1N7HA

Crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
339
structure length
331
Chain Sequence
RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-D-mannose-4,6-dehydratase
publication title The structure of the MUR1 GDP-mannose 4,6-dehydratase from A. thaliana: Implications for ligand binding and specificity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 129
structure length 331
sequence length 339
chains with identical sequence B
ec nomenclature ec 4.2.1.47: GDP-mannose 4,6-dehydratase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n7hA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1n7hA01
4B7XA 3ZI0A 1H5QA 3FCOA 4MVJP 4MIYA 4YJFB 5H82A 4E13A 2Y1CA 1XELA 4P8RA 3AFMA 4CQLB 4OXYA 4R9SA 1BSVA 3SC6A 1EDZA 1ADFA 1NHWA 2DQ4A 3LT1A 1PL7A 1NFQA 1XEAA 1DC4A 1QR6A 2EXXA 4IQGA 4MKXA 1U3TA 2BFOA 1SAYA 1QP8A 3E82A 3NYWA 1NVGA 4O6VA 4YQZA 2QZ9A 3H2ZA 2IXAA 3DL2A 2GSDA 1E3EA 4NNJA 3V1TC 2ZB3A 1Y8QB 3GEMA 1BRMA 5KKCA 4L73A 3AM5A 4GX1A 4HX5A 4E2YA 4CM7A 3ZWVA 2V65A 4U0KA 2QHXA 1I36A 1WDLA 3NAQA 5EL0A 4EDFA 4GKBA 3I9OA 2V6FA 3LT2A 1PQUA 2ZYGA 3FPCA 1U9JA 5IZ4A 3AUUA 2PGJA 1JQBA 3HE3A 4RVHA 3ZU2A 4D79A 4NBWA 5LDHA 1YQXA 5DZSA 1HKUA 1E7MA 3PJGA 3FRJA 3NTQA 4RPKA 2WSBA 4HNHA 4KQWA 3ZWWA 5JBIA 1DBVO 3U0BA 2NVUB 1LEHA 3D5QA 1R0SA 4WK6A 4BGUA 4GPD1 3FBTA 3E9NA 3JV7A 4RZIA 1Y1PA 3GVIA 3DTTA 4WNCA 3JD0A 4N5MA 1WP4A 2EJVA 5A9TA 5JDIC 1U5CA 3H9UA 1KIFA 1ENZA 1AXGA 4URFA 2A4KA 1MB4A 3WWYA 3WOHA 4F6LA 3ZHZA 3SLKA 4R51A 1ISHA 2JD2A 4I5GA 2CUKA 5DOZA 2JL1A 4UEOA 3UW3A 1BG6A 3JYOA 3EC7A 3I9LA 1YOVA 4RPHA 3G49A 3WNVA 4CM6A 4CR7A 2X22A 1BDMA 1TXGA 3W8EA 2Q4EA 2B4RO 3X2FA 1Z7BA 1PJBA 4MJLA 4XB1A 3K92A 4J7XA 1P1RA 3AUTA 3NT4A 4NG5A 3EUWA 3SX2A 1ZK0A 3CPSA 5KVCA 2IYOA 1P1IA 3LC7O 3AOGA 1YBMA 4IMPA 2JCYA 2ZIZA 5JAMA 1YJ8A 5HA5A 4WPGA 4K6FA 4CMIA 3WSVA 2WD7A 3LF2A 5BSFA 3PHJA 3HQ4O 2OGUA 1UDBA 1ISIA 2VZ8A 3FWZA 4RDHA 3WJAA 5JAIA 3DFZA 3L0DA 3OETA 1ULSA 4J1SA 3ASUA 3H8VA 4Q3NA 3LVFO 2VRBA 1NFRA 1J5PA 2IEDA 1EK5A 4XD2A 3TL2A 3ON5A 4DLLA 1IB6A 1ZFNA 3UUWA 4Z0HO 1CDOA 4MKRA 3ZW8A 4MINA 1UZLA 2X9GA 4AJHA 4PG4A 4OXKA 3S2IA 2PGDA 4WCFA 1HRDA 1HDRA 4UVGA 3NKLA 2C5AA 3K2EA 4EITA 5G0TA 1E1NA 1GV0A 4FFRA 3Q3CA 3JYNA 3LK7A 4BNJA 4IQ0A 1N1EA 1Z7EA 2BI7A 1U4OA 5IXSA 1TEHA 3O8QB 4JXKA 1JU9A 1ADCA 2Y05A 4J90A 1KVQA 4W7IA 3WWZA 4WEQA 5K6AA 5EIOA 1HETA 4RQTA 1Z6ZA 2HDHA 3PEFA 1WVGA 4YRBA 4JP2A 2PV7A 1TLTA 3QQPA 5BQFA 1LSJA 3FBGA 2EG9A 3DWFA 1AGNA 4DIOA 2X7HA 3HN7A 4H3VA 4DTIA 2C29D 3R3SA 4QFCA 4Z3KA 3IUPA 2NWQA 2Q99A 3A06A 4OAQA 5T64A 1Y5MA 3PFFA 4E5PA 4IZIA 2ZTLA 1V0JA 4RORA 3IIEA 4R69A 4RVUA 3DHNA 3KV3O 5ENDA 3BTOA 4JP3A 1KC3A 4PLHA 1L7DA 2G1UA 1JAYA 4NZ9A 4LISA 4XQ9A 2EW8A 4ALMA 4BS9A 4CL8A 1NASA 1N9GA 1YB4A 4IS2A 1LC3A 4JX8A 3BA1A 3C3XA 3VPHA 3QV1A 2O3JA 1PZHA 5G4LA 1I2CA 2BLLA 1HSOA 4J7CA 5GMOA 3IQDB 9LDTA 4PFJA 5G0SA 2B83A 2FP4A 3R3JA 1ZXLA 1QRRA 1U2GA 1YL7A 2R00A 4U6QA 4J49A 2EGGA 2NADA 4Q39A 4WKGA 1C0PA 1GCUA 4H15A 1VM6A 2GN8A 3F5SA 1U2DA 2Y1FA 2VHYA 3CXRA 2GPTA 4CQMA 5IZCA 3T7CA 1GYPA 1PJ2A 4MVJM 2HAEA 3H9JA 3OP4A 5L3ZA 3AWDA 3E48A 3FD8A 4Q3BA 3RFXA 3ROKA 1GYRA 1W73A 1P0CA 3DB2A 4CUKA 2B37A 2NU9A 4FW8A 5F1PA 4BO4A 3JQFA 4NJOA 1SCUA 4AJ1A 1ZIDA 1EVYA 3BHMA 1R6DA 3D3WB 3ENKA 1T2FA 4BOYA 2DFVA 4MP3A 1YKFA 2DUWA 3TL3A 1WNTA 2PA3A 2BGLA 5J23A 2OHXA 3AI3A 1KVRA 1VKNA 2C5EA 2SCUA 2VHWA 3F3SA 4G2NA 4O1MA 4XB2A 3U49A 2PTGA 4YJGB 5THQA 3H65A 4FN4A 4CV0A 3SJ7A 5JDCA 5ENVA 3PVZA 4K6CA 1W8DA 4YEDA 5DBGA 2X4GA 5IXYA 1B3BA 3EHEA 1F0YA 1MC4A 2P91A 2IRWA 2IZZA 5I7VA 1I8TA 3AI1A 1PJQA 2VUSA 3GNSA 3RD5A 3VZQA 4BO9A 3O9ZA 3VZPA 5TF4A 1UAYA 1XWFA 4OJNA 3GVHA 3FNEA 4GL4A 4XKJA 2HMVA 3WGYA 1T26A 4KUGA 3GR6A 9LDBA 2FPIA 3F9IA 5A5EA 2X0NA 4OIMA 2YHIB 2O3SA 5FF9A 2ZQYA 4LVUA 2C82A 1RM0A 1E3LA 3L07A 1V35A 2JFFA 1XU7A 4O0LA 1WLYA 5JY6A 4JJGA 2QQ5A 1E5LA 5JLAA 3A9WA 4BL5A 3TF5A 2ZKLA 2PZLA 3OIFA 3QJ5A 1JKJA 4ZU3A 5IDYA 1JWAB 4PZEA 2E48A 1GV1A 4ONEA 1LSSA 1UP6A 3C24A 4Q3EA 3CMCO 1Z74A 4GLLA 4TKMA 4DYDA 2GO1A 4GSKA 3UHAA 1OZAA 3NV9A 1MXFA 3GDFA 4LRTB 1FDUA 4D44A 2P5YA 3GH3A 4FFMA 5DCUA 3NGXA 4TVBA 3E5RA 3KO8A 4D46A 2DFDA 4BGEA 4XGKA 3OEYA 2VN8A 1F8GA 4PZDA 2C2XA 4ZJUA 4BNGA 4D0SA 4CQMD 4ZHSA 4MDHA 2P4QA 4KUHA 4HFNA 3E9QA 4IJVA 1HDXA 1Z73A 4MVJE 2GLXA 2B5WA 3C1OA 5CEFA 1VPDA 4YR9A 4R5MA 3JYQA 3ZDFA 1I32A 2B0JA 2HQ1A 3MTJA 4DBZA 2BHLA 1JAXA 2FR8A 2VRCA 3RBZA 3DQPA 4ALIA 4MVJA 2Z1MA 5JMWA 4NU6A 5ITWA 1NQTA 1WZIA 2WTBA 4DIBA 1K6XA 4XA8A 3CIFA 4CM9A 5CDSA 1A4IA 4CMCA 1YL6A 4UUMA 3DBLA 3GDGA 3INRA 1ISJA 4B4WA 5F21A 2CDAA 4WOKA 4AJOA 3DBVO 5KJ1A 1T25A 5FEUA 5JC1A 3KTDA 3VPGA 4W7HA 2VZ9A 5FYDA 4IZHA 1UH5A 4EW6A 4FOSA 1I5RA 3DMTA 1X7HA 4CMKA 4NFHA 1HDOA 4NJMB 2Y0DA 5BNFA 2OL4A 5JW6A 1LUAA 3QVOA 2NTNA 5B12A 3UVEA 1PJTA 2FRDA 5COAA 3W4JA 1BDBA 2OORA 3EVNA 4N5LA 1UDCA 3B1KA 1MXHA 5DOVA 2GN4A 4NK5A 4CLDA 1DLJA 1PZFA 1KERA 5C3MA 3AK4A 3WLEA 4D3FA 4AJJA 3KYCB 1CQJA 1MP0A 1Q0LA 4Z6KA 1O95A 5GZ3A 5L9AA 2NQ8A 1I3NA 1OBFO 3WICA 1JWBB 1SEPA 3RUAA 5DCWA 3GVPA 3JD4A 2AA3A 1BVRA 4WLEA 3WMXA 2Q45A 3KUXA 