3I45A

Crystal structure of putative twin-arginine translocation pathway signal protein from rhodospirillum rubrum atcc 11170
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
378
structure length
378
Chain Sequence
SLEAIRIGEINSYSQIPAFTLPYRNGWQLAVEQINAAGGLLGGRPLEVISRDDGGDPGKAVTAAQELLTRHGVHALAGTFLSHVGLAVSDFARQRKVLFMASEPLTDALTWEKGNRYTYRLRPSTYMQAAMLAAEAAKLPITRWATIAPNYEYGQSAVARFKELLLAARPEVTFVAEQWPALYKLDAGPTVQALQQAEPEGLFNVLFGADLPKFVREGRVRGLFAGRQVVSMLTGEPEYLNPLKDEAPEGWIVTGYPWYDIDTAPHRAFVEAYRARWKEDPFVGSLVGYNTLTAMAVAFEKAGGTESETLVETLKDMAFSTPMGPLSFRASDHQSTMGAWVGRTALRDGKGVMVDWRYVDGGSVLPPPEVVSAWRPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Twin-arginine translocation pathway signal protein
publication title CRYSTAL STRUCTURE OF putative twin-arginine translocation pathway signal protein from Rhodospirillum rubrum Atcc 11170
rcsb
source organism Rhodospirillum rubrum
molecule tags Signaling protein
total genus 147
structure length 378
sequence length 378
ec nomenclature
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3i45A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3i45A01
2VK2A 4RDCA 5D2CA 1OXKB 4W5TA 4IILA 1PNTA 3T95A 3O1IC 5E3JA 4YP9A 2F8SA 5KC8A 2JBAA 3GV0A 1NXSA 1M5UA 4FE7A 4YGXB 1BVHA 3NHMA 1DBPA 3RVOA 2OENG 3OQOA 3OLXA 5TPZD 1JBEA 4JAVC 1SRRA 4Z9BA 1MB3A 1DCFA 4Q6BA 3RVQA 2QVGA 1HEYA 4HNRA 1IIBA 1URPA 5TQJA 4Z4GA 1KMIY 1KRXA 4NCAA 3GBPA 1JLKA 1C0EA 1NXTA 3OLZA 1LK0A 1P2FA 1DCKA 3BRSA 4Z99A 4PE5B 4YRZA 1QP4A 1FFGA 3ILYA 4IMIB 1MAVA 4Z4HA 1Z2EA 2WJAA 1NATA 4UHKA 1DJMA 2H3HA 3H5LA 4LE0A 2JCGA 1JX6A 5T3YA 1P6QA 1U8TA 3HSYA 3CTPA 1FQWA 4EYGA 3F6PA 1ZH2A 1JDNA 1BA2A 2MSWA 3FFTA 3HV2A 3IPAA 3HO1A 3KCNA 5TQ2A 4NCBA 3QEKA 2NUBA 4H3KB 3KTOA 3ROTA 1MB0A 1NXOA 1CHNA 1DG9A 3EODA 5GQSA 1TM2A 4Q7EA 3CNBA 1NXVA 5IULC 3N75A 3SNKA 2CWDA 3LUKA 2FN9A 3O2QB 4D6XA 4MPTA 3QX9A 4W5RA 3SAJA 4F06A 3HM9A 3NNSA 3HUUA 5CHYA 5KQPA 4IF4A 2R48A 1ZGGA 1GUDA 2MYUA 1RPJA 1AB5A 1DC7A 4TLMB 2HPHA 2YHAA 4PEVA 3Q41A 4WWHA 1JF8A 4Q6WA 4RKQA 5FWYA 1J56A 5KI6A 3RVLA 2IPMA 4KZKA 3CHYA 5B3JC 4ZMSA 5JNTA 2WJWA 5DGCA 3L49A 2RDMA 5EWJB 2O20A 5IBQA 4RZSA 3HS3A 4WZZA 1RXEA 1R8JA 1H9CA 1USGA 1Z15A 1Z25A 4Z0NA 1S8NA 4YR7A 1RNLA 1DC8A 1ZVVA 3GL9A 3OLWA 4MGEA 3VNBA 2FMFA 3E61A 3DGEC 5EWLA 2FKAA 3DLBA 3GBVA 2FMHA 4RS3A 4TN5A 2L17A 1DP4A 1JFTA 3JPYA 3NHZA 3NNDA 3KHTA 3FGZA 2L2QA 1JYFA 3O74A 3H1GA 1W9HA 3FDFA 5FWXB 3OQMA 4YWHA 4MS1A 4PYRA 3F73A 1A0OA 4YCSA 4MQEA 4N76A 2ID9A 1ZITA 3N6VA 4RY9A 4ZPJA 5KC9A 3OLVA 3KLNA 3TD9A 1TJYA 1Z13A 2FVYA 4MLCA 3M9XA 5TQ0A 1M2FA 2PJUA 5EWMB 1A04A 5GOTA 2DRIA 1ISRA 3OMWA 3SQNA 1WETA 3H5OA 2B4AA 2JK1A 1SXGA 3H5VA 4JA2A 4O1IA 4MS3B 3MF4A 4KVFA 1BDJA 2IDMA 4NICA 4YS6A 3QELA 4MR7A 3HXMA 4HYEA 2OQRA 3DLHA 3I45A 3URMA 3TB6A 1P8AA 4EGSA 3LOPA 2JBAB 3I09A 3M6MD 2PUDA 3A0UA 2A9OA 3RVSA 3L6UA 3JS5A 3RVNA 4XARA 4F11A 3IP6A 3H1FA 3LTEA 4TMYA 3JY6A 4RY0A 2YHBA 4Z4CA 1JWLA 3EGCA 1EWTA 1U0SY 3A10A 1K66A 4W5OA 5CNMA 4QICA 1YTUA 6ABPA 4RY8A 4RK1A 4QYWA 1ISSA 1TVMA 1DRKA 2RJOA 2N9UA 3G1WA 3LUCA 3N0XA 3T6KA 5HSGA 1AB6A 3QLUA 3Q7SA 3OO1A 5B3JA 1OXBB 2IPAB 2IKSA 1D1PA 5KWSA 4XAQA 3D8UA 2Q5CA 3GWGA 3Q9SA 3KS9A 3C97A 2PUCA 3I5AA 4KREA 3O1HB 2GI4A 4OLAA 3OM1A 5TQ2B 8ABPA 3JTEA 2FQYA 3RH0A 3CS3A 4LE2A 2J48A 3F6CA 3CZCA 5CNJA 1EFAA 3Q7TA 4EVRA 4PICA 4F3TA 3RVPA 4EYQA 2E4UA 3KSMA 2JVKA 3K4HA 3QX8A 3GRCA 3O75A 1FSPA 4LX8A 3N0WA 4W5QA 5HQJA 4D74A 2RGYA 2NZVG 1YK1A 2GWRA 4UHJA 3JPWA 1A2OA 1D2AA 3I42A 1QP7A 1K68A 4N47A 2NT4A 4ZYLA 5JNUA 3O2SB 4ETIA 1ABFA 3IP7A 1APBA 1JFSA 3CG4A 3EAFA 3Q15C 1FFSA 2A9RA 2QXYA 5FWYB 1YS6A 1JHZA 3LUFA 2HQOA 3UUGA 2CHEA 2QV0A 1M2EA 2HJ9A 3RVMA 6CHYA 1D5WA 4N41A 1ZY2A 2PAFA 1DBQA 2MSKA 3NNNA 3B2NA 1I3CA 2E4XA 5IEBA 4F8JA 1GCGA 2JVJA 3G85A 3QEMA 5EWLB 4S04A 5JNRA 3NBMA 4Z4EA 1GUBA 3HDVA 1Y1LA 2FXIA 4KQ9A 5F64A 3LUHA 2MYNA 2JRLA 4G0PA 2WWVD 1DCMA 5BQ3A 4D6YA 4Z4FA 3T8YA 4KK3A 3MA0A 3QLUC 4F12A 4CBVA 4MS1B 3HCWA 4TLLB 4EYKA 4XASA 3T38A 4MQEB 5C5EA 2PE5A 2E4ZA 2LPMA 3MQ4A 3BREA 2QU7A 1E6LA 1U2QA 2FQXA 3N53A 4EUKA 2IOYA 1U2PA 9ABPA 5TQ0B 4DN6A 1QQAA 1TLFA 4IMJB 4RK0A 5ABPA 3SG0A 1L5ZA 3LMKA 4LZLA 1MIHA 1YK0A 4G0MA 5KQMA 3QELB 1ABEA 3LUAA 4MR7B 3IDOA 3SY8A 5JNVA 4KRFA 4LDAA 1Z17A 4RK7A 5HM6A 1ZN2A 3F7NA 5KQLA 1M5TA 1JH9A 4FB4A 1QP0A 2QW1A 4KV7A 4MR9A 4Z9AA 3CU5A 2PUBA 4G0XA 1QO0A 1QKKA 1VLZA 2QZJA 2FSPA 2GKGA 3C6QA 2ZAYA 3H6HA 3D02A 4N0PA 3EQ2A 3HDGA 1JFVA 5C5CA 1PNRA 1SXIA 3DBIA 3HK2A 5TE9A 2WB4A 2FEWB 3UK0A 1DRJA 3LUJA 5JNSA 2M98A 1QNLA 2JB9A 4RK6A 3RVRA 3KLOA 5IUJC 3OM0A 4MS4A 1Z2DA 3BBLA 3KJXA 3IP9A 5CNIA 2WY2D 2PL9A 2QVCA 2V0NA 3RVKA 2L18A 1EAYA 4EVQA 3GT7A 2HSGA 4JB2A 2CHFA 5JS1A 4JB0A 4PZ0A 3FFWA 1ZESA 2FTKE 3S99A 3OLYA 3DGFC 5T7BA 3OMXA 1YVUA 2FMKA 2GX6A 4DQDA 2PUFA 1SD5A 1T34A 2AYXA 2PLNA 3HJFA 3QLVC 4HNQA 2A9QA 4KFCA 3R0JA 5DTEA 2QR3A 1NXWA 3BILA 3DZDA 3LUDA 4DADA 7ABPA 4WT7A 4RXMA 5TPZA 2F8TA 4MQFB 2L19A 3TX6A 4EYOA 2LIVA 1VPWA 3K9CA 1PEYA 3IP5A 3LKBA 3GYBA 1LBHA 3CFYA 1BAPA 1RZRA 2WMYA 1F4VA 3KYJB 4RXTA 1W25A 5IUNC 2TMYA 4WXEA 1MVOA 2VUHB 3RQIA 1XWWA 2MYPA 1NY5A 4KQCA 4ZJPA 4MLDA 2LBPA 4XLTA 1PHRA 