C7RA 1Z18A 1C9EA 3QG1A 5AJYA 2C4WA 4MA4A 4MVXA 3IT2A 1V7CA 1KKUA 4ESEA 2XCTB 1BCSB 1YR3A 3DO6A 4ZREA 1ZX1A 3WRXA 4LJ9A 1SKAA 2XNDA 1FFDA 4MICA 5BSTA 3W78A 4C4YA 4KQ6A 5C9ZA 2Z3ZA 2QSUA 2YV5A 4DM4A 1WMAA 3EB9A 4EKIA 4MTCA 5D01A 5IXYA 3L7KA 5ARDA 1BRTA 1TA4A 2V7PA 3GJ4A 3PHJA 4YIHA 1G8GA 1G7RA 1DNPA 2FMHA 4JP1A 5A9SA 5KNDD 1Z4PX 2JJ2A 5JZMA 3ZL9A 1URPA 1IVNA 3NC4A 3RU7A 5K0BA 1F8YA 2H11A 2PX6A 5EVJA 2O59A 4ZV4A 2IC5A 5D87A 4I55B 3SSMA 1DINA 1GPMA 2O3SA 2OKCA 2XI4A 2ZJ3A 3FWHA 4XAQA 1HDRA 5G1PA 2EATA 1CP3A 2AC4A 2HSDA 3EG9A 4S05A 1R6VA 3O26A 1U3WA 3V7NA 2H54A 1X1EA 1ZC3A 3HNOA 4M0FA 5DHSA 3OQOA 1Z63A 2W6JA 1BQ3A 4HR7A 4P7KA 2J1LA 5KHOC 4G5XA 2H9IA 4IJWA 3K8YA 4J7CA 3CRW1 2WJ3A 2YWEA 4KNYA 1MO6A 4I1OA 5LR6A 4JITA 1IUOA 2X5XA 2A9KA 5HOQA 2BFPA 3RG2A 1N7GA 4OYYA 3SHQA 3W05A 3RI3A 2CXHA 5A05A 1SCAA 3HB9A 1NXQA 3ZD8A 3FPFA 3TE7A 4BQSA 4PG6A 4A6EA 2DC1A 3PC3A 1J0EA 1W2GA 3LYUA 3WYCA 1QG4A 1TUEA 4C3UA 2CJYA 3C3BA 3CW9A 3DOEA 1JEAA 1UFOA 3A9RA 3LCMA 5C0OE 4B3RB 1QH9A 2CXNA 3G0GA 8ABPA 1RPJA 1DKMA 4LYHA 3V1YA 3W9SA 4F6CA 3RSCA 4ZVMA 3AEQB 5B3LA 2GZ1A 2CXSA 3H84A 3IV6A 3DAPA 5JE8A 3U3XA 3CR8A 3FSGD 2VUIB 4B8WA 2B8EA 4GI7A 2I4TA 3U0BA 3JYOA 4RYLA 5F7OA 5ENVA 2GZAA 4OQXA 3OJFA 4KDRA 4DIKA 5EHZA 1FP4A 2O3JA 4P4NA 4AG3A 3JQQA 3DBRA 4LSZA 2EGGA 4PF1A 1FFEA 1CVRA 2DBVO 3B51X 3IQIX 1S1MA 1HYGA 3QFRA 5FTKA 2SKDA 2ZREA 1I1OA 4FGSA 5IMBA 3S2YA 3PWZA 2PAFA 1LZKA 1LWNA 1JR2A 1XELA 1RQRA 2ROQA 3HCBA 2R8RA 1LH0A 2X9NA 3IT3A 3OTQA 4OIFA 3U48A 2WF6A 3OE4A 1VZ3A 3UV6A 4IOJA 1ENPA 3HA7A 3HBFA 4LV6A 2YIDA 4WLVA 3C15C 3MPUA 1H1LA 3HA3A 1U28A 3IQZA 4LBYA 5JZOA 2PUEA 4UUOA 5JZ9A 1G9TA 1WTAA 2PQMA 3MNFA 4MLZA 3U7FB 2WYWA 1IH8A 3QX9A 3DLHA 1MG0A 1E1MA 1PYDA 2X1MA 3KQSA 1GL7A 2F3SA 3QMWA 4AK9A 3CUVA 1YDWA 1SKMA 4OB7A 3GFFA 4MUBA 1N6LA 1DTSA 4IIHA 1OKKA 1N2ZA 2YXEA 4ZI3A 5D00A 3FMVA 4Q3OA 1XK6A 4KH0A 2PL3A 3ZHUA 3P20A 4DCOA 1UWCA 3H8SA 3EVBA 2RC5A 4G8CA 3O8DA 3ICOA 2Q1WA 2NZWA 4NABA 3GQBB 4TVSA 4RTJA 1RAGA 5E9AA 1LBQA 3NBMA 4RS4A 4FXOA 1MHPA 4ZA2A 4AJOA 5HQ3B 3WIVA 1L5QA 2XOKD 3ABQB 5KNCH 2VPZA 2BGKA 3K94A 3E9RA 4KQ9A 3SF8A 3GA5A 4FZJA 1QF6A 4BLQA 