4YUYA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with isoquinolin-1-amine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
293
Chain Sequence
PGSELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
total genus 98
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuyA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuyA02
3BKXA 3KHKA 1WZNA 2IGTA 1BOOA 4HTFB 4OBXA 5DPMA 5EIFA 3EVEA 3LSTA 5DM2A 2XYVA 3MGGA 1G38A 2ZZNA 2UYHA 1XJ5A 3Q87B 4AUKA 2VS1A 3KPUA 2NXCA 1I9GA 3EVGA 3LBFA 4P58A 3G89A 3HCAA 3K0BA 4RWZA 4E30A 3FRIA 3B5IA 5DXJA 3P2KA 2ZLBA 4PYOA 3ORHA 4BP1A 5E1BA 1NW3A 3NVMB 5EKXA 5EPEA 3MTIA 2ZULA 4PONA 2PXAA 3GU3A 2IDKA 2ZIEA 2PKWA 3MB5A 5DT2A 2OY0A 4FSXA 5K01A 1JG2A 5T64A 4ZTBA 5K0BA 5GWXA 3OU2A 3FUUA 3FUWA 2AOXA 3OU6A 2EX4A 5K0JA 5FHRA 3RW9A 1RI5A 3IV6A 4JXJA 5DSTA 3FUTA 2K4MA 5HIMA 5ICFA 5LQUA 5BW5A 3PTAA 1L3IA 1QYRA 1M0EA 2IH5A 1G8AA 2ZTHA 1RI3A 3KR2A 3P9NA 3M6UA 2G71A 2AR0A 3ANXA 3G2PA 3ERCA 3I5UA 4PYLA 3JWJA 3LPMA 2VZ9A 4X41A 1KIAA 1FBNA 4V0QA 5DM1A 3U81A 4CTKA 2ZCJA 2ZIGA 1QANA 5HIKA 2PX8A 2ORED 2IP2A 2O06A 3QOWA 5FQOA 4CKEA 1SQGA 3FUXA 3SSOA 3OPNA 1XDZA 3G8BA 2Z6QA 2AN3A 3KQTA 2CWWA 2ERCA 3P8ZA 3PFGA 2OB2A 2VDWA 4FR0A 5EKUA 3OU7A 3SX0A 4DKJA 2G1PA 5BW4A 2HV9A 5GIOE 3KR1A 1FP2A 2JHCA 4PCLA 3LDFA 2WK1A 4DQ0A 4RV9A 3SSNA 1VPTA 5KYGA 4HG2A 1P91A 3LCUA 5HOQA 2JH9A 2NXNA 3P97A 2AVNA 4C04A 2PSSA 1R18A 5GP1A 4AZWA 2PGXA 2C7PA 2PT9A 1XTPA 3JWGA 2P3LA 3T7SA 3SM3A 2P41A 3QOXA 5GM1A 3UJCA 1X19A 3CJQA 5LSAA 4M37A 1DL5A 1SVUA 5CUQA 4C06A 1RI4A 3WSTA 4LWPA 2NYUA 2ZBRA 3PLAE 3P2EA 5E8JA 2ZBQA 5HEKA 5U4XA 3TR6A 5MHTA 1XCLA 4O29A 3HA3A 5EMLA 1L3BA 2B78A 5DTMA 4RX1A 4HRAA 3LBYA 4DCGA 5EHGA 2YUIA 5EG5A 1PRYA 4YUXA 3KQPA 3EVFA 3EVZA 4GC5A 3C6MA 4MIKA 3THRA 4LG1A 4RTRA 5LR6A 3R9XB 3B3JA 2BR4A 5K0CA 4R8SA 2ZBPA 1IY9A 2P8JA 3EVBA 5EZSA 1JG1A 4CTJA 3KPVA 2UYQA 2ZSUA 4LECA 4HC4A 1R74A 4KRGA 2AOUA 2JJQA 1R6AA 2H1RA 3LX6A 1G60A 3D2LA 2ZWVA 4KVZA 1ZGJA 3G5LA 1RI1A 1VQ1A 1RJFA 1X1BA 5DXAA 10MHA 5EMMA 2Y1WA 3E8SA 3M6VA 3HVIA 2YX1A 3HVJA 3HCCA 5E9JA 4OQDA 4AX8A 4BP3A 3DLIA 5JR3A 4V0RA 3CBGA 3EMBA 1NBHA 2PX5A 1KHHA 3HVKA 5K0FA 2YXLA 5CCBA 2NP7A 3GDHA 5CVEA 3G7UA 4OQEA 5C1IA 4QTUB 4KDRA 5CIYA 2ZZMA 4GUAA 3ELWA 1WY7A 4U7TB 4ER7A 4PINA 5D1NA 4YMGA 4E32A 3O4FA 4CKBA 1NW6A 3BXOA 5KQRA 5LQRA 2YVLA 2GA9A 2PWYA 3A27A 3EGVA 3EMDA 4KW7A 3V97A 2QE6A 2PY6A 4FGZA 4UOEA 3OE5A 3REOA 4EQZA 3RODA 4POOA 3LDGA 2YXEA 3KR9A 4RVGA 1AQIA 1DUSA 3DH0A 2YTZA 2H00A 3CCFA 3UFBA 4BY9E 1BHJA 3TQSA 5EEHA 2GAFA 1X1AA 3B89A 3MQ2A 5DRYA 2EG5A 4ISCA 4QTTB 1JSXA 3BZBA 4QQKA 4RTSA 2C7QA 1UFKA 3A25A 4E2YA 3NDJA 2B3TA 5F2OA 3IHTA 2AZTA 2QRVA 3KQYA 1DCTA 2PWPA 2GS9A 5EMJA 3KPWA 4R6WA 3NTVA 5DLYA 5FTWA 4Z2YA 3P9KA 3BWBA 5JUWA 3HCEA 3BGVA 5BXYA 2VDUE 2BH2A 3FTEA 1FPQA 1N7JA 3G2OA 1NE2A 3ELUA 3FPJA 1ZHFA 1SUSA 2P3OA 3SSMA 2HWKA 3A7DA 3FPGA 5GM2A 5HIIA 4DCMA 3NWBA 3AXTA 3OFJA 3FTDA 1TPYA 3UJ6A 2JHPA 3M33A 1NKVA 4H0NA 4DA4A 1MHTA 1D2CA 4PYJA 1L9KA 1Z3CA 3DMGA 2OBFA 3DXYA 2P35A 2AOTA 3L8DA 2ADMA 3E7PA 1AQJA 1YB2A 1VP3A 4FP9A 2O05A 1SG9A 2G72A 2P40A 3C3PA 4GOND 3KQSA 4P7GA 1JTFA 2ZIFA 4RTNA 2Q41A 1KPIA 1NV9A 3AWIA 3KPJA 5KS2A 1SUIA 3C3YA 2O57A 5FUBA 3DTNA 3HA7A 2BM8A 2FK7A 2PXCA 1I4WA 4RSRA 4RTQA 1R8YA 3KQOA 4HGZA 2NXEA 2FCAA 1JG3A 2PX4A 3HCBA 1QZZA 2HTEA 5E1MA 1EJ0A 4M36A 5C9ZA 2DPMA 5GINE 2NP6A 5K0EA 3UJ8A 5HFJA 4PYNA 1JTEA 4PYKA 1ORHA 5G02A 2FRXA 4YUVA 5IKMA 2G70A 2WA1A 2B2CA 2GH1A 2ZFUA 3SVZA 3FYCA 7MHTA 4YUYA 2R6ZA 3PX2A 1NW8A 1ORIA 5IH3A 1U2ZA 1VP9A 3PX3A 4OA5A 2XBMA 3NW9A 5K0LA 5LQNA 3EVDA 1XVAA 3LL7A 3B3GA 3GGDA 3CGGA 2Z6UA 3MCTA 5DTQA 1JG4A 2FK8A 3B7PA 3DR5A 3GIWA 1FJXA 1TW3A 2OKCA 4YUZA 1JSZA 4LWOA 5EIWA 3BWYA 3HM2A 2ONZA 5B1SA 1PJZA 1RJEA 2Y1XA 3FPEA 4F84A 3LGAA 1XDSA 4PIPA 3P2IA 3H2BA 4GC9A 2CMHA 1ZG3A 1O9GA 3UJ7A 3KQMA 4E2XA 3DMHA 5FCDA 4YMHA 5KQSA 1YFJA 4F85A 2CMGA 3B3FA 1WS6A 3BGIA 2PV0A 3DOUA 3PFHA 3UJ9A 5CCXA 3LKZA 3NDIA 1X1CA 5CVVA 3M6XA 5E2BA 4MHTA 5F2NA 3A7EA 5GOZA 3HCFA 3FYDA 5CVJA 1O54A 2XYRA 5E2AA 1Q0SA 3UJBA 3DMFA 3DXZA 4FT2A 4QQNA 1EAMA 3UJDA 3SGLA 4C05A 3R6TA 4GEKA 1D2GA 1ZKDA 2AN5A 3I9FA 3T0IA 4X63A 3DLCA 4XUDA 1G6Q1 8MHTA 1XDUA 3C0KA 3SMQA 3R3HA 4QDJA 2Z6AA 2AN4A 3S68A 4PNEA 5DM0A 3VYWA 4R8RA 3GO4A 4P7FA 2FHPA 5K09A 2I9KA 4RVDA 5EMKA 4RTKA 3EEOA 2IH4A 2EJTA 4IV0A 2OYRA 3TMAA 3GWZA 4EKGA 2V74B 3THSA 5D1HA 4HGYA 4M38A 3ELDA 5H02A 3OZSA 1D2HA 3LKDA 1RJDA 3AJDA 5P8WA 1P1CA 3OZTA 4IWNA 4PGHA 3TLJA 2PX2A 5EQJB 1VL5A 4BLVA 1B42A 1V39A 4C08A 4Y30A 1JQDA 4CXMA 2A14A 4U7PB 5DX0A 4AZVA 5F2KA 4DZRA 3G5TA 5EC8A 4RTJA 3EGIA 1TW2A 1VLMA 2AOVA 3TRKA 1HNNA 2FPOA 2GLUA 3EEYA 4HTFA 4KDCA 2IH2A 1M6YA 1F3LA 3OE4A 3SR4A 1NBIA 2B9EA 2JHAA 2NXJA 4GQBA 3TOSA 1P1BA 5CVUA 3MTEA 5EEGA 5GIPE 3LHDA 4M7RA 5DSXA 3GJYA 2ZVJA 4MWZA 3G2QA 1AF7A 1Q0TA 3A26A 5E1DA 3G88A 3ER8A 3IYLW 3ID6C 3HEMA 5M5BA 3BT7A 1WG8A 2YR0A 3FTCA 4EK9A 1EJ6A 1X1DA 3T7RA 3NVKI 1QAQA 2OO3A 2I6GA 4QDKA 1YFLA 4EMSA 4F86A 2IIPA 3BWMA 2G8NA 3A4TA 4PYQA 5CM2Z 4X1OA 1SKMA 2GB4A 4E70A 