3I45A

Crystal structure of putative twin-arginine translocation pathway signal protein from rhodospirillum rubrum atcc 11170
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
378
structure length
378
Chain Sequence
b'SLEAIRIGEINSYSQIPAFTLPYRNGWQLAVEQINAAGGLLGGRPLEVISRDDGGDPGKAVTAAQELLTRHGVHALAGTFLSHVGLAVSDFARQRKVLFMASEPLTDALTWEKGNRYTYRLRPSTYMQAAMLAAEAAKLPITRWATIAPNYEYGQSAVARFKELLLAARPEVTFVAEQWPALYKLDAGPTVQALQQAEPEGLFNVLFGADLPKFVREGRVRGLFAGRQVVSMLTGEPEYLNPLKDEAPEGWIVTGYPWYDIDTAPHRAFVEAYRARWKEDPFVGSLVGYNTLTAMAVAFEKAGGTESETLVETLKDMAFSTPMGPLSFRASDHQSTMGAWVGRTALRDGKGVMVDWRYVDGGSVLPPPEVVSAWRPAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Twin-arginine translocation pathway signal protein
publication title CRYSTAL STRUCTURE OF putative twin-arginine translocation pathway signal protein from Rhodospirillum rubrum Atcc 11170
rcsb
source organism Rhodospirillum rubrum
molecule tags Signaling protein
total genus 147
structure length 378
sequence length 378
ec nomenclature
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3i45A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3i45A01
1P8AA 2PUEA 4MPTA 1ZHHA 4OTZA 4EYKA 3Q7TA 1ISSA 3EULA 4HNRA 3BREA 4OATA 4CBVA 6CHYA 5JNUA 4KRFA 2FQWA 4G0QA 3EGCA 3M6MD 4G0PA 1Z18A 2PLNA 3SNKA 2H3HA 2CHFA 4MR8B 4IF4A 1M2FA 5T7BA 1USIA 3RH0A 3URMA 3GV0A 3N8IA 2JVKA 3QX9A 4RK6A 4DN6A 4NV3A 1NXOA 3TD9A 4KREA 3EJWA 2RGYA 3SAJA 4MQFB 5KC8A 2FXIA 4MLDA 4KQ9A 2WWVD 4JB2A 2FW0A 1J56A 1K66A 1LJLA 3H5WA 3E61A 3F6CA 3QLUC 3B2NA 1RNLA 3EDCA 5T3YA 2XDYA 4QICA 1FSPA 1NXXA 1LJUA 1ZH2A 3QELB 4NQRA 4N03A 4MR9A 5EWMA 3CZ5A 4G0OA 5DKFA 5EWJB 1CEYA 1USKA 3HZHA 2HSGA 4KPYA 1U2PA 2MSLA 4ZPJA 1H9CA 4JASB 5JNRA 3BILA 4MLCA 3OLXA 3O2QB 1NTRA 1KMIY 2JRLA 4MS1A 2A9OA 1LBIA 2WJWA 4KK3A 4WXEA 1NXWA 1PNTA 2PUCA 5CNKA 4YCSA 5HM6A 1QQBA 1M2EA 4TN5A 2QU7A 2R47A 3ROFA 1DRKA 4EYQA 4Z4HA 4KVFA 3HXMA 3QLVA 5TPWA 4PEVA 2L19A 4F3TA 3I45A 1YIOA 1URPA 4N41A 2GWRA 2I6FA 3KLNA 3CLKA 1C4WA 2B4AA 4KQCA 1D2AA 5ED4A 2GKGA 2CWDA 4GNRA 1DCKA 4MRMA 2DRIA 1Z2EA 1BDHA 2TMYA 3H5VA 1PHRA 3IPCA 4Z9BA 1VRVA 4F12A 1Y1LA 4LZLA 4WWHA 3H6HA 4F11A 2PMCA 4XFKA 1I3CA 3H5OA 4RK7A 2KYRA 2HQOA 2MYTA 4Q7EA 3RVOA 2PUDA 3LKBA 3KLOA 3TX6A 4MR9B 2FSPA 5EWMB 3N53A 5IC5A 3L6UA 2H0AA 3JY6A 2E4VA 3S99A 4W5QA 2PUBA 3HEBA 4RK1A 3UK0A 3BRSA 1JDNA 4JA2A 1EHCA 5GQSA 4L4UA 9ABPA 3NNSA 3D02A 3RQIA 2E4XA 2IPAB 1Z17A 3JTEA 4S04A 4RXUA 3KSMA 3KYJB 2MYUA 3DGEC 2QV0A 4D6YA 4JP1A 4MS1B 4RY9A 5FBKA 2HQRA 5IULC 6ABPA 2A9RA 2WMYA 3FFWA 5TQJA 4N76A 4LE2A 2NZVG 3IPAA 2JVIA 4B09A 2FMHA 1NATA 5TPWB 1LBHA 3GYBA 1ZVVA 3DLBA 1P6UA 3GRCA 2NZUG 3N0WA 2E4ZA 1AB6A 4W5NA 4P1ZA 3CS3A 3H6GA 2E4YA 4GPAA 2FKAA 4XXHA 5KQLA 4RKQA 3O1JC 4OBBA 4RWEA 3F6PA 1YMUA 1D4ZA 1JFVA 4RXTA 2BGGA 1F4VA 1F51E 1SRRA 3GT7A 3KCNA 5CNIA 4IMJB 1E2BA 5IUKC 1VLZA 1W9HA 1CYEA 1YS6A 3KHTA 3N0XA 1GUDA 3O75A 1OXBB 4MYRA 2ZWMA 2FMKA 3MIZA 1PEAA 4TMYA 4OLAA 3QLUA 1YVUA 5PNTA 3LUAA 3HCWA 4EYGA 2LIVA 1VKRA 4QYMA 1ZDMA 3A0RB 3SY8A 2PL1A 2CHEA 3UUGA 2F8TA 4EYOA 2FN8A 4MQEA 2ID7A 2NT3A 4D6XA 5IBQA 3RVRA 1YMVA 4RY0A 3UKJA 2NT4A 2X7XA 3VNAA 5KC9A 3OQOA 1D5WA 3IP9A 4RY8A 4EVSA 2YHAA 1A04A 1EWTA 1W25A 1B00A 4ZMRA 2FLWA 2FLKA 3HSYA 1TVMA 2WJAA 3W9SA 3QEKA 4Q6WA 1EAYA 3RVSA 1XHEA 5D2CA 1FFSA 5EWLA 2QVGA 1GUBA 3EQ2A 5IEJA 2V0NA 3C3MA 5C5CA 1BA2A 4OLBA 3LFTA 2L18A 4MR7A 5KWSA 4P98A 3I42A 3KS9A 1JHZA 2VUIB 5DTEA 2J48A 5HQJA 2JVJA 2M98A 1E6KA 3K4HA 5KQGA 3SG0A 3O1IC 1XHFA 5JNSA 2FQYA 1DP4A 3BRQA 3OLVA 3G1WA 3OO0A 4IMIB 5TQ0A 3CG0A 3RVQA 1ZAYA 4RKRA 3CFYA 3H1FA 3KTOA 3IP5A 5FBHA 1MAVA 2AYXA 2LUOA 4EVRA 2RJOA 4XARA 4O5AA 4YP9A 1QQAA 3LOPA 1RXIA 4G0XA 2FMFA 3R0JA 3O2JA 4KMRA 1QNLA 1MB3A 5TE9A 2R4QA 4MQEB 2PE5A 4LE1A 3N6VA 3C97A 3F73A 1BDIA 1FFGA 3MYYA 1L5YA 4N0QA 1BVHA 3RVMA 3HV2A 4H60A 3TMYA 4G0MA 4FB4A 4JOQA 1P6QA 4G86A 1NXVA 2O20A 3OO1A 1BDJA 3QK7A 4NCBA 3GWGA 3KKEA 5EWLB 1ABFA 4XAQA 1RZRA 3O2SB 2RDMA 2WY2D 1L5ZA 3A10A 1U04A 4O1IA 2QW1A 3CNBA 3LUDA 3H5IA 3M9XA 1GCAA 4G0ZA 4MR7B 3KJXA 4Z4IA 5IUJC 4NCAA 3ROTA 2L17A 1JBEA 3OLWA 3NHZA 5DCLA 1KGSA 2PUFA 1TMYA 3H5TA 1PUXA 3O1HB 3HO1A 3JPWA 2FEWB 2VK2A 3BBLA 4RK0A 4RSMA 4EGSA 4EVQA 1SD5A 1SXHA 3T8YA 4XLTA 2QZJA 3Q9SA 5TQ0B 3MA0A 3ILHA 5DLEA 3C3WA 4Z4CA 3O74A 1QP0A 4FE4A 3LUGA 3GBPA 1KRWA 2QR3A 1USGA 2GBPA 2MSKA 4PZ0A 3GL9A 4LX8A 4F8JA 1NXPA 1ABEA 2IYNA 2R25B 1LK0A 2FTKE 3O21A 3H5LA 3FFTA 1A0OA 1DC7A 2OENG 3A3KA 3DGFC 2OQRA 5BQ3A 3CHYA 3GBVA 1TLFA 1TM2A 2QXYA 1DJMA 1DG9A 3CKMA 4ETIA 3RVJA 1GCGA 1FQWA 2FVYA 3LTEA 3NNNA 4MRMB 5CHYA 4PE5B 3T38A 1Z26A 5KQMA 1QKKA 1U0SY 4XASA 2W42A 3GA5A 4E7PA 5C5EA 3OM0A 4PYRA 4RV5A 3EQZA 4TLMB 4RU1A 4EY3A 1RZRD 1IIBA 1K68A 1GLGA 5JNVA 4YGXB 2LP4Y 3QEMA 5IUNC 3F7NA 3HDVA 1QMPA 4RS3A 3NNDA 4UHJA 1DCMA 2JK1A 5IEBA 4ETMA 2IOYA 1YK1A 2F8SA 2PAFA 3N0RA 1E6MA 2E4WA 5BRJA 1JLKA 1YS7A 3Q41A 1E6LA 3CG4A 3QLTA 4IRXA 5TQ2A 1MVOA 4D74A 3DBIA 4WT7A 1QO0A 2WRZA 4LRQA 1BAPA 2AYZA 5HKOA 3I5AA 1U8TA 5JNWA 3G85A 1CHNA 1U2QA 2NUBA 3H1EA 2CD7A 4S05A 2IKSA 3EODA 1D1QA 1JL3A 1P2FA 4E7OA 5B3JC 2QSJA 3LMKA 2IDMA 4JAVC 5DGCA 5BRAA 1DZ3A 5TPZA 4MS3A 1JYEA 4OG2A 