4YUYA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with isoquinolin-1-amine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
293
Chain Sequence
PGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
total genus 98
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuyA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuyA02
4U7TB 1FJXA 4YUXA 2EG5A 1XCJA 3KQWA 2O0LA 3GGDA 3NWEA 3TM5A 4AZVA 3V8VA 3ANXA 2Z6QA 3UBTA 5IKMA 3FTFA 4EK9A 1SUIA 4M7RA 3A7EA 3EVBA 3FRIA 2CKDA 1P39A 3LCVB 1BKYA 4ER6A 1NV8A 2BM8A 4QTUB 4XUCA 3K6RA 3CC8A 1JG2A 4QDKA 2PY6A 3GRZA 2HNKA 3NDJA 5DM2A 4R8RA 3S68A 2PKWA 3LSTA 3OFKA 4M38A 3UZUA 2CMHA 4GBED 1UIRA 4EMSA 2IFTA 3O31A 4PGHA 3DULA 1FPQA 3LCCA 4RVFA 4RWZA 1M6YA 3MHTA 3HVJA 5HIMA 4PIPA 5DXJA 4EVIA 4PYMA 1X1DA 1KR5A 4R8SA 3LBFA 4DQ0A 5FULA 4E2ZA 2JG3A 3BWCA 5K0BA 5K0LA 4MWZA 5C9ZA 2G72A 3A4TA 3B89A 4DMGA 5CVEA 3HCDA 4V0QA 2ZTHA 3EVGA 1F3LA 5DXAA 5CIYA 3PLAE 3H2BA 3PX2A 1JTFA 3EVEA 2OYRA 3G8BA 3TRKA 3ER8A 2AOTB 2PBFA 3OU2A 5FHRA 5DRYA 1MHTA 3FUUA 3P2KA 1X1AA 2AN4A 3FPJA 3LKZA 4H0NA 1QAMA 5FUBA 5EMJA 2VDWA 3UJ7A 2XYQA 5BP7A 3EGEA 2HV9A 2XBMA 4RTOA 1NBHA 2ERCA 1YFLA 3KR1A 4HTFA 5KYGA 1EAMA 2BR4A 3CCFA 4FSDA 3FUTA 3KPYA 4M36A 4CKBA 4E2WA 2PJDA 2ONYA 2QRVB 3G5LA 5LQRA 3JWJA 3FYCA 3PS9A 1BOOA 3C0KA 3G2QA 4E2YA 1VQ1A 3HNRA 3EVZA 3UA3A 1QANA 3OZTA 5DPMA 1WS6A 3I64A 4FSXA 4WXHA 5MHTA 2I7CA 2OPBA 2WK1A 5BW5A 3M4XA 2EX4A 2PGXA 3QOXA 4YUVA 4K6MA 1EIZA 4P7FA 5HIJA 2HTEA 3TKAA 4C05A 1EJ6A 1WY7A 3G89A 4FZVA 2C7QA 3KQOA 4X61A 4AUKA 1D2GA 1R18A 1VLMA 1ZKDA 2B9EA 4KDRA 4PINA 2Z6AA 1VIDA 4JXJA 4RTQA 5GIOE 1KXZA 2VS1A 1FP2A 1KPIA 5EIFA 5EMMA 5K8VA 2ZZMA 4CTKA 5DTMA 3THRA 2JHCA 3KKZA 4Z2YA 1XVAA 2UYOA 4CXMA 3ID6C 2B2CA 3KQMA 3BKWA 5EHGA 3FTEA 3SSMA 1L9KA 5EIWA 4RYLA 3THSA 3HA5A 3R0QA 4GC5A 4CTJA 4A6DA 7MHTA 1P1BA 2VDVE 2R3SA 2C7OA 3PB3A 1TPYA 2PXAA 2BH2A 3OCJA 3UJBA 5K0JA 3AY0A 5E2BA 2QY6A 3OZSA 3TOSA 3C6MA 3P9KA 4KRGA 5C0OE 3HA7A 3GO4A 2AVDA 5LQCA 3NW9A 5IH3A 5GOZA 3GCZA 3X0DA 2XVAA 3OU7A 2ADMA 2P8JA 4RVDA 1RI4A 2G71A 2ZWVA 3CJRA 4RVGA 2ZULA 3SVZA 2YR0A 1I1NA 4OQEA 4RTSA 1U2ZA 4FGZA 1XTPA 5HILA 2YTZA 2PXXA 4FT4A 3I9FA 5CCBA 1WXWA 4GOND 1RJFA 2IGTA 2PV0A 2Z6UA 5HZMA 2C7RA 4QTTB 2QE6A 1NW8A 4E2XA 5EPEA 4E70A 1XCLA 3SMQA 3JWHA 4C03A 4ER5A 1V39A 3KQVA 4GOMD 2FK7A 5DRTA 5HIKA 1YF3A 1JSXA 3AXSA 4QVGA 3A26A 2LD4A 3FTCA 3UFBA 4X60A 2I62A 5EQJB 3UA4A 4PYQA 4WVLA 1UWVA 1M6EX 3GDHA 3AJDA 5F2OA 3KQSA 3M70A 2BM9A 5FA5A 5K0CA 3ERCA 5CD1A 4FS8A 3UJ8A 2K4MA 4R6XA 1INLA 3HEMA 3P71T 3HCBA 2IH4A 1G8SA 3TLJA 4F84A 3DMHA 2EJTA 3F4KA 1HNNA 3IV6A 1SVUA 2GA9A 3LGAA 3SGLA 2E5WA 1JTEA 4PCAA 1KHHA 3LECA 5CUQA 1VL5A 3LL7A 4L7VA 2OB1A 4LG1A 3SXJA 3T7RA 2PX5A 5EKUA 3REOA 1KPHA 3EMDA 3G2MA 1O9HA 5E2AA 2UZ4A 2QM3A 4OBWA 2AOXA 4A6EA 5FTWA 2KW5A 1P91A 4PWYA 2BR5A 1ZHFA 5T64A 3GIWA 4X41A 4B17A 1N2XA 1ZGJA 2DPMA 3OPNA 4MTLA 3LX6A 2AR0A 4PYKA 4ZTBA 1HMYA 1JQ3A 2P3OA 5E1BA 4RTPA 3DOUA 1RJDA 5DX1A 3KR9A 4ATNA 1WZNA 3IEIA 3FUXA 3LDGA 1D2HA 1G38A 3FUVA 1AQIA 3MCTA 5DTQA 5H02A 4C04A 5GINE 3P97A 2FRXA 4HTFB 3IHTA 3V97A 2AVNA 2OB2A 3BT7A 3ELDA 3A27A 4ER0A 1UFKA 4GF5A 2CWWA 5LSAA 4KWCA 2AN3A 2PWYA 3E05A 4KW7A 3EVFA 4O29A 4X1OA 3P9NA 4C06A 4CKCA 4R6WA 1KPGA 2OXTA 1IY9A 1NW5A 2YXEA 2HR1A 4HRAA 5FHQA 4MHTA 3U81A 1VPTA 3AWIA 5CVJA 3B3FA 3HCCA 3NJRA 3BUSA 4YUWA 1G60A 3R24A 1XDSA 4GUAA 5HOQA 4PYLA 1EQAA 5M5BA 2BR3A 4RSRA 1VP9A 4P58A 1YB2A 2G8NA 3SR4A 2GLUA 5D1HA 3TPZA 5T6BA 4IKPA 3FRHA 3I53A 5G02A 5K03A 2P7IA 5KQRA 4RX1A 2ZFUA 5KVAA 4DA4A 4BY9E 1X1CA 3BGIA 2FK8A 4IV0A 3MTIA 5GP1A 2AS0A 5K01A 1D2CA 3L8DA 3P9IA 4DCGA 2G1PA 4FR0A 2P35A 3G5TA 3GRUA 1QZZA 3OU6A 4PONA 3UJ6A 4F86A 3VYWA 3BWYA 2FCAA 3P2EA 3EEYA 2UYQA 3ELUA 3FPHA 2ZBQA 2XYRA 3EGIA 3NVKI 3EVDA 3KR2A 4OBXA 3KHKA 1RI3A 5DT2A 5E1DA 1YZ3A 3DTNA 1ORIA 3FPGA 3PVCA 2EJUA 3KPVA 3P2IA 1AV6A 1TW3A 3DMGA 3Q87B 4G56A 1R74A 3KQQA 2IPXA 2Y1XA 5LR6A 2JJQA 2N47A 3GRVA 3EVAA 3HCEA 3TFWA 4YUYA 5F2KA 3HVIA 4DCMA 2EFJA 4QPNA 4YV0A 5K05A 5JUWA 8MHTA 3TM4A 1L3CA 2IP2A 3TQSA 2PSSA 3HVKA 3CVOA 3EMBA 1M0EA 4DKJA 3FTDA 1RI5A 2ZBRA 3B7PA 1Q0TA 2ORED 2PT9A 3I5UA 5DWQA 2ZIEA 3DR5A 5CM2Z 2FHPA 5C1IA 1N7JA 3C6KA 3DLCA 4QQKA 3UJCA 2V74B 1KYWA 9MHTA 1B42A 2CMGA 2AZTA 3FPFA 4DZRA 3KQTA 4RVHA 5CVDA 5EC8A 3T7SA 4E31A 2P41A 2PX8A 3ELYA 3LDUA 5E8RA 3JWGA 5EEHA 4RTKA 2H11A 2Y1WA 1T43A 1H1DA 1P1CA 2XYVA 2VZ9A 5ICEA 3AXTA 5U4XA 5LQKA 4DF3A 3SSOA 3DXZA 5HEKA 1WG8A 4BP3A 4C07A 3DXXA 2OBFA 3LHDA 3PFHA 2PT6A 3D2LA 1RI1A 2ESRA 2YQZA 1SUSA 2PX4A 3MGGA 2ZVJA 5HIIA 4C08A 3HCAA 4E32A 5FWDA 1ZGAA 2GPYA 3M6UA 4PYNA 1YZHA 5GWXA 3TMAA 4GQBA 5B1SA 5EZSA 4E30A 1KYZA 5CVVA 3G2OA 4LECA 1Z3CA 3VC1A 5ERGB 1FBNA 5FQOA 1BHJA 4OQDA 2VP3A 1NV9A 1NBIA 3HVHA 5E1OA 5FADA 3ELWA 5EZQA 5BW4A 3FYDA 5K0GA 1JQDA 3RODA 2O07A 3KQPA 4OA8A 2NXNA 1O54A 2P3LA 5P8WA 1O9GA 3KPUA 3NWBA 3T0IA 3ER9A 2P7HA 3B3GA 3DP7A 2OO3A 4PNEA 5DX8A 4POOA 5DSXA 2ZBPA 4LWPA 5HFJA 10MHA 4YUZA 1YUBA 4HC4A 2OY0A 3LDFA 4AZSA 1JQEA 3CBGA 5LQNA 2ZZNA 1Y8CA 4HH4A 2JHPA 1JG4A 1DCTA 