1C1XA 1ZW1A 4FJ2A 4LN1A 4CMAA 5IG2A 5IDXA 2YUTA 4JROA 3DR3A 3PWZA 3ZNQA 1R4MA 1HF3A 1Y8RB 3BMCA 2E6UX 1O94A 1K2WA 2CDCA 1E7YA 1SB9A 2DTXA 3KM0A 2BFMA 1OMOA 1NPDA 4JBIA 3ZHYA 3ORFA 2UYYA 5JPIA 3PWSA 1HE4A 3NDJA 4W4TA 4NK4A 4I9NA 1DC3A 2W4QA 4JJFA 2WWRA 3P19A 4XYLA 4I8XA 1HTBA 5FFFA 1EBUA 3UGKA 4BV9A 1HXHA 3W6ZA 4NQZA 1MX3A 4W9NC 2RCYA 2GD1O 1LDNA 3STHA 4GQAA 1M76A 3JQ9A 3AY6A 1DHRA 4RCVA 4A7PA 4ALLA 3R0IA 4XYMA 4MVJD 3QRWA 4A5OA 3JQBA 2QYSA 3JQ8A 2O3QA 4WJZA 3ETGA 1QYCA 1E3WB 4J7UA 1I2BA 1DRUA 3EK2A 4UUNA 3QVXA 2NUAA 3P7MA 3VH3A 3WFJA 5L53A 1MG0A 5U4QA 2C07A 2V6BA 4UVEA 4YT8A 3OBBA 2EKPA 3GNQA 4BKPA 4CM8B 3D3EA 2EP7A 3M2TA 1ML3A 1I33A 2WDZA 3CEAA 4WGGA 2JCVA 4DREA 2Q1SA 4BMNA 3RUEA 1P1HA 4L4SA 1ZXBA 4ND2A 4E4YA 2RH4A 5F1KA 1FMCA 2X5JO 3T7EA 4BNKA 1A9ZA 2YJZA 1PU2A 4KTTE 1DJNA 3VTFA 4CLOB 3ONEA 1P45A 4PRLA 4BO6A 4F6CA 4EJMA 5GZ1A 1DXYA 3VKVA 1UXJA 4U6SA 1HDYA 4XQGA 5HRUA 5A05A 4CLEA 3DOJA 2PNFA 1H94A 2X58A 4QTZA 4XR4A 4BO3A 5IN4A 4NBUA 4NFYA 4IJWA 1EFKA 3IKVA 4FJ1A 2PLAA 4LCEA 1QKIA 5L4NA 4DPMA 3IKTA 3QP9A 4INAA 1WPQA 3DOCA 4LVCA 3D0OA 3HSKA 1B8PA 1O9BA 3K73O 4I08A 4I9HA 4RPLA 3TZCA 3EY4A 4RVSA 5IJZA 3JQ6A 3RU7A 5C7OO 1XG5A 5CEEA 4BO0A 3TFOA 3JQAA 4BQRA 1LU9A 1HEUA 2IDZA 2O7SA 2H1SA 3E9MA 4AJNA 1B14A 2UUOA 1TVEA 1N5DA 1M6HA 2J3IA 3HZZA 1PZGA 4TRJA 3QVWA 5CDUA 3SVTA 4DA9A 4A27A 1BTOA 4WUVA 3MJEA 2JAPA 2VOEA 4MPDA 2CNBA 2TMGA 4DYVA 1ZK3A 1F06A 5T8KC 2YV3A 4BNHA 4AG3A 1YWGO 2HMWA 3OQ6A 1R4NA 2Y1EA 4KQXA 5G0WA 3OIDA 1ZH8A 4E3ZA 3U3XA 3WGIA 3BIOA 2YHUA 4M55A 5KVQA 1B26A 3ZWXA 1SOWA 3JQGB 2D0IA 2Y0CA 4HNGA 4RVGA 4WEOA 1AHHA 2ZATA 1WMBA 2UVDA 2VYVA 2VUTA 1ZK4A 3GVCA 3GFBA 4M8SA 1CF2O 3RC9A 4E0BA 4R01A 4BB6A 3ICCA 3RVDA 2O4UX 4ND1A 3A28A 3SEFA 5CEJA 1EK6A 3F4LA 5L4LA 2B69A 2QRLA 3INTA 1C14A 2JJYA 4KMSA 1AE1A 1B15A 4YQYA 5FI3A 3ZV4A 4BMSA 4IIUA 4WLOA 1GAEO 1EMDA 1JN0A 4HFMA 5JDIA 1QYXA 4XGNA 1UZNA 1ZSYA 4Q3DA 2GZ2A 2O2SA 3KBOA 3D4PA 4GX0A 4DQUA 4L75A 2YQ4A 3QWBA 4C4OA 4M89A 4GVXA 5AYVA 5AXBA 2VWGA 2PKRA 3NDIA 1B8VA 4P4GA 2V6MA 1WAMA 4B7CA 4CMBA 4BO1A 4FB5A 3CUKA 2B4QA 4ALNA 4J9VA 4DMLA 3UH1A 1T4DA 1M2WA 1ONPA 5KKAA 3VVCA 3DBHB 5I7EA 4NR0A 3SC4A 4XZ3A 1YB5A 5BR7A 1SOVA 2W2LA 2OBYA 4P4NA 4RF4A 2Q4BA 3CZMA 1IHYA 3ADPA 4R1NA 3WB9A 2EF1A 3BMNB 4TRNA 1UP7A 2C54A 4P38A 4CR6A 1ZSVA 3KEQA 3MJSA 3CTMA 1M67A 4GMGA 2Q2QA 1K6IA 4ALJA 1EDOA 1PEDA 1U7HA 3JQEA 2NVUA 3PFWO 3KYDB 4M49A 1V3TA 2YDYA 1K0UA 2D4AA 2PZJA 4IGFA 3U09A 4CMGA 1GTMA 3V8BA 5AXDA 1Z75A 1M75A 1NM5A 3OQBA 4K1LA 4LSWA 3GRPA 2VCYA 2GUGA 3CH6A 4BNMA 4MO2A 2NNLD 1DFIA 3G1UA 5JE8A 5MDHA 4BNNA 1TA4A 1KEUA 2P9EA 5A4DA 1XIVA 3DAFA 5BNIA 3ZV3A 1QG6A 3IP1A 3NT2A 4JIGA 4R1SA 3GHYA 4L76A 1ZSNA 2VWPA 1B16A 2QX7A 4JK3A 2DTDA 3PK0A 3QWIA 4OMUA 4FS3A 5G4KB 1YDWA 2UDPA 2Z5LA 5L7WA 3VAZA 1I10A 1QXSA 5BNTA 4D3SA 4PLWA 3L77A 2E4AA 2JD0A 2VYVD 3ONDA 4YBZA 5EERA 5A9SA 4TSKA 4ND4A 3EW7A 3ITKA 3KHUA 3QWHA 2BGMA 1KBZA 3TSCA 2BELA 3HDQA 2XOXA 3ENNA 5L51A 3RUHA 4RO0A 3TQHA 2DKNA 2O3UA 2D5CA 1LLDA 1KETA 2JKVA 2O3TA 1TB4A 3TOZA 5IFLA 2OXIA 1O89A 4Z3DA 4R54A 4HUJA 1TT5B 2D3TA 4LCJA 1U8FO 2VNSA 3W8DA 4ZQHA 5IF3A 1LJ8A 2YV1A 4BNVA 3KZVA 2A92A 4GX2A 4Z9FA 3DXFA 4CR8A 2H9IA 3PDJA 2PZMA 2G0TA 1K89A 1GU7A 4PRKA 1UXKA 1OI7A 5B1YA 3PGXA 3GGGA 3C8MA 4XJTA 2XXBA 1OOEA 1KS9A 2P4HX 3K8ZA 1ENYA 4WCDA 2EJWA 3GC6A 3VKUA 3OHSX 3RROA 4DC1A 4E30A 4B4OA 1ZZEA 1VC2A 4BNXA 1U3VA 3NX4A 1C0LA 1NX6A 5C5IA 4HY3A 1ULUA 2W2LD 4EYEA 1LX6A 1LLUA 1PJLA 4UEJA 3DHEA 4OL9A 1DC5A 4XQEA 4TVOA 5ICMA 4DRYA 3F6YA 4M86A 3RKRA 2W8ZA 4I1IA 2Q49A 4E5YA 2PKQO 2OP0A 2DLDA 2X0RA 2Y1OA 4MKZA 1P77A 1V8BA 3F47A 2JHGA 2BH9A 1GUFA 2F1KA 3QSGA 4N18A 3G0OA 1Q2XA 3QVTA 4BHTA 5G0UA 4D0RA 2VZ0A 1V9LA 1IZ0A 3VZRA 3ZNOA 3GN1A 4EZBA 4QO8A 3HWRA 3ONFA 4TKLA 1LA2A 4OKIA 5TX7A 1F8FA 5CG1A 4W82A 4OH1A 3PLRA 4EUHA 1LRKA 1Y6JA 5DN9A 4QSMA 3I9NA 2IYPA 4J9UE 5TJHA 1XA0A 2ZCUA 5DCYA 1RWBA 2HSDA 3DAGA 4U0JA 1PGJA 5TGDA 3WGZA 4H7PA 4FJ0A 1DFGA 4D45A 3O03A 2XF8A 1HE5A 3ZHXA 4EBFA 4J3FA 4KDFA 3BHJA 3H9EO 2HUNA 5A3JA 3FI9A 3JSAA 3B1FA 1IYZA 1PSDA 3EYWA 5HM8A 4OHUA 3HN2A 4RJTA 3RKUA 5EN4A 1PX0A 2VNAA 2NTJA 1I2ZA 3KEOA 4PGFA 4UAGA 1IZ9A 1SZJG 3RI3A 1EUDA 3B70A 1ZEMA 2LDXA 4X54A 1P0FA 4W6ZA 4ID9A 4RF5A 3VH2A 3ZWAA 5I8ZA 1E7QA 2DBRA 3DHYA 3C1TA 4Q9NA 4U7WA 3W1VA 2BRUA 4Y98A 1PS0A 2AQHA 4Q3CA 3ZWCA 2X5KO 3ST7A 2EGHA 3RJ5A 3B6ZA 1BXGB 3WGHA 1Z45A 2EP5A 3H7AA 3KOUA 4YVFA 1HZJA 2UUPA 2EHDA 3WBFA 2B5VA 3GLQA 3QW2A 4DIFA 5FI5A 4CMEC 2GERA 3HJAA 3Q2KA 3D1LA 1C0IA 1YE3A 3LC2O 2VWHA 4E5MA 3DONA 4FBGA 2P9CA 3T4EA 1PJ3A 4YJGA 2GNAA 4GX5A 2Y93A 1YQGA 1R12A 3CINA 1N92A 2WD7B 4BO8A 1NVTA 4CMIB 5I7FA 3HDYA 4OSPA 1ORRA 3GOHA 3AM3A 2HK8A 3C1AA 4ITUA 2W2KB 2CVOA 1NNUA 2E49A 3I23A 2O48X 3ROPA 1GUYA 1P44A 4BUCA 2C59A 3AOEA 4LSMA 4B8WA 1UDAA 4FCCA 2B35A 3JTMA 5TNXA 1P74A 3RCBA 3OIGA 3H3JA 5DP2A 5JC8A 2YHIA 3GMDA 4PVDA 4TRMA 3FNGA 5A1TA 1PIWA 1YB1A 3FF4A 1O5IA 3MWDB 3I52A 3IDSA 5BSEA 4ZQFA 3BXXA 1U1IA 2Y68A 1KVTA 2RH8A 7MDHA 3ULKA 1GQYA 1T2DA 4LK3A 3VTZA 1EUCA 2YYYA 4E2WA 3K31A 4MOWA 2A9FA 2X23A 4MVJF 3VPXA 1VJ1A 4RV9A 