3MCVA

Structure of ptr1 from trypanosoma brucei in ternary complex with 2,4-diamino-5-[2-(2,5-dimethoxyphenyl)ethyl]thieno[2,3-d]-pyrimidine and nadp+
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title High-resolution structures of Trypanosoma brucei pteridine reductase ligand complexes inform on the placement of new molecular entities in the active site of a potential drug target.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 93
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3mcvA00
1Q7GA 4DVJA 1UP4A 3PP8A 4IDEA 4A2CA 4DQXA 4YT5A 2ZIZA 2EKPA 1DLJA 1NNUA 3RSHA 2J3HA 4JGBA 2X8LA 4OXYA 4XA8A 2AA3A 3VAZA 3WLFA 4EI2A 5IG2A 1Z74A 3AFNA 3FD8A 1YKFA 2HCTA 5T6BA 4F6LA 3VC7A 4GAEA 3UKOA 2C54A 2X9NA 3GZNA 3NEPX 2O48X 1SB8A 3VKUA 4R69A 1F14A 4GQAA 1FDTA 1E7MA 2DFDA 1YL6A 2YV3A 4E4YA 3P7MA 2V6FA 5KJFA 2AEMA 3KOUA 4O5OA 4BNGA 1MLDA 4DC0A 5THQA 2G82A 2ZTLA 4PZDA 3UVEA 1EUZA 3JQ8B 1YVEI 2P9CA 1Z45A 4IQ0A 4O63O 5TQVA 4U5QA 1GTMA 2WE8A 4PLTA 1DDOA 1ISIA 2O2YA 2GF2A 2Z1NA 4PLPA 2DVMA 3H5NA 2OMEA 3MJEA 4BKPA 1E7WA 1ZNQO 3OIFA 2D8AA 2WD7B 3RVDA 3JQAB 4NFYA 1F06A 4I9UA 4S1VA 1KIFA 1R66A 4RV9A 3F5SA 2DPGA 4LMRA 3E8XA 4M49A 4CM9A 1E7QA 6ADHA 3D1LA 5GZ1A 1EDOA 1E6WA 3GR6A 1EK6A 5A9RA 4QECA 3WYBA 4YBZA 1N1GA 5KCZA 4TRMA 3EYWA 4PIVA 2I76A 4R54A 1J0XO 3IQDB 1U1IA 4MKZA 1GEEA 5DNAA 1HZZA 3WQRA 2B36A 1BSVA 4B4VA 2V6BA 3UOGA 1VRWA 1XG5A 4UEJA 2P91A 4KDEA 4NJOA 2NV6A 1VL8A 1JU9A 4M86A 4M89A 3UW3A 1E3IA 1YXMA 3U4CA 3UHAA 2Z95A 1ULUA 2JFFA 4FFLA 5KVQA 1P1IA 4UEOA 2AEJA 4BNNA 3GPIA 1NFFA 3I3OA 4PRKA 3TN7A 4B7UA 3FTNA 2JCXA 2IYPA 2Q1UA 3FBGA 3LQFA 2EKLA 3FR7A 3OHSX 4JLWA 4O0LA 1CQJA 4ALKA 4LVCA 1PR3A 2YDYA 4RO0A 4TWRA 4AJKA 4CQMB 4ZICA 4C7JA 4W99A 1RPNA 4E33A 3QJ5A 3LT4A 2BF7A 4M1QA 4N54A 3PFWO 5DCUA 1MV8A 4PLZA 2CZCA 3HN7A 5GZ6A 2ZYAA 4E3ZA 4KZPA 1NPDA 2LDBA 4MVJD 1GV0A 1L7DA 1Y8RA 3ICCA 1NP3A 2JFHA 4P8RA 1V3TA 2PKRA 3I9OA 7ADHA 3T7EA 3QWHA 1EUDA 3ZU4A 1U5CA 3PGXA 4GI2A 2H6EA 2AE1A 3H2ZA 3IUPA 4OKNA 4EUEA 5KIAA 2WE7A 5G4KB 1K5HA 4BKOA 2D5AA 1YONA 3QQPA 3DMYA 3I9KA 3WICA 2GNAA 2P68A 5CPBA 1SO8A 5IZCC 1EK5A 4L8VA 1HF3A 4BOYA 1NR7A 2ZTVA 4I9HA 2ILTA 3ULKA 3HN2A 1YQXA 4XB2A 3GVXA 1NAIA 4A7PA 3MOIA 4UREA 5G0TA 4AJ4A 3IS3A 2QX7A 4HY3A 1GD1O 1P0CA 3TFOA 1QYCA 2ZATA 1DFGA 1VJTA 2A4KA 2Q99A 1KEUA 1NBOA 1K0UA 1KC3A 1DIGA 4NIMA 4UVGA 3EZLA 1Z7EA 3NAQA 2EGHA 4E2ZA 4ND2A 4CV2A 1IPEA 3H9GA 3NGXA 1PL7A 4WUVA 3JQ8A 4E5NA 2PY6A 4JCOA 4J49A 3E9QA 2BFMA 3BA1A 4FC6A 1O0SA 1EFKA 4BO7A 5MGBA 2TMDA 4QFCA 2EWMA 2HJRA 4IXTA 4NBWA 1ISJA 3JQFA 4RZHA 5TJHA 4EEZA 4WCFB 4NU5A 4DUPA 9LDTA 2WD7A 3K9QO 3JQAA 4B4OA 4CM5A 3B6ZA 3ZU2A 4NMHA 1AN9A 1GR0A 2HU2A 4RVUA 2E4AA 2V7PA 3I9LA 1GQQA 4CL8A 3L4BC 4YJDA 4YAKA 3DTYA 2PD4A 2IZZA 2PH5A 3ZHYA 1K6XA 4PG6A 2ZCVA 5LCXA 2O7SA 3E1KA 1DEHA 3O03A 3R3SA 1LDGA 1H9BA 1LEHA 4XEHA 1GQ2A 1IHYA 1KEVA 2BFPA 4GH5A 4ESOA 1AXGA 3I9JA 1BDBA 3OJLA 5L4SA 4M54A 5COAA 1N7HA 3JQ9C 3P19A 2JAHA 4FD3A 1M2WA 5KJEA 4WOKA 4YRDA 4BNTA 4GSLA 2VYVA 3M1AA 1ZXBA 3K73O 4NPCA 1NVGA 1X7DA 3DBLB 5IN5A 3VHRA 1Q7CA 4AFNA 3HG7A 4WASA 2HRBA 3K2EA 5KTKA 3K96A 5HTOA 2AQIA 3I83A 3X2FA 3JD2A 4R9RA 4D41A 1ENOA 5EQDA 3TWOA 4RPJA 5TS3A 1N9GB 4W4TA 4L4RA 1B15A 1BXKA 3VOSA 3L07A 4CUZA 2W8ZA 2CSUA 1U3WA 2EW2A 1I3NA 3OICA 3WJAA 3ROMA 3RC1A 4CQMA 4R1NA 2CNBA 3E82A 1ZVMA 4CUKA 1JDJA 2ZTMA 2FRDA 4OXNA 5CEJA 2YQ5A 4TZKA 3FTPA 3JQGB 3NJ4A 3WYEA 3CEAA 1JAYA 3HDJA 4JP3A 4JROA 3U0BA 1RYEA 4MOWA 1DJQA 3JQDA 2EP5A 3RD5A 5CDYA 4TRRA 4CMEA 4NI5A 3RC7A 5CFZA 4NJMB 4IY1A 1YO6A 4UUNA 4HXYA 4INAA 3BTSA 5ER6A 1PGJA 2D2IA 2J3IA 5ER9A 4KTTE 2C7GA 4JJIA 5G4KA 2RAFA 1SZJG 1P77A 2JKVA 1O95A 4HKTA 4KP7A 4E13A 1TXGA 3DAFA 4BO6A 3ZWYA 1H2BA 3OF2A 4ZHSA 3MWEB 4KQXA 3DBHB 1ZJZA 1Y8QB 1Y7TA 3DQPA 1YDEA 2J6IA 3R1IA 4ALIA 3WDSA 4BHTA 5BQFA 5FWNA 4YCAA 3GEMA 4MP3A 4S3MA 3RUAA 1B8VA 4QX6A 1T2FA 3ZHBA 4GL4A 5C37A 5BSGA 4HUJA 3WLEA 1GUYA 3JQBA 2YFQA 3ST7A 4J9UE 3ZWNA 1OMOA 2GZ3A 3ZWVA 1HKUA 2BI7A 3KLPX 3VH3A 4A73A 4EBFA 1ZK0A 5AYVA 2O3UA 3WMWA 4UULA 1G1AA 3FN4A 5KOIA 3RBZA 1R15A 3WS7A 3MZ0A 2VNSA 1OFGA 2VN8A 1C1XB 1ZO8A 3GGGA 2POQX 4KOAA 3VH4A 5CG1A 4TVOA 1I01A 3TF5A 1KC1A 4QEDA 5L7TA 3WIDA 4HADA 4NH4A 4WCFA 2NTNA 1M75A 2A35A 2OO5A 2DLDA 2Y93A 3ONFA 3PDUA 3PQEA 3LC1O 5EPOA 4WPGA 1B8UA 3PEFA 2PA3A 3HSKA 4XGNA 2PD3A 3OP4A 1PZHA 1T2CA 3GA0A 2O3TA 5H81A 3LT0A 4N5LA 2XF8A 1YL5A 2HAEA 4Q3EA 1Y6JA 1X14A 3DHEA 3O4RA 4PLVA 2VRCD 4JBIA 5JAMA 4RLHA 3C7AA 3SLKA 1WXDA 1ISFA 1DC3A 3G3EA 3JSAA 1HYEA 4EEXA 4GLLA 1SCUA 3ASUA 1HDYA 2GUGA 4JP2A 5ES3A 3GMDA 3OQBA 4DXHA 3V5NA 4H16A 3IDSA 4B79A 3C85A 5L53A 3QP9A 4P4GA 2X23A 4NFSA 1OOEA 4OOFA 1HDGO 1GEGA 1GZ4A 4D3FA 4LSMA 4TKMA 5F1OA 4EJ6A 3JCZA 3DBLA 4Q3AA 4YT2A 1G0OA 1N8KA 3AM3A 4IDGA 4JJFA 3VH1A 5IDYA 5EN4A 2YUTA 4NFHA 3INTA 3AI1A 2UYYA 4GSKA 2GZ2A 3WXBA 5AXCA 4OJNA 4KUEA 3GVCA 4J7XA 4TVBA 1LJ8A 1DFIA 3OEWA 3H9QA 4YAGA 5H82A 1W4ZA 5AXAA 2A92A 3PHIA 3W6ZA 4GPD1 4B3IA 1T2AA 3C3XA 4KDFA 4BO0A 4NBVA 1PJCA 4J90A 4DMMA 3AI2A 1UP6A 3TL3A 3DFUA 3AI3A 1QR6A 1ONNA 4WEQA 3JQGA 3VZRA 3MJ4A 