4YUYA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with isoquinolin-1-amine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
293
Chain Sequence
b'PGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
total genus 98
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuyA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuyA02
5DM0A 3T7SA 2P7HA 4GOOD 3LDFA 4M7RA 5FQOA 3EGIA 2HTEA 1RJFA 4OBXA 3GGDA 1JR4A 3ERCA 4JXJA 3PTAA 3G5LA 2VDUE 3OE5A 1TPYA 3MTIA 4P7JA 3TKAA 3VYWA 5DT2A 4P7GA 4AUKA 5EQJB 4XUCA 5C9ZA 4KRGA 2AOXA 3DLCA 3FPEA 2FRXA 1X19A 3I58A 3G88A 4OA8A 4FGZA 4E32A 3TKYA 5HOQA 5LQNA 3TFWA 4DZRA 1FJXA 3HCCA 4CXMA 2PXCA 3EEOA 1NE2A 3M70A 2BR4A 3A4TA 4HH4A 5C0OE 2OKCA 2GA9A 5ICCA 1R6AA 4DCGA 3M6WA 4GOLD 2P1DA 4RTSA 2PT6A 2OB2A 1ZQ9A 1YFLA 2C7OA 5EGSA 2XBMA 5E1BA 4YUZA 3OFJA 4YV0A 1D2HA 2QE6A 3GRRA 2CMHA 1XXLA 1SUIA 4BP1A 1RI1A 2JJQA 4LG1A 3DXZA 2I9KA 1Q0TA 1ORIA 2JHAA 5D1HA 5T64A 3GXOA 4PYQA 5T6BA 1JTEA 3C3YA 3UA4A 4AZSA 2GLUA 3PFHA 2OB1A 4AZWA 2DPMA 3TPZA 2O05A 1XDUA 2OBFA 1TW3A 2AZTA 2EG5A 5EEHA 4PNEA 3DP7A 3PLAE 2GH1A 4MTLA 3EPPA 1FP1D 2GB4A 3HTXA 2WA2A 3PT9A 5HIJA 5C1IA 3DOUA 4GEKA 3TM5A 2Y1XA 2IDJA 4RVFA 5CD1A 2VZ9A 3MERA 4HSGA 5EMLA 5K0LA 3P2IA 3UJ8A 1AQJA 2ZWAA 3R24A 2EFJA 2R6ZA 3M4XA 5K09A 5DTQA 1MJFA 5E1MA 4RTJA 3UJ7A 3CJTA 3FYDA 3UBTA 1O9HA 1WXWA 1RJDA 2P3OA 5MHTA 5HIIA 1KXZA 3GO4A 4X41A 3LGAA 5EMJA 3UJBA 5LQUA 4XUDA 3NMUF 3ER8A 2P8JA 4DCMA 2IH4A 1P91A 3MHTA 1KYWA 5BP7A 2YR0A 4B17A 1VP3A 2FK8A 3A27A 3EMDA 4RTKA 2V7EA 4GC9A 4YUXA 2N47A 4BP3A 5D1NA 3HCFA 2C7PA 4PCAA 4BLUA 3HCAA 2C7QA 4EKIA 3B5IA 3KR9A 3JWIA 3DMGA 3LDUA 5ERGB 2HMYB 4RTLA 4GQBA 2C7RA 2ZZNA 2UYOA 1L3BA 3KR0A 4ATNA 4AX8A 2P3QA 4QPNA 3KQOA 3TRKA 4BLWA 1NW3A 2IPXA 5E9WA 4R8SA 3OE4A 1VQ1A 2YXEA 3DMHA 3FUXA 3SR4A 3BGIA 3L8DA 3THSA 1RI2A 8MHTA 2B2CA 1L3IA 1P39A 1SVUA 3KQSA 4PONA 4V0QA 3PX2A 2ZSUA 2Q41A 2B78A 5K0NA 4X60A 2QM3A 1P1CA 5KYGA 5ICEA 1Z3CA 2PSSA 2NXEA 2P7IA 1DUSA 5EEGA 5EG5A 4Z2YA 3OZSA 4F85A 3E8SA 3KQTA 1L9KA 4M38A 3DR5A 3FPJA 4GF5A 4HRAA 5GM1A 3GWZA 5HILA 2ESRA 3BGVA 4C05A 2Z6AA 3HVHA 2O06A 3AXSA 3PB3A 3V8VA 3CCFA 2GPYA 4E2YA 5KQRA 3GU3A 1KPHA 3KQQA 5DM4A 5FHRA 3R6TA 2ZIGA 4X63A 3UZUA 5EHIA 1MHTA 1NW8A 2NP7A 3PVCA 3OU2A 4C04A 5K05A 1Y8CA 3EVAA 4M37A 4GOND 1UWVA 2FK7A 3BWBA 4IV8A 3T7RA 4RTQA 3DULA 4Y2HA 1JTFA 3CBGA 4G56A 2UZ4A 1YZ3A 3ANXA 2G1PA 4X61A 5GM2A 3SX0A 3KPYA 1QZZA 3BGDA 5FHQA 3BWCA 3MTEA 5KS2A 1G60A 3U81A 2Z6QA 5CIYA 1XTPA 5ICFA 5E8JA 5DXAA 1XJ5A 3NWEA 3T7TA 2JH8A 4L7VA 3UA3A 4C4AA 3I5UA 3GRUA 3IHTA 2BM9A 1X1CA 3G2PA 9MHTA 3M33A 4HTFA 4R6WA 3E7PA 3NJRA 5GINE 5FCDA 4C08A 1VPTA 3P97A 4HTFB 5E8RA 2BR5A 4AZTA 3NVKI 1JSZA 3CJQA 2AN5A 3LKDA 3SM3A 4OQDA 3TMAA 4KWCA 3TQSA 4KIGA 4P7FA 3UJCA 2IBSA 1ZHFA 2ZVJA 5CVJA 1QAOA 1EIZA 2IBTA 1NT2A 5K0BA 2PXAA 1EJ6A 1RI5A 2JG3A 3Q7EA 5K8VA 2CWWA 4P7KA 1RI3A 1VL5A 1BHJA 2QY6A 4CTKA 4CKBA 1WS6A 2I62A 2PKWA 1G55A 3A26A 4IKPA 1QAQA 2ORED 2OYRA 2IGTA 5E1OA 1NW7A 2GS9A 3R0QA 4A6EA 1AV6A 3FTCA 4K6MA 1BKYA 4H0NA 3ELDA 5FULA 3TOSA 3S68A 1M6EX 1I9GA 2IIPA 2XYVA 4EVIA 1JQEA 1P1BA 5E2AA 2PY6A 3GRZA 4ER6A 4LECA 4PINA 3DMFA 5FUBA 3KKZA 4YMGA 1I1NA 5EKXA 2AS0A 2R3SA 4GUAA 3OU6A 4O29A 1YB2A 1QYRA 2OXTA 2O0LA 1NV9A 1ZG3A 1KPIA 1KP9A 3BXOA 2EJTA 1DL5A 4CTJA 3H2BA 1N7JA 1R00A 3LCVB 3MAGA 3ORHA 2NXJA 5F2OA 4FSDA 3HA3A 3GRYA 2CMGA 1VLMA 3QOWA 1D2GA 4KDRA 3FPGA 2PT9A 3UWPA 5HIKA 2IH2A 2HR1A 2F8LA 5LR6A 2BZGA 3AY0A 3B3GA 1HMYA 3G8AA 3NDIA 4QTTB 4U7PB 4BY9E 3C6MA 5GWXA 1YZHA 3CGGA 4QVGA 3HVKA 4QVKA 4R05A 2OY0A 5LQRA 4HC4A 1SUSA 2ONZA 3A7DA 3HEMA 1V39A 1O54A 5E9JA 4E33A 5LQKA 4FR0A 4FT4A 3O4FA 3FZGA 4RTMA 3BWYA 5BW5A 3KPJA 5K03A 2ZZMA 3EVGA 2I7CA 1N7IA 3RW9A 3AJDA 3NVMB 3FTEA 1NKVA 4Y30A 3Q87B 4LWPA 4HG2A 2WK1A 3TM4A 2G71A 2P35A 5K0GA 2AOWA 4PIPA 4RWZA 2ZZKA 3LBFA 2ZFUA 1UFKA 1DCTA 3DLIA 5DXJA 2G8NA 5BW4A 1ZGJA 3FPHA 3K0BA 5DPMA 3AXTA 2ZBRA 3OCJA 3KQPA 4M36A 5DSTA 4PWYA 3SSOA 3WSTA 3X0DA 4C03A 3SSNA 1IY9A 1XDZA 3GRVA 1FP2A 3FUTA 3KHKA 1WG8A 3QOXA 1H1DA 5CCBA 3UJ6A 2VDWA 5KVAA 3C0KA 5G02A 3EVZA 1O9GA 2EX4A 4LWOA 1RI4A 3TR6A 3KU1A 3PS9A 2YXDA 4OA5A 4CKCA 2B3TA 2FHPA 2IDKA 1WXXA 2BR3A 2VS1A 3LL7A 5EVJA 1U2ZA 2NYUA 3I53A 3GJYA 3B89A 3LCCA 2NXNA 4E70A 3UJDA 3IV6A 1R18A 2XVMA 5DSXA 3FYCA 2OPBA 3LPMA 5K0EA 1JG4A 3CJRA 4C07A 5F2NA 3HP7A 5LSAA 1KYZA 3BKWA 3MB5A 3KQWA 2IH5A 4RX1A 3BUSA 3EMBA 1EQAA 3VC1A 5B1SA 2ZULA 4MWZA 1N2XA 1XVAA 1OR8A 2G72A 3HA7A 2P3LA 3HVJA 4KW7A 4XUEA 2AOTA 1VBFA 1ZGAA 1WZNA 1JG2A 2JH9A 3GIWA 3G2QA 2BM8A 1SQGA 3P9CA 1AQIA 2AOTB 2ZIFA 3KQYA 5CUQA 5EIWA 4ZTBA 5EMMA 2Y1WA 1NBHA 3K6RA 4ER5A 3FTFA 3RIEA 2ZWVA 4WXHA 1X1AA 2P40A 3I64A 3TLJA 3EVDA 5F2KA 2O07A 2PX5A 3KQMA 3R3HA 5LQAA 2UYHA 5GIOE 3EVCA 2YXLA 3P9KA 3HCDA 3KQVA 1JQ3A 4YUVA 2FCAA 4IWNA 4KDCA 5DX1A 5FTWA 5U4XA 1AF7A 5DTMA 5P8WA 5EIFA 3SMQA 1BC5A 1F38A 2NXCA 3JWHA 3OU7A 1ORHA 2QRVA 1G38A 1KPGA 2YUIA 3O31A 2QRVB 5EHGA 3BWMA 4RTOA 3OFKA 1HNNA 4EKGA 1L1EA 3DUWA 1PRYA 4FT2A 3OZTA 4R6XA 5E1DA 5K0JA 2PXXA 4DA4A 4AZVA 3D2LA 1YFJA 4EMSA 