4U7PB 3LKDA 3NMUF 3LCUA 2NP7A 4BLUA 5K0FA 5ICFA 2XVMA 3GU3A 3G2PA 2I9KA 1EG2A 5CVUA 2WA1A 1AQJA 5LQUA 3IYLW 3TKYA 3UWPA 1Q0SA 2FYTA 3QV2A 2PX2A 5JR3A 4AX8A 2IBSA 2BZGA 3VSEA 4QDJA 4GC9A 5GIPE 2F8LA 3OE5A 3EGVA 3UJ9A 5EMLA 3P8ZA 1YFJA 2AOUA 3K0BA 4UOEA 3R6TA 4P7KA 3G7UA 1JSZA 4RV9A 1SQGA 5GM1A 3EEOA 1PJZA 4PYOA 3R9XB 2P40A 4KIFA 1XXLA 3DXYA 3NTVA 1NE2A 3M33A 2OZVA 2P1DA 4PCLA 2VDUE 1RJGA 1NW3A 3BZBA 5LQJA 2B25A 4MQ4A 4YV1A 4QVKA 1JG1A 4AZWA 5KQSA 4CWAA 3EPPA 3EVCA 5KS2A 1PRYA 1G55A 3KPJA 4XCXA 1ZQ9A 3RW9A 3BGVA 2YUIA 3GJYA 4Y2HA 3MB5A 4AZTA 2IIPA 2B3TA 5CCXA 4EKGA 3DMFA 4PGGA 1ORHA 4FT2A 4IWNA 1VP3A 4OA5A 2A14A 3HCFA 5EHIA 4PYJA 2ZIFA 2ZWAA 4ER3A 5EVJA 4OX9Y 3B3JA 3NVMB 2AN5A 5EEGA 5DSTA 5K0NA 4RTJA 3GRRA 3Q7EA 3VC2A 3BWMA 3DLIA 3E23A 2NNWB 2DULA 2ZLBA 3BWBA 3CGGA 5ICGA 2IH5A 4QQNA 2IDKA 1R00A 1X19A 4R05A 4RTLA 4M37A 2PWPA 4KVZA 1WXXA 4EQZA 1L3BA 2YXLA 4C4AA 1G8AA 5DM0A 3ORHA 1IXKA 2GB4A 2ONZA 3G8AA 3LBYA 3A7DA 2CL5A 3PT9A 2O57A 1KIAA 4HG2A 5E8JA 3BXOA 4F85A 1SKMA 2V7EA 4BP1A 1RI2A 5EOVA 1SG9A 1XDUA 4RTRA 3UJDA 3C3YA 2H1RA 3E7PA 4E33A 3G88A 2GAFA 2UYCA 3O4FA 1I9GA 5K0EA 1KP9A 4RTMA 2HMYB 1X1BA 4YV2A 3GRYA 3MAGA 3R3HA 3WSTA 3I58A 5T67A 3MCZA 2AOTA 2GS9A 2AOWA 5K09A 3FUWA 2UYHA 4CKEA 2ZIGA 5FA8A 4QPPA 3PX3A 3HTXA 1I4WA 3PFGA 2NXJA 3NDIA 3SSNA 3FZGA 2B78A 2YVLA 1FP1D 2ZCJA 2HWKA 2OKCA 3KPWA 2ZW9A 3KQYA 4EKIA 3CJQA 5BXYA 2QRVA 1R8XA 2G70A 3KU1A 5EG5A 2NXEA 2O05A 2YX1A 3JWIA 5LQAA 2NYUA 4HGZA 2YXDA 2H00A 5DM1A 4DM3A 1JR4A 3OE4A 4RTNA 4NECA 4X63A 5E9WA 3M6WA 1QYRA 3DH0A 2Q41A 3FPEA 3E8SA 3M6VA 5DM4A 5E9QA 5E9JA 2IBTA 1R8YA 2QYOA 4MIKA 1BC5A 1NW7A 1MJFA 4KDCA 4XUEA 5D1NA 1AF7A 3UJAA 1NW6A 2NXCA 3CKKA 1QAOA 4KIGA 3P9CA 5DX0A 1DUSA 1XDZA 1QAQA 2PLWA 3GWZA 4ISCA 4YMHA 3M6XA 1NT2A 1VE3A 3A25A 1NKVA 3HM2A 3MERA 5EKXA 1EJ0A 2IDJA 2JHAA 5ICCA 1N7IA 1SQFA 2ZZKA 4Y30A 3CJTA 3MQ2A 3HA3A 3TR6A 2PXCA 3ME5A 3LPMA 5DLYA 4PIMA 2R6ZA 2JH9A 4YMGA 3O7WA 3HP7A 4GOOD 1IM8A 1VBFA 3KR0A 1DL5A 1JG3A 1TW2A 2IH2A 2GH1A 4GOLD 3OFJA 2ZSUA 2AOUB 3GXOA 5EGSA 3BKXA 3QOWA 5GM2A 2PVCA 2NP6A 1ZG3A 5FQNA 2P3QA 3T7TA 4ER7A 4XUDA 2WA2A 3GNLA 5E1MA 4HGYA 5FCDA 2C7PA 3MTEA 4PYIA 4BLWA 3B5IA 1RJEA 3SX0A 3OZRA 1F38A 4FP9A 4P7GA 4IV8A 5DTRA 2JH8A 3SM3A 5EMKA 1L1EA 1R6AA 4V0RA 4BLVA 2O06A 4P7JA 2FPOA 1XJ5A 3C3PA 4LWOA 2I6GA 3RIEA 1OR8A 3BGDA 3DUWA 4HSGA 5FWAA 5F2NA 3PTAA 1L3IA 1G6Q1 4GEKA 2AOVA
chains in the Genus database with same CATH superfamily
1C2YA 3P27A 1LDYA 1C8VB 1E96A 1HYQA 1TZBA 3AVPA 4YUXA 2VTEA 3NWEA 4MKRA 4ZA2A 4AZVA 1KJ8A 1XCOA 2CXTA 3F7NA 3SEFA 3H5OA 2BGWA 2O3TA 3ZDBA 3O03A 4EI2A 2O8CB 4KXMA 5LLDA 1G5IA 4B1FA 4IIFA 3U6BA 2V5VA 1KI7A 2HMUA 3NHJA 4AG6A 2XTMA 1CW2B 1PK8A 1BH2A 1VYVA 5IJ9B 2PPLA 1QRRA 1RWWA 3S68A 2QBYA 4R8RA 2Z3WA 3H9JA 2Y2VA 1ZHHA 2H1CA 1LK5A 4OAQA 1AKEA 2GJ4A 5GONF 1RXEA 3T6KA 1KY3A 3DYBA 2I4MA 2ZRHA 4IO1A 3QA9A 1M6YA 2XZOA 2IY9A 5JNWA 4N1AA 3WK6A 4DQ0A 4L4UA 1NIPA 4KSBA 5KJEA 4E2ZA 1XAJA 4LGYA 5IVKA 2A9VA 2H7YA 2RKWA 3DYVA 2RGWA 1DRJA 2FPRA 2NT3A 3NP7A 1DDGA 1CD5A 4JOSA 4RORA 3UATA 4YLYA 2CHGA 2RIRA 3A1SA 5HW0A 3ZTYA 4Y18A 1IYZA 4IQ0A 4XFJA 3E58A 4NAHA 3NIWA 2IV7A 1PR3A 2D13A 4LYGA 3ZJVA 2BFFA 4MUJA 3C16C 1O95D 4NZMA 4ND1A 2VDWA 1J49A 3GFOA 1ZMXA 3PNSA 2VNSA 3PPVA 4XW2A 1M2JA 1DQZA 2EP5A 4FN4A 2NTVA 3E82A 1UC5B 3GJ6A 3KFLA 5EJ2A 4QDTA 1E9RA 1CZUA 1JDPA 2IYYA 1EGVB 3RSCA 3UH0A 3ZE0B 5MFPA 5LQRA 1JFLA 2QRVB 4IPTA 3ZFNA 4QYMA 2ZWIA 5IN4A 2I3DA 2W8ZA 3PS9A 4W5HA 3FVTA 1HOTA 1T3GA 4FKZA 4ZOBA 3HNRA 2Z8ZA 3FAZA 4RAQA 2CEKA 5JEEA 3DPUA 4FSXA 4K6HA 5JXHA 4XM0A 1CUHA 4YRLA 3V7FA 5CG1A 4YRRA 3IOMA 1T4CA 5CLHA 3O91A 4BNWA 3IDZA 3X1XA 4JYAB 5IYZA 1MIHA 4FOLA 1D4OA 2KSQA 3WYBA 4JXJA 4N5LA 1D9XA 1LU9A 1NATA 4NICA 4DNXA 5HCIA 2OZPA 5GIOE 1YQ9A 3GG9A 4Z4IA 3K8ZA 4R81A 2F1JA 1IQ0A 1UDXA 1U0RA 4O2LA 3RRZA 3KKZA 3ESYA 3TLZA 4DMKA 1PGOA 2FSIA 3HQ4O 4PNZA 2UYOA 4ZU3A 4DN6A 3J81k 4IOLA 3N28A 1T8YA 3HJNA 4R68A 4GC5A 1THTA 4Q1VA 2HZBA 1A8HA 4MVJD 3VBCA 4W5NA 3LF2A 2IYWA 2DZDA 3NXKA 3WLOA 2H3EA 3KFXA 4LHYA 3EBOA 3MK31 3OCJA 2P2DA 4UZEA 5DZSA 5BVHA 2A9PA 4GYWA 1FYVA 1XWIA 2GK7A 2ZUWA 3LF1A 3HZRA 3LLSA 3C1OA 4KRGA 4MB2A 1AU9A 1UEIA 3N87A 4KYTA 4QL3A 2BGIA 1THZA 2H54A 4CLRB 1TAQA 3AVUA 3MZ0A 4IBOA 3JRXA 4B7XA 1ZYUA 3RJ5A 1K7YA 3CVWA 4G2NA 1QS0B 1WSDA 2UXDB 1XD2A 2ERYA 2AQHA 1XNJA 4HAYA 4G9EA 4Q21A 4V0LA 1SHKA 2MSDB 4ITUA 1A9XB 2OG1A 3QFFA 1J2UA 4Q0MA 1SBTA 1XQXA 1JE1A 3KAJA 1UFQA 2VP0A 2BBTA 2FPWA 2KYRA 4UM9B 3D6MA 2A58A 1TQ8A 1OU0A 3G1WA 4NPHA 4Q39A 3T3IA 3U1TA 5IW8A 3ZGVA 1XCLA 2ECFA 4LPKA 5PGMA 4TXHA 1EUCA 3PNPA 3GJZA 3M1AA 2G07A 5BN4A 5EXEA 4WCDA 5ALFA 1NURA 3PNLA 4I66A 3ZV4A 1DV2A 3OZ7A 1LFAA 1TEHA 4HUJA 5FUXA 3ETCA 4EF6A 1DGQA 2OV6A 2ZJBA 2W2LA 1P5JA 2NZVG 4ZYTA 2BSQA 1G21A 1Y8RA 3OHMA 1DKQA 2BM9A 5CD1A 4FS8A 2SICE 4RF5A 2CZCA 2W2VA 5KKCA 3A6EA 4EHIA 4AN4A 1OC2A 1DKLA 3DCNA 2B4QA 3BREA 3MLAA 2XA9A 3ONVA 3U3KA 3UKOA 3S6JA 5FUQA 2FQQA 2E6KA 2IX9A 1J8VA 3E81A 3TOCA 2GTHA 4FEYA 1R4NA 1VLHA 4NMXB 4D4JA 2Q1TA 4LV8B 5CUQA 4D46A 3MWKA 2RGXA 3D3WB 