5EOVA 4C03A 2YXDA 5E8RA 2CL5A 1HMYA 5DTRA 1YZHA 2UYOA 3KKZA 4PGGA 2BR3A 1I1NA 1KYZA 2JH8A 3CJRA 1O9HA 3GRUA 3GXOA 2I62A 1JQ3A 1WXWA 5E9WA 5K0GA 1N2XA 3RIEA 1L3CA 2LD4A 5K05A 3QV2A 4YUWA 5CD1A 3HTXA 4PWYA 3KQWA 2IBTA 2O0LA 3OFKA 4FT4A 2PBFA 2E5WA 1N7IA 2WA2A 5BP7A 3UWPA 2P3QA 2AVDA 3O7WA 2C7RA 3I64A 4R6XA 4DMGA 4GOOD 1Y8CA 1QAMA 3CJTA 5DRTA 1R8XA 1F38A 2XVAA 4PCAA 3GRYA 3LECA 2ZW9A 4PYMA 3HNRA 2QRVB 3PB3A 3DULA 2H11A 2XVMA 4FS8A 1ZGAA 2QYOA 2V7EA 4EKIA 4ER0A 2N47A 5DM4A 1VE3A 1FP1D 3BUSA 4CWAA 4AZSA 1IM8A 2UYCA 1KR5A 2UZ4A 2XYQA 3CKKA 3P71T 3FPHA 3NJRA 5ICEA 1OR8A 2IBSA 2NNWB 4YV2A 3JWIA 3PVCA 3LCCA 2OZVA 4GOLD 1ZQ9A 1KXZA 4E31A 5T6BA 1QAOA 1VIDA 3FZGA 4YV1A 3VC1A 3DUWA 1KYWA 5FA8A 5HILA 4KIFA 3HP7A 3VSEA 4A6EA 1EIZA 4E33A 2ESRA 1YZ3A 3TFWA 4HH4A 3VC2A 2AOTB 2R3SA 4PIMA 1XCJA 1T43A 4IKPA 4DF3A 1NT2A 2AOWA 2F8LA 4NECA 5FWDA 3TM4A 5KVAA 1RI2A 5E1OA 3P9CA 3GRRA 4KWCA 5FA5A 4A6DA 2BM9A 3TPZA 4ER5A 2JG3A 3MHTA 3PT9A 3V8VA 4MQ4A 3FUVA 4OBWA 2ZZKA 3GNLA 4PYIA 4DM3A 4RTLA 3MERA 3BWCA 4GBED 1AV6A 3E23A 4YV0A 3UJAA 4XUEA 3DP7A 4BLWA 1G55A 5K03A 3UBTA 3FRHA 3O31A 2BZGA 3PS9A 4GF5A 3ME5A 4QPNA 3TM5A 1JQEA 5DX1A 4RVFA 3F4KA 1NV8A 3CC8A 5ERGB 5FWAA 3Q7EA 2PT6A 4BLUA 2I7CA 3ELYA 4CKCA 3K6RA 3X0DA 2P7HA 3ER9A 4KIGA 4QPPA 3GRVA 5EVJA 1KPHA 3I58A 3T7TA 1R00A 1NW7A 3OZRA 3FTFA 5LQJA 2C7OA 5ICGA 4MTLA 5FQNA 2YQZA 3P9IA 5CVDA 5HZMA 1H1DA 2HR1A 4OX9Y 5T67A 1EG2A 4R05A 4E2WA 3TKYA 3NMUF 4P7KA 3KU1A 5FADA 4FSDA 3SXJA 2QM3A 1VBFA 2VDVE 1BKYA 3GRZA 4L7VA 4ER3A 9MHTA 1MJFA 3AXSA 2OPBA 4RTOA 1UWVA 1NW5A 2IPXA 3UZUA 4FZVA 3HVHA 3BKWA 3EPPA 4P7JA 1BC5A 2ZWAA 3FPFA 3LCVB 4AZTA 2PLWA 4GOMD 2GPYA 2BR5A 4EVIA 3TKAA 1XXLA 4K6MA 4XUCA 4WXHA 3KPYA 2OB1A 5EGSA 3IEIA 2CKDA 5E9QA 3AY0A 2PVCA 3KQVA 1UIRA 3KR0A 4RTMA 3MAGA 4X60A 2IDJA 2VP3A 2PXXA 3R24A 1EQAA 3G2MA 4IV8A 4C07A 5LQAA 4RTPA 2AS0A 3HA5A 4HSGA 4RYLA 5FULA 4QVKA 2DULA 5ICCA 3EGEA 5EHIA 1KPGA 2EFJA 4G56A 2AOUB 1JR4A 1SQFA 3DXXA 3C6KA 3M70A 3UA4A 2B25A 3JWHA 2OXTA 5DWQA 3E05A 4X61A 4B17A 2KW5A 2O07A 3NWEA 5EZQA 4C4AA 5LQKA 1YUBA 2QY6A 3CVOA 3EVCA 1L1EA 3G8AA 3OCJA 4QVGA 5LQCA 2HNKA 3GCZA 3HCDA 3M4XA 1WXXA 3MCZA 1IXKA 2EJUA 1KP9A 3I53A 5FHQA 3UA3A 4ER6A 4WVLA 5C0OE 1M6EX 5DX8A 1YF3A 5K0NA 3M6WA 3BGDA 3LDUA 4E2ZA 4RVHA 4OA8A 5K8VA 2PJDA 1P39A 2IFTA 1RJGA 2P7IA 2FYTA 4Y2HA 4XCXA 5HIJA 3R0QA 2HMYB 3EVAA 3KQQA 1G8SA 2P1DA 4ATNA 1INLA 2ONYA
chains in the Genus database with same CATH superfamily
2Y68A 3KHKA 1T6ZA 1E2QA 2ZTUA 1ORRA 2V6BA 3NHJA 4INJA 4UEWA 3VR0A 1BHSA 2Q4TA 2XYVA 1B6TA 2C94A 2HU7A 1OREA 2FSPA 2QR2A 2QRHA 3EULA 1JDBC 3KKKA 3KPUA 1LSSA 1WB4A 4DY6A 4Q21A 3H9GA 2XDQA 3VU8A 4GGOA 4NCBA 2JIZD 2AJTA 2WSSA 3M5DA 4I81A 2IY8A 3PCXA 4K6KA 2E37A 2NVUA 2PKEA 3G6KA 4PYOA 1KK2A 1IY0A 4NCKA 4R7ZA 1ESEA 1OPRA 3I9NA 1XTUA 4G0VA 3IGFA 3SFTA 4FKZA 4B6QA 1GTG1 2FPWA 2WJPA 2PR2A 4M0KA 1U98A 4LSMA 4ONEA 3RS3A 3TAXA 1FLAA 3CN9A 1MOZA 1AF4A 2ZYSA 3A2MA 4GZMA 4L95C 3WBBA 3CVUA 3HYRA 2QTMA 4HEHA 3GPLA 2D4AA 3IEPA 4UUPA 4OMDA 2K4MA 1YDEA 5EMHA 4BNHA 1QYRA 3GLGE 4ZI7B 1CY2A 2Y1LA 3ZX4A 5CPFA 3QA9A 4NV3A 1C0IA 1IULA 1DPGA 3UCFA 2VFAA 4D79A 5KNCA 4BYGA 1J8DA 5AKZA 4EB8A 4OHOA 4L8GA 5A0FA 2VZ9A 3VR3A 2M6KA 4EW1A 3R6GA 1WBDA 3MUFA 5HF5A 3VKGA 2CDNA 3SYTA 1MU0A 4K1XA 4ENPA 2D7CA 2BC9A 2O5CA 5EJ8A 2FSVC 2FZLA 2NADA 3DOHA 3FUXA 2IU6A 3IV9A 4IDOA 5DYNA 4CG1A 2UZAA 4EJ2A 4N76A 2RHGB 2X3YA 2CJFA 1UAAA 5F3DA 1Z4IA 1Q7RA 3KVVA 4KGVA 3MUOA 1KZHA 4IDPA 2VWPA 3LDFA 2BP7A 1HH4A 3E53A 3DWGA 1XDBA 3I9KA 5AHKA 1A9SA 2JH9A 5EPUA 1JU4A 4COKA 3OKFA 4EBFA 1EVZA 1B74A 6ABPA 5CA1B 1L4GA 4ZODA 4JELA 3B8EA 4M4SA 2I71A 5ESXA 3ZEIA 5IG2A 1O87A 5BW8A 4M54A 4B3DA 5HZGA 1CFZA 1YRLA 3C24A 4Q9HA 4G5SA 3GAMA 3PLAE 2XX3A 1Z7YA 4JGGA 5K1ZA 3KJGA 4EYOA 3R2JA 3TR6A 1DVRA 4N9WA 4X64B 1G5RA 3I6MA 5L4SA 2WTAA 3ND8A 1MJHA 2FKNA 4EGFA 1X77A 4HADA 4QPDA 1PGOA 1QPZA 4DXHA 4MCJA 5FUWA 2NU7A 1RQRA 1CUZA 3SNHA 1HETA 1LS6A 1ZM7A 4Y2GA 4PR3A 4KQ9A 4R5HA 2V6MA 4EHFA 4Y0AA 3ZLJA 5ALYA 2J9YB 3L84A 4QYIB 4NULA 3GJXC 3GEPA 2QW1A 3U4GA 4MYTA 2VYND 2F62A 1OLXB 1R74A 3MSCA 5JG7A 2JK1A 1XNJA 2AOUA 2JJQA 2YFHA 1WU7A 1GCAA 3KAKA 3DE0X 4EKNB 2AL7A 4O2RA 2VUIB 4IUCS 4R1OA 1GDTA 4GGMX 4TSKA 3HK2A 2JIDA 1OTYA 2DCUA 2ZI5A 2PQ2A 3U17A 3LUPA 4FFWA 4BLTA 2B4KA 4CMCA 2CCGA 5KYXB 5CFZA 1WE2A 2X5NA 3A6DA 3CNNA 3CT6A 5AKXA 2C61A 2NP7A 2D7JA 4JOCA 5BN3B 2XCTB 5FPPA 1PT9A 2ZIUB 1IYZA 1II9A 2J5KA 3F6CA 1OCEA 1GN8A 4B3GA 1WY7A 2Y4NA 4ER7A 4C20A 5C1BA 2ZE5A 1FNBA 2BGUA 3AG5A 4ZQFA 1XTJA 2OCXA 2P9YA 2VJOA 3HR4A 4IOLA 5AM4A 3ZU3A 1MF7A 3D4LA 3KDAA 5BN5A 3PCTA 3ZVNA 2OV2A 3IT1A 4RVGA 2NO4A 4IQ4A 4DLBA 4YWHA 2VDPB 2O4UX 3NAQA 1C4OA 1P5JA 1XZKA 3EC1A 3I1FA 4RLFA 1L7BA 2X41A 3A0UA 1JKFA 3WP1B 2GAFA 5DRYA 3LOUA 3L07A 3MGKA 3TXAA 4Q3NA 3VKVA 2FWIA 1XQYA 1Q50A 2OFOA 2WSSD 4DM7A 3L8FA 3QWBA 3UPDA 1DCTA 4D4LA 3QLUC 2O5RA 3SJUA 3U7EB 1P33A 4R6WA 4GM0A 4FYVA 5DLYA 5FTWA 2FPRA 2KYRA 5E4YA 2RAFA 3RKSA 1IZZA 1JEDA 3BM5A 4QDZA 4UASA 1Z6XA 4Y2SA 1REQA 3D6UA 2R48A 3WLTA 2P5TB 3KUKA 3ZX5A 4NVRA 4R2IA 