1N7HA

Crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
339
structure length
331
Chain Sequence
RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the MUR1 GDP-mannose 4,6-dehydratase from A. thaliana: Implications for ligand binding and specificity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
molecule keywords GDP-D-mannose-4,6-dehydratase
total genus 129
structure length 331
sequence length 339
chains with identical sequence B
ec nomenclature ec 4.2.1.47: GDP-mannose 4,6-dehydratase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n7hA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1n7hA01
3ZWVA 4BOYA 3T4EA 3ENNA 2ZCVA 3SJUA 3D7LA 4BNZA 3NTOA 5FI3A 4U6QA 4JJFA 3DTTA 3QLJA 1QR6A 1R0LA 2QG4A 1GZ4A 4GWKA 5TRTA 1VC2A 1NX6A 4XX0A 3ZWMA 1ZXBA 3FNFA 3RUCA 3V2GA 4L4XA 1DEHA 4E6PA 3NDRA 3TOXA 1P0CA 4MP8A 5G4KA 2YUTA 4TRRA 2AMFA 2FZEA 3ICCA 3ST7A 4PZDA 1KEWA 4RVHA 5KJEA 1LDMA 1AHIA 4IIVA 3S2IA 3KSDO 1GY8A 5L7WA 4CV1A 1PTJA 1R66A 1LI4A 4FOSA 3TPCA 2X6TA 1WAMA 3QWAA 3HDQA 1M6HA 2NU6A 5B37A 4DXHA 5B4UA 4M1QA 4EEXA 3OIGA 1U5AA 2RH4A 4ZVVA 3DDNA 4IM7A 1MG5A 2GZ2A 4AICA 5JMPA 1OC2A 1BW9A 4YXFA 4M49A 2PA3A 3A9WA 1V3TA 4J4BA 3LC2O 1T2EA 4BMNA 1SBYA 4RGBA 3INRA 4GWGA 3JQAB 3PZBA 3FWZA 2I3GA 2OL4A 3VVBA 4MKRA 5CPBA 3GZ4A 3PHLA 2Z5LA 4FJ0A 5JYDA 1J6UA 4JBIA 1EFLA 3H9QA 3LLSA 3ENKA 5A4DA 2EP5A 3L9WA 1NP3A 2CNBA 4DYVA 2P4HX 3PYXA 1NFQA 5JMWA 4IJUA 2OXIA 3ZWOA 5CG2A 3OJOA 1DBVO 1OAAA 4MVJF 4F3YA 4DBZA 3JQ7B 3AM4A 3O8QA 3VKVA 4YQYA 4FFMA 4QTZA 3DFUA 3BTOA 1Y5RA 1YBMA 4ALIA 2XXJA 4CQMB 4PLTA 3ZH2A 5A9RA 1B0AA 4QO8A 4YRAA 4PLWA 5L9AA 1SB8A 4IJWA 4AJKA 1X14A 4A27A 4R68A 1K2WA 4IGFA 4OYRA 3ZWBA 2LDBA 1LSUA 2J3IA 3GA0A 3KSUA 4J7XA 3K96A 4LSWA 2CF5A 4IJKA 4YTEA 1TB4A 4BKUA 3JTMA 4BO6A 2B4TO 1I36A 5CHEA 2AE2A 1X1EA 4A2CA 1N8KA 1UAGA 5JO9A 1RM0A 2YV2A 1HDOA 2Y0CA 2NVUA 4XRGA 3S8MA 2GZ3A 4CMIB 1PU2A 1UDAA 1ZW1A 2WD8A 5TT1A 4GAEA 5KJCA 4YT4A 4GLOA 3SBOA 1DO8A 3OEYA 2OUIA 1B3RA 2GO1A 1W0CA 2CSUA 1LSSA 4NR0A 2HAEA 2OP1A 1I2BA 1MC5A 2H5LA 4XYBA 1UXIA 5J23A 4NG5A 3ONFA 2VHVA 3JQ9C 3TRIA 1A4IA 2WD7B 1T25A 3P19A 1U3WA 3E9MA 1Y8QA 1DAOA 4BV9A 4B3HA 1QYWA 1OI7A 2G76A 2Y1FA 3R0IA 4FJ1A 4WE3A 3FI9A 1C1DA 4FGSA 3UFXA 3G49A 3Q3CA 3LT2A 4B4VA 4ZA2A 5IFLA 4LK3A 4RL6A 3H65A 3I9NA 1KETA 1Q7BA 3DFZA 1UDCA 4OAQA 3T7CA 3RUAA 2P9GA 1HDCA 2A35A 3OA2A 2CDAA 1EK5A 3I4CA 1VL6A 2JKVA 2G1UA 3EDMA 1I24A 3OP4A 4CM8A 1CERA 5IN4A 3WBBA 4DGSA 3NDIA 2R00C 2H6EA 4OXNA 3NTQA 4I5GA 1DHRA 1I3NA 2D5AA 3PYMA 1QORA 4OKNA 3W6UA 1ISHA 5A9TA 5KIAA 1NVGA 1E1MA 2X22A 3GVIA 3JQGB 3PJGA 3QY9A 2AQHA 1I2CA 3GRKA 4BGVA 5ES3A 2G82A 5FEUA 1PWZA 4IUYA 2C7GA 2DUUA 3I9MA 2R6JA 4ITUA 3C8MA 3NKLA 1IHYA 3F1KA 3OEWA 4CM4A 1T1RA 3NTRA 4FOOA 3I1JA 4GKBA 4AJ1A 4J6FA 5G0SA 1YWGO 5KVSA 3ZWNA 1ZMOA 1HYEA 3F6YA 4TQGA 4WEQA 1I3KA 3KTDA 4L75A 2J6IA 1L7DA 5FFFA 4CUZA 5DBGA 3DOOA 4EZBA 2PGLA 3ON5A 4BL5A 2Y1CA 4XJSA 5L95A 5ENDA 1R12A 3E5RA 1JAXA 3VH3A 3ZV5A 1DFHA 1KVSA 4QFDA 4RZHA 4Q3CA 4BS9A 3HUDA 2BHLA 3GAZA 3OIDA 5IDWA 1P3DA 2LDXA 3WOHA 4CMKA 2EW2A 2JL1A 2PZMA 1EDZA 1PGQA 2AEJA 1KERA 1Q7CA 3E5MA 3NUGA 4I8XA 4A0SA 5BNIA 4K26A 3UICA 1EFKA 1MG0A 4YJGA 3WR5A 4ILKA 3L4BC 3K30A 3O8QB 4RO0A 4Q39A 4J1TA 5KNLA 1WDLA 2AQIA 5FI5A 3WJAA 3TZHA 3SX2A 3WGYA 2VN8A 1E6EA 3ZNNA 3WG9A 1Y8QB 4FD3A 3D1LA 4DMLA 2V65A 5KOIA 4CM5A 3CKYA 4FFRA 4R1UA 3EVTA 5GZ3A 3ZV6A 1KC1A 3MJTA 2O2YA 3MOGA 3TDKA 4FSHA 4TZTA 9LDBA 3RCBA 3BAZA 3TNLA 2ZATA 2IZ0A 1B26A 1GZ3A 2E37A 1X13A 4GBJA 4NBRA 4EDFA 3I9JA 3H9GA 3W8FA 1X7HA 2HU2A 3I52A 4ZJUA 1DRVA 2EERA 4GLLA 2IODA 1LC0A 4Z0HO 1SAYA 5L4NA 2VYVD 3DHEA 5LDGA 3JD0A 3B20A 1EVYA 2PH5A 1HEUA 3RWBA 3JQ7A 4PZCA 2H63A 3I23A 5G0WA 4DLLA 4E2ZA 2NQTA 1YOVA 4PG4A 3S1LA 3KYDA 4R3WA 4BGUA 4XQCA 3K31A 5G0TA 5A04A 3U4IA 3AM3A 3AI2A 2GN8A 5COQA 2C2XA 3GNSA 4WCDA 3PPIA 2C0CA 2WE7A 1EVJA 3F4BA 2E4AA 7MDHA 3VH1A 6ADHA 4KDFA 4XEHA 4GGPA 3ZU5A 5TX7A 1ZFNA 3MJSA 2OZPA 2IYOA 4F45A 2EWMA 2J5KA 2PGJA 3IJPA 1GU7A 4QFCA 4XIYA 4BO2A 1BGVA 3P2OA 3DHYA 4CM9A 5IDYA 1H6DA 1ADBA 4DPMA 1DJQA 4PGFA 5KVQA 5KTKA 4J49A 3PHHA 2VRCA 1Y9EA 4DIBA 4NFHA 3SXPA 3AUUA 1RYDA 3WYCA 4GX2A 4NJOA 1O89A 3ZU2A 3LC7O 1IOLA 1T24A 3HFSA 5THKA 2TMDA 3LC1O 3U0BA 4MIEA 5AOVA 4OIMA 1DDOA 3H3JA 5T64A 1Q7GA 1PJTA 4MVJM 3VTZA 4A5OA 1PR9A 4EJ6A 2NVBA 5TQVA 3HDHA 2DLDA 4IDGA 4JP2A 4GX5A 3CXRA 4IY1A 1SO8A 1JKIA 3WQRA 2NU8A 3VPFA 8LDHA 3C1OA 3FSRA 3AU8A 1IE3A 4CQMA 1RM4A 3WGHA 1GL3A 4OO3A 3BYZA 3QVTA 2A4KA 1Q0QA 1G6KA 3A28A 3FD8A 3WGGA 3OJFA 4DPLA 4DPKA 2ZYDA 4M54A 1O95A 1NFFA 3CMMA 5T57A 5K6AA 1SCUA 3GMDA 3QJ5A 1IYZA 5FF9A 1PIWA 1N5DA 1GD1O 2W2KA 4E5PA 1QYXA 2VRBA 1WNTA 1P1RA 1E3WA 3IIEA 2Q99A 4IS2A 4FFOA 1NWCA 2Y0EA 1M67A 1Q1NA 1GQYA 1P9LA 1H2BA 4CMIA 4BO3A 1EQ2A 3FNHA 3KHUA 4B7XA 1NVTA 3E1KA 4JK3A 4TKMA 1Y5MA 1XU9A 1NHGA 3PI7A 1AN9A 1EZ4A 2IE0A 4PLVA 3O4RA 2D2IA 1L7EA 2O7QA 5DDIP 5TGDA 3K2EA 5B4VA 4RPLA 3UW3A 4JJGA 3GR6A 4W99A 3GFBA 3IQDB 1HETA 2EJVA 3TL2A 4OXKA 3U5TA 3RBXA 5I9MA 3QV1A 4TKLA 1M6WA 7ADHA 1PEDA 3PGJA 1LSJA 4U6SA 1P1JA 4Z3DA 2VYNA 2O3SA 3DZGA 3W4IA 