3OT1B 1CQPA 3IKJA 2NO1A 4O0LA 4P8RA 2PX5A 1QP8A 2WIAA 1G20B 1P4HA 3ICWA 1MJ5A 1HSOA 4QHYA 2BKAA 2PS3A 2ZR7A 2VBIA 3RT9A 4Z54A 2XA2A 1K86A 4ZKEA 3PXGA 4GG1A 5I7UA 1IZYA 4US2R 2GXAA 2DPHA 4OOFA 4H4CA 3OTHA 1JQ5A 1RHKA 1JUDA 1PGJA 4RSHA 5K3DA 1HMYA 1J8DA 1MOSA 3IJEB 1JKMA 3UV3A 4Z4FA 4HGPA 1M8JA 4MKGA 4RHYA 4WFKA 2P78A 2YZNA 1RQLA 4X90A 2DPYA 4WTOA 1NSFA 4BLPA 5ANRB 1OIVA 2HC9A 2PMKA 4NZNA 4LZOA 1N1GA 1MA3A 3NETA 3CLUD 1DAEA 5DTQA 2JB9A 3LLVA 4XB2A 1Q0QA 4C30A 3DZIA 2B92A 4G0PA 1LLFA 3A9VA 3AERA 3EVFA 4PX2A 4RM3A 2RGCA 3L0OA 4DXAA 3R3SA 3WWCA 1TF2A 5FBLB 2G28A 2FN8A 3UMJA 1P0CA 2FX2A 1NUUA 3CS3A 4KWIA 4JP3A 2I99A 1XC7A 4D6YA 721PA 4KV7A 5HJEA 1UAAA 3E1SA 1C3EA 1GUYA 4N6GA 4XYLA 3KTAB 3ED1A 5G02A 4G0VA 4XUGB 4YJ3A 1KERA 3I6ZA 5CDFE 3UKDA 1NQOA 9GPBA 4RHEA 4MB6A 5BUQA 3W4JA 3LT5A 2IWRA 2COUA 1YI0A 1QQTA 1ARZA 4LF5B 3L40A 1GZ3A 3OU6A 4PONA 1MUUA 4QRDA 4XPIA 2PUGA 3NOVA 1ZD1A 3T7CA 4BFUA 1I6MA 4X8MA 3DT8A 1WRBA 1Q95A 3GEEA 2ADFA 2AWNA 4F6RB 1NQTA 3I4CA 1Z2CA 1AK2A 5HJ7A 4IWXA 3Q8MA 3KQQA 3IVRA 5A3SA 1TDJA 2JJQA 4TVKA 3GARA 3R0ZA 4KEAA 4QXMA 3K6SB 2Q6VA 1QX4A 2Z9BA 3QTTA 5JBIA 3WX0A 1QGUA 3HBMA 4U2CA 1U3GA 3G8CA 4OYHA 2DH5A 4F3RA 1L9XA 2XVZA 4J1NA 1PYOA 4DCJA 5A9RA 2J7KA 1H93A 1N2ZA 4KXWA 2UZ1A 4Y6OA 4E1AA 4EKNB 4RKFA 2C8KA 5BMVF 1QYDA 3BSWA 3L41A 5CM2Z 2HQ1A 5BV2P 1BVHA 2FHPA 4RPGA 4C4ZA 2JGLA 1JQAA 1NOKA 4Z0HO 5IK2A 1SKYB 4UCXA 3RHZA 3HJCA 3OIWA 3E7DA 3GLHE 3SZLA 3T41A 1YQDA 1BXRB 1I3LA 3AINA 4D9JA 4FEAA 4L50A 3A3KA 4E31A 2F90A 3OF5A 3NCTA 1YOVB 1YHZA 3A9RA 4RTKA 4WCFA 3NM6B 2XGMA 3WMFA 4RULA 3C5HA 4YCJA 2BBWA 4CDRA 1U1CA 2XYVA 1CZNA 2FZ4A 2XHZA 4L8WB 4MQ6A 3RQIA 1CUAA 2HO4A 2Q3BA 2IE8A 2FEPA 3BTOA 1GILA 2DT8A 3GJSA 2P5UA 1LD3A 2RH8A 2WM8A 3OKAA 3SIPA 3AIOA 2BZ1A 2OG2A 2W48A 2XADA 4RV4A 3V8RA 4BX3A 3V7UA 3L4SO 5HIIA 5T3YA 4C08A 1R0CA 2BEUA 2FEMA 4I14A 1EJBA 1Q6YA 2AJDA 3D54D 3BZUA 2GCOB 2QTVA 1DO0A 3DVAB 2GR9A 3LUAA 4LBZA 1NQ5A 4G4IA 1ZGAA 1ABBA 4BNTA 1EFVA 4ITRC 2ODWA 2N1MA 1T9ZA 4LECA 3QYPA 1EFTA 4D97A 5AM0A 3D4PA 1BHJA 1KZ1A 3IS3A 4TS9A 4LE0A 4XM1A 3K9CA 4P6VF 3TUJC 1RMYA 3M1IA 1GO2A 5G41A 1NP3A 4UTOA 2VRWA 3KQPA 4GBJA 4JH0A 3FIUA 1GRCA 2IXTA 1LLQA 5P8WA 1O9GA 3DXFA 1XZDA 3L6UA 4MQFA 4QUJA 4RXTA 1W19A 1F8UA 4RK5A 2REQA 5EZYA 4HVLA 4D45A 1P60A 4LF6B 3U3ZA 5F52A 3RFCA 1QH1B 4DV1B 2OSBA 5L4NA 2WAAA 4A23A 4DADA 1Z6AA 3HYLA 2QZPA 3ZFPA 2JGDA 3QVUA 5JH7A 3Q3JB 3U1VA 4CT0A 1EG2A 3IMKA 1LS1A 3DEFA 2FZKA 2VJMB 2QN9A 5IDVA 5LP6B 2FYTA 1OU4A 4WIAA 1TQ6A 4BUZA 4NZYA 4EW3A 2IBSA 5DOZA 2XKAA 1U0GA 3WWDA 2QU7A 5FBRB 1GWNA 2X6RA 4C0BA 4B3MB 3DAPA 1AUVA 2OBMA 1XSEA 1T6ZA 1EGAA 2PQMA 3NCHA 3RSZA 2AOUA 3DE7X 4MW5A 3OLXA 5BQOA 5HIAA 5GM1A 5H59A 4UUBA 1SQGA 3L7CA 4EO9A 3GJ0A 2BDEA 4TN5A 4JENA 3BM5A 4H9GA 4Q3EA 2O5RA 4BB6A 5IBQA 1JFRA 2NUAB 1I9CA 4D6XA 1UT8A 3R4CA 2NWQA 3RYCB 1NNEA 3EUEA 1U7WA 4DGQA 5AOBA 1IY2A 5ABPA 1PJRA 4IHQA 4R8KA 6GPBA 1EQ2A 1Y7LA 1OREA 1ZM2A 4YV1A 4IHKA 4E5SA 4EHFA 1R5OA 3DB2A 3DCYA 3K2QA 3VZCA 2X5JO 1G55A 5C5IA 4FEGA 4OHKA 3WO1A 1UXHA 1G5QA 2CNLA 2C82A 1DXYA 1K7FB 5BQ5A 3VHQA 2UAGA 3GJ5A 4BEJA 2YIJA 4XAQA 3GJYA 1JNXX 4JR0A 2B9VA 1DC5A 4YRCA 3EXFB 4XLZA 1QOZA 1D6SA 3AZQA 2PMCA 3LJKA 3GFBA 1ENPA 4RHTA 4BNYA 4C0QC 4ZT5A 1JR3E 4Z9XA 1YTUA 1XRLA 1U5BA 4ON9A 2BEWA 3F98A 4HWTA 2CVHA 3TRJA 4CI9A 1SKQA 2Y4OA 4WXEA 4ZYUA 1NI3A 1ZP6A 5K0NA 4MR8B 2REXB 4P4GA 3C41J 3AVOA 4KAFA 4TS4A 4IFEA 2R9VA 4DEYA 2XR1A 5AWFC 2HY7A 5ULLA 5ECYA 5ICGA 4JVLA 4S0XA 3ZWXA 4G1FA 3UH1A 4JVOA 5IAJA 2XOEA 4FVTA 1RR6A 5A4DA 3ZCPA 1V47A 4GICA 3WYNA 4JEMA 4NULA 5M7EA 3FZQA 1W47A 1X9GA 4Y0AA 4N39A 2FETA 1UFRA 5KTKA 2ZT5A 4OJQA 2H5JA 3JSAA 4UXIA 4LZNA 3GYBA 4N3CA 1N2CB 1CWUA 1EWTA 1QKIA 2PZJA 1NVFA 3E7PA 4ZV7A 1A88A 4NJOA 4RK6A 1C9NA 1QF9A 1J5XA 2VHVA 4CEJA 4D96A 4PCUA 3D6FA 2PH1A 3EGOA 2FQXA 3GRYA 3KZNA 5AVJA 4ZVVA 3SFZA 1AKRA 1R9GA 3OQVA 1G16A 4O4IF 3IODA 4YO8A 2OCPA 4P33A 4S1PA 4HAZA 1OHHA 2JIQA 4QO8A 1I4WA 1PJSA 1J5PA 3AL2A 4QPZA 4PBRA 3RK1A 1YV9A 4WBNF 1E1CB 3ML1A 2GBCA 3IOCA 3OE7D 1NJGA 1TIKA 3IR5A 2J3JA 4P4SB 5EG5A 4ZMRA 4ZQFA 2P11A 2VJNA 3VKWA 3JATB 3JY6A 3L8MA 1PZEA 5KJ1A 2O7QA 1XUOA 3QE3A 3I6BA 3AEUA 3NBKA 1Y1TA 2ODAA 2VYQA 4RTNA 1F8FA 1UPAA 2WUFA 3RS5A 3U80A 2HA4A 1P17A 3AESB 2CUTA 3PQEA 1K6IA 4IDCA 1DIOB 3C43A 4UC0A 5C8ZA 1SCUA 1X1RA 4NL4H 4X20B 2YNMC 1QHFA 3VNUA 1Q11A 4OQ4A 3PQCA 3ZY4A 4V1CI 4P9NA 4UCQA 2QG6A 1SGWA 1II9A 2JHAA 4CM5A 2VSYA 3R5HA 2OUIA 2VXBA 4X54A 2BKLA 2P4UA 2ZJ6A 3R3JA 4FDUA 1GFZA 1VCMA 3I6QA 2JF0A 3DEYX 4G0XA 3ZTWA 3FHCB 5JXJA 4Q3KA 1A0OA 4M1YA 2ACKA 4RF4A 1ECBA 2ZRCA 5HRAA 3CZ9A 4R7GA 2YWFA 2FW1A 1WCYA 4Y1GA 4TKVB 2ZSUA 1EI9A 1TKBA 2R1ZA 2QRMA 3RT7A 3HWWA 1B6SA 5BV7A 3PITA 1QZ3A 1IU9A 3NKVA 3LXUX 1HKHA 4BVBA 2VFAA 2X14A 4ALNA 4HGYA 5JZOA 3M9LA 5FCDA 1UK6A 3MTEA 2IPLA 4RESA 3I8XA 4H60A 3GGOA 3AY7A 1NQVA 2E4WA 2NQ8A 5FBVB 4HLUA 8LDHA 1ZD5A 1G17A 1U5CA 4MKHA 1UZAA 1XFAA 3ZDDA 1T10A 1YL5A 1QH9A 3W04A 3ST7A 5HZHA 2IOYA 3NYRA 4BLVA 4UZFA 4ZCIA 2FOLA 4FZ5A 3T7EA 2ZYHA 2DUJA 1TCBA 2BEVB 3A9TA 4NEGA 2B2XA 1L6IA 