3MCVA

Structure of ptr1 from trypanosoma brucei in ternary complex with 2,4-diamino-5-[2-(2,5-dimethoxyphenyl)ethyl]thieno[2,3-d]-pyrimidine and nadp+
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title High-resolution structures of Trypanosoma brucei pteridine reductase ligand complexes inform on the placement of new molecular entities in the active site of a potential drug target.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 93
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3mcvA00
4KQXA 4J0EA 4R41A 1LDEA 1E7QA 1ZK1A 3MWDB 4NK5A 4BKRA 1C0PA 4BO9A 2JD1A 2JAPA 3G0OA 4JXKA 1Y1PA 1NQOA 3QHAA 4PRKA 1DAPA 1YOVA 4L74A 1VLLA 1XSEA 2HQ1A 4AJEA 1WDKA 3JQ7A 1H2HA 3R3JA 4XYGA 1KEVA 1YH3A 4ALJA 3EVNA 5ITVA 2HLPA 4B8ZA 4CLXA 3ONFA 4B7UA 5JCJD 3GHHA 3UFXA 1K0UA 3L9XA 4XZ3A 3KO8A 4FQ8A 5I7SA 1K6JA 2Z95A 3PDUA 4LMRA 5LDGA 3OETA 4PG8A 4WUVA 3U9LA 2C59A 3PJEA 3HB5X 1K6IA 2YY7A 4RPLA 3U4IA 4D0SA 2VYVD 1EVIA 1QXSA 4GQAA 4W7IA 1YL5A 4DIFA 5L95A 1CETA 1B2LA 4UVDA 4YAEA 3RC7A 2R00A 1HDCA 2NU6A 4H16A 5CG2A 1Z82A 2D0IA 3DQPA 1EK5A 3DZIA 3A28A 1CYDA 1I30A 3RASA 3KRTA 2SCUA 5AOVA 4IM7A 1HL3A 2JFGA 3PXXA 4MVJF 3K73O 3PYLA 1QV6A 2EJVA 2PKQP 2CVQA 1U9JA 3WTBA 3WNVA 2DT5A 3BHMA 3RIHA 1DRVA 5T6BA 4IZIA 2VOEA 3PHIA 3M1AA 3NYWA 3P2YA 4FPXA 3PFWO 1H9BA 1H9AA 2OXIA 4B4WA 4B3HA 2NVBA 3RC2A 5A3JA 2GERA 3ZV4A 4MVJM 4I9UA 3TQHA 1Y8QA 1V3VA 1ENYA 2VYNA 1ADGA 1R6DA 4R3NA 4N7RA 4RO0A 4YACA 3AW9A 1X1EA 4CJXA 1O8CA 4CQLA 3KSDO 3ZWCA 1GTMA 4Y9DA 1YOVB 2BI8A 5B4UA 3JQ7B 3HDQA 3RKRA 4WKGA 5A4DA 2E6UX 2X1HA 1HT0A 1GZ6A 3DOCA 3G1TA 3ZWWA 4MKZA 3RUAA 4AJ2A 1F06A 1MUUA 5EQFA 2B36A 1P44A 2E82A 3RU9A 1FXSA 3F5QA 2JFFA 4YQYA 4I9NA 1EK6A 4J9VA 3E5MA 3TNLA 4Z9FA 4TKMA 4BL5A 4LW8A 3ICPA 2V6FA 3WXBA 2CNBA 1IUKA 1MV8A 1ML3A 4PLFA 3CPSA 1NQ5A 5TX7A 4S3MA 2NTVA 1DC5A 2C5AA 1NFQA 2VWGA 5GZ1A 1B0AA 3PWZA 1ISMA 2W2LD 1I8TA 5C5IA 3ORFA 2I99A 3ZNNA 1U8XX 5I9NA 3U09A 1XCBA 3K30A 1B7GO 4BO2A 4F46A 4YAJA 4FBGA 1MG5A 3VOSA 4N5MA 5DCWA 5JCXA 1IY8A 2DQ4A 1TLTA 3ITDA 1UJMA 1P31A 4CMAA 2DFVA 3MOGA 1LDGA 2QX7A 1PJLA 5IN4A 1QYVA 5TJ9A 4CMIA 3K2BA 1W8DA 2Z1NA 1T1RA 2O50A 3CIFA 4BMNA 3A1NA 4IIUA 2H63A 1XYGA 1EVJA 3GNTA 1E7MA 3FTNA 5HTOA 1ISIA 4Z9YA 4DQXA 1B8PA 1NQAO 2H9IA 3D0OA 4NH4A 4W82A 2X6TA 4NIMA 3DZFA 3PTZA 5CPFA 2HMUA 5FF9A 2H1SA 2G82A 3C7DB 2A35A 5G0UA 1LNQA 4NBTA 2AA3A 3IQDB 6ADHA 4UEKA 1PR9A 2HO5A 4H15A 2TMDA 3LT4A 1NPTO 3Q6IA 3QVTA 2YZ7A 2IEDA 3NTQA 1Q0LA 3PHHA 3QWFA 4E32A 3IKVA 5EN4A 3I9OA 5C3MA 3VVCA 4E2ZA 1AUPA 2B69A 2G1UA 4IPTA 4GLOA 4CMJA 4W9NA 4CV2A 3GF4A 2DPGA 5COAA 3D4OA 3ROPA 4E33A 1KVSA 1SNYA 3ZV3A 2QZ9A 4BGIA 4I5EA 2IRWA 4BNVA 2YV1A 1E3JA 5DNAA 3V5NA 1I01A 3K31A 3MTJA 1DC3A 2FMUA 1PQWA 4BKUA 5JMPA 3ANLA 3DO5A 2WJPA 3Q1LA 3JD3A 3ZHYA 5B12A 3NRCA 2BFOA 3QV1A 3R3SA 1LLQA 4YRAA 4LN1A 1D3AA 1NVMB 1ZJYA 2IZ1A 3UCFA 4RF3A 3ANMA 3L6EA 4MKRA 2I76A 1HXHA 3D3EA 5DBFA 1NVGA 1DXYA 4XDYA 1ARZA 3RUDA 3ZHXA 1T2DA 3VVBA 5JNLA 3PJDA 3NDRA 4B3IA 3RC1A 4JJFA 3BMCA 4CMIB 2FY8A 2YDYA 3TOZA 4M86A 2O2SA 3DTYA 4GI2A 1DB3A 3JYPA 4D3DA 3GVPA 1SMKA 1VRWA 3PFFA 3HQ4O 4E13A 1SAYA 2ZQYA 4M1QA 4F45A 1AHIA 5DT9A 1LLDA 3RKUA 4TZTA 3H8VA 3H2SA 2YHUA 1N1EA 5COQA 4W4TA 3JQ9A 3IOYA 1ISJA 1ZO8A 3HDYA 1UAYA 1XGKA 3I52A 2VZ9A 1GDHA 1Z6ZA 2EG9A 3HN2A 4YQZA 4XR4A 1SOWA 1EMDA 2P91A 4MP6A 3D64A 1YO6A 3E9NA 5JS6A 2NU8A 3H2ZA 1IB6A 1PZEA 2FR0A 3OJFA 1M2WA 5JDCC 4E31A 2PNFA 1MP0A 2ZJ1A 4K1LA 4J9UE 3DAFA 4J7XA 4YCAA 3UKOA 4MJLA 3EAGA 3KLPX 4FGSA 1Y5MA 3VPFA 4EJMA 3ENNA 3HE3A 4J3FA 3ZHBA 1OI7A 3IDSA 4QSMA 1EE9A 3V1YA 1AGNA 3ROQA 3BHIA 4J6FA 4YT5A 3DHEA 4GL4A 4OIMA 3GPIA 4WE3A 1B8UA 4K9DA 4XEHA 5IZCA 1S7CA 3FBGA 2I9PA 3QSGA 1W6UA 4WEOA 3KBOA 1IYZA 4RV9A 3STHA 3U49A 5EPOA 4B4OA 5TLSA 1HLDA 1PGJA 2G0TA 2G5CA 4WLEA 3DXFA 2VCYA 3BMCB 3O8QA 3GGOA 1LRLA 5COBA 3CEAA 4ROSA 4GX2A 4EGFA 4OGWA 1ISHA 5KJEA 3AU8A 3JD1A 3HN7A 1HETA 4JK3A 4LK3A 1D7OA 3K6JA 3DZGA 4HX5A 1ZK2A 4FW8A 1VM6A 4N5LA 2AG5A 1LA2A 5JYDA 2Y1GA 1HSZA 1Y8RA 5K6AC 3GT0A 3I1JA 4WLFA 2FZEA 1IHYA 1A5ZA 1X15A 2YDXA 5DP2A 4I5FA 4XJSA 4J16A 1V3UA 1LSSA 3F9IA 4CLRB 1R15A 4WPGA 5L51A 4NI5A 4CQMD 1JVBA 2QYSA 3F4LA 2ZK7A 4PIVA 3OJEA 1XU9A 4YTEA 5B4TA 4RVFA 3M2TA 3RBVA 5HA5A 1QSGA 1IPFA 4E5NA 3KEQA 4MP8A 5TQVA 3N74A 4IDFA 3GH3A 2Q1WA 3BYZA 3FRJA 2OUIA 1DRUA 4A10A 2V6GA 3JSAA 3B20A 3DL2A 3B1FA 1T2CA 4DPKA 3GDFA 3NGLA 4IDEA 3AU9A 3QWBA 1YL6A 4GVLA 4IMPA 3OM9A 5CAEA 3DBHA 3KHUA 3OFSA 3W1VA 2XF8A 2E49A 4CMEA 3QVOA 1OAAA 3UGKA 1HE5A 1GEEA 1GFSA 4XIJA 2GDZA 1HYGA 2JAHA 4KMSA 2POQX 2Y1FA 4XIYA 1K2WA 1DIGA 3OJOA 4IQ0A 3ZWOA 3IP3A 2OOSA 1ZVMA 2J6IA 2QIOA 4P4LA 2J3KA 4QX6A 1A7AA 3WBBA 1LQUA 4HV4A 5A3VA 5TT1A 3OJLA 2FPIA 2OORA 4AG3A 1HDOA 5KNLA 4M8SA 1IULA 2HK7A 5TF4A 1QYDA 4HNHA 4RZHA 1VE9A 1Y8RB 2PWZA 3QVSA 4QEDA 2EV9A 5CEEA 4RDHA 4DBVO 2X9VA 2A94A 3AY6A 2D59A 4Y6RA 2ZJ0A 4KDFA 2W4QA 3LU1A 1DFGA 4FGWA 5BNTA 4PRLA 1RYEA 3C1TA 5KTKA 4UVIA 4CLOA 1I2BA 1MG0A 4FFRA 4BMSA 3S8MA 3D5QA 3VPHA 4UVEA 3WGZA 4DL9A 4X54A 4PG6A 5DF1A 5L7TA 4GVXA 3HUDA 1ULSA 4GWKA 2B4QA 5KVQA 4EJ0A 1PIWA 