1N7HA

Crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
339
structure length
331
Chain Sequence
RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the MUR1 GDP-mannose 4,6-dehydratase from A. thaliana: Implications for ligand binding and specificity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
molecule keywords GDP-D-mannose-4,6-dehydratase
total genus 129
structure length 331
sequence length 339
chains with identical sequence B
ec nomenclature ec 4.2.1.47: GDP-mannose 4,6-dehydratase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n7hA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1n7hA01
3DFZA 1WP4A 4Q39A 4BO0A 2G1UA 1LDMA 4KQWA 2GYYA 2EXXA 3DBRB 3GVHA 5FI5A 5L4NA 1RM0A 1ISIA 5IDYA 5EESA 1U1IA 3ZWMA 5KIAA 4AJ2A 4GX5A 3GGOA 2VYNA 1H93A 1EK5A 1PL7A 3DTYA 3OBBA 1KYQA 3QWIA 1O9BA 3E1KA 2A35A 3DMYA 1D7OA 3BMOB 3AUUA 5ER6A 2D3TA 4R5MA 3MCVA 4LW8A 3OMLA 4R1UA 1I2ZA 2HMWA 2PV7A 2HK7A 4FPXA 3AI1A 3GGPA 3PJEA 3WICA 1T2EA 2BFPA 3ONEA 4PFJA 4UUOA 3SEFA 5B1YA 3W4JA 3ONFA 1MFPA 2HLPA 4L4XA 3WSVA 3M1LA 4C7KA 2YFQA 1E5LA 1BHSA 3QY9A 5DULA 4D42A 1L7EA 1E7MA 2IZZA 4NU6A 7MDHA 4ZVVA 1ZIDA 5LDHA 1P31A 3X2FA 3I6IA 4RCVA 1ZK3A 1MGOA 1DRUA 3HADA 3ZWAA 4R51A 3AFNA 3UGKA 1QORA 4N5LA 1FDUA 3A28A 2F00A 3L0DA 4KP7A 4CUJA 4D46A 2JD0A 5G0TA 3LC1O 1LRJA 2B5WA 4A73A 3EC7A 5KJCA 3C85A 4Z9FA 3VZSA 3DAPA 3VH4A 2EGGA 5KJ6A 3R0IA 2D59A 1C0PA 2BI8A 1J6UA 3AOEC 2LDXA 4ITUA 4BB5A 3KETA 3G49A 4PG8A 4DQUA 2YHUA 4LRTB 5IN4A 5FEUA 1UAYA 2J5KA 3OM9A 1X0VA 5K0ZA 4B4OA 1XQ6A 2GZ2A 3AFMA 4O5OA 5GZ3A 1DJNA 5GZ6A 4GLLA 4PRKA 3GN1A 3FSRA 3MJCA 5A3JA 1A4UA 4B3HA 4HFMA 2I76A 1KY4A 1Z73A 4WCFB 5GZ1A 4NBVA 2IXBA 3NTRA 5A5FA 4CMIB 5C7LO 4PLFA 2ZJ1A 2O3UA 4IINA 3HJAA 2IZ0A 5I8ZA 5JFOA 3INTA 1NVMB 4M49A 1C1XA 1DC3A 3QRWA 3VTZA 5KJ1A 3DZGA 1XA0A 4II3A 2NM0A 4I5EA 5TSDA 3F1KA 4BUCA 4AFNA 2GNAA 4GWKA 1JWBB 1ONPA 3PHGA 3E5RA 4IQ8A 3PHIA 4IDBA 1N7GA 5I9NA 4EITA 1GYQA 3I9LA 3HN7A 3IS3A 1GPDG 4PGFA 3L6DA 4BO2A 2P9CA 1E1KA 4AJKA 3WNVA 4R68A 2PFGA 1YB4A 3WOHA 4GX2A 4PLZA 4HX5A 3U62A 1B14A 3CMMA 1PU2A 1HKUA 4LMRA 5JCXA 1D1SA 3O26A 3OP4A 1ENOA 2B0JA 1RM4A 1PWZA 1BWSA 1G0OA 5T67A 4E12A 4GPD1 2VWPA 3WTBA 2PZLA 3JD3A 1LUAA 5COBA 1Z82A 4YXFA 1AXGA 2GCGA 4CUZA 4N54A 5L4LA 3LT1A 4P38A 5HWSA 3TZQA 3KYDB 3FRJA 4FC7A 4RVDA 1R12A 4JP2A 4GGPA 4XGNA 3WIEA 4CLRB 1J0XO 2D5AA 1EZ4A 3WGTA 4TWRA 4CM7A 4OYRA 3JQEA 3AU8A 2VYVD 3OIDA 4YJGB 3F47A 4E5PA 8LDHA 1IPEA 1GDHA 1EDOA 4DPMA 2Y1GA 4DC0A 4GH5A 1LSUA 3P19A 1LEHA 5THQA 4B3JA 3KB6A 3PJFA 3BHJA 4L4SA 3NAQA 1P1FA 1P1JA 2PH5A 3EVNA 3KVOA 1HSZA 4EI2A 2PWZA 4B79A 5TC4A 1UZMA 1WMAA 5KCZA 5I7SA 4QO7A 4TKLA 4YJFA 1GUZA 1JQBA 4NBTA 9LDBA 3ZHZA 1DO8A 3PLRA 3T4EA 2ZTUA 1ZVMA 1GR0A 4U8GA 1YONA 3N7UA 4XYMA 1DIGA 3K8ZA 3TSCA 1Q7CA 2I5PO 3NTOA 2JHGA 4Y9DA 2OMEA 1GQYA 2EEZA 4KZPA 3AW9A 2PZMA 1VKOA 4LN1A 1ZO8A 4BQPA 1E3WA 3FWNA 3PGXA 1ARZA 2PR2A 1I01A 2Y1CA 1GQQA 4AJHA 3ZWWA 2WDZA 4NBWA 2EW8A 3I4FA 1O5IA 3HDQA 3ZV4A 4DBZA 3TOXA 1KETA 4BNFA 2EHDA 4CM4B 5DOVA 1KEVA 4E13A 3I5MA 4ND2A 4MPDA 3KYCB 3AJRA 3F6YA 5AOVA 4CR6A 4EUHA 4G81A 1RYDA 4QFDA 2ZCUA 1HL3A 1AXEA 3DZHA 3OA0A 3WYBA 3ASUA 2HRZA 3GH3A 4RF4A 1PJ4A 1AHIA 4WGGA 2X9VA 3UICA 3H5RA 4D45A 2CDBA 1TXGA 2CF5A 3OJEA 3PPIA 1YXMA 1YO6A 3V8BA 4IDDA 2C54A 4J1SA 1RM5A 2ZIZA 1Y81A 2OL4A 3EVTA 4XB1A 3UN1A 1DOHA 4OM8A 1KVSA 1A9ZA 2EV9A 4EEZA 4W6ZA 1Y8RB 1C14A 3PWKA 1N5DA 4B7XA 2FWMX 3AM5A 4CJXA 5IZCA 3JCZA 4Y6SA 3WGHA 5JAIA 2VT2A 2I99A 3RROA 3RUAA 4ZQHA 4PLYA 2HMUA 1NWHA 1R37A 4MDHA 1HDXA 5L4SA 4X54A 3K30A 3R6DA 1Q0LA 3RSHA 3L77A 4GSKA 1C3VA 3G1UA 1I33A 4OJNA 4E33A 2A94A 4GGOA 4RZHA 3TJRA 2OORA 1P1HA 4Z3KA 1ISFA 2B35A 1R4MB 4YRDA 1E6WA 1KY5A 4NBRA 4JIGA 2Q50A 1VL8A 2Z95A 3IC5A 4M54A 4F3YA 2RHRA 3V2HA 4YJHA 1I32A 2FR8A 3O4RA 4PVCA 4K26A 1HZZA 1LDEA 3CUKA 1YQXA 2VZ8A 3ZW9A 2EKLA 5JO0A 3BTVA 4M8SA 5IFLA 3OQBA 2O7SA 3RC9A 4LK3A 1P74A 2J3JA 1TEHA 2W4QA 4I5DA 4JP3A 4WLNA 4E2WA 3QWAA 1T25A 2FZWA 3JQ9A 4UVHA 4F46A 3ICPA 2RAFA 4ALIA 2HSDA 4WE3A 4CLEA 9LDTA 3Q0EA 4XGIA 4NR0A 4W7IA 3S55A 4RLHA 4BNJA 1QYCA 3E5MA 4E3ZA 2X4GA 3K73O 4R4JA 4IIVA 4L8VA 3FR7A 4KUGA 2EP5A 4BQRA 1VRWA 1EFKA 4J2HA 1TLTA 4CQMB 1YDWA 4EGFA 1NASA 5U9CA 1ZEJA 1HLPA 4MVJI 4INAA 5AXBA 1CDOA 2H9IA 3D3EA 1BXKA 1PS9A 3GF4A 4PG5A 5B4TA 1NQOA 2D8AA 3PFWO 3IKTA 4IZHA 3K96A 3VZRA 4E5NA 1SZJG 3W4KA 3VVBA 1LNQA 1BW9B 4NJMA 1SOWA 2FP4A 5EPOA 1GFSA 3DTTA 3WQSB 5DBFA 4M87A 1X13A 3PI7A 1P1KA 2HAEA 4ZJUA 2Q1TA 1LDYA 2EWMA 4YAKA 1M6WA 2JD1A 3C7DB 5CPFA 4ZU3A 1GADO 1VJ1A 4BKPA 2O3RA 1CQIA 2QRJA 2Q2VA 2CVZA 4CV3A 4D3FA 2IZ1A 3D5QA 1W73A 4MVJF 3IUPA 3LVFO 4WLEA 4DIFA 3HSKA 5CAEA 4CMEA 3GDGA 1X15A 4NG5A 2AEJA 1NR7A 4JNKA 2W2KA 3GHYA 3KLMX 3OFSA 5A9SB 1R15A 1H2BA 2O50A 2Q3EA 5JBIA 5JXWA 1U3UA 5A06A 1A27A 1FXSA 4DLBA 2EP7A 1E3LA 4OO3A 3PYXA 3UH1A 5DBIA 4XQGA 3WBBA 3GRKA 3RUFA 2X58A 3BYZA 4YBZA 4ND3A 3O8QA 3I9KA 4J3FA 4O0LA 2DBVO 3WQRA 2C7GA 4TRRA 1CERA 4AG3A 1P44A 1LXCA 1QYXA 1WWKA 3FI9A 3OJOA 4J91A 2DFDA 2EIHA 4RORA 1ZZEA 4XJTA 3JYNA 1B0AA 3HWRA 1SC6A 4WCFC 5JE8A 3RUCA 5HM8A 2HKIA 