3MCVA

Structure of ptr1 from trypanosoma brucei in ternary complex with 2,4-diamino-5-[2-(2,5-dimethoxyphenyl)ethyl]thieno[2,3-d]-pyrimidine and nadp+
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of Trypanosoma brucei pteridine reductase ligand complexes inform on the placement of new molecular entities in the active site of a potential drug target.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 93
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3mcvA00
1E1LA 3LT2A 5AXCA 5BSFA 3OICA 2BKAA 2HK7A 2PTGA 4YACA 5JCJD 2QX7A 3D4NA 2PWZA 2A94A 3OIDA 3PJEA 3ZU5A 4XB2A 5CEJA 4QSMA 1HWYA 3I4CA 4BS9A 3NX4A 3TZCA 3ANNA 1ENZA 2D8AA 1T2AA 4L74A 4JJGA 5A04A 1MC4A 4HFJA 3CSDA 3PVZA 5AOVA 4M8SA 2GD1O 1T2CA 2PZMA 2VHXA 1TA4A 3ZCXA 4YJDA 3KHUA 3WNQA 2VQ3A 3KRTA 1NBOA 2D5CA 3R3SA 1Y8RB 1LLUA 1P33A 2J3KA 2I9PA 2EF1A 1YB5A 4I1IA 5I8WA 3ETDA 3GEMA 3I4FA 3L4BA 1ARZA 1DLIA 3E1KA 1SPXA 3GHYA 1E7QA 1DHRA 1I3MA 2PR2A 1X13A 3DL2A 5EINA 1LLQA 5KTKA 4J0EA 4A27A 1HLDA 3ABIA 1RYDA 3F1KA 1WXDA 1L7DA 3KLPX 1Z7EA 1I33A 1K6IA 2NNLD 3BTSA 3P2YA 2DTDA 1J5PA 2IXBA 2NVUA 2Q50A 3RKRA 1LDEA 1QYDA 4TZKA 3DWFA 3MJSA 1RYEA 3EZYA 3GEDA 3MJEA 2DBQA 4E4YA 4FD3A 4UUNA 3H9UA 1TT7A 1ZSYA 1AHHA 4MVJD 1E3WA 4I5DA 3EMKA 1PS0A 1IUKA 1J6UA 4W6ZA 4BL5A 4ZQBA 1CWUA 4BB5A 3D3WB 2O4UX 2QZZA 1I3NA 1EUDA 5LCXA 4PG4A 4BKPA 1GYPA 4GKBA 3OETA 3UCFA 4ONEA 1VSVA 4HV4A 2O7SA 1LEHA 1PQWA 1VSUA 4LW8A 3TFOA 4EUFA 3L6DA 2JJYA 2O3QA 4PLZA 4XR4A 1B8UA 5T67A 4L4XA 5K6AC 3FNFA 4DIBA 4NJMB 1PGOA 4TVOA 3STHA 2VUTA 3PWKA 2A92A 2O50A 2Y05A 3CZMA 4L8VA 3I6IA 3CH6A 4TKLA 1HDGO 4DQXA 5CEFA 1S6YA 5DCWA 2EEZA 3ZNNA 4BO7A 4I9UA 1DHTA 3AM3A 4BKUA 4CLRA 4UVDA 1HDXA 4ZU3A 4N7RA 2WDZA 4JIGA 1BW9A 3DONA 2O48X 4GMGA 4PG5A 4A5OA 4AJ1A 3DBLB 3PI7A 2VRCD 1EVIA 3PPIA 4CR7A 1U5CA 3ZGYA 3KUXA 4M54A 1V9LA 1E7MA 2C2YA 2EGGA 3FBGA 4GQAA 4Y67A 1UXKA 3GN2A 4WEOA 9LDBA 5BSHA 3TZHA 4DBZA 4BMVA 4J7CA 3TOZA 2FN7A 2QG4A 3VAZA 4IIVA 6LDHA 4O5OA 2P4HX 4JQCA 1Z82A 2XAAA 4DYVA 4R16A 4HNHA 2YUTA 3HADA 3ZWPA 3HE3A 4BMSA 1HSZA 3WGZA 4YAKA 2VTDA 2NTJA 1PL7A 3WFJA 2GF2A 4W9NA 4UVIA 2HJRA 3QWFA 4B3HA 3IKVA 1HYEA 1CRWG 2NU8A 1XKQA 2Q4BA 4UAGA 3B6ZA 4FDAA 4NK4A 3GGPA 4E21A 3V2HA 1FDSA 1R4NB 3W8FA 2EERA 1LSOA 2P91A 3W6UA 4AL4A 4FPXA 2RH8A 3OBBA 4GVLA 4ZA2A 1YO6A 3JQEA 1SCUA 3PRJA 1GL3A 5L40A 4PGFA 3UF0A 3DZIA 1IPFA 4YXFA 3HFGA 3ST7A 3E82A 2AQ8A 3NV9A 1GEEA 1FMCA 3IC5A 3VPXA 4LVCA 5DBFA 1BXGA 3UKOA 1JW9B 3VDQA 4PVCA 1UDBA 4BNHA 1P0FA 1GYQA 4GGOA 4J43A 3UHAA 1JU9A 1DIAA 4IGEA 3AM4A 5A4DA 3LLVA 2WYWA 4BNGA 1KVRA 1D7OA 4NDNE 3GFGA 2HSDA 1GCOA 3CIFA 3IMFA 5EIOA 4XYGA 4FQ8A 3RBVA 2HCTA 5JSFA 4CR8A 4D3DA 2YZ7A 5TGDA 5TX7A 1OAAA 5EQFA 5KJCA 1PEDA 4MIEA 1DSSG 3GDGA 4J4TA 1IOLA 4K1LA 4YJGB 5U4QA 4ZICA 5JNLA 2V6BA 4MP8A 3TF5A 3VDRA 1LRLA 3LF1A 4GX5A 5DZSA 1VI2A 2W8ZA 1S7CA 4A0SA 4XYMA 4IUYA 1T25A 3PXXA 1PL8A 3AWDA 4RPGA 4YRAA 3JYOA 1A7AA 2Q1TA 4O1MA 1Z7BA 1PJSA 4RVDA 4OMUA 1TXGA 4R9RA 1UAYA 3GVPA 5EJ2A 3PHHA 1G0NA 1FDUA 