1JH9A 1JX6A 2WB4A 4H3HB 1AB5A 1Z12A 4NICA 2MSWA 2ID9A 2HQBA 3JVDA 4W5RA 2QVCA 3FDFA 3H75A 2IPLA 3M9WA 4IILA 3IP6A 4LDZA 3OLYA 3EAFA 1DBWA 1JDPA 3HUUA 3JVIA 4LDAA 1KRXA 1QP4A 3T6KA 4Z4FA 4DADA 3JPYA 4MS4A 2FMIA 4JB0A 4KZKA 5E3JA 2P9HA 3HVRA 4HNSA 2ZAYA 1M5UA 3QEMB 4O1HA 2B1JA 1ZITA 5GOTA 1NY5A 3MM4A 4ZYLA 2IPMA 1SXGA 2E4UA 4RZSA 1ZGGA 3N75A 3IDOA 2FQXA 2P4UA 3NBMA 3LKVA 5CNJA 4EUKA 4HYEA 3K9CA 5TQ2B 4Y9TA 4Z9AA 2JB9A 1DCFA 1NXTA 3Q7RA 2PL9A 3KYIB 4F06A 3OQMA 2VUHB 1VPWA 3HUTA 2Q5CA 8ABPA 2JCGA 3JS5A 1QO0D 3RVKA 1ZH4A 1UDRA 3HK2A 3RVNA 4HNQA 3SM9A 1APBA 2FEKA 1OXKB 1Z25A 2PJUA 3QX8A 3TB6A 2HPHA 4MS3B 2PUAA 2GI4A 3DZDA 1YTUA 1R8JA 2R48A 1T34A 4ML3A 3MF4A 4RK4A 4YS6A 1ZN2A 5TPZD 3CTPA 1DRJA 2FN9A 4ETNA 2LPMA 5JNTA 3LUCA 2MYNA 1DC8A 1M5TA 5FWXA 2PKXA 1XWWA 1DBPA 4MS4B 3OLZA 4IGAA 3I09A 4Z99A 2JBAA 5KI6A 2N9UA 4TLLB 1C0EA 2A9PA 3P9YA 4Z0NA 3E3MA 4N0PA 1HEYA 2GX6A 3FGZA 7ABPA 4Q6BA 4L85A 4KFCA 1Z2DA 5JS1A 3Q15C 4QYWA 4RXMA 3TO5A 1D1PA 3FMVA 3C3KA 4YO7A 5FWYA 3LUKA 4G97A 5I4CA 2LBPA 4WXMA 1FFWA 2A9QA 3Q7SA 5CNMA 4PICA 4YRZA 3DLHA 4G0YA 1YK0A 3T95A 1A2OA 4FE7A 1RXEA 3HJFA 4H3KB 3LUJA 5F64A 3FFXA 4DQDA 3SQNA 1WETA 2M1ZA 4W5OA 1EWKA 4RK5A 1ZY2A 1Z13A 1ZESA 1MIHA 2RJNA 1QP7A 3QLVC 4RDCA 1MB0A 2L2QA 3L49A 3CRNA 4YV7A 4KV7A 5BR1A 5B3JA 3IP7A 4MR8A 3OM1A 3RVPA 1Z15A 3VNBA 1JFTA 5JS2A 2YHBA 2HJ9A 1Z16A 3KG2A 5ABPA 4QPJC 4YLEA 4KNYA 4Z4GA 2VYCA 4WUTA 1JYFA 2FEPA 3MMNA 2IPNA 1PNRA 5FWXB 2PUGA 4MQFA 3MQ4A 1DBQA 3CU5A 2JBAB 4YR7A 3CZCA 1QPZA 3NHMA 4MGEA 1NXSA 3OMXA 1JWLA 3D8UA 1ZGZA 1SXIA 1JFSA 5KQPA 1EFAA 4N47A 3QELA 5FWYB 5EWJA 1PEYA 1RPJA 4YWHA 4WZZA 3OMWA 1EWVA 1ISRA 3HS3A 3RVLA 4Z4EA 4W5TA 5IX8A 4KK4A 4MAAA 3HDGA 3H1GA 1JF8A 1S8NA 1TJYA 3LUFA 4ZMSA 3A0UA 4UHKA 4M88A 3HM9A 2MYPA 3LUHA 3OQNA 4ZJPA 3C6QA 3ILYA 5HSGA 4LE0A
chains in the Genus database with same CATH superfamily
4KPGA 2PX6A 1XZEA 1V9CA 3OE7A 2K7ZA 3I0MA 1IM2A 2C99A 4MYUA 2R4UA 4MR8B 3SI7A 5AT1A 2A0XA 1H8EA 4KB5A 4YLGA 3B12A 1T4BA 1JHAA 3ICOA 4NV3A 3EW7A 3DL4A 3NU1A 3VR3D 1H9BA 1U3DA 4Z1MA 4HXEB 5KC8A 1XKXA 1V45E 4WLOA 3P26A 4EW3A 1ZQ9A 3HCAA 1J21A 1JKMA 2RHCA 2X7JA 5P21A 3ZE0B 3HZZA 2ADMA 4HFNA 4EFMA 1HYQA 3P97A 5K6RA 3DAOA 2QWXA 1S1MA 1PDWA 2JAHA 3PXXA 5AW6A 1I3MA 3RUFA 4MCHA 1XL0A 2XIQA 3L4BC 3PC6A 3U3XA 1G17A 2OOKA 1LJUA 3JD4A 3O0TA 4KR9A 1Z4NA 5EWMA 2EP8A 4R6WA 5EWJB 7ADHA 1AM4D 3ISVA 4ZEMA 4V1CI 4OJYA 2VA9A 2DG2A 1P1FA 2JAOA 3EGDA 4DANA 3I9FA 4O4JF 1WZCA 3DKKA 3F5DA 4YRRA 4RA6A 4HHEA 1FW6A 3DF9A 1UDXA 1TT7A 1WW3A 4MLCA 4D46A 2QYOA 3R9XA 3C3CA 3K2BA 1KI6A 1VJGA 4JJAA 3PEVA 2A0KA 3P19A 3H5NA 2IIBA 3GFQA 3PZRA 2PUVA 3GOHA 2WJWA 4MS1A 4LWZA 4QU0A 1PNTA 4YCDA 4J4BA 2DEUA 5KYWB 1E9SA 3NT2A 3A26A 5HM6A 1M34A 2COUA 3PICA 2F64A 4TN5A 4YAJA 4ZOLF 3TMAA 5J40A 3VR6A 1EB8A 4L72A 1YHZA 3ICQB 2VXCA 2W6QA 3LA8A 4H4DA 1CJVC 1DRWA 1KO7A 4U2GA 5HRAA 1RJFA 3DAGA 4A1OA 3NHBA 3KETA 1PP4A 4LGMA 4C29A 1UM9A 4DVGA 4P34A 2J9GA 3FOZA 1RXSA 4I1UA 5H8WA 1DOAA 2PIAA 1R1DA 4BV9A 4UHHA 5I7EA 2ZITA 2WUWE 3TSAA 1J4AA 4BMCA 1ODTC 4OB8A 4Z3DA 1B2LA 3DC7A 1K97A 1C3XA 1P2DA 2D0IA 1FP6A 2J6HA 2ZYGA 3R9KA 3ZHRA 3SOPA 5KYGA 3MOIA 4WXHA 4MW5A 2V6JA 5BNIA 4EI8A 4CIBA 3NBQA 4AZWA 4EG5A 1E3DA 4DG8A 1PIWA 1E2PA 4MIKA 1HH4A 2GSWA 3HMKA 1SBTA 3KKQA 3QPDA 5EPEA 4DHEA 2JJ8A 1A9XB 4CF5A 5L6LB 3ZHQA 1Y1RA 4HUJA 3U7GA 2HA6A 2IF2A 1LDGA 3DMTC 4PX3A 1XXLA 3NHRA 4OQZA 5E4TA 1O5OA 2DVMA 3E22A 1CJUC 3A32A 1MKYA 4RVGA 2UDPA 3A6KA 3KELA 4TS3A 4B33A 3LXUX 2Q6TA 4NYJQ 2YY7A 1IN7A 1DBSA 1DLIA 1YR9A 3KSMA 2JG3A 1QGYA 2N46A 4HLDA 2ETXA 3UJDA 5CK5A 4DLYA 2B8TA 1HETA 3HYNA 1MPTA 3LRXA 4PF1A 1RRFA 1P39A 3GEPA 1NVVQ 2AN4A 2JFZA 4JVSB 1K3TA 4YDSA 4E1AA 1BU5A 1NATA 2QXUA 1GPNA 2HWXA 1ODCA 3DC2A 2VZ0A 3IHWA 3A31A 2LKCA 4NZ9A 3H6GA 2MU1A 1E0AA 3BSSA 1O9GA 3LT2A 4ZODA 5A7GA 1OIWA 4KXUA 5ALXA 1SHTX 3WK8A 2P6OA 5DN6A 1F4VA 3JQFC 1CVIA 5IYZF 3ZBPA 2R8EA 1NNEA 1WU7A 1RVV1 2JL1A 4K81B 1BWSA 5FRDA 4BMYA 4NQZA 4UFNA 1I10A 2H31A 3KT0A 3RT7A 3WLOA 2QM3A 1Q5PA 4DWJA 1C80A 4M1YA 2X0KA 3EFEA 5AOVA 3S70A 1K63A 1E2GA 1RW4A 2G71A 1U1GA 3Q8LA 3ACDA 2G5GX 1L3IA 1SCJA 5E0KB 4Y18A 1WHTA 2MHCA 3QVLA 3CZQA 5J2TF 1S2OA 2XSZA 3ZHTA 5LWQA 1X7WA 4JITA 4FPXA 1QHGA 1PV2A 3AKCA 3FLBA 4YRGA 1N78A 2O2ZA 4BGVA 1N2GA 1YRHA 1GKLA 3RVRA 1SUFA 1XFAA 1RLUA 2IOHA 2UYOA 3OFJA 2NT4A 2H8GA 3ZDFA 1MGPA 3OE4A 3UENA 2ZJ1A 4GS5A 2JZNA 3VO9A 4E3WA 3MPUA 4IXMA 3ZV5A 3NWOA 1EWTA 1E7WA 3OX4A 4D3XA 5DB4A 4DM7A 4Z5XA 1DXHA 1PYGA 2DWQA 1THGA 1GQSA 1XD2B 1JT9A 2RHRA 3I52A 1Z4IA 1E9BA 4HBGA 1DC3A 2CZGA 1CQJB 2WZBA 1L9XA 4IP0A 1A5ZA 4LF9B 4BCCA 1Z0DA 2IXTA 3B9RA 1IZ7A 3DTVB 1MXHA 4N3NA 3S5UA 3WNVA 1DLJA 1SKMA 3WYAA 1QTQA 1N3LA 4E6PA 3T61A 1YVPA 4TQGA 3KS9A 2HF7A 2VDVE 1XJ5A 3QMPA 4I1SA 3PNQA 1L7AA 3OZFA 2W9XA 1IBRA 3VAZA 3BHJA 3DLIA 2OHVA 2ZE6A 4C0BA 3B9PA 1TRHA 3LH5A 2DM6A 3ONVA 1A50B 4YPFA 1B1CA 4CF4A 5C8ZA 1FNMA 2P0YA 4U4AA 1BE8A 4X8OA 3OKPA 3R7BA 3GFBA 1F8GA 1PD0A 2YWJA 1K2VN 3E2MA 1GIAA 2HBQA 2WF7A 5HCUA 3SF0A 3BORA 5IDXA 3HUEA 3AY7A 1XDSA 3PHLA 2IL1A 2WWGA 1VKZA 2NO6A 1P72A 3IAHA 1SQFA 3WP0A 3LW7A 4B31A 3SZUA 1GNSA 3G88A 4AKTA 2W6CX 4X6YA 3GMTA 4OQNA 3RTAA 2F4VB 3Q3HA 