3G0GA 2DQKA 2XUJA 1JFFA 1PWHA 3IEXA 4HSGA 5FWAA 3E9CA 4FE3A 1E69A 1UJ5A 2GZHA 4CEIB 3ILVA 5HM6A 1FJGB 3OUZA 3AJAA 2C20A 4PO8A 3EF0A 1FJXA 3RS0A 3JQ8A 4OQNA 3Q2KA 5DNWA 3EGCA 2P30A 2P62A 3I3SR 4ZI7B 4N6OA 1G64A 4MR9B 3KKKA 5D3ZA 1K98A 3CUYA 3IA2A 2QNRA 4A2WA 4CJXA 1OAOA 2VSXA 4A82A 2IY8A 7MDHA 5LQDA 1OXTA 2P5YA 3UC9A 4QTUB 5C37A 2Z0MA 4YQEA 2YV2A 3QVGB 1BU8A 3O3OB 1PJ2A 3AR7A 3V2GA 3AVYA 3I1JA 4J90A 1UBKS 1TECE 2BY4A 1A4RA 5EIXA 3OFKA 1N33B 1LZLA 3NHAA 3RV3A 2HRBA 4TTQA 1IK6A 2IS6A 2P75A 1ZCJA 5GV8A 4X7MA 4ALKA 3U44B 3FJOA 1AKVA 1PR4A 1W5FA 1U1GA 4FKMA 4R2LA 3HCNA 4HNAA 1UOQA 3FGPA 3ABOB 5KQMA 1H22A 4FDTA 3L8FA 4XJTA 4TUYB 4HEQA 2F62A 4UM8B 5TVKA 1MRSA 2G6TA 3HXPA 3P9RA 3D4BA 1QG0A 2ZTHA 3EVGA 4IAOA 1XZFA 3H2BA 2FQYA 3PX2A 3ZHOA 2HA0A 4CLDA 5J5CA 2X22A 1NLMA 2YXNA 4K3UA 4OQPA 5JDCC 4ESHA 5JASA 2J0SA 4GQIA 3DWGA 2FRVA 2PBFA 1WMFA 5E38A 4EITA 3AM5A 3N2YA 5I9NA 4H18A 1T35A 1NVEA 2UVPA 2XUDA 2CSUA 5J4LA 2XBMA 3FNBA 5LQMA 1VKNA 4DHWA 1EAMA 4NTZA 5BYBA 2PSDA 3UBMA 3W7VA 2V8BA 2OFWA 5H68A 4RKQA 4MEJA 1DLIA 4QOJA 3CUKA 1SC4A 1BOOA 1RKUA 1J97A 1FS6A 1KFBB 1PR1A 5IKEA 5DI9A 1UZLA 3UA3A 1BE6A 3OZTA 1PCXA 1VYHA 3E35A 5J2UF 1J0XO 3EGDB 2FI1A 2GYWA 3IRUA 4URFA 3QFRA 4QELA 5LZ7A 2ZE7A 5DHPA 4D4GA 3SJBA 3BCUA 3DBLA 1N5MA 1QIEA 2ZXFA 3GQBA 4C0KA 2QF7A 1D2GA 1PQUA 2TMGA 4RZ2A 5C8XA 1ZINA 5ALNA 4X00A 4UTPA 3QU9A 1KPIA 3WB0A 4MGZR 2NU7B 1M9NA 2C9DA 3DNPA 2O8DA 3NJ8A 3C3JA 2WTAA 1V35A 5IC4A 1DOZA 4EF4A 1VMAA 3LO8A 4MUHA 3HJFA 3LP6A 3UFXB 4L8FA 2KX7A 4OU5A 1XEFA 1UODA 4L3VA 3SXUA 2VNIA 1T5BA 1MQSA 2GYYA 2J5XA 1TTHA 4X71A 3DLHA 3ESXA 3S27A 5LDGA 5BVGB 2CK3A 3LW7A 5K0JA 5KYXA 5D8DA 4ND8A 4LTNA 3KQHA 1ZH6A 1Z5OA 3FZYA 4R01A 4O5AA 3ISTA 1CULC 1PTJA 3CF6R 5JJCA 2QDKA 1EFKA 2V7PA 2FZWA 4KXXA 3TI9A 5LZ8A 5J5VA 2AQ8A 3IJPA 2ZI3A 4C7KA 1SG0A 4XX1A 4DMFA 2ZPTX 2EHDA 2W8BB 2AD5A 3MTBA 3A06A 4RVGA 2GN9A 5CTAA 5IN5A 3UMBA 3DNMA 2ECKA 1Q7EA 2R6CA 4MWGA 3ZVNA 3NTLA 2VRNA 2OPHA 2XUZA 2XMGA 3AEKA 3NHRA 2FWNA 3QWHA 1XFDA 4MJ3A 4W9NA 3TQFA 5EJMA 1W4CA 3WZLA 5BRAA 1XRQA 1Y4DE 1RIFA 1RTKA 3BXFA 2ZBUA 3GELA 4IFTA 4PVDA 2BONA 4FIZA 1TA9A 1B0PA 2BRUA 4MGYR 1SPBS 5HIKA 4NARA 5TPWB 1T0HB 3AW9A 1IJEA 2GPBA 5FBZA 3UA4A 4QOHA 4PLFA 4P4LA 4UULA 5C5CA 4QGSA 3HGTA 1SXQA 3UYLA 1W0JD 2ONCA 1VKRA 2QT0A 4JJIA 2V6JA 5G3ZA 3ZBTA 5KNBD 3VKGA 5CT6A 5B3JC 3AL0C 3BQNB 3HEMA 3ECCA 4DR1B 3NBYC 3HCBA 4WK0B 4DNOA 3DBHB 2QTLA 2E2WA 2G80A 4L74A 2IXAA 4F84A 2FV8A 2B8NA 3E53A 4PFJA 4HZUB 3ABSB 4TZTA 4RPKA 3BXEA 1JTEA 3S28A 3AKYA 1PU2A 5JJ5A 1KP2A 3LL7A 4GI3A 3BVPA 3ESDA 3T7RA 1US8B 2DWUA 5HOEA 3SLGA 3EPJA 3HSKA 4C9BA 1NM5C 4YBZA 3VR0A 4BTEA 4B8ZA 1ZGJA 2QD3A 1CIJA 5EYPA 2AR0A 4BWFB 2KHZA 3R8CA 1GNTA 4F4HA 1XZBA 1FMTA 1NKTA 3F6PA 1M66A 4JKIA 5AJVB 3HJGA 2EX1A 3NAMA 4DSOA 2AEEA 2ORYA 3DF7A 3NDPA 1BW9B 2JL1A 3HFGA 2DQ4A 2JLCA 1FXWA 3H8WA 3GA7A 1G38A 4LSMA 4RV5A 3UK1A 4UHHA 1BIFA 2X8WA 2ZTUA 1OZFA 2DTXA 4JLOA 2C9CA 1CY0A 3KAKA 4MUMA 4UBOA 4EELA 5IASA 3AVXA 4PR3A 1ILEA 2H07A 4KWCA 5AVWA 1WR8A 1U7DA 1IIRA 4MAMA 2NVBA 2HNAA 3TTUA 1P29A 4WNAA 1NW5A 1EUDB 2I7XA 4BTVA 4YCCA 4AY3A 3FOZA 4PCVA 2G36A 5JCPA 1XJ0A 1VPTA 1G7CA 1I32A 1XCGB 4XIJA 1TD1A 4P3OA 4OQLA 5I4KA 5M5BA 1I1QB 3R9XA 1WBJB 2QQFA 3KEFA 3K9LA 2PBZA 3LTNC 5D1HA 4N76A 3AVQA 3O1IC 4HGQA 3PU6A 4MV5A 3V8NA 3QSYA 1U81A 3U7QA 3E7FA 4JSTA 1JU9A 2I55A 4FLFA 3UC5A 4D8XA 1S6YA 1ZD2P 3SHQA 4BQOA 1NX6A 2VTBB 4EATA 2B4YA 2UYQA 4L9RA 2R66A 4TX1A 1QFSA 1FCJA 3KR2A 2ZJ8A 2Z8XA 2JFNA 2OO5A 4I6GA 2EBHX 4M0LA 1WCIA 1FFSA 2ZRJA 4IIJB 2GM5A 4YJDA 5ER6A 4ZVSA 3MAAC 3SC3A 1FNDA 1Y3FE 3DMGA 4RXUA 3CPSA 1UPBA 2GETA 2GEUA 1NF3A 5THKA 3HP4A 3AF6A 3HCEA 3TLKA 4MAFA 3NO4A 4QPNA 4J4TA 2B35A 4RIFA 3TLGA 1G21E 2QTWB 3BMNA 3Q6MA 3OJWA 3WRYA 1WV0A 1LWNA 5EA2A 5KHLB 4AG5A 4ZZ1A 1RRFA 1UJ6A 2IJGX 1Q0TA 2F3UA 1Q7GA 4R31A 3VU0A 5LVAA 3H5TA 4UCFA 1OZ0A 2HZ7A 4X6LA 5A5DA 2MINB 1M1NB 3H9EO 1YE3A 2XRMA 3FYUC 5J40A 3QVOA 1L4KA 1T6BY 5G0TA 3LBAA 1WA5A 2B36A 3CB4A 3NRJA 1ZR4A 4DWOA 6YASA 3CQ9A 2P41A 1ZVVA 3CF4G 4V0NA 1WLSA 1V3VA 3NH6A 3T9BA 4DUGD 2IEAA 2IF2A 4PC1A 3JQFA 1KMHB 4DOMA 1GG8A 1M76A 2CCJA 1BZYA 1DXHA 1JG7A 1WPXA 1Y6RA 1ZI9A 3KVYA 4HSEA 5U4XA 1LPOA 5F12A 4ENQA 5F64A 4DNQA 1KQOA 2JKZA 3BS4A 3V4OA 4HN4B 4OHZA 4BV3A 2ESRA 3THWB 3U2QA 2ZVJA 5L3QB 5CLQA 2VTKA 4FC6A 3AP2A 2VDOB 2XMSA 3FMIA 4BQNA 4E32A 4MUXA 4LQDA 4IHAA 2FLKA 1R4MA 1QIKA 5FKJA 4CNBA 1C5KA 4GQBA 1FMCA 5EMNA 1DT3A 1SR8A 1T6XA 2RHTA 5K3SA 1QGED 5DVZA 1V11A 4JD5A 4DTCA 1I2BA 5DLQC 5FQOA 4CKYA 5ADHA 2RARA 1C1XB 4AJ1A 2JLAA 2OBBA 3G2IA 3D0RA 1JQDA 5I7AA 1JHRA 1T5OA 3VAAA 1EVJA 2V7TA 4N47A 3WLIA 2POCA 3RC2A 1V1JA 2PH5A 1JIXA 2PSFA 3NTRA 4QPDA 4BATA 4JYMA 4POOA 5CIQA 2NU9B 4EG8A 4C2BA 2PUBA 4Q3NA 1JQEA 2IKQA 3QZUA 2XYGA 5DGDA 3K9NA 1J0CA 3I6YA 1L7VC 4U7PB 4MQUA 1DRWA 1NOIA 1G1MA 1II0A 1YQUA 3DAFA 3E7XA 2GVNA 3FDFA 4R1QA 1NSTA 3AUTA 4UBKA 4YS6A 2ZS9A 1QV6A 1LH0A 1MT0A 1ORDA 1Z25A 2PRJA 2WA1A 2Q6OA 1DOAA 1YR6A 1P7YA 4IUBS 1A7AA 4KI7A 4BMDA 5IAGA 4DL9A 4ZALA 2WF6A 2BZGA 3FPBA 1XCMA 4X5OA 2CLIB 2RC5A 1RHUA 