2O3QA 4MVJA 4DC0A 3RUEA 3BMNB 1U2GA 4J9VA 2C20A 3U4HA 2W4QA 2VHZA 5L7TA 1XEAA 4AJOA 4XYGA 2JFHA 3ETDA 1ZUD1 3FCOA 3VKUA 2O2SA 4RLHA 2O3UA 4KZPA 2QHXA 4TVOA 5EIOA 1RWBA 1ZXLA 4I5EA 5GY7A 1LDNA 1WWKA 5F3RA 1FDTA 1I8TA 5L4LA 4KOAA 4QEDA 5DCUA 4IGEA 5JFOA 4CMEA 4ROSA 2EGHA 1Y6JA 1MX3A 1YS4A 4M86A 3GFGA 2Z95A 4BKOA 3Q6IA 1W6UA 3GNQA 4FDAA 1GQQA 4EEZA 3SEFA 5BQFA 2FY8A 4XDZA 3A14A 1C0IA 4UVGA 1F17A 4TRJA 1LLUA 1GPDG 2B4QA 1YB1A 1JN0A 4MIOA 4CJXA 3HQ4O 3C7AA 5GZ6A 2AG5A 1Y8RB 2CY0A 2YDXA 5DOVA 4MVJP 1M76A 2GUGA 4PVCA 3G3EA 1YDEA 5C7LO 4AJHA 1EBFA 2RH8A 4RF2A 3ZV4A 3GNTA 2AE1A 3C85A 3UCEA 1GV0A 1ZJYA 1E3SA 1NHWA 2B0JA 1V9LA 1J49A 1ADGA 5AVOA 3AWDA 5AXCA 4UVEA 1JKFA 3JQ9A 4EGFA 3WB9A 1XSEA 2BMAA 2NTJA 4E31A 2VUTA 1I3MA 4KQXA 4XJTA 3Q9UA 4NK5A 3FRJA 2HLPA 3DBRB 4PRLA 2OO5A 5T67A 1YBAA 2CUKA 4J16A 3UOGA 3VH2A 5BSEA 4BKRA 4Z9YA 4CL3A 4YT8A 4K1LA 4WLFA 3GHHA 3HE3A 3VZQA 2O23A 4E5MA 4XR4A 4H15A 1ZKMA 4LGVA 3UVEA 3ZU4A 2CMDA 3AFNA 3GDOA 3LZ6A 1K0UA 4FPXA 1Z82A 1F8FA 3EYWA 3EZLA 4XR9A 3PLNA 2UDPA 3U62A 3IDSA 4TRNA 1D7OA 3GN1A 4B7UA 1EBUA 2E82A 5DN9A 4CM9D 4NK4A 2PV7A 1FDWA 4IQ8A 1PQPA 4RPJA 2Y68A 2BLLA 3HDJA 3AY6A 3EGOA 1BXGA 1GUZA 5FYDA 1PS0A 4FN4A 1FDUA 4TZKA 5U1PA 4CV2A 2J8ZA 4I9HA 4RPHA 2FZWA 1VLLA 3OJLA 3ZI0A 3L4SO 4DQVA 1YDWA 3ZWCA 3MOIA 1H0KA 3GDGA 3DZFA 3NDJA 1HDZA 2P4QA 3HWRA 3RUDA 1R4MA 2D8AA 3ZHYA 2NUAA 3I9KA 4UUPA 4BNMA 2I5PO 3AOGA 4OGWA 2Q45A 3JQCA 3LT1A 2GERA 3OSUA 4K28A 5BSHA 2ZK7A 2IXAA 3E9QA 1NPYA 1WXDA 3WX0A 3SJ7A 4QT0A 3CH6A 1IUKA 4WLNA 4GI2A 1N7HA 2AHRA 3BXXA 1PL7A 2I6TA 4MO2A 3WNVA 3TQHA 1HWYA 1T2CA 3L6EA 2YDYA 1QYVA 4WLVA 4CLRB 4PG7A 4KDEA 4WPGA 4BO0A 2DBRA 2WYWA 4TSKA 4E13A 3CEAA 1XHLA 1ZK0A 3B70A 2AEMA 2O3TA 3E18A 1CETA 3ZWPA 2FR0A 5IAAA 2X7HA 1RPNA 4YJFB 5DOZA 2A94A 3H6KA 4I1IA 4ND1A 1ZK2A 5JXWA 3ZW9A 3ZU3A 4MVJD 4YPOA 2VTEA 3D5QA 3KSZO 4O63O 4N18A 1U28A 3ZHBA 5I7VA 1VKOA 3HB5X 1GFSA 3DAGA 2BGMA 1WMBA 2HMSA 3NEPX 3GGGA 4HFNA 3ROQA 4BQPA 3M6IA 5BNTA 5DNAA 4DREA 3OMLA 3F4LA 2VTDA 4GSLA 2Q1TA 4A26A 4NBUA 4XIJA 3JYLA 1ZMTA 1N9GA 5KWEA 1LDEA 5LDHA 4IDBA 3OIFA 1E1NA 3P5SA 1GCOA 1H9AA 4ALKA 1V8BA 5G0UA 5ILGA 3UF0A 3PFFA 4CM8B 2Q3EA 4GMFA 3VZSA 1PGOA 3B1FA 4C4OA 1ZBQA 1U8FO 3UCFA 4CMEC 1R4NA 1Z7EA 3L07A 4J91A 5JSFA 4PLHA 1ONOA 4CM6A 3OICA 3K9QO 4BKQA 2CD9A 2DPGA 1FJHA 4MDHA 2BGKA 1PZGA 1MGOA 2RHCA 2DPHA 4D46A 3RFVA 1EK6A 5CDYA 3CTMA 1U5CA 2YV1A 2WMDA 1NNUA 2FSSA 3AI3A 3OF2A 2C29D 3MJVA 3ZN2A 3RU9A 3DEYX 3GGOA 1GEGA 4A73A 1H93A 1BHSA 4ONEA 1KVQA 1Z73A 2F1KA 2WYUA 1QMGA 2CZCA 3D4NA 1E5LA 4JX8A 2VQ3A 4R54A 1U3TA 4YAKA 1T2FA 4MVJE 1YH3A 2UV8A 5L3ZA 3ZHZA 2E49A 1VRWA 2VT3A 5CAEA 2FSVA 3BMQA 3B6ZA 3BA1A 2VWGA 3GG9A 1D1SA 4YAIA 5A03A 1ZEJA 1Q2XA 4WKGA 2PZKA 2YHIB 3OQBA 1YGYA 1FF9A 2DQ4A 3AK4A 2O4UX 4BKPA 4BQRA 4ND5A 1JAYA 4MJLA 1WZEA 3NT2A 1HSOA 4J43A 4L73A 1O6ZA 2W98A 5EESA 2ZQZA 2VOEA 1UZLA 3QE3A 4E12A 2P9EA 1EE9A 1TEHA 1E77A 5L7YA 3TSCA 2RAFA 4LVCA 4ND2A 4MP3A 2ZB8A 5A3JA 2C5AA 2P68A 3ZWXA 2C5EA 1J5PA 3GF4A 1DHTA 1B8VA 3QP9A 1LLQA 4Y98A 3CE6A 2HQ1A 1UAYA 4A7PA 3PQEA 4KWHA 4GMGA 3HADA 4IS3A 4RDHA 4JJIA 3AI1A 2FPIA 3G1TA 3WJ7A 3ANNA 3WLEA 4MVJG 3BHJA 3ITDA 1DC3A 3C7CB 4M8SA 4NJMB 1LLCA 4JGBA 3AY7A 5KVVA 1CRWG 4JIGA 2GPTA 1MP0A 3BIOA 3ADOA 1D4FA 1A4UA 3U3XA 1G1AA 1ENPA 4BIIA 2NVWA 2BGLA 1UUFA 1KEUA 2EHDA 2EP7A 1F14A 4NI5A 1UXGA 1ISFA 2V6FA 3PK0A 4ND3A 3WLFA 3T7EA 1H6CA 5CG1A 2JAPA 3D3WA 3HNPA 4TWRA 2JD0A 4NMHA 4CL8A 1A7KA 1R6DA 4BMVA 5JDIC 4FW8A 3PDUA 1Z74A 1UXHA 4F6LA 1X7GA 4B79A 1N1GA 3ZNPA 2CFCA 4NDNE 5DULA 2BF7A 3H5AA 4RPKA 1XR3A 3K92A 3QVOA 4NBVA 3ZV3A 3JD2A 3I83A 1JVBA 4GGOA 1SOVA 3GK3A 5CPFA 1DIAA 3KBOA 4NIMA 3ZGYA 2X9GA 4OJNA 1JLLA 3B1KA 4WCFA 4CLOB 5CDSA 5IXSA 1YL6A 1E3IA 2TMGA 4F6CA 4CODB 1R37A 5IZ4A 3NJ4A 4KTTE 2QYSA 3PJDA 1KVUA 5TLSA 1H6BA 1W73A 3H9JA 1PQWA 4R16A 3R1IA 4LCJA 3QVXA 5C37A 1JKJA 3PZRA 3PHJA 2BKAA 2BFOA 4AJIA 2ILTA 1DRWA 2CVZA 4XGKA 3DC2A 4BUCA 3D3EA 1V35A 3VDRA 1NAIA 2VWPA 5DT9A 3ZZNA 2AG8A 1CQJA 4KQWA 2O3RA 1ZSNA 3H4VA 3I6IA 4Q3BA 1D8AA 4XKJA 4WCFC 4ZQFA 4KUHA 1DLIA 3LK7A 2HK8A 1IPFA 3TL3A 5HTOA 2FRDA 3FBTA 4BNJA 4E2WA 3JD1A 3JYPA 1A72A 3C3XA 4OL9A 1FXSA 4W7HA 3IKTA 4TMFA 4XGIA 4BVAA 3M1LA 2X86A 3WFIA 1LRLA 2YHIA 3PXXA 5A1TA 3EVNA 2B35A 2Y93A 5JYEA 1P44A 4NHEA 5DBFA 4J4HA 3PGXA 4J1SA 3WGQA 2ZJ0A 2UVDA 5T6BA 3O38A 3AM5A 4CLEA 3CIFA 1DC4A 4GL4A 1PGNA 4DWVA 4II3A 2EKPA 4HP8A 5DF1A 1GQ2A 3P2YA 3JQFA 1A7AA 1ENZA 4EJMA 1P77A 3E8XA 4XA8A 3DBHA 3DBLA 1NPTO 2JCXA 1EUZA 4PZEA 4RF3A 2X9VA 1QLHA 2B5WA 4P22A 2ET6A 4ZHSA 4BO1A 1FDVA 5I7SA 2BI8A 2RHRA 3LF2A 1W8DA 1HF3A 3PJEA 1T4BA 2C59A 2HK7A 1C0KA 2EIHA 3CZMA 4HX5A 4Z0PA 4MVJH 2ZIZA 2AQKA 4D42A 1H9BA 4OOFA 4JROA 3ZWAA 2R2GA 3HB4X 5TSDA 5K9ZA 4XQ9A 3EW7A 1ZVMA 2HDHA 2DUWA 3I3OA 2IXBA 4I08A 3QRWA 4GVLA 3GZNA 4XQGA 3TF5A 4RJTA 4UULA 5JLAA 2JD1A 3U9LA 2JAHA 1TXGA 3PTZA 4G81A 4L0QA 3STHA 1LEHA 1X1TA 2YY7A 3QWIA 3K2BA 3F47A 4I5FA 1VL0A 4BNVA 4LCEA 2D4AA 1IL0A 3P7MA 4H16A 1SEPA 4K6FA 3R6DA 2HO5A 3MJ4A 3G79A 1ISMA 2V6GA 3BMCA 2DTXA 1B15A 1QKIA 1YRLA 4GSKA 4P38A 1ZO8A 4TROA 4AJ4A 3V8BA 