4DT1B 1FL9A 3RVRA 3QEAZ 1V1MA 1GPBA 1U7XA 4UHKA 2W6ID 3WA6A 3LT0A 2QX6A 2R6CA 4EG8A 2FZWA 2MINA 5KNCD 3HKEA 1MV8A 2RK3A 4I55F 4JC4A 1R6UA 3VR3D 3DXYA 2P35A 4ZI7A 3L8DA 5DBGA 1EXMA 1OXSC 3PVZA 3GJ0A 2PH3A 2CLMB 4UNQA 1K6IA 2GKOA 4HQFA 3D1VA 4IHQA 1CR1A 1RTKA 4NY1A 4L16A 1XQ6A 4NKRA 2C1EA 4UJ5A 3TZQA 1FMFA 3H11A 5E4JA 5JO0A 3AVPA 2VH2A 4HH1A 2HA7A 2G4VA 3C3YA 2M9MA 3FYTA 1MO2A 4A03A 2VBCA 3OT5A 3CX3A 3HBAA 3FPAA 1Q1AA 3ZE0B 1E4OA 2OO7A 2NP6A 4KXNA 3L7AA 2XCUA 3UWDA 4PYNA 1FP4B 1LA2A 1N5IA 2I8LA 4IWYA 2J0QA 1XT6A 3A3OA 1TNDA 4JJZA 4KFSA 4XJSA 3ZHQA 5CTJA 3CFYA 4K0KB 4PFKA 2P65A 2PX0A 3NT5A 4CUZA 4BTLA 1HOXA 5IH3A 5C53B 1M2EA 4YRJA 2JK0A 3UJPA 1UM8A 1XEXA 1OXBB 2PUVA 3LOQA 5JNTA 3LL7A 3V1MA 1MG5A 5DF1A 2DHQA 1B76A 1SD2A 4HRVA 1W6UA 1P7CA 1Z6TA 2AMVA 4X1KB 3F46A 5DHRA 1DBIA 4M9ZA 2GFIA 5IXYA 2H9AA 4KN5A 4QGAA 1RWKA 2O7RA 5COAA 5D86A 1PW5A 4KJXA 1S02A 3RSSA 3U39A 3RSOA 3VH1A 4FYJA 4G8DA 3KYDA 3A6HA 3RLFA 2V7UA 3DDCA 3E2PA 3ACDA 1XDSA 4EECA 1NXTA 2QD3A 2J59A 3DBHB 3B6KA 2Y6VA 2VP0A 3SM9A 3V55A 2YY7A 3ASUA 2PUAA 2HCBA 4HCJA 5D85A 4MPRA 1U1EA 1SXGA 4GVXA 3WI7A 4PPQA 4TYWA 3FLBA 4UQOA 1AQ6A 3DMTC 1K7YA 5FWNA 2Y77A 1ZNWA 1P77A 4UPVA 3GFPA 1UQTA 1WNFA 2A5JA 2H85A 2HPHA 3ZGNA 1OH5A 4LF8B 3WSVA 3F8SA 5AKGA 4F9FA 3IQFA 2B3DA 4J0EA 3U1BA 2YC2C 3I42A 5EA2A 2X6RA 1A27A 2MYNA 4QUAA 4B34A 4NENB 3RYHA 3PHHA 4E46A 3S3TA 3TI9A 1LW7A 1JUDA 1P17A 1V6AA 2P9TA 4H1VA 1LI7A 3VZDA 4UEOA 1J8VA 3DV9A 2G17A 2RHWA 5A03A 5FRDA 3GJ6A 1W4CA 3E7FA 1NU6A 2EHDA 3RC1A 2K87A 1FX0A 3EEOA 2EJTA 3VVCA 1DRVA 3PR2B 3EZFA 4EKGA 1Q1GA 3TRHA 2AW5A 2EATA 3ELDA 2JGNA 1Q44A 2CK3A 2VIIA 4OJTA 3TW4A 3AVVA 3USZA 1BOFA 2DTDA 4QFDA 3RS8A 2I2BA 2BT4A 2DPHA 1I6WA 5FOTA 4BLVA 4YALA 1P74A 4ZJUA 4EEKA 1OWOA 4F3TA 3AP3A 5DX0A 2IV3A 2CDAA 1QNFA 4DZRA 3JAWB 3R5TA 1NDUA 2H7CA 1QH1B 2QTCA 2WJZB 3CV3A 4X3OA 1H5NA 1XA3A 3UV3A 3WLLA 2QV7A 4LHYA 4BQFA 3V8NA 1WMSA 1PWEA 4ODIA 3DE6X 1IEXA 1GILA 1NXWA 2WB4A 3MTEA 3D3KA 4EEZA 3ZQUA 4FZ5A 1OYWA 2VPIA 5IT4A 2V9PA 2WIAA 3K7EA 4DW8A 2NU9A 4RAQA 3WGQA 4YAIA 2C8JA 2IODA 4A9AA 4F3NA 4JP2A 3AF5A 3OQIA 2ZJFA 4EK9A 1VMIA 3GT3A 2LP4Y 4F0JA 5LA6B 1I2MA 1P5HA 1OTHA 3BWMA 4NPCA 1UPAA 2I34A 3EIFA 4KN8A 1FXWA 4Z53A 3ICCA 1DZ3A 2W37A 2ZSIA 3OHSX 4WZAA 1GL6A 5EUMA 4HNQA 4IL5A 4DEXA 3F78A 4D9BA 1HMYA 3EPHA 1M0SA 2E55A 3LKVA 4MICA 4FDVA 4A3SA 4MV4A 2JH8A 1EFPB 3HC7A 5H5JA 1VSTA 4M87A 5AW3A 4DSZA 1EHYA 1TUGA 5DHUA 4O59O 1ECGA 3S70A 1VG1A 3DWIA 2GSWA 3UMMA 1C9YA 1C3LA 4MEBA 3NKFA 4L4ZA 3EQZA 4U5XA 5AVOA 4W1SA 3VO1A 1CZRA 4MUEA 3O7WA 4NMHA 1ESNA 1XZDA 4W4TA 4XJXA 4R6XA 1QZXA 3SC4A 3T0FA 5JHGB 3HNRA 4ITUA 1KDRA 4PAMA 1LSOA 3B60A 2H11A 4FS8A 3X2EA 5EIOA 5L7YA 3TB4A 2D2VA 4KFRA 1J2EA 5ENDA 3AFHA 5JIBA 3ZWVA 4CWAA 3MINA 2Y67A 4W6ZA 1ADCA 1KERA 1VJGA 4F1WA 3DBVO 1JDSA 4BGIA 4DMHA 3F73A 1KJ8A 1ODKA 3I2FA 3EF0A 1Z82A 3IAS1 1THMA 3ZJ5A 1DXYA 4YCLA 3EZ2A 1A9XB 3H9BA 5B1YA 1PYDA 4WY5A 1EFKA 1TXGA 3ETEA 4UCXA 2W7TA 1FU8A 1QOQB 3EAQA 1WQ4A 5E7MA 2ZBEA 3PUXA 4AW9A 4BFVA 4XWKA 1XHLA 1FSPA 4POAA 1WHTB 3VC2A 1GPDG 1VKRA 2OYCA 2Q3LA 1E2MA 4MH0R 1CUWA 1PYGA 1S2OA 2HI0A 2XYGA 3O0TA 5JSFA 5KBYA 1WXEA 2X5XA 1XTTA 4KCGA 5CJJA 4EY5A 1DKNA 2Z8XA 4YCDA 1XA4A 1GL7A 3GRRA 2PD4A 1TUBA 2YFQA 2PL9A 4Q9DA 1GGFA 4J0DA 5I7OA 4XKJA 2VSYA 5HUHA 2OVFA 1AB5A 1T2FA 4C78A 5KWVA 2DQKA 2QT0A 3TRJA 1QQAA 3ICQB 5KJEA 4JYZA 2IV7A 1TKRA 4ZVLA 1VE7A 4JROA 4OQPA 3GFGA 4KR3A 4MDFA 4H15A 4L4RA 4Y2YA 5ALRA 3V4PB 2K6GA 3WQRA 4KO8A 4B7ZA 1UZNA 4MK4A 1FFGA 4Y9UA 4LRTB 2K7FA 1G55A 1OD6A 2F7SA 5BSGA 2QT1A 1F1BA 2X9NA 4GX0A 3FFAA 1IBRA 1QVVA 4YREA 1WULS 1DX6A 1ZL2A 4WKOA 5DX1A 5JI3E 1C2YA 2CK3D 2O1XA 3Q7EA 4N5DA 1RRPA 3BSFA 4M49A 4NBNA 4EPRA 3IP6A 4HX2A 4UNRA 3E81A 2H5LA 5H3CA 3TTWA 2ROQA 1KO8A 2Z5VA 1E99A 2ZXEA 4QOIA 4LV5B 2JB9A 4WAUA 3R3ZA 1YSCA 2HIAA 2V7TA 3AFGA 3ED5A 4JLNA 4G5XA 1QH1A 1SBHA 1BGXT 5A05A 1EEHA 4AJOA 4KG7A 3AUTA 3JVDA 1TZJA 3K16A 3M83A 4OHFA 2AHOA 4KREA 1AT1A 9LDBA 2OPBA 4YAGA 3EDYA 2OXIA 4AY2A 4XR9A 3HVHA 4LX0A 4QBFA 5SICE 3DVSX 3MLBA 2JLYA 1UBEA 4F72A 1UL1X 5J9FA 3TRDA 2F48A 4I50A 4EX7A 3AP1A 2IGBA 4D4KA 1R0ZA 2P69A 2WU3A 3KPYA 3OURA 3AY0A 3CONA 2HADA 1N2IA 3MAGA 1DTSA 5DYIA 3ZQJA 3LXRA 5HOEA 2X1VA 5ALFA 1HQDA 3W1VA 2VHCA 2R8OA 3PC8A 2ZROA 3D7KA 1QU2A 3OE7A 4XLZA 3DOCA 2Q2WA 4MW2A 4QNMA 3PU6A 1M83A 1D6MA 2VQ6A 3BHIA 5FWXB 2IUFA 3V2IA 3QGMA 1BN7A 3AY7A 4TQAA 2D2FA 4KPFC 3WWDA 1C41A 4BATA 3OCJA 5DGHA 1S9DA 2A4MA 4I9HA 4V0OA 4HUTA 2Q99A 5GJCA 2VDJA 4FOOA 3NEYA 1XTBA 1LZLA 4CEIA 1VCNA 5JCJA 4EQ6B 1V71A 3ZPXA 1DCKA 4E11A 4FJ0A 3WGVA 4E2ZA 3IOMA 5DW3A 3UV7A 4R2LA 1VSBA 1F8YA 4XCXA 2QIOA 3SQMA 2GVDC 4C0JA 4WGFA 4JS0A 4AKHA 1RCFA 4OYYA 3MMXA 3QLJA 3Q0EA 4GX1A 1ZXLA 4RS3A 1OFIA 3CW8X 4MHSA 5B4TA 2JLZA 1TZKA 1NVXQ 5JRZA 1PHRA 3STYA 1E58A 3UHAA 3RROA 4G0OA 4NZYA 4XXHA 1XJ5A 3DW3X 2Q6KA 3OZUA 3CR3C 3NS7A 2G0NA 1ZNQO 4MXDA 1ZCAA 4QOEA 4RKYA 1U2RA 1X87A 4GMFA 2HSZA 2W4MA 3H6HA 1GD1O 4UJ3A 3ZK9A 1A4XA 1DWUA 3IJRA 4K6OA 4FUQA 1Y6ZA 5CX4A 4NK4A 721PA 3ZY6A 4F71A 3KYCB 3IUBA 3LPLA 1DELA 2GZ3A 2B1IA 