2R97A 4EY3A 1E59A 2WYIA 1DBVO 1M1NA 4RH3A 1XQ1A 2N3ZA 5CCDA 3THYB 2BBOA 1IHDA 4Y9SA 1WWKA 5FKJA 5M5BA 2W42A 1PTJC 3GD5A 2BGJA 1DG9A 5TPZA 5DK4A 4DQLA 1NBAA 2PXAA 5EXPA 3R4VA 3SR0A 4MVJF 2NIPA 3GT4A 4Y9RA 3GXBA 1FNDA 1U65A 4YP7A 3IVMA 4DVJA 1UZAA 5FOQA 4MI1A 1QC5B 2G3YA 3URKA 5EJMA 3I6ZA 1W5BA 2FR0A 5B4VA 5DGCA 4KDCA 3KPJA 4MR9B 1JHPA 2IS4A 1UODA 2FI1A 2ZB2A 3C7KA 1SKYE 2VKQA 3P0IA 4G4GA 3WL7A 4CLOA 4PPNA 4AMVA 1RXYA 1Z8HA 4ZO4A 5BNFA 3MMPA 4JXZA 4B9AA 4TTQA 4LYFA 1M76A 1N6OA 2IYQA 1EA5A 1OREA 1EGQA 1UBMS 2PD4A 3VR2A 5DSXA 4NOKA 1OXKB 5J47A 4TTIA 5E3IA 1JQBA 2QTZA 4Q3KA 5CYPA 3UPTA 3KQUA 5KCMA 1IB6A 2I87A 3BE8A 1Y1TA 3HJGA 3UGTA 2IXDA 4UNQA 1NBEA 1UXOA 4P5EA 4REQA 1YCHA 4A4DA 1ACLA 2VT2A 3HJBA 3P0EA 2YQ4A 4JFAA 1ZJWA 2AC2A 5I7UA 2AYXA 4FE7A 4AROA 2WSBA 3IJPA 1E6KA 5G0UA 3TRFA 1MH1A 2XVMA 3S2FA 2CL6X 4GD3Q 4S12A 4TT3D 1V16B 4ZI7F 3HXPA 2WJ4A 5FBZA 1PZGA 3UZUA 2JGDA 2NU9A 5ITWA 4KR9A 1SXJD 1TB4A 3O0TA 1H9AA 4R8LA 4UBMA 1A7AA 2CVQA 2LD4A 3GUYA 4LV5B 4QDJA 4FUQA 4XFDA 4ZQFA 5K51A 1RRPA 3BZUA 4G81A 2JGDB 5G3YA 4JC8A 1Q7RA 4EEXA 2WIAA 4FNMA 3T41A 2ZWAA 2XUAA 3ZDZB 3EOAI 3EZGA 3CIOA 4CBVA 1Y9JA 2VRCA 2GH1A 3N8KA 1NPTO 1R8XA 2JBWA 3CIFA 3KQPA 5GZ1A 1OGYA 5ANRB 4BFYA 5GZ3A 4PC3A 3F1LA 4POAA 1Z4IA 3BWDD 3GI1A 2XUPA 2IYOA 3DVAB 3G5TA 3KOUA 4O2BB 3U4CA 5FDFA 1KOLA 4BIIA 1L5HA 3W2IA 1EB9A 2JDID 1KJ8A 3HR8A 4MH0R 4N3CA 1WNTA 1CJTC 1PZHA 1Z0AA 2BW0A 2XQIA 3S2SA 1VDMA 1U31A 4BVGA 3U80A 5BN4A 2GPWA 4KZKA 2HIMA 2WWWA 2DUMA 3QE0A 5FYDA 2PUFA 1Q1ZA 1IN8A 3IP6A 3L8GA 3LPCA 1I7QB 3EY4A 2IYTA 2IEZA 2OG1A 1RMTA 2AQHA 2OMKA 4NOLA 8LDHA 3JQ7A 1QANA 1E3WB 5F2EA 3G2JA 1WDKA 2BI7A 1ZUD1 3KYDB 4QOIA 5B3KA 5BN1A 1ODIA 2W8BA 1DQNA 4KOEC 3P0HA 1RYNA 3IEKA 4PZYA 1HZZA 2ZYRA 3A0UA 5E4TA 4KX3A 3ZLJA 2MINA 2NV2B 2JL1A 3TGWA 3IIEA 3C97A 3WLSA 3LHDA 1KXZA 1J2YA 3QLJA 4MNTA 5FWAA 1PJAA 3OJXA 3IALA 3DQZA 2XZOA 5GJCA 1DRJA 1ORHA 1WS6A 3IAS6 3UOWA 3HGMA 4LTDA 1Q44A 4NBNA 3O3OB 5CGQB 4QVIA 2NTNA 2WC1A 3WZMA 3C43A 1K6JA 4N0PA 5KX5B 3ZDDA 1DAMA 1KXJA 4MYCA 1RE0A 3N8DA 5CM2Z 4YJ3B 4D3DA 3ZTTA 5AM1A 4BLOA 1DBQA 1IWOA 4QQFA 1JXAA 4DLAA 1TW3A 4UTVA 5KNBH 3UGQA 1H8HA 