5L4LA 2DKNA 4ND2A 1GV0A 1WMBA 3UH1A 1FDTA 4YR9A 4J2OA 1NQTA 3WQQA 1Q1NA 1YL7A 3H9EO 3K2BA 5CFZA 2Q49A 1SAYA 3GGOA 3SLGA 1GZ3A 2DUUA 4KUEA 3SC6A 1A27A 1M76A 2HK9A 4EDFA 3M2PA 2PZKA 3DAPA 1WDLA 1QORA 3AI2A 5L7TA 3H2SA 2IRWA 1LNQA 2GDZA 3QE3A 5TSDA 5CDGA 3ZW8A 3TPCA 5C3MA 1EEHA 1SO8A 3LSYA 3RI3A 2UVDA 4L76A 4U6SA 2H1SA 5JDCC 3IAHA 3RSHA 2HMWA 5IJZA 5T8KC 1ISHA 3W4JA 3ENNA 1VL8A 5C37A 1O95A 1YJQA 2I76A 5F1KA 3WYCA 1XG5A 9LDTA 2O3RA 1D8AA 3PGXA 2QIOA 4OHUA 3TNLA 1DLJA 3G49A 4GX1A 4YA6A 2CNBA 4KDEA 4AJLA 3E9NA 4Y8VA 4D42A 4WEQA 3JQBA 1WDMA 1P1HA 4N5LA 3AOGA 1Y81A 3VTZA 3AFMA 1KC1A 5GZ3A 2WE8A 2BELA 3EGOA 1A71A 4YJFA 2Q45A 3QQPA 3RQSA 4A2CA 3QRWA 4FJ2A 1AGNA 3WICA 5JE8A 3VZPA 2D3TA 2D5AA 3ZV6A 3KYDB 3GDOA 1H6AA 3C7AA 2X4GA 1NFFA 3W8EA 3DMTC 3HDJA 3WGHA 1H94A 3W6ZA 4CL3A 2HRBA 1C0IA 2B4TO 1ZIDA 2B69A 1J4AA 4FJ0A 4EZBA 4XX0A 5JXWA 4OSPA 4RF4A 4OM8A 1WAMA 2VOEA 1HT0A 4Q39A 5KKCA 1I8TA 2J5QA 2X86A 1XCBA 4ALKA 4EUEA 1M6HA 1P1RA 2PFGA 1AN9A 4CMIB 2DPHA 3NUGA 1UZLA 1V3UA 4NG5A 3ONEA 1QYCA 2V6GA 1EZ4A 5A3JA 3U9LA 4NFYA 3ICPA 3V1TC 3TSCA 1U3UA 3KM0A 3QWHA 4O59O 3EUWA 3TN7A 5DOVA 3ZV4A 2CVQA 1J0XO 4B4OA 1IYZA 2R00A 5T64A 1BTOA 3P7MA 1G6KA 1Q0QA 3ULKA 4XRGA 4R01A 1PJ2A 3DBHA 1BXKA 3QVWA 2PH3A 1U3VA 4AVYA 3NTQA 3FWZA 1D1SA 4J49A 1EQUA 4PLFA 1TB4A 4BNFA 5A06A 3F5QA 4P8RA 3L4BC 2CDBA 4BNKA 1ISIA 4EJ6A 1KY4A 1ENPA 3LT0A 3M2TA 4KWHA 4XR9A 3VVCA 3MJCA 5TF4A 4IINA 2DPGA 2NUAA 5MGBA 2ZTMA 4XRRA 3TJRA 2OHXA 1SB8A 3CZRA 3AU9A 4MP3A 1ADGA 4D43A 4E2ZA 3GT0A 4EBFA 3NGLA 5KJ6A 3F4BA 3LT1A 2JHGA 5TT1A 1U8FO 4B8WA 1LDNA 5G0TA 4JBHA 4LSWA 3B1JA 4HADA 4DA9A 5ILOA 4ZRNA 3HDHA 3ONDA 4GWGA 4KWIA 4E5MA 1PS8A 2ZB4A 1ZK4A 1N1GA 3ZWCA 3RUHA 3WIDA 4Q3EA 4KP7A 4BQPA 3V2UA 1VM6A 1X7GA 3W4IA 3GVHA 4JBGA 4MVJI 3C1OA 1X1EA 3COSA 3I5MA 4HFNA 4LN1A 5JBIA 2YQ4A 1DAPA 1I2BA 2B37A 2HUNA 4ALJA 4J1QA 4RPHA 1T2DA 4UREA 1PZEA 4FFOA 5HWSA 1R4NA 3KZVA 5JY6A 5ITWA 4PZEA 4Z3KA 4FFNA 4AJIA 3BMNA 1P44A 4UUPA 2AE2A 1NP3A 4BMNA 4XIJA 1Q7CA 5CPBA 3JQ7B 2Q1WA 4UEOA 4J1NA 2EIHA 3LDHA 3H5RA 4RPKA 1RM0A 1YBAA 4BO0A 3BZUA 3WSWA 1F14A 2NV6A 4J9UE 4Q3AA 2BD0A 4FGWA 3LT4A 2GYYA 3OJFA 2GPTA 2QYSA 2ZTUA 4Z9FA 1H9AA 3GUCA 4WCFB 3HWRA 3WR5A 2NLOA 3K31A 4BV8A 4OIMA 4FN4A 1X1TA 1DPGA 3JQAA 4K6CA 1O8CA 3U09A 4ZN6A 1YONA 2AG8A 4RVGA 4U0KA 3QWIA 2J6IA 2Y93A 4RPJA 3RASA 2ZTVA 2GN4A 1PWXA 1K89A 2BHLA 2UUOA 1N9GA 1B14A 4J90A 4RPLA 2C59A 4IIUA 2H63A 3I83A 4DIFA 4M49A 1JVSA 4J7UA 4NH4A 5TJHA 4IY1A 2I3GA 2HO5A 3PYXA 1U9JA 4ZQHA 4BB6A 3DHNA 4DBVO 2OP0A 1K6XA 2PKRA 4YJHA 5BT9A 2IXAA 1A4IA 3ITDA 5I9LA 2IYPA 2D1YA 2EGHA 1ZXBA 4AJ4A 3O26A 4XQCA 3A14A 1LDYA 4Z9YA 5JS6A 3PFFA 4IXWA 3WGGA 3LQFA 2OO5A 4K9DA 1U5AA 4RL6A 1LQTA 3NT4A 3PWZA 4F46A 3NJ8A 1MXFA 2WMDA 4O63O 4OH1A 3HJAA 1LC3A 4FFMA 3DAFA 2VWGA 3OJOA 3PYLA 3WS7A 5CG1A 2W2LA 4LRSB 4BKQA 4ZVVA 4EI2A 4XDYA 1QLJA 1HE3A 2AMFA 3VPGA 2RHCA 4MJLA 1Y5RA 4URFA 4ZHSA 1IL0A 2OBYA 3MJVA 1XHLA 2O3UA 4XYLA 2ZKLA 3GAFA 1DRVA 3O4RA 5BSEA 5IDWA 1D1TA 5B4VA 3IOYA 4GI2A 