5A9TA 1BTOA 2W8ZA 5F1PA 4CLEA 1I3MA 5HS4A 1RM5A 3WGOA 2BF7A 3GHYA 1WDLA 4IQGA 3GK3A 3WGGA 2EIHA 1E77A 1BXKA 3OEWA 2W2KB 5L9AA 3LT0A 1KVUA 1UXGA 4U0KA 5G4KA 5I8ZA 1Y5RA 1ADCA 2X9GA 3GVIA 2B5WA 1PWZA 8ADHA 2Y1EA 2JD2A 2DBZA 1PTJA 2BFMA 4PLVA 3AM5A 4Z0PA 4OYRA 1HDGO 1I36A 1H6DA 4ZN6A 2VUUA 3K8ZA 4PZDA 1NFFA 2DC1A 2D5CA 3GNQA 1E3EA 1X1TA 4PZEA 2Y1OA 3LSYA 4HKTA 4N54A 4BV8A 4RVSA 4YYZA 3I9JA 2V7PA 3QIVA 4LVCA 3G1UA 1CDOA 4Q3EA 2GN9A 1GZ4A 1KYQA 1UXKA 4I8XA 3MJEA 2JD0A 3DMTC 3VKUA 3QA9A 1LQTA 3QW2A 4KTTE 4E12A 2PZKA 2JFHA 3NX4A 3ZV6A 1UDAA 4FSHA 2VHXA 1XQ6A 1Z7EA 4DMLA 1GZ3A 4YJFA 5JE8A 1LLCA 2CVZA 1I0ZA 1NWHA 4EW6A 3GA0A 4Q3BA 3G79A 4A2CA 3WG9A 2UAGA 2NV6A 2GCGA 3PLRA 3W4IA 1UP7A 1AN9A 5JCJA 3H5NA 2HRZA 1JAXA 1ENOA 4XX0A 1DHTA 2H5LA 1YQGA 4L75A 4WLVA 3GY0A 3E48A 4NHEA 1LEHA 4DIBA 3IUSA 4WJZA 4CV1A 1ADBA 2JL1A 1WLYA 1WMAA 3RBXA 3C7AA 3PHJA 1GY8A 4A0SA 3JYOA 4J43A 5G4LA 1M75A 5JAQA 1SEPA 3RD5A 2ZYAA 1HYEA 2HK8A 1S6YA 2PD6A 3WGYA 4Z9XA 5G4KB 4D43A 4MVJI 4IS2A 1EFKA 3CSDA 4M54A 4BQRA 4IDBA 3MTGA 5BNFA 1O95A 3ZNOA 2PGJA 3WX0A 3W6ZA 1KC1A 1FK8A 2BHLA 2FPGA 1TVEA 1H6BA 5L4SA 4EDFA 2AQIA 1GUYA 5JXWA 1B16A 1Y81A 4ZQGA 3QWHA 3JYLA 4H7PA 1R4MA 3KVOA 1L1FA 5GMOA 4E0BA 4IUYA 5JY1A 1YBVA 2VQ3A 4Q3NA 2Y66A 2J5KA 3AM4A 4O63O 4D45A 1H6AA 2DM6A 3PIIA 4XDZA 4XQCA 5AXAA 4DA9A 4XQ9A 4FOOA 5T57A 2D1YA 3I9LA 3U4CA 1JVSA 3UAGA 2O3RA 4BNYA 1GV0A 3VZSA 2PTGA 2XPCA 4GGPA 2IXBA 4F6LA 4CUZA 2IEBA 5L4NA 4UUNA 1QYWA 3HFGA 1XR3A 1X14A 3RI3A 3S2EA 1ZKMA 1JQBA 1QLJA 3E9MA 3SC6A 4KUHA 4BQPA 4GMGA 2P4QA 2QRJA 3H9QA 3WICA 1MFZA 4KWHA 5IF3A 4D3SA 3GG9A 5ENVA 2I65A 4BNXA 2X5JO 1ZIDA 3NUGA 3H5RA 4DQVA 1HDRA 1UP4A 5CPBA 1NFRA 4HFMA 2Q3EA 4FN4A 1XDWA 4B4VA 3A4VA 1UZLA 3C1OA 3AI1A 4I5DA 3RQSA 4HUJA 1C0LA 1LUAA 1CIVA 4G5HA 3IAHA 4ZD6A 3E82A 4QO7A 3A9WA 4E5KA 5G0VA 2EKPA 4ZU3A 1XLTA 4M87A 4R9SA 4YAIA 3WR5A 5JC8A 2W2LA 3DHYA 1E6EA 1EDZA 5LDHA 4CR8A 3BTUA 1DIRA 2AW5A 5KJ6A 3VZQA 4L9RA 3WQQA 4GH5A 3E5RA 3DZKA 1N7GA 1GR0A 1OBFO 3P5SA 4PLYA 2OL4A 1FDTA 2X5KO 4I08A 1PWXA 1R4MB 1ZUD1 2P5UA 3BAZA 3WSVA 5EL0A 3A06A 2CD9A 1PSDA 4J1NA 2HCTA 5ER9A 1PGQA 3K96A 5EJ2A 2LDBA 4FFNA 4FC6A 2WE7A 2ZIZA 5A1TA 4GMFA 1GPJA 4IGFA 3Q11A 4WNIA 4ZQBA 5KIAA 3I9NA 2W90A 4PG4A 4B4UA 3WDSA 3PYMA 1D1TA 1U3UA 2OZPA 5B1YA 4IS3A 4R68A 4YR9A 2O7SA 4NQZA 4C4OA 1U3WA 3PGXA 4R16A 1PL8A 1WDMA 2NNLD 3BMOA 3F47A 4B8WA 2EP7A 3NKLA 1CERA 4YB8A 3D4PA 1YQXA 4AFNA 3L0DA 3L9WA 4DLBA 2EXXA 3I4CA 4QO8A 1SC6A 4CR6A 4YJDA 4R5MA 1CF2O 3FTPA 2IZZA 4MVJH 1YBAA 4DC0A 1C1XA 1MA0A 3QE3A 4WLUA 3GOHA 4NG5A 1J0XO 1DAOA 3F4BA 3S1LA 3EZLA 1A27A 4E5PA 3ZW9A 2C0CA 3EZYA 4IIVA 4OO3A 1ULUA 3WBFA 1PGNA 1W0CA 4RQTA 4EJ6A 1L7EA 9LDBA 2C07A 3AUTA 1ZCJA 1QG6A 3BMQB 5L7WA 1HDYA 1DFHA 2NQTA 2Q50A 4CLHA 3LYLA 2EKLA 4DPMA 2WYWA 1M76A 4RL6A 2B37A 1EQ2A 3LF2A 1A72A 1DHRA 4MIEA 2HDHA 4CM8A 1X0XA 1ZXBA 3GDGA 4R5HA 1O9BA 2HRBA 3WWZA 2BLLA 2TMGA 4BNWA 1HSOA 1GCUA 1HDXA 1NBOA 4IDDA 1NHWA 2ZCUA 1NYTA 3PGJA 1KVRA 4BNIA 1LI4A 5DDIP 1JN0A 1V6AA 4PLGA 3DFZA 3OSUA 1N8KA 3PLNA 1CJCA 2A9FA 4LRSB 3GZNB 4WEQA 1BVUA 3GPDG 3OF2A 1HLPA 1SCUA 3DOJA 2GF2A 2JJYA 2A92A 3D1LA 3BMOB 5ER6A 1C14A 1HZJA 3JQBA 4PZCA 4UUMA 3QP9A 1R4NB 1P0CA 5THKA 3VAZA 3LC7O 3W4KA 1PQPA 3E6AA 3UN1A 4XGNA 4ALLA 3WGHA 4EEZA 1GADO 3WJ7A 3IJRA 2C2XA 3KOUA 1C1XB 2Y0CA 3TL2A 3V8BA 5A5EA 5B4VA 2Y0EA 1R12A 3I6IA 3HWRA 3WIDA 1U7HA 3V2GA 3MOIA 2NVWA 3GAZA 2AEFA 2ZTUA 3WTCA 3TF5A 3ADPA 4IY1A 4BV9A 3F46A 1Q2XA 2JCXA 3PZRA 1E1MA 1N2SA 1YDEA 2BFPA 4NPCA 4WCFA 5HRUA 4Q3CA 1DLIA 5L40A 5KCZA 4XYLA 4J7UA 2EGHA 3RFVA 1GL3A 1D1SA 5I9LA 4TMFA 3VPSA 1SB8A 3UW3A 1LSUA 1K3TA 3SBOA 2GGSA 5DP1A 1LDMA 2FPPA 3UXYA 1H2BA 3T4XA 1U3TA 2X9NA 5JC1A 3NTRA 3ETDA 1VJTA 1VL6A 4LGVA 2ZQZA 1DBVO 3DBLA 3GRKA 4K6FA 3ZDFA 3U4DA 2NUAA 2AXQA 3JQAD 4C7KA 1CEQA 3TN7A 3RCBA 3H5AA 3QWAA 1O94A 4JX8A 4R54A 3FNFA 5MDHA 5H81A 3NTOA 2B4TO 2C29D 4NU5A 3QVXA 3W8DA 1FDWA 4RVGA 3TZKA 5F3RA 1WPQA 1NAHA 3NT4A 4E3ZA 3IP1A 2B4RO 4OQYA 5GZ6A 1NXQA 3ZNPA 1P77A 1IHXA 2NU7A 4Z0TA 4EYEA 4BNJA 2Q1SA 5BSFA 1Y8QB 5L53A 4D46A 4AJHA 3NDIA 5IZCC 1NPDA 1WW8A 4U6QA 1T2FA 3OA2A 3NAQA 2AEMA 1E5LA 4CQMA 4LSWA 1HE3A 1U28A 4RQUA 4TRJA 4CQLB 1E0DA 4RORA 1HE4A 1PJBA 3PVZA 4WNCA 2DTXA 3L4BA 1YRLA 1O6ZA 1WNTA 4OSOA 4OKIA 3W6UA 2CZCA 4KUGA 4YXFA 4JQCA 2VTDA 1E3WA 5IG2A 4IMRA 1B8VA 1HDZA 1ORRA 2CDCA 1ENZA 1PJSA 1XU7A 2WYUA 4NFSA 4KWIA 2HKIA 5ILOA 1YKFA 2P9GA 1O5IA 2VWPA 3I3OA 4NBWA 3ETGA 3TFQA 3G49A 5U9CA 1BGVA 1OMOA 4J91A 4E5YA 5T64A 5A9SA 2X86A 3EDMA 4PLCA 4TRNA 5B37A 6LDHA 4AJNA 1KS9A 3ITKA 4H3VA 3PDJA 3GGGA 1QORA 1ZEMA 1EUZA 1AHHA 3OIFA 2HMWA 3OIGA 1X13A 2W98A 2I66A 1PS9A 4FFMA 1LJ8A 2NSDA 4KZPA 4D0RA 5IFLA 3DDNA 3IJPA 1E7YA 4OAQA 1TT5A 4R9RA 1RPNA 3KYDA 1DIBA 3V2HA 4FJ1A 4YEDA 3DBLB 3VDRA 2C7GA 1B14A 3FHLA 4BVAA 5EINA 1E1LA 3CTMA 4R1TA 3ZWMA 3ZWXA 3GVCA 1QR6A 4K26A 3NT5A 2PZMA 4PLTA 1ADFA 1P1KA 2X0JA 4DPLA 2I3AA 2CFCA 1KY4A 2AQKA 1Z74A 3FR7A 4FC7A 4DUPA 4XQGA 3VHRA 3R6DA 2NTNA 2AMFA 2DVMA 4IDAA 4ALKA 3A14A 3RC9A 2DLDA 2YFQA 4QXMA 4BO7A 1AXGA 3FSRA 4K6CA 5GY7A 2DTEA 2RIRA 