4RPLA 3MMZA 5JJLA 2H1FA 1KVRA 1GDTA 4ZJYA 3HV2A 3GARA 3TMYA 1WEKA 5LKAA 1WAMA 4CCYB 1R6UA 4JOQA 1Q22A 1BCSB 2ZZMA 2IEDA 3BXOA 1YR3A 2K7FA 5JC1A 1XV5A 3TS1A 3EBPA 4HEJA 1NW9B 1H2BA 2FF5A 4LQCA 4EUFA 3SLRA 1AV6A 1VFNA 1NJ5A 4BXOA 2NP6A 4RTSA 4DABA 5K20A 5IAAA 2H59A 1C2TA 2FPGA 5K51A 3CINA 4O1IA 3SJZA 1LPAB 4CIXA 3KJXA 3ND5A 3LKZA 3ROTA 1NJ6A 3E9NA 2JFVA 4AIRA 5AUPB 1B6SA 3ZHBA 3KXDA 3BD8A 1KR2A 4R81A 3WKAA 2HDNB 3R6LA 5KJFA 2AF3C 3A11A 3PFCA 4GZLA 2XKJE 3B1KA 2C4NA 3C6ZA 4NBRA 4CV2A 4KXYA 4WASA 2WLSA 4Y98A 1SHJA 1P3JA 1J8MF 1CP3A 1BX0A 3IPRA 5A0FA 4GO1A 4FE4A 3KVNA 5I7AA 1L5GB 3L06A 1Y98A 3LDGA 4KKXB 1IN8A 2VH5R 3I9JA 3VZRA 5D6NA 3GT0A 1FVXA 3WZMA 2YVUA 2JJ1D 2QRVB 1G5FA 3SMVA 3PHBE 4IJKA 4NBWA 3FTFA 3HJGA 3GL9A 1LVHA 3U44A 3MTDA 4ND2A 4II3A 2DPGA 2ZRMA 2ZROA 1C1YA 3OM9A 4JLAA 2XDAA 4XD2A 4AKSA 2ZBEA 2OBMA 1EXWA 5E9AA 2AFIE 2C78A 3ESCA 1KOFA 2WKQA 4HDRB 4I4LA 3QZUA 4U2BA 3V34A 5IHXA 2W7TA 1QVVA 1BEUB 1JIUA 2J3IA 3QY9A 3VKUA 1DG9A 3FYUA 4I08A 2YHIA 4GZ5A 5T4BA 3VISA 3M33A 3ZCVA 4UXJA 1R0BA 5KYXA 2F7SA 3PFNA 4CJXA 1YQ9A 3WOVA 2Q2WA 2WWXA 1NRIA 1N34B 3R7DA 4CVNA 3E03A 5CDUA 1ID8A 1QKKA 2HKIA 4P58A 1LI7A 2IU0A 1GRVA 3ZTTA 2DFNA 1N1EA 1U3UA 3G0IA 1CDZA 4QC2A 4CMGA 4RF3A 1YA4A 5A4KA 4IKPA 1NBMD 4RU1A 2H7VA 2Q21A 3CMCO 3D6TB 3T99A 2VHCA 3ZNQA 4BE9A 2FH5B 1RQLA 2FSVA 2GZ3A 1P18A 3M5CA 4UM9D 4XLZA 3M3DA 4BZQA 1EDDA 1E7MA 4MIEA 1O9HA 5C1BA 4ND7A 2I54A 3EOZA 3H11A 1Q7TA 2VATA 3JYPA 4Y2RA 2YY6A 1E2KA 1II8A 2BD0A 1IY0A 2O0JA 2ZR9A 1XZHA 3FYTA 3MPOA 2PAFA 4Q03A 1SIBE 4BKOA 4EJ0A 3K09A 1X1TA 3N2IA 3E8XA 5EQTA 4MOWA 4TVKA 3WGYA 4URUR 2EX0A 2PKYX 2XF8A 3WZLA 4PZPA 3VM6A 4R9UC 1XGKA 3HY4A 1IHXA 1YZHA 1J25A 2YVLA 5EUMA 3G85A 3JQ8B 4H7PA 1UZNA 3S8YA 1FDOA 3EIFA 4S05A 1NQXA 4HLNA 2WP8J 5JRZA 4D7AA 3I5MA 3CLUD 1C3VA 1Q6YA 4BKQA 1F8UA 2YV2A 2QSJA 2X0IA 1SQ0A 2UZ4A 2XRYA 2OBLA 3D43A 1ST2A 2R8RA 2ZAGA 1YFKA 4QPDA 5CITA 3KVRA 1DKPA 3RVBA 3VFDA 4E46A 3THSA 1KVTA 5HJEA 1KAEA 3V8BA 3H83A 1XVAA 3GJ0A 1XPRA 3IC5A 2G9UA 3N7UA 4RYDA 1KOLA 3EXHC 1UADA 4IAOA 1LFAA 1KRXA 3T9AA 2EFJA 3OQHA 2HRBA 5FTJA 3S6JA 3JASB 1TJPB 2PHZA 3AGQA 4JB0A 5IP5A 1SK8A 4JUCA 2ZETA 5D84A 3HVRA 3G9TA 3GR6A 2LCFA 1AF7A 4OQMA 4ZQHA 3IAEA 5HDBB 2MSCB 4DV0B 2G6TA 4IH1A 5CH3A 5CA0A 4WV3A 1NQVA 5K03A 3E3NA 4ZYLA 3ENNA 3HVKA 1F5SA 2Z3WA 1Z35A 3PA8A 4LA4A 2FN4A 1FEZA 1NVUQ 5KREA 2QR2A 2YICA 5A2GA 3ER9A 5ITVA 2CUKA 3DMTA 1T91A 4ESEA 5A6SB 4KYIB 4IDNA 1C1XB 3IEKA 3LO5A 1ZWLA 2F48A 1UZUA 4B76A 2G63A 2AXEA 1QKJA 1X1EA 3JWJA 1A9XA 1A77A 4PC6A 4ZTZB 2ZRJA 1Z7BA 4KDRA 4RGVA 4KFSA 3DFIA 3INYA 1JV2B 1T1GA 1EQ2A 2N1BA 4R2LA 3GEDA 1P74A 5AUNB 1NF9A 3REGA 4XI9A 3M2TA 2BSQA 1L2TA 4C3OB 3JALB 3Q8XB 1LQ2A 4TM7A 5JMPA 1N1GA 1RAAA 5CA1F 1JWBB 2E6KA 3BAFA 5DU2A 3VYTB 1VIAA 3SYNA 3N3AC 2IGTA 4KPEC 4IQ0A 2QUKA 1OFUA 1A71A 1SHZA 1TEXA 3BWCA 1N77A 3JYOA 1IRIA 2BEUB 4EFKA 1E60A 3ZNPA 1S01A 2DBQA 3BC1A 5I7FA 3AJ9A 4HVAA 3O3NB 4BQRA 3VBEA 1XQWA 1YL5A 2AOVA 4AKEA 4IGAA 1CRPA 3IVGA 2P62A 3RWOA 2DFPA 2A0YA 3M4YA 2FDXA 4HGQA 4WLEA 4FS3A 4PIPA 4ARAA 1Q84A 7ABPA 2RHTA 1SOVA 5EA2A 5FWDA 3U40A 3GFGA 3WGMA 2R97A 3ZX5A 3V6LA 1KH3A 1Z5UA 2IUYA 5ICCA 1KPIA 4Q4AA 3WKDA 2R1TA 4LSZA 4YJFA 2GXAA 1P9RA 3K05A 4JYBA 4TKUA 3KEGA 2OORA 4PX5A 3B78A 1ODJA 3B20A 1OUMA 1SHKA 1WMBA 2GYVA 3HJHA 1JB1A 2Y4OA 5HJ2A 4LY3A 5DRTA 2CLOB 4IG4A 1EXMA 1U8FO 2W11A 2GUWA 5JD3A 5DMXA 1O97C 1OZGA 3GXBA 3RNOA 5ECYA 4V0NA 1QP7A 1PG2A 1SUWA 2PM8A 3LZCA 4BVBA 2P90A 1HL7A 3L49A 3KUUA 3OT4A 1MOPA 1PKEA 3Q6MA 1ULUA 3DPUA 1K5PA 2ZIAA 1HI9A 1Z15A 2IDZA 2YZ7A 1QONA 2HNBA 1EUDB 4RMNA 4M0UA 3PQCA 4YCNA 1E69A 1JJVA 4E5UA 4Z4GA 3IAM6 4ND4A 5KTYA 3KAPA 2Z9CA 2HRDA 4C4YA 3U7HB 4I5IA 2O8NA 2C5LA 4S24A 4TWBA 4YV0A 4NOKA 1E1RA 4D0SA 1EE2A 2RGNC 1DAOA 3CZCA 4QDKA 4Y6RA 2QTWB 3UT5B 2IPOA 3AEUA 4AULA 3CB2A 1ZR4A 2AN3A 1P5JA 4LJ8A 2WSSD 2QGZA 3HEMA 2P6MA 4X5OA 5H0IA 1XVLA 5KQPA 2GAIA 2JGRA 4MA0A 5EZQA 4N47A 3H7IA 2WYIA 3P9QA 3WIEA 3AHIA 1G21A 4HB3A 3WMGA 1OIVA 3OICA 3RKSA 4DMHA 4IZHA 4DUZB 5ER6A 4N5LA 3ICCA 3NFRA 5CMLA 4J7CA 2SHKA 4KMMA 4Q39A 4W5TA 4Q19A 2OXIA 3QHQA 4UBLA 4L6AA 2EW2A 3ZXIA 1PWZA 2IY9A 4U8GA 4V0OA 5JPDA 1FVHA 4OP1A 1J39A 3L0BA 1ZOPA 1ZCJA 3K70C 3VOSA 1UJBA 3TE6A 2AD1A 2V6BA 5B6IA 4TRNA 2GN6A 2VSFA 3C6QA 4RBNA 3ZHUA 1Q95A 4LE0A 4MPTA 4UNRA 5BORA 1U3CA 2VSYA 1ISSA 4G1BA 5CD9A 2P65A 4Q9LA 6CHYA 4RE6A 4GI7A 1OILA 3OQPA 1OA0A 3WQHA 3BIWA 4F96A 1K6EA 1UWVA 3EIXA 4NBNA 1ECPA 1WOMA 2HHLA 3F97A 3O94A 4LN1A 5EJIA 1BGVA 3RGWS 2AX3A 2NZJA 5IT5A 2IZ7A 2PFGA 3W5IA 1IBKB 1R9JA 1V5WA 4GPZA 4RETA 2P8JA 2WF9A 5F77A 4ZV9A 5LU8A 3CUVA 3WMWA 3BQMB 2OBBA 4E31A 1ZSVA 4RMJA 4Z0TA 2JI6A 3BBPA 3MBKA 3AINA 4B3HA 5I01A 5M34A 1I8TA 3TBKA 2ORIA 2WWRA 3QMMA 3P9IA 3WSTA 1SELA 3MTBA 2O0MA 3H05A 3HYSA 4TZTA 1JQEA 5FIUA 1GADO 2QTNA 3NZEA 4R7ZA 4Q7QA 4G5XA 3REQB 5IU6A 5K9ZA 5HFJA 1SVOA 3DZCA 4M9XA 1ADCA 1TA9A 4G0OA 4GR9A 3AERA 2ODTX 4NCIA 3F4KA 1V0JA 2NU9A 4PYLA 2FR0A 3RODA 3JCZA 4MROA 5CDSA 5FOTA 1UK6A 1WVGA 2G4CA 3PC7A 1VHQA 1XA0A 2G0TA 5CCXA 4RKEA 1NVXQ 1EI9A 4BTEA 1FBNA 1QH1B 2IRWA 5GM1A 4CHTA 3DAYA 3EBLA 4RJJA 4NBVA 2A7QA 2NXNA 4P54A 1RBMA 2NU6B 3CQ9A 3WRXC 1XJ0A 1YE8A 