3SJAA

Crystal structure of s. cerevisiae get3 in the open state in complex with get1 cytosolic domain
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
350
structure length
338
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 119
structure length 338
sequence length 350
chains with identical sequence B, E, F, I
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjaA00
4IDQA 5EP1A 4WZAE 4HAYA 2QQEA 3H2YA 5FL7A 1ZNWA 4UNNA 5E7JA 1ZM7A 3LVQE 3W5IA 3AKEA 4EJSC 4QFMA 2H57A 4Q4HA 2JIZA 1IY0A 4AYWA 1XD2A 3ZQ6A 2J0SA 2ONJA 3BWDD 3SEAA 2AWNA 4UNPA 3NDPA 4HAWA 2P6UA 4ZIRA 2ZI3A 1SVIA 1C4OA 5EP4A 1D8TA 1LTQA 3D7MA 1KJWA 1UFQA 5FI0B 5J5CA 3U3RA 1UKZA 1U94A 1XEWX 2AN9A 1E2KA 4PSVA 2VHJA 1X8JA 2QN6A 4LCBA 4HZIA 1MOZA 2J0QA 2D06A 4KYUA 5FOTA 4YMWA 4ZDWA 5KNDA 1J70A 2IX3A 5E3HA 1EG7A 3NBZC 3P32A 4JL6A 5JFGA 1Z06A 1PVOA 2QBYA 2ZRMA 5DGXA 1YRBA 1FPMA 1JQLB 1ZM2A 1RZ3A 2KBFA 5JHGB 5FOWA 2KJQA 3RC3A 4B3FX 1UF9A 3THYA 5DYGA 3QPVA 2DYKA 3DMNA 4HLCA 4BLQA 3I61A 5HR5A 2E9SA 1G5TA 2BBTA 2JJ1D 1G7CA 1FTNA 5JWOA 2OXRA 2WPDA 4Y0AA 4EIWA 1WDTA 1Y3AA 2XAUA 3Q3JB 3ZIAD 5EE9A 3TQCA 3W8NA 1GKUB 4IOJA 1G5PA 1KZGB 3BJIC 5EE3A 3GLGA 2FZLA 2NPIA 2GXUA 2BDTA 4HZUA 1PJRA 1QVRA 3UANA 5JS8A 2NZJA 2VSXA 1I4LD 3KQLA 3UPUA 2ZVPX 5FPSA 1UKYA 1GRRA 2F7SA 4ARZA 4W5HA 2Z5FA 4QGAA 2JLRA 1J8YF 5KSOA 2H16A 1E6CA 1BOFA 4YMSA 5DNYB 2CL6X 5SZHB 1E2DA 2FFBA 3RRMA 1Z0KA 2GK7A 1HUQA 1ZCAA 2LWIA 1Z6GA 2P0EA 4C7OB 2O8BB 3VNUA 1T91A 2FJUA 4AYXA 1LY1A 1OXUA 1WCV1 4PZLA 4UJ5A 2IYQA 2Z6VA 4HLUC 2VP2A 4MUBA 4OQMA 4MRPA 3VR3A 3B5JA 2F3TA 2QE7D 3NXSA 4OYHA 4BLSA 3KQUA 1F2UA 2QP4A 3H4MA 2ZRPA 1QHHA 4JLNA 1LS6A 4LPKA 3SI7A 1IN6A 1XTJA 2EW1A 2CEAA 1QBKC 4DLXA 1Z3IX 2EWVA 2BBSA 4X8HA 4KFUA 1KI1A 4B32A 1OFIA 1P4SA 1VIYA 4URYR 5AWFC 1V5WA 2C9OA 1WA5A 4LC0A 4QRHA 2G9NA 2XITA 3GJ3A 1OFUX 1DBSA 1YJ5A 1E2PA 5FUWA 1HH4A 2C9YA 1GNQA 3D8BA 1NJGA 5DN6A 4Q1AA 2VP0A 1G4UR 2IYWA 4QOSA 2C2HA 4CDGA 3P4YA 5E7MA 1F6BA 2Z4RA 4C9BA 3CW2A 1EXMA 1Q1QA 5ELXA 4BFUA 1Q1ZA 1KIMA 4QNRA 2FV8A 2P6RA 5BWMA 1R8SA 2D2FA 3I73A 1IXZA 4GP6A 4RFSB 3QSYA 5TV2A 3WMEA 1RJ9A 1US8A 4US0R 3X1DA 4XVUA 4Q03A 3RSOA 3A37A 1E3MA 2CNWD 4C0KA 4ILEA 3FMOB 1S0UA 1XNJA 4DSUA 1D2MA 1LF5A 1NMZA 4AG5A 1E0AA 4KFTA 1DAIA 4TN1A 1NIJA 4JLPA 4Y0VA 1W7AA 1EFTA 3OIVA 3SJAA 2OE2A 4B44A 2ERXA 2RGDA 3SBEA 5KSPA 1OLOA 3EPLA 4IVRA 2GZAA 2W6JA 3IKJA 3S1AB 4BLRA 1SVKA 5K8IA 2W0MA 2VYFA 3ZQJA 2F1RA 3EZ7A 3FFBA 1U98A 1KY2A 4M22A 4PO8A 3KJIA 4DUGD 1CULC 4HAXA 1OFHA 1JECA 1YHNA 1Z29A 1WRBA 2OCAA 3ZD6A 3QQ5A 4DKXA 5DI3A 1OB2A 1IY1A 1G8HA 3CR8A 3QG1A 4UXIA 3L0IB 3O8BA 3U4QB 4FMDB 1AZTA 2HV8A 4A36A 1BMFA 2DWPA 2EYUA 3QF4B 4Q7LA 4BASA 1XRJA 5D3MB 2V55B 1FTSA 3GLHB 4O0MA 1EESA 4P31A 4PPFA 3U3KA 4BFTA 2BC9A 1KZ7B 3IPYA 5H1YA 4RD3A 3K0CC 3TIFA 2VHUA 1TX4B 5DSZA 1G8FA 1NKTA 4Z1MA 2YOGA 1N5KA 1JR3E 1L2TA 1QHYA 2G88A 4KI0A 4A0HA 1CR0A 3PENA 1YR9A 5DH9A 4O25A 2CL7X 1UADA 4PHTA 2PL3A 4Q7MB 1G7RA 3NC0C 2FN4A 4BFWA 1E0JA 4S35A 2IYXA 2NO0A 3BERA 3AKYA 1ZUHA 3W8RA 1D9ZA 3TSZA 4NE2A 5DIFA 4DSOA 4DCSA 4OHYA 5JRZA 4D4KA 1FP6A 4HAUA 1E1RD 3C14C 4JS0A 4EKDA 4IXNA 3U3OA 2J59A 1T0HB 4LK2A 4RY2A 1Z2AA 1EX6A 4LOAA 4RZ3A 1RIFA 4LC1A 2QM8A 4LYAA 3GLFB 3LQQA 5A0FA 1H8ED 3I92A 1W4RA 4D25A 1T3SA 2DFKB 3CNLA 3MLEA 1LW7A 4QBIA 4URXR 1MKYA 1P9NA 3UIEA 5J4VA 1KMQA 3THWB 3U44B 1GILA 1XZPA 1CJVC 4B3XA 5K8LA 2DB3A 4U02A 1M7HA 1L8QA 3BC1A 3BGWA 4EFMA 4MKIA 4BWYA 2QORA 1W0KA 4JKYA 4BLTA 1KTVA 1UKEA 2BHRA 2IYLD 721PA 4BECA 2NIPA 4PO1A 2G6BA 2V54A 2V8OA 3BS4A 4RKFA 4AK9A 8OHMA 3CNOA 3M6AA 1IHUA 3LQRA 2J9RA 4CVNA 2ZROA 3AM1A 1NG9A 4NYJQ 1J8MF 2Q21A 5JSZA 2AFIE 2NO6A 3CZQA 2C8VA 2IUUA 1G8YA 5LB4A 3B6EA 4P32A 1UAAA 2XNSA 4NYMR 1II8A 2CHQA 4PC7A 3HPQA 1YZQA 2JLUA 5IF9A 1ONBA 1SVOA 1W0JD 4M1MA 4Q9HA 4Q4JA 4RZXA 4A2QA 3M4YA 1HURA 3BH0A 4RFVA 1EWRA 1FQKA 4Q66C 1CR1A 1M7BA 3WYGA 3PEWA 4UNSA 1AQYA 1S3GA 2V7QD 3OAAD 4TLCA 4E03A 2ZXUA 1N6PA 4B34A 3AF4A 3WNBA 2AK2A 2K5UA 4QM6A 1SHKA 1JPJA 2GJ9A 2O52A 4E07A 1KKMA 5BN5A 3NG1A 4HUTA 3MWYW 4ESHA 4NL4H 1ELOA 2WSSA 4O2LA 3PEYA 2Q6TA 5KDDA 5FPHA 1CP2A 3CWZA 1JALA 5GADl 4OI1A 4MGIR 2IUSA 1L7VC 3SJCA 1CRPA 2GJAA 5HKKD 1T8UA 4LJYA 4TQAA 1T9HA 1N5IA 1Q0UA 4I1SA 1SHZA 3RS7A 2P5SA 2G1JA 4B47A 1QF9A 3CIOA 3I4LA 4I1OA 1W1WA 3X1XA 1XPRA 1OXTA 2ZE7A 2MSEB 3F8TA 2JIZD 3K9HA 1QG2A 2YVUA 2WWIA 2NGRA 3BFXA 3NH6A 3RRZA 3P1JA 4M1WA 3OE7A 2AX4A 5DI9A 4MDEA 2QMHA 5CM8B 2PCLA 2ZM5A 3PQCA 2O0HA 4LUCA 3K1JA 4B43A 4IFBA 4HLDA 4YDHB 4ITRC 1WE2A 1KK3A 1XEXB 2D74A 1E79D 1G3RA 1NMYA 1OHHD 3PIRA 2IC5A 4I4LA 3WP1B 2BMDA 3CH4B 3L2OB 1BH2A 1VYTA 4EQ6A 3FMIA 4ZCLA 2HLDD 2QM7A 3GLHE 6Q21A 1DELA 5J47A 4F7WA 5LPNA 4GNKA 3AVYA 1GL9B 5F9FA 3IHLA 4LDJA 2IEZA 1XTQA 1CXZA 4GZMA 3QUSA 4WBSA 2ORVA 4JIMA 5H8WA 1QHGA 4JLMA 4M21A 3T5GA 3ZH9B 1HTWA 1UEIA 2EVWX 4IKEA 5FPKA 2PT5A 4HDOB 4PQFA 3WRXC 1HQYE 5FR2A 1DADA 3EPJA 1T4GA 2KWIA 2ZRDA 3EZFA 1XXHB 5EUQB 3TUIC 2SHKA 4KJZA 1E9AA 3WMGA 2OT3B 2GVDC 2W2TA 2HT1A 3B1WA 2ZE6A 2QRNA 2P67A 2I1VB 5TDHA 1VDZA 2WJJA 4C0JA 1QVAA 5FR1A 3EPHA 1QHNA 2IBMA 