1IONA

The septum site-determining protein mind complexed with mg-adp from pyrococcus horikoshii ot3
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
243
structure length
243
Chain Sequence
MTRIISIVSGKGGTGKTTVTANLSVALGEMGRKVLAVDGDLTMANLSLVLGVDDVNITLHDVLAGDAKLEDAIYMTQFENVYILPGAVDWEHVIKADPRKLPEVIKSLKGKYDFILIDCPAGLQLRAMSAMLSGEEAILVTNPEISCLTDTMKVGMVLKKAGLAILGFILNRYGRSERDIPPEAAQDVMDVPLLAVIPEDPVIREGTLEGIPAVKYKPESKGAQAFIKLAEEVDKLAGIKAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords PROBABLE CELL DIVISION INHIBITOR MIND
publication title The three-dimensional structure of septum site-determining protein MinD from Pyrococcus horikoshii OT3 in complex with Mg-ADP.
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 72
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2001-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ionA00
5FL7D 1TADA 3LBHA 2OBMA 4O3MA 5FPKA 3V9PA 2WJYA 3UWOA 3ZLJA 4OQNA 4EJSB 2ZSEA 2EFGA 3WMFA 4D6PA 1VG1A 2R6FA 3LV8A 1XDBA 4Q00A 2ECKA 3GLIB 4QL3A 2GCPA 1KJZA 2Q9BA 3AV0B 4TLDA 1G3MA 2VP2A 4NBSA 5KPDA 3QXHA 3OIYA 4NCKA 1G21E 4QHSA 5TXGA 1UEJA 4ASUD 3QQ5A 4GPTA 1AGPA 1IOZA 4PANA 2A7QA 3AKEA 2Q6TA 1RRCA 2J46A 2P65A 2LWIA 1XEXA 1A4RA 2QRNA 4OJQA 3EA5A 2RGBA 2C96A 3I8XA 4QJ3A 1WBBA 4AKIA 2HT1A 5FPYA 2VPPA 3IBGA 3CX7A 1Z29A 2KI5A 2IS2A 2HXSA 1DAMA 3NG1A 1NNEA 4A82A 3S1AB 4A92A 2QMOA 4KBFA 1TQ2A 4B3XA 5B57C 3MAAC 2JJ2A 1ZBDA 1Y3AA 3NXSA 4XOIA 4UNNA 1IONA 3B1VA 5J4HA 2JIZD 4PX9A 4Q48A 3VKWA 2YWGA 4JLAA 3GJ6A 1IN4A 3BXZA 3CUEF 3IHLA 2AR7A 4JVSB 1QDEA 4DC9A 3DZ8A 4HAUA 4EDHA 4RY2A 2OAP1 5G3YA 3M1IA 3IEVA 4LHZA 5EZ5A 1ZJ6A 2VHUA 2CL6X 5D3QA 3K0FB 4LV6A 3GMTA 4URUR 1ZM9A 5TV2A 1N6NA 2B92A 2NOAA 4YMVA 5DH9A 1M1YE 5JJLA 1Q44A 2QEQA 4QBFA 2GEDA 2PMKA 3SHWA 4BFSA 3X1ZA 4PC3A 1YR7A 1VDZA 4BECA 2ZR9A 4Q9KA 5CYOA 2UVQA 1W36D 1Z6GA 1ELOA 1KK3A 3AVOA 2OCBA 1JPNA 3KKPA 4UXIA 1EFRA 4NCJA 2GEUA 3IKJA 4D80A 3ADBA 5BWMA 1IM2A 4PC7A 4MYCA 1CIPA 2P3SA 4NCHA 4KHZA 1BH2A 1E99A 1XPOA 4Q1CA 4WBSA 5CM8B 3U7FB 1E2MA 1XTJA 3RS3A 4JYCA 1S1MA 3T15A 3R7WA 1X8JA 2A2ZA 3WNCA 4DEYA 2WOOA 3E2IA 1E2DA 4BWYA 5L3SA 2FE4A 1ZRHA 3B9QA 4A36A 3FHCB 3BC1A 2WWWA 3IPYA 4U5XA 2VP4A 1E2JA 1VCIA 4XJXA 1GNRA 1F6BA 4M22A 5DE3A 3SE0A 4LHYA 4LJ6A 2O8DB 2UKDA 4Q4HB 1OFTA 3CNNA 3RRYA 3DPUA 3WXMA 2OLKA 4D4JA 3DDCA 2ODEA 1W4AA 5B30A 5JECA 1BS1A 2GCOB 4NYJR 5DO9A 1H8HA 2XOKD 1Z22A 1KKLA 4AYXA 4C4PA 3FMOB 1KI2A 4CEHA 2ZITA 3WHLA 3SQXA 3CF2A 2VHTA 4GDFA 4KLNA 1KK0A 5EP1A 1XB2A 2IEYA 2R6DA 2AFIE 2WHXA 3LQRA 5HCIA 4TYYA 2MMCA 5KDLA 1P72A 1RVDA 5JHHB 2FPLA 3CNLA 2OLJA 2QP3A 1VIYA 2O0KA 1MABB 1OKKD 2QPAA 2YJTD 3L8YA 2FU5C 5IT5A 1N0WA 2XTMA 4Q5IA 5H70A 3VR6A 2JJ8A 4R98A 4QHTA 1QG2A 1XF9A 2IT1A 2X77A 3K0CC 4G01B 4JJZA 1CKEA 1QHGA 5FUVA 3QJYA 3EWSA 1NRJB 4XVQA 1OE0A 3THOA 5F3WB 4LUCA 4PQRA 5GJCA 1F3OA 5C4GB 1Z5ZA 1ETUA 3LNCA 3EARA 4QM7A 3FVQA 4ABYA 1NJFA 3EZ6A 3T06B 1Z3IX 4HB3A 4JL8A 4Q1FA 5AJWA 3T1OA 3U44B 1UAAA 4KLZA 1OH5A 2VSFA 4MDFA 4HDOB 4C3ZA 1CULC 2ORVA 5AUPB 4C30A 2J7PD 1H8ED 3DHWC 2G0NA 1B23P 1N3BA 1HURA 3RYTC 3BH0A 1UPTA 121PA 1Z0AA 2EQBA 4DSUA 3Q72A 3TRFA 4OI4A 2DWPA 2ZI7A 2VEDA 5EJEA 1SXJB 2ZSAA 4MH0R 4AKGA 3RRNA 3RS7A 1MV5A 2ORIA 3FTQA 4GBMA 2ZREA 1G7TA 2HT6A 2DFNA 3OAAA 4HATA 3BOSA 1E2PA 3ZH9B 4H1UA 4XD7D 3O47A 2O8BB 3AKYA 5HE9A 3UANA 3W5IA 5JRJA 1FMLA 4OI2A 3VFDA 1CJUC 2O5VA 2ODNA 3KL4A 3T35A 4B6EA 1VYUA 2ONJA 1PLLA 1US8B 2WKQA 2NPFA 3TUJC 4LY6A 1E4YA 4QJ5A 4JT4A 1G8GA 1CRPA 4A9AA 2QM7A 3HWSA 2ZROA 3GFTA 4IDQA 4C0JA 4KSBA 4B33A 5BN3A 5JI2E 3R8FA 3T5GA 1PUJA 3IPXA 3BFVA 1TEVA 5C4MA 3TR5A 3MGCA 2QTHA 2W6IA 1CR2A 2OCPA 2VIIA 4Q1BA 1XTKA 4BLPA 3ZVRA 4P32A 1ZC3A 2ZE7A 1DEKA 2RHDA 4TTQA 5L8VA 2CVFA 2AN9A 4MYTA 3TW8B 2ERYA 2QORA 3QXXA 2BKEA 2RGNA 3B8HA 1B0UA 1DTSA 1DAFA 3GPLA 2AXNA 1G5RA 4POAA 4UNQA 4CF7A 5HPYB 3VNVA 3L0IB 3L82B 4OK5A 2A3RA 5IK2D 2DPXA 2RGDA 2X19A 4X8HA 5LD2B 1CU1A 4CEJA 3M6AA 4B34A 5EQTA 2Q0HA 4FW9A 2C9CA 1P9NA 3KB2A 3A36A 1OXSC 2WJHA 3CF6R 2BV3A 1E3MA 1SGWA 3UMSA 1QZXA 3PR1A 4DLTA 2ZANA 1I4DD 3IDQA 2RGGA 3CRQA 1I4TD 4NH0A 4E07A 3ADDA 2ZU0C 4ACAA 1OFHA 3AGPA 2O8FA 2X1VA 2P5SA 3CIOA 5KSOA 2CHQA 1RC8A 2HEIA 4MKHA 2F43A 2ZTSA 4N0DA 3MFYA 4JBYA 2A5YB 2FGKA 4Q01A 5AJZA 4IDPA 2N42A 2REOA 2CNWD 1G4AE 4C0KA 1D9ZA 3I3SR 5KSPA 3B7GA 2Z43A 4XSGA 4A1FA 3TR0A 5AUOB 1E2NA 3H0KA 3WMEA 4DCVA 3EA0A 5CLQA 2YV5A 3VAAA 1E98A 1J70A 4ARZA 3V00A 4RFVA 1QHHA 1VG0B 2YWEA 5DYIA 3MJRA 5J47A 3GCGA 2GJ9A 4US0R 2GDJA 5JCZA 4PO9A 3QPWA 2BVNA 1XP8A 1D8TA 3C16C 1OV4A 5SZJA 5TDHA 1G8FA 4YDSA 3AVVA 1JI0A 4II7A 2WIAA 1YZLA 3RC8A 4M9SA 2BOVA 2ZRMA 4RFSB 2IS4A 2AHOA 2V6IA 2QT0A 4JKIA 1XEXB 1GZSA 2IYVA 2ZRNA 3OIWA 2CL0X 1XXHA 1ESMA 1HQCA 4MRVA 1M74A 4FMDB 2FX3A 3VR3A 3W5JA 1CEEA 4I1OA 4C2TA 3OEHD 1KSFX 4UNPA 2C2HA 2DWOA 3U3RA 3GQBA 5J5CA 3MCAA 1M7BA 5CJPA 4Q4JB 5UKDA 2XTNA 3QSYA 2XZLA 1GKYA 2IYTA 2IYYA 3A4NA 3RHFA 4XVUA 5L3QA 2GJ8A 5FH9A 2HLDD 2EYQA 4EJSA 1UF9A 1TPZA 1MT0A 1TL7C 1ZCAA 1KDPA 1SQ5A 3Q85A 3GLIA 3HPRA 1XXHE 3PUZA 2CLDX 4A4DA 1KO5A 2BCJQ 4DWJA 5GVRA 2J3EA 4WXRA 3KQKA 1JB1A 3W3AA 4ZPXA 1SHKA 2ZSBA 4JVNA 4PQFA 