3SJAA

Crystal structure of s. cerevisiae get3 in the open state in complex with get1 cytosolic domain
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
350
structure length
338
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
total genus 119
structure length 338
sequence length 350
chains with identical sequence B, E, F, I
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjaA00
2R65A 3MJHA 2BM0A 4MRNA 4ZKEA 4B6EA 4MGZR 1WF3A 1ZU5A 1N6IA 3ND9A 3UIEA 8OHMA 4M21A 3K9GA 3UPUA 4FN5A 1KO1A 1Q3TA 4GMDA 2P3SA 1ZW6A 4Z1MA 1AQYA 1SKYB 5HKKA 4IDPA 3NC0C 2QMUA 3T15A 1HURA 3U3RA 4TYNA 3GEEA 1DAEA 2GF9A 3EAQA 3SC3A 4DZZA 3LX5A 4BLPA 1KZ7B 2FZLA 3W6OA 1L7VC 3QPVA 2DFLA 2XOKD 2ZRAA 3B60A 2JLXA 3ADDA 2O8CA 2CVFA 4KSBA 1XD2A 1S0UA 4US0R 2D2FA 1P60A 1XXHE 1Q57A 1H8ED 2ZS9A 3LBNA 1NVUQ 1OXXK 2FGKA 2QMHA 2HLDD 2OM2A 3VKWA 3EIHA 1YR9A 2PMKA 2CXXA 4N0EA 3TUIC 2IYUA 5H70A 3ETLA 3EXAA 3WNCA 2JJ1D 2VYFA 3VMFA 4AG6A 1G4AE 1MO4A 2C9YA 3KX2A 4LBWA 4OK6A 2ZRJA 1KDOA 4HAZA 4Q1EA 2MSDB 4A15A 4Q9KA 2ODNA 2ERYA 3P4XA 1WE2A 1CTQA 1W36C 2R6FA 2ZYTX 2DWPA 2QAGC 4Q9HA 3QIAA 2B7CA 1E2FA 1KNXA 1QHSA 2ZRFA 2WOOA 3B1WA 1KKLA 2QGZA 4GNKA 1YR8A 1ZUHA 2NO7A 4U00A 3BGWA 5SZJA 3K70D 1Z5ZA 1Q12A 3FTQA 1XXHA 4G1UC 3VKHA 4M1YA 1ZP6A 3U7GA 2ZYVX 1CR2A 4NE2A 1KY2A 2G6BA 1E1RD 1GFIA 3NEJA 3Q9LA 3R7WA 1KIMA 3KUCA 621PA 3U4QB 4B75A 3C5HA 3PCRB 2G0TA 5TV2A 3AEZA 5DLQC 1GKUB 1T6NA 5DSZA 4BFSA 1A2KC 2QRNA 3EZ7A 2W2VA 3NBXX 4WA7A 1KAOA 1MRSA 3I4LA 4ON9A 1NLFA 4C0JA 2ODEA 4CYMA 5JJIA 4F4CA 1UAAA 2V6JA 3IGFA 3W6PA 1Z2AA 1EFTA 2OESA 2HYIC 1VDZA 3SJCA 2YINC 4XVUA 4PXAA 5K8TA 3NHAA 4RD2A 3I73A 4JL8A 5DYGA 4QG7A 4ERNA 4OK5A 3AVXA 4FI3C 3DL0A 2NO1A 2QRZA 4LJYA 1G17A 4A2QA 5JCZA 1NNEA 3K53A 1E0AA 2RGEA 3BORA 1XEXB 5C46F 2GF0A 1HT1E 4XTRA 4KFUA 5D3MB 3HR8A 4PX9A 4X8MA 1VPLA 3W9YA 3PEUA 5EE5B 2XNSA 2O8BA 3LWNA 1B23P 4PC3A 2QN6A 4OL0A 4EPTA 1GAJA 1UBGA 5G3ZA 4DIEA 1E2IA 4HAVA 4MGKR 3EZ6A 4DHEA 5JJLA 5JZVA 3P27A 3EIEA 4EKDA 3LNCA 2H18A 2XJ9A 3SR0A 4WZAE 3R8FA 3IIMA 4TTQA 3MWKA 1QVAA 2XX3A 2GNOA 1XEWY 3HPQA 5F98A 1FTSA 2OBNA 2FH5B 5KSOA 1OXVA 1G8PA 2RGXA 2YVUA 2FOLA 2QM7A 4EPYA 4C9BA 1E0SA 2VH5R 5JSZA 4CEHA 2YC2C 4B3GA 2A7QA 3U3MA 1ZINA 3NIBA 4DVGA 3FMPB 2FFHA 4RFSB 5KU1A 1ESNA 3L0SA 4LI0A 4S2EA 1FTNA 1R8SA 3IBYA 5A4JA 3H84A 1E1RA 3TRFA 3L0OA 3QI2A 4OHXA 3ICEA 3VR3A 1JB1A 2FGJA 1MRNA 2RGDA 1QHHA 3CX6A 4PO9A 4BRUA 1KI3A 3WYGA 3B6EA 5EE3A 1G7TA 2Z83A 4AURA 4EQ6B 2B92A 3RS7A 2K5UA 3CO5A 5JJKA 1UF9A 4KLNA 3A8TA 2F43B 4L16A 3RABA 2EW1A 3X1YA 1OXUA 1P73A 3MSXA 4F93B 1FMLA 3KXLA 4TLDA 4A8JB 4Z1MD 1J90A 4Q4HB 3MLEA 3U7FB 5KDLA 3K0SA 1Z0JA 1NMXA 4IXNA 1FP6A 3DOEA 4OHWA 1G3IA 5HE9A 3PR1A 1OT3A 4BUJA 1P9RA 1R0WA 5FUXA 4GDFA 4HAYA 1XCPA 1YU9A 2QORA 4YONB 4HAXA 1N6KA 1SKYE 3SI7A 4RZXA 4PSAA 1FMJA 5CJPA 2DR3A 1XZQA 4P4SA 1FQJA 3FOZA 3Q85A 2CL0X 1GOTA 1G5PA 2XXAB 1XDBA 1F2TB 4BFWA 1XJ0A 2FN4A 1QF9A 2QE7D 4UXHA 4W5WA 2ZE7A 4TTRA 3T12A 1IXRC 2BHRA 1LV7A 3NKVA 4A6PA 421PA 4LHXA 3A1TA 4BEJA 1RZ3A 4F7WA 3B1ZA 3KL4A 5HPYB 1EWRA 1SHZA 4QRHA 3OIVA 3NBFA 1OV4A 1XTQA 3CZQA 3EZ2A 4N3NA 1S1MA 1G6HA 3WP0A 3W3AA 1V43A 2QAGB 3SZRA 4G5QA 1AQUA 2A9KA 4YMTA 1S8FA 3C16C 3KXIA 1UEIA 4JL6A 1YZQA 4LCBA 4TQAA 3BH6A 4TL9A 1FUKA 2BKEA 2V1UA 1J7KA 2ZI9A 4A2PA 1FP7A 4JLVA 1C4OA 1KI9A 2DY1A 3EASA 4MKGA 2LCFA 2QAJA 3U3JA 1RIFA 3E70C 1MV5A 4PAQA 1G8HA 2V4ZA 1W0JD 1VYUA 1P75A 3OIYA 4FXPA 4JJZA 4NONA 4Q9LA 3CKLA 2O8EB 4NYMQ 521PA 2H1LA 3LVRE 3N2IA 4PAMA 4DBLC 2CJWB 3S1AA 3ZYCA 3V9PA 4JLBA 1QHNA 2ZRHA 3L0PA 1CJMA 2F1JA 2J7PD 4K8OA 5HZHA 5H68A 2REOA 4C0QC 3RWMB 3OHMA 4D4MA 1ZNYA 2W0MA 3GLHE 2ECKA 1II0A 4B2LA 2ZI7A 1Z6YA 2IYZA 5G3YA 1L2TA 1TF5A 3QOFA 3NG1A 2IYVA 4NCKA 1YE8A 1VCOA 3RS5A 2I1VB 4Q7MB 1JI0A 3IO5A 2W83A 5EP3A 1TQDA 3IQXA 1U8AA 4I1OA 1U0HC 1T4GA 2G9NA 3RSLA 1X8JA 1XPRA 1DAIA 4DUGA 4B32A 3AUXA 4DKXA 4ZDWA 2WWHA 4LGMA 2C9CA 1VIAA 3AB3A 3AVQA 4P4TA 3H4MA 1MO6A 2ZJ5A 4AI6A 1CEEA 3IIKA 4JSTA 3ASYA 1OYYA 1SGWA 2JDID 2YOFA 3MD0A 3QG5A 1ONBA 1AGPA 1E32A 2OO7A 2E87A 2Q21A 4IOJA 4LBVA 4JYBA 4TYQA 4ZCIA 2R6CA 1TX4B 5C2JB 2GEDA 3PG5A 3B85A 4KLZA 4HDOB 2D4HA 4GZLA 4F4JA 1E1QA 4EUNA 2AXPA 1GP2A 3GLIB 2N42A 2BMJA 4GRAA 2ASEA 1KI4A 3QF4B 4UKDA 3T06B 1WBDA 3K70B 3AP2A 2DB3A 2LWIA 2XAUA 1SQ5A 4D6PA 1RJ9B 5GVSA 2R6AA 4EPWA 4X8HA 4IFEA 2BJVA 3IHWA 4TLBA 1E0KA 4EJSC 4XJXA 2V1XA 4Q4JA 2DCUA 3OEED 3TKLA 4D4KA 3OAAA 4I99A 2KSQA 4FWTA 1P7CA 1KNQA 2RCNA 2YV5A 1KI7A 2WKPA 3DZDA 3E2IA 5B30A 2QL6A 4NP6A 4O0MA 4IRUB 3D8BA 3WNDA 3F8TA 721PA 4IVRA 3D31A 3VHXA 3AF3A 2ZS7A 4XD7D 4BPBA 3D3QA 1IHUA 1UDXA 3W5IA 4NKRA 2P2LA 4YMUA 1XRJA 1U9IC 4D80A 5L3QB 4PZLA 3F0TA 3F5FA 1R5BA 4DLSA 5C1BA 1W7AA 3EPHA 2BWJA 2KB0A 2OAQ1 3ZLJA 3LVQE 2JATA 1Z8FA 2IHYA 3CF6R 3CR8A 3B5JA 5EQTA 5JECA 5JCPA 2A5GA 4MKFA 3U61B 4TZ6A 1CXZA 4G3XA 4PSKA 2IS1A 5FOTA 1P9WA 5KSPA 1VECA 1UDWA 2MMCA 1M8PA 3R7WB 5AK0A 3B2EA 1R6BX 2ZR9A 4CRWB 1IY1A 3RDPA 1AJEA 1W47A 2CHQA 4UJ5A 1UJ2A 4BQSA 3THYA 2VHTA 3IPYA 1OH7A 2H17A 3SYKA 5JWRA 4ZDKA 2QQ0A 5KOYA 5BYKA 4E07A 2FDCA 1R5NA 2WWGA 