5BT9A 4BV8A 3GGOA 3K2BA 3MJCA 1XU9A 2DBZA 3LDHA 1HYHA 1EQUA 3OJEA 4UUPA 1E7SA 4MIEA 2QRJA 1QMGA 3S8MA 1NHGA 1MFPA 1DHTA 5A9RA 4E31A 2XAAA 3KRTA 4U8GA 5EINA 3GMSA 4XEHA 4B4VA 2YFQA 4IXWA 1NAHA 5B4VA 1NYTA 3ZWOA 3GZNB 3FR7A 4AICA 1A7KA 1LTHR 2O7QA 3M1LA 2XXJA 1T2AA 4R9RA 5I9LA 1JKFA 4L0QA 1D4FA 4MP6A 4N5NA 1A72A 4IBOA 1H0KA 2Y1DA 2PY6A 1W0CA 3WMWA 1Y5RA 4RPJA 4EJ6A 3GPIA 1MGOA 3P2OA 2EWMA 3AUAA 3COSA 4GLOA 4HADA 4TROA 4N54A 4PLGA 1PTJA 2OOSA 1R0KA 3IJRA 4GBJA 1HT0A 2PWZA 3OJ0A 2YQ5A 1NP3A 3W4IA 5ILGA 4E21A 4F3YA 2AEMA 2O3RA 1N9GB 1HE2A 1GD1O 2JAHA 3GRKA 3LT0A 4FGSA 4GWKA 1J49A 3RSHA 4B3HA 1CRWG 3IC5A 5A3VA 1RJWA 4BKRA 2A94A 2FR0A 1B3RA 4WASA 3DZGA 1R37A 4IM7A 4YJHB 5TLSA 4XYGA 5KOIA 4IINA 1ZJZA 1ZNQO 3PXXA 2AG8A 3D4NA 3TPCA 3M6IA 2OO5A 4LRSB 1YGYA 2NU8A 1XLTA 1SBYA 3OM9A 1YH3A 2VWQA 3DZKA 2C2YA 2QW8A 3IUSA 3ZN2A 3U4IA 1VSVA 1SC6A 1GEGA 2OZPA 3F5QA 3LYLA 4GWGA 4UVDA 1U3UA 2IE0A 4NJMA 5LDGA 4BKUA 4CM4B 5MGBA 1DRWA 1E77A 4Y67A 4DL9A 1NWHA 3L9XA 3NJ4A 1I0ZA 2GN6A 3C7CB 4S1VA 3OFSA 1ISGA 2BKAA 2BI8A 4IDGA 4BO5A 3ICPA 2NM0A 3MWEB 4IDBA 1X15A 4PG6A 3ABIA 4QO7A 4AVYA 3MTGA 4HV4A 5KVSA 1D7OA 2JD1A 4W9NA 1RPNA 1LI4A 2A35A 1I01A 4EEZA 5T67A 3KYCA 3GAFA 1E1KA 1EZ4A 3OSUA 3T4XA 2CF6A 2V7PA 4QQRA 3TZQA 1NR7A 1QLHA 3GZ4A 1CIVA 1LSUA 3HADA 3S2FA 2HK9A 1P1KA 3IS3A 1Y8RA 2DBQA 2WM3A 3EDMA 4O63O 1ZBQA 4PCVA 2HMUA 4BO7A 2PH3A 4YT5A 2VUUA 3GPDG 4GMFA 4J2HA 1E3SA 1Z82A 5IAAA 4OOEA 4K28A 2R2GA 3CMMA 1WWKA 3JYPA 3BMOB 5B4UA 1IUKA 2Y99A 2HMSA 3MJVA 5AXAA 1T2CA 2ZCVA 2VYNA 2GASA 3A14A 1JDJA 2YZ7A 4Y6RA 3W4KA 2FSSA 3MOGA 4B4UA 3MZ0A 3C85A 4E5NA 3UAGA 1WXDA 1FK8A 1JVSA 3PIIA 5U9CA 3AI2A 4CM1A 3BTSA 1NQOA 5JFOA 1PR3A 4ZN6A 4A73A 1OAAA 3VZSA 2VOJA 3ROMA 4UULA 4L8VA 2WEKA 5AVOA 2EIHA 2G82A 4D7AA 3U5TA 1DO8A 1FDVA 4GKVA 2QZZA 2IZ1A 3KSZO 1E3WA 1DLIA 1LDYA 2X86A 3PHLA 1D8AA 1JLLA 4AJ4A 2IODA 7ADHA 4A2CA 3WGOA 4D3DA 1BGVA 4CM8A 4IDFA 5LCXA 2HCTA 1MV8A 3HNPA 3PHIA 4FFPA 1SB8A 3GG2A 1LDGA 1X1TA 5JY1A 3C7DB 1PL6A 3Q1LA 1IULA 4YXFA 5CDTA 2D59A 2H5LA 2HU2A 4ROSA 3GUCA 5K9ZA 4R41A 2JFGA 3IOYA 4XR9A 1G0NA 1LBEA 4KTVE 5TC4A 3O4RA 4CLOA 1Q7GA 3GHHA 1GQQA 5T8KA 1SPXA 2P68A 1SO8A 1EQ2A 2EKQA 4AJKA 3D5TA 3D4OA 4EEXA 2P5UA 4U5QA 4DXHA 3WGTA 3LT4A 1KEWA 1YXMA 5TS3A 3I9MA 3FHLA 2DVMA 1B7GO 1VJ0A 1OFGA 2O23A 3CKYA 3S55A 3PI7A 1DIHA 4Y6SA 4CLHA 1B8UA 4XRRA 4J4BA 3JQ7A 3ZZNA 4B3IA 4PVCA 3ITDA 5THKA 4EUFA 2IXBA 2VRCD 2IEBA 3OEWA 1A71A 1XYGA 3RBXA 5L45A 3PGJA 1R16A 3GVXA 2GZ1A 2ZK7A 3AU8A 3ZWNA 2DTEA 2NVBA 1XGKA 4LMRA 1ZK1A 3V1YA 4CM9D 2BFPA 3KETA 1RYEA 3AJRA 1HDGO 1VJTA 3H3FA 3TJRA 3BMQB 4HWKA 4O5OA 3PIDA 5CAEA 2OP1A 2Q3EA 4CL3A 2BFAA 1YBAA 5U1PA 1RKXA 2VYND 3PYLA 1TT7A 4QXMA 4MVJH 2I65A 1G1AA 1FJHA 2G5CA 1KY5A 4IGEA 5DT9A 1LDEA 2ZYDA 3DO5A 3TOXA 4KUEA 1CWUA 1GDHA 3B20A 4A10A 1LRLA 1ADBA 2RHCA 1VSUA 5COBA 2BF7A 4IY1A 1GPJA 1UZMA 2YDXA 3D64A 3CZRA 1UXHA 2CDBA 1K3TA 1C1XB 3JQGA 2Q1UA 4D41A 8ADHA 2BD0A 3JCZA 3RU9A 1N1GA 3BYZA 3BMCB 4II3A 4GSLA 5H83A 4IDEA 1IPFA 1WW8A 5A5FA 1ADGA 3I4CA 5FWNA 3WSWA 2CD9A 1ZMTA 1GEEA 3DOOA 2NACA 2W90A 4XYEA 5DBFA 1JA9A 1ID1A 1NTOA 1W4ZA 3WG9A 1WMAA 3DBRA 3NEPX 4J2OA 4J1QA 2AEFA 1HZZA 3M1AA 4PN3A 4K26A 3MEQA 1GL3A 2TMDA 3E8XA 3GFGA 6ADHA 1KEPA 2FPGA 1FDWA 3U9LA 5KJ6A 3LLVA 1C1DB 4FPXA 4PIVA 2PH5A 5KJFA 4RVDA 4FQ8A 2C7GA 2VTEA 3Q9NA 1IE3A 3HDJA 4TQGA 1PL8A 2PGLA 2NU7A 4B8ZA 4YRAA 2H63A 1V3VA 1N7HA 3DBHA 2VQ3A 3GEDA 1P31A 3LF1A 1X7DA 3IP3A 8LDHA 1O8CA 1J0XO 2GN9A 2C7VA 3RUIA 4BNLA 5COQA 2OUIA 2WE8A 3BMNA 3HHPA 5JXWA 5KJEA 3PQDA 4KOAA 1GZ3A 1H6CA 1WDMA 2CMDA 5DNAA 2I5PO 3WR5A 3JQCA 2AE1A 1XQ6A 2CZCA 3PJFA 2P9GA 3DMYA 5DDIP 1U3WA 5B4TA 4YJFA 3OA2A 3KYBA 4CQLA 1DIAA 1UXIA 3GF4A 1DAOA 1SEVA 4WLVA 3WNQA 2I76A 1P1JA 1E0DA 3TFQA 4B79A 3HG7A 2FHSA 3DZIA 3SJUA 1NWCA 5HS6A 1WDKA 4A0SA 4CLRB 4F45A 3UXYA 3NDRA 1Y8QA 4FC7A 1VL8A 4EJ0A 1QYWA 2I3AA 2X0JA 3ANMA 1K6JA 3WQSB 4A26A 4RVFA 5GY7A 3I6QA 1NQAO 5C7IO 3KVOA 3OH8A 1HL3A 3RWBA 1HYEA 2PD3A 5L4SA 3C7AA 1Q0QA 4PG8A 2C0CA 2DM6A 3E03A 1YS4A 4J1NA 4ESOA 1DC6A 4JBHA 5AQ1A 2V6GA 2Q46A 4YCAA 1W6UA 1AN9A 4JGBA 1S7CA 3QY9A 1N2SA 4XCVA 3WLFA 5T57A 2DT5A 3D7LA 5BSGA 3IAHA 3UOGA 5KCZA 2GRAA 1TT5A 3JQAD 4XIJA 4J4TA 1QV7A 4K9DA 5HBRA 4CUJA 3PJEA 3PYXA 3LSYA 5KIAA 4IJUA 1A9YA 2CF5A 3K9QO 3ZWBA 3UCEA 4JLWA 5IDWA 1B0AA 4I9UA 5B37A 4YACA 5A04A 4FGWA 3FTPA 3V2HA 1U8XX 1GADO 1PS8A 5TT1A 4DQXA 5JCXA 3E5MA 4Z9YA 4Z0TA 2GCGA 3TNLA 3H4VA 1NBOA 2ZJ0A 1QSGA 4JQCA 1IHXA 1EFLA 4G5HA 4FDAA 3FSRA 3HB5X 2Q2WA 4R1TA 4J16A 2O4CA 4JCOA 1I3MA 4RF2A 5I9MA 1HDZA 2Y66A 2ZTUA 1PQWA 3TZ6A 4BGIA 4RL6A 1DRVA 1BWSA 1D1SA 2CSUA 5KNLA 1YRLA 4ALKA 3I5MA 4BKOA 3WDSA 3WGQA 1BW9B 3WJ7A 2VT2A 1A4UA 3F1LA 4QFDA 3RJ9A 1X7GA 2ZTVA 1Q1NA 3KLMX 3ETEA 2NU6A 1XHLA 5LC1A 4PG7A 1KC1A 3ETDA 2E37A 3WS7A 3A4VA 3K30A 3OA0A 5I9NA 1YBVA 4XDZA 4E32A 5TQVA 3GGPA 4YPOA 1CJCA 1T1SA 3OJOA 2VHZA 4Y6PA 4YAEA 1QV6A 4HBGA 5L95A 4AJPA 3KXDA 3V2UA 4IMRA 4YWJA 4EUEA 4UEKA 1GZ6A 3BHIA 3FN4A 4F46A 3ADOA 1ISMA 2YFHA 3L4BC 1XR3A 3MCVA 4J43A 4PLZA 2VHXA 1UP4A 5CG2A 4WOJA 4DC0A 1GYQA 1DDOA 3OJLA 4PLFA 5EQFA 