5DCUA 1IB6A 2VYVA 4GH5A 5GZ6A 2DAPA 4RCVA 1XQ1A 1HRDA 2DFDA 1MFZA 2RCYA 3L77A 1P1FA 4FSHA 4YQZA 1UAGA 2IODA 4E5PA 5JYDA 3SX2A 4PVDA 1C1DB 2WM3A 5JC1A 3NRCA 3DFZA 2PD6A 5ICMA 2WYUA 3L6OO 4B4VA 5CPFA 5I7SA 1K2WA 5G4LA 4WLVA 1DJQA 4ZQEA 1P74A 3X2FA 2NU9A 3KSUA 2EG9A 2EKLA 1E77A 5TT0A 2NM0A 4EYEA 4B7XA 2B4QA 1ZCJA 3KYCB 2LDXA 3OEWA 4NU6A 3FI9A 4Y6RA 4YAGA 2Q1UA 4J2HA 2IYOA 4XYEA 1QYWA 1E3EA 2VZ0A 3FWNA 4PN3A 1F8FA 2GZ1A 1GTMA 2ZYDA 3B1KA 4FFRA 4R9SA 5F21A 1UZNA 4I5FA 3ZHBA 1CERA 4Y9DA 4HFRA 5KJEA 1CQIA 4UEKA 2GGSA 3IUSA 3AUUA 1Y7TA 3GNQA 3JD1A 3JQ9A 3RCBA 3VPHA 2I3AA 3DBLA 4E6PA 3K96A 4OQYA 1G0OA 1YOVA 5B4TA 1YDEA 1VE9A 4EEZA 4J1SA 1E7YA 2ZIZA 3KB6A 1JN0A 2DM6A 4YT5A 1WWKA 4GX2A 3S55A 4NJOA 3DMTA 2GLXA 5T6BA 4PLPA 4TSKA 4KUGA 4EITA 3LC2O 1Y8RA 2CDAA 3S2GA 5CDTA 4PLTA 3PLRA 4U0JA 2POQX 4EW6A 1Z75A 2Y68A 3NGXA 4BNWA 3ZDFA 3IJRA 1PTJA 4J6FA 1EE9A 3RC9A 1EK6A 1K5HA 3AUAA 4L0QA 4A03A 4BNXA 2C82A 1CEQA 4M89A 3U0BA 3BTUA 4DTIA 3ZNOA 4FOOA 4DUPA 3AY3A 3F1LA 4JJIA 1NASA 5TLSA 4XIYA 3ETEA 1ZBQA 2J5KA 5JMPA 3C8MA 2DLDA 2B5WA 1PL6A 1X0XA 5J23A 3QA9A 3GOHA 2HLPA 4DREA 2D0IA 1DIGA 3R1IA 4IGFA 4A73A 1ZVMA 4DWVA 3N7UA 3VPFA 4AFNA 1KERA 3DHEA 3DZKA 3H2ZA 3ENKA 1TT5A 4Z0PA 1M2WA 3BMCA 4GX0A 1KEPA 4ZJUA 4MVJP 5G4KA 3OQBA 2TMGA 4Q3NA 4WCDA 1D4FA 1DC4A 3FHLA 1V3TA 1ZSVA 1ULSA 4YVFA 3D64A 1ML3A 3FPLA 4YAJA 3RUAA 4FOSA 3E9QA 1QYVA 1A5ZA 3PQEA 4EUHA 3ZV3A 4AJNA 1VLLA 3PQDA 3QVSA 3VTFA 1HTBA 2FY8A 3INRA 4BO3A 5CP8A 1O5IA 4IMRA 4Q9NA 1YKFA 4DC0A 5KIAA 3RUFA 4MVJH 2WD8A 3A9WA 1EFLA 3BHIA 1BRMA 3B70A 3ZWNA 1R16A 3ZNPA 3RAJA 3GG9A 1PQUA 3DZJA 4QXMA 3KSDO 1WNTA 1TEHA 3MCVA 5EL0A 3ROMA 1P1IA 4CUZA 1NR1A 1B3BA 1FXSA 3EC7A 4ITUA 1HF3A 2BMAA 4CM9D 4HWKA 4J4BA 3DR3A 4E2WA 1IE3A 1VL0A 2OMEA 2Y1DA 3QLJA 4CM1A 3RU9A 2YV3A 4LSMA 3D3WA 4YJHB 3JD2A 3TQHA 1PGQA 2GZ2A 4YYZA 2NQ8A 2HMTA 5AVOA 1HZZA 1I30A 4L9RA 4PG6A 4YCAA 4TRMA 3UGKA 5ENDA 2YY7A 1QP8A 4BNJA 2H6EA 2X5KO 4UVHA 3FTPA 1E3WB 1DOHA 4BNLA 3D1LA 2EKQA 4IQGA 5A1TA 1ZEJA 3FR8A 3MZ0A 4Y98A 2X58A 4XQGA 2OGUA 4PRKA 2FRDA 1B16A 4NR0A 3H3FA 4E3ZA 4GSLA 3TFQA 1VJ0A 1W4ZA 3AI1A 1P9LA 2J5RA 1IHXA 3RIHA 5I7EA 1XA0A 1XDWA 1DIBA 3BMQB 1E3IA 1H93A 1B3RA 3RVDA 3TZ6A 3K2EA 1QKIA 3OM9A 2ZYAA 3QVTA 2YHIB 4IJKA 1SB9A 4QX6A 1I0ZA 5ES3A 1V6AA 2FSSA 2P4QA 4IS3A 3QIVA 3QP9A 3QJ5A 2CSUA 4B4UA 4BO8A 4N5NA 5G2OA 4E2YA 1PZGA 3OQ6A 3H4VA 3M6IA 1ULUA 1ISJA 3ZWYA 5F1OA 2PZJA 4P4LA 2Y1FA 4U5QA 1TLTA 3IJPA 1MV8A 1NX6A 3WDSA 5DBIA 3ITKA 1D3AA 3Q9UA 4CV0A 4YPOA 1XLTA 1YL5A 3HB4X 3IUPA 3HG7A 1BWSA 3GMDA 4WECA 4HUJA 1UXIA 3UFXA 3VKUA 2GERA 3JQ6A 3UAGA 4CM4B 2WEKA 5A9SA 2XXJA 3W1VA 4YRDA 2JL1A 5IN4A 3SJ7A 2F00A 1BW9B 3EDMA 7ADHA 3GRKA 1R66A 1R0SA 2E82A 2G82A 3WOHA 4ILKA 4HNGA 2Q3EA 5EESA 3WLEA 5JO0A 1WPQA 4AG3A 2Z1NA 2X23A 1V8BA 3JQ8B 2GUGA 2TMDA 5COAA 3OJLA 4RGBA 2YJZA 4CM5A 4Z6KA 3D5QA 4WGGA 3ZW9A 1LA2A 4JN6B 2WTBA 3ZWMA 1B2LA 1GADO 4FFLA 5B12A 3DAGA 1PGNA 1FF9A 4K26A 1X14A 5COBA 5IAAA 2W98A 2WE7A 5FFFA 1M75A 1Q0HA 4XB1A 2YW9A 4BNYA 