3MEQA 3H8VA 4U1RA 3TVDA 1VPEA 3LQRA 1W9HA 1Z39A 2PBLA 3FFTA 4WUTA 4V1CI 4YDQA 4V0RA 2PFKA 2EJTA 1P3Y1 1RJWA 2ZM5A 1H1DA 4B3XA 4YV2A 2B4KA 1B6GA 4Q12A 4N5HX 2DKNA 2WFLA 4V1CA 4LE0A 4JLVA 1YR6A 4WXYB 1JG3A 4AJHA 3PXBA 3BCSA 4D2IA 1Z5OA 5BR1A 1KC3A 2CVOA 2VQDA 3GRKA 3KQHA 2YMLA 4FCCA 2WMNB 2NTYC 4KR3A 2ZG6A 1QYVA 3J7TA 3R23A 5GZ6A 3K5WA 4TN1A 3IAXA 4HS9A 3FOBA 1Y3BE 4WNIA 4P4UA 1E6LA 4TZ6A 1L8XA 4R41A 3IAM1 5CNKA 1X80B 5TT0A 1UC9A 1B8NA 1T3HA 5IDWA 1XA3A 1LRKA 1N5KA 4JB2A 1JHQA 4LZWA 3TCNA 2J3MA 5BR4A 3R7LA 3HEMA 3WNCA 1GV0A 2HSEA 4NEGA 3X1DA 1QDEA 2VPYA 2V58A 5J40A 2CFSA 1EP1B 4RXMA 4CMKA 4F45A 2IHVA 1FFGA 2IRWA 4KYVA 2QRVB 5DE3A 3PUZA 1IUPA 3KKKA 5K45A 1IATA 2LUOA 4DLUA 5LQAA 1PUIA 3WDSA 2W2QA 1QOPB 3LHFA 4RLQA 4JWKA 1P29A 1EJBA 3D6FA 1C0KA 1UT5A 2FP4A 2PJDA 4DJ5X 2WTNA 3ZWNA 2OQRA 3GPIA 2JFHA 2PBRA 4HNHA 3QQPA 1E64A 3KTDA 4DNFA 4P3KA 2BGUA 3OZFA 2YIVX 4OXRA 2CFRA 3PIDA 4XCXA 2OVBA 3AOEA 2FR1A 3QVTA 2FB9A 5BWOA 4DTCA 4OAOA 3PTAA 3ZG6A 2VA8A 5JADA 5EMHA 4I4LA 4QAQA 3C1AA 4FYMA 3KSMA 1NF3A 2LVBA 2P9FA 3A4LA 5L40A 4ZO6A 4M46A 5KTTA 1LX6A 2OM6A 4E2ZA 4YGXB 4WLOA 2QAIA 3SQOA 5HIAA 4OCZA 4PPGA 1ZINA 3H2SA 4LOJA 5DISB 3ANMA 5LZ7A 4EPRA 1K4YA 4M7OA 4N7MA 3LCJA 4FSXA 2AWNA 3ZE9A 2J45A 4Z54A 4DR2B 4NJMB 3ZDYB 2JFVA 3GZTB 2RB4A 5DM0A 4L6CA 3UAXA 5EKXA 4Q03A 4AQYB 1MGOA 1Y4SA 3NHZA 3AT1A 5HPYB 4D74A 3HA5A 3ABOB 3MTQA 3PPWA 1RKQA 1SQGA 4RTOA 1U2TA 2J46A 3UWSA 3KM0A 5AMXA 4LKOA 1OX6A 5DHPA 2ODAA 2IFTA 2EU8A 4NG5A 1NMSA 1UXGA 1EHIA 1F51E 3IPRA 3PUYA 3QEKA 5AVTA 1FJGB 2V74B 1M6EX 1AN0A 4OYRA 3WIBA 3EZ9A 3E9QA 1AD2A 1JF8A 1P0FA 4J07A 4MJ3A 4TUYB 4LBVA 2INGX 2GHRA 4K1LA 3ZBTA 2HNAA 3ZU4A 1JT9A 1SCQA 2O8FA 4U7JA 4MS3B 1YV9A 3SVZA 5JCOC 1Z0UA 5EZYF 5IJ0A 1MC1A 1NMXA 2GO1A 3G49A 4TMYA 5C8DA 4FZRA 4BJ6A 2QRJA 4C76A 3D7RA 4XI9A 1G41A 2WW8A 3A1VA 1X7DA 1L5VA 4HRYA 4K05A 1GCUA 2PDAA 4K86A 3AESB 1KI6A 3LDAA 3LFTA 3O8CA 4MINA 1XDUA 5ADVA 3OLQA 4CCAA 1IU9A 1HEUA 1HUQA 2Y71A 5J4LA 3C0KA 4GRIA 1MRNA 4QQNA 1NONA 3LIIA 2ZUTA 2BGTA 3KKNA 2IP2A 3ENKA 5FV7A 3ES9A 2XXBA 1O0BA 2F3TA 2CD9A 3HUDA 5FNVA 4UM9B 3GROA 1SHUX 1V35A 3T3PB 1F6BA 2CMDA 3IL2A 