1LDMA 1L1FA 3ROQA 4YT2A 4CMEA 1LLCA 2FWMX 4CPDA 4DPLA 5JS6A 2J8ZA 1H6BA 1HWYA 4GAEA 1VL0A 4ZQBA 2IZ0A 3RUCA 2AHRA 5EESA 1N8KA 4AJEA 2GGSA 2HRBA 3E1KA 4TZKA 1T24A 4ILKA 5KWEA 1PGQA 1Y81A 1HLDA 3IL2A 5CFZA 3O8QA 2CY0A 2Q50A 3AFNA 3HFSA 3Q2IA 5DULA 1IY8A 1YVEI 2G76A 4D42A 2QG4A 1HSZA 3GNTA 3N58A 4YAJA 3RAJA 3WQRA 4NMHA 4DVJA 4XGIA 2GZ3A 1ISFA 4CV2A 2I67A 1IPEA 2J5RA 4ND3A 1NR1A 4IPTA 1O0SA 4CUZA 1L7EA 1BXGA 4CMHA 4YAKA 4B3JA 4AJLA 5KVVA 3JYLA 2PFGA 3TZKA 2WYUA 3RC2A 1PGPA 3NUGA 4FOOA 3VH4A 4DPKA 3W6UA 2GF2A 1FF9A 4UUOA 5JAZA 2POQX 1E6UA 3DC2A 4WLFA 4J4HA 1LSOA 3H9QA 5A9SB 3LC1O 3O38A 4CJXA 5IDQA 2NQTA 1CETA 1ENOA 5G0VA 3N74A 2DAPA 1YL5A 2H6EA 1E7WA 3WYEA 3P5SA 1R15A 2VTDA 3X2EA 4P4LA 2GDZA 3UFXA 5DF1A 1DOHA 2W2KA 3U4DA 4J0FA 4JJIA 3H6KA 1OC4A 2X9NA 4YTEA 4YT4A 1WZEA 4ND5A 5CDGA 3WTCA 3I83A 3PP8A 4ZVVA 3KSUA 1QYDA 4E2XA 2HJSA 5JMPA 1CERA 1UAGA 1FDSA 2NSDA 3ZCXA 2RIRA 2DC1A 4NHEA 1XCBA 4NDNE 4QUKA 1PWZA 4RDIA 4AJIA 2Y0EA 3JD1A 1LDBA 3HUDA 2AQIA 5EPOA 3E6AA 4KDEA 1RM3A 3RASA 4CV3A 1H9BA 4GGOA 1T1RA 3TWOA 1YOVB 5JO0A 5CDYA 2DPGA 1H2HA 2AW5A 1C3VA 4KWIA 4MIOA 3FWNA 4FSHA 4IDAA 3JD3A 3PZRA 4S3MA 1PZEA 3D3WA 3SXPA 4IXTA 1DB3A 3VC7A 1PR9A 2ZTMA 4XDYA 2D8AA 2Y67A 1R0LA 2J3JA 2Z1NA 4RPGA 3GZNA 4N7RA 1ARZA 3PLNA 3GA0A 2LDBA 2RHRA 3QWAA 1ZO8A 1Q0HA 3BTVA 2J3KA 4LGVA 1H2BA 4G65A 5C7LO 2YW9A 4CODB 4NBRA 1EE2A 2OFPA 4IDDA 4I5EA 1VLLA 3LQFA 3Q6IA 4B7UA 2FOIA 4DUPA 4BVAA 2ZQZA 3H5AA 3JD2A 4M54A 4OKNA 3WTBA 4CM3A 4GVLA 1XQ1A 4NBVA 3FR8A 1P9LA 1UXGA 4KZPA 4IS3A 1ZEJA 5T5QA 4HXYA 5AXCA 4WCFB 2Q2VA 2BMAA 4XJSA 4Z9XA 3TDKA 1GR0A 5HS4A 3Q11A 1UUFA 3VH1A 2X1HA 4NPCA 3V5NA 1EBFA 3FPLA 4PZCA 1PQPA 4RLHA 2JFHA 2AEJA 4YJHA 3VHRA 1KYQA 1BXZA 4BKQA 1UR5A 1BXKA 3GN2A 3GT0A 3U4CA 1GFSA 3NT5A 3Q0EA 1LLQA 2B36A 1VL6A 2Z95A 2WYVA 2G17A 3WBBA 3DDNA 2E82A 3ASVA 1TI7A 4M87A 3TRIA 2QRKA 3H5RA 1UJMA 2X9VA 4XX0A 4CM4A 1HDCA 5TIIA 4GGPA 2YV2A 1U5AA 4RGBA 4ZQEA 1JW9B 3VPSA 1DSSG 4W99A 2O50A 3PTZA 3UN1A 4IDCA 2AMFA 4C7JA 3QVSA 1E5QA 2OMEA 4BNUA 3E18A 3PHGA 3PPIA 4WCFC 3FNFA 4YAGA 5JYDA 2QYTA 2F00A 4R16A 4O59O 3EZLA 4Y9DA 5L7YA 5AOVA 4BO2A 4NI5A 2ZB4A 3PYMA 1FDTA 4PLYA 3DZHA 4J0EA 1RM5A 3I9JA 1J6UA 1V3UA 2DUUA 3DEYX 1A7AA 2PD6A 2I9PA 1EVIA 1DAPA 2WJPA 3UCFA 4OM8A 1EUZA 4OYRA 4R1UA 5HTOA 4OQZA 1NPYA 3WYBA 3WXBA 1F12A 4J1TA 3GY0A 1EE9A 1ONOA 3L9WA 4BNFA 5JYEA 5K6AC 3W8FA 1DIRA 1ZMOA 1MFZA 3BMOA 3UICA 3KB6A 1E6WA 1NVMB 2FY8A 2Y1GA 4NBTA 1MC5A 1O6ZA 4QT0A 2ZB7A 5JAQA 4BGVA 3R6DA 1Y9EA 5TJ9A 1DPGA 3IJPA 1DJQA 3WGGA 3EAGA 2GYYA 2HRZA 2HK7A 3AU9A 4BNYA 1CEQA 4CQMB 5F5LA 1X0VA 4MVJI 3S1LA 4DLBA 5K0ZA 1DFHA 1KY4A 3I3OA 3UKOA 1E3IA 3MJTA 1YQDA 4KP7A 4AFNA 1U28A 1P1FA 5L7TA 4FR5A 1Q7BA 3QWFA 4TRRA 4DWVA 1D1TA 3MJ4A 3G79A 4PLPA 3INGA 3P2YA 1LXCA 1E92A 3ANLA 3SBOA 3WQQA 1PS9A 1JKIA 2X8LA 3M2PA 3EVTA 4WE3A 3TZHA 4IIVA 2Q1TA 4ZRNA 4R4JA 4L74A 4OXNA 5ADHA 3RUFA 1GCOA 3RBVA 2EERA 3DFUA 1HE3A 3RC7A 1DEHA 1LC0A 3S2EA 3LLSA 2R00C 2AQ8A 3DTYA 3AOEC 4ZD6A 4C7KA 4LW8A 5DBIA 3H5NA 4PLVA 3WYCA 4EI2A 1E6EA 1DIBA 1RYDA 3DAPA 3OECA 3ZWMA 1PJ4A 3VVBA 1E3JA 1MA0A 5IZCC 2HMTA 3NTOA 4E2ZA 2FN7A 3U62A 2O2YA 5EJ2A 2NVWA 2RAFA 3AY3A 5I8WA 3H2SA 5EQDA 3KSDO 3WIDA 2W98A 4WLUA 4YYZA 3OF2A 4NU5A 4OO3A 2RBEA 4FFNA 3HDHA 1E1LA 1VI2A 4R3NA 1YDEA 5JO9A 1GY8A 1I30A 3G17A 3EZYA 4I5FA 3OMLA 2FPPA 1DIGA 1GUZA 3BAZA 3JQFC 2HO5A 3OQ1A 4DQVA 1I3LA 5F3RA 3RUDA 3BTUA 3UCXA 2CFCA 2AQKA 1BVUA 1JTVA 4FD3A 4YA6A 1C0KA 3ZNNA 1ZUD1 3LZ6A 3BMQA 3TN7A 1LQUA 2ZB8A 1U7TA 4FFLA 3GAZA 4NFSA 1MG5A 5EMHA 5JDCC 3WX0A 1V6AA 2OBNA 4IJKA 4M1QA 1H93A 1P33A 1SMKA 4GH5A 5CP8A 2PKQP 2NLOA 3I6IA 2NV6A 1IOLA 3DZJA 2JHFA 2FMUA 3H9GA 2FSVA 1XSEA 1Y9AA 3K5PA 3VDRA 2DU8A 4BIIA 3ZV6A 3RQSA 3JQDA 3N7UA 1AHIA 1HLPA 4CLXA 4MP8A 3CSDA 4KWHA 1ZVMA 3F4BA 3L6DA 3VDQA 5JNLA 1PJCA 2PD4A 3KLPX 5A06A 5L40A 3PZBA 3UF0A 6LDHA 2I6TA 2B4TO 2AE2A 4FC6A 4ZRMA 4IUYA 4XRGA 5F5NA 2QIOA 4HFJA 4TMFA 1XKQA 3AW9A 2ZJ1A 4RZHA 3Q9UA 3ZU3A 1T4BA 2FR1A 2J5KA 5KTKA 5DP1A 1U4SA 4CM5A 3GG9A 3NTRA 3QLJA 5ER9A 3DBLB 3PRJA 4ZGWA 5IN5A 3EGOA 1X0XA 3QE3A 3OICA 4H16A 3B1JA 3S2GA 2ZYAA 1M6WA 5CPBA 2EEZA 2YY7A 1ZK2A 2PR2A 2D1YA 2J3HA 2AG5A 1EVJA 4XYBA 2WMDA 1E7RA 4PLTA 1PWXA 3BZUA 1C1DA 5GZ6A 3QHAA 5TRTA 3PJDA 3QIVA 4BNTA 5A02A 3PQEA 5TSDA 2I3GA 2R6JA 4HFRA 1H9AA 1Y7TA 4Q3AA 2X6TA 1E1MA 3WIEA 1NAIA 1PJSA 2PZKA 3GUYA 3WFIA 4AL4A 3ZV5A 4XIYA 5CPFA 3F1KA 4NIMA 3I9KA 2J5QA 2DPHA 1XDWA 1GPDG 4MVJG 1I3KA 4JBGA 1A5ZA 4CMJA 1N7GA 1YJQA 3I4FA 1D3AA 4E12A 4WLNA 1VE9A 4FIZA 1NXQA 2ILTA 3RFTA 5ITVA 5C37A 3AM4A 4J91A 2WYWA 1I24A 3PWKA 1NQ5A 1R4MB 2P2SA 4I5DA 3DZBA 2X5OA 3EMKA 1KEVA 3U4HA 3ZU5A 3V2GA 3V1UA 1GQ2A 1FXSA 1NFFA 1P3DA 1ZKMA 3DMTC 1LQTA 1T2EA 2UV8A 1ONNA 4II2A 4BQPA 3SLGA 5A03A 2VHVA 2DBVO 3ZWPA 3FNHA 2WD8A 3VPFA 3CE6A 4CLRA 1R66A 1YONA 4OOFA 4ZA2A 3K6JA 1OC2A 1S6YA 1KVUA 3VOSA 3ZW9A 3NGLA 2EW2A 4L4RA 3GEGA 4YJDA 5I7SA 4BB5A 4QX6A 1X1EA 1Q7CA 1ENPA 3JQ7B 5ICSA 4QEDA 2X0IA 2Q1WA 3DZFA 3GDOA 3ANNA 2BGKA 2NTVA 1PGNA 3JQ8B 1G6KA 3G1TA 3RIHA 5JCJA 1KOLA 1VRWA 4XQCA 4BNZA 3RFVA 1J4AA 2D5AA 4RLSA 3K96A 1JVBA 