3SJAA

Crystal structure of s. cerevisiae get3 in the open state in complex with get1 cytosolic domain
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
350
structure length
338
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 119
structure length 338
sequence length 350
chains with identical sequence B, E, F, I
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjaA00
4TT3D 3WYAA 4DLWA 4URZR 1R0WA 1XCMA 3RRYA 4QNMA 4PHGA 1OFIA 2ZI5A 5J4LA 3UWOA 4NYMR 4LSGA 2PEZA 1KO8A 1Q1QA 2QMHA 1DG1G 2O0HA 3IIKA 4TLDA 2Q9BA 1Z63A 1AN0A 3ND8A 2B7CA 2ZRHA 3FKSD 3IIJA 1KI6B 1FTNA 4YC7A 3SJCA 4NYIR 4TZ0A 2AXNA 1DEKA 5TV2A 2V1XA 2G77B 4LYFA 4BEBA 3U44A 4AG6A 2OEPA 2BHRA 3K0FB 2PH1A 5IK2D 3RS5A 1N6HA 1P2UA 4UQOA 1MV5A 3OESA 3VR2A 2D4HA 1VHLA 4TN1A 4PC2A 2Z0MA 5EP1A 4GOKA 4UJ5A 1VYTA 5KYKA 3K0EA 1E98A 1XX6A 3IQXA 1YHNA 3EPJA 2I4IA 1CTQA 1SXJD 4AKGA 1E96A 1XEXA 2Z43A 4BLRA 4DKXA 3WRXC 3MWKA 4DUGD 3A58B 1IHUA 3RVBA 1OFHA 3P32A 3FDIA 3N5CA 2D7CA 3LX5A 1SXJB 4KSBA 1JBKA 4LCBA 5JS8A 2GBLC 2WJGA 1AKEA 3EA0A 4TTQA 3HPQA 4GPTA 1LF5A 2PZGA 3CX6A 2FF7A 1N0UA 2VEDA 1L4YA 3EG5A 2ZRJA 1GTVA 1TX4B 1UKVY 4AKHA 3NKVA 4XTRA 4QBFA 3RDPA 3EPHA 1PJRA 2J3EA 2WV9A 3Q5EA 4I4LA 2MSDB 4JLAA 3TUZC 1Z29A 3QXCA 2WPDA 1GIAA 2CEAA 3CRVA 1FQKA 2R6GA 2ZRLA 3DKPA 4DB4A 2BIFA 4ZO4A 2ZVQX 1WA5A 3AVTA 3CRW1 3NEJA 4KHZA 2WOJA 1RIFA 4URYR 1XJCA 4ZDKA 3HU2A 2JJ2D 3AM1A 1GG2A 1II8B 1W5TA 4LRWA 3VR4A 1ZC3A 2AXPA 1ESNA 2D3WA 2WSSD 5J5CA 5DI3B 4BLTA 4LHXA 4CEHA 1IN7A 3UIEA 3BJIC 4UNPA 1UPTA 2BKUA 1VPLA 1EFRA 4B35A 2OE2A 4TYPA 1R8SA 2J0QA 4C2TA 2Z5FA 1UBGA 3NC1C 4Q1FA 5JCZA 4W5HA 2WSMA 4LHWA 4P31A 4AC9A 1LB1B 3SFZA 4IVPA 3F8TA 3SJBA 3TAUA 4B32A 5HR5A 5JJLA 3HWSA 4LYHA 1IN5A 2FE4A 4A4DA 5J47A 2ZI4A 2BMFA 2HUPA 2F7SA 3GLFE 1G291 2ORVA 4XH9B 1CR4A 2ZITA 3TRFA 1E0SA 4LOAA 2IXEA 2C9OA 4HB4A 3CKLA 1US8A 1ZMXA 2BMJA 5GJWC 1CS4C 3TMKA 4MRSA 2NMVA 3NDBB 1XBTA 1CJTC 3QBTA 4HI0E 3TW4A 4CEJA 2HYIC 1AQYA 2AFIE 1X8KA 3GJ8A 1YU9A 4W7SA 3QKSB 1OE0A 2QRNA 5TXGA 4NL4H 1TEVA 3I72A 3P4YA 2IWHA 4JL5A 1NJFA 1ZM9A 3KB2A 5FTLA 4Q4JB 1AQUA 2C04A 5IF9A 3PUXA 3W34A 2WOOA 4PC6A 1UJ2A 4NDZA 3LD9A 2VH5R 5EXSA 1U0LA 4BZXA 1N6IA 1E2MA 1UBEA 5ANRB 5G53C 4DEXA 1TPZA 4PAQA 1SVLA 1KDPA 1XD9A 3BH6A 1OYWA 4IXNA 5FOUA 2O0KA 5BYJA 3SNHA 4JLOA 1DAGA 3IHLA 2EFDB 3IQWA 3B9PA 3RS3A 1YR8A 3IEVA 3QPVA 2GCPA 1Z83A 3A37A 5L3SA 5K8TA 2JJ1A 4B71A 2WMOB 3FVQA 1NLZA 2QPTA 4RZ3A 2ZJ8A 4LHYA 1HQYE 1SQ5A 2QG6A 3THXB 1EWQA 1WE2A 2GWHA 2ZRIA 1P61B 5H68A 3CF2A 4YMWA 3OZXA 3ZVRA 1QVAA 3PCRB 1ZCAA 3FMFA 1CR0A 3U3KA 2DHRA 4QGGA 1P2SA 5H8WA 2XOKD 4B74A 2OAQ1 3CPJB 5JFGA 4D0LB 3LBHA 2ODEA 1OHHA 1J90A 2IEYA 2REOA 1FOEB 2DFKB 2V3CC 1D2MA 1OT3A 1J2JA 2VSOA 3BH7A 3VR3A 4R71A 1RC8A 5JI3E 4TYWA 3R7WA 1Q21A 4X8HA 1UFQA 2XSZD 4Q4HB 4DCTA 4C7OA 3LLUA 1ONBA 1NMYA 2ZRAA 2QEQA 2Q3HA 1RRGA 2VA8A 4TQUS 3AF3A 2OCYC 3F3YA 3FKQA 4MQBA 3K70C 2O8DB 1KMHB 3IBYA 3RRMA 3MGCA 2JIZD 1S3GA 3PXGA 1YRBA 1R5OA 1U0HC 2GEUA 4B76A 3QPUA 4KFRA 221PA 2PX0A 2ZRBA 1XTRA 5AJWA 4B6FA 1GKYA 1XTKA 1JQJC 5FOXA 1QVRA 1P2VA 3SOPA 2G83A 3KUCA 4JYCA 1OJLA 1DE0A 2MMGA 4LJ9A 2HXYA 4ZCLA 2OAP1 3QKRB 1OSNA 3EIEA 2BKEA 1E2JA 4V0NA 4FD2A 3GLGB 4TMXA 2MMCA 3SS8A 3ZZUA 2N1BA 3I8XA 3L8ZA 2CK3D 1N25A 1E1RD 1ZC4A 3IKJA 3BRWD 1KK0A 4ZIRB 4ZDJA 1E9SA 1L4UA 1IQPA 2ERXA 4DDUA 3I62A 1BYIA 2GXSA 2FG5A 3QXJA 2XTMA 2ZXUA 4TQAA 1AJEA 4V0KA 4R7ZA 2ONJA 3ZZTA 2N42A 2NZ8A 3WP1B 5FI0B 3GEEA 2NO7A 4PSAA 4EUNA 3G82C 4IRUB 3IBGA 4MDFA 5C46F 1KK3A 1UDXA 1CF4A 2GJAA 1X8JA 1XEWX 4FXPA 2EYUA 2B8TA 2WZQA 2QT1A 4JMPA 4TL6A 2CDNA 1A2BA 4EPXA 2R44A 4LC1A 1HV8A 1W2GA 3GFTA 4LJYA 3A1TA 5IDVA 3CNLA 2ATXA 2V6IA 1OB2A 4DSTA 2WIBA 1ZCBA 2CL0X 1X86B 2JDIA 4M2LA 4C30A 5TVKA 1GFIA 2RHDA 2VQSA 2P6UA 4BASA 5BWMA 2JLQA 3VAAA 1E94E 5JSZB 4M53A 3KTAB 4Q1DA 3W5IA 4ESHA 2XZOA 1RFLA 5F98A 3KFVA 2EU8A 4JBXA 3ONWA 4N0DA 4F93B 2IC5A 3QF4B 4YMTA 1MH1A 3O8RA 4TL8A 5C1BA 2ZETA 5JJKA 1I4LD 4AY2A 2YWHA 5JEEA 1OIXA 3NC0C 5EUQB 4PZLA 3AF0A 1MRNA 4O2LA 1QHYA 5KNBA 1XFAA 4G5RA 2C95A 2KE5A 3CLVA 4B3DA 1XMIA 4A9AA 1KAGA 2DB3A 1UAAA 2BC9A 3D8BA 2V7QA 4Z8YA 5CLQA 3THYB 2H57A 1JI0A 3AVQA 1II0A 4C9BA 4DIEA 2RGNA 2ZANA 1M7GA 2Q3MA 3E70C 2ZJ5A 3RRNA 4EPWA 2YKGA 1EESA 1HE8B 5DYGA 2W6IA 3Q72A 4IEIA 4WVFA 1KKLA 2DCUA 3O8CA 4TL7A 2OHFA 1UEIA 1A2KC 1BH2A 3I8SA 3M4YA 2DY1A 2QP3A 1G16A 4BGDA 2EWWA 1P73A 2FJUA 3UG7A 4RKFA 4IOMA 5FUYA 5JCPA 1D8TA 3U7FB 1VTKA 3IPXA 4QNRA 4P4UA 4NBSA 2YWFA 4D80A 1XU4A 1E2PA 4IW3B 5TARA 5DNYB 2ZUDA 2V54A 4PPNA 521PA 2ZAOA 4JZKA 1HYQA 1NVUQ 1Z0DA 2PJRA 3J81k 1DAEA 3ZZ0A 3NBZC 3T35A 1EXMA 2IYTA 1F2TB 3GLIE 4NCHA 1CRQA 1E79D 2ZQ5A 3PQCA 621PA 3Q8XB 3RABA 4WA7A 3C5CA 2FH5B 4J0QA 2GRJA 2YHSA 3CW2A 5JMTA 2YINC 4A8JB 2GCNA 2JLZA 1H8HA 1NY5A 2EFHB 3CX7A 3MMPA 4PC1A 1GITA 3GEHA 1FW6A 4F91B 2X2FA 2QROA 5FOWA 2QORA 1MRSA 2QBYB 2Z4SA 2ZR7A 4TL9A 3P20A 5FR2A 3LW7A 3SC3A 2WM9B 5LB2A 2GXUA 2WTUA 3PUVA 2R6DA 3IPYA 1GL6A 1XEWY 1WP9A 4IXMA 2QSZA 1SVWA 3QY0A 4FINA 4CGZA 2QA5A 4TYNA 1XTSA 2X2EA 3KKOA 1IN4A 5SZJA 2NQ2C 3BORA 3BAFA 5L3RA 