1P62B 1YR7A 5KDLA 1OIVA 3AF1A 3NBYC 3EWAA 2XOKA 3W90A 3SFZA 3FHTA 3LW8A 3LBHA 4A2PA 1AS3A 1QHIA 3B78A 4JBXA 3GLFE 1P3JA 3GJ8A 3KJHA 1RVDA 1GDDA 4A15A 4LHVA 5TY0A 4CZ2A 1K5GA 2IYRA 3SZRA 5KU1A 1OKKD 3R8FA 1N6NA 2FH5B 1NF3A 3OEHA 3V4FA 3VX4A 3BB1A 4DZZA 2QP3A 3AVPA 1Z0JA 1G16A 4Q4LA 3CRMA 1WMSA 3R7WA 2ZS7A 5UKDA 2MMGA 2WMNB 3K0AB 3LVRE 3NH9A 2B7BA 3KJEA 1F3OA 3TVDA 1Q44A 1ETUA 1KI4A 1KJZA 4ZV4A 1N6LA 2DWQA 2VA8A 4YMVA 3OESA 1ZNZA 4LYFA 3MG9A 4DSTA 1P60A 2EQBA 5EE5B 4BFVA 4RCZA 2E87A 2YOHA 4DLZA 3RS5A 1X1SA 1ZIOA 2GVZC 5FTMA 4DT1A 1AQUA 1G18A 2AK3A 4GZLA 3V00A 5DN6D 2JLXA 4M1KA 1VYVA 3QXCA 4C0HA 2YOFA 3KXLA 1HYQA 3GD7A 5TVKA 3ZLJA 3EA0A 2I4IA 4WXRA 2W0SA 5FL3A 1YR8A 4G5OA 2H1LA 3WRYC 2OESA 4CT5A 4A8JB 3TSOA 3CX7A 4LBVA 4M1SA 1NSFA 4JYBA 5B58C 1SZPA 2IS6A 5BQ5A 1SVSA 5F3WB 2AD1A 2XXAA 3QKSA 2JLYA 4LGMA 2J7KA 1G19A 3HR7A 4GT1A 1DAHA 4EDHA 5CITA 3BORA 4YLGA 1QDEA 1G3MA 4U5XA 2YWFA 4YMTA 3QKRA 3DOFA 4UXHA 3REFA 4W9MC 4UKDA 1A2KC 2IUTA 3FKSA 4LYHA 5P21A 3G0HA 2BBWA 4H1UA 5GJVC 3BAFA 5HE8A 2G0NA 1SKQA 4HEJA 4Q4HB 4O2RA 1YKSA 1AKEA 3GPLA 3LAWA 4LSGA 2W6JD 1ESMA 1Z07A 3GFOA 3KKMA 4Q1CA 2ORIA 5EZ6B 1WBDA 3CH5A 2J45A 4ZIRB 3TAHA 4CF7A 4FMDF 1G7TA 2AFHE 2AL7A 2FPLA 3MWKA 4IRUB 3RVBA 1DARA 3ICEA 1GL6A 4V03A 2DFTA 521PA 3KXKA 1KDPA 4V0LA 4NCIA 3P27A 1JR3D 1KAGA 5IDVA 2Z43A 1QRAA 3W6NA 2AD5A 1GP2A 4AKGA 1E98A 2ZRHA 4JMPA 5FUVA 1R5OA 2QL6A 1W36C 4OQNA 3FDIA 2QBYB 4QHTA 2BM0A 4MRVA 4C0BA 2OFXA 2FSIA 5L3SA 4YMUA 2ZJOA 1KO7A 2REBA 2A9KA 4F91B 1IQPA 1IY2A 1GNPA 3K09C 3AVUA 1V43A 1H65A 4Z1MD 4TLEA 1NY5A 3B1VA 5FI1B 1Z63A 5FTJA 4YXWD 4JBWA 3EZ2A 3EC1A 1T5IA 1MO5A 1ZM9A 5DHFA 1ZD9A 1JAHA 2OCPA 1XBTA 2B92A 1BYIA 1P2SA 3GLGB 4XTCS 4HZUB 3WY9A 4RKEA 5L3QA 3L0OA 1E99A 1XTRA 5AUNB 1S1MA 1R0YA 3MWLA 1TL7C 4MRRA 1G5RA 1FQJA 3ZD7A 1S2MA 1GRQA 2JLQA 1KSJA 2BVNA 3LWNA 4ZPXA 3FMFA 5JHHB 1AKYA 3HYTA 4BEJA 2ZI9A 2BV3A 3V9PA 1CEEA 2OAP1 4XVQA 2O5VA 5C4MA 4ESVA 5EUMA 5DYIA 3FWYA 1AJEA 1ZUIA 4W5WA 2JDIA 2AXNA 4K81B 2FA9A 4C30A 4PPQA 2RGGA 3T5DA 1S1CA 2QAGA 1E2QA 1F2TA 4ZCIA 5FTNA 1W4BA 1F2UB 2VF8A 1FOEB 1I2DA 4BZPA 4PFSA 2CCGA 1PLJA 1QHHB 3HYRA 621PA 3W9YA 1W0KD 1UEJA 1OE0A 3SN6A 4BFYA 2JLVA 5AJYA 3E70C 2GHIA 4M1OA 3UMRA 3TNFA 1E9EA 2C78A 1Z08A 4B73A 3LXXA 4TTRA 2NO7A 3A4NA 4D2IA 4Q1DA 3KKQA 5JZVA 2BEKA 2PT7A 3ZZ0A 3B9QA 3GP8A 1XWIA 3IBGA 4WZ6A 1CJTC 2FEMA 4BLPA 1X1RA 1S9DA 5IK2A 1X8KA 4NH0A 3HU3A 3KXIA 4JSYA 4TYWA 1Z5ZA 4A6PA 2V6IA 3ZDQA 4IDHA 1HA3A 2V6JA 1CS4C 2IT1A 2IA5A 3N5CA 3RDPA 4C3ZA 1GTVA 4QL3A 4R71A 4CIDA 1OXVA 1G3IA 1MRSA 3AVTA 4FD2A 2B8WA 4KXFB 1E4VA 1I2MA 4ZKEA 1P9WA 2ZUBA 4DLWA 4AKIA 2VSFA 4MGYR 2V4ZA 3QVVA 2F9LA 4S2EA 2IYZA 2O8DA 3ZYCA 1RJ9B 1US8B 1XX6A 2V9PA 3GEEA 4LY6A 4LHYA 4PQRA 1WQ1R 2CCJA 4ABYA 4BQSA 4HUQA 2D62A 3VR4A 3ZS8A 2CJWA 1MO4A 2QTVB 1Q1BA 1XJ0A 4Q7JB 1MV5A 2FU5C 4F38A 3VU9A 2WSSD 1HE1C 2YV5A 3E5HA 3WMFA 4A0RA 4F4JA 4NCKA 2WJGA 3K0EA 3P4XA 2IYUA 3RS0A 2WHXA 2A78A 4JLJA 5LD2C 2HF8A 2EYQA 1FX0A 1XDBA 1YZLA 1YE8A 4JLOA 3G82C 4DBLC 4GL2A 3DVLA 4XD7A 4YONB 2X8AA 1OH7A 4KV9A 3QEJA 1KI7A 1AM4D 2WMOB 4DCNA 3SYKA 4EPVA 1DVRA 1DAMA 2FGJA 1FL9A 3K70C 5DI3B 2QPAA 3OE7D 3E2IA 3JZMA 1GUAA 3RLFA 3O8CA 1YZKA 3OFNA 4GFDA 3VR1A 3PJRA 5BYKA 2AKYA 1E2HA 4E09A 1U0HC 3A1SA 1D2NA 4BPBA 1KMHA 4FWTA 4JLVA 3T1TA 2XTZA 5SZJA 3VTKA 1XTIA 4LJ5A 4Q4AA 1W36D 4C4PA 2VHQA 1SULA 5JECA 2J87A 1KHTA 5EQTA 4YQFA 3EX7C 3AP1A 1LB1B 3CZPA 4KU4A 2N1BA 3VKGA 4AG6A 3P26A 3SU8A 5KDOA 2ZSDA 4RD1A 1OH8A 2ZS8A 3PCRB 5CDFA 1MH1A 3P20A 2D7DA 1SXJA 1Z0IA 4NYMQ 1KDTA 4C0LA 3GCGA 2ZS9A 2HCJB 3GLGE 4TZ6A 4N0EA 2A5FA 2IEYA 3T35A 1UDXA 1QHXA 5C4GB 4DC9A 2RCNA 3B13B 4Q1EA 2OHFA 5EE0A 1A82A 2PJZA 2W6IA 3TUJC 4IOKA 3Q7PA 3U6BA 1IN8A 5E7IA 1FNNA 2GCNA 5KO2A 4JJZA 5FOUA 1ZU5A 3X1WA 2GESA 4Q5IA 2XOKD 3ADCA 4DDVA 4QGGA 3U3MA 4CW7A 2FDCA 1E9SA 3RS2A 1X8LA 4DEYA 1X3SA 5JMTA 1GSIA 1LS1A 4DLSA 1XPUA 2PLFA 1NBMA 1TADA 1BS1A 4XOIA 1VCOA 1T6NA 5G3ZA 3SJZA 1G6HA 1MABA 2UZ3A 2FF7A 3DM9B 4MQBA 2HDNB 3ZVRA 3IQXA 1TF5A 4LV5B 1P75A 3EAQA 2XNDA 4D80A 3B85A 1AK2A 2QQ0A 3ICQB 3I1FA 3I8XA 1CTQA 3W34A 1DG1G 2PZGA 2ZI4A 3B2EA 2HCBA 5JSZB 1N6RA 1NBME 1D9XA 4N3NA 2IYVA 3KKPA 5FOSA 4F93B 2A30A 2OG2A 2FNAA 2ECKA 1Z6TA 3AB3A 4IOLA 4TT3D 4A8JC 2OEPA 5SZIA 1II8B 1NRJB 3QENA 1TQ6A 3BB3A 3TK1A 3N2IA 3EIEA 1TMKA 5TB5A 2ZAOA 5HTKA 1JXMA 2VF7A 4K46A 2QA5A 5CIWA 4QHYA 2TMKA 3CX8A 4PC2A 4Q4JB 4Z54A 2YKGA 1N5JA 4DXAA 1U0JA 2GA8A 3C41J 3ND8A 4GP7A 1E0KA 3HR8A 1DAFA 4TYQA 1X86B 1EWQA 4ZI3A 3GFPA 3RANA 3PUZA 1BKDR 3SFVA 2YINC 2YC2C 2VP6A 1W4AA 3BIFA 3GJXC 2GK6A 3BH7A 2G1KA 1B0UA 2Z4SA 2ZYWX 3I3SR 1N0UA 4FN5A 2QZ4A 2F1JA 2W58A 5GVRA 4URUR 1O87A 1VHTA 5AUQA 3ADBA 2GDJA 3FKSD 3GEHA 2F55A 4CRWB 5KSZA 4ASUA 4QJ5A 1N3BA 1GZSA 4DLYA 4N1AA 2FGKA 2GEVA 3AH8A 3K9LA 1ANKA 2WKRA 3QJYA 5AJVB 5E4FA 1Q12A 3QEOA 2BWJA 2YYZA 4OHVA 4B3BA 2QROA 4LJ7A 3QNUA 4HATA 4DSNA 2WBLC 1LNZA 1NN0A 3QIAA 1TUEA 3PFIA 4Q18A 4JLKA 3RC8A 2IS4A 2ZSEA 4B3CA 1KI2A 1W44A 1AN0A 2FZ4A 3CUEF 1KK2A 4IJMA 4M0LA 3K70D 3AEZA 1E9RA 4WOPA 1SVMA 2ZR7A 3BOSA 4ZO4A 