2YC4C 1E96A 1XD9A 3B1ZA 1UBEA 2YOHA 3BD9A 2ZS8A 4HUQA 1U9IC 1DO2A 1J99A 5EP2A 4Q18A 3GFOA 4NPHA 4DRZA 4OYHA 4TT3D 4HDCA 3IQXA 3L2OB 2C9OA 1CLUA 1FFHA 5F2EA 2JLWA 5IK2A 1OB5A 3RDPA 3RNLA 1P2SA 2WVJA 2NO7A 4LX0A 5EXSA 1Z6AA 4MYHA 1CBUA 5P21A 1JEDA 2OV2A 3BFKA 3HYTA 5AJYA 1CR4A 1RYHA 2NO1A 4TLCA 1O87A 3B1WA 4QNMA 5KDOA 3S1AA 1XJQA 2JJ1A 2A5FA 2XNDD 3AEZA 4Y0AA 2GKSA 5JBQA 2ZJOA 2EFHB 3R9WA 4Z54A 1U0JA 1U81A 3FYHA 3TVTA 3GLHA 5K8LA 1G8YA 3BFXA 5EXPA 2GBLA 1GITA 1XRJA 2ANBA 2ZJ8A 1I4LD 2NZJA 4Q9LA 1EFHA 1AN0A 2FV8A 3QUSA 2QUZA 1E94E 1VYVA 2GF9A 4GP6A 2FSIA 1E69A 2HJVA 4M53A 3NWJA 1VCMA 4AK9A 1EFCA 2ORWA 1F48A 3LXRA 1KI6B 3ZD6A 1OIVA 3DMDA 3G82C 2R9VA 3K0FA 5SZKB 3VNUA 1XCGB 5JS7A 1AKYA 4Q19A 4BUJA 2XSZD 3JZMA 4C2UA 1HV8A 2W2XA 2QAGC 3ZVNA 3KQNA 1WDTA 4P4SB 5B58C 3C8UA 2CLCX 2ZE8A 3H86A 2HJGA 4R7ZA 5CK4A 1KAGA 1X1SA 5E4FA 4YXWA 4B44A 2D3WA 3TK1A 3NBXX 2WWFA 4DLVA 4CEHB 3SFZA 4B73A 4CRWB 4AY2A 4LJ4A 3K9HA 4LYHA 2IYQA 3LY5A 3RS4A 1CXZA 2XZPA 1ZM3A 3SS8A 4YMWA 2ZRBA 4S2EA 4TQ9A 1WRBA 3NC0C 1P75A 3U3JA 821PA 1EG7A 1LVGA 3QXJA 4LV8B 4PC2A 3K09C 4QGHA 1MRSA 2G6BA 4RD0A 3BORA 3D6TB 2REXB 4B48A 1UADA 1KGDA 4FCVA 3LX5A 4EPWA 1XNJA 4EIWA 3Q7PA 4HAWA 1YVDA 2WV9A 3L43A 3PG5A 3IILA 1DVRA 2GJSA 4OHWA 3AVTA 4NDZA 1XCPA 1LS6A 1JR3E 1TQ4A 1ZU5A 4MKFA 1PV4A 3TQCA 4Q4HA 4V03A 3I1FA 5KO2A 3EC2A 2HCJB 1X8KA 1BKDR 2FZLA 4QNRA 1E0JA 4BFZA 3RRMA 3U3MA 5K8TA 1ZNXA 2OEPA 2ZE6A 2OXRA 3QKUA 2GCOA 3ND8A 4JLVA 1IBRA 3K0AB 1HA3A 4RD1A 3P27A 5BQ5A 4NCNA 1WMSA 2JLYA 2O8EB 2R62A 1E1RD 4W5WA 1YJ5A 2EW1A 1ZUIA 1RPZA 2XXAA 2IYWA 5E7IA 1W36B 1A2KC 1J8MF 1T0HB 4G3XA 5IHPA 1IN6A 3AKCA 2JASA 4IFEA 3REFA 1TMKA 3FMPB 3K1JA 1ZINA 2FN4A 1HY3A 1Z0JA 2J7KA 2OBNA 5B2ZA 5FR2A 3UMFA 4KFRA 4PPQA 3SOPA 3E1SA 3KQUA 2B8TA 2QRZA 3I8SA 5KDDA 4WVFA 1LNZA 4M1SA 5KNDA 4Q7KA 2C95A 1NSFA 4MGZR 5HE8A 2ODWA 2C77A 2GA8A 4AD8A 5TY0A 3DEFA 4MGYR 3WRYC 5FBRB 3AVXA 4P33A 4J0QA 4V0MA 1XD2A 4JIMA 2QN6A 3QIAA 4NU0A 4A8JA 2IYSA 1KJWA 3B13B 4RD6A 2EFEB 1N6RA 1X86B 2V1UA 3EWAA 2EFCB 1SVIA 2AFHE 3AUXA 1W4RA 3EASA 4RD2A 3ZGXA 2MSDB 3CRW1 1YQTA 1S96A 2VLIA 2GVZC 4I1SA 2OUKA 1T6NA 3FE2A 1OHHA 1VIAA 2J1LA 4Q66C 2OT3B 1HE8B 2ANCA 4BZXA 2B7CA 3NEYA 2A78A 2QTFA 2ZJYA 1SXJA 4V0ME 4BPBA 4CVNA 4UXHA 3CB4A 1NBMD 2J0UB 1SKQA 2HV8A 1W46A 1Q57A 4KFTA 4PPNA 3PV0A 1L4UA 1IY1A 4PSVA 4OKSA 4OI1A 2O8BA 1YZTA 3TW4A 5AR1A 4B32A 4MGKR 2ZRFA 2NGRA 2XJ9A 2WKRA 4IDNA 1M34E 2AWNA 4DLSA 1Q22A 1NG9A 3RSOA 2IEZA 1ZP6A 1VTKA 3BB1A 3K9GA 3OZXA 1E4VA 1XWIA 3U7GA 1SXJE 2R2AA 3PQCA 4ZKDA 2WAYA 5DN6A 5FBVB 3TIFA 5EE9A 1F2UA 3DKPA 5FBLB 4XWAA 3U3OA 3G0HA 1Q21A 3MD0A 2QY9A 1Z47A 4Q7JB 3CH4B 2JLZA 2J0SA 3AM1A 4MQBA 3FKSA 3OFND 4JYBA 1GL6A 3ZVLA 3EZFA 2D2FA 3U60B 2MSEB 1T8UA 2EU8A 5E95A 1E32A 4ARZB 3CONA 1CP2A 1OF1A 4LBWA 1QHHB 4PHFA 4S35A 2ZYVX 3R9IA 1ZC4A 1QF9A 1R4AA 3SU8A 1A82A 2FEOA 4LJ5A 3QI2A 1EFUA 1GL7A 4B71A 5H1YA 1NKTA 2ZRDA 4XVRA 3CX6A 4LPKA 3AVPA 1W0JA 5TVKA 3HJNA 1AKEA 4DLUA 1KDTA 5JJKA 1FPMA 2HCBA 4KV9A 1E79D 2PL3A 3TNFA 5FR1A 4V02A 1RKBA 1R7RA 3ICQB 1Z6TA 3SC3A 4LHVA 4BQSA 3EIQA 1U2RA 3O8RA 1G3IA 1IN5A 2VHJA 3T1QA 2EFDB 2AK2A 3I32A 4V0KA 2QTVB 4QGAA 2TMKA 4HB4A 5J4YA 5A0FA 2VF8A 1G20E 4B35A 1IHUA 2BIFA 3KB1A 5AJVB 1Z28A 1CJKC 3FOZA 3F0TA 2OCAA 3AP3A 2EVWX 5L3QB 1EX6A 4IDOA 4ZDWA 4TZ0A 3Q3JB 1IN8A 1CJMA 2WWIA 3WRXC 3W9YA 3F8TA 1U99A 1T5LA 4YMSA 1UFQA 2D7CA 2RCNA 3HR7A 3RRZA 3IEUA 5JHGB 1WXQA 1MO3A 5B64A 4A2PA 3K8YA 3SN6A 4HUQB 3FHTA 3OESA 2IUSA 2W00A 1XTSA 2XEXA 4O25A 4FMCF 4Q9HA 3U7HB 3P32A 2FF7A 4IVQA 2ZQ5A 4Z8XA 1M8PA 1P4SA 1HUQA 4RFSA 5C46F 2PBRA 1AGRA 2XNSA 1KI1A 3DVLA 3QXSA 3SHFA 4TMKA 3BK7A 4EQ6B 2W2VA 5JJIA 4P3YA 5GJBA 4F92B 2F55A 1U8ZA 2PT5A 2ZM5A 1N6KA 1XBTA 4UXJA 3L8ZA 4P31A 3SJBA 1NMYA 3FMFA 1GRNA 4FCTA 4QGGA 1KOFA 3K70B 4JVLA 1S3GA 2EWVA 5FTMA 1L2TA 1Y63A 4Q4JA 3GLHB 2F3RA 4O0MA 3O8BA 1BOFA 2F3TA 2QT1A 4LHWA 2BJWA 1OFUX 3B85A 1T0JB 1Z07A 3H84A 2NO0A 2OFOA 4N0EA 4BFUA 1RW4A 2R65A 4BASA 2QGNA 1T9HA 3VMFA 1SHZA 2OO7A 4CEIB 4FIDA 2G9NA 4K46A 3ZVMA 3LVQE 2C04A 2VSXA 3R9XA 4I99A 4IHQA 2AKYA 5FI1B 4AC9A 1E6CA 4Z1MD 2Z4RA 1SKYB 3LW7A 3A1WA 3BIFA 2FH5B 3KJEA 2WMOB 4KVAA 1MKYA 5HKKA 2P2LA 3T61A 4B74A 1M2OB 1YR6A 1J8YF 2QPTA 5SZHB 4OK6A 1PLJA 3FPAA 1GL9B 2EYUA 3FWYA 1JQJC 3EPJA 2X8AA 5CJ2A 5EXXA 3LBIA 3AF4A 2QM8A 2D62A 3TE6A 2RMKA 4X8LA 2F1JA 1V43A 1GDDA 1KI7A 4B6FA 3U61B 3RS5A 1EXMA 3EIHA 1FNMA 3ND9A 3REGA 5F98A 3NTUA 3W8RA 4RZUA 1BO6A 1LTQA 1PJRA 3PENA 2IYUA 2WWXA 5FL7A 3ZQJA 2GXUA 1UKEA 1AM4D 2CHGA 2W58A 1FX0A 2ZRJA 2V3CC 3PITA 3A1TA 3I5XA 5TB5A 4F91B 4QG7A 1KI6A 1C9KA 4HAYA 2PLFA 2OHFA 4GI7A 1LF5A 2ZS9A 1ZU4A 1II8B 6Q21A 1YRBA 4P4SA 4FD2A 4Q03A 3A4LA 2IUTA 2KSQA 1P73A 4ZCLA 5KUTA 2WJJA 1M7GA 2CE7A 4ESHA 2ZRHA 4ASUA 2OFXA 4BRWA 1E9DA 3VR5A 2IYXA 2FEMA 3AF2A 3SBDA 4Q9IA 4U00A 3IHWA 2WPDD 3IIJA 2HUPA 1KI8A 1ODFA 1Q1BA 4LBVA 3B2EA 1EWRA 1QRAA 2CCKA 3OEED 1LW7A 2Q21A 2XXAB 1HYQA 2ODBA 5G53C 2FDCA 1E9CA 2ZJZA 4JLJA 4LJ7A 1D5CA 1E2HA 4RZ3A 1XEWY 3CZPA 4ESVA 1SZPA 3RWMB 4NYMR 2DHRA 1X1RA 1Z8FA 2GAAA 4LGMA 1QHXA 4FMBB 1NN3A 1CTQA 3MWYW 4PAMA 1XD8A 4DSNA 1R10A 2WWGA 4GT1A 