1IONA

The septum site-determining protein mind complexed with mg-adp from pyrococcus horikoshii ot3
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
243
structure length
243
Chain Sequence
MTRIISIVSGKGGTGKTTVTANLSVALGEMGRKVLAVDGDLTMANLSLVLGVDDVNITLHDVLAGDAKLEDAIYMTQFENVYILPGAVDWEHVIKADPRKLPEVIKSLKGKYDFILIDCPAGLQLRAMSAMLSGEEAILVTNPEISCLTDTMKVGMVLKKAGLAILGFILNRYGRSERDIPPEAAQDVMDVPLLAVIPEDPVIREGTLEGIPAVKYKPESKGAQAFIKLAEEVDKLAGIKAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE CELL DIVISION INHIBITOR MIND
publication title The three-dimensional structure of septum site-determining protein MinD from Pyrococcus horikoshii OT3 in complex with Mg-ADP.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Cell cycle
total genus 72
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2001-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ionA00
2P65A 1RYFA 4PAQA 1O87A 3PUYA 3LBIA 1MO4A 4CEHA 2QG6A 3W9YA 4LV5B 3CZPA 1P72A 4QXAA 5H70A 4JS0A 4BZPA 1AK2A 2BCJQ 4TQ9A 1E1RA 2B21A 3I8XA 4BWYA 5B30A 2CL0X 3F0TA 3BOSA 1OH5A 4EPVA 3GJ7A 2ZUBA 1UF9A 4G5GA 4Q9HA 2AD1A 2WTUA 1VHLA 2A2ZA 3SBDA 1TUEA 1E0AA 1E6CA 3RWOA 1TF7A 5AJVB 4A36A 2WMNB 3K9NA 2G3YA 4PO1A 4IEEA 4M9ZA 4QGFA 2ZSBA 3L0SA 3BFKA 4XVRA 4IDQA 2IK8A 1Y63A 1QHXA 1ZD1A 4KVGA 3GJ3A 5FTMA 1KSGA 1PV4A 3CLVA 1F2TB 3S1AA 4JLBA 1JPJA 2GTPA 4B2PA 3I5YA 4PX9A 2ZJAA 1RE0A 1Z3IX 4Q7MB 3HR8A 2H92A 1WCV1 1Z22A 4LJ6A 2R6FA 3OEEA 2G0TA 4QGHA 2O8DB 1E2GA 3CR8A 3DZ8A 3QUSA 3DO6A 3WYAA 3V4FA 3A37A 3GEEA 4NKRA 4A8JB 2ZTSA 3EZ2A 1KMHA 3KKOA 2DWQA 4TN1A 3T1OA 2HUPA 3CKLA 3AF1A 4W5HA 4D80A 4ILEA 3QXHA 3WNBA 2WSSD 3QKSA 4B3GA 2IYXA 1IBRA 3TR0A 4TL8A 1W47A 3MUFA 1KJYA 3ND8A 3P27A 4LBZA 3UMSA 1KSHA 2W0SA 2V3CC 4Q4JB 4L15A 2OESA 1TU4A 3LLUA 1NIPA 1WA5A 3KX2A 4JVSB 1VECA 1KI6A 1U8YA 2IYYA 4PXAA 2V6JA 3NBZC 2R6GA 2HYDA 2O52A 1Z83A 1DE0A 3SJAA 2G88A 1KI8A 1SVOA 2XNDA 2ZETA 4TYQA 1R2QA 5CYPA 2J45A 2GAOA 2Z6VA 1W36B 1RRFA 3SDZA 5FUWA 3OIUA 5BN3A 5KSPA 5J4LA 3GEHA 4V0NA 4UNSA 2QORA 4JLNA 4US2R 4CYMA 3CRMA 4B3CA 4AY2A 3CF6R 2FF7A 4FINA 1RPZA 2SHKA 4PC6A 1FQJA 3ZJYA 4Z1MA 3B6EA 2FPLA 2VP6A 4HAUA 4C0KA 2HF8A 2A5FA 3EASA 1OF1A 3GLGB 1X6VA 2YWEA 3M0EA 3FB4A 4JJKA 1OYWA 4DLUA 1BYUA 1ESNA 3I4LA 4XJXA 2I4IA 1OFIA 2X1VA 1XD2A 3W8RA 1KZ7B 1NMYA 2ZI5A 4B6EA 2GXAA 3MWLA 1Z0DA 4FMBB 5F3WB 2V55B 4PSVA 2ZI7A 1W4RA 5HCNA 2IEZA 2Q3MA 5FPSA 3ZLJA 2ZRKA 3DKVA 3PQCA 3KXKA 1J70A 2W2VA 4TSFA 1LS6A 1RW4A 2WV9A 4ASUA 3WHKA 1OB5A 4FIDA 2VP5A 5CK5A 3P20A 1CKEA 2KBEA 4FMDB 3KKNA 3G0HA 1XB2A 2Q21A 3OAAD 4IFBA 2CDNA 3EC1A 4Q5IA 2PLRA 4BLPA 4B2LA 2MSEB 1G7TA 4KU4A 4GSYA 2ZIAA 2ZAOA 5AWFC 4MRSA 2FN4A 2IX3A 4RD3A 5E3HA 1GTVA 1N5KA 2ZRIA 4F38A 3QPWA 2XB4A 2J3EA 2OILA 1N6NA 1YU9A 2GZHA 5EXTA 1JR3A 3LRPA 3P26A 4KFSA 3I1FA 1K8RA 4FCTA 1Q3HA 2YOGA 5JWOA 3PEYA 5J4KA 3EZ6A 4ZCMA 1G21E 3FDIA 4UNNA 4C0LA 4CEIB 2D06A 4US1R 1U90A 1FPMA 2VHUA 3C7KA 4JT4A 3E5HA 3U5ZB 3KUDA 1HQYE 4JL5A 2FWRA 2O0JA 1F2TA 2HT1A 4PANA 3GLHB 3IBGA 4JYCA 4D82A 2FNAA 4MYTA 2OEPA 3RNLA 4PZLA 1GM5A 2ZU6A 3VNUA 2WWGA 1XU4A 2C9YA 1ZMXA 5AUNB 1RJ9A 1EWQA 2DFLA 3LLMA 5HZKA 2PMDA 1JJVA 1ZINA 3JVVA 3K9GA 1G17A 1G6OA 2GK6A 5L3QB 4A6PA 2O8DA 3U3JA 4BRWA 2B6HA 1UBCA 2G1KA 3UMRA 1L4UA 5IHPA 4KBFA 4L5BA 1UFQA 3VR6A 4A8JA 2HJVA 1G5RA 2ODEA 4LY6A 4V03A 2W00A 5DHFA 2LWIA 3AEZA 1P9NA 2FFQA 5G3ZA 2VP9A 3EC2A 2VP4A 4QG7A 4A4DA 1NVUQ 3HU3A 3AKDA 4UQOA 2BV3A 2FZ4A 1OPXA 4Q4HB 2O8BB 3KXLA 1E98A 1WE2A 5F98A 1E69A 4Q4JA 1G8PA 2IYVA 3SJBA 1B0UA 1D2MA 4J0QA 4DCSA 2ZJYA 2G0NA 5JHGB 1Z2AA 4B48A 3SZRA 1G3MA 1GOTA 2QTHA 3CX6A 4AKGA 4JMPA 4MGYR 4IW3B 1T3HA 3D3QA 4ARZA 2NMVA 3VR2A 3AP3A 1K5GA 3KKPA 2NGRA 2WM9B 4IKEA 6Q21A 1T3LA 3QXCA 2FG5A 5UKDA 3HPRA 5BW8A 4R7ZA 2ONJA 2OCBA 4QFMA 1ZM7A 3Q5EA 1AN0A 2W2TA 1FL9A 4HLCA 1AS0A 1GKUB 1MO3A 4EFNA 1XTRA 2N46A 2XXAB 1CEEA 2JATA 3HYRA 1VKJA 1VTKA 1H8HA 1GIAA 1TQ4A 3CNNA 4UNPA 3TJZA 4DC9A 3VKGA 1R8SA 3LVRE 3ZVMA 3CUEF 1N6PA 4BFTA 3SQXA 4TWZA 5BQ5A 3SFVA 5HE8A 3W34A 2IYLD 1N0UA 2QPAA 3FWYA 4HATA 2CK3A 4NYJQ 2ZJ5A 4I1UA 1GL9B 3TUZC 1E2KA 1WBBA 4BPBA 2ZRDA 1Z2CA 4AWXA 1WB9A 2VP0A 2FX3A 2ONKA 3LQQA 4DEYA 721PA 1YRBA 4TQUS 2QP3A 4P32A 4B3BA 1NP6A 4TLBA 4Y0VA 2QP9X 1HE8B 4TMKA 3NC0C 1MRNA 4I1OA 4DCNA 1FZQA 1T0JB 2P6RA 3H86A 1M7HA 4M9QA 1W48A 4KI0A 4U5XA 1SHKA 2D3WA 3FKSD 4P0TA 4AURA 1HE1C 2ZRCA 3MLEA 1GDDA 4PHGA 3R9IA 4Q4LA 4EUNA 4E07A 3B1VA 2BCGY 2GJKA 2IEYA 5EQTA 3QXXA 5TMPA 4A2WA 4C2TA 2ZE5A 5G41A 3H84A 4LJYA 4HAZA 5KDOA 1G20E 1G291 1KI9A 1PJRA 5EP1A 2IXFA 4OYHA 2J0SA 2WJYA 2W83A 3BE4A 5D3MA 1ZM9A 4MYUA 2QL6A 1OKKA 4MUAA 3TAUA 2HT6A 2ZM5A 1A2BA 2BBWA 3LBHA 1OXVA 2QAJA 4PQFA 4KSCA 3KTAA 4WZ6A 1QRAA 1J8MF 4KO8A 3HU2A 4HDCA 2BHRA 4BLRA 3VKHA 1S1CA 1TEXA 2IXEA 3GJ4A 1XMVA 1KKMA 4Q1EA 1AQUA 3CRRA 3ND9A 1BIFA 2N42A 1BH2A 1R0ZA 4D0LB 2F9MA 4TQAA 3TVTA 2G6BA 2BIFA 4IEIA 1I4LD 1DELA 3MGCA 4ABYA 2BKEA 2OBNA 4NP6A 4HUTA 3KDSE 2BMJA 2BJWA 4NONA 3LQRA 2GXQA 3NXSA 4Q19A 1DVRA 4ZDIA 1OFUX 2ATXA 4F93B 2WWIA 4G3XA 2FFHA 1RZ3A 3VHLB 4M0LA 3CF0A 2OLKA 3LVQE 5L3QA 4C7OB 1NIJA 4OQXA 4DCTA 1QG4A 1EFCA 2L0XA 2NO1A 5JBQA 4EKDA 1Q1BA 