1IONA

The septum site-determining protein mind complexed with mg-adp from pyrococcus horikoshii ot3
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
243
structure length
243
Chain Sequence
MTRIISIVSGKGGTGKTTVTANLSVALGEMGRKVLAVDGDLTMANLSLVLGVDDVNITLHDVLAGDAKLEDAIYMTQFENVYILPGAVDWEHVIKADPRKLPEVIKSLKGKYDFILIDCPAGLQLRAMSAMLSGEEAILVTNPEISCLTDTMKVGMVLKKAGLAILGFILNRYGRSERDIPPEAAQDVMDVPLLAVIPEDPVIREGTLEGIPAVKYKPESKGAQAFIKLAEEVDKLAGIKAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE CELL DIVISION INHIBITOR MIND
publication title The three-dimensional structure of septum site-determining protein MinD from Pyrococcus horikoshii OT3 in complex with Mg-ADP.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Cell cycle
total genus 72
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2001-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ionA00
3QXXA 3WXMA 3MUFA 1KMHB 3JVVA 4S35A 1IN5A 4QJ5A 1IY0A 3OIWA 1MO4A 4C2TA 2N1BA 5BYKA 2P5SA 2P5TB 1XDBA 1HV8A 5JJKA 4BEBA 3M1IA 4A6PA 1NN0A 5BN4A 2FSHA 1HYQA 4IDHA 4DIDA 4NH0A 2WJJA 4DBLC 4TTPA 4X8MA 1Z83A 5FPHA 3AKCA 1J70A 4V0NA 2XZLA 1C9KA 1Y63A 2W6JA 2FPKA 4A4DA 4MYUA 1NLZA 2VP5A 2JDIA 3MFYA 1E1RA 4IDOA 4TQAA 4C9BA 2F43B 2AHOA 1XTSA 1UEIA 3W8RA 1G8YA 1G3MA 5KUTA 3EZ9A 1XJCA 2PLFA 3T61A 3NBXX 1KY3A 3VR5A 2WJYA 1W46A 3J81k 2JJ2D 2C96A 2G1JA 2PJZA 4AKHA 1S4QA 1W4AA 1CRQA 1XMIA 1TNDA 3WBJA 1GKYA 1NVXQ 4JS0A 2RGDA 4PHHA 4LX0A 2PZFA 2QMOA 1Z0DA 4Q66C 3QJYA 3UK6A 2GA8A 1G7TA 5FPYA 2GRJA 4DDVA 3IEVA 4CEHA 4FMDF 5LDDC 1YZGA 4MRSA 5FOWA 5DYGA 2ERYA 4K81B 1KAOA 2B92A 1II8A 2ZM5A 2LCFA 1DAGA 3QKSA 1W47A 2DWOA 2N42A 4EJSB 1I2DA 1W36D 5EUMA 3AF4A 1E9CA 4FCWA 2CVFA 4J0QA 2MSEB 2Q3FA 1AS0A 3MWKA 1TF7A 1DAEA 2HT6A 2BMEA 3VFDA 1TQDA 2ZR7A 1JXMA 3VKWA 3U7HB 2XITA 2NQ2C 1X1SA 1Q20A 1YZKA 4UKDA 1P5ZB 4D4LA 1E9SA 5LD2B 1S3GA 3NC1C 4M4SA 1ZM7A 4YDHB 1JQLB 3CR8A 3ZVNA 4UNPA 4R2IA 1YR6A 2AWNA 2RMKA 1W2GA 3OAAA 1Q1QA 4L4UA 3NWJA 2VO1A 1W5SA 1W4CA 2VP6A 1WP9A 1XXHE 2G0TA 5TDHA 2ZI9A 3DHWC 1SGWA 4HB2A 4KJZA 3WNBA 4AD8A 4D26A 3TQFA 5CB8A 1XB2A 1ZINA 4CT4B 1HURA 2IYQA 2FPLA 1WRBA 2W6ID 3R9WA 1II8B 1G21E 2A5JA 3GEHA 1NBME 5E7IA 4BZPA 2CLCX 4GPTA 3BB3A 3AKDA 2ZR0A 3K0AA 4QFMA 4ON9A 4D25A 4AURA 2WJHA 1KI6A 2WWHA 4OJKA 3UWOA 1GNRA 4OQFA 1PVOA 4M9XA 3X1WA 1D6JA 4FMCB 2PX3A 3GFPA 4JKIA 4B3DA 5BWMA 1K5GA 2C98A 2EQBA 3PV0A 4JT4A 1RW4A 3B9PA 4A6XA 3I62A 4H1VA 1M8PA 3DKPA 3KDSE 4TMKA 1N5JA 4XTRA 2WMNB 1WXQA 1F3OA 4JBWA 1OV4A 1SHZA 4C0AC 4JKYA 3UPUA 4DEYA 2NZJA 3MMPA 2W2XA 2FGJA 1N6RA 5KNDA 4NYJQ 1AS2A 4TLAA 1DO2A 2VP0A 4JJZA 4P33A 1ODFA 2VP4A 1M6NA 3I8SA 3ASYA 3UIEA 3GLGA 2QNRA 5DHAA 2WSSA 4MKFA 3GLHB 4GOXA 4JT2A 1BMFD 1MH1A 3AGQA 3P1JA 3ZJYA 1XD8A 3QBVA 2EWVA 2AK3A 5TB5A 1UJ2A 4GNKA 3PIRA 1N3BA 4DKXA 1ESNA 4Q02A 5CB6A 1P7CA 2QAJA 4PAOA 2N46A 4KLZA 1T9HA 5BYJA 4TMZA 4LY6A 4PHTA 2CHQA 2FPMA 5K8TA 2J1LA 4NKRA 1MRNA 2HLDA 1S96A 4LJ9A 1OSNA 1UF9A 4XJXA 3L43A 2R6GA 3K70B 4BLRA 4EPRA 1KMQA 2CL7X 2QORA 2EYQA 2HXYA 1II9A 4W9MC 3WRYC 2XNSA 4ASUD 1TUEA 2QP9X 1VCNA 1QF9A 2BEJA 3EWSA 4AK9A 1TTTA 1JPJA 3LXRA 3JVUA 1BKDR 1DBSA 3LLUA 4ZCLA 4RCZA 4DLTA 2OT3B 5TVKA 4QHSA 4B2PA 3PUYA 5GVRA 5J4KA 4HUQA 1DTSA 4DLYA 2F55A 5J4VA 2W2TA 3EARA 1E4VA 1L4YA 1ZNXA 2ZSEA 3LNCA 1QHIA 2D7DA 3PXGA 3GLFB 4B3XA 1DOAA 5FPKA 1CXZA 1OJLA 3O47A 3FGNA 5FOSA 1ZMXA 1VHLA 1QHSA 3K0SA 2GCOA 5F9FA 5EP1A 4DT1A 1AQYA 3FE2A 2QE7A 3FMIA 1II0A 4PXAA 2BMJA 3D8BA 2FJUA 4IVRA 4FCTA 1U8AA 4V0OA 1IY1A 4B3GA 4ESVA 1ZU4A 1AS3A 1FFHA 3LDAA 3OHMA 4KCGA 4NHOA 1R8QA 4RD0A 5CLQA 5TARA 2DWQA 2IT1A 4G0NA 3FHTA 4CW7A 5TY0A 1U0JA 2IL1A 3U3KA 2ZRLA 4Q4JA 1ZAKA 3TW4A 2J7KA 2NG1A 2O0JA 3C15C 1NG9A 4B71A 3KTAA 3CB4A 1KI2A 2WKQA 4XD7D 2ORWA 4DRZA 4OYHA 5EXPA 3FWYA 2BVNA 3K0FA 3KB1A 2FNAA 3KJEA 3CZPA 3DMDA 4OHZA 3K9HA 5CIQA 4PAMA 3M0EA 4NYMR 1OYWA 3H1TA 4PC6A 2XB4A 1I2MA 2BBWA 1CF4A 4LPSA 5JS7A 1KY2A 1KDRA 1E96A 2CE2X 2GCOB 5EE1A 2OE2A 2QROA 4A2WA 4DT1B 4LV5B 2ORIA 1F6BA 4NPHA 4UNNA 5HE9A 1TU3A 3N2EA 2WAXA 3SHFA 1QRAA 1ZD8A 3WMEA 2QT0A 4PSVA 4QGGA 1KI9A 1ZUNB 2O8FA 4RKEA 3NHAA 3CX8A 3THOA 1OFUX 2NGRA 2ZS8A 5JI2E 2RGXA 2XB2A 5J5CA 4Q4JB 3SYLA 2DR3A 2OFWA 4PSKA 2CK3D 1LVGA 4DLVA 1XRJA 2F9LA 4KV9A 1E32A 2VP2A 4X8OA 2HYDA 4E07A 1N25A 2QI9C 3IO5A 1ZIPA 1Z6XA 2AX4A 3KTAB 4M1TA 1B23P 1D2MA 1EFUA 1JJVA 1XEFA 3OFND 5KSPA 2QTVB 2YHSA 1VG0B 3K70C 3LW8A 2EWWA 4B44A 1E98A 4PQYA 4B2IA 2LWIA 2XNDA 3RHFA 2EFHB 1NLYA 1T5IA 2OESA 4IW3B 2OCPA 2C77A 1UM8A 3HYRA 3QG1A 1E2GA 2ONJA 1GG2A 4Q9KA 4EAQA 3PUXA 1OXTA 2ZSBA 4B47A 4DC9A 5CK4A 4BFWA 1OT3A 1VG1A 2ZJZA 3P26A 2UKDA 3VNUA 1KSGA 3LFUA 1G8GA 1YU9A 2W83A 2GKSA 3HU3A 2NPIA 3LA6A 1AKYA 3DO6A 3GLIE 1E1QA 4KVAA 1BH2A 4ZPXA 4W5HA 4RZXA 4GP6A 3AF1A 4AC9A 4XSGA 3HDTA 3QOFA 4B35A 2YOGA 3BERA 3K09A 3FKSD 4E03A 3LX8A 2ODEA 1XCPA 4URYR 2J7PD 2AFIE 1G4UR 2YOHA 3LBHA 4QXAA 3ZIAA 2ZRAA 4Y0VA 1R0YA 2YWFA 1GUAA 3U61B 2IEZA 1ZC4A 2J0SA 4LYFA 4AYWA 1VCMA 4C2UA 1Q57A 2JLVA 3SI7A 1NJGA 3VMFA 821PA 2E9SA 4TL6A 3TAUA 1FX0B 4IDQA 4TT3A 3NH9A 3GLGE 1T4GA 3QKUA 1G5RA 1VMAA 2G83A 5C46F 2FSGA 1IOZA 2O5VA 1BOFA 5CYPA 2RGBA 1G64A 