4YUYA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with isoquinolin-1-amine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
293
Chain Sequence
PGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
molecule keywords Spermidine synthase, putative
total genus 98
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuyA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuyA02
2VZ9A 5LQCA 5HIMA 3SX0A 2QRVA 3GRZA 2UYCA 3NTVA 3TM5A 2B78A 3A7EA 3FPGA 4P7FA 2JH8A 2Y1WA 3DXXA 3BT7A 5DXAA 3G7UA 1NW5A 2IH4A 2HTEA 1QAOA 1SVUA 5E2BA 1FP2A 4QQNA 2LD4A 3NVMB 4PIMA 3TOSA 2ZLBA 5CVDA 2YXLA 5EEHA 3FPEA 4HH4A 5KYGA 3JWGA 3KPUA 3OE5A 4HGYA 4E2XA 5LQNA 5DSTA 2ZBPA 3ELUA 3KPWA 3HA7A 4PWYA 1XVAA 2A14A 1DUSA 5FUBA 1WXXA 3LECA 4PGHA 4GEKA 3FUTA 2PSSA 5ICCA 3PT9A 1R00A 3B3FA 2OY0A 3BWMA 5C9ZA 1KIAA 5K0NA 3ID6C 4PONA 3FTDA 2XBMA 2H11A 3LKZA 5GOZA 7MHTA 3E8SA 5D1NA 3DMFA 4QPNA 2AOTB 3CCFA 5HIJA 2P3LA 4FSXA 5EMMA 5K0FA 2P1DA 3NMUF 1HNNA 4ISCA 2PY6A 3SXJA 2QM3A 5ICGA 3BGDA 3LX6A 2P3OA 2Z6UA 3LCUA 1IM8A 1SUIA 2G70A 5P8WA 5ICEA 5D1HA 3CGGA 5DWQA 1N7JA 3GGDA 3NDJA 2WK1A 3G8AA 1YZ3A 3UJCA 5LQRA 3EVFA 5H02A 4R6XA 1KPHA 5FADA 3HM2A 4XUEA 3CBGA 3IEIA 3M6VA 2VDWA 5FTWA 4EVIA 4F86A 2ZTHA 4FT4A 2HMYB 3TR6A 3NWBA 5HILA 1D2HA 1G8AA 2QRVB 4PYNA 3DXZA 4X61A 3THSA 3UJDA 4E2YA 4P58A 1SUSA 3KQSA 3B3GA 3I64A 4IWNA 4QTTB 5ERGB 3MAGA 4EQZA 3C0KA 2ESRA 2P7HA 4C05A 4CWAA 4ATNA 3DXYA 4FZVA 2ZWAA 4E30A 3EGIA 1YZHA 2AOWA 2PXAA 1BC5A 2B9EA 2XYQA 4O29A 3EGVA 3FPJA 3PFHA 2JH9A 3HCCA 4RYLA 3HCFA 1RI4A 3DOUA 4GOND 4U7TB 4P7JA 4C04A 5LQJA 4GOLD 5T67A 4EKIA 3JWHA 5CUQA 2OKCA 1XDUA 3R9XB 2EG5A 3R0QA 2IBTA 2VDUE 2NP7A 4Y30A 4OQDA 3UJ7A 3KQOA 3MTEA 3AXTA 5GINE 2H00A 3HCEA 3DP7A 3PFGA 3IYLW 3OCJA 5B1SA 1I9GA 3P2KA 4L7VA 4R05A 1FP1D 3BZBA 3JWJA 3SMQA 3Q87B 4V0RA 1H1DA 2EFJA 4MIKA 3HCBA 1VP3A 1EJ6A 1YFJA 5DXJA 5BW4A 3NDIA 2I9KA 4C03A 3SSMA 5E2AA 2FK7A 2XYRA 2DULA 2GH1A 3GNLA 3KQPA 3R6TA 5EHGA 4RTNA 4KDCA 3HTXA 3S68A 4E2ZA 3SVZA 1JQDA 4HTFB 2VDVE 2BZGA 3LCVB 4PYOA 3THRA 3G2PA 2HNKA 2P8JA 5E8JA 3U81A 3FYCA 3RODA 4YUXA 4YV1A 2AOXA 4ER3A 3KQVA 1U2ZA 2IDKA 1UFKA 4M38A 4YV2A 4KWCA 1KPGA 1ZGJA 2PJDA 3BGVA 4M36A 5GM1A 5K01A 4MHTA 2P35A 5E1OA 8MHTA 2CMHA 3KQYA 3OU2A 2O07A 4KRGA 2BR4A 5M5BA 2G1PA 3NWEA 1I4WA 1P1BA 2OYRA 3TQSA 5EHIA 1TW3A 2GS9A 3TLJA 4RTQA 4BLVA 1WS6A 4KIGA 3P9IA 1JQ3A 3FUUA 5EIWA 1M6YA 4CKEA 3M6WA 4BY9E 5F2NA 3LBFA 1YUBA 2PX8A 3PS9A 4RWZA 5HFJA 4M7RA 1UWVA 1R8YA 4BP1A 3D2LA 3GRVA 4IV8A 1EIZA 2FK8A 4P7KA 4DF3A 5CCBA 3EVZA 2BH2A 3KPJA 1NBIA 3NJRA 3X0DA 3M4XA 3M6UA 2PKWA 3HCDA 2V74B 3ER8A 3ERCA 1L3IA 5E8RA 5K0JA 3FPHA 2DPMA 1ZQ9A 3G2MA 3A26A 4Z2YA 1QAMA 1XCLA 1ZG3A 9MHTA 3OZTA 1DL5A 2G8NA 2UYQA 4XUCA 1EAMA 5GWXA 2FPOA 1Y8CA 3UBTA 3C6KA 3KR9A 5EIFA 2GLUA 3V97A 4AZSA 5DX0A 2QE6A 3GWZA 4LG1A 3MCTA 4OX9Y 2IGTA 3LGAA 2YVLA 4CTKA 4K6MA 4R6WA 5GM2A 1VP9A 5C1IA 3P97A 5K0EA 3R3HA 4E32A 3KU1A 4HSGA 3I53A 3EVBA 5BP7A 1UIRA 5EC8A 3UA4A 2XVAA 3C3YA 3EPPA 5IKMA 3HVKA 1RJDA 4CXMA 3G8BA 1VPTA 5EGSA 5JUWA 1EJ0A 3E05A 5CD1A 3LL7A 2G72A 1R8XA 5K0GA 3PX3A 1VL5A 4RSRA 1NBHA 4AUKA 2E5WA 2Q41A 5F2KA 1AV6A 5K05A 1JTFA 2ONYA 2FRXA 2CL5A 2ZW9A 3NVKI 1AF7A 2AVNA 2ZIGA 3CC8A 3DUWA 4XUDA 5DM2A 2OBFA 3O7WA 5FCDA 5C0OE 4C07A 3WSTA 1XTPA 3TKAA 1JG2A 1L3BA 1VIDA 2EJUA 1Z3CA 2C7PA 1Q0SA 3CJQA 3KPYA 2PWYA 3KHKA 3C6MA 2ZIEA 2H1RA 1JTEA 1JSXA 2JJQA 2PX4A 5T6BA 1XJ5A 3DULA 2Z6AA 1P39A 3M33A 1X19A 3AJDA 2YX1A 3KR0A 3B89A 3KR2A 5FA8A 3UJ8A 2O06A 1SG9A 4RTOA 1INLA 5IH3A 2CKDA 1O9HA 1D2GA 4GC9A 3HVJA 3KQTA 4YUYA 3SSNA 3C3PA 3MHTA 3B7PA 10MHA 5CVJA 3CJRA 1KP9A 2B3TA 3GRUA 4QTUB 3T7SA 2Z6QA 2ZZMA 3EVAA 2O05A 3PTAA 2FHPA 3E23A 4A6EA 1YF3A 1MJFA 1JQEA 3BKWA 3I5UA 4QPPA 5EKXA 3GCZA 1ORHA 4MQ4A 4KIFA 4GF5A 1P91A 2P7IA 5EMKA 5EMLA 1G55A 1RI1A 5FHRA 2NXEA 1RI5A 3OE4A 2G71A 3LDUA 1N2XA 4FGZA 1WG8A 4LWOA 3FUXA 3LHDA 1D2CA 1IXKA 2GA9A 4PGGA 5DRTA 4EKGA 4RVGA 4HGZA 3ME5A 4X1OA 4ER0A 3MGGA 3P9KA 1KYWA 4RV9A 4FR0A 4RTSA 1WXWA 4BP3A 4X41A 3PB3A 4E2WA 1RJEA 2BM9A 3BWYA 1OR8A 1Q0TA 4RVDA 5FWAA 4EK9A 4QQKA 5DX8A 5GIOE 1P1CA 1B42A 1QYRA 2YUIA 2GPYA 3GXOA 3L8DA 4C06A 2BR3A 5EVJA 3DMGA 2AZTA 1RI2A 3E7PA 3KQWA 4XCXA 3JWIA 4M37A 1IY9A 3HVHA 5CVEA 5E9QA 5FHQA 5G02A 5U4XA 4EMSA 5BXYA 4H0NA 2HWKA 2PWPA 1WY7A 4RTRA 3AXSA 4PCAA 4E70A 3TFWA 1G60A 1X1BA 2PXCA 3AWIA 3FTFA 4YMHA 5KS2A 4FS8A 3A4TA 3I9FA 4QDJA 1MHTA 1WZNA 3QV2A 2IFTA 4FSDA 4IV0A 3GRYA 5ICFA 2P3QA 3KR1A 3PVCA 3K6RA 4V0QA 4RTJA 5E1DA 2IP2A 1NV9A 4YV0A 1EG2A 1ORIA 2FYTA 2YXDA 3DTNA 3Q7EA 4RVFA 4GBED 4YUWA 2V7EA 3BWCA 4MTLA 5EZSA 3IHTA 4ZTBA 3G5TA 1PJZA 1QZZA 3EMDA 5DM1A 2YR0A 2Y1XA 3OZSA 4PYMA 3MTIA 5K0BA 2PBFA 3FZGA 1G8SA 3LKDA 1F38A 1YFLA 1JSZA 1XDZA 2C7QA 2IBSA 3SGLA 5DTRA 1T43A 1BOOA 3G5LA 2OPBA 1L9KA 3ORHA 2B2CA 1AQIA 2PT6A 1XXLA 4FT2A 2CMGA 3VYWA 4RTLA 4MWZA 2JG3A 3P71T 3QOXA 5FULA 5LSAA 1NW7A 1O54A 1NKVA 3K0BA 5K03A 2IDJA 4KW7A 3G89A 4AZTA 4QVKA 1VBFA 1FPQA 4OA5A 1YB2A 3MB5A 4DKJA 4HC4A 3UFBA 2P41A 4GQBA 3EEYA 5HIIA 4Y2HA 4DCGA 2ZCJA 1XCJA 3IV6A 4R8SA 3HP7A 