1JR6A 2QUHA 3ZHRA 3GT3A 5KYUB 1TTPB 1OXSC 3MJSA 4YCNA 1G98A 1NL3A 4LJ6A 5HKAA 3PKZA 3DFFA 4PZEA 4AM8A 4LOIA 3G9UA 4R5MA 3CRNA 3PGLA 2AC4A 4E14A 1U0LA 1V3UA 3E9RA 5DYYA 1Y9EA 4ZRDA 3TQOA 2DOKA 2VUSA 3V1NA 4ZGWA 5JNTA 2P9QA 5L9AA 4LK2A 3UF0A 1JI3A 1GTL1 4RAOA 4HY3A 3OOHA 1T34A 1Y82A 4Q1EA 3NWJA 1Z22A 3FXAA 1N7HA 4BFSA 1O6FA 4HDQB 3P52A 2G63A 2KBEA 1ZIOA 3Q6IA 4WZZA 4XDYA 3SZUA 2FPLA 2H2FA 2QG4A 3T12A 4CTOA 3AFHA 1L4EA 3LW8A 1J4AA 1CHNA 1FSPA 4PS0A 1AS0A 1RJ9A 1QBKC 1RW4A 1X7ZA 4LMAA 4GBMA 4Z8XA 1IDOA 2JAOA 4JIGA 3MGCA 4O5OA 1F7UA 3RR2A 4RTJA 1T2AA 3V9PA 2GJKA 3NBAA 3ZWDA 4CU2A 3AKDA 3KZKA 3SZ3A 1PGPA 1Z0JA 1ODTC 3E23A 3T54A 4AMBA 4MJLA 3DT9A 1IM5A 2QX4A 2YHAA 3OM9A 4N0QA 2IDKA 3C98A 2C42A 3AFNA 2VRCD 3G7SA 3A1TA 1DAMA 2CDNA 2CF5A 4UM9D 2ZJFA 4Z7QB 2R1TB 3E0QA 1U8XX 2WSSD 3P2JA 4F2DA 2ZWOA 2EW1A 4KYIB 2A67A 3EIHA 1TX4B 3T4XA 2C2BA 3C7AA 4F85A 1C1DA 3AC0A 3KJHA 1TKAA 2PJUA 4OQYA 4ZAFA 3ACBA 3WDLA 1H2WA 1VL0A 4G4GA 2RHRA 4BQPA 5K8TA 1SB9A 1GJRA 3AJEA 5FORA 4PPGA 1RKQA 1W85B 2RBGA 2AMYA 2ZTLA 1Q7TA 3OX4A 4NEQA 4RNCA 4C20A 3I52A 4LVCA 3DW1X 4ZI2A 2AOWA 3LXRA 4GGOA 5C34B 3KB2A 3T61A 1MV5A 2VWPA 5KTSA 2HFKA 2V59A 2C7VA 2ACWA 3SZOA 4AP9A 2JD0A 4OP3A 3F5FA 1D2AA 2EBUA 3H84A 4QU5A 3VDMA 1PX2A 1VYTA 2HSJA 2VDJA 1TYDE 3DVRX 4QBFA 2YMQA 5HE9A 4DHEA 2V58A 3KQYA 4H2DA 1UBMS 1LNZA 1VI6A 4ZK2A 3BXPA 3QNUA 4I9HA 5C1PA 4Z51A 5DM1A 4HDNB 4WCFC 4ETWA 2FZEA 2QVZX 4ZAGA 3BFXA 3CEAA 4Q4JB 4BMZA 3TIGA 3R7DA 2JAPA 3BFPA 3ETEA 3RWMB 4O4LB 4LRYA 3FVQA 3HFSA 2VHZA 2OQRA 5EMHA 3ZU6A 5JS7A 1GZ7A 3I34X 4TLBA 4AQ7A 1AF7A 3N8HA 5EEHA 1M5UA 1U2GA 1FFGA 3A1NA 1QAQA 2ZI7A 4NG5A 4OL0A 3S29A 3M6XA 1PZNA 3RU9A 4WT7A 2OE2A 1QNLA 2FW7A 2I1LA 1XRJA 2QN6A 4JC8A 5I7OA 4DT1A 2UUAB 3M9WA 1U2RA 5B1YA 2GX6A 5JHGB 2ZJ3A 1DIGA 3GDGA 5E6SA 9LDBA 5FL7D 4ZDJA 3GPCA 5IAOA 2R6ZA 5L3RA 1YCFA 3OESA 2I6UA 4TL9A 5BMVA 1EUQA 1IHOA 1JDJA 2CYAA 4IEEA 3SZGA 2ZPUA 1OQAA 1JG3A 5JLJA 1BS9A 2H5LA 1GT6A 1N2OA 1RIIA 1W5SA 2EJWA 2GH1A 1DJMA 2YZ2A 4QOIA 3U4QA 3MS7A 1H5NA 2PVCA 2C58A 3H5VA 1BFUA 3COPA 4EABA 3KT8A 2WA2A 4AQDA 2O3SA 1AUQA 2GM9A 5FFNA 2I22A 4GMFA 3VYRB 2GKGA 4J0GA 3QOFA 1J42A 2WWYA 4B8WA 4IV8A 5KJ6A 3DWFA 2EKBA 4YROA 3V6LA 4UBNA 4Q34A 1VGRA 4Y6LA 4HLCA 1UMCB 4ZV9A 5DM70 1MP0A 2EFGA 3CY6A 4GRDA 3W6ZA 4RZSA 4G86A 2WKRA 2C96A 5E6UA 4MX8A 1COWD 4BNKA 3PWZA 5THXA 1FX0B 2JD1A 2P2YA 3F46A 3L93A 4UU0A 5TQJA 2ZRAA 3TW4A 1JQJC 3L0SA 4YRJA 1W581 2BI8A 3Q15C 1JDNA 1D03A 3ZV6A 1W44A 3K6KA 4RKRA 4URHA 3TK1A 3NOQA 3WLRA 3DUFA 3U31A 4DCNA 5EP2A 4BO2A 3HVRA 2FVYA 1QQAA 1CQZA 3ITEA 4PZCA 5CB0A 2RJ3A 2ZJ4A 4YRBA 4B2LA 5B6JA 4X6YA 1MC1A 1J2EA 4JEIA 4OHRA 3SVTA 4PFSA 4B6PA 2BM8A 2J9XB 3FDIA 3F7TA 3VR4D 1CZKA 2LR0A 2AQIA 5BYKA 2OQ2A 1R0ZA 4ISBA 4YTEA 3RIXA 2DECA 3ONWA 2AZMA 2R68A 5IX8A 4ME6A 3LSTA 1YKSA 1LV8A 4TRMA 4M38A 1KF0A 3QVMA 4C5BA 1YJ8A 1ZL0A 1ZUNA 3LUPA 1Z13A 1XMXA 3A10A 5KNDD 2BFWA 4XSGA 4LJ8A 2O0HA 3LBFA 3SOZA 4EY5A 1S9HA 2GPTA 2OLKA 3MC1A 3ZE6A 4FCCA 4EJ2A 5C46F 1I36A 1AIPA 1Y7HA 3B89A 1O8BA 3QY9A 4I55B 1VBNA 3AU8A 3HCDA 5WRFA 2QV0A 3E8XA 5MN4A 1UJCA 2CCGA 2IU0A 3VR2A 5CIYA 3PLAE 2WAOA 3RLFA 5DBEX 2IYOA 5A9SB 2AOTB 4KE9A 4DYHA 3OIVA 3U16A 2H52A 5I7FA 3CBQA 2B8EA 4ZO4A 5FUBA 1SO8A 1WO8A 1C1HA 5A2QA 3DE0X 5B6IA 1CRWG 4J6EA 2OBXA 2BUCA 1S3IA 5ITVA 1LK7A 1O8CA 1EGMB 2FPPA 2HO5A 2EQBA 5DH9A 4N5DA 5CDUA 1LUAA 4Z4GA 4PIVA 2G17A 1JWLA 2IYTA 2JHGA 2XMDA 3B7WA 3BE8A 1WS6A 4WXHA 3EXHB 2I7CA 3UWDA 1E9VA 1F5SA 1ZM4A 1BE0A 4DSNA 1N2BA 4E4TA 2WIBA 1CR2A 1J9ZA 4GNKA 1DKOA 2C9MA 3TXYA 5FI3A 1EJ6A 4L75A 3VHLB 4EPRA 4BTLA 4C0HA 5AOVA 3DHYA 3N6RA 4L9AA 2A88A 4ND6A 1QG2A 3LC1O 1EK6A 4D0SA 4CEHB 2VS1A 4DQXA 4KMSA 2RK3A 5EMMA 1YL7A 2Q3LA 3T06B 4LYEA 2VEDA 4ZK6A 1GPWB 2DFPA 4PAOA 1AUPA 1FJ2A 1TIPA 4C6RA 4IXWA 2XWPA 3BTUA 1L9KA 3MEQA 2FP4A 4ZC1A 3EIEA 4J4BA 4PRKA 2FNAA 3MG9A 1Q0PA 3UT0A 1E0SA 5CG2A 4FGUA 1KI3A 4OQFA 4PN7A 4KPGA 3CEJA 4NCXA 3VDNB 2WTBA 4U2KA 5CNKA 5KAPA 1ZJYA 1JLHA 4TLCA 1QDUA 2V3CC 5A7HA 1M33A 2OKGA 1OGYA 2XQKA 3LXXA 3PUVA 3T7JA 1Y9JA 4RA9B 1CUGA 4AZ0B 4LC1A 3GCZA 2D5CA 5CVCA 4NJEB 3GRPA 3CRQA 1VHTA 4NVRA 4ZVQA 2NUPA 1T3LA 2FJPA 2XUQA 3IUPA 3PQ7A 3NPMA 1I5OA 4X8OA 4AJOA 4NBNA 3VNBA 2Q5IA 3ORSA 1II8B 3ZJ4A 5BR8B 1RCFA 2LDBA 2J7PD 4B7AA 1KR2A 3BBLA 4O4IA 4EDHA 3K0CA 2PRSA 2EIXA 3PQ3A 5IJZA 4KQHA 2YS6A 2PZBA 3OURA 3K9HA 3N70A 4HXFB 1OI2A 3I8SA 3NKFA 4WBNA 3PHLA 3B2NA 3PL5A 4X60A 1GQOA 5KNCD 5ILOA 4WVLA 3FVVA 3OFND 3AJDA 1LDMA 3MUOA 4LQLA 3G6WA 3UAGA 2QZ9A 4A8TA 1L8AA 2PV7A 2W6ZA 3C3EA 3INGA 4QJ3A 4MB0A 4FXPA 4ZCPA 4HLUC 1JECA 4K9OA 3SBDA 4D80A 1E2LA 4BJ1A 2WV9A 1L7BA 1ESEA 1DTSA 2VJOA 3PQDA 5DHRA 1JKIA 4H08A 3F4KA 2ZQ5A 2OSVA 4L8VA 1JHOA 3CG4A 5L6MB 2IHYA 2FFRA 3PFFA 2IUUA 2V1XA 3WBBA 1G6KA 3I0ZA 1U0TA 2OD9A 2XGSA 1ORTA 4V2IA 3UHFA 1P73A 2XRZA 1DHRA 1QU3A 4UOQA 1YMUA 3BX1A 5ILGA 1FRNA 2KW5A 3EFOB 2M1ZA 4PWYA 1FRZA 1RXUA 3MA0A 4JHLA 2DPMA 1JU3A 2PUTA 1U0EA 1MGPA 1TD9A 3IP5A 4FXOA 4NONA 1L5KA 4IZHA 1XEAA 3SYLA 3Q3EA 1V5EA 4PTLA 1TKRA 5DHTA 3V4VB 4W5JA 3DC2A 1Z4KA 3NBZC 3AUKA 4L0DA 