4RLSA 3JV7A 3GVHA 1D4FA 3PWKA 2O3SA 3S55A 2O2YA 4HFNA 1BW9A 1C0IA 2BKAA 3ASVA 5G2OA 3UHAA 4N5NA 4RPJA 1UUFA 1KY5A 1WAMA 1MXFA 3P19A 5A02A 4LCJA 1E1KA 3DBRA 1LC0A 4I9HA 1UDBA 2WYVA 4LVUA 1E3WB 5LCXA 3LF1A 3SJUA 4ZRMA 2E37A 3ZGYA 3EC7A 3C1AA 1NWCA 3RUFA 5A9SB 2I67A 1Q1NA 4IGEA 3HDJA 4CMCA 1I32A 3KYCA 4URFA 4PGFA 2HJSA 2GZ2A 3H9GA 4RPHA 3ZU5A 3QJ5A 2O7QA 2BH9A 2VWQA 1C0KA 3RU7A 4ND1A 2RHCA 5FI3A 1FDVA 2WWRA 4HBGA 4XWYA 3PIDA 2YV2A 1U1IA 3X2EA 4KP7A 2BD0A 2CF6A 1LC3A 5CDGA 4OXYA 5JLAA 1TT5B 2ZYGA 4L73A 3FPCA 4XR9A 3L4SO 3G17A 3LC1O 2QRLA 3JQ8A 1QP8A 2O4UX 3GQVA 3LLVA 3HHPA 3VDQA 2YHIA 1I2CA 3RJ9A 3OP4A 4ZQHA 1N9GA 4TWRA 3ROMA 4BKOA 1X7HA 2YQ4A 1XQ1A 1NHGA 2WE8A 4JBIA 4RGBA 1R0SA 4XD2A 2EP5A 3GN2A 4QT0A 3C3XA 1HYHA 1D8AA 3KXDA 3ON5A 1P1IA 3VTFA 3D4NA 3RUHA 1EFLA 4TVBA 1BW9B 4OH1A 3ULKA 3DAPA 3EK2A 2AG8A 1EE2A 3AUSA 3SLKA 1T1SA 1QLHA 1ZZEA 2I3GA 2VRCD 3BHJA 5H83A 3DBRB 1TB4A 5CEJA 2V6BA 4NU6A 5L45A 1KEPA 4CR7A 1LBEA 5AXCA 1DO8A 3AUUA 1RM0A 5A04A 1ZBQA 5DZSA 4AVYA 3LZ6A 3K92A 2V6MA 2OP1A 1MXHA 2DBVO 2H6EA 5THQA 3BTVA 4FFOA 4NJMA 4J2HA 3W8EA 2UUOA 5I9MA 3MJSA 3PEFA 3OICA 1R0LA 3AM3A 4CLDA 2FZWA 5KVSA 2DAPA 4UVHA 1UXHA 4ONEA 1PS8A 4HFJA 2ZKLA 4IJKA 3WSWA 2NWQA 4E2XA 1YL7A 1X7GA 2G76A 2WD8A 1VPDA 3GVXA 4L4XA 4MDHA 1JWBB 2VHYA 4DYDA 3V1UA 1HE2A 3SXPA 4CPDA 1WWKA 1Z73A 5JAZA 2YV3A 4RLHA 2VHZA 3LDHA 5T8KA 1CRWG 2WD7A 3D5TA 1N1GA 4U6SA 3M6IA 2Y1DA 4BO1A 4Q9NA 2Y0DA 4IDGA 4XB2A 3O8QB 3DAGA 5ITWA 2VHVA 1GQ2A 1I10A 1MB4A 4Q3DA 2GZ3A 4JCOA 5T67A 5JO0A 3L77A 1LDYA 3WIEA 2NVUA 3K2EA 5G0SA 4BNFA 4NK4A 4J49A 3IS3A 1C3VA 1ZW1A 1KOLA 4A27A 1ONPA 1P0FA 2EW8A 2C5EA 3FNHA 5FI5A 1B15A 1WMBA 5KWEA 2NQ8A 1P1RA 3I9MA 3O9ZA 4FDAA 4WLOA 4QECA 3H6KA 4L4RA 3EGOA 1E5QA 3UH1A 3I83A 4WGGA 2P2SA 2CF5A 1Q0QA 2J3JA 1U5CA 1TEHA 1R16A 3PZBA 3ZWVA 1WZIA 4GWGA 2ZB7A 2DTDA 3TL3A 2DFDA 4MVJE 1PZGA 3HADA 3I23A 1V35A 4IBOA 4J2OA 2QG4A 1IL0A 4QQRA 4R51A 4TSKA 3L6DA 4CM6A 1X7DA 3X2FA 4IJUA 4BHTA 3CE6A 2JKVA 3H3FA 3FNGA 2GNAA 3RVDA 1JW9B 3UCEA 1MC4A 2X0RA 3NGXA 3QRWA 1YB4A 1E6WA 5CEFA 1P1FA 4OSPA 3TRIA 3PYXA 3DBHB 2UUPA 5A05A 2R6JA 5KKCA 1HTBA 4ND4A 4GLLA 3DC2A 3VZPA 2VOJA 2G17A 4DMMA 1JA9A 4FIZA 3NT2A 4Z3DA 3PQFA 3SC4A 4BS9A 4FJ2A 4PLPA 3VPGA 2J3IA 3AUAA 4CM5A 1GYPA 5ILGA 4AJ1A 5F5LA 4BNZA 4YRBA 4JNKA 2Z5LA 4GBJA 2ZTVA 1XWFA 2Q45A 4C7JA 1BXZA 2J3HA 1Y7TA 3KLMX 3OECA 4Z3KA 3P7MA 1F14A 1NM5A 3H3JA 3CUKA 3GUCA 1VI2A 3JD2A 1DLJA 4NBRA 1ZK0A 1PGPA 1BVRA 1ZJZA 2IDZA 4R1UA 4WCDA 4YJGA 4BGVA 4XYBA 1UAGA 4FR5A 4PN3A 5K6AA 4BO6A 3GDOA 1JLLA 4CMGA 4CLOB 3PP8A 3AFNA 1YONA 1UDCA 1N7HA 4RF5A 4JROA 2OGUA 3GRPA 3OQ6A 5FFFA 4AJPA 4QFCA 1NR7A 5L4LA 2FHSA 4AJJA 1GUZA 1F8FA 5KKAA 5A06A 4OL9A 3CINA 1ZMOA 5C7LO 4FFLA 1P45A 1IZ9A 1F0YA 3Q0EA 4E4YA 4QFDA 3AWDA 3BA1A 4CM4A 4RVUA 3K9QO 1ZNQO 2DKNA 3RUEA 3UF0A 1NQTA 1UXJA 2OMEA 1XEAA 3DZBA 1AXEA 5CHEA 1EDOA 3MWEB 3N58A 1ZK3A 1MLDA 3W8FA 5BSEA 5CDTA 3GZ4A 3CXRA 4DREA 4E5MA 2Y67A 3DMYA 3AY7A 5JDIA 1B3RA 4S1VA 2VT2A 3S2GA 2UV8A 2NADA 1QV7A 4KUEA 4YVFA 4U5QA 3ZW8A 2D2IA 3JQEA 4CM7A 1WXDA 5AXBA 2O3TA 1G0NA 4BNHA 1EBFA 1KVTA 4NFHA 2PLAA 3B6ZA 3I6QA 2R00C 4Z6KA 1A7KA 4GPD1 4HXYA 4A26A 3MCVA 1CQIA 2FR1A 1XG5A 4QUKA 4NBUA 1U3VA 2QRKA 4YJFB 1EUDA 1Z45A 3GC6A 1JWAB 3QVWA 4GGOA 4TRRA 4DLLA 3F6YA 3IUPA 2BRUA 3NDJA 4AICA 5I8WA 2EW2A 5HM8A 1IOLA 3ZHZA 2ZB3A 3ZI0A 4NZ9A 4BO5A 2XAAA 5TT0A 2AE1A 3JQBC 3FCOA 4RPKA 1JKIA 5EIOA 1RWBA 2EF1A 4BNLA 4XA8A 3SEFA 1F17A 1IPEA 4IQ8A 4J4BA 3OMLA 3DTTA 4NR0A 4OQZA 4F3YA 3MJCA 4HNGA 3WQRA 2PKRA 3EHEA 3FN4A 3TWOA 4CM4B 3WGIA 4XGIA 1BXGA 1PEDA 2EKQA 1A9YA 3AFMA 3RUCA 1DIHA 2YW9A 2ZYDA 4XGKA 2HUNA 2X4GA 2X58A 1M67A 3JQAA 2VTEA 4OMUA 4D3FA 3TFOA 4E30A 1M6WA 1OFGA 4TKLA 3FPLA 4XCVA 3TZ6A 1MFPA 5JMWA 4BNTA 1KETA 3DOOA 4OOFA 3U3XA 4ESOA 4BUCA 1PJ2A 4ZGWA 3ASUA 1EVYA 1I3KA 2IXAA 2P68A 4R1SA 4WASA 3WQSB 1KVQA 5CDUA 4JN6B 2PR2A 1GCOA 3T7CA 4NFYA 3WOHA 1ZSYA 3GEGA 4WLNA 5F1OA 4GX0A 1MGOA 4M89A 3RROA 2P9EA 3GMDA 4BO8A 4CMKA 1T4DA 2V65A 5G0WA 4IDCA 1NPYA 5JAIA 4GSKA 2IYPA 4J1SA 1VJ0A 2VT3A 3KSZO 4IJVA 5TJHA 5JYEA 1EEHA 1I24A 2PGDA 1NAIA 3GUYA 1ZFNA 3WMXA 4J90A 4MP3A 4P38A 1PU2A 5EMHA 3VKVA 1SZJG 2F1KA 4XYMA 5DULA 4YT4A 1VKNA 3ABIA 4CM9D 2PZJA 3MEQA 1TI7A 4BO3A 4CODB 4DBZA 4YBZA 2VWHA 1GU7A 4EITA 4O6VA 3PI7A 3Q2KA 4YAKA 3INRA 2PH3A 3SVTA 3PQDA 1FJHA 3C8MA 4ZICA 3L4BC 3ETEA 4YJHA 1DSSG 1PL6A 1HF3A 2BGMA 2UYYA 1P1HA 2ZB8A 4CL3A 1ZK4A 2BMAA 3JQAB 4BO0A 3WLEA 4ZRNA 5AXDA 4DYVA 4RCVA 4B7XA 1KIFA 2FWMX 1JDJA 1HZZA 5FWNA 4ZA2A 2RCYA 1B3BA 1CWUA 3ZWAA 1XELA 3AOGA 2ILTA 1GV1A 4CL8A 3DZHA 1FDSA 2VZ0A 3CZMA 4AJOA 2J8ZA 1H0KA 1TXGA 3HDHA 3NV9A 4W99A 5TS3A 1DJNA 1SB9A 1Y9AA 5H82A 2D4AA 3IL2A 3E03A 4L0QA 4B79A 4BB6A 4W9NC 3ZN2A 2Y68A 3AI3A 1V8BA 1PS0A 3TPCA 1N92A 4OJNA 3ZV5A 1XHLA 3DHNA 5ES3A 2LDXA 4FB5A 1U8FO 2BFAA 2B35A 2FR8A 4L8VA 4R1NA 3EY4A 1H93A 4KDEA 1BMDA 1PZFA 1E7WA 3KEOA 1F12A 4P4GA 1PJ4A 4EI2A 2JHFA 1PX0A 2UVDA 1ZEJA 3ZU3A 2NACA 3MJ4A 4TZKA 1GAEO 3RUIA 4EUEA 2GYYA 2GRAA 5C7IO 2JHGA 4IXTA 5DBIA 1DEHA 4E6PA 1P33A 1Q7BA 3CKYA 4A73A 4RJTA 4PLWA 3PQEA 