4S1VA 4NHEA 2NU9A 2YW9A 4RDIA 5HS6A 5A3VA 2QQ5A 2H63A 4NBUA 1DRWA 3ZU5A 3AI2A 3IQDB 2FHSA 1P9LA 4B8WA 4MIEA 4RF2A 1W8DA 4CMBA 2I6TA 1R0LA 2B4RO 3WGOA 4II2A 3MOGA 3T7CA 3VC7A 4RJTA 1I3LA 3L07A 3RIHA 3AOGA 4IPTA 4Q3CA 1DIBA 4HBGA 4IGEA 4ND4A 2VOJA 1IOLA 2HK9A 1HDYA 5IF3A 4B8ZA 2VTEA 3C7CB 2RBEA 5IN5A 4PRLA 2BKAA 2IYPA 4O63O 4PVDA 4Y98A 5H82A 4BO7A 4AJEA 5L95A 1T1RA 3E18A 2UVDA 6ADHA 1KBZA 3GRPA 2O3JA 4NFSA 1MG0A 4WOKA 5G4LA 2Y05A 2NACA 4CR7A 4XYBA 3CKYA 3HFSA 5TT0A 5JCJD 3GN2A 4MP3A 3P7MA 3S2IA 4UEKA 3MWDB 3AM3A 1YS4A 3DB2A 5GY7A 3KYDA 3DR3A 4L0QA 5BSEA 1PQUA 1UUFA 2NSDA 4QECA 1Y9AA 1F8FA 2YYYA 3EW7A 3RFTA 1B7GO 1I36A 1ENZA 4WJZA 2VWQA 5U4QA 3I9MA 3FCOA 3HQ4O 3PWSA 3IAHA 4FDAA 5CDTA 1H6DA 1LJ8A 1F14A 3LF1A 1WZEA 3WWYA 4E0BA 4DUPA 1YL5A 3TWOA 4P22A 3TFOA 4HV4A 1A7KA 4AVYA 3INGA 3ITKA 2C7VA 3K31A 5A9SA 5COAA 5KVQA 5BSGA 2FY8A 4FFOA 1BTOA 4KMSA 3CH6A 1UXHA 4CM5A 4FJ2A 1OOEA 3AK4A 3JQFA 3PHLA 2VNSA 4B7UA 4AJ4A 4Q3NA 4GMGA 3MJEA 4N5MA 4RQTA 1YKFA 4XYGA 2HQ1A 4A10A 3B20A 5AVOA 4RLSA 3BTUA 5CDUA 1BG6A 2BH9A 3GNQA 2CD9A 3KBOA 1YJQA 4EBFA 4BB6A 3W8EA 4EYEA 1HE5A 2ZATA 2X9NA 4BOYA 1BSVA 4M55A 4Y6RA 3PZBA 4BNIA 3SLKA 3NKLA 3UXYA 3PQEA 1XGKA 3JQGA 2PLAA 1MV8A 2JCVA 2Z5LA 1E77A 4FQ8A 1LA2A 3TL3A 2X5OA 3W8FA 2DBQA 4Z0PA 1HTBA 3RBVA 1PJCA 3B1JA 3DQPA 5BNFA 3TOZA 1PJQA 1KVUA 4BNZA 2GN4A 1EE9A 4NQZA 4R69A 3U5TA 4BMVA 1B8VA 4IZIA 2J3HA 3P2OA 4ZGWA 5A03A 4BO9A 5KTKA 4E2XA 1NBOA 5JDIA 2D0IA 3WTCA 3QVXA 1DPGA 4U0KA 1DB3A 1LLQA 3GA0A 3L9WA 3WJ7A 4E30A 2X23A 3AM4A 3FTPA 1IL0A 1FDSA 3FTNA 4ZICA 5AXCA 5K6AC 2P5YA 2WD8A 4PZEA 2V6FA 2AQ8A 3I9NA 4RPKA 2DUWA 4R3WA 1YQGA 1TT5A 3S2EA 4BO4A 1K0UA 4NJMB 4O59O 3RQSA 1LSSA 3A06A 1QRRA 3GEDA 1B8PA 1LLUA 4CODB 5KNLA 3W6ZA 2VZ0A 5TGDA 4HNGA 2NVWA 2VHWA 3JQCA 1YH3A 3KRTA 4NIMA 1BXZA 3E48A 4S3MA 1M67A 1UDCA 5C7IO 2DBRA 3OSUA 1EBFA 1H0KA 1P1IA 2B37A 3WFJA 4WLOA 1YB5A 3E9QA 3TQHA 1LU9A 4QQRA 2DLDA 3NX4A 3ICCA 1ENPA 3U4HA 4Z9XA 4YA6A 4CQLB 4AJOA 2YV3A 2CDAA 2X9GA 1XHLA 3NT2A 1BGVA 5A04A 2QYSA 3HN2A 1NVGA 3DBRA 2NUAA 1IZ9A 3QJ5A 1NVTA 2WEKA 4R9RA 1Q7GA 1W6UA 2AXQA 3WIDA 4BVAA 3OIFA 2GZ1A 4HY3A 2B5VA 1O8CA 4XWYA 1NFQA 2GN8A 3VPXA 1UAGA 5KVSA 1CRWG 4CUKA 4Z9YA 3D3WA 4E2YA 1JVSA 5CEFA 2NVBA 3SX2A 2O2SA 4D3DA 1T2AA 3DBLB 1JKFA 4QX6A 2DFVA 3WLFA 1HF3A 2XXJA 4GKBA 3O38A 1NR1A 1ZSNA 4QEDA 5A4DA 2POQX 3JQAA 1A9YA 3G79A 1E7WA 5AYVA 8ADHA 1GL3A 4TRMA 1VL0A 2CDCA 4DMLA 4U0JA 2NWQA 4Z0TA 5IZ4A 3PLNA 2Y0DA 1EDZA 2DBZA 1TI7A 2E4AA 5EJ2A 4D43A 3K92A 1ZNQO 1KOLA 3EUWA 4BNXA 4KQXA 5ENVA 1E3EA 2A9FA 5JMWA 4TVOA 2EGHA 4J7UA 1HDGO 1S7CA 1AUPA 1SEPA 4BKRA 1YGYA 1C0IA 5AXAA 3ZH2A 1OC4A 1SOVA 3WGYA 4TKMA 1GCUA 1E0DA 4UVIA 4LSMA 3H5AA 4Z3DA 3VDQA 4DLLA 4EDFA 3PHHA 2XF8A 1E3JA 3NDRA 4E4YA 1IY8A 4KOAA 4XEHA 2YFHA 1UXGA 3C1TA 2HCTA 1NNUA 3NTQA 1MG5A 4TZTA 3TL2A 4DREA 4XIYA 4OOEA 2YHIA 4Q3BA 2P5UA 1Y9EA 3ZNPA 3QIVA 3VH1A 4DWVA 4D0SA 4ZRNA 3O9ZA 2YHIB 3OJFA 4IXWA 3ADOA 1LDNA 4B4UA 5DCWA 4IS2A 5TS3A 4IS3A 2NNLD 3R3SA 3NJ4A 4EJ0A 4W9NC 3H3JA 2R00C 3TDKA 5JDIC 3L6EA 3AUSA 3QWFA 2NU7A 3RFVA 1CEQA 1DC6A 4KTVE 4W7HA 1E92A 3GZNB 2Y1OA 1ZK0A 4BNUA 5CPBA 3RKUA 1JA9A 5CDGA 4MINA 4DGSA 4MVJP 3ZV6A 1DHTA 4BO1A 4RL6A 2BD0A 3NGLA 2C59A 4AJIA 4E5KA 3HNPA 3UOGA 2AEFA 1ZMOA 4GMFA 5JPIA 1ZK4A 1HDRA 4A5OA 3NDJA 2VCYA 3PJGA 2YJZA 4WNIA 1HWYA 2AMFA 3LU1A 2BGLA 1XSEA 4H15A 2IRWA 2WMDA 1ZSVA 2Y0EA 3EDMA 3QA9A 5TF4A 3D4OA 1O89A 1Y1PA 2HU2A 5L9AA 2DTDA 4HUJA 1B26A 5F3RA 3DDNA 4EEXA 4HWKA 2FSSA 1BXGA 4U6QA 4NNJA 5JMPA 4CMHA 4WLVA 1T1SA 3CTMA 2X7HA 4GX0A 2NTJA 2HO5A 1IHYA 2XPCA 1I2BA 3GQVA 3RBZA 1T26A 3EY4A 3M2PA 4R9SA 5B37A 1ZUD1 2QX7A 1R4NA 4R16A 4E6PA 4JX8A 2YV2A 2GD1O 1V3VA 3E8XA 3COSA 3VOSA 2DM6A 2PZJA 5TNXA 1YJ8A 1BMDA 1DIAA 1SNYA 4CM8A 2BF7A 1PJBA 4R1SA 4K1LA 1Z7BA 1ADGA 3UFXA 3WR5A 4DYDA 2F1KA 3DAGA 4J4BA 3NYWA 3TN7A 1EVYA 5DDIP 1B8UA 1HE2A 2D5CA 3BMNB 3DO5A 1LTHR 4GSLA 4PIVA 4XD2A 3WGGA 5IZCC 1A5ZA 4W82A 3MOIA 4Q3AA 1TA4A 3SC6A 3GMDA 5CEEA 4PZDA 3MTJA 3HZZA 1WXDA 2NLOA 3GUYA 1DDOA 3DMTA 3HUDA 1U7TA 3ZWNA 1OC2A 2ZB7A 3NV9A 2JFGA 4CLHA 4OGWA 5CP8A 3V1UA 3H9JA 5JC8A 1FDWA 3L4SO 3PK0A 3BTSA 1C0LA 1GEEA 1IPFA 2FR1A 1V6AA 5DBGA 4IXTA 1LX6A 1LRLA 3T7EA 4KTTE 2QZ9A 4YAEA 5KOIA 2E37A 5JY1A 2D1YA 4BGIA 3EZYA 2QRKA 3U49A 1LRKA 4W99A 3W8DA 1NM5A 2RH4A 1HYHA 2BHLA 4YJDA 4ESOA 1N8KA 4NPCA 1FJHA 1HYEA 2ZKLA 4IUYA 4NMHA 2BELA 3JD4A 2CVOA 4BKUA 1V8BA 3W6UA 2NADA 3RC7A 1NFFA 1X14A 2IDZA 3LF2A 4UUPA 1XKQA 4CM9A 3AUTA 3RUHA 4PLCA 4BV8A 3H9EO 4E32A 2V6MA 2X86A 4C7JA 5JSFA 5C5IA 4B3IA 2I65A 1QV7A 2BGMA 1U28A 4FJ1A 4IDEA 5F5LA 4WNCA 3TF5A 1FDVA 3MJVA 1ZBQA 4L9RA 5K9ZA 3GAFA 3ZW8A 4NH4A 1U2GA 3F5SA 2C2XA 3X2EA 1NHGA 1PR3A 4BKQA 3WWZA 2BI7A 3DWFA 3PQDA 1NAHA 3GFBA 1NXQA 2VUUA 4P4GA 1HXHA 2B36A 3JQ8A 3CZMA 4PG7A 4A7PA 1MFZA 1YQDA 5DCYA 2Y66A 3E6AA 1MXFA 1Z45A 1YOVB 2O2YA 2W2KB 4IJVA 4PLPA 5JO9A 4R54A 1UXIA 4FFLA 2ZTVA 3DONA 3S2FA 4AJPA 2C5AA 4YT5A 5ILOA 4OSOA 3DFUA 3VH2A 2VTDA 1PQPA 1ENYA 2RHCA 2ZK7A 3C3XA 4RPLA 5DP2A 2NQTA 4GVXA 3WDSA 4HNHA 2WJPA 2UUPA 4E5YA 4JBHA 2G76A 3RD5A 5TIIA 2ZQZA 3F3SA 1K89A 