2Y67A 3GDGA 3QVSA 3CMCO 3NT2A 1P31A 1FK8A 1JA9A 4IJWA 1PS0A 3DO5A 3LC2O 4BO5A 1LDMA 4GX0A 1P0FA 2VRBA 1O89A 3VVCA 3CZRA 4NJMA 1JKJA 2HK7A 4CLDA 2E82A 3A06A 4CMGA 2VWGA 4L75A 4N7RA 4FJ1A 3Q2IA 5DT9A 4IZIA 3O9ZA 3FHLA 3IC5A 3EZYA 2WTBA 1A9YA 3DBVO 1WWKA 2X0IA 4KMSA 4H3VA 2NQTA 3W6UA 3D5TA 3HZZA 5T8KC 3EHEA 4JN6B 5JYDA 3DBHA 4RDIA 1Y8QA 1ZK2A 1CRWG 4RF5A 1NR1A 2QZZA 2HMWA 2AMFA 1ZK1A 3FNGA 2E6UX 1NAHA 2WM3A 1LBEA 3IUSA 4BGVA 2OFPA 4WK6A 1E3EA 3PK0A 4E2WA 2JL1A 1X7HA 4M87A 3OJEA 2Y1EA 4Q3BA 4EJMA 4WLVA 5I7FA 3U3XA 2ZTUA 1I10A 4FOSA 4RPLA 3WR5A 1SAYA 2AHRA 3DHYA 4PCVA 4R5MA 3ZNOA 1C1XA 3HNPA 1JW9B 2NU6A 3JYOA 3WG9A 4OIMA 5JPIA 4CM8B 4PLWA 2X22A 1U7TA 3ZNQA 1GYRA 2RH4A 3A4VA 3LLVA 3SX2A 3HE3A 5DOVA 4YA6A 2YV1A 2OORA 2NVBA 3EC7A 4MIOA 3RFXA 1GZ3A 3AUAA 1DHRA 3AOEC 5FI3A 3PGJA 2EJVA 3TDKA 2NU7A 3GUCA 2P5YA 2IRWA 4B3HA 3JYNA 1KVSA 3PHJA 2BI8A 3NDRA 5IZ4A 3ETDA 3JD1A 4FBGA 1U28A 3WOHA 1XU7A 4EYEA 3INRA 1AUPA 3PYMA 1QRRA 1ISMA 4Z9XA 3GAFA 1PJ4A 3OSUA 4B4UA 1GAEO 2DUUA 1ZK4A 3JQCA 2GPTA 4RF2A 2HDHA 3W4KA 5BNFA 3QY9A 2QYSA 5COQA 4DA9A 4RF4A 4M55A 4XGKA 3KYCB 3BIOA 4PG4A 5LDGA 4FQ8A 2CDCA 3QA9A 1KYQA 4D3SA 2I9PA 2E37A 3H9JA 1OAAA 2FN7A 1PX0A 2CFCA 3CINA 1R0SA 3DZJA 3D3WB 3QWBA 3RI3A 3FBTA 2Y66A 3C7DB 2FWMX 4XRRA 4J1QA 4XYBA 1HDCA 1PJSA 3D0OA 3NRCA 3RUCA 1DIBA 3GNQA 4IDBA 1O94A 3UICA 3IP1A 2HMSA 4RPKA 2VT3A 4DQVA 1MFZA 3OMLA 4PRLA 3GUYA 5ILGA 2F1KA 5FYDA 4D7AA 1DXYA 3GVPA 4HP8A 2O3SA 4NZ9A 3NX4A 4R9SA 3KETA 4XR4A 5GZ3A 2B4QA 1F17A 5HM8A 2HO5A 4D45A 1HTBA 1P3DA 5DZSA 3Q1LA 4IGFA 4ZQEA 2Q1SA 2Y1CA 1KY5A 5HBRA 1NQOA 1G6KA 2Q50A 1N92A 1E3SA 1VI2A 4DGSA 3SVTA 3W4JA 4FW8A 2JCVA 1PGQA 4BNIA 4O6VA 1E3JA 4E12A 5CG2A 3V1YA 5JSFA 1IULA 1OC4A 3BMOA 1SOWA 2Q49A 1Y5MA 1EZ4A 4Y6PA 2PV7A 2WEKA 4FFMA 4NBUA 3B20A 3C1AA 3TOXA 3U09A 1U3UA 2YZ7A 3E48A 4HFNA 1QYWA 1V6AA 3E9MA 4YJGB 1XWFA 3DZFA 3JV7A 1XIVA 1NASA 4A03A 4ZU3A 3FF4A 1UXHA 1E5QA 2OP0A 2YJZA 2DQ4A 3DOOA 3U49A 4PG8A 4Q3DA 4GX5A 3QW2A 3TNLA 3LK7A 4YEDA 3RJ5A 4E31A 2ZYGA 3RU7A 4MVJE 4BNXA 2IXBA 1R37A 3AU9A 2B0JA 5IAAA 3E9NA 4C7KA 4IDAA 1JQBA 3TZQA 1SBYA 1OC2A 1NVTA 3GRKA 2PH3A 4BNYA 2UAGA 1JTVA 2DT5A 2FP4A 1E3WB 7MDHA 3I23A 3ZU3A 4U0KA 2R00A 1NWCA 5JYEA 3ROKA 3EY4A 5G0WA 2X6TA 1ZIDA 3CTMA 4LRTB 1PJBA 5TNXA 4BNWA 3KO8A 4PG5A 3RJ9A 1SNYA 5EQFA 4DBVO 1U3TA 3U4HA 4DMLA 1K3TA 4JBGA 1EEHA 3WTCA 5U4QA 2FZWA 3AM5A 4NHEA 3GRPA 4D42A 4GGOA 5JBIA 1MB4A 2OL4A 3PRJA 1CWUA 3LT2A 4YQZA 1KEPA 1HSZA 4IMPA 2H1SA 2V6MA 3SBOA 3FI9A 1PWXA 1BVRA 2PWZA 3D4PA 2DM6A 3DC2A 3F1LA 3ROQA 1XQ1A 2CDBA 3SJUA 3ETGA 4PLYA 4CR8A 2PZJA 2G76A 3I6IA 4AJIA 3ONEA 2NSDA 2FHSA 3PTZA 3IOYA 5JLAA 3KRTA 1B14A 5CP8A 4LVUA 3KYCA 3P5SA 4YAJA 5DCWA 1E92A 3EVNA 4JK3A 2ZJ1A 5TGDA 4JXKA 4BNVA 1H0KA 3MTJA 4KTVE 4XYEA 2QYTA 1S7CA 4E30A 5DBIA 1JKFA 1CIVA 1U8FO 1Y9EA 3I52A 4CLOA 5TSDA 1WMBA 1WMAA 2RH8A 3NJ8A 4OHUA 4HX5A 3D3WA 1HYHA 2A9FA 4RPHA 1EMDA 1X15A 5CEFA 3F5QA 4DYVA 4P4LA 5IZCA 1YBAA 3TPCA 2W2LA 1DIRA 4URFA 3NV9A 3HB5X 1CF2O 1V3VA 4XKJA 3RC9A 4CMCA 2GERA 4XQCA 2WMDA 4ZD6A 3VDRA 5JCJA 3GZ4A 5KVVA 4YACA 4FFPA 2NADA 3ZV5A 1U2DA 2HUNA 4CV1A 4DPKA 1ADGA 4R68A 1NX6A 1UR5A 3JYPA 3AWDA 4MVJH 5TJ9A 3GH3A 5TT0A 4BNHA 1ARZA 4W9NC 2BRUA 2UVDA 5KKAA 2OBYA 4DC1A 2Q45A 2OUIA 5T57A 2WJPA 4CV0A 4E2XA 1I5RA 5DCYA 3LF2A 1NVMB 4I5DA 1C0LA 2Q2QA 4YWJA 3S2FA 4CQLB 5U1PA 1UXKA 4NK5A 2PZKA 4YQYA 4J43A 3ZU5A 4EJ0A 4Y9DA 4CM4B 4YB8A 1IYZA 4CM9D 4ROSA 3PLNA 1O9BA 4BO9A 4CODB 3TSCA 1VPDA 2GLXA 1DRUA 3WBFA 4D0SA 1J4AA 5HWSA 5A3JA 2HK9A 4HWKA 4MVJA 3CSDA 4PZEA 1RWBA 4TQGA 2HJSA 2X86A 2GDZA 4E5YA 1Q0LA 5F1PA 3WX0A 1HWYA 3L4BA 4YJGA 3D7LA 4YTEA 4AVYA 3GY0A 1LXCA 4PZCA 3OQ6A 1A7AA 3ITDA 2NLOA 1I30A 1NM5A 3FRJA 4WNCA 2HMTA 1TA4A 4UVHA 5JY6A 5T64A 1TEHA 2QHXA 2YHIB 2R2GA 1EFLA 3ANNA 4B7CA 3NTRA 4TROA 4DBZA 1U8XX 4BNLA 3VTZA 1NHWA 2EF1A 2H5LA 2ZB4A 1LQTA 4E2YA 3NDIA 4GLOA 4MIYA 5A4DA 1V35A 4CL3A 1M6WA 3ZWBA 3G0OA 4ILKA 2QRLA 4ND4A 3F1KA 4WLEA 1VM6A 4RLSA 1ADBA 1E3WA 5A05A 4OYRA 1HE4A 4R3NA 4GKVA 4BNMA 3L9WA 4XDZA 3ITKA 5A06A 2ZK7A 1PS8A 3C7CB 5HS4A 3A1NA 4CM6A 1G0NA 2VHYA 3OFSA 1DLIA 2YFHA 4KQWA 4W6ZA 2P4QA 4YDRA 1XSEA 1PL6A 1GZ6A 1PJ3A 2YY7A 3EUWA 2PNFA 3HUDA 4K6FA 2C20A 5T67A 2Y05A 5BSHA 2JFGA 2NQ8A 1BG6A 1R4MB 1O5IA 4Y98A 1IUKA 1YJQA 3I5MA 2CUKA 3FWZA 1O6ZA 3F47A 1CEQA 3B1KA 2PK3A 5JMPA 5KJ1A 2DU8A 4AJNA 2OZPA 1PZGA 2W2KB 2EERA 4A10A 2I3AA 1D3AA 1U4SA 4ZJUA 4OMUA 1EE2A 1AE1A 4CMJA 5I7EA 1WNTA 1TVEA 1K89A 3M1LA 3MEQA 1HDRA 4BGUA 3RBVA 1ZJYA 3KV3O 2HQ1A 4OH1A 4UUMA 1D8AA 4J2OA 2YQ4A 5C7LO 1ZSNA 2IEBA 4BQPA 2VWHA 3G17A 3ORFA 3SJ7A 4HNHA 3H5RA 4F46A 1MGOA 3UGKA 4ZQBA 3AJRA 1GQYA 1J6UA 2VQ3A 2Z5LA 3D64A 4MIEA 3PJGA 4ITUA 4J3FA 1IZ0A 2ZB3A 2G17A 1GDHA 6LDHA 2PFGA 2BHLA 4U0JA 4BKQA 1PJLA 1FDWA 1PR9A 5B4TA 1KVUA 4G81A 4XYMA 3ZHZA 2Q1TA 1OBFO 1U9JA 5JXWA 1LC0A 1H5QA 2X9GA 2PZLA 3DOCA 4OOEA 4UVIA 3B70A 3CXRA 2RHCA 1FDSA 3GQVA 2EEZA 2B5VA 2VHZA 3BZUA 1H9AA 1UZNA 3JQAD 4CQLA 3KM0A 2B4RO 2GZ1A 3C1OA 5DBGA 1Y81A 1BMDA 3OH8A 4CM4A 3GT0A 2PGDA 3RUIA 1UJMA 3D4OA 1IZ9A 1KETA 1PWZA 3PJEA 4U6SA 2NNLD 