4HKTA 3NJ8A 4QECA 2VT3A 5H81A 3RC1A 3MOIA 4YB8A 1CQIA 2I99A 5ER6A 3F46A 1HYGA 4AJ2A 4R3WA 4ZICA 3O26A 4L9RA 5CHEA 3ZGYA 3KYDA 3A1NA 1YO6A 4TZTA 2WE7A 2CVQA 1PGOA 4UREA 4EGFA 3IMFA 3I1JA 4OQYA 4G81A 3L6OO 4R68A 4BNWA 4NH4A 4A03A 1B2LA 2FZWA 3L4BA 1MLDA 4BMVA 3AY7A 2I66A 4R5HA 1VKOA 5JSFA 2D2IA 5BSHA 3LU1A 2CVZA 3FTNA 2PK3A 1EEHA 4P22A 3JQ9C 2EV9A 4GI2A 4YRDA 3QA9A 3L6EA 2JCXA 2HKIA 4WNIA 4LMPA 3HFGA 3JQBC 4OGWA 4YAIA 1F17A 3PHHA 3AUSA 4WECA 2J6IA 1H6DA 1LNQA 3PQFA 5G4KA 3NRCA 5T6BA 1BW9A 1LRJA 3OJFA 1CYDA 4XWYA 2HLPA 2FZEA 2C20A 3DBRB 4RF3A 4YDRA 4UVIA 5G2OA 3ZHBA 4DGSA 3JQAB 1NPTO 2AXQA 1QLJA 3GK3A 1F14A 5HWSA 3ZU4A 4DLAA 1BHSA 3R1IA 4J6FA 1KVSA 1SNYA 4JN6B 4OSOA 1QYVA 1QORA 1G0OA 3PDUA 4TWRA 4Z0PA 1A27A 1RM4A 1IL0A 4HP8A 4UVHA 4D43A 3ZNPA 4DMMA 1GZ4A 4FFOA 1EVZA 1AUPA 1BMDA 4DBVO 4PLCA 1AXEA 3HB4X 2GR9A 1H6AA 4IQ8A 4E6PA 1K5HA 4JNKA 5ES3A 1X14A 4Y8VA 5F1OA 4ZQGA 4BNIA 4CV1A 1R4NB 2HJRA 1M66A 1ZJYA 3G3EA 3GQVA 3ZWYA 4E5KA 1ZCJA 4E33A 1X13A 3L4SO 4RQUA 5ILOA 4L4XA 2ET6A 1MUUA 2XPCA 3ZH2A 5JCJD 4PG5A 5KJCA 5TT0A 2EKLA 2UAGA
chains in the Genus database with same CATH superfamily
1A9SA 2ZAOA 3IBGA 3GARA 3SBEA 4MH0R 4EX7A 4MIYA 4YJFB 5H82A 1Z29A 1XF9A 3DT8A 2JGDA 1AIPA 1DQPA 4QL3A 4LRXA 3KSAC 1E6LA 3MF4A 2EFEB 4MIKA 3SC6A 1OY1A 4LV6A 2NYUA 1ADFA 3ENZA 4JVNA 2IFTA 4DJJA 2JFQA 3R9XA 3Q87B 1KOFA 1CR0A 4AUNA 2EXXA 2PWAA 4P0TA 4LA4A 3E82A 2BFOA 2J9RA 5HILA 1NNEA 3VTKA 2AOTA 4ZCSA 3QEKA 4CG2A 4EFKA 3SQXA 2V97A 2IXAA 2GSDA 1I2DA 3GP8A 2NXWA 1JFVA 1NLMA 3H86A 1KOJA 5T4EA 3V1TC 1XZBA 4EVIA 2P1DA 2OR3A 1WP9A 4PIPA 4RSGA 5KKCA 1G20A 4YP0A 1WO8A 3A9SA 2W00A 3M6MD 3OTWA 1G98A 4PSCA 1DO0A 1ECLA 4FEEA 4LOJA 1RACA 2C9OA 3Q1KA 3ZXXA 3LUFA 1QS0B 4U0KA 1QRSA 5DB4A 1XL0A 3IO5A 1L5ZA 1U2RA 4Q4HB 3MPUA 1WDLA 2QLTA 1X2BA 3NAQA 1WUYA 4MUKA 4ZCQA 3OX3A 3RS4A 4OU4A 1FVHA 3PD1A 4GKBA 1Z6GA 3I9OA 4TOIA 4KYVA 2V6FA 4XCQA 4DLUA 1AC5A 4XPIA 2XRZA 1PQUA 4QYXA 4OQLA 2FPUA 2B21A 5HNKA 1TJ4A 2OE2A 5D51S 4ZEWA 3OWHA 3ZCTA 3MJDA 3WRWA 5J2TA 1HKUA 1E7MA 3X2SA 3VZCA 4DT1A 5KINB 5JCOC 1EFVA 4BX9A 2WUWE 1RKVA 4HNHA 2XCSB 3B5IA 4MWDA 4KQWA 3ZWWA 4KIWA 5GINE 1KI9A 3HWSA 1XCJA 1SHLA 1NXPA 2ZI7A 3FYDA 3P9YA 4DR7B 2WJAA 3JV7A 1SC3A 2VAPA 3CRZA 4HMPA 1P61B 1GAWA 4Z4HA 1DQYA 1UC5B 2EWWA 2XVXA 4IO1A 2DY0A 4N5MA 4WNCA 4XTCS 4UW9A 4Z1MA 2ZCJA 3N7AA 1U5CA 2XWBF 2CVFA 5B5SA 5JDIC 3KQLA 3EASA 3AVYA 1WXFA 3IULA 5HGJA 1MB4A 1V9CA 3F6BX 3QXXA 1C4OA 1K75A 1UOQA 2EBHX 4B45A 4R51A 1TJPB 3MGBA 4K2AA 4GOLD 5DOZA 3CKLA 4HZUA 2JL1A 3AZOA 4UEOA 5C1PA 1BG6A 3CN9A 5IC6A 5LUBA 1L4MA 2WLTA 2VH1A 2YBEA 3H1TA 4H4DA 3LUBA 4XASA 2AKEA 3I9LA 1PR5A 4KBGA 5CVDA 1KJJA 4LQDA 3WNVA 4CM6A 1H4VB 1Z7BA 2PWPA 4MJLA 5JS2A 4DMGA 3QLUC 4PZYA 4XB1A 3K92A 3RRNA 1P1RA 5D7BA 1EFCA 2QL6A 4EENA 3NHMA 2MSEB 2ZUEA 4NG5A 1CQZA 3ZXYA 1A2KC 4Q4JA 1JIIA 1ZK0A 4HXFB 3SIWA 3TBHA 5DLEA 2VDVE 4X84A 3AOGA 1TIKA 1YBMA 1SXQA 1ZLYA 3UMJA 3SZ3A 1YJ8A 3TXYA 4ZI5A 1PHPA 1SQ6A 4LX8A 2HEIA 1JTEA 2HLDD 3PQ2A 4LWOA 2Q8PA 2M6LA 1KO4A 5BSRA 3SK0A 1VYUA 2DRIA 2YXPX 3HQ4O 4V0KA 4R81A 3FWZA 4DWOA 5JAIA 2XZLA 3CLSC 5DLDA 3B3GA 2IWHA 3WNBA 3KQKA 2L18A 2N47A 3L0DA 3W78A 5B55A 1W581 1FRVA 3OESA 3LVFO 2VRBA 2WTNA 3JWEA 1RBZA 2H00A 4G9EA 4X60A 3REQB 1IB6A 1VI5A 1ZFNA 1M2NA 2EFJA 2H59A 1MJFA 1SH7A 3MRSA 4I36A 3HA2A 1OA1A 4B40A 3ZUPA 4WCFA 4HB3A 3RS9A 4RGVA 4F7DA 3CW2A 4HBZA 4BVBA 1ZHFA 3W79A 3DMNA 3ZC3A 3K5WA 2GK6A 3EH1A 3ND6A 5EJAA 3RIXA 1DKLA 2HDWA 1JHYA 4JB0A 2HA5A 3MYRA 5CT5A 3LY8A 2F1OA 2F8TA 2C5AA 1UJ2A 5G0TA 1E1NA 2I71A 3L5OA 2F3QA 3Q3CA 4PYNA 2VJDA 1L4UA 4RAQA 3JYNA 4BJ3A 4S24A 4XWOA 1N1EA 3A05A 2BI7A 1U4OA 4FFBA 4XM1A 4JXKA 1M73E 4QPDA 4AZVA 5IM4F 1M0WA 3WYAA 4PN7A 5IBCA 1KVQA 3K0HA 3AP1A 5EZSA 3NBYC 4BNTA 1VG9B 1Z7GA 2ZSHA 4QOHA 3IUQA 3THOA 1RXEA 4AURA 5IH7A 4V39A 2Q4DA 2FLWA 3LVQE 2ZT7A 5THXA 1YT5A 3EJWA 1BYUA 1BQ3A 1Z6ZA 3SZOA 2HDHA 1J25A 2HX1A 3PEFA 4MX8A 3WLIA 4DS3A 1UDWA 2XHZA 1TLTA 1OXBB 1T8YA 1B1CA 1VE1A 2P62A 1GIAA 4KEAA 3SZRA 4WI1A 1XMPA 4DMFA 2PIDA 1P4JA 3L6RA 3DWFA 4MICA 3SHFA 3DLHA 2GHTA 4H3VA 1RJDA 1M2KA 2XOKA 2E4ZA 2I03A 4JQSA 4B35A 2OENG 2MYTA 2SHKA 3IUPA 2QA5A 4JL6A 3RS0A 4C06A 4UBKA 5GGYA 3WLKX 2J46A 4WKNA 5EJGA 4KC0A 1V0JA 1Q74A 1OWOA 1V9SA 3JRWA 1TZ2A 3DHNA 3ONVA 4UBLA 2IX9A 5DTJA 1RXVA 2YZNA 3AFOA 4Y1RB 2B3TA 4LXHA 1ZM9A 3HCCA 3NP7A 4JBLA 4V0ME 4M6WA 2G1UA 2XUPA 1OFTA 2V7QA 4NZ9A 2EW8A 1A77A 2XBUA 4XQ9A 3Q7RA 4ALMA 3OUUA 3BA1A 2VTBA 3GJ3A 4KR3A 1FYFA 2I54A 5H80A 2CNOA 1R6XA 3E7PA 4J7CA 4KG7A 2C98A 3LUKA 1U90A 4HB0A 2C3YA 3EQ8A 5BR8B 3WP0A 4G86A 1NG1A 4RETA 4EAQA 5K3EA 2FKAA 1MEEA 3WRVA 5E1BA 4IDQA 3W34A 1RAEA 4H7HA 1U2GA 2ZG6A 2ODNA 5FUQA 4U6QA 2F48A 1TUGA 4J49A 1M0TA 3B6EA 3G89A 3GU3A 1OX4B 3D7RA 3IR6A 4L8GA 1C0PA 4L5AA 1NVUQ 1UPBA 5CB4B 2A5YB 1U2DA 3F5SA 3FDFA 3FROA 2BMVA 3HDGA 3UAYA 2Y1FA 3K0FA 5JVDA 4OXQA 4J94A 4PO1A 2GPTA 2OY0A 2JFYA 4CQMA 1IN4A 3HK2A 4AQYB 1A0OA 1BHJA 1OJ7A 1IBMB 1HM5A 5DW3A 2XEXA 1VYHA 3AESB 4NJEB 2RHTA 3H9JA 3OP4A 5CXXA 5LP6B 2VQ6A 4Q3BA 2KLHA 2IV2X 4LNUA 1OXXK 1NJ6A 2IXFA 2QZ4A 1AB5A 4ZT5A 4CT4B 5LQJA 