3BH0A 4WXPA 4C0BA 3B1VA 1S2MA 3LDAA 4Y0AA 5KPDA 2UKDA 4A0FA 3HU1A 2RGNC 4HLDA 4DLTA 1KK1A 4TSFA 3SYNA 3HR7A 3KJIA 2EQBA 2AD5A 5EXXA 1XTJA 4E09A 5FPTA 2OXRA 3DKPA 4II7A 5AUOB 1P72A 3L8ZA 1L4YA 4HB0A 1T0JB 4FMBB 4KCGA 2BVNA 5L3SB 1TF2A 1D9XA 2B7BA 4RKEA 2CHVA 3FFBA 4ZI2A 2J1LA 4ZCLA 1HY3A 3AVOA 1NF3A 1Q22A 1KSHA 1XJQA 3N2EA 1GG2A 4C0AC 1FFHA 1NN3A 4C7OB 4KI0A 1M2OB 1K6MA 4IHQA 1U94A 4PO8A 2WSSD 1E2DA 5LDDC 4B3CA 4JLMA 1OIWA 4BFTA 1DAHA 1KDRA 3C7KA 4Q02A 3A58B 5EP1A 4K81B 2CNWD 1CIPA 4O2RA 1WRBA 4LYJA 2WIAA 2Z4SA 1HH4A 2RGAA 1OPXA 2GCNA 2SHKA 2IYTA 1BMFA 2QM8A 1F48A 2GK6A 3CW2A 2CNWA 3WRYC 2ZUCA 4EIWA 1RRCA 1JEDA 5KNCA 3BFVA 2IW3A 4DCTA 1CR1A 5KSZA 1OW3B 3AVVA 5FL7D 3EA5A 2P67A 1G16A 3LRPA 4OI1A 3LQQA 2CLCX 1NSFA 4AWXA 5BN5A 2O8CB 2WKRA 3B8HA 4DRZA 4E03A 2GA8A 2YWEA 4OQFA 2IUTA 3RS2A 1UBFA 2IYWA 4LPSA 4CDGA 2XSZD 4BASA 5LB4A 1K8RA 2H92A 4DSNA 4C4PA 1W2HA 4IDHA 4KXFB 3QEJA 4HLUC 1EWQA 1G20E 2VP9A 1TADA 3FE2A 4JKIA 2GZHA 4DUGD 1JR3D 3RAPR 3B78A 1TU4A 4UNSA 1NVVR 3SFZA 4B48A 2IWRA 4KV9A 5EJEA 2JLSA 1ZM3A 5G40A 1QHIA 1P3JA 2BM1A 4U5XA 2XITA 3VU9B 5IDVA 5L3RA 2OCBA 2W0SA 1E0JA 2Q3FA 3SBDA 2A3RA 4Q4HA 3A1VA 2JLRA 1RFLA 2YOGA 4LOAA 5FR1A 1CKEA 3U2QA 3RS0A 4RSGA 3MWJA 5DN6D 4A1FA 2JCSA 3A4NA 1I2DA 3BE4A 2I3BA 5FFMA 4WOPA 2JLZA 2GXSA 2RGCA 1P2VA 4M1MA 4TMVA 4WZBE 2WJJA 4KU4A 2ZYWX 2C9OA 1X86B 3CX7A 3VR4A 3TUJC 2WWXA 1VKJA 2NO9A 1NMZA 1PLKA 4U02A 1NBME 4HLCA 2J87A 2ZU0C 3AVYA 1R4AA 3PUWA 2O0HA 1G291 1YRAA 4KHZA 3GJ5A 1NP6A 4BLQA 4ACBA 1XXHB 1DAMA 3JVUA 2QMOA 4DJTA 1E2QA 3CF2A 1FUUA 4JLPA 4QBFA 4HDQB 5D3QA 4Q7LA 1JALA 3U60B 5JFGA 5HTKA 2V7QA 5DE3A 4WZ6A 4PPQA 3QSYA 4MGIR 3NDPA 4PANA 3HU2A 2CHGA 5BN3A 1E9AA 1TQ6A 1N5LA 1R5OA 2DFTA 4F91B 2O8DB 3QJYA 3EZFA 3DMNA 3R8CA 2HLDA 3I8SA 3KQNA 3AVWA 2WHXA 1OIVA 2O8FB 2ZXUA 2ZAMA 3L0IB 1U98A 4OYHA 5GADl 3H0KA 2GAOA 2B8WA 4P31A 2ZE8A 1F3OA 3N70A 3NBYC 4TN1A 1VCMA 2EFGA 3KB2A 3QVVA 1AKEA 2BMEA 2PZFA 2FJUA 1VHTA 5H8WA 4OBEA 3ND8A 1G8YA 2FZ4A 2DPXA 2WBLC 3SOPA 1YQTA 1XMIA 1LF0A 1N5KA 2GXAA 2X77A 3RHFA 1PVOA 1ZNWA 2V55B 4ARZA 2P5SA 4LJ9A 4X8OA 1N2CE 2HJVA 2XJ4A 5HR5A 1OF1A 4M1OA 2GEVA 4HUQB 1RRGA 4M22A 5JWOA 1KO4A 1PUIA 2QG6A 2NTYC 2AFHE 1CJUC 3WYFA 3QE0A 1Z29A 5TVKA 2WZQA 4MITA 2IUUA 1G6OA 4NCHA 1FX0A 3RS4A 4NZYA 3TK1A 3KKPA 3UMSA 1KY3A 4B43A 1US8A 2FG5A 3FFAA 5CLLA 1G8GA 1XX6A 4DB2A 2J7KA 3FWYA 4EDHA 2QU8A 2FSFA 4CEHB 2AD1A 3NDBB 2ORVA 1YZKA 1OB5A 1HE1C 2J41A 1OFHA 4TQ9A 4LBYA 1XFAA 4M9QA 4EJSB 4FMCF 1DO0A 1YZGA 3I5YA 3ZD6A 3W6NA 3TH5A 4WIAA 4M1KA 4NHOA 1ZNXA 1OXSC 4MYTA 4UNNA 4B6FA 5CB8A 3TW8B 4QFMA 4IVPA 1ZCBA 3GLHA 1OB2A 1OJLA 3BAFA 3X2SA 2A2ZA 5UKDA 4FD2A 1FNMA 1Z2CA 2WVJA 3SU8A 1IN6A 3ONWA 3PENA 3PUVA 3UATA 2CCKA 4Q47A 4PZYA 4Q19A 4XIGS 5TY0A 4MRPA 3AF4A 2YHSA 3KZ1E 4RD1A 3AKEA 5FBVB 1BS1A 3AV0B 1X1SA 5FTMA 5FH9A 3BD9A 4E22A 3B82A 5AJXA 2ZRDA 3LXRA 5P21A 3H2YA 1P2UA 4AYXA 4DDVA 5JEDA 1BMFD 1NY5A 1Q0UA 1MT0A 2VHQA 1DAGA 3NH6A 1K5DA 1X8KA 2ZJYA 4BZXA 2IC5A 4YMWA 4BFZA 4QM6A 5EXTA 1QZXA 2MSEB 2XXAA 1M7GA 4KVGA 1S3SA 1F2TA 2BMDA 2IEZA 3ADCA 3THWA 3K0AB 4QC2A 1G3RA 4HZIA 5JBQA 3CRW1 3BB4A 4DDUA 2OXCA 2CCJA 1IAQA 1KI1A 4LPKA 1EFHA 1NKSA 2G77B 2ZYUX 2AN9A 2JLUA 1N5JA 5J40A 1LNZA 2OBLA 2ZPTX 1E9FA 2VLIA 4ZDIA 5EE1A 4A82A 5HKKD 1XBTA 2IUSA 2PBRA 4FCTA 2D62A 1EFRA 1Q44A 1NBMD 3QKTA 1OXTA 4A6XA 2ZJZA 1WA5A 4TMXA 2ZE6A 1E4YA 2J5XA 2VTKA 2ZRGA 1G18A 3AKYA 4FINA 4NYJQ 2R44A 3MRSA 3K0CA 3VAAA 2CCGA 3FHTA 1D6JA 2ZSAA 4IOMA 4PC7A 4QBIA 1W0KD 5FPHA 2CK3D 3OEHA 5KNDA 4B2IA 3MG9A 1SVWA 3UXMA 3B9PA 3QEOA 2WKQA 5L3SA 1G7RA 3VHLB 5J47A 1Q1EA 3HJNA 3WMGA 2A5YB 2IXFA 5GVRA 2Q6TA 5EUMA 5K8LA 3FPAA 2FEOA 2VPPA 2JJ2D 3KUDA 4OHYA 3ZD7A 2GJ9A 4TZ0A 4TQUS 1ZM9A 3W5JA 2VEDA 4BZQA 2NIPA 5E7IA 2A30A 5FTNA 3ADBA 2O52A 4ZKDA 1AK2A 3RRZA 4MGYR 5J4YA 4PHFA 1G19A 4O2LA 1Q1ZA 1Y63A 2BKUA 1E2MA 4QGGA 3RWOA 3LAWA 2VBCA 2J3EA 3PITA 2OCPA 2OLJA 2V6IA 1KMHA 5EE0A 1XTSA 1X6VA 2YC4C 1EFUA 5SZIA 1E96A 1R10A 2QA5A 3PVSA 2OLKA 1W4CA 3FKSA 1X1RA 1COWD 2W6JA 2C78A 2WTUA 3THXB 1AA9A 3CONA 4LJ6A 4P0TA 3Q7PA 2PT5A 2E9SA 3C5CA 2ATXA 1I4TD 4Q9IA 3TAHA 3VNVA 1DADA 2F1RA 4Y0VA 1OFIA 2ZM5A 1X3SA 2ZJOA 2BBWA 4BLTA 2JDIA 1SULA 1MH1A 1PJRA 3LBHA 1HUQA 5FI0B 1LTQA 1NBMA 2D74A 3GLIA 4QBGB 1A82A 4DWJA 3CWQA 4TYYA 2OZEA 1IN8A 2GHIA 1OKKA 3K9LA 5JEEA 2PEYA 2CLDX 2LKDA 2RGNA 4Q4JB 4RCZA 3DO6A 2QENA 1TNDA 4M0LA 4A0RA 3PEWA 3L8YA 1E9CA 4TTPA 2Q9CA 4F38A 1UFQA 1KK2A 1R0XA 1T3SA 4HB4A 121PA 2G88A 2GXUA 3QXJA 4TL6A 3O8RA 1IQPA 3AGPA 4HZUA 1XMJA 2ZSEA 1NG1A 2XB4A 2OG2A 1U90A 3LD9A 3CNOA 4B47A 3LW7A 3HPRA 5C4GB 5JHHB 3I61A 1CR0A 2EYQA 3BFKA 4XOIA 4GOKA 4FMDB 4BECA 1ODFA 2ZI6A 1GNPA 5CYOA 3JZAA 1CLUA 2VSXA 5JLJA 1WDTA 3DM5A 1JJVA 3T5DA 2ZJ8A 3THYB 3AKDA 1N6RA 3TR5A 2UZ3A 3F3YA 3HWSA 1Q20A 3U44B 1ZJ6A 4DLZA 3ZVRA 3CRRA 1LFDB 1KMQA 3JZMA 1EK0A 4TYWA 2HF9A 2PCLA 4AD8A 1E2NA 5B58C 3FDIA 3DZ8A 3IO3A 1XP8A 2QP3A 5JS7A 4BLOA 3ZZTA 3AH8A 5L8VA 2N46A 5J5CA 1F6BA 5BYJA 3V4RA 2F9MA 1P62B 1TEXA 1OIXA 2X19A 3K0CC 5AJYA 4B33A 1CP2A 1II8A 1D5CA 1GIAA 4UNQA 3WNBA 5KUTA 