2XZPA 4CW7A 1NBMA 1QHHA 5JHGB 2DYKA 4GFDA 4OQFA 3AQ4A 3QQ5A 1P62B 1KK1A 1HUQA 1VMAA 2RHMA 5CM8B 3TK1A 2ZE7A 3GQBA 2CBZA 1T5IA 1H8EA 1NL3A 4QBHA 5CM9C 3K53A 1CR2A 4GDFA 1KGDA 3K9GA 2REXB 1JR6A 2OLJA 3ZQJA 5AWFC 1ZJ6A 1SZPA 2IA5A 4JLMA 4OI2A 5EE5B 3HR8A 1W4BA 1E9BA 1UADA 3TSZA 4MGZR 3QNUA 3U6BA 1W0KA 5CK4A 1CJUC 2C77A 2QNRA 1BKDR 2Q6TA 4ARZA 4OI0A 5L3QA 1Q22A 2CHGA 3Q9LA 2VP2A 4HAWA 3SE0A 5GADl 3HR7A 1XTJA 1W7AA 1G5PA 4FCTA 1Z8FA 3AF2A 3M6AA 2QY9A 2VO1A 5KO2A 1RPZA 1IBRA 4OQLA 3T15A 4RFSB 3Q3JB 4PHHA 4QGFA 3R9XA 4UKDA 4DJTA 3SHWA 3VR6A 4HLUA 1XMJA 3FWYA 1MT0A 5FPTA 1G1MA 3QEJA 1RYHA 2J46A 2ZSDA 2IYUA 4KLNA 1QHGA 2K5UA 4WXPA 1IY2A 1OKKA 4MUBA 2JASA 4JL6A 3KXLA 2OV2A 2WPDD 3I1FA 1CBUA 2JGNA 2VHJA 3RRZA 3T1QA 4TTRA 2QT0A 1GUAA 3W6NA 1I4DD 3OFNA 4O0MA 2OCBA 4RZUA 4D81A 2JLXA 2UZ3A 2AL7A 4EJSA 4WIAA 1D2NA 2IL1A 2YYZA 3TVTA 4A36A 1E4VA 3Q5DA 3GJ5A 1CR1A 1LS6A 2KSQA 3W3ZB 4EJSC 1GP2A 1EFRD 4WOPA 5KTYA 5F9HA 4E09A 4OK3A 1EG7A 4HDQB 1ODFA 4MRVA 2BMDA 4HUTA 2ORWA 3NBFA 4PSKA 2GDJA 3I3SR 4X8OA 3LXRA 4MYHA 4ZPXA 4DCSA 2ZSEA 2HCJB 4OYHA 1BMFA 3ADDA 5DH9A 1L7VC 3SDZA 4FMDF 1KO7A 5FFMA 5FOVA 3TGPA 3WP0A 5JRJA 5F2EA 4RZ2A 2QTVB 3K8YA 5E7IA 3TQFA 1EX7A 4RCZA 1QHSA 2GCOB 5E4FA 1RRPA 4CYMA 3VR5A 3E2IA 1US8B 2ZE6A 1JR3E 1JECA 5KUTA 4KVGA 3A1WA 4R2HA 3VU9B 2NG1A 4TSFA 2GAAA 3BB4A 1CRPA 4XSGA 2PEYA 4LX0A 4MUAA 1M6NA 2H92A 3FYHA 2VHQA 4JLNA 2C9CA 2LKCA 3GLIA 3L0OA 1EFTA 2FU5C 1KI4A 4V0LA 4HAYA 1E9AA 4POAA 1F5NA 1FTSA 1KO5A 2GZDA 5CYOA 2YC4C 2FFHA 3CWQA 1SVSA 2IF0A 1NJGA 4LWZA 3D3QA 3M0EA 1F2UA 3L0IB 2VL7A 3T1OA 4GL2A 3WXMA 1KKMA 1G64A 2IS1A 2AKAB 4G5QA 2LCFA 4LV5B 4HLCA 3OIUA 3PEUA 5JRZA 4AKIA 1IY1A 3N2EA 2I1VB 2QENA 2JJ1D 1Q57A 2Z4RA 3CZPA 5EJEA 2TMKA 2ZRCA 1CLUA 3MCAA 4NZYA 3VKWA 2VP9A 1A5TA 4Z51A 3V4RA 2ZI7A 4ASUA 2G88A 3QF7A 4JVMA 5AR1A 4C0SA 1O87A 4F38A 5L3SB 1ZNXA 2JJ8A 1G3IA 5K8UA 1OH8A 4LV6A 2VPPA 3C8UA 1Q3HA 4MYTA 4HZUA 1DAKA 4CZ2A 2FFAA 1E2EA 4BWYA 2F1HA 2W58A 3SR0A 1G3RA 2EFGA 2IHBA 2WWWA 3BFXA 4HEJA 2GJ8A 4QFMA 3UK6A 3OE7D 4BLOA 2YNMA 1M74A 1NG1A 1OHHD 3PEVA 4XTCS 2O8CA 5EP2A 1W44A 3U2QA 3KUDA 3GJ6A 2GXAA 1KSHA 5JWHA 1GOTA 2IYVA 1DAMA 4WW0A 5DHAA 4RY2A 2AD1A 4Q21A 1N6KA 1PLJA 2RMKA 3GFOA 3RNLA 4DEYA 2YVUA 3CB4A 1IY0A 2X1VA 4C7OB 4LBWA 4JLPA 3K70B 4Q66C 2G1KA 4C0JA 4AI6A 3G0HA 4GZLA 3LXXA 5G41A 3KFXA 3A1UA 2J87A 1P7CA 2PZEA 2Q3FA 1XD2A 2IK8A 2XX3A 4PO9A 3V00A 3W5JA 3THWB 4D82A 1GNQA 1NSFA 4MRRA 1G17A 1OF1A 4B2IA 5C2JB 2B8WA 5EXTA 1AS0A 4OHYA 1RVDA 5L3VA 2O8FB 4JBYA 3NBXX 2XGJA 5GJCA 3KKPA 3LX8A 4QXAA 1JAIA 5FUXA 3GCGA 1D6JA 5HKKA 1S4QA 4NMMA 3SBEA 1P4SA 2F3RA 3RLFA 4OHXA 5EP3A 2ZTSA 4Q9HA 3I4LA 3LQRA 3TNFA 2ZYTX 4HUQA 3BB1A 2DFTA 3BH0A 2GZAA 1HURA 4A2QA 1OIWA 3UWKA 2OO7A 3VMFA 1QDEA 1JB1A 1KY2A 1W5SA 3AKDA 4ILEA 4W5JA 4OBEA 3B85A 4KLZA 1T4GA 1FUUA 1EX6A 3NHBA 2QGNA 3A4LA 1KZ7B 3QPWA 2QM7A 5KDOA 4TMWA 3S1AB 3FE2A 4CEIA 1XWIA 4JL8A 3HU1A 4KU4A 5B57C 1G41A 2O8EB 2H18A 2JDID 3ECCA 2JATA 1ZIPA 3B78A 4TQ9A 5FBLB 3RWOA 2UZIR 4EIWA 1EFCA 2V4ZA 4IDNA 4Q4AA 4LJ5A 4M0LA 4XJXA 4OI4A 3OIVA 4KCGA 5KOYA 1YVDA 3R8FA 2QQEA 5DE3A 1E9RA 4L9WA 4BLPA 2FGKA 1NF3A 1SXJE 4CT5A 4URWR 3ICQB 4ZDWA 2HDNB 5KNDA 4XVQA 3T12A 1G8GA 1TL7C 5D3MA 3VX3A 2PCJA 1N6NA 4YMSA 3EW9A 2HXSA 3AKYA 1GDDA 1LV7A 1KI8A 3K0AA 2V7QD 4AWXA 1JR3A 3DMDA 4MKFA 5DHFA 2AN9A 3KX2A 3CBQA 5GJBA 1ETUA 2GTPA 1G8HA 4V03A 4OQNA 4YXWA 1ZYUA 3EPLA 2XNSA 4B3GA 1Q1BA 3DEFA 1UM8A 1FX0A 2A2ZA 3PEWA 3A36A 5KU1A 2R65A 5KHOC 3AVVA 1NVVQ 1YZNA 1XZPA 1NN5A 1E2LA 2NZJA 1G7RA 4LV8B 1X1SA 3WMEA 1DG3A 4BFZA 1RRCA 5FBQB 4O3MA 4RCYA 3GJ3A 1UBFA 4IHQA 3DO6A 3AVXA 1VCIA 1C1YA 1P3JA 2GILA 4BECA 3K70D 3AKCA 2XXAA 1DTSA 4A15A 4GSYA 2QAGA 4TYYA 1S9HA 3AP2A 2CLSA 2O0JA 2RGDA 3KDSE 4W5WA 3AUXA 1E2GA 2JEOA 1GNRA 2OFWA 4B3CA 4B44A 4ZDIA 5BYKA 5EXPA 4M22A 3GPLA 2GEDA 2ZUCA 2CXXA 5FTKA 1S0UA 1TF5A 5GJVC 1JXOA 3SU8A 4XVUA 1QF9A 3TH5A 1E2QA 1TU3A 1VYVA 1VG0B 1KSFX 1NSTA 3QEOA 4PC7A 1UDWA 2QTFA 3DDCA 2A5GA 4EPTA 1VYUA 2ODNA 4HATA 5LD2C 1QBKC 1E1QA 2LWIA 4BE7B 4PR0A 5SZHB 2VHUA 3HYRA 4FMCB 3DVLA 1S1CA 3IIMA 2ASEA 2QQ0A 1Y3AA 2WICA 3FFAA 1H8HD 4KO8A 1GZSA 4FWIB 4WZ6A 2R6AA 1NNEA 5C18A 4MRNA 2OFOA 4DRZA 1WBBA 1XPOA 3VQTA 1ZM7A 2J7PD 2RGBA 1OB5A 4EDHA 3SYKA 1JEEA 2QE7D 2DWQA 4H1VA 3C16C 1YE8A 1E2FA 4IDQA 3LAWA 1GL7A 3B5JA 3T5DA 2FNAA 4M9XA 1TQ4A 3H86A 5H1YA 1HTWA 1A7JA 2VF8A 1OPXA 1KIMA 1ZIOA 3W3AA 4IOJA 2GKSA 4DC9A 4UXHA 3RC3A 1RW4A 1NN3A 1T8UA 1G4UR 1A1VA 1XJ0A 2SHKA 1E9EA 2ZR9A 3RSLA 2ANCA 3EARA 3KKMA 1E0AA 4Z1MA 1N6RA 1UKYA 3VKHA 3AGPA 1NBMD 3KQKA 2EWVA 3AH8A 2MSCB 2W2XA 4RD3A 2GK6A 1TNDA 2GETA 2QSYA 5F9FA 4WAUA 3CZQA 2CNWA 1YR7A 4WZBE 1DPFA 4R2IA 2P67A 1H8ED 3EZFA 3MLEA 2VIIA 1COWA 3CWZA 4TLAA 2WWGA 1KDOA 4XIGS 2OG2A 5H70A 2BWJA 1FMLA 2XTZA 3C14C 4V0ME 2J0VA 2ZJ2A 1HY3A 3LFUA 1I4TD 1DARA 4CIDA 4Q9JA 3AVUA 4PPGA 3SN6A 2ZRGA 5DN6A 4FI3C 2CCJA 2G3YA 2WWHA 2J41A 4MYUA 1NP6A 1KO1A 1W0KD 1E0KA 1EFHA 4M1YA 4B3XA 3EZ2A 2Q0HA 3ZGXA 3ZJYA 1MKYA 1AIPA 1P6XA 2BBSA 4QC2A 3B82A 3EWAA 1KNXA 3NIBA 2EQBA 3WNDA 3UKDA 2GESA 1Z0IA 