3F4BA 2RCYA 2JJYA 1HSOA 1QYWA 1J5PA 3MJSA 1KVRA 4P8RA 3B70A 3RU9A 1BW9A 2BFMA 2LDBA 3BMOA 4M89A 3PQFA 3GPDG 3SBOA 1SAYA 4RVUA 3U0BA 3VPHA 3WS7A 3I4CA 1P33A 1U4OA 4XCVA 3WG9A 3QVWA 2W90A 4R5HA 2JCXA 2ZQYA 2PGDA 1KC1A 1PJSA 2JD2A 2BFAA 1M2WA 3VKVA 4I08A 1EE2A 1HE4A 3ETDA 3D1LA 4OKIA 4CQMD 5T64A 5T8KA 1H6BA 4ILKA 2DPGA 1YVEI 4K28A 5G0SA 3RI3A 3D5TA 2UAGA 1E7QA 3ANLA 3WNQA 3WQQA 3DZJA 3L4BA 3QV1A 4J1NA 4WECA 4BNTA 4XRRA 3I83A 1VL6A 5F5NA 2Y1FA 3FD8A 5COQA 3H9GA 2JAHA 4CV2A 4DIBA 5L7TA 3GGGA 2Q4BA 4YCAA 1BDBA 3IP1A 1Q7BA 2E48A 4PG4A 1NQAO 5DT9A 1EUCA 2FSVA 4QTZA 1ISJA 3RFXA 2Y68A 3GY0A 4YDRA 3OA2A 3R3JA 4D3SA 4RV9A 2VRCA 2VHVA 3ADPA 2IODA 5GMOA 2AEMA 4DA9A 1UJMA 5G0UA 1RM3A 4BV9A 4DMMA 1V3TA 2NTNA 4UVEA 4BO8A 4KUHA 3H8VA 5JNLA 3OHSX 5EL0A 3QWBA 1H6AA 1PX0A 2DUUA 3OJ0A 4IMRA 4PN3A 3BMNA 1UP4A 2J8ZA 1GCOA 2VYVA 4TROA 1I30A 4PLWA 1AHHA 1GUFA 1TVEA 3OECA 4ND1A 2NVUB 2P2SA 3VVCA 2ZJ0A 1AE1A 1X1TA 3HE3A 4IDGA 3W1VA 1S6YA 3FPLA 4H3VA 1H94A 4MVJM 3BA1A 4NU5A 4HP8A 1QSGA 4EUEA 1CETA 3C7AA 4A03A 2OO5A 2DPHA 3JQ9C 3IKVA 1DXYA 2PD6A 1XELA 2EW2A 3LC2O 4YT4A 2GUGA 2FPIA 3VPSA 1NHWA 7ADHA 4WLUA 1EMDA 3LQFA 3V1YA 3H2SA 3U4IA 1UXKA 1XLTA 2QW8A 1D4FA 1Y5RA 4QSMA 5ENDA 4J2OA 2QG4A 2DC1A 3DBHB 4I9UA 5KJFA 1MX3A 3UF0A 1K6JA 1N92A 3IUSA 5JAZA 3UCEA 5IXYA 3BAZA 1NPTO 4ALNA 1HLDA 2GGSA 2Y1EA 5EINA 3SVTA 1ZJZA 3Q1LA 3JV7A 2PA3A 1YL6A 5L7YA 4ZA2A 5ER9A 1PZGA 3GG9A 4BNHA 1HDZA 2Y0CA 1ONOA 2PZKA 3JD2A 3TZ6A 2G17A 2PKQP 4FSHA 2ZCVA 1JN0A 4OL9A 4CM6A 1OFGA 1T2FA 3GLQA 1QR6A 4A26A 2C2YA 3QVSA 1U3VA 3MEQA 2OZPA 4RPHA 3A9WA 3PVZA 3KO8A 4UEJA 3ZWXA 1E3IA 4ZD6A 2GASA 1DIHA 1PJLA 2FPPA 1DHRA 4DLAA 1NWCA 2C07A 3FNGA 1X7DA 4BMNA 2P91A 2J3IA 2X0NA 3AU9A 3TZCA 2HMTA 1OI7A 3OF2A 2OP0A 1JW9B 1HRDA 5L53A 4A0SA 3DBLA 4BGVA 1FDTA 4OSPA 4WKGA 3VPFA 3OJLA 1CQJA 1U7HA 2HMSA 2YZ7A 5I9MA 4J4HA 4XIJA 3ENNA 1Y8QA 2I9PA 4FOOA 5TX7A 2V65A 3GVXA 3NUGA 1GQ2A 3ZV3A 3DHNA 3IDSA 2QZZA 2ZTLA 2PH3A 1X7GA 3LK7A 2B4TO 5KKAA 3I9JA 5JAQA 4CMKA 5K6AA 1DBVO 2ET6A 4XGKA 4OAQA 3E9NA 5CHEA 4CMGA 3UKOA 4Q3DA 3WX0A 4YQZA 5FI3A 5KVVA 5CG2A 3CZRA 4ZN6A 4I5GA 1LSJA 1OAAA 4FFRA 3UCFA 5C3MA 1RKXA 4L75A 4UVGA 4QFCA 2C82A 1EUDA 3JQAD 3Q9UA 3GNSA 2W2LD 2AHRA 3RJ9A 1ADBA 5JLAA 3FBGA 5HBRA 3TRIA 1ORRA 2G0TA 1YE3A 2JHFA 2XAAA 1PTJA 1SBYA 3ETGA 2G82A 5H81A 2W98A 3JD0A 4U5QA 1WLYA 3KV3O 4DIOA 1Q1NA 5ADHA 1B3RA 2AG8A 4ALMA 2QHXA 1UZNA 1XCBA 1ZH8A 3WFIA 1I3NA 1Q0QA 1WDMA 2WYUA 1WPQA 5TQVA 4XKJA 1D8AA 2XXBA 4MOWA 4NDNE 3F4LA 4FBGA 1U2DA 3CEAA 3PDUA 5ILGA 3WYCA 3ZU4A 3QLJA 2DAPA 4FW8A 1E5QA 1FF9A 3LC7O 3E03A 2VQ3A 3VHRA 1VI2A 1WZIA 2ILTA 3A14A 4YYZA 1A4IA 5JAMA 5L3ZA 1NYTA 2WD7B 2R6JA 1HDOA 2I67A 4D0RA 4FB5A 2IEBA 1E1NA 4K9DA 2EJWA 2H1SA 1NPYA 2YUTA 1KVQA 4CM4A 1EUZA 3OEWA 5EN4A 1DC4A 3V2UA 1LLCA 4YB8A 3U4CA 3F9IA 5MDHA 1NFRA 2WSBA 2BMAA 3RASA 1N1GA 3BHMA 4L76A 1UDBA 1AN9A 3GFGA 3GG2A 4PLTA 1TT5B 1R6DA 1J4AA 4KUEA 1H9AA 3VZQA 3ZHYA 4OXYA 3JTMA 2IEDA 2B4QA 3WJAA 4Q3EA 4XB2A 2GRAA 1SPXA 2PKQO 2P9GA 4TZKA 3WMWA 3EYWA 4YJFB 1UXJA 5I7EA 4PG6A 5JY6A 2X0IA 2HJSA 5EMHA 2PGJA 4YAJA 1DJQA 5F21A 1V35A 5IAAA 4XJSA 2YV1A 1ULUA 1FMCA 4WUVA 1C1DB 1A72A 3BIOA 3L9XA 1G1AA 1NAIA 4B7CA 4JQCA 1KVTA 4JGBA 5BSHA 4B4WA 1ZSYA 4HKTA 1QYDA 3GDFA 1T2DA 4RVGA 3WXBA 1N1EA 3OH8A 2O4CA 4DRYA 4R01A 3BHIA 5H83A 3ZWPA 1JDJA 2VNAA 2X1HA 5FF9A 1PGPA 1E7RA 2QYTA 1VSUA 3GDOA 4E21A 1I0ZA 4EJ6A 4YPOA 1P1RA 4BGEA 4BKOA 2P68A 4AJ1A 4DL9A 1B16A 2ZB3A 1YWGO 3DL2A 5J23A 3SLGA 2GO1A 1Y6JA 1B15A 3MWEB 4BHTA 4IY1A 1ADCA 3QVOA 1GAEO 5IJZA 3MZ0A 4IJUA 1QXSA 3V1TC 1DSSG 1R4NB 3KEQA 3QWHA 3O8QB 4MKZA 3LLSA 1DIRA 3JQDA 5TT1A 4NJOA 1EQ2A 1F06A 4YAIA 3ZU2A 2OFPA 4MVJH 1Z6ZA 4YWJA 4QXMA 2WTBA 2J5RA 1N9GA 4ZQGA 4PZCA 1HETA 3Q2KA 5EIOA 4LRSB 1GUYA 4MVJD 4Y6PA 3PYMA 2FN7A 1PJTA 4ZQEA 4HFJA 1LC3A 5B12A 1C1DA 4J6FA 1H2HA 4TQGA 1YBVA 1MLDA 1XU9A 1VLLA 2OOSA 2Q49A 3H9UA 4I1IA 3G17A 5IDQA 1LQUA 1SB9A 5T57A 3K2EA 3ROKA 4GAEA 2O3TA 3EZLA 4MP6A 4ND5A 1C1XB 1I3KA 3ZWVA 4JN6B 5MGBA 3IOYA 4OQYA 4TMFA 4MP8A 3RBXA 3B1KA 1QYVA 2P4QA 4CLXA 1XWFA 2Q1WA 3AY3A 3QP9A 3NRCA 4OXKA 4A27A 4CM9D 4MKRA 2TMGA 1T4DA 5DCUA 3S2GA 1W0CA 4J90A 4RVFA 4EZBA 4XRGA 4LGVA 1Q0HA 4FFNA 2P4HX 1AGNA 2AQHA 3JQ7A 3ROQA 1JVBA 3I3OA 3DOCA 1GEGA 3ZDFA 1WW8A 5DNAA 4G2NA 4J7XA 4HXYA 3S1LA 3RUDA 2PD4A 3KSZO 1OBFO 3TZKA 3UVEA 4DTIA 4F45A 1G6KA 3H9QA 2VZ9A 3O03A 1WDLA 3EK2A 2JAPA 4MIYA 5BR7A 3D4PA 3PHJA 1U8XX 5TRTA 3CSDA 5G0WA 4RPGA 2EF1A 2HRBA 1CF2O 4ZQFA 4JXKA 5B4VA 2C5EA 3AOEA 3H4VA 1NTOA 1BVRA 1YBMA 1KEUA 4MVJE 5CEJA 3G3EA 1A7AA 1PEDA 1F17A 1PGJA 1LC0A 2W2LA 3HDJA 3JSAA 3KM0A 3LLVA 1U9JA 1GPJA 3TZHA 4BMSA 4KWIA 5DN9A 2O3SA 4J9UE 3V5NA 3PTZA 2RH8A 1U4SA 4IDCA 4UVDA 2E49A 4ALJA 1O6ZA 3ULKA 2UDPA 2RIRA 5DF1A 4DQXA 2R2GA 1DRVA 3M1AA 4OXNA 1ID1A 5T8KC 4DPKA 4AJLA 2B69A 3CIFA 4AJJA 3K6JA 3VZPA 5I7FA 1H5QA 3NEPX 5HTOA 2GERA 3L4BC 4DPLA 1VM6A 3H6KA 3OQ1A 4FJ0A 4QUKA 2XOXA 3Q3CA 3V2GA 4OKNA 2EKQA 2PTGA 3R1IA 3SC4A 1U5AA 2Z1NA 3FPCA 5JCJA 1JWAB 2YDXA 4YAGA 2DQ4A 2GLXA 5KJEA 4UEOA 1WDKA 3DZKA 4J49A 3JQBA 1PGNA 3FR8A 2OP1A 4RZIA 4L74A 1ULSA 