3UZUA 1X1AA 5K8VA 1NT2A 3EGEA 2PX5A 3F4KA 3GU3A 5T64A 1SKMA 2ERCA 4R8RA 5F2OA 5FQNA 2ADMA 1NW6A 4PYIA 5E9WA 3OU7A 5EZQA 3UWPA 4AZVA 4PIPA 5E1MA 5HEKA 3DMHA 2OO3A 4UOEA 2UYOA 3LPMA 5E1BA 2ZIFA 3A7DA 3T0IA 2ZZNA 1RJGA 2PLWA 5BW5A 1M6EX 1FJXA 3UJ9A 2ZZKA 4RTPA 1KPIA 1ZKDA 5CM2Z 4DZRA 4CKBA 3V8VA 1PRYA 2AOVA 1DCTA 3KPVA 5DLYA 4ER5A 1QANA 3OFJA 3A27A 4QDKA 5DM4A 3HEMA 3VC2A 2AN4A 2NXJA 1JG4A 2ONZA 2AR0A 2YXEA 3BGIA 4OBWA 3TPZA 3RIEA 5JR3A 4KDRA 1BHJA 2AS0A 3EEOA 3P2IA 3BWBA 3ANXA 3RW9A 1KYZA 2GAFA 2PV0A 3EVGA 4PYLA 2B25A 4IKPA 5DT2A 3G88A 1R18A 4LWPA 2ZVJA 3MQ2A 2I7CA 2O0LA 3MERA 1AQJA 1JG3A 3H2BA 3KQMA 5GIPE 3ER9A 2PGXA 4FP9A 4YMGA 4DM3A 1RJFA 1G6Q1 1VE3A 4GOMD 4B17A 3BXOA 3UJBA 2KW5A 1L1EA 2AOUA 2VP3A 2HR1A 2XYVA 2F8LA 3DLIA 1O9GA 3TM4A 3GJYA 3O4FA 5HOQA 5EKUA 2AOTA 3BKXA 3LDFA 5EMJA 1NW3A 3G2OA 5MHTA 3G2QA 1SQGA 4OQEA 4DA4A 1X1CA 3BUSA 1R74A 3ELWA 3ELYA 3FTCA 3LDGA 4PCLA 2UZ4A 2VS1A 4DCMA 2R3SA 5CVUA 5CIYA 1M0EA 2PVCA 1JG1A 5DTQA 3OFKA 1KR5A 3PX2A 4RX1A 5EOVA 2I62A 3SM3A 3UJ6A 5LQAA 2C7RA 3HA3A 4E33A 4RTMA 1X1DA 3GRRA 5LR6A 3CJTA 3R24A 3EVDA 5DSXA 4DMGA 4POOA 3TMAA 2PT9A 2PX2A 2BR5A 5EEGA 4C08A 4CTJA 4F84A 1NE2A 4AX8A 2N47A 1G38A 2AN3A 4ER6A 3OZRA 2HV9A 2NNWB 2NYUA 2ZFUA 3UJAA 1NV8A 1BKYA 3SR4A 4CKCA 4X63A 4P7GA 5DPMA 4AZWA 4RTKA 2BM8A 4E31A 3P2EA 2I6GA 4LECA 5CCXA 3ELDA 1SQFA 2EX4A 4YUVA 3CVOA 2ZBRA 3EVEA 3FRHA 3HCAA 4C4AA 1I1NA 4GUAA 1VQ1A 2OZVA 3CKKA 2OXTA 3PLAE 4GC5A 2EJTA 2ZWVA 3DR5A 5GP1A 3DLCA 5K0CA 5KVAA 3VSEA 4QVGA 4PYJA 2QY6A 1QAQA 2AOUB 5CVVA 4PYKA 4U7PB 2ZSUA 1KHHA 2IH5A 4NECA 3FUVA 2JHAA 3GO4A 4OBXA 5DRYA 2UYHA 2R6ZA 5FQOA 2C7OA 3NW9A 3P8ZA 3SSOA 3TKYA 3TRKA 2YQZA 3P9NA 2ZULA 3A25A 4A6DA 3FRIA 4OA8A 2ZBQA 3B5IA 5EG5A 3FTEA 2O57A 1RI3A 1ZGAA 3AY0A 1HMYA 2IPXA 4RVHA 2NP6A 3HNRA 2OB2A 4WVLA 1ZHFA 3KQQA 3LBYA 4HG2A 2CWWA 1JR4A 3VC1A 3B3JA 1V39A 1VLMA 2NXCA 2XVMA 3FPFA 2WA2A 3EMBA 3FUWA 3M6XA 5E9JA 3REOA 4BLWA 4PYQA 5LQUA 5K0LA 4GOOD 2WA1A 5DM0A 4PNEA 5EQJB 5HZMA 2YTZA 3FYDA 3OPNA 3QOWA 4KVZA 3O31A 4G56A 2ORED 1EQAA 4HTFA 2P40A 1KXZA 1NW8A 5DTMA 4DQ0A 4F85A 2JHCA 3EVCA 1TW2A 2AVDA 3GIWA 5KQSA 3OU6A 1N7IA 3MCZA 3T7TA 2QYOA 5HIKA 2OB1A 3HVIA 5K09A 3I58A 2JHPA 3M70A 5EPEA 2K4MA 2PXXA 3KKZA 3UA3A 2GB4A 4BLUA 2IH2A 4HRAA 2AN5A 4JXJA 4WXHA 2NXNA 3DH0A 2FCAA 5FA5A 1FBNA 3HA5A 2IIPA 3LSTA 3GDHA 4PINA 1TPYA 4X60A 4ER7A 5KQRA 3T7RA 1XDSA 3P9CA 5LQKA 1R6AA 3LCCA 5FWDA 1L3CA 1F3LA 5DX1A 4YUZA
chains in the Genus database with same CATH superfamily
4JEMA 3CF2A 3NU1A 5JQGF 5C7YA 2NUAB 4EGQA 1RABA 1LBQA 1RHRA 5BURA 1HL3A 5JISA 2R47A 2HRRA 2R60A 2D1TA 1RP1A 2JBAB 3FWNA 2ILTA 3NI2A 2ZE6A 4E5KA 3EY9A 3N28A 1IIRA 1SY7A 4Q82A 1G8PA 1SXJA 3E5NA 3FTPA 3PUZA 3AR2A 4MNTA 1A76A 3C3WA 3ZLUA 1AF4A 4F71A 1A9PA 2CKMA 2VL7A 2ZJFA 3T38A 5F4BA 1YC5A 2WJPA 4JCOA 1ILEA 5JYEA 3DYVA 3T1TA 1W93A 2RGDA 2YBEA 4PGHA 3IQXA 4D0SA 5JQWA 2YWRA 3L84A 1UUFA 4KE6A 3WGTA 2EKPA 4BNUA 2EZTA 2OCYC 5K0NA 1FDIA 3FTDA 3ICEA 1MAHA 4LKRA 1WXIA 1OWOA 4QUIA 1ZHOA 3I04M 5TJHA 4ISCA 3ZZNA 2ATCA 4I5IA 2I29A 2D0IA 4NE9A 4YAWA 2QRUA 1ISIA 4OLFA 2ZRNA 3NHFA 5JVDB 1OMOA 4XRGA 3AHDA 4DB2A 3W9UA 4LRSB 5THKA 1RXYA 4ZALA 5CB6A 3GDWA 3DEKA 4CNQA 4EFLA 3EQ2A 2PS0A 2R7AA 4D92A 3KXKA 1DIAA 1E2QA 2VDWA 3EXG1 4L9SA 3QV1A 1P6QA 4UBJA 4G4JA 2BUBA 2MR5A 4AQYB 1P5JA 3TZ6A 1CQWA 2Y1LA 4DYVA 4QG3A 3LYHA 3ZLTA 2X1HA 4Y2PA 1NJSA 3SYTA 1WZEA 4OOFA 1GIAA 1X6VA 1GA6A 4FZVA 2ET6A 4EZEA 3OCUA 3EGIA 2HIAA 3M5WA 4AWXA 5K8TA 2R6FA 3T9CA 3K1ZA 3PPYA 4I1SA 1JDJA 5A0VA 5IF3A 5IC6A 1RLTA 1YAHA 4ZYVA 2HO5A 1C4XA 1CNEA 1XZQA 2CBXA 2RAFA 2JI8A 3CHYA 3D7KA 1U2DC 3HACA 1A9XA 2A1IA 2I4NA 5LBIA 2W0MA 1R4NB 1KXJA 3GFGA 1W87A 2DWPA 3MXTA 4FYKA 4EQ6B 5FO0A 3RTGA 3AFHA 4NK5A 1CS0A 4R1PA 5AUOB 1CY4A 2AX3A 3MILA 1J21A 1NPDA 2YIDA 3SMVA 5JLAA 5FRDA 4KXYA 3HPQA 3F3SA 5COQA 2PZ8A 4JC0A 4TSFD 5JFTA 1ZN2A 4QQFA 2PSFA 1K6EA 2B8JA 1BE8A 2PR7A 1T35A 3IQGX 3LNTA 2XUZA 4HS4A 1A7UA 4L2IB 1M2NA 2YH2A 2OGSA 2X15A 3ES9A 4I9NA 3A05A 5K6RA 2HHHB 2X2OA 2OZPA 4Q3LA 4MITA 1OVMA 4OJTA 3AF1A 3RV3A 3THRA 2ZI4A 4R8MA 3OM8A 4IXNA 3LUGA 4WDRA 3L05A 1BWPA 1QF9A 4I1YA 3K8ZA 5T8KC 1OGIA 2GAJA 4DW8A 4OEHA 4TLDA 3D4OA 1C7IA 1MX5A 1QB7A 1VECA 2H5IA 1KIMA 2I34A 3R44A 1UWCA 4HDKA 5H16A 1RPAA 4R2WA 3B3QA 1OJLA 2MYNA 4ADSG 2PZFA 4ZD6A 3RROA 4ZJZA 1FYXA 4BZXA 3RUDA 1P8JA 1UXOA 1YU6A 2C2KA 3RKRA 2XY4A 2F00A 5BSGA 3HU2A 5IVIA 1GZVA 1JYSA 3RVKA 2D1RA 2O0MA 1RT9A 3M6WA 5EHNA 3RI3A 3T94A 2ZJ6A 3ZEAA 5DNUA 1H1TA 2PTHA 4BATA 4ZCMA 1QS0B 5ARBA 2FX5A 2GCNA 4XYMA 3KWLA 1DG3A 3MB8A 2YRWA 1XMJA 4MPDA 4NPAA 4TKMA 1R8YA 2IXFA 3D2LA 5EJIA 5A4IS 2PZAA 2QRQA 4LHYA 2XCRB 4YRAA 3RRFA 4GL4A 5KYYA 2JLUA 2J5QA 1ZNWA 2C2MA 2UUCB 3B7WA 3QEMA 3WWEA 4WN9A 1YZYA 1N9KA 1W5BA 3I6MA 1IXYA 1HYBA 4C88A 2WSSD 4D5GA 2XNDD 1A27A 1BWRA 1GGHA 2XPCA 1SH7A 3OJWA 4EATA 1XZPA 1ENYA 1YVDA 3NM4A 1TYBE 3UC5A 4RVNA 4XRRA 1DC7A 2NZUG 3GLIB 1FFWA 2ZTUA 3VR5H 5ENVA 1UZMA 4OGWA 5KB3A 4B5LA 4YJDA 3ZJUA 4C3ZA 2GAOA 2OR3A 1FRVA 2D5CA 3EXHB 1QHEA 4ZEVA 3D6TB 3UBTA 4AZSA 4DUZB 3NHAA 3G0GA 3MGAA 