4GPTA 4DEXA 2ZI7A 4A0GA 1RRGA 2GEDA 1FZQA 2R65A 4D4JA 3IO5A 4JSTA 4LJ6A 1W36B 4EQ6B 2A5GA 2DY1A 1QG4A 4TQUS 4NCJA 5FUXA 3AUYA 1M1YE 4KODA 3X2SA 4WW0A 1COWA 4FWIB 2ZEJA 1CBUA 1ZMXA 4OK6A 1KOFA 3NDBB 5FPYA 1IXRC 1PUIA 1KY3A 2DR3A 3R9IA 3U61B 1RE0A 2QY9A 1GOTA 2WKQA 3MCAA 2NMVA 2REXB 1TUIA 4FIDA 1UPTA 3KL4A 4B35A 2F1HA 3ONWA 4MYUA 1ZUNB 2BMFA 3SR0A 3K53A 2QUZA 2FMXA 4B33A 3I72A 2KBEA 4MH0R 4H9GA 2VBCA 2J7PA 3Q5DA 4IVPA 3Q8XB 3A4MA 4B48A 3GJ7A 2BBOA 4BGDA 3CBQA 1U0LA 4AC9A 3RRNA 1W48A 3QBVA 3RWOA 4D82A 5TARA 1FMJA 1KJYA 2GZDA 1Z6XA 2E1RA 4X8LA 3VHLB 1WXQA 2GF0A 1YR6A 1JQJC 3B9PA 4AWXA 3LXRA 4EPWA 1A1VA 4YDSA 221PA 5C46F 3BB4A 3UMSA 5DE3A 5EJEA 2VP5A 3GJ6A 2FSGA 5EZ5A 1W2GA 3AF3A 4EPYA 4D26A 2JATA 3DKPA 4FXPA 3RS4A 1XCGB 1F48A 1F5NA 2ORWA 5CYPA 1XCMA 3ADKA 3WBKA 3ZZTA 4Q7KA 3VNVA 3QXXA 4R98A 1DPFA 4TTQA 2Q3HA 1GKIA 3U3JA 1K8RA 3JVVA 3GLIA 1IONA 1NL3A 3NEYA 1YQTA 1KGDA 2ZRNA 3EWSA 4KAXA 3ZJYA 3O8DA 4I1UA 5CK5A 5JI3E 2BEJA 4IDOA 2R8RA 1FUUA 2JASA 2XZPA 4PXAA 4WAUA 2JA1A 4MGKR 1II0A 1NLZA 2XSZA 5LDDC 2JJ2A 4P3YA 5GJWC 5IK2D 1Q1EA 3I5YA 2N46A 3QY0A 1ZM3A 2ZUDA 1RRPA 3BK7A 4LJ4A 4DT1B 3QE0A 1D2EA 1R0WA 5LB2A 2OCYC 4KLNA 4TL9A 1KI3A 2VP9A 5DLQC 3NEJA 1ZNXA 3GLIE 3T1VA 3AQ4A 3FHOA 1OYWA 2WJVA 5HZHA 1B23P 3CRVA 3FTQA 4TTPA 4MKHA 2C03A 1G8GA 5CB6A 1TEVA 1KSFX 2PZFA 4DHEA 3MMPA 5FL7D 2W00A 1KI6A 2EFDB 2XXAB 4R2HA 2VP4A 3H0KA 5HCIA 3QKSB 4TMXA 1I4DD 4Q48A 4GDFA 3RNLA 2GAAA 1KO8A 1Z0FA 3SNHA 1XMJA 3QKRB 3SBDA 3LBIA 4JT2A 2CLDX 1U81A 3VKHA 1VG9B 4B6EA 2HYIC 3SQXA 4EPRA 3FE2A 1IN5A 1VCMA 1XMIA 1XJCA 3LDAA 4LRWA 4B2IA 5LD2B 4A4DA 3NKVA 4FMCF 3GEIA 1N25A 4TQ9A 4XD7D 2R9VA 5EXXA 1OF1A 4OKSA 3GJ4A 5AJZA 1G6OA 3QKUA 3K70B 2JGNA 5FPTA 1N6KA 2ODEA 2ATXA 4HB3A 1HE8B 3OFND 5L3VA 2JAQA 3OIWA 3TQFA 4D4LA 1J7KA 2KE5A 2LKCA 2BCGY 4GRAA 2EFCB 4PC3A 3TJZA 1L4UA 3TLXA 2RB4A 2WPDD 2BM1A 3LRPA 1RRCA 2PX0A 2RHMA 2C96A 3AKDA 4A92A 4LBZA 4OI0A 4RJLA 5L3SB 1Z83A 3MRSA 2WICA 4MYCA 5G40A 3VR5A 4CT4B 2C99A 4LV8B 4Q47A 4JVNA 3DDCA 4Q00A 2ODNA 2BJWA 3MFYA 4DCTA 2ZRLA 2DFNA 1T0JB 3DZ8A 2IF0A 4IDPA 1G21E 2OFOA 4M1YA 4OHWA 1Z6YA 1ZIPA 1GL7A 1NVWQ 2ASEA 1VYUA 2VHCA 5ANRB 2FOLA 2QT0A 5L3QB 2RGXA 1OW3B 2D4HA 1LFDB 2Q3MA 3VFDA 4C2TA 3SE0A 1JNYA 3U7HB 1K5DA 2QP9X 2AKAB 2G77B 3KTAB 3PR1A 5JBQA 5E95A 1E96A 4P0TA 4E22A 2O8FA 4B3DA 1G41A 2QE7A 5EXSA 3SQWA 2D3WA 3SHWA 4UJ3A 4PSAA 4KLZA 1KK0A 1DOAA 2GZHA 2HT6A 5FBWB 2IS2A 4V0OA 1EFUA 3KUDA 5IT5A 2WWGA 1ZJ6A 1DEKA 2ZU0C 3DL0A 1Z2CA 1F2TB 4GMXA 5AUOB 2FEOA 2GWHA 3A36A 3A1WA 5G53C 4AIIA 1G3QA 1ZW6A 2F6RA 2HYDA 3T1OA 2CCKA 1NBMD 1S96A 1CIPA 1M8PA 1T3HA 4I1VA 1S4QA 4WIAA 1LF0A 2OFWA 4W5JA 4LZZA 3W6PA 1LVGA 4D81A 3H1TA 5B2ZA 2Z0MA 4L16A 3UWKA 2GCPA 5HE9A 2O8EA 3CRRA 1EFHA 3W6OA 3T06B 3GQBA 4TLAA 3U5ZB 1PLKA 1W2HA 2CK3A 1EFRA 4CYMA 3TGPA 4AURA 1IAQA 4DJTA 2ZRJA 1KI9A 2QTFA 3A1TA 1Z28A 2YWGA 1NSTA 2R6CA 2X2FA 4M9QA 4V0KA 1DO2A 5KYKA 3QF7A 1OIXA 3K8YA 2IWHA 3QVUA 3A1UA 2GRJA 2DFLA 3IEUA 5CIQA 1C9KA 1RYHA 4TWZA 1JB1A 2LKDA 3ND9A 5FOVA 1DG3A 4Q9LA 1ZAKA 2EU8A 3KB1A 3QPWA 1ZRHA 1Q3TA 4QHSA 3DMDA 3VR2A 5DHAA 3C5HA 3EW9A 4JKIA 1TTTA 3RABA 2O8DB 1XEWY 2IXEA 2F3RA 2VQSA 4IEEA 4EUNA 2B6HA 5DO9A 4HUQB 3W3AA 2CJWB 1IXSB 2ZU6A 3HWSA 4TLDA 1XD2B 4MKFA 4E5UA 1E9BA 1Q3HA 3UATA 3PUVA 3SHFA 2A2ZA 3VHXA 1IOZA 3VU9B 2VL7A 3B82A 4UXJA 2GILA 4H1VA 3VMFA 4EJSA 1X6VA 1E4YA 1VCIA 3ECCA 2OILA 2WWWA 2J1LA 2ZRBA 2CDNA 3LH5A 4LHWA 2GAOA 3X1ZA 5K8UA 1SVLA 3EA5A 2VPPA 4R7ZA 2MSDB 4N0DA 4Z8YA 2W83A 1XEFA 1FX0B 2ZJ8A 4BZQA 4L5BA 1YZNA 3A8TA 4LJ8A 3OEEA 4C0SA 4ASUD 2W2VA 3KFVA 1BMFD 2WWXA 1W5TA 3PEVA 5G41A 2I1QA 1AGPA 5IHPA 3ZGXA 4PZZA 4HYYA 2X77A 2JLZA 3BBPA 1XMVA 3EIQA 4PX9A 1KKLA 5EP3A 4PAMA 3NVAA 4IVQA 5C1BA 2QU8A 4DIDA 2FE4A 3LX8A 2IYTA 3PV0A 5F98A 5JJIA 1OYYA 3ZS9A 3THYB 3WNDA 2ZRCA 4RD4A 2GXAA 1BYUA 3NTUA 4LJ9A 5AJWA 3F3YA 1KMHB 4HAZA 2OCBA 2YHSA 1E32A 3PEUA 4NONA 3MAAC 4Q4AB 1KDOA 1VECA 2ZITA 2ZSFA 2HXSA 1RW4A 3AF0A 2WJYA 3UK6A 2FFAA 1E9DA 2O8CA 1NNEA 4QGHA 4OBEA 4Q9IA 4ARZB 1SVWA 1I4TD 1HT2E 1W49A 2DCUA 4QNMA 1CF4A 2C9CA 3CPHA 2OXCA 4Q19A 3WXMA 1M2OB 5D3QA 1SXJB 1PZNA 4DLVA 3U6KA 2QNRA 5CYOA 3THOA 5BYJA 1G291 1ZCBA 1WF3A 2GEUA 2PLRA 2WJHA 4WVFA 5KSYA 1RRFA 3K0SA 4OI4A 2Q9BA 5BN3A 4I99A 3K9GA 3KUCA 3NIBA 1G8PA 1ZC3A 1G1MA 3LO5A 3PITA 2J7PD 4RZ2A 1P6XA 1K6MA 4Q9JA 2RAPA 3AVWA 3VKWA 1DO0A 1NP6A 1JJ7A 1OJLA 1P72A 4HLUA 5CK4A 3W5JA 1N6OA 1YRAA 3I5XA 1WBBA 3B8HA 4C0AC 2VSOA 3DHWC 3THXA 2GTPA 3WHLA 1P73A 2R6GA 4L4UA 1AA9A 1QZXA 3Q85A 1GFIA 5CLQA 2XZOA 2V3CC 4PHFA 3ASYA 3QOFA 4NDZA 4M9ZA 2D2EA 1HT1E 3UKDA 1MABB 4XSGA 1NN3A 5M04A 3QXJA 1N6IA 4TLBA 1OH5A 3AVXA 4R9UC 2ZSBA 3C8UA 1CU1A 3U60B 2UZIR 3G5UA 4OQLA 4A82A 2QEQA 2MMCA 3AF2A 1QHSA 3BXZA 4NYIR 1ZP6A 1P2TA 5JWHA 3D31A 4MA4A 3ZZUA 3KFXA 3QBTA 3AGQA 2IW3A 3GMTA 3Q9LA 4C2UA 4NU0A 1ZYUA 4JYCA 2JJ2D 3O8RA 3EARA 4WA7A 3TR5A 3VX3A 2W2XA 2LCFA 4HI0E 4Q1BA 4RCYA 2XX3A 2YNMA 1OH6A 2X19A 2P2LA 1ZINA 2GNOA 5AJXA 2QSYA 1TQ4A 1GRNA 2YWEA 3NC1C 3PUYA 2FWRA 1OXSC 2WSMA 2ZI6A 3E1SA 5HZKA 1AGRA 2A7QA 2X1VA 5HKKA 3RRYA 