3IYLW 1JQDA 4ISCA 5HFJA 3ER9A 3KPVA 1YF3A 3ELYA 2NP6A 3A7EA 3P71T 3BKXA 4PYNA 5K0CA 3O7WA 2ADMA 1M6YA 3G89A 4YUWA 5DX0A 3FTDA 3ELWA 1M0EA 5K01A 3FUVA 4DMGA 2PV0A 1UIRA 4PYLA 2PJDA 2OZVA 5EC8A 3FPFA 1WY7A 3KR2A 3M6UA 3GNLA 5KQSA 2H00A 5DRTA 3GCZA 3VSEA 4E2XA 5JR3A 1PJZA 3HVIA 5CCXA 5CVUA 1L3CA 5DM2A 3FRIA 4ER3A 5GP1A 3B3FA 5EKUA 4X1OA 4FP9A 5ICGA 2AN4A 2GAFA 3C6KA 1SQFA 4PIMA 4CKEA 4YV2A 3R9XB 2PX2A 2CL5A 4CWAA 1RJEA 4RVDA 5FA8A 1YUBA 3EGVA 2A14A 4OQEA 4EK9A 1JG3A 5LQCA 1G8SA 3HA5A 5DTRA 1D2CA 1INLA 1EJ0A 1RJGA 2ONYA 2FPOA 3UJ9A 2YTZA 1G8AA 1G6Q1 3LCUA 4MHTA 4E31A 1JG1A 1KR5A 3CKKA 4PYMA 2B25A 2VP3A 2PLWA 2B9EA 5LQJA 2LD4A 5FA5A 3MQ2A 2BH2A 3JWGA 4POOA 2QYOA 4MIKA 4PGHA 3LECA 4BLVA 3LX6A 3DXYA 4OBWA 5DWQA 4NECA 3IEIA 3KR1A 2ZCJA 2ERCA 3KPUA 3JWJA 1QANA 4QPPA 3VC2A 4FZVA 4PCLA 4RSRA 2O57A 2ZIEA 5M5BA 3HM2A 3QV2A 5JUWA 7MHTA 2XVAA 1ZKDA 3NTVA 4E30A 3OPNA 4V0RA 2WA1A 1VIDA 4MQ4A 3CVOA 4C06A 3EEYA 3G5TA 4FSXA 1BOOA 2Z6UA 4EQZA 2AOUA 3F4KA 4F84A 2PVCA 4RTPA 1XDSA 4KIFA 3T0IA 4RTRA 2AOUB 3HCEA 4GBED 2UYQA 3SSMA 2PBFA 4HGZA 1SKMA 1R74A 1EG2A 5K0FA 5BXYA 1NBIA 3NDJA 1R8XA 4ER0A 3EVEA 3FUWA 4PYIA 2IFTA 2XYQA 4YMHA 5FADA 2UYCA 2NNWB 3P2KA 1NW5A 2VDVE 3LBYA 3LDGA 3THRA 1R8YA 5GOZA 1XCJA 2ZBQA 3FRHA 5E2BA 5FWAA 3MCZA 2YQZA 2YVLA 4HGYA 5GIPE 3HCBA 1X1DA 2AR0A 2HNKA 4RVHA 5CVVA 3BT7A 2JHCA 2PX4A 2V74B 3GDHA 3P9IA 5DM1A 5EPEA 3PFGA 1FPQA 3G2OA 1SG9A 2PWPA 2ZLBA 2I6GA 2XYRA 4R8RA 4RYLA 3KPWA 5FQNA 4XCXA 4GOMD 3ME5A 4OX9Y 5H02A 2AN3A 4QQKA 4DF3A 2IP2A 3LKZA 1X1BA 3B7PA 3M6XA 3EVFA 1F3LA 3NWBA 5EZSA 4GC5A 4YUYA 1KHHA 1NV8A 5EOVA 3G2MA 1EAMA 5DRYA 4PYKA 5DX8A 1T43A 3LSTA 4KVZA 2H11A 4U7TB 5FWDA 3UFBA 4DQ0A 3P2EA 3SXJA 3UJAA 4E2WA 5IKMA 5CM2Z 3OZRA 3SGLA 1VP9A 2K4MA 4IV0A 3I9FA 2ZTHA 4QDKA 1TW2A 2HV9A 4F86A 3E05A 3AWIA 2ZW9A 4RVGA 1KIAA 4QTUB 5EMKA 3MCTA 2P41A 3E23A 1VE3A 5E9QA 3NW9A 5EZQA 3M6VA 4PYOA 1B42A 3FUUA 1IXKA 3BZBA 4RV9A 1JSXA 5IH3A 3HNRA 2OO3A 3P8ZA 3SVZA 5HZMA 5HEKA 4QDJA 4PGGA 3EVBA 3REOA 4WVLA 1QAMA 3DTNA 5T67A 4YV1A 3MGGA 3A25A 2YX1A 3C3PA 2JHPA 1FBNA 4A6DA 3G7UA 5CVDA 4DM3A 3G8BA 2G70A 2AVDA 2HWKA 2PWYA 3ID6C 2CKDA 1IM8A 2PGXA 3LHDA 4P58A 2AVNA 2H1RA 3EGEA 4QQNA 5DLYA 2PX8A 2EJUA 1Q0SA 3PX3A 4PYJA 2ZBPA 2DULA 4E2ZA 1XCLA 2KW5A 3B3JA 4FS8A 4ER7A 4RTNA 3V97A 2E5WA 4DKJA 1NW6A 2AOVA 1I4WA 2FYTA 5HIMA 3RODA 3CC8A 5CVEA 3DH0A 3P9NA 3DXXA 4UOEA 10MHA 3ELUA
chains in the Genus database with same CATH superfamily
3HMKA 3K1YA 4PPQA 2BFBB 3M1AA 3SSAA 4FUQA 4F3TA 3EGIA 1M74A 3KVYA 1QH1B 4G23A 3H2ZA 1Y6GA 1CDZA 1CJUC 3U48A 2TSYB 1CULC 3WL7A 1GCUA 1M75A 3FDZA 3VFDA 2EP7A 4W63A 2ZIWB 2QRHA 2W6IA 3E35A 3E9CA 3IESA 3UKOA 2WDZA 3BICA 3PDIB 1YJQA 3QVJA 2UKDA 1IHXA 3B20A 4OHYA 1TM2A 1MABA 5HA5A 1I7DA 2CLMB 3CLUD 2G6BA 4R51A 2IP1A 2JAWA 4OA8A 4E32A 4EFDA 3G2NA 3WXBA 2FMTA 3DKRA 2PJRA 5CJ2A 3D6UA 3NEAA 1DKUA 4HH4A 5H59A 4HQ6A 3Q40A 4QOJA 2AN9A 2GA9A 4MNTA 1AZWA 4OUDA 3RS4A 4I99A 3DE5X 2B4YA 3ONWA 3VZDA 1PE0A 3ZCQA 4DCGA 4RTSA 2QV0A 3OFJA 4KWHA 4BIMA 1WDMA 5JY1A 4KXXA 4PAQA 3QXCA 2W37A 4A16A 4K6HA 1LV7A 3BMNB 4LKOA 3A0RB 1D3AA 3TCKA 1B6GA 1NFRA 5LB2A 1MB4A 4MS1B 3T9AA 5AVZA 2ZJ7A 2KHZA 1LWOA 1PCXA 3PFHA 4KQMA 3CKLA 3D5QA 1ONOA 1WB4A 3IMEA 2HC9A 3NG1A 4NAHA 4YJFA 3HTXA 5AJZA 2ATCA 4S2UA 5FUQA 1A71A 4W5OA 2OGZA 3M5CA 2MSCB 5GJBA 5DH9A 1SZCA 3OPYI 3OZAA 1BDBA 4II7A 3TTWA 4GI7A 1XZDA 3MERA 3N0WA 3TGWA 2F3TA 3OBBA 1NQAO 5I9SA 4F11A 1SIWA 2R6ZA 3M4XA 4YRFA 1NR1A 2IXAA 2I1WA 2WF9A 4Q4JB 4AFNA 3Q9SA 2JK0A 3DE0X 1JKFA 5TVKA 3FYDA 2C03A 2MT9A 2R96A 2YYAA 1IHUA 6ADHA 2GN0A 1S2LA 5HIIA 2H4FA 4TLEA 4XGKA 4IH9A 3T3NA 4BVEA 2WM8A 1XNGA 2LBPA 5AVOA 2CHGA 4X71A 3S2EA 1FTNA 3H8SA 4YDHB 1JE1A 1UJMA 2DUNA 4BAUA 5F73A 4UJ3A 1JHYA 3EMDA 3WMFA 4PCUA 2FEWB 2VHCA 1LD3A 5IFLA 2A0UA 3R7WB 3VR3D 2XE7A 1LNSA 4RGYA 2VRNA 2MMGA 4DNXA 1A1VA 5EKTA 3OTGA 3CPSA 3KR0A 3QHAA 1GTMA 2Z2KA 1WMFA 3GPIA 1L8LA 3MJ4A 1H3NA 1OPXA 2AQHA 2QSYA 2Y1FA 3P32A 4G89A 3TRKA 2IPXA 4BLWA 2OL4A 1KZ7B 1PT6A 2VHQA 5AI9A 4EPTA 5DOZA 1P1RA 3FYUC 1NBMD 2DQYA 2EQAA 1SVMA 4H77A 3K0AA 1C0PA 3A6HA 2I67A 1M67A 5A6SA 1Q92A 4HN4B 1CR1A 8MHTA 5HRUA 2OGSA 2CDNA 4IHJA 1W0KA 1P77A 1JDBB 2RK4A 3AUAA 3DOOA 3VAAA 3QYPA 1P1CA 1CQIA 1IY1A 5F4ZA 1KHTA 3R5XA 1DUSA 4LVUA 3U4QA 2XH8A 3EZ2A 2G67A 2VR1A 3SF0A 4C0AC 1B2RA 1G4AE 3GWZA 5FO0A 1EMDA 3F3KA 3HVHA 2XF2A 5JZ9A 4G1UC 1XU7A 1KPHA 1AB6A 1XQWA 4D56A 2ZIGA 4EQ6A 4CCYB 1UP6A 3AR8A 3RJMA 2ZSDA 1NDHA 3KYDB 3VR4H 1KKUA 4B75A 1ESZA 4I55F 2ENWA 2PH5A 3KO8A 4QEKA 5JS8A 2VYVD 5BYBA 4MJLA 3NH6A 2H85A 5AW8A 3I9LA 4CKWB 5C7OO 4WA8A 2B8NA 2FSVC 2FOXA 3V8NA 2FMFA 3FG9A 3LC7O 3TIIA 3ZHBA 4ZQFA 5EXEA 3FTPA 1G60A 1OD6A 2PT5A 2Y1DA 3IA2A 4GPEA 4G5YA 1DFGA 1N6IA 1SGWA 4HD8A 5TPWA 5BVGB 5CIYA 3BPSA 4BNFA 1NNUA 1U5AA 2QA5A 3AH8A 4QXQA 1DKMA 3O4JA 2HTFA 2X3YA 2QF7A 3GT7A 1IN8A 2Q0SA 4ARVA 4Q93A 1QIEA 3HUTA 5FCDA 5E8RA 3KEMA 2CLDX 1E8DA 4DSAA 3WJ7A 3FVTA 1U7DA 1XR3A 5CVCA 5L4SA 1AZLA 3W3AA 4GXQA 1GILA 1I7SB 4ZVLA 3DTVA 2JLRA 1YRLA 1FYVA 2PFSA 3DGFC 2IBTA 1SUPA 4DIOA 4M8KA 