4M46A 2CLDX 3B2NA 3N70A 1OWNA 1YHZA 2OORA 3VR6H 4QICA 2IEIA 1M72A 1YZYA 2XNKA 3D3NA 2G67A 4K6HA 1Y3BE 1ILWA 3NTXA 3AR6A 4JXJA 4MS4B 2X1LA 3IVCA 3JCZA 4DA0A 2GK4A 4BQRA 1G17A 1E1RA 4L8FA 1ECCA 3D6JA 4EZIA 4KN9S 2ZTHA 1RI3A 2Q3BA 3H86A 4X7RA 2O8FB 4QL3A 1P4SA 4N8DA 1RYBA 3IHWA 1JDNA 3C41J 5CNIA 1WZ2A 1DJMA 1G98A 3L0DA 1SU4A 3ESAA 3Q6MA 1KI8A 2RJOA 2YZ7A 4L5YA 4G81A 2CL0X 3TL3A 5IF3A 2CWWA 3E48A 3ZHYA 4X3CA 3SX0A 3OMXA 1RFGE 3ANYB 1LDMA 1SUEA 3BRWA 1E3DA 4AU1A 3FTNA 1SBIA 4ND1A 1YDWA 4YRZA 2FPMA 5L40A 1F4VA 2RH5A 1BMTA 3IPAA 3MTAA 4FLFA 4OQNA 4AP9A 2PUDA 2F8MA 2J4FA 2X23A 2ZCUA 3Q11A 1JYEA 1PDVA 2NNLD 3VSAA 3VPGA 5GADl 1U63A 3AHGA 3KAJA 4M6WB 5HX7A 4J0CA 2ZBFA 4DS3A 2ISCA 1HK7A 2EFDB 3GLHA 1MO5A 2OV3A 3QXXA 1XCPA 2G25A 4IG4A 4M9QA 4A91A 4ZZ0A 1DQPA 3GVXA 4IM7A 4LJ9A 3VSBA 4Q4AA 2JI8A 2VF4X 1WSBA 4DWOA 1C1XB 4AYWA 1Q0ZA 1W0KA 2QTZA 1SXJC 3D4OA 4HQ6A 2J33A 1I7NA 2B78A 2ETXA 1PEDA 3H1AA 4G0PA 4RX1A 5C35A 1TTHA 3DF9A 3HXLA 1PNOA 3CMMA 3IO5A 2O2SA 4YUXA 1TGYA 1V5FA 2AQKA 2PD6A 4YP7A 4MIKA 1UWCA 3CEPB 4IY1A 1CEYA 4QUKA 2R8ZA 3OE7D 2UVQA 1QC5B 4EFNA 5DISB 1MBZA 5EZSA 1Z73A 4KR9A 4AJHA 4PLYA 3N8NA 1N2CB 2PFSA 4UDOA 4W7IA 3GT0A 5TX7A 3OD1A 3VU1A 4ESVA 5EHQA 1TE2A 3EW9A 1ZGJA 2ZWPA 1RJWA 4QTXA 5IDWA 5KMGA 1IJFA 1J2TA 4ARAA 5J3JA 1UP7A 1KYVA 4WZAE 1NBEA 1FXSA 5LOVF 4PHHA 4F6RA 1YTLA 2PX5A 5JCJD 1E2BA 2A7QA 1K8RA 3IBSA 5C1IA 2VCYA 5CPBA 4GU5A 2IPLA 1K5GA 2J87A 4UUOA 4EGJA 1N9ZA 3QF7A 4NYIQ 4PINA 3O1HB 3AJ8A 3TTVA 3T9FA 1TM4E 3NXSA 4CKBA 3Q9LA 2EGUA 4LJ4A 3GNSA 2JZNA 3W6PA 2GA9A 1IN7A 3VU0A 1B43A 3EGVA 4BNKA 1XJWA 3ENKA 3REOA 4B1FA 3OPYB 1YMUA 5DV9A 2WD9A 2Y6UA 4EA9A 2REQB 4UTRA 5KYYB 1VLZA 3I1YA 3LPAA 5KAPA 1FW6A 2VNHA 2DBYA 2UAGA 2CMKA 2F9LA 4MGYR 4B6FA 5JAIA 4N5LA 3ETCA 3T3DA 4BNUA 3O73A 3V00A 5COQA 2APJA 2D1TA 1TCAA 4ISCA 2WT4A 3K0CC 2FN8A 4QQKA 5FF9A 3TW8A 1DEKA 1VB5A 1LLQA 1XU4A 4B79A 3N8IA 4OIFA 4ZDKA 1QVRA 3WB9A 2XDAA 1Z38A 5CT8A 2WTNA 4MLZA 4TTIA 1NI4B 1E8DA 5KYUA 3L7MA 5HP4A 1ULUA 1TU4A 5K5EA 1RKQA 3DZ8A 4HKTA 2VDUE 2MYPA 2Q2NA 4KK3A 4QJBA 1Z5UA 2G9RA 4GLFA 1QO7A 4KEAA 3E1GA 5FOUA 2I91A 5EE0A 4YJFB 1W7AA 4LF5B 1J2RA 1PTJC 3GFOA 4G1EB 4YP1A 3ZU5A 2WMNB 1P5FA 4DSNA 4G5GA 1OB2A 2DT5A 1E1RD 3DFMA 4PTLA 2QM0A 3F1LA 1PK8A 3IAS6 1FSSA 1S8NA 4JYMA 3BORA 1FLVA 2OAGA 1F14A 2Q3MA 2XUFA 3KAPA 3L77A 4JSYA 3A58B 3N5KA 3B1ZA 3W6UA 3GJ4A 3ZE6A 2O8FA 2CNNA 2NU6A 1HSZA 4Q82A 4IFEA 3K94A 3AJAA 3D2BA 1YZLA 2WOJA 4X44A 2P40A 4GOND 3VPDA 4PCVA 5KNBH 3PD1A 1PW7A 2XE8A 5KTYA 2O5EA 4BQQA 4DILA 2RHHA 3KK0A 2OCAA 3BRWD 1MN6A 3KCQA 2O57A 3S81A 5F4ZA 1PVOA 1EVEA 2JI9A 1WA5A 4JNCA 4KIJA 3ZLUA 1M34A 1I4WA 1Y6QA 1E66A 1XZ8A 3FSGA 3KQOA 4HFNA 1M2VB 4Q3EA 1JG3A 2ZUSA 4ILEA 4RYDA 1WSAA 2E6UX 1QMPA 1W5TA 2NSJA 4M36A 3HUUA 4M0EA 4P08A 3RDPA 5CAEA 5LZ4A 1T4CB 5L3ZA 5I8ZA 4HNGA 5TDHA 9ATCA 2J9FB 2JJYA 4JHLA 1WBBA 2WKSA 3R5SA 1Z13A 1MAAA 2XLBA 4A26A 4YUVA 1II8B 1W48A 1ZI6A 2ID4A 3E70C 1E2LA 1Q22A 1Z75A 1TT7A 2RHRA 2Q8PA 2VOEA 4F2GA 1W0KD 1ENYA 4ZVOA 1ZMRA 3MRVA 5B3KA 3P96A 1N1DA 4ZGGA 1XF1A 4J2TA 3BCSA 1I6MA 2NOAA 1KWKA 3WGNA 4EB0A 4DTCA 4E0BA 4X62B 5FTNA 1GPNA 2AC7A 4N5IX 4Q7JB 3RJ5A 3NT2A 1RQ7A 4MUHA 3QHQA 3V8BA 4MAAA 5IC6A 2O8DB 5LDHA 2WYOA 3IJ5A 3A9TA 1Y9AA 1X0VA 2HF9A 5JD5A 1YFJA 2IV2X 3L5KA 4GSLA 4JJAA 4MPTA 1PLJA 4Z9XA 1GQSA 1V7ZA 5FBHA 3UJ3X 3ZCVA 1N34B 1X7GA 2CLLB 4ZJYA 4JA2A 2R62A 5DGDA 2IDZA 2XB2A 3BDAA 4MHTA 1PR5A 2XZOA 5LYYA 1NZDA 2WTXA 4TLDA 5IWCA 3UKOA 2IZ0A 5BVGA 4JLWA 2NUAB 8ABPA 4TXJA 4OSPA 5LMCA 2AFHB 2GD1O 2WAXA 1N2ZA 2DMRA 2AZ4A 1J56A 2V5UA 1MDFA 3TR5A 2HJHA 4RXUA 1POWA 2AN4A 3WHIA 4MB0A 1ESZA 2NYRA 2Y27A 1VJ5A 4KUHA 4DARA 3T12A 4UTPA 4LTMA 1O58A 3DGEC 3R23A 1NNLA 1DSSG 4MEJA 2O8NA 3HDVA 4C0XA 1C9EA 4B33A 4RSMA 4RVDA 3SLKA 5EMKA 2ZIXB 2GPBA 3RASA 1ZD4A 2FH5B 3OQBA 5LQSA 5KYYA 2FDCA 2PUEA 5A7HA 4L5CA 1HLGA 2FEKA 2GF0A 2XE6A 4PZLA 3WLOA 2QVLA 5JC8A 1T3GA 1CYDA 2B2NA 2ZYGA 3GBSA 2FXVA 3TZEA 5J59A 5BURA 1W34A 3NUZA 1ZH8A 3QE4A 3KOUA 3TPCA 3ZKWB 2PGOA 4CXMA 4RDIA 4BAGA 2VJCA 2AF3C 3R4VA 4C2AA 4GG1A 4F9TA 3CZCA 1FQKA 1L7XA 1Y1QA 2AOVA 1JAHA 3AUJB 3DFFA 1H69A 4JLJA 4ZCSA 3RVNA 4C0KA 4O4IA 5I01A 3HXMA 4RK7A 4PRZA 4IDNA 2ZWMA 3P9PA 4YJFA 2HJVA 1YIAA 2OXCA 3PGVA 3HKDB 4RMHA 3AVUA 1G5IA 2WD8A 4YP0A 2RG7A 2O2IA 1ORWA 2NIPA 1VSVA 1CZKA 3LHDA 4JIMA 4FYPA 4ZU6X 1Q0TA 4RHUA 3NAGA 1U7UA 1OH6A 1DT5A 5AQ1A 1TDJA 4MQBA 3HJGA 2Q3JA 3OZVA 3RS2A 2ZB3A 4U2FA 3T52A 4XWAA 3GZ4A 5FPTA 5F76A 2XA2A 4BLQA 3FROA 1DG9A 2I54A 4J7UA 1UKAA 3M3HA 3I92A 3IMEA 4RSHA 4WXEA 3JR3A 4MV1A 5EOVA 4G1UC 3WGLA 2CL5A 5GY7A 3BHNA 1L5ZA 1Y6FA 2CUZA 4GXTA 3F3MA 5DTRA 2UYOA 3FSGD 2C95A 2OOKA 5ALIA 4IIJB 3U4QA 3PXXA 5KWEA 3FOEC 4TTSA 5CLHA 1S8FA 2DUWA 2X3UA 2RAVA 3RIEA 1L3CA 3RAJA 1DKQA 3G9QA 5JPDA 2PO5A 2YWRA 2F8TA 3H84A 4H18A 1RPTA 5EJ5A 1C0EA 3D0OA 1N5JA 4O0LA 1IRXA 3Q3CA 2RBKA 2XT0A 3HYLA 5D01A 1NT4A 4ZU1X 4JDUA 2ODQA 3MT0A 3CZMA 3A70A 2PIAA 4ZVMA 1II8A 1WV0A 1Y48E 2AI2A 1R8XA 2EZ4A 2HU2A 2IZZA 3AF1A 3NYRA 1DCFA 2VJDA 2HCJB 3VV3A 3JQ8B 4OD0A 5LC1A 4ENQA 4ABYA 2I7XA 3KQKA 