3SJAA

Crystal structure of s. cerevisiae get3 in the open state in complex with get1 cytosolic domain
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
350
structure length
338
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 119
structure length 338
sequence length 350
chains with identical sequence B, E, F, I
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjaA00
2EFEB 1GL7A 2CVHA 3VHXA 4P0TA 4B34A 3B2EA 1H8ED 5FTMA 4FWIB 4WZBE 4RCYA 2A2ZA 5GJWC 1AZTA 4JL8A 1U0LA 2H18A 2PCJA 4FW9A 4I1UA 2AL7A 5E7IA 3U3OA 4Q1CA 1HEIA 5G53C 5H8WA 4B35A 2VH5R 3OIWA 2DFLA 3LQRA 2QTFA 1E4YA 1LF0A 1DPFA 2A9KA 4B48A 1RRGA 4NONA 5KNBA 2J5XA 2HF8A 4E03A 1KJZA 4GPTA 721PA 2ZI9A 1A1VA 2D4HA 3SFZA 2QTHA 4PAMA 4DBLC 2HJVA 4ILEA 1KI1A 2XNDA 4ZPXA 2YOHA 2R6CA 4LUCA 5GVRA 3DO6A 2GJ9A 4TYWA 4NYMR 3H2YA 3G5UA 1SVLA 4OKSA 4FCTA 1E9DA 1AS0A 3HYTA 3Q72A 1NG9A 1J8YF 1FX0A 1VG8A 4M9XA 2W83A 1G4AE 1BOFA 3KUDA 4DB2A 2YWGA 4URWR 4AKHA 2RGEA 5TXGA 1NN0A 5BYKA 1W0KD 3CPJB 4FMDB 3SYKA 2GF0A 2OBNA 2ZE7A 4B3CA 1BMFD 4AD8A 2OFWA 3EW9A 2PZGA 3FMFA 2R6GA 2ZANA 3LVRE 3ZIAA 1IXZA 4GZLA 1XCPA 1IJFA 2XTNA 2H16A 3RSOA 4ERNA 3HU2A 2XB4A 2IYTA 3VMFA 2F9LA 4QHSA 4DZZA 4R2IA 2XJ9A 1N0UA 3B9PA 2BKEA 1YJ5A 3ND8A 4LHYA 4YLGA 4TYQA 4Q48A 4PAOA 4JMPA 3SHWA 3D7MA 3CUEF 1PLLA 3BH6A 3UPUA 1DBSA 1QZXA 1BYUA 3BFXA 3PUZA 3OF5A 1GTVA 1TQ4A 3B1ZA 3I8SA 1MABB 4DUGD 1NMYA 1KK0A 1J90A 2GESA 3NBFA 4G3XA 1ANKA 5HCIA 5J4YA 4V0NA 4URXR 4A8JA 4PC2A 3I5XA 2NZJA 1OIXA 1SXJB 2ZUCA 3I3SR 2C8VA 3KTAA 2BVNA 4RZ3A 5F9FA 1Z63A 2NQ2C 5DHFA 1XJ0A 1B23P 2ZSDA 1E2QA 1T0JB 1XXHB 3DZDA 2ZXUA 2ECKA 3BERA 4PAQA 4L5BA 1QG2A 3NDBB 2PZEA 2VHUA 2XOKD 3AV0B 1JXMA 4GMXA 2CXXA 3DPUA 1SULA 1Z0AA 5AJXA 4Q4HB 2OCYC 1GNPA 1Z0DA 2VSOA 3I1FA 2IEYA 1H8HA 1G6OA 3L43A 3QEOA 4CEIB 2IYUA 5BYJA 1W4BA 4OK3A 1ZC4A 3GLGB 4BEJA 4JBYA 4LX0A 5JEEA 1E98A 1NVWQ 1E0SA 2HT6A 3A1VA 1JXOA 3QXXA 4BLRA 1JJ7A 3P20A 3K0AA 2XXAA 4DEXA 5JEDA 4DC9A 4US0R 4F4JA 4MRVA 2EU8A 4FMCF 1SVMA 3F3YA 2X8AA 3TAHA 1DAEA 4XSHA 1CBUA 3WP0A 3KFXA 2FGKA 3W8NA 2AFHE 3ZVMA 3ZVLA 1IY0A 1XX6A 3A1UA 1HE8B 3KFVA 4TT3A 5CYPA 1I4DD 2NIPA 1NI3A 3F8TA 1MO3A 4NTZA 5JHGB 4V0LA 2AWNA 1P73A 3IIKA 3RS5A 1T5IA 5B64A 3EZ9A 4NP6A 3VR4A 3LWNA 3L8ZA 2O8EB 1XEWX 2JDID 1ZU4A 3A37A 5FI0B 4F93B 4I1VA 1EFRD 2CJWA 3MSXA 2GXQA 1H8EA 2O8DB 3D31A 3U5ZB 4HUQA 5AJYA 1PVOA 1ZYUA 3QBVA 4DLRA 1MRNA 3VX4A 1TF5A 2PJRA 1ZNWA 3IQWA 2AKYA 4IDNA 4HZIA 5EXPA 2DCUA 1YVDA 2W0MA 2QQEA 3MRSA 1Z6TA 5FBRB 3ZLJA 1P9RA 2Q21A 3BB3A 1IY2A 2X2EA 5LD2B 5KDLA 1WE2A 2R65A 2QORA 1N5KA 4WBSA 1G8PA 1ZRHA 3SN6A 1G17A 3W90A 3WRXC 1PV4A 3BE4A 3SC3A 2JLQA 3B9QA 3NC1C 3QVVA 4PX9A 1NP6A 3KXLA 5JLJA 1VMAA 2GCOA 3GLIE 2B21A 5F98A 3GLFB 2X77A 4EFLA 1U9IC 3KXKA 4HEJA 4MRRA 1US8B 2XZPA 4FMDF 1PUIA 1YZNA 2I4IA 4CEHA 2ZR9A 2Q3MA 4QM6A 2ZUDA 2KBFA 1TUIA 2C2HA 4CW7A 2QPAA 4DWJA 3VQTA 2BMJA 3QJYA 5L3VA 3Q85A 5LDDC 3J81k 4BQSA 2C95A 2CK3A 4EAQA 4MDEA 1D9XA 2JLVA 1W0KA 4MYTA 2OG2A 3DKVA 1UDXA 4AYTA 1RFLA 3HDTA 1NVUQ 1IXSB 4WXPA 1AS3A 4KU4A 3ZZ0A 2BCGY 4JJKA 5BW8A 2WAYA 4Q4LA 1M1YE 4XSGA 2GJSA 2J1LA 3R9IA 2VSXA 1E1RD 1O87A 2GZDA 2O0KA 1HQCA 4D0NA 3KKOA 1VIAA 2OZEA 2Q6TA 4OL0A 4ARZB 3RYTC 3W9YA 3MWLA 2RAPA 3NXSA 1E0KA 2AD1A 3VR2A 3TW4A 4JLVA 1IHUA 1HV8A 1LV7A 2WWWA 3MGCA 1JNYA 2F1RA 4XIGS 3O8RA 3QPWA 4X8MA 3K09A 4MYUA 1TU4A 2YYZA 4XWKA 4DUGA 1OKKD 5AJVB 4A4DA 4HAZA 1RVDA 3IO5A 2QMHA 3ONWA 4JLPA 4PQYA 4RZUA 4AKEA 4Q4AB 4ZO4A 2RGBA 2XITA 3BK7A 3EZ7A 3AVTA 4M1TA 2BMFA 2KB0A 3AB3A 4LPSA 4NL4H 3UWKA 3FPAA 1VIYA 4FXPA 2IYWA 1Z6XA 3R7WA 5AK0A 4TL7A 1N6RA 2J41A 4IVQA 1R10A 2QZ4A 4BLPA 1KDPA 4V0KA 4GT1A 1KNQA 3WNCA 1KI4A 1ZIPA 3CNLA 1JB1A 2VYFA 4TMXA 3LX8A 1KGDA 2J7PA 4TTRA 2XOKA 4O25A 3IBGA 3EX7C 1XZQA 4V0MA 5IHPA 2FSHA 1CJKC 621PA 3QF7A 1MO5A 1SHZA 2F3RA 5FBLB 1LVGA 2ZRGA 5FBVB 1YE8A 4CEJB 1WBBA 4TMVA 2HF9A 1IOZA 2R44A 4MKIA 3JVUA 2NO6A 1Z8FA 2FEMA 2DFNA 2YZ2A 4LOAA 3OE7A 5CJ2A 1KJWA 2ZRLA 2GETA 2YHSA 3RHFA 1UKYA 5B2ZA 4KSCA 4HDCA 4EJSB 3THXA 2YINC 1YU9A 5FBQB 4EPTA 1LW7A 1XCGB 2A7QA 1XFAA 2ZIAA 4KO8A 3EWAA 2RHDA 4LJYA 2ZI6A 1KZ7B 3LX5A 4RCZA 4URZR 5A0FA 5FH9A 5L3RA 4P33A 1OHHA 1XMJA 2IS2A 1ONBA 1G3IA 1P9NA 4B6EA 1YKSA 5EUMA 2YOFA 1II0A 1ZNZA 3V4RA 2W6ID 1UADA 1XRJA 3U4QA 1S8FA 2O8FA 2MSEB 1KIMA 3NC0C 5K8LA 3L82B 4KBFA 3QNUA 3C41J 4RSGA 2JDIA 5H1YA 3VU9A 5JS8A 4KI0A 3B7GA 2BWJA 3OEEA 1EFRA 3AQ4A 5KSPA 4OHZA 3NIBA 4UNPA 3U6KA 3QXHA 2WJGA 4ON9A 3RRNA 4ZI2A 3GD7A 4IDHA 4LYAA 1N6HA 1TEXA 2JCSA 4BFYA 3SHFA 4H1VA 1KKMA 3HYRA 5FPSA 3CRW1 2P6UA 3NKVA 2XNSA 1UKVY 2IT1A 3K1JA 1FUKA 1ZNXA 1E9FA 1XCMA 1MR3F 3EZ2A 3EPKA 4LJAA 1AA9A 5IK2D 2CBZA 2XX3A 3O8BA 3FKSD 2QMUA 3QSYA 4BE7B 1DAFA 2ZRDA 4TLDA 3REFA 3K70C 1EWQA 3EPLA 3KUCA 5HE9A 5FTNA 2GJ8A 4DLXA 1GRRA 1ZM4A 2ZJYA 3I73A 4PPQA 5B58C 4BRWA 1SVKA 5C4MA 3DOFA 2WJYA 5D3MB 1DARA 5GVSA 1WA5A 1HY3A 2ZS8A 3G0HA 2DWPA 4OQFA 4Q1FA 2IF2A 2ZI4A 5E4FA 2A5GA 1N6PA 4LWZA 4KXFB 5FUXA 4HB0A 1KMHA 4YMUA 1A5TA 3CR8A 3SBEA 2XSZA 4I1SA 3AVXA 1Z83A 2G1KA 3L0SA 1M34E 2ASEA 1VDZA 1S4QA 3QF4B 2ZVQX 1ZVQA 2ZRPA 