1IYZA 3TRDA 5ED0A 1H2ZA 3U7EB 1J06A 3LGAA 1HY3A 3G5MA 5JH7A 2FPUA 2R96A 4YJFB 3X1XA 1KOGA 4NS1A 3WQRA 3G2LA 2ZREA 3D8TA 1E7SA 3DEFA 2YINC 3FNQA 2H4JA 5JRDS 3G8BA 1E1RA 5A0FA 3F97A 3M6MD 5AXAA 3X1WA 4OGGA 5JANA 1I13A 1FMJA 3C6BA 4AJHA 4A8TA 1G9TA 2C03A 2O8DB 4G24A 2VC2B 2E5WA 2I78A 5JSFA 3WK7A 1YZQA 4TMXA 5ALRA 1R4MA 4HV4A 1MHPA 2R6GA 4YRKA 1UQUA 3ND5A 4LZJA 5DM2A 4OLBA 2OBFA 2I80A 3PTLA 3B2EA 4GS5A 4X90A 1TM3E 1DRKA 1B2LA 3D31A 3IPLA 2JI7A 3WA6A 5A03A 5LUAA 2LPMA 4D8XA 4CEJB 4HWSA 2HH9A 2CYAA 3O1IC 2GWRA 1FMTA 4KO2S 2LCQA 4DIKA 4EVQA 1RAEA 2V58A 1LK5A 2Z1NA 3L9WA 3NASA 3KEOA 4JT2A 4M22A 3ZK9A 1CEQA 1TLTA 2PL3A 2D0OB 4G0VA 2CJFA 2HRDA 2J5BA 2AV6A 2HBYA 2Y0DA 5AHOA 2Q0QA 5HMLA 4FGKA 3C3CA 1SG9A 4AMGA 1N4DA 1UBFA 3QEBZ 2IUYA 4GC9A 1F0NA 1MIOA 1NUAA 4EAQA 1E8DA 3KB1A 2Z58A 4DEVA 4QM7A 5CIWA 5LU9A 10MHA 5FWXB 2YJ3A 3IDQA 3K0EA 5DU2A 5EE0A 1JEDA 3SXUA 4QC2A 3PTAA 4GBJA 2BP7B 3LQ2A 2R4QA 4EFKA 5AUQA 1UAAA 1CKEA 3VO9A 4FR5A 5CT4A 1CRZA 3N7AA 3LZCA 4HBGA 2NXEA 4GW3A 4LF4B 1T34A 3WYFA 1E1DA 2C2HA 1WG8A 4ER6A 3LHDA 2VLIA 1NMQA 2EL9A 5JAUA 4OP1A 3AUYA 1HTWA 1MORA 4O1IA 2ZOSA 2H7YA 3UYKA 1RQRA 2NPIA 2B8NA 3I39X 5J9FA 4D44A 2COEA 5IMSA 1N6NA 4DN6A 5KKCA 3IPAA 4HZUB 5AHRA 1RYYA 1RJEA 3BWYA 1M6VA 1MEJA 3HR7A 4LF9B 3L0IB 5GIOE 2ZUDA 2F1IA 2Y27A 1Z38A 4KHPB 5EZ5A 1QYRA 1APBA 3VI3B 3NP9A 4I4TB 4ZOLA 1A88A 3A9WA 3GT3A 1HR0B 2I55A 4NULA 3CN9A 1ODKA 5JSKA 3RSHA 1VE9A 2AQKA 4HGNA 3UV3A 4BU1A 1T0HB 4UTVA 5KYXA 1IK4A 2DETA 4MUJA 2QIPA 1WY7A 4A8JC 4AJ2A 4E70A 4K0KB 1YE5A 4LJKA 4FMDF 3MJVA 3SC6A 3FTFA 4LZPA 5ALGA 1OLSA 2GEVA 5BR7A 3D6FA 3HE3A 2PBRA 3UJHA 1GTJ1 4GBMA 3K1JA 2AE1A 2WNIA 5KQGA 4IIHA 3U7FB 2IUTA 1F20A 4TTSA 5G0WA 3I8XA 4XVHA 3OETA 1X1QA 1WBDA 1MJGA 4DLUA 5F23A 4CMEA 2ZWIA 3LPAA 1ZK0A 5HBGA 1JFRA 2H1IA 1DOHA 4ZRMA 3ZHOA 3C7AA 1VSUA 1H8HA 1G8SA 2QQ5A 3CNBA 4V24A 1G3QA 2FVXA 3CXRA 2NO6A 3EXIA 4R9VA 5FTMA 1KP3A 2NU8B 1RTTA 4BCBA 1BX0A 3HDGA 2CNOA 2W7TA 3GPCA 1GGMA 1BO6A 3F3YA 4WTOA 4CDGA 1L4YA 5T3UA 4IIUA 3RWMB 3NATA 1I2MA 2F9LA 1MC1A 4NABA 2REOA 4FDMA 1I2AA 4BUJA 3L7JA 1WDLA 2WU4A 4GKKB 1KK2A 4E12A 3PVSA 1LSSA 1FRFS 3Q3VA 2VNSA 3BFPA 4Y0AA 2QN1A 3C5VA 4MYCA 2OAGA 2DH6A 1IPFA 4R69A 3EIEA 3U3MA 5G1NA 4FFVA 1DZIA 1KEZA 2DXIA 1W94A 3F6PA 2WIAA 3I2YX 4KNVA 1GQOA 5FQNA 3ZI4A 1T3TA 2D1SA 1ZM2A 2FX3A 5C3UA 1M1NA 1V4NA 2XAUA 3V1TC 3FF4A 1MT3A 2WJVA 3QJYA 5EP2A 1Y7IA 3T3GA 5A06A 4EEKA 4FUQA 5K0SA 3T0IA 3OH8A 1CY7A 4YHBA 2PD4A 5J4HA 4WNIA 4RLFA 2AR9A 1LPAB 1A77A 4DZRA 4E07A 1EXDA 1NN5A 2JIRA 3FYUA 4L9AA 3TNFA 5IAJA 4G01B 3HN6A 2YXEA 4WH0A 4CI9A 2QMQA 4UM8B 1U2SA 3LC2O 1HEIA 2IUEA 1LXCA 4F97A 2WIJA 1V2HE 2BUAA 1B1AA 3L0DA 4FMCB 1HX7A 4B79A 1SD2A 2AFHB 2BFDB 1XEXB 1COZA 1OI7A 1SCUB 4EG7A 2FU5C 4P3KA 2F62A 4XWWA 1RRKA 3MQ2A 4YDSA 4LJAA 4MKRA 2Z1DA 1TZ2A 2ASEA 1W85B 3A31A 1PYGA 1ABBA 2CVFA 4ZU6X 3MTAA 2HUPA 1KY2A 3ACDA 5FFMA 5AUPB 1RJWA 1UBKS 1DOAA 4RZIA 1VIMA 2XMRA 4NJOA 4Y7DA 5ALDA 3PPVA 4KR3A 1LEHA 2HR1A 4TQAA 1LFDB 4UJ5A 3JQQA 3I52A 5ADUS 2JGDA 4HDNB 1XI2A 4FR2A 1G20E 3MT7A 4B44A 4DNQA 1KAHA 1EGVB 1YONA 4RK4A 3HUFA 1X1CA 3I30X 3CUYA 5IBRA 1RWBA 4K05A 1C2YA 4DCMA 5CVUA 4HAVA 1PLKA 2I03A 3QX8A 1J7KA 1TLFA 3G9XA 4E88A 4B32A 2VP9A 2FFQA 2Q1SA 2WAAA 4HDNA 2W71A 4IFBA 3VZRA 1C8BA 2EQ5A 1X1DA 4I4CA 2AT1A 3H9QA 1G2OA 3K2QA 3C39A 1LQUA 3VDNB 4RDIA 2GPTA 3LDAA 2C2WA 1UP7A 4IDBA 1BJTA 4LHSA 5LXTF 1OX4B 2E4VA 1OU0A 5HKAA 3P4UA 1K3UB 2E7ZA 3AJRA 1ESEA 2N47A 2QB5A 1QHYA 1R0RE 3DNFA 3NVAA 3HL4A 1AMOA 1J23A 4MICA 4CF6A 1UBOS 2HM7A 1B8UA 1ZC4A 3AHCA 3CZQA 1NVEA 1UFQA 3H2YA 4EHAA 4MJ7A 3GT4A 1T0BA 1T2VA 3D2BA 5CGZA 3Q9LA 4GOKA 4HNQA 2IHVA 2BGIA 4AJEA 3OPQA 2GF2A 4KXMA 1E6CA 4EG5A 1J8FA 2OZVA 4Y6QA 2MSWA 2F55A 1UOEA 2EJTA 3UJNA 2OLKA 3LBNA 3HKEB 1ZDMA 4OFWA 5AKLA 4QVGA 2Z3WA 2PSEA 3I28A 4JLWA 5JS6A 1QK5A 4YCDA 4TYWA 4Q1DA 1GZ7A 2DOKA 2JLVA 4DJEC 1L9XA 3C8UA 3BA6A 3GO4A 3DW1X 3OSUA 3N3AC 5JXWA 2X8LA 4NYJQ 1QNFA 4V03A 1GITA 1JFLA 2CXXA 1XCGB 3F47A 3DZHA 4XCVA 4KOEC 3ZUPA 4C4TA 4F38A 2HSWA 2BN4A 2IOHA 2WIKA 2QMUA 1VMDA 4FJ1A 1C0EA 5GY7A 3VU3A 1RLOA 3ZJTA 2QLBA 3PBKA 3DV0B 1K66A 2WJHA 3PRYA 4UE6A 3X43A 2WTUA 1JA9A 3EN0A 5FXMA 4AP5A 2AUMA 5FPKA 2JKYA 4URWR 5AJWA 3VH3A 3QPCA 1W1WA 1WHTA 4MPPA 1PZMA 2C5HA 4AMUA 3RRYA 4LQ4A 3I05A 2IYQA 5K0LA 4X91A 2VJYA 4ZQBA 2O8BA 1ZXBA 3RU9A 1EXMA 4WX2B 2V9ZA 2C82A 3C41J 5DTMA 3WLLA 4PLTA 4UM5A 4UM9D 2ZK7A 3DDNA 3IQWA 1EYZA 1Z75A 1XTBA 4IVRA 1ZIPA 2VJDA 4BN4A 2I9PA 4N8DA 5CB8A 3UOAB 4CMIB 3KYCB 3IOBA 3H8WA 3Q5EA 4IIJF 2IKQA 3WIUA 9GPBA 2O8BB 3WC4A 3HDTA 2P9GA 2FCAA 4QATA 3GDHA 1I7QB 2IW3A 5AI8A 3KAPA 1KRHA 1U0RA 3LWDA 5CNJA 1UM9B 1Z83A 2H7CA 4XSHA 4DQLA 4E2WA 5BN1A 1PZNA 4IRUB 5FWNA 5LQCA 5IWAB 2ZDHA 1DAPA 2XW6A 3PICA 4W5NA 1U8FO 2BV3A 2UDPA 2V0NA 1VRWA 5FBQB 4BZPA 3CIFA 1CBUA 3I0NA 3TM5A 3GZTB 3ZTTA 3ZHVA 3NIWA 2B30A 2O2YA 2P4HX 3ND6A 4NCKA 1RCFA 1ZINA 1YK0A 2LD4A 1XMQB 1V43A 2HMSA 2ZLBA 3GJQA 4ZCRA 2BCEA 3CEHA 4HH4A 4X8MA 1NMXA 5BYBA 3U7RA 4YJ2A 1N5RA 2LDBA 2HY7A 2CCKA 4FMDB 1IHDA 3I9NA 4DSAA 1Q57A 4RJTA 2R6CA 3VR6D 