3BB3A 4L5BA 3T34A 4Q1AA 4EFLA 4QJ5A 1KZGB 1KI6A 5L3QB 4M21A 4B48A 1CJMA 2FPKA 1M7BA 4TLBA 1EK0A 4E5UA 4Z54A 4B47A 5AJXA 3L0PA 1G6HA 3VFDA 3MG9A 2KBFA 1BOFA 2FMXA 1E6CA 1OXVA 3HJNA 3QXXA 4HB3A 2IS6A 3I32A 3D6TB 2J45A 1TQ6A 1JPJA 1N5KA 1FNNA 4UNSA 5FTNA 5CJPA 4JJZA 4MGYR 3FMIA 1W4CA 2C78A 4B34A 4IDHA 2IW3A 5FUVA 4IFEA 2JLYA 3QVVA 1OKKD 4QKQA 4EPVA 2IYSA 1P72A 2BBTA 1Z22A 1S1MA 3EZ9A 4LC0A 4M9SA 1F48A 4X8LA 2XB2A 3VHXA 3GLHB 3W8RA 2QM8A 3UPUA 1J99A 1S2MA 1JPNA 4HDOB 1ZUNB 4A92A 4BFYA 3DPUA 1IONA 2CCKA 2P6NA 2GJKA 3OFND 4DUGA 1Q12A 2GF0A 2ZYWX 5B30A 1E2KA 1RYFA 2GZHA 4R98A 5E7MA 3GLGE 2A7QA 4TLCA 4BFXA 3SJAA 3V4FA 3W8NA 2ZREA 5HCIA 4EAQA 3B60A 5DYIA 2ZJOA 1HEIA 4Q01A 1HE1C 4EJSB 1MO5A 5LPNA 4MA4A 3B9QA 1P9WA 3LY5A 4A0FA 3AP3A 1KJZA 4C0AC 3SJZA 3GLFA 2VBCA 1Y63A 4G01B 1L8QA 3G5UA 2R9VA 4BRWA 1MO3A 3GJXC 3MWYW 4BZQA 1Z0KA 1BMFD 4CF7A 4Y0AA 3RS2A 3UATA 3PIRA 1TUIA 5LB4A 2O8BA 1II8A 1E2NA 4O25A 1SKYB 5FOSA 5DI3A 3RANA 4B2LA 1ZU5A 4D0GA 3BWDD 3GP8A 2JCSA 2CL7X 4BRUA 4TMZA 3FHOA 3U4QA 2GHIA 1G9XA 1YZLA 1M2OB 5B58C 2XTNA 1QHNA 1KNQA 3ETLA 5KSPA 2VHCA 1P60A 5A4JA 3ND9A 4WXRA 1OW3B 1S9DA 3DM9B 4LZZA 4W9MC 4BUJA 2RGNC 4FMBB 1OXXK 4D4KA 3QVUA 5CK5A 2X77A 1FQJA 1DO0A 2ZUBA 3RSOA 2AX4A 2YZ2A 4N3NA 1GILA 4GOJA 1PLKA 3KKNA 1SVOA 4V0OA 1FZQA 5EZ6B 3EZ7A 2HEIA 3TR0A 2AWNA 2GXQA 3B2EA 4XWKA 2VP0A 4L16A 1ZU4A 1E3MA 1G19A 3Q7PA 4P32A 3WRYC 4ACAA 1WDTA 4Q7LA 1XPRA 1Z28A 5FOTA 1R4AA 3BS4A 3LV8A 2FZ4A 4B33A 2F43A 1PLLA 3A1VA 1ZNWA 2BM1A 1T8TA 3ADKA 3C15C 1KDTA 4ZI2A 1J70A 2CJWA 2AWOA 2ZAMA 1Z6AA 1W47A 2GVDC 1JXMA 1QZXA 1R5BA 4UNRA 1IN6A 1W36C 4Q4JA 3IEUA 1U99A 1VG9B 3KJIA 3EASA 4A82A 5HPYB 3FHTA 2WMNB 1XXHB 4R9UC 4DLXA 3K1JA 3NEYA 1T91A 3KJGA 5E7JA 3AP1A 3ADCA 3OEHA 3WBJA 4DWJA 3B1YA 2ZE5A 5FUWA 4BFTA 4ITRC 3NTUA 4LHZA 1KDRA 3BFVA 5EE9A 4ASUD 4AD8A 4PXAA 1F60A 1M8PA 1Z2AA 4DXAA 5HTKA 2CE7A 3ZVNA 1EFUA 4U02A 421PA 4MDEA 4D6PA 5FH9A 5JJIA 2F1RA 2WAYA 1ZM4A 2CCGA 3SFVA 2J0SA 3UXMA 4QHYA 3I5XA 1R0XA 2IYYA 2JAQA 2FSHA 4HZUB 1ZINA 1SHZA 1YZGA 5HE8A 4ZCIA 4YMUA 2R6CA 5IHPA 1RJ9B 2ZYVX 1U94A 1KAOA 1VKJA 2EFEB 5KPDA 1OXSC 2FEMA 1WQ1R 4BZPA 1E2HA 4V0MA 3THXA 3RS0A 2ZYUX 1IM2A 4G0NA 4NYMQ 1PUIA 2AHOA 4TMVA 4ERNA 2IUTA 1U9IA 1G5RA 1VDZA 1XTIA 2ZI9A 3LDAA 2GF9A 3RWMB 3GFPA 1XTQA 5JZVA 4NYIQ 2B21A 3B1XA 3TBKA 1OH5A 1L2TA 4KITB 2ZSBA 2ZS8A 2E87A 4JLJA 4NCJA 2H8KA 1SVMA 4M4SA 5L8VA 1RZ3A 2E1RA 2G0NA 5TY0A 1Z06A 4Q4HA 1ZM3A 1ELOA 3DKVA 2W83A 4RKEA 5C4MA 2XB4A 4MKHA 1G3MA 2C99A 1U8YA 5B64A 4KI0A 4D4MA 1OYYA 4MKIA 5HKKD 2O8DA 1KMHA 2F9MA 3U44B 1NI3A 3BD9A 4OKSA 2P6RA 2QP9X 4LJ4A 4Q9IA 2D7DA 4FCVA 1KI1A 2RGCA 2Y8EA 4HB2A 4S2EA 4L9SA 3ZIAA 5J4HA 1FNMA 2NPIA 4OJQA 1CULC 2C8VA 4IFBA 1I2MA 1OXTA 3REFA 1TTTA 1AS3A 1UKEA 3CPEA 3BOSA 5J4YA 3M1IA 5AK0A 1MO4A 4P3YA 1HT1E 4RD2A 4G5OA 4M1OA 3KZ1E 3TR5A 1XEXB 1DBSA 5LBIA 2QMUA 5TMPA 2AR7A 1J8YF 3CX8A 4CVNA 2B92A 4OK5A 4BQSA 2W00A 4EQ6A 1KI3A 4DLYA 2QMOA 1E99A 3TVDA 2PMKA 4QBIA 3QKRA 4B2PA 4EPYA 3LWNA 4HAZA 3GLGA 5G40A 4HLUC 4C0BA 3ZQ6A 1QHIA 2BOVA 3OHMA 1KSJA 4ZIRA 5FTMA 3AF1A 5EUMA 3PJRA 3V9PA 2BCJQ 3DL0A 2ZIAA 4I1OA 2IXGA 4UXIA 4PAOA 4NKRA 3FB4A 4E03A 3TQCA 2ZJYA 3MD0A 4MITA 3GJ4A 3K9LA 3AB3A 2JA1A 1IN8A 1OFTA 4P0TA 4DLZA 2ZS7A 2OBMA 3CF0A 4A0GA 1P5ZB 4OJKA 3RS7A 2KJQA 4XWOA 5C4GB 2FSGA 3I73A 3LBIA 1UBCA 5DISB 3EX7C 4K81B 5P21A 4D4LA 3K0SA 4CEHB 3KB1A 3OEEA 4RD6A 2ONKA 2KBEA 2DWOA 4FW9A 4XD7A 1NKTA 1JR3D 2F1JA 3SYNA 4RD0A 4Q1BA 2G1JA 4I99A 1T3HA 2V6JA 4D2IA 4DSUA 3AUYA 3RC8A 3KTAA 3EC1A 4YXWD 3LQQA 3TIFA 1G6OA 5KSYA 3NHAA 3ZVLA 1K5DA 1YR9A 1S8FA 4I1UA 3FMOB 3BGWA 1LW7A 1PV4A 2W2TA 1KK2A 1OFUX 3WYGA 1IOZA 5BW8A 1YQTA 2J9RA 2QU8A 4BFSA 5HZKA 4D4JA 2CLCX 3NG1A 2IYWA 2ZE8A 1IAQA 4QM7A 2VP4A 4M1SA 3NBYC 3B7GA 3QXHA 4CEJB 2XEXA 4G5GA 1KO4A 5FPKA 3FMPB 4QBGB 3U3OA 1HT2E 2NO1A 4DBLC 4DCVA 2JLVA 1KTVA 1XCPA 1R0ZA 121PA 3B6EA 4H9GA 4NPHA 1IJEA 2QAGB 1YZQA 3AGQA 1XJQA 4P4SA 4NCNA 4PQRA 4DCNA 4EFMA 3RS4A 1E4YA 3FPAA 4GRAA 4KAXA 4DT1A 3UMFA 5IT5A 1GRQA 1Z08A 5GVRA 2ZI6A 4PPQA 2IS4A 1G8YA 4WBSA 1ESMA 2A78A 1E1QD 2ZPTX 3F5FA 4QHSA 5LD2B 1W1WA 3F0TA 1CKEA 4PZYA 4JT2A 4OK6A 1NIJA 2P5SA 3W90A 4JYBA 2V1UA 3LNCA 3EAQA 4XSHA 4IEEA 3LH5A 1II9A 4P33A 1E9FA 3CH4B 3UMRA 4PTLA 4I81A 4C2UA 2A5JA 3A8TA 3KKQA 5SZIA 4OQXA 4PX9A 2VHTA 3SEAA 2DFNA 2IBMA 4OL0A 2OESA 5CIQA 1RE0A 4LYJA 2NPFA 4AYWA 4E22A 5JWOA 3L8YA 4U00A 1MABA 1F2TA 2WWXA 5FPSA 4DDVA 1CJKC 4FN5A 2B6HA 1G21E 4MYCA 4Q48A 3H2YA 3OF5A 2J59A 4Q7JB 2QMEA 1W0JA 4KBFA 4AYXA 1HA3A 2D2EA 4MGKR 5FL7A 3PUYA 1GKUB 5FPYA 4E07A 3MSXA 1G3QA 2R8RA 2UKDA 2W0SA 3PUZA 2H7VA 2YOHA 2OM2A 3CNOA 4G1UC 2NGRA 4A8JA 1C4OA 1W4RA 4Z1MD 4KJZA 3REGA 2IUUA 3OAAA 2VSXA 3CRMA 4RJLA 1KYIA 1V5WA 1W46A 2LKDA 4QRHA 2QBYA 3T1VA 4IKEA 2WKRA 3PG5A 4JLKA 4U5XA 1COWD 1DAFA 5B2ZA 2NOAA 3C5HA 1Z6XA 4OHWA 3R7WB 2WJJA 4NE2A 1SGWA 4LBYA 4LYAA 3DMNA 4C0LA 2EW1A 3H0KA 5KSOA 1YZTA 3TE6A 4EKDA 4NP6A 1NN0A 1WMSA 2PLRA 3AVYA 3KXKA 4LGMA 5DN6D 3T1TA 3CONA 1G5TA 3DM5A 4GT1A 4B6EA 3KQLA 3DOFA 3TUJC 4GNKA 4PANA 4HLQB 5JS7A 3P1JA 2XNDA 