4EVSA 3C3MA 1D1QA 5PNTA 2PMCA 4RK5A 3MMNA 3Q7RA 4JASB 3FMVA 4ZMRA 1JDPA 5JNWA 4MQFA 2JVIA 4LDZA 1GLGA 1JYEA 2RJNA 2FW0A 4QYMA 4OLBA 4KK4A 5JS2A 3CG0A 3QEMB 2PKXA 1CYEA 2E4WA 4JP1A 4B09A 1Z16A 2FMIA 4E7OA 5BRAA 4YV7A 2M1ZA 4OBBA 4GNRA 5TPWA 4Z4IA 4S05A 1RZRD 2IPNA 4NV3A 4WXMA 1F51E 3EJWA 3IPCA 5FBHA 2NT3A 1UDRA 1DBWA 1Z12A 1ZGZA 2AYZA 1KGSA 2E4VA 3E3MA 4P98A 2X7XA 3HZHA 3SM9A 1FFWA 5HKOA 3CLKA 4MR8B 1D4ZA 4RKRA 3HVRA 1QQBA 2KYRA 3W9SA 4KPYA 2BGGA 4L85A 3OQNA 4HNSA 3O1JC 2IPLA 1YIOA 1YS7A 3MM4A 4ML3A 3C3KA 4IRXA 1ZAYA 2R47A 4MAAA 4RV5A 3KG2A 1ZDMA 3H5TA 4E7PA 1NXPA 4RSMA 3LUGA 2FQWA 5IEJA 1YMVA 4G97A 4N03A 3QLVA 4OTZA 4MR9B 1NXXA 3LFTA 3N0RA 4RU1A 3UKJA 4ETMA 3ILHA 3N8IA 4MR8A 3LKVA 1QMPA 1VKRA 4P1ZA 5IX8A 1NTRA 3JVIA 4G0ZA 5FBKA 4EY3A 2HQRA 1E6MA 3H75A 4H3HB 5KQGA 3M9WA 1CEYA 2GBPA 1GCAA 3CRNA 2PUAA 4G0OA 2FN8A 3KYIB 3O2JA 4LE1A 4Y9TA 4MS4B 1RXIA 1ZH4A 5I4CA 5IC5A 1L5YA 4N0QA 3A0RB 4XXHA 2R25B 2B1JA 3C3WA 2P4UA 1EWVA 1Z26A 5BRJA 2LUOA 4W5NA 1LJLA 3GA5A 1USKA 4YO7A 3JVDA 2WRZA 4RWEA 2R4QA 4IGAA 1U04A 4XFKA 5ED4A 5DCLA 3ROFA 3QK7A 4FE4A 1P6UA 3O21A 2P9HA 2VYCA 2MYTA 2PL1A 1C4WA 5BR1A 1PEAA 5DLEA 1EWKA 4GPAA 3BRQA 1LJUA 2NZUG 4MRMB 4NQRA 4RK4A 2IYNA 4M88A 1JL3A 1Z18A 5EWJA 1LBIA 3TO5A 4H60A 2FEKA 4G86A 2QSJA 2MSLA 3HEBA 1BDHA 2PUGA 4KNYA 3EDCA 1QPZA 2A9PA 3EQZA 3H5IA 3HUTA 4G0YA 3KKEA 1KRWA 5CNKA 3H5WA 1DZ3A 1PUXA 1QO0D 1E6KA 1USIA 1XHEA 2FEPA 2ZWMA 3QLTA 4L4UA 2PUEA 1BDIA 3VNAA 3CZ5A 1TMYA 3CKMA 4KMRA 4RXUA 4O1HA 3MYYA 4G0QA 5FWXA 2LP4Y 4MRMA 5IUKC 1E2BA 1VRVA 2E4YA 3TMYA 4QPJC 3MIZA 2VUIB 4LRQA 1YMUA 4O5AA 3A3KA 5DKFA 2ID7A 3P9YA 4OG2A 2H0AA 2FLKA 2CD7A 3FFXA 4MYRA 1B00A 5EWMA 3OO0A 2HQBA 2FLWA 3H1EA 4WUTA 2XDYA 2I6FA 4JOQA 1SXHA 1ZHHA 3EULA 4OATA 4MS3A 4YLEA 5TPWB 3H6GA 2W42A 1EHCA 3RVJA 4ETNA 1XHFA
chains in the Genus database with same CATH superfamily
2OO5A 2VK2A 2FX5A 1W35A 3SC2A 3TOVA 4M99A 3KT8A 1I4LD 3T95A 4DEYA 2ZS7A 4IG9A 4XQGA 1AG9A 1YDGA 2O1EA 3OCUA 2C5SA 4JP8A 3I83A 3U3KA 1BGXT 3AV0B 4ZAFA 1JBEA 4WERA 1EDBA 2O7RA 3E9NA 3JWHA 3RAEC 2CL6X 2GMWA 2ZBGA 1HDRA 1Q44A 2RGBA 3T1YB 3D7NA 1JLKA 2OE2A 1OX6A 4F5DA 4D6PA 4FNMA 4Z99A 4MB6A 2NNWB 1PQPA 1VLQA 3ZCRA 3GNQA 1RAGA 4IIGA 2AOUB 2G83A 4I50F 2EQBA 3IX7A 1G2IA 3MGCA 1CFJA 5DTJA 3Q1LA 2D00A 1JLRA 1WDLA 2CDAA 2QUZA 3IBGA 4KVAA 2FUEA 1S2NA 1QV6A 4YJGB 5G53C 5T3YA 3NV7A 5CB8A 5F12A 4RF2A 1EUZA 4LJ5A 4Q34A 5IXSA 3WGTA 3MS7A 3OWXA 1BA2A 1X13A 5EUCA 2I6XA 1XQ9A 3E70C 3JVVA 2GARA 2OV2A 5J1SB 4OK6A 3QVGB 3EMKA 3U2QA 1KYIA 2AD1A 2HSJA 2H4WA 3ESQA 4UAUA 4O2BF 1RXWA 3WQRA 3TZKA 1MB4A 2AI2A 3CPJB 1NYTA 3CNBA 4NF2A 4LI3X 3RFUA 4HPXB 3RSQA 5A4KA 1PRYA 4XM2A 5FBZA 4X44A 2H0QA 4JYZA 2LKCA 4K46A 5LXTA 2DLDA 3AHHA 4N9WA 3WRWA 4UHBA 3TINA 4EB6B 5EJ6A 4QJ4A 4BO9A 2VJDA 4L3VA 4HDQB 1GZ3A 3TNLA 4M1KA 4CXMA 3VV2A 2HDOA 4V02A 3VO9A 2MYUA 3D7SA 4NBSA 3M3DA 2HXYA 2AG5A 3FNBA 1T4BA 1OAAA 3VR6H 3X1KA 2OILA 4B3TB 3BCUA 3PGMA 1V1RA 2F17A 2G4CA 2V03A 2XVMA 3I4LA 3OKCA 4NZMA 3RC1A 3UGKA 5C8ZA 1MJ5A 4FMCF 5J2TF 3BWVA 3TVYA 2O06A 4NBNA 1C9JA 1TFRA 2JH9A 2Q99A 1C9EA 1SA0B 5CIWA 1FRZA 2F9LA 1E3LA 4R8KA 4TZKA 5C1PA 3BTVA 1RE1A 3VISA 1IHUA 1X87A 2J8ZA 4NMXB 1RKVA 3CR7A 5LQJA 2AHOA 1TW2A 3CRQA 4CCSA 4V0OA 1PR2A 2C29D 4HQ6A 2FW6A 2RHOA 1NFRA 3KU1A 1LBQA 2IGBA 2ECQA 3R2JA 4HLUA 1YDWA 4KWCA 1KTIA 4QASA 2ZG6A 4IXNA 3ZY3A 4JL5A 4CDGA 1PE0A 5E7JA 3AILA 5AICA 1B6TA 4A0QA 1N5MA 4X1KB 4RHTA 1C41A 4PNPA 1PBTA 1GTL1 3I0ZA 3N6VA 3RBZA 1XALA 1I3MA 1XO1A 3WB2A 2QI9C 3EOZA 2I99A 3N5KA 1WQ1R 5I7EA 4IP0A 5TQ0A 4FW8A 1EFKA 2OCGA 2XYQA 3LX8A 3BORA 4NJMB 5EWMB 1PX2A 5T6MA 2C5FA 1XAIA 2EXXA 2NGRA 5DYYA 3REQA 3W2EA 4EM6A 3UK1A 3ZJVA 4CCYA 3V32A 1P4GA 1NVFA 1Q3KA 2YXLA 3ZTYA 1QF9A 1TO2E 4CODB 4KFSA 1XNQB 3KK0A 2B99A 4IHKA 2V3WA 4H4EA 4U2KA 4X7PA 4HVCA 4NU0A 3TG2A 4GR4A 1M7GA 2JGLA 4WKNA 1PKEA 1XG5A 3B3AA 1QR2A 4D0GA 4NL4H 3EPRA 5DNAA 4HTAA 2ID8A 5EC8A 5JV5A 1IQUA 2NTYC 3T5GA 5BN1A 2A9OA 1SCAA 3L6UA 3OZRA 1WPQA 4NBVA 3S5UA 3OOHA 2CE7A 1UBNA 2B34A 1P2DA 1NG1A 3PLNA 4IIEA 3T4EA 5BWOA 1BYUA 3K73O 4LYYA 4DREA 1YT5A 2ECOA 4NARA 3AMVA 3GQBB 4ADSG 2WF9A 1Y7TA 2F3PA 3A10A 1PLJA 3PDIB 4FBGA 4ZOBA 4LAFA 3RU3A 1P31A 4N18A 1YTUA 4RHCA 4L6IA 1WUJS 3ILXA 3GEHA 2JNWA 4YJFA 4PTZA 4DVGA 5JAUA 4COOA 1L7PA 2Q6VA 1MH9A 2IZ6A 2QVZX 3Q98A 1XD2B 3ZWQA 1C7IA 4B43A 1D2CA 3IPRA 4NCXA 4C3VA 4ER3A 4JFRA 5DHSA 2AD5A 4HP8A 1D2NA 3DWFA 2G8LA 3UEOA 4BB6A 2GM9A 2RCYA 3OFVA 3OZXA 3BJMA 1FDWA 2VJAA 2ZJZA 4FFVA 4JYBA 4A8TA 4XCQA 4BLQA 3QUBA 4OHFA 4B46A 2ZRLA 2VATA 4W99A 3HJHA 1LBTA 3AESA 4FD3A 4IX1A 4HUJA 3K5IA 4XDHA 5EQDA 4JVNA 1Y4ZA 1NKVA 2ISCA 3ER6A 3NXKA 4KODA 4LE2A 1VKJA 4KI7A 1W5EA 2ADMA 2R4TA 3OEWA 4W9NA 5DOZA 3EEOA 2H4XA 1ZICA 1C81A 4DR6B 4OHKA 2GD6A 4BMCA 4DIUA 1H1TA 1WCWA 2OV8A 3CBQA 3SI7A 4ABTA 2G08A 1JDUA 3QV2A 1C30B 4LQ4A 5F1YA 4A15A 4DPMA 3FF4A 4FC7A 1AS2A 2X0EA 5K3EA 1N6RA 2ZRPA 1R6VA 3MELA 1OC2A 3GH3A 1ODSA 3O8NA 4ZZ0A 3LY8A 5HWSA 3DTVA 5CLHA 5LMCA 3KVNA 3BDAA 4UUAA 3O3NB 4PPGA 3BMQB 6REQB 4YCJA 2PFGA 3O2SB 5I3CA 3VKFA 3M6WA 4JLUA 2AJCA 2I33A 2PLWA 4RKYA 1LTKA 3T3NA 2BFFB 1ADYA 5ECDA 2GBLA 1NAIA 2XRFA 4NHEA 4LV5B 5AVJA 2PJDA 