3U6BA 2XGJA 3RNLA 1SXJA 5LPNA 3SQXA 3B2EA 4UNRA 3Q85A 1K6MA 3W5IA 3KKMA 4BFVA 1GFIA 1NVVR 3H0KA 1RC8A 4GFDA 2IK8A 1M7HA 1W44A 4LV6A 4YMTA 4KYIB 1OIWA 2Z4SA 1R8SA 3IDQA 3NTUA 2BMFA 4MDFA 1US8A 2KBEA 3AVVA 1YE8A 1QG4A 2J59A 3BH6A 4B3CA 4RD2A 5HR5A 3T34A 2J3EA 2I1VB 1QDEA 2IYSA 4PQFA 5JSZA 1FTNA 4A2QA 3O8BA 2IF2A 1DO0A 3G82C 1M1YE 4LBZA 2O8CB 1P62B 3HPRA 5DE3A 2QU8A 3VX4A 5CM8B 1NVVQ 3CWZA 1JECA 1IBRA 1LTQA 1QHNA 4ERNA 4KSCA 3BGWA 1Z29A 4MGIR 4TYPA 3VKHA 1VDZA 2PT5A 2XZOA 4BLSA 2H17A 2B8TA 2GTPA 1SXJB 1EFHA 4B76A 5CJ2A 1VCOA 4RJLA 3W6OA 2O0HA 3T06B 4A82A 2KJQA 4Q4LA 2L0XA 2JJ8A 3R8FA 2HJVA 2IYUA 2YC2C 4Q9IA 4BE7B 2JEOA 1WA5A 2CMKA 1DEKA 2Q3HA 1XTJA 5JHGB 3B1WA 1UKZA 2W58A 2V54A 4A9AA 3B1XA 2YV5A 4NTZA 1D9XA 1A4RA 4P32A 3T5DA 1KDTA 2HEIA 1HQCA 2GK7A 2HUPA 3MJHA 1NMYA 3WRXC 2VSXA 5FL7D 1KK1A 4PPNA 5FBLB 1J2JA 1G19A 1PLLA 2QMEA 3NEJA 4PSAA 3BE4A 2BCGY 4BQSA 1U81A 2DBYA 2VL7A 1EX6A 4RZ3A 4P31A 1RJ9A 3BBPA 5K8UA 4JSTA 1Z5ZA 4LJ8A 3L2OB 4D0GA 4ZI2A 2ZJBA 1E2QA 2ZRJA 1ZVQA 4CDGA 1WDTA 5KPDA 4TYNA 1NKSA 4LHXA 2QPOA 4G5QA 3W8NA 5JMTA 2WWGA 1RRCA 1KDOA 2HF9A 5FBWB 5FTMA 2BV3A 3IO3A 4LDJA 1X6VA 1KI1A 1Q1EA 2XSZD 2D74A 1Q22A 2ZPTX 1OH6A 3WHLA 3VKGA 1GIAA 3TW8B 3OE7A 1Z6GA 4Z1MD 5AUPB 5DISB 1W2HA 3RS5A 5IHPA 3HP1A 2ZRGA 3K1JA 2ASEA 1G7RA 1P2UA 3SYNA 3HWSA 5FFMA 3CRQA 1NRJB 1KZ7B 4LI0A 3GD7A 2ZVPX 1W0JD 4WW0A 4C0HA 3QENA 1LV7A 4CEJA 4OQXA 2YJTD 3L8ZA 1OIVA 4MYTA 3E2IA 5H1YA 721PA 2I4IA 1HQYE 1RJ9B 1B0UA 2WPDA 4UNSA 1G3UA 1SHKA 3EW9A 3R7WB 4TN1A 3SN6A 1FMJA 1E79A 5FTNA 1T0JB 2FU5C 1FL9A 4U7DA 2ZETA 2XOKA 4LHYA 3E70C 5GJVC 3K09C 4KLNA 2PMDA 2WZQA 3UWKA 1N0UA 2ZJ5A 5EE5B 4Z8XA 1ETUA 3RC8A 3K8YA 1E2EA 1CTQA 1BS1A 1Z6TA 2NZ8A 2VP9A 1G4AE 1Q1BA 1G9XA 5KSZA 1L2TA 1Z07A 5DYIA 1H8HD 2D06A 3CPHA 1QZXA 1NMXA 3DM5A 1NNEA 2J0UA 3LLMA 4WZAE 3QBTA 1Z06A 2FFAA 1S0UA 5G41A 5JCPA 5DI9A 1FTSA 1X1RA 4MYCA 4D81A 1QHXA 2BOVA 3OF5A 3AKYA 2V9PA 3IQWA 1XEXB 2QY9A 3KXLA 4Q7JB 3V4FA 5A5GA 1RVDA 3AF3A 5TXGA 4CYMA 2WAYA 1XPRA 1MO6A 4LV8B 2IHBA 1TX4B 4CEJB 4E5UA 1SXJC 2KSQA 1E2PA 1LFDB 4DUGA 2AXPA 4LYAA 4Q5IA 2NMVA 4UXIA 2MMCA 4A8JA 2V4ZA 2W0SA 3DZDA 3IBYA 4ZIRA 4JLDA 1Z0FA 2VYFA 2QPTA 2G6BA 5L8VA 1OHHA 5KNCA 4DVGA 1LY1A 5DHFA 2ZXUA 1KMHA 1WMSA 2PH1A 3CONA 4PO9A 2TMKA 2Q9CA 5FUVA 4QJ4A 3U60B 4H9GA 1R2QA 2ZUDA 4C3ZA 4LJ6A 3EG5A 4I1UA 2J0UB 2ZUBA 1KKMA 1FMLA 1N6HA 2O8DA 3ADKA 3TMKA 3IGFA 4LYJA 2D62A 4XSHA 3D6TB 5G3YA 2DHRA 2AD1A 4DLRA 1LF5A 4N1AA 3OIYA 2ZQ5A 5FBQB 2P6RA 2ERXA 2P0EA 3ZDQA 1GRRA 1R10A 2QM7A 3QXHA 1IHUA 5JEEA 3EIEA 1KKLA 5DGXA 4QGFA 4BLTA 2F43A 4HAUA 3WP1B 3A37A 3EZ7A 3RWMB 4HLDA 2OM2A 5M04A 1E69A 3IHWA 1WF3A 1NVWQ 4PPGA 4QGAA 2XTZA 5DLQC 2CNWA 1LF0A 4BECA 1EFRA 1FOEB 1NKTA 2B8WA 3TSWA 1IONA 4M53A 5FOTA 2FFBA 3KQHA 1GL9B 1CLUA 2ANCA 3TVTA 1YZNA 2ODNA 2QQEA 5J47A 2BM0A 2H57A 4UJ3A 2GVDC 5E7MA 1NN1A 2X2EA 3EPKA 4V0MA 2XTMA 4XVUA 2EW1A 1IM2A 3AP3A 1COWA 4M1YA 2O8DB 3IKJA 4HATA 3SU8A 3DMNA 3BK7A 4EKDA 4NL4H 4B33A 3TBKA 1P72A 3KQKA 1DAIA 2ZROA 3KX2A 4NMMA 1QHGA 4C30A 4IXMA 5F3WB 1TF2A 4DEXA 2I1QA 1L8QA 1WE2A 3F3YA 4EJSA 3CWQA 3CNLA 2QM8A 1KO1A 2Q6TA 5GVSA 1FW6A 2IUUA 4Q48A 3EA0A 3B9QA 1OLOA 521PA 1IXSB 1SKYB 3CKLA 3QEJA 1ZBDA 3A58B 3BS4A 2RAPA 1H65A 4A0HA 1MO5A 4BRUA 1X8LA 1IXRC 3LQRA 4ILEA 3SBEA 5AWFC 1GDDA 1OH7A 4EPXA 2B7BA 3KFXA 4TSFA 4X8LA 5AK0A 2ZYUX 2OCAA 2PL3A 2C9OA 3MWYW 2ZU6A 4KFSA 4HLUA 5KHOC 4MKIA 3QSYA 2W6JD 2G88A 4URZR 3F8TA 2JASA 4BFUA 1G6OA 2JDID 3EPHA 1E1RD 4DWJA 4R7ZA 1IJFA 2MMGA 5JWRA 2O0KA 3DEFA 1M74A 1D9ZA 2UZIR 2ZUCA 3O8CA 4FW9A 2WICA 4S2EA 4PO8A 1K5DA 2KB0A 3T1VA 3VU9A 4TYYA 5P21A 2NPFA 1YJ5A 5KSOA 2JLXA 3RVBA 3S1AA 1JNYA 3X1YA 4EPWA 5C4GB 1TAGA 3T1TA 2ZEJA 2AK2A 4JLJA 3ICEA 3WMGA 3ECCA 4LBVA 1OKKA 1XCMA 1YVDA 2JCSA 4TLBA 5C2JB 4CGZA 2JIZD 4PZLA 5DNYB 2EFDB 3ICQB 2FDCA 2XEXA 1V43A 3ZH9B 2BBTA 3ZVLA 4FMBB 2QT1A 1DARA 2V6IA 4MGKR 1GM5A 3RSLA 1N5IA 3X1XA 4LBYA 2R6CA 4XH9B 1JAIA 5G53C 1HT2E 2ZRIA 2EFEB 2P65A 2D7CA 5KDDA 4LK2A 3IEUA 4X8HA 4NE2A 3U6KA 1G18A 2C9YA 4F92B 2OCYC 2YWEA 2QQ0A 3U7FB 2D3WA 1AQUA 2R6AA 4B43A 4RD3A 3G5UA 2P2LA 3NH6A 1KI3A 3GLHA 3QUSA 5SZIA 3VU9B 5KU1A 3RRNA 4TL7A 4RZUA 3GEEA 5JFGA 1JAHA 4TMVA 5GADl 4M9ZA 2PLRA 4QRHA 3S1AB 5CYOA 2ZTSA 3W6PA 1T3HA 2Q9AA 2RGGA 1YRAA 4A8JC 4PHFA 4AG6A 1T0HB 3OAAD 4I4LA 1KSFX 2JLYA 2WWYA 4LWZA 2IS2A 4PC3A 2F9MA 4R2HA 3ND9A 4I1SA 1G7SA 4GZMA 1O87A 3AKEA 1R0XA 3I4LA 4U00A 2I3BA 4W5WA 4Z51A 4TQUS 1KJWA 1CR1A 2QMUA 2WOOA 1Q12A 2VQSA 3WNDA 3OEHA 3LX5A 3AVPA 1RZ3A 1A2KC 1XTRA 2BKUA 2WWXA 2ZREA 1E2JA 1ZC3A 4LJYA 1E9DA 3L0PA 2ZRCA 3TUJC 5KYKA 2BEKA 2OXRA 2OHFA 4RD4A 1QHHA 2FE4A 2IW3A 4G1UC 3RABA 1LS1A 1JBKA 2GHIA 3BFXA 2OEPA 1KZGB 2ZRMA 2YWGA 5FR2A 4HLCA 4EPYA 3K70D 1BMFA 1ZP6A 2RGAA 4JLMA 4B3FX 3FVQA 5FTJA 1YKSA 3IIJA 1CKEA 2IYYA 4Q4AB 4IFBA 2O52A 3C4JA 3EIQA 3GLFA 1IN6A 5AJZA 1L7VC 1KJZA 3AVYA 1ANKA 3WP0A 4G5GA 3ZYCA 4OJQA 5CDFA 2R44A 3ADCA 4PR0A 3OIVA 2H7VA 4KFRA 4KO8A 1R4AA 2R9VA 2WSSD 4MA4A 2J41A 1H8EA 2IUSA 4TL9A 3CPEA 4B32A 1U2RA 3WYGA 1M7GA 1N6NA 2BBSA 3H86A 1F48A 1ZNYA 2X19A 4XVRA 3BIFA 3I8XA 2H16A 5C4MA 1GAJA 1E2FA 3KJIA 3L0OA 4WBSA 5HKKA 