3MUFA 3LVRE 5KSZA 1ZD9A 2PZFA 3LA6A 4BFUA 2VRWA 4C0QC 4NHOA 3EPKA 1FMJA 5JWRA 2NO9A 2QPOA 5FTJA 1T3SA 2ZEJA 1LY1A 1LVGA 3AEZA 3PFIA 2VP5A 1X8LA 3JVVA 4HSEA 4KYIB 1XDBA 4Q7MB 1TAGA 1UKZA 3EA5A 3BK7A 4AYTA 1Z0FA 2ZRKA 2A9KA 3U60B 2XJ9A 4LK2A 4UNNA 4IOLA 4LPKA 3SHFA 1N5LA 4QM6A 2QI9C 1OIVA 1U0JA 3CRQA 2KI5A 5EP4A 4LUCA 2CVHA 3PR1A 4LBVA 1MO6A 1MR3F 1AGRA 2C98A 2E9SA 3A4MA 3Q85A 1AM4D 5FR1A 2AK3A 1R0YA 3NH6A 3U7GA 3T06B 2NIPA 1ZBDA 1XF9A 2FX3A 2W6JA 5CB8A 4I1SA 1NY6A 1N0VC 3RHFA 4RFSA 2GBLA 2IYZA 4HDCA 3QIAA 1ZNZA 4JJKA 2ZS9A 2J0UA 2CHVA 2A3RA 3P4XA 3BXZA 5J40A 1PUJA 2FN4A 2F3TA 4PHFA 1U98A 1CXZA 1E32A 1M7HA 4A6XA 2IEZA 1ZAKA 3WHLA 1U8AA 2O5VA 3CUEF 2BJWA 1W2HA 4O2RA 1LF0A 2WWFA 2IYXA 3GD7A 2AD5A 4UNQA 2BEKA 3EIQA 1T0HB 1AGPA 1R6BX 1ZRHA 1NVWQ 5CIWA 3KL4A 4I1VA 5TB5A 1ANKA 1Z3IX 2QP4A 4TMKA 3O8DA 4YQFA 1FUKA 3GLFB 2QUZA 1N3BA 4Q19A 2EYQA 3PV0A 2H1LA 2OT3B 3I5YA 4BPBA 2O8BB 4MRPA 1P9RA 4RFVA 1KOFA 5DGXA 3IGFA 1SULA 1R8QA 3P27A 4ABYA 2W6ID 1BS1A 4KFUA 1AA9A 2JLUA 3U4QB 2A5YB 1SHKA 3ZS8A 4DDWA 2DFLA 2YWGA 1ZD1A 2OXCA 4JVSB 1WRBA 3OIWA 4IOKA 2C96A 5DLQC 2ZVPX 3B1ZA 3WNCA 2EFCB 2YOGA 3B13B 2I3BA 2YOFA 2HLDA 3JZAA 2WJHA 2PT7A 2D74A 4GBMA 3UMSA 2QL6A 2VF7A 1XRJA 4II7A 4OHZA 2PT5A 2A5FA 3QKTA 4ZV4A 3VHLB 1O3YA 1TADA 1XZQA 2GCOA 2QN6A 3SZRA 1Z6TA 2ZRMA 2Q21A 2HT6A 3WHKA 2QAGC 4G5SA 4OI1A 1XNJA 3VU9A 5HZHA 2RKOA 1W36D 1AS2A 2BEJA 4TWZA 4JVNA 1DOAA 1M1YE 3TSWA 1DAHA 4HZIA 2F43B 3SYLA 2B7BA 1X3SA 1TMKA 2NO6A 4KFSA 3WBKA 3UANA 1AK2A 1Z0AA 2CJWB 1LNZA 1KI9A 1W36B 4PQFA 3PEYA 3ZD7A 2Z6VA 4JLVA 1DADA 2R62A 3OEHD 4Q9LA 3QXSA 1D2EA 4LPSA 1B0UA 3VNUA 3K9NA 2ECKA 3L0SA 3TAHA 2JLSA 3TUIC 1J7KA 1T0JB 4D25A 1G18A 2AK2A 4TYQA 5EE0A 4BFWA 3HYTA 2BBOA 2J7KA 5K8LA 4US2R 3AV0B 2YWEA 4NCKA 4PQYA 4M9ZA 2ZJZA 3FOZA 2F9LA 4BFVA 3WNBA 1P75A 2DBYA 2H16A 2WWYA 4BEJA 3SQXA 1T5LA 2C5LA 4DDTA 1YZKA 4OQMA 5J4KA 2XAUA 5BN5A 2AKYA 4JSTA 2F1IA 3P26A 3H4MA 3X1YA 2D62A 4JBWA 1JEDA 2X8AA 3BERA 4JLDA 4Y0VA 2OILA 3N2IA 3KXIA 2IS2A 2IUSA 3X1WA 4QG7A 3R9WA 2ZROA 1UF9A 2RCNA 4GMDA 4X8MA 1GWNA 1N5JA 4NYJR 3B1VA 2A30A 4UJ3A 2PL3A 4HLDA 5CLLA 2C2HA 4KBGA 1QHHB 3TKLA 2OCAA 4DLTA 1TUEA 3CM0A 2PLFA 1DO2A 2I1QA 4K46A 2FSIA 3A1SA 1FFHA 1YR6A 4Q00A 3CNNA 3TJZA 2PCLA 1SVKA 4LJ7A 3OE7A 2W2VA 5AUQA 4P4TA 2J1LA 2O52A 3QENA 1ZM2A 2HYDA 1IJFA 5SZKB 1DAIA 1W48A 2FPMA 4V02A 4DLSA 4AURA 2J5XA 1CEEA 2FSFA 4LJAA 1GVNB 1I2DA 1BIFA 2QRZA 4PO1A 2W0MA 2X19A 4RD4A 4TT3A 5BQ5A 4Q1EA 1G8FA 3ZIAD 2P0EA 3THWA 4HYYA 2FZLA 4IVQA 1AZSC 1IXSB 1PVOA 3LRPA 2IHYA 5EZ5A 2GAOA 2Q9AA 4ARZB 3C41J 2HJGA 3C4JA 5KDLA 3I61A 1NBME 1S3SA 2ZRPA 3BIFA 3WMFA 4A0RA 5CB6A 4Q5IA 4DSNA 2QAJA 1YKSA 2D06A 1Z47A 2WJIA 2YC2C 3FKSA 3K0FA 1K5GA 1S96A 2ERYA 4FCWA 4MGIR 2O8FA 1UEJA 3H84A 2QGZA 4M1KA 1AZTA 2RGXA 4Q4LA 1OH7A 1TU4A 1P2TA 4EQ6B 1K6MA 3LBNA 5IK2A 1N6OA 3DZDA 2F55A 1U90A 4F4CA 4DB2A 2BJVA 4JSYA 4A2PA 4F4IA 3W6PA 5FPHA 1Q3TA 3THOA 1Q20A 1KJWA 3PUWA 1QG4A 3L82B 3WYFA 4LI0A 1SXJA 4PPFA 4KYUA 1ZNYA 4U7DA 5CJ2A 4Q47A 2DR3A 4LDJA 2GJSA 3VKGA 3Q7QA 5AJZA 1XPUA 2V55B 3BFKA 1SXJC 2BV3A 3E1SA 3HDTA 4IDPA 3PITA 4M1TA 3HPRA 4Q1CA 4QOSA 3NDPA 3DHWC 3X1ZA 5JECA 3EZ6A 4YONB 2G9NA 1Z07A 3QG1A 4Z8XA 4IDOA 4ZI3A 1NLFA 4Q03A 3S1AA 1WBDA 3OEED 5G3YA 4A6PA 3WY9A 5CDFE 2O8EA 1CIPA 4XD7D 1X1RA 3VNVA 2F6RA 3KQNA 1R5NA 1OLOA 1GM5A 2BBWA 3D31A 2WBLC 1Z2CA 2H5EA 3GEIA 4RSGA 4AG5A 1P9NA 2FA9A 3GLHE 3U3JA 2ZU6A 3MWJA 1RKBA 1SKQA 1GRRA 5KNCA 1NMZA 4C4PA 3R8CA 1BO6A 2HF8A 5J4VA 3ICEA 1U2RA 1VHTA 2JJ2A 4KXFB 1VIYA 1WF3A 1IXRC 3DZ8A 1KHTA 2WVJA 4C0KA 2WSSA 3GJ0A 5FI1B 4US0R 1E9DA 3SQWA 1V43A 4NH0A 1LTQA 2Q9CA 2HCBA 3A4NA 4URVR 1AKYA 4MH0R 1YRAA 3AVOA 4TSFD 5BN4A 3ZD6A 4A0HA 3EC2A 1VCOA 3W9YA 2P5TB 4GI7A 3AVWA 1NLYA 1EWRA 3X1DA 5FBRB 1GRNA 1T6NA 3CH5A 2FDCA 1VIAA 1NMXA 4WZAE 3O8BA 1OXUA 3U5ZB 1X6VA 5EE3A 4F92B 4FWTA 4FMCF 3H1TA 1XEFA 4LY6A 4DHEA 2MSEB 4N0EA 5EE1A 2VYFA 5BN3A 1WB9A 2FOLA 3SBDA 3GLIB 1E0JA 4P4SB 1SKYE 4L4UA 1HQCA 3U61B 2JLWA 1ZW6A 2RGGA 2VLIA 3L43A 5JHHB 2IYLD 2OCPA 4DT1B 4IJMA 5KPJA 2OLKA 8OHMA 3QKSA 1NVVR 3KQHA 5IRCD 2R2AA 3K0CA 5AJVB 2ZR0A 3KJEA 4B3FX 4FMDB 3MAAC 2FWRA 2ZJAA 3LW8A 4F7WA 4CRWB 4IVRA 5DO9A 4YMVA 1T3LA 3QI2A 1F2UB 5E95A 4L15A 3MRSA 2G6BA 1Q1EA 2ZI3A 1SVIA 3K0CC 1A82A 1ZUHA 4DSOA 2CE2X 4B43A 1NIPA 1Z6GA 4Q9KA 1C9KA 1W4AA 5CYPA 2IYQA 2XITA 1OH6A 1YZUA 3IUYA 1MOZA 2WKQA 1U8ZA 3RYTC 1W0JD 4JKYA 1XMSA 1YJ5A 3VTKA 4AIIA 5FL7D 1MABB 3QOFA 2XZLA 1PZNA 2HV8A 1NRJB 4JIMA 1E69A 3ZYCA 4PSVA 3WMGA 2WHXA 3O47A 3OAAD 2FGJA 5F3WB 4QJ4A 1JJ7A 1G7TA 3UG6A 1Z0JA 1NVXQ 2P3SA 3PENA 2GEVA 3IO3A 3NH9A 3HP1A 3PVSA 2O8CB 1E2DA 3KJHA 2IX3A 3NWJA 3B1WA 2OZEA 1XXHE 4ON9A 1CU1A 4CT4B 2J7PA 1QHXA 2PBRA 5UKDA 4DIDA 6Q21A 4KVAA 2QE7A 3ZH9B 4ZCMA 3QKUA 4FIDA 3VR1A 3QSYA 1VG1A 1QG2A 2YJTD 4DZZA 1JAHA 2OBNA 5DSZA 1XP8A 2FFQA 3D7MA 2NTYC 1J8MF 1U81A 2VP6A 3BE4A 1U9IC 4QHTA 1Z5ZA 2KWIA 2V8OA 3QBVA 3FFBA 3FGNA 5AUOB 2CVFA 3C7KA 1XD2B 2RAPA 4KV9A 3AF4A 5JEDA 1ZVQA 2ZRFA 1KMQA 3QE0A 1F6BA 2XOKA 2GK7A 3CR8A 2R6FA 1H65A 1OV4A 1VG8A 2CHQA 2XNDD 4HAVA 