3VAYA 3VO8A 3NM4A 3WRVA 1NZDA 3UWKA 5JYBA 3GVPA 3GJ5A 4ZOAA 4R51A 4BXOA 1H6DA 4C1BA 4LZZA 1D5WA 2PMFA 2VDKB 4IDEA 4D0RA 3K6SB 4ARIA 3IQGX 5EAIA 1FS6A 5EUBA 3L4KA 3E22B 4RA6B 1KZ7B 2IEIA 1YGYA 3ULKA 3NBKA 3ROPA 1GCGA 3DBOB 5ECWA 1NM5C 2B2CA 1RWMA 3TRJA 1UJ2A 5JBQA 1CVIA 2C95A 4KQ9A 1C9NA 3H97A 4D9MA 4LF7B 1ZVKA 3T99A 3VOBA 5AJTA 4QQRA 1GT6A 3AG5A 3IEKA 2HL6A 3B1JA 1H4QA 2G9VA 3GMIA 1MV5A 1ZOLA 2C9YA 3Q0EA 2CXOA 3M5PA 3QLUC 3UPTA 3VTKA 3DMPA 1PW5A 3IR7A 2EW1A 1BHQ1 4H0FA 4HS9A 5KEIA 4J8PA 1JSCA 5HBRA 2BELA 2C8KA 3F47A 4G84A 2HLDD 4P4LA 2GB4A 2IOYA 2F1RA 1AZWA 2O1WA 3DULA 2DVMA 4OOEA 1RJFA 1FMJA 1UMBB 1WXIA 1Y37A 2Z08A 4LCBA 4BNYA 3F90A 1LSOA 2PKCA 4R54A 1H6AA 2D5LA 2WUVA 2HR1A 4TLBA 1EFPA 3H1TA 3CWZA 1F2UB 1LX6A 1N7GA 4G5FA 2O2YA 3TXYA 3RLIA 1GQRA 3AGPA 4I55F 5CH5A 1I01A 2BKUA 2VBIA 2D1RA 2VJOA 4K3UA 4TWBA 5CTAA 1MO5A 2PGXA 2X19A 1YJQA 3UAGA 1RBYA 4ZHSA 3THXA 1ZCZA 4BE4A 1YR7A 2IZOA 3AETB 3AL3A 1Z2OX 5CVCA 1Z33A 2ZAYA 2YMQA 2YR0A 4XVCA 3EIEA 1ZM4A 3HDGA 3QX3A 4A3SA 3HJAA 3IMKA 4XVRA 1P4JA 3QRWA 2H57A 1B2RA 2A5DA 1RDFA 1MX5A 4ND5A 5BW4A 1R0CA 2OZLB 1KERA 2F1HA 3KOXA 3P2KA 1F2DA 3BC1A 4KSCA 3DP9A 1P81A 2R7LA 4FN4A 2HJVA 4G07A 2WIAA 3KLOA 4JQSA 1RRFA 4C0WA 2I66A 1E3SA 4FMDB 2UUOA 4MI3A 5T4FA 4GM4A 2JL1A 2PL9A 3IAXA 4HFMA 4OL9A 1U0BB 3RVKA 4XGIA 5TX7A 4ZAYA 2WG2A 4I1RA 1WJGA 4P5EA 2NTJA 1KJZA 4HXEB 1JR4A 5BMVB 1BEUB 1MORA 3HCRA 2JHFA 4KDCA 2FTKE 3D2LA 1QCCA 1X94A 2G4VA 2H85A 3I1JA 1U3WA 1P9WA 1YACA 2H51A 2H52A 3SSAA 2ACEA 1JDZA 4B17A 2CNWD 4GSKA 2FJPA 4OAPA 3LJKA 4IGFA 1ZR2A 2JFVA 4NONA 4QXMA 3WBJA 3CUTA 4F38A 3CVUA 4DG5A 4J03A 4PFJA 4DADA 2W48A 2UZ1B 5EP3A 4WT7A 3R40A 1N4AA 2UDPA 2XHEA 5B30A 1JQLB 2C82A 1NONA 4BN5A 4BLVA 1M6VA 2LZ0A 3ZV6A 1NP3A 1SQGA 1MR3F 2EFGA 1K5GA 2VZEA 3GYBA 3X44A 3SJBA 4CR7A 1QHSA 4M9SA 4MVCA 2Z43A 4Q3KA 4HF7A 4IIVA 3VSDA 3DQPA 3MWFA 5ERXA 3K0SA 3UN1A 5AOCA 2I2DA 3TMKA 2BBSA 2P9EA 4LSGA 4KQCA 3H9QA 4DR2B 4YFVA 4RFSB 3MINA 4OMFG 4ZEXA 4EVSA 1GG2A 2DT5A 1F7VA 2QTZA 2R9VA 2RH5A 1HE2A 3K9FC 4YACA 1S8FA 1MABA 2QPOA 3FVWA 3FRJA 3MMNA 3UWPA 4AJ4A 5HZMA 4CUKA 2Y99A 2OBMA 1EUDB 4JT8A 5AKZA 4DXDA 5KYUA 5IJ9A 3WXBA 3C8ZA 3GPIA 3TW8B 4AS2A 4YRFA 1V1JA 3T0FA 2XXAA 3RUCA 2IHNA 1P9LA 1G41A 2Q7XA 3AKDA 1CYEA 1YE5A 2MINA 3AFNA 5B58T 4EJSB 5T4EA 3DNFA 3H8SA 1LPNA 3MC1A 2GASA 1IN5A 4ZCPA 2BI4A 1QQ5A 3CONA 4QWWA 1MRSA 2EFEB 1F51E 1U7UA 2YC2C 3A6ZA 4BFZA 3HG7A 1HFKA 2PT7A 1UDRA 3C15C 5H7XA 3FYSA 3A3PA 1KFKB 1PD0A 1U7WA 3IALA 2Q2VA 1B26A 3L0PA 4UDXX 5LUBA 4BQFA 1UFKA 2A0XA 1U8FO 2EGUA 3D4BA 4JUCA 3P4UA 4KNVA 5FCDA 1CRQA 2EIHA 1PLKA 1ZAKA 1T2UA 3HNPA 1Y1KE 3CEAA 3PWSA 4H16A 2JFUA 5IXYA 3MCWA 4E2WA 4EG0A 2ECFA 1B76A 3MLBA 3BRWA 1JT2A 4M0UA 2IVFA 1ZDMA 4UZSA 4FUTA 3NHFA 4G5XA 3C14C 3DTVD 4HWOA 2R6DA 4ESOA 4PIVA 3RE1A 3U09A 4HZUA 4N03A 1HPLA 2ATEA 3BE8A 3KSAC 2F3UA 1T5DX 3DZKA 5GJVC 3WLFA 4EMBA 4ENPA 2GCNA 4PM4A 1T3HA 2PZAA 5DGDA 3Q8MA 5B6PA 3PUKA 1UBMS 4OFBA 3RWBA 2V7QD 1S2OA 4XFDA 5IAEA 5K0EA 4P92A 2ZPTX 3L0YA 4U7GA 4UM5A 4A91A 2C59A 4FWIB 1FFAA 5CT9A 2QRZA 4PBTA 4OB8A 1FNNA 2GBPA 1GCAA 1XKTA 3HKDB 4DA8A 4EFNA 5DCWA 2YVAA 1QGAA 3GVHA 3L06A 5LJLA 3V80A 1D2RA 1N0HA 4PIPA 3ZV4A 4NFLA 1U9CA 1C3LA 1DJOA 1XVAA 2XEXA 4KP7A 1EWVA 5DNYB 1OXXK 3X1XA 4JENA 1UXHA 4OHVA 5BN5B 4RTNA 4PINA 4XIJA 4B7UA 2AT1A 1TEHA 1GFIA 4WQMA 4CR8A 4A0GA 2ZBPA 4LQCA 1J42A 2PZFA 3AINA 3PGLA 1DAEA 3I05A 1YRWA 1NF8A 1XRRA 5JCXA 3HACA 4KBFA 4MA5A 1EG2A 1E59A 1QG2A 2Y1DA 3F97A 3D3QA 1TK3A 2A5YB 5ILGA 2NZUG 4R5HA 3R7BA 1AGRA 1DTWA 4HH1A 1SUCA 4A6PA 3QTBA 621PA 4WJLA 4C76A 3SC3A 1KJJA 1Y7IA 3DKRA 5FDFA 3TO5A 1YONA 1KPHA 2B4YA 2JFWA 3R24A 4Q4AA 1L7RA 4CMEC 1X19A 5KYKA 4IIYA 2Z09A 4OL0A 3TZQA 2WIKA 5EZYB 2HADA 5C34B 3EDCA 1T9KA 3J7AC 2ZUVA 3EQZA 5D5PA 3IDSA 2B36A 2E1RA 1XLTC 2HK7A 2LGJA 4JVOA 4Z9YA 4ER5A 3JZIA 4QEZA 1BH6A 1BMFA 2PY6A 2YN2A 3MTQA 5KYWA 2VHZA 3O31A 5CIQA 4BEWA 3ASZA 3GJ6A 1NF3A 2XYPA 3WK7A 3DLCA 4DUGD 1VMEA 3C5CA 3TFOA 5I6DA 1E4EA 1UBTS 5EHNA 1Z0ZA 1PGQA 4FFDA 4M8SA 1R7RA 1X39A 1W4CA 4EAQA 2OQVA 4YT5A 2HMVA 3GIDA 4J0HA 4EW3A 2APJA 4G1FA 4MYDA 1C9MA 3WB1A 5DASA 2AH5A 5D3ZA 4DSOA 1QU2A 2CVQA 1CR1A 2GH1A 3S2EA 2H0AA 2PJRA 1T9CA 2XB9A 2BE7A 4PRLA 4X20A 1N7HA 5FXMA 4K9QA 4I1OA 4PSKA 3A3OA 4QECA 1XZBA 3ONFA 4LDJA 4I14A 1MN6A 3CN7A 3JQDA 1TUIA 1P33A 1VLLA 1XTVA 1FPQA 3VAZA 5CFOA 3GEPA 2VHWA 1UAAA 3FXAA 2DUWA 2W42A 3OQJA 4G89A 3UJ9A 1ZRMA 4WOPA 2WU3A 1OIVA 1E61A 3AVXA 2VXOA 3HUFA 2PKQO 3K6RA 4YJHB 4IILA 5F21A 3WLSA 4RKWA 3Q87B 1NW6A 1OZ0A 2HMTA 2XCIA 3OQ6A 3BCRA 3PDWA 4Q9AA 4CM9D 3WLLA 4JI7B 5A6SA 1QANA 4QD3A 4LYJA 3GVIA 1XZLA 3WJ1A 4WLVA 2ZI6A 4BIIA 4RBNA 2UXCB 3GRUA 2QYOA 3BK7A 3ZU6A 1LK5A 5CEEA 3P2IA 2C7GA 1HEYA 2ZPAA 4R1PA 1P6XA 2HQ1A 3U4GA 4OK3A 4AUNA 5ER6A 1S0UA 3Q8XB 4BLUA 5AXDA 5JYCA 2WAXA 3KL2A 5ECYA 1I51A 1KAEA 1LK0A 4NHOA 5UKDA 3MTAA 2WTXA 2IU0A 3ZTWA 1AKWA 2DHQA 1R18A 1IEWA 2JLYA 3OZEA 4QDXA 3T12A 1SUWA 3ILYA 3N2EA 3Q3GE 4YN3A 1E9EA 2AOTA 4L0CA 1Q0PA 2G7ZA 2P4SA 2O5EA 4A36A 2VTEA 3L1IA 1FQWA 1N8KA 4EYGA 1DLJA 3JQ8A 3HVKA 3FD8A 3P7MA 4RH0A 4DRZA 4E6PA 2HRDA 2NUBA 3EXAA 4WAUA 2YQZA 5I3ZA 4NCBA 3ONEA 4AKGA 4P7KA 4ZCQA 1A7KA 4JODA 