2O8DA 1DARA 4URWR 4F92B 1IXSB 3IILA 1XTKA 4KITB 4Q21A 4C0SA 1H8HD 1N0WA 1KYIA 2CL6X 4OI4A 4W5HA 3C4JA 1XD8A 2QEQA 3ZJYA 3J81k 2PZEA 1TTTA 2GKSA 3MCAA 5KO2A 2EFDB 1D8TA 1NI3A 5M04A 1VCIA 1KK3A 1S4QA 1SVOA 4FW9A 3BS4A 3GJ3A 2FPMA 3KFVA 4RFVA 4TMKA 4L8GA 3SQWA 3PJRA 1ETUA 4DEYA 4IDOA 4URUR 1J99A 1EG7A 3BC1A 1KSGA 2D7DA 1LS1A 1N6OA 4ITRC 2MMGA 3GEHA 1S9HA 5LBIA 1FNNA 1FZQA 2WMNB 2IS6A 3I92A 4KYUA 1OH5A 2FF7A 1GKYA 5K8UA 1A5TA 4HUQA 3QKSB 1N0VC 2VP0A 2KBEA 4AYTA 2ATVA 2AX4A 1II9A 5AJWA 2O8BB 4JLOA 1M74A 1NIPA 4KSCA 3RLFA 1ZD9A 2EYUA 4IVQA 5FOWA 2G1JA 2HDNB 4B2PA 1FQKA 3IIJA 1X8LA 2PLRA 4NMMA 2PJRA 4PSVA 1ZRHA 3GPLA 1KJYA 2ZRIA 1AM4D 1HE8B 1BH2A 2JEOA 4DXAA 3CM0A 4HATA 4YMVA 3QQ5A 3BB3A 3HU3A 4RD3A 3BXZA 3P32A 4IOKA 3K09C 1BIFA 2FPKA 3NHBA 3ZGXA 2PCJA 4JBXA 2B6HA 3R20A 3GFPA 4LSGA 1F5NA 1P2SA 1QBKC 2ANBA 2YYZA 3DVLA 4ZPXA 3ZS8A 4XH9B 3M6AA 3IDQA 4EJSA 3QY0A 3G5UA 4A92A 2V7QD 1UBEA 4RFSA 2FV8A 4QGFA 4IEIA 4Q4LA 3KXKA 2AWNA 5H1YA 3UWKA 3PFIA 1T8TA 5KHOC 3B7GA 1U81A 1UM8A 3CLVA 2WWIA 2W6IA 2GZAA 1E2GA 2KE5A 2RHDA 4ZV4A 4AKGA 3PV0A 1W1WA 2KWIA 3ZZUA 2GCPA 1Z47A 4NCNA 3O47A 1CBUA 4JVLA 2OCYC 2F43A 4MDFA 1N6LA 1SXJD 4R7ZA 4R71A 2H57A 3ICQB 3FKSD 3PUXA 3MAAC 2G1KA 5CK4A 1H8HA 4Q1AA 1OH6A 1NLZA 4ZIRB 1SXJB 3WP1B 4NYJR 2XEXA 1JQLB 2CDNA 3REFA 5DIFA 2GBLC 4LJ4A 1Z28A 5DN6A 2FSHA 1IBRA 2P5TB 4PPGA 2GJAA 1XZPA 1COWA 3A1WA 2JASA 4B35A 2YKGA 3GJ0A 4HDCA 4M1WA 1F60A 3FMIA 4HUTA 1FOEB 4MYCA 1GTVA 1Z3IX 1GRRA 4GSYA 3CX8A 4DCUA 4RD6A 4URYR 2ZR0A 2DWQA 4CT5A 2F7SA 1DG3A 2VP5A 2HV8A 4DEXA 4XVQA 5CM8B 2WJYA 4OHZA 1RE0A 1XPOA 4TMTA 1LY1A 2QTVB 4L4UA 4V0LA 1DBSA 2ZJ2A 1GILA 1Z0AA 1BKDR 1C9KA 2C8VA 2WWFA 4LUCA 5CM9C 5B57C 5CB6A 3I32A 4PR0A 4LHWA 2V8OA 4BFYA 4C0KA 3CIOA 3DKVA 1ZNZA 2KI5A 2FFAA 3SHFA 5DO9A 5GJCA 3TLXA 2BIFA 3G82C 2CMKA 5F9FA 3P4YA 4B3XA 1XCGB 1E3MA 3TSWA 1G4UR 2FA9A 4GT1A 1GL6A 3U5ZB 3U3KA 5FBWB 1E1QD 1N0UA 1Z08A 2EFHB 3PEYA 3OAAD 1XTIA 3UANA 3UMFA 5SZKB 1L8QA 2ZITA 3AVPA 1P5ZB 4GOXA 3K0EA 1SVMA 4ARZB 2EFEB 1E98A 4Q01A 2WAXA 1D2NA 2FFBA 4PZZA 3EWSA 1XU4A 5GJWC 2JJ1A 4UQOA 4RKFA 2WSSA 1CJTC 4XD7A 1XTRA 4B34A 1K5GA 3LW8A 1KI8A 2ZANA 1NSTA 1YRBA 2AWOA 5G41A 5FL3A 1VTKA 2ONJA 1FX0B 4TWZA 1UKVY 1R2QA 2ZRPA 4OI2A 1US8B 2FNAA 1G8FA 2X2FA 4KYIB 4IW3B 1Z83A 2GJSA 2ZJAA 4LY6A 2IBMA 4JKYA 4JVNA 2RAPA 2HCJB 3BWDD 2QTHA 1GM5A 3R9XA 2PZGA 2H16A 4MQBA 4QHTA 4QJ3A 4OQXA 4FMCB 1XNJA 1UKYA 3LLUA 3QVUA 2OCAA 2ZJBA 3LXXA 3B1XA 4DCVA 4FMDF 3LLMA 5IF9A 3GLIE 2J7PA 4W7SA 2XGJA 4Q1CA 5AUPB 2XZOA 3ZVNA 4JL5A 2ZRMA 3U6BA 1Z0IA 4DLWA 2H5EA 4DDTA 3TGPA 3BK7A 2V3CC 1W0JA 3GLHB 4PQRA 4TL8A 2R8RA 3BIFA 5FTJA 4QXAA 4TLAA 2KJQA 2WPDA 4DLVA 3PUYA 4B74A 2FSGA 4ESVA 1NVWQ 1QRAA 1T5IA 1KOFA 1EX7A 2QY9A 1G3MA 4MKIA 2ODBA 1KI6B 2IXEA 1XMSA 1KO5A 2IXGA 4M2LA 3ECCA 4DT1A 1DO2A 1EX6A 1OHHA 3PEVA 2YNMA 2OILA 3SYLA 2XTNA 5JHGB 2ZRLA 1Q1QA 4PPNA 5KDDA 5LB2A 2Q3MA 4CF7A 2VSFA 1ZC4A 4OQLA 1NN5A 3QNUA 4QNRA 3RSOA 1U9IA 2C2HA 3I72A 3BB1A 4D0LB 1UKEA 3THWB 4HYYA 3K0AA 1M1YE 4AKEA 3SHWA 2XB2A 1DS6A 3NBZC 3LX8A 4GP6A 4BFVA 1ZM7A 3N5CA 1W4BA 3IHLA 2PX3A 2WJIA 4Q7JB 3PQCA 5KPJA 4DB4A 1JPJA 1EESA 3KKMA 4CEIB 1HQCA 2FPLA 1SZPA 2G83A 3TE6A 1XPUA 2OV2A 3U3OA 5IRCD 4JLJA 1WCV1 2RGGA 2ZAOA 4HLUA 3A6PC 5FBRB 2VHJA 1AGRA 2GCOA 5L3QA 3K70C 2WICA 1TMKA 3EW9A 3HYRA 4V0ME 1RW4A 1ZBDA 2HT1A 4NYMR 3LBIA 5JRJA 3RRYA 1CS4C 1QHYA 2IX3A 1W5TA 4U7DA 1UBCA 3X1WA 2PJZA 4K46A 1NJFA 1NN0A 2HT6A 1ZD1A 1GL9B 5IK2D 1M34E 3HYTA 2B8TA 2D7CA 1SVSA 5CDFA 3TR0A 2G3YA 4M1SA 4MRRA 4NPHA 5DHAA 3VX3A 3GMTA 4V02A 2FE4A 4I1VA 1ZAKA 1JNYA 2AKAB 4UJ3A 1R8QA 2WPDD 1ESMA 3AP3A 1S9DA 2OAP1 5BXQC 4OQMA 3WRXC 3L43A 4L9WA 2NO6A 3EA0A 1T91A 1QVRA 1A2BA 5JI2E 2BBTA 2QNRA 3K0FA 4AKIA 1KGDA 1JPNA 2WIBA 2VHCA 1T3LA 1LW7A 1J70A 2BEKA 3D6TB 5TXGA 3UK6A 2GJ8A 4GPTA 1GITA 6Q21A 3H1TA 2GK7A 4NL4H 1GVNB 4DIDA 3GLFE 1IONA 1HT2E 2ZI4A 5GJVC 3TQFA 5KDOA 2ZRBA 3EPKA 1GRQA 5EXSA 5AUNB 4D25A 3G0HA 1CF4A 1RVDA 3D7MA 5IHPA 2WMOB 1E69A 1P6XA 2J59A 1XEFA 3MWLA 3VR1A 2WWYA 2AR7A 3H86A 3E1SA 4GZMA 4WBSA 1KI2A 1N5IA 5CDFE 2F55A 3C14C 4B3DA 2IYQA 3Q5DA 2ZSFA 2F9LA 2GJKA 4HAWA 4D0GA 4LHZA 2NZ8A 2PT7A 4H9GA 1GSIA 1W0KA 1GKIA 3GFTA 2BDTA 3KKOA 1GWNA 1IN5A 1J2JA 1WMSA 3KJGA 4KBGA 4FIDA 4PQFA 4Q7KA 3X1ZA 3THXA 3RRNA 4B3FX 1ZU4A 1JXOA 1CRPA 4AYWA 3CH5A 1CU1A 2ORWA 2FMXA 3E5HA 4UNPA 1ZUNB 4DDWA 2PX0A 1IN4A 1NVVQ 3CRMA 2ZIAA 5IK2A 3MGCA 1D2MA 4E5UA 2J0QA 1JECA 3KQKA 3RANA 3UMRA 3TJZA 4JT2A 3BH7A 3CPHA 2DFNA 2IA5A 4EPVA 2VQSA 4UNRA 3KQHA 3ZQJA 1Z22A 4D4JA 3EWAA 2GVZC 2GRJA 4AIIA 2IYSA 1E6CA 3QBVA 2PH1A 1ZVQA 4V03A 3IEUA 1RPZA 3EPLA 4KJZA 1ELOA 1GRNA 2IS4A 4O25A 1G21E 2IWHA 3AUYA 4GI7A 4PTLA 3CUEF 2PEZA 4A0HA 4ASUD 3NWJA 1AKYA 1G9XA 1VG9B 3C8UA 5AWFC 1Q3HA 3U44A 2H7VA 2OUKA 3VTKA 5DNYB 2F3RA 2AL7A 1Z63A 2JLWA 2ANCA 2R2AA 3CZPA 3SDZA 5A5GA 2NZJA 4W9MC 4LJAA 2Q3HA 1N25A 2F6RA 1FPMA 1VG1A 1NIJA 1ANKA 4DLXA 4MYUA 4M53A 3ZS9A 3TBKA 2VP4A 1E2HA 3ADKA 1IJFA 3B9QA 3Q3JB 1YR6A 4QNMA 5AJZA 4DSOA 1LS6A 2FEMA 3TVTA 2RKOA 3GJXC 4IOLA 2FFQA 1O3YA 4HSEA 2CEAA 5IT5A 4JMPA 