4M8NE 1E2IA 5A0FA 3VX4A 2H17A 2ZRNA 5KDDA 3X1XA 3ASYA 3AKEA 1Z6YA 4PAMA 3N70A 4JKIA 4A1FA 1TQ2A 1FP6A 2Z83A 3A6PC 2XSZA 2BVNA 2REBA 1A4RA 1F3OA 2QZ4A 4XOIA 1Q1ZA 4C0HA 1W49A 3QJYA 1Q44A 4LJ8A 2IWRA 1IXZA 3QG5A 1M34E 2JIZA 4ZKEA 3GJ7A 1JQLB 3B8HA 3T61A 5JLJA 1D9ZA 2V9PA 4QJ3A 1LS1A 1GL9B 2RGEA 4M1WA 1GAJA 1XB2A 1Q0UA 2IT1A 4YDSA 4HUQB 2NO0A 2QTHA 5CITA 3MJHA 2CMKA 4OHVA 2JLRA 2BMEA 4KODA 5G3ZA 4ACBA 4EFNA 4B75A 1D9XA 1ZP6A 2GJ9A 2ANBA 2W6JD 4GMXA 1G3UA 5FBWB 5A5GA 1N5IA 3NXSA 5AUNB 2WKPA 5ELXA 2WAXA 4PHTA 1CP2A 2ZU0C 3QUSA 4DLUA 3TLXA 3OIYA 1JJVA 1XD8A 2G0TA 3I92A 4JT4A 2CK3A 1E1RA 1D5CA 1N6LA 1VECA 3GMTA 5JBQA 5CDFA 4CEIB 2OXRA 1QRAA 1ZD8A 2J0UB 3CPHA 1E9CA 3U7EB 3ZS9A 4D0NA 4DCUA 4PC3A 4Q4AB 4AK9A 1KI2A 3BC1A 3GLHA 4MKGA 3NVAA 2P2LA 2ZJBA 1T9HA 1XMVA 2GVZC 4JLBA 2RB4A 4XVRA 4D26A 3CR7A 1VCNA 3CRRA 4QGHA 1GSIA 3X2SA 4L8GA 4NTZA 2PMDA 2KB0A 3R9IA 1G7CA 1WXQA 1KY3A 2UVQA 5D3MB 2BM0A 2RH5A 1DVRA 3ADBA 3RAPR 1G4AE 5K8IA 5JSZA 4H1UA 2A5DA 4QL3A 3MFYA 4A2WA 4QGAA 4G3XA 4NONA 4S35A 3K0AB 1NG9A 4GP7A 1N2CE 2PJZA 2CL6X 4TMTA 3TW8B 4URXR 2N46A 2ODBA 4PFSA 4HAXA 3QF4A 4K8OA 2EVWX 2ZSFA 1VCMA 3FHCB 4Q02A 4GOXA 4ZKDA 3EXAA 3CF6R 1B23P 4CDGA 3ASZA 1R2QA 3R20A 1FX0B 1TEXA 2DWPA 3LVQE 4UXJA 5M04A 3KQUA 2HLDD 4RZXA 2WWIA 2WIAA 4NCIA 5FL3A 5E3HA 3JZMA 4US1R 2HJVA 2VSFA 3SI7A 3THYA 3ZDQA 3E5HA 1GNPA 1G8PA 4XWAA 1WCV1 1G20E 3K9HA 5EXXA 2D2FA 2OSBA 2P65A 2XXAB 3CIOA 3K09A 5D3QA 5DIFA 1BYUA 4URUR 1KI7A 4YDHB 2RGAA 2L0XA 1HH4A 3U6KA 1RRFA 2FEOA 2GNOA 3K09C 4EPRA 3ZLJA 4B3BA 4HB0A 5DI9A 5JI2E 4LBZA 3MWLA 1XCGB 4ESVA 2FFBA 2PX3A 1FPMA 1N6PA 2ORIA 4N1AA 1KJYA 2BCGY 1K8RA 3FTQA 5AUPB 2C9YA 5LDDC 2GA8A 2IF2A 3IDQA 4JVLA 4LHVA 2ZM5A 4TZ6A 3JVUA 4YLGA 3BBPA 3EIHA 2AFHE 2FPLA 4KSCA 1G7SA 2C03A 4KFTA 4PO8A 2ZRDA 5HCNA 1FP7A 2IXFA 1R7RA 2VTKA 4TLEA 2DPXA 4B73A 5BXQC 4C3ZA 3U3MA 1KSGA 1EGAA 4Q18A 3MJRA 1LFDB 3T5GA 3IILA 1TQDA 1JALA 4M1MA 5HE9A 821PA 5FBVB 2HT1A 1XXHA 4LJ6A 3AVPA 4DLVA 4F4JA 2CLDX 3IO5A 3CO5A 3IHWA 1E79A 4BLSA 1FL9A 2WJYA 3EWSA 4NYJQ 3W6OA 3LLMA 3U7HB 3L2OB 1CJVC 2IYRA 3DOEA 2OUKA 4GP6A 3U3RA 5TDHA 4A8JC 2CNWD 2WJVA 4M9QA 2HF9A 1ZUIA 2ZSAA 4NU0A 721PA 1TF2A 4RD1A 1TF7A 2XJ4A 4HAUA 1JNYA 4PZZA 4BLQA 1NN1A 2ODWA 2YV5A 4Q7KA 4GZMA 2QPAA 2OFXA 3ZVMA 1RJ9A 3TSOA 1DS6A 4RVCA 5EQTA 1NKSA 2FV8A 1GKIA 3LO5A 4TTPA 5AJYA 4AKEA 4DLRA 5GVSA 3HU3A 4DVGA 1N0WA 4JS0A 1R10A 2ATVA 2OBLA 2BDTA 1DELA
chains in the Genus database with same CATH superfamily
1VJGA 1HMYA 4U3JB 1U1GA 4Z4FA 1SCKA 3Q9SA 4JJ6A 4KPUB 4HAOA 1MNAA 2G1AA 5K4GA 3CNEA 1OVGA 1UEXC 3QM1A 4HH0A 4JQOA 4NYMR 4MI3A 3UWOA 3R0ZA 1CUAA 2N9UA 2YHUA 3A3KA 2Q9BA 1B8PA 1AN0A 3BXXA 3N3BC 3TE7A 4CDMA 3UJAA 2PNJA 3V8BA 1FNDA 1T1GA 3CG4A 4KV7A 4DLAA 1EA7A 3C4QA 2YJ5A 4YC7A 3SJCA 4B3JA 5BR8B 5FA8A 1K3UB 1FP4B 4LVNA 4CCSA 5IT4A 3TTUA 4R7TA 1JDTA 1FBNA 3T3DA 4BEBA 4MVXA 4AG6A 5IT9A 2BHRA 3WX0A 2CZGA 1M6VA 2B2XA 2EZ8A 2WIJA 3GH3A 2E4XA 3JPYA 4II3A 1G6KA 3CSDA 3ZHOA 4S1PA 5I9BA 3HFSA 2H7CA 3OOHA 3OUZA 1M2FA 3M1AA 2Q3DA 3OESA 1GUYA 1JMYA 2H6EA 4DLLA 5EUBA 4D3XA 4PC2A 8ATCA 5K01A 3EFEA 1J2YA 1B00A 1ZWLA 1PEAA 1VYTA 3TIIA 1Q0SA 4L75A 4QTYA 4V1CA 1JH9A 2F8SA 1YHNA 2I4IA 2RH9B 3G0OA 1SXJD 4BLRA 1JG3A 1JV2B 2ZT6A 4KR2A 3DHVA 3A58B 4KQIA 4DMUB 5IP5A 2KPOA 3WR5A 2D7CA 4DLSA 3T4XA 5F33A 1QGED 1JBKA 4LCBA 4KSBA 4TKMA 3EA0A 3EGXA 3HVUA 3JAWB 4TTQA 1F1BA 4KDCA 4QECA 2C4TA 3CX6A 4GEKA 4DKJA 3WJAA 2GPTA 2KLBA 5DBHX 4ZQBA 1L4YA 3EG5A 3MOGA 4EVQA 1EGVB 1TX4B 3M4JA 1P4GA 4B4VA 2H48A 3H5RA 4F06A 2CXTA 2CC2A 3RDPA 4IYRA 1EMDA 4CLOB 4QYWA 3S40A 1N5RA 3EPHA 3Q5EA 4I4LA 3RSSA 3V6MA 2MSDB 2Y67A 3ML1A 3MTAA 4KREA 1G59A 3SIWA 1J23A 1ECFA 3ZDRA 3RKSA 2FLVA 1GIAA 1VDMA 3CRVA 1FQKA 2R6GA 2C7VA 3MS7A 2G8LA 3S28A 3OE4A 2HBZA 3PFFA 3DCJA 3Q15C 2BYTA 4URYR 3RM3A 4W6ZA 4ZDKA 4MJXA 1G8SA 3ZHXA 1F7VA 3GAMA 1W5TA 3VR4A 4LRWA 5IAOA 2PL5A 2AXPA 4NBVA 4P3NA 3LUCA 4BLTA 4YO8A 4K0RA 2OV8A 4KXWA 4LHXA 1OPRA 1B1CA 1N92A 1W29A 2FWJA 2Q8QA 1SVNA 3UIEA 5FPPA 3GOQA 3UPDA 3BWYA 4QARA 4S1TA 3LUFA 1L7XA 2BKUA 1S6YA 2FVYA 2CJFA 3JAKB 1R8SA 4RV5A 4RDHA 2Z5FA 2OKCA 3SKYA 3D1JA 3NC1C 4L0CA 3TMYA 4W5HA 4P31A 4N82A 4B3IA 4TUYA 4CQNA 1C3OA 1A95A 1VKNA 3QX8A 4X45A 3V9AA 3D6AA 4NJMB 1C3EA 1FXSA 3NJ4A 1Y5RA 1QU2A 4Y3UA 4Z9YA 3M5WA 2IZ5A 3DB1A 1LLQA 3R23A 1IN5A 4BMDA 4EO9A 1XHLA 5J47A 2QRPA 2OKGA 3HKBA 3B2QA 3GUVA 3HEMA 3GLFE 1G291 4P0QB 4KNVA 5JC1A 2DETA 4AP9A 4CKXA 8MHTA 3TRFA 1Z4PX 3O92A 2LGJA 5K3CA 1T6ZA 2PX8A 3L7OA 1CS4C 4DM3A 1I1NA 3CN7A 1YR3A 2KW5A 2Q2OA 3QBTA 4PRKA 3NP9A 4IL5A 4RZQA 2HYIC 1AQYA 2R1UA 2AFIE 4GXQA 3D7NA 3CUUA 4KE7A 4AQDA 1PFYA 4UHFA 4YIHA 3GDHA 3V3TA 1I2AA 1OE0A 1PZGA 1SKAA 4AZSA 2FRDA 1TEVA 3I72A 2I9KA 1KMCA 2E89A 3GZTB 4X7RA 3ZJUA 4JA0A 3KB2A 3OX1A 4RHFA 2HOQA 4MQ5A 1UOPA 4WJKB 1TAQA 2QN1A 2PUJA 3JSAA 4CTNA 4EZBA 4KHPB 5EZYF 3ZKAA 1QP4A 3W34A 4JCOA 3KP1A 2Y99A 1UJ2A 4QLAA 4Y2XA 3VV2A 3MCZA 2EZ4A 3LC0A 3IXMA 4V3CA 5ARDA 1LBEA 3AJEA 2JEZA 3EVNA 1UBEA 4NZOA 4PE5B 2CZCA 1PWZA 1P31A 4W9NA 5HF8A 2WWVD 1TPZA 4E6PA 2GWRA 1SVLA 1U1IA 7GPBA 