4U6QA 1RJ9B 1DG9A 1TKRA 2FPWA 2J4CA 4LJYA 3CZQA 2XE7A 4ZT4A 2XI4A 3AJAA 3GO4A 2AZTA 5ETJA 1KETA 1M2GA 5REQB 1U2TA 4CLDA 4F5EA 1B6RA 3L1KA 1OXVA 1NI5A 3ICCA 4RTPA 2J0SA 1HLPA 1SVNA 5FP0A 5LNK1 4D6XA 1NW3A 3LQFA 1AQYA 1LPMA 1U2ZA 3FPGA 1W6UA 4MB0A 3ZJ4A 1FUEA 3I8XA 3PKJA 1Y3HA 3K72B 3IKVA 5CHYA 4BX3A 3A9VA 2Q3BA 5KWEA 3QVVA 1WBJB 4S1TA 2CLIB 2HPHA 3PUVA 3O4VA 5CR9A 2BW0A 4BQSA 1DKPA 3EFEA 4OLHA 4DSAA 4IZOA 1GR1A 4U2BA 2CV2A 1J7KA 4TVKA 2KBEA 3PEWA 2HUPA 1XWFA 3VMMA 4URXR 3F6BX 1RIIA 2IXGA 2WICA 3NG1A 2XDAA 3BRWD 4N49A 4F3RA 5CDFE 1A4XA 5K7SA 1AMOA 4WOCA 2XZOA 4R3NA 5JISA 5AKIA 1QH9A 5EWLA 2GEJA 3GLKA 2PBLA 5E6RB 3GBVA 5LOVA 1PVOA 4UMDA 1NVDA 2C3UA 1KEEA 1JJBA 2RHJA 1QSGA 4KGZA 1MJHA 5BW5A 1CUUA 4P84A 1KVRA 4Q24A 1RHKA 5KSWB 1E7WA 1FRVA 1UWVA 2BF4A 1LWOA 3KKLA 3UCXA 2UXDB 5FWXB 4RIFA 4RIEA 2Q5JA 2YINC 4ARBA 3F73A 2OAP1 4MGYR 2OV1A 1TLTA 1YZVA 3OUTA 4F6LA 1ZITA 2QENA 5CX1B 1UK8A 1X1EA 2Y3IA 2ZWVA 4KSBA 2R44A 2QUAA 4BS9A 2H2IA 3ZCQA 4RVHA 2J3IA 4XPIA 2CHGA 1OZAA 3R3YA 1Z13A 3QYFA 2OORA 3O95A 2JG3A 5DXFA 2O8VA 3PA8A 3QJYA 2KPOA 4O4LA 4O4HA 4EGFA 4ENRA 1LRJA 4U1RA 4RVFA 2JK1A 4P36A 2QV7A 1RXSA 2Z2XA 3OJEA 1LDMA 5F5XA 2QAGA 4YS6A 4PAWA 5CK5A 3RUPA 4U63A 2IP1A 3DM9B 3USES 2EKQA 5CJ2A 4E4RA 2VCHA 4RKFA 2VPIA 1Y4AE 3WJAA 1LV8A 3KXIA 3WLTA 5L45A 1ECPA 2J9ZB 2Q6KA 4TM7A 2QAJA 3DF9A 4K05A 3O92A 3FVQA 1C8VB 2IEYA 1UFQA 2B4TO 2FW7A 4US0R 1U94A 5HEKA 3UXYA 1K75A 1UDWA 3GYGA 2PUDA 1N5LA 3FTFA 1TO6A 3M9LA 1VSQA 3ER8A 3KZOA 5GONB 4IRUB 3UUWA 1CR4A 1OY1A 1U0LA 5TNXA 4BZXA 1BS9A 3LS2A 2PKYX 2QTFA 3GOHA 2X9VA 3JD1A 4ALMA 2EFDB 4ODIA 5AMXA 1K97A 2BMFA 3MHTA 4DIEA 4YCDA 2PQ6A 1ZCFA 2HA3A 3GAZA 2JGIA 1RFGE 2ZUDA 4KC0A 2N9UA 3LUCA 2NUPA 4MVJG 4RF5A 4X71A 2XKAA 2NYUA 3VNQA 5IX8A 3G0IA 1N2BA 5EJ8A 1OXBB 2IPAB 4BFXA 3TSZA 4JEHA 1EDZA 4HGZA 1U28C 1P0PA 1P1BA 1CTQA 2IXBA 1NBIA 5FTWA 4YCLA 5AKGA 1TA9A 5K09A 5KU1A 1JECA 1NDHA 1XPUA 2XD4A 3OQHA 3ZWOA 1E2DA 1JU4A 1DXHA 1JU3A 3DCNA 1M34E 1F2TB 1W581 2PSHA 3PZRA 1FP2A 3VJLA 5CDSA 3R7DA 1EJ2A 2VSYA 1Y1RA 3HVIA 2CMFA 4ARVA 3ZVNA 1N7JA 1DDOA 2HWKA 1C3JA 2JARA 4DLWA 4DA7A 2Y0DA 4H6XA 4LX8A 4E1BA 5H81A 3KQLA 2XQIA 2CL7X 3BEOA 3VU9B 2O2EA 1KYQA 5JAHA 4N3AA 2PXCA 4AJNA 3PX7A 4HDKA 3ABZA 5CXUA 2C3YA 1KNXA 1UDXA 4LVCA 5TGZA 3UJ3X 2ZS8A 2NU8B 1IG0A 5DBFA 4BWYA 1FEZA 2ZWOA 4AQ7A 4D56A 3GCXA 1ILWA 1YL6A 3ASVA 3AUXA 3V9PA 3IL2A 5EYPA 2FN4A 1KH2A 2QNBA 4AF7A 5E8JA 1BDMA 3H17A 4URFA 3RIMA 1MZPA 1NW4A 2XUHA 1PL8A 3GEBA 3G9ZA 3K1AA 1JKJB 3HLYA 1WXDA 1PVDA 4FX5A 2AVNA 2NN3C 1ZWLA 2ODPA 4INZA 1DVRA 1CS0B 2E4XA 3U4QB 2C3MA 1Y48E 2E4AA 4QLOA 3MWKA 4UVEA 3WGQA 5B2FA 4BKUA 2ZTLA 3OIUA 4QGHA 4IIJF 2WWTA 4KWIA 2H59A 2BKXA 4NXMB 3V1UA 4F97A 1I8TA 4RS4A 2G36A 4IXMA 4RZ3A 3HU2A 4LDQA 1Q3TA 3T8YA 4RTKA 4I4CA 3Q5GA 3BHMA 2QT0A 1P75A 5K5EA 1YAHA 2HLPA 3ZWNA 4EW2A 1WBDA 1YR8A 1N6OA 5ALYA 3BREA 5AK3A 5I9TA 2P3QA 1QIDA 5EKUA 1HL3A 5FO1A 1U2PA 4HDRA 5I7HA 2J7KA 3AEZA 3NXSA 2ZE6A 5GADl 2V7WA 4L8VA 1XTBA 5LZ5A 4DYDA 3DE2X 5ABPA 3Q85A 1M74A 2KWIA 3K0BA 2IJGX 2VA8A 1C29B 4AY6A 4ZO9A 2QRKA 2IIQA 3R7LA 4GYJA 1M1NB 5D3MA 3TLBA 3QEOA 3TR6A 4D3ZA 1ESMA 2ZPUA 1Z17A 1JAXA 4ZRMA 1Z62A 1JDBC 1ZA1A 1L4BA 3F7NA 1O6GA 5EIFA 4DCSA 4GDFA 1HWYA 2JS7A 4LI0A 3ZXIA 5D84A 1MDBA 1AO3A 1QKKA 1SU4A 2FSPA 3CH6A 3KVOA 3QBDA 4XLZA 5AKKA 4IM7A 4CUJA 4EMSA 1FVXA 4LYGA 4TS9A 3KJFA 5LQSA 5KNBH 5GZ1A 3HC7A 1TECE 3E18A 5HX7A 1PYOA 2XMDA 3VAAA 1Z5ZA 4H1HA 1JR3E 1GG5A 4KN5A 5BORA 3LUJA 4QPPA 3OHMA 4W5JA 3F49S 4MKZA 4ATNA 1A1SA 3LQYA 4AIIA 1I5EA 2G9UA 5CNIA 3A04A 1X80B 1M34A 4N6OA 4PO1A 2H08A 3VHXA 1C3OA 1QHIA 2YS7A 3GPBA 1UBCA 2Z9DA 4NU8X 4RD6A 5AKLA 1HFWA 3H2JA 3EXIA 4MOWA 4BNKA 4KXXA 3S99A 3ZU5A 5CDGA 3DGFC 4JXXA 1BKYA 3ZCVA 4F4DA 5G41A 1NV9A 1EWRA 3S1AB 3VYRB 1Q0TA 1C1DB 1YDEA 2H5EA 1XUOA 4F72A 2CSUA 3LCRA 1QE3A 1U2SA 4NBUA 1QO7A 1SHZA 1J22A 2WLSA 5FI5A 3DZDA 4LY3A 2W6JA 3LUDA 4P82A 4QYTA 3PEUA 2ZIZA 4QYIA 5TJHA 3G8AA 3O38A 1DAGA 2GZMA 1T0PA 4K6OA 3CH5A 4UASA 3C7TA 5EP2A 3FOEC 2HWYA 3IVGA 3AF3A 1RVV1 5CT4A 4HFNA 1H2AS 1LBHA 5HM8A 2C58A 1RZRA 4OK5A 3E03A 4RXTA 5IUNC 1IWOA 2O8CA 2TMYA 3O47A 4RGYA 2JLUA 4L3WA 4ZOQI 1N9GB 3RQIA 4F9GA 3UATA 3HH8A 5K4GA 1QVWA 5JCOC 3TOZA 1Y3IA 2LBPA 4ZAVA 1O4WA 2D7JA 5IDXA 2IUFA 1YZ3A 3OOEA 2PMCA 4H15A 4JU9A 4PV7A 4RK5A 4ZZIA 4ZMRA 1KORA 4ITVA 1OGYA 2OHIA 3PQ6A 3BN3A 3KEGA 2XIQA 1GZ6A 2GHTA 3H84A 4R1MA 1CVLA 3ZZ1A 4AZTA 5JS2A 2QD3A 4AX4A 1ZXXA 4X6UA 5KNLA 2GXAA 5LYJA 2Z2YA 2E4WA 3QKIA 4D4JA 4Y7CA 4B09A 4EJFA 4U6SA 3SWWA 1V4NA 2P77A 3RJTA 1HY3A 4BV9A 4M0FA 4RVSA 4EW1A 2QIOA 2EKLA 2M1ZA 3N7AA 5GP1A 1MAAA 3HBNA 1KWKA 3SHOA 1LBSA 3WIUA 2WD7A 4UBKA 5JSYA 4EKDA 1EVKA 4ZQHA 3I6MA 3IE2A 3WGZA 1UP7A 3ZJ5A 2X9GA 3F7MA 2NT3A 1CUBA 2WUWE 5C7OO 2BRUC 2ZB8A 5ADHA 3BA1A 3W9SA 2EKZA 5HK8A 4ZQGA 4C6HA 1M66A 3UJCA 5MN6A 3IQEA 1T8RA 2WWGA 3ISVA 5C7YA 2VK4A 1YDFA 3UYLA 1DS6A 4WCVA 4XA8A 1P1RA 3HO6A 1MIOA 3AOEA 1BSVA 1BXRA 4E6EA 1Y5MA 1L8LA 1U3CA 2C3OA 3FVRA 4FMPA 4HFRA 2TSYB 1JFFB 3Q3VA 1FP4B 5IJAA 1RQRA 1TCUA 2PQ2A 1Y4DE 3KEFA 4AY3A 3LFTA 2YIMA 3R6TA 5EIEA 1JE0A 4NMLA 2F2TA 2HCJB 3H18A 5FX2A 3LKVA 1CUDA 1QMPA 4L8WB 1QWOA 1SZPA 2PZLA 3Q3JB 4QODA 