5ERXA 3DOJA 4UUAA 1EUZA 2BGJA 4K88A 4ITVA 4KXQA 1JHMA 1OE0A 4LDJA 3ETNA 4C04A 3Q2IA 4F06A 5HR5A 1RWQA 3UK2A 3RVSA 4CKBB 2FPGB 4JXXA 1UFKA 4R0NA 3AV0B 2NAFA 3E05A 3H9BA 1RAFA 5DEIA 2X0EA 1HR0B 3ORRA 1FTWA 3ZU2A 4ARZB 2FLWA 2PNFA 2YIMA 4F2WA 1S2LA 3TD9A 5IKXA 1O0CA 1TL7C 3K31A 4YVFA 2DLNA 3ORFA 4I50B 3NJRA 3SF8B 1G60A 3S44A 5JVDF 2ZBGA 3BXZA 3AIKA 4JQSA 5EE9A 1B6RA 2C99A 2BJVA 1COZA 2VQFB 1RACA 1IJBA 1D0VA 1AXEA 4HZIA 3R6WA 2I2AA 2OZLA 2X2OA 3IT0A 4IKPA 4ZPXA 5KVAA 3GLGA 1IBRA 4JZKA 1NTOA 2HU8A 3UUWA 4KFUA 4W8OA 5D84A 3L1KA 4TTVA 5IUNC 3B60A 4LNUB 1U1FA 1URPA 2BM1A 5AKGA 3SJAA 4E88A 2HWUA 3R8FA 2TMKA 3KOWA 1KZ6A 2IHKA 4RPCA 3TSAA 4DGSA 1AUOA 1KO4A 3DKKA 4F4DA 2VLBA 3JQAB 1MXFA 3NVKI 4ZCSA 3TZ6A 1VMIA 3ZLBA 2JBAB 4RDHA 3PR3A 4M0KA 5EXSA 2JNWA 4M21A 1FU4A 1R0YA 4NDNE 1Q15A 4FYHA 1U8EA 5KCMA 2PRIA 1ZIXA 2WF8A 3RSLA 4UOZA 2Z4SA 5KC9A 1NW4A 2N47A 3M4NA 3L7MA 2AZDA 2EZTA 2DLCX 2GWHA 4FHEA 2CVFA 1XMSA 2HK7A 1SD5A 3HCPA 4BO6A 3L4BA 5L8VA 3FTDA 1M3SA 1VB3A 1L5QA 3B7PA 3JVIA 3N6VA 2X9NA 1PL0A 3SQLA 4B85A 4BFLA 4X1IA 4TWZA 3WQBA 3FGOA 1ECGA 4PHFA 3C6KA 2OOKA 4U5QA 2WZDA 1YI8A 2JA2A 2CMGA 5KKNB 4H9JA 1N75A 1F4LA 3QH4A 5CVDA 1W4AA 4P3PA 2C8JA 3T4PA 5CB6A 3ZJ5A 3KQLA 1U4NA 3NBQA 1XPOA 5JTUA 3BL6A 3BMQA 1ITZA 5JROA 1OB2A 3CLSC 1E6CA 1G0OA 2F64A 2AC2A 1DNPA 5LQKA 1W49A 3U7JA 3ZLVA 4RIHA 4C4RA 3P94A 5H16A 3RYTC 1MORA 1P0MA 4EQ6A 5A7FA 2JBHA 1G8KA 5HF9A 3WA7A 3LFUA 3O8OB 4WD3A 4C7JA 3GVPA 1PJCA 2KS6A 2WJ4A 4IJQA 2GM3A 3MT0A 4Q6WA 3VPBA 5AK6A 3HCAA 4MWCA 3TJZA 3EMKA 1EVYA 3CX4A 3VPFA 5M34A 3UANA 2D0IA 2QTTA 4EAAA 3KTOA 1Y81A 1HF3A 4IX9A 2Q4TA 1KL7A 2J9FA 1E59A 3GLHB 4L2IA 3G82C 1IJKA 2JLWA 3I39X 2G88A 4HPJB 1NBIA 3ES9A 3H3XA 4UUOA 5E1OA 4ZTUB 4I5IA 3DC7A 2FG5A 5DGXA 3IRVA 5K0GA 2BRUC 3QF7A 5C7OO 3L7OA 1KY5A 3FIJA 3LUHA 4FR5A 1LQUA 2GKSA 3RASA 3TRHA 1L4MA 3HB9A 2OO3A 5ESXA 3LYAA 4JJ6A 4JELA 4DCSA 1DTWA 5EP1A 1TMGE 1JJ7A 2Q46A 3BIXA 1MX3A 4MA5A 4OH1A 4V0MA 2INGX 1AG9A 3GLVA 3QPCA 2F1HA 3H4IA 2I3BA 4PAQA 2ANBA 4Y9UA 3U4DA 4EA7A 4BZZA 5LZ2A 4BEVA 3T5CA 3PEEA 3VR3D 5TQ0A 3NEYA 2J30A 2X7XA 4WJLA 2BBSA 1X7DA 1FL9A 4JQCA 5IMBA 3OPYA 2EFEB 4Q82A 2PX2A 3FR7A 2GXQA 1I2MA 4EA8A 3KUKA 1L7XA 4OMDA 3UT5A 1Z8FA 2EJVA 5EN4A 5AHXA 5IDXA 2FUNB 2WP8J 2ZT6A 1DRKA 1WB9A 3AK4A 4R2XA 1PG2A 4R1PA 3Q9NA 1SM4A 4PAGA 1CLEA 1GCGA 2HJ9A 1NDQA 1ZXBA 4MPPA 2I33A 4UTXA 2VK1A 3WI7A 1K66A 1MQ9A 4TV9A 2MYNA 3S2YA 1CNEA 1U28A 3OTGA 4BGIA 1GNSA 2CLCX 4W6QA 4IZOA 5JAQA 4BNDB 4CM4B 1Y3BE 1YZQA 1C4WA 1P5FA 3ND7A 1A7JA 4L8GA 4PG5A 4ENVA 1POXA 4LGMA 1LC3A 5ARDA 1KAQA 1B8OA 2P65A 4AJ2A 4RANA 5K4HA 3JQGA 4H3SA 2YFYA 2FZVA 2FEWB 1UJNA 5ALWA 3ZHUA 4IGEA 2CLFB 1SCQA 2YJ5A 3D0QA 3RVPA 1JXAA 4B6FA 5KB3A 4HH0A 4WK4B 1EHIA 1NSYA 1ZRMA 2VOJA 3ESRA 5HF8A 1P31A 3GFRA 3EIWA 1BD4A 1B3BA 4OMCA 3HXLA 5H3CA 1Q0HA 5B12A 3TNDA 4LHVA 5EJAA 5DCUA 2VSOA 1C8BA 2OENG 2ANCA 4IWNA 4YASA 4ENRA 3LHSA 4ER3A 3PRKE 3NVMB 1Z45A 4LHXA 1RMQA 2V8OA 4B71A 1YGYA 4JJKA 4OATA 3VSCA 4RCZA 4W1SA 3QPAA 3VKHA 3BHJA 1KWKA 1EXNA 2ZLBA 4YAJA 3P9YA 2FXIA 3Q3CA 3RUDA 4KQXA 1FYDA 1H6AA 1LLUA 3P0RA 4WSOA 2K87A 2C97A 4PC6A 4HS9A 1J7KA 2JRLA 2RI6A 4ZCTA 4A8PA 2Y67A 3K2BA 4NESA 4EQZA 4TV8F 5TGTA 1MIOA 5B5SA 1FRFS 1LPBB 4GNRA 5IM4F 3ROTA 4QYIA 3SBEA 1Z7BA 4EIWA 1MRZA 5I4BA 3GAAA 2Q8PA 2ZBDA 1U99A 4HJXA 4TWIA 1XDUA 5IZCC 3VVMA 4ZZ0A 2H1RA 4MVJP 2DJ5A 5C7IO 1FFXA 2V98A 5IT5A 1PUIA 1GPH1 2I03A 4YRFA 4UATA 3KETA 4C6TA 3CA8A 4BJHB 3BE6A 5BNIA 3Q1LA 2H4JA 4Q1AA 1JHQA 4MVXA 3V34A 2CJFA 1NU6A 3KFVA 5NULA 4W1RA 1AX9A 1NN5A 4HRXA 4CL3A 5HXAA 4OQXA 2HWKA 1OLSA 4S1NA 1N6IA 4AJ9A 3EDCA 1RXYA 1SC9A 5REQA 1WY5A 3MRSA 4CQMB 5KWJA 1FXSA 4KG7A 1U7UA 2A1TS 1M2GA 4D8VA 3GVHA 1HE4A 1DIHA 1ISFA 1PAUA 3TB6A 4Z49A 2FWIA 1Q84A 3H9QA 2UUBB 4CCAA 2IQ5A 2VNAA 3K9BA 4UAJA 1RLTA 1YKFA 1PX0A 3QELB 3R5KA 5SY6A 3RABA 2WTXA 1FSSA 3O1JC 3JAWB 4I5FA 1V16B 5D1NA 2R5FA 1EBFA 3L8CA 4CKWB 4MULA 1D2NA 2NXCA 1R4AA 3M6MD 1D6MA 5DK6A 1E2PA 2I2CA 4BX2A 2K2WA 2W6JA 3LE8A 1N1DA 3PZBA 3QYJA 3NI2A 1J0BA 3COSA 2GMWA 1RWKA 1J99A 2A0UA 2B94A 2LGJA 4GYKA 3E9ZA 3W06A 4D8UA 4Q7LA 3KSZO 2EZ4A 2D7JA 2PKRA 3O7WA 5AIAA 1XYGA 1YVEI 2Z57A 1RBZA 1U7OA 4L8LA 4W5TA 1ML3A 2JJ1D 4FYKA 4Y67A 5BW8A 4MUGA 2C2XA 3L07A 3PNOA 3PNQA 5CLJA 3HJHA 2QXTA 3WZ2A 1S8NA 4F4JA 2FPSA 3Q3HA 4S35A 5DLPA 1QX3A 2CDCA 2Q5JA 3GEGA 2XCTB 3WSVA 1NMZA 3FB4A 3INRA 2PYZA 3BTSA 1F06A 5IT0A 2QG9A 2XRYA 2JI4A 3L01A 1H0RA 1E9FA 3HI4A 5LCXA 2J4FA 1KFCB 3UG7A 1HK7A 2ZIXB 5CB4B 1TT7A 4ZT3A 3EMVA 2O0KA 3H2HA 3IR6A 5L53A 1B14A 4H31A 1N5IA 3BULA 3U37A 2D74A 3LYUA 1LI7A 4PPFA 4QXAA 3EUFA 1T9GR 3M6UA 3UOGA 3C3AA 2AOVA 2J3LA 3OEHA 4GSYA 5D2CA 3GBPA 3L3BA 3UMCA 2F3SA 4BE7B 2ZK7A 3PP8A 5K4AA 5I45A 1GOTA 2A5GA 4MV6A 4X84A 8OHMA 1D1PA 1Z2NX 3F3SA 3PQ2A 4ILEA 2ZYWX 4Z2AA 4M1SA 4NQZA 1R8SA 1ADFA 2P1ZA 3L0ZA 4EDFA 3KQNA 4H9KA 1SJ9A 1B8NA 1TM4E 3UB2A 1QHSA 3ZPXA 4NG4A 4CQLB 5JISA 4U9HS 4IS2A 4NV3A 2PO5A 3HC7A 1HDZA 1X1EA 2PY6A 3GPDG 2EXXA 3LXMA 4H77A 5E0KB 3RUIA 3C6ZA 4OKNA 4LX0A 2VQ6A 2AKYA 2C8LA 1NHGA 4AJHA 2CMHA 2DSNA 1WTAA 