4JR2A 2XYVA 1P2BA 1QS0A 1A4XA 1YK1A 1V9SA 2JIBA 1VB5A 4HN2A 2WW8A 4JROA 4RLQA 2QRJA 4IXNA 4BO7A 4OX9B 3TRJA 2O0KA 5BYJA 1YQUA 2H63A 3D0OA 3HJCA 3SNHA 2DLCX 3DJFA 5LUBA 2BP7A 2NXWA 3DBHB 3CUWA 3OU2A 2FG7C 3AEXA 3Q7RA 2EL9A 1JP7A 5LMUB 4GMFA 2HWUA 3WKBA 4N3AA 4ZVMA 1Y8QA 2CNLA 1ZVKA 4G84A 3A37A 1FFXB 4MHSA 1M8FA 3N53A 5L3SA 2WMOB 5DSTA 4NI5A 2ZJ8A 5D8DA 1QUEA 4BLUA 2ZSKA 2ZCVA 3ABSB 2FK8A 1SQ5A 4FFOA 5CA1A 4UAJA 5KYUB 1WE2A 2WU1A 4RXMA 1UMDA 1BJTA 1NBAA 3FUWA 1PZHA 3E22B 4NCXA 4RQTA 3B48A 1P8AA 2WTEA 3PCRB 4W99A 2VPTA 2H59A 3IAUA 1P33A 4XB1A 2C84A 2VDWA 1JQAA 2O2GA 5JDIA 2WJAA 1SUBA 3DVQX 3HBFA 2YBDA 3T6KA 2BTEA 3Q0IA 3PT5A 3BM5A 3MB8A 5JYBA 2V3CC 2XUPA 1FOEB 2DFKB 1D2MA 1GTMA 4LXGA 1J2JA 3BH7A 5G1OA 1ISIA 2EJWA 1X7YB 4MEAA 3RVJA 5I7WA 1RC8A 1C4XA 4TYWA 1EBUA 3DOJA 4X8HA 2VYNA 1UFQA 2XSZD 4WLNA 2O8VA 2IV7A 4DCTA 4RTSA 1ONBA 1VLQA 1Q16A 2JANA 5H16A 4UTNA 5IYZB 1TM5E 5CAEB 3T0FA 3FPSA 2Q3HA 3H2JA 4TQUS 3HXLA 3NMUF 2ACVA 2OCYC 3FKQA 3K70C 4JP5A 4Q3LA 2E1PA 4ZQIA 3IBYA 2V98A 3NHZA 2R751 4UASA 2PU7A 3KOYA 5H02A 1CRLA 3KVOA 3PDHA 3PL5A 2QX7A 4W1QA 1AQJA 1YOVA 2P1DA 4B76A 4R1LA 5ALTA 1UMKA 4WOBA 1JAYA 221PA 5LQKA 2PX0A 2ZRBA 3BL5A 3CISA 3RYHB 3VDNB 5LVAA 1EXNA 3QHAA 5DTIA 1W2WB 1PRYA 1R0RE 4DCOA 4B6FA 3GRYA 3UM9A 1NULA 5FOXA 4MEJA 3VGPA 5TC4A 4UEQA 1L5RA 1EHYA 3MWDA 4OXQA 3DYBA 4P35A 5LCXA 2GF2A 3L4BA 3SOPA 9LDTA 4LMPA 4S1VA 3FYCA 1OJLA 3D4IA 5F4ZA 2X4GA 5AW1A 3CU5A 2ZXEA 2HXYA 1SKMA 4YRKA 1IN1A 3WA6A 2C8LA 1XZAA 2BKEA 3EIEA 3H05A 5J23A 2RDMA 3HCAA 2WWTA 3I45A 4OGLA 4NZMA 3GLGB 2D1RA 2IU3A 2HLNA 2QVCA 4XASA 4AF8A 3L8ZA 1NF2A 4YAOA 1E1RD 4ZIRB 3SWWA 2F3PA 3PXAA 4PPYA 3DDUA 1PTJC 2VSQA 1IQPA 2C97A 4ED9A 5KMGB 2ERXA 4INOA 2FR8A 4DDUA 2R5FA 1BYIA 3PX7A 1OREA 2G8NA 3E8SA 2GXSA 5DFAA 2WSLA 2OR3A 4EHBA 2ZXUA 2II6A 2C5GA 1KETA 3K20A 5DYYA 1RT9A 2N42A 2HQOA 4LJKA 4BJ6A 5FI0B 2FPIB 3GEEA 1JPVA 3VSAA 5C1PA 4HH4A 1IBMB 1MRZA 3QXGA 1UDXA 4P8RA 4PY2A 2WLSA 3QLEA 2PUGA 1XEWX 3BHNA 4FT4A 2C7PA 3P0IA 2UYYA 3WWOA 2K7ZA 5AIAA 4UTOA 1A2BA 1HV8A 2HEGA 4IWYA 3E4CA 3JPWA 4GKAA 4LJYA 3EHEA 3IEXA 4W82A 1OXMA 5TMEA 5L95A 3FETA 2V97A 4FDLA 4ZEOA 4M2LA 3ADPA 3DZFA 1HI9A 2WFLA 1GFIA 2VQSA 1XFDA 4EMBA 3M6XA 4X1YA 2XCQA 1Z6QA 1YBMA 4BNFA 3PA6A 1PUXA 2HI0A 2JLQA 4BNKA 2CW5A 2NNWB 3D3NA 1H3EA 2XZOA 4G0UA 3O9VA 1ZXXA 4P3XA 4INAA 5I3CA 1G0NA 2NV6A 1Z88A 4RH3A 4EW3A 2P77A 3QELB 4AXXA 4DR2B 2QIPA 5H59A 4LFCB 3HM9A 1PCXA 1RLMA 4REOA 3F8WA 3PNLA 5JJKA 1SXHA 4AY2A 4B31A 1CFZA 3NC0C 5EUQB 3LL4A 5J1SB 1GNTA 4YEDA 2KE5A 4P5DA 1XMIA 4LFBB 3ZWXA 3HA7A 1QH1A 1W76A 5KEIA 2HSEA 1H5NA 3D8BA 2A0UA 3GROA 1CIVA 4B17A 5CLQA 4Y2TA 3FYTA 1JI0A 3AVQA 1A2QA 1EZ1A 1II0A 3GNSA 3L04A 4X1OA 2RGNA 2Y9MB 1Y3DE 1JG2A 4TVOA 2COEA 1GUBA 4JH0A 2WSIA 1Q91A 3TLGB 3M3HA 1UC8A 4V1CI 3CZMA 1WY5A 4IEIA 4UW9A 4O6VA 4WVFA 5EA2A 1E6EA 1RPNA 3K1AB 2DCUA 5A6SA 2IH5A 2X4IA 3RS9A 5EWJA 4K3UA 3RREA 3RVKA 3AFNA 1R74A 2GHTA 3EZGA 1OX6A 1U6IA 4G67A 3M4YA 4S2UA 4RQBA 4BGDA 3VO2A 2PFSA 2FJUA 5FEUA 3F1KA 1OA0A 2PAAA 1VTKA 4ZRNA 3EMVA 4IJ5A 5JS1A 1U7HA 3MD9A 4C88A 5HJEA 4IW3B 5HM8A 3ZG6A 4LE1A 4OQYA 2V54A 2PSJA 5ERXA 2XE6A 1OGIA 1XL0A 1NVUQ 3WISA 1KFEB 3H5WA 3REQA 1SEVA 5F23A 2C61A 3PD1A 3KPVA 3N74A 4DA8A 3UW3A 3A06A 4BKQA 1S8NA 4ZO7A 1N2IA 4HQFA 4RHTA 2I4LA 5TS3A 1P0QA 1E9VA 3ZZ1A 3GLIE 4R5MA 4NCHA 1UIMA 2GB4A 1P77A 1E66A 2J9FA 3U3XA 4QASA 1CZKA 1RWOA 1V8OA 4JJEA 1I13A 5L4LA 3C5CA 1CEXA 4FX5A 1L5HB 5IKOA 2C2YA 3ZWCA 1DKPA 4I14A 4CV1A 2PAFA 3CW2A 2R96A 2YINC 5A9SB 1QMGA 4ZA2A 1H8HA 1XKTA 2VQFB 2CLEB 4OKNA 2B1JA 1CUFA 1DP4A 1GFWA 4HPWA 4PC1A 5BOVA 1UM9B 4L1KA 3E9DA 2G4CA 2PMWB 4R16A 5JMWA 4KN5A 2OXTA 2Z4SA 3BZUA 4MUMA 4BN0A 5FR2A 2Q6KA 1OVMA 4YPVA 3SC3A 1UWLA 5LB2A 3PUVA 2R6DA 5LFAA 1JNXX 1ACLA 2VR1A 5DXAA 1RZVA 2QSZA 4QOGA 1RAGA 1SVWA 4FINA 3NM6B 4DIKA 1WXFA 3I2YX 2CJYA 2QA5A 5TQ0B 5WRFA 1KP9A 4WOKA 3N6VA 1HKHA 1CWUA 3OUTA 3KD2A 1DKMA 2VHXA 4CW7A 4DOMA 2OQRA 1QHHA 2HR1A 1JI3A 3J7TA 2BMAA 5HK8A 2C42A 3RRFA 3S29A 4D3SA 4OFXA 2OMKA 4RZIA 1FVXA 3H83A 4HEA1 4N8EA 1NXSA 3ZU6A 1I14A 2RHMA 3MRTA 4U7JA 2XHEA 5LQUA 3GQBA 1T5IA 1H8EA 3F97A 1NL3A 4S24A 1CY8A 4V0SA 5CM9C 1EBBA 3EISA 5IJ0B 1F9AA 2R8ZA 1W8IA 7AT1A 3GIWA 2FZCA 3HP4A 2IEAA 4R6XA 2OUIA 4WECA 1USIA 3ZQJA 2Z6AA 1GUZA 2PA0A 1MG5A 2Y0BA 3ZTYA 5CPBA 1V7PC 1ZN7A 3ZWWA 1DWPA 4LISA 4MGZR 1YS7A 3VPFA 3U6BA 4E88A 3VR2D 5F51A 4BQFA 5L40A 4UREA 1CJUC 4OXKA 3IUEA 4QREA 4YV1A 4HGYA 4L4ZA 1E64A 1BKDR 1JF8A 4FEYA 2PD3A 4KO4S 1SHLA 5L3QA 3K9BA 3VPBA 4GAEA 4HAWA 4YNBA 3CLKA 2I6TA 2C88A 3HP7A 3KHTA 5T57A 1RHUA 1XTJA 4YRJA 3R6GA 3RJZA 2QY9A 2X0DA 4J1SA 2HTFA 3ABQB 3F8SA 5EPEA 1EJ0A 4JUCA 4DY4A 3ANTA 4IG9A 1PJZA 4RFSB 1UFVA 1SZCA 3TVYA 4AQ7A 1ZFNA 2QRUA 2C9DA 1IDN1 3UC9A 3AIKA 4QGFA 4A03A 3R9XA 2IVZA 3COVA 3VR6A 1TKAA 1DJLA 3FWYA 3GLQA 4N5HX 1JA1A 3GLKA 1G1MA 5CTJA 3GVXA 3QEJA 1SHTX 3ZHCA 1RYHA 3LE8A 1YRLA 1P1RA 4MR9B 2CVOA 2DQSA 3MN1A 5KC9A 3EG9B 1OKKA 1L8XA 2EGUA 3EA4A 3CCFA 1AHPA 3VYRB 1MHPA 3PWSA 4JL6A 2OV2A 2JIOA 1P74A 4YIKA 1SUEA 1IL0A 2AI2A 2V45A 1L7EA 4EG8A 1GUAA 