2HV8A 1ZJ6A 3RVBA 1IBSA 5BRJA 4YWJA 1FMFA 2JFHA 4M9UA 4GX1A 2CNNA 1R37A 3HFGA 3ZBPA 1AZSC 2XWPA 1PBNA 5D1NA 1OWPA 3DMFA 4QPNA 3I4FA 3OJFA 4YLYA 4BVEA 4BJHB 2D4HA 2PY6A 2QM3A 4M1WA 4UM7A 1VE6A 1ZWLA 1Z4MA 4YCAA 1T91A 4I9UA 3ZWMA 4BBJA 4IVNA 2HQSA 5IDXA 1OBFO 4ENQA 2VTBA 1T6XA 2OGUA 3CZ5A 3NORA 1AKVA 1JHXA 3G0HA 4O6VA 4OHPA 4V2IA 4D96A 3NEJA 1HE2A 4JI4B 5CPFA 2HUNA 2EFYA 4G9BA 4R6XA 1BTOA 4QAQA 3H83A 4D3FA 2ZTHA 4H3VA 1TZJA 2FN8A 2X40A 5LZ4A 4EG1A 1D2HA 3LT1A 4DQVA 2DJIA 3KV3O 4P58A 2GN8A 2G67A 3T7EA 3BPSA 3WKDA 3RFFA 4RVUA 5LNK1 1JYFA 1Z33A 4OHFA 1PJ2A 5K0TA 3T99A 3EZFA 3FCXA 4FX2A 3KLNA 4PLCA 4AZ3B 4RF4A 1PR9A 2GEFA 3IT2A 3VTZA 1ZGZA 4CMGA 1VJRA 2PGOA 3L8CA 3H0CA 3FPJA 4WGFA 3AHHA 2YICA 2ZJ7A 4KJZA 4AF7A 3AIOA 3KT3A 3HB0A 3HRIA 2QYSA 4L02A 3RRNA 4DVJA 4M53A 3WJ7A 5A05A 3L0SA 1RAHA 2A94A 3K73O 3B1XA 4KEAA 1Y80A 2PFKA 2O20A 3IAS1 2LCFA 2OKCA 4PANA 4Z7OB 2Q8PA 5KJ1A 4UOQA 4X6LA 4Y30A 4M6WB 2IXEA 4HB4A 1IB0A 3HHPA 3LGSA 1XELA 4DXDA 1LS6A 1ZK1A 5E6UB 5K9ZA 1IOVA 1T2EA 3OQVA 5DP1A 1YIDA 4FFDA 1H1DA 4MIKA 1WNTA 5BO5A 2J6IA 4JI5B 2B1QA 1WTAA 3W7AA 1U2RA 1OB5A 1KNXA 1NRIA 1T3LA 4DJAA 4J9UE 5C35A 4OHRA 3HTXA 1TQ2A 4V1CB 3EGXB 3X1MA 4FGUA 4F4JA 4MYUA 4TZTA 4B7AA 1WDWB 2X4LA 1T36A 3PYLA 2OUKA 4LRTB 1ZH4A 3WGQA 4BJ1A 1SCKA 4RHXA 5CDGA 3SC3A 2ZYWX 1YRWA 2P9TA 3TLYA 3FYCA 1ZOIA 3TKLA 3MOIA 2PMDA 1KKUA 2OEPA 1UBUS 4MVJM 2IA5A 2V7GA 3HJHA 1ULBA 4KO3S 4ABYA 2OVBA 4M36A 5BT8A 4F9FA 1Z17A 1HQCA 3DTYA 3H5LA 3R4VA 4PFSA 5E1OA 5FUMA 1N0UA 3R4CA 1N6PA 5HF9A 1DAEA 1F2DA 4DR2B 3GIDA 2YN0A 4KPFC 3K5PA 1TC1A 1EEXB 1ONSA 1U3GA 2N46A 4BNTA 1XTZA 2DPHA 1KZGB 1WS6A 2O2GA 2WNHA 1D0SA 1L5YA 1Z0FA 3DT8A 3H65A 3NAZA 4H59A 3D8HA 4D97A 2BJVA 4RIIA 1KL7A 3ICOA 2VXOA 4CYMA 3KXIA 4X7RA 5HFJA 5KYWB 3GLFA 1JVBA 3U48A 1WB9A 3HLTA 4P7KA 5KTKA 3OOJA 2C2BA 3AIKA 1A4XA 3MLAA 3QBJA 1L4HA 1SHJA 4KBFA 1TUIA 2RH9B 3QVWA 4L5JA 3I2JA 4B3CA 3KV1A 2EWWA 3ER8A 3WL7A 1G42A 1D04A 3L40A 2ZVPX 3P19A 4HLUC 2O5EA 2Z2YA 2QQEA 2EKQA 3AY6A 4L4ZA 2VK4A 1FP7A 1SUCA 1KYXA 1VYUA 1SD1A 2ANCA 3LUJA 4YMWA 2CVOA 1DTWA 3GCDA 3NGLA 3NHWA 4EG8A 1QV9A 3IX7A 4J1TA 1PF7E 2NQ8A 3O8LA 4Y6OA 5EPUA 4AD8A 4NDZA 1GFIA 3FIUA 1VJTA 2EP7A 2OC4A 4TSKA 3K0AA 3N05A 3OAAA 2ZJ2A 3TR0A 3WMGA 5DX0A 2YN4A 3OEEA 1H5UA 3GWZA 3RYIA 2IGTA 3AUFA 1B41A 1V3QE 1OI2A 5FOXA 5GM2A 1HM5A 4YALA 2C0PA 1TJ4A 3CG0A 2XXAB 4LJ9A 2JZCA 3JX9A 1GN9A 4PZLA 1GLGA 2J3JA 3AUJB 2XD9A 3L01A 3PKJA 4NVRA 1RJDA 3Q6MA 4W99A 4NYJR 4JUCA 5B58T 2HYDA 4EITA 5CDUA 5EGSA 5AVXA 1H8ED 3UXYA 4WXRA 3UPDA 3DVRX 3P2YA 4ZVNA 4B3FX 5JY1A 2YJNA 5JWHA 2Q41A 1UBLS 3SEQA 4KQ9A 2X0KA 3H4IA 1DPFA 1OD6A 1YZTA 4BQNA 2ZW9A 3E2MA 4DY6A 5ILOA 1NHGA 2IQIA 2GK7A 1KH3A 3R5FA 1VFNA 4K9MA 3LS2A 4DFDA 4G0NA 2AG1A 5F9MA 4BNYA 2QW8A 1VL8A 5JH7F 1T1GA 4LXYA 5H81A 2CL0X 3TSCA 1G59A 3GC6A 3IH5A 1NSTA 3KHKA 2CHQA 2ZIEA 5B1YA 5HNKA 1PX0A 4HMQA 1LK0A 2IE0A 3PC8A 1EHYA 2C9ZA 1UJ5A 5AVZA 1LPOA 4LGMA 1ZR4A 3IBFA 4M0FA 3ROFA 1AS0A 2ZRCA 1I7NA 1EE9A 3AIMA 2BI7A 3M3HA 4LRWA 1TVKB 3DBOB 4U2EA 5ESXA 3T34A 4C7VA 4I50F 2D3TA 4AI6A 5DLDA 1D2GA 1TKCA 1OFTA 1XJWA 1LNZA 1YL5A 1OTHA 1WMDA 1WX1A 3GQBA 3WQBA 2V59A 4MI9A 4TWAA 3SHQA 5BSTA 3K09A 1GTSA 4QLAA 1UMBB 4N3NA 1TA0A 5T8KA 3FA2A 5E4TA 2QAGC 4JP2A 4MQEA 3T61A 1PWHA 3FTQA 3PKIA 8LDHA 4GF5A 7YASA 1ZN8A 4MVWA 2XIQA 2WJ3A 1L5HA 2CN1A 2H8KA 3CMMA 3OE4A 3H1GA 1A04A 1N2XA 4OJYA 4HNHA 3FUXA 5ADHA 1A8QA 1TZCA 4KB5A 2HK8A 3TTXA 1FFGA 1TE2A 3SZGA 1V6CA 4DA0A 5A4JA 2RKWA 2Z5VA 3D3NA 1PN3A 4X41A 1Z6QA 4N0QA 4GKBA 4CQLA 3H5RA 4FKZA 1ICEA 2ENWA 3C7KA 5CXSA 4EG0A 3A4NA 3C4VA 3G9TA 4GKAA 1P1CA 1V37A 2XODA 3LAWA 4WEOA 4FYJA 1QBGA 4ECAA 5LKRA 2ZBDA 2I8AA 1ADFA 4X8LA 1RRFA 1I2BA 1S7GA 4L5IA 5CVEA 3C6ZA 1KDVA 3X1ZA 4HBZA 4RCVA 1J2TA 4WY8A 3JU3A 5DYNA 3UYLA 1F3OA 4ZIRB 4NFYA 3HBLA 3VUEA 1WPXA 4EL0A 2FWNA 3OQNA 2XKAA 3HZOA 4ZI7A 4R0MA 3EQZA 3NYIA 3KKOA 3UHPA 4CIYA 1LPNA 1TM2A 4FSDA 3HRHA 4NBUA 2GN0A 2WYHA 3BBLA 1EDZA 4OMUA 4GMDA 1A0OA 3WSVA 5EJ6A 3IESA 2HA2A 1NV9A 3IQFA 3LC1O 4EEZA 4D56A 3KVOA 1G17A 4Q6BA 4RSMA 4RPLA 1NWHA 3OE7A 3QQPA 4MWBA 4UCFA 1VFPA 5ABPA 1TT7A 1IQPA 3K2EA 1M2KA 5AK0A 5KI6A 2AQIA 3RDPA 2BEVB 1C8VB 1V16A 1THZA 5IXJA 4QA9A 1R8QA 4BNZA 4RAQA 1P1FA 4WJKB 1JSCA 3WWOA 2VJKA 4YP1A 4CN8A 3U6BA 2IBSA 1SA0A 4LYDA 3NKVA 3BGWA 1OX5A 2IOFA 1GILA 2XA9A 2VBGA 1ML3A 4FT2A 5KYUA 3LHSA 4JROA 3INGA 5AJHA 1KI8A 5J5AA 3RADC 3P71T 3DD1A 1TJNA 3GAMA 3K0BA 4Q47A 1JLLB 1NFQA 1LC0A 1Y89A 5K4HA 1YVPA 1T6YA 2FGKA 1L7VC 1CTQA 5FV4A 1U11A 3WNDA 1J07A 4BX3A 1JAXA 1G1AA 4Q3CA 1HEYA 4X1YA 4EZIA 3VMFA 1ZA2A 1REQB 3MLEA 2FXIA 1N0VC 3E2PA 3NDRA 5ILQA 3LW8A 1NC3A 1EI9A 1XU4A 2D8MA 3EAGA 3NRCA 5DBFA 3SK0A 2XLCA 4X3PA 221PA 3WP1B 2FW9A 1OT3A 3HP7A 4MRNA 3OX2A 2KE5A 1IPEA 1XPRA 3H5TA 2NXWA 1HOXA 4BGVA 2O50A 4U7HA 2FZCA 3DCNA 3V48A 5EZQA 3IOMA 3CONA 5CH3A 2HK6A 2F43B 2DHEA 2ZIFA 2L0XA 3HYTA 5AVWA 2PH3A 3Q0EA 3J80A 2AQHA 2O7SA 1ISMA 2RMKA 2WZQA 2FETA 3D3KA 3HYNA 4OPMA 1PVDA 3KYBA 4Q05A 1IBKB 2B1RA 4JKIA 2ATXA 3UTCA 2AN4A 2C42A 4C7MA 1ZJ5A 3DMDA 3GRFA 4R83A 1Q1ZA 2CBZA 3MWEB 