3LOPA 1LWNA 5MN4A 2JGMA 4CLXA 4Q9JA 2CCJA 2W9XA 3A26A 2O5CA 3JTMA 3DWGA 3IDQA 3H1PA 5E1OA 1IHYA 3BRWD 5PNTA 1UFVA 4FOOA 2BKAA 1GDTA 3QVVA 2IPLA 3OLVA 2GHQA 2H2IA 3CRVA 5EE0A 3UV6A 1FSGA 2RH4A 4N0PA 2PKQP 4YP9A 2WY2D 2V7QD 3IOEA 3SYNA 5KAPA 1AF4A 1I1NA 3OQVA 1KO4A 5EJAA 4O2RA 3UKDA 3DFZA 1S7GA 4L16A 3B2NA 5AVRA 3RU7A 1KPIA 1T2EA 7YASA 1OIVA 5CA0F 2O8EA 2BFEA 2ZTMA 2ODWA 3U4HA 2D6FA 2FQ1A 1Q7GA 2IOHA 1GZ7A 4IS2A 4TN1A 4Y98A 5IN5A 3DAYA 4DABA 2PGDA 1OWNA 3H65A 3IOBA 4DIDA 3U60B 3ESRA 4XWAA 2ILVA 3HLTA 1KSGA 5G0WA 3ZD6A 1T0BA 3USCS 3PTZA 3KFLA 1UCFA 3UMRA 3VYVA 3V7UA 3DCIA 3N58A 1NP7A 3NP9A 1BVHA 3HYLA 3SR0A 2HMVA 2HV8A 3EF1A 4O2BF 4JXXA 1N6KA 1JFVA 4HC4A 1SUSA 1YZUA 1V39A 4MW2A 2CXUA 2CLIB 3K9CA 3HY4A 2PQ2A 3FZGA 1S1MA 2QMQA 3BWYA 2V9ZA 3QVSA 5EWMA 1BXGB 1NBME 4KKXB 5ILGA 2G0TA 2J4CA 2NM0A 3VSAA 1AG9A 1P9RA 2CXSA 1J24A 2VAVA 4MGYR 3TLXA 4AK9A 4AKSA 1UXHA 1J21A 1VMAA 1W93A 3ILHA 4ZEWA 3SD7A 2C5GA 4RVOA 4B4WA 2G8NA 2RHMA 2XA1A 5F33A 1DFHA 1ZGJA 1CUFA 4ICIA 3ZH9B 1F6DA 1KC1A 3OCJA 1BE8A 5DSTA 4PWYA 2WD7A 4EG4A 2C5FA 1VMEA 4F2GA 1ADBA 5IC4A 1DV1A 1G3IA 1EUQA 2G8LA 2II6A 2PH7A 2SHKA 4N40A 3SQDA 2B99A 1E2KA 1S5PA 5ARCA 1DJMA 1FP2A 1UFOA 1T5LA 1Y9EA 1WIWA 1RPTA 2FB9A 1H1DA 2C7BA 2JCBA 2UZ3A 3F67A 2Z0MA 2ETXA 4AKIA 3C0KA 3ORFA 3BSSA 4WNCA 4BJ3A 3FOWA 3CWQA 2AG8A 4OK5A 4J4BA 4TLMB 5KU1A 4Y18A 2KB0A 5B6IA 4Q12A 4B5LA 3AP1A 4RH0A 3M6IA 1Z07A 4JU9A 3VH2A 1R5JA 5EFOA 4OIFA 3ADCA 1FDVA 2R6GA 3LCCA 4D8WA 2NXNA 3IAM6 5AKEA 3WIEA 5FI3A 3IE2A 3CMCO 4JQCA 1NFQA 4KTVE 5K3CA 2VK1A 3UMCA 3U7RA 1BZYA 1RD4A 1M1UA 3REQB 4ETWA 5K6TA 1OBFO 2OOSA 3JS5A 4WBSA 2WHPB 1C4XA 1GZ6A 1S3SA 1E3SA 1K86A 1O08A 1SZDA 3FFXA 3NEYA 1FJ2A 3SPXA 4F3NA 3EDYA 2JBAA 1PZGA 3KQWA 4M99A 4JC8A 3TQHA 2VWQA 5TJ9A 1G3RA 1GFSA 4IHKA 1O95D 3W8NA 1VL6A 1KQGA 1V26A 3PXCX 3UXYA 1MT3A 1UJCA 4JYMA 1NJ6A 4M9SA 3T7KA 5KX5A 2ODQA 3J81A 5LJLA 3ZS9A 1BGVA 4MVJM 1SCBA 2NSJA 4G4JA 3NIGB 4EKYA 1T9GS 1X1AA 2Y2VA 3DDZX 4IVPA 4XSVA 2NUTA 3VH3A 4MIYA 2JLQA 4P9NA 4B76A 3KQMA 2QPAA 1QFSA 3EXHA 3SJBA 3WDKA 2ISCA 4QPCA 3AY6A 2FJPA 5BNIA 3HO1A 1ESDA 1OXMA 2DC1A 1SG0A 2EBUA 3LUAA 4QARA 1DAEA 1U8AA 2CXRA 4TTTS 3ZFOA 5DHQA 2H7XA 1ST2A 4YJ2F 5EXTA 3UMFA 4CODB 4BHTA 3WYFA 5J4VA 4URWR 1FQWA 1YJ5A 2QLMA 2Z3VA 2AH5A 3BYZA 4QUIA 5TEVA 1ZKMA 1E8NA 2QRVB 3HFJA 1YKSA 1T9HA 4NU0A 2ZUDA 3R3XA 2Y2UA 1L1EA 1EVKA 2NVUA 4R6XA 2OAQ1 2VPWA 3CVVA 3DLBA 1GTG1 4NDZA 1S1CA 3D0OA 3MBIA 3IYLW 2JB9A 2ZWMA 4DA7A 3GVHA 3LWDA 3PLRA 5B1DA 1QHXA 1TUBA 1SULA 4OEHA 4C4ZA 3OLXA 3PQFA 1DIOB 1KBZA 4HDNB 4XVRA 1H6AA 3BKXA 1WCIA 1BQEA 1SBYA 2CJWB 2QRPA 2IHUA 4J1TC 1N6HA 1QQ5A 1SUDA 2IBMA 2JJ2D 4UCFA 3GZTB 3IH5A 5I4CA 1NLUA 1CJCA 2FZGA 2Q5OA 5DX0A 3ZHTA 4W9RA 4C0LA 5KHOC 4PE5B 1R9JA 3SEFA 5K01A 2D5CA 1BMQA 4B2PA 4DMGA 3BFPA 3ZV7A 1HDOA 1S8NA 3W7BA 2UUAB 2QSUA 2XUPA 3E9DA 2NTYC 3NHWA 4L50A 1AH2A 3EIUA 4RDIA 2VK2A 4E1BA 4B3FX 3B3FA 4GQAA 2XCUA 3UB3A 4AMZA 2ERXA 2J67A 2XT9A 4LXYA 3N5KA 1KR2A 3D7MA 3H18A 4RQAA 3SC3A 1KJYA 3NWOA 4C06A 1QM5A 5FKJA 1MW8X 4HFRA 3ZE7A 3B6KA 3RF7A 4BVKA 3W8EA 1V5IA 4GGMX 2QN2A 2WLSA 5KOIA 3N2KA 1G8MA 1SK9A 1OC4A 3SKYA 3PDCA 1H2EA 1PKEA 1ZINA 3EWAA 1INLA 4IIYA 5JMPA 4DPLA 1QH8A 3OICA 4R54A 1W0JD 4WESA 1CPYA 1TVKB 4BEWA 4ZQHA 1YRAA 4FHDA 4YFYA 5AWFC 3FIUA 4XZ3A 4E31A 1SZJG 4LS3A 2B9EA 2VP2A 3W04A 3A1TA 5FRDA 3LY7A 3QELA 2OYSA 2AD5A 4N01A 1U2TA 3PLNA 1W1IA 3NKLA 4PGHA 3K5IA 2I4NA 3LX6A 3OMXA 4DIMA 1OE0A 4NECA 5J4KA 1FFSA 1RJ9A 3HH8A 5C8YA 4HAZA 1L5GB 2AGVA 3STTA 3UMMA 3OJCA 3OZFA 4GXRA 1G21A 5KOHB 4F04A 3AX6A 3O2QB 3ZDCA 3L0DA 3ND6A 3SF8A 2C1ZA 4ITRC 4D9GA 4YWHA 5M5BA 3H5VA 3HM2A 2O8BB 4AKEA 4BZWA 1TD1A 3ANNA 4YA6A 2HFKA 3AUXA 3KJGA 3KT6A 4GT1A 1CERA 4DLKA 1L4EA 3PQ6A 3UMJA 1AXGA 2P3SA 3V7WA 4EQZA 1WPGA 3ZVRA 3M5WA 5ALHA 5C4GB 3R7SA 3C4QA 1IM5A 3LUHA 3MQ4A 2FH5B 4LY6A 2PBFA 3H8JA 1DTWA 3MN1A 3GFRA 3L93A 3O73A 4L9RA 3VJLA 4TGLA 5AK6A 5L3QB 1SD5A 2EGGA 3JQ7B 4B8WA 4MCAA 2C5AA 3TTSA 5JZBA 3M34A 1WZIA 2IF0A 1DRUA 4RPCA 1W4CA 4Q7MB 1E62A 2ZT8A 3UGKA 3VMFA 1FLVA 5EWLB 1LF0A 4LJ6A 5IVHA 2WD9A 4RKFA 3W5DA 1CZNA 5CVVA 3U3KA 2PX4A 3QKRB 1UDCA 4OLHA 3ZEAA 2BWJA 3UGQA 4QU5A 1RYHA 2HF9A 4HUQB 4Y2JA 2B8TA 1BMFD 4ZU1X 4Z3DA 3CVYA 3S2UA 5EYPB 2WAYA 2ZIXA 3DOHA 3BM5A 3KYJB 4CR7A 5B4UA 5DU2A 1WUIS 2HQ1A 2VPZA 3ZBTA 2Y99A 1X1BA 3T9DA 1RXUA 2EF0A 2HEIA 1RM3A 2J5BA 3FHOA 4CHGA 1H4TA 2HGSA 3B38A 3OIWA 1W36D 5J4YA 4PQRA 1P1IA 1U3TA 1IVYA 5CNIA 2VYNA 1KZ9A 4ZYXA 3CU5A 4RVUA 1CUBA 4D4HA 5EZ5A 2QE7A 2UVPB 4H6PA 3TW4A 3OD5A 4X93A 2NAPA 3PHIA 1EVJA 1Q15A 3H4MA 4J1NA 4MARA 5FWDA 2GFIA 3JQRA 4E2WA 2DWQA 3G0IA 4QXPA 5AIAA 3HB0A 4AROA 1KOGA 3ZN2A 3FZEA 4YRQA 1P60A 3KWMA 4PPGA 3F6BX 4IV0A 5DB4A 4CYMA 2AXNA 1TW2A 3QUSA 4N5IX 1JKXA 3C5CA 4ESVA 3F78A 4M0LA 2HCRA 3PC3A 4AJ2A 5EKDA 3TSWA 5AM0A 2A86A 3N0XA 5DN9A 1NRWA 1SXQA 4JDUA 3QLUA 2IYSA 2XWBF 3I5YA 2V4UA 2HDHA 3R5HA 3C8DA 4D0GA 5FPHA 3LKBA 1H94A 1SU4A 3MD0A 3WGHA 2XCLA 4RJLA 1OYYA 5LYJB 3MB8A 4TTSA 2Z8YM 3IS3A 4K40A 5CVDA 1N6PA 4OH1A 3TL3A 2JCXA 1NYLA 3SC4A 3SVTA 3ZVMA 3RVQA 2B61A 