1MU0A 1EB9A 1U9YA 2WAMA 3BD6A 1XCLA 1XZHA 3T3GA 3UH0A 3W6NA 1JQDA 1C1XA 1XDUA 1HZJA 2F3QA 3WLIA 3I76A 1DQSA 3WLOA 4WIAA 4EHLA 4A36A 3LY7A 3RU3A 1C30B 4GH5A 4NDAA 4EY6A 5JAHA 4W5NA 1GDTA 1E4VA 4QU5A 4KLAA 3NO4A 3GJ5A 1XVIA 1LS6A 4MB0A 1CZNA 3D9QX 5ES3A 4BL5A 1EFRD 3N8KA 4EJSC 3GQVA 3IUNA 3K0BA 2EBFX 5F9HA 1EQ2A 2B30A 2YBEA 4P34A 4XQ0A 4DPLA 2V65A 4E1AA 4F4FA 3MINB 4HDQB 3GF4A 3HUTA 4E3ZA 3A3PA 4HUTA 2BMDA 3EEOA 4CR7A 1TEHA 2DBZA 3PU6A 1RLOA 4ZPXA 4UATA 1BA3A 3FSEA 5DYTA 2EEZA 4G8CA 2WDZA 3ETHA 2ZSEA 3MGBA 4KDRA 3RO7A 4E4YA 1J8QA 2R4UA 2YUTA 3ILXA 2FEXA 3I6QA 3E1KA 4MVJF 5HF9A 4DG5A 2NO5A 3RBVA 2PUTA 1ZKDA 1CT9A 5JAPA 1V11B 3W7VA 5F2EA 5JRJA 1O89A 1J25A 3F78A 5EMNA 3SQOA 3COWA 4R40A 3I01M 4D8VA 5JY6A 5ED4A 2FPSA 2GZ3A 3SDSA 3NP7A 2ZYIA 4ENRA 3QE9Y 4WLFA 1QHSA 2IE8A 1C14A 1IB6A 4MVWA 1US8B 2GN6A 2ZE6A 4DADA 4EHHA 1AO0A 2AFVA 4R2HA 2HZBA 1FYVA 2AA3A 2R1VB 1ULTA 2QMYA 3EH2A 4RHEA 2GAAA 2JBHA 1FU8A 2BF7A 3BB4A 3ROGA 3HZOA 5ADVA 1JEYA 4G0VA 1YWGO 3GGJA 3LKDA 4MUAA 3E9QA 1EVJA 4YACA 4B0OA 2E4ZA 4BEVA 1XVLA 4B6OA 2IRWA 2VF2A 4BKUA 1T25A 3D3WB 4U8GA 2R8PA 2LKCA 2HJSA 2JZOA 1Q11A 3GNLA 4GMGA 4QTTB 1V45E 4F12A 5KQGA 4DUYB 1E9AA 1JLLB 4AJNA 1N5OX 5FWAA 4L0MA 2QJWA 2ON6A 3S5UA 4EG4A 3VU0A 5LLDA 1TD9A 1K4KA 1F5NA 1FNBA 1KH1A 1V95A 2PGAA 1V7QA 5CYOA 1HDIA 5E2AA 4DFDA 1S2NA 3NDRA 1KVTA 4LWPA 1WCYA 3T7IA 2HNKA 2FW8A 1KY5A 1N57A 4C78A 1K86A 3L0IB 3UT0A 5EYPB 4O1MA 3MJFA 4GL2A 2FXVA 1GEGA 4DPMA 3JTMA 1XZLA 2AKAB 2VHEA 4G5QA 4LV5B 1V3TA 8ADHA 1DX4A 3OIUA 4G1VA 4UM5A 5JRZA 1IEVA 1A2OA 2GTIA 3QX9A 3N2EA 4UVIA 3MUEA 1V4BA 4AX8A 1NPDA 4HDMB 2Q1WA 4BYGA 1KXJA 1CQIB 1C8LA 1VI2A 2TMKA 4BB6A 4E33A 4ESOA 4X9XA 5FWDA 3HJTA 4CMGA 4FJ2A 1WMDA 3G9QA 2OHGA 1AHHA 2JJ8A 3OZGA 4OSPA 4UARA 3NT2A 4LV6A 3I61A 3QWIA 4MYTA 3W8DA 2PK3A 4FZ3A 4BWYA 2W58A 1JKJA 1G3RA 2SBTA 3IAM1 2EFGA 4FGSA 2QY6A 3ZU4A 2XCTB 3LRTA 4NU5A 3A27A 3HXTA 1JSRA 4M7OA 1M74A 4XTCS 3PEVA 1P1KA 2I6QA 4UEOA 1W5BA 1BX1A 3R75A 2AE1A 3KUDA 1L1RA 3LVBA 5JWHA 1J06A 1HRKA 3LC7O 6REQB 4B6JA 1Q0PA 3ELUA 4Z5XA 2P9JA 3JQ7A 2R60A 2I03A 2QI9F 2ECQA 1N6KA 5DTQA 4DEYA 2G9QA 3TZ6A 2CNBA 2XV1A 4LK3A 3LQYA 5G0SA 2Z5GA 3AUUA 2C5FA 3EQ8A 4GYKA 4JLPA 3K70B 1A0OA 1NC3A 2GHQA 3PGMA 2JKZA 3LXXA 4GZLA 3WYCA 3ZE2B 2JAWA 3G0HA 1BQEA 2Q3FA 1P7CA 1P3Y1 1XD2A 4UZSA 1ZK0A 1ENOA 2J9YB 1B1AA 4OHKA 4PO9A 4D82A 4EMSA 1GNQA 3TR6A 3QPBA 4BLVA 1ZESA 2SKEA 5G0UA 4B3SB 3HG7A 4MW6A 4FJ1A 5KYGA 1L3CA 4LDPA 1G5HA 2B8WA 1BRTA 1MX3A 2A86A 2WHQA 1J00A 1H0HA 1NYQA 1RVDA 4HX2A 4RCVA 5H3HA 4CTMA 4XYBA 1D7OA 4CL0A 3S81A 4JBYA 2YXLA 5CVVA 3I9MA 5GJCA 1YQDA 3KKPA 2IEGA 4QXAA 3HI4A 5DB4A 3CWCA 4R68A 4H4EA 1MJ5A 6CHYA 2BE9A 3GCGA 3I04A 3RTGA 1A9XA 1S4QA 3IAXA 3PLRA 3P9SA 2BUBA 2A1UB 2VJPA 2Q3JA 4OHXA 5EP3A 4PFKA 5AM0A 3D8TA 2WIKA 2HXGA 3D8SA 3ZTWA 2P1ZA 3GCDA 3R3ZA 3WLRA 4YPOA 5JZMA 4B46A 3G1UA 4IHKA 2ONYA 4L9AA 5IANA 4NJOA 4PLHA 1G6Q1 2RBEA 2ZXFA 3D81A 4A2QA 1OIWA 2B82A 4EY3A 5AJTA 5EVJA 4MW7A 4XR9A 4ILEA 4PNZA 2GN9A 5L4NA 1NVTA 1YDMA 2FPWA 2W6CX 4L95C 4F5EA 1IZ0A 5CX1A 3CLSC 5EJFA 2QGNA 1Z4OA 3A4LA 2QVXX 3LUPA 3DE3X 3QPWA 7MDHA 4CQMD 3RU2A 5KOJA 4BBZA 1Z2OX 1I9GA 1C7JA 1QIGA 3S1AB 4CEIA 4GRIA 4KU4A 5B57C 2OCKA 1G41A 1BJRE 2H18A 3F1LA 3HH8A 3BQ9A 3TFOA 4H08A 2JATA 3SF8A 4JOCA 1ZRNA 3B78A 4I5GA 4TQ9A 3UJ8A 2UZIR 1EFCA 4QXPA 1GPLA 5BSHA 4IDNA 5AVSA 1RXWA 1P1IA 4LJ5A 2BFCB 1U0SY 4Y98A 2H2IA 2Q2VA 4XJXA 4OI4A 3OIVA 4F9FA 1WTCA 4G5FA 3R8FA 4YK7A 2C7BA 4KW7A 4FC6A 4PZCA 5FNZA 1Z62A 3EIWA 1B7GO 5IBPA 4QDXA 4XVQA 1FB5A 1XDWA 2SKCA 1G8GA 1PVVA 1USUA 5D3MA 3VX3A 4FUQA 1E5XA 1G60A 2E6KA 3EW9A 2HXSA 3AKYA 2BISA 1LV7A 1ZGAA 2P41A 2EG9A 1J39A 2JIPA 1VE3A 5M2QA 1ZZEA 4PGFA 4IM7A 5TSDA 4QICA 3BSFA 3WO1A 2GTPA 2XYPA 4V03A 3WGZA 5JYDA 1JYSA 3DH0A 3K6JA 4NFSA 2I33A 3FNFA 1GG5A 2GZ1A 2HJRA 3PEWA 1YQEA 3UJPA 1L5GB 4IR7A 5I7UA 4XDHA 4KR0A 1KWKA 1I3OA 5CH5A 6LDHA 1G98A 1NN5A 1FTYA 1TFUA 1XZPA 3BJRA 3WHIA 4OHFA 5B6IA 2NZJA 3F3KA 3UAWA 4ALNA 2PWYA 2VJKA 1YDGA 4BFZA 1RRCA 4JXJA 2PH3A 3V48A 4ZV9A 3PXEA 1C7RA 3V4LA 3CZCA 4N41A 4LKRA 1BSVA 5E6RA 3GEDA 1WW2A 1DTSA 2CKMA 3M89A 1X7HA 1U2PA 3QNWA 3WGOA 3K6RA 1XPJA 4D6YA 2CLSA 4IIUA 4RIHA 1ZI6A 3NEAA 2XCSB 1GNLA 1OC4A 2FRDC 2YYSA 1KAHA 3D1LA 1VBMA 4H31A 4FFSA 1Y8AA 1IPEA 3VH1A 4B3CA 3ACDA 5JO0A 3ZK8A 2CN1A 2GEDA 2ZUCA 3L6DA 1KQOA 1S0UA 5FTKA 5EAIA 4A5SA 5KJFA 1TF5A 3SU8A 1JXOA 3A6EA 4U2FA 4ZXPA 2X14A 5DCUA 1E2BA 2PGIA 2OFPA 1NSTA 1JZSA 1P7YA 2QDKA 1UDWA 2A5GA 1I4WA 3S2IA 1WU7A 2OGUA 3FF4A 1VSTA 1TKRA 4W9NC 2VHUA 3HV2A 3H3XA 5FLXA 2CFSA 3HCEA 4BB5A 4F72A 2ASEA 3LIIA 3OLQA 4DZTA 2IYPA 4FWIB 2GD2A 1ZH8A 2R6AA 4WZ6A 1X7WA 3ICPA 2OFOA 4OXNA 1DUSA 1SK8A 3A4TA 1WBBA 1P5HA 4NMHA 2WZCA 3SYKA 4BB0A 2C3OA 3DG9A 2QE7D 2O1SA 5JSKA 3JYLA 1GPUA 1YE8A 4IDQA 1SIOA 2FKAA 3CMCO 2ROQA 4M9XA 4ZWNA 1TQ4A 1Z4IA 2PE5A 3PUIA 5H1YA 1HTWA 3UO8B 2VF8A 2EW8A 3UPTA 1NM5A 4M0FA 3Q3EA 1W73A 4PLTA 3UN1A 3Q3CA 2GKSA 2CLFB 2WFZA 4JT9A 4ZQHA 3T3HA 1A96A 3RC3A 4ER7A 1MUUA 2EWMA 2RJ3A 3I6MA 3ZQKA 1G4UR 1T2UA 4WN9B 3EARA 4PGMA 3N75A 1O03A 2G5GX 2WINI 4Z1MA 