3MCVA

Structure of ptr1 from trypanosoma brucei in ternary complex with 2,4-diamino-5-[2-(2,5-dimethoxyphenyl)ethyl]thieno[2,3-d]-pyrimidine and nadp+
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
publication title High-resolution structures of Trypanosoma brucei pteridine reductase ligand complexes inform on the placement of new molecular entities in the active site of a potential drug target.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 93
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3mcvA00
2DBZA 1VLLA 4PLVA 4IJVA 5FWNA 2O50A 1B14A 3ANMA 1KYQA 3RSHA 4Z3KA 1H93A 4L76A 3JD1A 4NFYA 2NSDA 1GL3A 3H9GA 5A9RA 4CQMB 3CIFA 2ZATA 4OOEA 3U4CA 1LLCA 1YWGO 4FOOA 4G65A 4IM7A 3ROMA 4DQXA 4BNFA 2RHRA 1HYEA 2Y0EA 1XIVA 2EP5A 2ZQZA 3PWKA 4HFMA 4CV2A 5DDIP 4E21A 2Y1GA 5THKA 1PGJA 4ZU3A 5AXBA 3JD2A 4L4SA 2VNSA 5L7TA 2PWZA 4BB5A 2A35A 3C1OA 2EF1A 4DIOA 3PQFA 3GG9A 3AU9A 4LRSB 4A10A 2GN6A 1M66A 5JDCA 2D2IA 4MVJI 3D7LA 3MJCA 2FPPA 4H15A 2Q4EA 4F45A 1QXSA 3DZHA 2QZ9A 4UULA 3TNLA 5L9AA 1CQJA 3NJ8A 4WCFB 1Z6ZA 3Q1LA 4AJ1A 3ZWVA 1IPFA 1YQXA 4O0LA 3NDRA 1H9BA 4KP7A 2I3AA 1I2CA 2J3KA 1E1KA 5HS4A 5EQDA 2ZB8A 5C3MA 1B2LA 4MKRA 1EFKA 1X1TA 4M55A 4UREA 5LC1A 1RWBA 2X1HA 3EUWA 3V1YA 4J16A 4DTIA 2VHYA 3GK3A 4L4RA 3HN2A 1QV7A 4LVCA 4RPLA 4Z0PA 3JYNA 2E48A 4BQRA 1GR0A 5A9SB 2VOEA 2P68A 4IDEA 2GO1A 4BKQA 4KZPA 4HXYA 3GUYA 3PZRA 1ZSVA 1CIVA 2GSDA 3DTTA 3ZHYA 4CMGA 5U4QA 3AY3A 3LQFA 5KNLA 1DRWA 4YJFB 2QX7A 3GF4A 3S2GA 3RU9A 4HNHA 1PEDA 3DZBA 2CDAA 1V6AA 3UHAA 3ZDFA 2PY6A 2WDZA 3MWEB 1QRRA 3FF4A 3OIDA 3T4XA 5T57A 1U7HA 2Y0DA 4EJ6A 4MPDA 3H5RA 4ND1A 3QVOA 4O59O 1PS0A 1P74A 2DBVO 2HMSA 4JNKA 2C29D 2FP4A 3OA2A 5TGDA 4HX5A 4D7AA 4LN1A 2JKVA 2W98A 4URFA 3PHHA 3ZU4A 2VHXA 2F00A 1YJQA 3IMFA 4OSPA 2OP1A 2QG4A 3Q6IA 4RO0A 2Z5LA 3A06A 2JAPA 3HE3A 4II2A 4R1TA 4Z3DA 1GYQA 1C0IA 3BTOA 2FSVA 4MP8A 2FY8A 3MJTA 2O3TA 5IF3A 1E6UA 5I9MA 1HT0A 1LC3A 4BO0A 4TMFA 1AHIA 2CF6A 2OBYA 2YV3A 3D3EA 3COSA 1U5CA 3JYLA 4IZHA 4DYDA 4RPJA 3JQAB 2SCUA 4NBRA 3AK4A 1PL8A 3TZCA 3PGXA 3P2OA 3R3SA 3FD8A 1O9BA 1MA0A 5A4DA 1LQTA 2X5OA 3ZWXA 5LDHA 4MVJD 4WECA 5COQA 3LT0A 2AMFA 1WAMA 4XIYA 4OMUA 1ZNQO 1GZ3A 3HWRA 1LRLA 5G0UA 3TRIA 2DUUA 3IIEA 4MIOA 2X86A 2NTNA 4IBOA 5K6AA 2PZJA 2D8AA 1PR9A 2EGGA 1EQ2A 4BNLA 1DXYA 3OHSX 3VDRA 5CG2A 1QYWA 2JFGA 1PGQA 1B8VA 1VL8A 4KDEA 1V0JA 3JCZA 3ZWMA 4BMSA 2PD6A 3C7DB 1NVMB 2BFMA 3IUSA 1ISFA 4O63O 4X54A 3B20A 4HV4A 2UV8A 4FGSA 2D0IA 1B16A 4J90A 4NIMA 3RCBA 2IRWA 3OETA 4YRDA 4Q39A 3CTMA 1GV0A 1PJ3A 2Q1SA 2I9PA 4Z9XA 2NM0A 2IEDA 4MO2A 4GLOA 5BSHA 4JQCA 3FHLA 3HDYA 3KUXA 5A03A 5F5LA 4D44A 2DTEA 5I9NA 3BMQA 3KSDO 2D59A 3WSWA 4GH5A 5DBGA 4ALKA 5C7IO 4C4OA 1XU9A 3KEOA 4CMIA 4J7CA 1WLYA 4KDFA 1PJCA 2Z1MA 1XA0A 3K30A 2X0NA 3ICPA 4NBVA 4UVGA 3C8MA 1K2WA 4YRBA 1O5IA 1GAEO 2P4HX 3PWZA 4IQ8A 5IXYA 3FBGA 4RQUA 3RBZA 1FDWA 2JHFA 1KC3A 5JYDA 3RC9A 4NU5A 1JLLA 1ZJYA 2VOJA 3VPSA 4YR9A 4TRJA 2DUWA 4LCEA 2AE2A 2FHSA 3ICCA 3WDSA 4D41A 1P77A 4UAGA 2IEBA 1N7GA 2B4TO 4JBHA 5JC1A 3NT4A 4E13A 4N5NA 1EE9A 4CLDA 4IUYA 4CM8A 5ILOA 3VVBA 4I08A 4OH1A 2R6JA 4FC6A 3B70A 4ZN6A 3PIDA 2ZYAA 1LDMA 4XQEA 4FOSA 1SAYA 2DLDA 3I4FA 4U0KA 3V2HA 1GUZA 2GN4A 1CEQA 3BTUA 3WWZA 4INAA 1NWCA 3RIHA 2D1YA 3A9WA 1U2DA 3WQRA 1E77A 1VKOA 3E18A 8LDHA 3TZ6A 3D4NA 1RPNA 3MJEA 3I5MA 4YTEA 4BO9A 1YQGA 3NDJA 1JAYA 2DPGA 5EESA 1UR5A 5GMOA 3TDKA 1H6CA 1UXIA 1YB5A 2D4AA 2VHZA 4W99A 1YE3A 3GMSA 3TFOA 2O3RA 5FEUA 4TRNA 2TMDA 3I1JA 3WS7A 3RKRA 1ENZA 1WWKA 2G82A 4QECA 4B3IA 5AXCA 1O94A 3RBVA 1I2BA 5AQ1A 4HP8A 5TSDA 2WD7B 3ETGA 4WLUA 3KSUA 4B7XA 1AXEA 2HQ1A 4GX0A 3KEQA 5IJZA 4B4WA 3ON5A 2VT2A 5I8ZA 1C1DA 1PJSA 2HMUA 5G4KA 3JD4A 1WMBA 2YHIA 1JTVA 4BNXA 3BHJA 3PQDA 5MGBA 3U09A 1C1XA 1UUFA 2JFHA 2RHCA 4JROA 1OI7A 4Q3BA 2PH3A 1XQ6A 1XKQA 2PTGA 4J7XA 3E5MA 4BO5A 2X5KO 2VYVD 4MVJE 4LSMA 4GVLA 3H65A 4M86A 5DF1A 3SXPA 3WGQA 1ONOA 4WASA 3DR3A 4GQAA 1HEUA 1NHGA 3NV9A 1E3SA 4NR0A 3W8DA 1VJ1A 3PRJA 4DMMA 4DUPA 4E2ZA 3O38A 2W4QA 3F9IA 4MVJA 1E7MA 1GTMA 3PGJA 2ZJ1A 4XWYA 4BV9A 4QFCA 1BXGA 1U7TA 3EW7A 3R6DA 1XEAA 1I3NA 4N54A 3X2EA 4R9SA 4EDFA 1HF3A 4YPOA 4YJHA 1J4AA 3ADOA 1N8KA 1F8GA 3SLKA 1X0VA 4DIFA 1XELA 1VL6A 4PLZA 1Y8QA 1P1JA 5B4UA 3JYOA 1MFPA 2HRZA 3G0OA 3WMWA 2XPCA 5CDGA 1BDBA 2VRCA 1R16A 3BMNA 2FR8A 3RFXA 4AJEA 1TLTA 4BNYA 3UCXA 2TMGA 1BW9A 1GZ6A 1HETA 3VKUA 3MCVA 2Q1WA 3H9JA 4IPTA 3I9JA 5DP1A 4CMAA 2VHWA 1G0OA 4RDHA 4K6FA 4DLLA 4UEKA 1UP4A 1NVGA 5ICMA 2EW8A 2Q49A 3G3EA 3L6OO 1ZEMA 3PHLA 5B1YA 4L73A 2O3SA 2ZCUA 3S8MA 4Z0HO 3I52A 3SC4A 1T1RA 3JQBA 1PZGA 3FWZA 4RGBA 1BWSA 4CMIB 3JQ9A 2GASA 4ZRMA 4R01A 4NQZA 3WBBA 1ZMTA 3JQDA 1NX6A 1PJ2A 1X7DA 2JCXA 1PJ4A 3KM0A 2CDBA 3GQVA 5IN4A 1UAYA 3BHMA 2WEKA 2EHDA 4YBZA 5KJ6A 1A72A 1GCOA 1LSSA 3HJAA 1JDJA 2VTEA 1ZK1A 4XGIA 1QYDA 1I3MA 4RPGA 2WYVA 3JQ7A 5I7FA 2QRKA 4ZQFA 3ZNOA 3ZWYA 3RUDA 2O7SA 3RUEA 4FGWA 4A26A 2WD8A 4WGGA 3VTZA 4JGBA 2FRDA 2BFPA 3ZV3A 4TSKA 1HDRA 4DQVA 1HSOA 1T1SA 1NAIA 2FR1A 2YDXA 4R1SA 4J9UE 1PTJA 4FFLA 3ZWNA 4BO8A 3EC7A 4HADA 4ZGWA 5EERA 1LDEA 3PK0A 5F21A 3VKVA 