3BD9A 3K9HA 2EWWA 1X8LA 4DSNA 4KV9A 1KZGB 3IBYA 3IHLA 3QE0A 2IS6A 5DSZA 5B57C 4JSYA 4RFSB 3THWB 1UBEA 3A58B 1RRCA 1E1RA 1OYWA 4URYR 5D3QA 2XTZA 1Z47A 2BBOA 3VR1A 3CNNA 1ZM7A 4TTPA 4UJ5A 1F2TA 4PO8A 1L2TA 1D5CA 1XD2A 1FQKA 3GJ3A 1J99A 2GK6A 3GJ5A 1JAHA 4BEBA 2QA5A 2WSSD 2CL6X 3DHWC 3MJRA 2ZE5A 3PVSA 5E7JA 2D06A 2WV9A 2PEYA 4DXAA 4ZCIA 3SQXA 1OKKA 4AI6A 3OIYA 3TKLA 1G19A 3AP2A 3PCRB 3UWOA 1FTNA 1Q1EA 3LY5A 4JLAA 2ONKA 4FD2A 2HEIA 1GVNB 2H5EA 1X86B 2PEZA 3FYHA 3HU3A 1T8TA 1Z5ZA 1CJTC 4FIDA 2A5JA 2K5UA 3VR3A 1DE0A 1R0ZA 4DDVA 4JVLA 3B1YA 4R71A 1E9EA 2W2TA 3DEFA 5KO2A 1Z0FA 3C7KA 4TL8A 2PT5A 2SHKA 2GXSA 4CEHB 4NYJQ 2DWOA 3S1AB 1W36B 1K5GA 2QQ0A 1RYFA 4TMKA 2BOVA 4QNMA 4G5RA 4OQMA 2NGRA 2WWHA 3L0PA 4PO1A 1G7CA 4G1UC 5CM9C 1G291 2YV5A 3E70C 4YQFA 5JI2E 1Z0JA 1G7RA 1WQ1R 2QGZA 1IN6A 3BC1A 2FH5B 1UEJA 1N0WA 5C46F 1GIAA 3K0FA 4JVNA 3AP1A 2DBYA 4PZYA 4URVR 3K9NA 4HLUC 4HATA 5G3YA 3K8YA 1E9AA 5DI3B 1VG0B 5EE1A 3K70D 5JRZA 3A1TA 1T9HA 1R0WA 5FUWA 4LK2A 4B74A 5KDDA 1LS1A 1LFDB 3B85A 3QKSB 2AXPA 5EE0A 4LBYA 4DCNA 1TUEA 5JFGA 1U9IA 3ZH9B 3CW2A 1D2MA 3RS2A 1WMSA 1KY3A 2IYLD 3C4JA 3NH9A 3LO5A 4N1AA 4Q9IA 4KFTA 4F7WA 1EXMA 2CLSA 3MJHA 5EJEA 5FPHA 3L0OA 2P6RA 3GLHA 2UZIR 3VTKA 3CR7A 1COWA 1SVIA 1P2UA 2W6IA 4C0BA 3MWJA 4JSTA 3B1VA 1DVRA 4C2TA 4DB4A 2VLIA 4AYXA 1KI8A 1OXVA 2OSBA 1NL3A 4GFDA 4BPBA 4B3XA 3AF4A 1DAIA 3R8CA 3RAPR 1NN1A 4QL3A 2C96A 2Z6VA 4MRNA 1QHHB 4ZIRB 4IXMA 1R4AA 2PZFA 2QG6A 4NKRA 4TWZA 4I99A 3DVLA 4P3YA 4W9MC 2BCJQ 2RHMA 3GJXC 4JLMA 1P7CA 4NCIA 3W34A 1KSFX 2CL7X 3N70A 3BBPA 2ANBA 2I3BA 2Q9AA 3CX8A 5KHOC 2ZRNA 4P4SA 4QKQA 4LJ7A 3TUIC 4A6XA 3L0IB 1FW6A 3GJ0A 3P4YA 2CDNA 3EXAA 1ZUNB 2OO7A 2ZJZA 2OHFA 1VCMA 5IK2A 4BFVA 5JRJA 4K46A 5F2EA 4E07A 1NMXA 4TLEA 3CX6A 4IVRA 2NO9A 3SYNA 4J0QA 4HLDA 2IHBA 1P75A 1CRPA 3U6BA 4D25A 4HZUB 2VP4A 3WYAA 2QN6A 4S35A 3PUYA 1U0HC 3FE2A 5KYKA 1W4AA 1EWRA 1RC8A 1VCIA 1FNMA 3LH5A 1EGAA 4M4SA 3TE6A 1J8MF 121PA 4RD2A 4BWYA 1M2OB 4QGAA 2ZR0A 3EAQA 4PXAA 2HDNB 3EC2A 1TQDA 1SXJE 2ZI7A 2GAOA 3QIAA 4M1WA 4ASUD 1LY1A 1KYIA 1G6HA 2PH1A 1XTSA 2GDJA 5BN4A 4BECA 1N6NA 2V1XA 4QBFA 5L3SA 3KB2A 2H1LA 2ZREA 4DSTA 4Q9JA 1U98A 4MKHA 1ZUIA 3P27A 3IIJA 4BFZA 4QGHA 4LHXA 2QP4A 1H8HD 3U4QB 1U81A 1Q3HA 5FPTA 3RWMB 2FU5C 3TW8B 4C3ZA 3UXMA 1K6MA 1AK2A 4QBIA 2BHRA 4K8OA 5KUTA 2O8BB 1AQUA 3GJ8A 3KQHA 4MDFA 4Q5IA 4FMBB 4KFSA 4BLOA 1E2FA 1N5IA 4TN1A 3GLGE 2CCJA 1MO4A 2IS4A 2EWVA 5CB8A 2OE2A 2PJZA 3MG9A 5J4KA 2OCBA 4JBXA 2GEUA 5DGXA 3KJIA 3TMKA 3UG7A 1GDDA 3AVYA 1D6JA 1YZLA 2ORIA 3M4YA 3K09C 2Z4SA 5TV2A 4HUTA 2HLDD 4TYPA 4II7A 1M7GA 2OCPA 1DEKA 2VO1A 3MMPA 1QHYA 1HUQA 4TT3D 2ODEA 4YDHB 5CJPA 1E96A 2CCKA 4KVAA 1GFIA 2F9MA 2FSFA 2QI9C 2ZRAA 3PR1A 2D3WA 4Q66C 2FZ4A 2QSZA 2FV8A 3N2EA 2F43A 2LKCA 1WB9A 5JJLA 3OHMA 1N6LA 1Z6GA 2OAQ1 5EXXA 5FFMA 3RABA 3TUJC 4EPXA 3ADCA 4M0LA 4U7DA 3CPHA 4GBMA 3SOPA 2WJJA 4M1SA 3W5IA 2QL6A 2WAXA 3LA6A 2CLDX 5JSZA 3FHTA 4LC0A 2JJ8A 2XZLA 4EKDA 3QBTA 4KVGA 1KMHB 1KO1A 4LJ9A 4Q1DA 4CZ2A 3H1TA 4UNNA 2VF8A 2CHQA 2HXSA 2UKDA 3ZQ6A 4B3DA 5GADl 1GITA 3PG5A 1CS4C 3WBJA 2ZR7A 4P31A 1SVOA 1ODFA 2VP0A 1KK2A 4PTLA 1NKSA 5DN6D 4DT1A 1WBDA 1IN5A 4ABYA 1CRQA 5LB4A 2ZJ2A 5AJWA 3Q7PA 4GRAA 5DHAA 4P4UA 2CE2X 4PC1A 1SKYE 1IAQA 3TR5A 1A7JA 1R5OA 1TMKA 1G8HA 5TDHA 5SZKB 3E1SA 2CVFA 5L3QA 1MH1A 4WZAE 2D2EA 2OBMA 2GK7A 1W46A 5JWRA 3RS7A 1XD2B 4DLUA 1X8JA 1RKBA 1X3SA 1VTKA 3FFAA 4F91B 1GKIA 2QROA 3K0SA 3FOZA 4B2IA 2CK3D 4HAWA 1GRQA 5H70A 2V7QD 3Q9LA 4ITRC 3ZZTA 2RCNA 4B6FA 5LB2A 3ADBA 4NMMA 1GL9B 5KNDA 1P60A 1NJGA 4PC3A 4C2UA 3AGQA 2V6IA 4IFBA 4RD4A 3OIUA 1EFTA 1DELA 4W7SA 3TQFA 4IVPA 4IOJA 5BWMA 4XVRA 2IYQA 1T3SA 2JA1A 1IQPA 4LHVA 1I2DA 2X19A 1S1MA 2PL3A 2PLFA 4UNQA 2IS1A 4AG6A 5AUOB 2C99A 2IYYA 4GI7A 2W00A 3I4LA 2QRNA 5EP4A 3CM0A 2W6JD 5AUPB 3QXSA 2QPOA 5DO9A 1RW4A 3IO3A 2V6JA 1ZD9A 3SNHA 4XTRA 1R2QA 3C16C 2HYDA 3SEAA 1XBTA 3T61A 2IXGA 1E2JA 2OT3B 4GOJA 3BB4A 3LAWA 3QG1A 3U2QA 2FA9A 2FPLA 3GEIA 4BLTA 1SGWA 4DDTA 1X1SA 2HCBA 4BLSA 2FG5A 2W2VA 3W6PA 2DFTA 1Z08A 3B82A 1WRBA 4MKGA 2VA8A 2QT0A 2X1VA 3AF2A 2FPKA 2IEZA 4ASUA 1T5LA 2EYUA 1DAKA 2WJVA 1KMQA 2CL0X 1E6CA 3CH4B 2ZRKA 2QAJA 1TF2A 1ZINA 1ZJ6A 5HKKD 3KB1A 2J7PD 1CP2A 2WZQA 2O0JA 4DCVA 2VQSA 2WMOB 2V3CC 2P3SA 3GLHB 4QG7A 3T5GA 1TF7A 4C0JA 5JCZA 2BDTA 4UQOA 3CRVA 2QT1A 3WMEA 1R0YA 3T35A 4QBHA 2Q9BA 2ZJ5A 2O52A 3NH6A 1PUJA 4DDWA 1N5JA 3AF3A 3CONA 4LJ8A 2QNRA 1KNXA 4DSUA 4HLUA 1MT0A 3B78A 2CE7A 3IEUA 3OE7D 1NSFA 1U8ZA 3C5HA 4UXHA 1SVSA 4ZDKA 4JVSB 4RKFA 1S2MA 4GL2A 2ZRFA 2Z0MA 3Q8XB 1P62B 1G3RA 2GTPA 3PUVA 221PA 1XEWY 3O8CA 2ODBA 3GLIA 1AGPA 1S1CA 1KSJA 2HLDA 5CYOA 3WMGA 4EQ6A 3RDPA 4C7OB 4Q4JA 2H7VA 4UXIA 3QKTA 3DL0A 1NLZA 3FDIA 4M8NE 1OHHD 3Q3JB 3R20A 2ZJAA 1KKLA 3CX7A 1KTVA 4LYJA 2QBYB 1W49A 3R8FA 2A3RA 3U44B 4M9ZA 3VKHA 2ZAOA 3NHAA 4NCNA 2GAAA 2IWHA 4KFUA 1ZIOA 1D8TA 2J0SA 4FCVA 1UEIA 3I5YA 1VPLA 2ZPTX 2QMOA 5AJZA 3OEED 4DIEA 5KDOA 3T1QA 4B3GA 4CT5A 4Z8YA 1PLKA 1FQJA 2P6NA 1AZSC 1N6KA 1G5RA 2W0SA 1NKTA 1TNDA 1Z06A 3RRMA 2J9RA 2WWGA 1HYQA 1XTKA 1X6VA 1YRAA 1EX7A 