4GL2A 4RZ3A 1G5TA 2GTPA 1EFRD 2H8KA 3C15C 4LBZA 3BERA 4Q1BA 4RZ2A 3SS8A 1VYVA 3IBGA 1KZGB 4LWZA 2JIZD 3I62A 4H1UA 4GP7A 2ORIA 3UG7A 3OESA 3A1UA 1IXZA 2IYRA 3O8BA 3GJ6A 3CNNA 2ZVQX 2QBYA 4LDJA 3QG1A 1WXQA 2A5DA 3KFXA 4P4UA 1SVIA 4HAUA 4JBWA 2C5LA 1P9NA 1XEXA 2IK8A 3AVTA 4RD4A 4MRSA 4OK3A 2F3TA 3AF0A 5E95A 3LH5A 1IJEA 2VP2A 4V0KA 4XVRA 4YLGA 3FVQA 1S1CA 4M9ZA 1DG1G 2IS2A 1OFTA 1AS2A 2R6GA 3VQTA 1IOZA 3TQCA 1E9DA 2NMVA 1N6PA 4PHGA 4QHYA 2W2TA 4TT3A 1HQYE 3R9WA 2FU5C 2QPOA 4FCVA 1U8YA 2N1BA 3MWYW 4O3MA 3T1VA 1Q1BA 4M9SA 1ZYUA 2O0KA 4L5BA 1PZNA 1TUIA 3Q72A 1GZSA 3MMPA 1Z6GA 2WV9A 4BRWA 1JXMA 2WWWA 4HI0E 1OLOA 4JVMA 4DLUA 1I2MA 3QKSA 3ZVMA 1WBBA 5BW8A 2WJGA 1ZCAA 2ZUBA 2OFXA 3A1SA 2DYKA 5DH9A 3DPUA 4PC2A 4TL7A 4PHTA 3DMDA 3WHLA 3WHKA 3GLGA 3IEVA 1R0YA 1D2EA 5CJ2A 2WAYA 1UADA 4OI0A 2QSYA 3MUFA 2QP4A 3CNLA 3FGNA 3BRWD 3TAUA 3KQLA 3ZQ6A 4US2R 1NVXQ 1JEEA 4A9AA 1P2TA 1DE0A 1ZD8A 1MKYA 4XTCS 3EIQA 1E2LA 1W5SA 1L4UA 2ZU6A 1OSNA 1SKQA 1IY0A 4LK2A 2NGRA 1MR3F 4W5JA 1MABA 1W49A 5B64A 2L0XA 2YWGA 2ZI5A 5J4KA 4R98A 4JS0A 4IJMA 2VSOA 4PC6A 5CIQA 4DCNA 4BFUA 3KTAB 4RD0A 4G5OA 5TARA 4P33A 3W8RA 2NOAA 2IYLD 1JAIA 1E9EA 2C77A 4OHVA 2WJVA 2W6ID 2OHFA 2ZROA 4C0LA 3OZXA 1VIYA 5BN4A 3M4YA 4CVNA 3R9IA 1I4DD 1KHTA 2NG1A 2F1HA 1TEVA 3WBJA 2EWWA 4NH0A 3FKQA 4DLRA 1CJKC 1H8EA 1KJZA 1HEIA 1YHNA 1DTSA 1HTWA 2UVQA 4XSHA 1SXJA 4C30A 4ZIRA 5C4MA 4Q1DA 1AS0A 4LYAA 2J0SA 3ZIAA 1JBKA 1R0ZA 5DI3B 1Z6XA 2BJWA 3CF0A 1YJ5A 3AGQA 4C3ZA 1Z0KA 4D82A 4DSTA 4NU0A 4Q4AB 4Z51A 2C98A 4G5SA 1N6NA 2GCOB 2QAGA 4L15A 1AIPA 1E4VA 3U7EB 1OH8A 4R2HA 2WOJA 4LV8B 3X1DA 1GDDA 3A36A 1OYWA 1W4AA 4Z8YA 4D81A 1XWIA 4M8NE 4S35A 4M4SA 5EE9A 1S3GA 2RB4A 3GJ4A 4B44A 4JLAA 1RRFA 4PHHA 2W6JD 2R9VA 3DOFA 1D9ZA 2GBLA 3RRMA 4KVAA 4D26A 2I4IA 1SVKA 2IF0A 4YMSA 3LY5A 3QENA 3ZH9B 3CBQA 2DWOA 5DGXA 4URXR 4I1SA 4PC1A 2GXQA 3SFVA 3PXGA 3GLFA 1F2UB 1G3UA 1TQ2A 3CRQA 4IDQA 4I1UA 3T1OA 5HZKA 2ERXA 2CJWA 2ZR7A 2QROA 5TDHA 4A0GA 5FR2A 4I81A 1T3HA 2QPTA 2D2EA 3FHCB 5BQ5A 5F9HA 2NQ2C 2P0EA 5AJVB 3UWOA 3DM9B 5ELXA 2WM9B 2BOVA 4M1TA 4B3BA 3K0FB 2ZEJA 3KQUA 4DCSA 1DVRA 1NG9A 3VKGA 3CR7A 2W00A 1TAGA 4GMXA 2Q9AA 3TUZC 1IY2A 1DAFA 1RKBA 4ILEA 4LV5B 1ZM4A 5J4VA 4GBMA 2J45A 2Q9BA 3EC1A 1VG8A 5DISB 5HE8A 2DBYA 4MRVA 2Y8EA 2WJHA 4RCYA 2C04A 3OFND 2IHBA 1RYHA 5FOUA 2YWFA 2EWVA 2KBFA 2VL7A 1ZIPA 2CE2X 3WXMA 4TYPA 4MDEA 2JIZA 4XWAA 3CB4A 4D4LA 2NPIA 4US1R 1E94E 4LHYA 5TMPA 3UKDA 1PLLA 4JYCA 1E9RA 4ZI3A 4YDHB 4Q5IA 4Z54A 4URVR 1LVGA 2RHMA 2JJ2A 4ASUA 2MSCB 2YJTD 4FWIB 1OKKD 1TPZA 2OBMA 1T0HB 2ZI3A 1OHHD 4F4IA 3O8DA 4PO1A 2W2XA 2VRWA 4JVSB 1PUJA 4AY2A 1KMHB 3GCGA 3A4MA 1OE0A 4DT1B 2IYYA 3GD7A 1NMYA 4C0HA 4Q18A 5FL7A 1EXMA 2G0NA 2C03A 2ONKA 3M1IA 1QG4A 4CEJA 1I4LD 4CT4B 4A36A 2QTFA 3QXHA 5LD2C 3LQRA 3RYTC 2HXYA 4ZDJA 1KI6A 3EC2A 3BBPA 3W8NA 2QPAA 5JI3E 1E2KA 5LPNA 4LRWA 4R9UC 2REBA 4QM7A 3MJRA 2X8AA 4EFMA 4JBYA 3AF1A 5J4LA 1AZSC 2RH5A 2NO0A 4J0QA 3VR5A 2AFIE 4CIDA 4WVFA 3JVVA 5LD2B 4JLNA 4IEEA 1XD2B 1M7BA 1CJVC 4MH0R 4Q9JA 3BFXA 1SXJC 2ODWA 3KKQA 2OFOA 1OFUX 2FSIA 4MUBA 3P1JA 4A8JC 3A4LA 4CEIA 3Q8XB 2PLFA 4HZUB 2P6RA 5CLQA 1XF9A 5FUYA 3SNHA 3AQ4A 3QKUA 2IT1A 3T61A 4NBSA 5TB5A 1E79A 3SEAA 3DEFA 3U4QA 3KDSE 4LX0A 5ANRB 4IFBA 2PL3A 2RMKA 1QHXA 2ZQ5A 3QKRA 1KJWA 4QJ4A 1WB9A 2DFKB 3K9HA 3LFUA 1ZIOA 3CH4B 2P6UA 2QI9C 2VA8A 2D06A 2QE7A 3K09A 2ZS8A 2J0UB 5G53C 4KFTA 5FOVA 1G1MA 4KO8A 3U6KA 5BWMA 1XEWX 2HJGA 3NH9A 4BWYA 5JS8A 4BLRA 3EG5A 3I3SR 3EZ9A 4RY2A 2BMFA 1KAGA 2CBZA 4C7OA 5FBLB 3FMOB 3NTUA 4B73A 1II8B 4KAXA 4MA4A 2HCBA 5DYIA 1W36B 1NN1A 1DEKA 2AXNA 4IDNA 2IF2A 3ZIAD 1TU3A 5FPYA 1SVLA 5EZ6B 5JWHA 4YXWA 4MUAA 1NY6A 2ZETA 4DSUA 2XSZA 1ZUIA 5AUQA 1W46A 1MO3A 2O0JA 1VCNA 3PIRA 3TNFA 3K1JA 5J4HA 5B2ZA 2J0VA 1U99A 1IM2A 2JLVA 3DHWC 4TT3D 1VYTA 4YQFA 2DHRA 3VR6A 3VNUA 1KKMA 3X1XA 4MKHA 3QXCA 4ZO4A 1TF7A 4Z8XA 4JJKA 2Q0HA 3B13B 3QF7A 4D2IA 4HLQB 1YZUA 1Z0FA 1P4SA 2B21A 4JT4A 3TSOA 1Z0DA 3CWZA 2NPFA 3V00A 3W3ZB 4EFNA 4WXRA 3OF5A 2D3WA 2QGNA 2E1RA 1DOAA 2V54A 4BE7B 2OSBA 1NL3A 1J8YF 1KK0A 1NKTA 2XTZA 2Z4RA 4LC0A 4XWOA 1JR3E 4R2IA 3OFNA 2ZE5A 3QXXA 4BLSA 4JZKA 1LF5A 5AR1A 3EPJA 3CRVA 3NEYA 2W58A 3U7HB 3GJ8A 3MFYA 4HB2A 3OE7D 1UEJA 5CITA 1EGAA 821PA 3RC8A 1UPTA 1GNRA 2LKCA 1AS3A 3WBKA 3OIUA 4UXIA 1YKSA 2JAQA 3VU9A 2ZSDA 3A37A 3SQXA 1FW6A 2CK3A 3OEHD 1XCMA 2QP9X 1M7HA 1KTVA 5F2EA 5C18A 3FB4A 5KNBA 3WMEA 1C1YA 1U0JA 1HYQA 4Q66C 3QPUA 1T8UA 2VIIA 5FUWA 4IXMA 2ZRKA 2GDJA 3EARA 1SXJE 1FL9A 3HDTA 4ABYA 2V9PA 4QBHA 5E7JA 5FTLA 4NCIA 1Z06A 3T5GA 4NDZA 4OKSA 1N3BA 4N0DA 1DAKA 3IUYA 2EFCB 2QT0A 3K9NA 1A4RA 2AHOA 4YXWD 4M9XA 3ZVLA 4JLDA 1HA3A 2QMEA 3DDCA 4P4SB 4A8JA 1A7JA 1E9SA 4LC1A 1E99A 1XD9A 4C2TA 5KSYA 4PAOA 1A1VA 4EPRA 5DI3A 3IKJA 2OEPA 4JLKA 3NVAA 1ZMXA 2CL7X 5FUVA 2HYDA 5FPKA 1BOFA 1QG2A 2XTMA 2RGBA 4XWKA 3FYHA 2FX3A 1MOZA 2WSMA 1YZTA 3TMKA 4CW7A 2IEYA 5FTKA 5GJBA 4GFDA 2QSZA 4URZR 3AP1A 2F1IA 1JQJC 2VF8A 2GWHA 3QPWA 2ZRNA 3SN6A 4CGZA 5A0FA 1Z6TA 4HEJA 1JR6A 1UKZA 2O8FA 3AF2A 4QGHA 4LYHA 4AK9A 1U0LA 4ACAA 2VF7A 1HV8A 1T9HA 