4PAOA 1E4YA 4WA7A 2NO0A 4C9BA 5AK0A 2IYWA 4N3NA 1G3RA 5HCIA 3IKJA 1S1MA 2VSFA 1UAAA 1IN4A 2WOOA 4RY2A 2J0VA 2FEMA 4B76A 1NY5A 4DSTA 4Q4HA 2O8BA 4DUGA 2AWNA 2WWFA 4IDOA 1G8GA 4C0JA 4PFSA 2I1QA 1KHTA 4POAA 5KNBA 3RWMB 2OCYC 3VU9B 1N3BA 4B47A 2WWYA 3ONWA 2QP4A 4DLSA 3QPVA 4DCUA 4YONB 1A7JA 1YR9A 3THWA 1LB1B 2QA5A 3N2EA 1F6BA 1IN6A 1YVDA 2NZ8A 2VEDA 2YJTD 3CRQA 3LFUA 1R4AA 3TW8B 1CIPA 1NF3A 2AXPA 4BUJA 1KY3A 2EU8A 2AWOA 1OT3A 2F6RA 3U4QB 1AKEA 4U00A 1XPOA 1ONBA 4QHSA 1P3JA 4KLNA 4X8HA 3PEVA 1U0HC 1XXHE 2C04A 2GZDA 3QY0A 3K70C 4FCVA 3MWJA 4CVNA 1EFUA 5DE3A 2BEJA 2QUZA 4IDNA 4M1MA 2XEXA 4JVMA 1D5CA 2IT1A 3L43A 1IXSB 4BLTA 3U60B 4KVAA 2IHYA 2JEOA 3KZ1E 1NVWQ 4Z1MD 2ODBA 2Q6TA 1U8AA 3L0PA 1LVGA 4MRVA 1C4OA 1D9ZA 3WNDA 3QI2A 1MRSA 4P4TA 4YMTA 1N6LA 1M8PA 4KYIB 4KBGA 3Q5DA 1K6MA 1G18A 1COWA 2WSSA 4Q9LA 4YXWD 4LYFA 3BS4A 3LD9A 4TMTA 3SS8A 2FGKA 5EP3A 3FOZA 1Z6GA 3HPQA 3B9QA 2ZJ8A 2GF9A 4LJAA 2F3TA 4A8JC 3MRSA 3EIHA 1ZC4A 5FPKA 2IL1A 2ZRBA 4DDWA 2IHBA 4QOSA 3VHXA 3KQNA 5FTLA 4PZYA 1YZKA 1TADA 1KK0A 3PITA 5L3SA 2NO7A 4OBEA 4A2QA 2WIAA 2C78A 5C4MA 2ZRHA 2Q0HA 3K70D 1YJ5A 1XXHA 2HDNB 2UZIR 2X2EA 5SZIA 3C5CA 4O0MA 4EJSA 2H16A 4A0RA 1DADA 1JAHA 3EAQA 3TIFA 4B43A 4RD4A 3RVBA 2OUKA 1W36C 1P2SA 5GJBA 3MFYA 2R8RA 3PUVA 1PLKA 4QGGA 4CRWB 3LXXA 2IBMA 1N5LA 3PR1A 2DYKA 3EG5A 3QQ5A 1KNQA 1ZP6A 4MQBA 5JLJA 5EXPA 4HSEA 2ANBA 4LOAA 2R6AA 4I1VA 3V00A 5CM8B 1NN1A 5DN6D 2D2EA 4HDOB 1OW3B 1CRPA 3KQHA 4NZYA 2QAGA 3A4MA 4BGDA 3FMFA 3KB2A 2QSYA 1MV5A 2IS1A 1E0KA 3AV0B 4M53A 4NCHA 1N25A 2QM8A 3PJRA 1DAIA 2H17A 4XIGS 2PZGA 4LV6A 4XTCS 5CITA 3EXAA 1XZPA 3F8TA 1D6JA 4Q1CA 3AGPA 1N0WA 3IO5A 1YR8A 4PPQA 2WSMA 2HXYA 2ZUCA 1N2CE 5JI3E 4OHXA 4X8OA 1ZBDA 2ZANA 3OAAA 1KYIA 3SHWA 3Q9LA 1Q3TA 1T9HA 2DBYA 3NDPA 4NCIA 4LHWA 4R9UC 3VX4A 2X19A 2VBCA 3I61A 1G41A 2ERXA 2GETA 4TMWA 4IDHA 5GJWC 1NLZA 1Z0KA 3FHOA 3OFNA 1CR0A 4ZDJA 4QHTA 3VU9A 1QBKC 2XAUA 1ZAKA 1W4BA 1OFTA 4ZCLA 1N0VC 2IF0A 1W36D 3ZVLA 4E22A 3C8UA 2BJVA 2ORVA 4TL9A 1OIWA 1AIPA 1P60A 3IPXA 4QRHA 3U4QA 3SHFA 4JLKA 2CCKA 2ZSFA 1HV8A 2OXRA 3CWQA 5DYGA 3V4RA 2PL3A 2ZI6A 3CX7A 1T8UA 2GJ9A 3B1XA 3WXMA 1TX4B 3TBKA 1UBFA 4RVCA 3GLIB 1KI2A 2P2LA 3ETLA 3PUZA 5KSYA 3ZVRA 4Q47A 2CK3D 3RS5A 3EPLA 3KQUA 1ZU5A 2RCNA 4RSGA 1LF5A 4NL4H 3UG7A 3QXSA 3UWKA 1G3UA 4LJ9A 2WKQA 3NEJA 4AYWA 5KPJA 2FFBA 3M4YA 2DFKB 2QPOA 4F4CA 3CPEA 4HZUA 3TVDA 1D8TA 3B7GA 1U94A 1Q1EA 2PX3A 1E2NA 2F43B 4GOXA 1SXJB 3GQBA 3ZQJA 3EX7C 3SR0A 2WAYA 1IJEA 4HAXA 2O8CB 4JKYA 3RYTC 4PHHA 1J7KA 1PUJA 1ZRHA 2UZ3A 3MD0A 4H1UA 5A4JA 1Z07A 4W9MC 1CF4A 1UEIA 1UADA 2GJ8A 4QBFA 1N5JA 3LY5A 5FH9A 1CJTC 3ZYCA 1D2EA 4RJLA 3WHLA 1N6HA 1OKKD 3DM5A 4AD8A 1E99A 1II8A 3NC1C 4PSAA 5L3RA 2JLVA 3BH7A 4L4UA 1IY2A 4PHTA 1V5WA 3EARA 2Q9BA 3NVAA 2EFDB 5KOYA 3AKCA 1MO5A 3GJ5A 2CEAA 1T4GA 2EFGA 3L0OA 2WJHA 4TLDA 1GP2A 3BFXA 2VPPA 1WP9A 1EK0A 1XMJA 1E9RA 1OHHA 3BK7A 4H9GA 4OK3A 2B8WA 1NVXQ 3A1TA 2WKRA 1E2HA 3VNVA 4LPSA 3TQFA 3W8NA 5B2ZA 1UEJA 2BWJA 2NTYC 3HU1A 5IT5A 1UDWA 2ZR7A 4CW7A 3QNUA 4YDHB 2HCBA 3BB1A 5SZKB 5BN5A 2WWWA 4MA4A 3IBYA 1W46A 3AVPA 4PPNA 1NVVR 4DJTA 4D6PA 2RHDA 2ZREA 4XH9B 1EFHA 4RD2A 2FFAA 3SYLA 1G4AE 4MGZR 4DZZA 5AUOB 2A9KA 1T91A 3HDTA 4JLMA 3V9PA 2QROA 3TH5A 4LHXA 1U98A 2HLDD 3FKSA 4TMZA 1ZNYA 4O25A 1XFAA 5FL7D 1PLLA 2HXSA 3IILA 3BWDD 2J7PA 4OHZA 1ZUNB 4GT1A 4DUGD 2XZOA 1N6RA 2C03A 3IIMA 1I2DA 1F48A 4FN5A 4A0HA 1XWIA 1QHYA 1GILA 4JVLA 1KMQA 3T5GA 3CRW1 5TARA 2O0HA 4LI0A 4JYBA 4LPKA 1W4AA 3RDPA 4C0BA 3IPYA 4ON9A 4LV8B 5KDLA 1KI7A 1SVMA 2ZYWX 4BFUA 1T8TA 3NWJA 1QVAA 3LW7A 2IWRA 1R7RA 4EAQA 4NYIQ 4Q7LA 5K8UA 2V54A 2ZRLA 3BRWD 1A4RA 2OLJA 3DL0A 3NKVA 1KDRA 2CHVA 1U99A 1DG1G 4EJSC 2YHSA 4EPWA 2FH5B 5JRZA 1R5BA 1IHUA 5FOWA 4CF7A 4UXIA 4JT2A 5DI9A 2W6JD 1AKYA 3BFVA 5C4GB 5GVSA 3AM1A 3TQCA 1Z0JA 5G53C 1CRQA 3SQWA 3GJXC 1IXRC 1XCGB 5EP2A 2GBLA 2LKDA 3NTUA 2J0UA 1OE0A 1DO2A 2A30A 3WMGA 1COWD 4E03A 3H1TA 2F1HA 1MO6A 2QAGC 2QMOA 4KAXA 5DIFA 3BB4A 3WY9A 1OFHA 1VG9B 2J9RA 4Q7KA 2GXSA 3OIVA 3QBTA 2BMFA 1JEEA 1UPTA 2Y8EA 3QBVA 2AX4A 2KB0A 4FMCB 2A5DA 3RSLA 2XSZA 5EZ6B 2GKSA 5J47A 1Z63A 4KJZA 1A5TA 5GJVC 3NDBB 4G5QA 621PA 4LC0A 4YQFA 2EFHB 4GRAA 5EXSA 5CIWA 1RC8A 3I62A 2AK2A 3MG9A 2KE5A 2CHQA 2BBTA 2V1UA 3AVTA 2G83A 1P5ZB 1B23P 3IUYA 4UKDA 1ZD8A 1NLFA 2ZRFA 1KAOA 1VPLA 1XTKA 4FMCF 4D4MA 2FEOA 1MR3F 2AFHE 2Z43A 4MYCA 5EE0A 2BOVA 1KZGB 1MABB 4N1AA 3PEUA 2OG2A 1Z0AA 2YWHA 4JLDA 4BZXA 4QJ3A 1U9IA 2MMGA 4Z8YA 3LX8A 4JL6A 3AUYA 3NH6A 3RS0A 2NOAA 1E9DA 1KKLA 3B2EA 4FI3C 4HB3A 4Q66C 3W3ZB 2C98A 1Z5ZA 1VG8A 4HDQB 3JZAA 2DFTA 3T1VA 5CB8A 2FZLA 2RGAA 1GKIA 4TYNA 5JWHA 2REOA 4TTRA 3ZVNA 2Q9AA 1ODFA 1C9KA 4KLZA 4OI2A 4EIWA 4B74A 1FOEB 2DCUA 5CB6A 1M34E 1KJWA 4ERNA 3QF4B 1FTNA 4EQ6B 3L8ZA 4M1OA 3KJGA 3BAFA 4DXAA 2WIBA 4K8OA 4OI0A 1R0XA 3WMFA 5DHAA 5JSZB 2V4ZA 3CX8A 1CU1A 4MH0R 5LPNA 1E9EA 4B34A 1X1SA 1X1RA 3NG1A 2AL7A 2C8VA 2ZRMA 4UXHA 3DVLA 4YXWA 4RCYA 1QHNA 3QVUA 1OJLA 1W0KA 1TQ6A 4DRZA 3KQKA 2DWPA 5ANRB 1AS3A 3RS3A 4KV9A 1G16A 5EXXA 4AYXA 3MWKA 4DT1B 2OFWA 4XWKA 3MMPA 4RFSB 4Z54A 3J81k 2JLYA 1NBME 2KSQA 1NY6A 3TW4A 4BEJA 2ZI9A 2WHXA 2IA5A 1Z8FA 