5GJVC 3CKLA 1OIVA 5HZKA 4LI0A 4PR0A 1T0HB 2C77A 4DDUA 3D8BA 4DHEA 4QBGB 5DN6A 1NF3A 2WHXA 3SYLA 5E95A 4TMZA 4JT4A 1UF9A 2VL7A 4NH0A 4Q9LA 1UBGA 2JLSA 3QQ5A 2V1UA 4OJKA 5JJIA 1XJCA 4LV6A 2JGNA 1VECA 1N0VC 2LCFA 3EZ6A 4JT2A 1XMVA 1XWIA 4HDQB 4AKGA 4D0GA 2QM8A 5FOWA 3WHKA 1ESNA 3PXGA 3AKYA 4JYBA 4OQLA 4DCTA 3EPHA 2NMVA 3QKRA 4RD6A 3IKJA 2QAGB 2XSZD 4LC1A 2G88A 5J40A 2A78A 1YZGA 4L15A 1IN7A 4PHHA 1SXJC 1XEXB 4PQFA 3W3AA 4BFSA 3DMDA 1J7KA 1J70A 2V7QA 2LWIA 3PV0A 4WAUA 4RFVA 4JLKA 3BWDD 3AUYA 2HT1A 4KLNA 2ANCA 1JR3A 2DFKB 2VEDA 3U3JA 4B73A 4LYHA 4OHWA 5FPYA 2IYSA 1HTWA 1QG4A 1Z6AA 2IUSA 3AVPA 1WF3A 1UFQA 5KSYA 2JLWA 4XD7A 1F60A 4ACBA 5G40A 5K8IA 1GG2A 2G3YA 2O8CA 3TLXA 1S9HA 4YMTA 3BJIC 3ZJYA 2ONJA 5TMPA 4OK6A 5IDVA 3T15A 4TLCA 1W44A 2C78A 4AWXA 1NJFA 2W6JA 4Q7JB 3U7FB 2BV3A 1DS6A 1OYYA 5FTLA 1AGRA 5EE3A 2CHVA 5FOVA 3GCGA 3UIEA 3WY9A 3OEHD 3OESA 1XPOA 3LLUA 3UMSA 4Y0VA 3MLEA 4K81B 1NSTA 3K70B 1RJ9A 1GILA 1X1RA 1F6BA 3PEUA 3TK1A 1XZPA 4Q1BA 3KQNA 1W0JA 2GJKA 4V0OA 4NBSA 1Y3AA 3RS3A 2WJIA 3V4FA 2J0QA 1N5LA 5BXQC 5KNCA 1UBFA 1Q57A 2RGGA 2VRWA 1HH4A 3CNOA 1JR3E 2WOJA 2REOA 1FX0B 1G16A 2CNWD 5HKKA 3ZVRA 1NVXQ 2ODNA 4XTCS 4PZZA 3NVAA 2KWIA 3WMFA 1L7VC 3RC3A 3PEYA 2AD5A 4MYHA 1JQJC 1KI9A 2FJUA 4M21A 2V9PA 1KK3A 2W2XA 2ZTSA 4BUJA 3THYA 2WM9B 5HZHA 5DYIA 1CJUC 1Q1BA 1T3HA 5DH9A 3TUZC 3TR0A 3CIOA 2A5YB 3PJRA 1S0UA 3THOA 1OXXK 1XJQA 4B3BA 5LD2C 2MMCA 1E2NA 4WA7A 1KOFA 2HCJB 2FGJA 1UDWA 2FFBA 3H86A 2WBLC 4KLZA 4GP6A 1G41A 2WWIA 3TVDA 2I1VB 3EC1A 4KBGA 4Q02A 3U3MA 3PFIA 2HXYA 4NZYA 2JEOA 4DLTA 1TQ6A 5FUYA 3HPRA 3X1YA 3W3ZB 3CPEA 3BIFA 1TADA 1COWD 4L4UA 5E3HA 2NPFA 1SXJD 3SI7A 4CYMA 1QHGA 5K8UA 1P2TA 1NN5A 4A8JB 1W4RA 4AIIA 1E0JA 4YC7A 3RRZA 1Q44A 5CLQA 4BRUA 1HQYE 1E0AA 1HT2E 5ANRB 4XVUA 3KTAB 1QDEA 1QRAA 3IIMA 2IL1A 4LCBA 5DE3A 1L4UA 5JJKA 1CEEA 1Z28A 3KL4A 4PC6A 4PANA 2AK2A 4BZXA 2OLKA 1DG1G 1S9DA 3LLMA 2B7BA 3B6EA 4L9SA 2B8WA 1F5NA 1ZW6A 3V00A 5DNYB 2WKPA 4A0FA 2ZQ5A 3WHLA 4HYYA 1S96A 2VP2A 2NZ8A 5EZ5A 3HR7A 3BXZA 1BH2A 4PHTA 1P72A 1E2PA 4NYJR 4NU0A 5JECA 5AUQA 1A4RA 4JKYA 1E2MA 4ESVA 3G82C 4GSYA 1OF1A 1W5SA 2O5VA 2G1JA 3JZAA 1CJVC 2G0TA 2Z43A 4PC7A 4U02A 3K0AB 5JHHB 2XXAB 2BMDA 1DOAA 3ICQB 1CU1A 2ZU0C 2GILA 4HDOB 4B2PA 2FSGA 3R9WA 2OXRA 1Q21A 4TMTA 3TSZA 3MFYA 4JBWA 1K8RA 1ZU5A 4E09A 1ZCBA 2BC9A 4IJMA 4Q4JB 4LBVA 4DCUA 6Q21A 1QBKC 1V43A 4OI1A 3T12A 3X1ZA 2G0NA 1L8QA 4A2WA 2EQBA 4IEEA 2JJ2D 4JL6A 2RGAA 4NYIR 1OPXA 3TH5A 3SJBA 5JI3E 1A2BA 5FPKA 4EIWA 5FR1A 1F3OA 3VFDA 4KITB 2J0VA 1Q20A 1FMJA 1JBKA 2UZ3A 2JLXA 5GJCA 4EFNA 3T5DA 5LPNA 1P9WA 1R5NA 2CJWB 4TL6A 4IFEA 4A82A 1KSHA 3PENA 3CWZA 4NE2A 3CLVA 1Q12A 2AWOA 4HUQB 2IUUA 1TX4B 2J59A 5EP3A 4HB3A 1G5PA 2P2LA 3BRWD 3OAAA 5HTKA 4QM7A 4DKXA 3TSOA 4QJ3A 5SZHB 1DO0A 4Q18A 4XWAA 3REGA 3IGFA 1X8KA 4EJSC 3ZD7A 4JZKA 3KKNA 1E69A 1Q22A 3LW8A 5BN3A 4LJ4A 1HA3A 2ZRJA 3OEHA 2YWFA 1YZTA 3GQBA 1BS1A 3ND9A 2GWHA 2GCOB 2IA5A 2LKDA 1P61B 3PEWA 4H9GA 2AN9A 4Q1AA 3QVUA 3U7HB 1OH8A 3UK6A 1WDTA 2R8RA 5TY0A 1G4UR 3KXIA 2EW1A 1U0JA 3IEVA 3LVQE 4LDJA 2V4ZA 3UATA 3KQUA 2CNWA 4WXRA 3QKRB 1Z0KA 5DYGA 1RIFA 2H57A 3KJEA 2GCPA 4Z1MA 1OB5A 5H68A 4V03A 3KKMA 5CM8B 3IHWA 4B43A 2P67A 2YKGA 4NCHA 5KU1A 3QPUA 4CIDA 1Z3IX 1T91A 2RH5A 3NWJA 2PX0A 5HPYB 5EE9A 1CLUA 2AFIE 5JBQA 1E99A 3NTUA 3AGPA 2QSYA 4WIAA 4L9WA 4XVQA 4RD1A 1JAIA 4NYIQ 1XTQA 1ZUHA 4D0LB 4OHYA 3B5JA 3DM5A 2WWXA 2OUKA 1SZPA 4PO9A 1BO6A 2VTKA 1W1WA 4ZI3A 5C18A 1E79A 1Z6YA 4IOMA 4O3MA 4TYYA 2Z83A 3AKEA 1EFCA 1MABA 4MGKR 1QVAA 3ZYCA 1JPNA 4AG5A 4EPWA 1F2UA 3ASZA 3AVQA 4BASA 1II8A 1AM4D 1LS6A 1NVVR 1Q1QA 1GKUB 3PUWA 4RD0A 3UKDA 4JVMA 4PQRA 3CBQA 4A0HA 1SXJA 1ZM2A 4U00A 2FX3A 3CF0A 3QUSA 1XMIA 4JKIA 4EDHA 3SDZA 2Z5FA 2WICA 4DJTA 1NBMA 1YHNA 2OM2A 1E2HA 4DLSA 2BBWA 1XXHA 2QPTA 4US2R 3NBYC 4ESHA 4A2PA 2R62A 1KAGA 1ZM3A 1JEEA 4QJ4A 2AKAB 1XTIA 3BH7A 4IXNA 4OK5A 3R7WB 1G3MA 2XEXA 1VKJA 4AC9A 2OEPA 4D81A 1U99A 2IC5A 1KO8A 2JLUA 2F1HA 4Q4HA 1CULC 5B30A 3U61B 1KDRA 2XGJA 3RWOA 4C0QC 4RKEA 5EXTA 5FI1B 4CEIA 3TGPA 2BKUA 4GMDA 3FKQA 3GLGA 2REBA 2VIIA 4MYCA 1T8UA 1GRNA 1KO7A 2OBLA 2ZJBA 4G0NA 2YWHA 2GXAA 1R5BA 4HB4A 2C98A 4LHZA 4TTQA 4IDPA 4TSFA 2Q3HA 2BIFA 1U90A 4NCKA 4PPNA 1D9ZA 4RD3A 1GNRA 3AKCA 2IUTA 1FNNA 3RANA 3NDPA 5CDFE 1ESMA 1GNQA 2EVWX 4KJZA 1A2KC 4WW0A 1LB1B 3WBKA 3THXB 1EG7A 4BFWA 4HLCA 4IOLA 5UKDA 3DDCA 5C2JB 4YONB 3VKWA 1NBME 4WVFA 3TAUA 4UNRA 1W4CA 3KX2A 4IKEA 1AKEA 1LF5A 4YMSA 1XXHE 3U7EB 1C1YA 4PSAA 2MSCB 3AF1A 4GP7A 4H1UA 4AURA 2FZLA 2JJ2A 1OXTA 2ZRHA 4WOPA 4DCSA 3A1WA 1C9KA 3EA0A 1W36C 1KI7A 4RVCA 3N5CA 5DI9A 1JECA 2O8FB 1JR6A 1G3QA 2VHJA 2XZOA 5JWHA 2O8DA 1NVVQ 1QVRA 3GEEA 2R9VA 1W47A 3VU9B 3WYGA 2H8KA 2ZUBA 1GP2A 2FDCA 1ZCAA 2P5SA 2VHCA 4UNSA 2B7CA 3B1WA 4G01B 1T4GA 1GKYA 2QE7D 1EESA 3PUXA 2AHOA 2VPPA 4HAXA 3KKQA 4MA4A 4XH9B 1QHXA 4N0DA 2RB4A 5FOUA 1L4YA 1PJRA 3EIHA 1B0UA 3FHOA 1RZ3A 3I8XA 3CB4A 4O0MA 3GLFA 4LSGA 4XOIA 1OH7A 1US8A 1OFHA 5C1BA 1GL6A 2WJHA 1KI6A 1I4TD 1ZAKA 3HP1A 3GFPA 1EX6A 2FFAA 3GPLA 1IN8A 2IXFA 1XP8A 3SJZA 2G83A 3I92A 4BFTA 