3GP8A 1QHHB 2C9CA 4G5SA 1W4BA 4XTCS 2NO1A 4Q00A 3BAFA 1T91A 3TSZA 2NOAA 4QHYA 4EJSC 4HDOB 2HLDD 4MH0R 2QTHA 5EJEA 4QM7A 4C7OA 3QPWA 1ZW6A 1N6PA 3A1WA 4GP7A 4IOJA 1N0VC 1HEIA 2JATA 4B6EA 1OPXA 1UBFA 2P6UA 4E09A 5E3HA 1AJEA 1TEVA 1Q3HA 2CVHA 4NZYA 5LD2C 3EC2A 3A6PC 5DN6A 3TSOA 4ZDJA 1OFIA 3K0CA 4D4MA 1UDWA 2ZE6A 4ITRC 2FN4A 3D3QA 5DO9A 2GXSA 2FX3A 4HLUC 4BWYA 2Z6VA 2D4HA 1J7KA 1M7BA 2RHMA 4TLDA 1RPZA 1P75A 2OFXA 3K9GA 2NIPA 3GJ3A 5C18A 3UMRA 4FCVA 1ZIOA 4D0LB 3TNFA 1OF1A 2HDNB 4DCUA 3QG5A 5JI3E 3CW2A 2V8OA 1IXZA 3QPVA 4UJ5A 1C4OA 4LCBA 5JECA 3ZVMA 2CJWA 1KNQA 1PV4A 4P3YA 3ZQJA 1AGPA 3HPQA 4C7OB 2QE7D 4KFTA 1P2SA 3NVAA 3B13B 2WHXA 1G8PA 1NG1A 1KSJA 3AGPA 2HV8A 2BCJQ 4GI7A 1G3QA 3KJHA 4W7SA 3R9XA 2WSMA 3KL4A 2CBZA 3MJRA 1AN0A 2PX0A 4FINA 4KXFB 1ZM2A 2P3SA 5SZJA 4B73A 4Z54A 3P4YA 2QP4A 1U94A 4PZYA 4NCKA 4HAWA 4NONA 4HUTA 5IT5A 1AZTA 4CT5A 3C8UA 4HSEA 5EUQB 2IWRA 1JPNA 3UG7A 3TUZC 1NI3A 2HT1A 1A2BA 2GBLA 3PFIA 2W2VA 3TKLA 3BH7A 4IJMA 3BH0A 4AKIA 3C41J 3B7GA 2G9NA 3TR0A 4RCYA 3I5YA 4F93B 4QC2A 3THYA 3B1VA 3GJ7A 3HYTA 4NYMQ 3VR2A 4YMVA 2JGNA 2CJWB 3TVDA 4WIAA 1E2DA 1SVWA 1VHTA 1XNJA 4FMDB 1NLFA 1W7AA 3HJNA 3TLXA 3CO5A 1HTWA 3B1YA 3B60A 2ZJYA 2VA8A 3CZQA 2GZDA 3U7EB 2C99A 2JLWA 2DB3A 4DHEA 4QBIA 1JQJC 2V6JA 2WWFA 5HCIA 1OE0A 1CR4A 4TMTA 5E95A 1EESA 4YMWA 1UDXA 4L5BA 1YRBA 2D2FA 1UKEA 1EWRA 1GILA 1TQ6A 2H1LA 5E4FA 4O2LA 1QG2A 2G1KA 3SDZA 1XMJA 4QL3A 2JLZA 3KJGA 1CJUC 4Q7KA 5JJLA 4TMXA 1FX0A 1UPTA 4IOKA 2ZI3A 1W0KA 3SNHA 3CLVA 4D6PA 3U5ZB 1TMKA 2AXNA 3GLHE 3G0HA 1JR3A 1CBUA 1ESMA 2GXAA 1S3SA 3FMPB 4OHWA 2W00A 3I72A 3THYB 4KI0A 2XNDD 1DAKA 2BKEA 4IOLA 3U44A 1TF5A 1YR9A 2WWIA 4A92A 2IS6A 4Q1FA 3IPYA 3BXZA 4TTRA 2GF0A 3P32A 2RCNA 4O25A 4QOSA 1MV5A 1XEWX 3ZS9A 2WVJA 4EUNA 4YXWD 1XJ0A 2ORVA 3EWAA 2GWHA 2A5FA 1Z8FA 1KI7A 3W3AA 3ZLJA 2ATVA 3W90A 3B8HA 4LC1A 4CIDA 2O8EA 2IUTA 2ZI4A 1E1QD 4KITB 5ELXA 4TQ9A 1V5WA 3R8CA 1OXXK 4HLQB 1N5KA 4LBWA 3SE0A 4BZQA 2FWRA 5BXQC 2ZRPA 4YMSA 3REFA 2O8CA 1WB9A 3MWJA 2WIAA 3KKNA 5UKDA 4OHXA 4LZZA 4DDWA 1CU1A 2XX3A 2YNMA 2JJ1A 1OFTA 1QBKC 1YR8A 4JVLA 2GVZC 3GJ5A 5EZ5A 2V7QA 2GCNA 3ZIAD 3C5HA 3B6EA 3QXJA 4OK6A 2XZPA 4TYWA 2CE7A 2GJAA 1DS6A 3U44B 4BFXA 2GJKA 3GLFE 1VPLA 5D3QA 1SULA 4GDFA 3KZ1E 3AP1A 2WIBA 4M0LA 1EFTA 4DB2A 1AKEA 3K0CC 1G8FA 5GJBA 3MD0A 4IXNA 5EE9A 3SQWA 2JA1A 1HUQA 1U98A 2P67A 5FUWA 1J90A 2GZAA 4GRAA 3VQTA 1YZQA 4PTLA 2ZRBA 4TT3D 3PJRA 3LY5A 4OQNA 1Z08A 3KXKA 4AG5A 4QGHA 5FR1A 5AUOB 1ZD9A 5FPTA 2O8EB 1T5LA 1Z63A 1HH4A 1SXJD 4IOMA 2VSFA 3LXXA 2ZJ8A 4A2PA 4A1FA 1E0SA 4L9WA 3X1DA 1E0JA 3JZMA 4LGMA 1U8ZA 4AWXA 3M4YA 1IN7A 4KHZA 1ZM4A 1TUIA 5GJWC 1YHNA 2FFQA 1KYIA 4HZIA 3LQQA 5JEDA 2B6HA 2VHCA 4K46A 3PENA 1EXMA 1FP7A 3CIOA 3VX3A 1E9AA 4D0NA 3REGA 4PC1A 3NBFA 4OQLA 3THWA 2Z43A 4RKFA 4UXJA 5FI0B 2OLJA 1F5NA 1JEDA 3LD9A 2FG5A 1S9HA 1JJ7A 5B57C 5CK5A 4JLBA 2H92A 1OXSC 2NO0A 5IK2A 2WV9A 2C5LA 3ADBA 1RRGA 3EAQA 4BLPA 5H8WA 2ODWA 2E1RA 3KFVA 3ETLA 2V1UA 3T1OA 3GFOA 4ACBA 4JZKA 4CZ2A 3U3OA 5JBQA 5FUYA 1R5BA 2F3RA 1GNPA 4L16A 5B58C 2IYWA 4DLSA 3KKPA 2A3RA 4HB4A 3X1ZA 2WWWA 1G41A 2F3TA 4BRWA 4EIWA 1AK2A 1QHYA 3OIUA 3FDIA 1P9WA 3DVLA 4EDHA 4F38A 2GBLC 1ZJ6A 3W6NA 1O3YA 2A9KA 3U3RA 3C7KA 3W34A 4GBMA 2CCKA 2UZ3A 3F0TA 1E0AA 1NIPA 4DZZA 4A15A 3Q7PA 2X8AA 1PLKA 1MKYA 4O2RA 3CNNA 4LJ4A 3TJZA 4DSUA 4KODA 1IJEA 1JI0A 1VCIA 4EFNA 4US2R 3R7WA 1N0WA 1TADA 1YR7A 3THWB 3AEZA 1D2NA 1KTVA 2FEMA 3T1QA 5AUQA 4PC7A 1Z3IX 2LKDA 3IILA 4KFUA 1C1YA 3SHWA 3PEWA 4P4UA 3PUVA 2YKGA 2AD5A 4DSOA 1UAAA 2RGEA 2Y8EA 5AR1A 3V9PA 3ZD6A 4ARZA 5KNBA 4URVR 1G1MA 1N6OA 1LS6A 3MG9A 4NCHA 1JXOA 4LHVA 4U02A 4NYIR 4XOIA 4CF7A 2XJ9A 3EASA 1GRNA 2GDJA 1HE8B 2P6NA 2R6FA 1DPFA 2UVQA 3CM0A 4Q03A 4WXRA 3RRYA 4A0RA 1S1CA 2OV2A 1XEXA 5EE0A 4TLEA 1MT0A 3VTKA 3EPLA 2ZRNA 3VNVA 4Q1DA 1XD2B 3CRW1 3N5CA 4Q21A 4M1SA 4WZ6A 4BPBA 2VH5R 1E2NA 3IIMA 3W5JA 1J99A 3KQUA 2OCBA 3QKTA 4FD2A 2XJ4A 1ZNWA 3FHCB 4D2IA 2FF7A 1W5TA 3HU1A 3LW7A 3OE7D 2A5YB 2CCJA 3VAAA 1R0ZA 4JJKA 2QGZA 1ZM9A 1Q21A 4NYIQ 3EXAA 1XD9A 2FZLA 4PO1A 2QBYA 5AJWA 1XXHA 1Z0KA 5BN3A 2YOFA 2RGNA 1P60A 221PA 2R65A 3ZZ0A 1I4LD 1FNMA 3OEED 5HE8A 4ARZB 1W1WA 3WNCA 1Q0UA 1UBCA 1W4RA 1NBMA 2CL6X 2WPDD 1G17A 1Y3AA 1KJYA 2IYXA 4FMCF 4JBXA 4BLQA 3UXMA 2A5GA 2HF8A 1E79D 3IIKA 2W0MA 1Z6AA 2PBRA 4JSYA 4U5XA 1P6XA 5EP2A 4MRVA 2MSDB 2XOKD 2QTFA 2YC4C 3ZZTA 4QBFA 1JR3E 3H2YA 3ONWA 2E87A 3A36A 3HR8A 5GJCA 2GEVA 2QRZA 5DI3A 4ZDWA 1X8KA 1NVUQ 1EK0A 2LKCA 4L8GA 2WM9B 4URXR 2H5EA 4PX9A 1KK0A 2IHYA 3V00A 3I5XA 1E9RA 1Z0AA 2ZJOA 621PA 2QA5A 2XAUA 4Q7MB 2QBYB 2CLSA 1XXHB 2ZJ2A 2GILA 4IHQA 2DFTA 4DJTA 1GRQA 2F1IA 1NN3A 3IQXA 3NBZC 1CR2A 3CPJB 3R9IA 2BJVA 4L15A 1U0HC 2CEAA 2Z5FA 4C0JA 2IC5A 4DUGD 1FQKA 2OAP1 4PPFA 1GWNA 3QXSA 4M22A 2F1HA 4II7A 3X2SA 4RSGA 2A78A 5FOXA 4LYHA 1OHHD 2F1RA 3I73A 3U7GA 3A1SA 1UKYA 2ZIAA 4V02A 1VG8A 3LO5A 4ZCIA 1OFHA 2V3CC 2R6DA 4FIDA 2OG2A 2PEYA 1QVRA 2WJGA 5DI3B 5LBIA 1XZPA 2PEZA 1G20E 1SXJE 2ANBA 2ZRKA 1OH8A 4HDCA 3CRRA 4N3NA 2WBLC 3UG6A 1WCV1 3NBYC 3FPAA 4JVSB 1S8FA 1AZSC 2K5UA 1NY5A 2IS4A 4AI6A 2ZRHA 2SHKA 4WOPA 4C4PA 3TIFA 2REBA 4PC2A 1I4TD 2IYLD 