4URXR 5E7JA 4AYWA 2JIZA 3TKLA 3QG1A 5J4LA 1ZIPA 2G1KA 3U3KA 1E9AA 2OAQ1 3CRMA 1KY2A 4XWKA 4TZ6A 1XD2B 3L0SA 1JQLB 2XAUA 4DSOA 2ZS7A 4A0FA 4M1WA 1F2TB 4A8JB 3A1UA 2JGNA 3ZYCA 4LCBA 4QBHA 1TX4B 3GJXC 2ZR7A 5BYJA 1FP6A 4HAVA 4B2LA 1K5DA 3KJHA 5KTYA 2VSOA 3ONWA 3P4YA 5AJXA 4G5SA 3CNOA 4Z1MA 3K0AA 1S9HA 4JLOA 3PUYA 4DB2A 3NC1C 2ZUBA 2NIPA 4OQLA 2O8EA 1W5SA 3VX4A 2ZAOA 1VCNA 1LS1A 2WZQA 3QE0A 4GFDA 3DM5A 2RKOA 3LBNA 5FTKA 3X2SA 5CB8A 1P7CA 2IXEA 1P3JA 2MMGA 4PSAA 2A5GA 2JLUA 3PFIA 3K9NA 3UIEA 2GXAA 3N5CA 2C99A 2IF2A 1XEWX 1N5KA 1BYIA 1G7RA 1U8AA 2BM1A 3FHOA 2W6JD 4PQYA 4B3GA 2BMDA 2QP4A 2IYRA 2F7SA 4TTPA 4Q7MB 2C8VA 2V9PA 3PXGA 2PH1A 2CBZA 1DPFA 3SI7A 1R0ZA 3D31A 3DMNA 2B7BA 4F4JA 1UBGA 1YZNA 4TYQA 2QL6A 2P6UA 3EG5A 1Z83A 4OQMA 5DYGA 4DXAA 1OB2A 3WP1B 2QP9X 1S3SA 2B21A 2FWRA 1F2UB 3ZS8A 3U4QB 2J59A 1X8LA 1P2UA 2WOJA 2ZUDA 4AG5A 1UBCA 1DAGA 4PPFA 2V55B 2OESA 5E7MA 5BXQC 2VP9A 1HE1C 1XU4A 3NBFA 2NG1A 4IFBA 3WYGA 5FOTA 3IIMA 1K6MA 2IXFA 4OI0A 1KMHB 5KOYA 1CJVC 1COWD 1FMJA 2XOKA 2ZJ2A 1YRAA 1JAIA 1VECA 3CX8A 1DOAA 2WPDA 1Z6XA 2J0UA 1YZQA 4NYIQ 5AWFC 1OIWA 2ZXUA 4A15A 2NPIA 2PX3A 3SDZA 4EJSC 3PEWA 4TSFD 4IVPA 3QKTA 2ZEJA 3WNDA 2ZIAA 3NBZC 3I92A 2JEOA 3T5DA 1WBDA 2K5UA 1VKJA 4TYPA 1OKKA 5ANRB 2HF9A 4KFSA 1RRGA 2Z6VA 2ZJAA 4XSHA 3VQTA 2CK3D 3KUCA 4Q4LA 4BEJA 5KSYA 4NCIA 4LI0A 3AB3A 1GP2A 5G40A 1E0AA 721PA 4PZLA 2V54A 1E9FA 4JZKA 2DBYA 2I4IA 1Q3HA 1IJFA 1JAHA 1NLFA 2FJUA 3RS2A 4AKHA 3OIUA 4Y0VA 3KXLA 4EAQA 1JECA 3NH6A 4IJMA 3WNBA 3KJIA 3AUYA 4FXPA 2NO6A 1KSHA 4GOJA 4MRSA 3QVVA 3QKRA 5KPJA 2IS6A 3KKNA 2JCSA 1E9EA 2CMKA 1QBKC 2RB4A 5EXTA 4R71A 1PUIA 5IDVA 3HDTA 3X1DA 1OXUA 1XZPA 4JT2A 4M9QA 1T4GA 2J7PA 1H8EA 4QBGB 5L3VA 4PHHA 2BBSA 1NL3A 4HZUB 4QBIA 5EE0A 4DLWA 2GBLC 3P26A 1JNYA 1EWQA 2P67A 5DNYB 4ZO4A 1WP9A 3TH5A 1NVVR 1JXMA 3DL0A 4MUAA 4D4KA 2DWQA 3C41J 1P60A 4TL7A 1IAQA 1XX6A 5A4JA 4XD7A 3ZQ6A 2A5JA 5LBIA 4MUBA 1G3QA 3C7KA 3AF1A 3SR0A 2GRJA 4RKEA 1OH8A 4GP7A 2CJWB 1RJ9B 1DG3A 4FI3C 5JLJA 2FSFA 1XMJA 3B9PA 3HU3A 1HT1E 1ZVQA 5KNBA 1ZNYA 4PAOA 1JXOA 5LB2A 4DHEA 1SULA 3HU2A 4JL5A 2O52A 3WY9A 1KK1A 2WICA 4L15A 2ZI4A 3GP8A 1XCMA 3I73A 1I2MA 1JR3D 2VH5R 1N6LA 1RFLA 4B2IA 4JMPA 4Q9JA 4ZV4A 2R6CA 5LB4A 3BJIC 1U98A 4RJLA 3GEIA 4RD3A 4NKRA 3VR2A 4D0GA 1UM8A 1Q3TA 4XIGS 3EW9A 2X2EA 4X8MA 5J40A 2GK7A 2AXPA 3PUVA 4JKYA 1ZNWA 4D26A 2ERXA 4EFLA 2PCLA 1KDRA 1F5NA 2YOGA 3BB3A 5JMTA 1IY2A 1KDOA 3UXMA 1R0XA 1HQYE 4P4TA 4EQ6A 3ASZA 3GLIE 1X6VA 2Q3HA 2XTZA 4ITRC 3NKVA 4Q1EA 4WXPA 3BERA 2JLVA 4JSTA 3NH9A 1UDXA 4E22A 4HZIA 1MO4A 4B2PA 1KAOA 1XMVA 3KXKA 3TBKA 1DO0A 3ZZ0A 2ZRPA 4K81B 4YMUA 4HYYA 4F4IA 3T12A 3ZZUA 3OF5A 4LJYA 1ZUNB 2JA1A 2BCGY 2Q3FA 2ZI5A 4WAUA 1FUUA 2JDID 2FSHA 2QROA 1KI3A 5F9FA 1FQJA 2W0SA 1ZAKA 2O0JA 4M1TA 1N25A 1FX0B 2CNWA 1VG8A 1N6HA 1R6BX 2DFLA 4JLBA 4CGZA 4IVRA 1AJEA 4A0RA 1P6XA 1WA5A 5FBWB 4CEIA 4WOPA 5L3RA 1KIMA 1ZNZA 2V1XA 2ZRGA 3CM0A 4W5JA 2IWHA 1U0HC 4OBEA 2F6RA 1XTIA 2QMEA 4OJKA 3LD9A 4IXMA 1VCOA 4GZLA 3IUYA 1GNQA 1RIFA 2QGZA 3GLHE 3TGPA 3B5JA 3UG6A 4CZ2A 1E9RA 3GJ0A 1OYWA 3IBYA 2QA5A 5BN5A 1P9RA 4LZZA 2ASEA 3T34A 4CW7A 2JATA 1UJ2A 3VR4A 4B75A 2BM0A 4C0BA 3GLFB 3DOEA 3AKDA 4OHVA 2KBEA 1SVLA 2YWFA 3EC1A 4M1MA 4URVR 4F4CA 4A2QA 1ZM7A 3PCRB 4A0HA 2JLXA 4JVMA 1N6OA 2R44A 2GF0A 2FFHA 1Z2AA 2QI9C 1DAHA 1SKYE 2VP6A 2YKGA 2Z83A 3W8NA 5JCPA 2CCGA 2ZI3A 4ON9A 5C1BA 2ZRCA 2ZJ5A 3SZRA 1GTVA 3OEHA 5JSZA 5KSZA 4DT1A 1K8RA 1L4YA 1SXJC 2E1RA 3J81k 1VMAA 5IF9A 1W4CA 4Q1DA 4YQFA 1W2GA 1LV7A 2B8WA 4ZKEA 1D6JA 4TLAA 1E1QD 3A4MA 2HLDA 5CDFA 2DFTA 3QPUA 1LB1B 4PAQA 4IKEA 1N2CE 3A6PC 2FOLA 3EZ9A 4LYFA 4OL0A 1II8A 3PUXA 3QY0A 3LX8A 1YHNA 4M4SA 1SVSA 3NEJA 4JBWA 3SFVA 5M04A 4D25A 3TQFA 4R2IA 3WBJA 2BHRA 4RZXA 1DAIA 1TNDA 4EKDA 2FPMA 4PHTA 4EPTA 4A2WA 1KZGB 4TT3A 5FPTA 4Q47A 4HDQB 1D9XA 1SVWA 2RAPA 4MRNA 5CIWA 4B3FX 4D81A 3SQWA 5CDFE 4UJ3A 3HR8A 5EZ6B 2N46A 4W7SA 2QU8A 1TQDA 1R8QA 2OM2A 1TUEA 4MKGA 1TTTA 4JLKA 4B3BA 4WW0A 3HU1A 5IRCD 2WJGA 4GZMA 4DIEA 4FCWA 5HTKA 2XNDA 1G19A 2XB4A 2FFQA 2FPKA 3KTAA 3LAWA 4KCGA 4EUNA 2V7QD 1AZSC 2IHYA 2VTKA 3K0EA 1BMFD 2CE2X 3BS4A 2C5LA 3NHBA 1GVNB 1TUIA 3U5ZB 4WA7A 1GUAA 4RSGA 2VL7A 3MWKA 1W0KD 2JAQA 2GETA 4ZDKA 2CCJA 5LD2C 5J4VA 2OBLA 1M7HA 5EE1A 3IO3A 4HAXA 4JJKA 1F2TA 1GKIA 3KXIA 3EPLA 2GXQA 3VHXA 1TAGA 3FDIA 1JPJA 2FA9A 4DLZA 2BEJA 4EPRA 3PEVA 4TL8A 2XSZA 3QXCA 2VF7A 1AA9A 4DLRA 1W5TA 2GCNA 2R6AA 4BZPA 4A0GA 5CM9C 3QNUA 2DFKB 3RVBA 3E5HA 2I3BA 1J2JA 2VA8A 4OK3A 4G5OA 1TF7A 4TWZA 1T91A 4LYAA 4WZAE 2H57A 3I62A 3R20A 3X1WA 1KNQA 4BLSA 4ERNA 5F9HA 3P4XA 1L7VC 4KJZA 4AWXA 1EGAA 3TJZA 1OXTA 1QVRA 2KE5A 3AVQA 1A5TA 1VHTA 2Q9AA 4EPXA 1XPRA 1ZW6A 1P2TA 1XZQA 2JLQA 3GJ7A 1KJYA 5DI9A 3ZDQA 5JI3E 1OH7A 2G83A 2HXYA 4BLQA 2W83A 2AD5A 2Y8EA 5H68A 4ACBA 4LC0A 4F7WA 1XTRA 1Q1EA 2FMXA 3H4MA 3U4QA 2NZ8A 5CK5A 5K8UA 5HCNA 5JZVA 1NY5A 1OJLA 3F3YA 5AK0A 4BFVA 1NLYA 3QKRB 3LO5A 4KI0A 5DGXA 1KMHA 1TF2A 3KDSE 2IYZA 3GFPA 3JZAA 2JJ2D 3QEOA 1XFAA 3KQLA 2O8CB 1NIJA 2PX0A 4YMTA 1E1RA 4C0AC 4D82A 3I4LA 5CITA 3EZ7A 3MG9A 2ZSDA 4GL2A 3TAHA 1Z08A 2OXCA 3QBTA 3R8CA 4FMCB 1ZUHA 4HLQB 4EFNA 1W44A 4M8NE 