2FZEA 1DFIA 3H65A 2SCUA 1PZFA 3PYLA 2DT5A 3DBVO 3C24A 2J6IA 5G0VA 4ROSA 3DAFA 1YL7A 4EJMA 2WE7A 2Y67A 3K9QO 3Q2IA 2GZ3A 1ZKMA 4I8XA 1MP0A 1EQUA 2WE8A 3JQFC 3RVDA 4IDFA 3PEFA 1B3BA 1D3AA 1PS0A 1FK8A 1VSVA 4RVSA 4XYLA 5JDCA 1GU7A 1VJTA 3UHAA 3E9MA 1DAPA 1GV1A 1ZK1A 1EBUA 2HDHA 4BO6A 4BNMA 3BMCB 2WYVA 5U1PA 5KVCA 3KYCA 5L45A 1W4ZA 1N2SA 2NU6A 2GR9A 1G0NA 2NV6A 2ZYGA 4RGBA 3ZCXA 1CYDA 2YQ5A 4CL3A 4PLVA 1PL6A 1YDEA 3B6ZA 2CNBA 2OBYA 3CINA 4L73A 1R66A 1PS8A 3ROMA 4WPGA 4GVLA 2WYWA 3VDRA 2FOIA 4PCVA 4J16A 1Z7EA 2ZTMA 4WLFA 1XR3A 2R00A 1IYZA 1R0KA 2VHZA 5A05A 1NQTA 1ZCJA 2VRBA 3HDYA 3ZI0A 1UP7A 4RDHA 4XQCA 1JAXA 3ZHXA 4FOSA 1ZXLA 5AXDA 2X0RA 2X5JO 5LC1A 4GKVA 4CQMA 1I3MA 1K3TA 4M86A 5BNTA 5IXSA 1QMGA 1MUUA 1EVZA 1UDAA 1YRLA 2IE0A 2UUOA 3FWZA 3D3WB 4GI2A 3ZHBA 1Y8RA 4NK4A 4YEDA 5A02A 2QRLA 3B1FA 4JK3A 1QG6A 4XX0A 4DXHA 3RJ5A 2AW5A 3NGXA 4Y8VA 5ITWA 4D44A 2WD7A 3FHLA 5L7WA 3IJPA 5EQDA 2J3KA 4R3NA 4GBJA 4JROA 4DVJA 5CDYA 2CUKA 2GF2A 5I7VA 1E3SA 4NK5A 5I8WA 1PGOA 3H5NA 2FR0A 3D64A 3DZBA 2I3GA 3GUCA 2CVQA 3JQGB 1R4MA 3ZWCA 2X6TA 4J0EA 2CMDA 4ZRMA 3U4DA 1X0XA 2BGKA 1VE9A 2OBNA 4FFPA 3ONDA 4AL4A 3U09A 2JKVA 3DMTC 3I52A 4BO3A 3GOHA 3UW3A 2X22A 4J7CA 1JAYA 4FC6A 4GX1A 4LVCA 1LDBA 2YDYA 4XQ9A 4CPDA 4JBIA 3ST7A 2J5QA 3JYPA 3HB4X 1EK6A 1EEHA 4BNGA 3KZVA 1V3UA 2IYOA 3PXXA 3WMXA 1TB4A 1EVIA 1HYGA 1I10A 2W8ZA 4P4NA 4UREA 4FR5A 3BZUA 3TFQA 3RCBA 4HFRA 4XQEA 1LQTA 1X7HA 1GYPA 2PK3A 2Q99A 3HG7A 4DQVA 5A9RA 3GPIA 1WAMA 1ADFA 3G1TA 3ZWOA 1U3TA 1Y7TA 4XR4A 4KDEA 2Y93A 3ANMA 1M6HA 3JQBC 5BT9A 3A4VA 3PDJA 1XQ1A 4Q9NA 5T5QA 4TRNA 2BLLA 2EG9A 3FN4A 3WSWA 3DZIA 1UP6A 1U8FO 4GL4A 1PZHA 2PD3A 2C0CA 3GEMA 4PLGA 1UZLA 1ISGA 4I5FA 3D0OA 4CMIA 4G65A 1P0FA 2CF6A 4N5NA 3PJDA 5T6BA 1L1FA 4IMPA 1D1TA 3JQ7B 4MJLA 4CMJA 4CLRA 4I9HA 3JYOA 3KOUA 3WLEA 5HRUA 2NVUA 2NQ8A 4RQUA 3FBTA 4WEOA 4CMCA 1TT7A 4YT2A 1K6IA 3ABIA 4LISA 1JKJA 2O23A 2E6UX 1XG5A 3AI3A 3ZNNA 5DOZA 5IG2A 1PL8A 3GMSA 2AG5A 2JL1A 3DEYX 4CV0A 5A1TA 3BMCA 3ZWYA 1E7YA 3GVCA 5TLSA 1HEUA 3F1LA 3OEYA 4RF3A 3N74A 3BTOA 5F1PA 1Z75A 4BIIA 1IB6A 3PP8A 4A2CA 3FNFA 3L6OO 1N9GB 5IDWA 2D2IA 1O0SA 3NT4A 4YJGA 5BNIA 4K6CA 1O94A 3ITDA 1F12A 1XIVA 4ZHSA 5ICMA 4P4LA 5C7OO 1GZ3A 3MTGA 4BO5A 2YQ4A 3JQ6A 2DTXA 4J4TA 1CWUA 3ZZNA 1SEVA 3OQ6A 2VUSA 3D4NA 2Q45A 3JQ8B 4AJNA 1T4BA 2G5CA 1F0YA 4CR8A 1IE3A 3NT5A 4YT8A 4CLOB 5HS4A 2VHXA 3ZN2A 5KKCA 2VUTA 4LMPA 4BNWA 2CFCA 3SJ7A 1NP3A 1H6CA 2O3QA 4UUNA 3INRA 2OUIA 2V6BA 3QW2A 2Y99A 2H5LA 2Y1DA 3IP3A 3A1NA 4TVBA 5ITVA 1L7DA 2VYND 3P5SA 3CPSA 2Q1UA 3KYBA 1BDMA 1NX6A 2AA3A 4XZ3A 5LCXA 1DFHA 5TJ9A 4BS9A 1MA0A 3D7LA 5ICSA 3CE6A 3I23A 5EQFA 4IIUA 1E6EA 1PQWA 4W4TA 3LT4A 3HFGA 3RAJA 2O7QA 3GC6A 3RC1A 1GTMA 3P2YA 3GVPA 4E2ZA 3H3FA 3MJTA 4J0FA 4M1QA 3I6QA 4JCOA 1DAOA 4IQGA 1LI4A 5G2OA 2PNFA 4YQYA 4CL8A 1BVUA 1OZAA 2O48X 3HDHA 1KEPA 2ZB8A 4FGSA 4O1MA 1EFLA 3QQPA 4UUMA 1PSDA 3SJUA 4WCFA 4CLDA 4AICA 1VPDA 3C1OA 2B83A 3VAZA 3ZGYA 1KC3A 2OGUA 1HDCA 4DC1A 4R1TA 1QV6A 4PLHA 4OMUA 1LDGA 2CSUA 3FF4A 3I1JA 3KEOA 5JYEA 1F8GA 5FWNA 3GR6A 5CG1A 1DEHA 4MKXA 1KEWA 2AE1A 4JBGA 2A92A 3EMKA 3NJ8A 5BQFA 3ORFA 2Q46A 4FCCA 3VTFA 3QE3A 4EUFA 3ETEA 2HJRA 3KHUA 1HZJA 3PFFA 4HFNA 1PGQA 3WGZA 2VWHA 2BRUA 1SO8A 1QKIA 1RYEA 1M75A 3GK3A 1VJ0A 1A71A 2AQKA 3KTDA 3VKUA 2CZCA 4UAGA 5ES3A 1GZ4A 4BNLA 3AY6A 2PY6A 3IJRA 3VH3A 4FN4A 2GSDA 1K5HA 3H7AA 3F46A 3UCXA 1PZEA 2OHXA 3ZNQA 1I24A 1E7SA 1UR5A 4MVJG 5FYDA 3OETA 4BNNA 1ZK2A 1NQ5A 2HK8A 3GHHA 3LT0A 4Z0HO 1GY8A 1QLJA 4XYEA 4H7PA 5LDGA 1VC2A 5DP1A 3AWDA 2OXIA 2O4UX 3HB5X 3WGIA 3I9OA 4QO8A 3ANNA 4D7AA 4NFYA 4TSKA 3ZU3A 1I2CA 1R0SA 4YACA 5KWEA 4N18A 4UULA 2Z1MA 1NPDA 3C8MA 1P77A 3BMQB 3GZ4A 4IJWA 3NDIA 5L40A 2EERA 2PGLA 4D79A 3LZ6A 3EAGA 5IDXA 3K5PA 3QSGA 2VN8A 3ROPA 1PJ3A 3JYQA 4CLOA 4OIMA 1ISMA 1RJWA 1DLIA 1HE3A 1XU7A 4QT0A 5BSFA 3OICA 1YBAA 4WEQA 2WM3A 2TMDA 3Q9NA 4CM8B 3LYLA 3LT2A 1ML3A 1Y8QB 3QVTA 1YB1A 1JTVA 5F1OA 3GEGA 3U9LA 3M2TA 4FD3A 4XDZA 3PIDA 3TPCA 2VWGA 4J1QA 1XDWA 2VOEA 2UV8A 5B4UA 1JU9A 5C37A 3AUAA 2C20A 3S8MA 2VRCD 5JS6A 2EJVA 1T24A 3CXRA 3Q6IA 1B2LA 2H6EA 4JJIA 4N7RA 4LVUA 1QLHA 4IQ0A 3G0OA 1GZ6A 5HA5A 4YJHB 1U3WA 3DXFA 5EERA 3RC2A 1X1EA 1GV0A 1IULA 1BXGB 5CFZA 4KWHA 1PWXA 1M76A 3DHEA 2DVMA 2X0JA 1Y5MA 5JW6A 4J1TA 4DYVA 3DOJA 4RF5A 1JLLA 1O95A 3MJ4A 4BL5A 4BGUA 2HUNA 5AQ1A 3KLPX 1DLJA 1GD1O 2UYYA 2ZYDA 1HT0A 4LCEA 1I5RA 2NTVA 3W4IA 5G4KA 2YY7A 3E82A 2Q1SA 3KSUA 1MB4A 5G4KB 3ON5A 3STHA 4ALLA 3GAZA 5THKA 1PIWA 4NFHA 2GN6A 4E5MA 2DTEA 3F5QA 1DC5A 4YRBA 2FMUA 2AQIA 1BRMA 2ZYAA 2QIOA 3GZNA 4XA8A 5JDCC 1R16A 4GWGA 1WMBA 1P0CA 5TJHA 2JCYA 3PGJA 4CM3A 1PR9A 4RVHA 4CMEC 3K2BA 4MVJA 4ID9A 1T2CA 4J9VA 2ZB4A 4GLOA 4MO2A 3KSDO 1WVGA 4ONEA 4TRJA 1ZW1A 4NZ9A 3C1AA 1RPNA 4JJFA 4XR9A 3U3XA 3WGQA 5I9LA 1M66A 2X5KO 1E6UA 3FNEA 3UUWA 2WWRA 4IM7A 4J43A 4OOFA 4C4OA 3LSYA 2HMVA 3T4XA 1ISHA 1KIFA 4HADA 4RO0A 2D4AA 2FPGA 4IBOA 3EHEA 4K6FA 1LSOA 2CY0A 2I3AA 5A9TA 3IMFA 4MIOA 4XDYA 4BNKA 4LCJA 2AE2A 2GN9A 5DZSA 3CMCO 3ENKA 1IZ0A 3EGOA 4WOJA 1K6XA 3ASVA 1UH5A 3JYLA 4CQLA 4R41A 2P9EA 3JD1A 3KUXA 4JLWA 