2A5GA 2GJAA 2D2FA 3OFND 1JXMA 1HTWA 3Q3JB 2J87A 3OIYA 3P32A 3HR7A 2ZR0A 2Q3FA 3G82C 3ASZA 5BYKA 1OYYA 3AF3A 4M9XA 3RS2A 3ZS9A 1QHHB 4LWZA 3HJNA 4ITRC 5CM9C 3QKUA 3H0KA 4LHZA 2BBSA 3TSZA 2BM1A 2ZSDA 2JGNA 1HQCA 5FPYA 5FBVB 4PAMA 3BJIC 2C96A 2WICA 3AKYA 2IYUA 1UKEA 4F4JA 5JEDA 1M6NA 4R2IA 5DN6A 3WRXC 1SULA 4P31A 1XMSA 2DB3A 4IOLA 2V6IA 2YV5A 3TNFA 5KPDA 4LDJA 4C0AC 2B8TA 3KJEA 4GZMA 3KXIA 3K09A 1UBGA 2Z5FA 1OXTA 2YWGA 3GLGE 1FX0B 4JSYA 5E7JA 4B2IA 2LKCA 1BKDR 1G19A 1KI3A 1XTSA 2JASA 1Z0IA 3IEUA 3KQLA 1CJKC 2QRNA 1P61B 4DEXA 1NBMA 2RGBA 1LW7A 3RABA 5A0FA 3B1WA 4Q48A 5JS8A 3T35A 3MJRA 4M4SA 1U2RA 4HUQB 2ZJ2A 4L8GA 3T06B 2Q9CA 4LJ5A 1QF9A 2IUUA 2GXUA 2CL6X 4OKSA 1QHSA 2MSDB 1IM2A 1T0HB 3PIRA 1TUIA 2WKPA 2ZRGA 4GI7A 3T12A 3BIFA 3RHFA 4JL8A 3SOPA 2P0EA 4EFMA 3THYB 4QL3A 1S2MA 2AK3A 4Q7JB 1NKSA 1DAEA 1W5TA 4M1SA 1OIVA 4IHQA 4AIIA 1KDTA 1ZCBA 4F7WA 5D3QA 5FPTA 4URYR 3LA6A 1JR6A 3GFPA 5FUXA 5LDDC 1IXZA 2RGGA 4K81B 1NSFA 3ECCA 3TKLA 1S9DA 5C2JB 3IIKA 2GEVA 2AR7A 1Y3AA 2CE7A 1DS6A 4AKEA 1Z08A 4K46A 1OHHD 3Q7PA 5EUMA 4B73A 1KSJA 1FNNA 2EFCB 5H8WA 3AVYA 4IXMA 3FPAA 4LRWA 1VIYA 1CLUA 4KFUA 5H1YA 4UNRA 4NYJR 3B78A 1U81A 3ZZTA 3GLGA 4HEJA 4P4SB 3GLHE 2ZRNA 3ASYA 3WP1B 4DBLC 3ZD7A 2C5LA 3W5IA 5JSZA 3QJYA 5HTKA 5TDHA 4L9WA 2G9NA 3T61A 4TL7A 1XCMA 5KNCA 1KGDA 2GBLC 1EESA 4GBMA 1DAKA 4A0FA 1GNRA 3D6TB 4DDVA 2PJRA 1E2IA 1Q57A 2YOFA 5TB5A 3ZZ0A 3NBXX 3UIEA 4JIMA 5HE9A 1Z6TA 2WMOB 5DNYB 2GZAA 2WJIA 3WYFA 1OSNA 3C5HA 4LBWA 3U3MA 3W6OA 1I4TD 2J7PD 1UKYA 3SU8A 2MMCA 2XTNA 4GP6A 4OQFA 2OO7A 1KDPA 1J99A 3ADBA 2GA8A 1JBKA 1SXJC 3AVWA 2P6UA 4TTPA 1E2FA 3K9LA 5HR5A 1NI3A 1HY3A 5JMTA 1KK3A 3KL4A 5DSZA 2ERYA 3FMPB 5E4FA 5FBWB 4C0QC 2PMKA 3LAWA 4KFTA 1US8B 2EFEB 1I2MA 2ZUDA 5DYIA 1VIAA 2O8FB 1WXQA 1E1QA 3W3AA 221PA 4CEIA 2OZEA 3FGNA 3QF7A 3QKRB 1U9IC 3RSOA 1HH4A 4DSNA 2CBZA 3VAAA 4TT3D 2P67A 1WRBA 4NCNA 5JI2E 1X8JA 2FA9A 1E2PA 3U7HB 2YNMA 3AKEA 1XEXB 4YLGA 3GLHA 4CZ2A 1E94E 4ESHA 4TZ6A 2OAQ1 5CLLA 2H7VA 2P6NA 4HLUC 2J0QA 1G5PA 1ZD9A 2LCFA 4DWJA 1ZNXA 2ASEA 2Z4RA 4KXFB 4TYWA 1N6IA 2CJWB 2PEZA 3H2YA 2BMEA 1JPNA 4S35A 4PC7A 1TQ2A 4BQSA 2QY9A 4PTLA 1BYIA 1GKYA 2KJQA 3DPUA 3TAHA 4D0GA 1OH8A 2AHOA 5HKKA 4AI6A 2ANCA 4DDUA 2OFOA 2HLDA 2YZ2A 4IVPA 3M6AA 3W6NA 1MOZA 1BO6A 1E9SA 4B35A 1T3SA 3IQWA 1A2KC 5FL7A 3R8CA 5FFMA 1YE8A 2JIZD 3T5DA 1VYUA 2XSZD 3THOA 2Z83A 1UDXA 1SXJD 3SC3A 1CR4A 4PO8A 2AFIE 1NJGA 1AGPA 1S3GA 5DLQC 4AG5A 2A7QA 5JECA 1OXUA 4HUQA 1XTJA 2C9CA 4V0OA 3GEIA 1II0A 1V43A 3OESA 4FD2A 3EPKA 4C3ZA 1KO1A 1JI0A 1TL7C 2JJ1D 2O8EB 4RFVA 5E95A 1DO0A 4DLWA 2CE2X 3OZXA 3THYA 1IN5A 2GCNA 3A36A 1H65A 1DTSA 3I3SR 4WZAE 2ZRPA 3AF4A 1P4SA 3UMFA 3F3YA 4CEJB 3I8SA 4TYPA 5CJ2A 2CLSA 4JBWA 4MUBA 3LBNA 4GOJA 1F60A 2FGJA 4FW9A 2DR3A 2XXAA 2RGXA 2J1LA 2W6JA 5B58C 1HA3A 5FOUA 2OV2A 4A2PA 5DI3B 2IUSA 4LGMA 5FBLB 3OF5A 5E7IA 1A82A 1H8ED 4PC1A 3ZDQA 4DLTA 1SHZA 2ZJZA 5CIQA 4BFYA 2ODNA 4MKFA 2VLIA 1TNDA 1VDZA 3GCGA 1R10A 2EW1A 4CT4B 3W5JA 3T15A 4I4LA 1JQLB 3SFZA 3LWNA 2ATVA 5AJXA 3PEWA 1W0KD 1G8HA 2EQBA 3L2OB 4AC9A 1X3SA 1KSFX 4B44A 3GPLA 2ZRAA 3K09C 2PLFA 4LZZA 4AKIA 3IHWA 3IQXA 4G1UC 4WZBE 1GAJA 2G77B 3Q8XB 1ZUIA 2V7QD 4BE7B 2EYUA 4NCKA 3MSXA 4JLAA 4M2LA 1G7SA 1M1YE 1GFIA 3OHMA 3U44B 2PJZA 2ZJOA 3KJIA 3L0IB 2CL7X 3K1JA 1P73A 2JDID 4M1WA 5FTNA 3X1XA 4QM6A 2RH5A 2WWXA 3OE7D 5CK4A 1KO5A 4A15A 1JJ7A 3MAAC 2OFXA 4LBVA 2CLDX 4G01B 2FMXA 4NTZA 5EZ5A 5AUQA 1G3IA 1Z6AA 4V0LA 2UVQA 1BS1A 1GSIA 1LV7A 1E9FA 4M1TA 5EE3A 4MGIR 4FWIB 2GRJA 4HI0E 4YMWA 2FDCA 3R9XA 3GFTA 3P1JA 1L4YA 3K0FB 3FKQA 3QKRA 4TMVA 2FOLA 1Q12A 4O2RA 5FTKA 2VHJA 1AZSC 2ZR9A 4HAYA 1E79D 3C14C 1BMFA 5KO2A 1XEXA 1U8ZA 3CPJB 1SVWA 1SGWA 3CH4B 3VKWA 4H1VA 2GDJA 1P9WA 2ORIA 2WPDA 4Q00A 2XOKD 5SZHB 3UK6A 1UKVY 3DOEA 5C18A 5K8IA 3A4LA 1E0SA 4B33A 3ZS8A 4E09A 1NKTA 4IVQA 4C7OA 4D25A 1FUKA 3IDQA 5J4HA 2XNSA 2QEQA 2CHGA 1CJVC 4WAUA 4I81A 1NBMD 3CW2A 3KFXA 5LBIA 3SYNA 5KDDA 2AKYA 2P5SA 2XX3A 4JZKA 3ICEA 4Q1FA 1R5NA 1R8QA 4OQNA 2R9VA 3EWSA 4OQLA 4DB4A 3B5JA 4D26A 1DG3A 1GZSA 3SYKA 1E9AA 2XJ4A 2ODWA 1Z47A 1PUIA 5KNDA 4CEHB 2OE2A 3PG5A 1XZQA 3C4JA 4R2HA 1GWNA 1DAGA 1E2EA 2I1VB 1W0JD 2YKGA 4GZLA 3ZGXA 1OH7A 2CNWD 3I32A 5A5GA 2JLRA 2QMEA 5J4VA 3K0AB 4RZ2A 4JLOA 4YMUA 3CPHA 1ZW6A 1MH1A 5LB2A 2RGNA 2JA1A 1NN3A 1O3YA 4M8NE 2VQSA 4RKEA 1YHNA 3B60A 3PFIA 2QE7A 2HF9A 2TMKA 3RLFA 2JJ2A 5E7MA 1GVNB 4D4KA 1ZJ6A 1HYQA 4TZ0A 1YR7A 5DI3A 3S1AB 3CB4A 1ANKA 3CM0A 1JECA 5GVRA 5FI0B 4M9SA 3A4NA 3ZQ6A 4ZIRB 1KTVA 1R0WA 3VR5A 2HJGA 3EA5A 2REBA 1GUAA 1W2GA 3AVOA 2C2HA 4LHYA 1VCIA 2V8OA 3BERA 2FSHA 3A1SA 1Q20A 2HCJB 1ELOA 1JAIA 5IDVA 4Q03A 3EZ7A 4CT5A 3U7EB 4NDZA 2F55A 4B32A 2ZPTX 4TYYA 2D7DA 1EGAA 1P2VA 1WF3A 3TE6A 4AYTA 1N5IA 5IF9A 4ZKEA 3RRZA 1F5NA 3EZ9A 4Q01A 4Y0AA 3QKSB 2CLCX 2J41A 4TLAA 4KODA 4NYMQ 1S0UA 2BVNA 3QOFA 4X8LA 5FOVA 1HT2E 3EWAA 1ZIPA 4OHYA 1SKYB 1LTQA 2GEUA 1AGRA 4G0NA 2OSBA 2HYIC 3AQ4A 3N5CA 1XPUA 2GWHA 4D4LA 2ZJBA 4PC3A 2PZEA 821PA 3H4MA 1TAGA 2E87A 1EXMA 2K5UA 1QG2A 5JJLA 3A1WA 1NMZA 4YDSA 4JBXA 1GNQA 1EWRA 1FNMA 1XJQA 2F3RA 3A1VA 2R65A 2B7BA 3DZDA 1E1QD 4PPGA 4IDPA 1Q22A 2A78A 4LJ7A 