2PMDA 3QENA 3GJ4A 1XPUA 3WYAA 5JWRA 1SVOA 1WF3A 2QMUA 2QENA 3B78A 3JVVA 4LPSA 4O2LA 5FL3A 3KQHA 5BN4A 1N0UA 3QPVA 1KO8A 4L4UA 2GZDA 2EWWA 2ZRLA 3CPEA 4QKQA 4RZ2A 2PZFA 2VBCA 2RGEA 3CWZA 1WB9A 2MSCB 2QG6A 4G5RA 4O2RA 4L16A 5FBQB 4A6XA 2O0HA 1W0KA 2QZ4A 1NVUQ 2ZR0A 3KZ1E 3QG5A 3QVUA 5SZIA 3LDAA 1F60A 3AVYA 3WMGA 4WIAA 4BFTA 4H9GA 2F9MA 3EPKA 1XJCA 2IHBA 4RKFA 1EFRD 4OHYA 3CBQA 2E9SA 5DIFA 1E2FA 1E2LA 1BIFA 3N2EA 1HEIA 2WTUA 4B43A 1FW6A 4K8OA 3MWJA 5FPHA 4BRUA 3OE7D 4LYJA 4LHXA 1U0LA 2UZIR 4HZUA 4IOKA 2XX3A 2IUUA 2QSZA 3NHAA 3CLVA 4ZIRB 3RAPR 1NBMA 4BLRA 2WJVA 1NMXA 4NL4H 1G3RA 3DKVA 2FG5A 2G1JA 1UBFA 3ZZTA 4JS0A 2KWIA 5C2JB 5TMPA 4AG6A 1GG2A 3G5UA 2GK6A 4DCNA 3QOFA 4LWZA 4HUTA 1IXSB 5CYPA 4Q1AA 2GILA 1WQ1R 2CJWA 1RJ9A 2J45A 1JBKA 2GJKA 1IY0A 4CT5A 1NVXQ 1TQ6A 1XMSA 4KXFB 3GLGB 2IC5A 1H8HD 1P5ZB 4YLGA 1NN0A 4P4UA 1NBME 5G3ZA 2LKCA 4DCSA 1FZQA 2BBTA 4GRAA 2DB3A 4I1UA 3CPHA 2H92A 1GWNA 3IIKA 1PVOA 1EFTA 2OG2A 4HLUA 1NJGA 2OE2A 2VO1A 3L0PA 4YC7A 2AX4A 3U7EB 2W0MA 4KSCA 3OFNA 4B76A 1QVAA 5BYKA 3B6EA 4IOLA 2HYDA 3W34A 4KAXA 4IOMA 1W2HA 4UQOA 2HYIC 3RC3A 4JLPA 2ONKA 1G4UR 2V4ZA 4PFSA 4LV5B 221PA 4US1R 4HAZA 4KYUA 3BRWD 2PLRA 2C78A 1KO1A 3N2IA 1GNPA 3VTKA 2CVHA 1AK2A 1S9DA 2FZ4A 2XZOA 3M4YA 2BEKA 3SNHA 4C0QC 1L8QA 2H18A 2DR3A 4JLMA 1NF3A 3VKHA 4PSKA 4UJ5A 1KYIA 1E79A 2IA5A 3SYKA 1DELA 4X8OA 3UKDA 3B60A 1A2BA 2YINC 3E70C 4AYTA 5ELXA 3ASYA 5EUQB 1NY6A 4MRPA 3X1YA 2RHMA 1Z0IA 5JEDA 1AS2A 2F1HA 3CRRA 4QGFA 3UATA 521PA 1AZTA 4TTRA 3T1VA 1UKYA 1W36C 5JSZB 4DT1B 3N70A 1GIAA 3SYNA 1P2VA 2RH5A 3PEUA 4M1KA 4DEXA 5AUNB 621PA 5FPSA 2ZYUX 5JS8A 1UEIA 4B3CA 3UG7A 4FINA 4I1VA 2ATXA 1E2IA 1YZKA 4MKIA 4JLDA 1G6OA 1KTVA 2GTPA 1FNNA 3CRVA 1CRQA 1WCV1 2BC9A 3OAAD 2KBFA 3I61A 3CKLA 5EE5B 2WWHA 3OE7A 5D3MB 3B1YA 1PLKA 2BBWA 3NIBA 4NYJQ 1ZCBA 4WZBE 5FOWA 3VU9B 4B3DA 2P5TB 3LRPA 3QKSA 1DAEA 4DDUA 1U94A 1ZD9A 2VRWA 3LWNA 4U7DA 4BFXA 2D06A 1XMIA 4P0TA 2NO9A 2Q9CA 4E5UA 3AP1A 1KHTA 3UMRA 3GLFA 1G18A 3K9LA 4URYR 2J41A 2W6ID 4UNSA 2IL1A 1BYUA 3IO5A 4NYMQ 4MDEA 3CR7A 1J7KA 2H5EA 3C5CA 3AH8A 1OW3B 1W49A 5EP4A 1AS0A 4XWOA 1G7CA 1R0WA 2RGNC 1NMZA 4KBGA 3KTAB 1NIPA 3W6NA 3RANA 1N5IA 1GKUB 1RZ3A 1FP7A 3NBYC 3OIVA 3THWB 1G17A 4DBLC 2CEAA 4TMTA 1E9SA 4OHZA 4C0SA 4LBZA 5K8IA 1II0A 3CPJB 3GLFE 1T8TA 4QOSA 1KI9A 3VX3A 4G0NA 2GJAA 3PUWA 3ECCA 3QF4B 5GJWC 2QBYB 5FOSA 3CWQA 4PC6A 2A9KA 1HT2E 1YR8A 4WZ6A 2WMNB 3ADCA 8OHMA 2ZYWX 2W2TA 3THXB 1NP6A 1MOZA 5GVSA 5FTLA 4TQUS 4DLYA 3CH5A 5FUXA 4C9BA 1P61B 2QAGB 4US2R 3C14C 2A30A 1VHLA 3HP1A 4Q21A 4CYMA 4M21A 2PJZA 2HF8A 3V4FA 1QHNA 2BJVA 2BDTA 2RGXA 4CDGA 3Q7QA 1RRPA 1W1WA 4XTCS 5G41A 2ZVQX 3SJCA 3HYRA 4URWR 2RGCA 2YZ2A 1TEXA 1TF5A 4HEJA 4LJAA 3C15C 1G1MA 3CO5A 1JEEA 4HLDA 2WWYA 3EZ2A 1LFDB 2VP0A 5CLLA 1D2MA 4HI0E 3Q8XB 3LH5A 3FFBA 2FFAA 3B1XA 4TMZA 4PR0A 3W6PA 4DSTA 3CF0A 4PXAA 3AQ4A 1Z63A 1ZMXA 1O3YA 4V0OA 1XTQA 1CJTC 4KODA 2AK3A 3LLUA 1Q20A 2YOFA 1KZ7B 3BH6A 3FB4A 1W7AA 3KX2A 2PZGA 4DDVA 2ZAMA 3FKQA 1GOTA 2VQSA 5HR5A 1N6PA 1XEFA 1FTNA 3SBEA 4LC1A 1OFIA 5AUQA 4IDHA 1T3SA 3A1SA 3AVUA 4KFUA 3THYB 1RE0A 3KJGA 4DDTA 3OEEA 4LBYA 4TQAA 2IYLD 2GVDC 4RCYA 4DKXA 4PZYA 3TSOA 2NMVA 1J90A 1YKSA 3UPUA 2ZRKA 2XB2A 2C03A 1ZD1A 1UDWA 1R5BA 1KI4A 2E87A 2ZJBA 4Q02A 4IEEA 1JALA 3A8TA 3U2QA 4MYUA 1YZUA 5DISB 3SJAA 2QSYA 2ZI9A 5FI0B 2ZYTX 3C5HA 4DUGD 1G41A 4Q4AB 1D2EA 4BLOA 4TLEA 2QE7D 3LFUA 3W3ZB 3K0CA 3O8DA 4NYIR 5GADl 5DI3A 3H2YA 4TLBA 1G8HA 3I72A 5HZHA 3RSLA 1DS6A 3WBKA 4D4LA 4GMXA 3BAFA 3ZD7A 4DCUA 3NDPA 2R6GA 3K70C 4MITA 3WHKA 4GOXA 1E0KA 4YDHB 2JJ1D 4BGDA 4C7OB 2GNOA 4LJ8A 3K70D 5LDDC 5DLQC 3EAQA 2O8CA 1IJEA 3D3QA 5JEEA 2L0XA 4IOJA 5EUMA 2LCFA 1NVVQ 2CDNA 1NVWQ 4GSYA 2OSBA 2CLSA 1N0VC 5CB6A 2G0TA 4BLTA 3BBPA 2KJQA 1DE0A 3MMPA 2BMFA 3MLEA 3U6KA 4NE2A 3TLXA 2N1BA 4IEIA 5FFMA 1R8SA 4AI6A 3KKQA 1OXXK 2YYZA 3F5FA 2ZETA 4PHGA 4QRHA 1NN1A 2FSGA 2GEVA 1FQKA 4CIDA 3PJRA 4PO8A 1Z0FA 2PCJA 2D7DA 2LKDA 1E2EA 1FL9A 4PO1A 1JJ7A 2W6JA 1VG9B 1R5NA 4MGIR 4CT4B 1E2GA 4N3NA 2Z5FA 1ONBA 5CIQA 1MO5A 1K5GA 1G5PA 2IBMA 4YXWD 2JLRA 1E2KA 1NN5A 4M9ZA 4XTRA 1P9WA 1DARA 1NI3A 4Q7LA 1Z0KA 1NLZA 1JR6A 2YNMA 2PZEA 3W90A 1OPXA 3GJ3A 1E9BA 4NMMA 4KO8A 4MA4A 4QM6A 3D8BA 3CZQA 3L0OA 4I4LA 3BB4A 4V0LA 3AVWA 2GHIA 4QJ4A 3VHLB 2IXGA 2J5XA 3CW2A 4F93B 1Z6YA 4HB2A 4ZI2A 5BW8A 3TAUA 2H8KA 3X1XA 1RYFA 3A58B 2REBA 2ZU6A 2P6NA 2A5DA 3H1TA 1S8FA 1IXRC 2AL7A 1ESNA 1COWA 4NZYA 5EE3A 4R9UC 3LW8A 2IW3A 4ZIRA 1VPLA 4EPVA 1MR3F 1G7SA 2XGJA 1D2NA 4NTZA 1KSJA 4TYWA 1H65A 2D4HA 4HB0A 4TSFA 2VYFA 1G8PA 2BKUA 4LOAA 4UKDA 1S1CA 1S0UA 1QG4A 2QQEA 3LQQA 1Q1ZA 3ETLA 4HSEA 1N6IA 1OIXA 3MSXA 1EX7A 1E0SA 4EPYA 4TL6A 2IX3A 4DDWA 1S4QA 2CK3A 4ZCIA 1GFIA 2F1RA 1Z0DA 4TMWA 1U8YA 2WAXA 3GD7A 4QC2A 4TL9A 4ZDJA 4LK2A 3BGWA 3GLGA 4OQFA 2IF0A 4DUGA 5JFGA 2QE7A 2C98A 4GMDA 2WSSD 3VKGA 2AD1A 2FFBA 1Q0UA 1Z2CA 4GNKA 5FTNA 1QHYA 3TSZA 3MUFA 1N5JA 1DG1G 2YC2C 3EXAA 1G64A 4I81A 2IS1A 3V4RA 3ICEA 2C9YA 2CXXA 1IQPA 1ZYUA 2FNAA 3PVSA 4FMDF 5HZKA 4W9MC 2ATVA 1FOEB 4E09A 4Z51A 1OT3A 2GWHA 4DLXA 3I5YA 1QHSA 2IWRA 4H1VA 4ILEA 1OYYA 1TU4A 2DYKA 2QQ0A 3GLGE 3R7WB 1HTWA 2YHSA 