4KFRA 4Q01A 2C77A 4PANA 2WOOA 3KQNA 2ZJAA 1VTKA 2CBZA 2CL0X 1TQ2A 5FTLA 2WWHA 4D4MA 1OFTA 1P9RA 1GG2A 3LFUA 3QXSA 2ERYA 2QSZA 1DS6A 1UJ2A 3EXAA 4RD2A 4Z51A 2GXSA 4AD8A 2P65A 4JL8A 2ZI5A 4URWR 4POAA 1YZUA 1HV8A 4FMCB 4PPNA 3TUZC 1U99A 3U7GA 2JLSA 2R6AA 2VO1A 3LV8A 2WAYA 3IIKA 3UXMA 2CHGA 5JJLA 1U2RA 3CM0A 3VAAA 3REGA 4DLUA 4ZDJA 1E2IA 4B2PA 1E79A 3IIJA 1OHHA 1SGWA 2CVFA 4HLQB 1SQ5A 2HEIA 3ADDA 4CEIA 2WJIA 1Z6AA 4P4SA 5J4HA 2H18A 4HSEA 2P5TB 3C15C 2BMJA 2FG5A 2HLDA 3JVUA 3IQWA 4HDCA 4B2LA 2J0VA 2CXXA 2ANCA 2WVJA 4IW3B 4NKRA 2J46A 4TMTA 3SS8A 1RPZA 2VH5R 1M7GA 3TW8B 1VIAA 2ATVA 2J0UA 1G9XA 3MJRA 3K0CA 5BN4A 3IO3A 4DWJA 2FX3A 1D5CA 2RH5A 2OO7A 4B6FA 1Z0AA 4DLTA 2ZE5A 4ZI2A 1RKBA 1N0WA 2NG1A 4Z8XA 2YWHA 4IOMA 2A5JA 4W7SA 1YU9A 2H5EA 5H68A 4U7DA 4CEJA 4MYHA 2F43A 2QI9C 4NBSA 1OXXK 2FPMA 2Q9CA 5CJ2A 2VTKA 1J2JA 4OQXA 1KSGA 3OHMA 2ODBA 4BZXA 4ZKDA 2WOJA 1TNDA 3HJNA 2C98A 1KYIA 4FCVA 1E2FA 2NTYC 2YZ2A 3DKVA 4HB0A 1W5SA 3J81k 2B7CA 3L82B 3KQKA 3KKOA 4G5QA 4CEHA 1ZC4A 1R4AA 4ACAA 5B57C 5CDFE 1VHLA 2RHDA 4KBGA 1SXJE 1R0XA 2QAGC 3V4RA 1JPNA 2BMEA 4DVGA 1JEEA 2GCOA 4NPHA 2AHOA 4EFLA 2BCJQ 1ZD1A 3D6TB 4OHXA 4NMMA 4MKGA 4PPGA 5HCNA 2WKPA 2R6DA 3EASA 2XB4A 5FUYA 4TL6A 3TKLA 1UBEA 1KNQA 1OKKA 3TMKA 2OBNA 1RFLA 5AR1A 2IWRA 3OEHD 2WWYA 4MYTA 5JLJA 2XZLA 3Q72A 2XGJA 1KI8A 4BRUA 5A5GA 3FYHA 1FFHA 1WB9A 1XB2A 3CWQA 3K0FA 3RS3A 1XMSA 3MWJA 2Q9AA 2PH1A 1E94E 1Z47A 3CF0A 2CLSA 3CO5A 3R20A 3RAPR 1GAJA 2EFEB 2J5XA 3CX6A 5KNCA 4NTZA 5IRCD 4IEIA 2VIIA 4PC1A 1CJUC 4FMBB 5KNBA 2ZRFA 3TRFA 3EPKA 1IN7A 5JWRA 2FFHA 2MSCB 3ASZA 3GLIB 4KVAA 4M53A 1MR3F 4LX0A 4HB2A 3LW7A 4OK5A 2HXYA 4L9SA 1KAOA 1EFRD 2CK3D 2PMDA 2RGBA 3KDSE 2QTHA 1IJEA 2QT1A 4TMWA 2OSBA 1YZTA 2HJVA 1J90A 3CB4A 4TZ0A 4LWZA 1VCNA 1BIFA 1GITA 1ZVQA 4JBYA 4P4UA 4PZYA 3IUYA 3T12A 3N70A 1U8AA 3A1VA 4JVSB 1W46A 2GKSA 5AK0A 4V0NA 3NHBA 3WBJA 2JEOA 3C4JA 4XJXA 5K8TA 1ZNYA 2VHTA 4A6XA 1XF9A 2QGZA 2QPOA 1NLFA 1Z22A 3PXGA 2ZRIA 2WIBA 2CMKA 4QM7A 1HQCA 1CR2A 1NVVR 4QXAA 3C5CA 4NHOA 1N6HA 2OLJA 3U2QA 1KI6B 4EPXA 2R44A 3B1XA 3NBXX 4YC7A 4FCTA 4TMKA 2Y8EA 2R2AA 4X8OA 2QPTA 2G0TA 4B76A 3LLUA 2XB2A 1OT3A 2WAXA 2FSFA 1E9CA 1IBRA 2J41A 1D6JA 2ZYVX 4OQFA 4DDWA 1GVNB 3MD0A 2V1UA 1N2CE 1E2MA 3ZVNA 4JL5A 3LBNA 1JR3A 1R10A 1Q22A 2IHBA 2IS1A 3PUXA 4D0GA 3UG6A 3L0SA 4NP6A 4M1TA 2ZJZA 3RWMB 3B7GA 1BO6A 1MO6A 2Q3FA 3OEED 3Q5EA 1XFAA 3L8YA 2DBYA 5JJKA 4JZKA 2F9MA 3HDTA 2AWOA 3CLVA 1Q20A 3TAUA 3X1YA 3AVOA 1A4RA 1VPLA 3LD9A 4ON9A 3B60A 5JS7A 3I62A 4F92B 1NVXQ 4QC2A 1KO5A 1TU3A 3LX5A 5GVSA 4Q02A 1L4YA 2ZTSA 1JAIA 4US1R 1KO1A 3C16C 2NO1A 4MRNA 1UBFA 4PTLA 4YXWA 3UG7A 4BFXA 2RGNA 3IPXA 5A4JA 3GJ5A 1SXJC 1M34E 1HEIA 3BE4A 3R8CA 3MSXA 5FBRB 1OPXA 4IFEA 3AVVA 2DWOA 1FP7A 1XTSA 2OLKA 5EP2A 4Q9KA 4ZDKA 3FPAA 4OK3A 4AYTA 1SKYB 2A5YB 3LNCA 3F0TA 3I32A 4RD0A 2QGNA 2OV2A 4FW9A 4C7OA 2O8BA 1UBGA 1H8HA 2P3SA 2G83A 5J4YA 5CLLA 2ZE8A 4KCGA 4JVLA 4FCWA 3BFKA 3MGCA 1CKEA 1CJKC 1IJFA 1PLLA 1JJVA 2AXPA 4DIEA 1U90A 1JEDA 1U8YA 821PA 2JDID 4EFNA 4LBWA 1Z8FA 4OJQA 2PEZA 3A58B 3T15A 4KSBA 5GJBA 4MGZR 1G4AE 2B8TA 2O8FB 4A2WA 1NKSA 4M4SA 2UVQA 2QRZA 4MITA 2FPKA 5C2JB 2KI5A 2A5DA 2QMEA 4OHZA 3SOPA 1XU4A 3R7WB 4TMZA 2GXQA 4KBFA 3PG5A 3KZ1E 1YVDA 2R62A 4IDNA 1TF2A 4V0MA 3T1QA 1E2EA 4A9AA 5JEDA 4LJAA 1P7CA 3QG5A 1VG1A 1E1QA 4ZDIA 1JBKA 4PAOA 1AZSC 5FBQB 3FKQA 2DHRA 4GSYA 5GJCA 2HF9A 4UNQA 3L0PA 2BKUA 3CF6R 4IXMA 1N0VC 2ZPTX 3RHFA 3GJ0A 1G7SA 1R8QA 4JVMA 4K8OA 4O3MA 5JI2E 3FGNA 1P2VA 2PZEA 4BE7B 2O8EB 1JR6A 4BEBA 5H70A 2NO9A 3CNNA 4RFSA 4V0ME 4PHHA 4TSFA 5EXPA 4D0LB 2P6NA 5CM9C 2D7CA 4LI0A 4JJKA 3KQHA 2BJVA 4JLBA 4II7A 5J40A 4G1UC 2I3BA 3T61A 121PA 4KFSA 3KJGA 1PUJA 1GNRA 1R7RA 3H86A 3BRWD 1E2JA 5CJPA 4B71A 1G64A 2CLCX 3AVQA 1HY3A 4LYJA 4NCHA 4RZUA 1UBCA 4P4TA 4KVGA 2REOA 3UMFA 3MJHA 2GETA 2EFHB 2ZJBA 2IHYA 2OM2A 4QG7A 5B30A 2WZQA 1NVUQ 4UNRA 4DB4A 2XJ4A 2OUKA 4LBYA 4C0QC 4TL7A 2G3YA 4UQOA 2RGCA 2RKOA 1T8TA 3S1AA 3T34A 3ZVMA 4G3XA 1IN4A 1E2NA 5LBIA 3TH5A 5J4KA 3CKLA 1WP9A 1GM5A 1R5BA 1GIAA 421PA 1MRNA 1TF7A 2HJGA 1R0ZA 2PEYA 3DPUA 3A4LA 1PV4A 4RD6A 2IK8A 4L8GA 2DPXA 5EXTA 5JEEA 5FOXA 2ZANA 3EZ9A 5L3RA 5FBVB 1XPOA 4BUJA 3TE6A 3BD9A 4DB2A 4G5GA 4NCNA 3U7EB 4NZYA 3U4QA 4G01B 4DLRA 4BRWA 4L9WA 2PBRA 4XWKA 1KDRA 3QF4A 1ZM4A 4EJSB 4B75A 1UM8A 2B21A 3FFAA 5D3MA 3GLHA 2NZ8A 1XJQA 2CE2X 4WZBE 3FB4A 4P33A 4D0NA 2JCSA 2GJ8A 2WV9A 1NLYA 5DISB 3SYLA 2NPFA 4M9SA 2JJ1A 2EFGA 2PMKA 1DAEA 4X8MA 1T3LA 4F4CA 1G20E 4KITB 2QMUA 5HPYB 2GF9A 2ZUCA 3AP2A 2H7VA 2ZVQX 4Q1FA 1N5LA 3ZIAA 5KUTA 3NWJA 1NI3A 2PX3A 4OJKA 4PR0A 4PQYA 1CJMA 4GI7A 2ODWA 2QMOA 4XTRA 4DCUA 4HB4A 4QJ4A 4RSGA 5TMPA 2IYYA 1KNXA 2IYSA 2RGNC 2CHVA 3WNCA 3K09A 3LY5A 3PUWA 4G0NA 1FMLA 3DEFA 1XP8A 3TR0A 5AUPB 2ZJ2A 3DM5A 2PJRA 3EG5A 4AKHA 4QBHA 1O3YA 4TYYA 4PSKA 3AUXA 2KB0A 1SXJD 2AR7A 3EC2A 1JI0A 3HPRA 4A1FA 2O8CB 3QKTA 2R6FA 3GLFA 4XWAA 4LHXA 4NYIQ 3SJBA 5JCZA 1VKJA 1KO4A 5JCPA 1SKYE 4JLAA 1U9IA 3DO6A 1GKYA 2XTNA 2W6ID 3THWA 2WTUA 3U44A 4B74A 1UKVY 2IL1A 3TSWA 3CRW1 1R6BX 1NMXA 5KPJA 1FNMA 3CPEA 