4BN5A 4IQ8A 1XDSA 2O3UA 1JAZA 3L8EA 1Z13A 1IQRA 1RLJA 2Z5GA 3ELDA 3HN6A 4IZHA 5FO0A 5JNVA 1T0JB 2I1QA 1NVTA 1SCIA 2O0MA 1OU0A 2RGAA 2VF8A 3BN3A 3QPBA 1GO2A 2PD6A 5JAIA 4DCPA 3HCWA 5A03A 2FW9A 3OEHA 3QKSA 3BK1A 2YN2A 4U9HS 2RKBA 2AZDA 4Q05A 5JH7A 1JALA 2R0QC 3C74A 4Y9DA 5IBRA 4MV7A 4IUYA 1R3DA 3T4UA 1IXZA 1XZ8A 2DWCA 2ZANA 3ACCA 2MYPA 3M1AA 3H11A 3WMEA 4RKEA 4DDWA 3F3SA 2KQUA 1T8UA 5ECDA 3UKJA 4BFWA 1SRQA 1W59A 4OB6A 1LSSA 2WJGA 2JLRA 3N8GA 1C3OB 4KFSA 5F7XA 4RD3A 4QG3A 1SM4A 1MRZA 3WOHA 1YNSA 3RYHB 3SC6A 1BMFA 3BHNA 4GXRA 2A9PA 4YP0A 1I5RA 1ES9A 4C0BA 5KWVA 4L9SA 2ZUSA 4ZALA 1NMQA 4F9TA 2W2TA 2Q9AA 4KQWA 1TADA 4QAJA 2C5FA 4YI3A 1RBZA 3AKCA 1F8FA 1R9NA 1OI3A 1S7GA 2A86A 2ESRA 3FCXA 3MILA 2AJDA 2XNJA 4G2NA 2BF7A 2R9VA 2WUVA 1NQXA 1YZVA 4HJRA 3LBYA 4J0QA 5GQSA 5MGNA 5SYNA 3N59A 3M6XA 1SBQA 5LUAA 1OXTA 1O95D 3QVWA 2RE8A 5U1PA 1UBFA 2XRZA 2GXUA 3PQEA 3OI7A 2FDRA 2Y0PA 3MRVA 2Q3CA 2RHDA 4DQUA 5BUZA 3AF1A 2JCVA 2ECFA 4I5GA 1A98A 1HT1E 3KC2A 4HHEA 2OK8A 4GMXA 3IVAA 1THGA 4LNUA 3ZGYA 2B7LA 4ZYXA 4CQMA 1TJPB 3T3GA 2HQRA 3RUCA 5LZ2A 3EXHC 3ESXA 4IEIA 4II2A 4HAOA 1XV5A 4I19A 4LXXA 3FIUA 1W85B 4FX2A 5JSZB 4NLLA 4DBVO 2D54A 1Z15A 3INTA 1WZEA 4CQMB 1F2VA 4CL8A 3AQ4A 1II8A 5ALNA 5C5IA 1KS9A 4FFLA 1QK3A 1N9ZA 3HCFA 4JK3A 3A06A 3RW9A 3CLSC 1E5TA 3L82B 1XN1A 1GN8A 3KBOA 1BU5A 1Z4KA 3K53A 4WNAB 4ALMA 4B2IA 4EFNA 1HMYA 4XX0B 3T1YB 5EXEA 1BFUA 1FBNA 5BQOA 3U37A 2XJ9A 4XJVA 1IJFA 4R0MA 4PXAA 5DEOA 4D9IA 2Q2NA 1X1AA 2FP3A 2GBGA 2NAFA 1AUXA 3EXIA 4WFKA 1N2XA 4BMYA 4D0GA 2O8DA 1ODTC 1N3YA 1U5BB 2OQIA 3QF4B 4PZ0A 1GP2A 4HAYA 2ZAYA 4W5RA 3DO8A 3UK1A 2G4LA 3LT5A 1THMA 3S7ZA 2XCSB 2ZVQX 1NBME 1NF8A 2XTNA 5CX1A 2PPVA 1EDBA 2Q3FA 1MUUA 1R0CA 3FB4A 2O48X 5COAA 1H2HA 4LHSA 4ZP1A 2OZEA 3K1YA 3R9KA 1KVSA 1AKMA 4QUAA 1QSGA 4UM7A 2PTGA 4K6KA 1EAYA 4MPJA 2I6SA 2Y05A 2Y1GA 3NXKA 4ZCIA 1EBFA 3FSRA 3OPXA 4M0MA 3V1KA 1W96A 2KYRA 3D5TA 3JQFA 1Y8RA 3V33A 5TLSA 5TQ0A 1Q2XA 3OE7D 4N01A 1T9ZA 5AJXA 3PXGA 2JCGA 1RXCA 4FE4A 5FNZA 1XN4A 3P9QA 3ZQJA 1ICIA 1N2BA 3DUFB 2R62A 2H00A 2XUKA 3R9IA 3WQBA 3ONEA 3GOHA 4NMHA 4AX8A 2J5QA 3PU6A 1FDOA 1X1SA 1K2VN 3AETA 4DR6B 