5H8WA 2PT7A 1ZM2A 2G77B 3RWOA 5KNCA 4FWTA 3TSWA 2I1QA 4M0LA 5L3SB 1M6NA 2Q3MA 1G3UA 3QKSB 1T3LA 4AIIA 4DCTA 4DVGA 4E03A 4A8JC 1IXZA 4AURA 5GJVC 2GXSA 4KVGA 4LDJA 1GSIA 4QFMA 3Q5EA 1C4OA 1KSGA 2D74A 1R5OA 4G5GA 1E2QA 5FTJA 1Q12A 1MO6A 2IK8A 4V0NA 2AKAB 1R0YA 2GESA 3AF0A 1S2MA 1KO7A 3B82A 3GJ8A 3ZJYA 4HLCA 1OXVA 1OHHD 2V8OA 1OLOA 4IRUB 1SXJD 3BE4A 1HH4A 5FOUA 1X3SA 2BWJA 5FUYA 2J0QA 1EK0A 4M1OA 1AS3A 2G88A 4DJTA 1JR3A 1LF0A 2DCUA 3WYFA 3ZS9A 3KUDA 1WE2A 3Q9LA 4TN1A 4NONA 4ZI3A 1UKZA 4KU4A 4L8GA 5D3MA 5A5GA 4L9SA 1W47A 1YU9A 3K53A 2H16A 2OZEA 2J0VA 4KITB 4PC1A 2UZ3A 3VU9A 1MRNA 4JLNA 4IW3B 1SVMA 2OCYC 3DZDA 3D7MA 1AIPA 3ZIAD 3PEYA 3TVDA 2XITA 5JWHA 1U9IA 2ZRAA 3PIRA 5FUWA 3NVAA 3BWDD 3LVRE 1P62B 4L9WA 5DN6D 3M0EA 3FGNA 3MJHA 4D4MA 2O8DA 1ZM4A 3KFXA 2WJIA 4F38A 4TYNA 4RCZA 1NSTA 3LXXA 1FUKA 1A7JA 1U90A 4PPGA 4A6PA 2ZSFA 2ZUCA 1CR1A 1G16A 1OSNA 1VYTA 3FKSD 4L5BA 3FMIA 1XJ0A 2NTYC 3THWA 1MH1A 5KU1A 4BE7B 3LLMA 3P1JA 2WSSA 4NP6A 3EX7C 2JDIA 4D0NA 2G3YA 4LRWA 4EFMA 2PJRA 4M1YA 3QF4A 1W0JD 2KB0A 4W5HA 2QBYA 1DAKA 2YWHA 2Z4SA 1DBSA 2CHVA 1ZD8A 3THXA 1KMQA 3O8CA 1MABA 2GZAA 3ADKA 4C0HA 2B6HA 2D2EA 5C18A 4D2IA 3MWLA 3IGFA 1T5IA 4LJ9A 4DIDA 3RS0A 2ZPTX 2SHKA 2ZE5A 4LSGA 1ANKA 3EIEA 2P0EA 4FN5A 1KKMA 2QAGA 4MRRA 3W6OA 3U6BA 5JWOA 4OQXA 4N1AA 4GOKA 2ZRIA 2WBLC 3A37A 2BMEA 5DHFA 1NKSA 1N5LA 2DY1A 2H17A 3TUZC 1KK2A 1R2QA 3K0SA 2ZI6A 2VHQA 5LPNA 1SVKA 3CR8A 1G6HA 4IXNA 3U44A 1GM5A 2FGJA 4QXAA 1LY1A 4FWIB 3C4JA 4U02A 3DM9B 2QNRA 4M2LA 3NDBB 5EP3A 1G291 3K09A 3TUIC 3GJ5A 3UWKA 3KKMA 1KNXA 1G9XA 1QHIA 1T3HA 1V5WA 2YVUA 3QEJA 3SYLA 1ZIOA 2X2FA 5FOVA 1A1VA 1IN7A 3RLFA 3LA6A 3WP0A 5JRZA 1E1QA 4Z8YA 1YE8A 2J9RA 2QAJA 1C1YA 3KFVA 2F9LA 1EESA 1NG1A 4URZR 3SJZA 1UKVY 3Q5DA 1I2DA 5DI3B 4CEJB 1Z06A 4D0LB 3IQWA 2XJ4A 3KKOA 4G5QA 5E3HA 1US8A 4TMVA 2BBOA 3AP2A 3EPHA 5KHOC 1GRQA 2JLSA 3GEEA 4RD4A 3RABA 1CR0A 1G5TA 3ZIAA 5KYKA 2PEZA 1CS4C 3QF7A 4BEBA 2WM9B 4BFYA 3SEAA 3P20A 1JJVA 5TARA 2O8FB 3DO6A 4DZZA 2V6JA 2AWOA 3THYA 1OH6A 1GRRA 1Q1QA 2I1VB 2GZHA 3JVUA 2F43B 4PZZA 1II9A 4HLUC 2F1IA 4ZDIA 4XH9B 421PA 4BFWA 4OHXA 2CL7X 3MRSA 2BMJA 3T1TA 1AQUA 2WSMA 1TU3A 4UNRA 4RVCA 1GAJA 5FOXA 3TMKA 2NQ2C 2WKPA 1GILA 2QMHA 3HPQA 4G1UC 1PZNA 2H1LA 4R2HA 2J87A 2R8RA 2V7QA 1BMFA 4BZQA 3QBVA 4Q4AA 4AKEA 3UK6A 3GEHA 4JBXA 1W48A 3FFAA 2QPOA 5HKKD 3AGQA 3OHMA 2OFWA 4C0LA 4JL6A 1AQYA 2P6RA 4QHYA 3VR1A 1YZGA 4JSYA 4DB4A 3AF3A 5DSZA 4M9XA 2ZVPX 2VP5A 2PEYA 2Z0MA 4PTLA 5DHAA 2HDNB 5J4KA 1XXHB 4C7OA 1FTSA 2WIBA 1DADA 4B47A 4ZCMA 2H7VA 1W4BA 4NHOA 4YONB 2RGAA 1RRFA 1KO4A 4TMXA 1KY3A 3DOFA 1YR9A 2OILA 2VHCA 1CF4A 3A1VA 2GAOA 3BH7A 4KYIB
chains in the Genus database with same CATH superfamily
2QK4A 2VXBA 4MAMA 1SU4A 2E7ZA 5GY7A 3E6AA 4GF5A 3ZG6A 3V9PA 3K5IA 3UXEA 3UWOA 4JGGA 4IZ6A 4EI7A 5LJIA 4M0MA 5EUCA 3V9AA 4D6PA 2EFGA 1P1JA 2I4OA 2I7VA 2M1XA 2R6FA 3IBTA 1FYEA 4XEUA 4YO8A 2ATEA 1ID8A 4Q00A 3ZGNA 2BR4A 1RU3A 1MQ9A 2AH5A 3VPXA 1I01A 1XE3A 3NKFA 1L6IA 1NURA 3GZTB 4IX9A 3AV0B 1WDMA 3D6NB 5EIOA 2Q28A 4HDKA 2VP2A 1CY1A 3I4CA 3LUCA 4HN4B 4NBSA 4LOKA 4I3HA 3RTGA 1G21E 2GF2A 3MWEB 3ONNA 4YY3B 1UEJA 3CJTA 4ASUD 4LIPD 3D5TA 4B7XA 5C7LO 4EUHA 2NZYA 2C3OA 4UAJA 4X20B 3OLYA 1RRCA 1W25A 3LPDA 4B2YA 3ZCTA 1KQ3A 3U4HA 4HGRA 2RGBA 1ZUD1 3OC6A 1DWOA 5KJCA 4R8LA 4QJ3A 1N7GA 1O95C 2F48A 2HHAA 1GPKA 3RTAA 4JUFA 2XVZA 3FMVA 2FQXA 1QUEA 2VPPA 1RTKA 2R8OA 2X0RA 3CX7A 4NH4A 5JPIA 3KQPA 2IS2A 3ETHA 1NNEA 4MRMA 2SNIE 5FAXA 1RKUA 4BNYA 2SBTA 1GADO 2CMGA 1V7CA 5HQJA 1JQ5A 2XTJA 3TQTA 3B1VA 3CX4A 8LDHA 3ENVA 2JIZD 2XTAA 3UJBA 3JAKA 3WB1A 4CKZA 2BFCB 1PYGA 4JLAA 1N2GA 1YQ9A 2ID8A 2QYHA 2MR5A 5HHTA 3F9IA 2WFLA 5DSXA 2FZKA 1QDEA 2EHDA 1Y4ZA 3WGHA 4DC9A 2ZAYA 1X70A 4HAUA 3SXUB 4EDHA 1PVDA 2CZQA 3M1IA 2EOAA 3MMXA 4UZFA 1ZJ6A 3IQEA 2BGLA 2WMDA 3L3BA 1TJNA 4C7KA 4EZBA 3GAMA 5MN6A 5TV2A 2VCEA 3Q6MA 3R3HA 2DERA 1QVZA 1J8FA 4NIMA 5DM0A 3VISA 4TTIA 5HW0A 1Q44A 3RF7A 2EEZA 1YL5A 5KWJA 2VUUA 5BSMA 2GEDA 1GL3A 1O54A 3N0TA 3SHWA 4CL3A 4X54A 5AVOA 1NJ8A 5LUAA 2NYVA 4L27A 3X1ZA 3WG9A 3HYLA 1U28A 2IX9A 2PZMA 5FFNA 3OLZA 4EB3A 1W36D 4RW0A 1D0IA 1P1BA 1ELOA 3NGLA 4IWXA 1ZCJA 3KKPA 3MGKA 3ORRA 4I0WB 4XARA 4OF4A 1VHDA 2BTOA 3BSFA 4G0UA 1D1QA 4WEQA 3GMDA 2MSKA 1XGKA 2E6UX 3AEUA 5AVUA 1N78A 4Q1CA 1QTQA 3R7FA 1Q74A 4JQYA 1MJGM 1XTJA 4PYRA 5LZ2A 2EG5A 3U7FB 5KQGA 4WMLA 4HWGA 1ITZA 4NARA 2NTNA 3HCWA 1EHIA 3T15A 3VPFA 3WLPA 4AM8A 2G70A 4QPPA 3I0MA 2R66A 2AOUB 4ZYZA 1E2DA 4OSOA 5ALTA 1BSVA 4RK1A 2X22A 2IXDA 1F6DA 4QUDA 4NMWA 3QKIA 5BXYA 3FHCB 5BSRA 3IPYA 4U5XA 2BD0A 1E2JA 1GLVA 5JSKA 1FFCA 3AILA 3HYCA 4LSZA 1VI2A 1GNRA 1F6BA 2ZSUA 4I5FA 4OMDA 2F17A 3SE0A 4IIVA 4LHYA 4Y2JA 2FR8C 1YKGA 1F8UA 3D0RA 4IRXA 5AHXA 3AUUA 2O8DB 2WUGA 5BPFA 3FVTA 1Z13A 3EAGA 4O4LF 2UKDA 1ZXBA 3GOHA 4MB2A 1ZAYA 4YMGA 1V8BA 1C1XA 3CNNA 4N82A 3RRYA 3TLGB 2RH4A 5DHUA 4C4AA 3EIWA 3H18A 1PS8A 3DDCA 3HFSA 4EG7A 5ALUA 1PTJC 1VHJA 4IEFB 3REOA 4UM9B 5KTRA 5B30A 3AG5A 1JDNA 1BE0A 4NYJR 3A06A 2ID9A 1YRYE 3FOCA 1VZ3A 3H75A 5CVEA 4C4PA 3UCEA 1KI2A 3WHLA 1ZNQO 4Y9UA 3RYFA 4KO3S 1N9ZA 5K51A 2I2FA 3IAUA 4XX1A 5ESDA 3SZOA 2JGAA 