2GJ8A 3EEQA 4JJKA 5H16A 1OSNA 2FR8A 1EYZA 1D2EA 4XWTA 4EGJA 3OU6A 1Q6ZA 2X42A 5H9WA 1BXKA 2GF9A 1RE0A 3V2GA 2PV0A 1ONNA 5DTMA 1XXHE 4YJ3B 4GS5A 1NC1A 2QMOA 2G09A 3I1IA 4FDLA 5IZCA 5SZJA 1RXIA 1KQGA 5FLKA 1AS0A 2PPVA 4N0QA 4A9AA 2QHXA 1WF3A 1OE0A 3O8DA 5IFKA 3JWPA 4DR7B 3C3WA 4XOIA 1Z26A 2PMWB 4F1WA 2G1KA 5LNK6 1I7QB 1TAHA 4O4JF 4E2XA 4NOLA 3N2KA 1ZJ5A 3GA5A 4GE0A 3I32A 3F5DA 1WF6A 1WSWA 1DX6A 2JFOA 2D2VA 1ZRSA 2AE2A 2XQJA 5T6BA 4Z1OA 5BYBA 4W7IA 1X7XB 5CLGA 4X7MA 5ED4A 3KIPA 5KKNB 4FE4A 2WJZB 3DEJA 1C1YA 4RTRA 3AHDA 1WU8A 1DLIA 3LGAA 4G5SA 4YAFA 3DDZX 1RHRA 1VHQA 2Y9MB 2HBRA 2JIZD 2OYSA 3FW1A 2NO1A 3T5MA 4XSVA 2HJSA 4UAVA 2H1VA 1G6HA 1GYPA 1MF7A 2QT1A 3CLSC 1FMFA 1FVOA 1IN7A 3NYWA 4BUJA 1WCYA 1P5ZB 3G7NA 5CA1B 1Q50A 3PTLA 2AG1A 3KKEA 4HO1X 4ZCTA 4FYVA 3HYLA 3AEQB 3DE6X 2D3WA 1COWA 3TJZA 1JA0A 3QLTA 4WBXC 4B5KA 2W0SA 2MU1A 1Z7BA 1ISJA 3AJDA 3K15A 4B3HA 2FZGA 3PI6A 5AOAA 1A72A 3NIWA 1JMYA 3G3EA 1V9LA 5DHTA 3PEEA 5LP6B 1QHGA 2HBZA 4Q1CA 4EAAA 2CYAA 4PHCA 1NLZA 1YMUA 3OE7A 3A3KA 2BV3A 3QHPA 4MMYB 4S35A 1P5FA 2VHVA 2ES4A 4HUQB 1J99A 4OHBA 1PW7A 3NYIA 3G89A 4F7WA 3OO0A 4ZVMA 1XCGB 2GCGA 1CF4A 3GZNA 4C4PA 3VR4A 1KMHA 1XTJA 4TZ0A 4NH0A 1SXHA 2PVSA 3P9PA 4LYFA 4KG7A 5SYAA 3E7WA 1Q12A 4MDEA 3P9SA 3SZUA 4LJ7A 1P1KA 2BGLA 1OXKB 2ZQ5A 3B3QA 4YK7A 3SQWA 3FY4A 5EUMA 1UXOA 3BJEA 4C4OA 2GZ2A 1XPOA 1PL7A 1DWUA 2NO5A 2NVUA 3ROKA 1IHXA 1R5OA 1XRSB 2VQEB 4HVAA 2O2ZA 5EIOA 2BBTA 2W6JD 3KPVA 5TR9A 2QIPA 3NTVA 1DQZA 2OENG 3RRBA 3ZE0B 2GN2A 3DZBA 2R0QC 1SRRA 4JXZA 4ZCLA 4II3A 3NDRA 1RZVA 2QVGA 4UU1A 2EFJA 1YZTA 3TCKA 2FQ1A 3DPUA 1RRMA 1I2CA 1DJQA 1J20A 3AERB 4Q9DA 4G63A 3HSSA 1NMQA 1BMTA 1I3KA 2W2MA 3FNFA 3MMZA 4JT4A 4LRSB 4M6WB 4OSPA 2JHPA 3W7AA 1XXHA 1ENPA 3I73A 3TNYA 2CJWA 4UTOA 1I14A 2PMBA 3ORQA 3DUWA 1KAMA 3IXMA 3FWYA 4K2AA 4UTRA 2V6MA 2WJ3A 4M55A 5E0OA 3RUEA 3EZ9A 1ORVA 1VBFA 4PSVA 2AS0A 4XLLA 2SECE 2YZ7A 1OI2A 3K5WA 1JX6A 4FN5A 2H1LA 3SYNA 3HSYA 4BTEA 4GP7A 5C1IA 4Q4CA 3GLFA 4CL2A 3IEVA 2R6R1 1KC3A 3NUGA 1YJXA 3K7EA 3D2CA 1BX1A 2V1XA 4W1SA 2XWBF 3EYAA 1JLMA 5JCZA 3HXTA 1D5CA 1B7GO 1U02A 2P90A 3KWJA 4GLLA 4HAYA 4CKYA 3M81A 4CV1A 3EZGA 3MAJA 5G4KB 2B0JA 3SE7A 3SHWA 2RI0A 1QWSA 5K8UA 3N75A 5BV1A 1PT9A 2HFKA 3OHPA 3GEDA 3FDXA 1Z83A 1M2VB 3R7WB 2I9PA 3TZCA 2HY7A 3NT5A 3HM9A 3ELYA 3IBCA 5DE3A 4M0LA 2ZDQA 2R6AA 3WNVA 1DIBA 4GXTA 3CVVA 2Y1OA 4LRXA 4RF4A 3ASUA 2PR2A 1TEXA 3O93A 4GLBA 4H7IA 5DLYA 5KO2A 4FLMA 1QOQB 8OHMA 3L6OO 2HA6A 3D59A 3TLCA 4CF4A 4FJ1A 4MUKA 3AUTA 5B3JC 4PO8A 4KR9A 2F00A 2ONYA 4NDAA 3NUZA 2JASA 2OECA 1DBVO 4K3VA 3UCEA 4OV6B 2GHQA 1GZ4A 5EZSA 1SKUA 4NSNA 1T5SA 3MBKA 1T6YA 1ISHA 3OPYB 2EX4A 4FYJA 5TXGA 4WBNB 4P4UA 2G5TA 3FRIA 1GGKA 5AVSA 3LC1O 2I6SA 3NHPA 4ZT2A 1QCYA 1JR3D 1IC6A 3CSSA 2I62A 4YY3B 2GD1O 1CF9A 1PFWA 2ZYIA 4FGWA 2FSFA 3TZLA 4EGCB 3PE6A 3FYUA 2ZIXA 4GDMA 4QRHA 1Z0AA 2QRUA 4KUGA 3ZWCA 1A8PA 1O6FA 4D42A 3JW8A 3C3EA 3BSWA 3BHIA 4F3KA 1UBKS 1CY7A 2PUWA 3HV0A 3N76A 1FDVA 1CPYA 1M8FA 3PPIA 5F78A 5B55A 1Y1QA 2UVQA 1GITA 2XW6A 1WXHA 5KYYB 1CX9B 2ZP1A 3L40A 2FX3A 3DMFA 1R12A 1P17A 1NOKA 2UVPB 1AVTA 1B93A 3CIOA 3Q3IA 3WKBA 2XKKA 3SQNA 4YASA 5M04A 1ULZA 2YYSA 2SHKA 3MF4A 4YNBA 4EG1A 1YHYA 1ZK2A 2NAPA 4G41A 1HO3A 1Y6RA 3UUFA 4DUZB 3QKRB 2BFDB 4ZOEA 2UU9B 4A10A 2FZVA 4B6EA 2AEMA 3IELA 1MD9A 3G13A 5LQMA 3QKSA 3I9OA 3H11A 5EN4A 5FV4A 3BFPA 3DQQA 5F51A 1DUVG 3A0UA 3EVFA 2NZXA 4D7AA 1VCIA 1J5PA 3RVSA 4C43A 5HR5A 4ZRDA 1XK6A 1OA1A 1SCUA 3ZHVA 1MQSA 2DLNA 4XDYA 2HHJA 2PRSA 1A4UA 1KVUA 1VKHA 3MWYW 4II7A 2EJUA 1JJVA 1QZUA 2YHBA 1YO6A 3O03A 3LDUA 1RFLA 2PU5A 2WDZA 2X8BA 3DC7A 4MHOA 4D9EA 3U7HB 1K66A 4F1KA 1XKLA 2B5VA 2XRMA 3AU8A 4I5IA 2QD5A 3AY6A 4KQGA 2YQ5A 4X1IB 4EPRA 5L4LA 2IITA 1JU9A 4R8MA 4RMIA 3V4LA 4S3MA 3A28A 4KBGA 3VSCA 2IL1A 4HDSB 3OIFA 1COWD 5DIZA 1DHRA 1FX1A 2F7SA 2X5XA 1OYWA 2BF7A 2CFRA 4GOOD 2RHTA 3T5TA 2WNSA 4KQ2A 3RNLA 4TV8A 2WC1A 3I61A 4K26A 4AVYA 2CCGA 1G5QA 3CNHA 1ZYUA 4MRVA 1XB2A 3DB2A 2WTNA 1JQ5A 3ZLVA 3OE7D 4Y0AA 4FEGA 4AMUA 4ENUA 5TSDA 1XAJA 3KETA 3Q7EA 3Q7IA 3TGWA 5HFNA 2PGLA 1KY5A 4XX1A 4IRMA 4AS3A 2CKDA 4ENQA 1VHTA 2D54A 2FUNB 1GUZA 2E4UA 4M9UA 2JVKA 1OFGA 2NU9A 3OCJA 2OPHA 1KI6B 1M67A 2GEDA 1M6YA 4ZYTA 2PANA 3ZDRA 3NPAA 4D74A 1I80A 1BX0A 2RGYA 4LJ9A 4KITB 3NT4A 1YWGO 3QPBA 4LTDA 1W94A 4ARZA 1QP7A 1N9ZA 1SK9A 3WLRA 1CEEA 1ZP6A 3TE7A 4ZQFA 1APBA 4KCGA 5AUPB 1G38A 3WK9A 2IHJA 3HB5X 4IJ5A 3LZ6A 4NV0A 1JFSA 3NANA 4DILA 1IXYA 1WZEA 4PQGA 3WLHA 3ZS9A 1Q22A 2Q8PA 4N8DA 4L4YA 5GJWC 5ALHA 4BECA 3UBTA 1DPGA 3GGPA 3OZIA 1MOPA 2FW1A 5BWCA 4FGLA 4A7PA 3DYBA 2C5HA 4OEHA 4P83A 4YGYA 1NC3A 5T64A 1E32A 4P2GA 1EVEA 5B6IA 2IDKA 4ZVKA 3R3XA 4Y2VA 2EKPA 2AV6A 1HNXB 1DDGA 1Y8QB 1GA6A 1NUQA 4IY1A 4NZZA 3FE2A 3G85A 3T9BA 4KEAA 2AR7A 3FUUA 1E0SA 3GFSA 5HJ5A 3ADDA 1ZC4A 1QOPB 3T3GA 2F62A 1JIUA 2POCA 4CMHA 1UKYA 2WKPA 2AX3A 2I91A 4BHTA 3STXA 5BN3B 2B3TA 2EP7A 3EUAA 3V1NA 3K1TA 1Z8FA 2HRCA 1LDNA 2XMSA 4TLLB 4UUMA 5GTDA 3ORHA 1CQJA 1KMQA 4OMCA 2JI9A 2B92A 2R2AA 3T35A 4DYHA 3AL2A 1BCRA 4YBZA 4EUKA 3T9CA 3CLVA 4QUHA 2HJHA 1FFBA 3EVTA 3RREA 5JZ9A 1LI5A 3NT2A 5EIHA 4QYSA 3SG0A 3WWOA 3T5DA 4UBIA 5ALPA 2NVOA 3KZKA 2VPWA 3PNYA 