4PSAA 5A9SA 2GN1A 3LC0A 1H5NA 3DBLB 3IEMA 2QVCA 1X2EA 4MGZR 4XIJA 3RRZA 1OXUA 1WKBA 3T3IA 4FS8A 2DHRA 2I6UA 1DE0A 4WFKA 3V97A 5LL6P 5BRJA 4EVRA 3UUGA 2QTNA 2VF8A 3BXZA 4CM5A 2DECA 1PEYA 3CC8A 3BXHA 4PNHA 2D0DA 4HB2A 2TMGA 1GNQA 3EY9A 1RKXA 2TMKA 4I4IA 4JXJA 3SC6A 4UOEA 4P7JA 3GLHE 4WOCA 4UU1A 5FFNA 3PXGA 2L2QA 1AN9A 3T7SA 4M88A 3ZYZA 4HN2A 4M7RA 5FQOA 4QDUA 1H22A 5TMPA 5AHOA 1J6UA 1MUUA 3WGTA 1Q1GA 4XFDA 3NHYA 1WULS 3EFEA 2FCRA 1CD5A 3VU0A 2V7GA 3M3DA 5AKGA 1MEOA 2G77B 3S2IA 4LJ7A 3LQFA 1V3QE 2PSFA 4NULA 3IPAA 1GCAA 1VGRA 4Q4AB 5DWDA 1NVUQ 1LSSA 4M86A 2XIJA 3JQAA 4HR7A 4QOIA 3ZOZA 2D7DA 1ZK4A 3DQPA 4DR5B 4OI2A 1XMIA 2PXCA 3GG9A 1MX3A 1RAIA 2JS7A 3KYCA 1X8KA 3MFQA 5G53C 1NJGA 5FA6A 2OQRA 4BL5A 2WYVA 3I04M 4DIFA 1UAGA 4ZOAA 4KRYA 4I5IA 4FNMA 4EW1A 3IEKA 3HBNA 1XMPA 2VHUA 3WIDA 4YQFA 5SZHB 4H4CA 3WX0A 5BVHB 3L07A 2O2CA 4KC0A 4JQYA 1J4AA 3T7DA 5A0VA 4XB1A 2ATVA 2G17A 2J09A 3EGOA 4US0R 3UKJA 2JW5A 1GQ2A 3HUEA 4C5BA 4NCBA 5HKBA 4PG5A 3V4PB 3GLRA 5L51A 3I83A 2ALJA 4D57A 1K27A 3BJMA 2LIPA 4KN8A 5I3ZA 1DRJA 4B3GA 1PGQA 1MEEA 3ANMA 4W82A 2QQ0A 2ZJOA 3KJNA 3B85A 4WOBA 5C8XA 2AZTA 2BDTA 1U8FO 2GWRA 2EFYA 1HQDA 3L06A 1VPDA 1X1SA 2GXSA 1GN8A 1M5TA 2OFOA 2WG2A 3JARA 2E4AA 2ZR9A 2GB4A 1U7XA 3D6VA 1A88A 4FMDF 5J9FA 3URKA 3LCRA 3NWJA 3R4CA 4CF5A 1K6XA 2VPPA 4GEKA 1CUHA 4K9OA 2IDJA 2JFOA 4RVFA 7MDHA 1S9HA 821PA 1T8UA 2HQOA 5EMLA 2BRUA 4DB2A 2PAAA 1ID1A 3DV0B 2P91A 4BRWA 4YR7A 4IV5A 1XL1A 4KQHA 2OQ2A 5THXA 5AO9A 2XQGA 3AESA 4ZP1A 1JWBB 2Q6IA 5BN4A 2BT4A 4DCCA 5IKOA 5LQUA 1FLNA 4RCVA 4EF6A 2PSDA 4DRXA 2O8VA 2HF7A 2YHIB 1O97C 1VKJA 2OC9A 3JX9A 3RT9A 3UC9A 3K8OE 3RT7A 1AO0A 1WNTA 3EEFA 4ZI2A 3MUOA 1ZMOA 2GTPA 5JROA 2YV3A 1LI4A 5HMMA 3WB9A 1JIUA 2J0EA 2KJQA 2WIKA 4W1RA 3WK7A 3F9IA 5JBNA 4LRQA 4TSFA 3IP9A 4S1OA 1XFDA 1QB8A 3MNFA 2R4UA 3L6DA 4NNOA 4J1QA 3ZWOA 4ZJZA 2PS3A 5AOVA 5J2UA 2O8DB 1W47A 4CHTA 5B55A 1OX6A 2GEUA 4B48A 1PR9A 1U2DA 1XHEA 4DTCA 3PPYA 1NUUA 2ZJ4A 1E94E 2IZ6A 5K1ZA 1CUUA 3FDJA 3HU1A 5KX5F 2D0PB 1GRRA 2Q3CA 1UT5A 2GCEA 2PO7A 4FJ1A 3MSXA 1L3IA 2ZI6A 3NORA 4ITUA 3ICPA 2JI6A 1QV7A 3CEAA 5DCLA 1E3MA 2CNNA 2IOFA 2VDOB 4XD7A 5A3SA 4DY4A 3X1KA 2J7PA 3OESA 5D00A 1SY7A 1IN4A 3IP7A 2OXIA 5CITA 3FNBA 2G88A 1ZCZA 4RZUA 3Q3CA 3QVOA 1E3TA 1OWPA 3CH7A 1R0YA 3L7LA 1C1YA 4PG7A 4B6JA 3HXQA 4NX2A 3WL8A 4DHEA 1XOIA 1FW8A 2H4YA 2P9BA 3SEZA 2I3AA 4QT4A 1WZEA 3OURA 4L4UA 2PMFA 5KQGA 3ZY4A 3N76A 4M37A 5ELMA 2UXCB 1W4AA 4E3ZA 3S81A 2GZ3A 3L7AA 3F90A 3MXOA 4F5YA 3HJFA 2AYXA 2XIQA 3MJCA 1AKNA 2R8PA 3UXEA 1XC7A 2AQIA 1GFIA 2IXBA 3BWCA 3TBFA 2F55A 1EHIA 4AP5A 1YI0A 3FRJA 1JDPA 2P6MA 4WSOA 4UZSA 3EDQA 3IUSA 3O4HA 4FKBA 4GSLA 9GPBA 1VJRA 1YZLA 1SH7A 1O6BA 1Q1EA 2P2LA 2IP4A 2VT7A 2RGRA 2H4WA 2QD4A 4CM8A 2WEKA 1ZK1A 1OYWA 3HFRA 3RWBA 1Y3HA 3ZGXA 3G02A 4MA4A 1GKYA 1Z0FA 3BBPA 4IRMA 4D46A 4EGJA 1V6CA 1BTOA 1O6CA 2G4LA 2I2FA 3L1JA 4MUMA 2PTHA 3TQSA 5CDTA 2W2LA 2SCUA 4UNPA 3ZVKA 2ZVJA 4L78A 5TPZD 3FLMA 1LLQA 5CVJA 4E3WA 4FN5A 5LWHA 1D2MA 4RHFA 5C3MA 2OBNA 2JG3A 3FNHA 1OILA 4NYIR 3OIGA 5YASA 1TK9A 5B7PA 3WJAA 1QVZA 3W5SA 1A9YA 1G18A 2MSDB 4IDFA 1E3WA 2CHFA 4N12A 4ZT3A 2WPNA 4YPVA 4OMFG 3I76A 4HLUA 2GTHA 4XGNA 4DBLC 1M1YB 2E4WA 5AVVA 4YV7A 1GPUA 4K6MA 1BKYA 4UXIA 2JEYA 1K4KA 1BX3A 1E2NA 3Q6NA 3C6QA 4PGFA 2O1SA 4MV0A 5EHQA 4ZEXA 4F5EA 1E4EA 1VE6A 1X7YB 2OEPA 4U4AA 2OHVA 1KJWA 4FTWA 1FDWA 3ZE1B 3IXQA 4ZARA 3PRJA 2G25A 2RGAA 3GN2A 2W42A 5HFAA 2HRQA 2RHHA 1QK5A 2IPNA 1J5EB 2V97A 4U6SA 2AKEA 1NN5A 1QYRA 2ZE5A 3QFTA 2IY8A 4N54A 5HF6A 5EJ9A 2YIJA 4MRVA 3H42B 4GPAA 2CFIA 2Q4TA 1IOVA 4FSDA 2ZI7A 3CVXA 4DV0B 3UANA 5ERXA 2CMGA 1B26A 5HDQA 4KPEC 1PFWA 3X1ZA 4X8HA 4QYXA 1UK9A 2BZGA 3WGZA 3STHA 4OGGA 5EJ8A 5LR6A 4CU2A 4YAUA 3OO0A 5DNVA 3OJWA 2W6JD 4EMTA 5GWXA 3GROA 3DKKA 4YMLA 3KEQA 5A4IS 5I7RA 2OUKA 2IYYA 1KZ4A 1ZD8A 1FTWA 4P5EA 5KYXB 1Z26A 5KQLA 2GJ4A 2C84A 3PE4A 3ETDA 4R81A 4MVJA 4BLPA 4DDKA 3G8DA 3RW9A 3ZJVA 2WK1A 1A8HA 2QIPA 3DDNA 1NI5A 2NTJA 3UWOA 2B8WA 2BZ1A 1A9ZA 4HDMB 4BBZA 4WD3A 1XN4A 3CE9A 2H2FA 3AU8A 3KQPA 3L8GA 1ZN8A 3GHYA 4UOZA 2O8FB 3FGZA 4JYAB 4ZJYA 3BB1A 2EWVA 1BFKA 3HNOA 2HDNB 1E1DA 2PPLA 3OZIA 3LCMA 2WUFA 3MJSA 4N0EA 4H1VA 2PXHA 4Q3OA 5ARDA 5F1YA 4PG6A 3MWJA 3L7IA 3RLIA 4D9HA 2JKVA 4G63A 4P08A 1OXKB 1R4ZA 4YAWA 3TNYA 1AUOA 1YR1A 1VI6A 5AVXA 2BBTA 4KV9A 4YJHB 4KZPA 4QUGA 3D0KA 4F96A 2V3VA 3EQ2A 1WXXA 4K9QA 3RYFB 1W59A 4WUVA 2OV2A 1XVUA 4R1LA 3GZJA 2FQYA 3G6KA 3KT8A 5EVJA 3OQIA 2GHRA 1XTVA 3ZJTA 1JUDA 3SQOA 4W5WA 2ZSEA 2Q50A 4ZHQA 2XI4A 1EDEA 1LJUA 2BKEA 1QHGA 3KKKA 1H2YA 3PCRB 5ECDA 5I7SA 5C8DA 5KBYA 1RZVA 2AHOA 1BRMA 3EH1A 1PWHA 4KK3A 5CFMA 2N46A 2JLZA 3G0HA 2QDXA 3I92A 4U2DA 4XCQA 2EVWX 5JG7A 4RELA 2QZ9A 5KTPA 4W6ZA 1ZJZA 1ZI9A 5J63A 3RRYA 4O2AA 1T5OA 1RWNA 3PGVA 3QW4B 3B12A 2VF2A 3P9CA 1JQKA 5AM5A 1VKNA 2OE2A 3DS8A 4HADA 5EIWA 4LBVA 1SUCA 2CVQA 1K2VN 1NBHA 2FX3A 3BMOB 2FZCA 3C45A 4G1EB 1EB9A 5AW4A 5ITWA 1DJQA 2JJ1D 2ZKIA 1HZJA 1SNYA 2H52A 4ZOLB 2QTGA 4I08A 2Q4RA 4U8HA 5F2KA 4ZVQA 5LQAA 5LOVA 4LSMA 1UBGA 3E5MA 3ISTA 3VPSA 5CVTA 1EWVA 4HXFB 