2I91A 2OESA 3M89A 4D8WA 2HWXA 3IQZA 3TNYA 1NZJA 3QMWA 2B37A 1DBRA 3KJEA 4PTYA 2ODBA 5AKKA 4H4EA 3PFNA 2PRJA 2OPBA 4XIGS 1UMDA 1EVYA 2CKMA 1MENA 1D0IA 1R6DA 3BHMA 1D2EA 5GV7A 4C88A 4AWAA 4MP3A 1YKFA 5LQSA 1L5NA 1STOA 2HN9A 5BN5B 5HQ3B 3TL3A 1WNTA 2PA3A 2BGLA 1XNHA 2AJBA 2FGKA 1QQ6A 2GVNA 2WOOA 3OI7A 4G2NA 4NYJR 4OK3A 1JECA 1TJNA 5TMBA 3ESDA 4ZQCB 2PL3A 4B2IA 3QPDA 5IJ0B 3SJ7A 2ZIEA 1EB9A 3R2JA 4LAFA 4FFWA 3RJMA 1PNRA 4K6CA 4B43A 1QO9A 2C2GA 1B3BA 3K0AA 1F0YA 2H07A 2P91A 2CK3A 5LOVF 5I7VA 5D7NA 3AI1A 2OXEA 3GNSA 2NAFA 4US1R 4BO9A 3VNVA 4I14A 5LMNB 5B53A 4GL4A 3TLKA 1T26A 3N59A 4D9KA 9LDBA 4F85A 5H02A 1VCNA 3RS5A 3F9IA 1N78A 2O3SA 2QDXA 2ZQYA 4B48A 4E5VA 1HNXB 5CBPA 3L07A 1OWLA 3HV0A 3PI6A 4YJ2F 2XTJA 5BN4A 1V35A 3M4JA 2JFFA 3TDNA 1CQPA 4PQFA 5EY5B 3KTOA 5EJEA 5JY6A 4YJ3F 2G3YA 5JLAA 1UFOA 3CNNA 3MD9A 3A9WA 5JATA 2ACVA 2ROQA 4IXNA 4PAQA 3H8WA 2DWQA 3KCQA 4R9UC 4S1WA 2PZLA 4JI5B 1PQ4A 1Z2AA 3AB3A 1N5KA 2QSJA 4R8VA 4ON9A 1Q15A 3OQNA 3A70A 3BZBA 3LGSA 3MILA 1AZSC 1OZGA 3ZV7A 3B2EA 1NQVA 4UASA 1BC5A 1J9ZA 3RRBA 2ZJ2A 4PS1A 1UP6A 3C24A 3AUKA 3FHOA 3CMCO 3H1BA 1H0SA 3LUGA 4Q3EA 2VXCA 2GO1A 3DEZA 3NKFA 4I7EA 2Q5LA 4TKMA 4CG0A 5C18A 3E7WA 3UMMA 1V8OA 3I34X 4WFKA 4KE6A 2PZ8A 2P5YA 4FR0A 2XNJA 5DCUA 1QQBA 3NGXA 3FTCA 1NI3A 2WZBA 1JXMA 4UCWA 1FEZA 1TW2A 3CX6A 1DTSA 1QTIA 3I45A 4BEJA 4Z5XA 1DAHA 4S1OA 4BGEA 2EHJA 4P7FA 2NN3C 4P3KA 1YV9A 5HF5A 3B6KA 3N0XA 1RAIA 4O2BB 4RV5A 2VRNA 3FYTA 1C7EA 2P4QA 2ZZMA 3TLGB 3I12A 4A6XA 2JATA 1RJ9B 2M32A 3QE4A 2JG3A 4FT4A 4YAFA 3IYLW 3A2NA 2IUYA 1BU5A 2W6JD 5KTTA 2O7VA 2V8BA 4CF5A 1GKLA 1QIIA 1I32A 1YU6A 2MINB 4GWLA 5TPWA 1UK9A 2ETXA 5AD1A 2VRCA 1C81A 4I3FA 4MVJA 1WSWA 2Z1MA 3U40A 1G2PA 2QLBA 3MS2A 5MGNA 3KHSA 3BD8A 3IXMA 2ATIA 4QASA 4IVNA 4OHZA 2A1TS 4XA8A 2X4DA 5CDSA 5I47A 1C7QA 3VHXA 2GSWA 3DBLA 5KTPA 5EJ5A 2C1XA 4WOKA 5KJ1A 1IBSA 3DBVO 2NU8B 3LTEA 4CKZA 2IHTA 5DHAA 1KDZA 4EPTA 4YRLA 3Q7PA 2Y3IA 2QW1A 3VPGA 1KQFA 1PTKA 3HA3A 1WA5A 3AGQA 5IKMA 4FOSA 4CQJA 1EHCA 2A9PA 4PPNA 2EWVA 4NJMB 4TYMA 2DP4E 5KB3A 1KMQA 1XTUA 2FQQA 3NGMA 4Y6QA 3T3MB 3O7WA 1Y37A 1N6IA 3CG0A 4XW2A 3N86A 4DA8A 2Q6IA 4F72A 1C50A 4L4ZA 2ZRJA 3IPLA 4P36A 3EVNA 4OP3A 3ZQ6A 2W6NA 1HA3A 4XH9B 1XROA 4ZDKA 1PTJC 1PZFA 4CIAA 2XUHA 3AK4A 4QFBA 1OXMA 2V6IA 5JPDA 3GFFA 1Z4NA 4AJJA 3KYCB 1JDVA 1V8ZA 1Q0LA 3DG9A 3FUTA 5BRNA 2BHSA 2DHQA 2NQ8A 2ZDQA 3TEFA 1OBFO 2EBUA 2ZROA 3WICA 1EFDN 5FOXA 4DDVA 1E4VA 3GVPA 1ICEA 2CBXA 2XF2A 2BFBB 2AA3A 3FYUB 2BEUA 4WLEA 3WMXA 1G9TA 2Q45A 3OY7A 4M8IA 5AVKA 3TM4A 2NO0A 1ONSA 1N3BA 1W25A 4JR0A 2QRNA 3R5HA 4UMVA 5DNDA 3ZE8A 1EWRA 3JU3A 4KLAA 1Z5GA 3GJZA 4DIKA 3FF1A 3ZNQA 2PUDA 3EODA 2QM3A 1CG6A 3L93A 3R3ZA 4LHEA 1O94A 1XLTC 2HREA 4Q3LA 1VFNA 1E7YA 2FE4A 4NVRA 4BMXA 1UBMS 4EG7A 4ARCA 1J1UA 3H97A 1YB2A 1NPDA 4OBXA 5ESRA 1KZ1A 1S2IA 5CLFA 1SD5A 2HPVA 3ZHYA 2B25A 2UYYA 4HPXB 1TYBE 4PYMA 2FMHA 3GYGA 1HE4A 4OLAA 2R4UA 3R7BA 1RSZA 4DFDA 1YR1A 2VDNB 4JJFA 4WK2B 1G5PA 1UQUA 2ZSBA 4FGKA 3P19A 5AMXA 2VI5A 3UMBA 2GZMA 4XYLA 4I8XA 4WZ6A 1HTBA 2QAGB 3PX2A 4C7OA 1ODLA 4S1TA 1EBUA 1HXHA 3W6ZA 2XUQA 3STHA 4TS3A 1ECGA 1OIXA 2QLLA 4XUDA 4GQAA 3RK0A 1GPAA 2PR7A 2VHTA 1QVVA 4HEHA 1D04A 5EE5B 2WHPB 2O2HA 3R0IA 4PTZA 4R40A 4IDUB 3GEBA 3QRWA 5E6SA 2RONA 2O3QA 2ZUSA 1G8SA 4F1JA 1LBSA 2G1AA 1I9CA 3AB8A 3JZIA 4MS4B 1R8XA 3F9RA 4Y2GA 5FL3A 2CLDX 4LY0A 3W8RA 1W88B 4N3NA 3U7IA 2BLNA 4L07A 1Q44A 1D2AA 5DRTA 1QFZA 3GWZA 1H2WA 1CY0A 1CKEA 1COWA 1MKYA 1N2JA 2EKPA 3ICVA 2IBSA 3D3EA 2ZSIA 5KYTA 1PP4A 4GR4A 3TIGA 1I4TD 1ML3A 1UJ5A 2WDZA 2NUTA 2CMGA 2HSEA 4UM8B 3SS8A 1QK3A 2PMBA 2Q1SA 3GBPA 1NDQA 4I50F 4I99A 1BMQA 1J0AA 3Q41A 4L4SA 3WK5A 1YS2X 3E9YA 4ND2A 4FDVA 3UXEA 2ENWA 1FFHA 2RH4A 3LNTA 2X5JO 1E62A 3T7IA 2G5TA 3T7EA 3T3HA 3CN7A 4BNKA 1KO5A 3J80A 3UJ3X 5KS2A 3P2EA 3Q5GA 4PZUA 1PFYA 3LNCA 1FJXA 1DJNA 3VYUB 4Z7OB 5ICEA 2VPQA 4CLOB 1RE1A 1D8TA 4A2QA 4PRLA 2Z2XA 4S0XA 4BO6A 1LK0A 4ZAXA 4LOAA 4EJMA 4S05A 2XA1A 2XBMA 4O29A 4BP3A 5FNVB 1KK3A 2HI0A 3VKVA 4M36A 4ZOQI 3TZLA 5E9WA 1Y80A 1WF6A 1L5YA 3BUSA 3PKJA 1ZD9A 5F7JA 5KKNB 5HRUA 1HR0B 4KODA 3UB2A 1T4CB 2GJ9A 5AVSA 5AVRA 5B1HA 2WQ7A 1MQSA 2WA2A 4FJ1A 4ND7A 4ZT6A 4KIUA 3OWXA 3KL2A 4DPMA 1EP3B 4LE2A 4AKTA 1IM8A 3IH5A 3FNRA 3K09A 3KYIB 5EKDA 1ZH4A 4CM5A 4B1FA 1UPXA 1C7FA 1M8GA 2KE5A 3U9TA 2JZOA 1B8PA 3EEQA 1O9BA 4MJ7A 2G0AA 2HHCA 4I08A 4EG8A 1IHOA 3M6LA 1JYEA 2IH2A 2G9QA 4HVCA 5C7OO 3LY9A 3E9EA 3JQAA 1XTVA 3EUEA 5JNWA 1EFAA 1HEUA 4WINA 3A6KA 4HLUC 2H1SA 4OQNA 3ZGLA 2XX3A 1B14A 3AYXB 3JQRA 1ZQ1A 5G40A 3ZDBA 5AM5A 3QEOA 3WLAA 3VJRA 4ZOEA 3EDRA 2C78A 3H42B 3QVWA 4UU7A 1Z4JA 4NOKA 3K0KA 4IL5A 5UKDA 3G2IA 2VOEA 2GA8A 3FE2A 2TMGA 2R60A 3CVWA 4XSHA 4HN4B 1XEWY 2LCIA 2XQFA 3CZ5A 5H4GA 4E7OA 4AG6A 2PUTA 5BMOA 2B2XA 1SQ5A 1YQTA 1YZKA 4KHZA 4UNQA 1UK7A 4BZPA 3HVHA 1XP5A 4ZMSA 421PA 2ZZKA 4N3GA 1DKPA 1JDPA 2WR8A 1KP2A 1AX9A 2FI1A 4KQXA 5G0WA 2WAMA 1UDRA 3K8QA 4MYCA 4RH0A 4UNPA 3WBKA 1G2IA 4EFMA 3C6QA 1MB0A 4PC7A 1VQ1A 4KSCA 4F2GA 2X14A 3JQGB 4RVGA 2Y0CA 2XB8A 1AHHA 3MOSA 4G89A 5LVAA 3GJ6A 1U02A 3REGA 3LXUX 3N8KA 4RHXA 9MHTA 1BA3A 1ZK4A 