4HLQB 1BYIA 1DTSA 3QPVA 2FE4A 3GJ7A 4YMWA 4ZCMA 4ZV4A 1E3MA 4P32A 5HR5A 2KJQA 5IRCD 2HYIC 3DMNA 4PPFA 3TJZA 1ZBDA 1OFTA 4XWOA 1NIPA 2G6BA 3I62A 3QENA 2ORVA 1KAOA 1OV4A 4FINA 5J5CA 2ERXA 2GEDA 1GM5A 5FL7A 2RGNA 3GFOA 2XAUA 4QGFA 4GDFA 5A5GA 4ARZA 5EE5B 3KQKA 1JJVA 4IOKA 5TB5A 2GXUA 2J0UA 3QKUA 1GUAA 2DWQA 4DSOA 2VP5A 1RE0A 2GEVA 1N2CE 4JJZA 2JIZD 3LV8A 4G5OA 1MOZA 2P65A 5J4VA 4IEIA 1NMZA 5JWOA 3GLFE 1VG1A 2QUZA 1F2TB 3MWKA 1EFUA 4CT4B 2RGXA 4BLQA 821PA 3BS4A 4GOKA 1ZD8A 2N1BA 2ZROA 1C4OA 1E1QD 1Z07A 3ZGXA 1OIWA 1KDOA 4IW3B 3VKGA 2QMEA 2QENA 4Q19A 4Q4AA 1YRBA 2BM0A 1YQTA 5K8TA 1Z22A 3ZQJA 4DLYA 4I1OA 4G5QA 5E7MA 4W5JA 1J2JA 2X2FA 3CWQA 4PSVA 3GEHA 2KE5A 2BMEA 1R8SA 1JR3D 2VSFA 1CJMA 4NDZA 1E9BA 3OZXA 4F38A 4IDOA 5EUQB 1W36D 4BZPA 1JALA 3QEJA 4DIDA 2D7DA 4D26A 2F3TA 1DG3A 2QP3A 2EFHB 4KHZA 4PZLA 2JLZA 2IYZA 4XD7D 4PFSA 3ZVNA 2IYVA 5G3ZA 3EPJA 3HJNA 2D7CA 1NNEA 3SFVA 3AM1A 2FFQA 2GVDC 2Q9CA 3DKPA 4OI4A 3QG5A 5FOSA 3TVTA 3LBHA 3P26A 3T1TA 1GAJA 1HE1C 4A15A 2IXEA 2V55B 5BN5A 4JLDA 2YOGA 2GCNA 4M53A 1XEFA 4PPGA 4CEJA 3AH8A 4CDGA 1OT3A 2JAQA 3M6AA 4EPVA 2Q0HA 2YC2C 4R7ZA 1AIPA 3I72A 4R98A 3K0FB 1MV5A 4EJSA 5L8VA 2BM1A 5JCPA 2VP9A 5J4HA 3K53A 3LBIA 4QOSA 1DAGA 5JMTA 2XTMA 3OIVA 2WIBA 4L8GA 3LXRA 3RLFA 4A0RA 4D4MA 1CR0A 2DR3A 2ZRIA 1W0JD 1MO6A 1WCV1 3A4NA 4FN5A 3E2IA 2VBCA 2WPDD 2ZRMA 1Q1ZA 3U7GA 2IF0A 3X1WA 1XF9A 2YWEA 4FCWA 1E4VA 4W5WA 1BIFA 1IJEA 1NLYA 5FTJA 3LBNA 1F2UB 1FFHA 4KYUA 1YZKA 3EIEA 3L8YA 1UPTA 2C03A 4Z8XA 3Q7QA 1II8B 4LYFA 4RJLA 1CTQA 3MUFA 1YZUA 2EFGA 2J7KA 3MAAC 1E2GA 1E2LA 1VYVA 2GKSA 3VR5A 2YC4C 3SQWA 1NRJB 3BORA 1RYHA 3CZPA 3KJGA 4EPYA 4NYMQ 1UJ2A 2P5TB 1E2EA 2E1RA 4GNKA 4G5SA 4TZ6A 3CRQA 1GSIA 2QE7A 2WVJA 1N25A 2QM7A 1KY2A 3TIFA 4CF7A 1P2SA 5JZVA 3DM9B 2REXB 3FMOB 4A1FA 3Q5EA 4DVGA 2QRZA 1ETUA 4BZQA 1S3SA 3K9LA 4P4SB 3U60B 4A6PA 5LBIA 2GZHA 4URUR 2ZEJA 4F92B 3FB4A 3EG5A 3L2OB 4KFRA 5D3MA 3T1OA 1OXUA 2AXNA 2J3EA 2J45A 4QJ5A 2IBMA 2AK3A 4KYIB 3FFBA 3UMFA 3GJ4A 4D4LA 1OJLA 3TSWA 3F0TA 3FGNA 4KSBA 3SU8A 3WP1B 4QFMA 3FHCB 2RGDA 2AX4A 4TQAA 2ZS7A 4ZDJA 2GZAA 1R7RA 4B75A 1FOEB 5CK5A 2WTUA 1CXZA 5FBWB 3A1SA 1EK0A 1XD8A 1XTRA 2C9OA 3QF4A 5AR1A 4PHGA 2ATVA 1P3JA 2ZRCA 3GFTA 4G5GA 4BGDA 2CEAA 2XB2A 5C4GB 4I4LA 5FL3A 3K0CC 1D2EA 1E9SA 2AR7A 2F1IA 3CRMA 1XPUA 5L3SB 1W2GA 1FMLA 4RFSA 3FMPB 3THWA 1AKYA 1IBRA 3C8UA 3B1XA 4EPRA 1ZNYA 2YVUA 4QNRA 2GBLC 2JASA 3O8DA 1TTTA 1SKQA 1AJEA 4D82A 1CF4A 1OFUX 2NOAA 4IHQA 1OH5A 3A8TA 2JIZA 4ACAA 1VHTA 4JYCA 4QC2A 4MQBA 1CR2A 4YXWD 5KTYA 4QGGA 1G20E 2ZITA 2R6FA 1E32A 2RKOA 4WZ6A 4O2RA 2IYXA 1OLOA 2FSIA 5IT5A 1E2KA 4DLVA 3FMIA 1G8GA 4KAXA 4UKDA 1E1QA 4Y0AA 2F55A 1KHTA 2QTVB 2ZS9A 3LFUA 2PBRA 1Y63A 5CIWA 3ETLA 2EYQA 3WXMA 3KQLA 2PMDA 3A4MA 1SKYB 4YDSA 3MWYW 4C30A 3QI2A 4MH0R 4MITA 3SR0A 3ASYA 1PZNA 2B6HA 4JIMA 3H0KA 4ZCLA 1TAGA 1KI6B 4Q9HA 3I61A 2A5FA 2C9CA 2GA8A 2P0EA 4LRWA 4OBEA 3S1AA 4HAUA 2F43B 3EA5A 1D2NA 2NPIA 1W7AA 1M74A 3TRFA 3JVVA 4D2IA 2ATXA 3PQCA 2FNAA 2MMGA 1YR9A 4UJ3A 3TNFA 4QRHA 4MUBA 2G77B 2GF9A 3AKDA 3GJ6A 5JSZB 1U2RA 3TBKA 1N6IA 2ZSFA 2HJGA 2NO7A 3OAAD 3EARA 4RZXA 4OI0A 1P4SA 1ZP6A 4TZ0A 3BOSA 2Z4RA 3A4LA 1BMFA 4Q00A 5CIQA 3NBXX 3IPXA 1A82A 5DI3A 1E94E 1R0XA 1KO4A 4DLZA 4LJ6A 1OE0A 3QKSA 2ZYTX 1JEDA 2ZSBA 4Q1EA 4DT1B 5FOXA 2GJAA 1CR4A 2J0UB 2JLYA 2B8TA 2NG1A 2CHGA 2PT7A 3A36A 3ADDA 3B8HA 5KSOA 2OV2A 3EWSA 1SQ5A 4ZKEA 3LXXA 3VNVA 5SZJA 5TARA 5AUNB 3RS0A 4GZMA 5L3QB 1VYTA 3ECCA 4IDQA 5P21A 1G8YA 2WPDA 3KZ1E 4TQ9A 2DYKA 1SVWA 4TLAA 1E2DA 3HR8A 2F6RA 2W58A 1ZMXA 1K5DA 2KI5A 1O3YA 3BFVA 4Z1MD 2WOOA 3ICEA 2QU8A 4S2EA 1ZC3A 3AF0A 1UKZA 2C04A 2RGCA 3HPQA 3K9GA 1LTQA 2ZYWX 4ZIRA 1QHHA 2A5DA 1JPJA 3D3QA 1W5TA 2TMKA 4A9AA 4QXAA 5TVKA 4D80A 2C5LA 4DRZA 5EXSA 3RSLA 3UMRA 1P2VA 3UG6A 1FP6A 1G3UA 3NHBA 3ZZUA 3NEYA 5FUVA 1FPMA 4RY2A 2N42A 2CCGA 4B71A 2V8OA 4LBWA 4N0EA 1RRPA 3BGWA 4YMVA 2E87A 1E79D 3CO5A 3VAAA 2GHIA 3I32A 2EFDB 3LQQA 2VF7A 5KSZA 1XU4A 4C0AC 5BQ5A 3SZRA 4I81A 4P4TA 4V02A 2HUPA 4HZUA 1VYUA 5DISB 2Y8EA 2YNMA 1M7HA 3AEZA 5AWFC 1V5WA 2ZSAA 3T06B 2WKRA 1MRSA 2OLJA 3IILA 4LV5B 1TPZA 2QAGC 2ZSEA 1NBMD 4Q21A 3WNDA 2R6AA 4DEYA 4TYNA 2PLRA 4FI3C 1Q3TA 3VX3A 1DO2A 2ZI3A 1YR6A 3LRPA 3SJAA 1YR8A 2L0XA 2EFCB 3LDAA 1U8YA 421PA 2OCAA 1N3BA 3H84A 3SBDA 4MUAA 4HSEA 2IWRA 3N2IA 4NHOA 1KI3A 2RGNC 3BB1A 4C0LA 5G41A 1G1MA 3EZFA 1IY1A 1TU3A 4LV8B 4B2LA 1OXSC 1R6BX 2ZJOA 3ZDQA 2O8BA 3OFND 3BH0A 3RNLA 2IK8A 2A30A 2OESA 1ZM9A 4GOXA 4AK9A 1FTSA 4PHFA 1AQYA 5CB6A 1HT1E 5IF9A 2NO1A 3UANA 1NIJA 1HURA 4JS0A 4UXJA 5DLQC 1XDBA 4TSFD 4V0ME 1KK1A 1ZD1A 3NBZC 3M1IA 1WP9A 2FFHA 2UVQA 3D6TB 4YXWA 2FF7A 1IN4A 1DADA 2BEKA 5A4JA 4KCGA 3JZMA 1T6NA 1E9RA 2XJ4A 1I2MA 1T3LA 4A2QA 3GLIB 2H92A 1M7BA 3LNCA 4EQ6B 2ZJ8A 2FEOA 4B76A 4EUNA 5HCNA 2YJTD 3AVOA 3LW7A 1DAHA 1VCOA 2CLCX 4B44A 1TEVA 4M1OA 1UAAA 4B47A 4Q01A 1XPRA 3CF6R 1TQ2A 2FMXA 4OQXA 2R6DA 4B32A 5CITA 1U8AA 2OXCA 5HE8A 2QY9A 4A92A 3ZD6A 4LPKA 4CRWB 4JLNA 3E5HA 2ZAMA 4D6PA 1FP7A 1NN3A 1RRFA 1S3GA 2OAP1 2PX3A 3CZQA 3M0EA 4ZDWA 2ERYA 3SE0A 2ZM5A 3VR6A 