1CDOA 3FSRA 1LA2A 4LISA 2QIOA 1T26A 3L9XA 1ZEJA 1QP8A 2PD6A 3AUSA 4CLEA 1EVIA 1UXJA 2Y1FA 4YJFB 3S55A 5A03A 4WE3A 4BO1A 4RZIA 4NNJA 4XQ9A 3CUKA 3K5PA 2GN9A 1PGOA 3AM4A 2EGGA 3LDHA 5KWEA 2PTGA 2O4UX 3FWNA 4B8WA 2YHIA 4R3WA 4DTIA 1KOLA 4BO2A 2FPPA 3QWFA 4GWGA 2C2XA 2OP1A 4QO7A 5DP2A 3VPFA 2BH9A 3CPSA 1VL6A 3WGHA 2VYVD 2GASA 1YWGO 3MTGA 3PJDA 4CMKA 2NU8A 4LGVA 5TLSA 4OSPA 1UZLA 2ZJ0A 4LK3A 3ON5A 3INGA 1I33A 2NACA 2EP7A 2VZ8A 4K9DA 3HFGA 3ABIA 3W4IA 3FPCA 1LRLA 1UDAA 3RKRA 3MJTA 1VJ0A 3VVBA 2AW5A 4Q3NA 5L95A 3KYBA 4YXFA 3HHPA 1DAPA 4CQMD 2Q4BA 3VZPA 3JQFC 3WFIA 3F3SA 4L76A 5JDIA 4TRNA 2BGMA 3WGOA 1HLDA 1U3VA 3E5MA 5CHEA 1A27A 2IZ0A 2X0RA 3AU8A 4K28A 1WDLA 1R4MA 1T1RA 1RYDA 1ZZEA 1VJ1A 4II3A 3PWKA 4YPOA 2Z1MA 2Y1OA 4J4HA 3RAJA 3W8FA 5GMOA 1GU7A 3H6KA 5DULA 1GYQA 2RIRA 3H65A 5FF9A 2J3KA 4XR9A 1OI7A 1R0LA 2VOEA 2RBEA 3BAZA 3EVTA 3WGQA 2DPHA 1AHHA 3E5RA 3HFSA 2VTDA 4J0FA 4RQTA 3I4FA 3PJFA 5KJ6A 4XJTA 3OETA 2UDPA 3JQ6A 3L6OO 4IPTA 1XCBA 5DBFA 4A5OA 2GD1O 1J49A 2C0CA 1I3LA 4N5NA 5T5QA 1DSSG 3IAHA 1IHXA 5BR7A 4XGIA 4AJ1A 1NTOA 1YBMA 1DRVA 1GL3A 2BFOA 4F3YA 4O59O 5JDCC 4B4WA 4YT8A 3ROPA 1P45A 3U4DA 3QVXA 1ADCA 1PZFA 3L0DA 4FOOA 1KY4A 4UVEA 1DHTA 1X0XA 3G79A 3VPXA 1Q0HA 4KUHA 1K2WA 3KUXA 3B1JA 1CQIA 1C0KA 5B1YA 2EJWA 1A7KA 5AVOA 5C7OO 3JD4A 4MP6A 4D79A 5IDQA 4XX0A 3UUWA 1LSSA 2G1UA 2X0NA 3H9UA 4W7IA 4CMAA 4R1UA 1XKQA 8ADHA 1QLJA 3CKYA 3RBXA 1LLUA 4CMEC 3TZCA 1P1JA 4XIJA 3ZDFA 4IGEA 5IDWA 4ALMA 5A02A 1N9GA 4J91A 5L4NA 4OKIA 1NXQA 1LLQA 1MUUA 3BYZA 2NTJA 3AW9A 2G0TA 1JAXA 4RVHA 2P9EA 1EQUA 1Z6ZA 2D3TA 1NFQA 4NG5A 3RWBA 3S8MA 2XPCA 3RCBA 4YJFA 2Y68A 4QTZA 1ZW1A 2VWQA 3NKLA 1Z75A 4CV3A 1BGVA 2OGUA 4ZN6A 1B2LA 4IJVA 3TZ6A 4YAIA 3ONDA 2VNAA 3LU1A 1V8BA 1M76A 2D5CA 4Q39A 1SB9A 3DMTA 3HDQA 3QLJA 4D43A 3JD0A 4QO8A 3WNQA 1I2CA 4OSOA 1HZJA 3EAGA 1SEVA 2X0JA 1MG5A 1H6DA 4L0QA 2H9IA 1XLTA 2Q3EA 4WLOA 1Z7BA 4XIYA 3ZWPA 3WIEA 3ZN2A 1P1FA 3AUTA 1X7GA 4PLGA 1NYTA 1O8CA 3OQ1A 3VPHA 3OM9A 1E0DA 4BNFA 3V2GA 1DC5A 1XEAA 5G0SA 1IB6A 4HBGA 2NVUB 5G4LA 4GBJA 4WCFC 3GOHA 2WWRA 1E7SA 3GDOA 3KBOA 4AJEA 1T4BA 1GY8A 1Q0QA 1YL7A 2DTEA 1UAYA 3GG2A 4PLHA 4BO3A 3E6AA 1HE3A 4IQGA 4II2A 1L7EA 4OM8A 1GV1A 4C4OA 4BMNA 3ZWXA 1B7GO 5AXDA 3M2PA 1S6YA 2IEDA 1PJTA 2NVWA 3ZZNA 3GHYA 3PWSA 3GGPA 4H15A 4F45A 5IXSA 1WW8A 3KXDA 3FCOA 3GF4A 3HQ4O 4J7CA 3GFGA 4Q3CA 1PGPA 4MVJI 3LSYA 1BXGB 1QSGA 3I9NA 3GNTA 1UUFA 4X54A 5LDHA 1EBUA 3GAZA 4FFNA 3EDMA 1BXZA 2YV2A 4O1MA 3QV1A 5JO9A 4DLBA 3TFQA 4G2NA 2WYVA 3IIEA 2AG8A 1ZUD1 4E5PA 3DZKA 3N58A 4RF3A 1M66A 1Q2XA 1YRLA 4IBOA 1BW9B 2VUSA 1YGYA 3H2SA 1PGNA 2FOIA 4UAGA 3Q2KA 2BKAA 4YVFA 1P9LA 2FMUA 5DOZA 2VT2A 3PVZA 2JD2A 3ZWAA 1UAGA 3ENNA 4Y6RA 2W4QA 3DAGA 2VYNA 1NPYA 1LX6A 2B4TO 3KLMX 3LC7O 3NTOA 3QWAA 3K31A 5IXYA 1WZEA 4FGSA 4NQZA 3ANMA 4PLCA 2C82A 5CDUA 1ZKMA 2ZB7A 1R16A 1DOHA 4CMIB 2HK8A 2Y1DA 3FNFA 1K6IA 1U7HA 4Z3KA 2QQ5A 5F3RA 3PHHA 2AG5A 4NBTA 3ZGYA 4J0EA 4FSHA 4IM7A 4BO4A 4R41A 1N2SA 3TZHA 4GX1A 1VKOA 1DC4A 1ENPA 1LI4A 4J2HA 1EUCA 3CMMA 2QRKA 2D1YA 5F21A 1H94A 5JAQA 1E7RA 3RIHA 1BRMA 2C59A 1I36A 4P4NA 1I0ZA 1QKIA 4A26A 2QW8A 1LSJA 3PHLA 4ZQGA 2CF5A 5ADHA 3T4XA 5L7YA 4K26A 3GFBA 2C29D 4PN3A 2NM0A 3K30A 4U8GA 4G65A 4D46A 1F12A 3W8DA 5EJ2A 5BSEA 4MVJM 2HRZA 3A14A 3RROA 4AJJA 5I9NA 1GUFA 1B0AA 2B5WA 3BXXA 3NT4A 4FJ2A 4Z0TA 4MJLA 2FR8A 4TMFA 5AXBA 4JIGA 2NTVA 1LLCA 2VUUA 3NDJA 4IJUA 4RCVA 4GX2A 1XDWA 3PIIA 2FR1A 2GSDA 2FZEA 3QIVA 2DFVA 3AY7A 4P38A 1NFRA 5K6AC 1A71A 3LZ6A 2GN6A 1DFHA 5I8WA 2C5EA 4PLFA 4J6FA 5L45A 3BTUA 2I6TA 3COSA 2J5RA 2EIHA 2X5JO 3ASVA 4YT4A 4OAQA 4RVSA 1XGKA 1VE9A 1T4DA 2D4AA 1QG6A 3Q11A 1P74A 5G2OA 1WAMA 1XR3A 1UXIA 2BGKA 3Q0EA 4J1NA 5ILOA 2AQKA 2NVUA 1PQPA 2Q1WA 2PGJA 3ADOA 3H7AA 1VSUA 3RKUA 4PFJA 2I67A 4KWIA 2PKQO 4ALJA 1HE5A 4H7PA 4Z6KA 5A5EA 2W98A 2B69A 1JWAB 4J16A 2D59A 1ENYA 3LLSA 3PI7A 3RFVA 2WD8A 3HJAA 1B8PA 1LTHR 1T25A 3PFFA 4E21A 1ZSYA 1TLTA 4D0RA 3DFZA 2A94A 1YE3A 3K2BA 4CLRB 1BXGA 4CM8A 4YRAA 1AGNA 1U2GA 5A1TA 1FJHA 1UZMA 1LUAA 2H63A 2AQHA 1I3KA 2VZ0A 3N7UA 3OA0A 3ZCXA 5CDSA 3WTBA 4B3JA 5HA5A 4B7XA 4IUYA 4FPXA 1PZEA 3SC4A 2X9VA 4HNGA 3EW7A 1A4IA 1XU9A 2GRAA 1H6CA 2WSBA 4HFMA 4DPMA 3FNHA 4PG7A 4IJKA 3WJ7A 5CDGA 1HDZA 1JWBB 2I3GA 3A28A 3GEGA 3Q6IA 4K1LA 5EINA 5B37A 1PJQA 1PEDA 3P2YA 2WYUA 5A5FA 3KEOA 5COBA 3WMXA 1NWHA 3VDQA 1E1LA 2HSDA 2JHFA 3IP3A 5THKA 4ZVVA 1XHLA 3HADA 1C0IA 3LVFO 3GG9A 2Q4EA 3RUFA 3GVHA 3F4BA 4L73A 1ORRA 4CMIA 1C1DB 4FGWA 4FN4A 3DTTA 1C0PA 4CR6A 3QVTA 4BMSA 2UV8A 1Z73A 4Y6SA 3ENKA 4CR7A 1HL3A 2P4HX 4OO3A 3D4NA 5FFFA 1Q1NA 3D3EA 5L51A 1GPDG 4IQ8A 1YQGA 3JD3A 4JBHA 3ZH2A 4GMFA 1MC5A 1LSOA 3AY3A 3UCFA 1PL8A 4CMBA 3U5TA 4AJ2A 3RFTA 3H9EO 1WZIA 3ZNNA 3DL2A 3U62A 4B8ZA 3KSZO 4NDNE 4ZRNA 3ZHXA 4XYLA 1A4UA 5DF1A 4BO8A 3M2TA 4L9RA 4DLAA 3KSDO 4MO2A 1DIAA 1EDZA 4GMGA 4R5HA 3UCXA 4WEOA 1IL0A 2E49A 3VTFA 1H6AA 4FB5A 4XJSA 4FCCA 1X13A 5EERA 4NBRA 4I5EA 1H93A 5A3VA 4RVDA 5F1KA 1EVYA 3DONA 2IXAA 3R0IA 4OL9A 4FR5A 3OJ0A 1TT5B 1EBFA 2BGLA 5KKCA 1LU9A 1XYGA 4Q9NA 3I6QA 4DREA 1NPTO 1ONOA 3DDNA 2DUWA 1LC3A 4PVCA 