3HCDA 2DF8A 1O6GA 2DFTA 1H0HA 1E9SA 3UK6A 3HO8A 1J49A 2PZLA 1TAHA 4B4OA 1U2GC 1SPBS 2P90A 3FYTA 3HFGA 5E7IA 3ZW8A 1EP3B 1Q1NA 2W7TA 2QQFA 5GGYA 2Q3MA 4RUKA 1OH5A 2FW8A 4NJEB 3OM9A 5FEMA 2ZR8A 1QS0A 1JEQA 2FPXA 3P52A 4HJRA 1NRXA 4O59O 5FB3A 1NQUA 3FCUB 4EMSA 3F5DA 5CDSA 1SEPA 4INPA 5ALTA 2N9UA 2PT7A 2X1HA 3CF4A 3LSYA 4E12A 2R60A 4QU9A 2HLDD 2H0AA 2WIFA 3MBKA 4YI5A 4DT1B 1F14A 3OT1A 1C4KA 1F12A 3YASA 4F6RA 3WIBA 4E94A 3GI1A 1F8UA 2E7ZA 2WT8A 1R1DA 3R40A 4Z1MA 2HBRA 4A3SA 2BHNA 4JC4A 3GLKA 4TV8A 4ZI7A 2YXBA 1ZONA 1ZAYA 1UIRA 3C5HA 3V1MA 3X1JA 3WL5A 1VG0B 4W1SA 4GD3Q 3C8MA 4G0WA 1CUIA 1UJ5A 3EG9A 4NZOA 4WLEA 2BONA 2GPBA 3RBXA 3T9CA 5LD2C 2XJ4A 3ISVA 1L4GA 1OH6A 1RYBA 4OH7A 4QYSA 2JZNA 4FP9A 1P5RA 2CW5A 1ADFA 3C6KA 3QEKA 4U2FA 4EGSA 3QXGA 3E15A 3ZNNA 1QOQB 3QWBA 5KTNA 3C7TA 5KYYA 3R9XB 4QOGA 1RQXA 1QE3A 2I33A 3AVPA 1GQOA 3GZNB 4AMUA 4ALLA 4OHVA 4C6HA 3PVZA 4ZCLA 2VJCA 3JD2A 6PFKA 4E03A 3SFTA 1Z17A 5IBQA 2WLTA 3UJ9A 2FJUA 1W1UA 1OASA 2CBGA 3RSZA 1Y5NA 3EDCA 1G5FA 2CBXA 3UIEA 3NXKA 3HKDB 4EJSC 3JVDA 2YFKA 2PJZA 4WZAE 1FE8A 1UBUS 2Q2NA 4XYLA 1GPBA 3ZGYA 2G04A 3LHKA 1LUAA 3S4YA 4PRZA 3RAPR 2IYFA 2UZIR 4YRTA 1FFEA 4PLGA 3MUNA 2OQIA 4UW9A 1XL0A 1W9HA 3HJRA 2FPRA 1GNVA 4GPD1 4J7AA 4O4HB 3KQHA 4JYZA 4QA9A 3FSGD 1U2EA 3FJ1A 4PLWA 1ODTC 4ANFA 2I6SA 1AC5A 2AD1A 2Z09A 3CZMA 3TCNA 4G5GA 2B6HA 1OXSC 1M34B 1ZIXA 2ZETA 3IOYA 3F4KA 1XALA 4GX1A 5JCJA 5F5XA 4B7AA 5JAHA 1LLUA 4I3GA 4RTRA 3LYAA 1NUHA 3H2YA 5HM6A 1EXNA 1J06A 1ZXLA 1XZGA 4R71A 2F6RA 1N3IA 5FXMA 3MM4A 4GE0A 4YMHA 1JA1A 2XYQA 4EEXA 4ZRDA 3D4IA 2EF1A 1DX6A 3OEEA 2FGJA 5JSHA 1HETA 1UJ6A 4OFWA 5DBHX 5K2MA 3ZWVA 1E9BA 2Z8YA 4LFCB 4M1OA 4B87A 1ZR4A 5CG2A 1X1DA 4YCCA 3OLCX 3MWLA 3RB8A 2CLSA 3BT7A 4UHJA 2GFQA 3PC8A 3H5IA 3C4VA 3EPKA 2WDPA 1X13A 2XHZA 1ND5A 4R9NA 5LA6B 3ETEA 4JU8A 3RE1A 2PH3A 3GFGA 3ONVA 5F9MA 3PNMA 3VC3A 4D8TA 1RXVA 1GM5A 3DAPA 4IJUA 3CPJB 5DGCA 3U16A 4TYQA 1GGHA 1SKYE 1UR5A 1ZC4A 4PQEA 2R8OA 3FBWA 2I3DA 1K0FA 3R8XA 3ROQA 1P8AA 3O1HB 2QSJA 3F0TA 3KXLA 4BBAA 5J23A 4Y6PA 3JQGA 3ILXA 4K1XA 2X5JO 1NU8A 3B7PA 3DO8A 4ZAVA 2YZKA 5JDCA 1TJ3A 2C2ZA 1R27A 3GJ0A 3QMWA 4GC5A 1DC3A 2IKQA 2NV6A 5EOVA 5FDFA 3TUIC 4KVZA 1J97A 3H11A 3MMPA 2W0SA 2V7PA 1YDGA 2A0WA 1QGZA 4A36A 3BWVA 3O74A 1YDWA 4XR9A 5ALUA 1Q11A 4U1RA 2A5LA 3IP5A 1MIHA 4B3RB 1GP2A 1XZMA 1ZJ4A 1A9TA 2CHUA 4KQIA 1W76A 3INTA 4L57A 4L4XA 3Q2OA 2LVBA 3DDUA 3R3WA 4E15A 3HCPA 3NBXX 3E23A 3MS2A 4C14A 1MP0A 2FWIA 3I04A 3THXA 2XEXA 1U5BB 1KVSA 4P1ZA 3WAGA 4R9RA 3FUUA 1BX1A 4RE6A 1OKKA 4B44A 3PPIA 4QC2A 4NG5A 1DJPA 1YULA 2C4UA 3BIOA 1JI3A 3AOEA 2ZVQX 3QMPA 2ZTLA 5F77A 3QA3E 2G70A 2VTEA 4ZQBA 1ZN9A 1E20A 1JLLB 1U9IA 4AXXA 4F0JA 4EJ2A 2PZGA 3H9JA 3ENKA 2JJYA 1WNFA 3PX3A 4IX1A 5KMGA 4LVCA 2DULA 2HRZA 3LHSA 4D3YA 1XWIA 3WBKA 2QLNA 4RTNA 3FB4A 3LOQA 3O82A 4MV3A 5HS6A 3SHWA 2E5WA 5AKKA 3X2SA 4A10A 4AVYA 2AOVA 1NUAA 3A9SA 3PEFA 4KYUA 2VTBB 3TL6A 2IXDA 4GBGA 2Q0QA 3TAUA 1OCEA 1TQDA 4LOAA 3EISA 3KSUA 1B6SA 3IVRA 3KXPA 5GJCA 4C7OB 5EZYB 3VC1A 4ZXPA 5DM0A 1FRQA 4EH1A 1JAIA 1WMAA 2XUFA 4GOOD 1J0AA 4TN5A 5COQA 3ONFA 1EFUA 2DTXA 5EERA 5EIHA 1ZGZA 2EIHA 3QXJA 4F2HA 5JADA 4IDPA 3SYMA 3ERCA 5FD8A 4UMDA 3T8YA 1Z0AA 5CCDA 1P29A 3VYWA 1A2OA 1W88A 4BKUA 4ROTA 5C9ZA 5JNRA 4E4TA 3IQXA 3DHWC 3FPSA 3NC1C 4XWOA 4LXHA 3VVLA 2AFIB 1UK6A 4HTAA 2OXRA 1YQQA 1GAJA 1PTJC 4G1MB 4JLDA 1P0CA 2I66A 1G0NA 1E58A 1HUQA 1BRTA 1Q0PA 2AEMA 2F00A 3QU4A 4JMLA 2IGBA 2XQFA 2WICA 1U0RA 3DOCA 4QEZA 4MRMA 2H51A 1R6AA 5CIWA 2YZMA 5AKHA 2COKA 1IWOA 2GR9A 3NCHA 5AK4A 2XBMA 3TLBA 3NETA 4DRYA 4FYMA 3RV4A 3EOZA 2QE6A 3INNA 4WZ6A 2OZKA 4UNRA 1TUIA 1C8BA 1G9SA 2EJWA 4A2WA 4ZVVA 1SOMA 1QPGA 4QYWA 1Z74A 2DPYA 5G2OA 5T64A 3BF7A 5C4MA 1TQ8A 3VNQA 4FEAA 4QSHA 4HH0A 1V11A 2JGAA 4U7HA 5C80A 1PJQA 2DPMA 1XDUA 2OBFA 2PRKA 4GW3A 4MJ3A 3PGKA 3VH4A 3TLCA 1JQJC 3DE4X 4II3A 3GLIE 4C7JA 1JJFA 4I50B 2VJKA 4QPDA 3OF2A 4IMIB 2DBZA 8ATCA 2CV0A 4DMUB 1UWLA 3LV8A 4FJ0A 1VMIA 1VG9B 3CF4G 1YC2A 2CZQA 2QVYX 3GT3A 2HIGA 3CJTA 4FQ5A 4O6VA 1YQDA 1T9AA 1I0ZA 1KXZA 1QBKC 1E2DA 3OEHD 3TN7A 4BNJA 1D8TA 3OE1A 8GPBA 4IZHA 4GKVA 3P2MA 4LTDA 5TQ2A 4NE9A 3NMUF 2NYRA 2PQ0A 5KUTA 3NPAA 2IT1A 4V3CA 2V7EA 1WOMA 1Y6FA 2R6AA 3K1ZA 4X3OA 2C2YA 1XLWA 1JFFA 3AR9A 4G0UA 3HMQA 5JWHA 4C89A 4JT9A 1XZHA 3M3PA 4Y1FA 5B7QA 1YA6A 3TNDA 4A8TA 2X4IA 3GLTA 1JEOA 1RBZA 2CE2X 4GPBA 3GL9A 2WZBA 2QPOA 4N5MA 3DZBA 3FCXA 2FWAA 2QRNA 2GFHA 4P54A 5GMOA 2HSJA 5SYMA 1KEEA 4Z8YA 3WK4A 4BKOA 2W8BB 4X60A 4J29A 3GYGA 5EXDA 4Z9XA 2R6HA 4GPIB 4DR7B 1ZVQA 2DT8A 1DEHA 3WKAA 4ERNA 3OZSA 1OIWA 2ILTA 3N28A 1T5BA 1WU7A 4D92A 4Q7LA 3EASA 3N1UA 2IVZA 3DC2A 1FVOA 4E2YA 3VDQA 2ZSFA 1G7RA 3M6FA 4W5HA 3O8CA 1XEAA 3HDTA 3TE7A 1PFVA 5A0TA 4REQA 3H2JA 2NSDA 3UT5A 1ZU5A 5LYJF 2JASA 1JSRA 3PEYA 3FTNA 1SIUA 2LV8A 1DHRA 2P62A 3ZDDA 1NQOA 2CNBA 2FKNA 5HUJA 2FK7A 4JSYA 3MJFA 4KQXA 5DHUA 4RTQA 3WADA 3GIDA 3ROMA 1WB5A 4AIRA 1NXOA 4I1YA 1E9CA 5FBKA 5G3ZA 3ZZNA 1ZCAA 2ZJZA 3UUEA 1UFRA 2C4VA 1K7YA 2BP7A 3KPYA 3FAZA 1N0VC 5I9MA 5KS2A 1I3LA 2FMXA 4JQOA 4B7UA 4NVRA 