3SNHA 4II7A 3RS7A 4IOMA 5EUQB 2NIPA 4C4PA 5AJZA 1OXXK 5TY0A 2E9SA 3RS4A 3O8CA 5CDFE 4JVNA 1E2LA 2BDTA 4RCZA 1XEWY 4V0KA 4ZI3A 4GDFA 1XCPA 1ZUHA 2C77A 2OCAA 4B3XA 2FSGA 2XB2A 4Q9JA 1TTTA 1ZYUA 3GJ8A 3ADKA 4DSUA 3GLIE 3TSOA 4MGKR 1VCNA 3NBFA 1AS2A 2F9LA 2FPMA 2QTFA 4L9SA 4BLSA 4D0NA 5JEEA 5F9FA 4EPXA 5HKKD 2D74A 3UKDA 2J46A 4BEBA 4HB4A 2A3RA 2IWHA 4EPYA 1E4VA 4A0GA 1L7VC 3LO5A 3FE2A 1UM8A 4HLQB 1XD2B 2H57A 1ZNWA 5KYKA 1R5OA 3HYTA 2VO1A 1L8QA 2PEYA 2CMKA 1IJFA 4QHYA 2ZI3A 3FFBA 3D7MA 3RC3A 1EX7A 5KUTA 1IY0A 3DM9B 2PCLA 4WXPA 1FMLA 1GITA 1SXJE 2CVFA 3ZIAD 4DLYA 5L8VA 1XPRA 3RAPR 2NZJA 5EE1A 1OH6A 1FP7A 2W6IA 2WJVA 4XSGA 4B3DA 5FR1A 3L8YA 3QG1A 4BRUA 1LF0A 2IXGA 3EZFA 2WZQA 3LH5A 1UBEA 1LS1A 2R2AA 3EW9A 3U2QA 4BZQA 2EYQA 1EX6A 2RKOA 3P4XA 3LX5A 1SKYE 1JXOA 4NYIR 3W6PA 3WMEA 1QVRA 3K0AA 3A8TA 3AP2A 2G1JA 2VHTA 2REXB 5CDFA 4XWOA 3OIWA 4BFWA 4HYYA 4TT3A 5JHHB 3K70B 1E2QA 2DPXA 3PCRB 4OHVA 4LYHA 2YC4C 5EP4A 3CONA 1XD9A 1KIMA 3KUCA 2OBMA 4OJQA 1KAGA 1JALA 2ZU0C 2GCPA 3GLIA 4WXRA 1U0LA 1E32A 1T5LA 3AVUA 1E2MA 1YQTA 2QT0A 4NMMA 4IOKA 1AZTA 1P62B 3REFA 3EA0A 3U7GA 2KI5A 4ZIRA 3PV0A 3R20A 4ZPXA 3R8FA 3F5FA 3U7FB 2FSIA 1QHIA 1XRJA 4HZIA 2FSFA 3UPUA 4JLJA 1RJ9B 2P3SA 2XZPA 1P2TA 1HURA 1M74A 5J4YA 2GNOA 3ZD6A 1S9HA 2ZROA 5LD2B 4XD7A 1UJ2A 4RD1A 1P6XA 5BN4A 5AR1A 3FHCB 4TLCA 2Z0MA 2JIZA 4WW0A 3WYGA 4ESVA 2F43A 5FOTA 1SXJA 2C95A 4TLEA 5F9HA 4MKIA 4QBIA 4Z8XA 2GESA 3MWYW 4KITB 3L82B 5DGXA 1LNZA 4LUCA 2O8CA 2DY1A 2PBRA 3AVQA 1JNYA 1FTSA 2R6DA 2UKDA 3AB3A 1QDEA 4DCVA 3QEOA 4QGAA 4LYJA 1Z0FA 2WVJA 2JJ1A 3I72A 1Z28A 4WBSA 4XSHA 3AVXA 4YMSA 1Q44A 3NHBA 2IYQA 4C30A 2PT7A 4DIEA 3K0SA 1X86B 3QVVA 3TLXA 2PX0A 1G9XA 2QT1A 1Z29A 3CF2A 4M22A 4ARZB 1Z6YA 4US0R 3REGA 1QZXA 1W44A 2F7SA 1ZM4A 1RKBA 1WDTA 4HLUA 2GILA 3B1YA 4LHVA 5AJYA 3KFVA 2RB4A 1W5SA 3SJCA 1H8EA 2RGNC 4ZO4A 4DLXA 4W5JA 1EFTA 1GL6A 3SEAA 2VH5R 3T1QA 2ZI4A 2XGJA 1BMFD 2X2FA 1JR3E 421PA 2HEIA 3IHLA 2WPDD 2IYTA 3K0CA 4MRNA 3PUWA 5L3VA 4MDEA 5TXGA 2VHQA 4NH0A 2QRZA 4PSKA 4XVQA 3WP0A 3B13B 5IK2D 1SVIA 4Q21A 1WQ1R 1TPZA 3DKPA 2WWHA 4JKIA 2IYZA 2DWOA 1BOFA 1F3OA 1AA9A 1Q1ZA 121PA 1ZU4A 4IXNA 3GP8A 3P4YA 3BH6A 4TTQA 3B85A 1VG0B 2V7QA 3VQTA 2VA8A 4M1KA 1K5DA 5DH9A 1W2HA 4FXPA 4PZZA 3AGQA 2VSOA 1RRPA 5FOSA 4LJ8A 4RZXA 5DO9A 5JS7A 1XD8A 1F2UB 5HPYB 2ZYUX 1S8FA 4DKXA 3KKMA 4BFZA 2JDIA 1SQ5A 3UG6A 4DLVA 2O0KA 3SN6A 3OE7A 1NG9A 2ZVPX 2ZS7A 1Z06A 1YZUA 2OAP1 2Z4SA 1NN5A 2VP2A 3SE0A 2ZE7A 3CH5A 4LJ4A 8OHMA 4Q18A 4C0SA 5BWMA 1KO7A 1IY1A 5FBQB 4BLOA 2BEKA 3CIOA 1OV4A 4G5SA 3LDAA 1JEDA 2IUTA 5D3MB 4C2UA 1Q21A 4LX0A 4DHEA 4F92B 4Q9IA 1VG1A 1FMJA 2QE7D 4GL2A 2QGNA 2JJ2D 4FMDF 2I3BA 3QIAA 2OBLA 1E79A 3EIQA 4R71A 3BORA 3BGWA 3KTAB 1J90A 1E9BA 4HAWA 3D31A 3OEHD 1CTQA 4IJMA 1E2JA 3M1IA 2WJGA 3GJ0A 1DAHA 3BXZA 1ZIOA 2XOKA 5FI1B 1HEIA 1II9A 2BBOA 4OJKA 2J59A 2XTZA 1U0JA 3AP1A 2RHMA 2XJ9A 3C15C 5EE5B 3U3RA 3QKTA 1MKYA 1GRRA 1DBSA 1LFDB 3GLFB 3EPJA 3R7WB 1FP6A 3VFDA 4DSOA 2KBFA 4KSBA 3B82A 3UWOA 2IF2A 3QE0A 5EJEA 4QBHA 3AVVA 3PUXA 3UATA 3E70C 1S4QA 2GEDA 3U3KA 3X1DA 4BFSA 3ZH9B 2XITA 4IOJA 1WBDA 4P33A 4OQMA 1XDBA 2A5JA 4ZV4A 1XEFA 2VL7A 1W0JA 1G1MA 3Q72A 4O2LA 1Q1QA 1SKQA 4MYHA 4Q4AB 2CNWA 3K0EA 3U3OA 1XMIA 3O8BA 5FL3A 3NHAA 1M7GA 3VTKA 2AD5A 2NQ2C 4LK2A 4D81A 3PXGA 1G7CA 1MABA 1KDOA 2QPTA 2AN9A 2ZAMA 4NPHA 1UKZA 1OLOA 4JLPA 1YZTA 3C16C 4URUR 2FPKA 3DHWC 2PT5A 3U61B 3THWB 3CR7A 2QU8A 1YZLA 2BMDA 4UJ3A 3WRYC 3VR1A 4URXR 3NIBA 4MKHA 4DIDA 2YYZA 4M1YA 3FMOB 3FTQA 4GFDA 2QQ0A 2QTVB 5KU1A 4HLDA 3TUJC 3CBQA 1X8LA 3QF4A 1DEKA 1NSTA 4NE2A 4KHZA 2GAAA 4EQ6A 4ZDKA 3O8RA 2ECKA 3LXRA 4EDHA 1G8FA 1RVDA 2OHFA 3LW8A 3AH8A 4N0EA 1DOAA 1TQDA 2W2XA 5FPHA 1AM4D 4G5RA 1Z6XA 3IGFA 3Q7QA 3HP1A 1GRQA 3E2IA 2GF0A 2IYRA 2QM7A 4KFRA 3B9PA 4B3FX 2QBYB 2JLUA 3NBYC 1CJMA 1E96A 2WAXA 2ZSEA 3G5UA 3W90A 3EPHA 4XVUA 2JLSA 4QC2A 4L16A 4CDGA 4DT1A 2V9PA 3GLFE 1KK2A 2ZSAA 2ZVQX 4RFSA 1NG1A 3EIEA 4MKGA 4BFXA 2ZS8A 2D4HA 4I99A 5B57C 1F2UA 1FFHA 5JJIA 3WBJA 2QQEA 2W6ID 4I1SA 1E9CA 1WMSA 4WOPA 2GVZC 3D8BA 2OCPA 3AF2A 3K8YA 5P21A 2GHIA 3DEFA 4JLVA 4CGZA 5JRJA 4RZUA 1E1RD 1N6KA 1T6NA 521PA 5JWRA 5L3SB 1C1YA 4WVFA 4F4IA 2VTKA 5FUYA 5BYJA 3B8HA 4LC1A 3RRYA 1QHHA 1G6HA 3DMNA 2B92A 3Q85A 1XXHB 2QZ4A 3FYHA 2NPFA 1CJUC 4BASA 4EJSB 5F2EA 4AKHA 4JSTA 1GG2A 4QM7A 5LB4A 3WNCA 2CCJA 2QN6A 1G4UR 5K8TA 2R62A 2WBLC 1P75A 2ZITA 3THXB 4R98A 5TVKA 1E0JA 4NBSA 5C46F 2C9OA 1IAQA 4MDFA 2R6CA 1EFRA 1L2TA 1TEVA 3C41J 1FX0A 1KNXA 4HB0A 5HZHA 3K0CC 2QAGB 1QHGA 3LV8A 4YC7A 2ORWA 5FR2A 4A92A 2H1LA 3OEED 2IS2A 2H18A 4XD7D 5FOXA 3DMDA 3GLFA 4QBGB 4LCBA 1RYHA 4BLQA 3R7WA 4DLRA 1TF2A 4MRPA 1N6OA 5JFGA 1S3SA 3ZIAA 1DAMA 3GD7A 1KOFA 1NN0A 3ADDA 1VCMA 3KJHA 3VR3A 1I4DD 1VHTA 2EWVA 4MRRA 4NU0A 5K8LA 4O3MA 3IEVA 4U7DA 3I92A 5M04A 4QJ5A 1ZNZA 4C0HA 1XTIA 4WIAA 4GMXA 4F91B 4Q4AA 1KY2A 1JQJC 4EPTA 3U6BA 2ZYVX 1RRGA 2FE4A 3O8DA 1G64A 4B6FA 5DISB 1CP2A 5B64A 4PO9A 3K9HA 4X8MA 3PENA 3CNOA 1Q0UA 1YZQA 2JAQA 4PHFA 1ESMA 1GRNA 2QMHA 1NNEA 2XNDD 3CNLA 2X8AA 1XTQA 5FTJA 1PLJA 4LSGA 4OL0A 1PVOA 4OI4A 2VF7A 1NRJB 3QENA 4DLZA 1P2UA 2W0MA 1W1WA 3HWSA 4TMXA 