3S4YA 4J0HA 3ROZA 1NBMD 3HYSA 1VHDA 4DILA 5JAOA 3K8ZA 2V5UA 4JB2A 2GK6A 4G9EA 3LQFA 3V4OA 4AICA 5JDIC 4WAUA 3CZQA 3DLHA 3G2MA 3UHAA 3TEJA 5C7YA 5CG1A 3AF5A 5ICFA 5A4FS 2X9GA 3MLEA 3EZFA 4Z4QA 2VIIA 4H3VA 4C4AA 3CCBA 4I4NA 1LBHA 3WMXA 4F5DA 4O59O 3ENWA 4FNOA 4QUAA 1KDOA 2NYAA 3ECSA 1VI6A 3WGLA 2OG2A 3ZKWA 4RPCA 1PT9A 2J0VA 2ZJ2A 2JVIA 4NNOA 4Q7EA 3LFUA 1I7NA 1BEEA 4W9RA 4PPGA 2X76A 5A7FA 2ZRGA 1MB9A 4JFRA 2GPNA 2G3YA 4JMLA 3W05A 3WLQA 2J41A 4CLRA 1W0KD 5REQB 4JDUA 4LZOA 1E0KA 3KJFA 4AJJA 3HXMA 3AHFA 1AIPA 1KDVA 1V4NA 5DSXA 4V39A 5CNKA 4PVDA 4QC2A 4O2BB 3NIBA 5A04A 5BNZA 3N9IA 5HBRA 2AKEA 1SC1A 4D6XA 3IQDB 3UKDA 3CLRC 1R8YA 5FLKA 4BE4A 4ARVA 5A62A 3L4BC 5GGXA 1M6EX 1SCNE 4QJ5A 1KZGB 1LPNA 3CLTC 1PGJA 3SEFA 1A9TA 4E5SA 1E6KA 4M21A 3E9EA 3FLBA 4TLBA 1M7BA 4NNJA 3ROPA 3X1MA 4E5UA 4Z54A 5HK9A 4PQGA 2WKSA 1KYTA 4MQ6A 1P0IA 1ZH0A 2YY5A 1BMTA 3MG9A 3MWGA 4MINA 3QXXA 1I7DA 1E6CA 3ANNA 3DA8A 4HMOA 3D6TB 3JQDA 3P5SA 4BMVA 1JPJA 4P9NA 1J42A 3ZBUA 1FNNA 3L1UA 4FBGA 5A2GA 1DQZA 2NUPB 2B3TA 4B40A 5BXYA 1UBHS 2FR8C 1K3TA 3QVGA 3QH4A 4I4IA 2A88A 3NVDA 5BRAA 4JJFA 3STYA 3K71B 1N2HA 5K3SA 2BBTA 1Z22A 4LC0A 1ENZA 4LF4B 1F48A 1HSZA 1PN3A 3VHXA 2P9QA 1NE7A 2GVNA 3GLHB 1QCCA 2D1FA 3NC4A 1O95A 3QU2A 3UPUA 1J99A 1JPNA 1QH8A 3LUDA 4A92A 3L79A 4ZAGA 2AZ4A 2O3JA 3UYLA 2P6NA 4UEJA 4G81A 2GF0A 4QEKA 4C2BA 5B30A 5J3JA 1E2KA 4FDAA 5E7MA 1PK8A 3E7XA 4PNPA 2ZB3A 2AUNA 3UMVA 3SJAA 3DONA 2BMWA 3ONNA 4CV0A 1U7ZA 3FZEA 1XL1A 2JF0A 2ZREA 3IRVA 1R66A 1IG3A 1T0UA 2BH9A 4EJSB 4TKUA 3DQPA 4L27A 2RHTA 3PFBA 1POXA 3B9QA 3BKXA 1PJ2A 2Z56A 4BTVA 4INPA 3AP3A 2Q5CA 1IVSA 3JD3A 2EP8A 3GLFA 1V6SA 4HDRB 5B2EA 2AUTA 4P3PA 3CSSA 3JRWA 4MCJA 2NW6A 2R87A 3GJXC 4KG7A 4UHDA 3RVSA 1ECGA 4C04A 4TXNA 2G5CA 2BFOA 2H2WA 2L42A 3PIRA 4D8XA 1LD3A 4IP0A 2ONCA 3GGGA 4M8SA 1KVRA 1UXKA 4O25A 3D8UA 4FFPA 4FHCA 1FYDA 1O6FA 3OD5A 3QFFA 5FOSA 1EG2A 3DCYA 3RANA 1NQTA 4D0GA 2JCSA 5J58A 1GV0A 1V8FA 3FNIA 4BRUA 3DL7A 4LOJA 4YAKA 4BN4A 4C87A 1D8AA 3U4QA 2A0WA 1Z2PX 1CEYA 3KS9A 2GT1A 2XTNA 5IT0A 3ETLA 3VR5D 1P60A 3S68A 3WJ7A 4XX1A 2PTGA 1YULA 3ND9A 3CVVA 4W9MC 3JZFA 2Z5VA 4BUJA 2DERA 1QX3A 1VLZA 2RGNC 1OXXK 2C94A 3QVUA 5CK5A 3FPCA 3V46A 1OB5A 5IABA 1TK2A 4X7PA 4I1RA 5I7OA 3OLYA 4KK4A 3T4PA 3ZOZA 3TL2A 1FBTA 3LQ1A 1PLKA 3KKNA 3P9NA 3NKLA 4V0OA 5DNVA 3D7RA 4YRZA 4P53A 5CNJA 4PSDA 1RXYA 2GXQA 3IVXA 3W6ZA 4XWKA 5KYWA 4KRFA 2YN2A 2QRKA 3GFGA 3H19A 2IXBA 3LRXA 4J6EA 2I7DA 1LX7A 1DKOA 2Q4OA 4LDNA 2O7SA 1FRNA 3EGDB 4WXYB 3WRYC 1MFZA 1L7NA 3A7EA 1R4AA 3QPDA 2F8TA 5BRJA 4GZ6A 1PLLA 2RK6A 4JQZA 3FCUB 1H1TA 3A1VA 3IULA 4GLBA 4UMFA 5CLIA 3HZZA 2BM1A 1H0RA 1JU3A 1A7AA 1J70A 3L7DA 3OLZA 4GKBA 4UQPA 3TG8A 4CM8A 3KB6A 3EZYA 1MQSA 3CPSA 2O23A 2BM9A 1RP7A 2M1XA 1R5BA 1ZH2A 1IN6A 3N8HA 1R4ZA 2YL2A 4Q4JA 3S8EA 3CVWA 3KJIA 3LWBA 4ZVNA 4AB1A 4MUGA 5E9QA 1ULBA 2BFAA 2WMNB 3DPIA 2OMEA 3GFQA 5CBKA 4HNHA 5JCXA 3K1JA 4NBUA 1G2IA 3TM4A 4CV2A 3BIWA 5A3SA 1ADYA 6NULA 2GK4A 1A76A 5EE9A 5C5EA 3BFVA 3AX6A 4PXAA 5DNEA 3RRBA 4AD8A 1Z2AA 4ARSA 1EFUA 1IBCA 1UWCA 4BXOA 2W93A 1J0EA 3GR6A 1TE2A 1KRXA 1K7CA 4D6PA 1RPJA 2CHUA 4OB7A 4QT0A 3OVMA 1WB4A 4HVLA 4A27A 1R0XA 1FFCA 4WI1A 2PDAA 4H1WA 1ZRSA 4FR2A 2FSHA 1QIMA 4HZUB 5HHTA 1ZINA 4TKLA 1Q2XA 3U4AA 3X44A 5JZOA 3NQ41 4JP1A 1P1BA 3SKXA 3DPSA 3KQPA 1DRUA 5J1TB 4KIGA 5IHPA 1L7MA 1M75A 2Y77A 3BWXA 4OJNA 4RS3A 3G79A 3TLCA 1L1QA 1WD5A 1OXSC 4MV8A 5LXTA 1UPUA 2CWWA 3B1FA 1TDJA 4WK0B 4G09A 3WQRA 1IM2A 1MX1A 3FDZB 4TMVA 4Q7QA 3G88A 1PQWA 1HEUA 1A9PA 4MV3A 1DJPA 3CUKA 2YS7A 2ZI9A 3E0QA 2GF9A 1NQ5A 1XTQA 3ED5A 3PNOA 4RWEA 4AT1A 4OLFA 3HJFA 3TBKA 1TRHA 4F04A 2ZSBA 3UXYA 2ZAYA 3N2NA 2EC5A 2XMPA 1JQ5A 2H8KA 1SVMA 3BN3A 4M4SA 5DWVA 1S2IA 2G7MC 5C1OA 5D3ZA 4GPZA 1JQ3A 1OBCA 5TY0A 4MTCA 3QMPA 5NLLA 2X8WA 1OLXB 1QRDA 4RKEA 3OQHA 4MKHA 3UMYA 1G3MA 3ZLVA 1H2BA 3PQFA 3JVEA 1GFSA 4D4MA 5CGZA 3OH8A 4F3TA 4L5JA 1NX6A 2DC1A 1NI3A 3BD9A 4OKSA 1M6VB 4D9CA 2QP9X 1ECLA 4S2EA 5TPWA 2D7DA 5AW0A 4BQPA 5J4HA 5JQWA 1FNMA 2NPIA 4LMBA 1CDZA 4OJQA 1VPTA 1I2MA 1OXTA 1UDCA 3AY7A 2Y2VA 3KSBC 3I9NA 4J0CA 3BOSA 1XZDA 2HCFA 3HYNA 3IAS6 3OJXA 4H1HA 5AK0A 2PL1A 3PC4A 1QOPB 3R3UA 4B4WA 1JHQA 4P3YA 5FBKA 1HT1E 3ESDA 4AY4A 2ZLBA 3G0IA 4M1OA 4WV3A 1DBSA 2QMUA 4IKPA 1Z12A 4XVHA 1FP2A 2GBIA 2W00A 5HFJA 2VJQA 4C20A 1RQ7A 3OM0A 3QLUA 4MWGA 1E99A 3TVDA 4J07A 4D8UA 4E32A 1W6UA 3T1YB 3F4LA 4O5AA 3EGXB 4HAZA 1GZ5A 4Y1GA 5G40A 1MB4A 2BOVA 1KSJA 2O3SA 3PPYA 5EUMA 1RAEA 4KQMA 1BXGA 3L4JA 3UUGA 4LZAA 1I2CA 5GZ1A 3M6LA 3ZNOA 1JG1A 3B51X 4NKRA 3BULA 2LVBA 4ZREA 3DS8A 4E03A 3TQCA 1PJTA 5IWCA 4PS1A 1DQPA 3EXHC 3L9WA 3MD0A 2W98A 1O97C 2OY0A 4BGEA 2IHZA 4K05A 3GJ4A 4L0DA 5AI9A 3UY4A 1S2GA 4I50A 4BNZA 1IB0A 2Q1TA 2ZJ3A 2FEPA 3S70A 3SMQA 3UCXA 3M6MD 2ZS7A 2OD9A 3CF0A 2BGJA 2GEFA 5TGZA 4WLVA 4OJKA 4A23A 4PGAA 1MO2A 3BEOA 5DP2A 5KNDD 2KJQA 4P83A 2PD6A 4EY8A 2ZBDA 4IIBA 3E2MA 5EWLB 5D6OA 2NUAA 1O57A 3BHMA 1O1YA 5P21A 1A3CA 3N05A 3C3PA 4RD6A 1PJAA 2EZ9A 2IHVA 3B3QA 3V8QA 2DWOA 2IDJA 2BELA 3QPAA 4G07A 3WL4A 2QUHA 1JR3D 1JJAA 1ZS9A 1ODLA 1OMOA 4MJLA