3VDXA 4MR7B 4K9PA 3ZZ0A 1FP7A 1SCBA 1YQXA 4PIMA 1KSHA 4G9GA 2XDQB 4MVJE 4AD8A 1T2FA 5LQKA 1ZN2A 1IBLB 1NX6A 4QPZA 4PNZA 3GGSA 5J4LA 2BSQA 4IXDA 1L7VC 3FYHA 5GGXA 2DOKA 2POQX 3KXLA 1W34A 5FL3A 1QO0A 3L8FA 2WWYA 3L7AA 3H6HA 1Y7LA 3FMFA 2N0SA 3ISJA 1SVWA 3PE3A 4DLTA 2H8GA 3A6EA 3ANLA 5D5HA 4Q12A 4EHFA 2QX8A 3H2IA 5JVDB 3KZMA 3ML1A 4L74A 2COKA 4KHPB 1ECCA 2RGUA 2A5LA 1FVFA 2XUJA 3JASA 3UK0A 4B3JA 4JLAA 4E51A 2GWHA 1N8NA 4AXXA 2Q6LA 1OD6A 1QNLA 1RRVA 4WADA 3JZFA 2W71A 1N6NA 2RI6A 4JYCA 3QPVA 4FYWA 2J0QA 4NZ9A 2ZJ7A 5HUJA 1K2WA 4Y1FA 5AHWA 1IG3A 2WT9A 1XRJA 3AVOA 2V0GA 2L18A 2WAYA 4HXGA 1SB9A 1U2DC 1ZXBA 1GPNA 2PKEA 2IP2A 2QTVB 2VTKA 4V0RA 3N2NA 5FUXA 2VNHA 3H13A 3RHTA 1NRXA 4AZ0A 2H2WA 4PZPA 2JIRA 4PYNA 1FNDA 1N0WA 4REQA 1LLCA 2FMKA 3HLTA 1GG8A 3AYZB 5K0SA 2AYXA 5ELMA 2JJ1A 5CT5A 1NW5A 3KTAB 3QLVC 4NX2A 5IDWA 3BKXA 1BRMA 1NHWA 2PU7A 4MAMA 1P0FA 5FI1B 4KIFA 5A0VA 1ZD8A 3JQQA 2OEPA 2NO9A 4CQNA 1QDEA 3EZLA 5TPZA 1SY7A 3M6XA 1FYFA 1SQ0A 5I45A 4G5HA 4O2RA 1FX0B 3NIGB 3P0JA 3EXEA 2GM5A 1M2OB 3BWYA 4RZ2A 1L7OA 3PQDA 1H4SA 3SDBA 3UOWA 3ZHXA 2OR3A 5I01A 1U0JA 2CYCA 2HTEA 3GUVA 1ZS9A 1TYZA 4LUCA 2C1ZA 1SVKA 2PZKA 1ZCBA 3E15A 3GQVA 4MW9A 4U7TB 3V1KA 3GA7A 2CNOA 1PHRA 1XU7A 2HM7A 3JATA 3C3MA 3QXGA 3UJDA 1L3BA 1J8QA 1BGWA 2VJYA 2J6CA 5T4BA 3ZS8A 1YZUA 1RU3A 1Q1AA 3DAOA 2QLJA 1L5NA 1E3MA 1W0JD 2Q9CA 1TCBA 4F9FA 4IHJA 3U3OA 5CAEB 3AIKA 5JSHA 2Q45A 4G4IA 1OWOA 3K1ZA 5K8VA 3T3DA 1RI3A 3RYCB 3IMFA 2ZYHA 1NP6A 2QD4A 3VZDA 3NB0A 3OOJA 4M8KA 4J2TA 4Q4LA 3RU7A 4O2AB 3VZBA 5BRAA 2Z3VA 4FHEA 1G5PA 3P26A 4CG2A 2VQSA 2DUMA 4NMMA 4B73A 2FG7C 1G21E 3E5RA 2O8EA 5CM9C 4R8RA 3M1IA 1M75A 3B3FA 4POOA 3DEZA 4LMAA 1BZYA 3KT0A 4P0QB 3GRAA 2B4QA 2D1TA 3DLPX 2VF7A 4H59A 5H9VA 1JIXA 4CU5A 5B6JA 5CA0F 3LDAA 3K9NA 4TWJA 4MVJA 3H7AA 1YJBA 3FHCB 2GVZC 4FVTA 1LX7A 1UZMA 3GFFA 2XZLA 3KQNA 2VAVA 4CEJB 3DMYA 1EP9A 4FLFA 1LA2A 2H0RA 4QFDA 4HWRA 1MJNA 3MT8A 4S1NA 1AA9A 4C05A 1Q1BA 3BQNB 3SJAA 3DM5A 4RV5A 1WUHS 2MTBA 3C5WP 5TF0A 1CJMA 4HYTA 3SQOA 3NCHA 3LUGA 4I5EA 4Z5XA 3L7NA 2FQWA 1K27A 2FR0A 3KPJA 1TC1A 2FX2A 3N1UA 5EGSA 1NRWA 3SZLA 5JFOA 4F86A 3UENA 2X0JA 1YMQA 3W7BA 3AI3A 3YASA 3SIXA 5HFJA 1BE1A 1VP9A 1NXXA 3PC3A 4DV7B 1CFZA 1KP3A 2GJKA 2ZRIA 3DOFA 3ILHA 4GAEA 5ULLA 3HFJA 4MR8A 2WTEA 4KTVE 1UJ6A 4KQMA 3NOOA 4KQJA 1RWPA 4AF8A 3K5HA 4B87A 1UEIA 4ZVVA 1JI3A 5DBOA 1F20A 2OO5C 1KFCB 1QYIA 4EABA 1EM8A 1SBCA 3E48A 1JFRA 1LSJA 1BC5A 4CEIA 4OX9B 2E9SA 4NECA 5HXAA 1FDTA 1HDCA 1YRBA 4EPTA 3SJCA 1TVCA 1IQRA 2IF2A 3IJPA 5IF3A 5IJ0A 2ZI5A 2P5SA 3QVTA 1O5IA 5FTJA 3U37A 3C16C 1T29A 3UB4A 4C4RA 5KOHA 4J6EA 2HF7A 5K8IA 3C0KA 2L0XA 2XRYA 2YFHA 3JVDA 4G25A 2BM9A 3WZ2A 3VVBA 3OT1A 1FJGB 3VTFA 1EWQA 3CGGA 3EXFB 1K6JA 4E0BA 2PRJA 3O3CA 1P2TA 3EGWA 4F93B 1QIEA 1TYDE 2MSDB 3EEFA 4LA4A 4GPAA 2Q27A 4J94A 4GSLA 4M4SA 3TBHA 3KHUA 1Z6ZA 1CHDA 2BKEA 4A0FA 1YQGA 2R8EA 4ESEA 3ZK8A 2V97A 3WIVA 3UA4A 1JG6A 1J1IA 1PQWA 4URZR 3P4YA 2I7VA 2GBIA 2PUGA 2BN4A 3VC3A 2EZTA 3H5IA 3JD2A 3HU3A 5CW1A 4GUAA 4OXQA 4CM8A 4OSOA 3ZGYA 2YBDA 2R66A 1QO0D 1P5HA 4LF4B 4EF5A 4LTMA 1TMYA 2EG9A 3WB9A 1WDMA 3OFNA 5TDHA 5KMGA 5KTRA 2CDBA 1TJ5A 4GD3Q 2VRCD 3FCYA 4OXYA 5LA6B 5CLFA 1YUBA 3SC2B 3VOAA 3CF4G 3CV3A 1WW3A 3BXZA 2V65A 3JWJA 4DT1A 1P0QA 2VUIB 1DE0A 3C43A 2Q28A 1GNSA 1UBGA 5DKFA 5DZSA 3OZVA 1NG9A 5HKLA 2VF5X 1E3DA 1E2UA 1ECFA 1QLJA 1TK2A 2C42A 5DM0A 4EB3A 5DPMA 3ZGOA 1QHEA 1U8YA 1YE8A 4G36A 4O8ZA 4XX0A 1YHNA 5IAJA 4C3UA 4WUTA 1JJ7A 1FRNA 3EULA 1NQUA 3U3RA 2IPXA 4Z3OA 1C8LA 2VZ9A 4P86A 3QE4A 1XHFA 4G8CA 2H1WA 3FNQA 4L2IB 3QSYA 3KQKA 2O8FA 2WW8A 2XPCA 1R4NB 2IHUA 3QUTA 5EKDA 4TRJA 4DKXA 2JJ1D 3K1JA 2JBAA 2GILA 5KC8A 4AKHA 1P8JA 3KVRA 3K32A 4M2LA 4AP9A 3PNPA 4TZ6A 1N32B 1BVHA 4NJOA 1Y3CE 5IH3A 2IUEA 3CPHA 4HLUC 3RJ9A 3ZHZA 5TPZD 4ZARA 1S8OA 3PVZA 1U6JA 4J1TA 2P69A 3V4OA 4BAZA 5BQXA 1BD4A 1L1EA 3OD5A 1UM9B 3ROGA 3QVMA 1II8B 1WEHA 5B2ZA 1V5EA 2WINI 4MUYA 2B5OA 3MMSA 3BWBA 4V3CA 3DXYA 5F1KA 3WA7A 4PHHA 3G49A 5AK6A 4YRZA 2VQ6A 4H77A 2VHCA 1P2UA 3WNZA 4EOGA 2QS9A 3D3KA 4IV8A 3IR6A 5MN5A 1LDEA 1FXUA 4Q00A 5C0OE 4E5SA 1C4KA 3U4DA 4QJ3A 3LPCA 1ZUWA 3BH7A 2ZSBA 2CXRA 2HMSA 3ZE2B 2YWBA 3CW8X 2X1HA 4D9KA 3FPEA 4C7OB 5AO9A 3VKVA 4EKEA 4UOZA 3HV2A 4MKIA 2XCLA 3V7NA 2C20A 2WVGA 3H1BA 5EJEA 3HCNA 1XTQA 1G6OA 3OMLA 2WAMA 3H87A 5GQSA 3WADA 3KVYA 3M5CA 1P2VA 3K4PA 3OOYA 5LXTF 3KOYA 3O8OA 3MTBA 1E6EA 2B8JA 4J75A 1XDSA 4F2PA 2ENWA 1NSFA 1S01A 2YUTA 3IOCA 4LRTB 5DMXA 3ZDYB 3PVSA 3H5AA 3QX9A 4CMJA 4E31A 5EMNA 1KC1A 4F06A 4E2FA 5JRDS 1QO9A 2YIDA 2AA3A 1NL3A 3GPCA 3OPNA 2C88A 4GYWA 4QKQA 4PX3A 1KEWA 3AHJA 4J76A 3S7ZA 3WAJA 1QRSA 1AB5A 1XEXA 1G2PA 2FUG1 5BSFA 2IXDA 3M6VA 4IJWA 3JWIA 1E8MA 4MVJD 5DX8A 5ARDA 1Y9JA 4F91B 3FCAA 2UVDA 3MGBA 5F7XA 4RVUA 5K8CA 4YJKA 4LMPA 1OU4A 3QFTA 2QMYA 2QDXA 4QPDA 3HZOA 1E1QD 3KVVA 2RDMA 2QQ5A 2O3RA 4MUXA 4WXHA 4EB6A 4B4OA 1NF2A 1NURA 3HE3A 1C4XA 4OHPA 5JD3A 5KTTA 2FFRA 1TF5A 3NQ41 4FXOA 3M2PA 4MGEA 5IW8A 4AWAA 5ITSA 3EWIA 1EFRA 3P96A 3PBKA 4W9NC 1B23P 1LZKA 3VPDA 4DPLA 1JIJA 2K4MA 3A4VA 4XWYA 1SXJB 3V8QA 3KSBC 4TS4A 2FN7A 4BPRA 5CP8A 1NIPA 5EPOA 5F76A 3COJA 5AVRA 4YWHA 5J2UA 2ZSHA 2W4QA 1LNQA 