3FNHA 2E82A 4D41A 3PIIA 3RU7A 4U7WA 2PKRA 4G5HA 4I9NA 3BMQA 4YRAA 1N7HA 3AY7A 2FRDA 3Q11A 1ZFNA 2DU8A 4NI5A 4RPJA 5F1KA 3HHPA 4E31A 2DKNA 4JJGA 1KERA 3WBFA 2GPTA 3GT0A 3N58A 1P3DA 3JQAB 1I8TA 3QHAA 2JFHA 4FIZA 4IGFA 4Z6KA 3RUIA 1V9LA 4CV1A 4Y67A 2JFFA 2Q2QA 1E1LA 1U5CA 1K2WA 4OH1A 2NU8A 2VT3A 2EKPA 3DC2A 3GNTA 3ZWBA 2IXAA 1C0KA 3IL2A 3UAGA 5CDSA 2I66A 1ZMTA 5JC1A 3RWBA 1CJCA 4F6LA 4CMAA 5A5EA 1JKIA 3RKRA 5JYDA 1LLDA 4WCDA 1E1MA 1EVJA 1IUKA 1XYGA 1GYRA 4L4RA 1ZXBA 1ZJYA 2GDZA 4FS3A 4ALKA 3PRJA 4R1NA 4OHUA 1IHXA 4B4VA 3BXXA 5L51A 3PZRA 1KS9A 1SCUA 1E3WB 3ZV5A 1XEAA 4ZQBA 3IIEA 4OQZA 4FGWA 1SMKA 5FFFA 3SXPA 4U6SA 4WK6A 2V6GA 3WYEA 1ONNA 1MC5A 3GVIA 2Q4EA 4BNVA 1DFGA 2C29D 4O6VA 4F6CA 2V7PA 4DBVO 1H9BA 4LSWA 3WB9A 4H16A 3TNLA 3KXDA 1LBEA 3LDHA 1WNTA 3DOOA 1MXHA 1VKNA 4URFA 4WASA 6LDHA 1J49A 2BFOA 2A4KA 4YTEA 3DHYA 1P45A 3PWZA 1CIVA 1V0JA 3VPGA 3ZNOA 3H2ZA 4KDFA 4CM1A 4YR9A 3DBHA 2X8LA 4IJKA 4YVFA 2VHYA 3DZFA 2Q2WA 1ZEMA 4W9NA 1MC4A 4FFMA 4IDAA 3M6IA 1QP8A 1RWBA 3RUEA 1Q2XA 1Z74A 4GQAA 4BNYA 1OMOA 4EW6A 1PJ2A 1YOVA 3OIGA 1SB8A
chains in the Genus database with same CATH superfamily
3RS5A 1WP4A 5FWXA 4MMXB 2EXXA 1VI6A 4Y1FA 5EXEA 2FUNB 3U5ZB 3NIWA 4RA9A 3ZJYA 2QY6A 3WQBA 2BZ1A 1CHDA 1K7SN 2FZKA 3IHTA 3CUWA 5IJAA 5CLFA 1TTHA 3Q5EA 1G17A 2VYNA 4GS5A 1PL7A 3ZX4A 3ER9A 1G8PA 1J5EB 1JF8A 4YMSA 4N8EA 3V48A 1B0PA 3QWIA 2VIIA 2ZYTX 1DZIA 4OB7A 4L7VA 2H31A 4XUGB 3MNFA 3GLHE 3KVVA 1U3CA 3HCFA 3UHPA 5B3LA 2D3TA 4QU9A 3FIJA 4DLWA 1I2ZA 2PV7A 3IKLA 1KL7A 2PX8A 1PKEA 5LU8A 4U2BA 4FPXA 3AEQB 2YV5A 3QEBZ 2OAEA 4Y2JA 4CF5A 5ALMA 3DM5A 3ONEA 3SEFA 3VR4A 1FFCA 3QVLA 1MFPA 2HLPA 3HPRA 4Y1EA 1GN9A 4MMZB 1BN6A 2PSDA 1CF9A 3QFCA 4BLWA 1JAIA 4ZZIA 5CBPA 1PE0A 1L7EA 1OBVA 2V4MA 4UXJA 3VHXA 4NU6A 4ZVVA 2YC2C 3TSYA 1P31A 3CZ5A 4RCVA 1ZM3A 5B2EA 2ZSHA 3G2NA 3W5VA 2EFJA 1MGOA 1DRUA 5EIBD 2FF7A 4JUIA 3UB2A 3ZWAA 4MWTA 1YVPA 2ABWA 1UBFA 1QORA 1H2EA 2MSCB 3E5HA 4N5LA 3OKPA 4HLUC 4FINA 2F8TA 1X1AA 1RRPA 5G0TA 3FOBA 3LC1O 4L0DA 4NE9A 2IU6A 1UC4B 4A73A 3T9CA 4YX9A 3DLIA 4L5BA 1BFKA 2YZGA 3L2OB 3HJNA 4H7KA 5KAMA 4I2VA 3VZSA 2EGGA 1DZ3A 4FW9A 3R9KA 3R0IA 1U80A 3VI4B 1BCRA 3BKXA 1M7BA 2D59A 2V9ZA 3UUEA 5IH7A 4NU0A 2YIVX 5IVHA 1JXQA 4KYUA 2DE0X 4EJFA 4MUMA 4ROTA 4BB5A 3KETA 1R9GA 2NX2A 4JJ7A 1E9EA 3AVWA 3MUNA 2GN0A 4S1TA 1EFAA 1H1LB 3I1IA 3M3HA 3FMGA 4LRTB 2JJ8A 4XPIB 1P4HA 1SUDA 3K9HA 1UAYA 3EIWA 1RQRA 2J5KA 1CVRA 3OM9A 3UUGA 5K0ZA 4BN0A 5KSZA 4LMAA 2P6OA 4FNOA 2P5TB 3AFMA 4O5OA 2BKEA 4BP1A 4DG8A 1K08A 4X97A 3QXGA 1O9HA 1C9KA 3AX6A 3GFTA 4I36A 2XVYA 3IKTA 3OZAA 3P27A 3FSRA 3T5PA 1ZD3A 1KMMA 3MJCA 4NAVA 4CZ2A 2D8MA 3K0HA 4GVPA 3JARB 2HRCA 5AVSA 2GAFA 3CUYA 1VYTA 4PTLA 4WCFB 1V37A 1VE3A 2PUDA 3UPUA 2IXBA 4KSBA 4XFKA 5C7LO 1UWKA 2OFFA 3QE9Y 5CB6A 5B55A 4RTKA 5FOSA 1NR5A 1X1DA 2IQIA 4S24A 3VKWA 3SJBA 4Q6WA 3GP8A 1SC3A 1YD7A 1GG9A 3BWCA 4BC0A 2IZ0A 3INTA 3ELWA 1NVMB 5B36A 1KKLA 1P2TA 3KCQA 4M49A 3LZCA 3QRWA 2QN9A 3VTZA 4HDOB 2FB9A 1U2SA 2VP5A 4II3A 4PZ0A 1OHHA 3CW8X 3K09A 4OMDA 3KXLA 2Z83A 4QC2A 1XXHE 1JWBB 2AOXA 3E5RA 4I4CA 2X0DA 4AZSA 3H8WA 3MRTA 1G8KA 3MLAA 1NP6A 4R1OA 3L6DA 4H6WA 4AJKA 1E1KA 1C3EA 3EAQA 1AUOA 2QMUA 2WU0A 2ZGVA 3AQIA 1P19A 1Z35A 2PFGA 3KUCA 3LBHA 4RXMA 5FUYA 3M4ZA 4D3YA 4BWGA 1P4SA 2B8TA 2H1VA 4F84A 2WV7A 2O05A 1B14A 3OFNA 5AHOA 1KDRA 3CMMA 5LQCA 3AUYA 4K9KA 3BKWA 5JCXA 3PD0A 1D1SA 2QVBA 1MHTA 2L82A 2ZRAA 3I2FA 1ENOA 1I6MA 1RM4A 3JZMA 4EYQA 1M2EA 3R2JA 2NZJA 3OZVA 4GPD1 2VWPA 3WTBA 4RD2A 4BFSA 4AO8A 2Y77A 3R77A 4RHFA 1AXGA 2GCGA 2KX7A 1YVDA 1UZUA 5L4LA 2EF0A 4DQLA 4ISCA 3LK6A 4I1OA 1X7WB 3FRJA 3I2JA 5ALGA 1PFGA 2JFYA 3N07A 2HIGA 5TE9A 1OV4A 3A6EA 1NG1A 1J0XO 1Y1TA 2O0JA 3W9UA 4EQ6B 3FXAA 2P6MA 1EZ4A 1NN3A 1K5PA 3QE4A 3AJAA 3OLCX 3OP1A 3WGTA 4CM7A 4DJFC 3OJWA 3IVAA 3OIDA 4YJGB 1L5NA 3TINA 4UUAA 4E5PA 5DNCA 2Z8YA 2PHZA 3BJZA 1GDHA 1EDOA 1ZRHA 1GPWB 1VL1A 2YXEA 4TXMA 2Y1GA 1L5WA 1ZQ9A 2YFKA 3P9SA 4A1FA 3TQFA 4DC0A 3PXBA 3P19A 5IJXA 4B3JA 3F74A 3HDGA 1QVVA 3NAQA 1E6LA 1SU4A 2ONZA 2BCEA 2GUWA 4GQIA 3EVNA 3JZAA 2BAGA 3KVOA 2YICA 1UPUA 1GG8A 4FYPA 4GLBA 1OA1A 5ILQA 5I7SA 2P11A 1LK7A 2RGXA 4A15A 3PUXA 4YJFA 5C1OA 1GUZA 1QK3A 3MT0A 5A62A 4YECA 4KNVA 3GUVA 3N2NA 2DWCA 2Z56A 4JT2A 2HLNA 4ZYWA 2FQ1A 1YONA 2C3MA 4J0DA 4A92A 1YACA 1RHKA 1G6OA 1Q7CA 2R4UA 3O1JC 3TSCA 4BAGA 4Y9DA 3ZQKA 3O3OB 1COZA 5AM0A 2ZT5A 2PUWA 4DLKA 3MINA 3OQHA 3WA6A 1GPH1 2BEVB 2PR2A 1JTFA 1I01A 1WDWB 5ALIA 2CB0A 3SEAA 3DA8A 4MCJA 4Y2TA 2WDZA 2F1HA 5AJWA 3CSSA 2WOOA 3DO8A 3HDQA 3CJQA 3BSSA 3TOXA 4NJEB 2V3VA 2ZULA 2QQGA 4HLDA 4CM4B 3AB3A 1T5BA 4TV9A 1YZGA 4E13A 4YUZA 4AULA 4Z49A 1EWTA 2XB9A 2XQKA 3F6YA 4G81A 3CF2A 1DADA 4BVBA 1TPZA 3DT9A 2OORC 1E3MA 3ZXXA 3RWOA 2OKGA 2BM9A 2VPQA 3DSRA 3A9VA 3UK1A 1FX0A 5K20A 2FV8A 3ILVA 3WYBA 1TQ8A 4HAUA 1PJ4A 3BCRA 4D45A 3LX6A 1NXOA 3GT3A 2CF5A 3PPIA 3V8BA 1TYBE 2QM3A 4LJ4A 4J1SA 4UAVA 3UK6A 5LP6F 2FHPA 3H4MA 2R1TB 2QD4A 1AUVA 3LRPA 1I0LA 2EDAA 2HGSA 3DKRA 2MSEB 3I39X 1QBGA 1Y81A 2ZIZA 5JAUA 1FB5A 3FAKA 1T5DX 4FVTA 3UN1A 1RJEA 1Z26A 2HSZA 3O6VA 4OM8A 2ZSEA 1P73A 3EMDA 3JWJA 