3H8VA 2CSUA 2JD2A 4JCOA 7ADHA 4TVBA 3G17A 4PLPA 2EKPA 2QYTA 3E9QA 4EEZA 5JCXA 4HNGA 1JKJA 1A7KA 4L75A 2V6MA 1AHHA 3GY0A 2WTBA 4PRLA 1MC4A 4E5PA 4LRTB 2HUNA 4CLXA 1EDOA 2Q99A 5KVVA 4L74A 3GZ4A 3W6UA 1KERA 2AG5A 5JS6A 1JQBA 4CQLA 1HYGA 3VAZA 4RVHA 1U28A 4IDAA 3WYEA 3HN7A 4Z9FA 2DPHA 3QVTA 2GDZA 1NQAO 1FJHA 3EZYA 1XG5A 4BO2A 5A9TA 2O4UX 3FNHA 4KMSA 4RZIA 1P1FA 2PA3A 1V3VA 5G0SA 5TS3A 3Q0EA 4XYBA 4N5LA 1Q0QA 3F5SA 4RVUA 1C1DB 1WDMA 1XQ1A 2HMTA 1PL7A 3E48A 1NFRA 2VYND 4XQGA 5G4KB 3ZWWA 5ICSA 3EK2A 4BO6A 4IJWA 4L4XA 5L4LA 4L9RA 3OFSA 2CDCA 3ONEA 1WZIA 1C1XB 1LSOA 3OIFA 4DBVO 4YQYA 3PHGA 3AWDA 5GY7A 4QSMA 4Q3EA 4R3WA 1CETA 3PVZA 2VRBA 3D1LA 4EJ0A 2AG8A 3CZRA 2UUPA 3RC1A 4FJ1A 2FPGA 1GQQA 2CVOA 4XYGA 4ALNA 4IS2A 1ML3A 1MXHA 1Y9AA 1N9GA 5DCYA 5IZCC 4ESOA 1PQWA 3NTOA 3V1UA 3GVCA 1NQTA 3IKVA 2PGDA 2ZIZA 1Y81A 4QFDA 3L77A 4CMHA 1E7WA 3ZV4A 1KEWA 1M76A 1YKFA 4UEJA 4YRAA 3UUWA 1MV8A 1WP4A 3AFMA 4YJHB 4BNNA 3EAGA 5TF4A 4QXMA 2A4KA 2EP7A 5EIOA 1Y8QB 3IUPA 3ETDA 2YFHA 4GX1A 1RYDA 1HSZA 1E3JA 1Q7GA 3PTZA 4ZJUA 1E1MA 2PGLA 2G0TA 3BMNB 3DO5A 2PD3A 4JN6B 5L4SA 2ET6A 1OAAA 4FFPA 4MP6A 4P4NA 5CDSA 1LDYA 1UDCA 4TQGA 1QORA 1SEVA 1BW9B 1UAGA 1EBUA 2PNFA 3GNSA 2Y1DA 2DKNA 2FZWA 3KHUA 1IL0A 2H63A 3H3JA 1X14A 3STHA 1VM6A 1TVEA 4FFRA 1CQIA 3ZZNA 1ZK2A 3E5RA 3KYCA 4R68A 3S2FA 1FK8A 3GRPA 4JK3A 3PYLA 1IZ9A 3IAHA 2CVZA 1TT5A 1VRWA 3DFZA 5KKAA 4ZQHA 4BHTA 2I76A 2E82A 1X1EA 1N1EA 4PFJA 3L4BC 4FBGA 2CVQA 2NQTA 4RVSA 3CE6A 3Q2IA 3HHPA 4J7UA 2I5PO 2VCYA 4J4HA 1HDGO 2CZCA 4PLCA 3LC7O 2YV1A 1EBFA 3KETA 2OMEA 3R0IA 9LDTA 2W90A 1OC4A 3RJ9A 4YAGA 4ZQGA 2E6UX 3ROKA 2W2KB 1DC5A 4I5DA 1H5QA 2BRUA 1LDBA 3JQ7B 5HM8A 4MVJF 3U49A 1E6WA 3BAZA 3H5NA 1N1GA 4YJDA 1OZAA 1D4FA 1GEGA 3O26A 4D0SA 5KOIA 4NBUA 4GPD1 1Z45A 4MIEA 4LSWA 4ILKA 4B7UA 4DQUA 5DCWA 3I9OA 1E1LA 3FTNA 1ZVMA 1Z73A 3DL2A 3NGXA 3QVWA 1IE3A 3PDUA 3LVFO 2HJRA 5THQA 3INTA 3AJRA 5BSFA 4NJOA 4BO3A 3JQFA 1DPGA 4YAEA 3W4JA 1GYPA 3DBLA 2CMDA 3KLPX 3PFWO 1Q0LA 2J6IA 1IOLA 2I6TA 4MINA 1CYDA 2V65A 4RVGA 3BZUA 2YW9A 1GCUA 4PRKA 1TXGA 1GZ4A 1LI4A 1EVZA 4J4BA 4LCJA 3Q9UA 2JCYA 1DBVO 1XGKA 4CMCA 3DAPA 3BXXA 4IQ0A 4R41A 2P9CA 4CLOB 1KEUA 3KO8A 2CNBA 4J49A 4YVFA 3QWHA 4R54A 3JYPA 3ZHZA 1NR1A 4M1QA 5EL0A 3U5TA 2PKRA 2AQHA 4GVXA 1Z7BA 4DIBA 4IIUA 2X4GA 1WPQA 2LDBA 3F4LA 3P5SA 2AEJA 2AW5A 2LDXA 3K31A 3H9QA 4NJMA 4C7KA 3ROPA 5CFZA 5C5IA 1LUAA 2B4RO 4K9DA 5A05A 4DREA 4P8RA 4WCDA 3RUAA 1E1NA 3I9KA 1NASA 3E82A 4DVJA 2W2LD 4RF3A 3NYWA 5EINA 3HDJA 1JU9A 2B35A 2HAEA 4P22A 5AVOA 4FJ0A 4TROA 1N9GB 4OXNA 5K0ZA 4YWJA 1JAXA 4ALMA 3KZVA 4GWGA 4PLHA 3KV3O 3FNGA 2UDPA 4E12A 1MXFA 1QSGA 1U4OA 1DOHA 1Q2XA 1H94A 3VZSA 5L51A 1T2FA 1YGYA 1KEVA 3RASA 3HUDA 1VPDA 1MG0A 4LMPA 4ZQBA 3TZHA 3GR6A 5JNLA 4AJHA 4O5OA 4XYLA 1LDNA 4ALIA 4KQXA 4IMPA 1AXGA 3L0DA 4PG4A 1F14A 4PLFA 1R66A 1EE2A 3ANNA 4E32A 4ID9A 2FZEA 4RJTA 5ADHA 1R4MA 2PZMA 1SB9A 5EPOA 5LDGA 1ZIDA 2V7PA 1A27A 3OJFA 1FDVA 1F0YA 1ADGA 1Q1NA 4FD3A 2YZ7A 3DZIA 1IHYA 2OO5A 1P0CA 1P31A 3FR8A 4AJIA 2ZQYA 1G6KA 3RUFA 3KYCB 1RM3A 1WW8A 3HG7A 3IJRA 3ITDA 2FSSA 2NVWA 4XDZA 1DIGA 3GAFA 3ZH2A 4CM3A 4GWKA 1BMDA 4XIJA 1KIFA 1IY8A 4M87A 1E3IA 1P1IA 2NVUB 3KTDA 1HE5A 3KBOA 4FSHA 4ND4A 3NAQA 4G2NA 3H7AA 4IQGA 1YL7A 4IGEA 1UDAA 4D3FA 2BGMA 4IDFA 4B4VA 1C0PA 4Y6RA 3S2IA 3I9LA 2UUOA 2ZTVA 3C85A 2RIRA 4R69A 3D0OA 5KJEA 3INGA 4S1VA 1BDMA 1XR3A 4W4TA 3GPIA 4E4YA 4PVDA 1ZSNA 3QVXA 3U3XA 1R0SA 3WGOA 1T25A 3I3OA 1YOVA 3DHNA 1SMKA 1QYXA 4FC7A 1O6ZA 4NK4A 1VJTA 2XOXA 3JYQA 4PZCA 3AUUA 1V3TA 4ALJA 2PKQO 3BMOB 4MIYA 4NZ9A 2HDHA 4WLFA 3WYBA 4CPDA 3U9LA 1XWFA 2GZ1A 3EMKA 4FS3A 2XXJA 3WJ7A 2YJZA 1LLQA 3L9WA 4AJNA 1HWYA 4G81A 1PJLA 4E2WA 2I3GA 4PLTA 2PD4A 5IXSA 3MJSA 2BGLA 1LBEA 1DRUA 4TWRA 3DB2A 2Q45A 3DBLB 3OQ1A 2P91A 1I0ZA 1P33A 3AM4A 3QP9A 3WGGA 1LJ8A 1PQPA 4DL9A 4BNHA 1R37A 5C7LO 3KRTA 1RYEA 4YDRA 4XEHA 3QHAA 5C37A 1Y9EA 4FB5A 2J3HA 2J5RA 1RKXA 1OFGA 1ZH8A 4WNIA 4WLEA 1T2AA 1PZFA 1QLJA 3V5NA 3DAGA 3RUIA 2C59A 4LISA 4KWIA 4QO8A 3WX0A 3OP4A 3OJOA 4KQWA 5JY6A 2I67A 2JD0A 3HSKA 4J3FA 2IZ0A 5ER6A 5DT9A 5EN4A 1R12A 4Z9YA 1OOEA 2E49A 2HCTA 4WPGA 3UH1A 2QYSA 3QV1A 4I9UA 4RORA 3WOHA 2IDZA 3Q11A 2OL4A 5AOVA 4RVFA 4F46A 4NJMB 1SB8A 1BXZA 3AFNA 4BUCA 3U4HA 3FSRA 3GDOA 4B4OA 2B5VA 3ITKA 4CL8A 3C7CB 3WLFA 2NVBA 3WMXA 3D4PA 1H2HA 1UZLA 4XB1A 5EMHA 3T7CA 2V6GA 2X7HA 4KWHA 3OQ6A 1ADCA 3QSGA 2J3IA 4EI2A 3OMLA 5IZCA 4CM7A 1R15A 1AUPA 2W2LA 1NPDA 5JDIC 4DC1A 4CR6A 1PU2A 4IY1A 5G4LA 2VWQA 4IZIA 1H0KA 1K5HA 3VZRA 3HFGA 3IC5A 1I32A 3SLGA 3U4IA 5CDUA 4D42A 1I5RA 4CUZA 2CUKA 3K8ZA 4WCFC 3WQQA 1NTOA 3P7MA 4H16A 2JD1A 2B69A 1KVSA 1J0XO 1LU9A 4NK5A 4PVCA 3WJAA 4BNWA 5A5EA 5JCJD 4LMRA 1T2EA 1A4IA 5IN5A 5JAIA 1Q7CA 4TRRA 5A02A 4NI5A 1J5PA 4ZICA 3DZGA 4TZKA 3H2SA 1M2WA 3EZLA 2B4QA 1B7GO 3GVIA 4I8XA 4RPHA 4K1LA 1QR6A 2EJWA 1GPDG 2Y99A 2GLXA 3ST7A 4BNIA 1DRVA 1OMOA 2A94A 1AGNA 1UZNA 4GSKA 3B1JA 4HY3A 5CEFA 2EW2A 4NFHA 4A2CA 4CUKA 1X7HA 3AOEA 4AFNA 1X15A 3C1AA 3EY4A 3ZGYA 5BR7A 2DFVA 3GG2A 3OA0A 2DT5A 2HKIA 3WGYA 3L4BA 3CPSA 1M6WA 4CM4A 3RU7A 5IDQA 1H9AA 2J3JA 