4JJGA 3EEOA 4B8ZA 1EWKA 3O8NA 6AT1A 4LXGA 2H0AA 1ZL2A 1SQSA 4RXUA 4PO3X 3TNYA 4H15A 1DC5A 4A91A 2JIQA 3AM5A 2H4WA 2OO5A 2WT9A 4M89A 4CMAA 3EZ9A 4XX0B 5EZYB 3SYRA 1RADA 2O0LA 1C2TA 3GW8A 2P1RA 3DV9A 3PQ4A 2YIVX 3EPRA 2YY6A 5IYZB 2PGXA 4M3NA 1GCAA 2O1SA 2QRZA 1HRDA 1MC4A 1RJFA 2R751 4C7KA 5AI0A 1DDGA 1N2IA 3V8BA 3A70A 2IOYA 3E5MA 3ZCQA 3BHMA 4CL0A 4BLPA 4D1YA 3L0YA 3FLBA 5TPWA 4XIIA 5LXTB 3ETLA 2QL5A 3VQTA 3C1OA 3JQ6A 4TXJA 3ENNA 4XDGA 5KNBH 1ZVJA 3HV2A 3LPLA 5KTTA 2OQRA 3NM6B 4CDMA 2RD2A 1HYEA 2G80A 1JHUA 1GGJA 1Z5PA 2DMRA 2P5TB 3UQZA 2BFAA 1E79D 1ZP6A 1J5XA 3BCHA 3CUWA 1A5AB 2JJ2D 3GGGA 2BEKA 3JZAA 2E9SA 5IT0A 2CLSA 2OCPA 4YI3A 2A9JA 4RTMA 4C4RA 4F21A 3P0HA 2YHSA 1BOFA 4I5EA 2I2BA 4LTDA 1NWCA 1NVFA 3VRHA 2FSVC 1SKYB 2BMWA 3SF8A 2GRJA 1EQUA 1YCDA 4IW3B 1NE2A 3C3BA 4J43A 3ZTYA 5LD2B 5HFAA 2I22A 5IPFA 4MX8A 2X6QA 2B37A 4DNFA 4J7UA 2J7PA 2R1UA 3L77A 2O1XA 3WDSA 1WVIA 5B12A 4GPIB 5CCXA 3ELDA 1IBMB 4HX2A 2KI5A 2PYIA 1U7XA 3ZD7A 5KNCH 1P4RA 4K1XA 2G9NA 2PRZA 4GUAA 1X70A 3QUQA 1XDBA 5TQJA 2FG7C 3K0FB 3OURA 1CDEA 3VR1A 1HL7A 1QYXA 5GP1A 3TSYA 4BCDA 1O89A 1JQAA 2ZIUB 4YYEA 2GKOA 3HMKA 2JGDB 4GLJA 5IRCD 7ABPA 2YZKA 2VJQA 1H2YA 1TIKA 5TQVA 1R9MA 4N0MA 3ZWOA 1QJ4A 3D0RA 5P21A 1K6XA 1T1IA 4WZAB 1D2MA 2CE7A 3L92A 3ZU5A 1RLUA 2ZITA 3MCUA 3NYRA 3PQ2A 1NBMA 1B4DA 1Q11A 3CF4A 5T4HA 5BOSB 5LQDA 1WUYA 2B4RO 2WABA 2VQSA 3PR3A 4Y0NA 3DE1X 5E38A 1JEYB 2G04A 4E5PA 3QVOA 2WD7A 5IXSA 4C0SA 5I7FA 3PQEA 1BROA 4XTCS 2GF9A 3K71B 1E69A 1CR1A 4TUYB 3D6VA 3UMRA 1G64A 2HGZA 1TU3A 2DCUA 4JUBA 2BGGA 4H08A 1PR2A 1YTUA 1PGOA 2GCIA 2M98A 1E8MA 4JLNA 3U4IA 2HCRA 3BBPA 4OI0A 1NATA 2XTZA 4EYQA 1BDHA 3NIBA 5JD3A 2ON6A 4CV3A 2Z9BA 3UK7A 2FGJA 5GV7A 3DM9B 5C31A 1WB5A 1VCOA 4GU5A 2UXBB 1NW8A 2OM6A 4ESVA 4XIJA 2ZJ8A 4PX3A 4RAOA 5BSFA 1UXKA 3L7KA 1NR5A 3STTA 5C1BA 1EFVB 1AZLA 1P44A 3PQ5A 1ABFA 1CF2O 4L72A 4REOA 1JXAA 1OH6A 3AV0B 4LOAA 4OYHA 5AJUA 4PZPA 4JXJA 1JL3A 2I3GA 2NXNA 2AYZA 2WWVD 4QM6A 1XMSA 1BVRA 2OBBA 2XQGA 3PPWA 2R0QC 2VUUA 2YIJA 3PEUA 4IIJA 4JBIA 3G2NA 5ITVA 1O0CA 4LDAA 4JI0B 1PJSA 1SCDA 1VL0A 1A7KA 5F9HA 1JIIA 1FX0B 2YY7A 5DI3A 3ESCA 3KELA 3GVHA 4XSGA 5BUSA 4F98A 3BWEA 3OG9A 1SZPA 1VKJA 3SR3A 4B9EA 1TAHA 4Q19A 1IN5A 3BQMB 5J2UB 1OZAA 3AVOA 4KNWA 4HDQB 1WBBA 1J20A 3BB1A 4BL5A 5KYGA 3UMBA 4P31A 1OU4A 1TQDA 1F2TA 3IGFA 4D7AA 2GBPA 1LPSA 3ANTA 3HY6A 2JGNA 3K9BA 4ND1A 4RGQA 2CXNA 3LU1A 4A8JB 1BMFA 5IJ9A 4G4SO 2JGAA 1SUAA 2RC5A 3AONB 3TQIA 2GVDC 5CBKA 3GLUA 3N2NA 4ZVTA 1M2GA 1CB7A 4EPXA 3EIWA 3FDXA 4ZQIA 3SN6A 3DD5A 4G8JA 4RZSA 2HLPA 2P3LA 1LDYA 2GI4A 5FBVB 2WJ6A 3GEIA 3LQKA 4RJJA 5CTAA 3E53A 1N5MA 2CNWD 3SZ3A 5ICGA 4FE3A 4BGUA 3ET5A 3IDSA 3LUKA 2TMGA 4KXQA 4ZK6A 5ICEA 1U0BB 2EFEB 3IERA 5LB4A 3EW7A 3BL8A 3JS5A 3C3DA 1CQZA 2O48X 2CVHA 3GGDA 1R5NA 2C5EA 3JQFA 1XC7A 3NDJA 4FHFA 2H9YA 4QOFA 4UBKA 1W36D 4FKMA 3H87A 4UCWA 5AOCA 3FPCA 4QYSA 1R0CA 2Q5QA 3FNBA 5H02A 3TMKA 4E11A 4MR7A 1PL7A 3IP8A 1RM5A 2VBCA 1GXSA 4OM7A 3EXHC 4FT4A 4E03A 4LOHA 3QM1A 4WCFC 4YQFA 5HOEA 3FBGA 2Q45A 4I8IA 3NB0A 4L5YA 3J7AC 1BHSA 2G1KA 4GZMA 3FAKA 5JECA 4AS3A 2GZ3A 2O8FB 1FOEB 1Z8FA 4HMPA 4QPZA 2EZ8A 4Y2VA 3IA7A 4TYQA 2H2AA 1BC5A 3QPAA 3W3AH 4J0HA 4F5ZA 1V9SA 4JDUA 1AGXA 1YH3A 2I4RA 1FC0A 3F3MA 1MOZA 2V8BA 3CRNA 1U9ZA 2FQQA 1CQIB 2V98A 5T67A 3DDCA 3AH8A 4RSHA 1V8BA 2IXGA 2XAAA 4Y9SA 3SM9A 4IGKA 4ZV4A 4E5NA 3RBZA 2OE2A 1U8TA 4F5EA 4O2AA 3T0GA 5LCXA 2CHGA 3BXZA 1I7PA 4QPJC 5TEWA 1HDZA 3KJXA 1G20B 3FI0A 3MBIA 4OQDA 3S1AA 1QK3A 1YR8A 4OQPA 1XKTA 4MB6A 4DGSA 3NS7A 5GINE 3HCEA 3WK6A 1JFSA 1Y8RA 5CHEA 4U7FA 1XR3A 3F5MA 2AH5A 3RYHB 4CFZA 3S29A 4UTOA 1MABA 2BKXA 3UENA 4A10A 3DUFB 4MWGA 1V7ZA 4WZZA 4INAA 5IK2A 1YS2X 4ETIA 2DKNA 1S4QA 4YYZA 4ZGWA 5CB0A 1OC4A 1QPBA 1I3KA 2G9UA 1P3JA 1FVFA 2VHXA 2ZRPA 3PD1A 2ZUVA 3FPLA 3S68A 4EI8A 3R6LA 3VXKA 1HNXB 5DNAA 1E79A 2RSLA 2BZGA 2FUEA 2W6NA 3GL9A 4RA6A 4Y6GB 4D3XA 3V1NA 4YXWD 4KNYA 3ND8A 4OQMA 2VAMA 1FS5A 4JEHA 1GRRA 3JD4A 4RCZA 4GWLA 4BIMA 1U3FA 2WM9B 5T4EA 4E4TA 2QAIA 4UNIA 4XW2A 5KVCA 4C0AC 2GFQA 3WO0A 4OHKA 1W25A 3V4FA 4Q03A 5HZGA 1Z5OA 4BKUA 3WMFA 2IY8A 5ECGC 2D2FA 1ULHA 4IKOA 3PRJA 1T4CB 1DAMA 3HVUA 4LI3X 3HC7A 4F2DA 4ZDKA 4PQGA 5JNSA 3IEKA 2ZU0C 2XRMA 2YFKA 4LHZA 1Z15A 4M98A 5B2FA 3J81k 2OCXA 3PS9A 3UGTA 1DLJA 3BH7A 5IJ0B 2Y1DA 4YR9A 1TI7A 1J00A 3RYHA 3N2ZB 4TXMA 1VDMA 4KKVA 1NBWB 5TVGA 4EYKA 3NMUF 3CB4A 4W7IA 3ZN2A 3ECCA 4KR9A 1GNTA 1SJ9A 4E14A 4BB0A 4MINA 3T15A 2O14A 5AI6A 4FOTA 4TLBA 1NONA 2VPIA 1L3IA 5DCWA 2FUG1 2H0QA 3DZFA 2I1LA 2JA1A 4E2FA 5C32A 2W42A 4OK5A 2NMVA 3QJ5A 4Q1BA 4RYDA 1Y3CE 5IZCA 3CZMA 3V46A 2UYQA 5ESDA 2I91A 1FFAA 2EP8A 3ACBA 5ALPA 5L7TA 4RS4A 3N2KB 1XLTA 3ZQUA 3QKUA 4IMJB 1NAHA 4F3CA 1YDHA 3IVAA 3TLAA 3GAAA 4DWJA 5C8YA 1DRVA 1UANA 1BA2A 5TMBA 4R6WA 1O0SA 4RABA 1RHQA 1XKQA 2W4MA 1EXWA 1SBHA 5ENZA 2ZSKA 3JYLA 2KSQA 2H07A 2HAEA 2BTOA 3GLQA 4MR9A 1QHGA 5CNKA 1L1QA 4MUFA 3NHLA 4LPSA 2AI3A 4F6LA 5AQ1A 3K1AB 4HAYA 2RG7A 2J3KA 4MGIR 3AR9A 3INNA 4IV5A 1LB1B 3Q9SA 5EXDA 1U5BA 4F5YA 5I7UA 3CX8A 2VEDA 5K0GA 2Q5FA 5KNDH 1XAGA 1UKVY 