2GDZA 4HXYA 1EUCA 5A02A 3JYNA 2FHSA 3DL2A 3WGTA 3H9UA 2X0NA 5A5FA 3FPCA 4Y9DA 1K6IA 2EJWA 4QUKA 2PWZA 4XGNA 1QXSA 3Q9NA 1HZJA 4LW8A 3E82A 1KBZA 5H83A 2W8ZA 3BMOA 1I3LA 3A06A 3KM0A 1GV1A 3N7UA 5DP1A 4R4JA 2BD0A 4EW6A 1BW9B 5CEEA 1T1SA 3FHLA 3D0OA 5HRUA 5JDCC 1IZ0A 4FGWA 4RVUA 3INTA 1E1LA 3PIDA 4CQLA 1T2DA 1PZEA 2Q2VA 4L9RA 3UHAA 2PD4A 3KXDA 2IYPA 2BI7A 1TLTA 5KJ1A 3KVOA 1YJQA 1G0OA 1WDMA 1SC6A 1BXGB 4J2OA 2P5YA 2O48X 2QRKA 3BTVA 1ZEMA 5EINA 4R01A 5ER6A 3H3FA 1EUDA 4YDRA 3GGPA 3KO8A 5COAA 4C7JA 2ZTVA 4NFSA 5F5NA 4HFJA 3RC7A 1NAHA 1V3UA 3E6AA 4UAGA 4RQTA 5DZSA 2G5CA 3W8EA 5CDTA 3HHPA 4J0EA 1P31A 5BR7A 5I8WA 1N92A 1YE3A 2B69A 5CDUA 5KJ6A 1NQAO 4LRSB 1YONA 4PLGA 1DIBA 2A9FA 3WWZA 4UVHA 3L77A 2VZ9A 2H9IA 9LDTA 1KY5A 1PJBA 3AUTA 3K5PA 4YQZA 5ITVA 3L6DA 3BTUA 4PLYA 4BGIA 5A9SB 2ZYGA 3JQ8B 1X15A 4UREA 4YA6A 5EN4A 4DIFA 4Q3DA 3KRTA 4CMAA 3GEMA 4BO8A 3DBLB 4F46A 4ZU3A 2AW5A 3WICA 1I32A 4RF5A 3UXYA 2D5CA 4CM1A 1SOWA 2Y0DA 5GMOA 3RAJA 2Q1SA 4EUHA 1BXZA 5JAQA 1Z6ZA 2QYTA 5L51A 4CQMD 2Q1UA 3VH4A 1V0JA 2W2LD 3VZPA 3DB2A 2P91A 3RFTA 2FN7A 1QG6A 1XWFA 1CYDA 1KEVA 3UGKA 5MDHA 2HCTA 1FMCA 2WM3A 3ROPA 1B8UA 3N74A 3UKOA 5ILOA 1KIFA 1VPDA 2ZTLA 4WUVA 4BNTA 3WS7A 1IHXA 1XCBA 4QXMA 3OQ1A 2I66A 4TVBA 5BT9A 1QP8A 3JSAA 5JAIA 3JYQA 3JQBA 1ZJZA 2IEBA 5AQ1A 1OFGA 3SC6A 1Y1PA 1DC5A 5F1KA 3FWNA 2JFGA 1WVGA 2PD6A 3KYCA 1ID1A 2ZCUA 3IS3A 4WEOA 4BNHA 4D44A 4XYLA 1ENOA 3SLGA 3CINA 3OQ6A 4EI2A 1R0KA 2OORA 1YQXA 4LRTB 4PVDA 2OMEA 3WGOA 4CMGA 5G4LA 4DQUA 4RZIA 4QECA 4BNWA 4NQZA 2PLAA 3QIVA 4E2YA 1GDHA 5I9NA 3WMWA 4NPCA 3W1VA 5ADHA 1OC4A 1D3AA 2PKRA 1B14A 4KMSA 3VVCA 1KVRA 1TA4A 3SVTA 1QRRA 3GZNB 3GOHA 1Y7TA 1YL7A 2WE8A 2VZ8A 3OETA 1K6JA 1SEVA 3HN2A 3K8ZA 4WJZA 5DP2A 3VTFA 3WGZA 1DIHA 3FNEA 4OH1A 4GKVA 1OOEA 2NTNA 1U4SA 1JVSA 3IUPA 1I33A 5JY1A 1MV8A 4HADA 5IG2A 1UZMA 1GCUA 3EK2A 3GRPA 3GVPA 3OM9A 4ESOA 1AXEA 1O94A 2GRAA 1T2AA 2PR2A 3FR8A 4MOWA 1EMDA 4W9NA 3N58A 5LCXA 4J0FA 4AJEA 1ZK3A 1E7YA 3BMCB 4DBVO 2CVQA 2Z1MA 1A27A 3DBHB 1GYRA 3M2TA 3AU9A 1LJ8A 4DA9A 2UYYA 1E1KA 2DVMA 4HNGA 1HE4A 3EC7A 1DB3A 2DKNA 3RASA 1LQTA 3WYBA 4RVGA 1ZCJA 3QQPA 4FS3A 5ICSA 1LNQA 3HN7A 8ADHA 4CV3A 2FP4A 2Y1OA 1XQ1A 1MA0A 2B36A 3RUIA 3RC2A 3TWOA 3PWZA 2JFFA 2W2LA 4QO7A 1O9BA 2NACA 1MC4A 2QRJA 3DZJA 1E3JA 3ZHXA 4ALLA 3JYOA 4E5KA 4Y6PA 1HLDA 4FFNA 2V7PA 3W8DA 5IN5A 3FN4A 2ZKLA 1B3BA 4ZRMA 4OQYA 3W6ZA 2JCYA 5JDCA 3CPSA 2BFMA 1YKFA 5G4KB 4S1VA 4DVJA 4I5DA 2VZ0A 3PVZA 1R0SA 2QQ5A 5AYVA 3WTBA 1NQTA 4BNNA 3RUHA 3RC1A 1E7RA 4EBFA 1NPDA 1I01A 2QW8A 3JCZA 3DZBA 2X1HA 3WGIA 3JQEA 2J3JA 2J3KA 1P45A 3PDJA 5I8ZA 1JU9A 5HS6A 1E92A 4UUMA 3X2FA 5JCJA 1WDKA 3RQSA 4XRRA 4O0LA 1CF2O 1K89A 2X0JA 4G65A 3G1UA 2PZLA 5TJ9A 3HJAA 3DZKA 2AXQA 1ARZA 2Q50A 3PLRA 1UXJA 3Q11A 4LN1A 2PY6A 3GVCA 4R51A 3MJEA 4B7CA 4HV4A 4FFLA 5I7EA 1HXHA 3JQAD 5BNFA 2W90A 4HBGA 3KOUA 2JD2A 3O9ZA 3GPDG 2DBVO 4WNCA 3IUSA 1M66A 1QYCA 4CV0A 4EUEA 4DLBA 4R9SA 2NVUB 1DFIA 4BNIA 3QWHA 4BO9A 1BDMA 3OHSX 4AVYA 1XGKA 3ASUA 4FB5A 3IC5A 4U8GA 2YQ4A 1TI7A 2HKIA 1CEQA 4J7UA 4JBGA 1GUFA 1BSVA 1E6UA 2ZB7A 5G2OA 5T8KC 3WQSB 3AOEC 3CSDA 3NJ8A 3TZQA 2Y1GA 3Q2IA 1LSOA 1YQDA 1I0ZA 3DBVO 5JC1A 1AGNA 3I9OA 5HS4A 1KC3A 1JQBA 1PZHA 3GC6A 1B7GO 2B5VA 1U3UA 4YAGA 1YBVA 2DU8A 1P0FA 1LU9A 1ONPA 2NQ8A 1U1IA 4W4TA 4Q3AA 3X2EA 4W6ZA 1HLPA 3MWDB 2GR9A 3IJRA 3RBVA 4DUPA 4IMRA 4OSPA 1P1HA 1EE2A 2W2KB 3OFSA 4JN6B 3WFJA 4DTIA 1PJQA 5A06A 5JAZA 1HYGA 1F0YA 3NGXA 2DBQA 4W7IA 1LQUA 2DBZA 4IDDA 4LMPA 4UUOA 4PFJA 2I9PA 3MJCA 4YCAA 1JDJA 4NZ9A 3R3JA 3DZHA 1YB5A 3TN7A 4CUJA 4YYZA 1C1DB 3IOYA 5C3MA 4YJGB 5AXBA 2Y1EA 1P1IA 4ALMA 3GG2A 5CDGA 1XQ6A 3GT0A 3MWEB 2ZYAA 3INGA 1U7TA 1P1KA 4J7CA 4OM8A 4D7AA 2AA3A 3RKUA 4AFNA 1R15A 4YR9A 4ZD6A 3UN1A 5EQFA 4L4SA 4UEJA 1MUUA 1DPGA 2YYYA 5IZCC 4MPDA 1NASA 5U9CA 3C1AA 4ZGWA 3PQFA 3TOZA 1AUPA 1TVEA 2EV9A 4K9DA 1XA0A 1LUAA 3KYCB 2PZJA 3PWSA 3LSYA 4KUEA 4IPTA 4NU6A 1X0XA 2IZZA 1E3EA 3BTSA 1BVUA 2ZB4A 2O4CA 1H6AA 1UZNA 1KEPA 4BMSA 1Z75A 4YEDA 4IBOA 4WASA 3GMSA 3A4VA 3S55A 4Y8VA 4JBHA 2I76A 3KYDB 1H94A 1BG6A 1Y81A 1FK8A 3HG7A 1EQUA 4NFYA 1HRDA 3KUXA 1T4DA 4BGEA 1XLTA 4FFPA 3AUSA 1KOLA 3Q2KA 4PLFA 3NT5A 1CJCA 1G0NA 5F21A 1GEEA 1DLJA 3SLKA 1S6YA 2XXBA 4E0BA 1ISIA 1E7MA 2PH3A 3L0DA 1HL3A 4XD2A 1GAEO 1ZIDA 3GUCA 3OJ0A 1VSVA 3WTCA 2Q2QA 2QIOA 4HFRA 2C07A 1UP4A 1ULSA 1YB4A 1OMOA 3NV9A 3V1YA 3ZNQA 4I9NA 2VOJA 2X23A 3HDYA 1EEHA 5MGBA 3JQDA 1UR5A 2YV3A 3VPHA 4MP6A 3A1NA 4FR5A 1Y9AA 4IIUA 5AXDA 5EERA 2VHWA 3DOJA 2VHXA 4UVDA 4J9UE 3CZRA 1B2LA 3JQ6A 1E7SA 5BSFA 2AEFA 5JY6A 1PJ2A 4E5NA 4EUFA 2PD3A 5B4TA 3DR3A 4BB5A 5DCWA 4RVSA 1DIGA 2OHXA 1VI2A 2ZTMA 3VC7A 1P74A 2RCYA 4Z0TA 2EW8A 4L4RA 3DBRA 3LDHA 2Q2WA 4AJJA 3H2ZA 3E48A 5EMHA 1BTOA 1HE2A 2FOIA 3F5QA 1DFGA 3G17A 1LTHR 4NNJA 3WIEA 5L53A 1F8GA 1EVZA 1U9JA 3RIHA 1PS9A 3PRJA 4RCVA 4N5MA 5JDIA 3WMXA 1SZJG 3PEFA 1H2HA 4JNKA 2I99A 3WNQA 1VE9A 1V3VA 3I6QA 3QHAA 4QX6A 4CMJA 1C3VA 4CQLB 2HJSA 2X4GA 3PFWO 1I10A 4YB8A 2Q49A 1ONNA 3ZCXA 2RBEA 2IEDA 1LDYA 5K0ZA 3FF4A 4DL9A 4P4LA 2X9NA 3KZVA 2EF1A 3EY4A 2WYVA 2GLXA 1SPXA 4O5OA 4E21A 2ZQYA 