5BSRA 1IBSA 3VNUA 5E4FA 4DMUB 3LNTA 3IPLA 2EV9A 2PH7A 2D4HA 2H0RA 3ONVA 1C14A 3L0OA 4QOIA 3UPDA 3MJHA 1GZUA 2FWMX 5C1DA 2HF8A 1KH1A 2WI8A 3UG7A 2QDXA 4KMRA 1SRRA 3JCZA 3CCBA 3M33A 4M0LA 4PHFA 3WGHA 2A5JA 3RUAA 3N2YA 4ZQHA 1CX9B 3AP3A 2HMUA 4LEIA 1SWVA 1NWHA 1F4PA 4MDHA 1FQOA 1CDEA 2CXPA 1G9TA 2P7HA 1QGYA 1N9KA 5EWMA 2GN2A 2ZI7A 1MC1A 1NMXA 1DKMA 1LPAB 2D74A 3LQKA 2D54A 1B1AA 1PFVA 3M49A 2PMKA 4GSKA 4Z4IA 2DQYA 1XMVA 1NVUQ 1GNRA 1ZPDA 2QJFA 4JD5A 4LGMA 4E33A 4RZHA 2C3PA 3TJRA 1AQ6A 3N3BC 2XODA 3FJOA 1PJRA 2BMFA 1YRYE 1POXA 2V7EA 4JIGA 5H7XA 1L7VC 1JG6A 2XKJE 1VL8A 1C4WA 2B78A 4DLUA 1PLJA 4S0XA 3HU1A 1JWLA 3V2HA 4KQKA 1Z4QA 4TS4A 3RS3A 1W1WA 3GRVA 3M4JA 3O4RA 4I1UA 4PVCA 3WJ1A 3CNQS 7MHTA 4UTVA 1U02A 3ZW9A 3GEIA 2EKLA 1SKBA 3ZDRA 4M8SA 5ANRB 4MQMA 2AYYA 4LK3A 3OQMA 1P74A 1SD1A 4JI0B 2ODAA 4Z8YA 4I5DA 4JP3A 1U11A 1DWOA 2FZWA 5CLIA 1TJPB 1L5LA 4YUAA 1X8JA 3HWWA 5JNSA 3JRXA 3U26A 4XGIA 2B6HA 2HLDD 1PP4A 5J2TA 1CJTC 5CBKA 1RZRD 2WILA 3PA8A 1TZKA 3URMA 1TCAA 2X4GA 5KYXB 3EGIA 4R84A 2I29A 2MINB 4OBEA 4P92A 5LYYA 1DRJA 4YJ3F 3FR7A 3IPRA 4HQRA 3TH5A 5D86A 1TYDE 3T3PB 5JZVA 1BE8A 1VLQA 1YNSA 1VRWA 1EFKA 2CN1A 3KOXA 5HHTA 4CQMB 4FEEA 2AGVA 2IA5A 5U9CA 1HLPA 4RD6A 1MC8A 4NDZA 4L4YA 4F92B 3D3EA 3NRJA 1A4XA 3PCRB 2WHPA 3GF4A 4D3XA 3L0PA 1QKKA 4PG5A 5B4TA 1GCGA 1O95D 1NQOA 2D8AA 2H08A 4JLJA 3A3OA 4G5FA 3K96A 3CB2A 4AY4A 3DKIA 2Q9BA 3E7PA 1SZJG 3RRBA 1JI0A 3H11B 5EPOA 4EGCB 4LWPA 4BEVA 3DZCA 2YL2A 4FE7A 4D99A 1GPLA 2JGEA 4BCBA 3BA6A 3V2IA 3WQSB 4E5SA 4P7BA 2ZRIA 4M87A 3CT4A 1T3ZA 3OSZA 1N8TA 2BGJA 4O3FA 5E1OA 3U7JA 3WKDA 3W1WA 2EWMA 1QFZA 3IQWA 1M6WA 2PUFA 1EFTA 1UKZA 2VAWA 4ZU3A 1FE8A 4BKPA 4J1JA 3T52A 2CVZA 1UF9A 2FLVA 1ZN8A 1IHDA 4ND7A 2WYIA 3IILA 3D5QA 1Z8NA 4MVJF 4EG1A 1R74A 3OX4A 3HSKA 1ZOLA 3IPCA 3HY6A 3V8EA 2F4VB 1X15A 4C7MA 1J06A 2VP9A 4AU1A 3ACBA 1TZCA 4RU1A 2FDRA 4JNKA 2W2KA 1NE7A 1J8DA 2OCXA 2ZAOA 4FGLA 1HL7A 1H2BA 1U0HC 2FEPA 2O50A 2VHTA 3PQ8A 4EUKA 1KMNA 2QJWA 4WZAB 4C07A 4BYMA 2K4MA 3LKZA 1JPJA 5AW5A 4FMPA 4DT1B 1XNRB 3PYXA 3UH1A 3MS2A 2ZIEA 3COPA 1CEXA 1WG8A 4RDCA 5DBIA 2HTFA 4C0HA 2O5CA 4JYMA 1GSOA 1OTHA 2CLFB 4OK3A 2X58A 3HV2A 3TEFA 4X1YB 4YFYA 4EPWA 3JVDA 3MRSA 1O96A 1R8SA 5AVUA 4DWJA 4J3FA 5GJWC 2PEYA 1WF6A 2DBVO 2ODQA 1CERA 1THGA 4RMIA 1UKBA 5HEKA 1LXCA 1EM8B 3SE0A 3O8RA 1AKRA 4EX6A 5JAHA 1B0AA 1A97A 2IU0A 1KK3A 1GOTA 1SCAA 2Q5FA 3QU4A 4JA2A 5KX5B 4NHEA 3GJTA 2IH4A 3RYFB 4LXYA 4MWCA 1XJWA 2CW5A 4AAYA 4EVSA 3Q2OA 4QUBA 1CUZA 1FX1A 1PI3A 2H63A 2ZBRA 1PEYA 2IDKA 2Q29A 2R96A 3BWXA 2Q6VA 2WJYA 4GC5A 4D4GA 1A8PA 3PXCX 5EQJB 3GFRA 3I0ZA 2DCMA 2HQOA 2C9BA 3LVRE 4RF2A 2KJQA 3WL3A 4G1EB 2F2TA 4YMUA 1R0ZA 2WFMA 1R0LA 3E4DA 1DTEA 3T3MB 3QLVA 1OLUA 1WXEA 4LE2A 5AKJA 4GLJA 2F8MA 5LXTA 2HHHB 2QS9A 1I3LA 1QR2A 3KHTA 3OX3A 2IV2X 1RWNA 2QU7A 4EG6A 3UK0A 1OFIA 4HS9A 5HRCA 5D1NA 1WV1A 3L07A 3RIHA 1A0OA 1V5EA 2Q8PA 2QUBA 4Q3CA 4ENPA 3FVTA 4HBGA 4HDMB 1QJCA 4ND4A 5BQOA 4KG7A 4OG2A 4RH3A 2F9FA 5CVDA 1XWIA 1WCYA 4G0MA 5IF3A 1W0KA 5T4BA 4B8ZA 2VTEA 2ZTHA 1EGAA 1S9HA 2EYUA 5H82A 4O63O 1O08A 5L95A 2GSWA 1QTIA 5BW6B 4FLMA 2MR6A 3U80A 1N2IA 2G1AA 5DLEA 2UVDA 3LQQA 1KBZA 4HATA 4IOJA 3FGZA 4NFSA 1UOPA 1Q6ZA 3S7TA 3DMNA 3WHPA 3H0CA 4WOKA 5KX5A 5TT0A 4H0NA 1OAOC 2DQKA 4U9HS 4CL0A 5EMJA 1YS4A 2A30A 3DB2A 4L0QA 3DR3A 2IUSA 1ZNZA 2A6PA 3O91A 4HJXA 1UUFA 1GTSA 3QE0A 1F8FA 1B6TA 1DKRA 3WGMA 2YYYA 3EJWA 3EW7A 1B7GO 4WJZA 2R62A 2IYRA 2VWQA 5U4QA 2GKOA 3I9MA 3EGXB 4KX3A 3K5HA 3G2PA 4HLUA 1C0EA 3C3PA 3PWSA 2H0QA 3Q4GA 1I13A 4FDAA 1LPOA 2GAOA 4L4ZA 4KCGA 3LF1A 3HJCA 1FFAA 3HBNA 3AR6A 1SWWA 2EL7A 4P22A 3LIPA 4HV4A 3INGA 5LD2C 3F8TA 4CCYB 5A9SA 4BUZA 1E6CA 3QELA 2FY8A 4D4JA 5CX4A 4FFOA 4DLTA 4RULA 1BTOA 4M0DA 3V8NA 4KMSA 1RKBA 2ZUUA 4LYJA 1UXHA 4CM5A 2D7JA 1OOEA 2R4TA 3DZDA 3ZZTA 3WLPA 2XTNA 2W8BB 4I50A 5DU2A 3U1TA 3ZW7A 4BYGA 1FC0A 5EKXA 3DW3X 3WK6A 3DKPA 4AJ4A 2E1RA 4CIAA 2JLXA 1EFHA 3SF8A 2JGKA 1YKFA 5DTMA 1QTQA 2WSSA 2DX7A 4TWBA 1ZJ5A 1CUWA 3IA7A 3RYFA 4U7PB 3NEYA 1W36C 2RK3A 4YIKA 3ZL9A 2PA0A 3U81A 4ZT4A 1KI3A 2ZEJA 1WVMA 3SFTA 2F3SA 1WP9A 2WTMA 2WT9A 3JASA 3W8EA 3A9SA 4CKEA 3LBYA 5AKLA 5A0TA 4BOYA 2RHOA 5JS7A 3U6BA 4MEBA 2UVPB 4K5QA 1MKYA 4L15A 4Y6RA 3RSOA 3SX4A 3T1OA 3V7YA 1GNQA 2XGGA 2JCVA 3NYRA 3U4QB 4EY3A 1VPWA 1LA2A 3TEMA 4ASUD 4P36A 4LYEA 3A7EA 1XPJA 3PPXA 3OLQA 3E2PA 1QIJA 4UM9D 4IEFB 1JB9A 1F48A 2BKVA 3AGPA 4QRHA 3E9RA 2ZAYA 4L6IA 2JATA 1UMCA 5EJMA 1KVUA 2JLBA 3SSNA 3TOZA 4H1TA 3J7AC 1EE9A 3IV9A 4Q9IA 3WK8A 3ODGA 2IITA 4MQ5A 3CVJA 4DZZA 3SQWA 2PCJA 1B8VA 1RS0A 2WFLB 3MN1A 4DNFA 2IZ6A 2RCNA 3AEKA 4ENVA 2AOWA 3EVCA 1SKUA 4DIKA 4LI0A 3CZQA 1XAHA 3ZI4A 3ND5A 4G5XA 3OE4A 4P2GA 1WPRA 4ER6A 4DR2B 1UFKA 3O3MB 1JQ5A 1OFUX 2PO5A 1S2DA 2OXEA 2Y1KA 3EGCA 5AOAA 1OASA 2X23A 4B4KA 2IXEA 2E5FA 4NL4H 4Q66C 4B80A 1IL0A 5AXCA 4TWAA 1VMAA 1DP4A 1S9DA 2GZDA 4G25A 5B3KA 5AVYA 1I9CA 2Z57A 4I81A 3V80A 1CDZA 3E35A 3S2EA 2FJ0A 2OECA 3KZCA 3LE8A 3Q12A 1K0UA 1EP3B 1UM9B 1ZM7A 3R3XA 3W5IA 2GD6A 3NR2A 4KPUA 1LSSA 2FPSA 3VISA 4ZIRB 1QRRA 4K40A 3GEDA 4GPAA 3W6ZA 1VYHA 3TB4A 2VHWA 2V74B 2ON6A 