5K8IA 1R7RA 2GZDA 1QHGA 3Q5EA 1TL7C 2QBYB 3OE7A 2ZTSA 3OIWA 4JIMA 4HB3A 1GUAA 3W34A 1Z6AA 4AC9A 4EPXA 4L9SA 4LJ5A 2R62A 4D0NA 3L2OB 2ZRCA 2HUPA 4G01B 5KTYA 3EX7C 1EFCA 2BC9A 4GOJA 1G64A 2A5JA 4DLYA 3T1TA 1Q21A 2OE2A 1BYUA 2BCGY 3PUZA 2CE7A 1T5LA 1Y3AA 1AN0A 1KSFX 5EZ5A 2HF8A 3L82B 4Q00A 3C41J 2REXB 4V0OA 4OQNA 1G3QA 4P32A 4Q48A 2X2EA 3RVBA 3P20A 5D3MA 1CULC 4TSFD 4LJ8A 5DI9A 5SZHB 1YVDA 2ZVPX 1E2JA 4LZZA 2QQEA 3GLGB 1PLJA 4B71A 4QJ5A 1W2GA 1XMVA 3GEIA 1RRPA 4PQYA 2XNDD 3SJAA 2UZIR 4G5GA 3RNLA 3WMFA 3I5XA 2YWHA 4PFSA 1VG0B 4BZPA 3UG6A 2XNDA 2OFWA 4LYFA 4P3YA 3SJBA 4NCJA 2XZLA 2P6NA 1XB2A 2HEIA 1M6NA 2J46A 4NYIR 5FOSA 3VFDA 2C99A 5E4FA 1NJGA 4ESHA 1G41A 1W44A 2ZREA 1Z07A 3LO5A 2TMKA 5JSZB 3BOSA 3I1FA 3KKNA 4FCWA 4ZCMA 4LJ7A 3KJEA 1MABB 2IL1A 4QOSA 5CK5A 4QL3A 3GQBA 4B76A 1PV4A 1LB1B 1WQ1R 1TUEA 2P65A 4OJKA 1P61B 4H1VA 1NRJB 1SHKA 5EUQB 4WAUA 4KFRA 4CEJB 2EU8A 2GAAA 1QHHB 2QZ4A 2VO1A 3QF4A 1QDEA 2Z6VA 4EQ6A 2JLYA 3B1YA 2ZSBA 3KJHA 1O87A 5FI1B 1NLYA 1E2PA 5KYKA 5EP2A 2AKYA 3GLGE 5JRZA 2YOHA 3TW4A 4NYIQ 3WYAA 4MYHA 5FBQB 3LV8A 1DELA 1S96A 1E79D 3CPEA 1G7SA 1XJCA 1DPFA 1ZC3A 3WY9A 4V0MA 3HP1A 2XZPA 1MO5A 2C96A 4G5RA 1W48A 3VX4A 2R6DA 3KTAA 1IN7A 4RJLA 1G7CA 1E9BA 1JJ7A 2JA1A 3GP8A 4X8LA 3KB1A 3FHOA 1RJ9A 1YZNA 3TSZA 5CIWA 5L3VA 4QHSA 2A5FA 4Q4AA 2I1QA 4AG5A 5E7MA 3P26A 2A78A 5HCNA 4OJQA 1E2EA 3FMFA 2IYXA 1KDTA 3W90A 3ZDQA 1AZTA 1G5RA 1BYIA 2QT1A 3M0EA 4RVCA 1J8MF 1W36D 2HXSA 4RZUA 3AM1A 3IQWA 3T34A 4BFXA 3QUSA 1BO6A 5E3HA 2VHUA 5CYPA 4YC7A 4QKQA 4QGAA 4KFSA 3BJIC 4Q1FA 2JGNA 3ZZ0A 2GETA 4TLEA 1YZLA 1F2UA 3QKRB 4BEBA 3RC3A 1WP9A 3RS3A 3T35A 3OEEA 1B0UA 4TMWA 4UXJA 3SJZA 1KO7A 2O5VA 2ZUDA 1KDPA 1U8ZA 2XOKA 4LV6A 4IKEA 4CZ2A 4AKHA 2BBOA 5DHFA 1YR7A 2PMDA 1RYFA 2AK3A 3REGA 3THOA 2J9RA 2J0UA 2GEUA 2BCJQ 4I4LA 2AK2A 2YZ2A 4Q03A 5FOXA 3TIFA 2BV3A 1CR4A 1VMAA 3QXSA 221PA 2GILA 4KODA 2VP6A 1CRQA 3V4FA 2JLQA 4XSGA 2QUZA 5FPSA 2BEJA 3GLFB 2JJ8A 1W4RA 1V5WA 2C95A 3AKCA 2FWRA 3NXSA 1KSJA 2Z0MA 2O8EA 2X1VA 4N1AA 1GL7A 4PPFA 2Z43A 4EAQA 5JMTA 3LA6A 2BBSA 3S1AB 5HCIA 2CLSA 1N6HA 4WW0A 3T1QA 3VR2A 1H65A 4TLCA 3IPXA 3QBTA 3SE0A 2Z5FA 3CPJB 3Q7QA 1KO8A 3K8YA 5EP4A 1JR3A 1VHLA 4A4DA 1RC8A 3NC1C 1ZM2A 2EVWX 3I8XA 2CVHA 1U2RA 1TQ4A 3GJ7A 4YDSA 4A2WA 4BGDA 4LHVA 5F3WB 4TMZA 4C2UA 4V0NA 2GESA 4G0NA 5EXPA 1GNQA 4JSYA 4POAA 3SBEA 3O8CA 3GFOA 4DC9A 1JAHA 3TVDA 3ASZA 4EFLA 3AVUA 2OT3B 4NTZA 4KBFA 2GVDC
chains in the Genus database with same CATH superfamily
3MJHA 2IZOA 2V5UA 5DBOA 4EHNA 2VYVA 1J2RA 4MRNA 4ZICA 3BEDA 1OI3A 5HG0A 5JARA 1KL7A 3CVJA 3UVEA 3I6BA 3ILHA 3UC5A 4DA7A 5KINB 2O06A 1KO1A 1TMYA 4GMDA 2P3SA 5BQXA 3V7UA 1VJTA 3EMKA 4C4ZA 5AM5A 1ODSA 1O94C 1SKYB 3TYXA 3EEFA 3UICA 3R6WA 2BTQA 3FVRA 4IDPA 4P80A 3Q7TA 1DAEA 3EAQA 3JQ8B 4YREA 4AJHA 2GOYA 4WFKA 5DBEX 4JB3A 1NUAA 2G7MC 4BDTA 3LO8A 5KMGB 3ZBTA 4AJ2A 2ZRAA 4MKZA 2I33A 3LC1O 2O8CA 3N75A 2WUFA 3U13A 1N34B 5PGMA 1P60A 1L9KA 4G1FA 5TT0A 1NVUQ 1NT2A 2EGUA 4OH7A 4PLPA 2OM2A 3VKWA 3VNBA 3CB2A 3OH8A 1DUSA 4RX1A 3TUIC 5H70A 2QN9A 2XMZA 3ETLA 3FYTA 1FXUA 2WQZA 5ESDA 2A0UA 1LUAA 5IJ0B 2OP0A 5K2MA 3W04A 3FPFA 3SKVA 5HF9A 3VMFA 3WS7A 1EQ2A 1V16A 2C9YA 5J2UA 1FFBA 2WHRA 1DKPA 2BTEA 4BV3A 1Z8NA 1NYRA 2MSDB 2WU4A 4Q1EA 5CURA 4H7KA 4AJ1A 4C6HA 1BVUA 2ZYTX 1XGKA 4A26A 3DZKA 1TXGA 1E2FA 5FWDA 4FYPA 5J1SB 1OZHA 4TM8A 4J7XA 1KKLA 2QGZA 4G41A 4TKMA 3L1JA 5A6SB 2EX4A 2W43A 1YR8A 3DBRA 5NLLA 2UXCB 4AJIA 3RBVA 1IATA 4PYMA 3K70D 3LVFO 1UQRA 1XZAA 2B8EA 1YHZA 1ZP6A 3U7GA 2ZYVX 3M5PA 5FADA 3SSMA 2I78A 4BDSA 1UDBA 3R7WA 5KJ6A 1KIMA 3KUCA 1IXKA 2A58A 3PDIA 1JHRA 1OV6A 1VE3A 4B75A 1HZZC 3H2SA 3K6JA 3EGVA 3PKZA 3AETB 3CRZA 3NFYA 3T38A 1E89A 3AEZA 1YNOA 3LKVA 1SCUB 1BTOA 1N2CB 2BW0A 3AEKA 1V7PC 2DLCX 1AKRA 4G0PA 3EVCA 3ZWWA 4BFSA 1OI4A 3E0QA 2Y6UA 3MUOA 3HO6A 4HRYA 4BQEA 1J1IA 4LNAA 3IUMA 1NAIA 1NM5A 1NLFA 2D1YA 3ANNA 4ON9A 5EHGA 5EEHA 3U40A 4CV2A 4EUFA 3U09A 1UAAA 2WZDA 1VE5A 2CJXA 3I0MA 1ZRSA 6CHYA 2H1RA 1AGNA 3UJPA 2P2ZA 2C9DA 4EA6A 2OESA 3OLWA 2HYIC 1IZ8A 5FYQA 3OEWA 1LQTA 4ZZ1A 3AZPA 2AOUA 3LP8A 5JAMA 1QS0B 3NHAA 4LX8A 3OKCA 4RD2A 1BE8A 4UUAA 3QEAZ 4MEBA 3COVA 5HS6A 4OK5A 3AVXA 4FI3C 4XDZA 3DL0A 3JAWA 2ID9A 4LJYA 4AUEA 2LDXA 2ZT8A 1NJ1A 4IBOA 2XMQA 5JCZA 4MV5A 2PZMA 1E0AA 1XEXB 2FDXA 1E5VA 2GF0A 2H6EA 5G0TA 2BKXA 3ESCA 5E6RB 2VPWA 2CXNA 1MPXA 2WK1A 4PX9A 3W9YA 5EE5B 1CUBA 1PD0A 2Z2IA 2ZULA 3O7MA 4QBKA 1NX6A 5L7TA 3H5IA 1XAIA 1Y8RA 3GEGA 3Q10A 2R86A 3QYPA 4HAVA 3TLZA 3LBFA 1H0KA 2V4MA 1HDYA 4J4TA 2Q6OA 2VK4A 3SR0A 2FX2A 4WZAE 2GRAA 3WB1A 1KYWA 2EP8A 4MTCA 3HPQA 4IO1A 1SUCA 3BSFA 1GQOA 5ALHA 4BX0A 2DOKA 4DA4A 3H13A 4AKSA 4WCFB 1YI1A 3FF1A 1NFFA 2WSBA 1E0SA 2VH5R 4XDYA 3BD6A 5GV7A 3VH4A 4EPYA 4CEHA 4J1QA 4B3GA 4L0QA 3IDZA 4P3NA 1OI7A 3O2NA 1KJQA 5DNEA 3KC2A 4RA9B 3FMPB 2GFIA 2WJZB 4E15A 2XWPA 4QZVA 1V7CA 4M1ZA 4XGIA 2RKBA 3RSZA 1KRXA 2QF7A 4N0QA 3E4DA 1OLUB 1ZKDA 2RHWA 1E1RA 3EJ6A 3HXOA 2WJ4A 3QI2A 4W8OA 1KVSA 1YHYA 5I8ZA 1JB1A 2FGJA 3B7WA 4B3HA 2X42A 1PYGA 3FRIA 1FS5A 1ODIA 3IXLA 2PR2A 1KI3A 3WYGA 1L5SA 1MFPA 