3SKXA 3B53X 3GYGA 3KU1A 5GGXA 3UJ6A 3LQRA 5HCIA 4BLWA 2BFWA 1R8XA 3OWXA 3P0FA 1FFAA 2VJNA 3PQ8A 5JHHB 4IG9A 3DEIA 3CNLA 4DPKA 1YE5A 2XYQA 2NUTA 1IK6A 1CYDA 2O0KA 1Y4AE 1KS2A 2QPAA 3JYLA 5ULLA 4DLAA 5JISA 1TO2E 4AF7A 4Q5IA 3F4KA 4ZICA 3L6BA 2QN3A 3PJFA 4FHZA 5H70A 4MUXA 3VR6A 2EWMA 4D9HA 4E31A 4QHTA 1GGFA 3D1JA 5ELLA 4FS8A 3PL1A 1XF9A 1STOA 1IFXA 1P4HA 1XZCA 2X77A 3BRWA 3K0CC 4CCWA 2OWDA 4X45A 1RZRD 3EWSA 3HA5A 5HKLA 3V8BA 2JIMA 4XVQA 3PE3A 1L7OA 1RWOA 3AERB 4G0WA 3D3EA 7GPBA 1BVRA 1RJGA 1F0NA 4PQRA 4E30A 1IVSA 2JHAA 1ETHA 1MW9X 1Y33E 2NXWA 2Q1TA 3T06B 3ZLBA 4JL8A 1K4KA 1AD2A 1OGJA 5IUJC 2ZFUA 4JBGA 1RBZA 1OH5A 4RPIA 1N75A 4YACA 1X1TA 2VSFA 3P9SA 4MDFA 5AUPB 2ORVA 3KL2A 1WUJS 3ZDYB 1M34B 2G0NA 3I2KA 2QTWB 3ICCA 1B23P 1VL6A 2OC4A 4ZOLB 3SK0A 1ULZA 2IZZA 1YQXA 4Z0NA 3QX3A 1Z5PA 3KHUA 3Q0EA 2DWPA 3F9CA 5E3JA 3IJRA 4P82A 1AQNA 1QLJA 1ULTA 4AKGA 4KQXA 3BQMB 2BUAA 4NC9A 4YAFA 2GB4A 1TZJA 2Q29A 4MV5A 3I8OA 2DR0A 4MW5A 3OE1A 4GBMA 4Z7NB 3KSAC 3SBOA 4KRGA 2HT6A 1Y89A 1B8PA 1O2DA 2DJ5A 4XD7D 3ZH9B 5CVDA 3SX0A 2A3NA 3NTRA 5CA0B 4ND4A 3H99A 2LDBA 3VFDA 3OZSA 2VUTA 5LM3A 5A4KA 1VE1A 1W19A 2VJBA 3DC7A 4ZVLA 3P9PA 1NX9A 2WKQA 2NPFA 4Y7CA 1VKOA 4X66B 1U1GA 3I39X 1E4YA 4ENRA 5BVGB 3QVGB 3RTCA 1CRPA 4A9AA 2JEYA 2QM7A 2X13A 2ZROA 3HO1A 1X38A 1I1NA 3CE6A 3R8FA 1NBHA 1YULA 5KNBD 3T5GA 4K0KB 4BU0A 4GBJA 3CUWA 1PUJA 1M33A 1XJWA 4Y2PA 5DULA 5EPOA 4BMCA 1TEVA 3TR5A 1EEHA 4FGLA 1JKJB 4CMJA 3HGMA 4R0NA 1YS9A 2Q0QA 3AFNA 4ZRNA 2OCPA 3FFWA 4Q1BA 1XTKA 4U7FA 3PFGA 1FXSA 1UBOS 3ZGVA 2ZE7A 4LF7B 2NLOA 2D1YA 5BQOA 2BW0A 1Q0PA 2VJCA 5L8VA 2O1XA 4NFLA 4NULA 5EA2A 1FB5A 4Q15A 1ECCA 4YJ3F 5AW1A 4Q24A 3VR2D 3JX9A 3S7ZA 4BLVA 4BL5A 4ZJUA 3JQDA 3B8HA 3FNHA 2WDZA 2VSQA 5C0OE 4J0JA 3GPLA 4MULA 1M72A 2LXNA 2OD9A 3NV7A 4K87A 4CF7A 1T5HX 3L0IB 2W93A 3L82B 1XQ1A 3A4TA 1YJXA 3WB2A 2DOKA 2W4IA 4TXNA 1PBNA 2A33A 4G4JA 1G0NA 3E0QA 1FRZA 2A3RA 3HB4X 4JGIA 2I3DA 4RWEA 5FNVF 3V1LA 5IK2D 1CU1A 4CEJA 3I5AA 1L6RA 5DWVA 4EJ0A 1RM3A 3FPLA 3IV9A 4FKMA 2WUEA 3O26A 3KB2A 1QYDA 4MS1B 5KYGA 1HF3A 2WJHA 4DS3A 1TCUA 3CF6R 4X1IA 4D57A 3I1JA 4C0WA 1SGWA 2A14A 1C0IA 3UMSA 3PR1A 3RC9A 3K0BA 4UDYX 3BX1A 1HORA 2LE0A 1I4DD 3G89A 5BQPA 3IDQA 3RM3A 5JAIA 3C8HA 3E9DA 3N7TA 4IIGA 4YNBA 1XA0A 4BTLA 1U0BB 1M6YA 4IX1A 4ACAA 1OFHA 4EA8A 3CLKA 2X1VA 4LF4B 5FYQA 3DAFA 2J3DA 2RAFA 4LZLA 2OGZA 1MZVA 4D9CA 5A2GA 1GSHA 1QAQA 2A5YB 2WC1A 4RPHA 5AJZA 3H0EA 2N42A 4IDPA 2TMDA 2ZUUA 1W34A 2CNWD 2WTEA 3H9EO 4DCGA 1L4KA 2ZT8A 3I3SR 4Z9BA 3SG0A 1N33B 4EEXA 4TSKA 4QAJA 4OAOA 1K6XA 4XW2A 5JSFA 3TR0A 1E2NA 2BH9A 2IPLA 1XA4A 5EGNA 3VAAA 4Q4CA 1E98A 2IKQA 1J70A 3R3WA 1ZX1A 2R47A 1ZKMA 1MQSA 3EGEA 1EBFA 1LRLA 3NHZA 2TMYA 4KO4S 4RFVA 4AY4A 1LI4A 3BCSA 3MJRA 2JCBA 3B89A 3GCGA 3O5AA 2C5GA 4HDKB 4R2JA 5WRFA 2IYOA 1J8QA 3QPWA 1XP8A 1BCSA 2R00A 2PKWA 3H9CA 2OD2A 4H7HA 4II7A 1X9HA 1YZLA 2WIAA 4F9EA 2EJWA 3EEYA 5CM2Z 4EKYA 2UU9B 1UP6A 3V4ZA 1XTTA 2WTAA 1FK8A 2DUWA 1QONA 2IYVA 2O57A 4Z9FA 2WINI 2XE8A 2Y0DA 4R8SA 1GXSB 3MMZA 1HZZC 1XXHA 3NVMB 4FBLA 1HQCA 2PVCA 4L78A 3ZWKA 4BX9A 1E3WA 1PU2A 4EO4A 4ETWA 3L05A 4QXOA 1AHHA 1SHLA 1YBHA 3BF7A 1WMDA 3DDZX 3NR2A 2OGSA 4GZ5A 3VDNB 2QU7A 1LUAA 2VWPA 2Y71A 3DO8A 1FP1D 1OFUA 3USES 3PTLA 1P7VA 1D2HA 2ZP1A 4TSRA 3ZPXA 1KARA 1A9XA 1YCHA 2P40A 3GQBA 2Q4OA 4KMRA 4OGKA 3MCAA 1M7BA 1L4LA 1EMDA 3E58A 3P9KA 1UMBB 3UICA 4C7XA 2XZLA 1G0OA 2TS1A 4K2AA 1H3FA 1MGOA 3K1ZA 3EE6A 1E5QA 1THGA 2X4LA 4BBAA 5LUBA 2EYQA 1MT0A 4RTQA 4TWIA 3OVMA 5T5QA 4AMBA 2FQQA 3QWAA 3Q85A 3PUZA 3O8NA 4HJRA 1OVMA 3TWOA 1WD7A 1KO5A 4DWJA 1SOVA 3QXGA 2IPXA 1SHKA 5LP6C 3FA2A 4JVNA 4PQFA 1SCNE 3N2NA 2H1IA 3B1ZA 3RUAA 1UBEA 2B69A 2YQ4A 3Q3GE 4Y2HA 4ZA2A 5G02A 4KXMA 4PYOA 4TRRA 3M4NA 1U9IC 1WU7A 2WW8A 2PA3A 2OBFA 4C20A 4EKIA 4U2DA 3GFOA 3DT9A 3JASA 4I8XA 4NPHA 3EMBA 2X7JA 4MS4A 1I10A 3WQHA 4TT3D 4Z3KA 1G8KA 1NQOA 4HDCA 1A96A 1Z37A 2C9OA 5F2EA 2H0RA 4FDLA 5AW6A 4R8VA 1T9ZA 3VUFA 4DJ5X 4OY3A 3P45A 1JU9A 2WVJA 2HMSA 4LX0A 2HNAA 1C1DA 4J0GA 2P35A 1Z6AA 1S2GA 2Q0SA 5ALDA 4MYHA 2X9QA 1N8SA 3HYTA 3U39A 1CR4A 3BIJA 2VZ9A 2NO1A 3ELWA 1C8LA 3B1WA 4QNMA 1CDEA 1X8XA 2J3QA 4YBRA 1QK5A 3UMGA 4D8UA 3AEZA 4E6EA 4JENA 2ZJOA 4CIBA 2HJHA 1RDFA 2X5JO 3ONFA 5ER6A 1U0JA 1U81A 3I12A 3FYHA 3RSQA 4EY5A 3GLHA 5F2OA 4FONA 5K8LA 2CLEB 4OPMA 1G8YA 3UH0A 1FQWA 4YYZA 3DVAB 4KIJA 5AQEA 2X8LA 2X3YA 3HCAA 1EFHA 1AN0A 3E7PA 4BWFB 3QUSA 4HMOA 4MS3A 1DHRA 1VYVA 4EHLA 4EG5A 1DFIA 4FGZA 3PEEA 5GZ1A 4LOHA 2GYVA 5IJ0B 2BGMA 4AK9A 5CPBA 1B42A 2ORWA 3EVTA 4PZEA 3D6JA 2CT8A 1VA5A 2IHTA 1J22A 2WFAA 4S2UA 3QE3A 1Z4OA 3ZD6A 3VNUA 2R9VA 3G0IA 3W7VA 1XCGB 2OSVA 1W9HA 4NJMA 5JS7A 2LUOA 3BN3A 1ORIA 1WQ3A 3ZU4A 1LDMA 1HV8A 4RL6A 2QAGC 4ZVNA 3KQNA 3EXEA 3H1EA 3PRKE 1PNOA 3WI7A 3WK8A 2YRFA 3ICVA 1V41E 2CLCX 4YXWA 1XZDA 4MV3A 4N5HX 3EDMA 2Q5CA 1Z2NX 3G7UA 3N2YA 4PPYA 5CFOA 2ZGVA 1C7EA 4OOEA 4AMUA 3AEQB 1KC1A 3NBXX 4R3NA 1GM5A 3RSZA 4DMUB 3NYRA 1QH9A 2B6NA 2PZ8A 3B70A 1BGVA 4YT4A 3K9HA 1Z34A 2FW1A 3PQFA 4LYHA 3LY5A 3SS8A 1CXZA 1ZM3A 4HY3A 5DHRA 1QV6A 2XXBA 4YMWA 4S2EA 3M7IA 3FPJA 3BYZA 1HLGA 4GPD1 4B6SA 3NC0C 1P75A 2PVSA 4KG7A 821PA 1LVGA 