3X1WA 1KO4A 3KKQA 2YOHA 3UXMA 4A1FA 4AG6A 1XNJA 1HT1E 2FU5C 2OXCA 2YWFA 4DB2A 3BD9A 3A6PC 4P4SA 1G8YA 3QG5A 2QSZA 3E1SA 4ZDWA 2X77A 4GOKA 2IW3A 4BECA 1VCOA 3BH0A 4QKQA 3CWZA 3SBEA 4W5WA 1W7AA 2J5XA 3FHTA 3I5XA 1CBUA 1FW6A 4A6XA 1D9XA 3FVQA 2QBYA 4EPRA 2ZE8A 3ZZUA 1ZM3A 4AK9A 4QNRA 4YMVA 3ADCA 4HZUB 1DPFA 1ZM2A 1KI1A 4UNQA 1HUQA 1ETUA 4OHWA 2CVHA 1YZNA 5KSZA 5LD2C 1W49A 1KJZA 1IN8A 4GNKA 2N1BA 3CO5A 5J40A 4HAVA 1SVKA 4TSFD 2ZE6A 1SZPA 4ASUD 2JLZA 2BC9A 4GPTA 4EFLA 2JLXA 2GCOB 4A82A 3GJ6A 3QXJA 2IS6A 2HV8A 4D4JA 4URWR 1P9RA 2EWWA 2D62A 3GMTA 1KO8A 4PQYA 1RRCA 1TF5A 5H68A 3X1YA 1US8A 5IRCD 2O8FA 1IQPA 3LNCA 1II8B 2OT3B 3A1UA 3PVSA 1G5TA 1KI4A 1RFLA 1JR3D 2ZEJA 2ZYTX 4GP7A 5GADl 2OM2A 5GJCA 1GNPA 3IIJA 2VYFA 4LBYA 4BFVA 3THXA 4MITA 1YRAA 2NG1A 2VSXA 4ACAA 2CJWA 1SVLA 5IK2A 5KTYA 1NMXA 1TU3A 3NEYA 1E2DA 1EG7A 1AJEA 2GVDC 4PPFA 4Q02A 3A58B 2YVUA 1NL3A 1AQYA 4KYUA 2AKAB 4GMDA 4V0ME 4IVRA 3AUXA 1XBTA 1CULC 5C1BA 4Q9KA 2ZS9A 2AXNA 2V1XA 2IYSA 2JLWA 1VMAA 3QPUA 4JJZA 2QI9C 5CLQA 3TGPA 1CS4C 3QSYA 2H8KA 1TMKA 2B7CA 2BKUA 2RAPA 3TSWA 1IONA 1XEWX 2NO6A 2O8EA 2BM0A 2F1IA 2IS4A 1E3MA 2WJJA 1DAFA 1T5IA 4XTRA 4RZ3A 1PZNA 3RANA 1J8YF 3R9WA 3VMFA 5JJKA 3WBKA 3U6KA 1J2JA 2GK7A 2QENA 2VF8A 4G5OA 4CEJA 4ZI2A 2FV8A 1YKSA 3ICQB 2A5YB 3TR5A 4ACBA 2QNRA 4Q1BA 3BBPA 3X2SA 2VIIA 2JCSA 1P7CA 1KK1A 2C99A 3TMKA 2H5EA 1XX6A 3OEHA 4QJ4A 4TL6A 5BXQC 2R44A 3DOFA 3VR4A 4RD0A 3GFOA 4HB2A 4UXJA 2P5TB 4D2IA 1IOZA 1NJFA 1XJCA 4RKFA 2J7KA 3T1TA 3SI7A 1IN7A 1NLYA 1VYVA 2CCGA 4DVGA 2YC2C 1H8HD 3QEJA 2PZFA 2F1RA 5CJPA 3T34A 2RGEA 1CXZA 5JZVA 4FCWA 3RRNA 1DARA 4V0MA 2NO9A 2QGZA 2KWIA 5KSOA 2PCJA 1W4CA 2ZQ5A 3JZMA 3N2IA 2PH1A 4ZCIA 4PC2A 4S2EA 1KMHB 5G40A 3TRFA 4A9AA 3RC8A 1YR6A 4M21A 3BC1A 1X8KA 2J0UB 4OK5A 5AJWA 4FWTA 1XJ0A 4RD6A 2DHRA 4B75A 1OIXA 3FMIA 4PQRA 2XZLA 1XP8A 2RGCA 4NYMR 2RMKA 4E5UA 4DDTA 1JB1A 3CZQA 4P3YA 3U44A 4W7SA 2D7CA 2JJ8A 3B1ZA 1D2NA 4KCGA 1ZVQA 1KI6B 4NHOA 3NH9A 1SVSA 5G3YA 3TUIC 4ZKDA 1XF9A 3MCAA 2F1JA 2QMUA 5J5CA 2WOJA 1M2OB 4P4UA 1CR1A 3I73A 3N70A 2GCOA 3KB1A 4Q1DA 3X1ZA 1R0YA 1R6BX 4N0DA 5CYOA 4CIDA 1A1VA 1ZC3A 4IRUB 4LYAA 1FQKA 4V02A 3RRMA 5KHOC 2Q3HA 4UJ5A 4Z51A 1S96A 2GJSA 3K0FA 2E1RA 2NPIA 4IFEA 1YZGA 1G7RA 3CRVA 2CXXA 4QNMA 5FBRB 4NCJA 4PR0A 3MJHA 5SZJA 1OB2A 1CR2A 2MSCB 5AUPB 2FJUA 5EE9A 1VYTA 5JCZA 2XTMA 1OXSC 3BB3A 3FFAA 4OI1A 4Q1AA 1EFRD 2YINC 3SJZA 3AF0A 4XOIA 2RGDA 4URZR 3IO3A 4XWAA 2EVWX 2IC5A 5ELXA 2ZRJA 3VX3A 1LY1A 5TV2A 5JCPA 3O47A 2ZXUA 3K53A 1MT0A 3JVUA 4JBYA 4OK6A 2VRWA 4U02A 1FUUA 1M7BA 4URVR 1GL7A 2JLQA 1RIFA 3DDCA 1NVVQ 3TK1A 3UANA 1ZCAA 2O5VA 1G3QA 5FUVA 2W58A 4B71A 2DFNA 2VHCA
chains in the Genus database with same CATH superfamily
1DQZA 2P65A 3EODA 1B93A 3D6JA 1B41A 1H3FA 2HDOA 3BL6A 3GOQA 5DGCA 1V8DA 3RQSA 1T9GR 2H7YA 4JS0A 4IF6A 1H1LA 4EA6A 4PLCA 5JW6A 2FPPB 3BREA 4GE0A 5LXTF 1ISRA 4PXSA 4BWYA 3FPKA 2R3SA 2H4FA 3IPRA 4LHEA 4R8LA 2W8BB 3QE3A 2X3UA 1XZBA 2XUJA 3K30A 4PYLA 4GPBA 3V6MA 4C7VA 4G5GA 1HDCA 4UUBA 4UPVA 2D0IA 2BGJA 1NW6A 3MPUA 1E0AA 1YACA 4QJBA 1LBQA 2TMDA 2QSJA 2AGVA 2XDQA 3BYZA 1BN6A 2D1SA 2HK8A 5KYYA 5F64A 2WMNB 4RELA 2G3YA 5DTEA 3VPCA 4D57A 4IEEA 4H1HA 3TXYA 1I4WA 2QR3A 2ZK7A 3BFKA 4FYVA 2IK8A 1C8BA 5D00A 5CFMA 1D0IA 5FTMA 1ZD1A 2ZB7A 4IX1A 3E3LA 1AK9A 4Q3EA 1JXAA 1N8NA 2RI1A 4JBHA 2VTVA 4JLBA 2GTPA 5CAEB 2I22A 3CLTD 4B2PA 4TSRA 3UAVA 5ALDA 2P3LA 4PG4A 4FDAA 3KVNA 1ZG3A 2PUHA 3HR8A 1MW9X 1UBHS 1BS2A 3CUVA 3UJ8A 4L0MA 1I2CA 1N92A 3H8SA 3KBOA 3QUSA 3DO6A 3H0EA 2XKBA 4CTNA 4ESOA 4KDFA 2R87A 4KIWA 2DLCX 5DFAA 2OHVA 3T1OA 4MS1A 2WB2A 2YXDA 3RVSA 4ZO8A 3V1UA 1ZISA 5H16A 2A9QA 3QXHA 5E8JA 3TZQA 2HRRA 3COVA 4YEDA 4L0QA 4TL8A 4JDUA 5DHSA 4ZFNA 3KNZA 4BCDA 3T94A 2WTEA 1A7KA 3AYXB 3BTVA 3RG2A 3GOHA 1KPHA 3L6OO 2V0CA 3OBBA 4PFQA 4FZVA 4BAGA 5L40A 3PDHA 4HWTA 1O4WA 3LLUA 5JZ9A 3COWA 5EVJA 4I1RA 3PDCA 1QGAA 4A10A 4JVSB 5HIMA 1Y3DE 1U8YA 1ODJA 3L46A 2DKNA 1Z7GA 2H29A 2CWDA 3H04A 1H94A 3IJEB 2Y3IA 1JMYA 2ZETA 3NYWA 2KLBA 1G21B 3V33A 3VV3A 1JHUA 3CX4A 2J45A 4QASA 1BQEA 4K9RA 1VPWA 2JANA 2AIRA 1RRFA 1Y8RB 3B12A 1A1SA 3W05A 3ZWYA 5FUWA 2P91A 3UW1A 1JT9A 1RAGA 1JHDA 1VZ3A 4FT2A 3H5LA 4UAJA 5KI6A 4EATA 4B1FA 1KDZA 4US2R 3L6DA 2C97A 1X70A 2WFAA 1VSUA 5HMMA 1TKRA 2O8NA 4CYMA 3CRMA 3ZGZA 3NS7A 3S2UA 4ZZ3A 3VOTA 5IJ9B 1XKTA 2VRCA 4C4OA 5LC1A 4YDRA 3JQ9A 4RTJA 4N8SA 3WB2A 4ND3A 4PICA 4E1VA 2VS1A 3B6EA 2VP6A 2GOYA 4HAUA 2O7QA 2HF8A 3SKYA 4LF7B 4RNDB 1JIXA 2NZUG 4P8RA 3TF5A 5HOEA 4JJKA 3M0EA 2W2PA 1XTUA 1MPTA 4FW8A 4QXQA 5EWLA 4X20A 5ICEA 1JX6A 2QX9A 1UMBB 3BQ9A 3W8RA 1KZ7B 1NMYA 2ZI5A 3UMVA 1E9VA 2GXAA 4WN9B 2ZI7A 1L7OA 3OPMA 4MW4A 1GTJ1 4QEZA 5IZCC 5HCNA 2JGDA 1C7EA 2IEZA 3AOEA 1B26A 1OCEA 4E3WA 5B6JA 3A6GA 3MUNA 2AFRA 1OI4A 2VJCA 4LY0A 1U6JA 3DKVA 4MV3A 4GDMA 5HG0A 1P7PA 1LS6A 2WV9A 4LDPA 1QNFA 3F8SA 2PSFA 3HI4A 2FUNB 4NZZA 3VZCA 3WHKA 2J3DA 4GICA 3WWCA 2KBEA 4QYWA 1E1MA 4LF4B 3G0HA 3U81A 2Q21A 4PGGA 1DMSA 4IFBA 4Q5IA 2RI0A 1NVTA 1NC3A 1IBCA 2VPQA 4WJKB 3M5CA 3TMAA 1L5VA 2MSEB 4GSYA 2UVDA 2ZAOA 4MWEA 2YHIA 4DC1A 2XMQA 3L8FA 5B3JA 5E3HA 3N6XA 3NHSA 2ZRIA 2QWXA 3OOSA 3QPWA 