4L8VA 4BO5A 3ESBA 4PZYA 4NMMA 2QYOA 1VA4A 2B6HA 4NS1A 3SEQA 3T6KA 4C88A 2I78A 3C2QA 4ER0A 2DECA 2PFKA 2W6OA 1RQGA 1ZOOA 2MR6A 3GLHE 2IXBA 4NV0A 4TTQA 3THXA 5D00A 3A9RA 5GMOA 3VQTA 3ZIDA 1AKMA 5ICEA 3MTBA 3FPHA 1QJCA 4B47A 2WYHA 1S8OA 4FFNA 2OZVA 4JJKA 5A3RA 4L4XA 1ZSVA 3QOYA 4HDSA 3U9SA 1Q1EA 3E4CA 2VG8A 2QN2A 3ITEA 3ZC3A 2O8DA 1RXWA 2WZDA 1K7XB 1N92A 1GTRA 3BWVA 1PSZA 1GAWA 3PX7A 4E1VA 4LXUA 2PS0A 3JTEA 4HH4A 1GTMA 1R6BX 2BVNA 1TJ5A 1XNHA 2LE0A 4DLAA 4O6VA 1OFVA 1XFAA 2F8LA 3F7NA 3HRHA 3OOEA 5CNJA 2KS6A 3TLGB 2EWWA 4NYJR 3QE9Y 1D8AA 1XZNA 3AM3A 3CLRC 2PSHA 1R8QA 4GPZA 4JYBA 3E03A 1Y3IA 3DO6A 1VPLA 2H4FA 3TE7A 3R9XA 1E2JA 2CUKA 1EP9A 3DZDA 1OV4A 4I3GA 4K9DA 4YN3A 1Q7GA 2QLNA 3I73A 4JKYA 2ZS7A 5ADHA 2H3HA 4ETMA 1C3XA 1NMZA 3D5TA 4JR1A 4CNQA 5BNWA 3NANA 2Q9BA 5JSKA 1U9IC 4IEEA 1A0OA 4XWTA 2IOYA 4TMXA 5HTKA 2PJRA 2UYYA 3JD2A 2QTHA 1FQOA 4P3NA 1LV7A 3D7LA 4NI5A 4MLPA 4RD4A 2C3UA 4ZXFA 3WYGA 2BZGA 4H9GA 5DTJA 3ME5A 1MRZA 3HTXA 2G9QA 1H0RA 4V3BA 1SVLA 4IYRA 4INZA 4OXIA 2WSYB 4QXMA 1QHGA 1QQ7A 3B38A 4AWBA 2P7HA 3EB9A 1DFIA 2REXB 4QPPA 3I58A 1UZUA 3OIUA 2UUCB 3T9DA 1NVVR 1U0OC 2H48A 2JZOA 1DBQA 4EL5A 4OLAA 2GN1A 2VKQA 3EGWA 5FQNA 3P9IA 2KWIA 4WV3A 1JZSA 3E15A 5KEIA 4KN6A 2GEVA 3O4JA 4RZ3A 4U5QA 1XZMA 4BN5A 2BEUA 1I32A 2AW3A 2OHGA 4GKVA 1ZNZA 2CMFA 4ISBA 2XUKA 4P7KA 4RULA 4FC6A 4Z9AA 3ZYZA 4B3HA 4RHYA 5HBRA 2RARA 1JKJB 3EPRA 4YXWA 4CE6A 3ZFOA 1YGYA 2QTRA 4RTOA 1NLFA 5HCIA 5EZYF 3FAKA 2NXWA 4AZTA 4JH0A 1TVKA 3QKSB 4S24A 2GPYA 3UEOA 4G1MB 3TD6A 1FZTA 4Q34A 4K6MA 3GLFA 5CCDA 3CLUD 1FXWF 2B5VA 2HUPA 3GA0A 2E3JA 1G18A 1T2AA 1VHTA 2JAXA 3KQVA 3WC4A 3LYAA 3QUSA 5CFLA 3Q72A 2IDJA 1WR8A 3CRRA 4IJWA 2AJ8A 2EL9A 3IOYA 3HA5A 4HSGA 5EP3A 2YDYA 2BTQB 5G0SA 5LPNA 3CLHA 4I99A 4I4CA 1NVAA 3OEHA 4MDHA 2ID8A 1N4DA 5F7XA 4D3SA 2WQ6A 1VZ2A 4JP8A 4NBWA 4NV1A 2QZ4A 5THXA 2CJYA 2VTDA 5B3JA 2OXTA 3PUKA 4AY3A 3ICVA 1R4NB 2PZJA 4C4AA 4FWIB 2QAGA 3OIFA 4NARA 3EVCA 3P2MA 4QWWA 1JKMA 1X94A 2BUAA 1E7YA 1L6IA 2HNKA 4V1CI 3UUGA 3HVUA 1TVMA 1SCUB 4KQJA 2P91A 3OCVA 4JBIA 2VP9A 1KP9A 4ME6A 3DBLA 2PGNA 4NEGA 4GVLA 2FFJA 1M34E 2JLRA 5TS3A 5K3OA 4LXHA 3BGDA 4HZUA 1XKQA 2ZRJA 3LDUA 4IJ5A 2WMOB 1BXZA 4LJRA 4EO7A 3ND5A 2PU5A 5I7WA 1MZPA 3I9JA 2E49A 3HRIA 2P7IA 1X2BA 4F06A 3W8NA 3PRJA 5B2EA 3VHXA 3FX2A 1BGWA 2WT9A 4BP8A 1PS0A 3N07A 4GIBA 1A2BA 3D6FA 4D9MA 3T1VA 3EZ6A 3OBBA 1TCBA 1RXVA 3INNA 5K8UA 1N9KA 3OQOA 1COWA 4JJ4A 1E1YA 3VBCA 2A9VA 4IKEA 3LO8A 2OHOA 1X7WA 2ORIA 2CXPA 4MS1B 4BP1A 2A33A 1YB4A 3WNDA 1A5SB 2XUQA 1ABBA 5EZYB 3GU3A 4ZK6A 1WXQA 2PKWA 3AONB 1ODFA 1CEQA 2RGAA 1ZXBA 5CDHA 1FMJA 4C6SA 2BRUC 1L5OA 2NV6A 2LW7A 3ROPA 1KI6B 1KJNA 4C89A 3LQYA 2CF5A 2G40A 1Z36A 2GBCA 2I4TA 4DG5A 5HG0A 1U7ZA 4DLPA 3AVXA 4EI8A 1T1RA 5HXAA 5HVNA 5JCOC 4PO3X 1N6LA 2X0EA 3DYVA 1P5RA 1K06A 2XF2A 4M2LA 4MP3A 3WY9A 4F96A 1VXOA 1VG9B 4DLKA 1GNRA 2WM9B 4CMJA 1DKMA 1DBPA 3ESRA 1YJAA 1YVRA 1F9AA 1QKJA 3V1TC 1TM5E 4U4AA 3RVKA 4EGCB 2A0FA 4Y2PA 4H59A 3WK5A 2QRKA 4HDNB 1B6RA 3USES 3WNBA 4F38A 5L3VA 2EKBA 4B6OA 1GGNA 2RK4A 3U44A 1LH0A 4NBRA 3W5SA 2UXCB 3ZQ4A 3SBOA 3CLKA 2VPPA 3E9QA 1EVJA 3D1JA 5IU6A 1NR5A 4J2OA 2VATA 1TX4B 1DHRA 1FP2A 1JDPA 1ZWKA 4M1KA 4PSKA 5CH8A 5DHFA 3S99A 4BO8A 4KXQA 4JUDX 1A8PA 4AM8A 1Y5NA 4DLLA 4TLCA 4BNNA 2A9QA 2CVPA 2PSSA 3ZDQA 3DAGA 4YXWD 2ZBDA 1L7RA 3PFNA 3FNRA 4NABA 2HIGA 3OM9A 4L6AA 4UC0A 4CMEC 2QVZX 3K2BA 4QXQA 3KLBA 1GRVA 1VL6A 4C06A 1RI4A 2ODNA 3GHYA 1ADBA 4I50F 5JD4A 2Z3ZA 3P2EA 1ZUNA 2ZBQA 1SXJE 3EBPA 2ZJ7A 3INGA 4O4JB 3L6CA 1WCWA 5TARA 2QDKA 3N2IA 3QKSA 4HRAA 1N5MA 3K1AA 3L8GA 4CLOA 3EG5A 1QO9A 1XA0A 1JSLA 2B4RO 2C9BA 2GCOA 1V37A 1YB6A 2V8BA 3R77A 1BA3A 3RTDA 3FSEA 3WQQA 3LYHA 1P0MA 2YVKA 4GC5A 1G2PA 1A5BB 4OHZA 3ROXA 3ZV7A 3PICA 3ZJVA 1ACMA 1KBQA 2C03A 3OEHD 1P0FA 1BMDA 2P8JA 2QMQA 1RZUA 1VI2A 1GSOA 4R7TA 2ZJ8A 4CTJA 2CB0A 3CGWA 2NVWA 2ZSUA 4R1PA 1MNAA 3ZWPA 2JVJA 1YB5A 4EOGA 3RBAA 3LY5A 5K6AC 1G60A 2FAXA 2HDNB 2B21A 2ZQZA 1NI5A 4EM6A 1Z4JA 5HZHA 5E2IA 4J0JA 1R4NA 3A6PC 4ND2A 2ZBVA 4IZOA 4C43A 3CBGA 1DNPA 3LCRA 4S3MA 3P2OA 4GE3A 1P18A 1XZBA 2DGDA 2W0MA 2OK8A 2GYYA 3KWJA 4TKMA 5TT0A 4KDRA 2AQHA 1TEHA 4V38A 3T1TA 3AKYA 2QAJA 3A10A 3ONVA 2WVGA 3Q7PA 1D6SA 4D9NA 4F8YA 2VTEA 1I9CA 5M2QA 3B9RA 3O4FA 1P0QA 1YRWA 4LKRA 2Q2VA 1NAHA 4IQFA 4ZAVA 3VU9B 4AJJA 2PL3A 5LQRA 2VHXA 1KJQA 2OCBA 1Z37A 4H3KB 2BTEA 4HEA1 2Z09A 4MNTA 4OFZA 3RYIA 4F46A 1DUSA 1RWBA 1ONNA 2DQYA 2E7ZA 3ZE7A 3UFBA 4GYWA 4NHEA 5DFAA 1COWD 1ZOPA 1KY2A 4EELA 4EMUA 1PD0A 4FN4A 4RKEA 2WAYA 3EXG1 3ZNOA 1VC2A 5THKA 2AH5A 5IH7A 3MPOA 3TWOA 2B3TA 2QUZA 2RG1A 3IHTA 3NHRA 4GXRA 1CX9B 1H2YA 4RMGA 5TPZA 4RY9A 3HACA 5EMJA 4RPIA 4IVQA 3MWFA 4I4LA 3H97A 5I9SA 4FHZA 2COEA 2QGNA 5DYWA 4MS1A 3BWBA 5G53C 5JUWA 3FUCA 3RAEC 3HUEA 1CF4A 1R7RA 2G9ZA 3K6SA 1A9QA 1OUMA 1WMEA 3AJEA 2QRQA 3D43A 2ZB2A 2O1WA 4ZN6A 4FINA 3AG6A 5B1DA 1THZA 1WWKA 1MNQA 4GSKA 1JT2A 1YBVA 1PUJA 5HIIA 2QENA 1UAYA 1KI6A 4G85A 4Z3DA 4COOA 3WDLA 4GAEA 1TPYA 4D5GA 5EI5A 1PN3A 4URWR 1C2TA 1RM3A 2TECE 1MHTA 1MZVA 3BXHA 5FUMA 3O8CA 1GUYA 