1XTKA 2VLIA 2QAGB 4QKQA 4QBFA 1ODFA 2RMKA 5F2EA 2NOAA 2Z83A 5BW8A 3R9WA 4ERNA 1MO3A 1FW6A 4A0FA 2ZRKA 3WHKA 1E9FA 1UDWA 4OI2A 4XVRA 3L43A 3L8ZA 4PC6A 4TYNA 2IF2A 3M1IA 3THXB 3OF5A 1GWNA 2GBLA 4B3GA 4AKEA 2GJSA 2XNDD 3M0EA 1ZBDA 2QG6A 3AV0B 1CR4A 3U7FB 5TXGA 3WP0A 1TQDA 1XD9A 1Z0DA 1DAGA 4DCVA 4KYIB 2IXGA 2Q0HA 4TT3A 1IM2A 1VMAA 4FINA 3B1YA 2ZR9A 2ZYUX 4EAQA 1XCPA 2ZQ5A 1OV4A 1G3UA 3GFTA 1LV7A 2O0KA 2N42A 3KKNA 3TBKA 3BH6A 2CNWA 1M6NA 2VEDA 3VR6A 5CB8A 3TW4A 2IXFA 1E2LA 3R9XA 4GOJA 3SYNA 1OIWA 3RSLA 1W47A 2WWFA 1E0SA 4G5RA 4HDQB 2YJTD 4XIGS 1AIPA 3EZ6A 2JJ8A 2ZREA 2ANBA 4IHQA 2RGEA 2QAJA 3K9NA 3IGFA 1MT0A 2OAQ1 4M8NE 4NYJR 4MRSA 3QPUA 4URZR 5G3YA 2PCJA 3HU2A 4DUGA 3DOEA 1EFCA 1R2QA 3NBFA 1YZGA 1NJFA 4KHZA 1T5LA 2XJ9A 4TMVA 2ZRGA 3Q7QA 5FBLB 2L0XA 2XTMA 3OIYA 2ZR0A 2C95A 4GOKA 1NG1A 3CR7A 3FOZA 4DDUA 4ZCMA 1XEXA 3N2EA 2O0JA 4V02A 5SZKB 4MDFA 4DRZA 3ETLA 4U00A 2BIFA 4XWOA 3IDQA 4HAVA 1RC8A 1TEXA 1AS2A 1TPZA 4GBMA 2NQ2C 3VQTA 2ZETA 5FFMA 2CVHA 2J3EA 4AY2A 4L15A 5FH9A 2ZJYA 1KK1A 1DTSA 1F60A 4BFZA 1XD8A 4CEIB 4P4SB 1U8ZA 5KHOC 2ONKA 2C5LA 3BFVA 1EK0A 3NHAA 4CGZA 4AI6A 4FI3C 1II9A 2GJKA 4BLOA 2WM9B 1TAGA 3SC3A 3IILA 1S3SA 3CF2A 2J0UB 3KB2A 1COWD 4G5SA 1XXHA 3OZXA 4KO8A 5J4LA 3LLMA 3F5FA 1KSHA 3B1ZA 4LPSA 2BOVA 4Q21A 2FSHA 1M74A 4RVCA 5C18A 1E1RA 3CONA 1CRQA 2ZJ5A 3PVSA 1Q21A 1OB5A 4CEJB 2F43B 2OZEA 1Y63A 4QJ3A 4EPTA 2OBLA 1H8EA 1AS0A 1A5TA 5B64A 1NY6A 1TU4A 3TVTA 1U9IC 4I81A 3SDZA 3CPJB 1XXHE 1C1YA 2EWWA 2ZAMA 1E69A 1NN1A 4QGFA 2VRWA 3KTAA 4ACBA 1H8HD 5L8VA 3FHCB 2JLWA 3HP1A 1JXOA 1ZU4A 1NIPA 2WIAA 4XSHA 2XEXA 1VG0B 2OBMA 2A3RA 2C04A 4F4IA 4CEHB 5F9HA 4PAQA 1EX7A 2ZSAA 3CRQA 1Q57A 3W3ZB 3A6PC 3D3QA 4MUAA 4TYPA 4WXPA 2GCOB 1FUKA 5KPDA 1XZQA 3AP3A 4GOXA 4GMDA 3AKCA 4M2LA 3K0AA 1W4CA 3WYAA 1J99A 3IBYA 3ZVLA 3QI2A 4OL0A 4LHZA 1G17A 1NVVQ 2GBLC 4XH9B 5FTKA 2RGAA 4DDTA 4J0QA 2H92A 4D6PA 3MUFA 3RYTC 1OSNA 3WYFA 2X2EA 4TL8A 4PHGA 3K0FB 3H84A 1NN5A 2ZRAA 1A7JA 1DE0A 1E1QD 3EIHA 2FFQA 3O47A 4PO9A 1W0JA 2QENA 1CLUA 2UKDA 4URVR 5KOYA 1EGAA 2ZYTX 4QBGB 1VG8A 2XSZD 1RYFA 2V7QA 3OAAA 4US2R 2H17A 2YC4C 3QXHA 4KSCA 1ZD8A 3LA6A 3IIMA 1DAKA 1S9HA 4JLDA 1P2UA 4A8JA 5BXQC 4R2IA 1ESNA 3FMPB 1P61B 4M9XA 3IEVA 1R5NA 2H8KA 3IHWA 5JRJA 4TSFD 2F1IA 3KX2A 2ZIAA 3OIUA 5EE1A 1P5ZB 2V1XA 3C7KA 1E2GA 3DZDA 1A2BA 1S8FA 2BKEA 2CE7A 4LV6A 3FVQA 4JT4A 2HUPA 2KSQA 4BFSA 3JZAA 3AGPA 3UWOA 3I8SA 3HU1A 5KTYA
chains in the Genus database with same CATH superfamily
4DDKA 4GS5A 1RM5A 4GOLD 1GO2A 1AHNA 5L7WA 4RYDA 4L3WA 2OXTA 1FNCA 3A14A 1ZM7A 3GR6A 3NU1A 4OH7A 3KV1A 3WOVA 1XHLA 1JLLA 4EJSC 1MXHA 2IW1A 3TZCA 4REMA 4AYWA 4LVUA 2Z5VA 2M6SA 2Y6VA 4BJHB 4FDUA 2PO7A 3MOGA 4D9GA 3G2KA 1DBIA 1JILA 2AWNA 1Z5PA 2K4MA 3DEJA 4R9RA 1JB9A 5CX1A 3SEAA 5JCJA 3VC7A 1W19A 3F6BX 3D7MA 1LTQA 2FUCA 1KDYA 4AJEA 4D4GA 3PLRA 4TXLA 1EK2A 1IK6A 1U94A 2AN9A 4X41A 4PSVA 1KQPA 4QPCA 4YHHB 3HA2A 1H4TA 3FYTA 3LDHA 3QFFA 4K87A 4LCBA 4LNHA 3OZ7A 4WEOA 3ZDFA 1PGQA 4KYUA 4CU5A 2C84A 3MGAA 1EQAA 2JGKA 3RG8A 5T41A 2C82A 1YE5A 2IX3A 4J0KA 3NBZC 3P32A 4KI7A 3PXXA 5E3HA 1PVOA 2AUMA 4F5WA 4YUWA 4ZEVA 3EAGA 2ZRMA 3MC1A 1QCCA 5DGXA 3GYBA 4RESA 3V8RA 5LNK1 4NXMB 1FPMA 3OE5A 2C5AA 4Z9XA 4Z5XA 4A73A 1C7JA 1GN9A 5I8WA 1F2VA 1TO1E 2XGMA 4L76A 5GONA 3RC3A 1KZ4A 4M89A 1L6RA 1UF9A 2OGUA 2DYKA 3SDBA 2F59A 2Y9MB 4O2BA 1DZIA 1G7CA 2VA9A 5G1NA 2OXRA 2WPDA 5B4VA 3OO0A 3T7JA 1CDOA 2XAUA 4LQDA 3DBIA 1PT6A 3WGIA 3EEBA 1O94D 2JJYA 4OX9B 1ZO8A 2J9FB 1OGIA 2CVQA 3U81A 5IN4A 3TE7A 3GLGA 1GAWA 4MP8A 2ETXA 4HTAA 4KG7A 1LDGA 1QVRA 5ICCA 4IJVA 5FA5A 2YV2A 1KPIA 3K73O 3HJUA 3LY9A 4I9UA 3V8QA 5JXGA 1T3TA 4NESA 5FPSA 2EP8A 2OZLB 4EJMA 3N0RA 5IWCA 5D5HA 4GGOA 5WRFA 4RTMA 2XCRB 4ARZA 2ZT6A 4E2YA 2Q3JA 3D0KA 4K0RA 3FTDA 2GM5A 4QGAA 5DHTA 3VYVA 2YY7A 4DMGA 2NP6A 2HPAA 5E0KB 1C7FA 2APJA 2W71A 2X1LA 4BBAA 1SA0B 2K6GA 1KH3A 3MB8A 3MJTA 5AO9A 3R3JA 1XHEA 4Z53A 2F4NA 2Y76A 3VAZA 3NTOA 1M2JA 1ZJYA 1P0QA 2PRZA 3MTAA 3BF8A 4GH5A 2WT9A 4HPJB 4C6SA 4ZQBA 1NWHA 3W8EA 1RZRD 3VNUA 5JH7F 4AYXA 1LY1A 2VWHA 2R8BA 1D1TA 3D2AA 4UJ5A 3QIVA 3QFHA 3ZDRA 1R3UA 4MUBA 1TCUA 1SWWA 4ND3A 4FQ8A 1WCWA 3OX4A 3VR3A 3BA1A 2DVMA 2YVQA 3NXSA 3AFIA 4RDCA 1F2UA 3EOAI 2ZRPA 3IR7A 2YWCA 2I8AA 1EE2A 3HP7A 3M89A 3ZLBA 1EDZA 1U9ZA 2ZYDA 1QLHA 3KQWA 3INRA 1XTJA 2DECA 1M1UA 1WHTB 2EW1A 3Q41A 4K05A 5KC9A 1FSSA 2YVKA 2W6CX 1KS9A 3EMVA 3OTWA 4GYWA 2G8LA 4KFUA 4QUGA 4UZSA 1YDGA 1GPBA 5T67A 1OBHA 4RU1A 4X9XA 3L6EA 2Y05A 5ALQA 4WWHA 3PDJA 3U39A 3W2TA 4EUEA 4QRDA 1EK1A 1I3NA 5E2AA 1WDLA 1VLZA 1Q84A 3HCDA 4KGDA 2QTLA 2QV0A 1TCCA 3FWKA 2XITA 2YRWA 5EZYB 3MA0A 3G13A 4Z99A 2GARA 2C9YA 4HWSA 3D8BA 5DSTA 4ZU6X 4BO8A 5DN6A 4JQSA 1CY8A 1Z4QA 2VP0A 4P5PA 1P7VA 4JBIA 2IYWA 4QOSA 1UFRA 2C2HA 2C2YA 3ON5A 4FDAA 4UAGA 4X1KB 5E7MA 3V55A 2NXJA 2WIKA 4MSUA 3P9SA 5T6MA 4BVGA 2Z4RA 1HOTA 4IIDA 4EZBA 1E64A 2H0AA 2D5LA 1EXMA 1UC8A 3KCQA 4XDHA 3SPXA 1ILEA 2CB9A 4YX9A 2CDCA 4GZ6A 5BW5A 3IV7A 4BMDA 4HEA1 2P6RA 1SQSA 4HTFA 1CERA 1N1GA 5HQ3A 1ZN8A 4LJRA 2D2FA 3I73A 1NPYA 1G4HA 1Y7IA 2CL5A 2ZT8A 3DEKA 