4YMLA 1CP3A 3Q1LA 1TZMA 2BZSA 2J3EA 1N6NA 1P4GA 2OILA 1W93A 1JR3A 3QOYA 5CFRA 3KP1A 3ZHVA 5ILOA 3I2KA 3EZ6A 2LD4A 3UC9A 1DEOA 3UOWA 4JU9A 4ZCMA 5DNDA 1V37A 2VK2A 1UIMA 5KCZA 1IK4A 1ZI8A 2G80A 4Z0NA 2PWYA 4TZKA 4G8JA 1KYVA 4JA0A 1QCDA 4CCYA 2UZ1A 3CYFA 3PQ3A 4PLTA 2VHUA 4JT4A 3KUDA 2PMWB 1P19A 2QS9A 3D3WB 2O14A 2O0JA 2YHUA 3GLHB 3IBGA 3PICA 4BAUA 4DMFA 1SUIA 4D82A 4MYTA 4NS1A 4Y2SA 5E9AA 4EHBA 1GM5A 1A4IA 1XCLA 1XU4A 1EWQA 2Y6VA 1L6RA 1YBVA 1YK1A 3EMVA 1GT91 1ZINA 1QYWA 1G6OA 1MHPA 3SICE 1JJFA 1HYBA 2XIJA 4BRWA 4F6CA 2G6TA 4OG2A 4HJXA 5G4LA 5FJJA 2GPBA 4KBFA 2GD1O 1NQTA 4LY6A 4A8JA 4V03A 2VTBB 2GN8A 2ZRQA 3UHJA 5KNCH 3HVJA 1YQEA 5ALZA 4FQ7A 4JOQA 3DWFA 4AMYA 1HLDA 4RK0A 3O2QB 2O8BB 3K5HA 4N5DA 2I9PA 2QF7A 3KXLA 3UJCA 1HSOA 2E4ZA 2OCLA 4Q4JA 3MTEA 5F98A 1NJ6A 1D2MA 1VLJA 2QN1A 1VOTA 1RWBA 2NU7B 3B53X 2FDRA 4FOTA 4QFDA 4NNJA 2B0CA 1MV8A 3JQPA 3L1JA 3ROKA 3UWDA 4DR3B 1Z2AA 3SZRA 3EAGA 3SQLA 2PBLA 1PS0A 2QTHA 2GCIA 4MGYR 4ZYXA 3T7IA 4WCFA 4IW3B 1Z7WA 3CZRA 3HNOA 3HXLA 5DOZA 1SZDA 2A0KA 1HDGO 2WM9B 3HI6A 3U16A 1T3LA 1U3GA 5KQGA 4MROA 2ZIWB 4UPEA 2XKAA 3HJUA 1SKAA 5ICCA 5T8KC 3CKYA 4X65B 1L7PA 2A9OA 5MN6A 4HLCA 4L4XA 2W2TA 5LP6C 1HF3A 1E1DA 2X86A 3F2IA 4M1QA 1GKUB 1MO3A 2Y1DA 4PG6A 5A1TA 5J2UA 2N46A 1RWOA 2O6LA 3OQHA 5FNZA 3ETCA 1MH9A 2DPMA 4W7HA 1VKJA 3WL5A 1H8HA 1GIAA 5JNRA 4D6XA 3IB3A 1NQUA 2SECE 4HDRB 4XYBA 2P4HX 2WSLA 1FTQA 4XA8A 5WRFA 5AK4A 4A8HA 2ZZMA 1EDDA 3GB9A 3SQXA 1K8QA 1QE3A 4J1TC 3MTQA 3TS1A 4ZMSA 4Y6SA 2R86A 4HATA 3EW7A 2CK3A 4L8LA 4NYJQ 2ZJ5A 3QWFA 4LOJA 1GL9B 2ZJ1A 3M5PA 4W5QA 1E2KA 1DC7A 1LNSA 3PC8A 1WB9A 2VP0A 3DZFA 3IQGX 5J58A 5L51A 1CVRA 5FA8A 3BMOA 4GUAA 2Q2NA 1O9BA 2PGLA 3DEHA 1W35A 1Q0SA 3HEMA 2QP3A 3LJKA 4GI1A 3AR4A 1HGXA 4KO3S 4P32A 3ROXA 2G40A 3QEAZ 3KQVA 3BF7A 4LMPA 3NC0C 4MLCA 1JR4A 1T0JB 5JD4A 2P6RA 1CUFA 4QYXA 1C9MA 4TWAA 1IFXA 1WBJB 4W6QA 4EH1A 2YJ6A 1TKBA 1W48A 4KI0A 4O08A 4PAGA 3QUCA 1Q2UA 2O3SA 2RG7A 1SHKA 2COKA 5AOBA 5THKA 3U26A 3MLEA 4AURA 2H5JA 1YS2X 2ZVJA 3NC4A 4Q4LA 3OP1A 4Q1VA 4E07A 5FWNA 1A8UA 4WY5A 3WGJA 4I8DA 1TO1E 2YW2A 4D9CA 5ITZB 1J25A 3QXXA 4PV7A 3MOIA 2XCUA 3FWNA 2JJYA 1J0EA 3PEFA 4B4OA 2FSVA 2GS9A 1WL8A 4FFPA 4C2TA 5G41A 1V35A 3DLPX 4IMPA 2X7XA 4WA8A 4HAZA 4IIDA 1G291 1NE7A 2CUNA 4H7HA 4HWGA 5ALVA 3EA4A 4BLUA 1MA3A 1ZMRA 1ZM9A 5D3MA 2YQ5A 2HPZA 4LRTB 1Z0ZA 4MUAA 3U62A 1K8YB 1GPUA 1PZMA 3KEQA 4BNDA 2HT6A 1UKBA 3RVMA 2ZM5A 1A2BA 4C20A 3EMKA 3I9OA 4NY1A 5KVVA 1PG0A 3LQ4A 4TXHA 4BP1A 4PQFA 2NLOA 3AM5A 4KO8A 4FZ3A 3W9SA 4DR4B 4KK4A 3DZCA 1TRKA 3FUXA 4P0QB 1S1CA 4JY7A 1MEJA 4Q1EA 3HB4X 4DQVA 2FN9A 3GGCA 1A5ZA 3ENQA 1XELA 4B31A 3D8NA 3RUIA 2BFCA 3ONNA 2G6BA 2UVPA 3IKVA 4RNCA 4X6XA 3MGCA 4GX0A 4IXDA 4DY4A 2OBNA 2VUSA 1F4PA 1WSBA 2AI1A 2FRXA 1SD1A 4ZDIA 3WRWA 2ATXA 2MR5A 3K96A 1RZ3A 3B5IA 3PDWA 3HCPA 3VHLB 3WS7A 4QIHA 3CF0A 4NMLA 3SVLA 1BD4A 2Q1SA 4FFVA 4OQXA 5BVHA 1GG8A 1T36A 1DJPA 1YU6A 2P4QA 4DCTA 2O7SA 2L0XA 3C3JA 2I66A 4JLUA 1ZIYA 1TCAA 4EKDA 3WMXA 5M2QA 1Q1BA 4KAAA 3DHNA 2VJPA 1E4YA 4YMIA 2RIRA 2YFHA 1RWVA 4U6NA 1QKIA 4C9BA 2P9GA 1JDTA 3HGQA 4NEQA 1U2DA 3IKJA 2AJTA 4BN5A 4C06A 2WOOA 1HZZC 5E8RA 2OYCA 4DADA 1EGVB 2WVGA 4MQ4A 5TVGA 4DJ5X 1K2WA 4FS3A 3A28A 3RW9A 4Q4HA 1SQGA 3PYXA 4D79A 4GU5A 2GN6A 2EP8A 2WWFA 4IDOA 4PFSA 3UAZA 1D6MA 4OMUA 1A9TA 1PQYA 2R6JA 1N3BA 4YI5A 3STUA 1N5MA 4FGJA 3QPVA 3G2OA 3RC2A 3ABIA 1Q7TA 3GRCA 4DCUA 4HVLA 1YR9A 2XMBA 1LB1B 3ONFA 1Z26A 1YVDA 3CRQA 3LFUA 4GG1A 4J0GA 2Q1YA 4LZLA 4MWTA 1R4AA 3HJCA 4BUJA 3UAYA 2AXPA 3L49A 1I51A 1OT3A 3KUUA 4GSKA 1XMXA 5G1OA 2PYDA 1ZSYA 3IELA 4YQYA 3EVBA 2O54A 4GXNA 3AERA 2EZTA 3M6XA 3QY0A 4JBGA 4HQNA 3BJZA 2XGMA 5JIBA 1V9LA 3X3HA 2QUZA 4YGXB 4BCCA 1GDTA 4QVKA 3V9AA 1IXSB 4BLTA 3L77A 4FBGA 3CZ5A 1JHZA 5JCXA 2JEOA 1CY4A 1Y33E 1JLRA 4Z1MD 1EP3B 2JD1A 4JH0A 2Q6TA 3ZCUA 3AFIA 3ORRA 4MRVA 2H4JA 3TZKA 3QI2A 2NU9B 3LHDA 2HM7A 1MRSA 5GONA 4YMTA 1N6LA 2YL2A 1M8PA 4BLWA 1GAXA 5LLDA 2VLBA 5LOVB 1E59A 1A5BB 2V96A 4IYRA 3VR0A 3KVRA 4IO0A 1XRNA 1EE1A 2FCRA 2YXEA 2PA3A 4YPVA 4EDFA 5DSTA 3HMKA 3SS8A 2FGKA 3NTQA 5EP3A 4PYKA 4RF2A 3FOZA 1JEYB 1GTSA 2ZJ8A 2EF0A 2M2IA 2F3TA 4EYSA 3QPBA 4S0ZA 5B12A 5LOVF 4X1KB 3IMCA 2IL1A 2ZRBA 3D4OA 2PK3A 3FTNA 3HN2A 1ZL0A 4B79A 5IBQA 4GOND 1G6KA 2XDYA 4CV3A 2QRUA 2XMSA 3JU3A 5FTLA 3VC7A 5LLTA 3UJDA 4EG6A 1ZHFA 3DEKA 3K6RA 5KNDH 4M0UA 1KFJB 1OY1A 1XZGA 3WLQA 5D2CA 3NHFA 1GZVA 4MPJA 1YBMA 2A1UA 4RKQA 4N7BA 3I2FA 3ZBQA 3G5TA 3KXPA 4YXFA 5IJWA 1C7ZA 1OZFA 1YJ5A 3C1UA 4JJIA 4OYRA 5C7IO 5JSHA 1SHUX 1DADA 1JAHA 1FYDA 2VPYA 3EAQA 1O9HA 2RI6A 4OB8A 4NZMA 2BUCA 1XZKA 3UH1A 1ZUWA 3CEJA 4KH1A 4RD4A 2MU1A 3BRQA 5J5AA 4PBSA 3RVBA 3GRKA 2Q7DA 2R8RA 3PUVA 1PLKA 2ODQA 3HO6A 5G1PA 3FBGA 4UUNA 4CRWB 3LXXA 2R8EA 4CDNA 5FX2A 4X91A 3PR1A 2DYKA 2FG6C 2XUFA 1KNQA 3EG5A 4AY4A 1RLTA 1JLLA 2WYUA 1MZVA 5CT5A 1TVEA 2J5KA 2R6AA 3LYUA 1SUDA 4I1VA 4PO3X 5CM8B 4YRJA 1P80A 4HDOB 4G2NA 1N8TA 1FUEA 2OQVA 3VM6A 1ZEJA 4H6WA 2Y1KA 4NCHA 4AUNA 3UGKA 2PR7A 2QM8A 3J7AC 4BQRA 3ELDA 3GFQA 5HDQA 3JARA 1AQIA 1J2UA 3VR6D 1UZNA 2H17A 2QGFA 2WJ3A 1DO8A 1JHOA 1FJHA 2B36A 1PJ4A 1SBCA 2CZGA 4XIGS 4BN0A 4C4XA 5JISA 