1I3LA 4RLHA 3U49A 4QFDA 3RFTA 1LU9A 4EGFA 3BHJA 3DDNA 2FOIA 1PSDA 3TWOA 1MX3A 1Y9AA 2VCYA 3F9IA 4HKTA 1KIFA 3ZWOA 5B4UA 3RUCA 1PR3A 1GPJA 2FR0A 3K8ZA 5ER6A 1ZK1A 5F3RA 3RU7A 3V2GA 5L53A 3WGTA 4XZ3A 1W0CA 3MTJA 4QQRA 4NFHA 2AEMA 1VJ1A 3H6KA 1NR7A 3DTTA 3ORFA 1XWFA 3PEFA 3IP1A 3HSKA 3SEFA 1XSEA 4HX5A 1FDVA 4CQLA 3NKLA 4E5KA 1EE2A 1MLDA 1PGJA 1C1DA 4LMRA 5JAZA 4ZD6A 3GK3A 2AEJA 4Z9XA 3JSAA 2C54A 3WQSB 4CMHA 1LDMA 3FSRA 4DLAA 1Q0LA 4RDHA 3WQRA 4QO7A 1E7RA 2CVOA 4JP2A 1EFKA 1N7HA 1XEAA 2AQKA 3BIOA 3U4DA 5L4SA 4YT2A 2VHWA 1XU9A 4R5HA 4XQ9A 1C0PA 3CXRA 2EJVA 3KYBA 3OQ1A 4NNJA 4WPGA 4BO5A 1NHWA 3GVCA 3WJAA 3GQVA 1ZMTA 3OMLA 2JD0A 2XXBA 3HNPA 4WUVA 4GSKA 3PZRA 1EVZA 4G2NA 2QHXA 3L9XA 3IP3A 4P4GA 4RQUA 4ZQFA 2A35A 4FS3A 2NACA 4YBZA 2Q2QA 1H5QA 4TRNA 4U8GA 1GEGA 3JD3A 4D0RA 5U9CA 1YGYA 2AA3A 1EUZA 2C2XA 3FR7A 3ZWWA 1Q7GA 5AXDA 3JQGB 1B26A 1PX0A 3I52A 5IXYA 1B8VA 2BRUA 3JV7A 3RJ9A 3KYDA 3L07A 4CJXA 1O0SA 4CM6A 4CM8A 3JQ9C 4CV1A 1F06A 1N1EA 3C1TA 1NWHA 1ZH8A 3DBVO 1OBFO 1LLDA 1Z45A 1NVTA 2X8LA 4MIYA 4YTEA 4BGVA 2GR9A 1V35A 2C7GA 2W2LD 3VPSA 4F6LA 4RVHA 1U4OA 4FJ1A 4CQMA 3KEQA 4DVJA 1BSVA 5JYEA 4YDRA 3M1LA 4CLXA 3BTVA 3ZH2A 3JQ8A 4JK3A 3WWYA 3WLFA 3NJ4A 1SBYA 1EBUA 1E7SA 2P68A 1ISMA 3F5SA 4BV9A 2RHRA 4H7PA 3C7CB 2VT3A 1HKUA 1R37A 4CLDA 1T2FA 2R2GA 1KS9A 3NDRA 4RVFA 5A5EA 3GZNB 4IMPA 4OQZA 2EW8A 4B8ZA 4XWYA 3RROA 2EP7A 3AFNA 3CE6A 4CLOB 3PJDA 3Q6IA 2XF8A 4NMHA 4OJNA 1KVTA 2PLAA 1NXQA 2X0JA 1GPDG 2FP4A 2Z5LA 1KC3A 4QT0A 1MG5A 2EWMA 1LSJA 3OIGA 4BHTA 4IDEA 3O8QB 4J3FA 3JQAD 1UZMA 4BGUA 4RDIA 1YBMA 3MOGA 1C0LA 1ZKMA 4CL8A 1T26A 2VNAA 4J1TA 4TWRA 4ALNA 4BNZA 1T4DA 1T24A 3I9KA 1JTVA 4E12A 3EW7A 1DC5A 4ND3A 3TDKA 2OZPA 4XYBA 4TQGA 5HTOA 4KTTE 3DOOA 4OAQA 3BYZA 1ISGA 2VZ9A 5COQA 1YBVA 4MINA 3QW2A 2A9FA 3T7EA 3OP4A 1A4UA 4DGSA 1N2SA 1WVGA 3MEQA 1ZXLA 1U2GA 2BI8A 2CF6A 3C24A 3DEYX 2BI7A 3PZBA 3OHSX 2I99A 2R6JA 4A26A 4P22A 3Q0EA 4CM8B 4D0SA 1KVSA 4W7IA 1NPTO 1N8KA 2HAEA 4NK5A 4AJPA 4WLFA 3PHIA 3BMOA 3OH8A 1NWCA 2I6TA 2IEBA 3A28A 1Y5MA 2FPPA 4OXYA 1K0UA 3G1UA 4X54A 5KVQA 4N5MA 2P9EA 1O94A 2ZB7A 1HDYA 4WKGA 1GU7A 2YFQA 4JX8A 3EAGA 1MP0A 4WLOA 5GZ1A 3GA0A 3TOXA 2ZB3A 2ZYGA 1ENOA 3UXYA 2VNSA 3DZBA 4Y6PA 4E5NA 4CV2A 2HQ1A 4XJSA 1T4BA 2ZTLA 4PLWA 3S2EA 4ZQGA 5BNIA 3ZHYA 3OA0A 1B0AA 2FWMX 2GSDA 4NBWA 3RFVA 4R1NA 3AW9A 1U7HA 4L4SA 3NAQA 4XGNA 4CM4A 4GBJA 1MGOA 1E3JA 1N7GA 4L73A 3WFIA 1P31A 2QRJA 3AJRA 4CMEA 4F3YA 3H8VA 4RF3A 4CMAA 3HUDA 5EQDA 2VRCA 1N92A 4MKRA 4R5MA 5HA5A 2VZ8A 1ONNA 1C1XB 5CDUA 3VHRA 3O9ZA 3S1LA 4BO9A 4KOAA 3SVTA 1ORRA 3HQ4O 5L95A 1NYTA 4CM3A 4RZHA 1K6JA 1NQOA 1LLCA 4AJOA 4CLOA 4II2A 3UN1A 2YFHA 3PJFA 1FJHA 3I9MA 2NWQA 3PTZA 1DFIA 1M66A 3ICCA 3CINA 2BGKA 5BNTA 3DO5A 4LCJA 5AYVA 3GVXA 5KVCA 4W4TA 4TKMA 4PLHA 2WD7B 1ONPA 4J9VA 2BLLA 3BXXA 4N18A 2CF5A 1GY8A 3FNGA 5IDXA 2DTXA 3QHAA 3MJTA 5TC4A 4IDBA 1Z73A 1VL6A 3LZ6A 1EK5A 1QRRA 2JHFA 4FC7A 1EQ2A 4M86A 4S3MA 1GZ6A 5K9ZA 4CMGA 5JC8A 2WYVA 1RM5A 4WNCA 4INAA 2G76A 1DAOA 2FPGA 4C7JA 