3AP3A 3QXJA 4TLBA 2J46A 4IRUB 4B3FX 1VG9B 1W2HA 1LNZA 5EP1A 1CKEA 5DIFA 2J87A 4HI0E 3F5FA 1IM2A 4JLBA 1WXQA 1M8PA 1NLFA 4F4CA 3BFKA 2DB3A 4M1KA 3W5JA 3U3KA 4LZZA 1IONA 3QOFA 1IXRC 4X8LA 4PSKA 1UKEA 2QGNA 2ZE6A 4Z51A 2DPXA 4M9SA 1FZQA 3NEJA 4Q03A 4OQNA 4TMWA 1G5TA 3C5CA 3C15C 3V9PA 2CMKA 4LJ5A 4NPHA 4A36A 4A0GA 4A8JC 2WSMA 3RC8A 4M22A 4LBZA 2OFXA 4MGYR 2JJ1D 3DOEA 2PMKA 3EIQA 5FL7D 4Q7MB 3K0CA 3HWSA 2NTYC 2ZETA 1Z2CA 4Q47A 4ZDIA 3AVVA 3SS8A 4TL9A 2GRJA 1FUUA 1DAMA 2I1QA 4OJQA 5J47A 2GBLA 2NO0A 1P5ZB 3HU1A 1G18A 1KDTA 2PCLA 4LHWA 5FTKA 3R9XA 1E2IA 1XD9A 2VP6A 3IDQA 4US1R 3IPYA 3NG1A 1CR1A 3ADKA 4MGZR 5CLLA 521PA 4BFXA 4C4PA 4F4IA 3A6PC 5KPJA 1GWNA 1G8FA 2O8CB 3AVUA 4C0HA 3P32A 5EZ6B 2JATA 1OFIA 2V54A 4OI2A 1II9A 3SJCA 4FWTA 2DY1A 1KSGA 1VHLA 1N6OA 4TQUS 5CDFA 3DZ8A 4AYWA 1R8QA 5FOTA 2XNDD 2H17A 1Q0UA 2D74A 5SZIA 1GZSA 4Q7KA 3PIRA 1NG1A 1JQLB 1RJ9B 4NCJA 1OB2A 1M6NA 4C0KA 1RPZA 3K0EA 4W5HA 1XNJA 2ZYVX 1Z0IA 1MKYA 1KI2A 2BJWA 2ZU6A 2ODWA 4X8OA 4N3NA 1SHKA 1XB2A 1XTJA 4O2LA 4QHTA 4E5UA 5J4LA 1QHNA 5JS7A 3H4MA 4Q9KA 5EP2A 3KKPA 1OSNA 3OFNA 3C14C 3FWYA 2RMKA 3GP8A 2N46A 3W8RA 3ZS9A 3W6NA 2B92A 3ZIAD 1Z2AA 1XMSA 2OFOA 4MGIR 3THYB 2ZI5A 8OHMA 1UM8A 3IUYA 4JL5A 1AN0A 4C0SA 1OW3B 1TL7C 4CVNA 5KPDA 2ORWA 4R2HA 2VHQA 2GVZC 4OHVA 3RS4A 5ELXA 4Q7LA 3ZS8A 2Q3FA 2C9YA 2FWRA 1ELOA 3RVBA 1QHIA 5KOYA 2WWYA 4C7OA 2R2AA 4D4JA 1G21E 3IQXA 4OHXA 4POAA 1Z29A 5M04A 1NY6A 1I4LD 3FKSA 5F3WB 3QY0A 5EQTA 2QBYA 3MCAA 5FR2A 3T1VA 4JLOA 2KSQA 2QEQA 3U44A 1KJYA 1VCNA 4E22A 4QHYA 1H65A 4HAVA 2D2FA 4U5XA 2O8EA 4HAYA 3O47A 2O0HA 1KO5A 4HB2A 1BKDR 3WNBA 4R9UC 3GLHE 2VHTA 1QF9A 4XJXA 3AVWA 3VNUA 1AS2A 3U3RA 4M1MA 1W48A 2KBEA 3BAFA 4CGZA 1G64A 3EASA 4KODA 2FOLA 1QHSA 3T34A 4LY6A 3MD0A 1E9CA 3CF2A 4M9QA 1F48A 4MRSA 3LD9A 4AY2A 4MKFA 2F1JA 3PITA 4AKIA 1FL9A 3FVQA 1CIPA 1UBCA 4M1YA 4BFUA 2BEJA 2OILA 3B60A 4EFMA 3P1JA 3AUXA 4D4KA 2IHYA 5F9HA 1NY5A 4B33A 2MSDB 3KDSE 2FPMA 3P4XA 5CK4A 1U94A 2ZYUX 2IW3A 2BBSA 3X1XA 2F7SA 1G7SA 2QP9X 4M2LA 3VHLB 4C9BA 2BBTA 2WKQA 3GMTA 4Z54A 3CRRA 2WIAA 1P6XA 2BJVA 4OYHA 2JLRA 2ZRBA 4LGMA 4RZ2A 4L16A 3TQCA 3RRYA 3W6OA 3X2SA 2IX3A 3KJHA 2HV8A 2QAGA 2D62A 3X1DA 2WSSA 2GNOA 1OH6A 3QXCA 4ZKDA 1G9XA 4JLJA 1XEXA 2FN4A 3CH5A 2WWFA 1GOTA 2ZVPX 1JI0A 2IYRA 3FTQA 3WRYC 2JJ1A 3PEVA 3Q5DA 3WYFA 4DLWA 4FMCB 1G7TA 2DHRA 2E9SA 2WMNB 1YZQA 1YR7A 4MRPA 4X8HA 2G9NA 2ZE8A 5GJBA 3B13B 1EFHA 1PLJA
chains in the Genus database with same CATH superfamily
1B6SA 1GL7A 4Q82A 2J3JA 4C2BA 2JFYA 3LGSA 4OQPA 1RKQA 3VHXA 4P0TA 2VNSA 4G37A 5FTMA 4KRYA 2HTEA 3UAZA 1T25A 4NJMB 3Q7IA 4HQRA 3SD7A 2FSUA 4OB6A 1VLVA 2FN9A 4R2LA 3KR2A 4GYYA 5GJWC 4EZIA 1LVHA 2PCJA 4I1UA 1Z17A 2HL6A 4GD3Q 5E7IA 5EQJB 3RSQA 3QVXA 4B45A 4EVIA 3N75A 4B35A 2YJ6A 2DFLA 3RUDA 3LQRA 4RESA 1DPFA 2A9KA 4R40A 1BJRE 4UU1A 2OQVA 4AL4A 5FNVF 4EJFA 1ZESA 4C43A 4MW9A 2YNMC 3BRQA 3G8AA 4O1HA 4GPTA 3RSZA 3VH1A 4E03A 4GS5A 721PA 2E6KA 2GN9A 1EFLA 4F2WA 3SFZA 2NV0A 3C2QA 4PAMA 5HFNA 1VKRA 3VHRA 2HY7A 1V3VA 5IYZF 2AMVA 3DO6A 3OA0A 2GJ9A 3NHSA 2XRYA 3H2YA 3G5UA 4NYMR 4Y2SA 4AZ0B 5BN3B 4F4UA 5IU6A 3CX3A 4MJXA 2DUJA 1U3VA 4DLAA 5GGYA 5HKLA 2W42A 2PUGA 1DIRA 2VNIA 1E9DA 4EG4A 1NG9A 1I1HA 1FX0A 4E11A 3UH1A 5ALPA 2EJWA 3PQ7A 1UEXC 1IAVA 1MNQA 4YWJA 3W5CA 3VH2A 4D98A 3FSGD 2BUBA 4J0HA 1I8TA 1UZAA 4KQJA 4CE6A 5ICEA 3WTCA 5AHOA 3GK3A 1AUQA 3ZY6A 5BW6B 3S29A 3AESA 3JWEA 1WXFA 2BKAA 3L4BC 2PZKA 3G1WA 3SYKA 1ST2A 3I37X 2GD1O 5C32A 3GPIA 1NYTA 2QN9A 4OB7A 1KEPA 2VJAA 5EINA 2E18A 5TJ9A 3FMFA 2R6GA 1X3LA 3T0IA 4PZPA 3H99A 2VLBA 3HL4A 2OFFA 3LC0A 3L6DA 4PG6A 4PQGA 1UPCA 1YO6A 4GKVA 2H16A 5CG1A 3STWA 2WAMA 3FJYA 3K8ZA 4DBZA 2IYTA 3CZMA 3IDAA 5B4VA 5K3SA 2RC6A 1EVQA 4OHUA 2QZJA 4R2IA 2R6R1 4TZKA 5IFLA 4N47A 3UWSA 2BKEA 3ND8A 4YMTA 4TYQA 4Q48A 5JJCA 3KPJA 4KXYA 3M1LA 3SHWA 4EGSA 2SNIE 3BVPA 1DBSA 1QZXA 4PLPA 1BYUA 3TL2A 3NHWA 1RI1A 3IDZA 4DCCA 3K1YA 4KYTA 5FBZA 4ZI7A 3Q3CA 4DUGD 1YJXA 2C5SA 2Q2WA 1N2JA 4G3XA 2GESA 4QYSA 3BCSA 3JQPA 5IH7A 3ONNA 4CCAA 4ENWA 3GRUA 3ZHCA 4GXNA 4RV5A 3U4AA 1QOZA 3DTTA 1E5TA 2O23A 2NZJA 1CY0A 3N8NA 3H2GA 3OOHA 1C50A 3IESA 3QFHA 3BTVA 4MA0A 4RSMA 1VCHA 4DS3A 4P0PB 2ZUCA 4RZ3A 3LY7A 4OP3A 1HK7A 3NTLA 4P54A 4BLVA 3D4BA 1UP7A 2ZJ7A 4KW7A 2YJ3A 2QLBA 3L7BA 1T0JB 5CA0F 1ZLXA 3DZDA 3DKRA 3KOMA 1QG2A 3NDBB 5C9ZA 5ITZB 2PZEA 3MBOA 2VHUA 3C24A 3QX7A 5D5PA 2XOKD 2UUAB 3AV0B 1S3IA 2CXXA 1OXMA 2CMGA 1V2HE 2NAPA 2Y4NA 1SULA 1G0NA 1Z0AA 3SC4A 3U4HA 4F85A 2IYAA 1GNPA 5D2CA 1RWMA 2QRPA 1MFZA 2IEYA 1XRSB 3I1FA 5DYNA 1QLWA 4FYXA 1JYEA 4CQNA 3ESZA 2XRFA 3FOCA 3EDYA 3GVHA 1TW2A 1W4BA 5AKKA 5TE9A 3T7JA 3FTCA 1LKZA 1OBVA 4WA8A 4JGIA 4H3KB 4UU8A 3FOWA 4BEJA 4Z9FA 5LZ2A 2I2XB 1E98A 2HT6A 4HR7A 4L57A 4HYEA 1THZA 4DFDA 5K51A 3K0AA 4CMIA 1RMQA 2XXAA 5JEDA 3OPYB 2P62A 2P9CA 2PGIA 4DC9A 4F4JA 5IKXA 2EHDA 4U6SA 3F3YA 1N5DA 3HNRA 1JIVA 2LDXA 4KXXA 3HEBA 5F51A 5LP6C 1DAEA 3KV3O 4F9EA 3HB5X 5K2MA 4XSHA 3ORYA 2PMCA 3LA8A 3K9CA 1W52X 1I3MA 5AVJA 2H2IA 2QG4A 1VRWA 3SM3A 4FDVA 4BO4A 4KRFA 3TLEA 1HE8B 1BE1A 1NI3A 5JXHA 2AWNA 