2Y99A 2YYYA 1LDEA 3DHNA 3GMSA 3AUUA 5IJZA 3KSUA 1BDMA 1FF9A 2C2YA 3ZWMA 5G0UA 4OQYA 3PXXA 2DKNA 1UXGA 1TB4A 2P5UA 3WGYA 2Y0DA 4PGFA 1DBVO 2W2LD 4DIOA 1GCUA 3AFMA 1PQUA 4EUFA 3VPSA 5JCJD 3NYWA 1L1FA 2X58A 5H83A 4IDCA 2UUPA 4MVJF 1PQWA 1YB4A 4E32A 1YB1A 4ID9A 4HFRA 4Z3DA 2R00C 1WDKA 3CIFA 5A04A 3ICPA 4D44A 2Y0CA 3DZBA 4IDDA 3SC6A 1ZFNA 2I99A 2ZB8A 1KEWA 3KB6A 3B1FA 1GCOA 2OHXA 4A27A 3KEQA 1XELA 2CF6A 1PS9A 2JHGA 5BT9A 3JQ9A 2J8ZA 3KTDA 3N74A 5I8ZA 1XQ6A 1X1TA 3QRWA 4R01A 5C7IO 4Z9YA 4CLRA 4Z9FA 3PIDA 3OECA 4L4XA 1MXHA 4ND3A 1ISHA 3KHUA 1NHGA 5TT1A 5MDHA 1ZBQA 3DEYX 3KYDB 1VKNA 4ND5A 1ADFA 4ZGWA 5KVSA 1JLLA 4J1TA 3LF1A 3ZV3A 1D4FA 3VZSA 4EUHA 2LDXA 3H3FA 2EV9A 3GK3A 4MP8A 2I66A 3ZWOA 3RQSA 4IIUA 1CYDA 3FR8A 3WBBA 2PGLA 3QVOA 1KVTA 5A9SB 4E5KA 3WSVA 3PHGA 1HDXA 1WVGA 4AG3A 2DAPA 3ANLA 4FIZA 4I8XA 1GUZA 4OQZA 1GADO 1QLHA 5I9MA 1HETA 2V6GA 4EW6A 1IPFA 5BNTA 3T4EA 1C1DA 4M8SA 1GFSA 1FDUA 1LDNA 5IDXA 4BGIA 5BNIA 3H4VA 1SOVA 4W82A 2E48A 4I5GA 2CDAA 3IL2A 4U6QA 1E7YA 3BMNB 3OJFA 5L3ZA 5CEEA 1BHSA 3RU9A 3HDHA 3GC6A 3S2GA 4MKXA 3QWIA 2JD1A 3A9WA 1V3UA 3PQDA 3UF0A 1KERA 1AXEA 2GR9A 4GWKA 3I1JA 5K0ZA 1PTJA 3OIDA 3ZV6A 3PDJA 1LDBA 1T24A 3NTQA 2PLAA 4Y67A 4D3DA 3I9MA 2VCYA 4RVFA 1YJ8A 2FY8A 2DBRA 1RM3A 1P1HA 3GPDG 1E3LA 3WNVA 8LDHA 3G1TA 3M6IA 2GCGA 1GPJA 4G5HA 3JQ7B 3UH1A 1TT5A 4MKRA 2GN4A 4BMVA 5KJCA 2DC1A 3PYXA 2IYOA 4NU6A 5EIOA 4AJLA 4BIIA 4FDAA 4QFDA 3O38A 1ID1A 4LW8A 1EVZA 3NT5A 3SXPA 3GLQA 4DLLA 3S1LA 1JKIA 1HYGA 2DTDA 4EGFA 1LRKA 4J1SA 2DBVO 3WGTA 1JN0A 2VWPA 4BNKA 1HE2A 3UCEA 3GN1A 4E0BA 3L4SO 2QZ9A 4BL5A 4XYGA 5TIIA 1M67A 2I5PO 2CVOA 2VOJA 4YJHB 3DXFA 5ITWA 1MXFA 2IE0A 3PQFA 2XXJA 3PWZA 3HDYA 4DQUA 2O7QA 5K9ZA 3IMFA 3UXYA 2AXQA 2FSVA 4CLHA 3CH6A 2C07A 4BUCA 3WGZA 1D1TA 5IN4A 4I5FA 2F00A 4ALLA 3QE3A 4CM1A 2X4GA 1UP7A 2DBZA 1SPXA 4DIBA 1F0YA 2IZ1A 4J7UA 2AEFA 5JDCA 5IFLA 3O8QB 4TKLA 4IXWA 1VC2A 3KZVA 2B35A 2RCYA 1RM0A 1GYPA 4GKBA 5JY1A 4CLXA 3NUGA 2VHXA 1TT7A 3JQEA 2VHVA 1HXHA 3MWDB 1A9ZA 1H6BA 1DAOA 1VLLA 4OGWA 2ZKLA 1KVQA 3W8EA 2CY0A 5JW6A 2Q46A 2ZQYA 4WGGA 3RUHA 3KYDA 2V65A 1QORA 4UEKA 3ETEA 3PZBA 2YHUA 1V9LA 4XQEA 3WYCA 5ENDA 1RJWA 5C3MA 1LSUA 1W8DA 2CVZA 4XB1A 4RVGA 1RM5A 3AOGA 4WKGA 4RORA 1HSOA 1I8TA 2FSSA 3KVOA 1QV6A 5A9SA 3VH2A 3P2OA 4BQRA 1QYXA 1P33A 3K92A 1IOLA 3Q9NA 5I7SA 2NUAA 4RL6A 4FFRA 4EITA 4R1TA 4AICA 2Y1GA 1MX3A 3G49A 4HV4A 3PYLA 4I1IA 2X5OA 2W2KA 1SMKA 4RGBA 5L40A 4LN1A 5JCXA 1ZCJA 1ZMOA 3OBBA 1DC6A 5EL0A 1NQAO 4UVDA 3TL2A 1LLDA 1SEPA 1LNQA 1HEUA 3MJSA 2VRCA 1E6UA 3BMNA 5CPFA 4CM7A 1IE3A 4Z0HO 1HT0A 1F8FA 5J23A 4BGEA 2JAPA 1P1RA 1RM4A 4IS3A 4NK4A 1T2DA 4Y8VA 4I08A 3V2UA 5T8KA 2EG9A 1ISGA 2ZCUA 2IDZA 1CJCA 1DB3A 3BTOA 2OXIA 1YH3A 3JYLA 4BB5A 5JFOA 3GNSA 3SEFA 1HRDA 1YS4A 4MVJP 3GGOA 1UDCA 4YAEA 4JQCA 3WFJA 5LC1A 3D5QA 2IODA 2O4CA 4TRJA 2AQ8A 1F8GA 2CMDA 3JQ7A 1R0KA 1FXSA 2O23A 3IJRA 1YB5A 4I9NA 4LCEA 1E1NA 5EMHA 2O50A 4MDHA 1HDOA 2FPIA 3L77A 3WWYA 2GYYA 2QRJA 3FNEA 2CD9A 4YYZA 2B83A 5JAZA 4XZ3A 3TZKA 2G5CA 3AK4A 4FS3A 4N5MA 2C5AA 1D7OA 1DPGA 1ML3A 3WQQA 1I32A 2J3JA 4R16A 2BELA 3BHJA 2DTXA 4WLNA 4QXMA 1E6EA 4ZRMA 3UN1A 5CDTA 4P22A 4QQRA 4IS2A 1K6JA 1XA0A 3Q3CA 2PR2A 3VKVA 4AJOA 4RQUA 5AQ1A 4YJHA 3WGIA 3NGLA 2VZ9A 5CAEA 3AOEA 2FR0A 3OEYA 3W1VA 1N1EA 4IMRA 1P44A 3DBRB 2VTEA 3MJVA 3UFXA 5B12A 2X5KO 3WB9A 3GVIA 4XWYA 5JE8A 1DJNA 3TQHA 3ZV4A 4FJ0A 1E77A 2VHWA 4W7HA 5JS6A 1ZSVA 1ONPA 4J4TA 4DWVA 1NQTA 2C7VA 4WJZA 5TX7A 1FDVA 1LQUA 3O8QA 2HKIA 1I2BA 5IF3A 1B3RA 1D1SA 1JVSA 2NWQA 4XRGA 2PKQP 4ONEA 4LRSB 5DP1A 5JDIC 2X1HA 4J4BA 4E5MA 4JNKA 5I7VA 3JQBC 3GN2A 1A5ZA 3E18A 4JX8A 4RJTA 3S2EA 1FMCA 4TSKA 4DIFA 5ENVA 9LDBA 3U9LA 1W6UA 5L7WA 1E5LA 2D0IA 4UUOA 1R4NB 1LDYA 1N5DA 3F9IA 2HLPA 1EQ2A 1TI7A 4ZQHA 1ULSA 3V1TC 1OZAA 4BVAA 3F4LA 3MOGA 1W73A 3BMQB 3BMCB 4L74A 4XQGA 5EESA 1WLYA 5JC1A 2EHDA 1MFPA 2WYWA 2UUOA 1QV7A 3QHAA 3R3JA 3ZWWA 1B3BA 2QG4A 5HRUA 1MP0A 4CM3A 2AE2A 1DIHA 3IKVA 4XD2A 2BMAA 3TOZA 2ET6A 4BNZA 2J5QA 1LRJA 2SCUA 5KNLA 3DZIA 3JYQA 1QXSA 1UDBA 1P1KA 4F6CA 5ICSA 4BV9A 2DBQA 1N7GA 3BMOB 4LCJA 4IINA 1ZK3A 1PSDA 2XXBA 4QT0A 2FPGA 5C5IA 2GN8A 2NU9A 1QYDA 3ADPA 1MG0A 3V2HA 4XCVA 1X0VA 2O3JA 3H3JA 4GVXA 2HMUA 3H5AA 3WSWA 1NQ5A 2ZYDA 1B26A 2EKQA 1KS9A 1Q7BA 3V8BA 5K6AA 2CVQA 4R1SA 4EZBA 3OIGA 1KVRA 3LT1A 3G1UA 4FC7A 4WLUA 3RC2A 3I4CA 1CERA 1YOVB 2Q2WA 4ZA2A 5FI5A 5GY7A 3VZQA 1ZH8A 3GHHA 5L4LA 5TC4A 2OOSA 2XAAA 4BKUA 3PPIA 1YQDA 3BHIA 3F46A 3DR3A 4Z0PA 1DRWA 5BSFA 3U4IA 3DAPA 1PIWA 2XOXA 3DWFA 3S2IA 5F5NA 1PU2A 4JJGA 4YR9A 1KBZA 1T1SA 4IIVA 1J5PA 4QUKA 1ZXLA 4GGPA 3H8VA 1X1EA 4EDFA 3O26A 2B37A 1DO8A 2HMVA 3EGOA 3IJPA 2JJYA 5F5LA 3ZW8A 3AY6A 4IZHA 3RUDA 3MCVA 2BFAA 1T2EA 4MVJG 2YW9A 5ITVA 4BNUA 3GZNB 3WWZA 5I9LA 4BKRA 1MC4A 2JCYA 4J9VA 2R6JA 4A0SA 1MA0A 1U4OA 1AHIA 4CJXA 1C14A 5TRTA 3Q9UA 3R6DA 5KVCA 4CPDA 3GEDA 1YBVA 4L4SA 3BTVA 1H2HA 1I3MA 2TMGA 3DMTC 5A9TA 5ICMA 3IKTA 3DOJA 4FFOA 1HLPA 5DN9A 3DB2A 2I65A 2W90A 5FEUA 2OBNA 3OA2A 4MINA 4E6PA 2Y0EA 1M6HA 3DBRA 3F6YA 4GVLA 4RDHA 1SC6A 4DRYA 1C3VA 4U7WA 1I2ZA 4LMPA 2GGSA 