5JDIA 3VZSA 3QVXA 2JCYA 2C7VA 4IDAA 4KZPA 2WJPA 3TRIA 1B15A 1I3KA 4NJMA 3OJ0A 2W4QA 4S1VA 3TL3A 4DRYA 2RIRA 4QTZA 3W4KA 1R15A 3PHLA 1JWAB 1KOLA 1YB4A 3WGOA 3LLSA 3DZFA 3H7AA 5IXSA 4MVJG 1U8XX 2Y1GA 3SC4A 2W2KB 4GMFA 1IULA 3AOEA 2D59A 4XKJA 4IDCA 3KTDA 1JA9A 4ND1A 1F8GA 1IY8A 4EEXA 1E7WA 2ZB8A 1PJ3A 3LYLA 3DZGA 4D79A 3T4EA 2YV2A 2O3TA 1KEWA 2JCVA 5CG2A 4R3NA 2D2IA 3GLQA 3LVFO 4HY3A 4YEDA 7MDHA 3PYMA 2YHIA 4TRRA 1ZEMA 4CPDA 2FPIA 5JW6A 3ZN2A 1LRKA 1P45A 4F45A 4CUJA 2GN6A 5KVVA 1P1KA 1A9ZA 3BMCB 1DXYA 1GYRA 4A7PA 4N54A 2NSDA 1PJLA 2EW2A 3H65A 4D7AA 2O23A 5H82A 3NDIA 3VOSA 1DC3A 4CQLB 1NQAO 1BG6A 2I5PO 4TMFA 4OL9A 4AJHA 4I9HA 5FWNA 2RAFA 4IDGA 4HP8A 2PKQP 3CEAA 5I8ZA 1H9BA 4CQMB 4PIVA 4ZRMA 5DP1A 3D3EA 2BF7A 1VC2A 1EMDA 2HKIA 3UW3A 2PKQO 2NTNA 1DFGA 1PU2A 4ND5A 3UCEA 1G1AA 3RFXA 1ZFNA 5TQVA 3BHMA 5A9RA 2J3HA 3JD0A 3N58A 3WSVA 1R0KA 4AICA 1Z6ZA 1DEHA 1VKOA 3IL2A 3ASVA 3WTCA 1EUCA 2I66A 2QRKA 3PHGA 4R54A 3ASUA 3D5TA 1UDAA 1ZZEA 3Q2IA 4P38A 1LQUA 1CQJA 1ENYA 3L0DA 4IQ8A 4UVEA 3JCZA 3P19A 3ROQA 4CUKA 3I9NA 3L9WA 4MVJE 2BGMA 1UDCA 1NFQA 1U3WA 4DQVA 5F5LA 4P4NA 1CIVA 5IF3A 4U6QA 4BKRA 1E6EA 1WLYA 4BNIA 3GR6A 4R68A 8ADHA 4NBVA 4EJMA 1W73A 5L51A 1R4MB 2AQHA 2B4RO 3PWSA 4OXKA 5FI3A 2VHVA 3KETA 4PRLA 4G5HA 1DFHA 3IKTA 2RBEA 3JQGA 4BGEA 4UEJA 2I67A 1LSUA 2OOSA 1V3VA 4KQXA 4KDFA 1Q7BA 2GCGA 1QV6A 5KWEA 2VRBA 1R6DA 2BFOA 3HB5X 2JCXA 3NT5A 3WYEA 3DBRB 2Q1SA 3K9QO 3V1YA 1QLHA 2BFPA 3F46A 1C1XA 5IDYA 4YAEA 3BA1A 1MXHA 2QZ9A 1NVGA 3WYBA 1ID1A 3JQ7A 4MVJM 5L7YA 3GMSA 1O89A 1BVRA 1MUUA 2R00C 1E6UA 1SOVA 1WMAA 1XGKA 3TL2A 2PGDA 4QO8A 5AQ1A 2ZQYA 3QV1A 2BH9A 3EYWA 4J91A 4NI5A 2C5EA 3JYPA 1QYXA 1RKXA 4JNKA 2FZWA 2ZATA 1OZAA 5GMOA 1PZFA 1HLPA 3KSZO 1VPDA 1PJQA 5HS6A 2BFMA 1CDOA 5JAMA 1NAHA 3JQBC 5DN9A 3ZHZA 1BDMA 3H5NA 5H81A 5JO9A 2CFCA 4I9NA 1UP4A 4AJ2A 4O0LA 2FZEA 2C29D 3GDFA 3INGA 2CY0A 1RPNA 1LI4A 2UUPA 4K6FA 3EK2A 3Q3CA 4B3JA 3LK7A 4FBGA 4XQEA 3PQFA 1I5RA 4PG8A 1IPEA 1SZJG 1LDGA 4EJ0A 3LF2A 4J16A 3ANLA 3WNVA 4MVJA 1XQ6A 5LDHA 1JKJA 5K6AA 2YHUA 1TT5B 2EXXA 3FNHA 3DB2A 1DRUA 1EDOA 4PLGA 2AE1A 2Y0DA 3W8DA 1Y8QA 3KBOA 3L6EA 4IZIA 3PGJA 4LK3A 1QSGA 2X22A 1YS4A 3GFBA 3VH4A 4UULA 2LDBA 4JLWA 4WNIA 3VH2A 5AXBA 2JFFA 4OO3A 1ZSNA 1NPYA 4MO2A 3NTOA 1MG0A 4BOYA 1NM5A 2GZ3A 4D46A 2QW8A 3H5AA 2XPCA 4E30A 4H16A 1IHYA 4RV9A 3EZLA 4BNUA 1JAYA 4PLVA 3G79A 3DC2A 2Y66A 4LVUA 3JYLA 4XD2A 5A05A 2BFAA 4ALMA 4WLEA 3K30A 3MJ4A 4IDFA 4NQZA 4DLLA 1NAIA 3U62A 2CMDA 5MDHA 1LJ8A 5DULA 4RZIA 1ZJZA 1GUFA 1M67A 4OKNA 3GH3A 4PZDA 4WCFC 3GG2A 4WK6A 1LSSA 3H9GA 3WMWA 2W90A 1U7TA 3VZQA 3GN1A 3CPSA 2B35A 4WCFA 5IG2A 1E3SA 1PZHA 3DHYA 1EVYA 1YRLA 1QR6A 1KVUA 2HK8A 1CETA 1NTOA 3NYWA 3QSGA 4NU5A 5HBRA 1PGPA 2IDZA 4Z0HO 5HRUA 1GQ2A 3RD5A 1R12A 2B0JA 4BUCA 3GZNA 2IZZA 3CMMA 2GNAA 3HFSA 5CDSA 1JDJA 4ALLA 1ADCA 3WMXA 1ADFA 2Y1EA 3ETGA 2IE0A 1PJBA 2Q46A 3G0OA 4E5YA 2B5VA 3OIFA 4WE3A 5G0SA 2O3JA 4GLLA 1BDBA 2PGLA 4KTVE 4WJZA 4CLEA 5A5FA 2AG5A 4FW8A 5T5QA 2AQIA 2ET6A 4OOEA 1AHIA 