3P5BA 5TV2A 4NSNA 3ZWAA 2V0NA 3G8YA 4XVUA 4Q03A 2VYCA 3S7TA 1NFRA 1Y1KE 4FQ7A 4PG7A 2QQGA 3O2QB 4WLUA 2CNWD 2I33A 1A0OA 2V96A 5ENZA 3ZHSA 2WF9A 5EIXA 4OYLA 1G9SA 3WC4A 2IHVA 3NORA 2DETA 2JAWA 4EKNB 3HCEA 4YV2A 2WF6A 1GN8A 4K6KA 4KFTA 2UYCA 1DAIA 4J0EA 4RM2A 1NIJA 1GTG1 1EFTA 3SJAA 3OPVA 1RQ7A 2Q5FA 2OE2A 4P7KA 4P92A 3KU1A 4KACA 5FFFA 5KSPA 1KWGA 1OLOA 3EPLA 4I1PA 2PTHA 2ZLBA 3L4KA 1QOQB 5EUCA 1H2EA 3EFOB 4IFIA 1U63A 2GM3A 5TE9A 2OFPA 3N07A 3H13A 2GR9A 5K8IA 4HRXA 1U98A 4G9GA 3RF7A 1IHXA 1KY2A 3HN7A 4AAYA 5TPWB 2O2DA 5KCMA 2Q5JA 1CULC 3RSGA 5BP7A 1OFHA 1JECA 2UVDA 1SD1A 3IP9A 1SCQA 2VRCA 3D6HA 3JWJA 3PWSA 3QQ5A 3ZD6A 1G20B 3GD5A 4FWBA 3L0IB 1L9XA 3ETEA 2HFKA 3LQKA 3O8BA 4FMDB 1PUXA 1ISJA 1AZTA 1GTRA 4NLLA 4KEAA 4Q7LA 2NZ2A 4QBTA 4RZSA 1SELA 5HSGA 4ZEOA 5T4EA 4YQZA 1FTSA 1EESA 4P31A 4PPFA 3I4CA 3IPYA 4CQLB 5H1YA 4H0FA 3GPDG 3T9FA 5DW3A 1NFQA 3K0CC 1F6WA 2PUJA 4HFJA 4M46A 1YVEI 2EW8A 2R96A 3NP9A 4I9HA 5DTJA 4Z0TA 3ZHRA 2NU7B 2ZDQA 3D64A 4R69A 1XNQB 1TDJA 3O8OB 1C4XA 4A0HA 5IT0A 4E46A 3A3KA 2CL7X 1J8DA 2Q1UA 4PHTA 2IEBA 4BBZA 1CUXA 2PL3A 1G7RA 1R6VA 1E3DA 3CUUA 4JR0A 5AVZA 4E2XA 2IYXA 2XRYA 1J21A 3WWEA 2QTAA 1YL5A 1ZD3A 1WXXA 3FG9A 2YXPX 1PQPA 1F20A 5F2KA 2FPGA 1TD1A 4QOIA 5A71A 3UJ9A 5DIFA 2Z04A 2NYVA 5CX4A 2WFZA 4K9QA 5JRZA 4D5EA 1FP6A 1JDBB 1T5TA 4HAUA 4RY0A 3P9NA 5K6RA 1SZCA 2ZT5A 2DAPA 3BJRA 5EJ8A 1T0HB 4LK2A 2JIQA 4RY2A 1W1UA 2WE8A 5K3FB 4B7CA 1HEYA 1E63A 2XUJA 5FA6A 3TLGB 3GLFB 3KUKA 2RKBA 3LQQA 5I4BA 4RGBA 1UDAA 1Y8RA 4GX2A 4L5CA 3I92A 2BEUA 2W90A 2ROQA 4LXIA 1OLUB 4PGMA 1LW7A 1YRHA 2LIPA 3ELYA 3UCFA 4F3RA 1KMQA 1ZMTA 3RVDA 4URXR 5J4VA 3CVYA 1XZPA 3DZGA 4P3KA 1M7HA 4JDPA 1H2ZA 1BJTA 1I7QB 2HK6A 1M10A 1TZ2A 1XCBA 3OZAA 4B4KA 3CX3A 4C03A 4DIOA 5JPCA 4BLTA 2ZB7A 4ZOLB 3OM0A 4PFQA 2WTXA 2Z8ZA 4L02A 5CDUA 1TYAE 2QL5A 3V7YA 3D8NA 3TIVA 2N0SA 3FOEC 4DR3B 4BECA 4I19A 2NIPA 4RKFA 1JKIA 1YQ9A 2D5CA 4OLFA 4AK9A 2UU9B 1UPAA 3UKJA 3M6AA 2V03A 1E3SA 1EJ0A 2ZROA 4W7HA 3O38A 3UV6A 5EZQA 3WGVA 4E5SA 4TXMA 1BVYF 1L6IA 5A3RA 1F4VA 3CZQA 2C8VA 3S28A 2EBFX 2Y93A 3PFWO 1YJCA 1PW5A 2XNSA 2HIAA 4BKRA 4BNYA 3TCXB 1WDMA 5FNVF 1JDJA 1WPXA 5C5IA 1GR1A 3HPQA 1P7WA 1YZQA 3OPQA 5C8YB 5IF9A 5K6AC 3GIWA 5ALRA 1SVOA 1TRHA 3VNBA 3WDMA 3GEBA 1USKA 4PLZA 3MUEA 3IHKA 4RZXA 2HB6A 1N2ZA 2ID4A 4I0WB 1FQKA 1CR1A 2EIXA 2X23A 3EF1A 4W7IA 3WYGA 1XT6A 4GRDA 2OP0A 2PRKA 3LLCA 3SM9A 1AQYA 4R9VA 1YZFA 3L6BA 4TLCA 1LVUA 1P1JA 3NB0A 3AF4A 3TS1A 2K5UA 4DRYA 1HDXA 3V1KA 1JPJA 2C5GA 3J81A 4KNYA 1RLJA 1KKMA 4ZYLA 1J49A 1V1MB 1NJ5A 3NG1A 1PDWA 4HUTA 1UBUS 1N32B 3PDCA 3D2BA 3WZMA 1CQJB 4P36A 3NT5A 2FEKA 1DIBA 4N9WA 4O2LA 1EM8B 4H31A 5DYYA 2Q6TA 4YCCA 3NQ41 5KDDA 1CP2A 1X1AA 5GADl 1ZOOA 3OFVA 4P0QB 3OBBA 4OI1A 3SSOA 1Y5RA 1U04A 3T3DA 5HKKD 2QD2A 4TQAA 1X7WA 5HF8A 4PAGA 4EB8A 1ZWLA 3W5VA 1B0ZA 2QDKA 3A31A 4I55B 4U5QA 1F0NA 4WNYA 3X1MA 2AOXA 1SHZA 3D0RA 1ZK0A 4H35A 3RS7A 1OI2A 3BHMA 4M0MA 3B51X 2PKYX 4I1OA 2HTEA 4URFA 1OXTA 4Z6KA 4IJ5A 2MSEB 2EAUA 1MIOB 2P2YA 2Y99A 3DHEA 5GOZA 3AUAA 3RROA 3R5TA 4JP1A 2GZ3A 1UBMS 2QSJA 4GXRA 4RDIA 4J1NA 2YVUA 3RRZA 2NVWA 2VNHA 1Q0HA 5JPIA 5ITWA 1O03A 4YT5A 3L0BA 1B7GO 1PWXA 3GRAA 2PCLA 4FS3A 1N75A 2P91A 3OZTA 3NUZA 2VRBA 2DR0A 4B43A 3NOQA 4OA5A 1WE2A 3IOCA 3JTEA 3DNFA 4KLRA 4ZVNA 2XGOA 4CLRB 2D74A 3LP5A 3X43A 3DYBA 2RGYA 5IM4A 3HK2A 3PNSA 1BQ3A 3OF3A 4MMYB 4KITB 5I3ZA 2ZSUA 3LGXA 1DBWA 3DULA 4ZCLA 1FTQA 4I9GA 6Q21A 5AI0A 2GPNA 2WU0A 1GTL1 2ZWOA 5J47A 1EB9A 4QUEA 1FJGB 1RWMA 2IQ5A 4BB5A 2N47A 2XWBF 5F9FA 2P75A 3IHLA 3JZIA 5ECGC 4YAGA 2HHHB 2C7OA 4WLVA 1F1JA 1QH0A 2QLLA 4P3PA 4PG5A 1ZJZA 3R5SA 3VVMA 4A8HA 3LUAA 3JQBC 3JTMA 1HTWA 4DC0A 5EMLA 5CT9A 1UEIA 3HG7A 4LDQA 2EVWX 2PSHA 1C4KA 2RIPA 3Q3IA 1NVGA 3GAFA 4PQFA 1HQYE 1RSZA 2UVPB 4JR1A 1Y5IA 3G9TA 2FUG1 3AFOA 5E4YA 3NVKI 1T4GA 3EZFA 1D7OA 4FJ1A 1XXHB 4KPUB 3UOAB 5IJXA 1MPTA 2SHKA 2ZIWB 1DV2A 4KJZA 5EINA 4R3UC 3WMGA 4RMGA 4ZQIA 2GVDC 2RONA 3WLQA 2HT1A 1QYRA 1Z5WA 2WJ3A 3FSEA 4DV0B 3F97A 3QH4A 2CXUA 4MI3A 5JALA 2PD6A 4DWOA 4N3BA 2I1VB 2PKQP 1VDZA 4C3VA 2DLDA 2WJJA 3KSUA 3H6KA 4WECA 1ECLA 3EPHA 2IBMA 4FEYA 4AXXA 5KKCA 1NUAA 2VT3A 1MX3A 4JOQA 5KDLA 5IEJA 1OIVA 2X7XA 4ZU1X 1GA4A 4AT1A 1DWOA 1VFNA 3W90A 3AX6A 3WQHA 3NJRA 3LW8A 3LBHA 4PINA 4RJKA 1AS3A 3K5PA 2I76A 2CEKA 1KF0A 3EISA 1PR9A 1K9VF 1XN1A 2OYSA 1P3JA 4PY2A 1XAJA 4YJ3B 3NHMA 3OF2A 2I1WA 3AR3A 3IJRA 3T7EA 4DQKA 4LHVA 3CO0S 5TY0A 2VJDA 2XB8A 3KBOA 1WY7A 5KU1A 1RE1A 3C8ZA 1N6NA 5AOBA 3OEHA 3R5HA 2XT6A 2ABWA 3PFKA 5HF5A 4QTYA 2A4MA 1V1RA 1Z0JA 1PSZA 2Z95A 3E3NA 3QUTA 3IJ5A 3QLTA 2JVJA 1IVNA 3O8LA 2REQB 1DTEA 3LC1O 4HPWA 2WNIA 4I46A 4M49A 1RPNA 4LVCA 1GTSA 2BR5A 1ZJ4A 2PL5A 4FZRA 4I6JA 5HIIA 5IPFA 2XOXA 2VHWA 5L95A 3LVRE 3FZNA 2NNWB 4FKBA 4FBMA 4I4TF 5EZYF 1RLOA 1F3OA 2P4SA 3E15A 4FHZA 2UUAB 1PJSA 3GG2A 4MW6A 4YCBA 5EA2A 1KJZA 4B82A 1N6LA 1WHSB 3GAAA 3VBEA 2HSGA 3WJAA 4YMVA 4MRMB 1BXZA 2HQBA 3MG9A 1DC3A 3FVRA 5EE5B 3RG2A 4AMUA 3EZLA 3KT0A 3L8EA 1JSXA 2I03A 4U8GA 3WKAA 1ZIOA 2GVZC 2IVZA 2VPWA 3I76A 2AK3A 3LKDA 3MLAA 4DT1A 2JLXA 4M1KA 