2JL1A 1E0DA 4Q3DA 1I33A 3E6AA 3AY6A 1MLDA 3G1TA 4O6VA 4BS9A 2FPIA 1B15A 3ZCXA 2Q1TA 2Q50A 1HE2A 1DO8A 3ZWBA 4XRGA 1ZXLA 1JKFA 3K9QO 3GGPA 4FDAA 3WBFA 1DB3A 3VH1A 3FPLA 4CLRA 4R3NA 1ULUA 3LT4A 5F1PA 1U3TA 1EUDA 1H6DA 1DFHA 5I7EA 1JW9B 1LRKA 3AU8A 3C3XA 3R3JA 1YOVB 2NU6A 1ULSA 5BNIA 2BGKA 3FWNA 3HZZA 5F3RA 5A5FA 4AJPA 3PP8A 1G1AA 3WIEA 5JO9A 3L6DA 3GRKA 1ZKMA 5GZ1A 2VQ3A 3PXXA 1GUFA 4J1TA 4YJGA 4BKUA 5BSEA 3BMCA 3ORFA 4DWVA 2IODA 3NRCA 3TPCA 2X8LA 3QRWA 1E7RA 3PLNA 3CZMA 5T8KC 1HE3A 3ZU2A 1HLPA 1I01A 2CF5A 3NJ4A 2EG9A 3GEGA 2AEMA 3M2PA 1GPJA 3UCFA 1WZEA 5A1TA 4I9NA 1SC6A 3MZ0A 3T4EA 4K6CA 1ZK0A 1DC6A 1Z82A 2NNLD 1EMDA 3LF2A 5FYDA 5CPBA 4IJUA 3PJDA 3W8FA 3GC6A 4NPCA 1DSSG 3X2FA 3GHYA 4M89A 5CDTA 1PL6A 1WVGA 2I99A 1TEHA 2BMAA 2X6TA 4MVJG 3VH3A 4BMVA 4PZEA 5TQVA 1NFFA 3DAFA 1ISHA 1GEEA 5B4TA 2VZ0A 1SO8A 3FN4A 1NPTO 1DAPA 3MJ4A 4AJJA 1WXDA 4CQMD 5A04A 3MTGA 1KBZA 5L53A 2EEZA 2AQ8A 1U4SA 2R00C 4K26A 3M1AA 4L0QA 1VE9A 1IUKA 5KVQA 2Y66A 4NMHA 1W8DA 3TOZA 4B8ZA 1PX0A 5AXAA 3BTVA 2C20A 5DBIA 5HWSA 1IHXA 2QW8A 3O4RA 4J43A 4GSLA 4XD2A 1UZMA 3GN2A 2NUAA 3ZHBA 3MOGA 3WTBA 5FI3A 1HDYA 2VHVA 3KOUA 5DNAA 1ZSYA 1BGVA 1IPEA 1U9JA 5ENVA 2JCVA 3IOYA 4C7JA 3JQGA 1E5LA 1UXGA 2HK8A 3K73O 1CDOA 1MUUA 1N5DA 3MTJA 1VL0A 2VNAA 1E6EA 3M1LA 1S6YA 1YH3A 4BNJA 4HFRA 1QP8A 1UP6A 4A27A 2D3TA 2BI7A 3AI3A 3BMQB 3OJLA 3D3WA 3SJ7A 4BO7A 1R0KA 2Y1EA 5TX7A 4KUEA 3M6IA 1H6AA 1NQ5A 4BV8A 1T2CA 4E2YA 1K6JA 4I5EA 4YAKA 3ZI0A 4D3DA 3DMYA 5KJ1A 5DOVA 2G5CA 1JVBA 2BHLA 4W6ZA 1OC2A 1M67A 4UUNA 4JBIA 5BNFA 5JAMA 2Z95A 2XF8A 3OICA 4ROSA 3F3SA 4AJ4A 4WEOA 3BTSA 3DOCA 4F3YA 2D5CA 1YB1A 3DMTC 1PJBA 1TA4A 2WE7A 1SNYA 5F1OA 2WE8A 4QX6A 3TL3A 1YQDA 1KOLA 3SVTA 5G0VA 5CP8A 3D5TA 5L4NA 2PR2A 2F1KA 1BHSA 2B0JA 1WDLA 1D8AA 4J91A 1K3TA 1YS4A 1W6UA 2FR0A 2R2GA 4G5HA 4EW6A 3ZN2A 4CM8B 3GMDA 4YB8A 4IXTA 1I3KA 5JPIA 5CDYA 1E7SA 5JLAA 4CM4B 4GKBA 2NV6A 2Q3EA 3KVOA 4YYZA 1B3BA 4JLWA 4YT5A 3TJRA 2X9NA 4WLNA 3I83A 3WFIA 2AE1A 1B26A 3I6IA 2RAFA 5DBFA 2OZPA 3VH4A 5G0WA 2QZZA 4A7PA 1JN0A 1JA9A 2J5QA 2NU9A 3V1TC 1KY4A 4QTZA 1U8XX 1HDCA 3WG9A 2EV9A 1GDHA 3TWOA 3ZU3A 4Q3NA 1YONA 1EVIA 5JW6A 1GUYA 4QEDA 1ORRA 5DZSA 2FOIA 4RZHA 2HO5A 1SCUA 3PJFA 3I23A 2OHXA 4LVUA 2GNAA 2UYYA 1NFQA 1O89A 2A9FA 3EVNA 4XRRA 3BMCB 1XU7A 4I5FA 4N18A 1D3AA 5KVCA 4XGKA 4IXWA 3MEQA 5JYEA 3RUHA 3JQAD 4XX0A 1I24A 1ID1A 1DLIA 3M2TA 3KYDA 1R6DA 2YHIB 4IDBA 3UW3A 1EK6A 4DYVA 4OGWA 4Y6SA 5COAA 2OORA 2Y0CA 4Z0TA 4FFMA 1QYCA 1KETA 4BNMA 3PEFA 1V8BA 4HWKA 4WLVA 2HMWA 4NG5A 5TT0A 4O1MA 4D43A 3GPDG 3DOJA 5BQFA 2QQ5A 5J23A 3GT0A 2VYVA 4M8SA 1D1TA 2BD0A 2J5KA 3ZW9A 1Y8RA 1I3LA 2X0RA 1ADFA 1SOVA 2RH4A 1F12A 2BKAA 3W6ZA 1PZEA 3ZWOA 5H82A 2GUGA 5K6AC 1GQ2A 1M6HA 3VZPA 4ND5A 1W4ZA 4OOFA 1BXGB 4TVOA 4ZA2A 3LC1O 4CLEA 1U8FO 2YV2A 4NFSA 1XSEA 1I8TA 4DC0A 2B37A 4I1IA 1LRJA 1QLHA 2HRBA 2QRJA 4TKMA 4U6SA 5JY1A 3SBOA 4NBTA 3RBXA 2GD1O 3E03A 4A73A 3IP3A 5C7OO 3V8BA 4IJKA 3RKUA 3O8QA 3S2EA 1NPYA 2Q2QA 8ADHA 2PV7A 5DCUA 1E7QA 2DU8A 3JQGB 3HB4X 2PLAA 5JDIA 1W73A 3WGHA 1DJNA 4CM1A 4E3ZA 2GERA 2IXAA 1QKIA 3AOGA 4GGPA 1Y1PA 5L40A 1GV1A 2WWRA 1D1SA 4N7RA 5I7VA 5U9CA 1W0CA 3D3WB 4YA6A 4PIVA 3WWYA 4Y6PA 4RPKA 4NBWA 3FNFA 3KSZO 2C54A 5IG2A 1V35A 3PYMA 4L8VA 4P38A 1ZO8A 1Z74A 3UXYA 3EDMA 1ADBA 2AA3A 1LQUA 5ITWA 5JSFA 1Y5RA 4R1NA 4DPMA 3PHIA 5G0TA 2VZ9A 2DTXA 5H81A 3ZWPA 4D79A 4MVJP 1ZXBA 3AW9A 4CMKA 3U62A 5KWEA 3H9EO 4RF2A 5A9SA 3GHHA 1A7AA 3DBRA 2OUIA 1YXMA 1ZBQA 3AUAA 3WGTA 4GLLA 4TZTA 2POQX 1YO6A 4U6QA 4FCCA 3KYBA 3FR7A 1NM5A 2ZB7A 2GF2A 3KXDA 2DAPA 4PG8A 2PGJA 4YJFA 5IDYA 5HTOA 5HS6A 1HDOA 1V9LA 3FTPA 5A3JA 4TRMA 4NNJA 1KVUA 3OJEA 1T4BA 1YDEA 2OBNA 4PG6A 5HRUA 3C24A 2O2SA 1DEHA 1E3WA 4OSOA 4OXYA 3UKOA 4Y67A 4WOKA 4N5MA 4P4LA 3WIDA 1J6UA 1HZZA 1T2DA 1IULA 1NR7A 2NTVA 3AI1A 3I4CA 4IS3A 3VH2A 4EYEA 1HDXA 5JAZA 4CQLB 4WEQA 4H3VA 1D7OA 3WXBA 5H83A 1N7HA 1LNQA 4D45A 1MB4A 3EHEA 2DFDA 4A0SA 2P2SA 3QWBA 3GUCA 2CD9A 5ENDA 1TI7A 1P1KA 2EERA 1K6IA 1UJMA 4OO3A 3HDQA 2FMUA 3NGLA 2NU7A 4A5OA 3K6JA 3OECA 1IZ0A 4EGFA 2WYUA 1QV6A 3CEAA 3DHYA 4XQCA 4RLHA 3PPIA 4FIZA 2V6FA 3AUSA 3IS3A 1XHLA 3OM9A 5A06A 2GZ3A 3KYDB 3JQAA 4GMFA 3DQPA 2X9VA 4BGIA 1EZ4A 1X7GA 2VYNA 1E7YA 2GYYA 3E1KA 3EGOA 1JKIA 3PWSA 2NADA 4GX2A 3TOXA 1PZHA 4CM6A 4I5GA 3INRA 3GGOA 4PLGA 1UH5A 4P4GA 1H2BA 1P9LA 2NACA 2O7QA 3OSUA 3UFXA 5KKCA 1EVJA 3K5PA 4MKZA 1Y8RB 4WNCA 1N2SA 4GAEA 3L9XA 3UOGA 1LLDA 1SZJG 2YUTA 4DA9A 1C3VA 4DGSA 6LDHA 2I65A 3D5QA 1PGNA 5HBRA 3JD0A 1MP0A 1SPXA 2ZKLA 3ZWAA 3ONFA 2R00A 4J1SA 3DOOA 4LK3A 2O4CA 3GA0A 3SJUA 2WJPA 3LF1A 4R5MA 1DDOA 5G2OA 5JAQA 1BXKA 4PG7A 1LLUA 4FQ8A 5HA5A 4XYMA 4Z6KA 2XAAA 5T64A 1DFIA 1KY5A 1S7CA 3O03A 3O8QB 1L7DA 2BI8A 4EUEA 1KVTA 3GH3A 1DC4A 3EYWA 3MJVA 3OJ0A 1YL6A 2X22A 3N58A 3PQEA 2C7GA 4UVIA 4YT2A 4OKNA 3SX2A 1I2ZA 1LC0A 1MX3A 3GNTA 3HB5X 3QJ5A 1GY8A 4CM9D 3GAZA 2O23A 1MFZA 1NBOA 1B8PA 4UVDA 3WGZA 3A14A 1T4DA 4BGEA 1ZK3A 3GN1A 3BIOA 1RJWA 4XB2A 3JQBC 2YY7A 3R1IA 4Y98A 3JQ9C 1KS9A 3BHIA 3VPFA 4BGUA 1X13A 2EKLA 4WUVA 4YXFA 2VTDA 4RCVA 5JMWA 1TT5B 1E5QA 2P5YA 3L4SO 