2QQ5A 5L3ZA 1UP7A 3I3OA 4W82A 1N5DA 1AUPA 2ZQZA 3UICA 2G5CA 3WBBA 2B36A 2J3JA 4FCCA 3HHPA 1MC5A 1ADBA 3FRJA 1U4SA 1JKIA 1YVEI 4KUHA 4GVXA 1C0KA 3K6JA 4BNVA 4B7UA 4B7CA 1YOVB 4J0FA 1GAEO 3V1UA 1F0YA 4YT8A 3AY7A 4R41A 1T1SA 1I01A 4BKOA 4NBUA 3L4SO 1E1MA 1HE5A 2P9CA 5JCXA 1LBEA 3ZNQA 5A9SB 3D7LA 3ZV5A 4BO4A 5G0VA 3C3XA 3FD8A 2P5UA 5C7IO 1DB3A 4XA8A 1AXEA 3NDJA 3JD4A 1C14A 4R4JA 3HN7A 3KO8A 1YE3A 1X7DA 4K28A 4NBTA 1DBVO 2O4CA 2OL4A 4YQYA 4CMEC 3WGIA 5DBGA 2NQTA 1BVUA 2OP1A 5JCJA 5JFOA 1L7EA 3DMYA 5JMWA 1XYGA 2O2SA 3ADPA 2JKVA 5ICSA 3HDYA 3C85A 4G65A 4IPTA 4RVSA 3KV3O 3WB9A 1JLLA 3DBRA 2B83A 4NIMA 1U3TA 3H9QA 2OORA 2JFHA 1P1JA 4CMJA 1U2DA 1TI7A 4JXKA 1Q2XA 5FYDA 3S2FA 3I9LA 5DNAA 3LU1A 3KVOA 4DPLA 1RM3A 1KEVA 4CMCA 3TZQA 2VWPA 2IEDA 2ZCUA 2P5YA 5G4KB 1EBFA 3VZRA 2V65A 1LRJA 1F17A 5IZCC 3A4VA 3K73O 3S8MA 1OFGA 1I24A 2E49A 4J7XA 1OOEA 2I65A 1BXZA 4IZHA 3RUDA 1OMOA 3GNTA 3RC1A 1PIWA 1I2ZA 3SJUA 4AJJA 2GO1A 3LC1O 4QECA 3PK0A 3OFSA 1X0VA 2HMVA 1E3LA 4CQMD 2RH4A 5KNLA 4FGSA 2QRLA 2WWRA 1PQPA 3E9MA 3RKUA 4Q3DA 3VC7A 5IFLA 3G3EA 4R1SA 2HMSA 1U1IA 2G0TA 1A7KA 4HXYA 2EKPA 4GWKA 1JKFA 4TROA 5TRTA 2NU6A 5G0UA 2DVMA 2UDPA 1RWBA 3D0OA 4D41A 1FK8A 4MOWA 3HZZA 1Y6JA 3GAZA 2X0NA 5I9MA 5T8KA 5CAEA 5DT9A 2DU8A 4MPDA 3OEYA 3FTNA 2PD3A 2XOXA 3EVTA 3N74A 1N9GB 2PD4A 2DBVO 4BO6A 2VTEA 5F5NA 3P5SA 3U4IA 3RUEA 3WBFA 1H6CA 5JDCA 2FR1A 2VYND 5GY7A 4AJKA 3EHEA 3GVIA 2EJWA 4L4RA 3MTGA 5I9NA 4DC1A 1GQYA 1LTHR 3D4OA 5DF1A 3RJ5A 4CMBA 4DPKA 4RJTA 5IDQA 4GLOA 2Q2WA 1B8PA 4UVGA 2VHYA 1NFRA 4IJWA 4GAEA 1SNYA 2E4AA 4WLNA 1YDWA 3AUTA 3JQFA 1VRWA 2FSVA 5EN4A 2E37A 3RBXA 1RJWA 3QVOA 2GN8A 4L75A 1YQDA 5JLAA 2OXIA 1LX6A 4QFCA 4OGWA 5KCZA 3GEGA 2PNFA 3PFWO 3FF4A 3GHHA 3SXPA 2NVWA 2JAHA 4D3FA 3O38A 5THQA 1HEUA 2HRZA 4MKXA 2PH5A 4I8XA 2OFPA 3PIDA 1CF2O 1DIHA 1WZEA 1LUAA 2VT2A 2ZJ0A 2Y1CA 4DPMA 4D45A 2OUIA 3PP8A 3WIEA 3WG9A 1M6WA 4D44A 2PGJA 4R1UA 3IDSA 5KKAA 1GR0A 1H2HA 3BMOB 4G81A 1BMDA 1DO8A 5EERA 5CHEA 2IZ1A 2X7HA 2ZK7A 4QUKA 5ILGA 2HU2A 5FEUA 5HM8A 1SOWA 1GD1O 4ND4A 3ROPA 1H6DA 1BGVA 4Z0TA 3E5MA 4JP3A 4H3VA 4NHEA 2O7QA 5TS3A 3V8BA 3NT2A 1BXGB 1E1KA 2X9NA 3NTRA 3ROKA 1ZK3A 4YWJA 2YQ5A 4IM7A 3AK4A 4PG7A 4CV3A 2EV9A 2VN8A 2X0IA 5BQFA 1T2EA 2CD9A 2Z95A 4LRTB 4RORA 4Y6SA 3G17A 4OKIA 5U1PA 4R69A 3ZI0A 3B20A 1W6UA 1GCUA 1PR9A 3ZU2A 4E13A 1O6ZA 1HDRA 3KEOA 3HDQA 3E6AA 3MWEB 4I5GA 5F1PA 3GRPA 3Q2KA 3OA2A 1ZW1A 4IQ0A 1HDZA 2PA3A 4KMSA 4KQWA 1L1FA 1GDHA 2AEFA 2Y0EA 3FPCA 2EP5A 2YYYA 1HSOA 4PLYA 3KYCA 3D4PA 2O3SA 1W8DA 1XR3A 3IS3A 4OOFA 1TVEA 3PDJA 4PCVA 5DOZA 3FNEA 3E18A 2PY6A 3F3SA 3PDUA 3RC2A 3GC6A 5IZ4A 4FC6A 4O6VA 3BAZA 1V0JA 2IZ0A 4BNMA 5BR7A 1H2BA 1J49A 4JCOA 4FR5A 1R4MA 2Q2VA 4CLHA 3GNSA 5DP2A 3GPDG 4E2XA 3AY6A 5DCYA 5DDIP 3CUKA 1GZ4A 4NBRA 2DQ4A 4CMIA 1ZUD1 1Z74A 1ZO8A 3Q11A 2EHDA 5I7VA 2AW5A 3H9JA 4E33A 5FI5A 3B1FA 2C07A 4FFPA 4M1QA 1GV1A 1CYDA 4GPD1 4RO0A 2PZLA 2JD1A 1PJ4A 3U4HA 4CODB 4CLRB 3ZWBA 3INTA 2VOJA 2JAPA 3DZHA 3O03A 4JROA 4MDHA 5KJFA 3DOJA 1EVJA 