3O4HA 3RK4A 3DMPA 3D0QA 3QXCA 4YR9A 2RK3A 3RK0A 3WIOA 2GJ4A 2J6IA 2E82A 4LOIA 2M98A 3ZLTA 3VNSA 4P2BA 1NC3A 3OIDA 2P77A 3U4IA 4FUQA 4IHJA 2VAWA 4G5OA 5J1TB 1MB3A 3WRYC 1VBNA 4CT5A 3HXOA 4IJUA 4A8JB 2AFRA 3TSOA 2E2WA 2BGRA 4FYXA 1Z2NX 4LBVA 1GLGA 1C3LA 2V98A 2ZIGA 4HX9A 5F3WB 4OIFA 4JJGA 4CPDA 1G19A 3HR7A 1C4WA 1Z34A 2QM3A 2NXNA 4HQKA 1R15A 2GASA 4QASA 4UAUA 5CFPA 1WUTA 4YMTA 2ID7A 1MOQA 3QKRA 4IO0A 3DOFA 1I8TA 1WF6A 2JNWA 4MS3A 4JB2A 5BQOA 5DX1A 3KNZA 4MGHA 3ZGZA 2XA2A 2FRXA 2ECQA 1STOA 3JVEA 4YLEA 1YB2A 2X9LA 4HEJA 3KVOA 4Q4HB 3U49A 3HWWA 3DS8A 4Q1CA 3WMWA 5K6TA 3TOVA 3PEEA 1DT3A 1QOZA 2GZ2A 4RQAA 3CH5A 5IC5A 1NE2A 1NXOA 2AL7A 3EVFA 2VDRB 4FMDF 4H1TA 4LGVA 3K4QA 2G76A 1PKXA 4MQEB 3TGLA 4CMGA 1Y9JA 4FC7A 2NU6A 1SZDA 3HHPA 4NCIA 3QBJA 5IAAA 3U80A 1JR3D 2BN4A 4HN9A 3DBRB 1NV9A 1QRAA 1AHIA 1NZJA 2AD5A 3E8MA 4DA9A 4F56A 4AKGA 1GV1A 4HX5A 3P96A 3UAZA 1WEHA 2R7LA 3G6WA 4ZMBA 2ISCA 3A6DA 1DCKA 1IZ0A 2XDQB 3CN7A 5DEOA 1ACJA 4BJ6A 5F7OA 3A9VA 2QBYB 3STTA 4U7JA 1AOXA 2FSIA 4KXUA 1G42A 2A9KA 1IQPA 3ZV7A 3P9XA 1ECCA 3BE5A 1H65A 3EVNA 3X1KA 4X94A 4G23A 4TLEA 3G79A 2EARA 4GPEA 5KKAA 3SC2B 1MZVA 4N47A 1LDYA 3C3PA 3EZ2A 4PYKA 2E4WA 4W9NC 1CQIA 2PQ2A 5A02A 2OSVA 2H5IA 3ZD8A 1JHVA 1ZD9A 1JAHA 3EGEA 1I3CA 1PJBA 2B92A 1BYIA 1P2SA 2P30A 3FIJA 3IFSA 4NBUA 4NCXA 4NR0A 4XRRA 4AJNA 1OLSA 1VBFA 1E99A 1FUYB 1QH1A 1YR3A 3IHTA 3H11B 3L0OA 4MS1A 3EIUA 1Z7BA 3GUHA 1DKOA 1MQSA 1EGVB 1R0YA 1S1MA 3D3WB 4KYVA 4BLVA 4G56A 3UGKA 1ATZA 3EZXA 5CA1A 1KSJA 1U11A 2BVNA 2FETA 2JLQA 2B1IA 3BPSA 2CV2A 2PANA 2FW7A 2BF4A 3JWHA 3EDMA 4IP0A 3UA4A 5TMBA 3HYTA 3S5UA 3RC2A 5ICEA 5JHHB 4UVIA 1UOEA 2LPMA 1HNZB 5HJEA 5K05A 4WBNB 2HL6A 2OAP1 1LPOA 1YBVA 2CFIA 3PHHA 4ESVA 1WU8A 3ENWA 5EUMA 5HF9A 1NNI1 4BGEA 3FWPA 1CB7A 2WWVD 1K6IA 1MFZA 3OOSA 1HDCA 4C30A 5G4LA 4AMGA 1JWAB 2P2NA 4ECAA 4RTSA 5HA5A 1S5PA 1F2TA 1ODSA 2G36A 2NXCA 4ZOLF 4ZCIA 1N2EA 4BO0A 3R40A 1W4BA 4LZOA 3H5AA 4O4HA 3R0JA 4MS4B 5FTNA 3O9VA 2VF8A 3JU3A 3UN1A 1I2DA 3DE7X 3LPAA 2GF2A 2O2SA 4CUZA 3CZAA 3W9YA 4DGQA 4RIIA 5KYUB 1W0KD 1UEJA 1KYXA 1QIGA 2D1FA 4AQDA 1VLQA 1E1MA 1O6CA 2AUNA 3PI6A 3UGJA 3Q8WA 4LRYA 2DERA 1IUKA 3ZNPA 3A28A 3EUAA 3FSGA 3OM1A 3TNFA 3VISA 3VJMA 5BUQA 1Z08A 5KVVA 2Q29A 4TTRA 3QLVA 3UWMA 5EUBA 4Q1DA 3GDHA 2BEKA 4YR7A 1QQBA 3B9QA 2XQIA 2XB9A 3EHDA 4Y18A 4TSRA 1KFCB 5C8YF 4JSYA 4PF1A 4A6PA 4PZ9A 1BN7A 3FYUC 3GRYA 4TMXA 3H0EA 1RWKA 5BV2P 3WLOA 2IT1A 3BFJA 3MRTA 1JKFA 3N5CA 3DG9A 1M73E 5CW2A 5FWAA 1GTVA 4MI6A 4QL3A 4CIDA 1OXVA 3GW8A 1P8JA 1K8YB 4JUDX 1NTOA 3V6MA 3S2GA 4FYVA 4WGFA 1L7NA 3NIFB 3AVTA 5DTIA 1E4VA 1I2MA 1RYEA 3L4BC 4X84A 1DP4A 2V4ZA 1N2HA 4TV9A 7YASA 1M72A 4RTOA 2CMDA 1JG7A 2BZGA 2O8DA 2V9PA 1HKHA 1XX6A 2QRVA 4KC0A 2XAAA 4LY6A 2H5LA 4X7RA 3OWOA 1BAPA 3GRKA 2C8JA 4AN0A 4D8YA 2H51A 4ITVA 2YYYA 1WQ1R 3VYTB 4PRKA 1IRXA 1PSWA 1KC1A 2CLFB 2Q2NA 3CU5A 1P80A 1EAMA 2QTVB 3KK0A 1FYWA 3HZHA 1LJLA 4J07A 3HVUA 5ILQA 1WTAA 3ZKWA 4I55F 2RI1A 3K70D 3VU9A 2YV5A 1HE1C 3E5HA 5ERXA 2BD0A 3LZCA 2GLUA 2WJGA 4MWOA 4R3NA 3ZW9A 4B84A 4LRXA 2A78A 1VM6A 3TTYA 1RTTA 5BWNA 3N2GB 1QHEA 2ZYSA 3ETCA 3O3OB 1PR5A 4MQ6A 3V97A 1TM2A 3BHIA 1YZLA 2GD0A 1YE8A 3AESB 4FK8A 3QELA 4UFOA 3ZV6A 3DVLA 2VUTA 4H1WA 1LDNA 3DCNA 2X8AA 4YONB 3V8NA 3WGUA 1OH7A 3WGYA 3QEJA 1KI7A 2XUOA 1CHNA 4K7JA 3V2UA 1DJMA 3PRYA 1DVRA 2DEUA 4S2UA 1FL9A 4YH1A 4PSDA 4U9UA 5DI3B 2NW6A 2V7GA 3JZMA 3FGPA 5K5EA 3F71A 3OFNA 4R4JA 1C7EA 3R44A 4BVKA 2FI1A 3VR1A 2AKYA 1XZHA 3DC2A 5K3CA 5HFAA 3RFUA 1LX6A 3PEFA 5SZJA 3T1TA 1M1YB 3MTIA 4HH3C 3GRFA 4RK1A 3SHTA 5IKEA 1QTNA 1W36D 3R3HA 1A9XB 2HM7A 5C7OO 3JSAA 2QJFA 1RS0A 3DGEC 2R7NA 3O7MA 3ZWOA 4JI0B 1CRZA 1SCAA 4ZQFA 4MQUA 3TECE 2B1GA 3CUSA 1A8UA 1XYGA 4X95A 1MMFB 5KNBH 3WADA 4AG6A 3Q6IA 1RBMA 2XE6A 2CYCA 1N7IA 2FQ1A 2IEAA 4KRGA 3TQQA 2ZS8A 3PCRB 3TNJA 2XEDA 3WGGA 4FGJA 3NAZA 1Z0IA 3P0JA 4C0LA 4I3FA 1QKJA 1WG8A 2ZS9A 4KTTE 4HK4A 1HYHA 5H3CA 1CNFA 3G7NA 3I01M 2IXDA 3AINA 3WKEA 4DRXB 2I4RA 5IJ9B 3B13B 5EC8A 2YHIB 2WKWA 2PJZA 4U7GA 1A7UA 5AKEA 3TUJC 3ZTWA 4PQGA 4Z49A 3I05A 5ALKA 3QVGA 5BYAA 5FWYB 4N3CA 3ETJA 4WGGA 2ZBQA 5JSYA 2O2YA 5KO2A 2HPHA 1UM9B 4GI1A 3NANA 3AUFA 4YJ3F 5FOUA 1FRNA 2H1FA 4N65A 3X1WA 4C7JA 5I7RA 5P8WA 5M2QA 2XOKD 3ZHZA 1FEZA 3U3MA 3H4IA 4EVSA 3L4SO 4DDVA 2QPLA 3JPYA 3QGMA 1AUPA 1X3SA 2YQ5A 4KN5A 1GSIA 1L7DA 1NQOA 2HJRA 2RJOA 1Z82A 2CDRA 5HIJA 1TYBE 3IE0A 5AK4A 1AHPA 1P31A 2DPYA 3JATA 3ZXUB 3X44A 4YGYA 4Y9RA 4C43A 2QN3A 1G6HA 1MABA 3BVPA 3TX6A 2C5FA 2UZ3A 3HVIA 3B6MA 2YFHA 2B20A 1EUCA 2FF7A 4EEZA 1RKXA 1S2LA 2FOXA 2HDNB 3ZVRA 4MUNA 5IAEA 2I6QA 2AG6A 1VIMA 4A03A 4EGAA 3GC6A 1AK2A 1G2PA 2R8OA 3I1FA 3BK2A 1YA4A 3TSYA 2C7QA 5CT4A 3LBYA 2ALJA 3AERB 1DG1G 1X7YB 3WYEA 2NYUA 2ZI4A 5LA6A 3V33A 1QV6A 3NO4A 1JHAA 1YCDA 4KWTA 1NZFA 4O4LB 4R31A 3T54A 1NXVA 4CM1A 3KKPA 2PIAA 4TMYA 1U8CB 2A30A 3LUFA 4E21A 5HQJA 2FNAA 3AB3A 2GTIA 4PQEA 3ZQUA 1II8B 5CPBA 4IXDA 2P2SA 3FRJA 1JXQA 1FMCA 3D7RA 2PGAA 3RVMA 4BGVA 4BKQA 4GQAA 1RAGA 4LOJA 3L05A 3VZBA 4E3WA 5LP1A 1ULTA 2L69A 3CX8A 1YE3A 3S2SA 1N5JA 1WW8A 3UUFA 4C7KA 3IEIA 