1Y5MA 5BT9A 4CV1A 1TT7A 2OFPA 3CINA 4E30A 1X0XA 2B83A 2GN9A 1GQYA 5CEEA 3TZQA 4U8GA 3DMTA 1U3UA 4RLSA 3HDHA 1BSVA 2X58A 2ZK7A 2HMVA 5A3VA 1JWAB 4XQ9A 4YAIA 1A71A 1EK5A 3QVSA 1CJCA 2VUSA 1VSUA 1I30A 3ETEA 3F46A 4OHUA 4UUOA 9LDBA 2PH5A 1YRLA 2IXBA 3DBRB 4PN3A 5IFLA 3TZKA 2DQ4A 5EQFA 3NTRA 1GU7A 1F06A 5CHEA 1O8CA 4TKLA 3EVTA 1P1HA 1EUZA 1KVRA 2PKQP 3K96A 4BO4A 4BMNA 1A9ZA 5KJCA 3B1FA 5ITVA 4Q3AA 4Q3CA 1RM0A 5I8WA 1DC3A 2NWQA 1B0AA 3DXFA 1NYTA 2HK7A 5BNTA 3PJGA 2X0JA 2ZYGA 1R0LA 4NDNE 3NX4A 3WICA 2HSDA 1E3WB 4B3JA 4PZDA 3F1KA 1HDZA 2HLPA 4D0RA 2H5LA 1NAHA 4PCVA 4WJZA 4HBGA 4MDHA 1DJQA 1ZUD1 3A1NA 4EJMA 2YQ4A 3FI9A 5LCXA 3WNVA 2I66A 4XJSA 3LT2A 2NU8A 3H3FA 3LT1A 4GBJA 4DMLA 1UP7A 3RVDA 1NNUA 5TIIA 4XR4A 3OH8A 4IGFA 1CF2O 3WFJA 1A5ZA 1ZCJA 2WD7A 2Y93A 3DZJA 3DC2A 1DIHA 3LZ6A 4S3MA 2J8ZA 3DBVO 5L7YA 3GEMA 3OIGA 3IL2A 3UVEA 2O3JA 4QUKA 3UAGA 1PQUA 4RF4A 2EIHA 1LTHR 2B36A 1TB4A 3WGIA 4AVYA 2X9GA 5L7WA 3ZNPA 1Z75A 1IYZA 1IB6A 3AUTA 4NHEA 4AL4A 3VC7A 3ASVA 5DULA 1BVRA 2CY0A 3NUGA 3HADA 2Y1OA 4LGVA 5F5NA 3JQ8A 4HUJA 1ZJZA 2BF7A 5DN9A 1VI2A 2B5WA 3G49A 4FFOA 3RAJA 3K92A 2FWMX 2UAGA 4I9HA 4GMGA 3ZNQA 7MDHA 2ZB3A 4F6CA 2H6EA 2IZ1A 5GZ6A 4F6LA 1HLDA 4JXKA 4BKRA 3AI2A 4GKVA 3ENKA 4XCVA 3CXRA 1E3LA 2Y1CA 4OAQA 4YT8A 4AJ2A 3E9MA 4D46A 5IDWA 3VPGA 5KVSA 1SEPA 4FJ2A 2VRCD 3ZV6A 1ZK4A 3FBTA 1FXSA 1M75A 4XDYA 2Q2VA 1UXJA 4MVJM 4JX8A 5TJ9A 1ARZA 5ER9A 4CMEC 5JMPA 4XZ3A 4JJIA 1WNTA 1YDWA 4CLHA 1DIAA 3W1VA 1DFGA 2AEFA 1VSVA 3WSVA 3ZU5A 3LC2O 2GR9A 3FRJA 3F1LA 3DHEA 5KCZA 2GPTA 1FDUA 1R4MB 4EEXA 1A9YA 4BNGA 1EEHA 4BOYA 2EKQA 5TT1A 4AJLA 4BGVA 1PR3A 1ENPA 1O95A 1CRWG 3F5QA 1EUCA 2VWHA 3QA9A 4GGOA 4WLOA 3VOSA 1U3VA 3IJPA 1PGPA 3LSYA 4CM9A 4D3SA 3FCOA 1ZZEA 3JSAA 4W9NC 4E5NA 1JVSA 1FDSA 1DAOA 5ES3A 4YQZA 4B4UA 1PIWA 4OKIA 1I36A 5BSGA 4ND3A 4WK6A 2C0CA 2C2YA 1F8FA 1XDWA 2JAHA 3V2UA 2QIOA 1HXHA 1HL3A 5I7SA 4DPKA 1J49A 3VPXA 4CMBA 2RH8A 4K28A 3ABIA 4J0EA 3HQ4O 5TJHA 3N74A 2EGHA 3CMCO 3LDHA 3GFBA 4W7HA 3TN7A 4DXHA 1HYHA 1SBYA 4IDCA 3W8EA 1P1RA 4E33A 2Y68A 2XXBA 3OEWA 3AM5A 1MG5A 3LLVA 4LW8A 4MJLA 3BYZA 4CJXA 4Y9DA 2GCGA 3ONDA 4PLYA 3OEYA 1NWHA 2BELA 2D5AA 2DBQA 3DWFA 3SEFA 3HFSA 4YCAA 4Y8VA 5CEJA 1P44A 1DHTA 3CSDA 1ZMOA 3S1LA 3ZW8A 1C0KA 5FI5A 3JQFC 1C0LA 5I9LA 5B37A 2Y1FA 1XCBA 4BNVA 4ZVVA 4J1NA 4JP3A 2P9GA 4UVHA 2X0IA 1QG6A 5EJ2A 4YAJA 3ZHXA 1MGOA 3LK7A 1ZFNA 5CPFA 5U1PA 2JFFA 1ISMA 3OBBA 5CAEA 1PWZA 2PZKA 3PZBA 4E0BA 1E92A 3TFQA 4CV3A 1XYGA 1JWBB 2O2YA 5T6BA 3FNEA 3GDGA 4EUFA 5KIAA 3RFVA 4DLAA 5CG1A 2ZTUA 4BVAA 4R4JA 3DTYA 1RM5A 4JP2A 2BLLA 3ADPA 4BNZA 3DFUA 4DBZA 2DM6A 2GRAA 2G1UA 1KC1A 3MWDB 1DHRA 3GZNA 3H4VA 3JD3A 1PSDA 2EWMA 2EXXA 3ZV5A 4E6PA 3ANLA 4J9VA 2JHGA 4BNKA 3RFTA 3DBHA 3JQ8B 1U2GA 4J2OA 4JBGA 4ZQEA 1O0SA 3FPCA 4XYEA 4B8WA 5JBIA 1GFSA 4H7PA 4KTTE 4KUGA 3F4BA 3U0BA 1LEHA 1OBFO 3RI3A 1HRDA 4RF5A 2H1SA 1G0NA 1UXHA 5KTKA 4GI2A 3JQEA 1CWUA 3W4IA 2VN8A 3UF0A 1K6XA 3H5AA 3QE3A 5JDCC 3IKTA 1FF9A 3ASUA 3VDQA 1NXQA 3WB9A 4RV9A 5JC8A 2CFCA 2VT3A 2X5JO 3E8XA 4XJTA 5L95A 3GFGA 1YBVA 3QWAA 4EZBA 2OOSA 4CR8A 2RCYA 2E4AA 3G1UA 1U1IA 4HFNA 2O48X 2V6BA 3JQCA 2NQ8A 1L7EA 3RROA 3QIVA 4UUMA 1GYRA 3QWIA 2DBRA 3KB6A 2Q46A 3PDJA 4YACA 2RBEA 1AN9A 1LXCA 4RVDA 3WLEA 4GX5A 4BKPA 4DPLA 1K89A 4B7CA 2GGSA 5JCJA 5GZ3A 3Q9NA 1ISGA 4WKGA 3NT2A 3I9MA 2VWPA 2YYYA 3C1TA 1YB4A 3PJEA 3W4KA 4HFJA 4CL3A 5B12A 3OF2A 4OJNA 3RQSA 1I10A 3GEDA 3ZWCA 5F1KA 2ZTMA 3VVCA 4J0FA 3NEPX 2Z1NA 1EDZA 1P3DA 3A28A 1ISIA 1BRMA 2BFOA 3RC2A 3IDSA 4KUHA 5KJFA 3UGKA 4BNUA 4R1UA 5IDXA 5TLSA 4BQPA 4OL9A 3IQDB 4OIMA 1PJTA 3Q3CA 4CM5A 6ADHA 1ZW1A 2Y67A 1VJ0A 1DLJA 5JE8A 2AHRA 3B6ZA 1CERA 4W82A 1V3UA 3JTMA 1PJQA 3QWFA 5IZ4A 2C07A 4UVEA 3VZQA 4U7WA 1PS8A 1P45A 1YVEI 2HU2A 4CODB 4UEOA 2E37A 4ITUA 3KLMX 5FF9A 3CKYA 2VUUA 3D64A 4RQTA 5FFFA 3ZNNA 2W2KA 3I6QA 4M54A 4PGFA 4AJKA 2OGUA 1VKNA 1VC2A 2ILTA 1EFLA 3ROQA 3K2BA 5DP2A 1YBMA 2C82A 2P5UA 2Y05A 2ZTLA 4EUHA 4CLRB 4OXKA 2WSBA 4ONEA 3LU1A 1QYVA 3AY7A 4QT0A 4XKJA 4R5HA 4J6FA 3L6EA 4IDDA 3S55A 4E2XA 2DTDA 4IINA 2VUTA 3OQBA 2DVMA 1LA2A 4JJGA 4OQZA 4E5MA 1R4NA 1N92A 3MOIA 4KOAA 1ENOA 4YJGB 4AG3A 3BA1A 2ZYDA 1GADO 1HE4A 3G79A 3LLSA 1Y6JA 2A92A 3F47A 3QY9A 2VWGA 3RWBA 3DZKA 3GGGA 3WYCA 4XGNA 5TC4A 4ALLA 3JQ6A 4IMRA 3GVPA 4EITA 2H9IA 4MP3A 1ONPA 3I9NA 4BL5A 3TSCA 3IP1A 4NU6A 4JJFA 4CLOA 4FFNA 1ENYA 4J2HA 3TF5A 1NHWA 3WTCA 2IYPA 5T5QA 4HKTA 1A4UA 2IE0A 3RD5A 2W8ZA 2HK9A 4WOJA 3NTQA 3E9NA 5IAAA 3UICA 2DC1A 1FDTA 1LSJA 3GVHA 1HZJA 3WQSB 2AQKA 1PGOA 2GN8A 2P9EA 2IZZA 3PHJA 3PI7A 3QW2A 1T24A 3T7EA 2C7VA 4IDGA 3ENNA 3UN1A 4BIIA 4II3A 2O3QA 3GZNB 2G17A 3JV7A 4XA8A 1MC5A 4CQMA 2YDYA 2C2XA 1GD1O 3NT5A 5T67A 4B3HA 1QMGA 5COBA 4CUJA 1RM4A 3P2YA 2O3UA 1KEPA 3DBHB 1YJ8A 1F17A 4J4TA 2PK3A 4WE3A 4ZRNA 4BB6A 5JXWA 4AJOA 3ULKA 4NH4A 4U5QA 3TL2A 3P19A 5JFOA 3RJ5A 4A03A 3NDIA 4OQYA 1LDGA 2Q2WA 1K0UA 4PLWA 4QQRA 4ZD6A 2OXIA 5JO0A 5TRTA 3CMMA 4E31A 1BTOA 5L45A 4MVJH 3NKLA 3HNPA 1PS9A 3VHRA 1DIRA 1WDKA 3SC6A 4MKXA 2PFGA 2GZ2A 3DONA 4WCFA 4CMJA 3PYXA 1WMAA 4KTVE 4CMEA 3Q2KA 3CH6A 3O9ZA 4R16A 