4ER0A 4YUYA 1VFNA 3CLRD 4K40A 1O4WA 2H51A 4NP6A 3L7CA 1RYNA 2PUDA 1V8PA 2H2GA 4MCJA 2AOWA 2WHPB 2ZTVA 1W87A 3L8ZA 2IU4A 4M0EA 4NZZA 2E55A 1XEWX 2JDID 2B30A 2XDAA 3A37A 3R3YA 4LZOA 5FI0B 2CNNA 1VPDA 3GBVA 1ZH8A 2F8MA 2DX7A 4GYKA 5JH7B 5KYTA 3TX2A 2CF6A 2JLYA 3T95A 4KWEA 1QFJA 4LOLA 4V2UA 1AHNA 1KKUA 4EB8A 1H8EA 3O3NB 5FWXB 1SUAA 5ARCA 1L1QA 3AYZB 4HUQA 4JEUA 1MRNA 1J49A 5AXCA 2W48A 4Z4EA 1MX3A 2DCUA 2QX7A 2BDEA 5DOVA 4H0FA 2WZCA 1A3CA 2W0MA 2AC2A 2QQEA 1C7EA 3MJSA 4RMJA 3ETNA 3WKBA 3LQKA 3MRSA 1Z6TA 1FTWA 2CN1A 3VYSB 2FDXA 5LP6B 2J3KA 2Q21A 3BB3A 2FZWA 2WHQA 5REQA 5CVVA 1DB3A 4IJ5A 3LUJA 4BRZA 1WIWA 2BW0A 2Q1WA 2R65A 1AK1A 1N5KA 2Y1EA 2Z4TA 3SN6A 3W90A 1N2CB 1P2GA 2PBZA 4MWCA 3KHKA 5FKJA 3QE9Y 2FUCA 4GKKB 1NP6A 1I7PA 2XUAA 4Q39A 3SDSA 4ZO9A 1EIZA 1XZIA 2B21A 3KD3A 5BWCA 5F98A 4WXEA 3SC2B 4FJ0A 1U9IC 2C2GA 3KXKA 1TLTA 5JAPA 3L6EA 5GOZA 3QLJA 2OOKA 2I4IA 4MV6A 2YVQA 2YL2A 3CLUD 2Q3MA 4QM6A 2ZUDA 1UZMA 2J9FB 3E3LA 4CW7A 2X4DA 2DH6A 4IJ6A 1R9NA 4I9NA 1H1LA 3H7AA 4X1YA 3VQTA 1A8PA 3DHVA 3MGBA 1QQ7A 2RKBA 3AMVA 3ESRA 4GQBA 5F73A 2FSVA 1WXGA 1Y1TA 5E0OA 2BEWB 2V7GA 3J81k 1EDEA 3NORA 3WK9A 2CK3A 1D9XA 1YCGA 1OC4A 1TMGE 2IITA 3DNFA 4G24A 3SICE 2PPLA 4MVJH 1VI5A 1ISPA 1UDXA 5F2KA 4AYTA 5BVGB 1IXSB 3C43A 3DOUA 1AS3A 2GH1A 3GVPA 3R3VA 3HBNA 2ZWAA 4INAA 3EN0A 4QOGA 5JAHA 1EIWA 2O8NA 2PJUA 4OFBA 4KC0A 3LF1A 1LDEA 4QODA 4HFRA 3T9BA 1M1XB 1M1YE 3I6YA 3TEJA 1IQRA 4HWGA 3PP8A 2NP7A 3RC1A 1E1RD 1DJNA 2GZDA 4AZWA 2HJWA 2O0KA 4D0NA 2W6MA 3KKOA 2OZEA 2I6XA 1TT5B 4OL0A 3NHJA 4O4JB 2IDKA 1Z7EA 3PDWA 3O38A 3NXSA 4JQSA 3DFKA 2AD1A 4PYNA 1DQNA 3R7LA 3CNEA 3OZAA 3TW4A 1FYXA 3C7TA 4KGZA 5CH3A 2R1TB 1GXSA 3T52A 2VR1A 2PXAA 5KQRA 3MGCA 3PHBE 3VZBA 2F1RA 3WLEA 3O84A 4GI3A 4WJLA 3O8RA 2JI4A 1NASA 2B25A 2XI4A 2B5WA 1EE9A 3CZAA 4OXRA 4PG4A 5EP2A 2FN8A 2AN3A 2YYZA 3NETA 3K6SB 5J2UA 1OKKD 1Y9EA 5AJVB 1EA5A 5IP5A 4A4DA 3O95A 5BV2P 3DEHA 4G86A 3A9VA 3QELB 3LPDA 4BGUA 4RSHA 4BCBA 1PL8A 3ONWA 1I0LA 3BPSA 4JLPA 4EW3A 4Q4AB 3EZ7A 1P19A 3QNMA 3BUSA 3WRYA 4YCCA 1WZIA 3SXUA 1GQYA 1U3DA 3GDFA 2AYZA 3DZBA 2WUFA 3UWKA 1Q7TA 1YL7A 1TKRA 4UHKA 3CKKA 3V8RA 2IYWA 2GM9A 1WPQA 1Z6XA 4YLYA 1DWOA 3VDQA 2FPIA 3HYCA 3R5SA 3MWGA 2QZ4A 2JIPA 2RGUA 2QUKA 3N76A 3QY9A 4GT1A 4BO7A 2HBZA 1KI4A 5AXDA 3W1WA 1NDUA 2ADFA 4TTRA 3LX8A 1KGDA 1YU6A 1TCVA 1VLQA 1JSXA 2P1ZA 3K5WA 4TN5A 3COJA 2ORED 3F49S 3ZLBA 3HJCA 4R9NA 1V4NA 2PSDA 3VPXA 2V65A 5G1OA 5JZ9A 5L4SA 3QV2A 2OC4A 1XZQA 1W29A 4PFQA 1ZKMA 1AQJA 4QDUA 621PA 2VDRB 2VHXA 1IL0A 1ORTA 4ND1A 2F3RA 3ZK9A 1LVGA 1WSAA 2W4MA 2ZRGA 3MJTA 3WWOA 1JSLA 1SBHA 3SFTA 5FBVB 2EBFX 4D0SA 1IOZA 2R44A 3O93A 4NNJA 2DFNA 4I7EA 3WAJA 1KJWA 1EE1A 1K92A 1IQUA 3G9UA 5F5LA 2GETA 3RHFA 1UKYA 4EJSB 1SA0A 4XE5A 4XOUA 3OP1A 5JYDA 2ZBDA 2ZBGA 5CXXA 1LW7A 3NIWA 4MVJE 3AHDA 1EK6A 3FLBA 2ZIAA 3LLSA 1PQUA 2I03A 3BE6A 3EWAA 3K94A 4LJYA 2BY4A 4HTFB 3SQNA 4RCZA 1WW8A 3AL3A 3D8TA 2PKXA 1XTZA 1OHHA 1XMJA 4RL4A 1XMPA 2XRZA 4YUAA 1P9NA 5H3HA 2PUCA 1FFSA 4GSKA 5GIOE 3JSXA 2B20A 3F2IA 2O3SA 2FOIA 3DKIA 1LA2A 1L5HA 3V2IA 3V4RA 4I4TF 3RVPA 1XRJA 3U4QA 1BGVA 4GUDA 3Q7EA 1GR0A 1KIMA 2Q4DA 3DV0B 4LXQA 4CLOA 5K8LA 4LXUA 1RQ7A 3LCCA 4BP1A 1EJ6A 2J3IA 3G8DA 5H1YA 1QQBA 4AS1A 1A9OA 1PR3A 5I7EA 3DLIA 1QYDA 3B7GA 3P2MA 5D3ZA 5DGCA 1N34B 4A6DA 3O4VA 4KPGA 5EPUA 4GKBA 3U6KA 2FXVA 3QXHA 2RFLA 3RRNA 4ZI2A 4KN8A 4IDHA 2XZTA 4UDYX 1N6HA 2JCSA 5DIZA 5BO5A 3RWBA 4BFYA 3GA0A 3ZBUA 4H1VA 1KKMA 5FPSA 5G1PA 4B0OA 2QRUA 3CRW1 3KQSA 1KJ8A 2XNSA 1UKVY 3C39A 4WNAB 3JASA 5ES4B 2Z6QA 2R97A 3DTNA 4B7XA 1FUKA 2BSXA 3NTQA 4GGOA 3OE4A 2PIAA 3VYRB 4P93A 3EPKA 2CBZA 2XX3A 3O8BA 2BDUA 2JCGA 5DM1A 3FNEA 5CW2A 4BOYA 4CTKA 2JFNA 3PEEA 1FP2A 4F3CA 1UDAA 1JDBB 3HGTA 1N2ZA 5D6OA 1ZI8A 1FS5A 1Y1LA 4K87A 4S1WA 4R1UA 4ALNA 1P1CA 1SVKA 5A6SA 1JTFA 4DNQA 5EFZA 1P4HA 4Z4HA 3P9YA 3GNTA 4KWCA 1VKNA 2BM9A 5PNTA 1HY3A 4BX8A 4J1TC 3MTJA 1JVNA 1WBJB 3ZH2A 3U7JA 3V7UA 1F14A 1UFKA 4OQFA 4G0VA 4Q1FA 3GT7A 2IF2A 4YRKA 2A5GA 1N6PA 5K6AC 4HB0A 3TTXA 4YMUA 4P38A 1XQXA 3SBEA 4CHTA 6ABPA 4R9VA 3AVXA 2G1KA 2FR8C 1QONA 3H5NA 3ODGA 3CN9A 1F7UA 5LQSA 4C3UA 2ZRPA 3BD9A 1T9DA 2IBSA 3UB3A 3FVTA 3H8SA 4II3A 4U7TB 1NJSA 2NTNA 5B58T 1IBLB 4KV9A 4EF4A 2PKWA 3EVCA 1L5FA 3COYA 2YXLA 4P22A 4OJYA 1DAPA 5ALQA 3KP1A 5DSZA 5F7ZA 4D45A 2IS6A 2AOVA 3O94A 4TS9A 2I2BA 3ET4A 3QH4A 1JDJA 3QTLA 4MUKA 2ZBQA 4IUDS 2XTZA 2YJ5A 4RKWA 3VR1A 2GKOA 3LUDA 4RGQA 4CR7A 3FCUB 1ZM7A 2OMEA 4TTPA 5F4ZA 1F2TA 2IQ5A 3CINA 3IV7A 3OLWA 4BO5A 4AX8A 1D5CA 1GYRA 1XD2A 4MQ5A 1AV6A 2GFHA 1IQ0A 2CXRA 3UJDA 3P2JA 2VXYA 2DWCA 4PX3A 4LEIA 3E1KA 3FSEA 3SZOA 3AOGA 4BEBA 2QV7A 2BRUC 1GADO 1L8XA 2ZE5A 5E7JA 4EA7A 1JILA 2PEYA 3AEUA 2AI3A 4TPKA 3TXXA 4Z3OA 2OV1A 4BMSA 3B6MA 4ML3A 1G19A 3AP2A 3UWOA 1DBIA 4PFJA 4V38A 4YP5A 4QXOA 3UUWA 2ONKA 2C2OA 3TG8A 1WJGA 2HEIA 1GVNB 2H5EA 2PU7A 1EFPA 5DHPA 1Z56C 2UZAA 5NULA 1CJTC 4RV9A 3RT1A 2K5UA 5CW1A 3VR3A 2XCTB 1PX0A 1R0ZA 4R71A 4FHFA 1RXEA 3DEFA 3R4CA 1TCAA 3C7KA 4IIVA 4AUEA 2VSNA 2XWPA 2PT5A 3UC5A 5TPZA 2PNFA 4GR9A 1I4EB 3S1AB 3G0IA 3QVMA 1C0PA 