3TZCA 5JBIA 2O7SA 2X0RA 4LVUA 3Q0EA 2ZTUA 4P4GA 3DAPA 4D43A 4D0SA 3GPIA 4YBZA 4RDIA 1UXKA 3ZWWA 3U4CA 1VJ0A 2VWQA 5A9SA 4RV9A 4IDAA 4U0KA 2V6BA 1HTBA 1JW9B 4RLSA 2I3AA 1VL8A 3QVSA 3VDQA 1BDBA 3HSKA 1E0DA 3KLPX 4B4WA 3AFMA 3FBGA 3RKRA 4LMRA 3K6JA 4Q3EA 5AXAA 1MXFA 2CDBA 3ONDA 4YJFA 1M2WA 4YACA 4DC1A 3W4KA 4N5LA 2I67A 4ZQHA 4E4YA 5KCZA 3BMNA 2JHFA 1ZK4A 3ITKA 3QVWA 3S2EA 1PS8A 4D79A 3OA0A 4BO4A 2BH9A 5EJ2A 1NYTA 4UUNA 1DC6A 1Q0HA 2X0IA 1VJ1A 3C7DB 4J2HA 5L4SA 5K6AC 2WWRA 1IB6A 3MTJA 5IDXA 3JQBC 5COBA 1VM6A 4YAJA 5ER9A 2JCVA 4R41A 1XELA 5ITWA 4BNFA 1HYHA 3S2FA 2G17A 4BB6A 3IP3A 4J4TA 3WQQA 3IKVA 3QWBA 4PRKA 3PQDA 4IDCA 2Q1WA 4FC7A 1V6AA 5JS6A 1KYQA 1WP4A 4AG3A 2FR8A 2EGGA 5TS3A 1SB9A 3M1AA 2GF2A 1I2ZA 4L74A 5TC4A 1HDRA 1C1XA 4YJHB 1EDOA 1H5QA 4A03A 1XDWA 4EITA 2NADA 4CLDA 4UEOA 3ULKA 4AL4A 2YHUA 3DHNA 4OSOA 4B8WA 5CEFA 4DQXA 1XYGA 1B8PA 5JW6A 1JTVA 3PP8A 2QZZA 1BWSA 4EJ0A 1ISGA 4I9UA 3V1UA 1HDYA 2IDZA 4DLAA 3DMYA 3IL2A 1YL5A 4MKXA 4WLUA 3GEDA 3ORFA 5JCJD 2FPGA 2FWMX 5TIIA 2HMUA 4XZ3A 1MFZA 4BNYA 2Q4EA 1GYPA 4NH4A 3E03A 4IINA 1F12A 2YQ5A 4GX0A 1UP7A 2Y05A 3KETA 5H82A 2WDZA 1E6WA 3KYBA 4WK6A 2HRBA 1M75A 1R4NB 3TZKA 4E5YA 3VAZA 4CM4B 2YZ7A 3F9IA 1QLJA 1LRKA 1GUYA 3GHYA 1DAPA 3DMTC 2VCYA 4M55A 2F00A 4XB1A 2PKQO 5TNXA 3WDSA 3PWKA 3H5NA 4J3FA 4QQRA 1KVTA 4C7KA 1NR7A 2WSBA 2HRZA 3UAGA 1ZZEA 4D45A 4WECA 5CEJA 1YVEI 1EVIA 1LDBA 2D59A 3FTPA 3I9LA 4IMPA 4CLXA 1FDSA 1U2DA 1QV7A 3GEGA 4HUJA 1CWUA 4E2XA 4J90A 5IDQA 5C7IO 1C0PA 1WLYA 2D0IA 1GADO 1NQ5A 2VYND 2PTGA 3GAFA 3GQVA 4OHUA 1NXQA 2GASA 4FC6A 3RUFA 1LX6A 4L76A 2P9CA 1LRJA 1ZSYA 4XYEA 4CLRA 3AY3A 4Z9FA 3AJRA 2VT2A 4OXYA 3ASVA 1RM5A 2Z1NA 3NYWA 1E3LA 1KS9A 2XOXA 2VNAA 1PSDA 1RKXA 2HJRA 2CDCA 3FTNA 3FR7A 3KEQA 4R3NA 1SNYA 1YO6A 4CUKA 2V6MA 3COSA 2PFGA 3NX4A 4O59O 4PLZA 5EQDA 4CLOA 3DO5A 1K5HA 3BZUA 4OKIA 3ROMA 1PJSA 1PJ4A 4WOKA 5H81A 2P5UA 1GTMA 2NNLD 1LLDA 2OBNA 4KTVE 4H3VA 4OQZA 1R4MB 1VJTA 1OZAA 2ZB3A 5IF3A 4R9RA 4Z3KA 4NU5A 1J0XO 2FPPA 2C82A 4MVJI 4E32A 5GZ1A 1NBOA 5KKAA 3MEQA 4YRDA 4D3SA 1WW8A 5JCXA 2GNAA 3JQAA 2PK3A 3V2UA 4E33A 3LT4A 4YRBA 3BHMA 3DZIA 3ANLA 1C14A 4RF4A 3VPGA 4E30A 4AJLA 3D3WB 4D41A 3WIDA 2YFHA 4XYMA 1E7WA 3OH8A 1I30A 4XWYA 4PG8A 5I7FA 2X5OA 3U09A 2J3HA 3CUKA 2GGSA 3H8VA 4HNHA 5FWNA 3GLQA 3RJ9A 3VPXA 3MTGA 3O26A 4CMHA 4M87A 2DFDA 4PLPA 1BXKA 5EPOA 4YWJA 1BRMA 2IZ1A 3EAGA 4FIZA 3JD3A 4GQAA 3LQFA 3H2SA 4OMUA 1HZZA 1NFRA 4Q9NA 3WSWA 1HE3A 3PYLA 2OGUA 1LDGA 1XU7A 1C1XB 3FPLA 3PHIA 1RYEA 1A5ZA 4BNKA 3L4BA 4KWIA 2NTVA 4J1NA 3ZNOA 1Y8RA 2AQ8A 4YVFA 1IULA 4HFMA 4FQ8A 4D3FA 3BHIA 1S7CA 3V5NA 2OFPA 2E48A 3CMCO 3D4PA 3LLVA 5A5EA 5KKCA 3HZZA 4G2NA 1WZIA 4TRMA 1I5RA 3IMFA 4INAA 4O1MA 4RPGA 4CM3A 1ULUA 3EHEA 3KEOA 2RIRA 2JHGA 2NV6A 3V2HA 3O03A 2NSDA 3VOSA 4W9NC 2NU9A 1PX0A 1E7QA 2O50A 5I9LA 1D1TA 4IQGA 3PIIA 2BELA 4NJMA 4LSMA 4JQCA 1MFPA 2Y66A 1UJMA 3RVDA 1PGJA 3TZ6A 3RSHA 4FJ2A 1BMDA 3DTYA 2WD7A 3DWFA 2UUOA 3RFXA 4U0JA 4NBTA 4PG5A 1JWBB 4UVIA 2WEKA 2B37A 4BNUA 1GR0A 2DFVA 4XDYA 2Y67A 4N7RA 3ZW8A 5B1YA 5L45A 1U3VA 4CMCA 1N1EA 3GY0A 4D3DA 1TT5A 2VUSA 1U4OA 3KLMX 4WGGA 4IZHA 2VYVA 3D5TA 1O0SA 3RJ5A 3ROKA 2PKQP 1O8CA 5JE8A 2Q46A 3WBFA 4U5QA 3F1LA 1N7GA 4NBWA 2SCUA 4ALJA 2PGDA 2D1YA 2X5JO 4CPDA 3F5SA 5LC1A 4B8ZA 4L8VA 5F1OA 2GZ1A 1AHHA 1N9GB 2D3TA 4R69A 1NWHA 3I4FA 5T8KA 2J5RA 4K6CA 5JPIA 5IXYA 4N54A 4IXWA 3MZ0A 2H1SA 4J1QA 4II2A 2JJYA 4D0RA 1VSUA 4BNLA 4P8RA 2QZ9A 2DC1A 2GSDA 5CFZA 3DMTA 3SC4A 5L40A 1CQIA 3PHGA 3ONEA 1DXYA 4IJVA 5C7OO 2Q4BA 2O3JA 5TF4A 4W82A 4AJPA 5HA5A 3OJEA 4GX1A 3EMKA 3MCVA 5F5LA 1OBFO 2GYYA 5JC8A 4XQEA 3GH3A 5TT0A 4JP3A 2EG9A 4CMBA 4ND4A 1IPEA 2PNFA 1MXHA 2GN4A 3T4XA 3TFOA 1PWXA 1J4AA 1LXCA 2B83A 3H7AA 2XF8A 5B12A 5BSGA 1U7HA 4YT2A 1LA2A 1UP6A 1DRUA 2Y1DA 4ID9A 3LF1A 4M89A 2DTEA 2EEZA 4Z6KA 3WYEA 4WOJA 2DAPA 1C0LA 2IRWA 1ZNQO 3EZYA 4XB2A 4ZQBA 1ML3A 4BO7A 4YAEA 1ORRA 1UDBA 1JWAB 4WLEA 4XCVA 1CDOA 1DOHA 4WCFB 4KUGA 3V1TC 2HMWA 2NU7A 2VHYA 3LVFO 5HM8A 2CF6A 3R3SA 2QRLA 4BNGA 2Y99A 2CVOA 3QW2A 1NR1A 2DT5A 1ISJA 4LISA 1NTOA 4PIVA 5CP8A 5A3VA 3QWFA 5IZCA 2A92A 3BMQB 2VUUA 4RORA 6LDHA 3NT4A 3PJFA 4S3MA 4R1TA 3AUAA 4BHTA 4Y67A 1PQUA 3NRCA 1Z7BA 2BFPA 4Z9XA 1IZ9A 1UH5A 2BFAA 1L1FA 2VNSA 3DONA 3RC9A 1YJ8A 2QX7A 3H5RA 3TFQA 3KB6A 3L6OO 2HSDA 4AJNA 4B3IA 4DIOA 5C5IA 3UCXA 1WPQA 1PJLA 3RD5A 1ENYA 3JQFC 4IDEA 1QYDA 3D4OA 4YJDA 1YOVB 4CR8A 4QSMA 3NAQA 4IZIA 1MB4A 3GN2A 3U4DA 4PG6A 4ALNA 2C2YA 4G5HA 1NQOA 3WXBA 1PR3A 2OBYA 5IJZA 5JAMA 1ZH8A 4PCVA 3KV3O 3TJRA 1HKUA 1DIRA 4IDFA 4MKZA 1BVRA 3EUWA 4B3JA 3AW9A 3JV7A 2P2SA 3ETEA 2WTBA 4HWKA 1TT7A 3HFGA 3L9XA 4BV8A 4CLHA 3GVHA 5G0VA 2EKQA 4JCOA 4ZQEA 1YXMA 2NWQA 1PGPA 5TJHA 4CR7A 3RROA 4ZQGA 3H9EO 2UAGA 4A10A 3QSGA 3ADPA 4R5HA 4IXTA 4O6VA 2HMTA 4R5MA 5A05A 1MLDA 1XKQA 3DXFA 1GPJA 3FNGA 3JQ8A 4RVDA 2EKLA 2XPCA 1X0VA 2GD1O 5JO0A 5U4QA 1DJNA 1RM3A 2WJPA 1U8XX 3RI3A 3LYLA 4DRYA 1LBEA 5KVCA 4N5NA 4R1NA 1Q0LA 1R16A 3ICPA 1NM5A 5KJFA 3AOEA 2HK9A 4P4NA 4HKTA 3K73O 2J5QA 2GN9A 4U7WA 5DCYA 4WLOA 3I5MA 4JXKA 3U49A 4GH5A 3GUYA 5HBRA 1A71A 4X54A 1ZK1A 