3HBJA 1RP1A 1KI9A 2H5JA 3B3GA 1K06A 1FNMA 2V4UA 3CO0S 5F7ZA 2OP0A 2ZIEA 4PYMA 2QZ9A 5LBUA 3OIVA 2B2XA 4WCFA 3U9LA 3WVNA 3UGJA 1B73A 2H1RA 3THWB 4BO0A 4S2EA 3QV1A 1U7DA 1K7XB 1XMXA 4YLYA 1X77A 1WXGA 3DXZA 4FHCA 4EG8A 2GBLC 3NALA 1G5RA 2J85A 3OMWA 5BYJA 1N6KA 4HN2A 1E3WB 4N9QA 1NJ6A 4M9QA 4NBWA 4WW0A 1SXGA 3U7IA 5FL7A 4RTMA 4B85A 3QELA 2O8BA 2QF7A 2OQRA 1TAGA 2HNKA 2CWWA 3LWDA 5D6NA 2RHDA 1OBHA 3EFHA 1NUTA 3W79A 3MUOA 5IBCA 4PHTA 3NX4A 3I37X 1EUCA 1AJEA 1KSJA 4K6HA 4BVEA 3N2GB 2C7RA 1N36B 4CQMA 4CLXA 3C3JA 1NPTO 4RGBA 5FBQB 5AVYA 2PWAA 4MRAA 2UUCB 3ZLBA 1PDVA 4KXNA 3UMVA 2X14A 5L4SA 4CKWB 2CVOA 4I1PA 4N4AA 1DBIA 5LBTA 4MNTA 5JLJA 2FPIB 4YC7A 1S3GA 1Z07A 3UH1A 5GVRA 4HV4A 4P3OA 2J9FA 3PXGA 4EUFA 4TKUB 4DY6A 3U7RA 4P3XA 4EKYA 3PUHA 1AGNA 1DPFA 2X76A 1BEEA 1DDIA 2RIRA 3AUYA 4A8JC 4EA6A 1E1CA 1GTG1 4YMHA 5IPFA 1AB6A 4D45A 3MRVA 5IU6A 2EVWX 2O0LA 3QWHA 3QF4A 2XMZA 4UMVA 1US8A 3DOOA 4RYDA 4X54A 1LRLA 1E18A 4HUTA 4R2KA 1YRYE 4P7FA 1AOXA 1D07A 3D8UA 3GWGA 1YJAA 3OFND 2NV0A 4MWBA 3RRYA 4KREA 4ZGGA 4AP6A 2OHFA 1NQVA 4OLAA 3GXOA 1E3TA 3LDFA 1WW2A 2R1ZA 3VX3A 3ZU2A 1L4NA 3SP1A 1BEZA 1O6ZA 2R60A 1G2OA 2WEKA 4P8RA 5TQ2B 3RH0A 1JEAA 4A2CA 1IHPA 4RANA 3F6CA 3IT1A 1I10A 2EFYA 1E3QA 1XMIA 3EQ9A 4J91A 1N3IA 2Q5EA 4Y9DA 3RWOA 3TRFA 5J23A 4AI6A 4RPJA 2I76A 3VZSA 4C87A 4D9CA 4QT0A 4GP6A 3NASA 5IG2A 3A70A 4AG6A 3HVUA 4UJ5A 1HQCA 1VGVA 2ZAOA 3EBPA 4UHJA 3TSYA 1R0BA 3SS7X 4GPBA 4BU1A 1K68A 5AW9A 3ZVMA 3CW9A 3BXGA 3PEFA 4K87A 4KDEA 1VPEA 3UZUA 3DS8A 3O0TA 2R6GA 4OFXA 5FWYB 4MDFA 1EGMB 3G8DA 1VL5A 1PFKA 2HGSA 2HKIA 4N6GA 3QWAA 1NW8A 5IH7A 3EQ8A 3N2LA 1JFLA 1Z5WA 2X4DA 4HWSA 2K87A 4LECA 4R8VA 3J80A 3RVMA 4R7GA 3P32A 2BGUA 4UXIA 5JRZA 1I4OA 3AW9A 4GOJA 5C46F 3K9GA 1IEXA 3EH2A 4A8JB 2J6IA 1YQDA 3FHOA 1PZGA 2HK9A 4I1YA 5L3RA 2Z83A 4CT0A 3FB4A 4NIMA 4EIWA 1GADO 3CLRD 4RPGA 3P9QA 4MUAA 3PNQA 3OURA 1JPJA 5BSVA 1Z36A 3ZGXA 3LUBA 5AW5A 4Z8XA 1GZDA 1RXVA 5GV8A 2OWEA 3G2JA 2JRLA 3I30X 1M7BA 2HEIA 5H3HA 4EGAA 4EUEA 4C0AC 4ZAWA 4AB1A 4NZNA 4LKRA 4RD2A 5FQOA 3UMCA 1XTPA 3W3AA 2W4MA 3H4MA 4OQNA 4FYYA 3UV3A 3T38A 3F98A 3L8DA 1BMQA 4KH0A 1SOAA 3HUDA 4RA9B 5SZHB 1UPAA 2PE5A 2DTDA 4E15A 1RYBA 2OESA 5FADA 1M1UA 2C94A 3N53A 5T8KA 3GCDA 3NKVA 4PXYA 3LBIA 2J0UB 1EI9A 2ODTX 1ZRHA 4IMJB 3BICA 2J3LA 2IS1A 2BDTA 1L8AA 2ZRJA 4CFSA 4LZLA 1C3EA 3PXUA 3JALB 4BKMA 4D9FA 2I3AA 2JFXA 4BCCA 2PBFA 3EH1A 3D8TA 4RORA 1N5IA 1WNTA 2OB1A 2WHRA 1UPBA 3IDOA 4PLVA 4DLNA 2VEOA 3CMCO 4FOPA 2PUHA 5A4MS 1EGHA 3QIVA 2NZ2A 3PDCA 2GXSA 3DONA 1M5TA 4Z1MA 2WOJA 4HH0A 1VDZA 1V3UA 4Y6SA 5KTOA 3QLJA 1AMUA 3W2GA 1SQSA 4LY6A 5GOZA 3E4CA 1YFJA 2ZIVB 3MW8A 4MWDA 2HXGA 4O0LA 5AI4A 3DVRX 5KIAA 1C80A 5ALNA 2B8NA 3K9LA 2O4CA 4C4YA 1JFVA 4AG3A 4OHWA 3IKLA 3T1NA 4U7JA 1YDHA 4Z4QA 4RDHA 4R0MA 5GPBA 5IS2A 2KBFA 1NV8A 2A59A 3CR3C 2QL9A 3HABA 1R0RE 4XCVA 5GAJA 1Q57A 1OI7A 1GSAA 2QTTA 1X1DA 1HZZA 1XTKA 2X15A 3ENKA 1EFRD 2C7BA 1RCFA 5HQTA 3PDHA 1KJIA 4N1AA 2BDEA 3ZDXB 3D8RA 4DJFC 3HL4A 3KV1A 1XEAA 5KNDA 1W85B 1O96A 3L7LA 5KDDA 1GYRA 4R71A 4C89A 4ECAA 4IOKA 3DQZA 4DKJA 2CFIA 2I4MA 1NBWB 2WYIA 1PIWA 3FH0A 4P3PA 4KB5A 1UK7A 3VJMA 3QJGA 5CYOA 3PTAA 2GJAA 2PLNA 4DQUA 3B1YA 1KZYC 3LNCA 4HNQA 2ZEJA 4OYYA 3B6ZA 4G67A 1XTTA 4Q39A 2I2FA 3WZMA 4ZQCB 2WOOA 2Y1WA 3BULA 3CUVA 5G0UA 4F3NA 1P5JA 4ND8A 5EPEA 4ZANA 1TD1A 2GGSA 2WG0A 2Z56A 1DIRA 5FL7D 1LI7A 2PQMA 1P3DA 1CP2A 5DNUA 5HKAA 2R96A 4OX9Y 2DT8A 1XPJA 4GO1A 3LKBA 3GI1A 4QXAA 1I2DA 4IL5A 5EIBD 4FI3C 5HCNA 3RF6A 4LCEA 4AWBA 2MINB 1XPRA 1V8BA 2DFTA 2FWNA 2W58A 4F4FA 1TCCA 2VBGA 3W5HA 2C54A 3JAWB 1SXPA 1G1MA 4J4BA 2YXDA 4QNRA 3WAKA 5BN4A 4U7WA 1YB5A 3A9RA 1H4VB 3DUFA 3LXUX 4TQGA 4CQMD 4DL9A 1KAHA 1GXSB 1K7CA 2BPOA 1QHFA 4IIBA 1AKMA 1ZJ4A 3H8WA 3L0DA 1I3NA 2OTCA 2Q3FA 5DBEX 3TD6A 1GN9A 4HDNA 3PFNA 3CX3A 3QBVA 2P7HA 2VSOA 2YUIA 1D0IA 1A77A 1MPXA 1I30A 4OI0A 1P77A 4QELA 4CHGA 5EKSA 1IXRC 5LZ2A 1LPPA 1VPVA 5L6LB 3ICOA 3ET5A 2C4NA 4LHXA 1A8UA 2WQZA 2QRVA 3T5AA 3NAGA 4IHQA 3EVNA 5FJJA 4INAA 1G8FA 3BB3A 2ATIA 5C1OA 2A1TS 3VKWA 1X7ZB 4RESA 1FNBA 1G6Q1 1CZRA 1FC0A 1PGPA 4FHGA 1CRPA 1P3JA 1OBFO 4LXQA 4U02A 1PN3A 1SO8A 3N0VA 3QPCA 3TXXA 1DBWA 4X61A 4UARA 5IAAA 2O3UA 2BHNA 1U1IA 4JLOA 4RETA 1F7UA 4E2ZA 3CLKA 1BGVA 2Q7OE 2F67A 3FKQA 4DNFA 3OETA 4RKRA 3P19A 4J0EA 4RIIA 5ELLA 4WASA 2HDNB 3GP5A 4C7MA 4ER6A 1YIOA 1DJNA 3E1GA 1NBOA 3C3KA 3WLMA 1M83A 1R0ZA 2H4YA 2G80A 2OGWA 1QFZA 3EWNA 2H2FA 4KU4A 3KG2A 1XNGA 2FPSA 3H5TA 3OTIA 3B6KA 4DF3A 1G59A 1NXPA 3B8HA 2HAEA 2LCIA 2YCBA 4O6VA 4YUWA 4P35A 2Y6VA 1JEDA 3NDIA 3LBAA 3KE8A 1U1CA 5BUSA 1Z0SA 5LR6A 2QPTA 1KI2A 3D4PA 2UYCA 3V8MA 2Z6QA 4RU1A 1RWNA 2QN2A 4PQFA 4ETMA 3QYAA 1TI7A 3LQKA 3U16A 3C5EA 3G02A 2WWWA 3AIOA 3T1QA 3U1TA 4ER0A 5DBIA 1G3IA 6YASA 1Y3FE 4KO8A 5FBKA 1JKMA 1G5FA 1I6LA 4WK0B 4EY3A 5BVHA 4YJGA 1TM4E 1Y6FA 1RADA 2ZRQA 1AN0A 5LQDA 5BT8A 3MQ2A 4P58A 2C99A 2B0CA 5B1DA 2P9TA 3EK2A 5DP1A 4KR7A 3KOOA 1RI1A 4BNDA 1MKYA 3QVGA 2ZTMA 2FN8A 3ZWAA 1G1AA 2VHUA 1QFYA 1XTSA 2BMWA 3VHQA 5IMSA 1VIMA 4NS4A 1B8NA 3THRA 2H9AA 1WCIB 3N8HA 3I9FA 1CCWA 1KARA 4BUCA 5AFSA 5C8XA 2GRJA 2QN1A 1DG3A 4GVXA 1RPZA 2A6PA 3V4PB 2LUOA 4I8DA 3W3AD 1KU6A 4CIVA 