1JDBC 4RSRA 1U4NA 4GMFA 4JVLA 4R7TA 4J4HA 3ZQ4A 3H6GA 3ZPXA 1DEAA 4FB4A 2Q9BA 4JUIA 2AVNA 3NLLA 2GQ0A 5H8WA 4RKYA 2G28A 5CX1B 3NHJA 1KSGA 2W4IA 2ZVQX 3CSUA 3L7LA 1L3BA 1YR1A 4R31A 2I6FA 1DMRA 3G2JA 4R1UA 2PZEA 4OYYA 3GFRA 1FB5A 3R6DA 5HF8A 1X74A 2YOHA 3A3OA 3NNSA 2JGLA 2E37A 3IUNA 3Q7QA 4L50A 3PD7A 3DULA 3AOEC 3SP1A 4MLCA 2ZRKA 1CUWA 1RXUA 1GQFA 1JUDA 2QTCA 4EQ6A 5BORA 2TSYB 3M33A 3IKMB 3PPXA 1WUTA 2A9KA 3B52X 1E6KA 4DSUA 3A0RB 3Q88A 4EI7A 4YUYA 2UVPB 3I3OA 3DCIA 1KNQA 3ZDZB 1BCSA 1MFZA 3R09A 4IINA 3RNLA 3C98A 3T7SA 4N7RA 1JHMA 5D7BA 3RO7A 4E5VA 1QTQA 4IH9A 1PUJA 2ID9A 4HWKA 2G0NA 3OUZA 2V97A 2GUGA 2HHCA 2Y1FA 3CCCA 4X3OA 1PQWA 5EINA 4GOXA 4MRMB 5I9IA 1IZYA 2QTFA 1G55A 1RI1A 3L0ZA 4L8FA 1GFWA 1RI5A 4M7WA 2FPRA 4B4OA 3LTEA 4YT8A 3V4RA 2QVXX 5MDHA 2RHLA 4QZVA 2FPWA 1JDBB 1G63A 1N2ZA 2X2EA 3F8SA 3H8VA 1NLMA 2PH5A 2XEXA 1FQOA 3I8OA 2WWIA 4G6ZA 4YPFA 4A2CA 4LGVA 1R6TA 3U39A 4PG4A 2C8LA 5T57A 4N03A 4IHJF 1I1HA 1M5UA 2Q9AA 3T3IA 2H0RA 2GPYA 4TYPA 4ZI5A 2XUGA 4E46A 1UK7A 3LIPA 2R62A 2HMTA 3FZYA 4J6FA 3DHNA 3NOXA 1UBNA 3IAXA 3IV9A 1LCIA 3RYFB 4AY4A 2CNWA 2HA0A 1ZC3A 3Q3GE 3TF5A 2PUFA 4MVJP 2ZUEA 3LHFA 4YAIA 2VQ6A 1PZFA 5MGBA 3I34X 3TJMA 2EERA 1G21E 3TTSA 4UAGA 2H1FA 2Q5CA 3O90A 1BE0A 1ZZGA 2V96A 1Y7LA 3GRYA 4YIKA 4G84A 5JMTA 4NBTA 2GZ1A 2FQWA 4J1TC 3T35A 3WYGA 5E1DA 3DEYX 3P96A 1E2BA 1IE3A 4G5QA 2W6JD 4RVFA 1P1RA 4AY3A 1YSCA 1JTVA 4G97A 4V0MA 1X80A 5DN9A 4FN5A 4B3RB 1SCQA 2W90A 3HKCB 1AG9A 1CERA 4TKUA 2OXEA 1WUHS 3ZNNA 3OKAA 1C3OB 2PRJA 4V2UA 4Z3DA 3CNOA 4PM4A 2ZS8A 3KKNA 2I4IA 3FZGA 4O4LB 1G1MA 4OK3A 3WIDA 3AL2A 4YPVA 6ADHA 2WIGA 2FDCA 1ZO8A 2VVTA 3JASB 4L5AA 3TGPA 3T1HB 3BN3A 3CLHA 3ORHA 1AJEA 4G4SP 4ZCLA 1UJ4A 3ZE1B 1C3OA 1WE2A 3FWKA 3R3VA 5ARDA 4C7JA 1H2RS 3AB7A 3OLQA 4HQLA 4CMJA 2CJWA 1NW7A 3I5AA 5BVHA 4C0KA 1S3FA 5B37A 4WLVA 5WRFA 4JT8A 1E1YA 3I32A 1FW8A 2CD9A 4H6WA 1QP7A 3DP9A 2N3ZA 2VOEA 2SNIE 3B9BA 2G5TA 2VJAA 2WDPA 3C3JA 3VR3A 5H4GA 3AHJA 1JRLA 5DJ5A 3P45A 1OIWA 3QW4B 3R5KA 4IFIA 1P7CA 3TZCA 2AKAB 3M4YA 2ZCJA 1SC1A 3SAJA 1XA3A 4NE2A 3RVNA 1X1AA 2VDLB 3EGEA 4MR8B 3GV0A 3QVGA 1C9MA 4I19A 4CM4B 2MYTA 4RU1A 2WKPA 3PFCA 1DTSA 2JRCA 2OO7A 1PUIA 4G5GA 1J0XO 1NYLA 1R3DA 2J08A 1N34B 3HI4A 1UOPA 4JI6B 1R4AA 2VPQA 4L73A 2ONCA 1L5NA 1M83A 1CIJA 5BWNA 2ZZKA 3LLUA 1WEHA 3VU0A 3PZRA 2Q0XA 2RHRA 4BWGA 3CKYA 3NEPX 4QU9A 5DLYA 3RUAA 2O7VA 4RXMA 2FEXA 1QGZA 3IUPA 1IZ7A 3AVXA 3UHJA 4CI0B 4Z7QB 1JAHA 3C1AA 5CJ2A 1DAGA 2E48A 4RACA 4XIFA 3WYAA 3VX3A 4D9BA 5KNCA 2XTJA 1R18A 3C5WP 5FO1A 5I9NA 2DT8A 4LWPA 4EVRA 3LX5A 4KLCA 1I4TD 4MS4A 4MJLA 1XTVA 2H4FA 3I1YA 2W0SA 2HWWA 4X1IB 1EGAA 4LDRA 3GROA 2GX6A 1S89A 3HKBA 1XTTA 1YS1X 1DE0A 1DQPA 4HI0E 1K75A 3LP8A 4HEJA 1VC2A 3GJYA 1NZJA 1U1FA 3ONEA 4PLZA 4AJLA 3WSWA 3ZG6A 1CRLA 2P90A 1IOWA 1SQGA 2ZYHA 3EXFA 3G2QA 4HF7A 3MRXA 4KFRA 5T7BA 1QRAA 3OEHD 3N0WA 5ECYA 1Z0IA 1RSZA 4B6EA 4NP6A 4AY6A 4JWTA 1D8TA 4B80A 3E84A 4BE4A 1MPTA 1AN9A 4ZO8A 1H22A 5ALWA 4OAPA 5KTOA 4U3JA 4UVIA 5AICA 2VOJA 5F5LA 1X8XA 2Z43A 2FEAA 3LP6A 3RG2A 1FFBA 4GDFA 4NNOA 4DMGA 4Q15A 4JR1A 4RJIA 3U44A 3EXEB 1G4HA 5CYGA 3ZHZA 4KXWA 3KYDB 3WXMA 1YOVB 5JASA 4P81A 3JQBC 4XWGA 4K6CA 2O2DA 2WILA 2QUAA 2ZCUA 1OLSB 4G8CA 5J59A 5HA5A 2H85A 2HV9A 2NYUA 5K8LA 5KPDA 4PZAA 2BY4A 2Y3IA 4EBFA 5HWSA 2DPYA 2GPWA 1CJVC 2AUTA 1D2NA 1J1IA 1W88A 3NRJA 3L8HA 1Y3IA 4ZOCA 2ZBRA 4U5XA 5D51S 1M1XB 2PRIA 3A1UA 3GZJA 4GP9A 2REXB 3IKVA 1CEXA 2IXDA 3LOUA 2JIZD 2VQDA 2WZCA 3Q40A 4GNKA 1MAAA 2GHRA 5KJEA 2YWFA 4ENPA 1Y9JA 1SB9A 4V1CA 5IC4A 1QV6A 3F7NA 2QY6A 3TAUA 4D0LB 1XN4A 5DGXA 4U7PB 1GNRA 2OESA 4RC9A 5DYWA 2X1LA 2X6TA 2W2MA 3UXEA 4BNFA 4ZKDA 1OH8A 3I5YA 1M8FA 3OY7A 1SZJG 3H1EA 4KZPA 5D3MB 1A5SB 1Y37A 4KPYA 2Q4RA 3DE6X 1Q50A 1K0FA 2PRKA 4OBEA 5ECDA 2YCBA 2BSAA 5JG7A 5IDQA 2AMJA 3T8YA 2VJBA 3HWRA 3AKYA 1DEOA 2EKZA 2WT4A 2ZRGA 1J0BA 4OQNA 4GHWA 4J0DA 1CUSA 1T5DX 2VHVA 3S8EA 4RKWA 3U44B 5IP5A 3WGOA 3VC1A 4OMDA 4HQFA 1Z47A 2O2IA 4M8KA 1Z5VA 4K86A 1CUIA 2RH8A 4IO1A 5DYGA 2GZ2A 3BHIA 1GYRA 4QGFA 3ZKWB 4CQMB 2XOEA 1GTG1 9ABPA 3O8QB 3QOWA 4OVKA 3HM9A 2DWCA 4EI2A 4MS3B 2QXUA 2UYGA 5FFNA 2AD5A 3NTQA 1ZI9A 3MCZA 4PX2A 3DE7X 4B6FA 5TT1A 5BW6B 1P2FA 2L82A 1OYOA 1YIAA 4N48A 3OT1B 3SCZA 2IS2A 5FOSA 1MQ8B 4F0JA 4DMMA 3VR6A 2O4UX 4RTRA 4HXGA 5G40A 3BREA 3PUIA 5KC8A 2OC9A 3V7YA 4EAAA 2HT1A 4A27A 4RQTA 3LCCA 1ESMA 2IC5A 3JQGA 1MVLA 4RZUA 2WE8A 4KGXA 2B4TO 2I33A 4F46A 1U98A 3ZE6A 1FUIA 1YULA 3A32A 1G66A 2IXTA 3VZBA 5IK2D 3A7EA 5CB4B 3CUUA 4H7HA 3DFFA 4Y2QA 5E7QA 2Q5JA 4MWSA 4ZEOA 3RTCA 3G7UA 1CZRA 1W4CA 2DG2A 1FP2A 3JYPA 2ZXFA 1SFRA 2PSDA 2YQ4A 3WLRA 5AW8A 2IU4A 5LYJB 3TQOA 4GM0A 1CP2A 3OE7D 4UBIA 5C8DA 3C1TA 2OGTA 3FKQA 4LNUB 4IDHA 3RLIA 1KQGA 3KVNA 2V1UA 3AFIA 3LDHA 3U4DA 5C81A 2BYTA 1WXXA 3CW2A 2ASVA 4NMLA 2OG2A 3NUQA 1QLHA 1RKUA 2R6JA 1J5PA 1NBOA 3FUTA 2Y4NA 3KKKA 3GFTA 3DNMA 5JSYA 4F5DA 2AZXA 1KIAA 2DR3A 5E7MA 2IVFA 3F7MA 1E2PA 3MJTA 1G2QA 2Q2QA 3PWKA 1J4AA 2GZMA 4MYSA 1ZSYA 4S12A 4MMYB 1KE2A 8GPBA 3GLGE 4CTMA 2XBMA 3CS3A 2VDKB 4B33A 1EP9A 2MWMA 1EHIA 2PL9A 4HPJB 4QXPA 