1G7TA 3CCCA 3TLEA 1Z4OA 4BNGA 4FKBA 1QLHA 5ILOA 3BD8A 5DASA 3BICA 2BGWA 3UBMA 4KLNA 1RKXA 2F43B 2BE9A 1G8KA 2EW1A 3KZVA 1J4AA 4L16A 4XLTA 4XUDA 4ZAZA 5AYVA 1P73A 4NMWA 1RQXA 4NBTA 4U0KA 3LK7A 1V4BA 2Q5LA 1Q5PA 2Q29A 4Q4HB 2WF6A 3U7FB 1HE3A 2WLTA 1X92A 5KDLA 5EGNA 3FNFA 4KFCA 3FYSA 2NWQA 3DOEA 1G3IA 3H7AA 3CPSA 1OT3A 1ZO8A 1EA7A 5HE9A 1FP2A 2QU7A 3FDZA 3CUVA 4GDMA 1XCPA 4BFLA 4EGQA 5JY1A 3DKKA 2QTCA 2DWCA 3FETA 1SKYE 2A9VA 2OZLA 3Q9SA 1FMJA 1PHRA 3CURA 2WYWA 1U1CA 2OORA 4YNBA 5LU9A 5D6NA 4R9SA 4COKA 3FOZA 3Q85A 4K6MA 3DZFA 2XXAB 1F2TB 3HCFA 3COJA 4J76A 4EO7A 3O1LA 2HQ1A 4JI4B 2LXNA 2QE7D 1SUDA 3A3PA 4W5WA 2C7GA 2X15A 2QN3A 5T67A 2GEBA 2DPHA 2GFHA 5EQJB 4B8YA 4CWAA 2IH4A 5EMMA 5DU2A 5IC6A 1GGEA 1M1ZA 3LUPA 3NIGB 3BJZA 3Q41A 4BZZA 2XZTA 4F7WA 5CCXA 4X54A 3OIVA 5KHLB 3BHMA 2DUJA 5KTOA 3RUCA 2QGFA 1QP4A 3CZQA 1TYAE 3PQ5A 1G6HA 3I9V6 5J9FA 4XYBA 3W3AA 5DBIA 2I2AA 4CTOA 1TLFA 3A1NA 1CUEA 3LY9A 3HA2A 3KYJB 3EQ8A 2BFPA 4W82A 2FRDC 1YB7A 3KXIA 4AMGA 4JL6A 2ZWIA 4TQAA 2P68A 4TL9A 1XCJA 3OOSA 3WAJA 2C5EA 1F6DA 4JEUA 4TKZA 2QRLA 1F3LA 4M6WB 4A16A 5A4KA 3ZGYA 1X3LA 1C9MA 2WP0A 3M6WA 1FDWA 4FFMA 4P5PA 1C4OA 5EKDA 3EASA 3M5CA 2WD7B 1E20A 1J97A 4MKGA 1FSZA 1OGYA 2IQIA 5GONA 1OTXA 4Z0PA 4KN6A 3S7ZA 1OT5A 1WXWA 2H59A 3U3JA 4MP8A 3E53A 1G8HA 3J7TA 1JG2A 2ROQA 4NONA 1KMCA 1CETA 4GPAA 3MJDA 4MTLA 3PKIA 4NYMQ 521PA 1ZOLA 1BVYF 3GVXA 1YC5A 3DHEA 1Y3DE 2JGJA 3SX4A 5CD1A 3HLYA 5F1PA 1Z56C 1A27A 3INYA 4KQJA 3TJRA 3TLJA 1IHPA 4INZA 2O8NA 1CJMA 3L0PA 4K8OA 3QFCA 4HXEB 5HZHA 3G0BA 4GE0A 4C0QC 5CDUA 4P4GA 4B80A 1UPAA 4CKWB 2GNAA 1Z6YA 3MTDA 1SZJG 2GGSA 1VYHA 4ZOBA 4J94A 1USUA 4PICA 1OPRA 2BF7A 4NCKA 3RS5A 5ER6A 4YJ2A 5HDQA 4B09A 3I52A 4L28A 3INTA 1FFGA 1DQSA 3BTUA 3RFVA 1UP7A 4Z7QB 2W83A 5L95A 1YACA 1U1FA 4OG2A 4B6OA 4I1OA 4OM8A 1U0HC 1KDVA 2G9NA 1DDGA 1X8JA 5I45A 1XPRA 4DUGA 4Q3DA 4BU0A 4DKXA 5J5VA 3DJYA 4LGMA 1GN8A 4X9XA 4ZYXA 1K8XB 3OX3A 4PZCA 1R16A 4RACA 1CEEA 4ZAVA 1LCIA 3ASYA 3BTOA 3HHEA 4V2UA 4FYIA 1P1CA 2JDID 2YOFA 1QRUA 1SK8A 4YJ3F 1ONBA 4D99A 1IQUA 2P77A 3N6RA 4JYBA 3HGTA 1TX4B 3LGXA 4KDFA 4M0DA 5LL6P 2ZYIA 4BO4A 1V48A 5DKFA 3BQNB 4WY5A 3TOSA 3PFFA 1LQ2A 4EUNA 4QSHA 3WIDA 3CMCO 4ZCPA 2PO5A 4RESA 3HA5A 4O4HA 2HSJA 1T1IA 4GRAA 4XDGA 1PS0A 5AW6A 2DB3A 3AP2A 5SYAA 1NOKA 2HREA 2XAUA 1YF3A 3K9BA 1SQ5A 1LC0A 4OXXA 5EY5B 4RIEA 3KEOA 1BXRB 4CLRB 3SWWA 4WQMA 3IHWA 3HXKA 2F67A 4XJXA 5IJ9A 1I6WA 3ENNA 3TKLA 4G65A 3OAAA 2B2NA 5K20A 2DFVA 4FWTA 4LE2A 2IHKA 5HMMA 5G0WA 3ENZA 5HBGA 1A50B 3MS7A 1THZA 3H19A 1LBSA 4JUAA 4J6EA 5B30A 3QE9Y 3WHIA 1TCUA 3L7YA 1JI3A 3LMKA 4QEDA 4CFYA 2GUGA 3I01M 3IODA 3V4PB 2GM5A 3F6YA 4XD7D 5IJXA 1DMSA 3O4HA 4BMZA 1JILA 3IR7A 1H69A 1XTUA 1JDUA 2VF2A 3QELA 1XRJA 3QMPA 3FCCA 2PUTA 1ZMRA 3F5FA 1R5BA 4DBVO 3EPHA 4GC9A 4ISBA 2HO5A 1X7ZA 2KB0A 1I4EB 3ZLJA 1ZK3A 2VJNA 1V5EA 2WNIA 3VNQA 4BE4A 5H80A 3CF6R 3CR8A 4C08A 5JCPA 5MN4A 3U61B 2XDYA 1Y82A 3IH5A 2IIVA 2AUNA 1CXZA 4KWEA 4X1KB 5A7GA 1VLMA 2E5WA 3N2KB 3ZI4A 4BMYA 5D5HA 4UMVA 1TZKA 4GLOA 1VL5A 4XXHA 1UZAA 4FGLA 3OCYA 2IS1A 1Z7YA 1IPEA 2BFCB 2PSJA 4BB5A 5KSPA 5C3MA 1QP7A 3R44A 1FJHA 1YIDA 3R7WB 4ETIA 3ACCA 3RDPA 3T0IA 2IZZA 5JNUA 1Y1RA 1YH3A 5DLYA 2A0WA 1AJEA 3U0BA 2AFVA 2HHAA 3RREA 1AQLA 3TPZA 1UJ2A 4L73A 3WXBA 4BQSA 4ETMA 2NYAA 4EX7A 3FVWA 4OJNA 4F7DA 3IPYA 3FUXA 1E3DA 3B52X 4UPVA 3SYKA 3TCKA 3WZMA 4Z6KA 5C7YA 1ACMA 5KOYA 4X24A 3NKLA 4E07A 4S1WA 2GH1A 1D7AA 1GLNA 1R5NA 1VOTA 2PVPA 3IOBA 2HPAA 3KWLA 4HFNA 4WXPA 3T7TA 3ZDXB 5HYVA 1FLDA 3NV7A 3K16A 2UKDA 1K75A 1VHJA 2RGNC 2HA2A 1KK1A 4CG0A 4J9UE 3R8FA 4N5MA 3KJIA 3C5VA 2WHPA 2YW9A 2NPOA 4E09A 4NC9A 4OTZA 3DKPA 5AUOB 5JNWA 1P72A 3L8ZA 3OD1A 1NASA 2R8OA 1L4YA 2VDRB 3IURA 3V2HA 2EWMA 4DY6A 1F9AA 1I9CA 1T0JB 4I2VA 1YRYE 3CUSA 4QDUA 1TF2A 1Z5NA 2MT9A 3CLRD 4HX9A 1HPLA 4YWHA 5I9TA 4F5ZA 3CLRC 4OPMA 4F3KA 5AW1A 2XNCA 1JAYA 4UZFA 1JHOA 1XJQA 4Z2YA 4JLSA 4N0MA 4XB2A 2E49A 5E6UB 3OZEA 3VO2A 4IHQA 1AQNA 1H4VB 1C2TA 3EIFA 4RKRA 1T24A 3BG5A 4HS4A 3RC7A 5TEVA 4B3CA 3G8DA 4AM8A 1RI3A 3C7KA 3MMNA 4Q02A 1HNWB 2I2XB 4YY3B 3TI9A 2CNWD 3UT0A 2BFEB 2ECQA 2WIAA 2Z4SA 4QD3A 2RGAA 4FGSA 2RAFA 3H9EO 1SOMA 3B2QA 1NUUA 1NVDA 4RH3A 3CW2A 4BLWA 2WR8A 4N82A 4D9NA 3GIDA 4EIWA 2B9VA 3Q9NA 2VATA 4YJGA 2IW3A 3V8EA 1XCOA 4DCTA 2OKGA 3ELWA 4V1CI 4JHXA 3KE8A 4BO6A 1KQFA 3ZLUA 5FL7D 1PQUA 4DV2B 1KMMA 4OQYA 5LBUA 1LPOA 3RPEA 1G16A 1Q7GA 2H63A 4JX8A 3UH1A 2CXOA 4OI1A 3KJZA 3LQQA 3IAS6 4AWXA 1TKBA 3B8HA 1Z16A 2LZ0A 1ZI9A 2BI4A 3FXAA 4LYDA 3D5QA 4LY0A 4ZC8A 5LP6C 3T41A 3W5SA 2YWEA 3ZHTA 1NC3A 2WU0A 2IUTA 3N05A 4MAAA 3KDAA 4HWKA 1CF9A 1K8RA 2H92A 3T4UA 4G67A 4DOMA 4DSNA 2GK4A 2O05A 4IDHA 4DV1B 2X5NA 5E6SA 1C0IA 4KXFB 4B4UA 2AVDA 4CMHA 4HLUC 4M1QA 1G20E 1TADA 3FE2A 4PYRA 5D85A 2QUJA 4DUGD 1KFJB 1J07A 1N75A 4KUGA 2P9YA 3MTQA 4OQEA 5B53A 1GGVA 2IWRA 4B48A 5IJ0A 2BM1A 1V3QE 4KZPA 3DLAA 4L9AA 4U5XA 5THXA 4ZOEA 3EZLA 5J2UB 2AR0A 1C7RA 2Q0XA 3G9QA 5IDVA 3V32A 4QOGA 2GZMA 3GZ4A 2PIAA 1YKGA 2DWUA 3F3SA 1QVWA 3UAWA 4AJ4A 2ZIVB 5IAEA 3NYQA 4BP8A 4Q4HA 3ENWA 4BJ1A 3GDOA 3PPIA 2YOGA 