3HB4X 1BVUA 4ZQFA 3ZNPA 2O3RA 2VYND 4CLOB 3V1UA 4CMHA 4PVDA 1WP4A 1ZEMA 4WOJA 3PLRA 1U5AA 2VUTA 1E1MA 4ALNA 4UUPA 4QSMA 1A72A 4MPDA 4RPGA 3RASA 1EE9A 4AL4A 5AOVA 2O2SA 3TRIA 4NR0A 1Z82A 3SLGA 1B16A 1YDWA 1VL0A 1QMGA 4WECA 3WGGA 3C24A 2X7HA 1IY8A 3EK2A 3T7CA 3UAGA 1CETA 4N18A 1V0JA 2JD0A 2Q2VA 1Y1PA 1VSVA 3EMKA 3DZGA 1ENZA 1R4NA 4BNJA 1BTOA 4BS9A 5B4UA 1Y9AA 4AJPA 3DZHA 5B4VA 3BMQA 2PZMA 2WDZA 2EW8A 1I24A 3BMCA 2EXXA 3CZMA 2ZQZA 4WCDA 1W0CA 3E03A 3MJCA 1UH5A 2YDXA 4R4JA 4WNIA 1PJ2A 4XDYA 1R12A 2O3QA 3HWRA 4DYDA 2GO1A 3ZI0A 4R51A 3GDFA 3BHMA 4TZTA 2RHRA 4AJHA 2P9GA 5TF4A 3C1TA 3L6EA 1Y5RA 3QVWA 4DPLA 1JVBA 3PZRA 5JO0A 3LYLA 4YRBA 3WQSB 2BD0A 3OJOA 5JMWA 1BWSA 4W9NA 5HS6A 4OXKA 3K6JA 1E1KA 4IDFA 3TJRA 3QSGA 3CE6A 1QYVA 2P2SA 4ND1A 4BV8A 5JC8A 1ZMTA 3C8MA 4LSWA 1R6DA 4BB6A 5L9AA 5U9CA 3VPGA 3RUEA 5JAIA 4HFJA 2J5KA 3JTMA 4K6CA 2BLLA 1YOVA 3STHA 5G0VA 4DL9A 1Y8RB 4WLFA 1EVJA 3ZW9A 4CUJA 4KWHA 3L6DA 1WPQA 5JNLA 5DDIP 4KUGA 3X2EA 3FPLA 1BW9A 1WDMA 3ZWCA 3K8ZA 1RKXA
chains in the Genus database with same CATH superfamily
5F9MA 3SJBA 1PLJA 3PP8A 3WGVA 3FPSA 3UMVA 2OLJA 3JRXA 3I09A 3RSHA 3ZX5A 1OBCA 3PNMA 2X8LA 1PYGA 2AA3A 3KZXA 1B6GA 4FT4A 2GPNA 3WLFA 1KAMA 3FD8A 1FQWA 1YKFA 2HCTA 5T6BA 4OAOA 1KHHA 3GZNA 3NEPX 1H9CA 3MS7A 4C0HA 8GPBA 2O48X 1LS6A 1SB8A 1TVKA 4RUKA 1NUAA 3ETLA 4KN5A 4MB6A 4Y1RA 1EFRD 3C3MA 3PFCA 4HNAA 3P7MA 2V6FA 2QTVB 3W5IA 3PNSA 5KJFA 5JOQA 2AEMA 3W5CA 2P2DA 1N2OA 2HO4A 4S1OA 5THQA 3TLEA 1G19A 2ZTLA 4ZT3A 4QELA 2GZAA 1U1GA 2QD1A 1JDVA 2YNMA 1Q3HA 3U48A 2P9CA 3H2GA 5TQVA 4P7KA 1FYXA 4PPGA 3KAKA 4R05A 2WE8A 5BP7A 4I3FA 1QR2A 2HDNB 4S2EA 2FCRA 1S2IA 2DVMA 2EGUA 4QOGA 1R0RE 4RNCA 5IUNC 1NJ8A 2WKWA 3ME5A 9GPBA 3TGPA 2LR0A 4G84A 5AIAA 3P9KA 1ZNQO 2ACKA 3OIFA 3C14C 2XCIA 5FPPA 5IAEA 1HEIA 2WQ7A 5JATA 4D8VA 1F06A 1QAOA 3PRHA 4S1VA 1KIFA 1OFTA 2HA2A 2OV4A 3F5SA 3Q3HA 1JAHA 3M4NA 2C4NA 3CZAA 6ADHA 1E7QA 3DF7A 3CUTA 3OM8A 5CVCA 1G17A 3D1LA 1QRAA 3N5KA 4YGYA 3GRFA 1E6WA 2XEXA 4MARA 1EK6A 4RHYA 4BQNA 1MQ9A 1ULTA 2XUHA 3A3OA 4IWXA 1VMEA 5A9RA 1D4AA 3WB2A 1SVMA 2DKOA 2YC2C 3L18A 4LFCB 3UJNA 2GZSA 4GXNA 2ZU0C 3ZUPA 4PIVA 1D8TA 1P2BA 2I76A 2DWPA 2H1VA 1MO3A 4LHEA 3OAAD 1TYAE 2FFAA 3DVAB 4MKZA 4ECAA 2HWYA 4AXBA 4ENWA 2EX4A 2OXEA 2W83A 1CFZA 5LMZA 1HZZA 3BD6A 3ISJA 4DJEC 4OJYA 3AEUA 1HMYA 4UHBA 1JR3E 1VRWA 2SKDA 4INZA 2RHDA 4EYQA 2IK8A 3EIEA 5DLDA 5E4YA 3GEBA 2P91A 3PXCX 4YYEA 1CF9A 5CA0B 2ZI7A 4PZZA 5A9SB 4NJOA 3LPDA 1N3BA 2K4MA 1JU9A 4MYRA 3HBFA 3NDBB 1E3IA 3KFVA 1K92A 1LV7A 4LZNA 1EVQA 5KVQA 4UEOA 4RVCA 2AEJA 1O87A 2GA8A 1WW3A 2FWAA 3KB2A 3RVOA 4P7GA 1FB5A 1NFFA 4PRKA 4B33A 3BWDD 4DDTA 3FTNA 1PSZA 1UBLS 2C3PA 1QHGA 2VF2A 2G4CA 1Q3KA 2PZBA 1VPWA 2Q1UA 4R7ZA 1G60A 3FBGA 3TR5A 2FI1A 2O1SA 2B8TA 1ZNXA 1N3LA 4HH3C 1EPUA 2GFQA 1TGVA 1FDOA 3TLZA 5BVHB 2NNWB 3ORYA 3G02A 3T3OA 3TI9A 4ZV7A 4LVCA 3UHOA 1A5BB 2IOHA 4C7JA 4A5SA 4Q4HA 2D7JA 4X1IA 1RPNA 4LF9B 4ZVMA 5ESRA 4G89A 4IJMA 2BF7A 4M1QA 2NUBA 4N54A 1DQRA 1K8ZB 4OUDA 3FOWA 4Q4AA 4X61A 4WA7A 3WY9A 4KPYA 5GZ6A 2ZYAA 4LX0A 2ZOSA 4GT1A 3GLIB 4GRAA 3JASB 1L7AA 2LDBA 4MVJD 3KT6A 1REQB 1RABA 4N0EA 2AOXA 2WJ4A 5SYAA 2NXWA 1V3TA 1EBBA 1FQKA 1ZONA 3EG9A 2XECA 2PKRA 2XWQA 3VR4H 2VPYA 4Y2XA 3EPKA 1NNEA 1AKUA 4Y9TA 5IULC 3RIGA 2VDWA 2E0IA 5ELXA 1BD4A 3SEZA 2H6EA 4UASA 1FP1D 3LX8A 1NW3A 2GXAA 3J7AC 3W5AA 3VV2A 3PQ5A 4OKNA 5T41A 4PZAA 5KIAA 5LMUB 2J9YB 2NZ8A 5G4KB 3EX7C 1QU2A 4DLSA 5HFJA 2QR2A 3Q7SA 3A3KA 4BKOA 5D51S 2UZ1A 4NEQA 1X7XB 1CJVC 3WICA 2GNAA 2Q3MA 4WACA 1SO8A 1G3UA 4U63A 1HF3A 2GFIA 3RIEA 2J5XA 1P80A 1U0FA 3FH0A 3AFGA 4BOYA 5JMTA 1Z68A 3EFBA 1V45E 2DZDA 2ZTVA 3H18A 3ULKA 1UJ4A 3EODA 4H1TA 4A7PA 3MOIA 4B80A 1FNCA 3UOWA 3IS3A 2DHQA 2BFFB 4FMPA 1P0CA 3PBKA 4QYIA 3TFOA 2ZATA 2XMPA 1VJTA 1HG1A 4JR1A 2A4KA 4OBWA 2C5HA 4QM6A 2VDLB 2OC4A 3OFJA 3BILA 4I50A 3KJFA 3UANA 1KEUA 4LTNA 3FOFC 3SP1A 1C3LA 4JI2B 4OA8A 4OX9Y 4UVGA 1G2PA 1Z7EA 2B0CA 2I7XA 5CFNA 2QN8A 3RS2A 1JTEA 1IPEA 3NH9A 1DQPA 2BRUC 3JZMA 3I5UA 3JQ8A 4WY5A 2IY8A 4M76B 3RC8A 2QWXA 1KO1A 1ORTA 4ISBA 4KE8A 3RS5A 4ZEVA 1E18A 3QUSA 4QLBA 4EB6B 3T5CA 3RF6A 4QBIA 4P36A 3AF3A 5H4HA 4M0DA 4RQAA 4NBWA 3KLNA 5F64A 4EEZA 4LZJA 2IXFA 3NU1A 1U0LA 4JP5A 2WD7A 1E4VA 2FCAA 9LDTA 5LSAA 1CD5A 2PMWB 4AX8A 4B4OA 5LD2C 3QOXA 3AY0A 3DO8A 1AN9A 2ZJ3A 4G5SA 5D2CA 5FQOA 2V7PA 2CUNA 3E05A 4ZOEA 3SJZA 1IXYA 4G9BA 4LE0A 4CL8A 2ZE6A 1ZCBA 4YAKA 4KBGA 2BMVA 2IZZA 3F6EX 3ZHYA 2ZCVA 4QLAA 4J8PA 3LIPA 3M70A 3OP1A 4UNIA 3E1KA 1DEHA 5AHRA 3WV4A 1NVWQ 1GQSA 1JNXX 1M2GA 2A58A 4PQYA 3UNXA 5CVVA 5TE9A 3RADC 3KEGA 3S1AB 4ZTZB 2JGEA 3VKHA 3U3RA 5EPEA 1XNQB 2OXRA 2X1LA 4GH5A 3N28A 3QE4A 2XBLA 3JATA 4HNSA 2IUYA 2O5RA 2Z1DA 4IHAA 4NL4H 3OLCX 4DM7A 2DP4E 5FV4A 1SCUB 2Q3BA 4KGZA 4HO1X 5L4SA 4HI0E 1W35A 4P86A 5HYVA 3JQ9C 2CHQA 4Q1AA 1CQIB 3SHTA 3AM1A 1KDOA 3TXXA 1PT8A 1R88A 2VXBA 4MDYA 5KJEA 1LWOA 5BN3B 1Z7WA 3UV3A 3C39A 4NPCA 3KU4A 1NVGA 3IELA 4FDUA 5CRIA 3K4PA 4JUAA 4OFXA 3RS8A 2CXTA 5FLXA 4KODA 4DLVA 3HM2A 3HSSA 4TTVA 4EVQA 5KTKA 1RAGA 2R3SA 2ZRJA 3X2FA 3I83A 3OSZA 3JD2A 1XZIA 1B8OA 2WU1A 