2OSBA 2ODBA 3B1ZA 3H4MA 2IF0A 3HR7A 2DFLA 3IPXA 2A2ZA 3LV8A 4HAXA 4M21A 1ONBA 2HJGA 2C2HA 4MYHA 3KXIA 4PHGA 3RDPA 1Z22A 3IBGA 5A4JA 2FSIA 2IYRA 4TLCA 3SJCA 3SJAA 3P27A 3U3MA 4A0GA 5HTKA 5AJVB 3QI2A 2WOJA 3GFTA 4OI2A 3EA5A 1FPMA 4KBGA 5BW8A 2O8BA 3GJXC 4URWR 1KNXA 3MWLA 2CLDX 4JIMA 4DLZA 3VR1A 5HPYB 2CNWD 4LOAA 4Q4HA 3SC3A 3T5GA 3A1UA 1EFRD 4IEEA 3FMOB 2ZS7A 3PUZA 4GZLA 1P2TA 1N6LA 1OB2A 1VTKA 2ZAMA 4BEJA 4HZUB 1RYHA 4GL2A 2ZI6A 3KQLA 1GSIA 2QZ4A 4TZ6A 3CRMA 4PAQA 3ZS8A 3DDCA 2BJWA 3FB4A 1COWD 4Q1AA 5BQ5A 1VECA 3NDPA 2CDNA 4HYYA 1U9IA 3AH8A 2IYVA 2JJ2A 1VYUA 5JWHA 1P4SA 1G3RA 2QPAA 3K9NA 1GTVA 4DCVA 1G7CA 1SKQA 4XWAA 1Z2CA 1RRPA 1YQTA 2QG6A 5HZKA 4WZBE 4RVCA 4MUBA 1TEXA 3QKRA 1E2HA 4JLPA 2PZEA 4FI3C 4JVNA 2VF8A 4C0QC 1MO3A 5JLJA 4K8OA 2BHRA 3QIAA 4G3XA 2WTUA 5SZKB 1ZU5A 3AVTA 1IN8A 4D80A 2O8BB 3TE6A 4HB3A 4OK3A 4YQFA 4DIEA 5KDOA 2QAGA 1BO6A 3QVVA 4Q4HB 4BASA 1R5NA 4TSFD 3MAAC 2VHTA 4EQ6A 1DAMA 1MABB 1IQPA 2IYTA 5IRCD 2GNOA 4DSTA 3QF7A 4NCIA 5FL3A 3SBDA 2JIZA 1NMZA 5KSYA 4ZKEA 4QM6A 5ANRB 3AF0A 1UBEA 2RGNC 3OZXA 2ZYTX 3A1VA 4JLNA 3AUXA 4I99A 4QHTA 4Y0AA 1A7JA 2AFHE 4ZO4A 1TQ2A 4YONB 2C8VA 1Q3TA 3BD9A 3U3JA 2IXFA 5LB4A 3T15A 4RD6A 3QQ5A 1E99A 2OO7A 4XVQA 3SYKA 1XJQA 1OKKD 3QKRB 4LJ5A 1S2MA 3RANA 2F7SA 1HA3A 2EYUA 4RFVA 1ZD1A 2OFOA 2DYKA 4WAUA 1R7RA 2Q0HA 2PMKA 3NXSA 3PUWA 3NHBA 4I1VA 4OKSA 1GITA 2J0VA 5HCNA 4C0SA 2JAQA 1VIYA 4V03A 5KOYA 2W6IA 1KO8A 2QAGB 4Q4AA 3AVUA 3CF2A 3L0IB 2OUKA 2GETA 3B5JA 3H84A 4QNMA 4EQ6B 3DKVA 4M1WA 4YC7A 4TMWA 1W36B 4N0DA 2ZYWX 4IFEA 4AY2A 1E9BA 1MRSA 4W5JA 5EP3A 1UBGA 4LJAA 1FQJA 1WBDA 3AM1A 4DCSA 2QP3A 3L0SA 4Q19A 2XTNA 4CEHB 3BWDD 3WYFA 2BC9A 4AYTA 3GLIA 3C14C 3I3SR 1KDPA 2VF7A 3AV0B 4NYJR 3JZAA 3QKSB 3VR4A 3RC3A 2DWPA 3MGCA 3TH5A 5F98A 1L4UA 1E2MA 3AUYA 4DXAA 1E4YA 1E3MA 4BZXA 4OBEA 4Q47A 3BORA 3A4NA 1WBBA 4URUR 1D8TA 2BDTA 5L3RA 3GCGA 4RFSA 4R71A 1W48A 5EXXA 2C03A 2ZSAA 2OBNA 2VLIA 4QKQA 4HB0A 3A8TA 3K9LA 4D4KA 4HAZA 3OEHD 1VKJA 1E2LA 1XX6A 1KO4A 3WHKA 5CM9C 3NDBB 1P73A 2RH5A 1ZNZA 1YZLA 2AKYA 3B82A 5FBVB 5K8IA 3ADDA 1VYTA 1DELA 5BN5A 1YZUA 2OBLA 4MGZR 3AVQA 1E6CA 3EX7C 1XF9A 4YDSA 4G01B 4IDNA 2GK6A 2EVWX 1NL3A 2FFHA 1U90A 4AKGA 5K8LA 3Q5EA 3LBIA 5DIFA 5KDLA 2Z0MA 4OI0A 1IY2A 2B21A 3GLIB 4PFSA 2JLUA 1UFQA 2QSZA 4ASUA 3FFAA 1K8RA 2AN9A 3PQCA 5L3QA 2WJVA 3TGPA 4IRUB 4YMUA 5L3SA 3A4MA 4R9UC 1EGAA 4CVNA 3K0AB 2QL6A 3BB1A 5IDVA 1KI6B 3KB2A 2NO6A 4JVMA 2DCUA 2G0NA 1N2CE 1OXUA 1RYFA 2F6RA 3LBNA 1GZSA 4RFSB 5JRZA 5AUNB 3GMTA 1H8ED 4IEIA 1Z0IA 1I4DD 4MRRA 1D2EA 5DSZA 1SKYE 2Z83A 1A1VA 1OXVA 4POAA 1P9NA 3WBKA 5JZVA 4DLUA 2NO7A 2GAOA 1AIPA 4NDZA 1LB1B 1M2OB 3SJZA 2ZRDA 1U9IC 4M1OA 3I32A 3PG5A 121PA 4LRWA 3ZQ6A 5HKKD 1OIXA 4KBFA 1ZCAA 4A0FA 4M9QA 2NO9A 2VRWA 3PEUA 4Q1BA 4QBHA 1XTIA 3TUIC 1A5TA 2PCJA 4Q01A 2JLQA 4WXPA 3GLGB 3ND8A 4P0TA 1RRFA 2AR7A 1PZNA 4JLAA 1DG3A 4ZDIA 4F4CA 3VHXA 4V0ME 1JEEA 3RS4A 3CH4B 4EPVA 3CNOA 4OL0A 4D4JA 1E2KA 2RB4A 4Q7LA 3QPUA 4G5OA 4LJ7A 4DDTA 1CR0A 5L3QB 3FYHA 2VSOA 1G6HA 3ZGXA 5L3SB 2QAGC 3MRSA 3I61A 3TR5A 4KYUA 1S9DA 5DN6D 3PITA 1XP8A 1NIJA 1R0WA 1XTKA 2RGCA 1QVAA 3DZ8A 4KSBA 1W36C 4IDPA 1Z0JA 2ZE7A 4XD7A 2VHUA 3EZ2A 4ZV4A 1RFLA 3GJ8A 3QXCA 4JBYA 1GL7A 2WKPA 1XEWY 1HT1E 1SVLA 4QG7A 2BWJA 1E9FA 3IUYA 1UKVY 4FXPA 3SZRA 4QBGB 3D7MA 1GP2A 4GT1A 2VHJA 4JYBA 4V0KA 5FI1B 3SFVA 4NCNA 1BYUA 3NC0C 3CF0A 3CR7A 4HUQB 4MQBA 3WY9A 2GJSA 6Q21A 4MDEA 1HE1C 5CITA 3BC1A 4NP6A 4F4IA 1F2TA 4OI4A 2J46A 3U2QA 5TMPA 4O3MA 3SOPA 5JHHB 3W9YA 2IEYA 4YLGA 1NJFA 1KI4A 4MGYR 4RD1A 2ZI5A 4Q9HA 3SEAA 4LC0A 3A4LA 1U8YA 2VIIA 1XCGB 2WJIA 4LUCA 1IN4A 1DE0A 1E94E 2CK3A 1KAGA 2GJ8A 5F2EA 5JWOA 2A30A 2RKOA 3EIHA 1Z2AA 4N0EA 3CF6R 5CLLA 2YINC 2ZJAA 5CJPA 4F91B 3OFNA 2CCGA 2GESA 3PR1A 4LHWA 2KWIA 3M6AA 4Q1CA 5EQTA 3RYTC 1X86B 5AJXA 1KO7A 3HU2A 1OW3B 2BBOA 5J4LA 2GJ9A 5J4HA 1G3IA 1P3JA 3TAHA 1XFAA 1TU4A 2QGNA 4CRWB 1VYVA 3NG1A 4TL8A 4M1MA 3MLEA 2EFCB 3K0FB 5IF9A 4OQMA 2R8RA 4Q1EA 3FOZA 3KKOA 1F2TB 2ZS9A 2Z4RA 4GOJA 3ZZUA 4BFSA 3GEIA 3GPLA 2DFNA 4ZCMA 3LAWA 2ZSDA 4JL8A 2X2FA 3UKDA 2OAQ1 2YWHA 3DL0A 2ZANA 3NIBA 5TV2A 1F60A 1KHTA 4IKEA 2X1VA 1CEEA 4A36A 2VTKA 1YZTA 2AL7A 1LNZA 1KGDA 3RAPR 4YXWA 8OHMA 1W0KD 1AA9A 1KI8A 3FKSA 2QUZA 2R62A 5AJYA 3B85A 2J7PA 2O8FB 4M1KA 1JR3D 2DPXA 1KOFA 2ZITA 3CUEF 1CS4C 1Z28A 1FUKA 1U99A 3N70A 1TL7C 1OH5A 2HXSA 5H70A 3I1FA 4JLOA 3RS0A 2ZI7A 4BFTA 3UMSA 2JLSA 4TYQA 5EXTA 3NKVA 4RY2A 3DM9B 3QF4A 4E22A 2ZR9A 1PUJA 4US1R 3ZVRA 2FMXA 1EX7A 5EP4A 3V4RA 1ZUIA 1CJVC 2GZHA 2QN6A 4AKEA 2X77A 1P2VA 3U4QA 3THXA 2QSYA 2OBMA 2PT7A 4DDUA 1AGRA 2OXCA 4XWOA 5EE3A 5EZ6B 4LSGA 3BJIC 5FUXA 3FFBA 4C0KA 1T3LA 5KPJA 1RIFA 1XMSA 2GXUA 2FGKA 3Q7QA 4QNRA 1DG1G 2IXGA 4ZKDA 2EFGA 1XPUA 3E5HA 3RRZA 2CHVA 4NBSA 1RE0A 3O8DA 4I81A 4XIGS 2JLRA 3I92A 1R5OA 2H8KA 3B78A 4OK5A 4Q9LA 1Q1ZA 3CX6A 1P61B 2GEUA 3RS7A 2ZVQX 4F7WA 4DLWA 4TTQA 4AYXA 1W49A 5CDFE 2GXQA 3IHLA 2XXAA 4DB4A 1CIPA 5G3ZA 2GAAA 3CBQA 1T3SA 3D31A 3K53A 2JJ1D 4C0LA 1M34E 3Q3JB 3LRPA 1JB1A 1PJRA 4PQRA 5C1BA 2V7QD 3GJ6A 5FPSA 2HYIC 2ZRFA 3PEVA 4BUJA 4US0R 5JS8A 3Q72A 4BGDA 5A0FA 5KO2A 2ZAOA 3T12A 1VG9B 1F2UA 