4TWIA 4LOAA 4M0CA 3FAKA 1KRHA 3FHLA 3FAZA 5CFMA 2D3TA 4C05A 4DF3A 1ZR2A 4M7OA 5DN6D 3HRKA 3NHUA 5FFMA 3JQ6A 4WOPA 2G4VA 3TRJA 5K6TA 2FB9A 4PQGA 3SYMA 3HCOA 1P2VA 2VKQA 4NENB 4WZBE 1F7UA 2QUKA 5CFPA 2HGSA 2OZLB 3NC4A 4YV2A 3HXMA 1JVSA 3CX7A 1NYTA 3ZDCA 5E1BA 2YJ3A 1JKJB 2HHCA 3TUJC 4F71A 2NO9A 4NCAA 1NMZA 3SSNA 3ER8A 1KP9A 4U02A 3V3TA 2PUWA 4RIHA 2N75A 2EW2A 2H1CA 2ZU0C 2FY8A 1UXJA 1FRZA 1PL7A 3Q6NA 1UFOA 4JGGA 3AUTA 3KLMX 4OKIA 3PUWA 5G0SA 4MPPA 5IJWA 2RE8A 1OBVA 1YRAA 1P5RA 2Y92A 4MJ3A 1AXEA 1XXHB 1DAMA 2VDNB 2BUBA 3JVUA 1H23A 3N86A 4HSGA 1E2QA 1PR2A 4RVSA 2V8BA 3ROQA 3N2ZB 2ZB4A 1RAFA 3CF2A 4BMCA 1T9CA 4PXSA 4JLPA 3WJ2A 1J8DA 1WDMA 1U5BA 3JS5A 4RAOA 4MKXA 5JFGA 2DHCA 3S5UA 4EA9A 3JWHA 4WZ6A 4ZAXA 1LRKA 4PPQA 1BHO1 5KQGA 4RJ2A 3COZA 4RJJA 2Y93A 2P9FA 1IJBA 4L4ZA 2V9ZA 2PQMA 5ITZB 4RM2A 2JFYA 1E5QA 1E9AA 1X7YB 5BYAA 2EDCA 3ZW7A 4DLKA 4F91B 2IU3A 4ITUA 5JPCA 1C7QA 3K1AA 4Q4DA 3EZFA 3RKUA 3DZHA 3H83A 3PYLA 5IKOA 5H82A 1MVLA 4M89A 2G9RA 3MOIA 4D98A 4E5SA 5LZ9A 4QTXA 1EH5A 3W2IA 2DHEA 2JBAA 2VCYA 4X3PA 5CT4A 3NCHA 2GAOA 2EFYA 2TMDA 4I46A 4MQUA 5FOQA 3MJEA 3BZUA 1OBFO 1ZJYA 1VCMA 3GFFA 3QVVA 2Q5QA 4YPVA 1NXPA 4PG6A 4UNIA 8MHTA 3D7SA 2OCGA 5IT9A 2FJUA 4EF4A 5H8WA 3W2FA 1U0SY 5IDYA 7ADHA 3ROGA 1JXQA 3QUQA 2GBPA 3VYUB 1ZMBA 4TKLA 1JEQA 4E13A 3W8EA 1I2CA 4RO0A 1N5KA 4AUKA 4PSDA 2JEZA 4H77A 2ZGVA 4X8OA 4F5EA 1UBUS 4EFKA 5HR5A 4M1OA 3G85A 3DVRX 1GAEO 1KO4A 4XFKA 3RW9A 4CQNA 1EDOA 3EIWA 3HCEA 1RQ7A 3IDSA 4WSOA 2QG6A 4PN3A 2Z9CA 4YV7A 2C61A 2NTYC 2O3TA 3M82A 4FR5A 1CJUC 4IPTA 5G4KB 2D2XA 2REQB 3QE0A 3RTCA 5KCZA 4A3SA 1MP0A 2QN8A 1FX0A 4NZYA 4LAFA 1E3EA 3KCQA 3RAFC 1US8A 2FG5A 3HNOA 1DXOA 3CUYA 4N5LA 2C8LA 5AW0A 3LI2A 4D3DA 4YRBA 5EWLA 3QOYA 4I6EA 3HQ4O 2J7KA 4RVGA 4NE7A 1RWMA 3NALA 4B2YA 4QUAA 4XJVA 3DPIA 3V46A 1M1XB 2LDBA 4MWZA 2PZBA 2HJRA 1YZKA 2ORVA 2ZJFA 4PX2A 1ISMA 1Y4UA 4AWBA 5CR9A 3VC2A 4ENTA 3WIUA 3IE2A 4LBYA 2I7VA 3A4TA 3DAFA 4M9QA 4EJSB 1NPTO 4B0PA 1KYVA 4DUPA 1O5OA 4YGYA 2ZUSA 1DO0A 1QR2A 3ZD6A 4AROA 2VNHA 3IPRA 1WZUA 1PEAA 3D3JA 4FOLA 4RHXA 2VQDA 5IBRA 4IS2A 3VJRA 1OXSC 5CB8A 3ZU3A 4IVPA 1ZCBA 1OB2A 3X2SA 2A2ZA 3DXXA 4FD2A 1U4SA 4A8PA 3GY0A 5BN4B 5E0KB 2X0DA 1M6EX 4PCAA 3G5LA 3NEAA 4B3RB 5EC8A 3RIEA 2ZDHA 5CIYA 1AV7A 3CZCA 1R9GA 5FBVB 5EJ7A 2WM3A 1RHMA 1WTCA 3GWGA 4U2KA 5HIAA 5HTOA 2ZTHA 3ESXA 3GJTA 3PPYA 1JT9A 4Y2RA 2D00A 3QVGA 5P21A 2P30A 4R8LA 2GPNA 1EFVA 4ZQHA 4M0FA 1P2UA 5K0EA 3HNPA 1YUBA 1RLUA 1EYZA 5D84A 3OJWA 3AEQA 3H9CA 2G04A 1DAGA 2OZPA 3VZCA 4DXDA 2ZJYA 3CFYA 4YMWA 3QYJA 1J5PA 5EXTA 5JVDF 2J9FA 2HN9A 4E6EA 5C7IO 3EGWA 5T4HA 3GPBA 4LVUA 3IJRA 1RHKA 1C1DB 2WU8A 1S3SA 3NHSA 5I5GA 2W37A 4YCLA 1G3RA 3P2EA 2J32A 3DO5A 1G5FA 3EYAA 4TS1A 4B3SB 4CMKA 2V7WA 4LPKA 2XA1A 1EFHA 3AJ9A 1NKSA 3VR4D 1NUTA 2FQWA 2CMGA 4ND8A 5FYDA 2RFLA 2AN9A 2ZYUX 4Z4EA 3FGZA 4PEVA 1HNXB 1FU7A 3H5VA 2ZPTX 2JKYA 4CKEA 4ZDIA 4N9WA 3KTFA 2IPAB 1NNLA 1XBTA 1Y3FE 4FCTA 4DHWA 4YUWA 1LBTA 3HJGA 3KKKA 4OJYA 1Q44A 1NBMD 3CCFA 5EWJA 4R8SA 2J3DA 1E7QA 1X0VA 3N0VA 1EZ1A 4TMXA 2ZE6A 3FOWA 5JSKA 1E4YA 2QM3A 2VTKA 4FINA 3A6JA 2R44A 2W5UA 3MRSA 4JLUA 1HZJA 1U2GC 4WZBB 4ZPJA 1G0OA 4YCDA 4E1VA 3P71T 5AO9A 4C6RA 1XAJA 3EQ9A 4IOMA 3JATA 1URPA 4MWGA 5FLYA 5FPHA 3QPAA 2PH5A 5B7PA 3MG9A 5EJGA 3SYTA 4KPYA 3LWZA 5A5VA 3B12A 2Q7DA 4GOMD 2PMFA 3Q4GA 1IVSA 3TNJA 4QYSA 1WUJS 1T3TA 5J47A 1MOPA 3EDRA 5CNJA 1BJTA 5EA2A 3GVPA 4DCOA 1XQVA 2PGLA 4MUMA 1L5GB 5K8LA 3FPAA 1Q7BA 4HQOA 4QRIA 2C4MA 2VYND 1N2JA 4OHYA 4GO1A 1MEOA 4YJ3B 1WCYA 1ZM9A 1EBUA 3FWZA 4NFLA 1IIBA 3OPXA 2NIPA 5FQNA 1OXKB 1ZK2A 3WE7A 4ABTA 4MPTA 4GMKA 5AQEA 3L6UA 3CINA 4YUXA 3C5EA 1T9KA 4NRDA 3ADOA 4MGYR 3LPAA 5J4YA 1GR0A 5ILGA 1UP6A 3RSHA 2TECE 1V7QA 1E2MA 4QGGA 1HTBA 3LAWA 2VBCA 5TR9A 3HYLA 4JEIA 1O6CA 5EE0A 2GBIA 1W4ZA 3HUUA 5ARCA 4FQ7A 3RVLA 4YJGB 4FFPA 5IULC 2J48A 3H8JA 4FEEA 3N8DA 1OXBB 3VSDA 4MXDA 5I7UA 3FKSA 1X1RA 1MOSA 3L5OA 2W6JA 5A5EA 1EAMA 4B87A 1M72A 2XUPA 1BEZA 2C78A 3V1YA 2WTUA 2BM8A 1SXIA 1DB3A 2CB9A 3F98A 2QW1A 3AILA 4FKZA 4P9NA 3BQMB 2VR1A 3AR4A 2ATIA 2K7ZA 3RSGA 5IJ9B 3IR5A 4ZTUB 2J08A 2F1RA 2PAAA 2PS3A 2DSNA 1BHQ1 3LT0A 2JDIA 1SULA 4UEJA 2EGHA 5E6SB 5IKEA 4D56A 1NBMA 2NVBA 2Z2KA 3CKYA 3QU4A 1TECE 5DEIA 1AHIA 4DV0B 1A82A 2V7VA 4FMPA 1XUOA 3CWQA 3VVCA 5TPZA 1G63A 2OZEA 4MPDA 2Q50A 3KSMA 3OF3A 1OKKA 2B3TA 2W7TA 2R8EA 2LKDA 1V95A 4MVJF 5HF5A 5D5PA 4QAJA 1FYDA 4MQEA 4Q4JB 1TNDA 4M0LA 1K2WA 3U80A 5AJHA 4TTPA 1ILWA 2Q9CA 3IRVA 3U4AA 3MLAA 2NTNA 4FEAA 5C9ZA 2K2WA 3HM2A 3UW1A 4KR6A 3WK4A 5GZ6A 3PNOA 2G88A 1B3RA 4FS8A 4TL6A 3O8RA 1R18A 2B37A 3AGPA 4HZUA 1CEXA 1XMJA 4MB0A 1GU1A 1RAHA 3ESBA 3R3UA 1SU6A 4KSYA 4M98A 4YP0A 1KTIA 2O0LA 2XB4A 2OG2A 1U90A 4XRRA 1JSLA 4F4FA 1HR0B 3I28A 1OLSB 2OB2A 2CXRA 4UBNA 4LWPA 1CR0A 2EYQA 3BFKA 4XOIA 3UUGA 1JKJA 1T0PA 3GAZA 4O4JF 1TLLA 5CYOA 4PAGA 2Z9BA 1CLUA 1VB3A 1K4YA 5CX1A 4CI0B 3THYB 1JJVA 4X62B 2NTJA 3D8TA 5CCBA 1JT2A 3AKDA 2C7QA 3N7TA 1WWKA 1S5PA 1Q20A 1ZGHA 1E58A 4ZARA 2EKLA 1SNYA 3ZXUB 4MVJM 2WTBA 3TXAA 3ZVRA 3W2EA 3O8QB 4MI9A 2QKYA 3B6MA 5JADA 2JI6A 