1B6SA 3HCRA 1NI3A 1PKXA 5GGXA 3UJ9A 4KE7A 4M0KA 2XAAA 3JQGA 1V8BA 3W3AA 4UU7A 3EIOA 4QUIA 4DSZA 3PX7A 5F3RA 3IKTA 4Z4QA 4N8SA 3T95A 2JGFA 2NYRA 4MVYA 4NHEA 2QD3A 4BX9A 3D3KA 1KZ1A 1N2JA 1TLTA 2FFQA 1X1CA 2OBBA 1JFSA 3VJRA 3MGKA 3UT5A 1CQWA 4PPQA 2CYCA 5J63A 4YJ2A 1X0XA 4Y6RA 1QAQA 4TMZA 3E15A 4QKQA 5HJ2A 5BNIA 2IZZA 2LCIA 4ITRC 5EUQB 3K0AA 2F3RA 1NN1A 3B9QA 4OXQA 3UT5B 4GLOA 2EFCB 2JASA 2G9VA 4JLDA 4R83A 4UKDA 2SNIE 3ET4A 2EOAA 1EM8B 1MQ8B 1Z8FA 2EP7A 2QJTA 1AUOA 5EE1A 3LM8A 1HYQA 4QPNA 4AZ3A 1KPIA 4R9SA 1TC2A 2OESA 3AZOA 3LSYA 1WW3A 2C3YA 2FZWA 3CX4A 3VR5H 2AXEA 2BFOA 2HZ7A 4E5MA 2WAAA 3DULA 2XUZA 4RTRA 5KO2A 4QO7A 2YJ6A 3QNWA 3DS8A 1G2IA 4DRZA 2GNOA 2H92A 1G2PA 2A57A 3NATA 4WMLA 4MI9A 1QF7A 2B0CA 2G77B 5ADHA 3PZBA 1TYDE 2Y99A 1QHGA 2I5PO 2IELA 2ZFUA 4H3HB 5AKXA 4JI5B 4KR7A 3VR3D 1DRVA 4M0PA 2FEPA 2J32A 5FFFA 4OLBA 1GZUA 1JSLA 4D56A 2IIVA 1JJ7A 1E7SA 3GDOA 3NNSA 5I3CA 3F73A 3HGTA 2N42A 3D5QA 4WTOA 5E7MA 3B3FA 4XVCA 3GLHE 3NHYA 1U8UA 2PGXA 2W58A 1ODLA 2OP1A 3F6CA 4KRGA 4QDUA 5KPDA 5ERXA 1JR3D 4PG4A 3EVGA 3O8BA 1GUYA 4WKPA 1OASA 3T15A 2R6HA 3C4QA 1WXWA 4D79A 5L95A 2J31A 2O2SA 5FQNA 4DR7B 4I3HA 4TQ9A 4CCYB 4K2HA 5CLGA 1AKRA 2PFSA 3N2GB 4FT2A 5FR1A 4GOJA 4NJEA 5T41A 5C7YA 2GAFA 4KXYA 9GPBA 1FPQA 2I4NA 1MJ5A 4R1LA 1SELA 2GJSA 3LOPA 1R0RE 3NUZA 3W5VA 4J0EA 3M3HA 4A5OA 5ABPA 1B3BA 1TJYA 1U1DA 1WB6A 1R8SA 4UJ3A 3VSCA 1W36B 2C83A 3CY6A 2XADA 4NHOA 1SEVA 1YC2A 1E0KA 4XYEA 3S6JA 3EXG1 1GTMA 3ACBA 1THZA 1KQ3A 1LJ8A 1Z9BA 1EP9A 1W25A 1KA9H 5JDIA 1F2UA 2JB9A 3KZXA 3MWJA 5IWAB 4MRNA 4X97A 1NOJA 4CIBA 2M1XA 3F9RA 1AKQA 1EFCA 5EP4A 1GG5A 3H1EA 1X7WB 3I04M 3PFKA 1O6CA 4OGWA 1Q3TA 5AI0A 4B46A 4FQ8A 4CT4B 3RU3A 3FZEA 4KVAA 3WLQA 5C80A 1EFVB 1Q1AA 3ZS9A 2QD4A 2HQBA 3DBHB 4AMBA 1E96A 1JMVA 4L15A 1F60A 4P98A 5CITA 4RENA 4XWWA 4HFNA 1W8IA 5TSDA 1Z5UA 4YVFA 1DTWB 2H52A 4B4VA 3UWOA 5JWRA 2OZLA 1SVNA 2ZWPA 5SY4A 3SDZA 1REQA 4EAQA 1HQCA 3Q1LA 4WT7A 5ADUS 5JXGA 3OOJA 2ZJYA 2C98A 1MPXA 2HBQA 4Q7JB 3CNBA 2HQ1A 3SKXA 3C5VA 2PUDA 4CEJB 3U3KA 4EA6A 1RWOA 1E4VA 4RACA 1F4VA 3KT8A 3ENQA 4PFKA 1UXJA 1ZJ4A 1SC1A 4JOQA 4RGBA 3KWLA 1LFAA 3O4RA 3R77A 