1D2RA 3TRJA 2GGSA 2LP4Y 2RJ3A 3O1JC 4IPTA 2Z6UA 2X8JB 4KPUB 2FR0A 4QJ5A 5FIUA 1RKVA 2SHKA 3MRSA 5ALMA 5AW7A 3CE6A 1SN7A 4UU8A 1U31A 3CH4B 1V1MA 3HGTA 4TS1A 2Y76A 1ELOA 3LT2A 1EQ2A 2A9FA 3EIXA 4UQOA 3UMFA 4RXTA 1DKLA 4QX6A 1WSDA 3TO5A 1CZOA 2P78A 3SWWA 4H1UA 2A67A 2A2ZA 3O74A 5K8CA 3L8FA 4K81B 3I5XA 2QRVB 2QQFA 5I01A 1EFPA 3UJDA 1NQ5A 1B0AA 4QODA 2FRDA 4JASB 3UQYS 4W5TA 1QQ5A 1KORA 1S2NA 2IYAA 3L82B 2HF2A 3NIGB 2AK2A 4LYFA 4N3CA 1AOXA 1Z62A 4G1FA 5FOUA 3A1VA 3PK0A 1YT5A 1M7BA 2B5VA 3AEUA 5GGYA 4DS3A 3VUFA 1ADJA 1E3DA 3H05A 3Q2OA 5COAA 3DKPA 3WMEA 3HXTA 2NUPB 3HCFA 2W2KA 1ZSVA 3DOUA 4Q00A 5LQJA 1ZW6A 1WR8A 2C2OA 3A3NA 1TK3A 3GLHA 3IIKA 3EASA 5C7IO 3GCXA 4KH0A 1DAOA 1WSBA 4KDFA 1I6LA 3TLEA 3K9NA 4RHCA 2MINA 1M1NB 1J22A 1NVGA 3WYEA 5H68A 1L0BA 3MTEA 3UUWA 1LF5A 5JYBA 5JNLA 3U3ZA 4GPBA 1N77A 4C5CA 3S28A 4R05A 3BZBA 4G81A 4KITB 3EDRA 3LM8A 5H3CA 4NBVA 5KWJA 3I9OA 4OFZA 2I9KA 2B8EA 1DQYA 1YR6A 2PMWB 2OT3B 1IQUA 4P4NA 1CUEA 2VNAA 3PXCX 2PKCA 3VX4A 3E1GA 5CFPA 3R6TA 5HSGA 3AEQB 2DFKB 1VBNA 5K3DA 1E3IA 3W5AA 1P2VA 2BHSA 2F1OA 4RIHA 2NN3C 2DFPA 1QJCA 4ENUA 3CUSA 4HGPA 3S2FA 4CR7A 2QTHA 5FPPA 5K99A 2DWQA 2H31A 4JITA 3IT1A 2GF0A 1GAWA 3PG5A 2WWYA 4B76A 3DYBA 3F4LA 4CBVA 2L69A 1SOWA 2OORA 2HA7A 4YN3A 1N4AA 9LDTA 4INZA 4GE0A 4JC8A 3LXRA 4FCVA 3WYCA 1AGYA 3EWNA 1YV9A 3P0FA 4YV2A 1KF0A 1POXA 2Q9UA 3AB8A 3IBCA 3UXHA 1FFXA 2ZRQA 3A9UA 2P27A 4JD5A 5K01A 2GXAA 1D5CA 3CURA 4C4PA 4MUXA 4ZYWA 1YA4A 4FOLA 5KX5F 1OA1A 4JS0A 2Y67A 3RVMA 4C7OB 1QIIA 1GKKA 3M6AA 4JKOA 2NU8A 3UJPA 3TLJA 3H2KA 1V1RB 3EIOA 4J1QA 1YIOA 3X2FA 3FUUA 3NANA 4R2MA 1EBBA 4Q1EA 2JJ2A 4ACBA 3W8EA 2OL4A 1GG2A 2Q5IA 5FPHA 1YUBA 3E15A 4DUGD 4I3FA 4DDWA 1M54A 4BMNA 1J5EB 4BKRA 5ALFA 4ZWNA 5B7GA 4DV2B 1A9SA 4H3HB 1WKVA 4L8GA 2FWMX 1IOLA 2PWAA 4UCQA 3R7SA 1DV1A 2FSPA 3CZPA 4WN3A 4TQ9A 3SFZA 3I6ZA 2PGLA 3HXKA 4F4IA 1LRLA 1Q77A 1XHLA 2AJBA 4M9SA 4ZKEA 4RPGA 4JLKA 1NOIA 1PNQA 1QIMA 3EEQA 4YCBA 1UBSB 1A4RA 2Z56A 3IEVA 3OO0A 4F45A 1CRWG 3EG5A 4Y8VA 5CURA 5JC1A 2J0UA 4XD2A 1Y5LA 3GFVA 3SHOA 3F96A 5K5EA 1FQKA 1NGSA 4B0OA 5BSHA 4F93B 1SXPA 5KVVA 3PEWA 1F06A 4LVCA 5A62A 1FXWF 4FYVA 2CMKA 2CLCX 3IO3A 3IJRA 4UVHA 1YZNA 1U8XX 1C9NA 4X1KA 2PEZA 2BLNA 3EUAA 4CT5A 3BE8A 3P97A 4QXOA 3I53A 2WAXA 4LNAA 3TLCA 2X23A 2OZLB 3EA5A 3I2KA 3UA4A 2E4XA 4LA4A 4AZ0B 2HX1A 4Q7EA 2X7JA 4TV9B 2DP4E 4K2HA 4RWEA 3CYFA 5EKSA 3DFZA 1RBQA 1TUBB 3KKPA 5ES3A 1KYQA 3IFSA 1JMYA 2EG9A 2HHJA 2LW7A 4F6RA 5DLEA 1CQJA 2QYTA 3GCWA 4KN6A 2I6QA 3TCXB 1K8XB 1GZ3A 5K05A 1PZEA 2DBQA 1JTFA 4EA7A 2O8EB 3E82A 5JJLA 3GZ4A 2CNBA 4DA6A 2ECPA 4IJMA 5DK6A 1YCHA 2NZ2A 1OLXB 1QFYA 1KZHA 3WNCA 1EFTA 3TKAA 4F6RB 2Z2IA 1AHIA 1BGWA 1M7HA 4FYWA 1SUEA 1YKFA 2A58A 2YCLA 2BBSA 1T24A 1L2TA 2H1RA 4J7AA 2H1SA 4L4SA 1R0LA 2CC2A 1DEHA 1VE1A 1WCIB 3IAS6 5FWYA 2JIZA 3GG2A 3OMXA 4KXLA 5FUXA 3VBEA 4BNIA 4BMSA 5K8UA 2D06A 2DGDA 1ESZA 2QN9A 4B7CA 2EKDA 1UCFA 2MSNA 4BQRA 1KK0A 4MPRA 4FNOA 4FNGA 2WJ4A 4C0WA 4ETWA 4RTOA 4CMIA 1F2UB 2BGMA 4AJIA 1JWBB 4AU1A 4CV2A 3ZFOA 4CQNA 3F5SA 1ZI6A 5T4FA 6CHYA 5K6TA 3C3PA 1KFEB 4RM2A 3NZEA 4GVLA 5CVJA 1KP9A 3GRUA 4TTAA 2X0EA 5EIXA 3X1DA 3M89A 1OFVA 2H2HA 3EVAA 3U4GA 3NV9A 4A4DA 4CQJA 5A1TA 2VRCD 1NPYA 3SF8B 2GR9A 3IUBA 5FF9A 3DB1A 1B3RA 5J4VA 4Z4IA 3QE9Y 5EIAA 4QBKA 4CLHA 4GKVA 4M0EA 5LJLA 3DMTC 1DG1G 5C4GB 3TXYA 5JMWA 5K45A 2F67A 4PAOA 5FBRB 4IMRA 2VDPB 2WUGA 3CSDA 3J7TA 3L7BA 4PPQA 3S7ZA 4E7PA 4CKYA 2XGSA 2W2QA 1FTQA 3P9KA 4RH0A 3MTGA 1I1OA 1JFTA 4LOLA 4HY3A 3WLHA 2H9IA 1OLXA 2C8KA 4IF4A 5CLIA 1CE8A 1Q0TA 3QU4A 5FWAA 4EK9A 4EPTA 2B1JA 1QGOA 4RGVA 1G20A 1C3LA 1IIBA 1OBCA 3EF3A 4JJAA 4QGSA 3DMGA 3EDOA 1CLUA 1DQNA 1NJ1A 3AV3A 3E7PA 4ZI7F 1H9AA 3M81A 3VKUA 1NI4A 3THWB 1ZMRA 3DO8A 3KKQA 1UJCA 1FTSA 1NW4A 1QONA 1Y42X 1CDOA 4HXYA 5EIEA 3Q3JB 5IEJA 3SHTA 4JLDA 2V9PA 2OGZA 4ZVKA 4QDJA 2QAGB 3CO5A 4BV3A 3K6SB 4EB6B 4RTJA 1OIXA 3R7WA 2PUHA 1U65A 2ODTX 3N7TA 2AQ8A 3Q7EA 1V95A 5ELLA 5EQFA 4N9WA 1ZI8A 2BFBB 4K7JA 2XUDA 4BNLA 4E6PA 5AXDA 3HV0A 1KDZA 2NUTA 1C0KA 3EMDA 4YC7A 3ONWA 2DFNA 4GWKA 1J2JA 3FLEA 1XMVA 4C0LA 4AQDA 2RBEA 2RJOA 1C9EA 2W2PA 3BMCA 9ATCA 1UJMA 4FW8A 4I5DA 5LP6F 3K0AB 3EY4A 1TJPB 1A71A 3O9VA 3PV0A 2R8RA 4M1QA 1T43A 5GJWC 3A9RA 3EWSA 2QUKA 1E5DA 4Q18A 5MN6A 3ETEA 1QIJA 3EZLA 3EDMA 1SZCA 1Z2CA 4GRAA 1K8RA 1CE8B 1PG0A 1A96A 4HNAB 5KYWA 1EHCA 1KQ3A 1GLNA 5FULA 4RA9A 5JPCA 3I62A 4BWYA 3KOUA 2CVPA 4LXIA 3SOPA 1Z5UA 2XF2A 1JFVA 3KKLA 4K9LA 3R5XA 1RRCA 4O2BB 1YDFA 4KV9A 2VP6A 1F4PA 2ZEJA 4UHFA 4FYXA 1T13A 4IEIA 2O1EA 3LZ6A 1E9EA 3EEYA 3KX2A 1GU7A 4Y2HA 1BH6A 3ZHCA 2ZDQA 3TX2A 4L0CA 1XK6A 5CAEA 1PYOA 5EIBC 5T41A 3S2EA 3SE7A 4N7BA 1A9XB 2PKXA 3TRFA 4QBFA 1UMKA 4B9AA 4RENA 3WL8A 3G5AA 1AC5A 1AQLA 1FNSA 2R8XA 3BYZA 2BKUA 1Q3HA 3ON5A 4B46A 5JMPA 3AEQA 1ZVQA 5HEKA 4GPTA 3AU8A 3VZCA 1J9GA 2DUUA 4IY1A 4ON9A 4FQ7A 3WGMA 3UJ9A 5B3JA 1L7EA 1QYWA 1ZKDA 4PZYA 2FEMA 1A82A 1JPJA 1YVRA 2BJWA 2ETXA 3KPVA 2IWHA 2HLHA 4M0DA 1AHNA 2NO9A 1R5OA 4Z4FA 2MYPA 5EWMA 1R0KA 4LK2A 1JBQA 1Z5WA 5JVDA 1FJ2A 1TUGA 2JFXA 4XLLA 1HH4A 4OTZA 1IRIA 1X1SA 