3MD9A 3PDIB 2QLLA 3TSAA 1WV1A 3KWLA 4RPJA 1F51E 3BIFA 3KFLA 3VOSA 3KD3A 1J0EA 2P41A 4CUZA 2CSUA 2NUTB 4PYQA 1RZRA 1YRHA 1PFWA 5CCDA 2BEWA 1W1IA 2JHPA 2VPXA 1M10A 4RSHA 3TXAA 3UUEA 3DEHA 4ED9A 5EJ5A 3A04A 3BS4A 4HWSA 1ELOA 5FOQA 3AHEA 3PQ8A 1QJ4A 2YQ5A 3KKLA 1H4TA 2PJRA 3CEAA 1WO8A 3AEKB 2C96A 4I3GA 2D7DA 3QZUA 1GXSA 4PF1A 3WLIA 4BVHA 1RYEA 3OF3A 5A2QA 1XZNA 1Z25A 5CDYA 3ZEAA 1LK5A 4JBXA 4B6QA 3RTDA 1SQ6A 5LXTA 4CMEA 3TUJC 5TGTA 1XCPA 5DISB 5A6SB 5IK2D 1IBCA 1TTQB 1R27A 1YO6A 1DCTA 2BMJA 1AKQA 2WHYA 1J2TA 5T6MA 2AXEA 4EG5A 2QN3A 1Z5WA 1MVNA 4KTTE 2C7GA 2CNOA 2WWHA 5C4GB 5J5AA 2GMWA 1C4WA 4J0IA 1ADJA 2RKBA 4WXMA 2J4CA 4BE7B 1PHRA 1SZJG 3U6KA 3BQNB 4HKTA 3E5HA 3OX1A 3GLHA 3DAFA 3E35A 3CEMA 2FFBA 4ZHSA 4JBNA 1XZCA 1FFGA 2B1GA 2BGRA 3DBHB 3NAGA 3LMKA 3R1IA 2J6IA 5BQFA 2ZIVB 4YALA 4BHTA 5FWNA 1TIPA 4M9CA 5FBWB 1E2UA 4GC9A 4MP3A 3RYIB 2F4VB 1QZUA 1GFZA 2AIRA 3GB9A 2CXRA 1G59A 3LCJA 2NV0A 3OCCA 5C37A 4UE6A 4U2KA 6REQB 5CT4A 3ST7A 2YFQA 1GGFA 4J9UE 4HX9A 4XWGA 3VU3A 2GZ3A 4JI1B 1ABFA 4GI7A 1QTIA 2A9JA 4N3GA 4OMDA 5KQSA 3HPQA 3V7NA 4UHHA 2BI7A 3X1YA 3KLPX 1FNDA 1BHJA 5IP5A 1OREA 2XTZA 3HEAA 4MHSA 3WRXC 3JW8A 2O7NA 3FTCA 3DD1A 5EZ6B 3BD8A 1BQEA 1SXJB 3UMMA 4R1PA 3RVKA 1P5RA 3FN4A 3DLTA 3G8BA 3V48A 4WWHA 4XIIA 3GGGA 1F6DA 3VH4A 4BFCA 1GPH1 3BGOS 1I01A 3PQ6A 5JVDA 4XAQA 5L7TA 4R2HA 1LNZA 3SJCA 3WIDA 2HN9A 4HADA 4B3XA 2QN2A 1WM1A 5I45A 1M75A 1QKKA 2A35A 1G8SA 2CMGA 2R25B 3K9LA 5EXSA 4YXWA 3MT8A 3ROFA 4ZV4A 5KWVA 4RY8A 1VP9A 2G1KA 4ZO7A 3PQEA 3LC1O 5EPOA 3S40A 4L9WA 1Y6ZA 2NU7B 5HFNA 1A9XA 2C5LA 2PA3A 2Q2NA 4QUEA 3EC1A 2FW0A 3EWSA 3OP4A 3GA0A 2JGIA 2O3TA 4RYLA 3DZ8A 3EIQA 2IU3A 3LT0A 5H81A 4Q3EA 3LGSA 1T8RA 4ABYA 4AAYA 5BYBA 4TLLB 1XT6A 3NWBA 1UPUA 3A6LA 5L3QA 4YRRA 4TQAA 4WY8A 4BQFA 5B58C 4KLCA 3JZIA 1DC3A 4RZUA 4FHZA 4HGYA 4RK0A 4B74A 2B9VA 2GZDA 3GJSA 3KTAB 3UWPA 4FNOA 2AS0A 3IMEA 1XPOA 5KOHA 5ES3A 2FEOA 2PKYX 1VMIA 3GMDA 1JQEA 4JGIA 4KIUA 2RGCA 4TKVB 2O19A 3V5NA 1O97D 4H16A 1CJSA 1R8SA 3C85A 2X23A 4EI7A 3UB4A 2WIBA 1RYFA 3HB0A 1DTWA 1TM5E 5JARA 3EQ2A 3ZIUA 1QLWA 1UBTS 4TKMA 1DJOA 1SHKA 2O8EB 2RCNA 2Y0PA 3QLVC 3R77A 3LK6A 4A91A 3VH1A 1JDSA 1L9KA 3AM3A 4NU0A 5IDYA 2CNNA 3INTA 2UYYA 4GSKA 1W85B 2GZ2A 3DTVA 1X9IA 2D74A 5FO1A 3WXBA 1T1IA 4KUEA 4J7XA 4F11A 2ID4A 4RIHA 3ZJYA 4BN4A 5BNWA 5H82A 2O8BB 1Z18A 3VNAA 4GPD1 4B3IA 5CK5A 1T2AA 2ZRHA 4MKFA 1QIJA 1QOZA 3CUUA 2ZI9A 1L8XA 1COWA 1TQ8A 2P5SA 3DM5A 4J90A 5F33A 3H99A 3VNVA 1UP6A 3TL3A 3ZIAA 4YAOA 9MHTA 1MD9A 2AR0A 1ONNA 4Q1EA 5JZOA 1N0WA 1ZMXA 2J0QA 3BH6A 3GDGA 5KINB 1XZPA 4JGGA 2FXVA 1DRKA 2AOUA 2XGGA 4IX1A 4DT1B 5JS8A 1II8B 1TZJA 1X1BA 1KEEA 3QBDA 3WYGA 2NSJA 5FOUA 1VZ3A 2YVLA 1T5BA 1XTZA 1P0FA 1ESCA 2CC2A 3DV0B 2HK7A 4CLDA 2E82A 3D8TA 3B3FA 1AURA 4L75A 1OYVA 2Q9AA 1RRCA 2XOKD 3VDXA 3O83A 1M5UA 3EXIA 3KFXA 1BS2A 3Q2IA 4O25A 1Q6ZA 5BUCA 1TCAA 2G1JA 5DLEA 1QHHB 1L4YA 5EUMA 1THTA 4K8OA 5FWAA 1USWA 1WXQA 4UFPA 3DDOA 3KNZA 2X0IA 4LOJA 2H2IA 2HXGA 1FXWA 1YTLA 3RH0A 1YJCA 4P2BA 3W6UA 1T36B 2ZI5A 3O8LA 3OO1A 1KI4A 1N57A 2I2DA 3EHEA 2P9YA 3GLGB 1B0UA 4JN6B 4QXOA 5ALYA 2VRNA 1EWRA 4RA9A 4RDIA 4TM7A 4RF5A 3AR3A 3AQIA 5CH5A 1G3RA 2FWBA 2QZZA 2I87A 4RS3A 1K8QA 1ZK1A 1FXWF 1RI3A 3D7SA 3FNGA 1GRCA 2VL7A 3ESXA 4PNPA 5LU8A 4MUJA 4NZPA 3CSSA 3DCIA 3RARA 1NAHA 1PW7A 1P7CA 1LBEA 3ND9A 2ZB2A 5K3CA 2BMDA 3AHDA 4GXQA 3R5KA 3CGWA 4LZWA 5TGZA 4DLYA 1JIXA 4NCAA 2XYQA 3L0OA 3Q88A 4QXQA 1KZHA 4DN6A 2AFHE 4EH1A 1X7HA 1KH3A 2IUTA 2Y1EA 4EJMA 4J3NA 3G59A 5DGTA 4ZYLA 2TYSB 4QDTA 1I10A 4R8RA 5DYIA 4E07A 1EG2A 4PCVA 3COPA 4JOCA 1XEXA 1QHFA 1Z3IX 3NVAA 1JW9B 5D87A 1BEZA 3JYOA 1W0JD 3QEMB 3DAYA 2G36A 2HNBA 2Q41A 4LXYA 4QDUA 4UD6A 5FA8A 3LXUX 3ZNQA 1GYRA 2PT5A 4ZTUB 1U8ZA 2VBCA 1E79D 3VSAA 3HE3A 1IUOA 3SICE 4CNQA 1MMFB 3BX1A 4LVNA 2FP4B 5HG0A 5IVIA 2GVNA 1PWYE 4EABA 3UGJA 3DE4X 1X19A 1DHRA 2IZ5A 3AOEC 3AUAA 3NGMA 1CZNA 4Y18A 3UM9A 3CF2A 1NLMA 3GUCA 4IKOA 5KKNB 3QMWA 1B76A 1WMFA 2HC9A 2V7UA 4ZAVA 4EPRA 4NABA 4US2R 3HP1A 3V6LA 2QY6A 5ITZB 3HU5A 5C8YA 5E9WA 4I4TA 4IFIA 1W4AA 5LUAA 1OLSB 1XP8A 4M1TA 3WOHA 1I6KA 1XFAA 2VP3A 4R3UC 2V4ZA 3CW9A 7ABPA 3INRA 1GU1A 5F98A 3IMCA 3OE5A 1GAEO 2P4SA 4JI5B 3PTAA 1ZK4A 3MS2A 3K1YA 1M0WA 3IT2A 4MR9B 1H2XA 4GZ6A 4X92A 5GV8A 1Y7LA 1X42A 2P3QA 1I80A 1A9TA 1IOVA 1RBYA 1WPXA 3HRIA 2R8EA 3FHOA 4UM7A 5CUQA 3T7IA 2P6NA 3MFQA 1FS6A 2H1CA 4M55A 4XGKA 3KYCB 3ZJ4A 4FQ8A 3VPDA 2CDCA 5DNUA 1A5TA 3PDCA 4D3SA 2PXHA 4RXTA 1O4VA 4UMFA 4C0BA 2GEVA 3BFXA 2OR3A 3CR7A 2Q8NA 1IZ7A 3BJMA 1K06A 2YZ2A 4EYOA 3ZHTA 2I9KA 1QRUA 1S96A 3RGGA 3QWBA 3FBTA 5DM0A 2BKLA 1TQDA 4XYBA 3DF9A 3I32A 1PKXA 3D0OA 1WBJB 1CUUA 1F1BA 2P65A 1Z9BA 2ODTX 4IDBA 5EKXA 3IP1A 2HMSA 4RPKA 1SBZA 2MSLA 3WL7A 1E5XA 1ZJ6A 2I55A 3GUYA 1G4AE 2F1KA 2J41A 4PW0A 3PHCA 5F2OA 5KHLB 4HP8A 4YV1A 3NX4A 2B98A 3CN9A 3KD2A 5BW4A 1LVHA 1YZ3A 3L06A 1XA4A 4O8ZA 4FXPA 3N3AC 2Y9PB 5E6RA 2BMFA 4C76A 2B4QA 1XQVA 1ZLXA 2JBAB 2VJCA 3L7NA 4N0PA 4W1QA 3UJDA 3G0GA 3OPYA 4MA5A 5HM8A 5JCZA 2CLEB 4D45A 4F3NA 1SC1A 1FTSA 4IGFA 4YUVA 5A5VA 5K0NA 2Q1SA 1TA0A 1QE3A 2Y1CA 2XGJA 4F1WA 