2QQ0A 1U8EA 2PRZA 4YUVA 5JPCA 4QNMA 1ONPA 2I7TA 2HWWA 3L0CA 4ARCA 1MIOB 1C3OB 1UJMA 1UMBB 4OQMA 5BYBA 5EWJB 4G4JA 4G1UC 3O91A 5CM9C 1V45E 2Q8QA 2YV5A 3GGDA 1K7CA 4LF8B 3CCBA 4XWWA 3SZ3A 1NRWA 2X0KA 3BC1A 4G4SP 2BHSA 4I36A 1N0WA 2X8JB 3K0FA 3PKIA 2DFPA 5HNKA 3AP1A 2DBYA 4IGKA 4PZYA 5HKAA 3H9UA 3FCAA 4A6EA 1J20A 2K2WA 3QOYA 1M1NA 2YMPA 4JR2A 4U3JB 5IZ4A 1PK9A 1X80B 4D3SA 1LFDB 5C5CA 2XDYA 3B85A 2HZ7A 3QKSB 2QVLA 4G1CA 4K3VA 4ZVLA 3I12A 2OYRA 5IVDA 2DUUA 3HL0A 4E12A 1D2MA 5IJXA 5IM4F 3RF7A 1WMSA 1KY3A 1W8DA 3V2GA 4ID9A 2XYHA 4YJDA 5ITWA 3OIGA 1NZJA 3Q15C 2VNJA 3C3XA 3GLHA 1VE9A 3FLMA 4UBKA 5B12A 3UJNA 4EKGA 1RYBA 2JGFA 2ISQA 2CXQA 2W6IA 5JXIA 2GM5A 3BBLA 4LXHA 1DVRA 4O2BB 4C2TA 1KI8A 1YRLA 4NXMB 1ZK4A 4GFDA 4BPBA 1GGJA 4G89A 1Y82A 4XCQA 4B3XA 3AF4A 3Q12A 1QR6A 3H1BA 1DAIA 1NN1A 3OM8A 2C96A 3UYLA 3C98A 3FM9A 2PAFA 1QORA 1PVVA 4Q34A 3HCEA 4BGEA 1PNRA 4YT5A 1NX9A 3D0OA 3OI7A 4MIEA 4IG9A 2BCJQ 4P3YA 4UVGA 1P7CA 1M3SA 4NV3A 1RM5A 4U0KA 3NAMA 2Q9AA 4ETWA 3TIGA 3DMPA 2ZRNA 2P9TA 1NBWB 4A6XA 1G2OA 3L0IB 3GJ0A 2BZ1A 4EY5A 3DT9A 2GZ2A 3H2SA 3HB1A 4IQFA 5JRJA 2CLOB 2WINI 1Z16A 4F3KA 2C31A 1D3AA 4IVRA 5I9BA 4OX9B 3GP5A 2F8LA 1T4CA 4YT8A 2OK7A 2QZZA 2YHBA 1OLUA 1WZ2A 1UINA 3NWPA 4GOOD 4M1QA 2GUGA 3I8OA 2B3TA 1TZBA 1GAWA 1G8SA 3NB0A 4G36A 4X60A 1NF9A 2PQ6A 5SYAA 2QN6A 3E82A 1AO0A 4JYAB 1QDUA 1U0HC 3FE2A 3PNBA 4ENQA 3Q2OA 3ON5A 3N2GA 1CIJA 4RD2A 5DWVA 6AT1A 2XTAA 3FZGA 3KAQA 4QGAA 2ZR0A 3EAQA 4EW1A 2BHNA 3EC2A 3FROA 1TQDA 3NIFB 2CDCA 3BTSA 4HEHA 1SXJE 4BC0A 2VUUA 1IATA 5C8ZA 4WCDA 3OECA 4M76B 2CVZA 2R68A 2IEBA 2OMKA 2GDJA 3D5TA 3RFCA 1JV2B 1M2VA 4BECA 3VSBA 2V1XA 2XBLA 4NK5A 4QBFA 3RVKA 1UR5A 5L3SA 2NU9A 4MDYA 4YRIA 2P75A 4KE7A 5LIPA 4UOEA 3P27A 3JPYA 4OM7A 5DYWA 1A9RA 3FNHA 4QGHA 4KQMA 1MU0A 3GFSA 4EYGA 1W96A 5FPTA 3VSCA 3VGJA 4KE8A 1J5EB 1NI4A 4LNUA 3RWMB 1Z9BA 4C3ZA 5ECWA 4LMRA 3SM9A 2AUMA 1YQQA 2HA2A 3KQHA 4WNIA 1NOJA 2V96A 5DGHA 1JAYA 2CWDA 3RV3A 2CCJA 1K68A 5BXQC 1ZVMA 4ID3A 3C3KA 1EDBA 2F90A 1P4GA 2FMFA 2PJZA 3PHJA 1X7WA 4LOIA 3VPFA 2I33A 3ZE7A 5E4YA 3TMKA 4QOIA 4RUKA 3Q0TA 1D6JA 2YICA 3ZC3A 5CB4A 1MVOA 1GFWA 1BFKA 5C7LO 3ER8A 3D8SA 2LCIA 2JGMA 4DIUA 2IELA 3DZGA 3U44A 3L01A 3L8EA 2AV6A 2ODEA 2Q1XA 2RHCA 1C0IA 2ASVA 1Q0ZA 2QTZA 1HFJA 4L85A 4R0VA 2CCKA 3FGPA 1KPHA 1SBYA 2FK7A 2C42A 2ZRAA 2QMQA 3PR1A 4FDLA 1Y81A 2H9AA 3PNYA 1G59A 4EYSA 1YL6A 2VDVE 3H2IA 2F43A 2LKCA 3WKCA 5D7NA 3VPBA 1A9XA 1N6LA 5EXXA 1QC5A 4U7DA 3FI9A 3FZQA 1ZR2A 3SOPA 2WJJA 4ER3A 4NU5A 5AHWA 2QL6A 3LA6A 2DSNA 3W5IA 4L76A 1ZFNA 2QRVA 1RMTA 4LC0A 5AKYA 1MEOA 3IQZA 4CIVA 2R3SA 3QRWA 4UCWA 2BFFB 3P5SA 2FHPA 3NX4A 1KYVA 4UNNA 4ZRDA 5EHNA 2HXSA 2UKDA 4B3DA 5DX0A 5GADl 1AE1A 1YUBA 1XKQA 3HO6A 2JFUA 1A4IA 5EIBC 1ODFA 5JCOA 3OKFA 3OPXA 4Z4IA 4NPAA 3IP1A 3KB6A 2WF8A 5HZGA 1TKCA 3OQBA 5HOQA 4UVDA 2ZJ2A 2IIQA 3Q7PA 4GRAA 2WUVA 4X5OA 3TLZA 1RPNA 4CCYB 1JHXA 1Z62A 1SKYE 5DASA 1G8HA 1ID8A 3LOUA 3H5OA 3W9SA 2YMMA 2TS1A 4DQLA 1MH1A 1ZA1A 4WZAE 4A03A 4F5YA 2OBMA 2PGDA 4CM4A 1M0EA 3WWEA 5LQJA 4I08A 3RS7A 3OLZA 3NFRA 3RQIA 1LQUA 1X8JA 1H69A 5BNZA 3PB3A 2WJ4A 2VDKB 3DPSA 3ZNOA 5BR8B 1JDUA 4UARA 3FFAA 4G56A 4J4BA 4YRRA 4CDRA 5A71A 4TROA 2GRUA 3RSFA 2CK3D 2H2DA 4FD3A 1E8NA 3EH1A 5TPWB 2NU8B 2C4NA 4HAWA 1WNTA 1E4OA 4ITRC 3NVMB 4D41A 2Z9BA 2XUDA 2WNIA 2JFOA 2VRBA 5LB2A 3VO1A 4DMRA 1AQ6A 3VTZA 2FCAA 5KNDA 1UMKA 2KYRA 3ETEA 2RB5A 4PC3A 4C2UA 3AGQA 3ELUA 2C54A 3OT5A 3HP7A 4IFBA 3EXFA 4NF2A 2VAPA 2AW3A 3F3SA 3LUPA 5IN4A 4IVPA 2IZ6A 3DTVB 5DRTA 4IOJA 4UPEA 2WDZA 1OAKA 1RE1A 3JD0A 5EIOA 3C3BA 4I5DA 1IZ0A 4OH7A 3D54D 1I2DA 2X19A 1S1MA 4EG1A 1P2BA 3HBJA 2C92A 3L7MA 3U7QB 2CLLB 3EXEB 4BU1A 3CUWA 4NOLA 2VA9A 1NQWA 3SAJA 1APBA 1LPOA 1JHPA 4IILA 5CCXA 5A4KA 3SMVA 2L2QA 2QPOA 3JYLA 4UM7A 1NDQA 5DO9A 2E5WA 3IO3A 2V4MA 2V6JA 4KMSA 4W5RA 3QU2A 1QAQA 2CV0A 3SNHA 3AR2A 4NBNA 5AH0A 4PCVA 3IT2A 4UATA 1E64A 1XKTA 3SEAA 2QX9A 1MJGA 1E2JA 1SQGA 2X5KO 1EUZA 3SXPA 4BE4A 3LAWA 3U2QA 3R4VA 2CJFA 3GEIA 1QF7A 3E9NA 1K9VF 1SGWA 2PSSA 4FUTA 4HO1X 1KYXA 2YFKA 3IAS1 2FG5A 2Q6VA 2W2VA 4BVEA 4LF9B 2BP7A 1YUMA 4R41A 1I3NA 2X1VA 2DJ5A 4BN0A 1O9GA 3PQ8A 4MUXA 1ZJ4A 4YP6A 4DEVA 5KNCD 4ASUA 3KR0A 5IPFA 3SX0A 2EYUA 1DAKA 1N0HA 3DLPX 2A9PA 4WK2B 2IOFA 2QAJA 1HT3A 3D8UA 4QSMA 4IGEA 2AQ8A 2AH5A 1S8OA 4RH3A 1EXVA 4ZEMA 4ECEA 5I7RA 4DCVA 2VQSA 3DVAB 2WMOB 5FNZA 1DDIA 2NSDA 4I6JA 2I6UA 3EBPA 3T5GA 1WNFA 4C0JA 3FRIA 1OI3A 4UQOA 4ZHQB 4M87A 3T35A 3RFFA 5ITVA 2CKDA 4MMXB 1TRKA 2ZJ5A 2O52A 3HRHA 1QGED 3NH6A 3OSZA 4Q3EA 4CUZA 4H1WA 1Q7EA 3AF3A 4LJ8A 1C1XA 4P5DA 3V4PB 2QVBA 2M6KA 2YWJA 4HLUA 4BKQA 1AQIA 1IB0A 1MT0A 2CE7A 9ATCA 3G3EA 1U8ZA 1EAYA 2IDJA 3HM2A 1PP4A 1SVSA 2H0RA 5KQGA 5FADA 3R5XA 1ZMRA 5KCMA 3S8YA 1G3RA 3NM4A 3U9TA 1ULZA 4AJ4A 4QIHA 1Q1GA 4DMKA 1TQHA 2VT7A 1KSJA 4U7WA 2AC4A 2LIVA 3R7AA 5JZMA 1V16B 3PQEA 1OHHD 2MYUA 4I50B 1KKLA 3RU7A 1UZUA 2WV7A 4ALMA 2G82A 4LYJA 4YP0A 5IMBA 1WCXA 3IE2A 1MDFA 3CNHA 3KU4A 4RDHA 4HDRB 3VKHA 4Y6SA 2I3ZA 1VSVA 4GICA 3P9IA 2IWHA 3LQ1A 4KFUA 2J0SA 4FCVA 1XKXA 1X42A 3T3GA 4I55A 3H4IA 4J0EA 1P29A 