2BIFA 3NEYA 3QF4B 4PPQA 3KKQA 4BLOA 1SZPA 1U0LA 3AVOA 1NN5A 1BIFA 3L82B 4PZZA 3R20A 1T8TA 3C5CA 3U4QB 3E1SA 3THXB 1GNQA 4JL5A 5JRJA 2YZ2A 4XWKA 4DCTA 2ATXA 4MKHA 4P4SA 1E0KA 1A82A 1ZM3A 2VHQA 4EFMA 5FOUA 1J8YF 2IYZA 4BFYA 2YYZA 1DAFA 1TPZA 2RHDA 3LVQE 2GEDA 3TRFA 4OI1A 4ZDKA 1OB5A 3T35A 3KUDA 4F4JA 1KK3A 4B3BA 4M2LA 4UXHA 4JYCA 3SR0A 1T8UA 3BB4A 2REXB 4MRPA 2MSCB 2XXAB 1G5TA 2A5DA 4UQOA 4HAYA 4JMPA 1UADA 4GMXA 1DAHA 2R2AA 1IAQA 4D82A 2FV8A 1XU4A 2VBCA 4RZ2A 2FA9A 1XD2A 2V55B 1LW7A 5IK2D 1E2IA 2ZSFA 5FL7A 4CEIA 3SS8A 2DFKB 4B2LA 1F2UB 4KVGA 1J8MF 4GSYA 4AIIA 3QY0A 2ONKA 2IA5A 3WYAA 4P4TA 5SZHB 3DPUA 3CX7A 4ABYA 2B7CA 2G3YA 2HCJB 3CH5A 1US8B 3RSOA 3VR3A 1OYYA 3O8RA 5B64A 4P4SB 2IXEA 3Q9LA 5FTKA 2J87A 5KTYA 5JSZB 1S1MA 2CL0X 5F9HA 1GL6A 4B74A 4DLXA 1N6KA 3AVWA 1DVRA 5G40A 2PCLA 2XSZA 1Z6YA 2GF9A 2QENA 3UATA 1G5PA 1FP6A 5H68A 2H18A 5EXSA 3KUCA 1G291 1G8HA 3CRVA 3RLFA 4DSNA 1PLJA 2NTYC 1SQ5A 4MITA 4Z1MA 4TWZA 1GKUB 2IX3A 2REOA 3SJBA 2CHGA 2ZE5A 3EZ6A 2GCPA 3VR6A 4R98A 4I1OA 4JL6A 5HZHA 1MR3F 3F5FA 1EFCA 1W0JA 4HAVA 4PANA 3K0EA 3FMFA 1NSFA 4M8NE 3PVSA 4WVFA 3TK1A 4BFZA 5D3MA 1XPOA 4CEIB 1JALA 2WMOB 4B34A 1NP6A 5E7JA 4OHVA 5FH9A 3DOFA 2VPPA 4ZI3A 2AKAB 1SVKA 2FH5B 2FZ4A 2OLKA 5J4YA 2EU8A 1R6BX 2FOLA 1N6IA 1X8JA 2V1XA 4TZ0A 4GMDA 1CJKC 3N2IA 3P20A 1XMVA 2A7QA 2PJRA 1RKBA 1SVSA 2C04A 3DOEA 4NCJA 3RRMA 3AP2A 5B2ZA 3OEEA 4MKGA 5JCZA 1E9EA 1H8HA 2QEQA 3ASZA 3P4XA 1XZQA 3L8YA 4LHZA 4ESHA 3Q8XB 3FKQA 5LB2A 1GKIA 3LVRE 1P9RA 3QNUA 1KK2A 2G77B 2ZU0C 421PA 2J45A 2Q9BA 4C0BA 3VHLB 4B6FA 4KAXA 5JJIA 4EPTA 2OILA 3PCRB 5D3MB 5FOVA 1ELOA 2FSFA 1Q44A 1WQ1R 2Q3MA 4Q9JA 3QE0A 1ZUHA 2DY1A 1KIMA 3BRWD 1N5LA 1NBMD 2IWHA 1ZYUA 2YVUA 1KO5A 1KSHA 4IVQA 4FWTA 2D2EA 3LWNA 1NSTA 2BM1A 4H1UA 1SVIA 3BOSA 3KQNA 3W3ZB 3RWOA 3GQBA 5DH9A 1VIAA 2WKRA 1HY3A 3SFZA 4FWIB 2AWOA 4G5RA 2VEDA 4OHYA 4O0MA 3UANA 3LH5A 5FTLA 3GJ0A 1TQ4A 1UEJA 4V0LA 4MRNA 3C16C 4JLKA 1CJTC 2Q21A 1SVMA 2KBFA 3UMFA 3OESA 3AVXA 2J0QA 3BFVA 1ZCBA 2J5XA 4FN5A 4HI0E 3QEOA 4Z8YA 1CP2A 4M9SA 4JLVA 1CULC 1PUIA 1GOTA 3Q5DA 2CXXA 1NY6A 3GJ4A 4HZUA 2IS1A 2FEOA 4IVPA 5FBRB 4MUAA 1NF3A 2C78A 1D5CA 1BYIA 3FHOA 2KI5A 1T6NA 2HCBA 2ECKA 1XBTA 4HEJA 2ZE8A 3ZD7A 2F1JA 4WA7A 5L3VA 4EFLA 3RS3A 4ACAA 3A1TA 1FUUA 2QRNA 3RS2A 1EG7A 1AM4D 2BMDA 1MOZA 1XWIA 1X3SA 2QMHA 2J9RA 4B75A 1CJMA 1ZRHA 3MSXA 5J40A 3FTQA 4Q18A 1FNNA 3TQCA 3EPJA 3AQ4A 2IBMA 2PZGA 3AB3A 3PEYA 1G16A 1JR6A 1GVNB 4DCNA 3EC1A 1FZQA 1Z47A 3EZFA 1DADA 2KE5A 3BFKA 1SVOA 4UNQA 1CRPA 4KU4A 4NU0A 3AF2A 2ZYVX 3MCAA 3WMFA 4L9SA 4A8JB 5CIWA 4GOKA 2C95A 4HDQB 4ZIRB 4LPKA 4QJ3A 5B30A 1XTQA 4B48A 1MABA 2OZEA 1EWQA 3QVUA
chains in the Genus database with same CATH superfamily
4KOAA 5FQOA 3UICA 5J58A 1KMHB 5L6MB 1XVIA 1NDQA 3OF2A 2WHEA 3W7AA 5CA0A 1IY0A 2JEYA 4AQ7A 4C4SA 3LC2O 3CJRA 4Q9DA 2A5LA 4MVYA 4CMEC 1RRVA 3ZDFA 2P5TB 2G9QA 1Q77A 4BEBA 4CFYA 1BWQA 3I64A 4RH0A 5F4ZA 5KYVA 3FAZA 4K9OA 3EVCA 2QX9A 3ORYA 3Q1KA 4OMDA 4GX2A 1VFNA 3GW8A 3AHFA 1EM6A 2I55A 2ZIUB 1SQSA 3PC8C 3GAAA 2FPGA 3G79A 3LOUA 3OZIA 3AW9A 3PPYA 4X8MA 1IUNA 5BW5A 5GINE 3ISTA 1TUBB 1N2IA 3BDAA 2W6JA 2FPKA 4A4DA 5JDIC 1M5RA 1NLZA 3EQ2A 3EFOB 2JDIA 3D6UA 3FCYA 5BURA 4TQAA 3A1DA 2CNLA 4LVCA 1FMCA 2YV1A 3UCEA 1XTSA 3UFBA 1UEIA 4BBPA 3W8RA 1ZZEA 1NW8A 2PJUA 2GPYA 2QYTA 3MLAA 3IJRA 3EZ9A 3MPUA 1XJCA 2PLFA 4HVCA 5TS3A 5TQ0B 4CCYB 3VR5A 5LWQA 2O6HA 3G0CA 2OO5A 1W46A 1RXYA 2VOJA 3NTLA 2JJ2D 4MV4A 4AXBA 3J81k 2PJZA 3AIOA 3KDPA 3Q88A 4YT5A 2JARA 1S4QA 1W4AA 3N05A 1CRQA 3FLMA 1K66A 3SMVA 5M2QA 3WBJA 4U2KA 5G1NA 5KKNB 4ABTA 2B1RA 5K7SA 4Q66C 5CH8A 3TLCA 1VE7A 3QJYA 4KXUA 4PBRA 3BX1A 3VSAA 1XOIA 5JU6A 1QGDA 3PDIA 1R88A 3IEVA 1LNSA 3E1GA 1ADCA 2HPAA 5LDDC 1YZGA 3VR4H 2DQKA 1SMKA 2DR0A 4K81B 3WWCA 2B92A 5ARBA 4L5CA 1J22A 4D46A 4EJMA 4FC7A 2ZCJA 3JZFA 4MS4B 4CM1A 2WQ6A 4PCAA 2DWOA 4GMHA 1ENOA 1PJ8A 1LLCA 1UOEA 4G1BA 1E9CA 2YYAA 3E5RA 4HDNA 5MGNA 3CJTA 2Q0QA 3MWKA 3F3KA 2ZT8A 1KBZA 2PXCA 2BMEA 5KINB 4EB6A 1TQDA 4X41A 5EESA 2ZUWA 3DAFA 3S55A 3U7HB 2XITA 3D6AA 2NQ2C 3A6DA 3PJGA 4XWTA 1WB4A 1Q20A 1P5ZB 4D4LA 1S3GA 3FYTA 3NC1C 1ZM7A 4YDHB 3WGJA 4V0RA 3ZVNA 4UNPA 1JDJA 1GA6A 4FGUA 5L3ZA 3E3NA 2AWNA 4FMPA 4R9NA 4CLEA 2JCGA 2N1MA 1Z82A 4L4UA 2H9AA 4HBGA 4UDNA 1E5QA 1HDEA 4ENWA 1H6DA 2EJWA 1UMDA 2H5IA 4Q3CA 1QC5A 4BP3A 4KIWA 1WP9A 3KWLA 1KJ8A 3MJCA 5TDHA 3U7RA 5KB3A 4KJZA 3IT3A 2VHXA 5L7YA 2Q4BA 3TQFA 3UZUA 4BEWA 5AVYA 4G86A 1CJCA 3DYVA 3HV0A 4EUFA 1LTKA 3RK0A 2GLUA 2L2QA 3M1YA 3R9WA 3EF0A 2ADFA 1II8B 3GEHA 3L1HA 1IRXA 1NBME 1ZIXA 3LTNC 4BZPA 3DP9A 2QTMA 3OTGA 2XMSA 5HP4A 1K63A 2I99A 3ANSA 3QYAA 3LY7A 1PVOA 3HFGA 4E7PA 1TT5A 2V6BA 1QG6A 4M9XA 1EVQA 1KFKB 2I7CA 3X1WA 2P79A 1D6JA 4IS2A 3M9LA 4P81A 1WEKA 4HNHA 2RAVA 2XUQA 5HJEA 2J3DA 2M1XA 2MOKA 5CXUA 3PV0A 2HCRA 1WMEA 3O4HA 1NNI1 2MTBA 3KDSE 1KWGA 1GEGA 1E7WA 1T24A 2XGGA 3PNQA 4R1UA 1MHPA 2JBAB 1F3OA 4CM9A 2IOFA 1JILA 4JKYA 5CVCA 1FVHA 1MAHA 2NZJA 2A86A 1LK7A 4O2AB 3DC2A 3OCXA 1B76A 1QO0D 1ZICA 2FGJA 3EDRA 3KEGA 3RTCA 4AWAA 3T7EA 3WSWA 2HL6A 5KNDA 1PR2A 5KVCA 1DO2A 2VP0A 4AP6A 4UPEA 2GM4A 1RM3A 1Z17A 3ZCSA 3L1KA 2GPBA 