3RARA 3HWX1 3OOEA 3GP8A 3PENA 2BTQA 3IMEA 2PUAA 1V9LA 5DXJA 4AO8A 1H4QA 4C2TA 3IQGX 5FD8A 2CVQA 2Q1YA 1QGAA 1SBCA 2OHXA 4IXTA 5D7NA 1FFCA 4MWZA 4FZ3A 1FC0A 5D3KA 4CL0A 4DLBA 4DMGA 5AVSA 3VNVA 1Y6QA 4FFOA 2C9ZA 3ESQA 2FQWA 3QBDA 4OGWA 2C2ZA 2VK2A 4FYMA 2M6LA 1IBKB 5LDHA 4M9ZA 2QL6A 5KDOA 4OJMX 2PCLA 4F11A 3LKZA 3HJAA 3EQZA 3QUBA 2BLLA 3CZ5A 2UUPA 4P92A 1UK9A 1P77A 4FX2A 3UTCA 2QVYX 5DWDA 1ZRSA 1YDEA 4LPSA 1VIVA 3KU4A 4DA9A 1U80A 5JIBA 2YY7A 3PXDA 1MABA 1Z62A 4PEVA 4ANFA 2DQSA 1JYEA 2WIDA 2GPWA 2XMCA 1QORA 1P2SA 3LV8A 3RVLA 4NI5A 3W2TA 3REQA 1BDMA 5MHTA 1GQYA 4CETA 4N3GA 1VSUA 5HIJA 1NTRA 2XXAA 2LPMA 1E4EB 1V2GA 3EARA 4FZVA 3TQCA 5DN6D 4YDQA 5AW0A 5J4KA 3EX7C 2D0DA 4HS4A 1VLMA 3OECA 2QTGA 3LY5A 2F3QA 4U7WA 5H4HA 4P2GA 2D4AA 4N0EA 4WK6A 1D4FA 1ZCFA 1WIWA 1TFUA 1AMUA 2OV4A 2A0WA 5F3RA 4KPEC 4DV3B 2GRJA 5HS4A 3WGUA 2GPSA 3I37X 2DCMA 1UKYA 2X0IA 1RPZA 3CR7A 3C8DA 3ZG6A 5DGHA 5EUMA 3TRFA 2O7VA 3IXLA 4K9MA 2Q3MA 2OHVA 3NDBB 1ZU4A 2E48A 3AO0B 1Q92A 4JT2A 4MDYA 3WC4A 2PGIA 2QD1A 1TPYA 2QSUA 2AIRA 3LWDA 4Z5XA 1GPLA 2HGZA 1E3DA 1Z68A 2J5RA 2WIJA 3EQ2A 2XUOA 3GEPA 1F6BA 4LJKA 4DXDA 4NCNA 3HA7A 1U6IA 3B5EA 3GO4A 3OQ6A 3ND5A 3RFFA 4BKUA 5ALHA 1H8HA 3MPUA 4BP9A 1V9CA 2ZRLA 6REQB 4OJNA 5HK8A 4KXNA 3V8QA 4ZEVA 1I4LD 5IPFA 4YJHB 1IB0A 3EJWA 3T15A 3TB4A 5KX5B 2XVAA 1NJ6A 1Z6XA 3PDIA 5E4YA 3OG9A 3UMSA 3KV3O 1L7PA 4K28A 2AMLA 2HL6A 2XKBA 1HM5A 3MQFA 1IZ0A 4FYXA 4TTPA 3L0DA 2YTZA 4K81B 5ADWA 4JLPA 2JLYA 2R1UA 2EP8A 5KTMA 1MJHA 1ZA1A 2JS7A 2PL1A 2PS0A 3QYAA 4IDQA 5BNTA 5EPEA 4YREA 3UWMA 1PT9A 4HL6A 4N8EA 4D74A 1GDTA 3GLRA 2YHBA 1RQPA 1K5DA 1CY2A 1KC1A 4M55A 1KO8A 2QRJA 3JX9A 3K3PA 3QBTA 1JHDA 4GH5A 1ZBQA 1OBFO 2DY1A 1L5ZA 3AXSA 1M1ZA 3BDVA 4GWGA 4RHUA 3SJZA 5ALIA 4YQFA 2QLNA 1KI1A 4MVJE 4Z0PA 3AHHA 1MKYA 1XZAA 1W5BA 1CVRA 2B21A 2CLDX 2E4XA 4ARSA 1W52X 3MWJA 5G4KA 1I0ZA 5FL3A 1P62B 1M2OA 4E0BA 2AI1A 2PD4A 5CT5A 2G7ZA 2OGZA 2DAPA 2EYUA 1WM1A 3BILA 1Y3AA 2WHYA 3BTVA 4OXNA 5F21A 2G5CA 3SCZA 3W5DA 2Y9PB 2V7UA 5AJXA 4YAUA 2YYAA 2TECE 3PXUA 2EJTA 2TMYA 4C2AA 5AW3A 4FB5A 1LPNA 1RM4A 3JQ9C 2QM0A 5HF6A 1JHXA 1GUDA 2Y66A 1B76A 5JC1A 2N42A 3FNHA 1HBJA 2OCYC 5I47A 2DQZA 1CUUA 3QQPA 4M0PA 1CT9A 4OBWA 4L9WA 4G8CA 1VA4A 1DRVA 1MEOA 2RONA 1EXWA 3N76A 4B3DA 1QB8A 3MXOA 3TEJA 3D8NA 3VGPA 3WBJA 2QTCA 3PJFA 4N6NA 3LOQA 5F51A 5JO0A 1TA0A 5E1BA 2P3OA 3UO8B 1W6RA 3ZBUA 2NVOA 4YI5A 4RH0A 1UM9A 2JZOA 2BFFB 1NXSA 5KWVA 5ARBA 2X2FA 2VDWB 3PUIA 4KMOA 1DJLA 1UOPA 1AQIA 4E03A 3UK7A 3TJRA 3DHNA 1O5TA 2VRBA 2YV3A 1QK5A 4F4FA 3NHFA 4YAIA 2EKLA 4RHFA 2VAMA 4C7XA 4D8YA 3TGPA 2BOVA 2PWYA 3ZHBA 1JF8A 4AB1A 1IMOA 2WF9A 3D8HA 3MBOA 1DEHA 4RFSA 3U4AA 3F6RA 1YQXA 1CE8A 3HBLA 4B74A 4GMDA 1CDEA 2XAUA 1JWBB 4LXHA 1ODJA 3PEVA 1QRAA 1E5TA 4D98A 1OJ7A 3B3FA 2WPNA 4ZHQF 4EEZA 1T4CB 5CLLA 1YR3A 2GPAA 4LS3A 4RSRA 2PH7A 2WUWE 5IYZB 5G1NA 4WWHA 3WMRA 4HNRA 3TPZA 2WOOA 2QTRA 4JEUA 2VT7A 1H2RS 1PEYA 2IZOA 3NORA 1IC6A 1TUBA 2P7IA 1C0LA 3DKPA 5MGNA 4PQYA 3R20A 4K9PA 3RWOA 1DKPA 1IHDA 421PA 1G8YA 2OEPA 3P9IA 4G0WA 4HOYA 1BJKA 2BFNA 4FR0A 3EW9A 1E9CA 3HWRA 2O8VA 1SVWA 3ZXUB 2IK8A 3Q0EA 3N2KA 2ZRPA 1KQGA 3ASYA 4EHKA 1YU6A 4NBKA 3UXYA 1HQYE 3B20A 4IDAA 4ZVKA 1M10A 1ZJWA 4R2MA 2KI5A 5BVHB 1FMLA 1SU7A 3JALA 2ZJOA 5EJ5A 1CP2A 2ZVQX 4U9UA 4DCMA 3T7KA 5K05A 1ZO8A 1A5TA 4PO1A 4FMBB 1EVKA 2PE5A 4D1YA 5TARA 1XD2B 1TZKA 5TR9A 1RI5A 2Q3JA 5DCLA 5EJGA 4B7CA 4IINA 3DPSA 3NNNA 4KN9S 1C41A 4RM2A 5P21A 3TQQA 4DLVA 3DR5A 4EJSA 2NQ2C 5I7SA 5C1IA 3V32A 2OK8A 2EFCB 1T9HA 4IM7A 3S8MA 1QR6A 1QIFA 1PFKA 1UF9A 3QJGA 2VK4A 2P4HX 3R3YA 3L1VA 1YZFA 3FDJA 1A4UA 4H7DA 4I3FA 5JSUA 4GKBA 1EUCB 1W5EA 1AOXA 2P6UA 2PX8A 4EX6A 3KOMA 1JKXA 4NNJA 5BN4B 2IWHA 1GZ5A 4F8YA 4ZVNA 5JMTA 5DI3A 1E1RD 1SPXA 2CL6X 1G21B 3D7NA 1Y8RB 4DQVA 1RAEA 2Z2XA 1PIWA 5KTYA 3TVDA 1FOEB 4F5WA 2FP3A 5JYEA 3K0SA 5H5JA 3C7KA 2R8EA 4L15A 3M4ZA 1CS0A 3PC8A 1DOHA 1YQEA 3U39A 3ONFA 1V8ZA 2OAP1 3TMKA 2CD7A 4YDSA 4AU1A 1FYEA 1EMDA 5A6SA 2J33A 3NHMA 3SOPA 3JZMA 2ZYUX 3RTAA 4Z7JA 1A1SA 3CF0A 4B83A 1N6PA 1A8PA 1R4NB 2JJMA 5CVVA 1KVTA 3RM3A 3SBXA 1ZD4A 1EXVA 2I4LA 3K0CC 1JH8A 3BF8A 3EH1A 5TPZD 3RNLA 4GLBA 5IVIA 1A9PA 1B1CA 2YMLA 3PUWA 4OA8A 4MR7A 3BG5A 3C15C 5I8ZA 3A05A 4EENA 1L6RA 3QV1A 4LJSA 3OJCA 1RBQA 2WWGA 4S1WA 1MB0A 3I12A 2GD6A 1N9GA 1LA2A 1A2QA 1XMJA 2WFLA 2IZ7A 4Z4QA 1YRAA 3GLGE 4FFLA 4WOKA 2NOAA 5GGYA 1H05A 2HTFA 3D4NA 3VAYA 3R75A 4B34A 2RAPA 2PYIA 3LP8A 4JP1A 1IOVA 1YQTA 2PQ0A 4HADA 3ZY6A 2RHOA 1D3AA 4PHGA 1PZMA 3TEMA 1Q0SA 1EH5A 3QY0A 4LY9A 4YP7A 3WFJA 4PLHA 3R41A 3D5EA 3T3GA 1SIWA 1GL7A 3Q8XB 3QPDA 3WWYA 4TGLA 1ZM9A 2VA9A 2RGRA 1Z29A 4YAFA 3JYPA 4B3CA 3KE8A 3LPNA 2AFVA 3ZBQA 3HXTA 1P1JA 4CHGA 4UOEA 2IZ5A 1DRUA 1OFTA 1ZGBA 2VA8A 2P3SA 1KJNA 3C8ZA 1TAHA 2GXSA 3C4QA 1TQHA 3DA8A 3C6BA 1F14A 3DXYA 3LC0A 5F9MA 4M9XA 3QVVA 1NBAA 2YWHA 3H19A 4QUIA 4YJ3B 3E48A 4O1MA 4DVJA 3GUVA 2DG2A 4DCVA 5DCWA 4B0PA 5BN5A 1VG0B 1ZR2A 2PRYA 2VR1A 5JWOA 2IZ6A 1TKCA 2BGMA 3E18A 1E9DA 2W83A 1RM3A 4OXKA 4CTMA 1VKJA 3AP1A 4XPIB 3G0IA 3M82A 2A4MA 4BBPA 2OFXA 2AUTA 2PXHA 