1NVTA 2Q1UA 4R51A 4YT4A 1C14A 1U3WA 2WYWA 2X23A 3GLQA 3UCEA 2ZJ0A 1HTBA 2QHXA 4FR5A 1HKUA 1L1FA 3DDNA 4J1QA 3B1KA 2ZB4A 4R9RA 2Q4BA 5K9ZA 2NTJA 1YL5A 4DRYA 1YBAA 2PZLA 4W9NA 1DIBA 3GVXA 4W7IA 3AOEC 2IYOA 4GL4A 3CUKA 3TQHA 4RDIA 1LSUA 2NVUA 1Z7EA 3LYLA 1Q0HA 2P4QA 1T26A 5L3ZA 1B3RA 4FW8A 4PG5A 3WR5A 2YHUA 4FPXA 2EJVA 3V2GA 5DOZA 2YFQA 3H2ZA 4CV0A 3K2EA 4BKOA 3D4OA 4OYRA 5AYVA 2AQIA 3DEYX 1H6BA 2YQ5A 3DZFA 4E5YA 2HJSA 1LX6A 1EVYA 3H6KA 2G76A 4U0JA 4Q9NA 3GNQA 3RUCA 3L07A 1P0FA 2UVDA 4EBFA 1NQOA 3VPHA 5TNXA 4BNTA 2BFAA 4XR9A 3WNQA 1E3EA 1Y7TA 3AM3A 4ND2A 1U5AA 3A4VA 4CR7A 3BMOA 4AICA 3C7AA 4JIGA 3RC7A 1AE1A 4RL6A 1B8UA 2AXQA 3GOHA 1R4NB 1BVUA 2QRLA 2OP0A 4OM8A 4B79A 3H9UA 2NLOA 1NP3A 4MOWA 4UUPA 4IIVA 1ONNA 2FN7A 3F6YA 1SOWA 1UDBA 4YEDA 5T8KA 1KVQA 1PWXA 5ILGA 3VTFA 4M49A 1ISJA 1ZEJA 1EQUA 1FMCA 1UXKA 4FN4A 3GDFA 3QQPA 3QLJA 1Q7BA 4QO7A 1XLTA 1BG6A 3PLRA 3PFFA 4BO1A 2C5EA 4E5KA 5B4VA 2WMDA 4ZHSA 3N7UA 2ZCVA 2BH9A 3PIIA 3U4DA 4DLBA 2VZ8A 5MDHA 5AXDA 2JJYA 2WM3A 2C5AA
chains in the Genus database with same CATH superfamily
2GK3A 4QT4A 4JP5A 4IJVA 1B14A 1OX6A 1UFVA 1IHPA 1RLOA 2Y76A 5DO9A 3ZHQA 4F3TA 1XBTA 1EFRA 4DNXA 3IO3A 7GPBA 1GL3A 3QG5A 1XLVA 3LPDA 4KN6A 2BJHA 1OR8A 1ZU5A 4D99A 1X7WA 2Z6QA 4Q0MA 4OOEA 3PE4A 1KJYA 5KS2A 2D1RA 1ZH2A 4G65A 4IM7A 3PEYA 1FP7A 1MQSA 2ZI6A 1EI9A 1Q7TA 2OA0A 4BNFA 5JAOA 1HYEA 1PG0A 1XIVA 2ZQZA 4KE8A 3OY7A 1NSYA 3T3PB 4BRWA 1A2OA 3GAMA 4E21A 2FR8C 4II7A 5F7ZA 1NW6A 1MIOB 2N42A 3H1FA 1FZQA 3KOMA 4IIFA 8MHTA 3IE0A 4G26A 4M8LA 5AXBA 2AJTA 1A9TA 4ZZ0A 4BN0A 3SNKA 4OBEA 4ZC1A 2FMXA 2P0YA 3ER9A 2EFYA 3AU9A 5HTKA 5HX7A 2QUZA 4Q9HA 3LOQA 2J48A 1NRWA 1Y6GA 1MABA 2D2IA 3PQ6A 4LYJA 4EG0A 1W85A 4G8BA 4AUMA 2FPPA 1CE8B 4NX2A 1QXSA 3DZHA 3CE9A 5HIJA 2WHRA 2JJMA 3TNLA 4P0QB 2HA0A 3ED5A 3MHPA 1X3SA 3N8KA 1TU0A 3NJ8A 3STTA 3T6KA 3UMGA 4DMRA 1PUXA 4AMUA 4UASA 3UWDA 3ZWVA 3A3PA 1YQXA 3K8OE 4O0LA 2HTFA 4CT0A 1I2DA 1KKMA 1SHZA 4V2IA 4E03A 2J09A 4E14A 4OJKA 5FB3A 3UJPA 4FX5A 2ZVPX 1EB8A 5HS4A 5EQDA 3JWEA 2F43B 1VLVA 2IIQA 4LX0A 4Y2TA 4KACA 4ZI7A 3L05A 5C8YB 5HVNA 1EFKA 2IGBA 3UV7A 3GP8A 3I04A 2WIDA 3E22A 2GPBA 2CCGA 4AS3A 4UREA 1I14A 1M6EX 1Z35A 2BI4A 1GNRA 2ETXA 1HL7A 2L17A 3JVIA 3N76A 4M0MA 4UAJA 1AS3A 1GN9A 2WFZA 3ZYCA 4WXYB 3Q3GE 3Q3EA 4ECEA 2QU7A 5H68A 1VA5A 5B1DA 3KAQA 2AUNA 3LUCA 2ZT6A 3LZDA 2HN9A 3ESRA 4LVCA 4RPLA 4WESA 4X44A 1KZHA 4EPVA 4QZVA 5IM4F 4JT8A 2D3WA 4ZFNA 2VOEA 4NMMA 4ZCIA 4KZPA 4HXYA 1RI3A 4K88A 2EL9A 3KR2A 1CIVA 1ECGA 1PTJC 2C5LA 1IOZA 2GSDA 2YRWA 3F5MA 4H1TA 4CMGA 1XUOA 3G0DA 1IVNA 2VDMB 4JU8A 5BR8B 3KSRA 2CK3A 4W5OA 1MRSA 4PAWA 2QX7A 3MRVA 3AQ4A 4OFXA 3DQQA 4G8CA 1XMVA 5EYPB 3HH8A 1L4EA 1PEDA 4FP9A 2Q5IA 2CDAA 1YIAA 3Q0TA 1JLHA 4MGEA 1CZLA 1WTAA 3OIDA 5DTQA 5LB2A 3T4XA 3NMUF 1CQPA 3ZIAA 4PTZA 4AS1A 3ZD7A 1QJCA 1YS6A 5A7GA 2G80A 2FF5A 2AGVA 2Y0DA 2FXVA 2VG8A 3H1GA 4BLQA 5C34B 1GA6A 2V7GA 5H3LA 1H4SA 2YW2A 2NAPA 1TTTA 1T5BA 4EKGA 2DBVO 2GHQA 2HMSA 2FP4A 5TGDA 2W5UA 2VDNB 4NCXA 2R66A 5J4VA 3WAGA 1PL0A 3B7PA 4MNTA 1Z4OA 4TS4A 1AV7A 1P0IA 2F00A 3LHIA 1F2TB 2QG4A 2Y0BA 5K0BA 2JAPA 4LXQA 1JSRA 1E5XA 2ZUCA 3I6YA 2MMCA 4RE6A 3TLGB 1C0IA 1QH0A 2WKPA 2FSVA 2AC4A 3BTOA 3ONWA 1QTIA 2FY8A 2NU7B 4KMOA 4PTYA 1WXIA 4IRUB 2VAXA 5I9MA 4BO0A 3UCFA 1AHIA 3D3EA 3G2NA 3JYLA 1JEQA 1U5CA 2C78A 2IUFA 1UK9A 4LYFA 5HCIA 4DYDA 4UTZA 2ZM5A 3NOXA 3Q87B 2ODEA 3FB4A 1UEXC 3ASYA 5A7HA 1LTKA 4AZ3A 3SVZA 2HU8A 4CEJB 1MA0A 1E9DA 4NU8X 3RRYA 4P54A 3KJGA 3F6SA 4ND8B 2X5OA 4YRLA 1RBQA 3NPMA 5COQA 3LT0A 3LIPA 4MZDA 3H0CA 1WCIA 2GCOB 3D7NA 5HQJA 4K46A 1ZL2A 1L7VC 1ZNQO 2A9OA 3HWRA 1LRLA 5G0UA 5NLLA 4HDSA 1TF7A 2XSZA 4V1CI 2HRDA 1A69A 1VG9B 5FLXA 4BAUA 2P9TA 5K6AA 3AEKA 4UM9D 1PBNA 1PR9A 2D8AA 4TTPA 4NMXB 5EKSA 1DXYA 1J9GA 4LWZA 4EHJA 2ZSKA 1WKCA 2ZWMA 2JFGA 3MXOA 4L8LA 3K70C 2CB9A 1ICEA 5AVRA 2PRSA 3BC1A 3JCZA 1J70A 3NHYA 3MRSA 3DL7A 1OLSA 3D7MA 4M0KA 4B45A 1JIVA 3IUSA 3GW8A 4GWLA 4H7DA 1BDHA 5IVIA 1D2AA 2WIFA 2J9GA 2BDEA 4YY3B 2ZT5A 1PR1A 2IE8A 1B16A 1P1CA 2Y8EA 1BOOA 1KZ1A 2ZIXB 3MS4A 3OETA 4QOFA 2WWYA 4RHYA 3KZKA 4X92A 4Q39A 1GV0A 1PJ3A 1VOTA 4EVSA 2FUEA 3G6WA 4GLOA 2I1WA 1RKQA 5BSHA 3HDYA 5CLQA 3FKSA 2O2CA 3N3AC 4D44A 5B36A 1MDBA 2YY6A 4CKXA 4UATA 1MBZA 4MYHA 1MO5A 3QE4A 3DLCA 4UD6A 3OWOA 5BQ5A 1G3RA 3WSWA 2I2AA 1E2UA 4Q5IA 5DBGA 1BIFA 1CUYA 1PT7A 2LE0A 3KXIA 1HO3A 4PO9A 1XU9A 2QUIA 5J5VA 1E1RD 1PJCA 4DHEA 2G3YA 2QPTA 2E4VA 1WD7A 3RAGA 3BXPA 3WLQA 2ACWA 3GA5A 1W29A 1QGZA 1VLQA 5GV8A 5TMDA 4BX3A 2C9DA 2W93A 3C8MA 3EHDA 3DPSA 1GAEO 2JARA 1ODIA 3A27A 3I6BA 3M6LA 3PWZA 4IQ8A 1ZUNB 2VRWA 3FBGA 5AT1A 3W2EA 5IVDA 3EW9A 4RQUA 1Z5GA 1NNEA 1BFUA 2IOHA 2JHFA 5CT8A 1J1IA 3TSYA 4EB3A 4NU5A 1JLLA 1OWNA 4BFCA 2VFAA 3BWVA 2BMEA 2HY7A 2VOJA 4YO7A 2IF0A 3VPSA 4MAMA 2Q1XA 1X7XA 2RI1A 1UJ2A 1Y4SA 4JLJA 1SBCA 1YJBA 1SC3A 1XEXB 3ZDDA 3G9XA 4GZMA 3ZHSA 2VHTA 1P77A 1R8JA 4FYMA 2IEBA 2AC7A 3GGCA 1N7GA 2J7PA 5G41A 5P21A 3P32A 2Z4TA 1Y1QA 4JBHA 4MJXA 3ILSA 4TV8A 2ZJ8A 4CT5A 4CLDA 1M7GA 3KXKA 1G3IA 4HG2A 4IUYA 3VVBA 4CM8A 4CTOA 4OH1A 4FILA 3PXDA 1ZISA 3BRQA 4ZN6A 