1U0OC 4FFBB 3ASYA 3SC2B 1RBZA 2X8WA 1GZHB 2VNJA 3ESZA 4EG0A 3GLHB 1SXGA 1F1BA 4G9BA 1Y3DE 4RNCA 1D5WA 7GPBA 2ZBQA 2Z57A 2NQTA 3PKIA 4KQJA 5TB5A 5F2NA 1BVUA 4GNKA 3D4BA 4OHMA 5AHWA 4P7GA 1PFKA 4DKXA 4UUOA 5AJHA 5CB6A 2YMQA 1TGYA 2HF2A 3AM4A 4CGYA 4BTLA 1T9HA 2BEUA 4TMZA 4PHTA 1REQA 4FKZA 4HWPA 2X3UA 1H4SA 1V96A 2FPMA 2EATA 2O14A 3GRCA 4ZZ0A 5KSWB 1RTTA 3F5MA 4NKRA 4OAPA 3R9KA 1S96A 3RG8A 4LJ9A 4RZQA 1UL1X 2WTNA 2VYNA 4XJXA 4Q05A 4DQXA 4DRYA 2FLWA 1KEVA 2R6GA 2XT6A 3SSMA 2H1OA 3CV3A 1NULA 3K70B 1H3EA 3FSRA 2CL7X 1BVRA 3GH3A 1Y98A 1GQFA 1ZA1A 2IUFA 2EYQA 4WECA 1CZLA 1ADYA 4N8EA 2O2JA 4AJ9A 4ASUD 5DNCA 1KMCA 2AC4A 2DUNA 2DQSA 2BUBA 2FRDA 3EWSA 4TVBA 3C4QA 4YJFA 4CQMA 3LXRA 4I6JA 4WUTA 1DBSA 1RPNA 3VH1A 2Q0SA 4XVCA 5KWJA 4MV5A 1AQ6A 1JTEA 4FYXA 3IEKA 3ZNPA 3HYSA 1A9QA 4U8GA 3H11A 2QZJA 5J4KA 1BXGB 1TJ5A 3WJAA 5REQB 4DLYA 2ZTMA 2F55A 4WERA 3EARA 4EOGA 3SZGA 2ZDGA 5AIBA 2WHYA 3DE3X 1OZ0A 3PXGA 5K4AA 1WEHA 1JHDA 2OO5C 3R4CA 4MWCA 3T7TA 3D4LA 2OPHA 3VBCA 1UXKA 2ZIXB 5FOSA 3WIVA 2I2FA 9ATCA 1XQWA 5F9FA 4G1EB 4P1ZA 1IUOA 5K0ZA 1KVQA 5A4FS 2QE7A 1DEHA 3FMIA 5EZSA 4BWVA 5EKTA 2EKQA 5JIBA 3D8BA 3P9PA 3IAS6 4KPEC 3DF9A 1P5HA 4IVRA 4PLTA 1GUZA 3FF1A 2V7EA 1LC3A 1IY1A 3PL5A 4ZVNA 4B3GA 3FCSB 4NHOA 3K96A 5F77A 4AS3A 3VJLA 1Z4PX 2O2GA 1U2DA 1PIWA 5CLQA 2GN6A 4D9EA 1P5RA 1U0JA 2H1IA 2YMPA 4HYQA 2H8GA 2G1UA 4O4LF 1O95A 2CMFA 3QW4B 1PS0A 3OKFA 4AZWA 2B4TO 2NG1A 5JNWA 1Y80A 3UQZA 5DIZA 4B71A 1JFFA 1SN7A 1BEEA 2O50A 3GIDA 2W22A 4R68A 1DKMA 4CIVA 2ZM6B 3FWYA 4WLNA 1EVZA 1GFSA 3K0FA 1XQ6A 4TUYF 4H7HA 4RWEA 5JLAA 3CZPA 3VOSA 1WABA 5TF4A 2PPVA 1KQGA 1B00A 2B5VA 4PAMA 1IIBA 4NYMR 1RI4A 4DXHA 3T7RA 4UTNA 4GQIA 5ADVA 3OZTA 4HGZA 5EJFA 5HA5A 3R7SA 1STOA 1P1FA 2UZ1B 2H9YA 1KDRA 2CE2X 1P29A 1PN3A 1T5HX 1TJYA 3PF8A 4AUEA 1FVXA 3JQFA 4YASA 3P2IA 2X0RA 2O06A 3AJ9A 4PXSA 3A3YA 4R5MA 3K9CA 3MJ4A 4PQEA 1TU3A 5LUAA 4TXNA 2FQ1A 4YHHB 4W9RA 1RYEA 1U2EA 5INTA 1I7SB 1ZUNB 3G68A 4K1LA 4LZJA 1SQFA 3NHAA 1URPA 3CX8A 4HRAA 3HBAA 4RKEA 4X1YA 5E3JA 3THOA 1GJRA 5GTDA 4QPZA 2C2ZA 2FEWB 4F2DA 3H5NA 4K88A 3E0XA 2DR3A 3H4VA 3STXA 4NFYA 5I5EA 1J7JA 4HEA6 1E32A 2H1VA 2X8JA 1JLRA 2XQVA 5KOIA 1GQRA 3L7NA 2QI9C 5HG0A 2V96A 1ZIPA 3GY0A 4UTVA 3JQQA 2XA1A 2POCA 2XTAA 4GI3A 3PQ6A 1LSJA 3IURA 1B6TA 5KSPA 2QTVB 2YHSA 3EIFA 2GPNA 1S7GA 1JHZA 4HOYA 3F6SA 2ZBDA 5K3SA 1QHEA 3FPHA 5IN5A 4Z4GA 1V95A 4LY0A 3WV5A 3VPSA 4GRIA 4HK4A 1PJ3A 1LXCA 2OD2A 5LN1A 3L4KA 4DCCA 2LWIA 2XNDA 3IP8A 1M2GA 2QLJA 1T5IA 3ER6A 5I5GA 3U17A 5A6SA 2DRIA 4FI3F 4WACA 4OREX 1HTBA 3QG1A 1E3QA 4KQHA 3R6GA 4ALJA 4EAQA 4F85A 3E22B 4PHCA 2XVZA 4XGQA 4OP2A 4DRXB 1OXTA 2O1EA 5AKGA 1NBAA 1XDWA 3B5IA 3G8AA 3KPJA 1HLFA 1DV1A 4QQKA 3UV3A 2YWDA 1GUFA 3WTCA 5CK4A 5AD1A 4BFWA 1SCIA 3H5WA 5LQNA 1MVOA 1OT3A 1I1HA 1NQWA 2WG0A 3GFBA 3Q6MA 4NWIA 1MMFB 3LFUA 1KSGA 4BKQA 1G8GA 1X92A 1YU9A 3BZWA 1F2DA 5B1DA 5BV7A 2NPIA 1DAOA 3PTAA 3DO6A 1E1QA 1DQPA 3UV7A 3ZWCA 4G24A 2OHVA 2PGLA 4W5HA 3MF4A 4ZPXA 1E2UA 5DYYA 4YDRA 4WKGA 2F8SA 1RI2A 4RZXA 2VF2A 4CU5A 2PO7A 2E4VA 4YUYA 4Y2QA 1F12A 2J5RA 3OOEA 3RBXA 5CFLA 3HG7A 1AMNA 1E1MA 2YOGA 4KR6A 4MI3A 5AVQA 2V5UA 3K09A 3F96A 3K8QA 3LX8A 3NYQA 1IJBA 2ODEA 5A3RA 3KQTA 3OWXA 4YIKA 1BSVA 3PHLA 4O5OA 2DR2A 1G4UR 2HK9A 1O5OA 4QXAA 4UUPA 2ZRAA 2NWQA 3M2TA 3THXB 1GSHA 4Y0VA 4HDSA 3P0RA 4ND8A 3U61B 3F74A 5JYBA 2IEZA 2FRDC 3E9YA 3KSZO 1HC7A 3IPAA 3NAZA 4OXKA 1O94D 1BMQA 1Q57A 4HQRA 4C2UA 1FSPA 3KQMA 1MF7A 2PGJA 3KLNA 821PA 2FHSA 1QS0A 5JNRA 4LVNA 2OR3A 5C8XA 1HDGO 2E9SA 3HXPA 1FX0B 3CX4A 4IDQA 2H4FA 3UB4A 2YDYA 3DT9A 1ZJ4A 3EQ8A 4YWHA 5C46F 4KMOA 4S0XA 3OIGA 1BRTA 4EKEA 3MBIA 1IOZA 2VKQA 3KZOA 3LIIA 2O5VA 1BOFA 1JIUA 1YS2X 1TA9A 1KVUA 1G4HA 2P41A 2Y9MB 4LE2A 1X74A 1EHIA 4RADA 5CYPA 3RYFA 5LPNA 3M6MD 4BLUA 4UNRA 2JG3A 3Q85A 2UU9B 1Z5GA 1VI6A 3I9JA 4OMCA 1U4SA 1K6MA 2PZLA 4ZWNA 5T7BA 4BFVA 5BOSB 4U63A 2G6TA 3H0KA 4J07A 1RC8A 1ZOLA 4G9GA 2IK8A 1M7HA 1W44A 3MJEA 1GPMA 3M1LA 3TSAA 4F3CA 2EL9A 3I01A 3Q9NA 1R8SA 2QZZA 1NW5A 3SOZA 3G0GA 3RC7A 5C80A 3L8GA 2H52A 2KBEA 3A14A 4MDFA 1Z4MA 4NBVA 1YE8A 3RO7A 1QG4A 3F97A 1E6UA 3G7UA 4ZQBA 4G4SO 4GO1A 5CB4B 5IKPA 5ES4B 5BV0A 1Y9JA 2I1VB 4PQFA 3SHVA 2XB8A 3ETEA 1U2DC 1Z4IA 1UJBA 2IF2A 1RM0A 2M32A 3O8BA 4IR7A 4UZEA 3KJNA 5EYPA 3MS4A 3W5CA 1T13A 5B6PA 1HFJA 1GPKA 2P9YA 2Y68A 3KYCA 4XOUA 2QS9A 1XQXA 3ZV3A 1O95C 2FWAA 3DS8A 2IEDA 2WYVA 3C3CA 3HPRA 5FHQA 4KOEC 2QU8A 3VPGA 3VYTB 1C9DB 1PGJA 3SXUB 4EUKA 1A9ZA 5KHLB 3TRHA 4DTIA 4WQMA 3BGWA 1YQ9A 3VVLA 4TYPA 1MAWA 1ITZA 1MV8A 2PT5A 4ID3A 5AOCA 4PN3A 3WGVA 4BLSA 4CIWA 2H17A 2B8TA 3OZWA 4U5QA 1MGOA 2IRWA 3IP5A 1EFHA 4RHXA 5A05A 2JFFA 3HWWA 3PTLA 4I1RA 5DCUA 1TU0A 4OJMX 2KJQA 4G1FA 4Q4LA 4CL2A 2CLFB 3R8FA 1QGOA 3NM6B 4DMRA 2MU1A 1HDIA 1R15A 2O3UA 3DKKA 4Q9IA 3W4IA 4NMHA 1KJQA 3EZNA 3HFRA 3FPKA 2CFRA 3QP9A 4BE7B 1WA5A 2GOYA 3NP7A 4FK8A 1V3VA 3U39A 3JQFC 3K32A 1OZHA 2H0RA 1UZMA 2OLEA 2Q3HA 5TJHA 4H1WA 1TPYA 1FSZA 1IUKA 1BVHA 1WV0A 4E3ZA 1C7FA 2IYPA 2V54A 3NOVA 4QPPA 3B1XA 3V6LA 3ZWAA 2UUAB 5JATA 4GI1A 4NTZA 1D9XA 1A4RA 2FZEA 2GK7A 4TTTS 1H9AA 2QG9A 1L7DA 5BWBA 1XZNA 3IIEA 4F97A 4D9HA 2NSYA 2AOXA 