2OUKA 1AVTA 4N3BA 1OC2A 2WP0A 2XMDA 4FX5A 4S1NA 1OA1A 1ZD5A 1M33A 2QRJA 3M0EA 2YXBA 3AFOA 1T4CB 4GBMA 4HNTA 3R5SA 4CYMA 3FZNA 1G8MA 4NARA 3OFSA 4M9SA 1C4WA 2D1SA 4HWKA 2F59A 4Q1BA 3ST7A 3WYEA 3TD2A 4TLCA 5BN1A 5JWRA 2WTNA 3DUFA 3NOQA 4OHRA 3IPCA 4MYCA 2CL0X 3MD9A 2V3WA 3IHKA 4RM2A 1WP4A 3GCDA 1GL6A 3LT5A 4GOLD 3FHCB 3TFOA 1PK8A 4ZZ2A 2ZIZA 3BD6A 3VSCA 2G09A 3C8DA 3MB8A 2REBA 3OM8A 1VPVA 4NJMB 4WQMA 3EASA 5JH7A 1E8NA 3ESXA 1AO0A 2IHTA 5G0UA 1UXIA 3QVOA 1MQSA 1CP2A 1J0EA 4PX9A 1IEQA 4GZMA 4RUKA 1NBHA 5IC5A 4J07A 5F33A 3WNZA 1DX4A 2PXAA 3EWSA 2GBIA 2P9TA 5EJ4A 1E2UA 1TYCA 1TUBA 2VH2A 3ANTA 1HOXA 3NBKA 3OZSA 3TW8B 5AJYA 5JD6A 2XCSB 3HBLA 3OQ1A 3TQCA 2JLSA 1TADA 1WCIB 1WNTA 1WMEA 2EG5A 2F67A 3D02A 3DM5A 4G2TA 4GVXA 4JJGA 4M9ZA 2FUG6 3FPAA 4WFJA 1DO8A 1K27A 4IDOA 5C53B 2O8CB 4M49A 5D01A 3AO0B 4HGNA 2DHCA 1FFXA 4RY2A 2D5LA 1Z6TA 3KX2A 1RC8A 2ZWOA 3VPSA 1E1QD 4NBUA 4MITA 2FFRA 3FFWA 3I92A 4FOSA 4K6OA 4EI2A 3E27A 5LMUB 5AW3A 3T3EA 1NKSA 1Q92A 1S5PA 1TO1E 2RGGA 1XTRA 4JL6A 2QGFA 1OX4B 5HCIA 5TPWB 3T9BA 2NZUG 5KPJA 421PA 4RTPA 4P1ZA 1PGOA 1FLDA 3EXAA 4UBNA 5G0VA 5LP6F 4MICA 5IKPA 5CYPA 3AJEA 2BCJQ 3HL0A 2PFKA 4RMGA 3GT7A 5IVIA 1H2EA 4FYYA 3CBQA 1E2EA 2QLNA 3DJYA 3II6X 1W2WB 2J85A 2FP3A 2PCJA 2FZ5A 5EZYB 3PTAA 5L3QB 1FFCA 1ZNYA 4JI2B 2ZRIA 1JG2A 1N75A 2A1UA 2BT4A 3DD5A 5AI4A 3KL4A 2GN1A 2GA9A 2PJRA 4QG3A 3WDLA 5F23A 2O5VA 2C00A 4L3OA 3IMCA 3KT3A 5ENZA 5T6MA 5TJHA 3IR6A 1Z5NA 5YASA 1H6CA 4HB0A 4K7JA 2NAFA 2Z04A 2IUEA 2VAMA 1PZHA 3PKIA 4EQ6A 4ENPA 1LSOA 4Q24A 5BVGA 4LJRA 1WLYA 5LN1A 3ADDA 3RYCB 4I5EA 3AY6A 1FP2A 3N7TA 3PR1A 3NOXA 1CR1A 2B0JA 4JU9A 1QOQB 1EK5A 4RD4A 1XSEA 3WC4A 4BMVA 5JRDS 2QX8A 4YASA 1DV1A 2FLKA 1ZG3A 3P1JA 4PCLA 1Y8RB 4K88A 4TWIA 2I1LA 3FSGD 5ECDA 3JQ7A 3IKLA 3FBTA 2ZIFA 2Y1WA 4K9QA 4H9GA 3SEFA 3ZI4A 1GUBA 4Y2GA 3RROA 2N0SA 3OIYA 1KJ9A 2H48A 2WTXA 2X0JA 1ZZEA 2Z4SA 3QHPA 4O4LA 4UTXA 3ZJYA 4B1FA 4DMMA 2FPIA 3PIRA 4JT2A 4MWOA 4OLJA 1P1JA 3ITEA 3EVAA 1A9TA 1QHIA 3IHTA 2VSQA 2WPDD 1M74A 2DFLA 1IHPA 4DCJA 2A30A 2J48A 3DTVD 4O2RA 1XYYA 3SHWA 5IK2A 4IV0A 1UMBA 1NWHA 1ZUIA 1WHSB 4DPMA 5CFMA 4UVEA 3PUWA 4LY0A 4M4SA 4PHTA 4B4KA 4MB2A 3C6BA 3K9FC 2YBEA 4L74A 1N33B 4B40A 4CFZA 1R9MA 3EIWA 2QSUA 2CEAA 3FPLA 3W6PA 5LMCA 3O2NA 5E3IA 3TNFA 2ZQZA 2YVQA 5THKA 2XGSA 1RIFA 2FMFA 3OPVA 5AJVB 1X1RA 1ENOA 1JI3A 5K3CA 1R4AA 3DDCA 4GX1A 4X8HA 3U39A 2XDQA 2PG3A 3TQSA 1DSSG 4RIFA 3CMMA 2V96A 4M1WA 3TTWA 4DCCA 4DJDC 1VRWA 2PKQP 1SN7A 1BDIA 1FFGA 3O8QA 2TMDA 1KK3A 4BWVA 1I4EB 3CE9A 4KXWA 3RVMA 3TE7A 3U3OA 2RIRA 2K2QB 4G0MA 5BOSB 1R6VA 3CH7A 4JT9A 3V8VA 2BGMA 3K9QO 5HKAA 4JI1B 4UE2A 2NZ8A 4EX7A 2ZT8A 5D5PA 1SCUB 4G86A 3UB4A 2QORA 1P0QA 3CXUA 5E6SB 1LTHR 1SVWA 4B3GA 1ZGJA 2GJ8A 5JLJA 3GLFB 5EWLB 5JQGA 4WNAB 4G5SA 1TKRA 2GB4A 4Q66C 1J22A 4RL6A 4GVPA 2BFOA 5LZ7A 5ALGA 4L28A 2KLHA 3CNBA 4L02A 3EUFA 1DIGA 3HHPA 5IN5A 4F9FA 621PA 1M6VB 2C3UA 4MVJI 4NCAA 4KXMA 1R0ZA 3NHZA 3V3TA 2PSEA 3NYIA 2GAFA 3O1HB 1O95D 1VCOA 4E5NA 4F8EA 5EYPA 3ED1A 5EJ2A 4LZOA 1PR9A 4WLNA 4L7QA 4D9CA 3PNVA 4TGLA 2Z6UA 5TQ0B 1GZ3A 2W22A 3ILHA 2JHAA 3Q9NA 3OBIA 3EN0A 4NZOA 1M2VB 5ALWA 5JVDA 1CR2A 3PSHA 5U4XA 3RPEA 3RU3A 1VIVA 3OY7A 5KYVA 3IERA 2VP2A 3FR8A 3T7TA 1EFHA 3UVEA 1JLMA 2RK4A 2NVBA 4QUBA 3TQFA 3SF8A 3PRHA 1MG0A 2V6MA 1OT3A 2QD1A 2YYZA 3ELUA 2GAAA 2ZS7A 1CZUA 1QV7A 2HCTA 1PUJA 4JC0A 3FFTA 1HNXB 3DOHA 3X1KA 2BH2A 1MX5A 1FTQA 4QOHA 3QG5A 3VDQA 5BQ3A 2PQ6A 4KV9A 3D8NA 3KE9A 4M0PA 4M1ZA 3SX0A 4FJ0A 2OGWA 3GIWA 3E4CA 1TQDA 4NJOA 2AMJA 5JD4A 3WQRA 3PQEA 4RW0A 4DYHA 2XE4A 1KI3A 3FAZA 3IFSA 1GXSA 1G2IA 4GPBA 4BMSA 1HR0B 4YONB 2WT9A 3FMGA 3ZDDA 2W37A 1VJ1A 2JFOA 4UQLA 4KQKA 2JFXA 3IULA 4QVIA 3LYLA 2GILA 2XOKD 4L6IA 3ETNA 1R3DA 2LP4Y 3QEMA 4WK2B 5CR9A 1N5DA 2WE8A 5BXYA 4KH0A 1PS8A 4DXDA 4DV1B 3PC2A 1MVLA 3TZQA 1QUFA 3C39A 2A4MA 3PQ7A 3ZJ5A 4BKMA 8LDHA 1G3RA 1HSOA 3FGOA 3QV2A 3W2HA 3AUFA 4PWZA 1I2CA 1YK1A 1RLJA 2Q29A 2HRCA 2RHMA 4CDMA 4LNUB 2ZTSA 1A7JA 2CDCA 5FB3A 3ZD8A 5JD5A 3WGGA 4WESA 4JWTA 3CG4A 3KOWA 2BMJA 2VWGA 4LVCA 3MQ2A 1N2JA 3ZWDA 4C0JA 4F2PA 1E4EB 1UBMS 3I8SA 2RCYA 4UPEA 4WOCA 3LUBA 4N8SA 4EW2A 2RG7A 1IBSA 2D54A 1LTQA 2OP0A 3E18A 2WJZB 3IHLA 4TOIA 4XCVA 2NTVA 1MV5A 4X6LA 2V7TA 5COBA 4ARSA 3C7TA 5CUQA 1RQ7A 4G8BA 5DULA 4HZUA 5DGCA 2XCIA 4C7XA 4V2IA 2NW6A 4G67A 1SXJB 2I1WA 3SR3A 2WMOB 4UD6A 5GZ1A 3OETA 3SXUB 5DWDA 1S3GA 2NU6A 1JEEA 4BUZA 1NR5A 4MI1A 3NIBA 1T3SA 2BHSA 4QO8A 4DNOA 4IV8A 4RTMA 3A28A 3WWDA 4CCSA 1PBNA 4NDZA 4OY3A 3NVAA 4RIEA 5BQ5A 1JDPA 3FMOB 4O3FA 1FNCA 1I9GA 5IH3A 4CKCB 1W88A 2GEUA 3LHDA 4YFVA 1ZSYA 2W2OA 4J4HA 4KZKA 1JMKC 2H92A 4EB6B 4FMCB 1WUJS 4W9RA 1JHMA 3SP1A 1HNZB 2CLMB 2QDXA 4P3KA 5KB3A 2BY4A 2IYSA 1GN9A 4HADA 3EFOB 2EP7A 3AB3A 1WCV1 2XQGA 3MIIA 4H18A 5AK4A 1UBSB 5D85A 1NM5C 4NIMA 3OKFA 5LWHA 4G4JA 4X7BA 1RYEA 4R8KA 3PSAA 2IXBA 3JVEA 3GJXC 2IYRA 2JBWA 3KJFA 4G84A 4NSNA 4O4IA 3GUYA 4Y9TA 3AUTA 2DUUA 1KDPA 3QEOA 2V4MA 3G2HA 3JYNA 4ZI5A 3WLNA 4M9UA 5E9WA 5FTKA 5ALVA 1ZOLA 2VUHB 3WK6A 1NUTA 2Y1XA 3EAGA 4D44A 1CF4A 2EYQA 5B53A 3D2AA 1MQ8B 1YH3A 4D0LB 1CJBA 2CNOA 1AJEA 1Z08A 2A35A 2ZBDA 3QNUA 4LHZA 4A15A 3HK2A 3RVNA 1SKQA 1HYBA 1K4KA 