2XW6A 4IVQA 1ZHFA 2JDID 1NQOA 3KUUA 4TWBA 4XM2A 5CGQB 4A2QA 2PX4A 3L6BA 5BNZA 8ATCA 2Q50A 5JAHA 1FNBA 4MQ5A 4OPMA 1E3SA 3W3AH 3ZR4B 5KO2A 2G71A 1KO5A 5D3MA 3GUUA 3ITEA 1J8DA 5E95A 2OKCA 2OYRA 2XGMA 3W4JA 4FW8A 1OAOA 4BRSA 1QZ3A 3IEMA 1VI5A 3PS9A 2W4IA 5HF5A 1CUVA 1N6IA 1BEEA 3VGJA 3IAM1 4MLPA 3L8DA 3EMBA 1QQTA 3SVZA 2P2NA 1IIBA 5K0TA 2VTVA 5DMHA 1YJXA 4RV5A 1Y5MA 4X3CA 1Q7TA 3UJ7A 2WEKA 5HIAA 1EZ1A 1U3UA 2JRLA 2R7NA 3E48A 4KSBA 5BSMA 3GRZA 3COZA 4FMCF 2FFJA 3E9MA 4RCYA 3C41J 3FLAA 1H42A 1N2EA 1UBNA 3O7MA 4YJGB 3WLMA 4Y2VA 3JV7A 5AW2A 1WVIA 3D2CA 4YLYA 1KIMA 3EVGA 1E5QA 1D9ZA 4LVOA 4MW1A 2QVXX 2YJZA 4BC0A 4QGHA 1Q0RA 1U2TA 1QZZA 3DOOA 4HPXB 3U49A 2J4FA 1F8XA 4Q3DA 4AG5A 1X80A 4FYVA 1PT6A 3TLCA 4GX5A 1DP4A 2GFHA 3ZXXA 4DVGA 1EAMA 3RJZA 5KNCH 2YWJA 1P6QA 2WRZA 3KG2A 2IITA 2B2XA 4NLLA 3URKA 3R74A 3DW1X 5H16A 4BNXA 3ONWA 3GLFB 1SUFA 2AB0A 5DH9A 1R37A 5DI9A 4FYMA 1SBQA 4M0PA 1ETHA 3HLKA 3E9NA 4C7KA 1XVTA 3M81A 1B6SA 5IAAA 1RTTA 4R7GA 4Q1FA 3ENWA 2JGFA 3HZOA 4QSHA 2P2LA 3E58A 3OFND 4H7IA 2GK4A 4AF8A 2RHGB 5B2FA 3ESBA 2WF5A 1JTVA 1MV5A 2UAGA 4IDHA 1E3WB 4YNBA 2FGKA 4O2BB 5I47A 2XQFA 1SXQA 2R00A 1XRSB 3ROKA 1SVUA 2DPYA 1KDPA 2Z5VA 2W9XA 2X6TA 4IRXA 4LRTB 4BNWA 4Q21A 3KO8A 4PG5A 4LS3A 4DKXA 1SNYA 2ZP1A 3F49S 5EQFA 3G1WA 4DBVO 3WNBA 2PSSA 1N5OX 4IIYA 1RLJA 1U3TA 4QIHA 1I3CA 3Q7QA 5B7GA 4ER0A 3WTCA 1N1DA 5D85A 5JBIA 2PYZA 2QB5A 4JJZA 1X92A 5H1YA 2P1ZA 4G1EB 4C20A 4JI6B 4IMPA 4ZAFA 1MQAA 3A6PC 3B1WA 3SBOA 3K71B 1KAQA 1GSIA 3H3XA 3IOCA 1TYBE 4CIDA 1PJAA 4XI9A 4BZPA 2F8LA 1D0VA 4MV3A 4EKGA 2PZJA 1U7WA 2BZSA 3I6IA 3ONEA 4NOLA 1E6LA 1BKDR 1LZKA 4FLMA 1E2JA 4RABA 3F3MA 1E92A 4BNVA 2M98A 4GR5A 4AN1A 4CCYA 4XYEA 4COOA 1O1YA 2VPIA 4KO3S 3WL4A 1CIVA 3I52A 5HTKA 3OAAA 1ZCFA 1RKVA 5HQTA 2L42A 2RH8A 4EF5A 1JDUA 1P4HA 1H0SA 3A7DA 4ODIA 1AY0A 5AUNB 2HHCA 2A9FA 4QBGB 1ZHHA 1NW8A 1X15A 5C81A 3TQCA 4DYVA 2O7VA 4P4LA 3RTEA 2P8JA 5IZCA 5IBQA 1XTUA 2Q0SA 2GCIA 3A10A 3IAM6 4PTLA 4E4RA 3QFTA 3HB5X 2RJNA 1KJ9A 3KK0A 2WMDA 3LFTA 3HXMA 4V1CI 4MYCA 1KPIA 5BR4A 4FFPA 4S2UA 2NADA 4EHNA 3ZV5A 1D5CA 1U2DA 1GRVA 2O2HA 1Z17A 3H6GA 2DKFA 3LXXA 2G3YA 3N7TA 1Z0DA 3QUTA 4DPKA 4YDSA 4R68A 2XCOA 4XW2A 5FTNA 1UR5A 3BWCA 5I48A 2OQVA 5KYWA 4IHJA 4QZVA 2XCSB 3BZBA 2GYUA 4H2DA 4C5AA 1GL7A 1G64A 1QPZA 3AR8A 3E3LA 3TNDA 4KBYA 4JSRA 1XI2A 2WF7A 3MPOA 3SG0A 5E2BA 4RGYA 5AW0A 5JU6A 3U19A 3GJZA 2OO7A 2Q2QA 3S2FA 3X43A 4YH1A 1RMQA 2D1SA 5U1PA 4YQYA 4CQLB 3T4PA 5IBCA 2QW0X 3LLCA 3TVYA 4P92A 4EJ0A 2HWKA 4HPWA 4QICA 4EJSA 4NYJQ 1IYZA 4YB8A 3I5YA 4IH1A 3PLNA 1IRXA 1O9BA 3E22B 3HCRA 4XE5A 1JPVA 2PPLA 5TEWA 4E22A 5BXYA 2CV0A 4LA4A 1N6RA 5TVGA 3OTOB 1RE1A 1XPJA 3EF1A 3N86A 1MOZA 2NPOA 2JJ2D 5GM1A 3WA6A 4MVJA 3E2IA 4E14A 2UUBB 2WWIA 4FYHA 4Z8YA 2LBPA 5J2UB 3TE6A 3QW4B 1GLVA 3OTIA 4NENA 2NO5A 3BORA 3P96A 1SULA 2FUG1 2GDZA 3GGCA 3F2IA 1Q0LA 4G4IA 5F1PA 5IJ9A 3UMSA 3Q9SA 1KOJA 1E4YA 1M5TA 4NYJR 4Q7QA 2QX4A 2ZIUB 4D3YA 3EIWA 1BU5A 4AVYA 5ES4B 5CFMA 7REQA 1SU6A 4EGAA 3K2QA 2QMQA 2XR1A 1A7AA 3JVUA 3LRXA 3WZMA 1I30A 4DV1B 1NN1A 4WNCA 3ZS9A 3ACBA 3DTNA 3IAUA 2SKEA 3WISA 1M2EA 4AIRA 5KB3A 1U8XX 1SCAA 1K66A 2FJ0A 3H5OA 3QU5A 2A88A 3FPHA 3N0RA 2CLCX 4O4IB 1D07A 1HUQA 2EF1A 3PQ4A 4EPYA 1EK1A 3T9BA 4DDKA 5LQCA 4UU0A 2NU8B 1A8SA 2HH9A 1LQTA 1XDBA 3M1YA 3BGWA 3G2HA 4G23A 4B9AA 1S2DA 3N3BC 4CL3A 3CWCA 3G0OA 4A8TA 1T2NA 3IA7A 2Q5IA 3NHRA 4YN3A 3E9EA 3TFWA 2ZJ7A 4KQFA 3T3EA 3D6TB 3M49A 3EEFA 1FS4A 1NOKA 2DR3A 1WEKA 4Z7QB 4KREA 4MV9A 2R48A 4E46A 4TV8F 1JJIA 1U11A 2VQDA 3L7AA 4YLGA 2DWCA 2LCQA 1A9PA 1BNCA 3IQIX 3NKVA 4MMXB 4WBNF 5A06A 3VR4A 3L4EA 1PS8A 5DSZA 5LQNA 3T41A 4O3FA 4DCGA 5HS4A 4IUBS 5FBHA 1D0IA 3I62A 4M1KA 2W71A 4YRPA 3OFSA 1DLIA 3B60A 2P4QA 5J4LA 1IHOA 3BJZA 1QIDA 3FSEA 3EOAI 4KU4A 4K6FA 2VCEA 2YY7A 4G5QA 3HUDA 2WJ3A 4I9FA 1KO8A 2IYRA 3N2EA 4JLKA 2NQ8A 3OKAA 1R4MB 4UFNA 6NULA 4OXQA 3E7FA 5H68A 4UTPA 2TECE 2X9QA 1YJQA 3I5MA 3S2YA 2CUKA 1H3EA 1O6ZA 3B1KA 3K0FA 1J2JA 2P78A 4I55B 4LRXA 3DFIA 1OASA 3ILHA 1QV9A 521PA 3R7LA 1WHTB 3IPRA 1GITA 5DIFA 1U4SA 5AR1A 2FMXA 4OK3A 2OWEA 3G8CA 4LRYA 4OMUA 4CWAA 4JXJA 6GPBA 3ZDXB 3ICEA 4Q7JB 5I7EA 5I4IA 5HXAA 1YMUA 4FZVA 3S81A 3DQZA 2Z8ZA 3M1LA 3MEQA 2PANA 2GBLA 3RBVA 4JXXA 3U17A 3K9GA 4J2OA 3U40A 2YQ4A 1Z5OA 5E6SB 5GOZA 1RXWA 4ABTA 2RH9B 1VKRA 4Q9AA 1DUIA 4B3CA 1FSZA 1Q7EA 1KZYC 3AP2A 2WABA 2VKTA 4WXYB 5KYUB 1EHCA 3GJ3A 4OI1A 3OVMA 3N07A 4MQFB 2CMFA 3AJRA 1NMXA 1XRLA 2VQ3A 1G21E 3NTLA 3PJGA 4MIEA 5DMXA 3GYGA 4DMKA 1L7RA 1IZ0A 3WADA 3E9RA 1UADA 3PG5A 2ZJYA 4WN9A 4W9MC 1IEQA 4IOKA 2BUAA 2PFGA 1SU4A 4D8YA 3NHLA 4EARA 3GYBA 1FDWA 2ZRKA 3ANTA 1CJBA 1PBNA 4GF5A 3FCEA 4XYMA 4MMYB 3LKDA 5B4TA 4QUBA 2G77B 4G0OA 3DOCA 3UMJA 2G5TA 3CXRA 1XWIA 2I2AA 3GQVA 5AJZA 2IC5A 5FR2A 3FTEA 3QYJA 2VHZA 1EK0A 1D6NA 1MC8A 2FZLA 3PF8A 4QGBA 4B31A 2COKA 1X2EA 3DEKA 3PGLA 5D1HA 4NXMB 1C8BA 2OMKA 4YV0A 2PS0A 4FEYA 2B4RO 1PUIA 3SR0A 1L4BA 2PGDA 1QGDA 2AJLI 4EVIA 4DJ5X 2O0MA 2FEMA 2IOFK 3OPVA 3U7QB 1OPRA 1PWZA 2BKVA 2FN4A 2IYSA 2V0CA 2GBGA 3BC1A 1ZOLA 4GYKA 4QKQA 3TEMA 3ZY3A 1FRQA 2NP7A 2H5EA 2I2BA 