3MCAA 1TTTA 1PQWA 1PJRA 2DZDA 1U7TA 5LDHA 3ICEA 2ATXA 4NEGA 3CSDA 3DKPA 1IJFA 3KAPA 1MQ9A 1LK0A 1IOLA 3G2PA 3KZKA 3OVMA 4IG4A 1P33A 2ASVA 2EX1A 2C3OA 5BSRA 3ZCRA 3SU8A 2QVZX 5F7JA 5FTKA 3WKEA 3SM3A 1EX6A 4LW8A 4FDVA 2DTEA 2FUKA 4NU8X 3WO0A 1XTZA 4C78A 5I9NA 5KQSA 3RC8A 2ZWPA 4QGHA 5BSWA 1XTBA 3P9XA 4QWMA 3IUEA 3WNDA 4RIHA 2QY6A 1TIBA 1FSPA 1RFGE 2ORED 1U8UA 1W34A 3WISA 3FFTA 2OR3A 1G20E 2P9FA 2PUEA 3F7OA 3P5BA 1I9GA 3VYTB 5BV0A 2FXVA 1CEEA 1F8GA 2GD6A 1RRMA 1H23A 2JCSA 3ZIAA 1Z8NA 4NK4A 2QAGA 3IA7A 5KSPA 3PQEA 4GPZA 2J5QA 1OFUX 2OO5A 3FMPB 1AO3A 1ECBA 5HF8A 2O0LA 1DAGA 1F5NA 1ZAKA 1KYQA 4MYCA 4N7RA 4OP2A 1EM8B 4MQ5A 4CTJA 3HY6A 1P0IA 4NEHB 3DHYA 4JVSB 5JANA 3RSQA 2B5VA 2JPDA 3H3XA 4E14A 2FMKA 3G1UA 1HNZB 1L8OA 1L4MA 3TNJA 4JBXA 2CL7X 3UWPA 3RTAA 1NBOA 4D99A 2QN3A 4PLHA 1XV5A 1KKLA 2FZ4A 3H9CA 2IHZA 3KFXA 2G07A 4IOMA 4Q4HA 2CLHB 2WZCA 2I71A 2Q27A 4MICA 2AG1A 1E2BA 4FEEA 2JBWA 3HB7A 4WI1A 3UFXA 2DRIA 3KJFA 4BU0A 3WWDA 1IBKB 1O54A 5EHZA 5KVCA 5LQKA 1Q22A 4TT8A 3SDSA 5KTTA 3KJZA 1SU7A 3I6BA 3FZQA 4MUJA 3WLLA 2A5JA 3IMKA 2NV0A 4MWEA 3OQ1A 2FZWA 5SY4A 3TIVA 5KNBD 2VJMB 3C3JA 4GLFA 1P2TA 3FTEA 3HBMA 1REQA 2C8LA 2G71A 4FZ3A 4HGQA 3WRYA 3ZIUA 5JYDA 3T3OA 1ONNA 3D8SA 3DPSA 1E6CA 3IXMA 3HBFA 4DRZA 5KIAA 5JD5A 5DXJA 3EGXA 1U9YA 2VRCA 1GFWA 5TY0A 3N3AC 1PI3A 2HM7A 1P31A 1USGA 3EWNA 3RANA 3WSTA 1WW8A 2AK3A 5GOZA 4P38A 5BWLA 1UBHS 4CG2A 5F7XA 5A4FS 1P5FA 4Z0HO 1YHYA 4C7VA 4Z4EA 1V9SA 2Z6VA 3SKXA 2DPLA 1KRXA 4Q48A 4KR0A 3PGLA 1DC7A 1Z0SA 1P80A 5HMLA 4M1ZA 1DCKA 1RI4A 1USKA 2BFWA 2HQBA 5LCXA 4BC1A 3OCCA 2B3TA 2E6KA 2F1KA 4B3CA 1US8B 2PL3A 3T5GA 1X94A 1ZYUA 2Z2XA 3N8NA 4S1NA 3JZMA 2HUNA 1FPMA 3B89A 1UPCA 3DO6A 4MUHA 1QHHB 4PRKA 3W78A 4YP1A 1U7OA 5JOQA 1BWRA 1FIUA 1PR1A 1P45A 4UAGA 1NXXA 3L6OO 1QYVA 1E63A 2HU2A 4K2AA 3W4IA 5LNK6 1JG4A 4CEHB 4A9AA 5LBTA 2W6NA 3BTVA 4ZN6A 1Y1KE 1RWVA 4IJ5A 4EMUA 3I28A 1LPMA 2WYIA 3VR6D 4KXLA 3O2SB 1LPBB 2GF2A 4TV9A 2IYLD 3KKMA 4LX0A 3OM8A 2X2PA 1KZYC 3TK1A 3HB1A 4FGKA 1XMJA 4ILEA 4AY6A 3GP8A 3OMWA 2PGIA 1ISFA 3WGMA 4KPFC 2CVPA 1KTVA 1Z6AA 2YWEA 2W6QA 2O3RA 2ZWVA 3INGA 4Y67A 5DYTA 3GUHA 3J7AC 2B8EA 4X8LA 4GVLA 5DN6D 4TWRA 4D8VA 2WJZB 3UC5A 6CHYA 1QIGA 4RCZA 4QGSA 4M6WB 2C82A 5AI5A 4KUGA 5J2TB 2FR8A 4CKZA 1MRSA 1W29A 2IYPA 3EARA 3UW3A 4YCDA 3C6BA 1Y63A 2WP8J 4XCVA 5BOSA 1JKIA 1Z47A 3F7MA 1AGPA 1AK9A 2XW6A 5DYWA 2ZM6B 3JTEA 3ESZA 4NE7A 4H6WA 3T7IA 3WAKA 2X7XA 1CRLA 3FHCB 1HNNA 1GVNB 3DUWA 2CZCA 3K5PA 1TYZA 2GX6A 1CHDA 1XYVA 2YJ5A 1G5RA 3ASVA 3LWNA 5ADHA 5JJCA 5DE3A 3HYNA 4BOYA 2WV9A 4GDMA 4AZVA 1PK8A 3PFKA 1AS2A 2QI9C 1VGVA 3OECA 3QXXA 1KMCA 3K2EA 5K8CA 1XTTA 4KLNA 3N59A 5EIBC 4RXMA 5FNVA 3OQJA 4CM1A 1PQ4A 4RV5A 2WHYA 1C14A 3U4MA 1VFNA 2FZEA 2IDZA 5IVIA 1CBUA 3QWFA 1T2DA 3W6PA 5KAMA 1DKLA 5JRZA 2PZJA 2VI5A 4FINA 3QENA 2WFMA 4FS3A 4NZNA 1C3EA 2XNJA 4P3NA 3SDBA 2OLEA 4LSGA 4P80A 4D44A 5CT8A 3ZQ4A 4U9HS 1LH0A 4KN5A 5DT9A 5CXQA 4MLZA 3VSEA 1Y3AA 3DT9A 4RA6A 4BE9A 4CDNA 5HWSA 4QYIA 3DFIA 2OBBA 2JCGA 3QU7A 1L3CA 2I65A 5EINA 3UWMA 1TMGE 1CP2A 4RFSB 2PZBA 1GPWB 3D8RA 4WOKA 4A8JA 1DLIA 2P2DA 4AG5A 2W4QA 4B82A 1OLXA 3HEAA 4IVQA 3CKMA 3F7TA 3KT0A 1XCPA 4RVDA 5KWJA 4CWAA 1RJEA 3JVVA 2FPUA 3ZU3A 1K98A 2H07A 4CKEB 5HZKA 3RS5A 5LDGA 1E64A 3CUWA 3BWEA 2OV6A 2AWNA 2KLBA 4FYXA 1NF8A 2L19A 3DHNA 3EWIA 4LRXA 1DBVO 1FRFS 4LYFA 4QAJA 3L43A 1OXXK 4LISA 1DINA 2Z08A 1NF3A 3HCWA 3HO6A 4J0IA 2PLWA 3TW6A 3GELA 4WK4B 1N2BA 4TKVA 2ZXEA 4NY1A 4P4SB 1QYWA 2V58A 3FJOA 1M2GA 5AP9A 4KX5A 2PCLA 2WQZA 1NLMA 1NVGA 1XAIA 3CLTC 3O8OA 3R3VA 2XLBA 2LE0A 4KWEA 4HDAA 2AJTA 4XIYA 1T3SA 3AJEA 4DMHA 1YRQA 1VM6A 5KKCA 4FZVA 5ALYA 4MZXA 3G1TA 3WLNA 2C9OA 2OZLA 3KBOA 3QV2A 5EIAA 1JG6A 3GMSA 2K5UA 1JSCA 2ET6A 2ZRKA 3K1AB 4LAFA 5KHAA 2WA1A 4JUBA 1B00A 4TVKA 3NNDA 1Y80A 2VUSA 4UZEA 4HKTA 4E6EA 2J0UB 1N8TA 4GNKA 1ODFA 1XMSA 4YCJA 1RVDA 2N1BA 4MUKA 4RESA 3WI7A 1A9OA 1J25A 2W4IA 2PUHA 3A1WA 4OP3A 3RS7A 5JJLA 4FDMA 5AM3A 1M5RA 9LDBA 1X7XA 1NBIA 1LBSA 3HP1A 3EFBA 4RDCA 4EG6A 1GSAA 1TPZA 2VDKB 1UWKA 3ORQA 4REMA 2BFCB 1F2TB 1WAMA 3NEJA 1G64A 1UBNA 3P2KA 4I5DA 5ILQA 2B7LA 1VDMA 2LTAA 1QVRA 1WHTA 1HMPA 3ACDA 3WYCA 1FVFA 1T15A 1X0XA 4BP8A 4OLBA 3F1LA 5BPFA 4MYRA 3JD3A 3SHQA 5HW0A 2O5EA 2F3SA 3KL2A 5TC4A 2HKIA 4Q5IA 1YZYA 1XTRA 5DW3A 1KK1A 3C85A 4R8RA 3HR7A 4YGXB 5ALNA 1EVZA 1UBJS 4JJ7A 1HGXA 2ASEA 4EA7A 3NO4A 1RE1A 4XCXA 5DM70 3HKEA 5JXJA 2RE8A 2HI0A 2CEKA 1Z28A 3LHIA 4QQKA 1Q0UA 1UINA 2QTWB 2YW9A 2YZNA 4UFNA 3U6KA 1E2EA 2M6KA 2W71A 1TZJA 2VTDA 3B1WA 4HO1X 5EE9A 1XD2B 2Z57A 4I8XA 3TH5A 2VNJA 1DKOA 3RYTC 1GV0A 2XWQA 4EJFA 2WU3A 3FI9A 1Z56C 1ZJ5A 2Z8ZA 1JEEA 2VDNB 3QJYA 5D3MB 5DI9A 1C7ZA 3AF5A 5CHEA 5LKAA 1OQAA 1NE7A 1NG9A 3DZHA 4R2JA 4DSOA 5KSYA 2V3CC 3F5MA 4Q1AA 4ZOLF 2G1JA 5IKMA 2KBFA 4YT4A 2GJ8A 3P94A 4K9RA 2PL9A 2I1VB 3OIDA 2EHJA 1CUZA 4CCAA 2JFWA 4ZK2A 3C70A 2VFAA 4QBIA 2NPFA 5LFAA 1XB2A 4NYJR 2GEBA 2G82A 4L07A 1DC8A 3G85A 1NVVR 1MO4A 3SAJA 3ZZTA 2PUVA 1NT4A 4EZBA 4FM9A 3QI2A 3TO5A 3H3FA 4PGGA 1NJFA 4Y9SA 3ZDEA 4I7EA 1QAMA 3AHGA 3PI6A 4RABA 1PFYA 