1TCUA 2V5AA 4UUAA 4JI7B 2WABA 1CUJA 2REQA 4J1TC 3ZQUA 2X5NA 5HIJA 1ECFA 5LP6C 4F9TA 4CMIA 1NW6A 1T3LA 1UKAA 3G9UA 3SHOA 3D81A 5L7TA 2F3UA 2YJNA 4EJMA 4B46A 1L7MA 3MTEA 1M76A 1K75A 4BX2A 5ARCA 4UARA 2QLFA 1RI2A 1Z7WA 2B8NA 1OH7A 3H2SA 3DTNA 3IAS6 1C1HA 2CZQA 2W4MA 4PRKA 1UP7A 3UO8B 3CPSA 4W1RA 4GF5A 3PL5A 1TMOA 5KEIA 5M04A 3BWDD 3TCXB 3MINB 1KEWA 1KYXA 3VYWA 1TD9A 2O7NA 1GKYA 5IMSA 3X1ZA 3PX7A 3FZGA 2X13A 3Q15C 1IXZA 2NYUA 4HGRA 2I6QA 2G5TA 4R1OA 5EVCA 5L3QA 2Q6OA 4IJ6A 4ZT2A 4I8DA 1QSGA 2FRDC 2H9IA 2LBPA 3N2GB 4AWXA 2I29A 1RC1A 2VHZA 3DBHB 5BQPA 2FSIA 3BMXA 4CMHA 2SKEA 1L4MA 1WQ3A 1M75A 2FUEA 2W2KA 2XWPA 1XLUA 3FPJA 2UYCA 2DBRA 4MEBA 4H3KB 1DFGA 2DPLA 5DHAA 3JV7A 3JZIA 2J4CA 2PD6A 1S02A 5CPBA 4PO3X 2XE7A 1M3SA 5C8YA 4TUYB 5L7WA 1XWFA 4JOCA 5AHKA 3NANA 4L8LA 3GLIA 1RKQA 4RKFA 3FOEC 1W9MA 3F6EX 4CEJB 2BGRA 4K6HA 4BVFA 2WWFA 4ZAZA 2JIOA 3VU3A 2A59A 4RCZA 2YWXA 3KFLA 4KV7A 1CY0A 3QUAA 3ZWWA 1CF9A 1MX3A 1UJMA 3GGGA 1RRMA 1JFTA 2V54A 2VT2A 5JS2A 3H3JA 1SM4A 3KG2A 5H9WA 1P0MA 1GARA 2O6LA 3OWOA 3QITA 2IWHA 1KEZA 1U9CA 1Z8HA 2JGLA 3FRHA 2FEPA 2XUZA 3KQWA 4FFMA 5TGDA 2HNAA 4EVIA 3SJUA 3OEED 3ODGA 2XUPA 3DZKA 3LDUA 3TBHA 3ZC3A 1V8OA 3LJKA 1SCKA 4TM8A 1GQQA 4MWCA 4J0KA 5AI9A 3DVAB 4OXXA 1JWLA 1T9DA 2ZJ4A 5GV8A 5LB4A 3Q7QA 3ADKA 4RF2A 2FPOA 4OGGA 4E5KA 4E5PA 2BP7A 3I73A 1ACJA 3FR7A 3GQBB 3KD2A 2ONYA 2Z4TA 4G4SP 2PD4A 4LTDA 4M0FA 5DBEX 4AUKA 2C7RA 5K0ZA 3GMSA 1EFPA 3GG2A 3KLMX 4TXNA 1FJHA 1L3BA 4UOQA 1DE0A 2O8EA 3PPYA 2IXAA 3KQSA 2ERYA 3YASA 5EJEA 3HDGA 3LUPA 4YR9A 3GY0A 1B73A 3MG9A 4ENRA 2QE6A 3IJPA 5ALKA 3UEOA 1BXRA 3CUKA 1X9HA 4BJ5A 1I01A 1KP3A 1TIBA 2BCGY 4ILEA 4C2UA 2O4UX 4YQZA 4EYKA 3F7MA 1A95A 4KN8A 5JS8A 3AVVA 1RPNA 4Q12A 4KQIA 2R7LA 2Q5HA 3IQEA 4CBVA 3CUYA 3M6MD 4LRTB 1ZEMA 2YWGA 4OK5A 4DV3B 1WXXA 2CHFA 1QQ6A 5HQ3B 2CBGA 2WM9B 3FCEA 3LLCA 4FYJA 1YFZA 6PFKA 4D92A 3OY2A 1EUZA 3IBYA 4M1MA 5E6SA 1DJLA 4GMGA 3WLTA 1D7OA 4BVAA 2V7BA 2DY0A 3QF4A 4NH0A 4EY8A 4ZU6X 4QQNA 1PSDA 5AW9A 1GPAA 1IUPA 1FYDA 4L27A 4MVCA 5AVRA 2EF0A 2ZYWX 4TYYA 4NENB 2CEKA 2PMFA 3KYDB 4TSKA 4AB1A 2ZJ3A 2VDMB 3WMRA 5I8WA 4X44A 3VI4B 4EF5A 2C7BA 1CUYA 3O8OB 1CEYA 1CNMA 2J8ZA 4WKPA 1P2BA 5AFSA 4O02B 4GYWA 3OF3A 4R2IA 1PJAA 1U2PA 2UVQA 1OLUA 4MMYB 5FEUA 2J4DA 3KWLA 1ESMA 2DGDA 2LCIA 5EMMA 3C4VA 1WULS 1XKTA 2P3OA 1NN3A 3ZLJA 5AVSA 1N3IA 2GK6A 4Q93A 1WB9A 3NRJA 3WE7A 2VN8A 5JWHA 3PF8A 4RD0A 4G5GA 3VUEA 3UM9A 2V8BA 3GJZA 4BNHA 2EX4A 4BMOB 4PQEA 3RASA 4OHUA 1LFDB 3AI7A 3TJMA 2AVNA 3RLFA 2VQ3A 1NG1A 4DLUA 3I2JA 1ZMBA 2CVPA 3JQCA 4V0SA 3RW9A 4AMBA 5KYKA 3ZBTA 3N7AA 2QX4A 4LC9A 4KO2S 2HDOA 3ESAA 4WL0A 4Z54A 3AFHA 3JRWA 1E6WA 4N5HX 1WUYA 2GKGA 2PFSA 4E88A 1CT9A 3GD7A 4ZHSA 1OE0A 1AHIA 1SNYA 3GPDG 3QXHA 2CXRA 4LBYA 2I5PO 1NNUA 4FFDA 4R8RA 4K8RB 4OAOA 1ZJZA 2JFUA 2ODWA 1GU0A 4OQDA 4WWHA 4BNZA 4V0QA 3JARA 4Y1RB 5CH5A 1S3FA 4XFKA 1VBMA 3VR6H 3WNBA 4INAA 3TXXA 4O33A 3ZWPA 4CKWA 1EB9A 2J30A 1P0FA 1O6BA 4RMHA 7AT1A 1CVRA 2IQIA 3F9IA 3TX6A 3HWSA 3LP6A 1A96A 3HSKA 4TMTA 1LVUA 3EC1A 1HDOA 1F0YA 5HDQA 2H0AA 1RQPA 4P31A 3RSGA 5FUQA 1O3YA 1QGUB 4KYVA 3S99A 1BG6A 4W5QA 1GR1A 1R8XA 1QIDA 3EZLA 1D04A 4MKFA 5DWVA 4QE3A 1OJ7A 3DYBA 3CF0A 3MMXA 2AFVA 5F3RA 1KXJA 2ID4A 2LW7A 3LQ1A 2EYUA 3ORSA 3KBBA 2XMBA 4EO7A 3GDWA 1BD3A 4I19A 2B94A 3TSOA 1ZXXA 3NBZC 1FTGA 4CF6A 2VQDA 1IN1A 5CXXA 1IH8A 5TQJA 3WA7A 4QBHA 4QJIA 4YRTA 3VKFA 2BTQB 5JR3A 2PA0A 3GYBA 2WKSA 4RSRA 1XZNA 3EUWA 5BY2A 2C9DA 2H7YA 1AB6A 3C8ZA 3D6VA 4QBFA 1UBNA 1T8YA 3CS3A 4UCXA 5FPYA 2HZ7A 1Y4DE 2R66A 3SZGA 1N1MA 4WLFA 1N6KA 4XZ3A 3F6PA 2KJQA 1XVIA 3E1GA 2GRUA 3TTYA 1WPXA 3VC2A 121PA 4TMWA 1SRRA 2QI9C 2BM8A 1Q44A 4MZDA 4IMJB 2IV3A 4BV8A 2GZ1A 5JDCA 4UHCA 4YP0A 2AOTB 4OI0A 2F90A 1TTPB 1LI5A 5CA0F 5BN4B 2A9KA 3BN3A 4KYTA 1KFCB 1XNHA 2XVMA 2AZXA 3O75A 3WGKA 1REQA 4RZIA 3ORHA 1GUAA 1N2EA 1NM5A 2CXOA 2H5JA 2VJYA 3HJAA 3OIUA 4V0LA 5FFMA 1KSFX 3S1AB 4B6OA 4BYMA 2I8LA 2CB9A 3CLUC 2C61A 4HR7A 1MT3A 4HPXB 3B1YA 5ALOA 1DEAA 2BMEA 1EXVA 2PL1A 1VYVA 3X2EA 4UU7A 3UB2A 4F04A 1IM5A 5K0LA 1YD7A 3STYA 5KNDD 4RTRA 1GWNA 4IX9A 3GH1A 5D00A 1NW7A 4K9PA 4IWXA 2PZKA 3TF5A 2G82A 4OU5A 3PE6A 5JADA 3OQOA 3QIVA 1D5WA 4V0MA 2CK3A 4J1TA 2CYBA 4PRZA 3KYBA 5ERYA 2G1UA 3PFKA 3P9NA 1JQ5A 4W8OA 5C3MA 5HHTA 4I50B 4YUVA 3BA6A 3LBAA 1H2RS 3LK7A 4OM7A 3RYHB 4RH0A 4POOA 2ZTUA 4DMKA 4HC4A 1SBCA 1EVEA 1JHVA 1YV9A 2JFNA 2OV6A 4U1RA 3U4AA 5FYQA 4CM9A 4MUHA 5E6UB 4XEUA 2D2IA 1PZGA 5IC4A 2VTVA 4OLBA 1V5GA 1VJ0A 3ER6A 3UMRA 3RFUA 4L22A 4Q3LA 1X7HA 1IRXA 2J33A 4IQGA 5ETJA 4UUQA 1FRNA 4OMUA 4OLHA 3ND6A 3WRYA 3TM5A 1A1VA 2FQYA 1M2OA 2P30A 4WZ6A 4KVZA 1U0BB 3RRMA 2D6FA 2QIPA 3B1VA 2OGZA 3RC9A 3WHKA 1ZYUA 1SPXA 3CFYA 4RKRA 2FPUA 5U1PA 4LHSA 5TF4A 3K6JA 1W85B 3TJZA 1FLVA 2J5KA 2PIDA 2VF8A 3ZWXA 3IBGA 3K1AB 3R0JA 1CJCA 4G65A 1MB4A 3CF2A 4KMRA 2IHJA 4WN9A 1J0BA 1MB3A 3R76A 1OPRA 2F4NA 2ZW9A 5JPCA 4KOEC 2DWOA 4ATNA 3VNVA 5LQAA 1H2XA 1GAWA 5B3LA 3HABA 4NFSA 4HLUC 1EA7A 1EP3B 1JZTA 2PD3A 1XAGA 2QNRA 4YMWA 1DG3A 1QDEA 4PHHA 1ICEA 3BHNA 2YZ2A 3H2BA 4WY5A 5D51S 1DJOA 4A73A 3ZTWA 4OKIA 2RAUA 3U7QB 4A8TA 1UF9A 3BFJA 4YP6A 4BO4A 1RT9A 1R50A 4L16A 3RTDA 2CMHA 5T4EA 1TYDE 4MAFA 