2PCLA 2WT8A 1E2NA 5K09A 4WX2B 1E2BA 1BEEA 1C4XA 3PTLA 2YIDA 2I2BA 3IO3A 5I9BA 3THSA 1I80A 4I66A 5IM4A 3QU7A 5I9SA 4HNQA 1XRSB 3AH8A 4WNCA 4DQLA 3S6JA 2I4TA 2IY9A 4CIBA 1F6BA 3TBHA 5L8VA 4MDHA 5BYJA 2F9MA 5DYYA 5IN4A 1QFSA 2X19A 3K0CC 4ALLA 3HBMA 4PY2A 1T2VA 3G0CA 1X7YA 1YS4A 4XGRA 3MZ0A 2MU1A 3WNBA 5KUTA 1YCGA 5BV1A 1OJ7A 3M70A 4G4GA 2PGNA 1P31A 3IILA 2GHRA 4KITB 2I66A 1H8HD 1N0WA 2BTOA 1MD9A 3UK7A 5I7FA 2NX2A 3ZE1B 2BRUA 3ZJYA 3KTDA 5KO2A 5DLDA 2IP4A 3MYYA 4CF3A 1S4QA 3GUZA 3R7AA 4JI5B 1CQJA 3DS8A 1OXMA 2GTHA 1SPBS 2WC1A 3PPXA 3ANMA 7AT1A 3N7AA 4UM9B 2UZAA 3KVVA 1WUHS 1ETUA 2VDKB 2HIAA 3ACBA 3FNHA 3PJRA 1J99A 1XZBA 3AW9A 3D4IA 5IN5A 4JYZA 1LS1A 1Z5OA 4CN8A 1J2YA 3WWPA 2YWCA 5BURA 5T7BA 4C03A 5ICFA 1CY8A 1Y7IA 1UDCA 2CJYA 2XWSA 5A7HA 4IX1A 1I1HA 1DAOA 1X2EA 2EDAA 1BX3A 3FOAA 4I55F 5DULA 5TJ9A 3VI3B 4ZZIA 1ZAYA 1UDAA 2QTNA 4BYMA 1L7BA 2DGDA 3QKSB 3F7TA 3ISVA 4ZGGA 1QKKA 3OF2A 3GC6A 2IV2X 3UV3A 3EPPA 1DG9A 2KBEA 5AKJA 5AD1A 3MTEA 4AS3A 2JPDA 3DEYX 1II9A 2DC1A 3HBAA 2X9GA 1WSWA 4R1LA 5LA6A 2BGUA 4KSCA 3TRDA 5FA5A 3FN4A 5KVQA 2X8BA 4PGFA 1AZWA 5CA0A 3ROZA 1W25A 2QUHA 3RUFA 5AVXA 5KYWA 2ENWA 2C2ZA 3IIJA 3RH0A 1X8LA 2I67A 2PLRA 2VZ9A 4NMMA 3DVSX 5EWLB 5KAMA 4PSVA 2QTRA 1ZRHA 1J8FA 1ZOIA 3HCPA 4UCXA 1ZMTA 1HE8B 5JAPA 5CEFA 2XMPA 1RJWA 3DOIA 3FPSA 1JR2A 3BB3A 3HU3A 3BXZA 3P32A 4HEA1 3K09C 1BIFA 2FPKA 3NHBA 4IILA 2PCJA 4AXXA 4GBGA 2I65A 5LUBA 2C4WA 1B1CA 3B7PA 3ZY4A 3M34A 1BE0A 3OUTA 3R20A 3GFPA 5EIFA 2OXTA 1P2SA 2ANBA 2YYZA 3A4IA 3DVLA 3ENVA 3HVJA 1QGZA 3I6IA 3NTQA 1CHNA 3LQYA 1TW2A 1W94A 2VWGA 2CHUA 4I1IA 3U49A 5TGDA 3VSCA 4A92A 4TOIA 5JJ5A 2JGLA 4N7MA 1Y33E 3R76A 3QFHA 4YGXB 3UGJA 3LSTA 4LY9A 4QBTA 3FUVA 3E8MA 5B37A 1ZH8A 1X8XA 1QTNA 1ZY2A 4XUCA 2O2JA 2WWIA 3H11A 4IUBS 2V9CA 5AI6A 5EVCA 1XTTA 2YFKA 5HFJA 1J42A 5ALWA 4K1XA 2X0KA 2PKQP 3AIIA 3NHKA 2PPLA 4O29A 4X92A 2VPYA 1SG6A 4MROA 5GZ3A 4HDAA 5IMBA 4ZGWA 3IQZA 3OZCA 4LYEA 4O63O 4OQDA 5CFLA 2RD2A 5AW5A 3PEEA 3IMKA 5HCUA 5D01A 2F43A 3LPNA 3G8BA 4C4AA 4L22A 2D0IA 2OD7A 3WGKA 3ICQB 3P0JA 1UODA 1LSUA 1H8HA 4D74A 2B4YA 4BQPA 3WP1B 1XLUA 1AX9A 1VI2A 4N6GA 4CG1A 1I6LA 3IDFA 3AR6A 2H8GA 3GCXA 5DN6A 4GX1A 1R0LA 4B6JA 2GJAA 4EZEA 4ZVSA 1AURA 5T41A 3SZ3A 4ARVA 2V97A 1CDOA 2JASA 5B2FA 4FFLA 3D4PA 1IJKA 4WL0A 3INNA 4OV6B 4OLBA 2B6NA 1FOEB 1U3TA 2OTCA 2W48A 3CSUA 3EC7A 4DCGA 3PQ8A 4ED9A 4MYCA 4RTMA 1Y98A 1Z3IX 2ZWAA 4Q3NA 2E21A 1QE5A 1FFXB 1U3GA 1YFZA 1IB0A 2CUZA 2ZR0A 1OASA 2DWQA 3E0XA 4G8CA 4ND8B 4MVWA 2VHEA 1GYQA 2HV8A 3BF8A 5DGTA 4H2DA 4V0LA 4L4UA 2QTBA 2EBWA 5KS2A 2I4RA 4L50A 4C21A 1YJBA 3VVMA 3I9JA 1Y3IA 3A3OA 4CEJA 4LXHA 3C6ZA 2KI5A 1NW7A 3FCEA 3KVRA 4B45A 2GQ0A 3DLBA 2CMKA 3OFJA 3U9LA 4ZAFA 2HPVA 4B3XA 2CZGA 3TSWA 2KX7A 1K9SA 2JH9A 1GL6A 2KQUA 4ME6A 4NMLA 1PWEA 3MBOA 1KYXA 1NW6A 3PEYA 3UMFA 2Q2NA 2GYWA 1JEQB 2H11A 2NSHA 4GEKA 1XZNA 5SZKB 2GYYA 4AY6A 1S8AA 4WJKB 3G7UA 1P5ZB 2VDWB 3INGA 2DFDA 3SC6A 4ZOQI 4OYYA 3T1HB 4WWHA 2TS1A 2JJ1A 4UQOA 1CJTC 1HE4A 5JQGF 5I9LA 2XBMA 3IVAA 4B34A 1QX4A 2XMBA 1UT8A 4JEHA 2PR7A 4LA4A 3BKXA 4IXWA 5GONB 1NSTA 4HTFA 2REQA 3V33A 2EQ5A 2JK1A 2ZIXA 3T7IA 1YRBA 2AWOA 2JGEA 2N9UA 3BRCA 2DQSA 2ONJA 3TZHA 4BQQA 5CXUA 1VMIA 3IUEA 3K4QA 2ZRPA 4INAA 4ZO9A 4TWAA 4QDTA 1US8B 1GO2A 3DNFA 2WFZA 2Z8YA 3IMGA 4IINA 5CP8A 2FZCA 2WG1A 4KYIB 3ST7A 4EA8A 2VQFB 2VUIB 1L6IA 2GJSA 2ZJAA 4OP3A 5FBKA 4JVNA 2HCJB 4RYDA 3ZU4A 4HDKB 4QDKA 3UOAB 3A14A 4BY9E 3CZ5A 4MQBA 1TVKA 4DMMA 1LKZA 5F7JA 4OUKX 2BEVA 2NUTB 3FTNA 5K4AA 1Q83A 3FIUA 3LXXA 3M1LA 4CKWA 3ETEA 5E3IA 4L4YA 1RQLA 5EHIA 4F97A 2FUG1 3ACDA 1IZ9A 1G21B 3DDZX 4W7SA 1BN7A 3MC1A 3CE6A 4FIZA 3A6HA 2XZOA 2ZWPA 3CTPA 2GPBA 1NQXA 4JL5A 2B1RA 2GI4A 3E27A 3QV1A 1Z0IA 4LDPA 4WLOA 3TGPA 3DW3X 5JZOA 5ALDA 3DOJA 1JLSA 2WE7A 3BK7A 2V3CC 1W0JA 3I12A 4XYGA 4FB4A 2AEFA 1Z6QA 3E7XA 5K4HA 1CCWA 2M32A 1VKRA 3F5QA 1IM5A 4WZAB 1QANA 4QXAA 4TLAA 3DJFA 2HJWA 2XYGA 3FLBA 3JWPA 4ZTBA 1JFSA 3K8ZA 3WG9A 1NVWQ 4ZI5A 1KOFA 5CTJA 1MB2A 1G3MA 2VYQA 4RCVA 1M8FA 1ZH2A 1XMSA 3NM5A 4RPLA 4YROA 4FFBB 3MCTA 3SSOA 4F8YA 5L40A 2VHYA 2NXCA 2VDQB 2XD9A 4ENSA 2HQSA 2ISSD 3KKZA 3OIFA 3UAOA 1GCGA 2CJPA 3UKJA 1MAHA 4NABA 1QAOA 1R0BA 2YBDA 1FDOA 3W1EA 5JHGB 3W5BA 1HDOA 4CNQA 2Q62A 3H5OA 3O5AA 3IA7A 3BBLA 3FFXA 1NE2A 2Q3MA 2JRLA 4OSPA 4ZI7B 1BFDA 4MRAA 4OQLA 3KHKA 5EJ5A 5EIBC 4TXLA 1MB9A 2QJFA 4BJ6A 3QQPA 3BB1A 4CTNA 1EVLA 4HYYA 3THWB 5FHQA 3LKBA 4AP9A 1NF8A 1ONOA 3SHWA 1SK9A 3BGOS 2XB2A 4GQAA 3R77A 3T0FA 4WEOA 4BFVA 2VA9A 1LWNA 1W4BA 2ZATA 2PX3A 4OVKA 1ZK4A 4EX6A 5AW7A 2FR8C 1EESA 3LIIA 3NBUA 1X70A 5BMOA 5BQPA 4BO8A 2H07A 2OQIA 4G6ZA 2PYZA 4TTIA 5AESA 1XPUA 2VJDA 4D45A 4IIEA 3V8VA 1WCV1 1M1UA 4N48A 2NV0A 5LLSA 2OGZA 3ODGA 4M54A 3QELB 4TV9B 4DQ0A 4K7JA 5AW9A 3ZGZA 3FROA 2VHJA 1FP4A 2GCOA 4OMCA 4RDHA 3EW9A 4V0ME 2GZ2A 3K70C 1RW4A 1ZBDA 4TWRA 5CM2Z 1PJBA 3ZHSA 4O6VA 5H7XA 1W5TA 4DV5B 3K6SB 4M3NA 1GRVA 3X1WA 2FUEA 5DM1A 5H3CA 4GVPA 4ENVA 2Z2ZA 1ZD1A 4U5QA 3SF0A 4H3KB 1KVTA 1EBBA 1CIJA 5IK2D 4DJDC 1M34E 3AY0A 4OHOA 2PZAA 3HJAA 1VJ1A 3LM8A 3P4UA 1THGA 2W93A 3AK4A 4FHFA