3C24A 1LC3A 1YQGA 4GVXA 3ANMA 3DOCA 2VRCD 1ADFA 1PL8A 4HY3A 1TT5B 1AE1A 2FMUA 4FBGA 4YT5A 1WMAA 5THQA 2OP0A 2X8LA 3ETGA 4OOEA 1PL6A 3F3SA 4PN3A 2I65A 1PJCA 3JD4A 1AXGA 4Q3NA 2DTDA 4PLCA 2POQX 1IY8A 1GZ6A 2FR1A 4BNXA 3NGLA 3E9NA 1QV6A 5HWSA 2GN6A 1GYQA 3LU1A 5ICMA 5JNLA 1RJWA 3ABIA 1A9YA 4B4UA 4JLWA 1KY4A 3RBZA 3JQGA 2UUPA 4CR6A 1NVMB 2X5KO 4Y6SA 2XAAA 4RQUA 2EXXA 4ZN6A 1HDGO 3WSVA 3BMOB 4B4OA 1QSGA 4KP7A 3VPSA 3C1TA 1CIVA 3IP1A 2NM0A 3UH1A 3GDFA 4YJHA 3UUWA 1XG5A 4DMMA 1B16A 1VKNA 3G0OA 4AJ2A 4Y6RA 1K3TA 2E6UX 2GCGA 4UEKA 4R1SA 2C54A 1A9ZA 1X7DA 1O5IA 2YW9A 4ZICA 3ZDFA 1P1FA 1PZFA 2HMVA 3F46A 3S2GA 4ZRNA 4EYEA 1W4ZA 4FCCA 1E5QA 4CM7A 4BO5A 3D64A 2DM6A 2HUNA 3OBBA 1XIVA 2BRUA 3M2PA 1HT0A 4MINA 2G0TA 5ENVA 1N2SA 2OOSA 3Q1LA 4IQ0A 2NLOA 1ADCA 3ZWYA 3IAHA 2B4RO 2ZJ1A 3W4JA 2R00A 2YJZA 1HSZA 1JA9A 2VWHA 4E3ZA 1HDXA 4RVFA 5DBIA 1F06A 3B1JA 1E3WB 4GPD1 5T5QA 3VHRA 4MIYA 1Z45A 1K6XA 1T26A 1HE5A 1ZSVA 2X58A 2YFQA 3RU7A 4URFA 3LT0A 4H7PA 3DQPA 3OECA 1P33A 5EL0A 5F1PA 3WWYA 3QA9A 3VZRA 1SMKA 4DYDA 3DAFA 3GVXA 2C7VA 1DSSG 1PJ3A 4WNIA
chains in the Genus database with same CATH superfamily
1DNPA 2FN3A 3OZIA 3K1ZA 4H6WA 3ENNA 3ZWVA 5BUSA 3SQNA 2WD9A 2E4XA 4ARIA 1PEYA 1ZLYA 5FI3A 1ORWA 1XCMA 2IL1A 3LI2A 4MUGA 2J0SA 1JEAA 1C81A 1OXKB 1QR6A 3G02A 1VA5A 3A9TA 4LV6A 1NX6A 4BJ1A 2P2YA 3ZWMA 3RUCA 3V2GA 1ABBA 3SXJA 1VMEA 1G66A 1IBLB 1DEHA 1VHTA 4E6PA 1SRRA 2RI0A 1KO4A 5I47A 1OE0A 1UJ6A 1DEXA 2YZKA 2ZZKA 2AMFA 2FZEA 1MPTA 4LJ8A 1J23A 2D7DA 2VL7A 4K6HA 2H07A 4JWKA 1E0KA 4O3FA 1G8GA 5KJEA 1V1RB 3AG6A 1J90A 3PC8A 3PEVA 4JEMA 4B76A 4X20B 1W4RA 3HJBA 1DC8A 3BS4A 4F4FA 1VE1A 3HDQA 2XNCA 1J2JA 1XZFA 1YJCA 3AR2A 4GZ6A 1I3OA 4R9UC 2RH4A 1ZIOA 2IYFA 3TNJA 3U3JA 3WQHA 5AI4A 1I6KA 3D59A 4LZPA 2ISQA 1MG5A 2GZ2A 2IPXA 3AEKA 3EFHA 1AKNA 1EU1A 1OC2A 1BW9A 3QFSA 3RS9A 2HX1A 4I55A 4NV3A 4Z0NA 2WT9A 3N2GB 2IEIA 2LD4A 4X63A 3ZEIA 1FW6A 3MRVA 3WIBA 1YQ9A 4DLSA 5JBNA 4RIIA 2QY9A 3SZUA 5KNBA 1OT3A 5A5VA 3JQAB 2MMGA 4IVQA 3VU9B 4RC9A 1UFRA 1PNQA 3EISA 3K0FB 3PQ2A 2VHJA 4L8LA 3D8UA 5CPBA 5FWYB 3UMFA 1W49A 4FLFA 4DT1B 3E7DA 1QAOA 4IDPA 2UZ3A 5JYDA 1URPA 2P9YA 3TLBA 1AK9A 4U2FA 2EP5A 1DAEA 2CNBA 1MMFB 3L9WA 2P4HX 4MAFA 1EX6A 1TDJA 1YGPA 3LFUA 3ZE2B 3OQOA 2E1RA 2CV2A 4LGCA 4N3AA 2B1RA 2C9MA 1OAAA 4RD4A 3U56A 1F60A 3PDHA 4F3YA 3JQ7B 2IPMA 1J99A 2NO6A 4YQYA 3VKVA 4Z1MD 3P27A 2C2MA 3FCAA 4FFMA 1CFJA 1YFZA 2F48A 1W52X 3BTOA 4FSDA 4K7JA 2HRDA 4GF5A 2H65A 2GBFA 3L7DA 4PLTA 1DTWA 1DDIA 4QO8A 1D6JA 4PLWA 1A2OA 4YRAA 5L9AA 3KHKA 3V48A 1XRJA 4QQKA 1RYNA 5CYGA 1Z17A 3G6WA 5LB2A 1IY1A 1SCBA 5FBKA 3TLEA 2UKDA 2SKEA 4DY4A 2LDBA 2E4ZA 1BVYF 3GA0A 3AXSA 2WABA 4MRPA 3F2VA 3K96A 5ALWA 1FB5A 1SZPA 2PMWB 4L3WA 4UDOA 3KKEA 4MK4A 3NBUA 3NORA 3EH1A 1DAKA 1X1EA 1T0UA 2BZSA 3PVCA 4RJKA 2HWKA 3KU4A 1APBA 1RM0A 2X9LA 1XD8A 4ZK6A 1U3GA 1X9HA 2NVUA 4PO3X 1O95D 2MT9A 1N6HA 4XRGA 2CXTA 1KI2A 5TPZD 1TUIA 4QD3A 3QLUC 1RAIA 1PU2A 2R47A 2WD8A 4M1TA 3AFHA 5CYFA 5FJJA 1W581 2GVNA 3UV6A 5KJCA 2WSSA 2PPVA 4GLOA 4QPNA 4HWOA 3K9GA 1R0CA 4NR0A 3UIEA 1L7NA 1ILEA 1MC5A 5J5AA 3TW6A 4FFWA 5C7YA 1JLSA 2FKNA 4LOKA 3T3MB 1FIUA 3JWHA 1PQYA 2J59A 4H0CA 1T25A 1II8B 2HCFA 2XHZA 2CZQA 3GRAA 3HV0A 2IDKA 3OU7A 4QLOA 4ER6A 5KX5F 4MGKR 1FPQA 2AR9A 2CW5A 2Y1FA 3R0IA 2BEUB 3KFXA 4X97A 3R24A 5E4JA 4F5DA 3R3XA 4FGSA 3UFXA 1E8DA 3DLCA 4U6NA 3LT2A 4ZKEA 1FP7A 4EI7A 3CR8A 4G9BA 2P3SA 5IFLA 1Q19A 1FUKA 4RL6A 1F5NA 3R7WB 2CLCX 1CD5A 4F2DA 3I9NA 4BHHB 2ZRBA 3WKDA 4YI5A 4DEXA 4ZFNA 3VUFA 3OIWA 2ZJ4A 3DCNA 2P9GA 4D42A 4M0LA 3ZKWB 1EK5A 3WVNA 1VL6A 2JKVA 2CK3D 3U39A 2XLBA 2G9ZA 1WHSB 3V33A 4QEZA 1ZC3A 5JSZB 4FFSA 4OV6B 1WXQA 4D8XA 3P94A 2H6EA 2QGZA 4I5GA 4HG2A 1NY6A 2D5AA 4IVPA 1QORA 3CRRA 1ISHA 5AKXA 5A9TA 5KIAA 2ZTHA 1E1MA 3RPEA 1MAWA 4JVOA 4FEGA 1XALA 4EKEA 2MSDB 1C9EA 2Q27A 2AQHA 2YHAA 3GRKA 3H5TA 1ML4A 2G82A 3VUEA 1DMRA 3QOYA 1CZUA 1PWZA 4TMWA 4GBMA 4IUYA 5ALSA 1L4LA 3L6RA 5LM3A 1R6XA 4F3RA 1GPAA 3C8MA 3G9ZA 3IYLW 3NHZA 3NKLA 3SIRA 1IHYA 3F1KA 3OEWA 4CM4A 1T1RA 3NTRA 2R0QC 5EMJA 3R7WA 1BMFA 2NPIA 4OQFA 2B6HA 5FULA 2P6RA 1YWGO 4KX3A 1SRQA 4QM6A 3E4CA 3ZQKA 2VJDA 1HYEA 1LPOA 4QODA 4WEQA 5IT9A 5KNDD 1B1AA 2JFWA 1I3KA 1P9RA 2ZFUA 3CEHA 1NUSA 3KTDA 4L75A 4ZVRA 3UHFA 4W5NA 4F9TA 4OD0A 1KK3A 1ZGHA 2R8EA 5HKKA 2PGLA 3DOEA 5CAEB 2Y1CA 4EY7A 3KAQA 4G5RA 4FUQA 3KXIA 3AHGA 1PLJA 4ZJZA 1DFHA 1KVSA 5B2FA 3G2IA 3R6TA 1J5XA 3HUDA 1BA3A 3WRXC 2J85A 3GAZA 4G5SA 4G36A 2V55B 4IDUA 2EW2A 1ETHA 2IEGA 2NT3A 1PGQA 4DR5B 1BKDR 3ZS9A 2A0KA 3PNPA 3K1TA 3U5ZB 1MG0A 3ECSA 3GJXC 3K30A 3L4BC 1PZNA 8MHTA 2C3MA 1C9YA 2DFKB 5K4HA 2QQEA 4UAJA 4X93A 4AUKA 1PR2A 3RSSA 4X44A 3SX2A 1NJGA 3WGYA 5GIOE 3BCRA 1F6BA 3R5FA 3I34X 4ZRDA 3W9BA 3RSLA 1Y8QB 2F1IA 4H31A 4UUQA 3D1LA 1N1MA 1PQ4A 3GRVA 3CKYA 1R9JA 4R2WA 3T7DA 3ZE9A 5H8WA 5KNCD 3IESA 1ZD1A 5KDLA 5IDVA 4XDHA 2FWRA 1SIUA 3QY0A 4HAYA 4JR0A 5ABPA 5JD4A 5EUMA 3MJTA 2H5JA 2KX7A 1KDPA 4EBBA 5KAPA 1Y34E 4G8BA 1M8FA 3TZBA 4Z4QA 1SVMA 1WMSA 1X3LA 2A5JA 2IZ0A 4TT8A 3VNAA 1GZ3A 5IULC 1E1CA 3TE7A 1RC8A 2AYYA 5JEDA 3I9JA 2PRIA 3W8FA 1X7HA 4UBKA 5KC8A 