3H17A 4KHPB 5IT9A 5LBTA 1P1FA 1ZZEA 2E3JA 1A5SB 1SGWA 3PNPA 4X24A 5FWYB 2IZOA 4CMHA 3S2EA 4OI4A 4ZIRA 1ZISA 5LDDC 2A0FA 2OFOA 4EVQA 3RRNA 2ANBA 2GHTA 2LRHA 4JASB 1ZSVA 3Q8LA 2B4YA 3ZJYA 1P2SA 2AYZA 4KO4S 1HLDA 4MUIA 2O7SA 4CKBA 4DRXB 1NURA 4V3CA 1OBFO 4AY3A 2WQ7A 1WA5A 3RVPA 1I33A 2KWIA 3I1FA 5EE0A 4RJIA 4KVFA 1AQIA 1UK9A 4DV2B 2AXPA 1KEWA 1UOOA 2YNMC 3LXMA 3G2NA 3PT9A 3ZY4A 3VZRA 1JJFA 3VI3B 4YEDA 1SFRA 4D99A 3A25A 3O91A 2FDXA 3B60A 3TLGB 4EYEA 2VPWA 4UTNA 1XMOB 1N6RA 1Z34A 1Z2CA 2UUPA 5D7NA 2OPHA 4I66A 5CDHA 4LK2A 4XIGS 4Q3EA 5IVHA 2I7XA 1FY2A 3MJTA 4J6EA 5LZ5A 5HIIA 4F6RA 4N54A 1W87A 2FSVC 4RH0A 5EGNA 4XD2A 1GZ6A 3R44A 4Z0TA 1KY2A 3L41A 1S3FA 4DDMA 4GM0A 5FWDA 4EPWA 2YCLA 1RI2A 3DZDA 3GOQA 5AP9A 2JIOA 1YS1X 3DFFA 3FX2A 3H05A 2J08A 3HVHA 1TEXA 3QP9A 3U4DA 4WY5A 1JDVA 5CFLA 4BRSA 1QGUA 3NEAA 1AVTA 1PNQA 4MVJI 1S8AA 2J41A 3ULKA 3VTFA 3ZY5A 3CS3A 2VA9A 1F4LA 5PGMA 3STXA 1VE3A 1BXGB 2DETA 1T8YA 2I29A 5HBRA 2EZTA 1Y98A 3PHGA 2XOKA 2I6QA 4CTNA 1GQSA 3FMGA 4IH9A 4B09A 2AFRA 2C94A 3G79A 1RJ9B 4P34A 2R1VA 1NVMB 5KVQA 3DD5A 3PFFA 1BE6A 2XDQB 2DHQA 1N2CA 2LWIA 5CLLA 1GKYA 1O87A 1Y5NA 1IBKB 3HWX1 2WZQA 2A9OA 3K7EA 5JZBA 4RTMA 2DPGA 2IHYA 3FWNA 4LCJA 4Z9BA 1BMTA 4AJEA 1E58A 1V3TA 2F7SA 4PSKA 5SYAA 2O8EB 1KEZA 2F9LA 3I42A 2JAWA 4MKRA 4RJLA 5A0FA 1N3BA 2HIAA 4CI0B 2YXNA 3F6SA 3ZWPA 3ED1A 2ZJ7A 3B1YA 2ZRPA 4TS3A 3A0RB 3ZCRA 2BZGA 1FLAA 2PSDA 5JMOA 1Z4JA 1MOQA 1KU0A 1MO4A 3NJRA 1FF9A 1T15A 2JD1A 2OFPA 3M4JA 3MQ2A 4FP9A 1MVOA 2I22A 5AIAA 1I2BA 2NVBA 5HTKA 1U63A 4R05A 1VGVA 1GGHA 1BRMA 1Z5WA 3AX6A 1U9IA 3BWCA 2W9XA 3CRNA 1KFCB 2NSJA 4YBZA 4YTEA 1LPBB 2C9MA 1KDVA 3T38A 3E03A 3KQLA 4X61A 4ZOCA 2ZE8A 4IIBA 5F76A 1EK0A 2B6NA 3OQVA 4U2GA 2N75A 4FYVA 4IOLA 4D9HA 4YQYA 5EXSA 1PEKE 3HADA 4Y6OA 4PRYA 1IXRC 3I2HA 2YVAA 2HC9A 4OBBA 2WWXA 5HS6A 4AYWA 1BHO1 2I6TA 4M99A 1LS1A 1OXBB 1QFMA 1GPKA 1RC0A 3ND8A 3OQIA 1CUXA 1J0AA 3LWBA 3O83A 4K6MA 3F3MA 4Q21A 6REQA 4FMCF 3B6IA 1SIWA 4GWGA 2ZIAA 3G82C 4EF6A 4N8EA 5KTYA 1KEKA 1SXJA 4XPIA 5G53C 3SEAA 1EIZA 4JJ7A 1ZJ6A 1KJJA 5E95A 4F5YA 3GFBA 2Q28A 4QOFA 4TVOA 1TYAE 3KT6A 3C1TA 1WXHA 2DHDA 4PAGA 2QI9F 