3PPXA 2F00A 3NEJA 4UVEA 4YQEA 4DA9A 1T29A 3L7OA 1FVFA 5JMPA 3SHQA 2VL7A 2UYHA 1MC5A 3AUAA 2X3YA 1NAHA 1KE2A 3T5TA 1WDTA 3ITEA 1JU3A 1KJ9A 3U31A 4ENQA 4TYNA 3DHEA 3SNKA 4G5QA 1VMKA 1NPYA 1PL8A 3A6HA 2WWGA 3JU3A 3AJEA 1KDOA 4IJ6A 3WQSB 3UWMA 1Z2DA 3IO3A 3K4QA 2AZDA 3V55A 4C4TA 4GEKA 2C2OA 1KI1A 4R3UC 3X2EA 5ITZA 1Q1EA 2C92A 2FE1A 1NUPA 2AZXA 1OH6A 5TPZD 1SXQA 1EA7A 3NNSA 1J2EA 4MVCA 1X13A 2QYSA 3R75A 4JQSA 5ALNA 4PR3A 4O4IF 4WZBB 4HQ0A 3DWGA 3EXG2 5HDQA 4FYWA 4TKZA 2X9VA 3KLPX 1WCIB 4DN6A 2DLCX 1NRJB 2ARKA 5PGMA 3ZGZA 4UHEA 1W0JD 4YAGA 4Y1GA 4WW0A 3B2QA 1A9SA 4RHCA 4YR7A 1XO1A 2RI0A 3E7DA 4J1SA 4OQXA 2HMVA 4P5DA 3L8ZA 4L3OA 3FPFA 4DMGA 5ED0A 2YVKA 2AMJA 4BMXA 4DM4A 1JW9B 1RJ9B 3HJCA 1C1XB 2YFYA 4UNSA 1K9VF 4B4OA 3L05A 4P7KA 4WA8A 3R7WB 3ZHQA 3FFTA 3SN6A 4IIHA 4QOHA 1E79A 3TM4A 2NUPB 4HQFA 1NVAA 5AXBA 1YUMA 2HDOA 2Z8YA 4MW2A 2LP4Y 4LHYA 3E70C 3KXPA 3K09C 3WV4A 5FIUA 1JIVA 4MQ5A 1N0UA 2FN3A 1Z2PX 2O2HA 4Z8XA 2XRMA 1ETUA 1YB5A 2ZT7A 1BS1A 2NZ8A 2XWSA 1G4AE 1U3GA 2D06A 2WNSA 5DYIA 5JZOA 2J0UA 3LLMA 4WZAE 3QBTA 5AVZA 3DVAA 1YV9A 5KQRA 3PHIA 3GGSA 4RY0A 3P45A 1X1RA 2G67A 3FUXA 5K9ZA 3NM4A 1A72A 4B4DA 3KOOA 3AKYA 3IQWA 1TB4A 1AXEA 4Q7JB 1Y4ZA 2QRVA 5LIRA 4YJDA 5TXGA 3TMYA 1NPTO 3HBFA 4JJ6A 2ZBRA 4OQPA 3FUCA 1FP4B 3ILYA 2ETXA 3IQDB 4BAGA 4E5UA 5I48A 3AMVA 1GZ6A 4MLDA 2KSQA 5TQVA 2UXBB 1E2PA 3F3MA 1X1CA 4DUGA 1FEZA 1BE1A 2I8LA 4MWDA 2H63A 4MVXA 3DDNA 3QNMA 4UXIA 2IZ0A 3NWOA 2PUDA 5FWNA 2HTFA 4NF2A 2W0SA 3DZDA 3JS5A 4IH9A 1PR4A 1DTEA 4MUGA 2P5YA 2UYQA 3KRTA 2J9XB 4NK5A 5EN4A 2PNJA 2WT9A 3TL2A 1AHHA 4UE3S 2EP7A 2NAFA 4AY3A 1GPWB 1RYYA 1Y3IA 1YD7A 4DJEC 1KMHA 2IUEA 2ZXUA 5HBRA 2WM8A 4PO9A 1GPDG 3ZY5A 3U60B 2P2YA 4QJ4A 3DL4A 1FNSA 2Q0XA 1UK9A 2ZBGA 4KRGA 2HM7A 4C3ZA 4H17A 4I1UA 2GWRA 2XTJA 4QDUA 3GPDG 5DLYA 2O8DA 1KP3A 4X1KB 3NCTA 2VDQB 1K0FA 3YASA 5AW7A 4M49A 3HP7A 3BCUA 5G3YA 4CHGA 2DHRA 3UEOA 4X92A 4ZP1A 5EEHA 4X60A 1LF5A 1USGA 2E3JA 5FBQB 1N2CA 2EFJA 2P0EA 3S3TA 4UAGA 5C8YF 2XADA 3O8OB 1NVKA 1WW3A 2CXNA 1V41E 2QB5A 1XCOA 2PN1A 4X94A 2FVYA 3N1UA 3LTEA 1D7AA 4DLLA 1FRNA 4PQGA 3A37A 2BHNA 3RWMB 3NMUF 3FLBA 2R8OA 4HLDA 2GNAA 4RS3A 3RJ9A 4MPTA 3RVQA 1BNCA 4Y2UA 2OG1A 3ZHCA 1KVRA 1V45E 3IHWA 2QUAA 1BDIA 4QGAA 1YNSA 3NVKI 3OZSA 1LDYA 4GX0A 2OCIA 4MTLA 4EYQA 1LF0A 4HXEB 5FRDA 4ARBA 1AO0A 3UV6A 2IITA 1H3FA 4NICA 3LPLA 2C3UA 4ZAFA 1GL9B 2ANCA 3TPZA 1ETHA 1H2XA 3QV1A 2ODNA 4QARA 1JJIA 1QX3A 1EM8A 3A9UA 4RA9B 2H57A 1W52X 3FZYA 2GVDC 4UJ3A 2J3LA 4RW0A 5E7MA 5FUQA 2O19A 4V0MA 1IL0A 2A0UA 1LNQA 2G5GX 4J49A 3R09A 3PQ2A 1KMMA 3AP3A 5EWLA 4F6CA 4XVUA 3K15A 4IUYA 1XNQB 2DG2A 5CTAA 4MIYA 3IKJA 3CZ4A 2R86A 2ZYSA 5I47A 3BK7A 4OB8A 2ZZKA 3MELA 4NL4H 4EKDA 4QVIA 4QA9A 4OFBA 3WIBA 5FWYB 5IAOA 1Y1SA 3WC4A 1QHGA 3ETDA 4OV6B 1UWCA 5E4JA 2V3VA 1QX4A 2WG2A 1SIOA 4S12A 1RWMA 4DUYB 3P0HA 1UXGA 3EQ7A 1IOLA 3N7UA 4KQKA 4Q48A 1L4NA 2B61A 1OLOA 2ZTHA 3AHCA 3CUVA 3IR7A 3QEJA 5JSQA 5AIAA 3QA9A 3BS4A 5A4AA 2ILTA 3AHIA 4LNUB 1QDUA 3LCCA 1QB8A 2YYSA 4WHMA 3GUVA 4RPJA 2HDWA 5AWFC 5I8ZA 3OM1A 5AW9A 3QH4A 4CKCB 4WT7A 1Q17A 2VK1A 1DJMA 2B7BA 1K2WA 3HB1A 3K30A 2OXIA 4NV1A 4RQAA 4B3RB 2F4VB 4KJXA 3QPCA 1KAMA 1F38A 3KQQA 3ZOZA 1P3Y1 2Q6IA 3MTDA 3O4RA 3V34A 2XMQA 3HNPA 2O8VA 2QTLA 3BIOA 2QX8A 3F8TA 3OCVA 3TJMA 4BFUA 4QU9A 3V7NA 4DWJA 4V3BA 2MMGA 5B2FA 1PAUA 2O0KA 1ID8A 5CVTA 3O3CA 2QTNA 4HXGA 5F35A 1IVSA 1D9ZA 2UZIR 1ECCA 1WUKS 4FQ7A 2CYCA 2WICA 4FW9A 4BN4A 4TYYA 3DZIA 3T1VA 1QR2A 4DV6B 1U6KA 5IMBA 2D2VA 4GH5A 3X44A 3GVCA 3KOMA 3GVHA 3DFUA 4IH4A 4YJ2F 3V4VB 4HVTA 5AT1A 3BE6A 4ZVKA 3DEKA 2A8YA 4W63A 1E1YA 1JLLB 4LBVA 3E4DA 3H3FA 1WP4A 3WMGA 1AH2A 1XCMA 1BWSA 2M98A 1Y8ZA 4X3OA 2DBZA 4INPA 4EFDA 4PZLA 1ORIA 2EFDB 4EI2A 2ADMA 1A4UA 4K6OA 4NFLA 5DNYB 3ICQB 3OSZA 1V43A 1WV1A 4PE5B 3HNOA 1M33A 3ZVLA 1O03A 3WZMA 1D2CA 5GGYA 2PE5A 1D4FA 1IEQA 1DZ3A 4EY5A 2ZRIA 2HWXA 3EUFA 1GNLA 1CF9A 2I3ZA 3NAQA 4K9NA 4X63A 2JBAA 4RU1A 2JB9A 2Y76A 1OLXA 1NC3A 3D9QX 3IT0A 4X8HA 2QDKA 5EJGA 3RUHA 1MHTA 5KYTA 1U1FA 5AKIA 3IQZA 3S27A 3S7ZA 4JR1A 2PUGA 1KRWA 5T3UA 3D0RA 4AX4A 4G4GA 3TIIA 3U81A 5DBIA 4EENA 2OZPA 1JZTA 1U8FO 5DWQA 1A69A 4Z1OA 4LYYA 3L0YA 1A2QA 3G5UA 5EAIA 3JYNA 4G25A 3GLHA 1L8LA 3GFQA 5SZIA 4RZUA 3GEEA 4Q7EA 2PLRA 4AZ3B 2F90A 3VYWA 3ZD8A 2JJYA 3LX6A 1U3FA 5I9MA 5DGTA 3W6PA 4RELA 1RJDA 3E9RA 4CMKA 5B4VA 1T0HB 3OAAD 2Q1WA 5JYCA 4XR9A 3E61A 1DEXA 2WWYA 2JLYA 3P9YA 4H7DA 4Y2GA 2F9MA 5CEJA 3OBBA 2JHGA 3U7JA 2Q3BA 1J0XO 2J8ZA 4KR0A 2PV0A 4DDMA 5AW3A 1XTBA 1V7PC 2XVXA 1G7SA 4GZMA 3I4LA 1R0RE 5GIOE 1X7HA 1KJWA 3KOYA 5JCJA 4UC0A 2WYIA 3WNDA 2G08A 3ACBA 3LX5A 1A2KC 3G02A 3M70A 1E2JA 1ZC3A 3I4CA 1KU6A 3P0FA 1M72A 4LJYA 4XX1A 3CXRA 2XMRA 3ESYA 4E94A 2P9HA 3TOSA 3UJ7A 2WU3A 3PNYA 1YBVA 1LS1A 3M89A 2QL7A 1QFXA 5TQ2B 2R7AA 2OEPA 1AKMA 1C4XA 2ZRMA 3CYFA 1UWLA 4CV3A 5EINA 3VVBA 2WHPA 5REQA 5A7HA 1HTTA 1BMFA 1ZP6A 1WMFA 2RGAA 2GB4A 3K70D 3FWKA 3GHHA 2R5NA 4B3FX 4W99A 1EKXA 1M6EX 5FTJA 5EPUA 3IMEA 1HG0A 4IFBA 3G7NA 3C4JA 3RM3A 3WIDA 3CMCO 5ICMA 1E61A 3OKCA 1ABBA 4F1WA 1T5BA 1P1HA 2QW1A 4PFJA 1R3DA 4ZV7A 5JADA 3OD5A 3SE7A 4EVRA 2I91A 3KQYA 2PAFA 1ZVVA 5IDXA 4TSKA 