3D6NB 1VPEA 2OBFA 1PV2A 3L0CA 3UXYA 1NJ6A 1FRNA 5EKSA 3WRYC 2V58A 4PBTA 2E82A 2JH3A 5JC1A 4FP9A 3LJKA 1IVNA 2O05A 1TCVA 1W5SA 2D4HA 2IUYA 3OAAA 4FZJA 3W2GA 4DUPA 4Q7QA 2Q41A 1E6UA 4W5OA 4Z3OA 2H59A 2F67A 5KS2A 2JGJA 3IB3A 3NVAA 1SUIA 4ZQCB 3K0EA 3FETA 3KEOA 3CVXA 1YR6A 3QWIA 1GRCA 1E4VA 4IS3A 3DTNA 3HP1A 1JWLA 4DJ5X 1K97A 2LIPA 4Q03A 3AJ9A 1A88A 4RSRA 3LRTA 5EJIA 4FNGA 4HLQB 4LYDA 1SGWA 2PX4A 3T3OA 3ON5A 5AIBA 4HBGA 5DBHX 3LQRA 3L7OA 4A0HA 2VHTA 3EYAA 1R9MA 4N8SA 3UJ8A 1WP9A 3L05A 5EP4A 4XVQA 5BSWA 4QYXA 1AHPA 5B58C 2WUFA 3V46A 5CLJA 5IM4F 3NT4A 1JRLA 2QOEA 4FHCA 1GGEA 1QBGA 2A9PA 1YB1A 3IRVA 5C80A 4Q6BA 3ZVMA 4NOLA 5DMHA 3UHFA 1PT5A 2P6OA 2ZFUA 4TLEA 4Q4DA 1VJRA 2HRBA 1OQAA 5C8DA 2XBMA 3WQBA 4OYHA 1V7PC 3EVDA 4W1RA 4YS6A 1NMQA 3GVPA 2P2YA 3ZV6A 2NM0A 5JY1A 2XB6A 1KKLA 1WF3A 1L5KA 5KYWB 1ULBA 4JB3A 2ONZA 3KS9A 4ZZ2A 2OA0A 1CDOA 4G0MA 4S1WA 4QFMA 1IB6A 1UT6A 2O4CA 4D3DA 4ID9A 4H4DA 4RGVA 3RVQA 5C8YB 3UJ7A 1O9GA 5HM8A 1UPUA 2O7SA 2DQ4A 3GLUA 2YYYA 2ZRLA 1UBOS 3B3FA 1KDTA 3BGIA 3GGJA 2JJ2A 4KXVA 1QBKC 3BILA 4EARA 3ASYA 4LSWA 2DPGA 2A0YA 3NDIA 4J03A 2P2ZA 4BZXA 1KOGA 2DG2A 2XD4A 5B7PA 4HDCA 3L02A 1W94A 5BUQA 4RLSA 1AKWA 3TINA 1Z63A 4G8CA 5EXSA 3OA2A 4FT2A 1H85A 3DDWA 1GPAA 3WOHA 4GI5A 1K6MA 2ENWA 3BIXA 2NT3A 3I9FA 1SN7A 4MR8A 4MVXA 1U6KA 3N53A 1XDUA 1DI0A 5FTJA 1GKLA 4QAJA 4ZO4A 1Q6YA 5IW8A 3IAUA 2XTMA 4IDDA 1GU7A 5FUYA 2OCDA 1FFYA 2F3RA 1BDMA 4A0SA 3OTOB 2OD7A 4EDFA 1MKYA 3F2IA 2RJNA 4W5NA 2IXGA 2D6FA 3QG1A 4UMEA 3MVEA 2DLCX 2PDAA 2Y1EA 3OZSA 5TPZD 1RJDA 3PGJA 3KBOA 1YZFA 3LFTA 1USUA 1VOTA 5GPBA 4C5AA 4Y9SA 1IHDA 3WK9A 2EFGA 4AG3A 1JLRA 3FHCB 3P0HA 1TTQB 4IUDS 3VSCA 5EIAA 4RTJA 4ZCLA 2ZUUA 4B5LA 1UOPA 2Q7XA 3IURA 4FHFA 1P4AA 5F9FA 5CJPA 1HYHA 1M6YA 2JAHA 2R85A 1LEHA 2YN0A 2DJIA 4G37A 2ZRPA 3CY6A 1UZLA 3QVGA 1JJVA 1U7OA 5FBKA 2IK8A 3MQFA 3G8CA 1CQXA 4MVJM 4OXQA 2JFGA 4RMIA 4BHTA 1UMDB 1RLMA 3MUEA 1SBTA 1COZA 3FOCA 2ZWOA 3FWZA 1TRKA 1ONOA 1P8AA 1VLJA 4GT1A 3DS8A 3A26A 4MKRA 4PWZA 1N5DA 5E1DA 1ZI9A 1TFUA 1TJ4A 1X3SA 1W4RA 1C1DA 3BMNB 2OO3A 4OI0A 4D74A 4IJMA 4X7PA 1GPH1 4B3CA 3RUHA 3O74A 3H4MA 1AJEA 4IRMA 1MMFB 3ZCXA 4C3ZA 4ITVA 4FDUA 4TXHA 1J6UA 2SCUA 3QXJA 4FCWA 1TMYA 2A0XA 3ZI0A 1EFCA 4BLPA 2I62A 3SNKA 4DSTA 1GZHB 1Z56C 1VJCA 4HP8A 4LOKA 4H1HA 5TMBA 2CYCA 5CXSA 5CD1A 2NZJA 2Q21A 2PZGA 3DMYA 3AO0B 4YCAA 5FI0B 2IBTA 4FT4A 3ZWXA 4QSHA 2MCFA 4CZ2A 1QV6A 2H2HA 4CV3A 2XTZA 5K0TA 3VYVA 4Z2AA 1CJBA 1NQVA 1DUVG 2CFSA 1RBQA 5FFNA 1DC7A 1LPOA 1M0WA 1OSNA 2HSDA 3OP1A 4MVJI 4OEHA 2H51A 1JMKC 4PCAA 4R9VA 1XRRA 3CF6R 3FGZA 2F3TA 4UKDA 1G6HA 2VSQA 4Q3KA 4ECEA 3PNOA 3W3AA 4FMCB 4ARUA 2QD4A 5K4GA 1O8BA 3LYUA 5FH9A 1BDJA 1AN0A 2ZANA 2LTAA 1R4ZA 221PA 4AJNA 1T5SA 3TIXB 5DBIA 2AJLI 4YV2A 2BE7A 2OQIA 5AI8A 5MN5A 3FB4A 3GC6A 3QWHA 2A59A 1ZQ9A 3CEJA 5EIFA 1J0CA 3S1AB 1QAOA 1XCMA 1FRZA 3W7AA 1GNLA 4QJ3A 2VAXA 4ZOAA 1H4QA 3JY6A 4JVOA 5C8YA 4ETIA 2VSXA 2JJ2D 4WEOA 3UOGA 5K8JB 1IEQA 3TG2A 1U7TA 3OLQA 4DNQA 1ZK1A 4JIGA 5K51A 2YVUA 1UM9B 3QE2A 3L0ZA 1XQWA 4OGFA 4PO9A 2Y2VA 4CKZA 4A4DA 3ORQA 1DXQA 1JEAA 1U31A 2HBZA 3BMCA 4WT7A 4FFMA 2NTYC 5B55A 1JVSA 2ZU6A 1E0AA 4KDFA 3OOHA 4LGVA 3ZH9B 3WRYA 1U4OA 4KWCA 2VN8A 3IEMA 4DPMA 4KI0A 5JNSA 3N7UA 1A7UA 1M2WA 4CRWB 1GM5A 1JXAA 4EHIA 1GZDA 4IW3B 2YJ3A 1J22A 1X42A 3AHIA 1I3MA 3DMNA 3F97A 1UXIA 3GG2A 3IAXA 1QCCA 3QLTA 4O2AB 1JHVA 4Y9RA 1G66A 4E51A 4NICA 1Z5VA 4B74A 1PTKA 1T36A 1V6SA 5FEMA 3V4RA 2JD0A 2IYEA 3B6EA 3OJXA 4FMDB 4HGNA 3YASA 4BQEA 5LZ9A 3R5JA 4F4DA 3JARB 5TQ0B 4PNPA 1ZN2A 1SCNE 2OZKA 1LLCA 1LV8A 2KBFA 5BYAA 3DD5A 1F48A 2LPMA 4HYTA 3TL6A 2FXIA 1PYOA 2VDWB 1YWGO 4PXYA 4MKGA 4RD1A 2UV8A 5JROA 2QWXA 4WZ6A 5AYVA 4KFUA 1GG9A 2GBLC 1U4SA 3IMGA 3FTFA 1PQ4A 1LF5A 4L0MA 5J4YA 1NVFA 1HFWA 3QW4B 3AFIA 2NU8A 1Z2NX 4XVUA 4GWGA 2AUTA 4NG4A 4O4IF 3SC2B 4OX9Y 1NHGA 1YD7A 2PV7A 4NCXA 2W5UA 3NMUF 2PGIA 2XWSA 3FNFA 3KU1A 1NGSA 2GESA 3Q2IA 3S2GA 1ZOLA 4BX8A 3C5EA 5LBUA 1WZUA 4E09A 1QIFA 1K86A 1XCGB 1B0ZA 3BFJA 3P27A 2QTFA 2QRGA 4Q3LA 2XSZA 3MT9A 1YOVB 2AG5A 4HEA6 4R68A 3UZUA 5C5EA 2UXBB 1XL0A 4FD3A 2ODTX 3CO5A 4N3BA 3C3MA 4M1WA 3I2GA 4ALKA 1JJBA 1I5RA 4BFSA 4XUCA 4CMKA 1L1RA 5LQMA 3M0EA 4MGKR 1P44A 2C8LA 4UAJA 1R9GA 4FGKA 2DETA 3W5HA 4D98A 4LPKA 1S2DA 3TFOA 4FW8A 3UXEA 5D84A 5TVGA 3W2EA 4CMAA 1EQAA 3G2MA 4KQWA 1EMDA 4GHWA 4KO4S 2BGLA 4YDSA 4JEUA 4ZXPA 5BQOA 2CXOA 2EFJA 2VHYA 2NYAA 1CUGA 2YWJA 3AF0A 2HEGA 1SKBA 4FDTA 1ZM4A 3PBKA 2B25A 3PNLA 5DOVA 3GEDA 4H60A 1USWA 1A2KC 1SFRA 1YQWA 1YUBA 2RHOA 5AKKA 3VZCA 2BI4A 2O3JA 1EGVB 2ZQYA 3PEUA 4RJIA 3R0XA 3M4XA 5FR2A 2HPAA 1PL6A 1WTCA 3C1AA 1I10A 3K0HA 4BGEA 4ER6A 4WVLA 3U37A 4X8LA 2G06A 3F90A 3V8RA 4C14A 3M6WA 1RQXA 3G0DA 5JVDB 3WQSB 4BX9A 1EP2B 3I05A 3W3AD 5K8VA 1F5NA 3L1VA 4GR5A 1SOUA 2I8AA 2IFTA 2RKOA 2BY4A 2Z1MA 4O2BB 5FTKA 5KYVA 2I65A 3LBIA 5IC5A 4C7XA 2HMYB 2R2AA 5AESA 2DZDA 4PNZA 1U2QA 1WZNA 4MWSA 3IPCA 2IYLD 4YONB 3KQUA 1G38A 1GAXA 5JS2A 1BS9A 3D8TA 3HY4A 3JD3A 4IJ6A 2HMUA 2VS1A 1I9GA 3UMVA 4R0VA 1EXVA 2ZRHA 5G0TA 4ROSA 1I7LA 3TQRA 3Q3GE 1KQ3A 2C2OA 2YBEA 