3KYCA 5DXFA 2HPHA 4KO3S 2NU8B 1NOIA 1UK8A 2YZ7A 3F5FA 5F1PA 1KEVA 2JI8A 2RMKA 2V6FA 2Z2YA 3AF5A 4IQ0A 3CNQS 4G0PA 4AKHA 1NVKA 4GR9A 2YMQA 4ROTA 1GQ2A 1T0IA 3WLKX 1AK9A 2V8OA 2JDIA 2DUJA 4BEBA 5BNTA 1OBHA 3ND5A 1G6OA 2ZJ4A 3S1AB 2DR3A 4L28A 3DE2X 4P86A 4TYNA 4WW0A 3DPSA 4GT1A 1M2WA 5CLHA 4LJ7A 2J5RA 2P8JA 3U0VA 3VDRA 3AMVA 4PNPA 3LYAA 4G6ZA 2JLSA 1QHEA 1RMYA 2IV2X 1OXVA 1L7VC 2G0TA 2UYQA 4FFMA 3GDHA 3I6MA 1B42A 2QE6A 4LZJA 1I6WA 5CU7A 4B3MB 1DO0A 3WZLA 3WJ7A 5E3JA 1JYEA 5KJ6A 1N5RA 2CNNA 4DZZA 1GTSA 5DYNA 3K70D 1O3YA 3A6KA 4Y2QA 3DE5X 1U6IA 3WK9A 5B1EA 3DLPX 4LC9A 4BRUA 3VX4A 2P9GA 3CISA 5CT8A 1G5TA 1UBEA 1GA1A 2G07A 3ZEAA 2ZE6A 5G4KA 3RT7A 3TOZA 3WIUA 3LLCA 2EYUA 5DTRA 5LDHA 3CF4A 1DQYA 4RJKA 4LF4B 2AOUB 3BIFA 4NCIA 4FC7A 5JCZA 1PKEA 1JA9A 3JWEA 4GW3A 3ONVA 1ZCZA 1O96A 2WTMA 5G2OA 1WPRA 3X1KA 2B8TA 2LCFA 3U7IA 4C14A 3GB9A 4K6FA 2WT4A 3OBBA 3P1JA 1E1NA 4IGAA 1FYWA 5CW2A 4JNGA 1HOXA 2WMDA 1QV6A 4KSBA 2VTBB 3OTIA 3S8MA 5JLAA 1FCJA 5D5QA 1QVRA 3MBOA 3NIWA 1AO3A 4B2LA 3JU3A 1XWWA 3SEFA 1IMOA 2BEWA 1ZLXA 3R4CA 4PX3A 3P9RA 1MEOA 2H0QA 4R3NA 4PV7A 3AIIA 3BL5A 2XH8A 1VHLA 3HTXA 1Y7TA 5IKOA 3I5AA 4CKEA 3KKMA 2Q6VA 4F92B 2AZ4A 1NPYA 2QNIA 4XWYA 4OHXA 3D0KA 5DM2A 5C37A 2ZSJA 4PU0A 3QHAA 5U9CA 2ZM6B 2EKZA 3SQWA 5KYYB 5HRAA 2DWQA 3EEYA 3WGVA 1PTKA 3AP1A 3T06B 2BMWA 3W4IA 3U39A 3VR6A 4XOUA 4X3OA 3ER8A 4R16A 4L5YA 4MMXB 1KBOA 4R1OA 3FYUC 3TLEA 4OPMA 4S0XA 2LCQA 1LC0A 4NE7A 4CM4B 1QIHA 2RK3A 4YAKA 3F47A 1WZUA 4NFHA 4OQEA 4G3XA 1P74A 3E2PA 4H2DA 1GGKA 1XP5A 4EQ6B 3KR0A 1I5OA 1HDIA 2EJWA 2W0SA 3E7XA 2W22A 3H99A 2D2XA 3RSSA 4LMRA 3V3TA 3ZWVA 4HXEB 4ZT5A 2NWQA 3NBXX 3SEQA 4TTTS 5DASA 1KWKA 2E7ZA 4QQ8A 3PEFA 2G70A 4P2BA 3ZIAD 2OGZA 4U00A 4R1TA 2XZPA 5CXQA 4O3FA 3JW8A 3REQA 3CG4A 3HYRA 2OLKA 3EZLA 3HYTA 1Z82A 2HA3A 3LTEA 1GZHB 4GMKA 4O1HA 3COPA 5TGZA 3RVBA 2X4IA 1GHTA 2ZUBA 3OPVA 5HMLA 2YXPX 2ZRFA 3CZMA 2DFTA 4X7PA 1Y6QA 3K2IA 5IT4A 1HE4A 3K15A 2GAJA 2RHHA 4GX1A 4HOYA 3WGIA 3V4VB 2BKEA 5AKYA 3H86A 5EIAA 2GYWA 1NC1A 1QTRA 2ID9A 4FBLA 5KMGA 1OFUA 4JYPA 3VTKA 3ZCXA 2V1UA 4M0EA 1BVYF 2DH5A 4F2DA 5KB3A 3OU6A 3NYWA 4JS0A 4NVRA 3DTVD 2QQGA 5SICE 