4EHAA 2AOWA 3CLVA 1LK5A 3QBTA 4OHXA 1YASA 1OWNA 2VBGA 4NDAA 1E6CA 1YFJA 1EWYA 2AFIB 2XNKA 1PJBA 2CVOA 2VJKA 4MGZR 3ZE7A 1RYNA 3WBFA 2D0OB 4MYDA 4EMSA 2JLYA 1YQTA 2X2PA 1J23A 1BKYA 1J2YA 1XXHA 1PEKE 1WIWA 3DYVA 3KAKA 4I6JA 3WFZA 1KGSA 5BWLA 3RS2A 2UVPA 1NC1A 1T0HB 3FWHA 2CKDA 1BW9B 3PQ8A 3S2GA 1U4NA 4ITUA 4NBLA 2NAPA 3FLAA 2WF8A 4W82A 4YLYA 4G9EA 4QHYA 3EXEB 3DO8A 3WDMA 1HF3A 1PHPA 3EMKA 4IKOA 2GPBA 1XU4A 2FKNA 3O74A 3VH1A 4BN0A 3T5PA 4RTNA 3GBPA 3ETHA 1J8YF 1SC9A 2E4AA 2PLRA 2YN4A 2FJ0A 3D7MA 3F1LA 4JR2A 2JPDA 4GQBA 3ZPXA 4BZZA 1BX3A 3G2PA 2MSKA 3DOEA 2B20A 4PZ0A 4XWYA 1N6PA 5KNCH 3EVDA 5K7SA 2OK7A 2IU6A 5EOVA 5KDOA 5LQMA 1HNWB 1IAQA 1Y9AA 1NVFA 2XYRA 4DEVA 1G5RA 1LK0A 5IJ0B 4BOYA 1QMGA 2X19A 1C7ZA 2Y92A 3QMVA 5EMJA 5H68A 2WJGA 1U99A 3DGFC 4CTMA 1VSUA 3GP5A 2R7NA 1T2UA 2PGIA 1TM2A 2QXYA 2A4KA 5LNK6 1QOPB 3W79A 5FTLA 5DNAA 3HJRA 1NI4A 4S2EA 2C7VA 2R6JA 4ZIRA 3T7RA 4RHTA 4RJTA 2D00A 2YRXA 2VHYA 1PGNA 3VPXA 1NF2A 4KYUA 5KQMA 1H5UA 5KQRA 1MGOA 3ETCA 4X41A 5JATA 2JGAA 4E14A 4BDTA 2Z5LA 3ASZA 3MJ4A 1GUZA 1NMXA 4WFIA 4KQJA 3LIIA 4FWTA 3SQXA 2VAXA 4JKOA 3BK1A 4DUGA 1XNRB 1KQFA 1U8ZA 4UHJA 1RBYA 3MJVA 3T34A 1DAHA 4TS1A 2AX4A 1X39A 3F3SA 4AN4A 4BNTA 2EBUA 2NZWA 3PHIA 2F8SA 3CW9A 3S5JA 1F2TB 4F4DA 1SQ5A 2E4WA 2X5JO 4OKSA 4L57A 2W2VA 4CETA 1E6LA 4IRXA 3A04A 1HA3A 3WKCA 2QL5A 5KYTA 4BX8A 3ON5A 4D99A 3VR5A 2E18A 1Z29A 2PH7A 1HMPA 1KYQA 2C4UA 3STXA 1C1DB 5CVDA 4WBNA 1VG9B 5LBIA 2FUCA 3EODA 3BJRA 1IY1A 1WXDA 4RFVA 3SVTA 3U2QA 4UHBA 5CB4B 2Z3ZA 4NP6A 4PAOA 1IIRA 1K86A 5IZ4A 2O8BB 2CLLB 1LD3A 1OZ0A 4QTYA 1M10A 2O2GA 4C4AA 4TYWA 2NM0A 4UOEA 3R44A 1GFIA 1XX6A 4WNCA 1Q2UA 3PXUA 4BB9A 1SXJD 2G83A 3FDFA 4JUDX 4Z3KA 1SWWA 1IUOA 2Q0HA 4LDZA 1PI3A 1PJ2A 4BYGA 4UUNA 4DG5A 4RA9A 1LPSA 1ZM3A 3GLUA 5GGXA 4Z4FA 4N7JA 3E23A 1PX0A 1O87A 2FMIA 4IJMA 5EN4A 4C6TB 3PBKA 2PU7A 2P9HA 2IFTA 2R6GA 4EI7A 4OAQA 2ZAYA 2XXAB 1L5QA 2O07A 1BSVA 2RHJA 2I7TA 2I4MA 2ZPAA 4HGOA 3GBSA 3OAAD 4GLFA 2ODPA 2PBLA 4ZAFA 5LDGA 2GBLA 1TQHA 3IAM1 5GOTA 2LDBA 1DAIA 2X14A 2JF0A 2ZRLA 3UJCA 3N75A 2EAUA 4JBXA 2P4UA 3FPCA 4HAUA 4OF4A 5AXCA 2VWHA 1FFEA 4FBMA 1Q77A 4UNSA 2W6JA 1DCFA 5JSFA 2GEKA 5KCMA 5IDWA 3DH0A 2H4FA 2ONKA 3EF0A 5GZ6A 2XY4A 1QC5B 1E7YA 3PV0A 1Q15A 5JE8A 2P5TB 4PZAA 4Z6KA 2CXQA 3M4XA 3PE4A 2Q3DA 4GDMA 4V3CA 2QTMA 4XQGA 3VPCA 1UPXA 1UDRA 1V26A 2C2XA 1QQTA 1EX6A 1EWRA 4YMVA 3P7MA 2PA3A 1F14A 1CE8A 1L7VC 1J6UA 1U2DA 3QU2A 1Y1TA 1KFKB 1IDN1 3G7NA 1WZUA 1D0VA 3E35A 1KETA 3A7EA 2QN8A 3FRIA 3C3YA 4GP9A 4JR1A 3TTXA 3ZBQA 3UJBA 1JA9A 1QIIA 2PR2A 3IOCA 2LPMA 2XNSA 4EIWA 2QD3A 3C1AA 2MYNA 3AI1A 1JILA 2R8PA 3BMCB 2PQMA 4RFSB 1L7DA 2PRIA 2RGEA 4ETWA 2HGSA 4OBWA 1MJGA 3SD7A 1COWA 1C4XA 1WJGA 4KAJA 1XQXA 1CUAA 4EY7A 3DF7A 3DE3X 3ELYA 4JZKA 4N3CA 2G1AA 1ODLA 4L85A 3MLAA 5JS1A 2GNPA 3ZYCA 4ARZB 2NUPA 3IDQA 3KEMA 1E5XA 2VRCD 3Q7PA 3AHFA 4IYRA 2H1LA 1GVHA 5GJCA 1NPYA 3ETLA 3LT0A 4BNLA 1WMFA 1AQLA 1EK2A 4ZREA 5DTIA 1B14A 2J07A 4ZVSA 4QOIA 3E9EA 3VGPA 3MJSA 1SUDA 3M6AA 1LI4A 1HWYA 3PUXA 3QKRA 1GA4A 1G64A 5E7IA 1BQEA 2ZR8A 3RV4A 2VRBA 5LM3A 2XZOA 3K8OE 4JC8A 1X7ZA 1OD6A 3MJTA 3MGCA 4P93A 4KLRA 3ZW8A 1U2SA 1FTYA 1UBGA 1ZESA 3AVPA 3KIPA 3LC7O 4IJUA 4JYPA 1E8DA 3ZGXA 4N5NA 3PCRB 1GAQA 1E63A 4P7BA 4Y2VA 2L2QA 1ZO8A 4H3SA 4IYJA 3CRNA 2ZUBA 3QKSA 4JK3A 4MVJM 3VU1A 4CN8A 2XA1A 2D7JA 5ALSA 2AEEA 2GJ9A 3V48A 2B7BA 2ZYAA 2I2AA 4EA8A 4LXHA 3BIFA 2KBFA 2O7SA 3HB0A 1WVMA 2XTAA 2WTUA 3L3BA 2ZB2A 1X7GA 4XOIA 5E6UA 3MQ4A 2DPHA 2AWNA 5C3UA 1X87A 3CURA 3Q8WA 3OZDA 4ALJA 2WYOA 4L2IB 1A2QA 1NXSA 2PZGA 4K03A 5EE9A 2BVNA 2Q2NA 1J5XA 4MWDA 3KR1A 2HBZA 3N3BC 4RHEA 1JLHA 1I30A 4A23A 4JXXA 1ELOA 5CM9C 2DERA 1KE2A 2QB5A 2ZRBA 3NQ41 4R7TA 4P8RA 1XVVA 1F6BA 1GRRA 3ME5A 1RPJA 3HFSA 3R3UA 4KRXA 4ZVTA 2O4CA 1EWVA 5EKTA 4Z4EA 4FOTA 3EPJA 5CT8A 4FHGA 2ZT5A 5F1OA 4G8CA 5DMHA 4A26A 3TX2A 3SQOA 3C7KA 5K0JA 1JF8A 2RKWA 3ENVA 4GRIA 1QNFA 1XD8A 4KR2A 2EWMA 1X77A 1Q14A 3NPAA 4AUEA 1RDFA 2OD7A 5TVKA 3LUHA 2PGDA 2QX6A 1P81A 3D6HA 1CTQA 2Q6LA 5JWOA 2GZHA 2V55B 1OJLA 4OATA 4GKKB 4KRFA 2RBGA 3Q0IA 2PEYA 2DE0X 4MP6A 1OFUX 1Z8NA 2VJMB 4CT4B 1NURA 3X3HA 1I4OA 1YE3A 2BFEA 3AUKA 2VI5A 5HK8A 3UAZA 3H87A 3RH0A 1P0PA 1RHUA 4TKVB 3UMFA 4J29A 4K9MA 1E79D 1F48A 4GUAA 5JAZA 1ORWA 521PA 3R5FA 3ZDQA 1DB3A 2J9FA 4MKGA 1TAGA 1XCPA 2GYYA 3B5EA 3HRHA 3A2LA 1C8BA 4ZU1X 2BFCB 2VHVA 4IXDA 4CV3A 2F62A 5A3QA 3IXLA 4QFBA 2IHVA 1UOEA 1NXXA 2YR0A 1OPXA 2CDBA 3I2KA 1ZH2A 4LG1A 5IKOA 4ZAGA 3HNOA 2WNSA 1J70A 2LRHA 3EXIA 3HZHA 3CB4A 1SXQA 1VE6A 2ZWVA 3O31A 4JLBA 2ZANA 5EIWA 5JYCA 3ICPA 3HACA 5FQOA 5CVEA 2XVAA 5FO1A 5HCNA 2CLHB 2W6IA 3KUXA 4JASB 1SBIA 2H4YA 3VPFA 5H3LA 4DR6B 4RVUA 2F17A 1WSAA 3FG9A 1ABBA 2P9JA 2H51A 3FYDA 2QPTA 4LCEA 2H4HA 4Q9AA 3V9PA 4V0RA 4YJKA 4RPJA 4JD5A 2CFTA 1GZ4A 4KVAA 1PW7A 3KB6A 5FPHA 3V4SA 4F84A 1L4NA 4PAWA 3NVDA 1Q7RA 1MRNA 5B5SA 2FPLA 1TQ4A 1W0JA 3QYFA 5CGQB 1H05A 1V8PA 4MCJA 2HO5A 2RH9B 5CVVA 1I4LD 4C7BA 2EZUA 2G70A 1O95C 1EJ6A 1UBLS 2HU2A 1USWA 4PHGA 5BMVA 1DKRA 3KWJA 1QFYA 1DBRA 3QFSA 5CDYA 4LVUA 3OPXA 1CY4A 2CYAA 2VNAA 1DIRA 3AVQA 4XB1A 2CFCA 2O1XA 4AUMA 5FPTA 4QFDA 1CY1A 5IF3A 1BMFA 4OSPA 3DFUA 1DT3A 3WV4A 3V7NA 