5IDWA 1H5QA 2ZCVA 3FI9A 4BNNA 2UDPA 1T25A 5EESA 4AJKA 3Q2IA 1YVEI 4ZHSA 3DZJA 2D5AA 3KM0A 4J4TA 4LISA 4MKXA 4WOJA 3LLSA 4UEJA 3GR6A 3HSKA 4GAEA 9LDTA 2VZ8A 1ZMTA 3V2UA 3H9JA 1YB1A 3EYWA 3GEMA 4YJHB 1HKUA 1LTHR 4KQWA 1FDUA 3AOEA 4O1MA 4EZBA 3INTA 5IZ4A 2NTJA 3FNEA 3JQGA 4BNUA 4OXKA 3HJAA 3JQ9C 2FSSA 3RFXA 1YGYA 4J1QA 1U5AA 4K28A 4G2NA 1KBZA 2EHDA 3NEPX 4UREA 3EMKA 3AJRA 4CM8B 2BI7A 4E21A 3K5PA 2HMVA 2GSDA 5JFOA 2J5QA 2GUGA 1VJ1A 4MPDA 1T24A 4D79A 3ENKA 4LCEA 3VH2A 2ZTMA 3JQDA 1U7TA 5TNXA 1Q0HA 1YS4A 3PPIA 4ZQEA 2WMDA 1R66A 2IODA 1A4IA 3U0BA 3ZU2A 4D7AA 1QKIA 2EWMA 3JQFA 4LRTB 4BIIA 2PD4A 3RJ5A 3GAFA 1K6XA 4IJWA 1T26A 1H6CA 2GZ1A 4I5GA 4MVJP 3ZH2A 1TA4A 2VRCA 4R3WA 1JKJA 3WJAA 3WYCA 5F5NA 3WYEA 4LSMA 3ZWNA 1E92A 1Z75A 4QTZA 1VSVA 1XIVA 3KSUA 2CDBA 4JBHA 2YUTA 3I4FA 3VZRA 5KOIA 4PLHA 1OOEA 3SX2A 3Q3CA 4LMPA 4RF4A 4U7WA 2C2YA 4IZHA 2RH8A 3H65A 4YDRA 4AJLA 1T2EA 4TROA 1LU9A 2NM0A 1MC5A 3WLFA 5T5QA 5BQFA 1T4BA 4NDNE 2Q49A 1RKXA 1SO8A 2CMDA 1QRRA 5U1PA 5JSFA 1XKQA 2OHXA 1UXIA 4MIOA 1P9LA 1QYCA 2GN8A 1YBMA 3ADOA 4HP8A 3VTZA 2X0NA 1DFIA 4MVJA 4WCFB 2QYTA 4JP3A 3JTMA 3JQGB 1ONOA 4CMHA 1HEUA 3KUXA 1NTOA 2DUWA 1L7DA 5K0ZA 1UH5A 3TSCA 1ZXLA 2CDAA 2C7VA 3JYQA 3UOGA 3ONEA 1EQUA 4OOEA 3D7LA 2PA3A 5L7YA 1VC2A 4XQEA 1UR5A 4DIOA 2HSDA 2CY0A 1PJTA 4DLAA 3CZRA 3VH4A 4WECA 5JAMA 2A4KA 3ANNA 2RBEA 4JBGA 4OKNA 1V3TA 5K9ZA 4BO4A 2Q2QA 4CUKA 5A9RA 2PKQO 2F00A 3T4EA 4MVJG 3WGTA 1A9ZA 1V0JA 1EUCA 2O4CA 4BKQA 5A5FA 1IE3A 2BELA 2OFPA 4FS3A 4J7CA 4ALIA 4J0FA 5ICSA 1J49A 2XOXA 3BIOA 1G1AA 2OBYA 2QQ5A 4RVDA 2CVOA 2Q1TA 4FOSA 4CM1A 1GYQA 1UP6A 4E2YA 3LVFO 2GN4A 2Y05A 4UUPA 4ZVVA 1EBUA 3Q9UA 4CMEC 5TIIA 5T8KC 3MJVA 3FWZA 4Y6SA 1ENPA 2OBNA 4CQMB 1R0KA 5A03A 4N18A 7MDHA 5KJ1A 3PJFA 1G6KA 1BRMA 2PGLA 1DC6A 2PFGA 4B3JA 3EW7A 2YQ5A 2RH4A 2OO5A 5F21A 4JJGA 2O3UA 3HNPA 1Q7CA 2DU8A 3IIEA 2PZLA 1LXCA 1E3LA 1U4OA 3OQ1A 4R69A 2GLXA 2OP0A 3TDKA 5ENDA 5GZ3A 3I9KA 1JKFA 1RYDA 2HAEA 4PCVA 3IKTA 2JCVA 2X5OA 4O59O 3S2FA 3RBZA 2AQ8A 4R01A 4EEXA 3IMFA 4XRGA 4U8GA 4MO2A 3KYBA 2I6TA 3QY9A 1AE1A 3GN1A 3KV3O 4GKBA 1E6UA 1X0VA 3TZCA 4EBFA 3TZQA 3JQCA 4ZQFA 1IZ0A 2AHRA 2P4HX 5IDYA 3COSA 1ZSVA 3LC2O 4MINA 4TQGA 2EERA 3KYDB 3R0IA 3PK0A 4PFJA 2VYND 1TT7A 2RAFA 3OEYA 3F3SA 4GX1A 1BDMA 1DOHA 1J6UA 4CLRA 4ZJUA 2YJZA 4L4SA 3OHSX 4UEOA 4NJOA 3UICA 4DVJA 5J23A 3JCZA 3Q9NA 5C7OO 2CSUA 1Z7BA 3I5MA 1YB5A 3WWYA 3OJ0A 3C24A 5TRTA 3DWFA 3PHLA 5IJZA 3DEYX 1J4AA 3HZZA 3DBVO 4HWKA 4P22A 2HMTA 2PD3A 1J5PA 2D3TA 4E2WA 2Y99A 3U62A 1DRWA 4OXNA 3F1LA 3M1LA 2X23A 5IDXA 3FR8A 5HBRA 1GD1O 4ALNA 5JBIA 2Q2VA 1W73A 3TJRA 5DN9A 1BSVA 3LK7A 4KTVE 3QLJA 5CP8A 1E7RA 2O48X 2P9CA 4BGEA 4KOAA 2IE0A 3HG7A 1VSUA 2NLOA 1BWSA 5DCYA 3CMCO 1P74A 3KYCB 1N5DA 2B5VA 4Q3AA 4YPOA 3PJGA 2AQHA 3U4HA 2GASA 2EJWA 3JQ6A 1G0OA 1R37A 2IYOA 3ZWYA 5TC4A 3OBBA 2B0JA 2E48A 1LLUA 4MVJD 5KVCA 1GQQA 2EGGA 3C7CB 4IXWA 4ND3A 3JQ8B 4DQUA 1UZNA 3G3EA 3OH8A 5G0TA 4BGUA 4YAGA 3BZUA 2YHIB 4J1TA 2VUTA 3S2IA 3DR3A 1JTVA 1YJ8A 2PK3A 1LSOA 4HY3A 1N9GB 2PY6A 3HFSA 3P2OA 3D3WA 5FYDA 4PG5A 1SEVA 1I5RA 2VN8A 1K89A 5JW6A 2BGKA 4DTIA 2Y93A 5ICMA 2ZB4A 1JU9A 4FJ0A 1NVTA 4A03A 2CUKA 1I2ZA 3BMNA 2R2GA 3PWSA 3KB6A 4WOKA 3WS7A 2YFHA 3GNSA 4BMVA 5BNIA 4Q39A 2FP4A 2W2KA 1B26A 4NBVA 1A71A 4DC1A 4OHUA 3KETA 3B70A 4P8RA 3SJ7A 3E8XA 1T2AA 5JDIC 4CV3A 2HK9A 4PVDA 3BTOA 4XKJA 2B83A 4M55A 4RZIA 3SLGA 2EEZA 1GYRA 2WEKA 3V1TC 2NU9A 4FFPA 2Q4BA 4NJMB 5JPIA 3CH6A 5KJFA 5KJCA 5KVVA 2QW8A 2ET6A 2X8LA 4YRDA 4CM3A 4O0LA 4BNMA 5CFZA 4ID9A 2Z1MA 4J4HA 1NX6A 1PQUA 2YYYA 4PG7A 5U4QA 1A4UA 3AK4A 4AJIA 1SOVA 3CMMA 5BSGA 4DRYA 3QQPA 1UZMA 2FRDA 5AYVA 4EUHA 1LRKA 5EERA 3OQBA 2Y1CA 3FD8A 4RDIA 4Y6PA 4FCCA 2AEJA 2VHWA 4G65A 1ZSNA 3F1KA 2HU2A 2D8AA 2Q46A 5JDCA 3NJ8A 1PL7A 2VNAA 4CV0A 3D3WB 3WB9A 1DC4A 4DXHA 5ADHA 3PHGA 2X7HA 4WK6A 2WD7B 3PRJA 1LRJA 4YA6A 5FEUA 1GEGA 3O38A 1PGOA 4GX5A 1P1JA 3IC5A 3T7EA 1PJ3A 1ISGA 3BMNB 1GUFA 1MX3A 4CUJA 1M66A 4BB5A 1ID1A 4Y67A 2O3JA 3TZHA 3MZ0A 2NVUB 3B1JA 3O26A 5CDSA 2O3QA 1BHSA 4JLWA 4BOYA 4EUFA 1RJWA 3BTSA 2FSVA 3ZZNA 2I5PO 2IZ0A 3UUWA 5BT9A 3H7AA 1PZHA 2RHRA 1H94A 5F1KA 4AJ4A 2FOIA 3ONDA 5AVOA 3L6OO 1HRDA 2VUSA 4B7CA 3AY3A 4YT2A 1E3IA 1HWYA 1KEUA 3GFBA 4CM9A 2HJRA 3GLQA 4OM8A 3O4RA 2GD1O 4P4NA 2Q99A 1Y9EA 2DBQA 4CMBA 5TSDA 1GQYA 3HB4X 1YJQA 1YWGO 2C82A 2Q4EA 3ROKA 3GMSA 4UVGA 3DONA 1CQJA 2DPHA 1E1NA 5CDYA 3KZVA 1JAYA 4NMHA 5IN5A 3VH3A 3ZNQA 4INAA 3GFGA 3ST7A 2XXBA 3WNQA 3INGA 5JY6A 3AI2A 4UULA 4XYEA 1QYXA 1PJQA 1EZ4A 4M49A 3MJTA 2C20A 1V9LA 1BG6A 3VH1A 2VNSA 1YQDA 4YT8A 4JIGA 4UAGA 3L07A 1C1DA 4I1IA 4BNGA 4ITUA 4GKVA 2DBRA 1DPGA 5IXSA 1DIAA 4JJIA 3F5SA 3ZCXA 3R1IA 3EVTA 2Q1UA 1VL8A 1XA0A 3FWNA 1OC2A 1WZEA 3H4VA 2VYVA 4MIYA 2C54A 2WM3A 4II2A 4ALMA 3OA0A 4Y98A 5IDQA 2QZZA 4F6CA 4TVOA 1LDBA 2WDZA 4DGSA 1YE3A 4G81A 3WMWA 3ZWBA 1QMGA 2JCYA 2X0IA 1DDOA 1P3DA 2P5YA 3FF4A 4A7PA 4A5OA 2J5RA 4MOWA 1SPXA 1DJQA 1RM3A 3WFIA 4UUOA 2GPTA 4DWVA 5DOVA 4YJGB 4W7HA 8LDHA 4YWJA 3FBTA 3U5TA 4Y8VA 3E18A 3M2PA 1LX6A 3RSHA 1I3NA 3GEDA 1I3LA 2X22A 1ZH8A 4IINA 5C37A 4D42A 