3W9YA 5FBVB 4Y8VA 1E5DA 1AY0A 1CEXA 3ZHZA 2V6MA 2B30A 3IMGA 4MP8A 3G9ZA 3NV9A 1XRQA 1RYDA 4ALMA 3QG1A 2BMEA 4MKHA 3KSRA 1G8JA 4UNQA 1C81A 1QHEA 2FN9A 3ZWAA 5K5EA 2HSEA 1KWKA 3SZ3A 5C7IO 2XBUA 1K4YA 1U8EA 2PWBA 4D9MA 3PSAA 5LZ9A 4WCFC 2RGBA 3DC7A 4YACA 5LZ2A 2P8SA 2WNSA 2YOHA 3GAFA 4GLOA 1GZUA 3ZY2A 1I4WA 4K87A 3JV7A 1O2DA 1VE1A 5JAIA 2ZJ8A 3Q4GA 3DXXA 4ENQA 4TTAA 1RLMA 4PYQA 1VL2A 1XZ8A 1YE5A 2X13A 4I8IA 2P7HA 4QNNA 4RQUA 2ACVA 5TGDA 3TLYA 4EB0A 3GGDA 4P3KA 3V1YA 1LC3A 2LWIA 4TZ6A 1N4DA 1TPYA 1U0OC 1WV0A 4YJDA 4AJLA 4BV2A 4AUKA 1PV1A 4U02A 2WWVD 2VPTA 4HAVA 2RGCA 1U1GA 4YRRA 1EESA 3SZUA 3E6AA 3KDPA 3RRNA 3E8XA 1JEAA 2HMTA 2G9ZA 5K8TA 5DVZA 3JR7A 4Z53A 2H9YA 1J0BA 3I2GA 4KYVA 1O3YA 1NVEA 1EGHA 4ND1A 5B4VA 4PC1A 4CF3A 5BWCA 2HA2A 1H05A 5I8WA 2EKZA 2WJ6A 4GM1A 4BQPA 4BTLA 1HZZA 1U94A 3GQBA 1BWPA 2NYAA 1EX1A 3IBYA 2GN8A 2JNWA 1U0HC 1ZVMA 3C8ZA 1S0UA 3PXEA 3L6BA 3JQBA 1ND6A 3LD9A 1P3Y1 1IPFA 3JD0A 2PUWA 1Z2EA 1O77A 1Q50A 4L6CA 4O4HF 1ZH4A 1F20A 3BJIC 1DBPA 3GVPA 4B7XA 4BLTA 4JLSA 4TMTA 5FOXA 4KQWA 5IF3A 3G9TA 1HRKA 3LCJA 2Z5FA 1PW7A 5IVKA 2J3IA 5JH7A 1UM9B 1LSUA 3IUQA 4LVNA 4N6GA 2Q6KA 3IP1A 2W2KA 2R8EA 4U2KA 2O05A 4JYPA 2QLFA 4ZMBA 2JGKA 2N0SA 3FKJA 4WJZA 2AJCA 2YFHA 2G1AA 2XRYA 3TTYA 2XYPA 1PDVA 4KAJA 5FBWB 2KQUA 1Z8HA 2Y1XA 4Z0NA 4TKMA 4L85A 2VZ9A 2FF5A 2PRZA 5JAOA 4LF7B 3QKSB 3UJ8A 2JRLA 1W8IA 3RRJA 5A4KA 3UBTA 2AMVA 4GXNA 4E5MA 1WXWA 5A06A 1CY6A 4YEDA 3IR7A 4UBKA 5K8JB 3NX4A 5AH0A 5AVWA 2R8ZA 4H4DA 2TMYA 3IOCA 2ZJ0A 3WTCA 2IU4A 1VP3A 1Q2UA 3UG7A 4YUAA 5LQDA 2I2XB 3I9MA 1F1BA 1P1HA 3DGEC 3PFNA 2C7QA 1JPJA 1XCOA 5T6MA 4AN4A 4YRDA 2JHFA 3DMGA 1CY7A 2B1JA 2UYOA 1H1LB 2O7QA 2NOAA 3AM5A 5DLDA 4AKHA 1TJNA 3ZTWA 2GK4A 2GZSA 2SKEA 2YINC 4K9DA 3U80A 1NW3A 4MR9B 4QU8A 3RRFA 3KUXA 3DEIA 2A7XA 3UOWA 1T6XA 3GMIA 1ABEA 3QX8A 4J7UA 4BB5A 4UTRA 4IIUA 1SFRA 1FDUA 3U1VA 2IY7A 3E1SA 1BWSA 1T8YA 2Z56A 5REQA 3AL2A 4BO8A 4EUFA 1RQLA 4ENVA 5BSHA 3NDBB 4S2EA 4IGIA 4KLAA 1KEPA 3IIIA 3EJWA 5EG5A 1FQKA 3K0FB 2XADA 2I4OA 3KQTA 3FPJA 4GF5A 4U6QA 1AKMA 3ONDA 4I9NA 2YWJA 3VDNB 3WNZA 4FEGA 3AXSA 1QG2A 3LH5A 2GPYA 2WSSD 3KQQA 3VX4A 4K9NA 3W7AA 2YXNA 3B3QA 1P0PA 2EKDA 1QLJA 3ND8A 3QLUC 4RF5A 4C6TA 4K3UA 4YO8A 3OZWA 3QF7A 4UEWA 3HKBA 4G1VA 3ZV6A 1LBEA 4CV2A 4ZTZB 2VJOA 1NFFA 1R6UA 3OA0A 1OI7A 4TMFA 3CIFA 1G7TA 2WUVA 1BH2A 1SWWA 3VDXA 2C7GA 3ANXA 2JKYA 1BN6A 2ID9A 5IP5A 4KOEC 1HTWA 4M0PA 4BNDA 3CB4A 5IDQA 5IK2D 1RZUA 3OAAD 5CK4A 1T36A 3T7TA 1SCJA 2JH8A 3A3YA 1QIKA 3N8DA 4LBZA 3GRUA 5EZYF 3RGWS 2DUUA 3N6RA 3D2BA 3F3SA 3L77A 1V8BA 5MGBA 1KQFA 3Q6IA 1V71A 1PS8A 4G5RA 1I4OA 1K9VF 2Q46A 5EQDA 3TR0A 1ZFNA 3IALA 4UBIA 1KE2A 5LXTB 2D2VA 2XMPA 4R68A 1IDN1 1X38A 2PL5A 1AZSC 4OKSA 5CW1A 3RF6A 1HSOA 1F06A 3IAHA 4JH0A 4WDRA 1EUYA 2ZUTA 5HP4A 2XODA 2JL1A 2WNIA 1Z22A 3D6FA 4GR5A 2J3DA 3K32A 1QAQA 3LGSA 1BFDA 3HS3A 1LX6A 1DRWA 1KK0A 1NW7A 4TROA 3ZE2B 4DC0A 3U56A 4EYSA 5IJ0B 2QL9A 2J3EA 2YYYA 1CX9B 2PFKA 3EUWA 1GPJA 1NOIA 4QJ4A 3QH4A 3W2FA 2ZEJA 3SMVA 3EPHA 1N25A 1O87A 2AC2A 1AZTA 1F17A 1G6HA 2ZIZA 5M04A 4MINA 3OMLA 3VR5D 4ARSA 4PINA 3TOCA 4ER6A 1NULA 1VE7A 4OB8A 4QREA 5BSFA 2EQ5A 2FFBA 2R3SA 1E3IA 2YYZA 1MTZA 4YS6A 4L2IB 1Y7PA 4QBTA 4O4JA 1CIJA 1E6MA 2XUAA 3ORHA 1UEJA 1BMTA 1SCUB 1IUPA 1DS6A 3BBLA 2O3QA 3ES9A 3GEHA 4K6KA 3ZV4A 1B4DA 2V3WA 2IYVA 1D9ZA 4I4TA 1VLMA 1GTSA 3NAMA 2C4WA 1TA0A 2X2OA 1TZCA 3DAHA 3OD1A 1OAOA 2OSVA 2NO1A 2WMOB 3E9RA 3G8AA 2V55B 3FMIA 2YASA 3NU1A 5FTNA 1GGEA 5IXJA 4I50F 4XDZA 1P4JA 2FMUA 4QTYA 4UCQA 2FG5A 5F5LA 4W5QA 4Q21A 1JE0A 4MJ7A 4AUNA 4MWGA 2FPGA 2V9PA 1GKUB 1VZ3A 2XA2A 4PNZA 2FPPA 5DTJA 3VJRA 4RA9A 4AO8A 3PYLA 5K03A 2BRUC 2O6HA 2B5WA 3OQNA 3AJAA 3UHPA 2AQKA 3O1IC 5F1OA 3VUEA 5LD2B 3A6PC 1N33B 3BFKA 4EARA 1K5DA 4DDMA 4EHAA 4EPXA 3ILSA 4GI2A 2ZE8A 4MA0A 2QGFA 3FPHA 3FF1A 1CQXA 3ASYA 4XX0B 2QRJA 5H82A 3THYA 4LWZA 2JEZA 3ZFUA 2XF8A 2Z1DA 4A23A 5LNK1 3COJA 1MAHA 4L9SA 2X8AA 2G28A 3EFHA 4NICA 5CTAA 4AJPA 3FUTA 1T3TA 4KAXA 2CT8A 1A7UA 1J90A 2YJGA 3WZLA 4AJ9A 4X0EA 1IJKA 4GX2A 1R6BX 2A1TR 2O7NA 4NOMA 2Z2ZA 1FS5A 4PLFA 4R31A 1OIXA 1W8DA 4RIGA 3I4LA 5KNDA 1GOTA 1X7DA 3OHMA 2PSEA 1BGWA 1NVFA 2ZBDA 4U9IS 3H13A 2IDKA 2BSQA 2BR3A 1TCVA 3ZE9A 1E7QA 1B8NA 3G0BA 2LKCA 3M9LA 4E70A 5MGNA 4K0KB 3FMVA 3DM9B 3IQHX 1V1RB 3KHSA 4G84A 2M2IA 2XGSA 1L7EA 1XXHE 3HP7A 3RTDA 4LYDA 3BKWA 4L6IA 3DQQA 2NU9A 2CF5A 3PUVA 4H1UA 3VI4B 2EL9A 3TB6A 2XUQA 5AM4A 3W2TA 2JARA 4JEMA 3CW9A 4MUEA 3T0FA 1TUEA 1ZO8A 3VO8A 4H60A 4ZOEA 3GAAA 1YR2A 1T8WA 2NO4A 2QRLA 2RGXA 2OAGA 3E9YA 2QTVB 4J03A 4MWZA 5HXAA 2HMUA 2AOTA 3K9LA 5JFOA 2UVDA 1KQPA 5AHRA 3FAKA 4GU5A 2BSAA 4M1WA 1NC3A 4PG8A 4R1MA 3DZKA 1N2CB 1OZFA 4WY8A 2C9BA 3G0GA 3CKYA 4LF5B 6AT1A 3SLRA 1H65A 5CTJA 2XKBA 5BN5A 5CYGA 2HK8A 2YJZA 3IQEA 5IUNC 1IJBA 4FFWA 1UM8A 3ZGLA 4GKJB 2YNMA 3ZHUA 3EVNA 3BL5A 3RJTA 3CEMA 3QLVC 2AG0A 4JJ4A 4C4OA 4WN9B 5L3ZA 3SBEA 1DHTA 3EQ8A 4TQUS 5E6SB 4UEKA 3ZV3A 3R8CA 3NB0A 4UVDA 4WADA 5FIUA 4TRJA 5J40A 3CZ4A 1DXOA 3FPCA 3GJQA 3NVDA 3R0IA 5AJWA 1I3MA 1GNSA 1KO7A 3MYYA 2RAUA 1WCYA 3LG2A 5DASA 