1CDOA 1LA2A 1Q1QA 3B38A 3CH4B 4RNDB 3BCSA 3L9XA 3TTUA 4A1FA 3ICWA 4N7BA 4AKEA 4C21A 4D81A 1W46A 2C88A 3PUJA 2CL7X 3Q3VA 3OPXA 4YJFB 4CTNA 2QXTA 1ZVKA 5HMMA 4LZOA 3ZVNA 3CUKA 3K5PA 4U7JA 4FFBA 4ZK2A 3T99A 4K88A 2Q6VA 1MRNA 2HIAA 1M2VA 2DOKA 3F8WA 2Z30A 3AM4A 3BMXA 3L02A 4YHBA 4UTVA 1X70A 2P69A 2FX2A 2X3YA 3G5MA 1M2OA 3KQQA 1YR2A 4MLZA 2YHIA 3ETJA 3LUFA 3MA0A 4MZDA 4R3WA 3U7EB 2FPPA 4BO2A 4GWGA 1KS2A 4R2XA 4PYRA 3TG8A 1SCJA 3BREA 4LC9A 1CZOA 3IO3A 2VYVD 3WGHA 1NA5A 1YWGO 3MTGA 4NEGA 4DADA 4UFOA 1D4OA 1QHSA 3OMWA 4RFVA 3SBEA 5LDDC 1F38A 4LK3A 3HMQA 1I33A 1V2GA 3INGA 1RRMA 2XD9A 1MENA 1KP9A 1T8UA 2EP7A 1R0XA 4ARSA 4K9DA 3L7IA 4H17A 2REBA 3W4IA 3PUXA 4K9KA 1JGTA 1LRLA 2V5VA 2FWPA 4MPTA 4MWOA 4UZSA 4Y9UA 3RKRA 4V03A 1OYOA 1IWOA 4B3DA 1J1UA 1KL7A 5L95A 4YMHA 4QTTB 4CKBA 2AJTA 2VBFA 1C7IA 3I8XA 1SVNA 2Q4BA 5JWHA 4HH4A 3K70B 1RHQA 3O8BA 1VL5A 4XTRA 3VZPA 1VE6A 4F85A 1HLDA 2F1IA 2MINA 3AINA 3DFKA 2YWCA 3DO6A 1UBEA 5AJXA 5BMVA 2O7RA 3IBSA 1JDBC 4YRZA 1Q20A 1TRKA 1VJ1A 1GCIA 4II3A 4RL4A 4DIEA 5DHSA 2Z1MA 4KO1S 3RIXA 4DM4A 4BJ5A 4G5XA 1FPMA 4BKMA 3M6LA 3K0BA 2FPGB 1QH8B 4UM5A 5GMOA 3U3DA 1GU7A 2YOFA 5JRZA 2W2QA 4BLUA 1P7VA 1D0SA 3D8NA 3N6RA 3R3VA 1ZRMA 2IHJA 1AM4D 3BAZA 1CVRA 2I1WA 3EVTA 3EXHA 1NMZA 2Y8EA 4U7FA 3I45A 5C18A 4MRRA 5BW6B 5FUQA 4RQTA 3I4FA 4K6KA 4BP8A 4FKBA 1PQ4A 2PAFA 1KXZA 3Q3JB 3CCBA 3JQ6A 4H4CA 4DJTA 4JC8A 3N2GA 4TWZA 5C46F 3IIIA 1XCBA 1JQDA 5DBFA 2GD1O 5ALHA 4A5OA 1QQ5A 4D56A 1DSSG 1E4EA 3R0ZA 1MJHA 5B55A 4ZGBA 1KJQA 2LPMA 4LXUA 4B0OA 5CR9A 4F96A 4ERXA 4XTCS 3VTKA 5KHOC 2ZJBA 4EGSA 5JDCC 4B4WA 1B43A 1RCFA 3B78A 3SDSA 1RLTA 5LYJF 1JNYA 2LNDA 3Q7IA 1ADCA 2AYYA 4FOOA 1KA9H 1DHTA 2ACVA 3G79A 1NONA 3G2OA 4RVNA 4KUHA 5CGZA 5BPHA 4L22A 5T4EA 1K1EA 2QL5A 3A6ZA 1PNVA 4KR0A 1AS2A 1KMHA 4R2KA 1VHDA 2WG2A 3JD4A 5AVOA 1OILA 3RS4A 2XA1A 5HP4A 3ZVLA 2OGSA 2QAJA 1NV8A 1Z16A 1J0CA 1X87A 2G1UA 3AETB 2CMHA 3DJFA 1S9DA 1XKQA 1S0UA 1TGYA 5EJ9A 3LOQA 4EX7A 3QXHA 3EARA 3RBXA 4CMEC 4RTOA 2ZS8A 2KBFA 2HSZA 5IDWA 5HCUA 1A8HA 1SOAA 1L4MA 5L4NA 3CVVA 1MUUA 1KQNA 1G3IA 5HJ5A 2GLUA 2XUDA 2CK3A 2AFIB 4KPUB 2ZIXA 2J3EA 2ALJA 3AUXA 5DRYA 3COVA 5P21A 1JKMA 1J9EA 4N12A 1NFQA 1QIIA 1V5GA 4NG5A 1POWA 4BTEA 5JXHA 4JVLA 3S8MA 3TGLA 4CCAA 3B82A 3NHSA 2XOKA 2Y68A 2BDUA 3LX6A 4FNGA 4QOJA 4QTZA 4Q9IA 4BVKA 5KSOA 1KOGA 3U4MA 2WUGA 4L02A 3T4UA 1Z75A 3WK4A 4ZP1A 1B2LA 4IJVA 5BSUA 3TZ6A 4DDMA 2ZDHA 2PRJA 1M76A 2D5CA 3EXEB 3GROA 1IG3A 4LKRA 2WJZB 2HXSA 2PX3A 3R7WA 4D43A 4L0MA 3VDNB 3LYAA 3P9ZA 3PFGA 1YCDA 4M7RA 3WNQA 1UMKA 3ZX4A 2VPTA 4OSOA 2I0FA 1M3SA 2J7PD 3EAGA 5F12A 1O0BA 1VPTA 1CY0A 3FYDA 2BCGY 4JLDA 1UFVA 3Q12A 3TRFA 2GM4A 4ER6A 2BKEA 3I1FA 1WULS 1XLTA 3HVIA 2GCOA 5CNIA 2XZLA 4QUGA 1V1RA 4BJ1A 3ZN2A 1GR1A 1P1FA 1N2XA 1X7GA 2WJ6A 1U63A 4OHVA 1R5BA 1NYTA 1O8CA 4IL5A 5ICFA 2O8DB 4TS9A 3FVVA 4HC4A 4WFJA 1A77A 2D0PB 4GPEA 1C8LA 2NZ2A 2RGXA 1RWPA 1Y0BA 1PLKA 2W6NA 2PIAA 4D5GA 4GBJA 821PA 2PRYA 5BWBA 4C5BA 2WWRA 4HR7A 1E7SA 4X7BA 2E2WA 5E8JA 4AJEA 3B7WA 3D3KA 2MDTA 3CA8A 1UAYA 1TKAA 1UPCA 1W0JA 4LFBB 4AO7A 4PIMA 2DBYA 2F7SA 4IQGA 1QRTA 1T4GA 1GV1A 4ZMSA 3O1HB 3JRWA 5ENZA 2JC3A 2XA2A 3LUGA 1B7GO 2JH3A 3O0TA 1I7QB 4ENSA 4EJ2A 3M2PA 2CT8A 4BLQA 3OZRA 3LPNA 3GGPA 3NOQA 1Z62A 2PS1A 3DZCA 4LSZA 3AF6A 2DJIA 3ZKAA 1P1BA 2RBGA 3FCOA 3GF4A 5EMHA 2OV8A 4MKHA 1JJBA 4MGZR 2RI6A 1ZGHA 2BEVA 2C92A 3TLGB 3DCNA 3E8SA 1SVOA 3GEIA 1DEXA 1SCNE 4OHRA 4YFYA 3I9NA 3I2HA 3RYCB 3NWJA 2B2CA 3SQOA 1QAMA 4KO2S 4YBRA 4UAVA 1W94A 5EKTA 2N0SA 3NHZA 4O1MA 4BCBA 1XD2B 2YWBA 3TFQA 4G2NA 1VGRA 4Q1VA 5ALOA 4BXOB 1J06A 1ZUD1 4B9EA 3DZKA 1RQPA 1HORA 4BTLA 3BIJA 2C2KA 3U3OA 3VR6H 1Q2XA 2J3LA 3SHQA 4KO4S 5ALWA 3LPMA 3WLJA 4UAGA 3HTXA 5DOZA 1P9LA 2FMUA 1Z29A 1PI3A 2VT2A 4MV7A 5FTMA 1CU1A 5H80A 1Z38A 721PA 4Y6RA 2R7AA 4Y6OA 1TYZA 1ZVJA 1QJCA 2Z4TA 3KLMX 2B4TO 4LBZA 5IXYA 2QEQA 5K03A 3K31A 3C4QA 1SXJD 2VHQA 1RDFA 1VLJA 2YBDA 5AUPB 2FFQA 2X3UA 1T0PA 3AEQB 1O96A 1R16A 1K6IA 2OGZA 2Q6OA 3GAAA 5DGXA 2QQ5A 3FVTA 2XUAA 5DKFA 2JFPA 3G7SA 5LJLA 1CX9B 2G28A 5I9IA 4X62B 1CRPA 2BJVA 1X38A 4KSCA 4JI4B 3GP3A 4DQLA 3BUSA 2A6PA 1AOXA 1LK0A 1Z2AA 3OIVA 2CLFB 3JAKB 4NBTA 3ZGYA 3SSAA 4BO4A 1WA5A 4UBLA 2QU7A 5J2TA 1VKOA 1QVZA 2HJVA 2C83A 3IBFA 1V3QE 3ICOA 5C1OA 1QX4A 2QVLA 5J2TF 1LBTA 4NCJA 3OI7A 1Y6GA 2DETA 5ADHA 4EW3A 2BKXA 3T4XA 4CIBA 3WO1A 4EL0A 3K8YA 4KITB 3GFBA 4PN3A 1RHMA 1U5BB 2NM0A 5ALMA 5TMEA 5LIRA 3T3NA 4LJRA 1RPAA 1SRQA 3PPYA 4Z7JA 4AMBA 4EVRA 3W6NA 4JYPA 3A14A 2VP4A 5CM2Z 2V1UA 1JG4A 4INOA 4J0JA 3RROA 1ZGGA 1GQFA 4LOHA 3RSCA 4AJJA 5CB4F 5I9NA 3WMGA 2B5WA 1AQJA 5LQRA 1EESA 1LVGA 3HI4A 2CJWB 4HN4B 2Z4RA 4YAFA 5AI5A 3VO1A 4DLRA 3BD9A 4GOLD 2XT0A 2QG6A 4TTQA 4F9TA 2NTVA 4IJUA 1PRYA 2O0LA 2YMPA 5H70A 5L3VA 3VR2A 1BCSB 2H7XA 3PR3A 1D2CA 2FZEA 4MCJA 2XUIA 1FLDA 2JFNA 2ORVA 4Q7KA 3AP3A 1GUBA 3NP7A 4P38A 1AZSC 4RSMA 5K6AC 3LZ6A 2GN6A 2GPBA 3Q41A 5F9FA 1S3GA 4KKXB 3HCNA 5IARA 3TR6A 2J5RA 2OO3A 3D81A 2WA1A 3BT7A 4AZVA 5LM3A 1DOZA 3UWOA 4RA6B 4Z2AA 4ZOAA 4MUXA 4KCGA 4F1KA 2AFHA 3CX3A 4PBRA 4QT4A 1HR0B 3MGBA 5LA6A 5F3WB 4RSGA