3C7DB 1UXGA 1QV7A 1PJCA 4DIOA 1ZNQO 2QYTA 3GF4A 4CMKA 1JWBB 1ISFA 1UXHA 3T4XA 4BNNA 5I7FA 1ZJYA 2E48A 2HJSA 2CDCA 4GL4A 4M87A 2HDHA 1LDBA 2GN9A 3R0IA 4IJUA 3I9JA 6ADHA 4JJFA 3VVBA 1YL6A 4B4WA 2X9GA 1E92A 2JFGA 3CKYA 3SBOA 3ZZNA 3JYNA 3KXDA 1XU7A 3MOIA 3WGYA 4Z3DA 3RUIA 2F1KA 1I32A 1EDZA 2GASA 3DFUA 4W7HA 4XEHA 2V7PA 1KBZA 1I2CA 1KVQA 5KVSA 1SEVA 1E0DA 3PHJA 4LISA 5B37A 4ESOA 3OJEA 3GGGA 2YV1A 3LC7O 5LC1A 1SC6A 1P3DA 3UCXA 5IN5A 1XELA 1CJCA 4WOKA 2C20A 4XDZA 4DMLA 5KOIA 5IZCA 5A9TA 3E48A 5ER9A 3JTMA 5L9AA 4MP6A 1E5QA 4II3A 4IJVA 2NVUB 1IZ9A 3E03A 2H5LA 1WW8A 4RF2A 4QEDA 4WLUA 4ROSA 4UUOA 3PIIA 3AI3A 3Q1LA 4DXHA 4UUMA 1SEPA 3GPIA 5H83A 3RC7A 3HN2A 5BSGA 4I08A 5G0WA 1WDKA 5T57A 3P2OA 3EVNA 3I9OA 2GRAA 3BMNB 1UP6A 1Y9EA 2Q4EA 2OBNA 4BGIA 3FBTA 4DL9A 2Y0CA 1MA0A 1X7HA 5A03A 3BMQA 1GQQA 4BO2A 2VHZA 1NHGA 4Q3BA 1NNUA 2W2KA 3AOEC 5CDYA 1OC4A 3UVEA 1YQXA 4NPCA 3ZU3A 2NU7A 3I23A 4TVBA 3I1JA 3E5RA 1MFPA 1H6BA 3OSUA 5EMHA 4I5EA 3X2EA 2UAGA 3Q9NA 3A06A 4C7KA 3NEPX 2NADA 2X5OA 2ZJ1A 5A02A 2G17A 4FIZA 2X0RA 4DQUA 2DBRA 1KY5A 5CEEA 4F6CA 3E8XA 1UJMA 4A10A 5EPOA 4HBGA 3RBZA 5JDIC 3C1AA 3R3JA 1U28A 4MKZA 3SLKA 2ILTA 5ITVA 1PJTA 2FHSA 3AU8A 1ZK2A 1VJTA 5A3VA 1HYGA 4BIIA 1UXJA 3TZKA 3AM5A 4E32A 3DOCA 2PV7A 2O2YA 3GY0A 1A9YA 3VH1A 3ZWXA 2FMUA 2JD2A 2Q99A 4MVJF 2WSBA 2E6UX 4IBOA 4LCEA 4PFJA 5THKA 4XGIA 5AXAA 5C5IA 5JAIA 1AE1A 1HYHA 2WD7A 3JQAB 1QG6A 1F12A 5TJ9A 1KYQA 4AJEA 4J4HA 5JPIA 1A72A 4YT4A 5HS4A 1WP4A 2DBZA 1K3TA 2VYNA 1DRWA 2Y67A 4BVAA 4DMMA 3EY4A 3OECA 3ON5A 1HXHA 1QMGA 4YRBA 4IDDA 1IZ0A 3IQDB 2X6TA 2CVZA 4B79A 4RVUA 2YDYA 2NTVA 1KEUA 1GUYA 1NPDA 4PLCA 3U3XA 3ZWAA 5C7OO 2ZCVA 3S2IA 4NZ9A 2J8ZA 4C4OA 2X1HA 4WOJA 4W9NC 4D3SA 4ZGWA 1YH3A 5ENVA 4Q3CA 1YJ8A 1P77A 4OYRA 2C5AA 4HFMA 3T7CA 2J3IA 3KLMX 1AXGA 2UYYA 4JBIA 5LDGA 3JYQA 3K92A 1E5LA 3FN4A 2X9VA 5L4NA 1HDOA 3CMCO 1YWGO 4H15A 2G1UA 3F47A 3V5NA 3JQCA 4TZTA 4RF5A 1OI7A 3M1AA 2VYVD 1E1NA 2VWQA 3R6DA 4E31A 3GUYA 3WTBA 4B3IA 4RQTA 5L7WA 3WWZA 4DLBA 4R1TA 5FF9A 4IS2A 5K0ZA 2NVBA 4YAIA 5TNXA 1WZIA 3OF2A 3ZWVA 4GGPA 4JGBA 1HE4A 1H0KA 3PLNA 1UR5A 4CM9A 1DJNA 2V6FA 4YJGA 1ZK0A 4OSOA 2P9GA 3QWBA 2CUKA 4LMPA 3VH3A 1NQ5A 2P2SA 1BHSA 2A4KA 4CR6A 5KJ1A 2Y99A 4YB8A 1Y8QB 3F4LA 1DDOA 2UV8A 2H9IA 4W99A 3ADOA 1KETA 1JQBA 1MB4A 3QWAA 1X15A 4BQRA 1E6WA 2DUWA 3MWDB 2HMUA 4TRJA 5BNFA 1OC2A 1ONOA 4WASA 8LDHA 4XCVA 3KOUA 1PWZA 4BNTA 2SCUA 3DXFA 1HETA 1UUFA 1HL3A 2Y1OA 3H3JA 2X5JO 3GZ4A 1DC6A 3A1NA 3WGQA 3JQDA 1B7GO 1GUZA 1ZMOA 2DTEA 2Z1MA 4R3WA 1SMKA 3DBHB 4GKVA 4ID9A 1GFSA 1T1RA 3CTMA 2VUUA 4PZCA 3RWBA 4NFSA 1YQGA 3DTYA 1UH5A 2PK3A 3ZHXA 4FB5A 4IXTA 1NVMB 5TIIA 1RM4A 3FCOA 1P0CA 3U5TA 4M55A 3UUWA 3JQFC 5B1YA 5L45A 3O8QA 3I6QA 1I36A 4CM7A 4MIOA 3DQPA 4LGVA 1HDCA 3WJ7A 1QXSA 1VKNA 5C7LO 1C3VA 5ADHA 3ANMA 4XGKA 5JAQA 4OXNA 2DC1A 3UOGA 4ALIA 1FDWA 1Y1PA 3AUSA 4XJTA 2DFVA 3ZU4A 2BGLA 4BO1A 2C0CA 1I10A 2FR8A 1JVBA 2DT5A 2AXQA 1R0LA 1LXCA 3K5PA 4RLSA 2V6MA 3IIEA 2AHRA 2VUSA 3G1TA 3F6YA 3PJGA 2VWHA 1O9BA 1PS9A 1YXMA 4U7WA 1JAXA 2CZCA 3QY9A 5JY1A 1LC0A 2YDXA 1HE2A 3VKVA 4E0BA 1YB1A 1HZJA 1XIVA 3ONFA 4YJFB 3WX0A 4R51A 2D4AA 3BTOA 3U4CA 3WXBA 4DYDA 1DIRA