4I3FA 1Z4KA 1CRWG 3TVYA 1DMRA 1N6KA 3I9V1 1YSCA 3VSAA 2W0SA 1NKTA 2WQZA 3DFZA 3JQ8B 3D6JA 3RRMA 2Q1SA 1QQ6A 5DRYA 4JI0B 4ZREA 4ZEOA 3K5IA 1ZCJA 1LK7A 4GLLA 5F4BA 4GXTA 3K0HA 3TL6A 1U3FA 3SF8A 3SHVA 5AVVA 1UJNA 2C4WA 4PR0A 4E1AA 2PMWB 2F3QA 3STTA 1RM4A 3N0WA 1O58A 5G0WA 2VNKA 2ZDQA 3SZGA 3DB2A 4YV1A 2A4MA 3IJ5A 4RPKA 2VL7A 3HBMA 4NH0A 1NKVA 1KARA 1PR2A 1UBGA 2GD6A 3CF4A 2QTBA 3QQ5A 4FR5A 1NFFA 4OJKA 5JTUA 2XCQA 2H1RA 2V1UA 1FRVA 1H9BA 2AXQA 4AXXA 1ZIYA 4KVFA 1YJQA 2JGNA 1T2EA 5K03A 2RK6A 4HDQB 2YS6A 2QM8A 1IUPA 1E3WA 1QZZA 2AOTA 2HV9A 1X9IA 4RVFA 1LJ8A 4L0QA 3VVMA 5DTMA 2CNKA 1ESNA 3PXGA 3WHKA 2LTAA 1HDXA 3MS2A 4QUHA 3JWGA 4NCXA 1DRJA 2ALJA 4OQLA 1SD5A 3EPHA 2NMVA 1Z2DA 2QAGB 4KG7A 3L18A 5SY9A 2G88A 3FPCA 3MC1A 3LIIA 4K2AA 4RVUA 4QG3A 4IS3A 1IN7A 4W5NA 4PHHA 3L04A 4LRYA 1W6UA 3W3AA 1YMUA 3FVWA 1J7KA 1TD1A 2UV8A 1ECCA 2LWIA 2V7QA 4RFVA 4S1TA 4WPGA 1MC4A 3BWDD 3HVIA 4HNQA 1DWPA 1U28C 1XK6A 1WQ4A 3II6X 4ZXPA 2M98A 5BV7A 2JGEA 3Q8MA 2YFHA 3U3JA 2IYSA 1K2WA 4N03A 1HTWA 1QXSA 1Z6AA 1EK1A 2IUSA 4OMFG 1UBJS 1I7SB 5KSYA 2JLWA 5DHRA 3ZDAA 4XD7A 4D4GA 4S1PA 2Y1CA 4LQCA 1LDGA 4EK9A 2G3YA 4LZPA 2H7YA 5E3JA 4ZQGA 1T1GA 2F4VB 3GARA 1X9HA 3EIXA 4AMBA 4BRSA 5TMPA 4KDCA 3WOHA 2H1VA 1GLVA 1DU4A 3OZBA 3G6KA 3L5KA 4Q7JB 3T9CA 4DIKA 1DS6A 1DEXA 2QLLA 4UE2A 3ZWOA 2WFLA 4C7KA 5JXWA 2JFWA 3MT7A 4L74A 3LUBA 1NVTA 3WGJA 4HZGA 1N3YA 1NTRA 3KXDA 1SOMA 1YBAA 3GBPA 3UIEA 3ZNQA 3V8VA 4BMPB 4C4XA 2QTNA 3IBSA 3ZLUA 4LXIA 3VC1A 3OESA 1PO7A 4INOA 4LC9A 3UMSA 4Y0VA 3VR3D 3AW9A 3K70B 2VJLA 3K9BA 4UFOA 1PZMA 2VOEA 3TK1A 5IZCA 3VHQA 3G2JA 2YWDA 4HVTA 4JX8A 4JN6B 4V0OA 1TCBA 4HD8A 4MWEA 5EERA 3RS3A 2QL7A 3GFQA 4C78A 2J0QA 1D1SA 5TPZD 2IP2A 2QGFA 4WGFA 4ZVMA 3ENVA 2J9XB 1QLHA 5IKMA 5JQWA 3W5AA 1JG6A 2PXHA 2E85A 2ZWOA 3C4QA 1YI1A 1R3UA 2CNWD 3L93A 4ZAYA 4YP7A 5HKKA 2AN1A 3KRTA 2QL5A 5FWYB 2OO3A 2ODNA 3LKVA 4R1TA 1PV1A 1MZPA 4ZCTA 2AD5A 4M98A 1KI9A 2CGEA 1JHAA 5KVQA 4O1MA 3MINA 2W2XA 1ZJZA 1GSAA 2Z9DA 1H22A 5K3DA 1Z4PX 1M75A 4O4IF 3UT0A 1T3HA 3CJTA 1N2OA 2IXAA 3TR0A 1CZNA 2A5YB 1MEEA 4R1PA 4Y2YA 4CV0A 5KTOA 3WL8A 1RZRA 1JHZA 4DA4A 1LLCA 1HOXA 4DXDA 1W85A 4BNLA 4RMIA 3REQB 3UZUA 3VKUA 2EKQA 2Q6LA 1ZN7A 1CW2B 2HCJB 3DBVO 4CQMB 3CTPA 4MYDA 1FVFA 1ZOLA 1YBVA 2O59A 3RG8A 1G41A 3B7WA 5AICA 3IBFA 1NBOA 2I1VB 3EC1A 4Q02A 3B1JA 5FV7A 4QARA 1GNSA 3RBXA 1I3LA 1JYSA 3UCFA 2JEOA 3ZV7A 5LOVF 1I1NA 4H3HB 4NBTA 1N2IA 2HWXA 4XARA 1B00A 1XL1A 2Z95A 5IC5A 4GLOA 5IWCA 1TADA 4X7BA 1RAIA 4OL9A 4RXUA 5AKIA 5TRTA 4J8PA 2NPFA 3S4YA 4RTOA 4KQFA 4UM8B 4IGAA 4KQ9A 1NN5A 2C2ZA 1E1CB 1P8JA 3I2FA 1P91A 2JFBA 1WWKA 1YOVB 1D4ZA 2O2IA 3ER9A 2W2MA 5BYAA 5JQGB 1I36A 1ZY2A 2UUPA 3ZOKA 3UW1A 3L49A 4MAFA 1WG8A 4J3FA 1LWOA 1QDEA 1OZGA 3TOVA 4QFBA 1XZKA 2IL1A 3O5AA 4FOSA 2V8BA 2XWJI 3OF3A 4LCBA 5B7GA 3CSSA 4RF4A 3U4MA 1PR0A 3NOOA 3HCDA 5AJHA 3U19A 2IOFK 3K1TA 3M2TA 3AU8A 3FBWA 3GLKA 2R7KA 2YXBA 1X7GA 3KUUA 4K6HA 4IM7A 2CMDA 3V00A 4D8YA 5LKAA 4BMXA 4Q3KA 3ZK8A 2CJYA 1Y34E 2H2FA 3KOOA 4MQ6A 2H8GA 3NHPA 2Z8XA 1ZPDA 4CLDA 3BXZA 2GD2A 4C7VA 2WJZB 5JY6A 2B2XA 4CFYA 1GTRA 4NYJR 3EWIA 5K45A 5JECA 3HP4A 5AUQA 4ZYLA 4ESVA 3G82C 4KNYA 4MP6A 2O5VA 1TM1E 2P77A 2G1JA 3X1JA 2C2YA 3FSRA 3L1JA 1XN4A 2AVNA 2IVZA 3BT7A 1EQAA 4NAVA 2FUKA 1QU2A 4YI3A 2QSUA 5K3EA 2GTIA 4YIKA 4AVYA 1Q21A 2XDQA 2SKDA 3JATA 4YNBA 5EZQA 3MFYA 1FP1D 1KFJB 4AJHA 4CGYA 4QUAA 1XDSA 2BC9A 4IJMA 1R6TA 4HX9A 2O3RA 3HRKA 4LBVA 1WS6A 1UXKA 3C6ZA 3T12A 3RUFA 2NN3C 3X1ZA 1BGXT 2CKMA 1E7YA 3A6DA 3H0EA 2JJ2D 3P8ZA 1W76A 3KR9A 3Q40A 4RA6B 3TH5A 3DVRX 4ARSA 1EWVA 3ZHSA 5JI3E 1A2BA 2AG8A 4AZ3B 2PWYA 4E1BA 1JJIA 1RD4A 4HGYA 3EHDA 4MS4A 3AXSA 5CH8A 3RH0A 1PTKA 2ILTA 2HU8A 5F1YA 3T4PA 3PFKA 2SKEA 3F8SA 4KV7A 4TXMA 4B5KA 1FTGA 1ZRMA 4FE3A 4FYHA 2ZULA 1KSHA 3PENA 4HPWA 4LECA 4NE2A 3CLVA 2AWOA 4C6TB 5EP3A 3PC7A 2R86A 3UWMA 1XCOA 2GN8A 5TS2A 2FWPA 3OAAA 4Z99A 1RIIA 1U7OA 3AFIA 3INRA 1TYDE 3BMOA 4Y2QA 1JXAA 2VJMB 4AB1A 4QNNA 4JQCA 3TSOA 1K3TA 4QJ3A 4ZOAA 1ZHHA 3ZD7A 4LXYA 2VJCA 4RE5A 2JIMA 2Y76A 4JZKA 5BMVB 2ZATA 1LLQA 4MV5A 4XI9A 5AK4A 1HA3A 3PGA1 2Q4TA 2G36A 3S2EA 3DUFB 1ZLYA 1BDJA 2P35A 3ABIA 3EXHA 1BS1A 3ND9A 5G4KA 4P53A 3UF0A 1HFEL 4F60A 4YAGA 2GCOB 2YVLA 1P61B 2HIGA 5E9WA 1MOSA 4P3NA 4IINA 5TC4A 5IEJA 2AN9A 3ROKA 1VI2A 1VM6A 3QFCA 1T43A 3QVUA 2C57A 3GA5A 4V2IA 4KNWA 3ED5A 1OH8A 4NCAA 2QUAA 4P3XA 1SCUA 2RH9B 4NBRA 4U7GA 3IEVA 4B6RA 3OETA 2D8AA 4MIYA 4ZVPA 3KQUA 4G0OA 4WXRA 5EKTA 3ESCA 4RXTA 4FGLA 1L7OA 1P7PA 1H1TA 1OB5A 3U7IA 2O4UX 3I5UA 3KKMA 4KVZA 3B38A 1YCFA 4YJFB 2NTEA 4QUBA 1F0PA 4BVHA 2Z3WA 4B43A 2JZNA 2P67A 4NMXB 4G0WA 1UP6A 3K92A 2N3ZA 2HPHA 2Q3BA 3LUKA 3VPGA 1TGVA 4CIDA 1VRVA 3U49A 3NWJA 1PT6A 3LIPA 4ETMA 5AK3A 1CLUA 4F71A 3RCBA 5A0VA 4KKXB 4QDOA 1E99A 3DQPA 3BG5A 3O31A 1IOWA 3HXQA 5T41A 4LDAA 2YN2A 1PEAA 2ACVA 4EYKA 2TYSB 4EGJA 1RHMA 2WWXA 2G5TA 2OUKA 1U11A 3FNFA 1P2FA 4ZI7F 5KYNA 1ZA2A 1Z6YA 4IOMA 3WB2A 4JI2B 2XVMA 1EZ4A 2IZ5A 3JQ6A 2WYUA 3VJMA 1P0QA 3KDAA 1L5OA 1QVAA 4AJ1A 2NLOA 3NNSA 3OLYA 3DBIA 1KEUA 1N2EA 3AHFA 3A9CA 1JPNA 3EYAA 3L1IA