2WSBA 3ICCA 4GSLA 5I7EA 4RF2A 1GPDG 2FN7A 2ZATA 4FD3A 2PV7A 3ZWPA 4O5OA 4XJTA 2E4AA 2Q2WA 1LSJA 3E9QA 2XXJA 4PLZA 4ND2A 2BGLA 4XRRA 1U4SA 1O0SA 3EUWA 3OIDA 4PVCA 3DFUA 3C85A 4AL4A 1C1DB 3LT1A 3B1KA 5LC1A 1RM4A 1ISFA 1NR1A 2O23A 3GG2A 4R4JA 1YXMA 1KC3A 2QHXA 4II3A 2GR9A 1OZAA 2ZTLA 5CG1A 4RVHA 3QWIA 4WCFC 5BSHA 1WP4A 3AOEC 1NASA 1U2GA 3JYNA 1SBYA 3JD4A 1VKOA 4L76A 5DCUA 4Z0HO 1PR3A 3WYBA 4BNKA 1FF9A 3KTDA 1EVZA 3UVEA 3DB2A 3WFJA 3W4JA 1YDWA 1E7SA 5HWSA 3BMQA 3VC7A 7ADHA 4NNJA 1VL0A 2HMSA 4BKPA 1K5HA 4ND5A 1BDBA 3E1KA 1FMCA 4JP2A 1U2DA 4XB1A 3H9UA 3RWBA 3GGPA 3JD0A 1E3SA 3RAJA 3O03A 3TOXA 3LQFA 5DBGA 5MGBA 4JGBA 5JO9A 1O89A 3JQFC 1PJCA 2DUUA 1LDNA 4HADA 5EQDA 1ONNA 2VRBA 3NJ4A 4HFRA 3UCXA 3DMTA 3BXXA 1Y6JA 3ZU4A 5DOZA 4D41A 5AQ1A 5I7VA 4TRMA 1F8GA 4U0JA 3VPXA 4ILKA 1OC4A 2GN6A 5I7FA 1I33A 2PH5A 3GZNA 3WGQA 4W6ZA 1WVGA 1KERA 5BR7A 4D44A 5IXYA 1W4ZA 2AE2A 5L3ZA 4RPGA 1NP3A 1M6HA 1Q7GA 5HS6A 3LT2A 3RFTA 1R4NA 1BXGB 3H9EO 5TGDA 1NNUA 2WTBA 5IAAA 1KEWA 2GO1A 3N7UA
chains in the Genus database with same CATH superfamily
1ZCBA 4JX9A 1TYCA 2HJGA 2CGEA 1FFWA 1E7QA 3EIXA 3MWDB 2AUMA 1C0PA 4KYIB 1SCBA 1K8YB 2JD1A 2OCYC 3ZIAA 2JAPA 1EG2A 1B1CA 4LF4B 3IPAA 4JXKA 2ADOA 4RGQA 2XGOA 1CQZA 3EVZA 2IT1A 2PWBA 3OWHA 2HSEA 4PRKA 4Q4AA 1ND5A 2COEA 3BMXA 3RGWS 3PE6A 3LA6A 4AJEA 2HQ1A 4RTRA 4I7EA 4Z4FA 1RXEA 2IYWA 1T8RA 3HI6A 1CVRA 4YJ2F 3FPKA 1V7QA 1WCXA 5KTSA 2VPPA 5ITVA 2GBGA 2H85A 4MR9A 5DE3A 4CLXA 3M9LA 4LC1A 4CIVA 4HN2A 3F98A 4INZA 3IPCA 1ZOOA 2ZBRA 1M34B 5I7RA 1K6JA 1Z5WA 2Z95A 4G37A 3TIVA 5FWDA 2HNKA 2FVYA 3OETA 3QUQA 4GC5A 4BRUA 3OFND 3U9LA 2FEWB 4I8DA 4JP1A 3GCWA 2V3VA 5F2OA 3WLJA 1U0EA 2HIMA 4E2FA 3A10A 1K6IA 2W6CX 2YY7A 4N01A 2ZPAA 1ZUWA 4YIKA 3UT5A 4I1RA 5J40A 4W7IA 5LMCA 4BQQA 4L85A 4DIFA 4B9EA 3ESBA 1B2LA 4HAZA 5LXTB 1MX1A 2G8LA 3G2QA 2R00A 3R3ZA 4S1PA 3FHOA 1EFCA 3KC2A 4Y18A 5EVCA 5AUQA 4B82A 3N3AC 5ALFA 1EK5A 3HR4A 3THSA 1RPTA 3FFAA 1N3IA 3C39A 3H13A 1ZNYA 2Q6LA 4IM7A 5AOVA 1FVFA 1HL3A 5F4BA 4EG6A 3WA7A 2F2TA 3K73O 4ZC8A 1QV6A 2FSUA 1WCV1 2EJVA 2F55A 3H6GA 1ZNXA 1KYYA 1QGOA 2PPVA 3DS8A 1W75A 1PL0A 3HGQA 3O2JA 2DT5A 1A8UA 4EWLA 4KPUA 1CY1A 1R6XA 3QFCA 3ODPA 1PX2A 1RJFA 3T9CA 3FUWA 4ZAXA 4C43A 3ZCUA 2N9UA 1NUQA 1W36D 1RYHA 3LKDA 3PHBE 1KQPA 1C7RA 3P9CA 3OQNA 3LBYA 3SQNA 4MVJM 2QVLA 2Q6KA 2QD4A 1GN9A 3TR5A 3ESDA 1C3OA 3EXIA 1PBTA 2VYNA 1R6DA 3ZCQA 4N7RA 3KAPA 4YACA 3N28A 3VKGA 1X1EA 3IODA 1OTHA 3CJQA 1CZLA 1XALA 1Y1KE 3ZI7A 4Q37A 2Z30A 1S8NA 1T8PA 4CQLA 3OTOB 3NHPA 2R5NA 4A8JB 4JFAA 4MA4A 4Q4AB 3EQ2A 1WG8A 1FRFS 3N0WA 1T4GA 4RTLA 2PKEA 1KI9A 1A98A 1BX1A 4MULA 3VYSB 2P2ZA 3ZR4B 4EA6A 1NIPA 3RKRA 4WKGA 4FM9A 2C7PA 1VKJA 2E6UX 3R20A 1C41A 1GZ6A 1P4SA 4JI6B 3NVKI 1COZA 3DOCA 1H5UA 3G1TA 1R6BX 3NYIA 5IVIA 2WQ6A 2AF3C 5CT8A 1SBHA 2Q1YA 3BH6A 3V7NA 2AJDA 3RUAA 1PI3A 3RG2A 4AWAA 3OVMA 3DE1X 2QG6A 4D4JA 3OAAA 3AHCA 2B36A 5EMMA 1P44A 2J3QA 1FXSA 5EOVA 4URWR 3UAOA 3E5MA 5DB4A 3LY5A 3QOXA 3VNUA 4CI9A 8AT1A 2NZXA 1O6GA 3NOQA 1LI5A 1PT8A 3UT5B 2CCKA 3ICPA 4KBGA 4AG6A 5AFSA 1NF3A 1T1IA 1SUWA 1QHEA 4LRXA 3A0UA 3FNQA 4PLFA 1NI4A 1ZRHA 1P4JA 5FHRA 1W9MA 3P45A 4HH1A 1NFQA 3UJCA 3PWZA 4M37A 5EP2A 3TAHA 4MV8A 4QOGA 4Y1RB 5C5IA 2DQKA 3U6KA 1YR7A 2I99A 3P0EA 3ZNNA 4US2R 4AECA 4QOJA 5C52B 2FPUA 2GXSA 2DUJA 3GRCA 4AYXA 5EJ7A 3LW7A 2MR5A 2PH7A 1B7GO 2RBGA 2ZRGA 3DMFA 4LWZA 4TN5A 1MG5A 4DQDA 4N5MA 5GM2A 1UDXA 1UJMA 2P11A 1K86A 3V46A 1CZRA 5HF6A 1WQ1R 3U1TA 4IF6A 3WV5A 4CMAA 3EXEA 2I2XB 3MOGA 3B3QA 3O9MA 3OY2A 3R5KA 5LD2C 4BE7B 1C3OB 4GOMD 2OBBA 4PYLA 1PJLA 3JALA 4PZPA 4CZ2A 5IN4A 4LMAA 4YMSA 1Z36A 1W8DA 3K2BA 3N05A 4HQFA 4R1LA 4EY7A 1IH8A 4QQNA 4RD1A 1GU1A 5LJLA 1UDWA 3K3PA 3A6KA 4U63A 3VKFA 3R4CA 4MZXA 1QH1A 5HTOA 4Z9YA 3NHMA 4Z7NB 4C4ZA 1CR1A 4DA6A 1YZVA 3KBBA 3DZFA 4LHYA 3SK0A 3ZLUA 3K6RA 4AO7A 5CPFA 4Y1GA 3WKDA 2V98A 5LYJF 3UXHA 5EZ6B 4QVKA 5FR1A 2IC5A 1LB1B 1LNQA 3R77A 4NBTA 2V4MA 4ZO6A 3RG8A 4TYYA 1PZMA 2ZI7A 4MRVA 1Y9DA 2D1QA 4AZWA 3C6BA 3LT4A 2XYRA 2X1MA 1NPTO 2LKDA 3CEJA 2OLJA 4ZT4A 2A9PA 1RI4A 2WUWE 1UOOA 2YZ7A 1QVVA 3OTHA 4M1YA 1IN1A 2DWCA 2GCOA 4E32A 2X42A 1I6KA 4G25A 4YJ2B 4UASA 3EIHA 1UF9A 1J97A 1YS9A 2P2NA 1TK2A 3HCAA 4H2DA 4IPTA 4DLWA 4Q1DA 2ZUSA 3ZVNA 4LF5B 2JPDA 4TL8A 2DPGA 5TMBA 2FUKA 1NI4B 2DHRA 1BC5A 1P9RA 2IU3A 4GI1A 3IO5A 1JHXA 3ROPA 4BGIA 2CXTA 5KREA 4M1TA 1QJ4A 2BI4A 3ANXA 2IGBA 4QD3A 3V5NA 3PDWA 1I01A 4GZMA 4GC9A 4PX5A 3S6JA 1DC3A 2QBYB 3B9QA 3ZGVA 4JJ4A 1TO6A 1IN7A 3I76A 4D74A 2I4IA 1XDZA 1Q95A 2O2ZA 4LOJA 3W5SA 2PUVA 3ZE1B 5F52A 1HY3A 3DE3X 4C5CA 4MWBA 1Z3CA 3FOCA 1JHMA 1I7DA 3DP9A 3R3SA 1IZYA 3MAAC 1YRYE 2Y2UA 3ANMA 4WW0A 2I76A 3D3EA 5KX5F 1JHDA 1KQ3A 3CB4A 5DBFA 3OCYA 3RK4A 1E60A 2N46A 2CVPA 3EXEB 3RUDA 3O8CA 2JIOA 2J6CA 4NWIA 4RKYA 3KCQA 3AINA 4WNYA 5CYOA 4QYTA 3JALB 3V8MA 3NDRA 1NRWA 4CDNA 1L7PA 1Z17A 3EBOA 4CCYB 5AW8A 1OWLA 4GI2A 3B53X 1Z56C 2VVTA 4B7ZA 5AVZA 3GUHA 3WLKX 1BROA 1ABBA 3FTCA 2O54A 3AP1A 1HYBA 1P7VA 1VRWA 2WLTA 3PFFA 4NEHB 1DZ3A 1DV2A 1QH1B 3O9VA 3NS7A 4IHAA 3VU0A 5E1DA 3HKEB 2CEAA 1LLDA 3RKUA 4TZTA 1PRYA 1PT6A 5CT5A 