3FDJA 4M8SA 1RD4A 4IRUB 1VMEA 2RHWA 3LRXA 4BB6A 3RVDA 5BWLA 4OI0A 2BF4A 3A28A 4B34A 4BCBA 1EVLA 2W37A 4OYHA 4Z7JA 1PX2A 5A71A 3WLTA 2HXSA 2MT9A 2X15A 3VSEA 2XRMA 5FI3A 3HJHA 1D5WA 3BG5A 3DE7X 2RG1A 2TS1A 3DKIA 3N0VA 1AK2A 2AR0A 2C77A 2P0YA 3HUFA 4XWGA 4HFMA 1JN0A 3T5DA 1GPNA 4MUMA 3DZ8A 4C2BA 1EP1B 2ZRHA 5FAXA 3RIEA 4TYWA 1ZSYA 2TECE 1K27A 2GZ2A 2O2SA 4M1OA 1NF2A 2PX6A 1BQ4A 2JEYA 3S68A 5A6VA 2PH7A 3IJEB 1QKJA 4KRXA 4MV1A 4L75A 3QWBA 2ICAA 4M89A 1KIMA 1PK8A 3N2YA 4GVXA 4PHGA 4BMDA 4H7JA 1GSIA 5J58A 4FX5A 5L8VA 5HQTA 1AKYA 1ULBA 2HSWA 1SELA 3WKEA 3OJXA 1FVXA 3WQBA 3ZIDA 3BGVA 4M0EA 5BYBA 4QHSA 1B0ZA 5C1OA 4GLFA 1RHRA 4YJKA 3MCZA 4NCNA 2F8SA 1KYIA 5I7EA 5KKAA 4CZ2A 2A6PA 2IP2A 1TIPA 1U1GA 2QUIA 1R00A 4NR0A 4P82A 1V4NA 3SC4A 4A8HA 1QHYA 4P4NA 2W2LA 4YMSA 1Z16A 4BE7B 2Q4BA 3SSAA 3MHPA 4M1MA 3CZMA 1A88A 5LA6B 2YTZA 1IHYA 2I6XA 4R1NA 5A7HA 5I7WA 1E1RA 1FSGA 2Q4RA 3ZCRA 1K6IA 1JV2B 3WK4A 2XMZA 4GLJA 4F8JA 1EDOA 3FNIA 2RGYA 3JQEA 3ML1A 2XUDA 4M49A 1V3TA 5AM1A 4ETNA 2FJPA 1FJ2A 2GEFA 2PIAA 3E9RA 3IKMB 1MW9X 3KB2A 4ZZ1A 1X8KA 3ZY6A 3U09A 1GTMA 3Q7EA 3V8BA 2VYFA 4RXUA 2ZULA 3W77A 1M75A 1NM5A 2QJWA 4LSWA 1NZFA 1JDNA 2VCYA 3FPHA 3PNBA 5EUBA 2GHIA 4EO7A 3KUKA 3CRVA 4HSEA 2NO7A 1Q83A 2I4MA 5KYWA 4DUGD 3CLTC 4MRPA 2ZUTA 3DVAA 3O93A 3MK31 1BU8A 2NNLD 2Q9BA 2DWUA 1JXOA 2WUVA 4R05A 2HK6A 4RKWA 5GVRA 3ZJUA 3NHZA 4IUCS 4I55B 4HMOA 3ANSA 1N1DA 3MSCA 3WKCA 5A4DA 1K8XB 1XIVA 2BTOA 4F12A 2GPSA 2ZANA 4HLNA 4Q05A 2WSYB 3EEYA 3DV0A 1QG6A 3IP1A 3MTBA 3NT2A 4JIGA 5EMLA 4OGGA 3SEQA 1WZUA 1RYFA 1B16A 3A4LA 2QX7A 3DVLA 2CEAA 4F3TA 2WFAA 3PK0A 4OMUA 4EPRA 4FS3A 2A7XA 1ETHA 5G4KB 2Z5LA 4K6MA 4ENVA 4WTOA 2ZT5A 1OZ0A 5JECA 2I34A 3L77A 2JD0A 1R3UA 1Z2OX 3DMPA 4NONA 1XMSA 1C9KA 4D1YA 4OLHA 3EW7A 2QX6A 5JASA 2ZUBA 3V48A 1KBZA 3H5LA 3TSCA 3K70B 2EQBA 4ASUA 2ISQA 3OZWA 3OX4A 2FNAA 2A78A 1XQXA 3AUYA 1NN1A 3FSGD 3FTEA 3KAJA 3I2FA 2O3UA 1YULA 1GARA 2ZYSA 1Z38A 2FPKA 1CV2A 4PCAA 5IASA 1TFUA 2P3SA 3TLXA 3W90A 1KETA 1ODIA 2OLKA 3P71T 4G63A 5JHHB 1SVIA 4MWBA 3WK9A 4QXQA 4R54A 4IFIA 1G8GA 2D3TA 4ZAGA 2VNSA 3V4SA 3W8DA 3DDSA 1RRCA 1OWMA 4BNVA 4HXEB 4Z9FA 3HU3A 4D9JA 3HXLA 2X4IA 4CR8A 2GLTA 1OLSB 3PDJA 5C51B 2WHYA 3IALA 2AL7A 4X44A 2GRUA 1OVMA 2PZMA 1AN0A 3RWOA 2CJWB 1GU7A 3LQKA 2I0FA 3EVEA 5K3FB 1KFCB 3H18A 5I9BA 1AV6A 1B0PA 5B3JA 3GGGA 3LA8A 2RKWA 3PUVA 4QPPA 1GA6A 1CUGA 3CLRC 1KMIY 1OOEA 2NV0A 2P4HX 2PSEA 1XOIA 4K9NA 4XGRA 4ZTZB 1EM6A 4DC1A 3GC6A 3M6WA 2Q7DA 1AQNA 3KQMA 3QPVA 3PEYA 1RI1A 1T36B 2FWAA 1LWOA 1ZZEA 3KR2A 2LRHA 1VHLA 1OWPA 5E9AA 1SOAA 1LX6A 1LLUA 2SNIE 1B8OA 2VPIA 3DHEA 3CWZA 4IG4A 1T43A 4UXIA 3RVLA 4XQEA 4TVOA 2H08A 3ZHRA 5ICMA 1JBKA 2ON6A 5EA2A 1N2HA 4YCNA 4YCMA 4ZKDA 1GL7A 3RKRA 2IIBA 1KAGA 2W8ZA 3THXA 2Q49A 4MCHA 5ALXA 1CDEA 1LV8A 1U2ZA 2PKQO 2W6QA 4EMUA 5A62A 2RHJA 2Y1OA 3CLSD 4MKZA 1NW7A 3SXUA 3F47A 4M1YA 2JHGA 3N87A 3NORA 1AMOA 1GUFA 2ST1A 5L3SB 1P73A 3G0OA 2NU6B 3V97A 4BHTA 2VZ0A 3O74A 2PZEA 3EXIB 3QLVC 2AFRA 4FZJA 1GGJA 3ZNOA 1VHJA 2E9SA 2JFVA 3ONFA 4FR2A 4KV9A 4WV3A 1LA2A 5EEGA 1OTHA 4YI5A 1F8FA 4B6GA 5AW6A 4UOQA 4YREA 5CG1A 3BIWA 4OH1A 3GRZA 1QNFA 3PLRA 4U5XA 2FMFA 1IK6A 1DJLA 1XALA 2EKDA 1Y6JA 4QSMA 3I9NA 2IYPA 5TJHA 3RE1A 1ESEA 4RD4A 4WKOA 3V4ZA 2JIZD 4HH3C 5KAPA 5IP5A 4M7OA 5BWCA 1U0RA 1CHDA 3GELA 1CUVA 2H7YA 4U0JA 3TIIA 1U7WA 2POCA 2WMNB 1UC9A 4FJ0A 5J63A 4WZAB 1DFGA 4B0PA 1JH9A 2PUHA 1VA5A 3B1YA 1K7EB 4HNTA 5K09A 1Z68A 4DCOA 3CH7A 2XF8A 4YV2A 2GH1A 2R6AA 1HE5A 1X7ZB 3ET4A 1HH4A 3M81A 3NVDA 4JLUA 3ZG6A 1HEIA 4TWIA 5E6RA 4BWFB 1W0KD 2Z8YM 1WPRA 3D2BA 3OCVA 2V7XA 4LZNA 4MA4A 3NOVA 1AMUA 5AW3A 5HDBB 4BFVA 4MSUA 1GXSB 4PSAA 5F35A 4I1SA 3B1FA 1IYZA 1ZBDA 4KU4A 1Q6ZA 4UBJA 3M9XA 2X0DA 5K8CA 5TQJA 1YHZA 5ALEA 1G55A 1PX0A 2VNAA 2NTJA 3BK1A 5JZ9A 3OT4A 4PGFA 4UAGA 4IJSA 2DULA 1SCKA 3HZRA 1Z62A 2ZBUA 1K97A 3B70A 1ZRSA 3Q6NA 1K3FA 2DBYA 2PGXA 2YZKA 3H1AA 3UPUA 3R5FA 5M5BA 2FLVA 4L6CA 4RF5A 2I29A 1ODKA 1W59A 2WJ3A 4ZOLF 4EHNA 5IT5A 1FRNA 3RSFA 5HUQA 1LPPA 2DBRA 7AT1A 3W1VA 3C1TA 3BIFA 4RY0A 4ZV7A 4Y98A 2F1HA 5FADA 4M37A 2VT6A 4QUIA 3B12A 4TMXA 3ST7A 2DR3A 3RJ5A 4AU1A 3B6ZA 1AGXA 4Z51A 5AVTA 5LPNA 4DR3B 3C3MA 2IHYA 4XM0A 1DV1A 1Z6PA 1OJLA 4YVFA 2UUPA 4CXMA 2JLYA 1UFQA 4NCKA 3WWPA 5ESWA 2P9TA 3HJAA 2G36A 1JUDA 4OFWA 3BH6A 1XHEA 1TTQB 3AH8A 5EE3A 3O91A 1KMNA 1PDOA 4FBGA 1ZITA 2MSWA 1DX6A 2Q21A 1IY2A 1H69A 4Q02A 3EPJA 1NXWA 1V1MB 5E7JA 1ZVVA 2HCBA 2HT1A 1MMFB 4G1EB 5G1OA 3BGOS 4CMIB 3A9CA 1N92A 2PX4A 4HZGA 1BAPA 1NVTA 4R2JA 5EIHA 5FEMA 1SC4A 2VDRB 3HDYA 2FG6C 3KPUA 5AI4A 4BFUA 1QANA 4EF5A 3GOHA 5I3CA 4Q4AB 3HGTA 2JDIA 1AH2A 3UFXB 1FP7A 4OQMA 4IICA 4MWOA 5BVGA 2W2KB 4D4HA 2C59A 3AOEA 4C1NA 3HRKA 1K7FB 5JNUA 3TGLA 3FOAA 1P74A 3RCBA 1WV1A 3U44A 5DP2A 1T5IA 3GMDA 4CNBA 1AZTA 5BV8A 1G7RA 1QFJA 2KBFA 1D6SA 2WPDD 3JWHA 3D6NB 4KAXA 1O5IA 4YRZA 3MWDB 5HUHA 5JXIA 3BFKA 3IDSA 5IJ9A 4KN9S 4H1VA 1RZRA 4K9SA 1KVTA 5D8DA 5J5CA 4F11A 3RFFA 1GQYA 2VJQA 5LLSA 1P5FA 1T2DA 3CUVA 3WK8A 4EH1A 5DX0A 3VTZA 5KC8A 2YYYA 1SKBA 1TVMA 2BZ1A 2WUGA 2X23A 5IUJC 1E2KA 4RV9A 3BF8A 2JF0A 4DR5B 3U7RA 2QY6A 