2Q2NA 4RY9A 3V1TC 3DEZA 4X65B 4DSTA 2JA1A 1ESCA 3CF4A 1ZMTA 4AZTA 1YR9A 2FMFA 4DLRA 2P91A 2XYHA 1T8RA 3CNNA 4ZOLF 4EX7A 4QAJA 5C81A 5HP4A 1S01A 4PGGA 4GWLA 3UMVA 4ARIA 5EUBA 1QGUB 2VP9A 1PNVA 4QC2A 2BT4A 2GCNA 3DKRA 1OLOA 5AM5A 5EEGA 3SN6A 4MGEA 1XZNA 4H7JA 4ADSG 1Y80A 3N0WA 5KC8A 1Z34A 2UZ1B 4NF2A 2KE5A 4GI7A 3L8EA 1VKHA 3USES 3MGAA 3IP7A 4W8GA 2Q99A 4U8GA 2PWPA 3TXAA 2FUEA 1E3EA 2EATA 3FD8A 2H51A 1L4FA 4CIWA 1HQCA 2JFQA 3GJTA 1EK2A 2XTJA 3DMRA 3FBGA 4JJ8A 3DG9A 3EQ8A 2P77A 4D5EA 2QSYA 5B1IA 4WCFB 1T9CA 5KOIA 1TMKA 1CP3A 4Z53A 3WJAA 2EKZA 1GYQA 1L2TA 1J9EA 2B30A 2UYCA 2V7WA 4I7EA 5DTEA 3O0TA 3UAOA 1XZHA 4DDHA 4BB0A 5CIWA 1MF7A 1IY8A 3PHCA 4I4CA 4ZFNA 3L4BC 2OCBA 3E15A 1RYDA 2BEUB 2FSHA 4XVHA 4QBIA 2IVZA 2Q9UA 3AOEA 3GG2A 2QTVB 3GW8A 4XOUA 2X9VA 1B41A 1Y4SA 4RHCA 5L3ZA 3ZOKA 5CFOA 3QLVC 1EFVB 2PH3A 1ZN2A 4ACAA 2XGOA 4URVR 4TYMA 5MFZA 4YDRA 2ONKA 4RL4A 3HU2A 1FRQA 1V48A 1KJIA 4A8JA 3DE5X 3F1KA 1VIYA 2ZW9A 4Y9RA 4DJ5X 2WUVA 3JASA 3U3DA 5FUMA 4OD0A 3IJRA 1SU6A 2YX1A 2OAQ1 3EF1A 3LFHA 5CCDA 1IUKA 2YXDA 1EXMA 1ONPA 2J0UA 1AGNA 1QYXA 3EYAA 3FG9A 3O2QB 4MQFB 5D3QA 4F5YA 4R84A 1AV7A 2VDRB 1GTRA 3F5DA 2REQB 2R79A 1Y9AA 2HCBA 3KM0A 3PGMA 4O4LF 3QKUA 5EZYB 1RRCA 4ESEA 3G0DA 4L57A 4ZCQA 1KWGA 3EWSA 2D1QA 1P1RA 3TPCA 1QE5A 4CUZA 2AC7A 2V6BA 4R0VA 5DX0A 1GGFA 1KI9A 1XDZA 2BEKA 1QONA 2BKVA 2QLMA 3IFSA 2JGDB 2G1UA 1KBZA 2RH9B 4DAOA 4WCVA 2DWQA 1AKNA 5KKAA 5JH7B 1SQFA 4FE7A 3F96A 4OSOA 2B0JA 1TEVA 1N5JA 3P0JA 3O26A 4TMZA 3GGSA 4KLNA 2WMYA 1BA2A 2VPXA 2EF1A 2R1VA 3GZNA 5BV1A 2RD2A 3I45A 1NUQA 2IEGA 1KH2A 4QOSA 5DHSA 4TYWA 1EVZA 4TYYA 1KXJA 4DMUB 2ZRNA 2ATXA 3NFYA 2I3GA 2AOUB 1XCBA 1XNHA 2ETVA 3BKXA 1USGA 3OFJA 5KIAA 1GCUA 2GARA 5B37A 5TEWA 3EVNA 1YS2X 4PZPA 13PKA 2Y99A 3OPXA 5BQ3A 1JYFA 2CZQA 1RWBA 2V7QA 3MJVA 3PZRA 5JANA 4ZEWA 2YJ3A 4CPDA 3RQSA 5K8JB 3ZZNA 4A15A 2QLTA 4M1OA 1BA3A 1SOMA 1DQYA 1FDRA 1ORRA 1WNFA 1WQ4A 1ZU5A 2FFAA 3VJMA 1TE2A 3K9WA 5CAEA 5J58A 3MUNA 4G1EB 1XKQA 4PZDA 4WV3A 5LOVF 2QAIA 3FWHA 3JQAD 4AD8A 3O9ZA 1MD9A 1KJWA 4P7JA 1T91A 2JFPA 4DY4A 3VA7A 4MQBA 3VVLA 2B1QA 2JI7A 2IEBA 3DUWA 3UJ3X 4DCPA 3I5MA 3P2MA 2C8VA 1P2GA 1U1IA 5DX8A 5M2QA 4W1QA 2D7CA 3V55A 3L0BA 2EG5A 4FGJA 1LLCA 2O0LA 1M75A 1U5BB 4CZ2A 2HSEA 1I4OA 2HSWA 4BWGA 3UPUA 4DYDA 1SUIA 3TQRA 1BWSA 1YMVA 3EVBA 2V3VA 5F9HA 3OHSX 1AS3A 2HGSA 1UBOS 4TXLA 4ZCRA 2KB0A 4QTYA 3R0VA 4ZYZA 1ISMA 1Z4JA 1NV8A 1I0LA 2A94A 2CFCA 1DXQA 4YO7A 1AA9A 1TYEB 3GAMA 1ZWLA 1M7HA 2P6PA 4HYTA 1Y6GA 3UG6A 3B3AA 2Y0BA 5TY0A 3TAUA 2QLLA 1JGTA 3K4HA 3SP1A 5BURA 1ACMA 4K9KA 5HSGA 1V5WA 1IRIA 3FSGA 2G09A 1LW6E 3O2SB 2BSAA 3ZVRA 1AO3A 1ULSA 2Q6LA 2EL9A 3CPEA 4K9QA 3KJNA 5AW5A 4Q3AA 4ZYWA 2ATIA 2J32A 3OO1A 1CS4C 2PSJA 2WABA 3CSSA 4Q3CA 4RF3A 2BGUA 4XYMA 1Y34E 1V3QE 3I28A 5A5VA 2YHIA 1VJ0A 2ABWA 2DHEA 3PYXA 4ZOEA 2XZDA 1GQSA 2NSLA 4D3YA 4CEJB 3AF4A 5CT8A 4CV0A 2A0YA 4EL5A 3D02A 3GDFA 5BUZA 4WPGA 1SKAA 3ZW8A 3MSCA 4XLLA 4JASB 3NATA 3T1VA 3QEKA 4LY3A 3R7AA 4BNVA 2QTHA 3OQJA 4A6XA 4XWWA 3HCWA 5I4IA 5JFTA 1U9ZA 4MS3A 2HV9A 1LX6A 4G0UA 4V2UA 3C4JA 2WT8A 1RNLA 5KYGA 1TM1E 3RC3A 1QTRA 1JU4A 1RXSA 3SYTA 4LHZA 4BPRA 1B43A 3ZD7A 2PT5A 3AEUB 3I64A 1KEKA 4H1UA 3A0UA 2A9OA 1FE8A 1N9ZA 3U5ZB 3BSFA 1BMFA 2I65A 4BC1A 5FV4A 1SVOA 2QX7A 1RWMA 4RDXA 1SCUB 3B51X 1F1JA 1UDBA 1KSHA 3C5VA 4KYVA 2RDMA 1R18A 3NHWA 2DRIA 1CUVA 5FTKA 1H2BA 2M2IA 1EP2B 3DBRA 1F0YA 4OO3A 2ISQA 5EIFA 5GTDA 2YRXA 1DAGA 2OV2A 4CTKA 2IF0A 4HQKA 1XLTA 2CJXA 5JSQA 2VIIA 3CX7A 3L8ZA 5A3RA 1LBIA 5K3EA 2EJBA 3AUUA 4AY4A 4DREA 4FFMA 2PSEA 3NKLA 4ED9A 2QAGC 3CNLA 2PJZA 1CJMA 1NUHA 1VCHA 3FDZA 4RH1A 2R3SA 2HYIC 1P4JA 3EAFA 4Y6RA 1ZESA 3NOOA 4TT3A 1NVXQ 8ADHA 4TV8A 2G5TA 3DFIA 3H86A 5CHYA 4QICA 1H4TA 1BCSA 5IM4A 5SY9A 4NDZA 1VFNA 3T1YB 2OWDA 4ALMA 4NHEA 1ZOIA 3F78A 5CT9A 4WAUA 3PWKA 3A3PA 2B7LA 5DW0A 1Z0IA 5JCOA 1TC1A 2Q7XA 4WFIA 3LQQA 4DLXA 4J4HA 2DTDA 4H1VA 1D1SA 2Q0QA 4MI6A 4O6VA 3H1FA 4M1QA 5KPJA 1L5NA 4TKZA 4IH9A 5AM1A 2YRFA 5ENVA 5CCBA 3B9BA 4EG3A 3HKEA 2CZGA 2HLDD 2L42A 3OE1A 4IMPA 4IOMA 5IJXA 1JIQA 4I1IA 4ZVLA 4E70A 3OWOA 3TG2A 3CWZA 1FSFA 4PTYA 3TNYA 3JQ8B 4LJLA 1JQKA 3K05A 3PCRB 5L4LA 4TLLB 4FU0A 1NG9A 3DMPA 4PYQA 2YIVX 4JLNA 1IRXA 1P2DA 1QK3A 1R6DA 2BGGA 2H18A 4IFIA 4Z0NA 1ZGHA 3EVTA 2QE7A 4U7DA 3M34A 3AHJA 4DCTA 1EGQA 5LQSA 1IOWA 1PV1A 1CR0A 1U8YA 1I94B 1PSDA 1UMBA 3WKCA 4DMLA 5T7BA 4GKKB 2K6GA 3TLCA 1G3QA 1TVCA 1Y6JA 1JHYA 1Q1QA 1YB4A 3ENQA 3AIMA 2D06A 4B3HA 1GAWA 4BVLA 4HV4A 3PVZA 1P80A 2PMWB 3U7HB 1U2SA 1T1GA 4CLXA 2YY5A 4HNAB 5AKKA 2BMDA 1GVHA 1JR3D 4HFMA 3B2QA 4D43A 1C0IA 3UXHA 4EYGA 4A6EA 1JYSA 1L5MA 2CV0A 3L7AA 1HG1A 1YS6A 2BR5A 5AP9A 4A3SA 2VH1A 4MYUA 2NVUA 4F97A 2IGBA 2C3UA 2H08A 2WU4A 3C3XA 5LXTF 2UKDA 4UUPA 1KVSA 3WB2A 4YY3B 3N0TA 2H0QA 3EZ2A 1W0KA 2C2YA 1Y42X 2IHVA 1BGXT 2UVPB 2AK2A 4FHZA 3RVOA 4AS2A 1XK6A 3K1YA 4BAGA 4HT3B 1IPEA 3PDHA 2AFHA 2Q4EA 2XRFA 1QZXA 2Q9AA 3A4NA 2X9LA 4MKZA 1NJ2A 3IQXA 4GF5A 4LE1A 4H3KB 4LYYA 5A1JA 4YHHB 3F6EX 3LQRA 4CQMD 4S1OA 1ADBA 3H11A 4LHEA 4N5NA 4UPEA 3UB3A 3ZXIA 5T4FA 1QVRA 4P4N