4XQ9A 2XODA 1KP9A 2G9ZA 3UUEA 3PFKA 3BORA 5LBUA 2YMMA 3RKSA 1KGDA 5DVZA 4ZTZB 4KUHA 2F8LA 4L2IB 4IJQA 4M99A 4ZO6A 1XNJA 4EMBA 3RSGA 4EIWA 5AVVA 4DQXA 3Q7PA 4RESA 1BA3A 1YVDA 2CVPA 5ENZA 1XV5A 5B1SA 4BWVA 5KWVA 4L0DA 4R2WA 4C21A 2A1IA 2GZMA 4P7JA 4OHWA 4YAJA 4MHTA 1VBFA 1EB9A 1O4WA 3PUJA 2C61A 1ZU5A 2V6FA 2RBGA 5HVNA 3CURA 1WMBA 1HE2A 2X8BA 2Y27A 3CLHA 3PNMA 4OA5A 4Z99A 2K2WA 3T5PA 2P0YA 1E0JA 1PR3A 2Z1DA 4BFZA 5BW5A 1LLQA 2FLVA 4N03A 3U3MA 1GG5A 1ZK1A 4YAIA 5K8TA 3R4CA 2P1ZA 1ESDA 1D0VA 1S4MA 2PXCA 2ZE6A 4EW1A 1SIOA 5IZ4A 3D7NA 2XBLA 2XGOA 4PRYA 1JQEA 3WFJA 5CA1F 1E59A 1NQ5A 4DUZB 4ZV9A 5BQ5A 4JI0B 2H5IA 3IFSA 4IDAA 3H6GA 3RKRA 1NW8A 5IMBA 2X7XA 2AS0A 4IXWA 1VLJA 1E1RD 2ZDQA 2V3WA 3Q15C 4OM8A 2BSQA 2IHVA 3PEFA 4JUIA 1RPZA 3JQ9C 5K0LA 4POOA 4S1OA 2GBGA 4AF6A 1J8MF 3VVCA 1T0HB 5G0TA 1V47A 3RF6A 4BBZA 3ZQUA 1IN6A 5KQPA 4AJ2A 1IZYA 4OYYA 1TMKA 1RAHA 2EP7A 1D1TA 3FMPB 2C4UA 4LA4A 2CY0A 1Z0JA 1AQ6A 3N7UA 3K4HA 4DA8A 2L42A 5LMNB 1P5FA 2QRZA 2FUG6 4ZTBA 5JBIA 5KDDA 1L5YA 2WK1A 4E2WA 1OPRA 2Z57A 4M1SA 1QQ7A 3NIGB 2JNWA 3A28A 5HE8A 4PX5A 4QXQA 5AVWA 2CMDA 2AG0A 1AB5A 4F9FA 4L5CA 1T2UA 3K94A 3WRYC 5B6JA 3QWIA 4JEIA 1Y6GA 1K8XB 4I6EA 4P80A 1GPWB 4LNUB 3ILSA 1E6MA 1VL5A 4NU0A 1VE5A 2JPDA 4HBGA 4YASA 1KJWA 1F8YA 2GM9A 4KQ1A 4R1SA 3UC9A 5ADWA 1SWVA 4WZAA 4DR6B 2P9HA 2V1UA 3EWAA 2EFCB 2XA9A 3NVDA 1SVIA 1ST2A 2AFHE 5A1JA 2DY0A 1YF3A 2ODAA 2VATA 4GYJA 4X94A 3RKUA 2I66A 3GUUA 2V6GA 2AR0A 2JD1A 2VI5A 4HH3C 4Q3LA 3WICA 4GWLA 3QTBA 1T0BA 5IAAA 1Y34E 4RQAA 3UQYS 3AUFA 5EIXA 1Y7IA 1PG5A 3FE2A 1OHHA 2ABWA 3EXHA 1HE8B 3JQAA 1SUPA 3KPWA 4BZXA 2B7CA 2A78A 4V0ME 2MINA 4IVNA 2HU2A 3EOBI 3OX1A 2C5AA 4PY2A 4AT1A 1CEQA 3T7KA 1SKQA 3TTYA 3BMQB 1M1UA 4WNYA 1KAMA 1B3RA 2BH2A 1IY1A 3L07A 4OI1A 3QEBZ 3TW4A 3DAOA 4MGKR 2AN4A 2XJ9A 4LZPA 1BU8A 2BGTA 1KJ9A 1U5AA 1PNVA 4RS4A 2AWNA 1NBAA 1T4DA 2RIPA 3ET5A 1DL5A 1R4NA 4MLCA 4N3AA 4TRJA 4PLGA 4AX8A 2PX8A 2R8XA 5KJFA 1VTKA 1Q0TA 1E4VA 4EK9A 1ZH8A 3L93A 3PQCA 4KYTA 4EHJA 4ZYTA 5K0JA 5J3JA 4XJTA 1UKBA 1TDJA 3COYA 3JSAA 3T9EA 1MTZA 1RI5A 3DBOB 1PT7A 4RVUA 2HV9A 1XNHA 3U3OA 3G0HA 1MIOA 1ECFA 2PPLA 1A69A 3KVVA 2OWEA 3BULA 5IS2A 4GIBA 1V1RA 4HH0A 2PRJA 4S1TA 3RTBA 3AF5A 3S29A 5FQOA 4F4IA 2JLZA 3DP9A 1JQAA 4RVOA 1T4CB 3AM1A 1RI3A 3TW8A 1DX4A 2H4FA 4WLFA 4YRCA 2C3UA 2RK3A 4MCHA 3EZFA 3FM9A 4R7GA 3U60B 3HK2A 4IJWA 2C5SA 2V6BA 1D07A 2ECFA 1JHDA 1R0RE 3HCPA 3TQSA 3VI4B 3SU8A 2F9FA 1VKHA 2FEOA 3QI2A 1EFUA 2B5VA 4YT2A 1NKTA 1BCSB 1K75A 3MJCA 3B1FA 4XVRA 4N12A 4Q7EA 4EYKA 4UHKA 1PWZA 3AVPA 4JJEA 3ITKA 4RMJA 5I7FA 5CEJA 2HA2A 3HJNA 3OH8A 4DLUA 4AXBA 3OZWA 5THQA 2C8JA 5JJKA 3QITA 3GZNA 4HG2A 5KREA 1E79D 4R2MA 4X6LA 2ZBPA 3TNFA 1T8RA 2E4ZA 4HV4A 2QW1A 1HFKA 2GUWA 1R7RA 1AF7A 1Z6TA 4QUBA 3T5BA 4BQSA 3M6FA 1B43A 1KBOA 2PD6A 2A9RA 2IKSA 4BMPB 6GPBA 1UWKA 4FILA 2GOYA 1IN5A 3T1QA 4NZZA 4DJDC 4CN9A 1W94A 3UMBA 4HWSA 1KMIY 2NM0A 4JJFA 3FIJA 4QGAA 2TMKA 3SQOA 4IKOA 4RZHA 5B1HA 1G20E 3I5UA 4ZOBA 1KWGA 2O54A 3L1IA 1DZ3A 5AJVB 1QE3A 3FNGA 1LXCA 1N2ZA 3QI7A 1ADCA 2Q3EA 3KSDO 2OB2A 2X0FA 3MT8A 2WA2A 1EX6A 1OR8A 5ES3A 4TZ0A 2HCTA 1RVV1 5JSHA 2WWIA 2KYRA 3K0KA 4QULA 3SYRA 4KRFA 3NJ4A 5KTSA 3W9YA 2I4NA 4U9HS 4WDQA 5JY6A 4NS1A 4FSHA 5K6AC 3JZIA 3S55A 3RBAA 2RCNA 1OA1A 2C4TA 4MW9A 2K4MA 5JHGB 1VJCA 3G8CA 5B64A 3ELBA 4LVNA 3LMKA 4IGKA 4RY0A 4L57A 1CQZA 4JCOA 1ZVVA 1FFBA 1XTSA 3HWWA 3MMNA 3P32A 5T7BA 4MS4B 4DF3A 1ZBQA 1M8PA 2HA0A 1HUQA 3ZWDA 2NVUA 4UQLA 3Q3CA 2FAXA 1IPFA 1V7ZA 3ZV4A 2R1VA 4CMEC 2XQVA 3R0JA 4EHIA 3BK7A 3AZOA 1RWMA 3R7BA 1EFPA 2YFQA 3V7FA 1U8ZA 4JYZA 3L6OO 4L95C 2PT5A 3OMXA 1TM2A 1C7FA 1QGZA 2G5TA 2XLBA 3L8ZA 2KS6A 4TZKA 5CTAA 1Q84A 3WWYA 3FMFA 4OGWA 3MTIA 1GGMA 3ISVA 4FCTA 4QGGA 4TN5A 1KOFA 4A73A 1Z4MA 2YWBA 3O2SB 4GC9A 4TX1A 4ZVPA 1Y63A 4ZQIA 4Q4JA 3GLHB 1O8CA 2F3RA 1Z4JA 4KQMA 4TWRA 3B6JA 1ZIDA 1BOFA 3P0IA 5IAEA 2F3TA 4HBZA 4KR3A 2BJWA 1HDXA 1Z07A 2PXHA 4MV6A 2NO0A 2OFOA 4S1PA 5ER9A 4BFUA 4NMLA 1EUCA 2GEKA 2Z9CA 5KB3A 2ZQYA 2QGNA 4BASA 4TV8A 3TRIA 4CM7A 1RKVA 1YT5A 1T35A 4TYMA 1V5IA 3PIIA 2IOYA 2RG1A 5I5GA 4J0IA 4KOEC 4WKNA 3ZTYA 3U4AA 4OLJA 2C04A 4PNHA 4B4OA 5LL6P 3R9XA 3VPAA 4X7MA 4TS3A 2Z4RA 1SKYB 2XB9A 1YIDA 3EXEB 5DGCA 3M34A 1VGVA 2Y4NA 3C1OA 4KSYA 1O94A 1W87A 3ESXA 5JZMA 3SLGA 5HKKA 3CHYA 2QZPA 2WVGA 3F71A 1J8YF 1DP4A 2PMBA 1NZDA 1P1KA 1PLJA 3H4IA 3QPAA 5JMWA 4PN3A 1W5EA 2EYUA 3FWYA 4JJAA 4YHBA 3B7PA 1U0FA 3BGSA 1RWBA 5CJ2A 2XDWA 1ORHA 3QYPA 1NXVA 2JVJA 3LBIA 5AKGA 3GRKA 4EMUA 4ZK2A 4W6QA 1GAXA 3MTAA 4BAUA 1VKNA 1ODJA 1E0AA 1V43A 4YJKA 3KCNA 3OUUA 4V3BA 1RD4A 4OP1A 5KCMA 4DSAA 5AW7A 2NP6A 1EXMA 2AA3A 2X9LA 2OUIA 4MV0A 4WZBA 2HQRA 4RIEA 1C2YA 3NTUA 4IUYA 4MK4A 4RZUA 5JQGB 4D9MA 4HDMA 1LTQA 2BI4A 2ADFA 1TJ3A 3ZQJA 4F3RA 3HJGA 3UJDA 1AM4D 2CHGA 3A4IA 1FX0A 2ZIUB 3MGGA 4MQLA 2AOTA 3TEFA 1UBMS 3A1TA 2IZ1A 1SPBS 4F91B 1K9VF 5DLYA 2VJDA 1KI6A 3H2IA 2OHFA 5DPMA 1YFLA 1MB9A 2EZ4A 3FETA 4GI7A 4WY5A 3MD9A 3S40A 3JAMA 4FD3A 3NBQA 4HWTA 3QRWA 1CPYA 2VR1A 5EEHA 3L77A 1XDGA 3EVAA 3RTEA 3WTBA 4BO3A 4F12A 3RRFA 4MWGA 1NXWA 3IV6A 1G2IA 3BXGA 2DBVO 4P4SA 4Q03A 4BN4A 2IUTA 4YRNA 3V4LA 2H2AA 