4V1CB 3USZA 4IHQA 1A9OA 1F6WA 4DKJA 1AXGA 5K8LA 5EQFA 3FIUA 2C9YA 2BGTA 2KYRA 3QKUA 1U31A 1Y7HA 1DO0A 3KFXA 4TV9B 1NN0A 3P0EA 4RF5A 4F8YA 2PUDA 3W78A 5EJFA 4GH5A 1G42A 3NXKA 3INRA 1GT6A 2HY7A 1CKEA 1YJ5A 1Y4SA 3H0CA 1GPKA 2HDHA 1A8IA 4F7WA 2VYFA 4YQFA 3EDRA 1KDZA 3L6RA 1NVEA 1IQUA 1EUQA 1Z0JA 4QVKA 2GKOA 4ERXA 2FZ4A 1H2FA 5E2BA 3R77A 4TMFA 5LUAA 2E49A 4ANFA 3EJ6A 4M22A 2XF2A 3CSDA 3HA2A 4CMKA 5GM2A 1L5FA 4RVOA 3GW8A 4IIGA 3UGTA 3FTCA 1G3QA 1ZM4A 4KXNA 2A9RA 4XB6B 3TR0A 3O38A 4IOKA 5AQEA 1HYEA 3EY4A 4GX0A 4YCCA 5JXJA 1H4TA 1THMA 1BXGB 1LUAA 5D87A 3E9YA 4LXIA 1NKVA 1Z2CA 3X1XA 1KERA 5D6OA 2WZDA 5IMBA 4BNFA 1WW2A 3DLCA 1QH0A 2QE7D 1TFUA 1DAGA 4TT3A 1D4ZA 1VLVA 1W94A 1NVDA 1PLKA 1QM5A 2ZIXB 3U9TA 1MA0A 1O4VA 3D4OA 2VYVA 1ZOIA 1P29A 2AR0A 4OJMX 3A05A 4CLHA 2J3DA 3B6IA 5A4DA 1VJTA 2ZRKA 4UREA 2MCFA 3UCFA 2OHHA 2YUTA 5E1DA 3HLTA 4CM8B 3W7BA 1I3NA 4LBWA 2PYDA 4HUQB 3JQAB 3W8FA 1MFPA 1ZX1A 3A6JA 4WOJA 5PNTA 4JUFA 4E30A 3JQBC 3IA2A 5GY7A 1E3MA 2C3YA 1JDBB 1ZICA 2O1WA 3ABOB 2VHXA 2PKEA 2R6AA 3LBYA 4J7UA 3RS3A 2N3ZA 1LQUA 1U2TA 4CM3A 1E9FA 5IJZA 2EJBA 4OOEA 4R7GA 2C54A 4FHDA 4Y2UA 1IAVA 4IHAA 4YB8A 4N6GA 1KWGA 3TEFA 4DIMA 1CZKA 1N5KA 3VNAA 1G5IA 3IO3A 5JI3E 4FGUA 5HF8A 5B36A 3DG9A 1GTG1 1G98A 1C7IA 4BAZA 5IBRA 3K0FB 1OBOA 2C20A 4H0NA 3B3JA 4NMMA 3W9SA 1ESDA 4NF2A 2O3JA 1CULC 5TLSA 4NMHA 3QVGB 5G4LA 2KW5A 2G77B 4U5QA 5BR7A 2P9QA 3ANLA 1UMDA 3GRVA 3EQ2A 5A5VA 3NKVA 3WY9A 3E0QA 4DLPA 2HPVA 3QQ5A 3QVXA 1U7XA 2B3TA 2G0NA 3KHSA 4MR7A 5IARA 4C5CA 3K6SA 4HSGA 3WVNA 3H86A 5KHAA 3CRRA 1A2KC 3K8ZA 1XZGA 2PBRA 1PW5A 4OFBA 4PXSA 2JHCA 3O7WA 5AK6A 1LU9A 3K4HA 1A9RA 4KGXA 1FFDA 4WA8A 1OAOC 2VZ9A 1QGDA 5A5EA 5EZYF 3GUVA 3G1WA 5AI6A 2AK2A 3ABRB 3CEAA 2EFHB 3D59A 5DTMA 4BVLA 2J0UB 1ZNZA 1X2BA 4A2QA 2HQSA 2R2GA 4K86A 4ZDIA 4JLUA 3GJSA 5F9FA 1T2EA 3OWXA 1NJ2A 1Q57A 1M7HA 4FSHA 1MENA 3U37A 4NDNE 4HTAA 4M3NA 4B6SA 2M32A 3NTRA 4CCWA 2ZRPA 1DRVA 2X1LA 1CUFA 4IO1A 2QRLA 4QDTA 4ASUA 1KZ9A 4D97A 5C8YF 2C0CA 3MYYA 1Z74A 3FB1A 4FDAA 4WCFB 5BSRA 1KBQA 1L5YA 2VK1A 3B5IA 1UJ5A 3TI9A 1ZD8A 5HKLA 5BWOA 1X80A 3T5BA 3DZGA 4OGWA 4PLGA 3ZY6A 4W7SA 2FN7A 1Y7LA 2IOFK 3BXEA 3LI2A 2P9CA 2I78A 4FGJA 4L5BA 4F21A 3C2QA 1YR6A 2JLVA 4NY1A 1NA5A 1SCQA 1QFJA 4B3MB 2ENWA 2PWPA 5JZSA 1BDJA 1ZL0A 3E4DA 5HWSA 4K1XA 1FS6A 5FNZA 1X9GA 2ISCA 1RLOA 3C1OA 3UMVA 4EEZA 3J7TA 3R4CA 4Q4DA 2M6RA 1CQIB 1QZZA 2RAPA 1LKZA 2I3ZA 1C0PA 2DY1A 2LZ0A 2O23A 4HCJA 5EINA 4B7AA 5IUJC 1K1EA 4ZO4A 1BD4A 1JQDA 4D98A 1CUGA 5DCLA 4B75A 4UKDA 5EXXA 2IEYA 1Z6AA 1FB5A 2PGNA 4HWSA 1T8UA 4P35A 3TL2A 1TUEA 4AC9A 4AURA 3SC4A 3UN1A 2E37A 4QTXA 4I9NA 5JAMA 3D3WA 5KTNA 5IT9A 1RYBA 4ZCLA 5F1KA 3EX7C 3P0JA 3TIFA 2TS1A 1ZJWA 2XUHA 5HGXA 1E3JA 1OWLA 4KDCA 4YXFA 1KMMA 4GPD1 3CLSC 1XQVA 3D6UA 3GA7A 2HEGA 4GPTA 3DL0A 1AKUA 2DH6A 1CCWA 2DHQA 3ZDRA 5FV7A 5MGNA 3N39C 3AETA 1QHHB 4U8HA 4B6FA 4B74A 5A4FS 1G9SA 1R3UA 3NR2A 4I9UA 4LRUA 1B74A 1CF2O 1TO2E 4ZO7A 1A76A 2C04A 1F0PA 3DKRA 3L05A 1T1IA 1E0DA 1MRZA 2JD0A 1SA0A 5TMPA 3W5BA 5FFFA 1TVKA 3A1NA 3EGOA 3PUIA 4FMDB 3RTCA 4AT1A 4N01A 5DGXA 2A5FA 3G17A 2O2HA 3TECE 4IDEA 4C2BA 5MF6A 1EUCA 5DWQA 3DKIA 2BEKA 1NHGA 9LDBA 1QGZA 5F1PA 2KHZA 3W8RA 4Q3CA 3F71A 3C41J 4YCJA 2D7DA 1CZRA 5LOVA 4HX2A 2IP2A 2DX7A 1TEVA 3IMFA 3M9LA 3VH4A 4D9IA 1U7OA 3ZNOA 2C5BA 4WZBE 4KZPA 4KIGA 3BTVA 1F2UB 4QFCA 3EQZA 4X20B 1IIBA 3IIIA 1L4KA 4C03A 2C95A 2Z9DA 1SC1A 1J06A 1QMPA 4D3DA 3CNEA 3NNDA 1J8VA 3IAS1 4GM1A 3GD5A 2CDRA 3MSCA 2JI7A 1CJTC 3RREA 5BSKA 3RBAA 4ESHA 1Y80A 4KNWA 1N2IA 3JQ9A 4B34A 3HKEA 4GP6A 5DPMA 3VR4A 3U5TA 1E6MA 2XGMA 1DTWA 1R9NA 2XIJA 1ILEA 4G24A 2WNIA 3DDSA 4B9AA 1V6AA 2H2IA 5TQ2A 1VZ3A 2Q1WA 3DA8A 4BP3A 2FZEA 2IYVA 3JVVA 4HX5A 1K7XB 5CYOA 3SX4A 3GA0A 2X0RA 2AE1A 3LGAA 4LRQA 2XB4A 2ONZA 4BIIA 3HDHA 1U0TA 4DR4B 4MKRA 1QIFA 2B1IA 4NCHA 4Z7JA 4RYLA 4OX9B 2EFGA 3JYQA 1DIHA 1DT5A 4BFZA 5B4UA 4ZQCB 2DHEA 4IR7A 1IOWA 5IXSA 4P5PA 1P9OA 1ATIA 1XBTA 3BE5A 1HRKA 3CV3A 4LTNA 4EUNA 2HT1A 2XQIA 4RULA 2G17A 5TPZA 1EE9A 5LYJA 4E21A 1E6EA 3KVOA 3IESA 4MUKA 1JAIA 2HQBA 3LNTA 3ZGVA 2QVZX 2GERA 3B3FA 3M9WA 4FS8A 3IP6A 4MV3A 5K3DA 4K6GA 3U4QB 3QVVA 4PFQA 4EHBA 4PYNA 3S8EA 2ZUFA 3UHAA 4CKEA 2QQEA 3BCSA 3UBTA 2VEOA 1UL1X 2HWUA 2QD5A 3BZBA 4FWIB 3C3PA 1Y3FE 3T4XA 2IU4A 1SOUA 2AI2A 1HFKA 3PB3A 1WD5A 3B38A 3C3XA 4GI3A 2IS1A 1GRCA 3FSRA 2CXPA 2B1JA 3DVLA 3PNLA 2V9PA 5C1PA 3I6QA 2PKQO 4K6CA 2FEAA 2XWJI 3RT9A 3UG6A 4B4DA 5UKDA 3GUCA 3NAQA 5E1MA 2VUSA 1K6XA 3EPPA 3W9YA 3NBMA 4FEYA 4KXVA 1EP9A 3FM9A 2IVFA 3TAXA 2VNKA 4DBLE 1I24A 1TVCA 3HN7A 3CT6A 3HADA 5IPFA 4J3JA 3AEKB 4UZEA 2FSFA 5AKLA 2IYLD 2GFIA 2RB5A 2LXNA 2BFWA 2Q6VA 2PBFA 5SZIA 1ZWKA 3WV5A 4AY3A 2NO1A 4NFLA 4GE0A 4TVBA 1W4RA 1IK4A 3P94A 4EY6A 4NV0A 4ZV4A 3ADCA 3UB3A 3L92A 3LW8A 4I5GA 1QH9A 2OD2A 3KTFA 3CEPB 1JBKA 3SU8A 3G9XA 4U7GA 2NACA 1CNFA 4BNMA 4YACA 1X1QA 1RFLA 5I5GA 3ZU5A 5TGTA 4BFCA 3CW2A 1UC9A 4D4KA 2O5EA 4FZ3A 2GCGA 2PUAA 4YA6A 3ZLUA 3DZDA 4KN9S 2ZB8A 2G04A 1PQYA 1HX7A 3H2IA 4XJVA 1UP4A 4J90A 1NY6A 4RH1A 2GK4A 5TS3A 3FUXA 4JQOA 3UXYA 1ZW6A 7MHTA 1ISHA 2AXQA 2OUIA 3P2IA 3BAZA 2WE7A 5JECA 2WTBA 3LCUA 3VX3A 3KUKA 3OX3A 2PKXA 1U0JA 2QROA 4RPHA 