4JELA 3UANA 4IO1A 4NF2A 1KI7A 3I3SR 5D3MA 4Q48A 4EFMA 4NIMA 4PF1A 1J0EA 1QVRA 3MRXA 1CLUA 1M67A 1H65A 4HB0A 5B57C 3OSUA 1W59A 3AWIA 1H0KA 4CF7A 5KIAA 3WLNA 1M0EA 3WFJA 3MMNA 2OV2A 4WLOA 5HIJA 2WJ4A 4CT4B 2IF0A 3TQHA 1LU9A 3OMWA 4W5HA 3NX4A 3P9RA 4HTFB 3SSOA 3ICCA 3X44A 1D9XA 3L6RA 4ARVA 5B6JA 4QNRA 5CT6A 4V0LA 3KEMA 4PAQA 4YA6A 2DR3A 4JLNA 2CDAA 4ESEA 5ICCA 1DKNA 1ZKDA 3FYCA 3H2KA 3S44A 2ESRA 3NKFA 4MLPA 3IDZA 4H6VA 1BGVA 4EB6B 5A04A 4B3MB 2QYSA 2WTNA 3HN2A 4W5RA 4G4JA 2GXAA 5BQ3A 2H4WA 2O7NA 3K9BA 4AMGA 1NVTA 1YI8A 4L95C 1SBZA 4MRMA 4P32A 4QRDA 1MO3A 1O8CA 2FSVC 2GAAA 3HA5A 1P4AA 4NBSA 5FR2A 4Z9YA 1R9JA 4RIGA 1ML4A 4KXFB 2QNIA 1JVSA 1A9OA 3DBOB 3AXSA 5CB8A 5CEFA 4CIDA 1Z2DA 2EP8A 2VP3A 4LY0A 1JKFA 1MEJA 2IYVA 4FYMA 4MUKA 1DXHA 2E21A 1XTIA 2A9KA 2VVTA 1FVXA 2B7LA 3PX2A 4AUEA 1F2UA 3WLFA 1HF3A 2R60A 1TEZA 2XXJA 1UJ4A 1V3QE 5JTUA 1ZITA 3U4AA 3CF4A 1QG0A 1NR1A 1PYOA 1ZSNA 2WVHA 2XSZD 4GZMA 4OFZA 5GONA 1UMKA 3OEHA 4ZZ0A 2V3CC 1A9YA 5AYVA 4Y9SA 3AT1A 4TRMA 4RSRA 4QRIA 2BEVA 2WJGA 5TGTA 1KQGA 4HYEA 4M7RA 4PO1A 4XCXA 4F0JA 3OPYA 1THZA 1X7YA 4FHFA 4JLKA 4ACAA 5IZ4A 4DWOA 1HORA 2AMJA 1X7ZA 2DBZA 1Z8FA 2H4XA 4IDOA 4U2EA 4QUGA 4GPTA 5CIWA 5DWVA 4IJMA 1RLJA 1MNQA 1ZNQO 4NHOA 5IW8A 2HIHA 2WHPB 3EUWA 3FHOA 3M6LA 3R5JA 3WKCA 3X1WA 3ZQJA 2Q5IA 5AJTA 4TVOA 2EGHA 2V98A 1HDGO 1L8AA 1S7CA 2FFJA 4H4EA 4JLPA 1SEPA 4PICA 3TTTA 1NM5C 1C8VB 3NFYA 1VIYA 4MV3A 3FZNA 1M2FA 4AQDA 2WIDA 1SOVA 4LX8A 1IXYA 1NW9B 4RCYA 5KQMA 4Z3DA 4DLLA 3PHHA 3SP1A 2FWAA 1MO5A 2XF8A 1A9RA 4MWSA 4BX9A 1IUNA 4C7XA 3ED1A 1TD1A 1CHNA 2YJ3A 1R6TA 3ADKA 3GUZA 4XEHA 4CEIA 5DSZA 2HCTA 1M2VA 3M4YA 4NEQA 1KSGA 4QXPA 1JXAA 2CDRA 1U8CB 1TUGA 1Y9EA 2P5UA 2O2XA 3QIVA 3R7WA 4JASB 4ZARA 2YWEA 4WZ6A 3O9ZA 4LF9B 2P6UA 3KLOA 1ZMBA 3NAMA 3L4EA 3EODA 1YQWA 5FD8A 2QLBA 5EHXA 2R3SA 4JZYA 5TS3A 4F2PA 3IAAA 3D7MA 3D6TB 1R1DA 3RIXA 3HNRA 1L5OA 5CB4B 3B48A 3C8ZA 1O5OA 3NPMA 3PNMA 4FP9A 4BU1A 3AUSA 3G2OA 5GINE 2RGNC 1NUUA 4MWGA 2Z4SA 4QARA 3FHTA 1JL3A 2XB6A 4LNUA 4QBIA 1F5NA 1V1MB 1A95A 1E92A 1YI1A 3GD5A 3RKUA 3V7NA 4HAXA 5B58T 3EOZA 1V5WA 4MINA 1FRNA 2CT8A 4LZJA 1ZAKA 3DPUA 1L4LA 4URZR 5EJFA 2PAAA 3WYAA 3IA2A 4E5KA 1N0UA 2QG6A 1ZMOA 4A5OA 4C78A 1HDRA 2VCYA 3DC7A 3P2IA 3PJGA 3BBLA 4KO3S 4WNIA 3E7DA 5T3YA 1NW5A 3H5OA 4FYKA 1P5FA 1S2IA 1YFKA 1C8KA 2BIFA 4A0RA 2BGLA 2IL1A 3LNCA 1XSEA 4ZVUA 1N34B 2IRWA 5KVAA 1XRRA 1AZTA 3GRFA 4PQRA 3UTCA 2Y0EA 4V1CB 5KQLA 4Y2VA 2J0EA 3WGVA 3SZLA 1Y1PA 3D6NB 2HU2A 2WJAA 4KV9A 5HCUA 2IV3A 1OLXA 1B26A 4UDOA 2WA2A 4EEXA 2YWBA 1FXWF 1QIEA 3DF7A 4HWKA 1K97A 1CJBA 4NNJA 2ASEA 3E7WA 4WH0A 4WLVA 3ZZ0A 3VKGA 2H7VA 4QYSA 2PZAA 2BEUA 1CDDA 1XKLA 2HO5A 4XFJA 2XHZA 2YINC 1K75A 2GB4A 1P2SA 1T26A 1TW3A 3CLKA 3EY4A 5B37A 4CW7A 5K0BA 3PB3A 2H18A 1LW7A 3BIFA 3HCPA 1ZGGA 3AYXB 4CFZA 4RACA 2XNSA 4PCUA 1ODTC 4Z4QA 3RADC 4CYMA 2GZSA 3WYDA 1UMBB 5LZ5A 5KTRA 1DIAA 3HBJA 1SNYA 2HRRA 3AP1A 5D85A 1CE8A 4GI7A 2RB5A 1W85A 4DR1B 2QSJA 3PUHA 5KTTA 4DNQA 4ECEA 4KQCA 1JNXX 2VDLB 3UFXA 4B3TB 1CBUA 1WUIS 1GSIA 5FOTA 2RE8A 5FDFA 1RAFA 2WQ7A 1II8B 3JQQA 4J4BA 2DFNA 1RCFA 1K68A 1L4KA 3AVOA 3WGGA 3DO5A 3TDMA 5IZCC 5CU7A 3K0KA 3P0RA 2QB5A 1N1MA 3IQEA 3GLGE 1DV1A 1S2OA 2GCNA 4IGKA 2J5XA 2WWYA 1JE1A 3MTJA 2QP9X 1MENA 3PFGA 4WDQA 2NLOA 1H1LA 2V58A 3HUDA 3DMTA 4M0PA 3ZWNA 4C2TA 1OC2A 2IP4A 3NV9A 2FG7C 4CLHA 3BPSA 3K70C 1OAKA 2CEKA 2Z9CA 5ECWA 5MHTA 4WXYB 3ZR4B 2C1EA 4Q4HB 4KXQA 3KVYA 5HBGA 3VTKA 3SAJA 5BVGB 2MSWA 4K6KA 2XRZA 2AR7A 2G1KA 2ZR7A 4QODA 1ORTA 4NE2A 4OYHA 4TZKA 2EX1A 2R7MA 4PO3X 1LX6A 5BSEA 4KAJA 3S40A 1IK4A 4F60A 5LL6P 1GIAA 3FIUA 4BVEA 2O1XA 1JLSA 1CEYA 1TTPB 2BEKA 3EZYA 2QRKA 3FOCA 1IY9A 1NQVA 5FBRB 4W99A 3W8DA 4EYKA 2ZS9A 2XGJA 3A32A 2REQA 1HEIA 4GDMA 4PC2A 3T5MA 1N8KA 5KX5F 5JSUA 4OHFA 1FJHA 4QPJC 2F64A 1I7PA 4J94A 1YQTA 2CVOA 1V8BA 4K9PA 2A4MA 1R0RE 4IX1A 2QBYB 2IEAA 2HF2A 2FWNA 5CDHA 3IURA 1P17A 1XRQA 3LF2A 3R23A 5LZ7A 2IIPA 4OLJA 3RU3A 4LFAB 2G9VA 3AUTA 4OUKX 3U44A 3KP1A 2FPKA 3L8FA 1GKYA 4E32A 2P5SA 5P21A 4DHEA 5BV2P 3K3PA 3N2LA 5JSFA 4DSUA 1EFVB 1QFJA 1TJNA 3UH0A 2B9VA 3NHSA 4O33A 1UADA 2DPXA 4FJ1A 3FSEA 3T99A 4WNCA 1P3Y1 1FDVA 1L4FA 1ZBQA 3MJVA 1I4TD 5K9ZA 1RHJA 2IEZA 4QJBA 5B7QA 3AMVA 1U2GA 1ZXXA 1UOQA 3L0SA 2PX2A 2Q7XA 3KALA 2Q0QA 4WKOA 3BRWA 2XUPA 5LZ9A 2XTZA 3DR5A 4WN9A 1C9JA 1PR3A 1ZNYA 4YALA 3WWZA 2AFIB 1O0CA 1Z4PX 1W88B 1IOZA 1H8HD 2IEGA 3AIIA 3HL0A 1NXQA 4P4GA 2B36A 3JQ8A 4E3WA 5EY5B 3AVXA 1YQDA 2Y71A 4JBNA 5DCYA 2Y66A 1MOZA 2GA8A 3GJ3A 1K9SA 4TSRA 1NVWQ 1WPXA 4AO7A 1H4VB 3RIEA 5FWXB 1UXIA 4HQLA 1G5RA 2GK3A 1TO1E 2V7XA 2VEOA 2W00A 2ZTVA 3MLBA 4FFLA 3R41A 3S2FA 4AJPA 4EWLA 5ILOA 1I2MA 1ULBA 3COJA 2HWWA 3HCAA 2M1XA 1C9EA 5CIYA 3H2BA 3A2KA 5HOEA 2PBZA 2JJ1A 4WFQA 3IIJA 4GVXA 5DBOA 3WDSA 4HNHA 2WJPA 4YJKA 1M1XB 1W5BA 2MHCA 1M6VA 2PS1A 3RFUA 3LP5A 5LYJF 4CHTA 1IWOA 3VUEA 4PINA 5DHQA 4MI3A 2B61A 1XRSB 2BBSA 3F4BA 4BV2A 2PUBA 2RCYA 4N41A 2PQ6A 1HSOA 4NG4A 4ZEWA 3Q7IA 1J5PA 4I4NA 2HBRA 4NP6A 5FA5A 4OHCA 1TYAE 2XWSA 4BLQA 1JGTA 5EZYB 4DVGA 2BFMA 3GJSA 1MR3F 3HSSA 1M2GA 3SIWA 4PANA 4FX5A 5B1SA 3PQFA 1VYUA 