4DSAA 3UYKA 3NAQA 1KJ9A 4GLLA 1D1QA 3I53A 3PQ2A 2EFDB 2QLJA 1J24A 4MHOA 1Y3AA 3RRJA 2WNSA 5EZQA 5IPFA 5IASA 4DB2A 1EESA 3G9UA 3REOA 5DYWA 4NE2A 2GLXA 4DF3A 4F46A 4OI0A 1TQ6A 2D4AA 2ZLBA 4FHFA 2YZNA 1Z5NA 4N5MA 3WFZA 2FW7A 3ZD7A 2XB6A 3OCWA 3VPBA 3UJNA 4ZHQB 1R6XA 1E60A 3IP1A 3N7TA 4OU5A 4GI1A 4DWJA 4KP7A 2O8VA 1A82A 3TOCA 2C29D 4AWBA 2O6HA 2ZB8A 3KAPA 2OD2A 3BWBA 4MJXA 1K6IA 4GMFA 2C0PA 4CL0A 1QZ3A 1QDLB 4QJ5A 3IAM6 2QG6A 4I1YA 4BQQA 1OXMA 1C7FA 2DG2A 3L05A 5KAPA 4WNCA 4QYIB 3VU0A 1ZNWA 2FX2A 3UMGA 1E7RA 2PZJA 3F4LA 1P9LA 4L7VA 3ZWQA 1DTEA 4ZMSA 4EGSA 1CR0A 4MV9A 1O54A 5K09A 2BM8A 4L74A 5L7YA 4REOA 3WSWA 1MHTA 2C07A 2PFGA 3LX6A 1JEQB 2Q3HA 1FLVA 2DOKA 3OZXA 1N2HA 5DW3A 1KAHA 1DPFA 1TMOA 1CNFA 4KQIA 3HWRA 4MDHA 2DECA 2QD2A 4IDEA 5DRTA 1NAHA 2BTQB 1CERA 2HM7A 2NNWB 3MT9A 1N0HA 1PAUA 1Z33A 3R3JA 3OWHA 4YN3A 4EY6A 3UMYA 2XYGA 2H4XA 1D6SA 3CZ5A 4IMIB 2XTMA 4HXGA 4P0TA 2PX0A 4IQGA 3L18A 2GHIA 4BTLA 5C1BA 5JR3A 1QRTA 1YVDA 2GZ3A 2WA1A 3CKKA 1XQWA 3AFGA 1ULTA 3OPYI 4TKVA 1QH1A 2GZHA 2II6A 3MB5A 4NR0A 4O1MA 4CPDA 4W5NA 1NE2A 2YWXA 3QUBA 4JHXA 5AJZA 2OZPA 5LXTB 2Z6AA 4L8WB 2KX7A 3MS4A 5E6UB 3ND6A 3RC7A 3ETHA 4ARBA 4YT4A 1F14A 4QYWA 3F5DA 1H3FA 4F21A 2RGWA 1IBSA 4BNDB 2WSSD 3KRTA 1QU3A 3O0DA 2QRGA 4P83A 4QXMA 1TZJA 4RPJA 3HXQA 2WMYA 3VPFA 3ZI0A 4ETMA 1KC1A 2H2IA 1UJ6A 7ABPA 2PE5A 4LRTB 4OREX 2HCBA 5B12A 4AAYA 1M8PA 3WYAA 1R66A 2HK8A 3LPMA 3P0FA 2FCAA 2IP1A 5F35A 3RJMA 3V4ZA 3WKBA 1E6MA 1O4VA 1OFVA 4RJ2A 3FXAA 3SJCA 5BQ3A 3RH0A 3QPAA 4F7DA 4F4IA 2IUYA 1OZHA 2OSVA 4BHTA 1ESEA 2A5DA 2XCRB 4M1ZA 4UTOA 1LDYA 1RE1A 1W0KD 4GICA 3HI4A 1WSBA 2GD1O 3L43A 2L18A 4GPTA 3D0OA 1XAIA 3R0JA 5E6RA 2B8JA 1RKBA 4JJ4A 3S5UA 1QHFA 4FLEA 3WLRA 4BNWA 3UFXB 3ZV3A 3LRTA 1AV6A 3LQ4A 4TTPA 3RASA 2REQA 5FOXA 1BHQ1 4WH0A 1O95A 5J2UA 2FEKA 2XYRA 1YL7A 3BOSA 1D3AA 4FMDF 5C4IA 5C8YF 3H18A 3NRBA 2CDBA 4S35A 4OJYA 4E7OA 4TSFA 3W77A 4OGLA 2RHCA 4ZV9A 3ZWXA 2DAPA 1PSWA 1F8XA 2WKWA 3L5OA 1C9NA 2VDWB 2RD2A 3AV3A 2GVNA 4RO0A 2FHPA 1D8AA 2YHBA 4ZOAA 5J2UB 4I1IA 3H2YA 2MSEB 4EKDA 3VH3A 5JAZA 2DBZA 5I5EA 1KGDA 3LYLA 1VKZA 3PUJA 4PRLA 2HPAA 4X5OA 4ZOLF 2VT6A 3TIVA