4TSKA 4YT8A 2PM8A 4DL9A 1Y8RB 2OFPA 2OWDA 4CMBA 2QJWA 4QBKA 5BN1A 3F8WA 4H27A 1JT9A 3GJ5A 3P20A 4GRAA 5K3OA 3PHJA 1M6YA 1YH3A 2CMDA 5CAEB 1UZMA 2W2TA 1KI6B 1E4YA 2JBHA 4ID9A 5IDYA 3RTCA 5AESA 1U8TA 1X7ZA 1XEXB 2C2XA 2LP4Y 3AUYA 4BNXA 3WQRA 2DFPA 2PQ6A 4RQBA 4MULA 4MV5A 2A4KA 2OZVA 4M55A 3MWDB 2HLNA 3EQ6A 4B43A 1L7QA 4D0NA 2VRBA 4JY7A 3WLRA 1WUJS 5CVUA 1C8VB 5BORA 4Z49A 1JFSA 5GP1A 3S40A 1DQYA 4F2PA 2VCHA 3BMCB 2DUJA 3D3EA 3IQIX 1F4LA 4OJYA 5BQ3A 1Y7TA 2F90A 3BGWA 4BQFA 5FL7D 1LSJA 2ZATA 3EHEA 5DTEA 1CUDA 2IODA 4Y3UA 4EK9A 4D1YA 5IU6A 1HE1C 4JZYA 5I7AA 3WLOA 1TRKA 3WLHA 1IZ7A 4JGIA 1JKJB 3EXAA 2MMCA 1XF9A 4EJ0A 1U04A 1L5FA 7ADHA 3F6RA 3FWZA 4EEKA 3TF5A 3DYBA 2BMWA 5IT9A 3ZDZB 1ZWKA 4NYIQ 1XJQA 2CLEB 3T3EA 1T0IA 2C58A 4UATA 1SD1A 3BK7A 5G41A 5L7TA 3ZKWA 3K6SA 1AD2A 1ESNA 5CNJA 1CZUA 1W87A 1U6KA 4ZYWA 2GO7A 1XHLA 3NBUA 4TS4A 4CIBA 1QANA 1K4MA 1MG0A 4OXYA 4JUCA 3IXLA 5GJWC 1I4LD 4C2TA 5AJUA 1B0ZA 2J3HA 1RYNA 4PQFA 4ODIA 2FG7C 1TGVA 1XPJA 4FGLA 4M22A 4BE7B 4OYRA 1Z4KA 3Q8LA 2BEUA 3U3JA 4BCBA 4I46A 4JC5A 1SQ0A 2OV4A 2RKWA 1LFDB 2ECKA 2NQTA 5TS3A 1Z2CA 3L05A 1U99A 2WB4A 4DV3B 1IRXA 1DWQA 1OLSA 2D7CA 2BY4A 2Q2QA 4HEQA 5BQ5A 2NUAA 1K66A 5JEDA 1I0LA 5GAJA 3ZD9A 5K99A 4YRSA 1W5TA 1T8RA 1B43A 2VDVE 4D4LA 3AEKB 1OTXA 3DL7A 3GLGB 1DZ3A 4U39A 4IQ0A 1EUCA 3HCBA 5GIPE 1KH2A 4AJHA 1C50A 3M6AA 4E1VA 3CV3A 2VTKA 3CG4A 1G59A 5AI8A 1OI4A 4RYLA 2BGRA 5GADl 1D0SA 2OO7A 1YVEI 2X9LA 1WSDA 2H2HA 3ANSA 4H3HB 4EHKA 3VHXB 2R6R1 3L7MA 4E21A 3PXDA 3AKEA 1IUKA 1BW9B 3B70A 3HEBA 4OLJA 1RT9A 3R5KA 4RVSA 4GE3A 1UOEA 1T1RA 1UMBB 2ZYSA 4JQSA 4EYGA 4PTYA 2IE0A 2YN0A 5KWSA 2RHTA 1E0KA 3QEMA 3M8KA 3F2IA 3ZFRA 1E98A 1GUFA 3CLSD 4I6JA 2UAGA 2CXPA 3A4MA 3G2MA 5GZ1A 1EWKA 4ZDKA 1YOVA 1T4CA 1VA4A 3LSTA 1YOBA 1IMOA 4CMKA 3UFBA 4ZV9A 4ZCTA 4LC1A 4LDNA 3UJAA 1T9CA 4AUMA 1TA9A 1HYEA 5J2TF 3OG9A 4HMOA 5IN4A 2VEDA 3AETA 4BNMA 3IKLA 4FHEA 1R5OA 3I9FA 5H9WA 4NXMB 4BFVA 4MWOA 4TKLA 4QTUB 2JI4A 1AUQA 1NU6A 5CRIA 2HSGA 4RFLA 4ZC8A 1FVHA 3NW9A 4GICA 2WT9A 1VHLA 2WTXA 1LI7A 3IQWA 4HL6A 3S1AA 2ZOSA 3FIJA 2PYIA 4HXGA 4J76A 3Q8KA 2OO3A 5C18A 2JD0A 5JAUA 1CJKC 1TTHA 2ZUVA 4TL9A 1ZZEA 2O7SA 5LQSA 3U3ZA 2C83A 5L4NA 5FBRB 3NOXA 4DTIA 5D6NA 1CFJA 1FBNA 4PU0A 4KSBA 4BB9A 3FHLA 3C5EA 3UAYA 4N76A 3HUMA 2ZRJA 3CHYA 1BWQA 3LHDA 3EDRA 4YAFA 5CURA 2VDQB 4RADA 5EJIA 4QQNA 3SHFA 5D3KA 3HV0A 1MFZA 1V1JA 5AHXA 5F23A 2TYSB 1JL3A 1OWMA 2X9VA 4Q3KA 1LDGA 2OG2A 3QKTA 3B1VA 4NCIA 4ZVSA 3RVKA 4FGJA 5CA1B 2ODNA 1A7KA 1GJRA 1FUEA 3PUZA 5KOJB 1U31A 5CM8B 3FKSA 4EG3A 3PTLA 4A0RA 1CJSA 1RQPA 1FP4B 3S28A 5IKPA 4K3VA 2OC4A 3HDHA 2JIOA 4HNTA 1MCZA 2JGFA 2JF0A 2YUTA 3I30X 3IUJA 4P3OA 4KFCA 1A7AA 1UPAA 3BTOA 1C4OA 5K3AA 3C14C 4BFUA 2XOKD 2OOKA 4IEIA 3GRKA 5EWJB 1JHUA 1FDIA 3S2GA 1QE5A 5IDXA 4IUDS 1Z5PA 3HB5X 1Z6QA 4UHHA 1DSSG 4D5GA 3I9OA 2HJHA 3DOEA 1F9EA 2REQB 3UHAA 1NE2A 1SBQA 2QK4A 2LKDA 1FJGB 1W1WA 2O59A 4D3FA 4ZI7B 1PYOA 4NK5A 4YRBA 1YU9A 2R25B 1V37A 4OHZA 1HNXB 1FXWA 4DUGA 3O8LA 4OU4A 5L6MB 3FX2A 1G9TA 4YUZA 2GKSA 3R77A 1SA0A 4FKZA 1LVHA 2C57A 3UYKA 2E55A 2JGDB 1E3QA 1HYGA 1PGJA 4BX8A 2VBFA 2HCBA 3DXZA 4NZYA 3TZCA 4IDOA 4LC0A 5D1HA 3C41J 1AKTA 3C3BA 3ZLUA 1TCBA 2VBIA 4AYXA 4QUKA 3D6NB 4R1NA 3OZDA 1VOTA 4KQJA 1QIHA 5A7HA 3T9FA 1SOUA 2PGLA 1XD9A 4HB0A 4WZBB 1O96A 1VIVA 2EG5A 4WK6A 3HYTA 2P27A 1XWFA 3UTCA 2MINB 1WXQA 2BFDB 1BN7A 1KEZA 4X3CA 3T5AA 1MDBA 4JA0A 3B51X 5IEBA 5CD1A 4WVFA 3WBFA 4HSGA 1Y6QA 2VP6A 1F0YA 1L7MA 1SUBA 5FUXA 1XA0A 4QRHA 3MWEB 1FFHA 4M8SA 5EXSA 2NU8B 2G9RA 3QKUA 4UD6A 3BDAA 5M3BA 1KDPA 4UM7A 1LS1A 1H85A 2ZJ1A 4PM4A 1MOSA 1QP8A 1KY4A 4NCHA 4C4XA 1QO7A 4ZJPA 3PC8C 3P0EA 1P1KA 3MVEA 4MLPA 3QBDA 1JZQA 2Y1LA 1KMHA 3D9QX 3OX3A 3R2JA 4L76A 4ZOCA 5WRFA 3V5NA 5C2JB 3L4BA 4YUXA 1N77A 4UM9B 3VUFA 4NYMR 4RMNA 4R2WA 1NMEA 1BCRB 2XT6A 3B5IA 2D1SA 1YE3A 1BHO1 1LTQA 4LDZA 4CMIB 2VK8A 4EY6A 3I3SR 3MPOA 4G3XA 1YGYA 2YN4A 1S2DA 4MI9A 3DDSA 8ABPA 1AKYA 5K6RA 1IHDA 4G5SA 4MA5A 5JDCC 4WT7A 1ZS9A 3F5QA 3FUXA 4BNHA 3VU9A 3BGIA 3O26A 4DADA 1E1CB 1AURA 1J2UA 1ZRNA 3KT3A 4Z4FA 4E5SA 1M7BA 1YQUA 2OP1A 2A9PA 3OKCA 4MRSA 4ARBA 2Q45A 4B33A 2R84A 4PAGA 1O4WA 2HO5A 1DUVG 3P5SA 1DQRA 3H4IA 5M29A 5HILA 4HRAA 1OBVA 2Z6AA 3BSFA 2PUFA 3O0DA 4U7WA 1RXIA 1UK7A 2ACKA 4F12A 3U7EB 1VLJA 3ZZ0A 2RHRA 1PD0A 1Z08A 3PD1A 4RJ2A 1L4YA 2GJSA 3ADKA 1MHTA 3D7NA 1MT0A 1KVQA 3NVAA 1DOAA 5I7WA 3AHDA 2DQ4A 4C2AA 3MZ0A 3EA0A 3AHHA 1D7AA 2MJLA 3AR3A 4ERXA 2BGGA 1VRVA 1HKUA 1PJSA 1TK2A 2BFOA 4J75A 2UZ4A 1YIOA 5AJTA 4WBNA 1C3OA 3CVUA 4TXJA 2Q3LA 2RHGB 4DBVO 1MBZA 1U9IC 3E3LA 2O4UX 4B6FA 1ODLA 3MMNA 5JJ5A 2O14A 5IMBA 4CN8A 5EJ7A 3D1LA 3K2BA 1EBFA 4RZHA 3O93A 3RFVA 2VXYA 4LNHA 4L7VA 4IOLA 3CCCA 4KO1S 1GL7A 1RRKA 3UCEA 5AW0A 2VJBA 3I0NA 1VI5A 1QR6A 5KTYA 4GZMA 2G1UA 1BCSB 3ECSA 1D1PA 4LE0A 3PUYA 3LLUA 2WM3A 4KWCA 4WZZA 4Q19A 3FY4A 4YLGA 4OQFA 4CETA 1FK8A 2W83A 5CEEA 3PBKA 5TQ0A 4QUDA 3O8QB 3QBEA 4UUPA 3BJZA 4FLFA 4Z54A 4WEOA 1PT7A 4D3ZA 1W35A 1U0EA 1E1QA 3AR6A 1M8GA 4XQ0A 3TJZA 2IOYA 1B6RA 1HK7A 3RSGA 4CKBB 4CW7A 1JVNA 3PHLA 5DGHA