3T5BA 2I1QA 3WGUA 1Z39A 2AWOA 1NVEA 1GVHA 2AHOA 3DJFA 4JQYA 4QPNA 3U0BA 2R6DA 4DJDC 1K7CA 2HA6A 2RH9B 4I66A 4QDKA 3WV5A 1U4OA 3AO0B 2GM4A 2G9QA 3A0RB 2R48A 1SRQA 1GU0A 1RZ3A 5JD5A 1IHOA 2REBA 1W9MA 5JRDS 4QU0A 3S7ZA 2G3YA 3ETDA 3DFIA 1B00A 5IJ9A 2VNIA 2P9HA 3GIWA 3FYHA 1XPUA 1Q1BA 4DR6B 1V2GA 5DO9A 3HS3A 1GPUA 3RI3A 1YVEI 4K28A 1LBQA 1AKQA 4HQOA 3KL2A 4ZT7A 4QREA 4ER3A 5L8VA 1HRKA 4IKOA 3B8HA 3WQQA 1XAIA 4LY9A 3ZDAA 4OJKA 4DW8A 3R3HA 4K46A 4WECA 4AT1A 2FSPA 4Q1CA 4BQSA 1EVQA 3AXTA 3I83A 1VL6A 4M1TA 1PVOA 1I4OA 3FD8A 5L7TA 3H9GA 1BU5A 3W79A 1EK1A 5H1YA 3THWB 2REQB 2Q4RA 2IPMA 4WINA 1BDBA 2OO5C 4NNOA 3IP1A 2O2JA 1BQ4A 1UINA 1DGQA 2ZUEA 3QLTA 1FYVA 1NT4A 1R00A 3TE7A 5KWJA 4Y9TA 1TLLA 2ERYA 2HPHA 4EHKA 4F5DA 2EBWA 3L82B 3V9AA 2XT0A 3ANYB 1ZOOA 1NYQA 5E2BA 4FZ3A 1C9NA 4L9AA 3A9TA 5CT5A 4ARIA 2B1JA 2XCSB 1RC1A 3QEMA 5GMOA 4RZQA 1K9VF 3CA8A 3INYA 3TR0A 1ZL0A 3G6WA 2VJYA 2AH5A 4IEEA 2NTNA 1C4OA 2Q4OA 3ILSA 3FVWA 4UOQA 4QTYA 2WD9A 3QWBA 2O2EA 3DL7A 2OSVA 3FETA 2MWMA 4BXOA 3I2YX 2DUUA 1V4NA 1XZAA 4P34A 4WD3A 3OJ0A 3EN0A 4PN3A 3BMNA 5CFPA 2P1RA 2IYFA 2VYVA 3FDZB 2YJGA 5CVCA 4AMYA 4DNOA 3TIVA 2NVUB 2J6BA 1WS6A 3VVCA 3PFKA 2X0EA 3HDVA 2X3UA 4LHEA 1HZZC 4IDGA 1XZIA 3W1VA 3FPLA 4H3VA 2WQZA 4H7EA 3BA1A 1ODKA 2ZSUA 4HP8A 3C7AA 1NMQA 1WD7A 3KQPA 1UEJA 2DPHA 3D02A 4FXPA 3IVRA 3PU6A 3JQ9C 4MB0A 4U7HA 2J9RA 3ND8A 1DXYA 1O96B 3NIGB 4XIFA 4YT4A 4AZTA 1IHUA 4KYTA 1L5QA 5FADA 2J6CA 2FPIA 3CEMA 4MJ3A 3WK9A 1X77A 3GBSA 7ADHA 4WLUA 1EMDA 3DQQA 4QU8A 4NNPA 3V1YA 1XN1A 4AP6A 4X84A 4DM3A 3U56A 4AP9A 1G5IA 3KJEA 1Z5PA 1JX6A 1DQNA 2JFQA 4WUTA 1EQAA 2WMOB 3G0CA 3MQ2A 2XWJI 5I4IA 1Y5RA 3I53A 1TADA 4P58A 3ZDBA 3DBHB 4I9UA 3R5SA 4D9JA 1T1EA 3JTEA 2D06A 3EEQA 3Q98A 5HKAA 1OHHD 4LF7B 3BAZA 4UM9B 5ALUA 4DMKA 3DAOA 4LZWA 4IV5A 4ALNA 1ICIA 5FPSA 4D26A 2Y1EA 2ZUSA 1ZJZA 1X2EA 2RAPA 1SC9A 2V7QD 4Z7NB 4HF7A 4E14A 1PZGA 1Z34A 3HWX1 1HDZA 2NUTA 3G0BA 3JD2A 4PHHA 1GO2A 3VNSA 4B2LA 2PKQP 1JFTA 3AZOA 2ZCVA 1J8FA 4HEA1 5CGQB 4F6RA 1AMUA 3MCAA 3KFXA 5ES4B 2FPLA 3ZGOA 1KZ6A 1QHEA 1KI6A 1A2OA 1J2YA 1KKMA 2HM7A 1P9OA 2NYRA 3GLQA 4ZT3A 4A26A 2JI8A 3FYTA 3O31A 3R44A 5HIMA 2PX6A 3UGTA 2PGIA 2QDKA 4RPHA 3SKXA 4YXWD 4I7EA 1D2CA 3GQBA 3SX0A 3Q87B 4INPA 4UEJA 3CO0S 4GOND 3ZWXA 2YOHA 4V0RA 4EHDA 1DU4A 1OXBB 4JC0A 1I1HA 4Z3OA 3TI7A 4PR0A 3DE5X 3DLBA 2CNWD 3NBAA 3S2UA 5JV5A 4CKWA 2J3IA 2OFWA 3IE1A 3D3KA 1R0BA 4NYIR 4MS3B 1T3TA 4M9CA 2VSNA 4UE6A 4ZFNA 1RPZA 1ELOA 2GVDC 4XI9A 1ZGCA 3MFYA 4KPGA 4V3CA 1JW9B 1PLLA 2XWBF 4P7JA 2QLMA 5L53A 1OBCA 4G24A 3DBLA 1WB6A 2FAXA 3FTEA 1M2VB 1L6IA 1X9GA 1EVLA 1XZPA 3VPFA 1I0IA 4MA5A 1U7HA 2JCGA 3KD2A 4LJAA 1FP1D 2YZ7A 5ENZA 2IBTA 2XW6A 3SOPA 3SWWA 4XOUA 3DCNA 4XIJA 1J56A 2XNDD 4M1MA 1SXJE 2V65A 3NUGA 3W8NA 3OCCA 4ZAGA 4C3OB 1I3CA 1C3OB 3OVMA 2IHJA 4RGQA 1Y4DE 1Y9DA 3IESA 4IZOA 4N03A 3I9JA 5JHHB 3T7SA 2E6KA 1P7WA 1KXZA 1QX3A 2PKXA 3I1FA 4KAAA 3SKVA 4D4MA 4W5NA 1QYRA 1Z62A 1KBOA 4EYOA 5FNVA 2XCTB 4YQZA 5FI3A 4RTNA 5C8YA 2JBWA 4M1EA 2PSJA 4JJ8A 2PE5A 3NC0C 3AR9A 3A9CA 1W19A 2CKMA 4LGCA 5C34B 3RVBA 4ND8B 4UVGA 4M1ZA 5AM5A 3MFQA 3VDXA 1KYTA 3GW8A 4QFCA 2YBEA 2C82A 4OHZA 2ZUFA 3GNSA 2W2LD 3LP6A 4QUEA 4KPFC 4YRIA 4RADA 3I30X 3H42B 3Q88A 5I4BA 3FKQA 4POAA 3TRIA 3JYHA 4CQNA 1SUBA 1NXWA 1D09A 3GDHA 2JHFA 2XAAA 4W5TA 4ZYYA 3BORA 1SBYA 3IEMA 1Q22A 1D4ZA 1ESDA 2QMYA 5H81A 3TZEA 2R7LA 3ZTWA 5I4KA 2QYOA 3IBGA 3JD0A 2ZLBA 1G98A 2DJ5A 4U5QA 3AG6A 3IB3A 5TMDA 4DIOA 5ADHA 3ZS9A 4GUDA 1B3RA 2AG8A 2FN9A 3DWIA 2OCKA 2QHXA 4ALMA 1UZNA 1RRKA 2LKDA 3H2GA 3BRWD 4O8CA 3TL2A 2PQ0A 2BFDB 2QT0A 2XB2A 4DIUA 2RGNA 3UT6A 3EDQA 4H2DA 4XKJA 3WKAA 5ERYA 1RJ9B 2Q6LA 2ZYSA 1D8AA 4NDNE 1F3LA 1EXMA 2JZOA 1HLFA 4NZZA 3T12A 4NESA 2G40A 5K8TA 3CEAA 3O4GA 1L7QA 4W9MC 4NYJR 3WB2A 2J33A 1RFGE 2ENUA 1GPKA 5MF6A 2A1UA 1OILA 4FZVA 3WHIA 4LDQA 2AFIE 1JQEA 2ZUCA 3RR2A 1XVVA 2VRNA 3CEPB 3E03A 4JKIA 2VQ3A 3VHRA 1E3QA 5DM2A 4DSTA 1VI2A 1O97D 3DXYA 4YYZA 3ZTTA 3MIIA 4GECA 3R76A 1CP3A 2WD7B 1XJCA 4GOJA 3RVLA 1SHTX 3T1YB 4QDUA 1G63A 5AHRA 1HDOA 1DX6A 1L7OA 2NNWB 3BF7A 2O57A 4NMLA 4S35A 1LFDB 3MYYA 4K9DA 3AVUA 1E4EA 4EFNA 1ZM4A 2B5OA 3BK2A 2DJIA 1HG1A 3QX8A 2YUTA 2YTZA 5DNWA 4TV9B 2CDNA 1T0BA 4TLLB 3RRXA 4RKWA 5LZ2A 3QMWA 5EN4A 4XVQA 4DSAA 3V2UA 3P96A 3NM5A 1H85A 3MWKA 3U4CA 3F9IA 5MDHA 1NFRA 4C0KA 2BMAA 3S68A 1BA3A 1COWD 2HR1A 3L0IB 2AFHA 3K72B 3T9FA 3PEYA 4Y7DA 1XU4A 1QH0A 4IIFA 3ZE9A 4LGYA 3RNOA 2ZJFA 1UEXC 4KUEA 3VZQA 4FGZA 3SI7A 3ZHYA 4AIRA 2OLKA 5CLQA 5IT5A 1JTEA 5BNWA 3TLCA 4XB2A 2GRAA 1SPXA 2YN0A 2ILVA 2P9GA 2BE7A 2XE4A 2ZP1A 3GL9A 3EYWA 3KPWA 1KDPA 3FHJA 3P5BA 3PGVA 4PG6A 4RMJA 3G23A 1QQ6A 4O2AB 5KNBD 1Q0UA 2PGJA 4PW0A 5LJIA 3RYCA 2JK0A 4PC7A 2I6QA 1C3LA 1UBCA 3I01M 3L5KA 4PRZA 4WZZA 4HGOA 5EMLA 3VSEA 1HNXB 4TGLA 4XJSA 3DE6X 4F56A 3QFSA 1YIOA 2O8DB 4Z1MA 2EBUA 1A72A 3BIOA 3KK0A 2CMFA 1BWRA 3HJTA 3X3HA 2OGWA 4OP3A 4JQCA 2IYYA 5B1EA 2O7RA 3P1JA 5K45A 1N7IA 3L8YA 5BSHA 3EGDB 2AF4C 5FWYB 1ZSYA 5CA1F 1PLKA 3B5IA 1T2DA 1P62B 1RP7A 5TQ2A 4FYIA 1J24A 3IR5A 2R7AA 1D5CA 4O4IB 2ZCJA 3LPNA 5H83A 1ZVJA 2P9ZA 3I5AA 4LJ5A 3W5H