3QFFA 4H6VA 4KBYA 4OVKA 2JI6A 1ZD9A 2DSNA 2PIDA 2C54A 4FGJA 4HATA 1GUDA 1QOPB 1RQNA 2A78A 1DIAA 1NZJA 5EPEA 3IHLA 1AA9A 1G21B 4JUIA 4N9QA 4I2VA 3HFGA 4LDAA 5K0BA 5IRCD 5CBPB 3MLEA 1Y9ZA 2JGMA 3O8DA 4OIMA 3PK0A 3FGPA 5BR1A 2QG9A 4XGQA 1OXUA 1DRJA 2NSYA 1DJLA 3FPCA 5MFPA 5IDXA 4QJ5A 1N3BA 4N3GA 4UARA 4XD7A 1B16A 4WSOA 1GVHA 1CSEE 1KDYA 3IXLA 4PC2A 4NXNB 3SKVA 5BW5A 1ZK3A 3ENNA 2RKWA 1BFUA 2FJPA 2J3QA 2WJJA 3OQPA 4O2AA 4P93A 5J47A 2RI1A 3HJAA 2EBUA 3C1OA 1JALA 3HGTA 5IVHA 4MW0A 1WP4A 4J0FA 4B3TB 4CI9A 3ILSA 1V41E 3ZY3A 1JBQA 2EL7A 4CTKA 3GJTA 1XDGA 2BFDA 2I2FA 2CNKA 3JARA 3G0OA 1EK1A 5SY6A 4D5EA 4IO1A 4B5KA 2IP2A 2O06A 3DE3X 3QOWA 4JB8A 5EWJA 1NHWA 5HJ2A 5JAQA 3SSOA 3DVAA 3TBHA 3UTCA 1JWBB 4KC0A 3KQTA 4DMRA 5DNYB 4AJPA 2G36A 1BFKA 2VDWA 3QWFA 5IS2A 4JJ8A 5A4AA 1UDXA 4OXNA 1RVDA 4RESA 5BQ3A 5DM60 2ZEJA 5K8CA 3K31A 5K6RA 3FOBA 4B83A 3WWPA 3T7DA 2AG6A 3LQFA 1H2XA 1ISSA 1RABA 5K3SA 1N0VC 1QYXA 3AGPA 4UTVA 1YZNA 4YRQA 2P9QA 5TF0A 2IEZA 3ZIUA 2DVMA 2XSZD 4NOJA 5MGNA 3ITNA 2J0VA 4HNHA 2JW5A 2AI3A 4BRSA 3UW1A 1ADGA 2ZBRA 3KP1A 1VRWA 4DUGA 1R2QA 1S4QA 4BC0A 1SCAA 3SJBA 2OHVA 2QTVB 4O29A 4FX5A 4ZO9A 4UNIA 1NPYA 2EDAA 4UHHA 5D2CA 4O5AA 1NBME 4G4SP 3B9BA 4M0MA 1T6NA 2PZMA 5EG5A 4JI8B 1XMVA 3EVZA 3C6MA 1C3OB 4QBGB 5FBQB 4D80A 3AP2A 5IBCA 4TQ9A 3FFXA 4R8SA 3OA0A 5EUBA 1V7QA 3AL3A 4MKFA 3PQ7A 3DB2A 4K05A 1U0HC 2PJZA 1LDEA 4I14A 1JDTA 2X13A 4L76A 1UJ2A 2W93A 1Z5ZA 1HT2E 2X42A 1YRBA 3G5LA 3H7AA 4KVZA 5DXAA 3ZK8A 3AKDA 1I4EB 1Z83A 2IHVA 3B1JA 3E9EA 3HVIA 2ODBA 2I3ZA 4WNIA 3FE2A 2P3SA 3I8OA 3BAZA 5JSZA 5BPHA 5CCBA 1CPYA 4FBMA 1ZLXA 4LE2A 5M34A 2XYPA 2PYZA 3SBDA 5JSUA 5FUVA 3K0AA 2Y1FA 2I6TA 2CHEA 4KGZA 1PD1A 3H9CA 3SVTA 1L6RA 2YOHA 3EJWA 2QX9A 1CJUC 2PZEA 4I46A 3FDZA 2PWYA 5DK6A 4FIZA 4EFDA 4LZOA 5EFZA 1QYIA 3SS7X 1R0BA 3ONDA 3VMFA 4EQZA 4J2HA 2JCVA 3L41A 1PFQA 1X7ZB 2FX3A 3G5AA 4OLFA 4O63O 1OGJA 4WLUA 1JPUA 2QXTA 3IODA 2CE7A 1HKUA 1MR3F 1E2PA 2JBAA 1G59A 1QG4A 1AVTA 2F17A 3QG5A 3D64A 1FDIA 3R3JA 2FMFA 4ZDIA 2X9VA 1LLDA 4HDKA 5JYDA 1WQ3A 2P6UA 5BNZA 3LA6A 3U60B 2DPXA 4A10A 4FQ8A 3N28A 2WILA 4G9GA 2WD7A 1L4EA 5CLQA 4I9UA 4TMWA 2CV0A 2BH2A 1F8XA 1OBFO 4BRUA 3UK0A 2WJWA 1RKUA 3B51X 2Y1GA 1GA6A 2FPLA 4XFDA 2B0CA 2BH9A 2HWKA 1Y7LA 3IE0A 4I1SA 4XD7D 5DH9A 3QVJA 1ECBA 2XWQA 2X2FA 5JXGA 2GZRA 2JHPA 2BFBB 1SWWA 3UK2A 4H0NA 1NNI1 4NU8X 3LMKA 2HREA 2IP1A 4A27A 4LMRA 1Y89A 3OCWA 1SCDA 2GVZC 3H05A 3C6ZA 4IIUA 4KR0A 3V7YA 2WYIA 3GUZA 1FSGA 1QGUA 1MO4A 1BH6A 2AMLA 1BXKA 4YP6A 3RC3A 4JMPA 4LY0A 3S55A 1W85A 2BE9A 3NDRA 4RABA 1ZM3A 3MPUA 1TKBA 1H1LB 1NV9A 4DC0A 3H6GA 5DU2A 5I7EA 2HXSA 3F6RA 4F8JA 1NMSA 1KJIA 4WOPA 5LD2B 4BMNA 3CKLA 2QLTA 4EG4A 4YJ2A 1IVSA 3WRWA 2ATVA 2PXCA 1FFHA 1CTQA 4KL8S 4D45A 3HCBA 3UW3A 4QOFA 4WK2B 3ZE1B 2CGEA 4EG3A 5C9ZA 4KXWA 3X2FA 4YMVA 2SBTA 4JL5A 1TGVA 1TKCA 1XAJA 4RO0A 1W9MA 2P6MA 4QE3A 3ITDA 4JT9A 2C4VA 2CE2X 3IEUA 1EDZA 5AI5A 1A8IA 4AWXA 2H4JA 7MDHA 4DUGD 3NM5A 4RORA 3VHQA 2PQMA 1QVZA 5IJAA 1X13A 2EZ9A 3H5IA 1Q5PA 4PHFA 2J45A 4BBJA 3DCYA 2EG9A 2OXFA 5LQNA 2P5YA 2NUBA 4JB2A 5HCNA 4DR1B 2IU3A 2QTVA 4TN1A 5BW6B 5U9CA 1LZKA 5CURA 2BKUA 4WACA 4MWOA 1H1TA 1YRAA 2SNIE 2PL5A 4JB0A 4M0PA 4RZXA 5FNZA 1J8FA 3B53X 3FYHA 5J4KA 3EYWA 3QTTA 1HYQA 4YCBA 9GPBA 2VXYA 3BXXA 1OT5A 4PIPA 5G4KA 1PL7A 2HLPA 1OA1A 3BE6A 2DPLA 4E2XA 6PFKA 3PL1A 5BV7A 5IAAA 3NKLA 2ZS9A 5AHOA 1SG0A 1FYDA 2F2TA 3KTFA 4TLBA 4YX9A 3DKKA 4IIBA 5A9RA 1W1UA 3ESQA 4I4NA 4IDQA 1JFSA 1ZUHA 5CVVA 3ZDEA 3M6XA 5ILOA 2IEBA 2IYXA 1DP4A 1Z9BA 4ZOLB 4WCDA 2D2IA 1LK5A 2VDKB 3DXZA 3LV8A 3QUCA 1IY1A 3R6TA 5HHTA 3ROEA 1E9EA 3BD8A 3LQ2A 4ZOCA 5GZ1A 3C3EA 5BYJA 1QFMA 2HSGA 4KV9A 5E9AA 2Y93A 1J42A 1LTKA 4QDJA 3V4SA 2X2EA 4XDYA 4F92B 4MVWA 4NJEB 3VYTB 2Z6AA 5K99A 1EUYA 3MGAA 3O90A 1V9SA 1EWTA 3QPUA 3I2KA 1QGED 2H1HA 4N12A 4U2BA 4W5JA 3IVAA 2WT8A 1QWSA 1X7ZA 4MW5A 3TQFA 4M53A 2Z5GA 1XRQA 3VI3B 3THSA 4HQRA 3WYNA 1HBJA 1KXJA 1JDZA 2WWXA 3MJEA 1TEXA 4OFBA 3RU7A 5CEJA 2YJZA 1I7QB 1A96A 2Y71A 3DAOA 1KNXA 2QD2A 2OLKA 2H5JA 1BA2A 5ED4A 1ILEA 4YVFA 2F4NA 2XCRB 1S2MA 2E2WA 2ZJ2A 4NDZA 1A8HA 4YRCA 4ZRNA 4H3VA 4YCNA 5CLIA 5BOSA 3UPUA 3MYYA 4OFXA 1HNNA 1N77A 4Z6KA 2IH2A 3KTDA 3UBMA 4YI5A 1Z0SA 3K5IA 2A0WA 2WSBA 3A6JA 1PNTA 3W1EA 4DZTA 3IIIA 3KBBA 3TZHA 1OILA 1RC8A 3GJYA 4KWTA 1AF7A 5C7YA 3CRMA 3ER8A 3BMXA 3SWWA 1HLFA 4BWGA 3HV0A 1OWLA 3R6WA 5JT1A 4OQ4A 3ZNQA 1JTVA 1X1DA 1JB1A 2Y0DA 1MB3A 1JVNA 1T8RA 1NP7A 4LV6A 4XWYA 1K8XB 2WIBA 4WD3A 5CA0B 4AS1A 4RJ2A 1SA0B 2GB4A 3OTWA 1MAWA 3MHPA 1M54A 3ZUPA 1VYVA 5GQSA 2Q0XA 2VAMA 3TQOA 1Z4OA 3D6AA 1IOLA 3JYHA 4Q00A 3A9VA 2NSDA 4PZDA 1OXMA 3RYTC 5BQ5A 3QXSA 3WQHA 3QK7A 4EUNA 4PHCA 4UUAA 3WHKA 2EP8A 2AG1A 2QMYA 2X86A 3H8VA 4R1SA 3BE4A 5JISA 4BJ6A 4XRGA 1F3OA 2D7DA 5I9TA 4B7XA 1CUEA 1VG8A 4Y1RA 3OP4A 4AYXA 4D6PA 3GRYA 2ZW9A 2JGLA 2QRVB 2ZBGA 4FK8A 5BWMA 3STXA 4M55A 5IJ0A 4OI4A 2ZDQA 4KAAA 2XQJA 3PDIB 1F0YA 1FP1D 1TK3A 1UC8A 1UBFA 2WAAA 3LRPA 4RY0A 4XOUA 4GMGA 2UYCA 2WV9A 1JJ7A 2C2MA 4LF7B 4XQGA 3L6BA 5EKDA 3WE7A 2HMSA 1THTA 2ZRIA 2YZMA 1MX5A 4L6CA 3CR8A 