4XQEA 3FVRA 4FOSA 2DLDA 1L5HA 4GVPA 1CBUA 1FQJA 2M98A 3HY6A 3V2HA 1JLSA 2AOUA 4MRAA 1CEQA 1M5RA 3SQXA 5ALUA 1I6LA 2P1DA 3DE0X 4E88A 3H8JA 1L7OA 1NWCA 1WB5A 3JXEA 2D1YA 4OUKX 5LP6C 1ID8A 4O4JF 1VKOA 1QK5A 1QIFA 8LDHA 3TZ6A 4HC4A 3TM4A 3L7AA 3DNFA 3G5TA 4QBKA 1B0UA 1GN8A 2FW9A 1MR3F 3NDJA 4R1PA 1FP4A 5D6OA 5EESA 1UR5A 1DXHA 1IQUA 5GMOA 2INGX 5B3LA 4RK6A 3RAFC 1WZ2A 1I7QB 2C97A 3ZDCA 3TDKA 1CVRA 3VFDA 3FPBA 2D4AA 3ZUGA 3GMSA 5FTKA 4W1PA 5CNMA 4CKWB 3DLBA 3F2VA 4TWZA 3I1JA 2YXLA 4AD8A 3RKRA 2IEZA 1DUIA 1ZD4A 2IDMA 2ZS8A 3EDQA 1UPFA 3ZZTA 1PUIA 3O8LA 2Q6IA 3PKZA 2PJRA 1O94A 4G85A 3RRMA 4NZNA 5DLQC 4HP8A 1SVMA 5CXXA 4WLUA 3KSUA 4B7XA 1SOUA 3KEQA 1B76A 3P4YA 1Z0UA 1QGYA 4W5WA 5LJLA 1DKPA 3FLBA 1UJBA 4RIHA 4ZEWA 3CEMA 4DV2B 3T9DA 2W6ZA 3JD4A 1O0BA 2WAOA 4ZO6A 1JTVA 3PQDA 2P6PA 5BT8A 1PSZA 2EWVA 4OB7A 3EVDA 3SNHA 1G9XA 4HAWA 1A77A 1UUFA 2JH8A 4JROA 4OFBA 3HM9A 1FFYA 3FIUA 4HAUA 4EAAA 4H77A 4HSGA 3E5MA 2LRHA 2X5KO 5KYWB 3CF4G 4RHCA 1DO2A 2G06A 5EEHA 2GM3A 1NG1A 2O2ZA 4M86A 4OHWA 4WFIA 3WGQA 4FHEA 1MENA 1ULHA 1E3SA 2QK4A 4ZHQA 4UHJA 1MTZA 1RMQA 1UMBB 1ABEA 2OO7A 1U8ZA 1IG0A 2FMKA 3MN1A 4OP3A 3OT4A 4JDUA 5F4ZA 4F7WA 3I92A 4E2ZA 1YASA 2XA1A 1J23A 3L02A 3S5JA 3FTQA 2G6BA 4JXJA 5IT9A 4QDTA 1RE1A 2II6A 2O05A 3L0YA 5CD9A 1QNFA 3NU1A 3I5UA 3F7TA 4RFLA 2N0SA 1U7TA 3K3PA 3R6DA 3X2EA 4R9SA 1HF3A 5ANRB 1EA5A 1XRSB 4HWOA 3WWEA 2YNMA 3DOUA 1F8GA 2ORYA 3VU0A 5DI3A 3EARA 3OE7A 1EFPA 2VTBA 3R3ZA 5GJCA 3JYOA 3OCUA 4OGGA 3VR3A 3EG9A 2QV7A 4CRWB 2Q5LA 2JHAA 2XYPA 5TXGA 3L4KA 2EOAA 1XAIA 1AKYA 4HF7A 1G7TA 4MR7B 1CZUA 4LKOA 1YULA 1TLTA 3LWZA 1BW9A 3D8UA 1K6MA 1NTRA 1IN5A 2VDVE 1GQOA 5CIYA 4B09A 2XOKD 3ABRB 3CVXA 3H9JA 3E1SA 4OBWA 2X0EA 4CMAA 4EHBA 5JSUA 1GSHA 1UP4A 2JF0A 3L6OO 3AL3A 3LLMA 4S1OA 1C41A 2PUDA 4L73A 2O3SA 3RVSA 4I50F 2HNKA 2X1VA 2XD9A 1X9IA 3CX3A 3LGAA 3N86A 2HL6A 2JLWA 5C32A 3BGOS 1ULBA 4UEQA 1BWSA 1J1ZA 2HCFA 2WU4A 3JQ9A 2ZSEA 3OKPA 5HF9A 4DCPA 4HNUA 5C5DA 3HU2A 1RQNA 1YDFA 3HKCB 4S1NA 3PUIA 2HHCA 1Z2DA 2B30A 3RSOA 4HUTA 1YZHA 1UOPA 3OU2A 4C7OA 3GEEA 1ORHA 1JVNA 4H7JA 4MR8B 3BHMA 3NATA 1JG3A 1YHZA 2WEKA 3K09C 1JDBC 2AF4C 2FH5B 2HF7A 4MTCA 2EHDA 5NULA 3WL8A 2BFFA 4FOLA 2OQIA 4TYQA 1Q3TA 4TL9A 2XAUA 3DTVD 4MQUA 1IONA 3TW6A 4M7OA 4D2IA 3L8MA 4EJMA 2PEYA 3ED1A 1I3MA 1R4AA 1Y4DE 2SECE 2QTFA 3JQ7A 4OA8A 3ZY4A 2IH4A 1IEVA 3OKFA 3ZNOA 4G0QA 2PRYA 5CM9C 2EAUA 2YZGA 3ZWYA 3R44A 1WV0A 3HJFA 1G5FA 3IR6A 4TX1A 3DC7A 1Y6RA 3D02A 1JXOA 4FGWA 4EMUA 3SYMA 5CXSA 3PHCA 4I6JA 2FRDA 4LF4B 3ZV3A 2YY5A 4TSKA 1HSOA 1T1SA 4R1SA 4AAYA 1T91A 4FFLA 5JS7A 1RCTE 4O2BA 3EC7A 2OPHA 1GNTA 4HTAA 1SCJA 4ZGWA 1TPZA 3IP8A 4NFLA 2CSUA 3Q3VA 1N5KA 3G17A 4KI7A 4N8EA 4MV1A 2EKPA 3E9QA 3HVHA 5K3DA 3ZDQA 3RYIA 1A7KA 1ZA1A 4AKTA 4CWAA 4Y2RA 1AHHA 4EECA 4C0HA 4DA7A 4CXMA 4PRLA 1MC4A 3H13A 4MXDA 4KJZA 2PPLA 2VP0A 2Q99A 3MBOA 3R5FA 4LHZA 5KVVA 1GDTA 1E1YA 2WUVA 3GZ4A 4INZA 4L74A 3W6UA 4MB0A 2F8TA 1KERA 3P9IA 1SQ6A 3QX7A 3WHIA 1RHMA 1HYGA 4DRXB 5JS6A 4RVHA 2IYVA 1U28A 2NSYA 3TINA 4DMUB 4M0LA 3UJ6A 1QTRA 4LI3X 4KYTA 2IGTA 4ZC8A 1SG0A 2ZSHA 4KQCA 3VVLA 2DPHA 3PBKA 1WE2A 3OCCA 2GDZA 1ZHHA 1NQAO 1FJHA 3EZYA 2BFBB 3O4HA 2WNIA 3WIVA 3ZUPA 2A9QA 4B7ZA 1XG5A 2AFIA 4FCTA 5A9TA 2O4UX 3AHHA 5ARDA 4M0EA 3SR0A 1G8FA 1P61B 1MOZA 1WUTA 5A0VA 4BE7B 5ED0A 2KS6A 2LGJA 5LMUB 2J30A 1Q0QA 4H08A 4N5LA 4ETNA 1C1DB 1U0HC 1WDMA 1XQ1A 1YZYA 2HMTA 2PA0A 1NFRA 3IIMA 3SR4A 3A36A 3FROA 3T35A 4BO6A 4IJWA 4UHHA 1GTSA 1Z18A 4L9RA 4PIMA 2VF5X 1OILA 4O4IA 1EFVB 4PAGA 3LLUA 3H4MA 3VUFA 4N01A 3PHGA 4TYWA 2H4YA 3PGVA 4AY5A 4L7VA 4DSZA 2JKYA 4Q3EA 2QTTA 3QFHA 3S7TA 1GJRA 1VMKA 2R751 1CY4A 1V7ZA 4IDNA 3W6NA 1ZH4A 5EVCA 2CVOA 2G7ZA 2IZOA 4L95C 5EE5B 5I8PA 1QIIA 5IZCC 2I9KA 4KFRA 5EEGA 3NTOA 4GS5A 3JASA 3QF4A 2CBGA 2EFDB 2I0FA 5BVHA 2ZIZA 4RAQA 3L77A 2H1VA 2Q4DA 5J2UF 1TIKA 4FR2A 4MX8A 4YUAA 1R1DA 1RSZA 1YB2A 3ABSB 2R1TA 2DLNA 4YRAA 3CB2A 1WP4A 3PCTA 1P3JA 5GJWC 5E0OA 4M9ZA 2AJDA 3RT9A 3Q72A 2ISCA 1IWBB 2QL6A 3VR2D 5I6DA 2XNHA 3AZOA 3DXZA 1J0AA 2D74A 3HZOA 4GX1A 4HS4A 4K86A 2R7KA 4O8CA 2W8BA 4M3NA 1Q7GA 2GLUA 3LCJA 3PTZA 2EBUA 2PSJA 1NZDA 3B2QA 3HY4A 4KPUA 1Z13A 4JL5A 1BCRB 1XNJA 4FFPA 5AKKA 1SG9A 4ZTUB 1LDYA 4OHYA 4JASB 2H4JA 1TM3E 5IANA 3N2KA 5IC6A 3AHGA 2JFUA 2XUPA 3GNSA 2OSBA 2PGOA 1OB5A 1EDDA 5ALGA 1E2HA 1X14A 2OHJA 3INNA 3OQVA 4KRXA 3ZZNA 1CQIA 4TLMB 1L5YA 3E5RA 3KYCA 4RLFA 3RBAA 2C2OA 3Q7SA 1JMYA 4R68A 3GRPA 1RAFA 5HYVA 3RC8A 2YXEA 3BE8A 4B44A 3D2BA 4WSOA 1VRWA 1Z2PX 2VEDA 3DFZA 2JFNA 5ELLA 3L8DA 5TEWA 5CJJA 2R5NA 3MINB 4LHYA 3NHMA 4MWSA 4NATA 2G4LA 2KBFA 4X00A 1IN4A 2I5PO 1QGUA 2YIVX 1SCBA 3BCSA 4J4HA 5BO5A 4GQBA 3DEFA 4L1KA 2CJFA 2R44A 1EBFA 2VATA 3PSHA 9LDTA 2W90A 1JF8A 1PKXA 4GBMA 1P80A 2AFHB 1QH8A 4QOGA 3TKLA 3K0SA 1R3UA 3IRVA 4YAGA 2J4DA 3VPBA 4ZZIA 4IOKA 5BVGA 2E6UX 3ROKA 1Z6AA 1DC5A 3SF8B 5DM4A 1H5QA 4X6YA 1LDBA 4BXOB 3WK7A 3H16A 4QBIA 3UAWA 3GLFA 2RI6A 1Z07A 4MVJF 1DCFA 1GGJA 1QS0A 1T1GA 1E6WA 1WUHS 3EULA 3CH4B 1F3OA 1D4FA 1MD9A 3D8RA 3O26A 4ZARA 3TD6A 1KK0A 4C4RA 4HH0A 1U2SA 4NBUA 5KKNB 2PX4A 2AKYA 2ZI5A 3TB6A 