4HNAB 1XZPA 4F6RA 2V3WA 5GGXA 1V7QA 2P2DA 1XZMA 2NWQA 3OOJA 4L02A 1BZYA 1Y5IA 5BNZA 5HHTA 4ZCPA 1NF8A 1R50A 4LNAA 1CUYA 3GCXA 4WXMA 3F9IA 2E4AA 2ZANA 5KYUA 3DYBA 3Q9LA 4ML3A 4J7AA 2MSWA 5L3ZA 3IP8A 1IXYA 4NCIA 3IAM1 1NP3A 3GX1A 3K92A 3KOWA 4LHWA 4U7PB 2YV2A 4TLMB 5CUQA 4AW9A 2VBCA 4ZOQI 5BWCA 1G41A 1OOEA 4MVYA 3GLSA 2ZWPA 1R4NA 3HKEA 4M9CA 5GJWC 3EDQA 1NLZA 1WD7A 1Z0KA 3F49S 3FHOA 3FZEA 3OFNA 1TK9A 4YP1A 1DC4A 1RRVA 3VU9A 3RSFA 3WGMA 4LXXA 4BGUA 3EXG1 4FE4A 1ZJ4A 2FWPA 1C30A 5C34B 4LMAA 3SNKA 4MIOA 4KBYA 1Q7GA 3VJKA 5EZYB 3WJ1A 4E88A 2GPTA 2ORVA 3O4JA 4TL9A 1LDMA 1PW5A 5CCEA 3DAYA 4KREA 4QRHA 3OLCX 2LIPA 4KQMA 3IUSA 1JPVA 2O2HA 3SHFA 1ZSVA 1RKVA 4MVJF 1UXOA 3KL2A 1ZD2P 3CWQA 4LQ4A 5JAMA 3QU2A 4Q3CA 2W6MA 1NXQA 1EFLA 2XBMA 1HDEA 1S6YA 2PGAA 2WJAA 5EZYF 3V55A 3ETLA 2JS7A 3UA4A 3PUZA 5J1SB 3ZVRA 4ZVSA 5JY6A 2FTKE 4ZCSA 5EY5B 2FQ1A 3PE3A 3RS5A 2UXCB 3KQUA 3F9CA 3RSHA 1U8TA 3RIGA 3ZKAA 1ZU5A 2O1XA 4RF4A 2QTCA 5IVIA 3UENA 1Z62A 1Z8HA 3ISJA 1G60A 1U0TA 2EEZA 3OJXA 3E61A 1E5XA 4I3GA 4ZGGA 1CUAA 3EB9A 4GVLA 1GPKA 5FRDA 1DKUA 2H2DA 3GRRA 3OM0A 1QBGA 4AYWA 6LDHA 1YQDA 2XWQA 5KPJA 2O57A 3IE1A 4N5HX 3CPEA 1WKCA 1ECGA 3UAOA 1GTRA 1DOHA 4GX1A 4K0RA 4ZOCA 1PX0A 5FNVA 1D8TA 1VMIA 5K9ZA 4ER7A 4FM9A 4QATA 4TZTA 1PE0A 4RBNA 1E2NA 1M1ZA 1SOWA 1DPGA 4FYYA 1CQXA 4K6HA 4JVOA 4RA9B 4J1NA 3TD6A 4KQCA 3L3BA 4Y8VA 2JJMA 5AM5A 2WAYA 4ECAA 2R7NA 1MT3A 3DDOA 1KP2A 3RYTC 1TA4A 4E7PA 2NXEA 5A4JA 3V8RA 1DV2A 3WICA 1UEIA 4A6EA 1CF4A 1DJOA 5DM0A 2GJ8A 1R15A 1ENPA 3JYHA 1H93A 1ND6A 2ID4A 5DGHA 4QBFA 3T7SA 1H0HA 4CQMD 1UJ4A 3PJEA 1Y6RA 2EF1A 3NFRA 3KZKA 1D2EA 3EZNA 1KEEA 4ALNA 4RJLA 5G0SA 4JV5B 1DX6A 5HEKA 3DM5A 3ECAA 4PSAA 4G1BA 3NC1C 5L3RA 5C8VA 4DFDA 1Y82A 2JLVA 2PX5A 2QY6A 4L4UA 1V5WA 2RC6A 4CMAA 4ERXA 1EH5A 5AVQA 5JDCA 4E46A 2OORA 3AKCA 4MX8A 3GJ5A 3Q10A 5FT9A 5H4HA 2NUAB 5HX7A 4W5NA 3G2KA 4O2AB 2M1XA 1ML4A 3E7PA 4ME6A 3PTZA 1RIIA 1G8JA 2GSWA 3BFXA 5GY7A 2VPPA 3D54D 5LDHA 1FJXA 2WRZA 3B6IA 3MWDB 1NVXQ 5CD9A 1FS5A 2WKRA 4EYGA 1E2HA 4D3SA 2H1FA 4MPRA 2NTYC 4CMEA 1BU8A 1P5JA 3Q40A 4KLCA 2CGEA 3F1KA 5IC4A 1T5HX 5BOSB 2YMPA 1MX1A 1Y6FA 4O2AF 5DWVA 2BTEA 1GKLA 4HMQA 4RPKA 3AJAA 4EM6A 3JRWA 1GGHA 4MA4A 1ZI6A 4PPNA 4GR5A 3B6ZA 4DJTA 4D6PA 1AHNA 4Q9AA 3A6FA 3RJTA 4AP5A 4RD2A 3BA6A 2HMAA 2XMZA 2ZTHA 2OENG 4MGZR 1V2GA 4M0KA 1U04A 3TLCA 1T91A 4MKXA 1B0ZA 1M2HA 4KNVA 1NKVA 2HLDD 4LHXA 5F1KA 4Y9RA 5JG7A 2X4IA 3SXPA 3QE9Y 1SG6A 5D86A 4KRFA 3PWSA 4P7FA 2BY4A 1JSLA 2BGIA 3QVXA 1PWYE 3TI9A 4BUCA 1U6KA 3CIFA 2AFHB 2HXSA 3IILA 1GAQA 3BWDD 3HA5A 4I50A 4G26A 1NJ1A 1V45E 2AHRA 3KYJB 3M70A 3N6RA 4GT1A 1P39A 1TK2A 1N6RA 2C03A 3IIMA 4B0OA 5TQVA 1IZZA 1F8YA 4FN5A 4YROA 1D5WA 2C5GA 3FLBA 5K6AC 1JIVA 4QG3A 4NOKA 5KVQA 2O0HA 3KRTA 3NAGA 3RDPA 4C0BA 3AW8A 3WLAA 1YA4A 4LV8B 3N05A 1VYHA 1TJ5A 1GSHA 2Q50A 4FFBB 4XZ3A 2QVLA 1KGSA 2ZYWX 1N2GA 3AZQA 3MK31 2P30A 1DWPA 1XXLA 3U7RA 4EAQA 2O8EA 4MHSA 5TSDA 2VDNB 3DL0A 4P7GA 4QGBA 3NKVA 4RQAA 4H7KA 1K7XB 4J0FA 2VNJA 3A9CA 3EDYA 5BNTA 4EPWA 1UXHA 4ZEVA 2FH5B 1JUDA 1L8OA 2GWRA 1R5BA 4FONA 2PXAA 4MLZA 3NDRA 1D2CA 3CKMA 4PCVA 3UJAA 1U7PA 4YN3A 3ZI0A 2DM6A 4RK4A 5BNIA 2W6JD 1E1NA 3TNDA 5C4GB 1JIUA 5GVSA 3AM1A 2A59A 1DIHA 3AINA 5G53C 1N0IA 2H48A 1FA9A 1PWZA 3H99A 3L7CA 3MWEA 3SQWA 1T4BA 4MUFA 1BXZA 4WNYA 1JV2B 2XTJA 1XCGB 2OPBA 2XMDA 2BFPA 4FHGA 2GBLA 5D84A 2XCRB 3KQMA 3YASA 3NTUA 5AMXA 3VZDA 2UV8A 5AQ1A 3RYIB 1C41A 1DO2A 1COWD 1I3OA 3CXUA 4QOIA 2QVXX 3BB4A 3WY9A 4X1YA 1NRWA 4QLOA 1KZ1A 1P18A 1CNMA 4KGXA 4C3VA 3OIVA 1K3FA 4JP8A 3AY0A 5CT6A 3RU2A 3JAKA 3QBTA 2Y8EA 3RSZA 1WB6A 1XZLA 2A9FA 5AVTA 3VNSA 4RIHA 2EKQA 3VJMA 4CQJA 3RE1A 1Z63A 1IEVA 3HP4A 4Z7OB 2H65A 2EFHB 3BFPA 3ME5A 4GRAA 4QQFA 5CIWA 5EXSA 4PX2A 3U1VA 1RC8A 2AK2A 1V1RB 4Y0NA 2BBTA 1M2OA 1EVEA 1P5ZB 1B23P 4LCJA 3KJQA 3AUSA 2GZMA 1KAOA 1VPLA 1UAGA 2HSDA 3DDSA 3NYRA 5ECWA 5EE0A 5B7GA 4N1AA 1JHXA 2OG2A 2Z1NA 1NMEA 3GNLA 3DG9A 4OCZA 4JLDA 4UCQA 5HFNA 1UMDB 3V4VB 3D9QX 3WIVA 4B6GA 4QJ3A 2VVTA 4NWIA 2Y0PA 4Z8YA 1B15A 1X7YB 3V4OA 4BX9A 2QYSA 4ZMBA 5C1OA 3KV3O 1T5DX 3WO0A 4YP6A 3W3ZB 1UPBA 1YWGO 3E2MA 1VG8A 4HDQB 4NOLA 1SG0A 1XMQB 2OHOA 3D2LA 3EXEA 1H9BA 4K28A 2Q62A 3AY6A 3QE2A 5H82A 3ST7A 3SSNA 3I6YA 3TB6A 4EVRA 1GKIA 4OQEA 5C53B 3AESB 4U0JA 1C9KA 4KLZA 3EQ8A 4OU5A 4J4TA 1FOEB 4KLRA 3SWWA 4GUDA 1ZIXA 4ZOLB 1VIMA 3V34A 3W4JA 1PGOA 4J90A 1FTNA 1KEUA 1OU4A 2HMUA 4A03A 4Z7JA 3L8ZA 3KDAA 3ZHXA 4M1OA 4DXAA 3BAFA 3TQHA 4QOGA 4JI2B 2JI7A 1R0XA 1X9GA 4XQCA 5JZSA 4AZTA 5CDSA 2JFGA 1H3NA 1MIOB 4K3UA 1J0BA 2O3TA 3E15A 1Q50A 1X1RA 2AL7A 2QIOA 4UXHA 1R9NA 3PX3A 1U4OA 1QHNA 3QVUA 1CYDA 4ZOLF 5DW0A 1KTIA 3MINB 4RK5A 4H08A 4KDEA 4FOSA 2NTVA 2DWPA 3HQ4O 1AS3A 4JJ8A 2OHXA 2WG2A 1G16A 2YRXA 5U9CA 2VXCA 1NBOA 2E4YA 2IYFA 4NIMA 3CE9A 3ZWPA 4RPGA 2G4VA 1MB0A 2VDJA 4BB5A 3CZ9A 4DT1B 1UDAA 2O50A 3TIGA 2JG3A 1RHQA 1VKNA 1PUXA 1T4CA 1VXRA 5JCJA 3GEMA 4Y2QA 1NY6A 2OO5A 4BEJA 1AVTA 3VTAA 3D8RA 4EGCB 3KYDA 2HIMA 4R6XA 1I3NA 5JADA 2QLLA 4B8YA 1WV0A 5CVCA 2G82A 1JDUA 4JKOA 3CISA 4BO0A 1QGED 1QAOA 2JPDA 2Q3FA 5IJZA 4MEJA 1GY8A 3UK1A 1QHFA 3LM8A 3PNSA 4FC6A 1LFAA 1OYYA 3FKJA 3IAXA 