2CL6X 2IUUA 2YUIA 4DY6A 2VYFA 3QX8A 3IO5A 1GCAA 4ITVA 5DHSA 3UANA 4KWCA 3WFZA 2FEKA 2WT8A 1DRVA 4PBSA 3W5HA 1P2FA 2IODA 4Z0HO 5HKKD 5L4NA 4BJ6A 4HPWA 5LDGA 2H4JA 1W87A 3BD6A 1XRLA 2WUGA 3ZWDA 3FH0A 1KJJA 1ZD2P 3RWBA 2CFOA 2WTUA 1UPXA 4XPZA 3HRKA 4DLLA 2PSJA 1YOVA 3S1LA 4R3WA 1G55A 3N6RA 4PPYA 4DDVA 5ITZB 1X7XA 1JIUA 4EO7A 5B6IA 1DEAA 3AI2A 3AV3A 3QV2A 2QV0A 3QVJA 3GNSA 3ZLJA 2IYSA 3PPIA 2C0CA 2EOAA 3F4BA 5CXSA 1CRPA 3FROA 1PG2A 1IAQA 1U5BB 3BULA 6ADHA 1U9IA 2G5GX 3FETA 5MFPA 3LL4A 4GGPA 1ECCA 5TX7A 3VZBA 3NANA 2HWUA 4RV5A 2OZPA 3ZWOA 3P2JA 4CVNA 2EWMA 3MHTA 1OROA 5L8VA 2COKA 2QN1A 3ROFA 4QYIA 3I62A 3F7OA 4GL2A 1N0VC 1G19A 2ZYUX 2C04A 1BHO1 4QDUA 4DPMA 5KTKA 1CC1S 4A6EA 4V0OA 5ECYA 1U81A 3AUUA 4GLFA 3H05A 3Q3GE 4K8RB 3DVAA 1YVDA 1REQB 3ZU2A 1T3ZA 1SKBA 3I05A 1IOLA 1T24A 4B0OA 1NVKA 5ISMA 3U0BA 1QZUA 5TARA 2YY5A 1DDOA 1EFVA 5H16A 2OV8A 4JJ6A 1WPXA 1UWVA 1HE8B 2O57A 4MVJM 3PUVA 2NVBA 4EJ6A 4CDMA 4FYXA 3FUWA 4I4TB 4KQ2A 4YCLA 3PXUA 2E18A 2A59A 4JASB 2MR6A 4FHDA 2FSIA 1X87A 2ZJAA 5I6DA 4AK9A 1SO8A 2BFCA 2RH5A 4HLQB 2O2EA 5TY0A 1JILA 3H84A 2C3PA 3EHDA 3NEYA 4FMDF 4JUBA 3AU8A 1ZQ9A 4MYDA 1IE3A 2C5BA 3CVJA 5E6RB 4CQMA 1DTWB 1IMOA 4R31A 5FBQB 3RHTA 3QVTA 2J30A 1Q0QA 3FD8A 4LOJA 4OGGA 3QSYA 1US8B 4KJZA 4DPLA 2ZYDA 5ELMA 4HQ6A 3PXBA 4M54A 2AWNA 1NFFA 1V11A 5M3BA 1TZBA 3QEBZ 4EFKA 3FCSB 4JI7B 1YRYE 4NCJA 3CF6R 5FF9A 4J0HA 1N5DA 4QOJA 3CPEA 5ADVA 3T1HB 1A8SA 2W2KA 3WNBA 4E5PA 5J2TB 4K9NA 2VRBA 5EFOA 4UXHA 1VG1A 1N6NA 4FOLA 1KWGA 2JGAA 4B9EA 4F4IA 2Q99A 4M22A 4ZMBA 3BWDD 4OX9Y 4IS2A 4L0MA 3EVDA 4H77A 2RK6A 4JLPA 1E6CA 3QM1A 2VPTA 5AD1A 1CSEE 3SYNA 4BX2A 4DCUA 1ONSA 1YR1A 3KHUA 1IWOA 2XZTA 4EZIA 4FKBA 2CKDA 3E1KA 3AVOA 1KDOA 1GZVA 4XM2A 1NRXA 3GH1A 3OTOB 2YOGA 4ABTA 2HJGA 1X86B 3AL2A 3LHFA 1AN9A 2PKWA 2IE0A 1ND5A 4MW1A 3U4MA 1N5MA 2BUAA 1L7EA 2P6NA 1ANKA 4XIGS 1T6YA 2ECKA 2H3EA 3K2EA 1ZX1A 3GUUA 3M0EA 4JZYA 5DH9A 1HQYE 3MWEA 3Q3HA 4A8JC 3GR6A 3LDGA 2GO7A 4H7DA 1E9EA 2AI3A 2OQIA 3IQDB 4W99A 2HXGA 2Z98A 3A8TA 5KHAA 2BRUC 5GTDA 4B83A 3QU2A 4M0EA 2ZIUB 3HR4A 2JCGA 4I66A 4YFVA 5ALVA 2VAPA 3QV1A 3RLIA 3UJ6A 1YR9A 1KAGA 2JBAA 3S1AB 1K06A 4MR9A 4N8SA 4ZVTA 3BRCA 3D6VA 2V7BA 2VYNA 2O3SA 3COJA 4C5AA 5IXJA 4AM8A 5LWQA 1YB2A 4XASA 2O3QA 5JHGB 2VYCA 1IJFA 1C7EA 2LNDA 2ZRPA 1NXVA 4QRHA 2SBTA 1Z3CA 4J9VA 5IKXA 2DWQA 3CEMA 1GQFA 2J4DA 4RESA 3T5GA 5AI6A 4LF4B 5KCZA 2OG1A 1RI3A 4XYGA 2JH9A 1VDZA 1PFKA 2QJTA 1QK3A 3CUEF 3KLOA 4ZMRA 2O3UA 5B7QA 1J7JA 2EQAA 2QHXA 3O83A 1HK7A 5E2IA 4JZKA 1H0HA 4A6XA 4K2HA 3R8XA 3ZJ5A 4JC5A 5GY7A 3VC2A 4D0NA 3CLUC 5CA1B 1M1NA 1YA4A 1F8UA 2AOUA 2Q7XA 3NIFB 2HF2A 2FGJA 5HK8A 5L4LA 1JIQA 1OSNA 1MAVA 3VNRA 4B6OA 1FNSA 3CCFA 3IE1A 1KMIY 3GZTB 5TPWA 4K05A 4OLFA 3PUIA 2COEA 1M7HA 4CMEA 1MVNA 2BT4A 1FDOA 4ROSA 5ED0A 4YREA 3TECE 2GXQA 3PXDA 2ZVQX 3GFGA 1XKXA 4M1OA 5EHNA 4BKOA 2BFFA 3LNCA 5HIJA 4G1FA 2JLUA 1UBOS 5A3RA 2P1DA 3KVRA 1RQXA 3S29A 3SEFA 5BQFA 1MQ8B 4XDZA 1C0IA 2LTAA 1QQTA 4P3PA 1EZ1A 4TTAA 2HR1A 5CM9C 3PKIA 4M8KA 4UXJA 1GPDG 2WU3A 4CJXA 1PUJA 2XUOA 4K9LA 2AG5A 1Y8RB 2CY0A 3I9V6 4XTRA 1B2RA 2GUGA 1N36B 1FLVA 3H11A 1ADYA 1YDEA 4PVCA 4KMRA 5C7LO 16PKA 2GMWA 3I92A 2RH8A 2NZ8A 4X20A 4Y1FA 2OZVA 3UCEA 3ZV4A 1V9LA 2BHSA 1P60A 3AWDA 1TLLA 1GKKA 4IV8A 4JB0A 3WB9A 4P5DA 5M04A 3O8BA 1CLEA 1XLWA 5BN4B 1JP7A 2VUTA 3U7GA 1I3MA 4BQNA 3BRWD 5HQTA 1IBRA 1G2QA 3FRJA 4FKZA 1DRJA 1V2HE 1ZUHA 5T67A 3G6KA 4XW2A 2VJLA 4B81A 2IKQA 2VF8A 2R5WA 4WLFA 4Z7QB 4HQ0A 1ZIXA 1G5TA 4LGVA 1ZKMA 2JK0A 4RVCA 1TUGA 1Q83A 2JDIA 3GDHA 3IJ5A 4D4KA 4F71A 1RXVA 4U7PB 1F8FA 2QORA 4X71A 1Y4SA 3BCHA 5IJXA 4GHWA 2WJAA 2NN3C 4QGGA 2A5FA 4NV1A 3U62A 1K5DA 3IQXA 3IDSA 2R96A 3IBTA 4AQ7A 2HGSA 3VYRB 2E82A 5BUQA 2XDYA 4LF7B 1DAHA 1QLWA 4OJYA 3IIMA 2C7BA 4IQ8A 1YOBA 1N6OA 4AYXA 1NXPA 3EMDA 3OKAA 2J5XA 2Y68A 3DEKA 2BLLA 3H5OA 5F3DA 3VMFA 3AY6A 3PEUA 4ZAGA 721PA 2IHJA 2O2HA 2PXXA 2WU8A 5CBKA 3X0DA 1QHFA 3FPEA 5FYDA 2O7NA 4HZGA 3RAGA 1Z4PX 4OXQA 3RVNA 5BMOA 2HTFA 2XOKD 2IZOA 4K6KA 2C5GA 3VNQA 2WRZA 4CV2A 5DXJA 4EDHA 4EHFA 2POCA 3EIUA 5AM5A 3N7TA 1ZGGA 1KJNA 2FU5C 3OJLA 4MVYA 4WL0A 3ZI0A 4EQ6B 4FIDA 1E2MA 5CB0A 2BFEA 2H54A 5G1NA 4KN6A 3AETB 2P4UA 2PIDA 3SM9A 1HEYA 3EBLA 2P4QA 1SC3A 3RUDA 2WWIA 3K9CA 4PQFA 5D00A 3TW4A 5JRZA 3CY6A 5SY6A 3ZHYA 2IP2A 2NUAA 3TNFA 4FNGA 5K0CA 2XF2A 1UM9A 4D9GA 3JS5A 3KKOA 4F60A 3JQCA 3BCUA 4K28A 3WP1B 1T0IA 1SKAA 4HNQA 1D6SA 2HIMA 2ZK7A 5HQ3B 3SJ7A 3KJFA 4OM7A 2QNRA 3OVMA 4GICA 4B31A 1X1AA 3DDSA 1N2CA 1NXTA 3DMGA 5FBVB 3A37A 1KO5A 5MN5A 3AG5A 1EDDA 2PV0A 5KDDA 1AA6A 1R74A 3KWFA 3GFQA 3NCHA 4TS9A 2RK4A 1QYVA 3NWOA 1NJ8A 2ZXUA 3I32A 3F90A 1C41A 1D5WA 2HCBA 2RBKA 3HLKA 4EHAA 3U16A 1KNQA 2A5DA 2WYWA 3E15A 3IPLA 4Y3UA 4C87A 5TPWB 5A0TA 2IYWA 1SQ5A 2C4TA 4MUAA 3B70A 2ATCA 4HAIA 4MA0A 5TMBA 4DXDA 5BR1A 3M6AA 1L7XA 5IAAA 2X7HA 4AD8A 1FFYA 5DOZA 2A94A 3QVLA 4BRSA 2XOKA 3O4GA 4IXMA 1OYYA 3AKCA 3FFTA 4Q93A 4YPOA 4TYNA 2ATIA 4ZO4A 4L6IA 1R10A 4MGYR 3BB4A 1O94C 4O63O 3TO5A 4A9AA 1XV5A 1E1QD 2HLNA 3C7KA 3L46A 4IHQA 4OQDA 1VKOA 4P84A 4LWZA 4EP1A 5K0FA 1CHNA 2RDMA 1R27A 1WMBA 2HMSA 