3DB2A 3DDUA 4Z99A 5DX1A 3DO5A 2Q1SA 1JDUA 2EWVA 1PJSA 1RD4A 4D9FA 2FR1A 3OCYA 3E3MA 4NCJA 3RBZA 3SX2A 4CLEA 3RARA 4FDUA 4XCQA 1YGYA 3TDNA 4PZEA 3LP5A 4FMCF 1SVKA 2QRHA 3ZIAA 2VTBA 2PV0A 2JH9A 3FMVA 1S7CA 4LRYA 4PG4A 1JG1A 4PO9A 3LUKA 1ISIA 2P2ZA 3AZOA 3BSYA 4I55A 3KFVA 1JR6A 1FFWA 2A9QA 2AW5A 5E7QA 5CNMA 5TMBA 2UZIR 3M1YA 4GM0A 4G09A 1LX6A 1QK3A 1YK0A 3NHAA 4GBED 2GFQA 4LUCA 5A4MS 1FRFS 2EQ5A 1O77A 3QOFA 3TLEA 2Q3EA 5CFOA 2P67A 1EXNA 2C92A 4QUDA 2ZUTA 4M0MA 3OQVA 1S9DA 4IDPA 4ZZ1A 3SLKA 3UWOA 4BMPB 2CVFA 4DPKA 5JC8A 1Z13A 1EIWA 1J8QA 3LY5A 2NV2B 3D5QA 3GOQA 4MKZA 2QM0A 5EMHA 1AUPA 5ICGA 5EZ5A 3QLVC 4QEKA 1BN7A 5F7ZA 2AKEA 1R00A 3TQOA 3UA4A 1ORIA 2PVCA 4W6QA 3LQRA 1G1MA 3KZMA 3TSZA 4B7CA 3CEMA 1UJCA 3FNGA 5AR1A 5MGBA 3NC0C 4OAPA 4RANA 5FQNA 4YAIA 1E5LA 3C6KA 5M29A 1JYFA 5DT9A 5KJEA 1ONBA 4J2HA 4FLMA 5FOUA 1TLLA 3VGJA 3INGA 3P2JA 5BYJA 4ARVA 1VCIA 1Z2PX 2G72A 1ND5A 4EMBA 4X95A 2PUGA 1QUEA 1P1KA 1NDHA 4NU5A 5JHHB 4R6XA 3HXKA 4J16A 1UK7A 3NHMA 4EUEA 1S2LA 4IXTA 5LBUA 1S96A 4FFOA 3EVFA 5EE5B 2J3MA 4HKTA 3FUVA 2BTEA 1QGED 3D1VA 1NRWA 3DMPA 4FCWA 3WB0A 5CFRA 3A6FA 2ID8A 4MRVA 5AYVA 3TVTA 2APJA 2YJ4A 3EZYA 3L8HA 4V39A 5AI0A 1XTPA 1IMJA 4OMDA 4WZZA 5CYFA 3RVLA 1I0IA 2WJJA 2BJHA 2CJYA 2H65A 3D3NA 4XQEA 5ILOA 3V8NA 3T7IA 5E9QA 3VQTA 5IKMA 3T1VA 3H1GA 2F43B 2PXHA 3COSA 4EY4A 3LUFA 4ZMSA 1XEXA 1FU7A 2R87A 1TZCA 3OPYA 3UJHA 4BC1A 5JYDA 2FZGA 1XWIA 1Z39A 4NS1A 2CGEA 5BT9A 4DMFA 1H6DA 2J3QA 5FLKA 4OHOA 2B61A 3AILA 4P4GA 1GG8A 1WZNA 1P8AA 3GVHA 3UWKA 4OTZA 5CIQA 4BO2A 1NC3A 4ZI7A 5J58A 1GCUA 2ECFA 3FOBA 1WB6A 4K46A 2J41A 1YZVA 4P2GA 4TUYF 4WXYB 1P75A 3VSEA 4JI8B 2IHUA 1JAZA 1JRLA 2AOUB 4WBXC 4X8LA 1RWNA 4OKNA 1O89A 3NTVA 4KQ6A 3TCNA 3ZHCA 2BR5A 4TKZA 1VMKA 3QWFA 5F52A 3RHFA 1G2QA 2JCXA 3OEHD 3URMA 2PTGA 3GAAA 2FA9A 3PUJA 5CURA 2DLDA 3IVXA 1WV0A 4PYQA 1NXOA 3ITNA 4LPSA 3RU2A 2OCXA 1C7QA 1X13A 3WIBA 4QOFA 4OI4A 5FWNA 4DQ0A 3ET4A 1J99A 1MH1A 4I9HA 4KBGA 3CXRA 2LV8A 2PMEA 1KAHA 1AQIA 1CDOA 1LJLA 2DPYA 2F3TA 4EPWA 5A9SA 4QPZA 4DDKA 5DLQC 3VR1A 5A71A 4W4TA 2WJHA 5E6RA 1IQPA 2GAOA 4MPJA 3OZXA 1FU4A 3WRVA 1P3Y1 2WT8A 3LS2A 5EZ6B 3ZQ6A 3H2GA 3RIMA 5KTRA 2ZRCA 1OHHD 4KPYA 3OHMA 1WSDA 2AG1A 2X8WA 2B25A 1ORTA 4CQLB 1WCXA 2P4SA 3ECCA 1A9YA 2BJWA 1OASA 3GLTA 2JFFA 4KI0A 4LZWA 4NPHA 3WISA 1MFZA 4MW7A 4YJ3B 4RZUA 4BMXA 4WIAA 2XUJA 4FNGA 1C8LA 4HAIA 2DETA 3I64A 3RRXA 1DAPA 2Y0EA 1BHO1 3STHA 3EHEA 3Q8KA 3W2EA 4E32A 2J9RA 2XUFA 4L8VA 2B8WA 2ZI5A 5JFTA 2Y0PA 1M6EX 3FOWA 3ANMA 2FZVA 5B1YA 4PEVA 4C7MA 3M3HA 2IS2A 2FOLA 4BQPA 1YIOA 1I13A 2HF2A 3GUHA 5CAEB 1R66A 3KLNA 3OLQA 2ZZKA 3IQZA 1DDGA 3UHPA 1WDTA 4C0HA 3Q98A 1QE3A 3LWZA 1VRCA 5E4YA 4GNRA 4AZ3B 2GS9A 2GN4A 4YYZA 2DRIA 2P9EA 2VQSA 3ESQA 2C03A 2WZQA 3IAXA 4MI3A 4ZOBA 3CISA 4MVXA 1KZ1A 3F6RA 4HYYA 1H2YA 1NNSA 1WBJB 3V8PA 3KSDO 4A5OA 3ZE9A 4CTKA 2QY9A 4F7DA 4OFZA 5B6JA 3QSGA 4GD3Q 3U3RA 1G8HA 2OHIA 3H7AA 1RQXA 3KQYA 2RHOA 1DEXA 5KAPA 5LZ9A 1XOIA 3RVOA 3LKBA 3H2ZA 3HRKA 1SVSA 1LWNA 2CBXA 1JIIA 4FNMA 3QENA 3N2YA 3WTBA 4EJSB 4RQAA 3KSAC 2Q45A 1CY2A 3D8RA 3IUPA 2HZBA 1V35A 4S0XA 1L5OA 2O5RA 2Q5EA 3RK1A 3TRKA 3ZOKA 3ZWMA 4WDRA 4EELA 4UDXX 4ZALA 5TRTA 5K01A 2NG1A 3RAEC 1GPWB 3ANSA 3BFXA 1NMEA 1OB5A 1KEEA 3OZGA 3KZKA 1VJ5A 2PDAA 4IJWA 3K94A 2I2FA 3WNDA 3DGEC 3HU5A 1TJ5A 4GMDA 4M0DA 3WZ2A 3QX3A 4LISA 2ZXEA 1Q1ZA 3IT2A 1S2MA 3V1MA 1DX9A 5H82A 4RLSA 2GM9A 4LWOA 5I9MA 3HTXA 1N6NA 4G0NA 2EU8A 3GFVA 5THXA 2PZ8A 4UNIA 2PRSA 2BFFB 3AFGA 5G1PA 2XQFA 6AT1A 3O4FA 1GPUA 5ITSA 3JQRA 1IHOA 3ZJ4A 1QBKC 1IMOA 4G4SO 3T7EA 2ZYRA 3QRWA 3DAPA 3B82A 1Z83A 1IU9A 1ZMTA 2HN9A 3AP2A 1PL6A 4Q47A 4DZZA 2EZTA 4Z86A 1YS6A 3MOSA 2V3CC 1E9EA 2IYPA 2XCOA 3COYA 5C8DA 1EVYA 3WGIA 1EESA 3K71B 2V6IA 5CIWA 1LK7A 2BHRA 2QSZA 3PD7A 1TGYA 5L51A 3PUZA 4F5WA 5ELMA 3T06B 1ONOA 3PHCA 3PXBA 2DFDA 1AKNA 4LMAA 1QYRA 2OOSA 2I7DA 4I3FA 4MMXB 5F5NA 2HHHB 3ZXSA 2I2XB 3KZOA 3HR8A 4CI9A 4CR6A 3Q5GA 4FFBB 3SKVA 4X1OA 2ZJ5A 4EYOA 3JQAD 1C9JA 3R0VA 1G8YA 1M34E 1VGQA 4TL6A 4PQGA 1Y5IA 4GYJA 2P2DA 5EHQA 2FPPB 5IBQA 4B44A 1SXJC 4V0KA 2CVQA 2RGRA 3DEKA 5KC9A 3NHFA 3RC3A 2WYHA 5BVHB 1RQGA 4LXYA 4QGFA 2JAWA 3FTPA 4MVYA 3UANA 1W25A 4WEOA 1AURA 2LDXA 2RGAA 3F2IA 4HRVA 4PC1A 1EAYA 3NGLA 4YUZA 5CPFA 4PIMA 5E2AA 4ZYXA 5BYKA 3IL2A 1Z5GA 5BMOA 4LXQA 5AJZA 1FMCA 4HFRA 4MQ4A 5ADHA 4IHKA 1SOMA 2AMLA 5IEJA 2FWBA 3ZWAA 5B7QA 3KJEA 2ZBFA 3I2GA 4M54A 4R0MA 5LNK1 2Q8NA 4GYKA 4TL7A 3T9DA 4Y67A 4FTWA 1RXUA 3NIFB 2IHNA 4NBKA 3LC0A 5SZJA 1OBHA 3AKYA 3WNCA 2BAGA 4GOJA 1QZ3A 1Y7TA 1Z45A 3W05A 3F9RA 2J45A 4BLVA 4R1PA 4XIGS 2YWEA 1W2HA 1XZCA 4FFPA 3PNKA 1T8PA 1T35A 4TV8B 4C30A 3RHZA 1D4AA 1ZCBA 2BMVA 1Q91A 3CH6A 3BGDA 3DJFA 4QRIA 4XTCS 4TZ6A 3GRZA 4CUJA 3RC1A 1IPEA 1V48A 5D7BA 4BCDA 1E1LA 3ZD6A 4HRXA 2XI4A 2HK8A 5EP2A 3P20A 5FOSA 3V6MA 4HDCA 2RI1A 1VCMA 1XJCA 1Y3DE 2PSFA 4C9BA 1KY4A 4QOEA 2FR8A 1C3EA 1HE1C 3ND7A 4DR5B 5JTTA 4A16A 1YO6A 1RJ9B 1U2ZA 3IXQA 1DDOA 3W1WA 1X7YB 1Q83A 2RH5A 4S1WA 5DTQA 3NP9A 4NXNB 1A88A 4EFNA 3BRWA 3PNYA 1C4OA 4RHCA 3L1IA 1RR6A 2YW2A 3QWIA 4I50F 1PL8A 1EM8A 5TR9A 4XH9B 4ECEA 1UJ4A 3AGPA 1W8IA 2OT3B 4FI3F 4DV7B 1RZRA 2D5AA 5DTRA 2XUGA 1Q12A 3NBXX 3CRV