4XUCA 3IPRA 3QPAA 4BV3A 5F12A 2CFRA 3ERCA 3ESCA 3TLJA 3KSMA 3EZ9A 1SKYB 5ESXA 1F4PA 1ZA2A 1GA4A 1RQRA 3HXMA 1I7QB 4IOLA 1ZO8A 3HDYA 4JKIA 2JCBA 1HFJA 2P75A 4R81A 3A6FA 5ADVA 2CV0A 1VOTA 4JEMA 1GDHA 1Z6ZA 3SEQA 1VIAA 4TXLA 4WZAE 2EG9A 4HNUA 1EFRA 1Z4KA 3VR6A 2FUG6 4UD2A 5CUQA 4LYJA 4M98A 2DPXA 1TM7E 4MP6A 3WWPA 1YO6A 3HA7A 1H3EA 1JHPA 4UU8A 3S2YA 2FPSA 2XADA 2Y4NA 4N03A 2QL7A 3HSSA 2RAPA 4UHDA 1IB6A 4R2LA 3KLBA 1PZEA 4WASA 3OJFA 5JDCC 2VRWA 1Y5LA 1XCPA 4M76B 3DAFA 1DI0A 3FE2A 4MJLA 1W1WA 1GJRA 2PJDA 3MS2A 5DEIA 3KLPX 3WMGA 4KWEA 4DDWA 1BJRE 1XNJA 1Y5MA 3ELBA 3ENNA 3VPFA 3EG9B 5FBRB 3U48A 4EJMA 3G88A 3HJRA 4QSMA 4ASUA 4YASA 1AGNA 3W9YA 4BO3A 2I54A 5FCDA 3GPIA 1U8ZA 3L7MA 4HWRA 1YMUA 2CYBA 4DHWA 1GGVA 1S7CA 2FFAA 4G0QA 1U9IC 4FGKA 3MF4A 3QSGA 2H2AA 2XEDA 1SCQA 2NX2A 4FNGA 3KBOA 5D3MA 3U49A 1KTVA 2ENWA 1TA0A 1AKUA 1H69A 5TLSA 1HLDA 1P8JA 1IIBA 3EFHA 4BJ6A 3TW4A 1D6MA 3ZYCA 3D8UA 5B1SA 3VU9A 2YNMD 5B30A 1HEIA 3CEAA 2MTBA 3FUXA 4GX2A 4F9FA 4G0VA 3O73A 4OGWA 5KJEA 1YV9A 5KWIA 1ESDA 1FW6A 2VF5X 2WAXA 1L7QA 5A7HA 1D7OA 3EF1A 2JG3A 2FKNA 3KZCA 2WAMA 3EZ7A 4WY8A 5CFQA 3P2KA 2AG5A 4JYPA 2ONJA 4QGSA 4L78A 2PZEA 4WD3A 1Y37A 3AO0B 2J1LA 2Y1GA 1EI9A 1X70A 2Z04A 3KKKA 5K6AC 1GXSA 1D8TA 4FE4A 1Q6ZA 1FLAA 1GNRA 2FZEA 1IHYA 4WXHA 3LT5A 5CCDA 3F5FA 1M1NA 5CJPA 3UY4A 3ZJ4A 2JIDA 4G9EA 3FRIA 5E2IA 5KYXA 2J3DA 4HF7A 1XZBA 5FOVA 3A3OA 2QYSA 3ENVA 5LYJB 4HUTA 2DLNA 2VYCA 1JLSA 3WK4A 3UK1A 5B4TA 2ZSUA 1X42A 1SC1A 1TMKA 3S40A 1XJCA 2EU8A 4D8WA 3JW8A 1IPFA 2PV0A 2CNWA 1WXXA 3MPUA 4E5NA 2RG1A 3D8BA 2IL1A 3C7KA 3LW8A 2O8FA 3IH5A 4JT2A 4IDFA 1R8XA 3GH3A 1T3GA 3KYJB 4MUEA 2Q1WA 3C6KA 1FDRA 2HGZA 3FRJA 3KIPA 5CVCA 3PB3A 1DRUA 1QANA 2V6GA 3THOA 3U39A 3UG6A 2PS0A 2C5HA 2XODA 1JPVA 3Q0IA 2ONZA 1LV7A 1SBTA 2H1FA 2J6HA 1YQ9A 1JQ3A 3CWZA 3DL2A 3NWEA 3BJMA 4G4SO 3GDFA 4IDEA 3E5NA 3CVJA 5FPHA 2HX1A 3A1DA 3AU9A 1PUIA 1MRSA 3EGXA 3EUFA 3QWBA 5LZ8A 4BNDA 1B6GA 4FYKA 4EO7A 4KQMA 1RKUA 2VSQA 3DBHA 4NBKA 4P2GA 2XNCA 5DX0A 4KQ1A 5B3JA 3PXGA 1P7YA 3JZMA 3W1VA 5J5AA 3RADC 4URUR 3SC2A 3J7AC 1YZUA 2B7BA 3SVLA 4BVJA 4CNBA 1J22A 1G9SA 1HE5A 3O7MA 1GEEA 4E5DA 3OE7D 3EGDA 2GDZA 2JAHA 4X8MA 5E9QA 4KMSA 1AMNA 2VJQA 1AMOA 1NV8A 2Q5EA 4Q3OA 4DV3B 1K2WA 1RKQA 4JJAA 3VU9B 1G59A 1TZ2A 1OFHA 3JAKA 3BBPA 1MW8X 2F3UA 1K9SA 4Y2UA 3HMKA 3V8EA 1D0IA 4IQ0A 1UAAA 4X85A 4H1TA 1OXKB 2J3KA 5KX5B 5K3FA 2CXUA 1A7AA 3DEKA 3H8SA 3WV4A 1GGKA 4ZC1A 3CUSA 2VAWA 5KNDD 3B51X 1E0AA 1DT3A 3HPQA 1MB0A 2HK7A 2VHEA 5EHZA 5TR9A 5JHHB 4RZHA 1GXSB 9ATCA 3M6FA 3QVSA 5CLIA 2XA2A 2C9YA 3KL2A 4YS6A 5CEEA 2E5LB 1GZHB 2TECE 5A4IS 4OHVA 3RVKA 4RIFA 2ZAYA 3LU1A 3C6YA 4KQ9A 5I51A 1DMSA 3OU6A 1ICEA 4QU9A 3JSXA 3N8HA 1AT1A 2XUIA 3IIKA 1G8PA 3LCUA 4UVIA 4OYYA 1N36B 4MKIA 2FCRA 1TC1A 1A0OA 3PNKA 4FGZA 3D5QA 1KI4A 2YJGA 4DM7A 4WKNA 3VO9A 3LOUA 3VPHA 4YRIA 4G0WA 2W58A 1X92A 3BFKA 2ZWPA 3GFOA 2Q3FA 4H60A 2GXAA 1BTOA 4GQBA 2JFBA 1I3MA 4L6IA 3VBCA 3H7IA 2XT9A 2QORA 3WGOA 1VCIA 1YMQA 5LYYA 4GLFA 1FY2A 2IPNA 2VO1A 3GK3A 2AV6A 3IUMA 4KQ2A 1Y6QA 4MV6A 4BNDB 4PHTA 5EIBC 4BU1A 2IYQA 1T3ZA 2WNHA 5IWAB 1XRSB 3S28A 3SS7X 1CS4C 3FVRA 4MEAA 1MCZA 2BM9A 3VR1A 4RTJA 3F4KA 1ADCA 2HBYA 3GVIA 5C46F 5K0BA 1XNGA 4PRZA 4QYIB 3R3UA 5CFLA 1CUFA 2B5WA 3H42B 3CF2A 4YRPA 4LY9A 2DBZA 1UL1X 2BFMA 4G8BA 4D3ZA 3AM5A 3H4TA 3IUEA 1XTSA 3DLAA 4Q66C 4F5DA 4DCOA 2FMKA 2X0KA 3L8ZA 3USCS 2VL7A 4IFTA 5EQJB 2O59A 1NFFA 4HS4A 4HS9A 4GRDA 4CN9A 4DLRA 2H17A 3WGLA 4ARZB 2CN1A 4GR9A 2GDJA 2QRHA 3DDWA 1EEXB 4PGMA 4PZEA 2R7MA 4RVSA 1CY4A 1JT9A 1ZC4A 5DNWA 5FTNA 2QIPA 4FI3C 1NMEA 1CDOA 1ODCA 2RGEA 3F96A 3N7TA 5BPFA 4Q3EA 1QP0A 1KYQA 3HO6A 4GM1A 4RL4A 1R0YA 1W2GA 3UB3A 2PZKA 2JFHA 2YRXA 1KMHB 1L0BA 3E0XA 3M89A 4D8XA 4HNTA 5IM5A 1TPZA 2VHXA 1Z7EA 3WNDA 3K8YA 3MAGA 1NBME 4YJFA 2QRVA 4LDRA 4EW6A 4B48A 3G79A 4A2CA 4DQKA 2EL9A 2GZSA 5ALEA 2UAGA 1KDVA 5LWHA 3W4IA 2NZ8A 1BJTA 1VBKA 3NLLA 1RBMA 2HRZA 3OZVA 4E11A 2C3PA 5IT4A 1ENOA 3BERA 5DBEX 5B1HA 2H5LA 4A6XA 1IOVA 2V6JA 1L5YA 3OPNA 3N70A 5ITZA 1CZKA 4S04A 2WWYA 2G83A 1T0JB 2WK1A 2XNHA 4ND8B 4DB4A 4DIBA 1NY5A 1XO1A 3KD3A 5AVKA 3DOFA 1Z0ZA 1UJCA 1WMAA 2HF2A 4O2LA 3C7AA 3PHJA 5E6UB 3CKKA 2C92A 4A0SA 4HB3A 3L6RA 4J43A 2IBSA 3CXUA 3O2SB 4NZOA 5JXIA 5JAQA 2ZYAA 2HK8A 4EI8A 3WGYA 4Z9XA 2WM9B 1PEAA 3HB9A 5B1EA 3CSDA 5HFJA 4R8LA 4MV9A 2PSSA 1AKYA 1O95A 3X1KA 4S1WA 2PGJA 2HT6A 4B6GA 4DQ0A 1PSZA 1AUOA 3FCAA 3QU5A 3LUGA 2RONA 1TVEA 1H6BA 3IBCA 2WPDA 3UBMA 5DW0A 3ROFA 4M0EA 3UWDA 2C98A 3NV7A 3NPMA 3QEMA 1PN3A 3L0ZA 2PRKA 1WCIB 3KVOA 4E0BA 4Y2TA 5CFOA 2V55B 4N49A 2HHCA 4B84A 4BMZA 2FZ4A 4Q9KA 1DQYA 1O9GA 4LJSA 4BQOA 1OLUB 3SYMA 4ANFA 5DTRA 4EHIA 3BCUA 4LBWA 5DM2A 2DM6A 3AHGA 4XDZA 3KT6A 5AXAA 4DA9A 2QQEA 1NKSA 2I55A 1JR4A 5BRNA 1QIJA 1J2TA 2GBLC 4DA0A 1JVSA 3ZGOA 3W05A 1BWPA 1GV0A 1T0IA 4BNYA 2QZJA 3AERA 3OZ7A 4MVYA 4JVNA 2PUEA 3BGDA 4GPIB 5D3ZA 2FUEA 1RZRD 2ECPA 4GF5A 4PTZA 3HFGA 3Q3IA 3R5SA 2QW1A 1E2EA 3NNSA 4B80A 1DIOB 1KFEB 1ZKMA 1F1JA 1JQBA 1HLFA 4KUHA 2DHCA 2P4QA 3H9QA 4MV1A 1F1BA 1N2JA 5HUQA 5IF3A 2JLUA 2M6LA 1R9JA 3A6HA 5ENVA 1LZKA 1E3DA 