1IQUA 1XD2A 3DAGA 4R2XA 5E1MA 5C31A 1OTXA 2C9CA 1EUQA 5F51A 3REQB 4Z4FA 4HB4A 4ARCA 1C9NA 2ON6A 4B4DA 2WDPA 2VTDA 1LNSA 4A26A 4DDHA 2F62A 2DG2A 1GTSA 5H9VA 4PQGA 1JHYA 1M1YB 2FPLA 3DCJA 2Q6IA 2FV8A 2ODEA 2Z43A 4AY3A 1OQAA 4ZCTA 1VBFA 4IDBA 3LPCA 4G4SP 3P5SA 3I5AA 4QXPA 1GCOA 4ALKA 3CN9A 2HSEA 3EVZA 221PA 4Z8XA 2C9BA 4BJ3A 1E18A 2Q3EA 4CM8B 3CVVA 4GKAA 3COWA 1NJFA 2EFEB 3P0JA 1AUOA 1Z4LA 4QVIA 2DRIA 3FVWA 2RI1A 3FKJA 4B71A 4MW0A 1R4NA 1Z7EA 3L07A 3JW8A 5BPHA 3TLXA 2Q3HA 2QUJA 3USZA 1PFUA 2BF4A 3LUCA 5CXXA 2DPGA 1SC4A 4BKQA 2WMYA 5FA6A 2BGKA 1PZGA 2D8MA 3SF8B 1T8TA 1CUZA 1WSWA 4ESVA 3Q1KA 3RFVA 3H2JA 1QOZA 1ZD8A 2ISSD 2XCTB 5CDYA 5ESXA 3PUJA 1U5CA 1UT5A 2AOXA 2G9RA 1UDRA 2YV1A 3VSBA 1MQSA 2FSSA 2AJ8A 2JASA 3MJVA 1R8QA 4FSXA 3F78A 4MR9B 4F12A 3GGOA 1N1DA 2ZJ6A 4MRNA 4HYEA 1FFAA 1TW2A 2UZ4A 1JR3A 1I3CA 1KVQA 3KHTA 5CGQB 2WYUA 1QTIA 2F1KA 1XRNA 2CZCA 1M83A 3D4NA 3FZYA 3L8CA 3OFJA 4G07A 4JX8A 4R54A 1FNBA 3W2GA 4OJKA 4BMCA 2PBLA 4EA8A 1YH3A 3PDIA 1UKZA 2E49A 1TECE 2HQBA 3B13B 5EC8A 2PQMA 2FSVA 4KLZA 3B6ZA 3ZY3A 3G8DA 2ZT8A 1E5XA 2VWGA 3B5EA 2QK4A 3BH7A 3QUTA 2V3CC 1G21A 3HEAA 3M5DA 3HY3A 3P9RA 2WF6A 1V8PA 4PNEA 5JMOA 3BK7A 4GGMX 1BWQA 1YZLA 1T8SA 2YHIB 5EE3A 1DPFA 2DQ4A 1O6GA 1EFDN 4MUBA 2CHFA 2L69A 2QX4A 3CEPB 1JAYA 4ND5A 1MDBA 3KQKA 4REQA 2Y1KA 2VQFB 4L73A 2AOVA 4RNCA 2W98A 1KWKA 4EYOA 2BFFB 4E12A 1HX7A 1QTRA 4M83A 1GGEA 5IEBA 2JLAA 1J9ZA 2BVNA 4YRLA 1EVQA 3LBIA 1TEHA 1Z33A 1E77A 1Y1SA 2RHMA 3PDIB 4IQFA 3T3NA 3TD9A 2ZUEA 1AQUA 1BFKA 1NV9A 4IDHA 1ESEA 2K5UA 4HMPA 1BOFA 5A3JA 1W5EA 5AW3A 2Q6VA 1MW8X 5E6RA 1TX4B 3PQ5A 4J2TA 1NXWA 2QAGA 3QP9A 3A3PA 3CE6A 2PUHA 5FLKA 4DMUB 3NYIA 2GD0A 4GMGA 3UQYS 1PHRA 4EK9A 1RHRA 2PBFA 3QKSB 2GS9A 2H85A 3EQZA 1P29A 3NM4A 1MAHA 4QDXA 3O9MA 1C7IA 5K0NA 1J1UA 1I7QB 3EY9A 1FOEB 4HGOA 3B5JA 4M8SA 1XZPA 4EUSA 2C4KA 1TMKA 4DV6B 1LK7A 1QP4A 5KVVA 3C43A 1LBHA 2GPTA 2QTGA 2UYQA 5A4IS 2IC5A 2XKKA 2OV3A 3GLUA 2AF4C 4URWR 5DRYA 5BSTA 1RRCA 3JATA 4BLQA 5HCNA 2QENA 2VKTA 4JCCA 1UUFA 4LYEA 4Z4IA 2QD4A 1F14A 1Y4DE 1ZL2A 1EB9A 2AN9A 5AVQA 1JHXA 3NHMA 5K05A 3MUFA 3MW8A 2O8DA 5LL6P 3CIOA 4QOHA 4ND3A 1JEYB 3T7EA 4EG4A 1U0NA 1HY3A 3AEKB 3DT6A 3EBPA 4TWRA 2XNSA 4V2IA 2XB8A 2QAGB 5DXAA 3F96A 4ARZB 2PSDA 621PA 4JV5B 1H1LA 4FR2A 2AXNA 3ROGA 3WAKA 4JLJA 5I7OA 1FXWA 4B79A 2EKZA 1NIPA 4ZHQA 1L8AA 2F1OA 3HKDA 3O4VA 2CFCA 3PX2A 4G56A 3B3AA 4IOMA 4NDNE 3BICA 5CX4A 4A16A 2I54A 1XNQB 3GGCA 3AJDA 4RPKA 3N0TA 3RANA 2ETXA 2QVLA 5EYPB 2A2ZA 3JD2A 1W44A 2YNMC 3FKSD 2GJAA 3EZXA 5CPFA 4AP9A 3KBOA 5FOXA 3ZGYA 4OJNA 2CNNA 1SXIA 2HUPA 4WCFA 2IF2A 4CLOB 5F9HA 4BQQA 3NHJA 5K3OA 2JC3A 4DLXA 2ZPAA 3IODA 2HHCA 1ESCA 2TMGA 4DJ5X 4F6CA 4CODB 1R37A 3EPRA 3MBOA 1RYZA 4CL0A 4D2IA 1M2KA 4IHJB 3B1VA 5TLSA 1H6BA 1TW3A 5BWLA 4H35A 2CV1A 2P90A 2I62A 4JMLA 3N8DA 2WVJA 3PHJA 1NUUA 3I1FA 3QTLA 3MT9A 2ILTA 3EXIA 1E99A 3ZIAD 3VSAA 4BUCA 1V35A 3KUCA 4H08A 2IEAA 4H4CA 2FW1A 4KKVA 5DT9A 3VDXA 2WILA 1MT0A 2D06A 1X8JA 2JGLA 3IT2A 3KE9A 3MSCA 4ROTA 4ZQFA 5EWJB 3ECAA 1ECJA 2C4HA 3QLVA 1XZHA 3UMMA 2QLJA 3MHPA 5B3AA 2O6HA 2XYHA 1GQRA 4F5YA 2QD2A 4D4JA 1A5BB 1CDDA 1GZSA 4ZOLA 4HEA6 5CT6A 4BAUA 3NP9A 4C76A 3JD1A 3RU3A 1ZJJA 4ACAA 4YCNA 1XEXB 2J0VA 3LVRE 3STWA 1CUEA 4GPZA 4MYRA 1O54A 2FMIA 4KO1S 4MKGA 1P81A 1FLDA 1W4CA 3LQRA 3T7SA 1QTQA 4XGIA 2I4RA 1LRLA 4MYCA 2OA0A 3W1WA 5J2UB 2WWXA 5TQ2A 2YHIA 5KTRA 1GL6A 2PE5A 3OM0A 4RENA 1WB4A 3K53A 4M1ZA 4DIMA 1SUPA 1Z5UA 5E4FA 4E11A 5FPSA 1DUSA 3EVCA 1EXWA 3UO8B 5KHOC 3DUWA 5DBFA 2EBHX 2GJSA 4J4HA 2P9ZA 5T4BA 4NCHA 5IABA 2ZJ0A 4QDTA 5T6BA 4UARA 4U8HA 4C7OB 3CIFA 3U4QA 1PGNA 2EKPA 1AY0A 4BLUA 1GG8A 4U7DA 5DF1A 4YWHA 5EIXA 1L7OA 1FQKA 2OCGA 3DBIA 3IMCA 3JQFA 3W8NA 2A1UA 4G89A 4OK3A 4XA8A 3SKXA 2WJ4A 1ZH0A 5GWXA 3NHKA 3T1VA 3C5VA 1ADJA 1DTEA 4PZEA 2BZ0A 2YTZA 2B5WA 5DTEA 2PUEA 3D31A 1QIGA 3DUFA 5I7SA 2BI8A 1EJ2A 1JXQA 1XKLA 2CFSA 1HF3A 3LF2A 4K6OA 5JECA 1J1ZA 2DQYA 4ZANA 2YASA 2EIHA 4HX5A 4DJEC 5B36A 4LGMA 2AQKA 2J09A 1UOPA 1D4OA 2H2FA 2XYPA 3PTLA 4JROA 2R2GA 1U7WA 1BQ3A 3NBZC 1B74A 4MEJA 6PFKA 5K9ZA 3KQNA 2NUTB 3BRSA 3EEYA 2QM3A 3AZQA 3IR7A 2IXBA 4I2NA 4X7RA 5A0FA 5F5XA 3IOBA 3TTXA 4DYHA 5UKDA 3SR4A 1HDEA 1GT91 5JZOA 3QLEA 4HDKA 1PJZA 4JLOA 1AKRA 1EJ0A 3JWJA 5K09A 1DG3A 2JD1A 1P91A 2CLEB 4MWEA 3DW1X 4NDAA 3WWCA 3STHA 2F7SA 1X1TA 4FWBA 2R62A 2YY7A 4HGQA 2W9XA 3ISVA 4TWAA 3STVA 1NW6A 4BNVA 4DLRA 3R6WA 4E5DA 1T9KA 4H16A 1P2DA 2YY6A 1SEPA 3U3OA 5JRDS 3PC4A 4KWTA 2XIJA 3HKDB 3FLMA 3WQBA 1XZLA 3TZEA 1K4KA 1YRLA 4GSKA 5JTTA 2Z9CA 4P38A 1P3JA 2N3ZA 5DTRA 3TLKA 3CTPA 1X70A 2JLZA 1DKUA 1UBUS 2K2QB 3TEJA 3DL2A 4C7XA 3AI7A 4YRIA 1Y6FA 1QPZA 1XDDA 1CUBA 2B9VA 4HWRA 3AR3A 1QDUA 1T6XA 3ACBA 4MV3A 5I7UA 3Q8LA 2EJWA 1TYBE 4CCWA 1UMBB 1BD4A 1X1RA 3Q9NA 5AHKA 5H83A 3RS0A 2B1QA 1G5HA 4AURA 5FR1A 3A06A 1JKMA 3KWJA 4DUZB 1UC9A 4EGAA 4WZBA 1GR1A 4L72A 1E1QA 5BQ5A 1KU6A 3QOFA 4EJSA 5LP6A 3COZA 3EGVA 1BW9B 5DHQA 5F23A 4ZV7A 1EDBA 2C77A 5CEEA 4HXGA 1T1SA 1P5ZB 3C16C 2WZQA 4DDKA 3O92A 2C0QA 5BY2A 1ZVVA 5F7XA 1KMCA 3VR6H 1RCTE 3AQIA 3EFEA 5HTKA 1E1LA 3PIDA 1CX9B 4G37A 1RPTA 