1U0JA 2YKGA 3QLUC 2GA8A 3D59A 1SEVA 2O3RA 2W43A 2BPOA 4HVLA 4EK9A 4MUEA 2ZWMA 4TYQA 2IBTA 3STYA 2FFJA 1Z13A 1Y81A 3MTGA 1TA9A 1XVAA 1C8KA 3K7EA 1PG2A 4KR0A 2R4UA 3RANA 2CW5A 1A5SB 5AKGA 3SFVA 2NZUG 5EJMA 3L84A 1PFYA 1PQYA 1W30A 4YREA 1AVTA 3IQZA 2OK8A 4JNCA 3G2OA 2R1ZA 1DC8A 2GK6A 2I78A 1JQBA 5AVQA 1BC5A 2G1KA 1B0UA 2AVNA 4QATA 4F4FA 2ZJ7A 3T52A 4BNHA 1T9GR 1HMYA 5JS8A 1KH1A 4FN5A 2QZ4A 2ZUEA 4GLFA 2F1JA 5GQSA 2OZVA 2H1VA 2E5WA 2ZYGA 4FM9A 1Z75A 2J8ZA 4BU0A 4PNEA 3G1TA 3K0BA 2F55A 4CRWB 2CXPA 2GAFA 4D8VA 4CG1A 1SM4A 4C3UA 1N3BA 3DGFC 1CUVA 1H2RS 1NM5C 4DLYA 2FGKA 2C8KA 1QVWA 3MTEA 4DHWA 2YHAA 5IH3A 1MEEA 2WKRA 5AKIA 2H2IA 4RXUA 3A3NA 4TWIA 3AI1A 1SC4A 4G0YA 3UMGA 5GGXA 4EB6A 1A2OA 2Y67A 4OHVA 4B3BA 3LCUA 1M0EA 2WM8A 4KE6A 2HIMA 2VDNB 3GT3A 2II6A 3HKDB 5DXJA 1LNZA 1B43A 1GRCA 1Q92A 1D2HA 1GZUA 2WTAA 3PPYA 4DF3A 2GPBA 2W22A 2HMYB 2XUIA 4TKVA 5CLHA 4RIGA 1E6KA 5IMBA 4AS1A 3LMKA 1W44A 3ML1A 3OICA 3CUEF 4IJMA 4M0LA 4MV6A 2Q5LA 4C6TB 2F62A 3AEZA 2IHZA 1KWKA 1SVMA 2RJNA 3HFGA 1E7MA 2P11A 2WHPB 4PNZA 3PX3A 4QPDA 3X3HA 1GPH1 1FZQA 1W5AA 3FJYA 1P7YA 1EVEA 3RV4A 4D4JA 4LJ6A 2AMJA 4N76A 2VTBA 1QG4A 2A1UA 2B83A 4PICA 1N2GA 3CY6A 5ALWA 1K4KA 1QKIA 5FUXA 3IAHA 2DR2A 3AUYA 1M1YE 4Q3KA 4CV2A 1AT1A 4KODA 5D7BA 3ORFA 3X2SA 4J0HA 4Z4QA 1JE0A 1E4EA 3NDBB 4IIHA 3VVLA 1IXRC 1Z7EA 4KV7A 2R6HA 4O1IA 5I01A 4XVHA 2CNKA 3G2LA 1P5FA 1RE0A 2DF8A 4EUKA 1KYTA 2GA9A 1Z36A 3ZDEA 3DAGA 4FIDA 4JDUA 1YJQA 4XX0A 2LVBA 3K31A 4I5DA 1PEAA 4Q6WA 4HSGA 4P0PB 1Q0TA 3WTBA 2Q3DA 1EZZA 4ALKA 4CCYA 2P4UA 3H1GA 3NS7A 4B33A 4KW7A 3I72A 4ED9A 5BN1A 1FP4B 2LNDA 1NI4A 4CXMA 6REQA 2J7PA 1YRLA 3Q5DA 1SC9A 3KEMA 2IVFA 3DLAA 4WBNF 1CE8B 4EW6A 3Q8XB 3RYHA 4XRGA 4YY3B 5B6PA 3GGJA 4F3CA 1D0VA 1PP4A 1N9GA 2B1QA 1L8AA 3RRNA 1W48A 2NU9A 2PUFA 1Z6XA 3VHLB 4PLFA 1M5RA 4MWSA 1JQEA 1WXQA 1F8UA 1YR6A 2BMAA 3PXCX 4Z3OA 3N39C 5F35A 3BSYA 1A1VA 1FLNA 2YXDA 221PA 4F7DA 3G2QA 4WKPA 3BB4A 3UMSA 3GEMA 5DE3A 5EZ5A 3TPZA 1AK9A 1W2GA 3RH0A 1T6ZA 2H6EA 1Q83A 2Q8PA 4U9HS 2Q45A 4OXRA 1AXRA 1XCMA 3C6KA 2OK7A 1XKXA 3F3MA 4Q7KA 4AM8A 1JJIA 2X5OA 5REQA 1DPFA 1Y1PA 1A4XA 4WK2B 3AHHA 1G8AA 1GKIA 3U3JA 1K8RA 3JVVA 4CIVA 3UH0A 3CRZA 3HB5X 2XWJI 3GRUA 1NL3A 2QUHA 5KVQA 2VDWB 1W85A 3KO8A 5CCDA 3U4GA 4YRKA 2ZQYA 2P8SA 4C5BA 1ZL0A 2ZVDA 3HXKA 1U8EA 1XR3A 2NUTA 3BMQA 2PKXA 4B6JA 4KAXA 4KR2A 4ZTZB 2IDJA 1MCZA 5DT9A 1FUUA 2WG1A 3UMYA 3QITA 4E5PA 4HS9A 1K63A 4MWGA 5CPFA 1KYYA 5GJWC 2B37A 1Q1EA 4NBRA 1W94A 4N0MA 3SZOA 3P2JA 1ZM3A 3JYNA 3FYUB 2C2XA 2FLWA 2IYAA 1OBFO 3B8EA 3Q3CA 1D2EA 1QZZA 2J3LA 2Q5IA 3MMSA 3GLIE 2OCYC 2XDWA 4KLNA 4Y2XA 4L07A 1AUXA 3VC3A 1T6YA 2HI0A 3EIFA 3R8XA 3UK2A 5JLAA 3FY4A 3NHUA 1JTEA 2V74B 3T9CA 2FY8A 1LBSA 4S24A 1QX3A 1CS0A 4DNPA 5HZHA 2AIRA 5CYFA 1B23P 2C03A 1M8JA 1WCIA 1G8GA 3D5QA 1KSFX 2PZFA 3CX4A 3HBNA 4J9VA 1CIJA 3CCFA 4Z2YA 4HVAA 2JHAA 1JU4A 2B0CA 2W11A 3W1WA 2AXEA 1V1JA 2EFDB 2PS0A 3KU4A 1BWQA 2XXAB 4ZZ3A 3H0KA 2YV3A 4DZTA 3QKSB 3EXHA 3MQ4A 4YP9A 4D02A 5HKAA 1PEYA 1RKUA 5TX7A 3I5UA 4CI0B 3MT8A 3U26A 1VLHA 1BWPA 1SUSA 5ARDA 4CGYA 2BM9A 3HYSA 5I9NA 1UK9A 3CF4A 4MKZA 4CMIA 3JX9A 2R751 3OMXA 5TRTA 4P34A 2H07A 4WFJA 1P4JA 1T15A 3C74A 4Z7JA 1C50A 3M1AA 1E7WA 3CURA 4ZHQA 3O4IA 3T5PA 3IDZA 4B2IA 4LRWA 2CFSA 4A4DA 3WLFA 1IMJA 1NRWA 1UKAA 3DL2A 2UDPA 5LLDA 5JZMA 2O2CA 3DV9A 3IPRA 4XD7D 5EXXA 2CB0A 4H3HB 4OKSA 4AN1A 3TTXA 1Q74A 5IASA 5DM1A 4ENUA 5GAJA 1YZVA 2OMEA 1LDEA 3MIIA 3SVTA 3I23A 1FRQA 1ZOPA 2H54A 3KTFA 4MHOA 1T5BA 2HK7A 4DA4A 2GFIA 2OLEA 2C3OA 1F0KA 3USES 1K4MA 4D4LA 1Z2DA 3LWDA 4JX8A 3TLXA 5FYDA 2BCGY 1MAAA 2X8WA 4XSVA 3UT6A 1RXUA 2VQDA 2WPDD 2X22A 3LRPA 1P39A 3O8QA 4C1BA 1VBMA 8ADHA 2C96A 4A92A 2BRUA 1AKTA 3E9ZA 3MJDA 4OGKA 3LPCA 4HO1X 4RJLA 2PY6A 3D81A 5DLPA 3MRSA 5C80A 3QX9A 2C99A 1PVVA 4KR7A 2RGWA 3DDCA 4MB0A 4LGYA 5CW1A 4DMHA 4DCTA 4JENA 2DFNA 5LZ5A 1M6WA 2P6OA 2OFOA 5AW8A 4E1AA 4AJ4A 5AI5A 5TQVA 1E3EA 3BIXA 2BKLA 2XVZA 4QTZA 2ASEA 2R7AA 1W9HA 2VHCA 5ANRB 3HYLA 2B5VA 2ZJ6A 5D3ZA 4RIFA 2B5OA 5IAKA 3GARA 3PC2A 3QWFA 3O84A 3BJZA 3RVSA 2Q3MA 4IGIA 3GDGA 1W34A 4M38A 3AEUA 1K5DA 3BHJA 2QP9X 1KBQA 1MLDA 1NRXA 2AKAB 3PR1A 2ZTUA 1Z9BA 2X9QA 2FXIA 3LHIA 2PSFA 4P0TA 4Y6SA 1M6YA 4AJHA 4GOND 4YIHA 4V2IA 4JOCA 4OSEA 5EXSA 1KZHA 4B3DA 1W59A 4MARA 3C3JA 2O59A 1L5FA 4UJ3A 5G4KB 1QIEA 2I6UA 4KLZA 1KK0A 1NMEA 2DBZA 4WHMA 1PZMA 4ZVQA 3B53X 3KZMA 2X3YA 4KSYA 5DTRA 1GRVA 5BY2A 3A6JA 4OGFA 3IPLA 2YBDA 3FCSB 3LSYA 4RVNA 5IFKA 1U1CA 3DL0A 4E94A 5BSUA 2VSNA 4AIIA 1W8DA 4CNQA 2F6RA 2QMZA 2VWQA 3EGXB 3AF5A 1D0SA 1CF9A 1S4QA 1WQ4A 3DZFA 4WIAA 4G63A 2BSQA 1KXZA 3C1TA 4TTIA 5M3BA 1LVGA 4PU0A 4D81A 5A9RA 3N6RA 4Z2AA 2Z0MA 1Z7GA 4EFDA 2VVTA 2GCPA 3ROXA 3H3FA 4ZQEA 3HKBB 5KX5B 1L4HA 3CRRA 1GL3A 1LZLA 4O4LF 2CUNA 2QIPA 5A3VA 3W6OA 4CKCB 1R4MA 2V7BA 1N7GA 4ZOEA 3GEDA 1N2IA 1UAYA 2ZRJA 3K1YA 2IU0A 1D1QA 5I45A 1KYVA 2BFFA 1E4OA 4MI9A 2X2FA 3UAXA 3F7MA 4AU1A 3DBHB 1M8GA 1FSZA 1NC1A 2H5JA 2YMQA 3GFVA 3N8DA 3PIIA 4NU6A 1OIXA 1OREA 1V3UA 3WSWA 5ADHA 2R5WA 3FPJA 3W05A 3BM5A 1RCUA 2EFYA 3TTTA 2DFLA 1XVLA 4BMNA