4IIJA 5BYKA 3RS2A 1PEKE 2XXBA 1TTPB 3ETGA 4ZQEA 5B55A 3ZS9A 2VRNA 1VE6A 3HJNA 4ITRC 2JKYA 2P3QA 4JT9A 5BW4A 3C6BA 3SKXA 1F51E 3A4VA 4G9GA 1KFCB 2H54A 4KYVA 2BM1A 1JWAB 3BK1A 4J07A 3UJHA 3V1MA 4A0SA 4BFCA 5FBVB 4NJEB 2C96A 1RBZA 2IYUA 3SLKA 2N75A 5DN6A 3WRXC 1BS9A 1SULA 1TM1E 2HDWA 2CSUA 5FAKA 4IOLA 1DGQA 2Y77A 1RU3A 3DVAA 3FGZA 3KWMA 3PC4A 5C8YA 2AUMA 3KJEA 3BD7A 2PFSA 3S2EA 4GZMA 4D97A 1UOPA 1MHTA 1CDDA 2C83A 4K86A 1R9MA 2E5WA 3RO7A 4BO5A 1STOA 3ZLTA 2JASA 1RP1A 5DXFA 4GAEA 1XU9A 2BRUA 1VSBA 3AHGA 3VH2A 5K3SA 3UB4A 1XAJA 3S81A 3KQLA 3W5CA 1E7QA 3EH1A 1L9XA 1NVAA 1ZGGA 1TZJA 2W9XA 1P61B 2ONCA 4D4HA 4BJ6A 1EVKA 4V39A 3RABA 4B81A 3B1WA 4S1OA 4Q48A 5JS8A 3T35A 3MJRA 5TC4A 2CZQA 1X0XA 3EGDA 3G1WA 4RPLA 2RE8A 4HUQB 4YIKA 1JXQA 4H3KB 3T06B 4EJ0A 4LJ5A 4ETIA 4FXOA 2I71A 3P9ZA 1HG1A 4D41A 1OX4B 5AI8A 3ZWQA 4XCXA 3BWXA 5B7PA 3LT5A 5ALPA 5IAAA 1IM2A 6PFKA 1DEHA 1T0HB 1TUIA 2ZRGA 1P0MA 4I5GA 1SWWA 1BE6A 1Z5UA 3PHLA 4C6SA 5L53A 4QTTB 1PL8A 3THYB 2E4VA 2KHZA 3M4NA 1V95A 4QL3A 1VGQA 4XUCA 4DA8A 1OIVA 4AIIA 5GZ3A 2J9GA 5D3QA 2CLIB 4FWBA 5TQ0A 3JQGB 3L4KA 4URYR 3LA6A 3V7WA 5LDDC 3NHWA 3LT1A 4W9NA 2PKXA 3H9CA 3JQQA 1FEZA 1RMYA 5KOHA 4YRAA 1QKKA 1W19A 4OFBA 2IXDA 4NMHA 2VATA 1AY0A 4YIHA 3IJPA 1JEAA 1Z08A 1JHVA 4DYHA 3Q7PA 4LYGA 2E3JA 4B73A 4V1CB 4BO4A 1FNNA 1PGQA 5EJIA 1ODLA 2QW1A 5DYTA 4EUEA 3G2JA 5KOJB 3N0TA 1ZCJA 2YWRA 3JQBC 1GU1A 4FNOA 3A6HA 3ZZTA 1ZBQA 4HEJA 3R9KA 4BNZA 2FWNA 2EDAA 1VXOA 2A1IA 4EELA 5GGYA 4XI9A 3OWOA 1JEQA 4E1BA 3ZD7A 1F2VA 2J9FB 3UGQA 2PL1A 2PKRA 5AVXA 1O8CA 3L04A 4HDMA 4NZPA 1XJ5A 3E4DA 5ALOA 3MRTA 2G9NA 5FWAA 2PT9A 5KNCA 1NPYA 1DQRA 3ZHUA 2V6GA 1PQ4A 4A0FA 1GGMA 1ECPA 3AFHA 2IU0A 2YOFA 1L4NA 1RHRA 4UMDA 3A1DA 3I4FA 4J16C 3GWGA 4R2WA 1CR6A 1KZYC 2FXVA 4FP9A 3UIEA 1SG9A 5DNYB 2ZSKA 2WJIA 4NOJA 2M9MA 1F0PA 1UBKS 1PBNA 2ZYDA 5B36A 4R2MA 3U3MA 1DUVG 1I4TD 2J7PD 4K9OA 4Y2YA 1F8GA 1UKYA 1Y1TA 4ISBA 4ZVMA 3IBCA 3KZOA 4QU9A 3ASVA 2PSDA 2XTNA 3CT6A 1V6AA 2C2YA 4GP6A 2OO7A 4N6GA 3OQIB 5IDYA 1C5KA 1KPIA 4UUOA 4WZAB 5A62A 1SXJC 2QN2A 3B2QA 1JF8A 4TTPA 2QU7A 2XOEA 2ACVA 3ADPA 3SC6A 1APBA 2DTEA 4GKBA 4IJ5A 2Z95A 5JPDA 5JMTA 1UP4A 4DV7B 1ZHOA 1IBKB 5DSZA 2G9ZA 4PLVA 3V8VA 4J75A 3AEKB 5E4FA 4R01A 3SR3A 4KFTA 1SC9A 2WFLB 3SK0A 2NO4A 2ZUDA 4GLFA 4UZFA 1KWGA 1AURA 4M54A 3CUWA 4UDYX 1ILWA 221PA 2JL1A 1UOEA 1NQWA 3QF7A 2RK3A 3KO8A 4HSGA 5E4YA 5TX7A 3SIPA 3T7EA 4DSNA 3VAAA 4E31A 5DYYA 4HS4A 1J0XO 1WRBA 4P82A 1X8JA 4MQFA 4MO2A 3MTDA 3O03A 3EXFA 2B0JA 1EIZA 4JP5A 1XEXB 3ESBA 3JAWA 4RIGA 4RU1A 1VFPA 3JS5A 2Z3VA 4YLGA 4CZ2A 2H5IA 4QO7A 2G9QA 4HLUC 1EFAA 2J0QA 3K73O 4F2HA 3HUDA 4LOIA 1RJWA 3K94A 1EK1A 2Z4RA 3FCUB 3KOXA 4CNBA 2PEZA 1Y6GA 1N0HA 2GFIA 2C2GA 2VPWA 2BMEA 2W6OA 2YHBA 1JPNA 3H2YA 1A04A 2QX4A 4FDMA 4P81A 5DTQA 4BQSA 4PTLA 1OH8A 3BXOA 3H2KA 4NZOA 1WXEA 4FFLA 4LG1A 2ECPA 1O8BA 5IYZA 2VAMA 1U7HA 2OFOA 3NBAA 2YZ2A 4YJHA 2AZ4A 3CNHA 3M6AA 1MOZA 3TB4A 1E9SA 5DM70 2BGUA 3IQWA 5EKDA 3QWHA 1A2KC 2Q5IA 1ORIA 3R8CA 5TE9A 4AQYB 9LDBA 5KSOA 3ZTWA 3W04A 1FXWF 5T4FA 4U7WA 3GG9A 1VP3A 3DOHA 4N5MA 1SXJD 3LHIA 3RVQA 1NJGA 1AGPA 5DLQC 2A7QA 2B30A 5BSMA 2PS1A 3RC7A 1OXUA 4G1EB 1N2HA 1YSCA 2JBAB 1OFVA 4PE5B 4ZJYA 3EPKA 4ZHQA 4AO7A 2C5BA 4C3ZA 5AVVA 4Q34A 1U0RA 1LLCA 3ROEA 1HLPA 2PXXA 2NACA 2O8EB 2HQBA 1QO7A 1J1IA 5E95A 2G25A 1E5TA 3R0XA 5AFSA 3T5MA 3EMDA 4XEUA 3ITDA 1WKBA 3KLMX 4P34A 3I3SR 1NYRA 1BCSA 1W76A 3QMMA 3UJPA 2YMQA 2WA2A 3M3PA 4QTUB 4TS1A 5CNMA 2PJUA 2X0NA 3CZMA 4R83A 1JTFA 1PFUA 1SU6A 4G25A 4KAJA 1I1QB 1F60A 4FW9A 1C81A 2DR3A 4Y2XA 2RGXA 4GXTA 2J1LA 5F1YA 5JC1A 3GJZA 3EEQA 2XKKA 1BTOA 4A2PA 4FTWA 1RD4A 2IUSA 3QYFA 4PC1A 5HDBB 1EVIA 4DLTA 2B4RO 5CIQA 1TM4E 1Y7HA 4BNGA 4LKOA 3UH0A 2K2WA 2DFDA 4UUMA 3DMPA 4G63A 1IM5A 1E66A 4XRRA 1R10A 2EW1A 3F5MA 3LOUA 3W5JA 3PDIA 4I4LA 4W1RA 4ZJPA 2QUAA 4B6RA 1IB6A 3E9NA 1JQLB 1LI7A 3SFZA 4DYVA 3GNQA 3LWNA 4UAVA 2ZTMA 3GEBA 1BXRA 4U9HS 3FJOA 3HCFA 3KYBA 4E5KA 3LVBA 4R2XA 1KWKA 2YV1A 3M82A 3SHOA 4CMCA 4C0XA 4J3NA 5BQ3A 1DUSA 2AFIA 2HFJA 4WZBE 4MUYA 1GAJA 1SUCA 2G77B 2VUTA 3E8XA 1BWPA 3IE0A 3RKSA 2CB9A 3WJ7A 1YQUA 3LL7A 3OOHA 2O9JA 3K5WA 3ORQA 1M1YE 3U44B 3L0IB 5HBRA 3FYUB 3R1IA 2AYZA 4MQEA 1P73A 5C0OE 2D2XA 2JDID 5AW3A 3NT2A 3X1XA 3BEOA 4GZ5A 3IMGA 5DT2A 4ZVTA 4FEAA 3TVYA 5ALHA 3PQEA 1D2RA 3MAAC 2Q6VA 1GR0A 4IBOA 4ATNA 1W2WB 1WZEA 2OFXA 3VYWA 5D6NA 4XPIB 3T5TA 1Y1RA 2CLDX 3FY4A 1LNQA 2VK4A 3T3GA 1SC3A 4HL6A 2DJ5A 2PRYA 5AUQA 1ZN9A 1Z6AA 4GI2A 3I04A 1SU4A 1H22A 5ALIA 4B3HA 1EXWA 2PRZA 4M1TA 3EMBA 1BVRA 4B9AA 4FWIB 3DXZA 3R9XA 2G5PA 3GFTA 4ZTZB 3ZJVA 3K0FB 2FEWB 3G79A 3LUKA 4LJKA 5FTKA 2H3EA 1AZSC 3DVQX 2PYIA 2ZR9A 1QH1B 3C14C 4CT0A 4YK7A 3IAUA 3C3YA 5ALRA 2UYCA 1QK5A 3EHEA 1OZHA 3EGIA 4WBNA 1SGWA 3VKWA 3TD2A 2JI8A 2ORIA 2WPDA 4Q00A 2XOKD 3DV2A 5C18A 4RJJA 1OGIA 4MWGA 4D5EA 2BFFA 2C2WA 1HDOA 3EZXA 2VNIA 4S1PA 4XCQA 4B33A 1WUJS 1AA6A 3UMYA 2B98A 4D6YA 5J4HA 1PQWA 2XNSA 4I66A 1SPBS 2CHGA 3LWZA 3AL2A 2VDKB 2OV6A 3IQIX 4UHEA 3VSBA 4WAUA 1KZ6A 1UK8A 3KQSA 2E37A 1NBMD 2H4YA 3WLPA 4RC9A 3BDVA 3ISTA 4QYIB 3KFXA 2NP7A 4LNUB 5ALSA 5KDDA 2FQYA 1SUEA 2XX3A 1OUMA 2CNNA 2ZBDA