2I65A 4BV2A 2FLKA 4A2PA 1U81A 1NUAA 1UP4A 3H5RA 5CPBA 3ZOZA 4DQVA 1RZVA 1XVIA 4JB3A 4HFMA 5SZHB 2W5UA 2BSAA 4B4VA 2A0KA 3R3WA 4TX1A 4YAFA 3A4VA 1UZLA 1ZIPA 3AI1A 3C1OA 3S70A 3RQSA 1N34B 1PBNA 2WWHA 4HUJA 2EFHB 3KCNA 1LUAA 1K0FA 4PPYA 2P5TB 4ZD6A 2JK0A 3A9WA 4DV1B 3IQEA 1JECA 3LP5A 3W1WA 1JZSA 4KK4A 1IY1A 4I2NA 1DMRA 4M87A 1GNLA 3WR5A 1QNFA 2W2LA 1FFEA 3A31A 3JZIA 1EDZA 4XVHA 3GFTA 1Q6YA 2Y1WA 4R6XA 1DIRA 4O0MA 2GFHA 1JLRA 3A37A 2XEXA 5KJ6A 3SOPA 1Q0PA 1BE8A 1A2OA 4EDHA 4GH5A 3GIDA 4QLAA 3FOEC 1N7GA 2OBLA 3U4GA 3QU2A 1OBFO 1H0RA 2WTNA 2XDQA 4H7KA 1B0UA 2Z2XA 1FYWA 2HDWA 2FQYA 2X5KO 1OI3A 1ZUD1 2H4JA 3WSVA 2ZTHA 4F86A 2O57A 1NU6A 1YA8A 2C88A 2O8NA 4PFSA 1T5SA 2ZJ3A 4J1NA 1PGQA 1XKLA 1Z33A 2NOAA 3A4NA 4JC5A 4KXWA 3K94A 4LUCA 1HK7A 1IQ0A 1LS1A 3IIMA 3QTTA 4GMFA 3OCCA 4JL8A 3REGA 3TCXB 4IGFA 4WNIA 1EAYA 4ZQBA 2XF2A 4ARVA 2W90A 4B4UA 2PS9A 3TLKA 1IHDA 3AERB 3PYMA 1D1TA 3NNNA 5B57C 5B1YA 3QF4A 1IVYA 2H8GA 2IOHA 2O7SA 2J9FA 4DY6A 3F71A 4OMDA 1DKQA 4DSAA 5TQ2A 4ZCTA 5KHOC 1IZZA 4D9JA 3PGXA 4M21A 3H97A 1MDBA 1PL8A 2IP4A 3BMOA 4NE2A 4B8WA 3DDSA 3AFGA 2X3YA 2QLMA 3D4PA 1YQXA 1A5BB 4LGYA 4AFNA 3L0DA 3C3KA 3E7PA 1UT8A 3QOFA 2GAFA 3GBPA 2Q3LA 1RLMA 4CR6A 5EC8A 4KFUA 4RGVA 4TV9A 3IDFA 2IZZA 1QPGA 4DC0A 1XMOB 3STVA 5DGXA 1QF6A 2WSLA 3BRQA 3LQYA 4V0NA 1ZQ9A 1A27A 1TQ6A 2X9QA 2Q0QA 5I5EA 3H05A 4H3KB 4C0SA 2Q9UA 3V4VB 1II0A 3EZYA 4IIVA 1XDSA 4ZT7A 4C3ZA 4BEWA 4F3NA 4C0LA 5JFGA 4B6EA 9LDBA 4JC4A 5FO1A 1OX4A 4RANA 4W5OA 1ZCJA 3BMQB 3UJPA 2PXXA 1I1HA 4G09A 2BLNA 2CE2X 1YMVA 1J1UA 1ZIYA 3QPUA 2WYWA 1M76A 1Q74A 5EA2A 3TLEA 3CNLA 2HK6A 5H70A 2ZE5A 2SKDA 1JDZA 2O0MA 1ZXBA 3G0CA 3N6RA 2EEPA 3CF6R 5SZIA 4YRNA 4R5HA 3LFUA 4X61A 1FYFA 4KO8A 5LL6P 1T8UA 2QR2A 4BWYA 4JB8A 5MFPA 1TUEA 1Q21A 2BW0A 1B6RA 1N6KA 1SBZA 5ECWA 4YPFA 2WJVA 4GI5A 1D04A 3EUEA 4B32A 4HDKB 1NHWA 4RQBA 5GPBA 1NYTA 3PGJA 2YWCA 2B92A 3KLNA 2OCGA 4LDNA 2DT8A 5JJ5A 1E2MA 2PMDA 3T9DA 1Y4SA 3EXAA 1XT6A 2ECOA 4LJ6A 1A2QA 1CJCA 5JTUA 3LUDA 2AI3A 3LCJA 4BAUA 2WMYA 4XUEA 4AY2A 1OLXB 3NUZA 2WPDD 4JLKA 4OJYA 5A7FA 5BPHA 2J9FB 5CB4A 4JUFA 5TQ2B 1ACMA 4QYWA 3AETA 1PW7A 3BMOB 4MHOA 1BAPA 1XQYA 3BGSA 1N1DA 3K4PA 3KJQA 4LNHA 1NN5A 4TWBA 4TYMA 5ER6A 4RK0A 2IYNA 2WWVD 1P0CA 1ESEA 3AR5A 2VHTA 3VAZA 4ZO8A 3E6AA 4TZ0A 3UN1A 3M8KA 4DBLC 1XB2A 4IO0A 3CLRD 1QONA 4DG8A 1GADO 2QPAA 4EB8A 1X3LA 3IJRA 4ZVRA 4Q4LA 3F7MA 1UANA 3MVEA 3PA8A 2C2XA 2IW1A 3Q5EA 2IUEA 4Y6OA 3VZDA 4QXAA 3D4LA 3REFA 1RAEA 2Y0EA 4KYUA 1J2UA 3I6IA 3HWRA 1JAIA 1G9XA 3TQRA 4JT9A 4J3NA 1AA6A 2NVWA 3G9UA 4PAMA 5TXGA 3K0CC 3KP1A 2UZIR 3KUDA 4F84A 5DX8A 2Y6UA 3PZRA 2WIGA 3B36A 1OX4B 1N2SA 1YDEA 3BRWA 3HU1A 2BFPA 3KL4A 1CUCA 1ZA1A 1USVA 3WIBA 5HRUA 5IJWA 5FADA 4IXMA 4TQUS 5FTKA 4MPPA 4P5EA 1GWNA 4J7UA 5FUBA 3QBEA 5BSTA 3RW9A 5A5DA 2FJUA 4R1MA 3FMOB 4HDQB 1LSUA 4UPDA 5BWBA 1VDMA 5EE5B 2ACEA 3ZI4A 2OEPA 3VJRA 3R76A 3VR6H 1DAMA 1G8KA 3DYVA 3KFVA 3VVLA 1U3TA 3T15A 2FMHA 2X9NA 3ROEA 5DNUA 5JC1A 1CDZA 1U1EA 1VL6A 1V5GA 3VXKA 2H31A 3LNTA 2CMGA 2GPNA 3F6SA 2EJTA 4JIMA 5J5CA 2HSGA 3U4DA 1PG0A 1JNXX 4HR7A 3PUVA 1BGXT 1M0WA 4J07A 2B1GA 1OKKA 4GYJA 5I9TA 5DK6A 1I51A 4HWPA 5K6TA 5MDHA 3W8DA 3QVXA 4HZUA 3CRW1 2ICAA 3LRXA 4DANA 1GSAA 1Y8CA 3QHPA 4BCCA 1K8QA 3G85A 2ZZNA 1DZIA 2EWWA 2WJIA 4U4AA 1IHXA 4EYEA 4Y2XA 4BNJA 1QTIA 5BSFA 1T5BA 3ILVA 4I99A 3NDIA 5IZCC 1KI1A 2XHZA 3I5YA 1RVDA 2EQBA 2F9LA 4U6QA 4JI1B 2QVYX 4IDQA 2EL7A 2HWYA 3NAQA 3AHHA 3L7JA 4LSWA 1U7DA 4BVBA 3HBJA 5BV2P 1YIAA 2JW5A 2IYEA 2XKKA 1XJ5A 3N6XA 4KGVA 1RRMA 4F5ZA 1KORA 4OSOA 1CDDA 5BWLA 3ADDA 2GZHA 2J07A 1JXOA 2HXGA 3NGMA 2VTDA 1E3WA 4H4CA 4L5CA 3V3KA 4YXFA 4YXWD 5JMTA 4NFSA 5CX1A 1GKYA 4AWBA 2HKIA 2P9GA 3TFQA 2ZRKA 1HBJA 2A9QA 4WZBE 3PLAE 1YZGA 4J91A 4E5YA 5K0NA 1TRHA 1X8XA 4PLCA 3COYA 3T95A 4MR8B 4AJNA 5DFAA 4H3VA 1BKSB 5B2FA 1JNYA 1ZEMA 1EUZA 5F76A 3OIFA 2OVBA 4M1OA 5CRIA 4K0KB 2RKWA 1SHUX 3OIGA 3ACCA 3GJZA 1X13A 3KOWA 2W98A 4J16C 1PS9A 4FFMA 4M1KA 2JJ2A 5EE3A 4Z7OB 1PNTA 4D0RA 3AP2A 3CWCA 1C8VB 3IQZA 4L02A 5A62A 2GYUA 1ODIA 4FLEA 4QQ8A 3CIOA 1TT5A 1UKVY 3L82B 3V2HA 4QL3A 4KQGA 5CR9A 4YEDA 3VDRA 1E4OA 1B14A 1V11A 1GILA 2O6HA 2W6IA 2WJZB 2XLBA 3FLAA 1GQFA 4PYIA 3GT7A 4WCVA 5EINA 5HKLA 4HT3B 3GVCA 2I2AA 2OBXA 1XF1A 4IJ6A 2NG1A 4PLTA 1FMTA 5SYMA 2ZWOA 1G21E 2QUBA 2JI8A 3ZD8A 4L95C 4DUGD 4BAGA 4HZUB 3WL7A 1R6UA 4Q4HB 4HRVA 8ABPA 4K2AA 4AF7A 3GRRA 5DI9A 2PE5A 4PYRA 1V5EA 4HHEA 1H2ZA 2QN6A 2DYKA 4PQFA 4BO7A 1M34E 5D5QA 3FSRA 2G7MC 4K6CA 5ALRA 4BMOB 3AILA 4AUKA 4RPCA 1NVVQ 1P0IA 1NBAA 1RYZA 2WU0A 3LQ1A 4TM7A 1QR2A 4QPNA 4X3OA 5FL7D 2WUEA 2WB2A 1D4FA 1FE8A 3PWKA 1S2DA 5TMPA 4YLGA 3FYHA 1BW9A 4UNNA 4H4DA 2BKAA 5HKKA 2OB2A 1R0RE 1WY5A 4H1HA 5I6DA 5KMGA 4ICIA 1A7UA 4TMKA 3H1BA 3P71T 1KY5A 1WAMA 1RBQA 6CHYA 3KAQA 5DLPA 4B46A 2Q3JA 4GR5A 1QF9A 3E27A 4L4UA 1ITZA 3T3PB 2X2OA 3F7NA 1E3WB 2OHFA 1PK7A 2I62A 1G60A 4RMJA 5HKBA 1QK4A 3O6VA 3BGOS 1ORTA 1WKVA 2Q2NA 4UCXA 3PS9A 2IEYA 3EC7A 1YSCA 2OORC 1XX6A 3C1AA 4NDZA 4ZO4A 4EB6B 5KOJB 1DOAA 4KLAA 2FJ0A 5FWXB 2HJSA 1FDOA 1Y3AA 4P36A 4RPHA 3ZU5A 2ODEA 4F3RA 2VWQA 2Z43A 