5B7PA 2GPAA 4NZOA 5HIJA 4A6XA 1X7DA 2FPOA 3N3BC 2GFIA 3DZ8A 4EYSA 1UFVA 3R3HA 2BM1A 4KDRA 3I39X 3Q0TA 4L4SA 4PX5A 2AGVA 5FJIA 2FUG6 1HDOA 3AI2A 3DEYX 4J9VA 3A06A 4MIOA 1QKIA 1X74A 2DFLA 2V7EA 3O21A 3W8FA 5C5DA 3C85A 1PEAA 2B1RA 1T9BA 4BCBA 1MBZA 4EG4A 2ZYGA 1DT5A 1LJUA 4NJEB 3RKSA 1J5EB 2C9DA 3DMDA 1TUGA 4DLVA 5HRCA 1LBIA 1SA0A 1OPXA 1E98A 1W5BA 2XMPA 3GN2A 2ODBA 4I36A 4QOHA 4YH1A 2ADOA 4WY8A 4NE7A 2ZXUA 1KWGA 2WM9B 2FWIA 3VR5H 4Y1GA 4BLOA 4G0YA 3TPCA 3T3HA 1JB9A 3ZQJA 4Z1MD 1A8SA 1S3SA 2C5GA 2FHPA 3GR6A 3PP8A 1YAJA 2OM6A 1VCOA 1JMVA 3KSZO 4HRAA 4UEJA 4F60A 1X1SA 2KI5A 5JZSA 2CVHA 3VX4A 1P74A 1O94A 4DSZA 2RD2A 2QXTA 3L77A 4B6SA 2R6FA 3KR2A 3RSHA 3M6UA 2X5OA 4L72A 4X1KA 2JHAA 1MTZA 3TMYA 1OTHA 1ZH6A 4NE2A 4BP8A 1L5WA 4D25A 3AO0B 2H11A 1K8ZB 1M9NA 3D2BA 1JTVA 3JYQA 3I5YA 1DKRA 2FMTA 4YDSA 1UUFA 1XRPA 4JP5A 5EWMA 4NJMA 1W47A 2HQBA 1P3Y1 5G1PA 2WWFA 1DBRA 4PPYA 4JOQA 4Y98A 1BO6A 2B98A 2ETVA 2R7MA 3STHA 5KNDD 4IG4A 3MUNA 4OXIA 2WSBA 5H68A 3E84A 1EHCA 1IEVA 1XU9A 3VNRA 5L95A 1N2CB 3O0DA 3KDSE 4A27A 4FNOA 1NWHA 5KVCA 4PLPA 3UT5B 4NOMA 4G8JA 1WX1A 5MF6A 3I34X 3E5MA 3W2HA 4V1CI 3O1IC 5E3JA 4MARA 2DBRA 4ISBA 5HNKA 4GH5A 1PU2A 2ERXA 4N3NA 5G0VA 3ZJUA 4IICA 5TMEA 1G17A 4PZDA 1FYWA 1IM5A 2OHHA 2EDCA 2VNAA 3CBGA 3IFSA 3CRZA 3JQ8B 3FNRA 1WB4A 4XUCA 1AH2A 2RHCA 1TB4A 2VO1A 3GQBA 2WJIA 3H3JA 3PDIA 4FDVA 4IIJB 1SMKA 1ZU4A 4RACA 4KLNA 3PCXA 2F59A 4JOSA 1LVHA 4ZYVA 3DW3X 1MU0A 3AVWA 3W4JA 2D0OB 1ACMA 2QN6A 3L7KA 2YFKA 2VDRB 4MW0A 5I51A 1XD2A 2IYTA 1RRPA 4LNUB 2E5LB 4LHYA 4B2LA 4IMIB 1D0SA 2XGJA 1T24A 1SCQA 2FR1A 1E9AA 4XJSA 4PRKA 5DT2A 5I9IA 1OWLA 1K8QA 3Q2KA 4ILEA 4DMKA 4BNTA 1B4DA 1D1TA 2MR5A 5FEUA 2QAGC 3DXFA 3QG1A 5ES3A 1P5RA 2EW8A 4WGFA 5IABA 4Z7JA 4QTUB 1J49A 3GT4A 4LN1A 1S2MA 3WG9A 1Y9DA 3SYLA 1IZ0A 5KBYA 3BB1A 4EI2A 4DIBA 1K4YA 4EBFA 4NZPA 1NXOA 2P2DA 5K0FA 1U8ZA 2OVBA 1YVPA 1HNNA 5I4IA 2QRPA 4M9XA 4RHEA 3WICA 5AW2A 4RGVA 2B82A 1C30A 4IZ6A 4EJ6A 2HA4A 3WGKA 2QUIA 4NCNA 3INNA 3TGLA 4U6NA 2HDWA 2X4GA 5FEMA 2G28A 3RUDA 4A2QA 3EFBA 1ZU5A 3O7MA 4LJ4A 4TKMA 3BMQA 1PJ4A 6REQA 5KQPA 2JGFA 3E2IA 3O7WA 5TF4A 2RI1A 4K81B 4PEVA 5KVVA 3I2FA 3EHEA 1AF4A 1UAGA 3DAFA 2BFFA 4AC9A 3EVGA 5FOTA 1ZD4A 2WD9A 2KLHA 1NWCA 2FPGB 4ZMSA 3FJ1A 4KSYA 1G3MA 1SU8A 2CFTA 3KQWA 4JEMA 4UHEA 3G0BA 2O20A 2SCUA 4QOIA 3HCBA 4DM4A 3KTFA 4MCAA 4RVNA 3BWDD 4Q02A 1GRNA 1RXEA 2O48X 4Z54A 1UC5B 6AT1A 1N2ZA 3BKWA 2W00A 3E22A 1Z25A 2P2SA 4RA6A 1N8TA 3AEUB 1SCKA 2I2WA 2ACWA 4BKQA 4RPKA 3RW9A 4HDOB 3CC8A 3IKJA 4XTCS 1NLUA 4KZPA 5ICGA 1GPBA 2BCJQ 4I8XA 2BHSA 3LXXA 2P6MA 3UK7A 3JPYA 2ZIWB 2ZR0A 4YUAA 2L2QA 2BFOA 4HQOA 3WLQA 2AIRA 3OQMA 3ASYA 4B6OA 4DLKA 3D81A 4PGAA 3GXBA 1XVTA 4TWIA 4X91A 4C22A 2XUFA 3D43A 3L3BA 3N86A 5LC1A 3M4JA 4RY9A 4ZPJA 3O2NA 3AVVA 4MAFA 4OBXA 3CWCA 4QJ5A 4ZDJA 4UFPA 7YASA 2MIIA 4O4LF 4O4HF 1M2FA 1J00A 1T2DA 1UMBA 1ABBA 4I99A 5AW1A 1XV5A 4EHNA 1XA0A 2B4AA 2VZLA 3NAQA 4H31A 5SYNA 4GMXA 2RGEA 3VVMA 3IVAA 1CUFA 1F2UA 3CRW1 3RS2A 2KJQA 1J09A 3C39A 3URMA 1D03A 2OMKA 1YQUA 3MTEA 1XMSA 2XT9A 2CLHB 2ZE7A 2WG1A 1MGPA 2G82A 4OHRA 1QVAA 3R0VA 2CKMA 3AETA 4YV0A 5T3UA 1VE9A 5KVSA 3RVNA 3M6FA 4F11A 2I3BA 2I54A 3H1FA 3QOWA 2BUAA 4JR2A 2OZLA 1Q83A 5EE1A 4YCCA 1FFEA 4KFTA 1R4AA 2ZULA 5DGTA 1QYVA 4JKYA 1DC4A 1F6WA 5COAA 5KTMA 4FWBA 3CY6A 3MT9A 5CDHA 2QN3A 1DRKA 2GDJA 5HSGA 1VYVA 3K9BA 1TTHA 2LTAA 3QLUA 1A27A 3Q7SA 1P62B 5IWCA 4ENSA 5BMVA 1Z5GA 2BGMA 5FI3A 5LQCA 1KP9A 1VA4A 3H4VA 2ZAMA 3I6YA 3P2OA 3F71A 2QYTA 5EMKA 1DOHA 1GKUB 4XD7A 3AHCA 5JBIA 1H05A 3OZUA 3BPSA 1E2FA 3BDIA 2FQYA 3AJRA 4Y30A 4B8ZA 2E37A 4Q4JA 1GILA 3C1TA 1J97A 5E7IA 3UMRA 1AC5A 3DHVA 1W36C 5ADUS 2MSNA 5IBRA 5JS1A 1V37A 2IYUA 2WWHA 5EYPB 2HNAA 2UZ1A 1Q77A 4HATA 2GLXA 1XKQA 2J3MA 3LECA 5B1HA 4JI4B 2O50A 3A1SA 4AKTA 1AU9A 3WFJA 3JR3A 4IS2A 4PGFA 3CF4A 1PDWA 1KY2A 1YK1A 3WL6A 4BATA 3ETEA 3QE2A 4BL5A 1D2AA 4F46A 2PRIA 4RZXA 4BFCA 5CIYA 2VYNA 2Y1EA 4IDDA 5HUHA 3S6JA 3V4SA 4GEGA 1A82A 3CVJA 5KOJB 3VHRA 2YHIB 3ZQKA 1IPEA 2WZQA 4MX8A 3I2JA 1RHJA 2PT6A 2VAPA 2F3QA 3G1TA 3KYCA 4EHLA 4KJXA 2BEWB 2GXUA 4JLMA 1YS6A 3ADBA 4RFSA 2IYAA 4RMHA 3TQQA 3ZHQA 2FNAA 3PRKE 3QNUA 5CJPA 5HZHA 3DHWC 1LQ2A 1GFSA 4KLZA 4UE2A 3WLNA 5BUQA 1ETHA 4GL4A 5EZQA 1JVNA 2HB6A 3C2QA 5IAGA 1WA5A 4B8WA 5A3RA 4D4HA 1N1EA 3PIRA 1UBSB 1X3SA 3ZDAA 2FPMA 1KPIA 2X3UA 4JHLA 4MKHA 3TW8A 4FK8A 4KQXA 5JJIA 1O03A 1QPGA 1Z5PA 2H4HA 4HEHA 3ZD9A 2DQYA 3IAHA 3NBMA 4U9HS 3DVLA 4OJYA 1Q15A 4NCJA 4D9BA 2FXIA 2PUVA 4EJSA 4ZVNA 3I8OA 3IA2A 1BS2A 3LUHA 1JHPA 4YRMA 4Z4FA 5JAMA 3PUJA 1QQ7A 3H1AA 4UJ3A 1IB0A 4CIWA 521PA 4Z7QB 3ESDA 1JEQB 1DIAA 5KVQA 5CFMA 3E7FA 4W6QA 4MQEB 2OSBA 5D8DA 3FLMA 1K5DA 5U4QA 1Z9BA 2LPMA 3GCGA 3CR8A 2R1TB 1E3JA 3IAUA 1TKBA 4HAUA 2HD4A 4RLHA 5LKRA 1DRWA 1N2XA 4B3CA 3FZNA 2WFLA 3WO0A 5AK0A 2C2WA 3SF0A 3IXLA 2Y8EA 2PNJA 1MIHA 1X42A 2BAGA 4EX6A 1QG6A 1U1DA 4MPRA 1GL3A 1PJQA 4HB2A 4PS0A 3DT9A 3AR5A 4HYYA 1DO2A 3F7TA 3O5AA 3OUUA 2EJCA 5JNVA 4IDCA 4LDAA 5DRYA 1M0EA 1OHHA 1OV4A 5BT9A 4BZZA 2PSSA 1HKHA 1LDYA 1M3SA 3LOUA 2WDPA 5JWHA 1ECGA 3KAJA 5KUTA 4DCTA 4CDMA 4YMSA 1VL2A 4FJ0A 3DDSA 3ENNA 3EXIB 4AJHA 2JJ2A 1Q6YA 2G5CA 3GELA 4N0PA 4DA0A