4IICA 2X3UA 1T2DA 2GEFA 2R84A 2V9CA 4FFBA 2CVPA 3GT3A 1KE1A 4PC6A 2O5VA 3R40A 1YJQA 1G0OA 2V03A 1WDMA 3AFGA 3M4NA 4RQBA 2F8TA 1BXGB 4NZOA 5HGXA 2GVDC 1X7ZB 1ZOIA 1ZEMA 1ZHFA 2A88A 2B8WA 2XDQA 4LQLA 3H3FA 1E9RA 1O5TA 1H8EA 1GKLA 1VJGA 2IYUA 2W8BB 3E0XA 5COAA 4C7JA 5A4JA 2IIBA 2QRVB 3PUWA 1EGHA 3SYLA 2HPZA 4AIIA 4HSEA 5F5NA 2QPOA 3OKFA 4HDNA 4QHTA 3RC7A 1CUYA 4E3WA 4EQ6A 1SBZA 4J0EA 1P31A 3KTAB 3V9PA 3AF3A 2YIJA 1EXVA 3WWEA 1YE3A 5CDUA 2VJQA 2VP5A 5KJ6A 4PNZA 4QJIA 2WQ6A 3KR2A 2O0MA 5DASA 3TQQA 4J16C 1YONA 1GT6A 3D8SA 4MGIR 1U2ZA 1MPXA 1N0IA 2GBLC 2H11A 3NB0A 4MWDA 2ZZNA 5E8RA 3TW0A 9LDTA 1KY5A 1PJBA 4BEWA 2I4OA 3JTEA 4B44A 5C5CA 3AKYA 1X15A 3F97A 4UREA 4NENB 3QPWA 2Y0PA 2R6FA 3VOAA 2DHEA 3NVAA 4QUDA 4U2DA 1MVOA 1FRNA 1W2WB 3USES 2M32A 4Q3DA 4CFZA 5ERGB 2O05A 1NI4B 2O1EA 1W47A 2QLNA 3HNRA 1OR8A 5EQJB 3WICA 1I32A 3N2IA 1L8OA 3ICOA 2BBTA 4I99A 3HKBB 4M3NA 2PSHA 3AJ9A 5KYWA 1A76A 1IM5A 2L19A 2OM6A 4AY5A 4EHIA 5AW5A 3UAOA 4BTEA 2DT8A 1V0JA 1UBGA 1VHWA 1BN7A 2JK1A 2J9ZB 5IAEA 1KDVA 3HVIA 3K05A 3OX4A 4QBIA 4R0MA 2YKGA 1BZYA 5ALHA 3WKAA 1XWFA 1CYDA 2ONZA 4DCGA 5AM0A 3HHEA 2WHXA 1I4DD 3QF4B 4RKRA 5MDHA 1QZTA 1RAGA 2II6A 5DNUA 3EX7C 1K75A 4G6ZA 3UKOA 2XTAA 3L8DA 5ILOA 2AG1A 3HACA 1N5KA 4MRVA 2RGNC 1XCBA 1KAHA 3C5HA 1HPLA 1RQGA 1NBMA 3LVBA 3OKCA 4I81A 7REQB 3BK1A 2BFCB 3BJIC 1ZRNA 4OBBA 1VBMA 2ROQA 3TK1A 4BVLA 4ZDIA 1EAMA 1Z62A 1IBKB 1QP8A 1L6IA 1GTRA 1F7UA 1QH1A 3JSAA 1RYYA 1Z0AA 1EZZA 5DU2A 5JAIA 3GLGE 4IO1A 4FUTA 3JQBA 1ZJZA 3VYTB 1JHAA 1ECPA 1KI3A 3OZTA 2BW0A 3REQA 4R71A 5F1KA 3WYAA 4CHTA 1QC5A 1WVGA 2A86A 4JB3A 1UPFA 2WR8A 2ZCUA 3N70A 3ES9A 1GGVA 2HEIA 4BLPA 5K3SA 4XYLA 2P69A 1VP9A 2NO5A 4XARA 1GAJA 4BJHB 1YZQA 3N9IA 4U1RA 2VRWA 3QTTA 3HBJA 4NBNA 1NOIA 1KO8A 2XGOA 4HXFB 1Q21A 1RADA 3BQ9A 5G4LA 3ZY4A 4P0QB 2AYZA 3CRMA 5GVSA 1A77A 1C1HA 4QECA 4TTVA 1VTKA 3DNMA 2P5SA 3UWDA 2PLAA 4NHOA 4P7JA 4E2YA 2VPPA 3A3OA 3PT5A 3TPZA 3F3YA 1QJCA 4Z7JA 1MTZA 1L5SA 2YXDA 2MR5A 2XDAA 3BF7A 3JWIA 4NPCA 1TVKB 1XU4A 2BIFA 4L5JA 1G7SA 4OHPA 4RUKA 1D3AA 2PKRA 2FX2A 4YS6A 2X8JB 3FLAA 2YNMD 3CSUA 2QE6A 4JS0A 4GQBA 1RIIA 1A96A 1NSFA 2WE8A 2JI4A 3GOHA 3OETA 3JALB 1K6JA 1SEVA 3HN2A 1U04A 3KDPA 4MQBA 4WJZA 5AW8A 3NI2A 3Q5GA 5BT8A 2OC9A 3FNEA 4Q16A 1OOEA 2NTNA 2ZP1A 3P8ZA 1U4SA 1JVSA 4HADA 1BEEA 2AWOA 3GRYA 4CF4A 4NJEB 1ODKA 3E5NA 3LPLA 4OUDB 4ENWA 3HEMA 3ZX5A 2VJNA 1FE8A 1VE7A 3OZEA 4O0MA 3ZQ4A 1C4WA 1U7PA 2RBGA 2XE4A 4W9NA 1UDWA 3NHBA 2KPOA 3NTLA 5A71A 2QP4A 4EA7A 4OHWA 3EOZA 2WICA 4Q4JB 3VU0A 1RPJA 1JLMA 2OPBA 2CVQA 5CITA 3F7TA 1NVWQ 2MYUA 1KI9A 1A27A 1M10A 2VQ6A 2X42A 2ZQ5A 3AUFA 3AU9A 3GX1A 3HFJA 2F9FA 1C3XA 4I50B 3KQUA 2C99A 3K5IA 3U1TA 1Y3AA 1G42A 2WC1A 3DUFB 4C6TB 2H1RA 1Z5OA 2WKSA 3E8MA 3WYBA 1LQTA 2QRVA 1QG2A 3JQRA 3AHJA 4GOXA 2I2BA 4H7KA 1Q1BA 4LX8A 1LNQA 3HN7A 3W05A 5LSAA 2FP4A 3X1JA 1QF9A 4NCKA 4CF7A 1MA0A 4R84A 4K0RA 1AZLA 2G77B 3RC2A 2OGTA 3PWZA 1HT1E 2JFFA 3IAFA 2NACA 2PKCA 1MC4A 2QRJA 3DZJA 1E3JA 4G85A 2IFTA 4ZVPA 1SU4A 4GI7A 5AUQA 4Y6PA 3VC1A 3ZCVA 4E5KA 5L3SB 4OP2A 2V7PA 3W8DA 3EW9A 1TJ3A 2HRQA 1DX4A 1B3BA 2ZKLA 3AR8A 4IHJF 2ZUCA 4BMXA 4CDGA 4QT4A 2QM0A 3CPSA 1KQPA 4B85A 2AG0A 1G5IA 2P67A 1MOQA 4N0QA 4RNDB 4S1VA 3EMVA 5EIBC 1VIYA 1QVWA 3UJ7A 4EPRA 2BCJQ 5CIYA 3OI7A 1S01A 4ETMA 5C53B 4LJRA 1NQTA 2JDID 1O6CA 4BNNA 1W0KA 1V25A 3OTGA 5K8TA 2A0YA 4BLWA 4B3TB 4Y2QA 3VPAA 1Z5VA 3FDZA 1T4CA 1C5KA 1D2AA 2X1HA 1HTTA 1EVEA 2QX6A 3UWKA 3WGIA 3HLYA 3PE6A 1TCAA 2IXDA 3ZE0B 3FOFC 1P45A 2BEVB 3GFFA 5K20A 2FOXA 3HCFA 3KZOA 3HJFA 2HA6A 1BNCA 1A5SB 1GNQA 2W4MA 5JCJA 4EMBA 2ZYTX 4EPYA 1HLFA 1RZ3A 2VHTA 4GIBA 2C8VA 1CF2O 1K89A 4WVLA 1ZMRA 2PZLA 3M6UA 4U7HA 5JXHA 3DZKA 2AXQA 4TN5A 1YF3A 5I9SA 1PWYE 2PHZA 1KQOA 1EINA 3PLRA 4LN1A 4LJ6A 1U2EA 2PCJA 2Q62A 4GRAA 4J1TC 3HO8A 4DILA 3HCBA 3KKLA 3K1AA 3CVYA 1E3TA 5I7EA 5KWJA 1GPMA 1Q6ZA 4O4IA 2LV8A 2BGWA 4WD3A 4C78A 2B2XA 3F67A 1LY1A 2DHRA 2IU4A 4B2LA 3F6PA 1DBIA 2O1WA 3GAMA 4HLNA 4NPHA 3ZD9A 4HQKA 4WNCA 3QYPA 2I7CA 2O2DA 5K3CA 3RYFB 1QYCA 1ZHHA 2CYCA 1VKJA 3VR4A 4RADA 1ATIA 4DLBA 5ALKA 1QRSA 1DFIA 4BNIA 3X1YA 5KCMA 3NHSA 2PZBA 1BDMA 1MJHA 3OHSX 3G2KA 1EIWA 5IUNC 3SC3A 3SM3A 4I8IA 1AN0A 2G07A 4KQ9A 1GNVA 1X7ZA 2ONCA 3C6BA 4JBGA 1CEQA 1NUHA 5EEGA 3NWJA 1GUFA 3N1UA 4W63A 1UK8A 3AOEC 1KMQA 2GZHA 2HADA 2PYIA 5DX1A 3P52A 1DWPA 3W5SA 2VDWA 5DK4A 1PRYA 2F8LA 2R8RA 3H5IA 4DVGA 4UU8A 4NEQA 1YQDA 4JBLA 1AGNA 3D3QA 4L57A 3V8EA 2FFHA 4MQEA 5FCDA 1ZD5A 4NY1A 4BMDA 2PRJA 1U3UA 3LWNA 1P0FA 1S3GA 4L6AA 3WRXA 4BDTA 4ZOEA 4Q3AA 4JWTA 4XWGA 4IFEA 2OPHA 1HLPA 3MWDB 2GJ9A 3KD2A 5ALQA 2GM4A 5HK9A 2BFEB 2A9KA 2D5BA 3R09A 3AETA 3IAAA 3LBAA 1EE2A 1U9IC 4Q9DA 2W2KB 4BQIA 3S7ZA 5JAZA 2J33A 3PIRA 3I01A 4HDCA 4AF6A 4N7JA 3NGXA 1JPUA 2GZDA 3GUZA 4MJXA 2LWIA 2X77A 4IDDA 5FHQA 4DWJA 1TK2A 3KZMA 4TQ9A 4OXRA 5EIFA 3RTEA 5JG7A 3R3JA 2ICAA 4F1JA 1YB5A 4XSVA 4HI0E 4HAVA 3ED5A 2WTAA 3M4XA 1JDVA 2QW0X 4YYZA 4FYHA 2QP3A 2CN1A 1Q0RA 4YJGB 3W2IA 5C3MA 2RGYA 4EKYA 4D0GA 1RPZA 1O96B 1WOMA 1P1IA 4MKFA 3JRXA 3AUJB 4ZAFA 1V48A 3KG2A 2ID4A 3MWEB 3WMRA 4F5ZA 1V71A 1KAMA 2CNOA 2R5N