3HUTA 2OM6A 3PVCA 1MTZA 1HI9A 5CYPA 4WESA 2AFIA 5KAMA 2IXTA 4W6QA 4ARIA 4G5QA 3MJHA 4B7UA 1J07A 2F3UA 1AXRA 3LW7A 4KIFA 2QG6A 3MFDA 4AIIA 4R0NA 4BAUA 2NPIA 4CU5A 5KJ1A 1N2GA 1QGZA 2HRQA 1C7JA 2VZLA 2W83A 4M8KA 4IAOA 4NLLA 3TW0A 3DM5A 4QQFA 1NLZA 3AZOA 3OQJA 5KJCA 5F9HA 2A30A 5DTEA 1NUQA 5FWDA 3TM4A 1RI2A 3NNSA 4Y2QA 5KCMA 3ZFNA 4MKXA 1J8YF 2GSDA 4R1MA 4ZOLA 1T13A 3VZPA 4KBFA 3QQPA 2JRCA 4BJHB 1USIA 2BM9A 4O1HA 5BMVB 1FEZA 3GEBA 3Q98A 4PYIA 4O8ZA 4DM3A 4RTLA 3P9YA 1I14A 5LUAA 1KMQA 5ADUS 5AO9A 3BWCA 2R2GA 4DIMA 1MRSA 2WJAA 4WOKA 1J4AA 3UJAA 3DLHA 2LNDA 4O1MA 4U6QA 4E5SA 5AM1A 1YZTA 1QVAA 2OZLB 4JYPA 3KTOA 1C80A 2PJUA 3I30X 4TRJA 4BMXA 2RC5A 4H3SA 5EHZA 4HDRB 1JG7A 2EQAA 2XMSA 4QYMA 2MSKA 4Y1GA 2CDBA 4WLFA 1Y3FE 5D7NA 1IOVA 3HDQA 2QL6A 1VPWA 3DFZA 3G79A 4RDXA 3GNTA 3PXEA 8OHMA 4RK6A 3AI2A 3WKBA 1G5FA 1JWAB 5TB5A 1XX6A 1A82A 3S2YA 2ZSJA 3PC6A 1V35A 4LJ8A 4Y6LA 1CUFA 1CE8A 2CJPA 1BE0A 3D3WB 4U7WA 3K30A 3B1FA 1LQ2A 3RSQA 2AJCA 1ZBDA 5EJ7A 5L95A 4ZD6A 4TRMA 5AK4A 3TH5A 4WGGA 1FFSA 4YBRA 5CLLA 2PT5A 4BX2A 3LCVB 1J25A 1HXHA 1IBCA 3RRJA 1I1OA 2DKNA 3NGMA 1MVLA 3P52A 3OKAA 5AP9A 1OI4A 1FUEA 3SX2A 3UMCA 4IGIA 1Y6GA 4K9KA 4ARBA 4BGDA 5MN6A 3BE5A 1LCIA 1YHYA 2PVCA 4ZOEA 5BVHA 4FE4A 2VT6A 4V0KA 4RTMA 1HTBA 3D02A 4LQDA 4IV8A 4LZWA 5JPIA 4F5WA 4XDGA 1T9GS 1SA0A 1W6RA 4F9EA 3D3QA 1ESDA 4F2WA 2W2QA 3ZHVA 3QOFA 1F5SA 2H2IA 5JQGB 4RF2A 1GZUA 4TVSA 1YE5A 2COKA 3A9SA 4CLEA 4D44A 4EPXA 3A32A 3EXHB 4DZZA 2JASA 5DMXA 4B17A 4DUZB 3B3QA 5EZQA 5LP6C 2AJBA 1E59A 3HGQA 3ZUGA 4CV2A 3SZGA 3ILXA 1E9VA 3NGLA 2Q4EA 2VQFB 2JGFA 4I9FA 4DYVA 1L7PA 3CG4A 3T3MB 3PYLA 3LVFO 3EAGA 1W4AA 4WKPA 1RE0A 3JU3A 4U2GA 3PKJA 2ZSBA 2V5AA 3PDCA 3B7WA 5DCUA 1GA4A 3GLRA 5JMOA 1T8UA 4RPKA 3ESYA 2I2AA 3U0BA 1XPRA 1V3QE 4JXXA 1J9GA 1QK4A 5KVSA 1HQCA 2WSLA 3EVAA 4JQZA 1G8SA 4MWDA 5AW4A 1HKHA 5HM6A 1O96B 5IX8A 1C9MA 3FZQA 2GZAA 4UM9D 1BOOA 2LBPA 1Y98A 3MWLA 4MGHA 2Z2JA 1OROA 3H2YA 3QTLA 2NT4A 1M5UA 3CMCO 3EX7C 1XMPA 3SZRA 1QCDA 2Q9UA 2ZR9A 1GARA 4NMLA 2Q1SA 1UKEA 1E3LA 1VHJA 3P2KA 2QVBA 4OK6A 2Z9BA 2NUTA 4ZFNA 4URYR 1QUEA 1H22A 4RCZA 1CNFA 1EM8B 1HE1C 2B7LA 5LLSA 4BNIA 1HPLA 2QLJA 1NNSA 3KFVA 2HJ9A 4MS3A 4QHTA 1YQQA 3S4YA 5LN1A 1FTWA 3GG9A 5BRJA 2GILA 3DE1X 3FUWA 3OTIA 4L8LA 1IZYA 3R44A 3S5JA 4FHDA 1KYIA 1WM1A 2OV1A 4JGBA 1IG3A 5B53A 3AM5A 2X1MA 1YDGA 2DWOA 4MQFB 1HDRA 4TQUS 2QYTA 4Z99A 1SUDA 4IJUA 5GV8A 3H2HA 2IH5A 4BNWA 3L9WA 2UXDB 3CNOA 3H3JA 1MAUA 1CZUA 2G71A 4I9GA 3L1UA 3WV5A 1PUIA 2QJOA 3RHFA 1DTWA 3IQWA 4QELA 1LTHR 1C1YA 5FL7A 3KQNA 4AMUA 4GYYA 2C96A 1ZH6A 2DOKA 2IYZA 3HI6A 1Y4SA 3MM4A 4ZAGA 4V1CA 3PFGA 1SUCA 2AX4A 3CU5A 4EL0A 4YYEA 3TLEA 3G68A 5EERA 4JYAB 3KR1A 1IXYA 1XROA 1YR1A 2H6EA 2JHCA 4AJ2A 4YAUA 1JZQA 1KZ9A 1QLWA 1IFXA 3J81k 1HURA 4KBGA 4HG2A 4CM7A 5JWRA 5E4TA 1ENPA 1EE2A 4EY3A 4TKVA 3I5XA 2LR0A 2JATA 4C04A 2LUOA 3JRWA 4LYHA 2PT9A 1XTPA 2C2KA 3PDWA 4XI9A 3K6KA 1VA5A 2QRJA 1K08A 4P8RA 4DDHA 1SVUA 4NMWA 5FIUA 1K75A 1UBGA 5JJ5A 4DIUA 4JXKA 3E18A 1PJ3A 1RAEA 1LK7A 1T1EA 1DU4A 2L2QA 2YS6A 1EE9A 1CUSA 4Q7EA 4AD8A 3BH6A 4EFMA 5EJFA 3CVWA 1FMCA 3M1LA 4PPGA 5DO9A 1S7GA 1MJ5A 3JX9A 1UBSB 1ZCBA 3MAJA 4RZQA 1EUDA 3CPEA 3KU4A 5J4HA 3OZFA 5C34B 3OTQA 3TSZA 1BFDA 1DARA 4GBMA 1MQAA 4ZAFA 3RAGA 4INPA 3UTDA 4V02A 1JFRA 1ID1A 1GZ4A 3BK1A 4FEAA 1W47A 4BO1A 4G24A 1PNRA 4FDMA 4LECA 1NG1A 4MVCA 3RFXA 4CQLB 1VB3A 3O2JA 3OZBA 4PQEA 3KXDA 2GUWA 2IS4A 1S9HA 3G7SA 5JDCA 2YZNA 4CF5A 2RGGA 3QU2A 4WIAA 3WWEA 5KTMA 3AYXB 3K53A 2ODWA 3M9XA 1DX4A 1XWWA 3STVA 3TDMA 3TNYA 4DLUA 3EMBA 1JLSA 1TO2E 4P35A 5JARA 2FPGA 4OQEA 3OY7A 4A6XA 4ZT3A 1I3NA 4HLUC 5D5HA 1XAGA 1Y37A 2FKAA 4EG1A 3DWFA 5AQEA 3X1JA 4DQDA 1RRGA 4H7HA 4UBKA 2AUMA 2BLLA 1KY5A 2VUUA 3VR6A 5CJ2A 2XCOA 3F9IA 1H2BA 1AZLA 4DCCA 5IJZA 1O95A 1AA6A 2P6RA 1WTAA 1WMAA 1Q15A 4TS4A 3QEMB 1U7DA 4G2NA 3FY4A 4WZBA 1KSJA 3AIMA 2XRFA 3KR9A 3R76A 4XDHA 3VTKA 1VHLA 2ST1A 3H2KA 4DXDA 4EG0A 4ED9A 1OV6A 5I3CA 4WEQA 4AKIA 121PA 1BW9B 4LYEA 1MC5A 3EGDB 3WRVA 4JLAA 1BTOA 1N6NA 1XLUA 2Z95A 4JEHA 4RADA 5IZ4A 3PCRB 1EFTA 1WMBA 2AZTA 1N0IA 3AR7A 1NVGA 4AL4A 2RGNC 4UUNA 2X9GA 3KRTA 4GI3A 3BRQA 3TUZC 3GMDA 2CHFA 4MMZB 4QBHA 1YVEI 1Y63A 2AI1A 4WK4B 4UQPA 4BNTA 2AFIE 3EDOA 1CIJA 3V4FA 2QW8A 3N74A 2FPXA 4E21A 1ISHA 4N49A 2RC6A 3Q9NA 4FQ7A 1KE2A 3SF8A 4YQZA 1JEJA 2IDMA 2P6PA 2GXSA 3F5DA 4JLVA 4Q5IA 2VBGA 3MWDB 3X1XA 3C6QA 2ZU0C 4YI3A 2CZCA 1QCZA 4WH0A 3DMGA 1ZU4A 4YWJA 1MV5A 5C8XA 5EUCA 2JA2A 4FMDF 4DR5B 4XWGA 2GETA 1KP2A 4NCHA 1JDJA 5FL7D 1CJMA 3PJDA 1H4TA 3LUCA 2M1ZA 3H87A 1SVMA 2VH1A 4EUKA 2YJGA 2Z08A 3PKIA 4YEDA 1JTFA 2SHKA 3ZS9A 1Z2AA 4YP9A 2YW9A 3ZQKA 4B9EA 4BZQA 1ZO8A 2P2DA 3QY0A 5A9TA 1NYTA 1W25A 5H70A 2KE5A 4FFVA 1ZINA 2VUTA 3HA7A 4GWLA 2BM8A 4KVAA 2FK7A 1N6IA 4FOSA 4MA0A 4WJLA 2GYUA 5ITVA 2MSDB 5CXXA 1TMGE 4MX8A 4YCMA 2GJKA 4X97A 1PFYA 3ODPA 4OHKA 1EJ0A 5J4VA 1RC1A 4QO8A 3P0IA 2WMDA 4YO8A 4LC1A 1XI2A 2FOIA 1J0EA 5IEJA 1B8NA 1HDOA 4CDGA 2EFHB 1IMOA 2I22A 1T5TA 1GNSA 2WWHA 2FRXA 1NMXA 1GAEO 1SPXA 2DLDA 4LNUA 5H3HA 4D9KA 3U3XA 4X5OA 2GH1A 3N0WA