3WDMA 4BTVA 2J3LA 1VLHA 2OK8A 1NDUA 3IVMA 1SU6A 5EXDA 5M3BA 2JGNA 3AFGA 2Q1YA 1JT2A 5TARA 3RHSA 2B0CA 2NUPA 3NGXA 3MWGA 2VXCA 4YR7A 3LVFO 2HJRA 3AT1A 4MHOA 5CFPA 3INTA 5DW3A 4H6VA 4NJOA 4BO3A 1QKJA 3QYJA 2EZUA 3IHWA 3K72B 3K4HA 3T0FA 3CBGA 3V1KA 3BK1A 4UNRA 1IOLA 3ELYA 3RC3A 1KMMA 3N5CA 5KX5A 4R2WA 2XT9A 1CYDA 2WJZB 1M2OA 5DCLA 1R5JA 1TMKA 4JI8B 4D82A 5EMMA 3VSDA 3NM4A 3E2MA 2O7NA 1P72A 1U0LA 2IU0A 3Q9UA 1XGKA 1E5TA 1ORDA 3DAPA 5IHPA 4PS1A 2PJZA 9ABPA 1SK8A 5LXTB 2C2HA 4NAUA 2P9CA 1OJ7A 3WP0A 1Z29A 4CLOB 4B3BA 4J49A 4P7BA 4C78A 5HE8A 2DQYA 3QVLA 2PIAA 4V0QA 3OOJA 3UWOA 4I1OA 3JYPA 4V1CB 3I28A 1G20E 5LZ4A 4LOIA 3ZGNA 2J1LA 1QJ4A 2YWBA 4PBSA 3GPCA 3PHBE 1FYXA 5EL0A 4YONB 5C8XA 5I7RA 1VMAA 2I54A 1I6MA 2AIRA 1XEWY 3JVVA 4PIPA 2Q9AA 4QNRA 4US0R 2X0DA 1O4VA 2X4GA 1WPQA 4JQOA 4M7WA 1IJEA 1RRMA 2YV5A 4IIJA 3CKLA 2PGNA 2Q8QA 2XQKA 3B1XA 3BORA 5HDQA 3Q6NA 4ZPJA 4EP1A 2BF4A 3ZQ4A 4L8FA 2PKWA 2R96A 3RH0A 3VU3A 1FP6A 2WPDD 5K3AA 5D3MA 5E6UA 5JAHA 4URVR 1OKKD 4WY2A 2C2MA 4RMGA 3LQ1A 4BQIA 7MHTA 3OCZA 2ZJZA 5F4BA 2FPGB 3FUUA 4RF3A 4R84A 5EINA 3HDJA 1JU9A 2HAEA 3OD1A 1GG2A 1JILA 1KH1A 1USUA 1N9GB 1STOA 2P2NA 3FYTA 1CG6A 1IZ7A 1FEZA 3LG2A 4N1AA 3KZVA 1S9DA 4MUYA 3P9RA 3NM5A 1KMQA 3FNGA 3X0DA 5IP5A 5JRDS 3H2IA 1MXFA 1QO9A 2ZJAA 2H85A 3IB3A 4EO4A 3QXJA 1T2FA 1YGYA 4RHUA 4BFTA 1ZONA 1JE0A 3B5IA 4E7OA 3IJEB 2VJMB 1KIMA 4XH9B 3TZHA 4J0QA 1QO0A 4XLTA 3R09A 4AJHA 4XYLA 1JU3A 3CKKA 1LDNA 4ZYWA 1D4OA 1Z7WA 2DGDA 2OR3A 4LAFA 2DQSA 2OCKA 4B81A 1R66A 3ANNA 3H2HA 5B30A 3DMRA 1ZJ6A 4CTJA 1YZGA 4QYIB 1EXNA 3CW8X 4B8YA 1RAIA 2V7PA 3KL2A 4BP8A 1ADGA 3RCBA 5CB4B 5REQB 1KYIA 4DR7B 1NV9A 2H07A 3BIFA 2PLWA 1IHYA 1N6PA 3G2KA 1XROA 4MYSA 1P0CA 2F3RA 3LZCA 2XKKA 4AJIA 3WLSA 3U4AA 1XLWA 1RM3A 3BJMA 4L22A 1ZDMA 2Q5CA 4FLMA 3IJRA 4ARSA 5FLKA 5IK2D 3ITDA 3TOSA 2QDXA 2GZMA 5FTNA 3KCQA 4FLEA 1J8QA 1U2EA 4XDZA 1TO1E 1BXRB 5IPFA 2YYZA 1T1EA 1JP7A 1KIFA 2CUZA 5AICA 1P1IA 3WE7A 4K87A 1CNMA 4FSHA 4EB8A 2P90A 3NAQA 4K2HA 4G2NA 1ODFA 4P3KA 3C6MA 3LPAA 4I8DA 3QFCA 4TM7A 3L8HA 3FSEA 1ODKA 3JPWA 4N4AA 1Z0DA 1C0PA 1Z0IA 1UPTA 3SQOA 1O3YA 4G5YA 3QBEA 1EDEA 4MK4A 1TGYA 2C04A 2H51A 2X8BA 4KK4A 4M6WB 3U7GA 4J0IA 4UBOA 4F5WA 3O8CA 2ZTVA 3KVRA 3PT9A 4X85A 3UHOA 4AZSA 1ELOA 1W47A 1VPVA 2RIRA 2Z9DA 3AR8A 3C85A 3D8HA 4J0DA 1RRKA 3PEVA 4P9NA 4YBRA 1FDIA 2H5JA 2HJVA 1WZCA 2ODNA 3INGA 3BH6A 4E4YA 2HWKA 3GPIA 1MHTA 3QVXA 3VSCA 3U3XA 3MQ2A 3WGOA 3I3OA 3LUBA 3KELA 2O5CA 4BMPB 4NK4A 5CYPA 5EXXA 2XOXA 1JEYB 1ZAKA 1XZHA 2GBFA 2GPSA 1V3TA 2WC1A 4PZCA 4D4IA 1EHYA 1SIWA 1T4MA 1QIJA 1EX9A 1FFDA 4H59A 3SSAA 3BMOB 3M5WA 3PQCA 2HDHA 4FHZA 1XEFA 4JEUA 1M0WA 3O90A 1DE0A 2GZ1A 3A9RA 4X0EA 3H97A 4FS3A 5J1TB 3U9LA 3CCFA 1PV1A 1U3CA 3E7PA 4WAUA 3T7AA 2Z2IA 1ILWA 3L9WA 1D0VA 4HUQA 1PJLA 1QOQB 5LP6B 2PD4A 4B87A 3IUQA 1WBBA 2XE4A 3IR7A 3CR3C 4IR7A 4D4MA 4K9MA 4PQYA 2XR1A 3MAJA 3SXJA 5C7YA 2Q45A 1SWVA 3DBLB 2AH5A 1UOOA 2P91A 3ABZA 3QP9A 3AM4A 4H0NA 4U1RA 3WGGA 4B5LA 4JX9A 3OTWA 3OWHA 4OYYA 1YS9A 3BKWA 2PUJA 5EMLA 3F6BX 1A5TA 1WL8A 2BY4A 4HDNB 3DS8A 3HUUA 4XEHA 5DXJA 4MR9A 5JSZB 3TQCA 1L5KA 3N05A 1MNAA 1Y9EA 2OVBA 5C37A 4MYRA 2G4VA 2ZYVX 5D6NA 3CYFA 4ZOLF 1ZH8A 4WNIA 4WLEA 4GI3A 1FNNA 4JUBA 4DLVA 3EUAA 3K9CA 1PZFA 1QVZA 3K05A 4K03A 3ROEA 2ADOA 3V5NA 4B76A 3D6VA 2IV7A 5JZOA 3RUIA 3UMYA 5FAXA 1V6SA 4QO8A 5THXA 3TL6A 4ZRDA 3A58B 4NZMA 5JY6A 2JD0A 2JFQA 1XRQA 1XZFA 3NO4A 4FDTA 2CC2A 1SVSA 1R12A 1TFRA 2PNJA 3DWGA 4WPGA 1R9JA 3UH1A 4BQQA 5ICGA 2FX3A 3QV1A 4WK2B 4YJKA 1TIPA 2PPVA 2MTBA 4I9UA 4IFIA 4N6NA 1NVDA 2IDZA 2OL4A 3Q11A 3TM5A 5AFSA 1G20B 4F46A 3KPJA 3E2IA 3IPAA 4KO1S 4ARZA 2ACKA 3U4HA 3AUYA 3GDOA 1X7WB 4RBNA 3TTTA 4B4OA 3C7CB 3IDAA 3WMXA 1ZIXA 1XO1A 2IHYA 3HU3A 1ZNYA 1HFJA 3L2OB 4XB1A 4CIWA 5H7XA 1Z4PX 3R4VA 3QZUA 3U4QB 1Z8FA 4WXPA 3CNQS 1ADCA 3KZOA 1X86B 4NCKA 3TSWA 3OCWA 3KTOA 2J3IA 4EI2A 4YMLA 8AT1A 2G72A 4CM7A 1U8AA 1R15A 1G63A 1MB0A 1EFUA 1KY2A 1RJGA 4QPNA 1QAOA 4RL4A 1NUAA 4P6VF 5K3CA 5JROA 4TYMA 2WUEA 1UBHS 1TYEB 3MTAA 2A0WA 3L93A 1H0KA 1K5HA 3QVUA 2HDNB 5FTMA 3VZRA 1F7UA 3FKQA 5KREA 3AHCA 1NV8A 1W85B 2AUTA 3SLGA 4AKEA 4DQKA 5CDUA 1DQRA 1GSIA 4WCFC 1SCQA 5CB6A 3WRVA 2H1LA 3ESBA 5DYYA 1J0XO 2OGSA 3U2QA 5A6SA 5K8JB 1IRXA 1G5IA 1JAHA 1EIWA 4PU0A 4UBIA 2XNJA 3JR3A 1FLDA 3IBSA 2VPQA 1XAJA 5IN5A 1RWVA 5EIFA 1FPMA 1ZH6A 4ZICA 2IOFA 1IY0A 2OD7A 2XNDD 3DV2A 1MRNA 3EZLA 3GVIA 5JJ5A 2NXEA 1YR8A 3UMVA 5JCZA 1N5MA 2EJWA 1GPDG 1AZSC 2OBFA 5HFNA 2Y99A 1MEEA 4WY5A 1RQ2A 3ST7A 3IVRA 1S3IA 3E22B 1NP7A 2HLNA 1DRVA 1ZHFA 1SXJD 2CXNA 3L04A 4JUAA 3SFVA 2Z83A 3AIOA 2VA9A 1OWPA 1UZNA 1FLAA 3A05A 4HLUC 2IDJA 2IP2A 1C2TA 3H83A 4UTVA 4N3GA 1L7XA 2EW2A 4N12A 2CHQA 2FZLA 2FWJA 3T38A 2EHJA 4I3HA 2WSIA 3KYJB 1JXMA 2DFVA 4ENTA 4EPTA 4IF4A 2RGNA 3DZ8A 2UZ0A 3CFYA 4JLAA 1P4AA 4JOQA 1KGDA 4RK7A 4W5JA 3L4BA 3WGYA 1FXWA 4IJMA 3GEIA 4TM8A 2C4VA 1TPYA 3HBFA 3S1AA 4W5TA 1OSNA 5IDQA 1H9AA 2J3JA 2SKEA 1E0DA 3QUAA 4HEA6 3ZZ0A 4WBNF 1J21A 1MLDA 5LYJB 3KDSE 4X64B 3ZCUA 3RO7A 2CJWA 3C97A 1B15A 1KP2A 3IO5A 1TL7C 4NCHA 3FI0A 1II9A 4JP1A 3U40A 3ZXIA 4XWTA 