3HJNA 1H66A 4WOBA 4DPLA 1NA5A 3DQQA 2PVPA 5TQ0A 1BW9A 1JQLB 2QD4A 3O26A 2ACWA 5C46F 4LCJA 1G6KA 3E9CA 3VHQA 5AW0A 1LDGA 3GBSA 2P5SA 3AY3A 3TQCA 3D8NA 1W6RA 1HTTA 1KC1A 2NSHA 3HBJA 1RXEA 3ILVA 4NV3A 3C70A 1Z08A 2XVXA 4IMIB 4PRZA 3W5IA 2QG4A 3D4NA 2WHEA 1QZUA 2WF7A 1G6Q1 1CZNA 1XEWY 3DE3X 1XD9A 2E49A 3C7DB 1EX7A 5IN5A 3U7QB 1IJBA 2B2NA 2XOKA 4KLZA 1RQNA 3OLVA 4OXIA 4YAFA 2PMFA 2BHLA 3ZVRA 2I54A 5CW2A 3S4YA 4F6CA 4DC9A 1LRKA 3KB2A 5TR9A 3PITA 1IZ9A 5MHTA 1FP4B 4OQEA 3M9WA 3B38A 2HFKA 2I65A 2XUOA 3A1CA 1G7RA 4PCLA 2JI9A 1TA9A 1SKBA 2YRFA 2GD0A 1TVCA 4HNSA 4IDEA 1ZXLA 1FDWA 1GRNA 2GK6A 2YJ5A 2WF8A 3OFKA 4RSGA 5DKFA 5DTQA 3X2EA 4EY6A 1SXQA 3R3ZA 2XQKA 2QRHA 1W1IA 1Y6QA 2GSWA 4GNRA 5LQAA 1DV2A 2AEFA 1ZM4A 5LR6A 4V0LA 1AHHA 3C3KA 1LDBA 4O8ZA 4EJ2A 3E7DA 3I8SA 3A1SA 4W5QA 4YBRA 4EO9A 5REQA 4C7BA 1YB5A 3AM3A 1GARA 4FZRA 4IQ8A 4TMYA 2JLWA 3QWFA 5KCMA 1A8UA 1T1RA 2CW5A 4Q21A 5KAPA 4RHFA 3VR6H 3GN2A 3QEKA 1FE8A 1OXVA 3NTOA 4GGPA 4MUNA 3VNBA 3TQRA 4AX4A 5DLPA 4C87A 3GX1A 1I1NA 4WZAA 3ZFNA 2NO0A 3EXHA 2FE4A 2I2AA 5B30A 2NYRA 1ENZA 1WOMA 3DLCA 3GVIA 3H3XA 1RPTA 2G4LA 4CEHB 1VB3A 1OV6A 3W7VA 3DWIA 1U99A 2WMDA 4M8LA 3TD6A 1PW7A 4URXR 1BG6A 1XRJA 2H6EA 5DHSA 1L5SA 4TUYA 4OBXA 2IF2A 3KP1A 4QFBA 3QBTA 4UEOA 1P45A 3F1KA 3ABSB 4BVBA 4N7JA 2C7OA 3IAFA 1BRTA 5IBPA 2X8AA 1B73A 3FHOA 2X0JA 2MU1A 4CM8B 3T7JA 2I1QA 3ACCA 4JFAA 5BMVA 3G0BA 2QN3A 4ALIA 3SYMA 4HDKB 2RKBA 1D7AA 1I3LA 3RT7A 3FTEA 1I0LA 2FSUA 3HCPA 4I2VA 1JIXA 1PJLA 3L4EA 1ZOPA 4QBHA 3E4CA 1AD2A 4RVHA 4WLOA 2GTIA 3N6VA 2XR1A 3ONFA 1Q7EA 4Z4EA 5AKZA 3SLRA 4E4RA 1JZSA 1J97A 1USVA 4K9NA 3EMBA 2JBWA 4NV1A 4P9NA 3WGKA 4GX5A 2I5PO 1QRSA 1PSWA 3PYXA 4PYQA 4K0RA 3MF4A 4D82A 1SVNA 1P4HA 2JJ1D 1DIOB 1QG2A 5IAKA 1GR0A 3OD1A 2WIBA 1KXZA 1LY1A 1RU3A 2EDCA 4FXOA 5EESA 1TW2A 1UMBA 5HS6A 2J9FB 1R64A 3HEAA 4LISA 3G6KA 4YAOA 4ASUD 4MCAA 2M9MA 3WO1A 1U4OA 3VPGA 1GDHA 1RYNA 5EPEA 3V5NA 1PD0A 3VZPA 3A1WA 1JE1A 3HI6A 3LHKA 3PXEA 3V9AA 4KQCA 4MXDA 2P9ZA 4PINA 2GVNA 2WU0A 4X60A 3PWSA 3W8FA 1L4GA 4DCUA 1ZOSA 5HQ3B 1U7OA 2CXHA 1EP1B 1S2IA 1ZUD1 3NQ41 2QPOA 1ORTA 3IMCA 1YBFA 4I6EA 2B2XA 2NV2B 5HIMA 1IAVA 3PIIA 3RVLA 5K7SA 3RYCB 2UYCA 4YAJA 5IHXA 4DV5B 3ICWA 2H63A 4P7FA 2Y1WA 1BVYF 2WTAA 2CE2X 1ZM3A 5FNVF 1KZYC 1LTHR 3QXHA 4I66A 4OMCA 3SBDA 5F7XA 1JR3A 1WEKA 2H08A 4I50A 5TQ2A 1JXMA 2BGNA 2Q1XA 4H4DA 3ZDCA 3FPAA 3FPEA 2XYGA 1BX1A 1EWRA 3UXMA 2I6UA 1HE4A 2YN2A 3B1FA 4HZUA 4PLWA 1X9HA 4BNGA 5DDIP 4DARA 3FPSA 1FDTA 2PNFA 2EW1A 3M2PA 1XB2A 3QVKA 4GP6A 3WGZA 3A3KA 4QEKA 4U9IS 4U7DA 4ZMBA 1QV7A 1ISFA 1V3UA 3T1OA 2VAVA 4D9EA 1E58A 1TQ8A 5FJJA 1AKQA 3O93A 2WD8A 1R0SA 3AF5A 3ZJVA 2R2GA 4HRXA 4BX2A 4MA0A 2O2JA 1U0OC 3EEIA 1S4MA 1F48A 1SELA 2A3RA 1NZFA 4CCWA 3Q72A 2P3OA 1J8QA 1VMAA 4IX9A 2BFBA 4BNNA 1SVOA 5HS4A 3OSZA 4MKIA 2Q3HA 4KYUA 2AJTA 1FDOA 3I04A 2WKWA 5F2EA 1HZZC 2VJMB 2YC4C 3MIZA 3OFND 5G4KA 5JBIA 1DQRA 1PGJA 3DBIA 2VUTA 1BDIA 3QLTA 4Y2TA 1UH5A 3JQAB 2ZR0A 1N8TA 2R1VA 4FYPA 1GTL1 4GP7A 4KQ2A 4M0UA 4KAFA 3QE4A 2Z1MA 1YOVA 4G5HA 4X44A 1JI3A 3SQOA 3T9AA 3UNXA 1G8AA 5BSMA 3GUCA 4RL4A 2Q5LA 1LBIA 2G40A 3W9SA 2IZ6A 1T9ZA 4BNXA 1XXHE 3DQZA 4R5MA 3DZCA 2XGOA 2O8DA 5EXXA 4HDSB 5AKHA 1NKTA 1E1NA 2HJSA 2R84A 1AUVA 4IHJA 1XTKA 2A30A 2EKBA 4FDAA 1NY5A 4INJA 2OGWA 1UP4A 2B9EA 4YECA 3D4BA 4NYMQ 3WB2A 5IU6A 3BERA 4O2AF 1L7RA 4RYLA 5LPNA 3COVA 4O8CA 1Y4ZA 4HK4A 3IP7A 2PR2A 5EQDA 2I3ZA 5B4TA 2GRUA 1NR1A 1S3IA 1U1DA 4WOKA 2IEZA 1T2FA 3OAAD 3HYLA 5JZVA 1JEYA 4ZYYA 4JP8A 1Y48E 1K6IA 2A1UA 1N25A 3CX6A 3OT5A 2HDNB 5EMNA 5TVKA 3JCZA 2OFFA 3R9IA 3KOYA 6YASA 5EJ4A 4PHGA 4ZICA 1EK1A 1NU8A 5D3QA 1C3JA 5H3HA 1C3VA 1TEXA 3A8TA 3C14C 3OF2A 4V0RA 4AULA 4DMKA 1TF7A 3D6HA 4FI3C 3I12A 4MKFA 5B4VA 1R0ZA 4NL4H 5F12A 4P0QB 5ICSA 4HWTA 4U0KA 2VZLA 3UW1A 4TL8A 1VYTA 1Z5GA 5DB4A 4ID9A 3W4IA 1LKZA 4D9MA 2FSVA 4R7ZA 4R71A 5AESA 4ZOEA 4E5YA 3DNPA 4RDHA 2VDVE 1AO3A 4II7A 2AKYA 2NAFA 3WL3A 5BV8A 2IQ5A 1MZPA 4ZCTA 1ZNQO 2TRSB 4BS9A 1JX6A 1TMKA 2WSIA 4WERA 4X9XA 3E9NA 2FOIA 1EINA 3AVWA 2OPHA 2NUPA 1HZJA 2Q29A 1TTHA 2ZI6A 1H9CA 4K3VA 2BONA 3L49A 3S44A 2O07A 1Z4QA 4JQOA 5BNFA 3KL2A 5U4QA 2VZEA 1QH8B 1ZNZA 3EZGA 4EKEA 3X1KA 5ELMA 2Q4DA 3OMWA 1QOZA 2QJTA 3MAAC 4MV5A 3P9IA 1MQSA 3ABQB 2CZQA 5A9TA 2ZBGA 1FNMA 3CNLA 5F2NA 3AJAA 2HZBA 5HJEA 2C5AA 3NDPA 4B0PA 4C3UA 4M7RA 1ZEJA 1SXJE 2W83A 5FORA 5LJIA 1YA6A 4IJVA 4BC0A 3UPUA 1BFUA 4B3SB 1Z3IX 2W6QA 1RC0A 5CXUA 1PR0A 2R4UA 5KU7A 1NYTA 3OWOA 4O02B 4YACA 2V74B 3TTVA 1B3BA 1UQTA 4PQYA 5LZ9A 5HM8A 1L5GB 2SICE 4LRYA 4MYHA 3V42A 1FRNA 4D9JA 3L1UA 1J8YF 1N2HA 3MUOA 4G1UC 4QICA 4X20B 2CNLA 2FQYA 1MZVA 5FL3A 1J9ZA 2ZIWB 3HXMA 1RRPA 3H42B 1PK8A 1MBZA 2QNIA 5TC4A 5DGHA 2ETVA 5GWXA 4D3YA 2HCTA 3Q7SA 4OJQA 3HK2A 4QJIA 5D6NA 4BFYA 3RD5A 2J5KA 3KR9A 3PCRB 4QUHA 1PT8A 2PT7A 4IZIA 4NPHA 4YXWA 4CEIA 2K2WA 2G3YA 1G7CA 1GEEA 2X3UA 4GPZA 4K6MA 1VP9A 5I7AA 3DBRA 4PLVA 3IPCA 2OLJA 3S2UA 2CFIA 5BP7A 1FLAA 1QG6A 4Q9HA 5SY4A 1W5AA 3N87A 2XVAA 5HHTA 3AHEA 4FLMA 1O97D 3L46A 4HGRA 3UATA 3FFWA 2HPVA 3VPAA 4Y98A 3WLFA 2XEDA 3H1AA 3JZIA 1I4OA