4EGFA 1L4MA 1PHPA 4LGYA 1IUKA 1V48A 1PKEA 2XRZA 3PWTA 2PKCA 3VR5A 1P29A 4EKEA 1U2GA 3ZEAA 2Q46A 3IHWA 1UQTA 1ZKDA 1Q1BA 2CYCA 1QRAA 4MUHA 1GQOA 1LW7A 4AJHA 2BZSA 5G53C 2FDCA 3S27A 4ALJA 3MK31 2EJTA 2Q0XA 2PGLA 1C8BA 2OVFA 3ENZA 1P7PA 1XEWY 3CZPA 3OIGA 2XWQA 1AU9A 3G0CA 1XTBA 2GKOA 3FDXA 1WZNA 1KY4A 2ZIEA 3FTFA 3DNFA 4C78A 2DBZA 4PAMA 1MOQA 4UFPA 3ZDEA 4DSNA 4KQFA 4XRRA 4CBVA 3HCBA 3R8XA 4AYWA 1RAAA 1WHSB 2ZIXB 3AM5A 1E3LA 4P3OA 3QG1A 4WLEA 4A8HA 3G79A 1AOXA 4UHJA 1K27A 3RU2A 4JLWA 2JANA 1YSCA 4Q1VA 2IDKA 3CRMA 2VG8A 3BMCA 2UYQA 4B6GA 4LISA 4X92A 1VPTA 1JQLB 4B7AA 2Y9MB 3DMTC 5K8JB 2GHTA 3OPNA 4KAJA 4LCBA 1CFJA 2QJRA 4QBHA 3RD5A 2ZR7A 3VHXB 3E0XA 4B2LA 1ZLXA 5IP5A 1OREA 4LMAA 2PU7A 3IVXA 4EA7A 4N39A 3IMFA 2VSOA 4B8WA 4F86A 5KWSA 4G5SA 1Y6RA 3CXUA 4Z1MA 3W0LB 4LI3X 3OQ6A 2DP4E 2B4QA 2DQYA 2ID7A 3L7LA 4JLOA 3ZXYA 2PX2A 4BCCA 5K0SA 3NC1C 2JS7A 3C6MA 2IS6A 2KMLA 4BV2A 1VCNA 1DUSA 3QE0A 5FTKA 1G5HA 2IHUA 2VK2A 2RKOA 4JC5A 2JHGA 3P94A 3BK2A 1P7CA 1U11A 2XI4A 3NWPA 1JFVA 1P3JA 3IAM1 1H0HA 2JLUA 3I28A 3GDFA 3N5CA 3ODGA 2C99A 2IF2A 2ZATA 1NXQA 2N47A 1ZI8A 2ZTHA 3HCDA 3QVXA 4NRDA 4Q05A 4S1WA 5A4DA 4YV1A 2DC1A 2Q3DA 3SX4A 4ZC1A 4HGYA 3N3BC 4WD3A 3INYA 1X7ZA 4IUBS 4BQOA 1QCCA 1SU6A 2ZQZA 5DM70 3JQ6A 2NTJA 4TTPA 2ZXEA 2F7SA 4KQCA 1V7QA 3FPCA 3P2OA 3RIGA 5FBKA 3L1UA 2WD7A 4ECAA 2LRHA 4FDMA 3H8WA 4B6OA 2B7BA 1FJ2A 1YJAA 1XAIA 3EG5A 1QF7A 1Z83A 1OB2A 3WWEA 1VBNA 5F12A 1UMDA 1GKLA 4R7TA 1S3SA 4KPEC 1D6NA 4GRIA 1K2WA 2B21A 4I08A 1SC6A 1JJIA 3OF3A 3WGKA 4JCCA 3U4QB 2DH5A 4M7WA 1UK7A 3VUEA 5IAGA 1UBCA 3R5KA 1V1RB 4PPFA 2BHTA 1KYQA 3N39C 3FNRA 1QV7A 2QD5A 3FCXA 3NIDB 4CFZA 3BJEA 3M5DA 2FZVA 2ZAIA 3WYGA 1WW2A 4RXUA 5FOTA 2YUIA 3A3NA 4OI0A 2C9MA 1JG2A 3F7OA 2JH8A 2QXUA 3ME5A 1SRRA 4DLNA 1CJVC 1P3Y1 2XOKA 2WFMA 3G3EA 3UT5B 1JI3A 3WQQA 1FXUA 2PKRA 4ZVOA 2YJ5A 1E62A 4E3WA 5K0BA 2JCVA 4EY3A 1OIWA 2ROQA 1BW9A 2GH1A 2VUSA 4UE3S 3SDZA 3W2TA 5LQCA 3ZTTA 4FT2A 2O8VA 3QKTA 5AP9A 3EOAI 1J49A 1M73E 2ZEJA 3WNDA 3NBZC 5L53A 1EWYA 3T5DA 1D7OA 4RSRA 2Y68A 4G4SP 3ZGZA 2WSBA 4RELA 3KUXA 1Q7EA 1XF1A 1S6YA 1ABFA 1Y5NA 4MVJH 5U4XA 1N3YA 1NYRA 2ZJAA 3VQTA 1IK4A 2Q2NA 1ZSYA 1GA4A 3ZXXA 2M98A 2P91A 2X41A 1P74A 3ED5A 3KNZA 2UVPA 1GP2A 2NVWA 1SOUA 3AB3A 4NCIA 4PZLA 5G40A 1EYZA 2V54A 4AMZA 5A4MS 721PA 2ZZMA 3NOVA 3O82A 3LY9A 4ZEMA 2ILTA 4UBMA 3RBZA 2I4IA 2W6MA 3O9VA 3WQRA 3MCVA 2FJUA 4WJZA 3GH3A 3G2KA 4IF4A 1NSYA 3E15A 3RS2A 5IAOA 1G6Q1 2H1HA 3E53A 4ND3A 3X2EA 2CLFB 2C83A 2ZB4A 1IPHA 3K5WA 2JH3A 2EBFX 3V2IA 3SVLA 3AHJA 3T3EA 3QKWA 4FXPA 1SVNA 3RQSA 4ENUA 1GSOA 1I9GA 1W581 2J33A 1NBWB 4O02B 4TT8A 3QKRA 3WLEA 4AS1A 4II3A 3EN0A 4CM4B 2JCSA 1GFZA 2CMKA 2RB4A 1ONPA 2UUOA 2WNIA 2WYOA 5CH3A 5DMHA 5EXTA 4D3DA 4D9JA 2ODQA 3HDTA 4BZZA 1OXUA 4GLLA 1T8WA 2QHXA 3RT7A 3FYCA 4YYEA 4CCYA 3R76A 3G2IA 2HBQA 4UOZA 2HR1A 4QBGB 5JS1A 3OU2A 2CJXA 2BTQA 2HRZA 1WV1A 2BBSA 3J80A 4QBIA 3FNFA 3P26A 2XD9A 5KNCD 1DTWB 1ORWA 2ZIVB 3P2KA 3RAFC 1XNQB 1EWQA 4ZO4A 1P45A 5LBTA 4RDXA 1OAOC 2HJ9A 4Z7OB 3IEMA 4MUAA 3DQPA 1GAQA 2EP5A 4EG8A 1C3LA 1FFXA 2BFDB 3BE5A 1OT5A 2NVUB 2NU8A 1KYTA 2I6TA 3AOEA 4BJ3A 1EK2A 1E6EA 5IBRA 4J8PA 2R6HA 2CNKA 3AF1A 5JUWA 5ALXA 1A72A 1Z5VA 3F5MA 4Q6BA 4WSOA 5CVCA 4ZU3A 2UXBB 1KXJA 2CJWB 1RJ9B 5BUZA 4CDRA 1K7YA 3A25A 4WXHA 2KM1A 4UDXX 1XMJA 3B9PA 4N41A 1GZ3A 1HT1E 1K6IA 1RCTE 3EHDA 4BO8A 3H9BA 1ZNYA 2XMRA 1QGUA 3LCMA 3ZD9A 4PAOA 1QRTA 4R9VA 4MYSA 5DW0A 4CT0A 4DHEA 4JUBA 2PZAA 4JWKA 3WY9A 3CG0A 4BO5A 1B0PA 3ZW8A 1XCMA 2Q99A 1I2MA 2FUCA 3IDZA 3L4BC 2H06A 3SQDA 1EDDA 2O3RA 1RFLA 2QRGA 2CF6A 4HNQA 4YDQA 1XZFA 4JMPA 3KZNA 2QGFA 4XRGA 3PF8A 6YASA 4RLSA 1G5IA 4P98A 5ECDA 4ZU1X 2OHOA 3S2EA 4C4RA 1SCUB 4D0GA 4AP6A 4CQNA 4XIGS 1RWPA 2AOXA 3MCZA 4P1ZA 4EVIA 2OB1A 2AXPA 4RH0A 1H5NA 1ZNWA 2DM6A 2FVYA 2PL1A 1Z74A 5EIBC 5BQFA 4G67A 4EFLA 2O7VA 5H4HA 5J5AA 1KDRA 4CHGA 1LBQA 1WZCA 4ZJZA 2ZUEA 2JB9A 4QICA 4L0MA 1HFEL 2X4IA 2GO1A 1WMAA 1HQYE 5AW3A 1TQHA 1A7KA 3GLIE 1NOJA 4ITRC 3RVDA 2YY6A 3FLEA 3BERA 4Q1EA 5TC4A 2JLVA 4JSTA 4E22A 3O84A 4QU9A 1MO4A 2Q1SA 1KAOA 4OV6B 4W8GA 3N2GA 4ZAZA 4D8YA 1A27A 3TBKA 2C1EA 1W88B 2M1ZA 4UM9D 5BWOA 4UHBA 2C92A 5BSEA 4CKCB 1TCCA 4G0QA 4K86A 4R69A 2OFPA 4UUNA 3TMYA 4RANA 3OF5A 1XJ5A 3ZZUA 3D7RA 2MU1A 2Q3FA 1SQ6A 4WAUA 1G98A 1Y1PA 1FUUA 2ENWA 1O9GA 2JI9A 3H1PA 4IIDA 2CXPA 4WZBB 3VYVA 2EJUA 5F2KA 2P9JA 2H1CA 4IHJA 2J3KA 1S2OA 3TKAA 2P6PA 4L51A 4M1TA 2DFLA 1FX0B 3ANSA 5ICFA 4MVYA 2P4SA 2BRUA 3AJDA 3GRAA 1AJEA 1L9KA 1OY1A 1P6XA 4L9RA 1K4MA 4XX0A 3H8SA 2PWPA 5FBWB 4EH1A 2PUGA 4CEIA 4WOPA 5L3RA 2VT3A 1KIMA 5IW8A 2V1XA 2IWHA 2ORYA 1FFEA 3QELA 2VXCA 3O38A 2R8BA 4OBEA 1XTIA 4BRSA 4BYMA 3LD9A 1FLDA 1LFAA 2NVBA 4D46A 1RIFA 1XMXA 1H3NA 1HSOA 4EW3A 3M6WA 1UIRA 3U9TA 3C3JA 3HO6A 4MV7A 1PI3A 5AM1A 3OCXA 4CZ2A 3GJ0A 3O4GA 2IV3A 3DV0B 1ESEA 9LDTA 2BI8A 3FHLA 1CUBA 4LZZA 2X14A 3KSZO 3WMRA 5JROA 1K7EB 3H2SA 4GOND 5BT8A 4RVSA 1TRHA 3HXKA 3VR4A 4C0BA 2C5EA 4ZMBA 3DOEA 2C31A 4H31A 1KFKB 1BS9A 4OHVA 4V24A 2YWFA 3EC1A 3VPHA 4CUZA 3O4VA 3RYCA 2FSVC 3ZR4B 4C87A 1MXHA 1JU4A 5AI5A 1XLTA 2ZSJA 4JVMA 3QFRA 2AUTA 5EVCA 4ENSA 3F90A 1XRQA 1V6SA 3W8NA