4ENRA 4JB2A 3D2CA 4XRGA 1ZXLA 4ZAGA 3V1LA 2WZDA 3T7IA 1P6UA 1W581 2XADA 4Q1VA 2XZDA 3OOEA 1EYZA 4X3OA 3L06A 4H1HA 3GP5A 1U3TA 4MICA 2B3TA 2G9UA 3C3XA 4FHCA 3R3JA 1OBCA 4KH1A 4WCVA 4YRFA 2VJDA 2XWJI 3WLKX 1ECFA 4YQFA 1AMOA 3C1UA 1L5OA 3HZZA 3O6VA 3QU7A 4JBYA 1P2BA 1J42A 1VHTA 1SK9A 3NKFA 3MOSA 2P5TB 4P7FA 4BLUA 3RF7A 1RPJA 4YJGA 4AY3A 1QHYA 4HRAA 3OPQA 3LTEA 2HCJB 3O1JC 2IODA 3R20A 1DWQA 1A98A 2D00A 4MVXA 2OC9A 4HB4A 4DSAA 1ZOPA 3GFTA 3RHZA 1VKHA 5AMXA 1AK9A 3T95A 3PLNA 1SC9A 1C9MA 3U7JA 5AESA 5FR1A 1HLPA 3D8TA 5D86A 3ZU2A 3O4JA 1I01A 1EVQA 4J94A 3REQB 4FDUA 1Y34E 3GEGA 2AEMA 3HBJA 3M2PA 3OBIA 2D7CA 2AF3C 2DFLA 2I71A 4D0GA 4HL6A 2G6TA 2CLEB 1CFJA 1JEQB 1POXA 1P5JA 1YJ5A 1KMCA 2HDWA 3KV1A 4BVGA 4BC0A 3VKFA 3HB9A 3W7VA 3N2IA 5EIXA 1VCNA 5FYDA 1EZZA 1GNSA 1T36A 1YB6A 3PE6A 4UHFA 1P0MA 1RQRA 1WLSA 4M4SA 5DTEA 5EVJA 5TVKA 3GC6A 3W8FA 5CDTA 3GHYA 2H29A 2YBEA 1PL6A 2G08A 4MVJG 3VH3A 1KBQA 1O6GA 1SULA 3A25A 3Q7TA 4MCHA 4AMYA 5JTTA 1G291 5LFAA 3N5KA 1WCIB 5B4TA 5LOVF 4UPVA 5DYWA 1VIAA 3KJEA 4KX5A 4LDZA 1RXEA 4UC0A 4HDSB 3LW7A 5AKEA 2ZJ6A 3NBKA 1UT6A 2ST1A 4G5SA 4O4LF 4QOSA 4BVJA 1UDWA 3EVGA 1J06A 1OE0A 3TIVA 1ZGZA 3AO0B 3LMKA 3W2TA 1U4SA 3HKEA 3CNOA 3M1AA 4R7TA 4BVBA 1U1CA 4NMHA 1S4MA 1YZKA 2QRPA 1YZQA 1V8PA 3BTVA 4PNPA 2H1CA 2C20A 3PNMA 4QATA 5DNVA 4YAOA 2GTIA 1S01A 2Q0QA 5AK3A 2GM9A 4U7PB 4UCXA 5K0LA 1M34A 2E87A 3MOGA 3JS5A 4HN9A 4AK9A 2QTVB 2PGIA 4W5RA 2VHVA 4YRMA 4RTNA 2IX9A 5KDOA 1IPEA 3EGVA 3M4YA 5ENVA 4PS0A 1RXWA 1PFVA 1VGQA 1H22A 2JCVA 3JQGA 2GEFA 4PC3A 1JRLA 3R8FA 1Z88A 2HK8A 2PMKA 3QXHA 4DJAA 4MWBA 1JA1A 2XRZA 1JFSA 3K1AA 3AHEA 3M1LA 1A50B 1DKUA 1W1WA 4BECA 1NKTA 4DDTA 4HFRA 1W87A 5A4DA 1UP6A 1K27A 2D3TA 1J7KA 2I3DA 2PCJA 2WAMA 1OY1A 3OJLA 4GICA 4BP9A 5FV4A 5KSYA 2WJ4A 1VE6A 3IAM1 3IT1A 2ZTSA 2ZWAA 3SJ7A 4C87A 3GLUA 3BB3A 2B21A 1HYQA 1DBWA 3F4KA 2O8EA 3BERA 1K6JA 4PR3A 1XLUA 5C35A 3E9DA 1QZZA 4ITRC 2BR5A 2EF0A 4ESHA 4XWGA 2WU3A 2ZRJA 3CKMA 1CV2A 4PWZA 5DOVA 1UPAA 3OAAA 3WMGA 1JVBA 3GLHA 4ZMRA 2IYUA 5JAMA 4FHDA 3OICA 4AJ4A 2QJRA 1KO5A 1Z47A 3TDMA 4QDZA 4X7PA 3E58A 3O92A 4YQEA 3DMTC 1JLLB 2WE7A 4L51A 4B3TB 2ZE5A 3P20A 4QU8A 1SNYA 5F1OA 3AETA 4QX6A 4N8DA 1OXSC 3CNBA 4NECA 2ENWA 2FZCA 3KIPA 5IWAB 4F5DA 1BE6A 2FWIA 2PR2A 2B0JA 2R6HA 2WHQA 2E4XA 4ZQCB 3OTOB 1ZICA 3G5MA 2P8JA 1K3TA 4KQIA 3NR2A 5ALRA 4B31A 1RLMA 4G5HA 2B1RA 2B8WA 2YZKA 3IH5A 5SYAA 3BZBA 3ZN2A 4CM8B 4EW6A 3DW1X 1WEKA 4WVFA 2FPLA 1E7SA 1LJUA 1WX1A 3PNSA 4CM4B 1S8AA 2FNAA 3KAJA 2Q3EA 3R3UA 4GKBA 1L5HB 2OZKA 4OQMA 3DZDA 3W5HA 1N2BA 1AGXA 4WLNA 1RKUA 2GZDA 2SKDA 2IV2X 3U7QA 4M0DA 1B26A 2OSVA 5ALIA 5BN4B 4Z4GA 2RAFA 4NULA 5DHSA 4RD6A 1Z6TA 1MGPA 1ZBDA 2QZZA 1U0JA 4IYJA 4NDZA 5G0WA 1JN0A 2IYSA 3RR2A 3T4UA 3V1TC 4A7PA 1XD9A 1H1LB 1O87A 2PBFA 1KY4A 4FMBB 1FSPA 4IIEA 3KWLA 4KG7A 1YZTA 2E7ZA 3LUPA 4JJ7A 1HDCA 3KZMA 1OYYA 1FP4B 2EV9A 5CFQA 4UM5A 5C3UA 1BO6A 1OQAA 2EKDA 3S70A 1DJLA 4EELA 3DSRA 1EUDB 5AKIA 5DHRA 3BILA 1ZGBA 3NGMA 1AHNA 4ZOCA 4QEDA 4BPBA 1EA7A 2PS1A 3FMOB 2HO5A 4G5OA 5A7FA 1SCUA 1ZWLA 5FA8A 1GQRA 3A37A 2HBYA 3CJQA 1XPUA 2GNAA 2QRZA 3CONA 3IQEA 1W4LA 3MMPA 1W94A 3CUVA 1U7UA 2FU5C 2QLTA 2WRZA 4OHFA 1SD5A 2G71A 3RG2A 4RS3A 2FE4A 4L6IA 4G63A 4I5FA 4N18A 3FPFA 1TKRA 2Q7XA 1QIMA 5KVCA 2C2KA 4XGKA 3PX7A 4CU5A 1E4OA 4AMBA 1CY1A 4JEHA 3JQAD 4MWOA 4XX0A 5KYKA 4N0EA 2FX5A 5E4TA 1I24A 2IPNA 3M9LA 5AQEA 3VNSA 1DLIA 3ZHCA 3TECE 3KYDA 3FDXA 1KQGA 4OGWA 1J0CA 1ZD9A 2Y0CA 3U16A 4QYMA 1RIFA 1VLZA 1W2HA 4CF6A 3CUTA 4HWKA 2NYRA 4F11A 2FMHA 1N2IA 1W4CA 4YRKA 4KR6A 1GPH1 5KHAA 4D43A 2PFKA 3JAWA 2QQ5A 1A8SA 2YZNA 1BYIA 1V48A 1C7RA 3KL4A 4OG2A 3R74A 3RPEA 5J23A 2VYVA 2DULA 4IX9A 4ZHQB 1F1JA 2GDJA 2J5KA 4KSCA 1KPGA 3RM3A 2X0RA 1ADFA 1SOVA 2GAFA 2MT9A 1N6NA 2BKAA 3L0BA 5MN4A 1ZX1A 2D1TA 3VZPA 3SQMA 1QVRA 2E6KA 1ITZA 1QTNA 3ENVA 2C9MA 3K2QA 2AI3A 2I4IA 4TVOA 4ZA2A 2CWDA 3BEOA 3Q3IA 4DMGA 1XSEA 1I8TA 4DC0A 2VK8A 4E5DA 4I1IA 1WCWA 2HRBA 3SJZA 4C7XA 2IY8A 2FW0A 4KJXA 4TKMA 4UPEA 2QD2A 3TXAA 4RZSA 4UM9B 1EFPB 3RBXA 5JY1A 2ZBFA 4KEAA 2OD9A 3N9IA 5AO9A 4ZALA 4EH1A 5JWOA 3HUTA 1XZAA 3AHDA 3VC2A 4JI6B 3ZXYA 1NPYA 4CTMA 3ILVA 5FOQA 3RS7A 5AP9A 3NDBB 2AMLA 2A9RA 2PV7A 3L43A 3TKYA 2BYTA 5TF0A 2JHPA 3DVSX 3ILXA 1SQFA 3EC2A 1HE8B 2AT1A 3EOZA 2IXAA 3R7DA 5E7IA 2YWHA 4GGPA 5EJMA 3CVUA 1GAXA 1E6MA 1IBKB 2OUKA 4QA9A 4E2FA 5L40A 2VCHA 1U2PA 1GVHA 2I7TA 3DDOA 3UMMA 3W05A 2WWRA 4J0GA 4N7RA 1W0CA 5E8RA 3CPJB 4Y6PA 1WXFA 4RPKA 2QKYA 3FSGA 2IYZA 3DJYA 4NBWA 2J3DA 2HX1A 1K8ZB 3QJYA 2HO4A 2O5VA 1ZIOA 3ANTA 1QC5B 3CTPA 4JLKA 1ZO8A 1DBRA 1ECPA 2Q3FA 1Z74A 1T0HB 3I45A 3P96A 4NMWA 4R2HA 4X90A 2ECPA 3EDMA 3FOWA 3V7WA 3W5SA 2NT3A 1IZZA 1GU1A 1LQUA 2XF2A 3E9CA 4AX8A 3S2SA 1Y5RA 4MW1A 1XTQA 5G0TA 1YK0A 1KSGA 3UMRA 4N3NA 2VZ9A 2DTXA 2E85A 2C4NA 4UHBA 5F35A 4DEXA 4Z4CA 3ZGOA 1RDFA 2FWBA 1IQ0A 1KAOA 1X8LA 5LWHA 2JGRA 2GJ4A 1D0SA 2R4TA 1R7RA 1EM8A 3HI4A 3NBUA 5KWEA 2QZPA 3VQTA 3PR3A 1J25A 3P9QA 4FXOA 5A9SA 3NC1C 4ZCTA 1H2ZA 2DLCX 3DBRA 1UWLA 3N8HA 4X45A 1PJZA 3TG8A 1KI9A 3DFIA 3AUAA 3O1LA 3WGTA 4PFSA 5DNCA 4U6QA 1K4YA 3KXDA 1