4YMHA 1GUDA 4YRJA 1G5TA 3QPBA 3MBOA 1HYHA 4MR7B 1EQUA 3ZI4A 1USIA 5TF0A 4BEBA 4MIEA 1A7UA 3MAJA 3QKSA 1QMGA 4ARUA 3RKSA 3VSBA 1NHGA 3EVFA 1EM8A 3AQ4A 2AEEA 1JEQA 2XAAA 3KRTA 1JAZA 1OTYA 1T6BY 3N9IA 3QHQA 5EZYB 4G2TA 1Z13A 4IXWA 1XWWA 4QDKA 4YXWA 3RTBA 4B4VA 1CUYA 3O6VA 1TKRA 3GZNB 3FR7A 4AICA 5JAPA 4DGQA 2HJGA 1AK1A 2XXJA 4R9RA 4Y6OA 2C7OA 1JR3A 2PA0A 2FW9A 1UEXC 1VMKA 3HSYA 3QITA 4I1VA 3E0XA 1D4FA 4RZXA 1UOEA 4N5NA 1A72A 1ZMRA 4FGZA 1H0KA 5KHOC 2AFHE 3AHEA 2DQYA 4YIKA 1P4GA 1XJWA 5SY4A 3GPIA 1MGOA 4QDOA 4ZAFA 5KBYA 2IYRA 1VLHA 3COSA 3HBNA 1JPJA 2A1TR 3N2EA 3TR6A 1GG8A 1SQ0A 4B85A 3B5JA 1R0KA 3IJRA 2XDQB 1N2EA 4E21A 2J4DA 4F3YA 1NP3A 3O2JA 3OLWA 5AM4A 3KU4A 1UOOA 2J9GA 1EJ2A 3BGIA 3MT9A 4B3HA 1OYYA 3RLFA 5EYPB 3A0RB 2XTZA 1K8YB 1L7NA 2HUPA 3GPCA 5DM70 2XMCA 1GLNA 2HRDA 2XQIA 4Z4GA 1XNRB 4NV1A 1R37A 1M7GA 4YJHB 5TLSA 3HXQA 4YYEA 3PPWA 4KWCA 3E8MA 4IINA 4ZVSA 5KOIA 1ZNQO 3PXXA 3NYIA 4RH3A 2AG8A 3D4NA 3TPCA 2B2NA 3KOZA 1Z63A 4HEA6 4FYVA 4LRSB 5JWHA 3SHVA 4TLLB 5A5VA 4FHCA 3PE6A 2VCEA 1XAGA 3OC6A 1YH3A 4D5EA 3IUSA 1DBQA 3I04A 3PFCA 3TTYA 1JA0A 1GEGA 3A9TA 4L50A 4UVDA 5F7ZA 1RI2A 1U3UA 1M8KA 4KN5A 1RC0A 4BFLA 4MHTA 2Q6LA 1NJSA 2QJFA 2GN6A 3ODGA 4IDPA 4ZODA 3PXAA 2HWYA 1JDZA 4S1VA 2FG7C 3OFSA 1ISGA 1GTVA 1IY1A 1BX0A 2AOUA 1KZ9A 4HAIA 3T06B 3GRCA 2NM0A 4NZMA 1RAHA 4TTQA 5JH7B 2JD1A 3CJRA 3FPAA 5D00A 2BEWA 5B57C 3R0JA 1BX3A 1KH2A 1CNMA 1I01A 4DQDA 1O77A 1SRQA 2IYFA 2J0UA 1MJGM 3RTDA 3PQCA 5CNJA 1OE0A 1HE8B 1MBZA 2BFCB 4KPEC 1L9XA 1ORWA 4RKRA 5E3HA 4C7BA 3NHAA 1E1KA 3JTEA 1LKZA 1YMQA 3HUTA 3LUHA 4V0RA 3T4XA 1E9BA 4I9GA 2B92A 3TX2A 4DA4A 1XD8A 2FPRA 3TZQA 3CWCA 1NBME 3A2LA 4ZOBA 1QLHA 3KQTA 3UJ9A 1CIVA 1RQNA 1Y63A 4JJAA 4PBSA 2F67A 3TQOA 5M34A 2P77A 3JWPA 4O63O 4OHBA 3RLIA 1U5BB 1BXRB 1KA9H 1JLRA 4DCGA 3SYLA 5IAAA 4GC9A 5HVNA 3VUEA 4OOEA 2PX2A 4NEHB 4F1WA 3HKBB 3CMMA 4RE5A 2Q8NA 1I4DD 1JFFB 5B4UA 1BFUA 4IP0A 4B6EA 1T2CA 3ABQB 4MYDA 2QTZA 3SE7A 5TB5A 2VYNA 1NYLA 4B6PA 1L5MA 3W4KA 3MOGA 3KDPA 1L4GA 3VR5D 1PCXA 3CF4G 4E5NA 4X20B 2YWFA 2UZ0A 5CLJA 5IWAB 1JVSA 2IC5A 3PIIA 4ND6A 4O1IA 2A4MA 3GLTA 2J3QA 2GZAA 5JFOA 1PFKA 1PR3A 4FD2A 4JHXA 5KTRA 4X66B 4DZRA 2CMFA 4K5QA 4RENA 1EPUA 1OAAA 2NYAA 2VOJA 1D9XA 3VZSA 3WLSA 1EX9A 2WEKA 1ECFA 4Z0TA 1VGVA 5K6TA 4EF6A 3RSZA 1FDVA 2K7ZA 1TAHA 2JBHA 2P9HA 2QZZA 3CRNA 2OMKA 3EWNA 1DNPA 2QT1A 3ECCA 3KSZO 1MO6A 2X86A 4JX9A 4JITA 1D8AA 1W2WB 3OPVA 4ZMBA 4N41A 3T34A 2VDUE 4UARA 2TSYB 4K9RA 4ER3A 1SR8A 1XTSA 4JFAA 2QD4A 3WGOA 4OEHA 2P35A 3U3MA 2NXNA 2G7MC 4IDFA 2YRXA 2HCTA 4Q7LA 4BLUA 1MV8A 1W85A 3FCAA 1TCCA 3ICOA 4YFVA 4KQFA 1Y6RA 2Q6VA 2JPDA 3GG2A 2FZGA 2QU8A 1X1TA 3PC7A 3RB8A 3C7DB 4D2IA 1MB9A 3DMGA 1IULA 2B2CA 3N8IA 3OZXA 3DEIA 4ROSA 4HB4A 2HNBA 3EQ2A 2ACEA 1TEVA 5AOAA 4ANFA 3IOYA 4XR9A 1MAHA 1VPWA 2IYEA 5KSZA 4LXYA 1Z4QA 4B6JA 2BBTA 4AQ7A 1Q7TA 2DPLA 1CVRA 3MGGA 4UZSA 1Q7GA 3GHHA 5T8KA 2P68A 3AZPA 1G21B 4DXHA 3O73A 4Q1VA 3WGTA 3I8SA 4N3AA 3BE6A 1KEWA 2NYRA 2VDJA 4KQCA 3T3EA 2C95A 3PLAE 5DGIA 1CJKC 3MFYA 2DVMA 4WADA 2BBOA 1VJ0A 3P0FA 3S55A 4Q7MB 4RABA 3PI7A 1GPBA 2MSCB 3PRHA 1N7JA 2AWNA 2J09A 4N0DA 3KSMA 3V8EA 3WWEA 5AUNB 4L02A 5AJHA 5HIKA 5KI6A 5BUZA 3ZZNA 3THYB 1BVYF 4LHWA 3QXSA 3R7NA 4XWTA 4P4TA 4UD2A 3P2JA 1NQXA 5JD3A 4UXJA 1EB8A 3VR2D 3KQHA 3GVXA 4F5ZA 2GZ1A 1E5VA 2ZK7A 3SMQA 1CIPA 4DANA 1RRPA 5GGXA 2D1RA 2DTEA 3MJRA 1JLMA 4LEIA 3FYUC 4CEHA 4O59O 2R8RA 2ZS8A 4LMRA 4EHAA 1YZGA 2OHGA 5EIEA 5IPFA 2E4UA 1RYEA 3GXOA 2ABWA 3AJRA 1VJTA 3H3FA 3S40A 3TJRA 4O5OA 1HKHA 3WWOA 3PTLA 2Q3EA 4DABA 2BFAA 1PLJA 2Q3HA 3B85A 4IKPA 1ZOOA 3ZIAA 1C3EA 5ECYA 1ZG3A 2W2XA 4Q0MA 2VJYA 1G4AE 3BVPA 2OFWA 5GONB 1YI1A 2WUFA 1CJSA 4RHCA 1G1AA 1U80A 1F4VA 2I65A 3KEMA 3OIVA 4HAXA 3IQFA 4IEEA 4JVMA 2PUBA 4DOMA 4O4IB 3EIWA 1RLIA 3DO5A 3B3AA 1W5SA 1XFDA 3GCZA 4KUEA 4HWPA 4V0OA 1GQFA 5T4BA 5EUCA 1S3SA 4LG1A 4A10A 1A97A 4V1CA 2A3RA 3DE5X 2JIMA 2QQ0A 1S02A 5H16A 3BDAA 4IY1A 1LS6A 1UZMA 2HCRA 3N0RA 4B2PA 4R2WA 2YDXA 3D64A 3IT1A 2QZSA 3NTLA 4K86A 1I94B 3SOPA 1JQ5A 1UKYA 2CDBA 5IRCD 3UAWA 1GZ7A 4M1ZA 1K3TA 2LKCA 3ER6A 3CKKA 1UOPA 1MVOA 2Q1UA 3OEED 3QENA 4EW3A 121PA 4Z2YA 3T1TA 3GLFB 3AF2A 2BD0A 4XGQA 1KEEA 2NPIA 3RGGA 1I13A 3VDMA 4FYYA 5DXFA 3UMGA 1P4HA 3BMCB 4B3TB 4A0RA 3NAMA 4JJ7A 4O4LB 1IPFA 3L7OA 4JP8A 2H16A 3HVUA 1WW8A 3G2HA 5NLLA 3I4CA 2VVTA 5L3VA 4MKIA 5EJ4A 1ZONA 1X87A 3ZGVA 3DOOA 5KDDA 4CF4A 2QBYA 1ID1A 3H83A 5FFNA 1ELOA 1W4ZA 3DGEC 1PHRA 4LRYA 1RT9A 2CXHA 3NEPX 4R8SA 2XSZA 5ARBA 3AV0B 3CUTA 4F93B 2IKSA 4ENSA 4OI4A 1A98A 3ROTA 2JLZA 2HH9A 4HVAA 1FDWA 3ITEA 4NU8X 3U9LA 1Z5VA 1C30B 2YW2A 4Q1DA 1LPNA 1GGHA 5KTOA 1T4GA 3NWBA 1HQDA 2W6OA 1ZOPA 2P78A 3E58A 2AC7A 4JUDX 4X6UA 1IE3A 2WU0A 2YZGA 2NUPA 4LBWA 3EXHC 3LLCA 3HR7A 2PGLA 4J6EA 5AW1A 4MPRA 3CNEA 1E1DA 3ZGOA 2H63A 1U6KA 1ZD4A 4KJZA 1V3VA 2ORVA 3L7IA 2ID7A 4P53A 4X1YB 4R7GA 3SF8A 1EUYA 1V41E 4UOEA 1CK4A 1X7DA 1ZN9A 2AH5A 3LF1A 2NUAB 1O8CA 1J39A 1T9BA 2RHGB 3KKEA 3NCHA 1J0XO 3RUIA 1M7HA 3C8HA 4TTTS 5COQA 3KFXA 2WE8A 4KPFC 3WGMA 3ROGA 1QU2A 3CNQS 4B75A 3ISTA 1YB7A 5CDFE 2XXAA 1YJCA 4FP9A 5KJEA 2DQZA