5DPMA 4P53A 5KAMA 3RU7A 4MQFA 4ND1A 4RMGA 4F0JA 5B53A 1FDVA 3EZXA 1HQYE 1IK6A 4KB5A 3UJAA 3H1AA 3U44A 1E5VA 1DDIA 1WF6A 2GYVA 2R6CA 1LC3A 2YRWA 3NYQA 1ZHFA 1T1JA 1TT5B 5CDGA 2ZYGA 3CB2A 2Q6VA 3FPCA 4Z51A 1E9EA 1Y5NA 4FCWA 4OHKA 2JANA 1GN8A 1S3IA 4TVKA 3JXEA 2QRLA 5BWOA 4JI4B 3O8OB 3PUXA 1L5RA 2OILA 2OSVA 3IR6A 4N8EA 4RJIA 1P72A 5AHKA 3QKWA 4I50A 1ZH2A 3VDQA 4DY4A 1J0DA 3GJ6A 1JG3A 4MJXA 3ROMA 3ZBUA 3R2JA 1RIIA 2A9RA 1THGA 1Y4AE 2NO6A 2FEAA 2YQ4A 1Z12A 1F9AA 2ZETA 3KYIB 4LRUA 5H1YA 4C6TA 1MU0A 1DX6A 4JBIA 4R31A 4XD2A 3UT6A 4PZYA 2EP5A 2AWOA 2J67A 2GCIA 1IVNA 3GN2A 1HYHA 4TXJA 1D8AA 4G5RA 1F7UA 2GBCA 2FRXA 2AD1A 1LPMA 4KO4S 3I72A 1BW9B 3S1AA 4OH1A 2JGLA 3ULKA 2RGGA 1Q91A 3DAPA 2XMQA 3UJ8A 1BN6A 3SLKA 5KMGB 1A8IA 1T1SA 1QLHA 2GEKA 3MAJA 5FO0A 5LFAA 3MN1A 2AOVA 3BWYA 3RF7A 4ZPJA 1TE2A 5SYNA 4B0PA 4B7AA 4N3AA 4CR7A 3AXSA 2X9LA 3QVLA 5A3QA 5J4KA 5KHAA 2DFTA 3PGMA 2E89A 5KTPA 3KKMA 3D4BA 3DCYA 1KXJA 4H08A 2HRRA 4AVYA 3LZ6A 4AMYA 5JROA 2LGJA 1KI8A 1X3SA 3QPCA 2V6MA 1QTQA 1K1EA 2ZUTA 4MQMA 2GZRA 1G7TA 4E15A 4OTZA 1OI2A 2DBVO 2H6EA 4EVSA 4NJMA 4OL0A 1J24A 4KIWA 2CCJA 3GJQA 2HN9A 3OX3A 3UATA 1HFKA 5I9MA 2WLSA 3F74A 4M36A 4O1IA 1CUHA 1FB5A 2DUNA 3QJYA 5HQ3A 8ATCA 1KZGB 5DMXA 1CJSA 3OUUA 3TVTA 3N86A 1HNZB 1YZLA 3LDFA 2XVZA 1A96A 3U44B 4UBNA 4KDRA 1L5GB 1HKHA 2YS6A 1YC5A 4IJKA 2YXBA 2WSSA 3ZS8A 3AIIA 4BKMA 1YL7A 4Y0VA 1M6VA 2B82A 3WGNA 1UZUA 3OTIA 1KGSA 2QTFA 1VPDA 5P8WA 4B3SB 2AZTA 1M8GA 3EVBA 3G5AA 2R6DA 4MDHA 4YUXA 6ABPA 1ZBDA 4I1UA 3GO4A 4MLCA 4P84A 1J21A 2JLQA 3SXPA 2OGTA 4EECA 4ND6A 4TTTS 4PAGA 1HGXA 3AYZB 2R8EA 5T8KA 1CRWG 1UK9A 3AUYA 3RGGA 2J0UA 2ZVDA 3M3HA 1N1GA 4U6SA 1FNMA 2F3TA 4BEBA 3FPFA 1G20A 4J3JA 3OZAA 4RX1A 5DJ5A 3M33A 5FKJA 2J7PA 8OHMA 1ID8A 3IHWA 4K3UA 3SE7A 1Q17A 1WKCA 4BO1A 3NVMB 2Y0DA 4BLPA 1YU9A 3QFTA 1W36C 1C3JA 3CH7A 4WOCA 3NHFA 5K4GA 2DSNA 2QLLA 3MK31 1DTWA 3P1JA 4JLSA 4NMWA 3L77A 2QP9X 4PYNA 4DCCA 3TLCA 2NVUA 5CM9C 1EESA 1QWSA 4JC0A 1Z6AA 1GPLA 1LBIA 3PICA 1ZW1A 2CLHB 5C5EA 2OQRA 2VLIA 4IFBA 2NZWA 4FYWA 4KJZA 5D3KA 1EXWA 1L7MA 1WMBA 3DAHA 2J5BA 3O9ZA 1XAGA 4FDAA 4QECA 4WLOA 3ZVLA 1JDVA 2CJXA 4FXPA 2R0QC 3RVJA 4V0SA 3OIUA 1XLVA 4H7HA 1N5JA 1GUAA 4KNWA 4PSDA 4WGGA 2DX7A 4UHJA 2CF5A 1U8YA 2Y76A 3UHJA 2QF7A 3W2HA 3ZDRA 1V1JA 2J3JA 1W88B 1SURA 4FHZA 4AUEA 1U5CA 2ZYVX 1XK7A 4AZVA 3EIOA 1WBDA 1WZIA 5HIKA 2ZB7A 1T1GA 3N2YA 3B2EA 2JF0A 3EIFA 5C4GB 4AX8A 2RGXA 4Z9AA 1LPSA 2QG4A 2W2OA 1OB5A 3R75A 2ZS9A 1ZGZA 4MPRA 4CM6A 3X2FA 3MB5A 2ZVJA 5FI0B 3H3FA 1U2SA 1M6VB 2OK7A 5KAPA 4QPJC 4WESB 3NBXX 3D6NB 3FGNA 2BFEA 4M99A 1WEKA 1KDYA 4EO9A 1YQQA 3O91A 2VDVE 2UZAA 9MHTA 4LE1A 5JNRA 4Y9UA 3TR6A 1SM4A 4BFWA 3E4CA 1SKYE 5A05A 3DD1A 1Y80A 2PT5A 3WO1A 1BFUA 2WSIA 5A6SA 2ANCA 3R44A 2J0UB 4UEWA 3WWDA 3AGPA 3IVRA 3I5AA 3IDOA 2ERYA 2DLCX 1AQYA 3BIJA 3CRNA 3GPBA 4Z3DA 5JATA 1Y89A 2OWDA 3S5JA 2W4IA 3B7GA 5JD6A 5HXAA 1QAOA 1QPZA 4OBWA 3AUAA 3BE6A 3ND6A 1AQJA 1GYPA 2DEUA 1P6QA 3W2IA 2CNNA 3CCCA 4OX9Y 4WY5A 1DTWB 1REQB 4YRBA 2GYWA 3X1ZA 1TJ4A 2N75A 4QBTA 1SVNA 2ZTVA 3IQIX 5JOQA 1G5RA 2Q45A 1VIMA 3IHKA 1WP9A 2FPIB 4IVPA 3A3PA 3RRFA 2VG8A 1A5SB 1DRKA 1GAJA 2VAPA 2FWBA 1Y7TA 2R1ZA 4GRIA 4I1SA 5C5DA 4O8CA 1YI0A 3RS3A 5KBYA 3VU8A 3QVJA 1DLJA 3L4KA 1PGPA 1EWTA 1YI1A 4FFBA 3KZOA 1P2TA 1J2JA 3PPWA 2VUIB 1ISPA 2ENUA 2P90A 2F3QA 1JLLA 3V9PA 1NJ2A 4CMGA 4E09A 2JH8A 4LNUB 3AFNA 1YONA 5CBPA 4YFVA 1UDCA 4UZFA 2OGUA 4WH0A 2BMEA 3GRPA 3QOYA 3MHPA 3ADKA 5FFFA 2I7XA 4O25A 2JHAA 3G0BA 3PUJA 3A04A 1KJJA 1NR7A 3GLGA 3C3WA 4QVIA 5IKEA 1U0TA 2R6HA 2QN7A 2Q1XA 3LHDA 5HGXA 2ODQA 1FFCA 1B2RA 1A5TA 1AS3A 5BWNA 3TIFA 2QUJA 3VR2D 3V4SA 1Z4PX 1K5PA 2BFEB 3MRVA 1BE0A 3O75A 3QUAA 3CINA 4OL9A 1N33B 2NGRA 2I2FA 1MAAA 5FNVF 4F12A 1P45A 5C7LO 1MAHA 1F0YA 1YQWA 3Q0EA 3QX9A 4LKRA 5AJWA 2ECKA 4CRWB 1W35A 3KSBC 2A0XA 5A6SB 4DIKA 1ML4A 2XMRA 2WU3A 3NWJA 4BFZA 1G38A 1ZNQO 2ZYTX 1XE3A 3ITNA 5LIRA 3T5TA 1NNI1 2ZRFA 3UF0A 3FTDA 2HLDA 1UXJA 3D2BA 3DOIA 4Q3KA 4X64B 4BJHB 3DZBA 3C4VA 1YS1X 4FN5A 1W96A 1AF4A 1JQAA 2C8JA 3KK0A 1LJUA 3L7AA 3UTDA 1G5TA 4AMUA 4AP6A 5ISMA 1FMFA 1YDHA 3AHEA 3G2KA 2A0WA 1THTA 4US1R 3IERA 2JVJA 4M7WA 4X90A 5BSEA 3SS8A 2JIZD 3IQFA 1II8B 1B3RA 4RFSA 3TRHA 3DPSA 3L8MA 4OQFA 5MHTA 1SG9A 4O29A 3S2GA 4HQ6A 4M1EA 4O02B 3TTUA 4BX2A 1V4NA 5AW0A 1R1DA 4NXMB 2PSFA 4LFAB 3JQEA 4R9UC 4KX5A 5B7NA 3GJ3A 4BNHA 2J9YB 2PMKA 2PLAA 3I6QA 2R00C 1JDBB 3CUTA 1A7KA 1SU8A 3GP5A 1L4NA 2VDNB 1OJ7A 2ZJYA 2ZYSA 3MCVA 4HXYA 4W8OA 4G07A 1WOMA 3T7IA 2BJVA 3D0QA 1ORVA 1EGHA 2LRHA 1SU7A 3Q7RA 3C41J 3GEBA 3ZEIA 2XZLA 1D0VA 4MKHA 5JYBA 1I7PA 2QMZA 4CF7A 3GCXA 2HIHA 1Z6QA 1FSSA 4HDMB 3F6YA 1KBQA 3ICQB 2BRUA 3REOA 3TE7A 3DEZA 4KYTA 1FDIA 3RSCA 3E3OA 2EW2A 4AICA 1IOLA 4XX0B 3ZHZA 1HPLA 3ZI0A 1U02A 4LWPA 3CY6A 5TT0A 3QKSB 3ESYA 1XTTA 3FCOA 1K7CA 2CFSA 4S2EA 4UDOA 5EIOA 5I3CA 4F5WA 5CB8A 2V9ZA 5I48A 3SNKA 2EYUA 2GK4A 2PHZA 3G0DA 4IQ8A 3SN6A 1ZESA 5DM0A 3BSYA 2IDJA 4DR6B 3N6VA 4ZXPA 3LX4A 4HNGA 4HX2A 3TLGA 1RRFA 3K6KA 1OD6A 2G5PA 2O2XA 4IRUB 1NATA 4X95A 4L3OA 4XGIA 1TRKA 1DTSA 2EKQA 3GFQA 4MTLA 2QTNA 3H1FA