2PZAA 2TS1A 3LSYA 1M2EA 1QB7A 3ZJ4A 5EVJA 4KB5A 3OIVA 4KFRA 4KO8A 5D86A 1KZ1A 4BMDA 2Q49A 2RAUA 4MA4A 4FSHA 4IX9A 1D1PA 1U2RA 2GTHA 2QLLA 1V11B 2D2IA 4JP3A 3H86A 1MG5A 1SHTX 4ROTA 1MORA 2WD7A 3BIFA 5ARCA 1G55A 2HADA 2YX1A 4W5TA 4I4TB 3JQAB 1IY8A 1ZY2A 3I0NA 3KJIA 3L0OA 5HKKA 3GP8A 1GTG1 5CT6A 3S6JA 3FNIA 1ZVJA 2IQ5A 1VI2A 4MMXB 4RABA 4CI0B 2Q3EA 4JEUA 4LZOA 3I9KA 3IAAA 4HDOB 5EJEA 4QM7A 4WX2B 1E4EB 3HBMA 4HWTA 4J4HA 5U4XA 1ODCA 5CNKA 1SC4A 1ZJWA 2J6CA 1N6PA 3A1WA 4NNJA 2B6NA 2DC1A 2P35A 4B6EA 1OPXA 1IHPA 3A9TA 1UBFA 1XDGA 1Y1TA 2FPOA 2P6UA 4AAYA 1YVPA 5E3HA 1ORVA 1M8JA 4NZYA 3A6PC 4YAKA 3TSOA 4BVGA 3K0CA 4GU5A 4D4MA 1UDWA 4ITRC 2VPZA 4WBNB 2DPGA 5THKA 4WLFA 1QYDA 3UKJA 2DAPA 3L4EA 1J7KA 4KZKA 1M7BA 1M34B 2ALJA 4TLDA 1LRJA 2J3MA 4ENTA 2WB4A 3B3FA 1ZD3A 3C1UA 4LY3A 3UMRA 2CFTA 4BGIA 1QFJA 2DQYA 4BVAA 1QCZA 4D0LB 3TNFA 3DKRA 3LX4A 4UQLA 2PUFA 1HYEA 3OTHA 4LGVA 2HDNB 1B26A 4DCUA 4IHAA 3DLTA 3P2MA 5D1NA 3ZV5A 5J2UA 1P7VA 1VE9A 5C53B 2J4DA 3L7MA 1C4OA 2D5CA 4WEQA 3U09A 2EF1A 2CJWA 2NAPA 3AONB 2PA0A 3E27A 3E9MA 3HZHA 3ZQJA 3K6SA 1QPGA 3TCNA 5ITSA 3L1JA 4KFTA 4KDFA 1T5SA 4NIMA 2J33A 2R85A 1YOVA 3N6RA 1R16A 1NG1A 4A1OA 1P31A 3QUTA 2HV8A 1NBOA 4J1NA 3WK4A 5HIIA 2PRSA 4OKNA 1WTCA 3WRWA 4QVKA 1VMDA 2X8BA 3QXGA 1CF2O 2C29D 5ADUS 1NZDA 3KKLA 5FTWA 3HDYA 3TQHA 2HZ7A 2VC2B 3U4HA 4DUPA 3O4FA 3Q7TA 1WCXA 4GNRA 3ROGA 5JQGF 3X3HA 4K3UA 5DW3A 1A3CA 2P3SA 3JAKB 4Z54A 1T1JA 1IBKB 2Q2QA 4HPXB 4PZYA 4QPDA 4BKRA 1AZTA 1EB8A 4HNAA 3OY2A 4DRXA 3UPTA 4B80A 4WWHA 1I3NA 2EP5A 2H3HA 3KE9A 1GR0A 2W11A 2JGJA 4MS1A 5EUQB 1CYEA 2HT1A 1SCKA 3ZU6A 3TKLA 2W2VA 4L0CA 1NW9B 3KPWA 3BH0A 4NJOA 3UKOA 4MW7A 3V7UA 4IUCS 3O3OB 3QLVA 1OPRA 4NAHA 4U3JB 4W8GA 2VUIB 2Q3LA 1XLTA 3DE4X 4FFDA 4X64B 4MDHA 2C54A 4E88A 3SHTA 3SM9A 4NYMQ 2VH2A 2WSIA 4WIAA 2EC5A 1VHTA 4FMDB 1AU9A 4P98A 1OX6A 2NYVA 4Y2XA 3WK8A 4ETIA 3DEIA 2H4XA 1C4KA 1PBNA 5U1PA 1L5WA 2D5LA 3CO5A 3GP5A 3GUZA 3B1YA 4PX3A 3CNHA 4UM7A 3QFFA 2HK8A 5F78A 3PS9A 3CZQA 4C4XA 1ZHOA 4U0JA 1ZK4A 2PZMA 4I5GA 4QYIA 3UUFA 4DHEA 4LXIA 1F20A 4QBIA 5IKXA 1JDUA 5EZYB 3K0KA 4UAJA 3I83A 3A28A 4BTEA 4BMVA 4DM7A 1OE0A 3JYLA 1ZS9A 3BZUA 3D4OA 3GDOA 3WJ2A 1QUFA 2X0KA 2D1SA 3C7TA 3U48A 1AQJA 1VIMA 2D2FA 4FE3A 2LDXA 4W4TA 1Z5NA 1RS0A 3TZ6A 2WAOA 2AOWA 2GK3A 2YCLA 1CJUC 4FCCA 5JJLA 3HC7A 2AOUB 1FX0A 1Q0LA 4GD3Q 4Q37A 1JVSA 4OQ4A 4C89A 3OCJA 4Z0PA 4OXYA 3OTOB 4BDTA 4D6PA 3CLVA 1GNSA 3EZLA 3L77A 3U5ZB 4PYMA 1I7NA 3GLHE 4LSMA 1FTWA 5EJAA 5B3AA 3U0VA 3VGPA 1JR3A 3NKFA 2NTEA 4F6LA 1ST2A 3T4PA 3FMPB 5TT0A 3C7AA 3QPAA 4LXGA 4E08A 3CLSC 2DWCA 4R2LA 1DKNA 1R8JA 4EHFA 3GCXA 4EG7A 4ZGWA 5AW0A 2AOTB 4K05A 2IS6A 3PR2B 4UM9D 4ZEWA 2GF0A 3WFIA 3TTWA 5TGDA 1ZJ5A 4QOSA 5TRTA 1MV5A 1XEWX 3QUQA 1WOYA 3H5AA 3ZS9A 4N76A 4EUNA 4ZHQF 4EUSA 2AXQA 3ZQ4A 4RTPA 5LLSA 3ZWPA 2P69A 2B4RO 3SYTA 1P1CA 3EEYA 2GWHA 4J91A 4ZMSA 3IKTA 4OSOA 2XF8A 2G72A 5EJ6A 3HJFA 1QZ3A 3ZCQA 3N59A 2ATVA 2XB6A 3PWSA 3FA2A 4YP6A 3PPWA 2O8EA 2ZJ1A 4L2IA 1JUDA 1N2OA 5EIAA 3K5IA 4AXXA 5CH3A 5KJ1A 3SE0A 4LBWA 4EA6A 1M1NB 3IKMB 4FXOA 3P2OA 3T8YA 3PRYA 3F49S 3MWJA 4FOLA 4MQEB 3AB7A 5ECDA 2ZB7A 1TAHA 4OHXA 2BE7A 3VNBA 4DDWA 1QBKC 4H31A 3AETB 3QTBA 4PZUA 3EISA 2GCNA 3ZIAD 3KJZA 3WLFA 3IYLW 4KLRA 4RAOA 3BE8A 3SX4A 3WLTA 3U44B 4BFXA 3CZAA 4V0QA 5D3QA 4KQ2A 1PQWA 1PYDA 1ZUWA 2C4UA 1B3RA 3IOCA 2WIBA 3TLGB 3WQBA 3DJFA 1AKEA 3C39A 3K0CC 1FDVA 1G8FA 3E8XA 4QRIA 3LF2A 3SF0A 1ESZA 2X42A 1TM1E 2R2GA 5CVDA 5FUWA 3ANYB 3UB2A 3DCJA 4GRAA 1DCMA 1YT5A 2D7JA 3GROA 2NX2A 1FDWA 4PTLA 5HJ7A 3PJRA 1QLWA 1Q11A 4WKCA 1GCIA 4RXUA 4HQ6A 4YP9A 1AHPA 3EVDA 4NOMA 1BTOA 3AHDA 3H42B 4FB4A 1RU3A 1W85B 4DG8A 1JA0A 4TKUA 2B37A 1HH4A 4P4LA 3S2FA 4EDFA 4D45A 3RHSA 4WOBA 1W2WB 5JFTA 3R2JA 2VSFA 3LXXA 1NRXA 2AW5A 3I42A 3X1DA 1E0JA 1U7DA 2VNAA 1U8ZA 3A6KA 3M4YA 1NUHA 4WDRA 1ZM4A 4D6YA 1TUIA 3CWCA 2AI3A 3S99A 3ZHBA 1KYIA 2JHFA 2H1WA 1MNAA 2ZJFA 2PSEA 3BRCA 3HUTA 1ENPA 4TXLA 4UD6A 1AV6A 2B4YA 3TIXB 1CLEA 5CGZA 1B93A 4FS8A 4OQLA 4PC1A 2CLLB 1PGPA 3CXUA 4P58A 3THWA 2C7PA 1U2GA 1LLFA 1YONA 3NLLA 2OLJA 3KKEA 2I1WA 3WISA 4ZYXA 1JJ7A 1ICEA 5CLHA 3U7QA 5CK5A 1ODJA 1OXSC 1S2NA 4JU9A 5JQWA 3V2HA 3ADBA 4EY3A 3EAQA 3BPSA 1AVTA 4HD8A 3GBVA 2VDPB 3I37X 4J94A 5AVRA 4H7PA 4AZ3A 7MDHA 1SK9A 2V1UA 4XRGA 2PZBA 2R0QC 1XZDA 4UU7A 4NG4A 1DMRA 2ZUFA 3P9XA 4YJ3B 4H7FA 5DXAA 1R5BA 2DOKA 5B58C 4M3NA 4WZBA 5BNWA 4LAFA 3KKPA 2JS7A 1QHYA 4L7QA 1SAYA 1T4BA 2IPNA 1WCIA 3DVLA 4OIFA 5IBRA 3GMIA 4BB0A 4DIMA 1TKBA 3L0DA 1O3YA 4M6WA 3RU3A 2YQ5A 3W34A 3F6EX 2FPRA 2CCKA 3QLVC 4BVLA 3I58A 5FLXA 4N41A 4KN6A 1XLTC 1ND6A 1E0AA 4DZZA 5ARDA 1RI3A 1EQ2A 3LIPA 2HQOA 1UBNA 3ROKA 4EG8A 1MKYA 1DOHA 3TJZA 1TVKB 2IEAA 5KYUB 5FA8A 3ISVA 1RMQA 5CA0F 1C1XA 2D4AA 1XUOA 1TM2A 3R7WA 4CLOA 3HGTA 3OQOA 3PE4A 1TADA 1YOBA 1YR7A 2PVCA 1D2NA 2W4QA 3DZJA 1GQSA 3JWIA 5B3JA 1JG6A 2BMWA 1NQOA 4L8YA 4OU4A 1R0CA 2RKBA 1Y5LA 2WMYA 3KVOA 4WK6A 5AUQA 4CIAA 1XVVA 4FYJA 4LKOA 1AKVA 4GXNA 4BMYA 3PEWA 1HFEL 4P4UA 4C1BA 4J8PA 2AD5A 4Q4CA 1UAAA 5IARA 1QKJA 2VCHA 1U8CB 2Q27A 1PJLA 3EZGA 1G1MA 1ZH8A 4YQZA 5TC4A 3RD5A 1JXOA 5K99A 4MUJA 4U02A 3G2HA 2ZG6A 4XOIA 5FADA