chains in the Genus database with same CATH superfamily
2VK2A 5J5CA 1KJ9A 4RBNA 3F90A 4WFIA 2TRSB 3REOA 4YCSA 7YASA 2HHLA 4KG7A 5A4AA 3B89A 4BZPA 2I7VA 4C7XA 4JXXA 3NEAA 2XB4A 2J7PD 2ZUBA 4YACA 1JAZA 1Y33E 3D4NA 2PWZA 3W78A 1DDIA 3D2CA 4L3WA 3HN6A 1NP6A 5KNCH 2M1XA 5ALZA 3TSWA 1ZXXA 2X8JB 3ENWA 3ZU5A 5JIBA 2PUBA 1Q0SA 1ZCFA 1GPNA 5EUBA 5CIWA 4PZPA 1JNYA 1GPAA 2PYZA 1XRLA 1V48A 3VNVA 3I4CA 4IZ6A 4KREA 3TZCA 1SOMA 1VB5A 5FWXB 3H2YA 1OVGA 4X64B 5A04A 1JB9A 1MC4A 3SM9A 3TVYA 1T2CA 1JLMA 4PZZA 2BZGA 2BE9A 1JYFA 2GFIA 5JH7B 1U9IC 4DNFA 1Q17A 4HH0A 3NHWA 1NUTA 2D5CA 4I36A 4NOMA 2VC2B 1KI2A 2CVPA 2A1IA 1P33A 2LCFA 1U8AA 1BCRA 4I1IA 3NNNA 1W46A 1OYOA 3I4FA 1XCLA 1HY3A 3KT8A 1KORA 3PGKA 2PSHA 1DLIA 2XMZA 2FR8C 3O94A 4L57A 4GD3Q 2F8LA 4WBNA 3E5NA 3HVIA 3JS5A 1IWOA 1TMGE 2FUG1 2DJIA 2AX4A 1WXDA 3KLPX 4KFTA 1K63A 1I6KA 1Z7EA 3PHBE 3VOBA 2AIRA 3M3PA 4EQZA 1ECFA 3DNFA 1URPA 2IXBA 2EF0A 4Y2UA 1BWPA 1JPNA 1BJTA 2W37A 3B1WA 5CH8A 2JJ1D 4TZKA 4WESA 4YIKA 1RYEA 3MJEA 2EZ4A 3P9KA 1R50A 4O2RA 2KSQA 4QGGA 5E0OA 4P7GA 4TQ9A 1NP7A 4C21A 2ZYHA 3ZCVA 3FCCA 1CE8A 1JIVA 1SKYB 2F4NA 1SHJA 3DP7A 4MW5A 4B2PA 1YAJA 3ZKWA 2IC5A 2JIRA 2WAYA 4OTZA 3EMKA 3RWMB 1L9XA 3LUHA 3OZWA 1RACA 1PS0A 1QPBA 4JJAA 4CKZA 4XASA 3LBAA 4BL5A 4MW2A 4ZQBA 4Q93A 4X6XA 2IXTA 2LTAA 1DJPA 1RW4A 3FVWA 2YZMA 3HI6A 1EUDA 2PBFA 2W6MA 3KZKA 4L4ZA 4PG4A 4UM7A 5H3HA 4EOGA 3B53X 1OFUX 4BDSA 4GKBA 2ID8A 1GL9B 2JJ2A 2PS1A 1B73A 4ACBA 3ZIUA 2FZ4A 1XMVA 1PQWA 1VSUA 3DULA 4LW8A 3KC2A 4GE0A 1FFEA 3BICA 3QU9A 3B8EA 5E9AA 1HPLA 4EUFA 1Z6GA 4IP0A 1CHNA 1SCJA 2JJYA 4U8HA 4ZHQF 2O3QA 1X1CA 3B2NA 5HK9A 5T67A 3LQKA 2EU8A 3FNFA 4AM8A 5JS1A 1XDBA 3QMMA 4FFBA 3OOJA 2YKGA 2WPDA 4WXMA 2GZDA 3TOVA 3OZIA 5GADl 1RABA 3PWKA 2IYQA 2O50A 1MO3A 4KQ9A 4OVKA 4LUCA 3ZX5A 4BDTA 4DEXA 4FWTA 4EG5A 4K1XA 4QA9A 2EEZA 3HXOA 4BXOA 4BO7A 4JLMA 2YC2C 1ZYUA 4UVDA 5HE8A 1HQKA 4DW8A 1MN6A 2C9CA 4YCDA 5DHAA 1QRTA 3C3DA 4FMPA 4NXMB 1SFRA 2WDZA 5CGZA 3T1NA 1BW9A 3ET4A 3ND9A 4PG5A 4B9AA 5IVDA 4WFQA 1JI0A 1TX4B 3LQ1A 4ZZIA 5LMNB 1DELA 3IDFA 3DBLB 1PVOA 1EVIA 3FVRA 3ED1A 3RRMA 3UC9A 1U5CA 1P4GA 3KUXA 1V9LA 4B44A 2XZPA 4FZVA 1TLLA 2IP4A 4G1VA 5E38A 3C6XA 3EPLA 2EGGA 2P6RA 3H0KA 4PE5B 2I2WA 3IQEA 4HT3B 1A8PA 1JIXA 9LDBA 2VLIA 4UQPA 4BMPB 3TZHA 4DBZA 5CIYA 2IOFK 2PEYA 1OLXA 5FD8A 2Q7XA 2Z04A 6LDHA 1Q22A 2XAAA 2WUFA 3BRSA 4R16A 2XQFA 3QQ5A 4HNHA 1EGMB 2AN3A 3HE3A 4QICA 3D1VA 3WGZA 2FWJA 1T2VA 2GFQA 2OVFA 1DADA 3NONA 2NTJA 3CSSA 3WFJA 4FIDA 2GF2A 1TTHA 2PX6A 3NYRA 3QVVA 4FOLA 4R2WA 2ODPA 4TSFA 4UBKA 4WOPA 5KZMB 4B3HA 3O3CA 4O4LA 1IB0A 3AC0A 1M34A 3CLSC 3E84A 2NU8A 4ND8B 2QM8A 5SY4A 3SC3A 4FDAA 4NK4A 3S4YA 5BSVA 3SWWA 2HU8A 4TMTA 5DX8A 3EW9A 3V2HA 1SOUA 3KT6A 3FCSB 3PPWA 1OV4A 5IUNC 4MDEA 2Z08A 4N76A 3DGFC 4L6CA 2P40A 4FPXA 5C31A 2WM9B 5CX4A 1GNLA 3TUJC 2POCA 1FRQA 1KDRA 2PT9A 3AFOA 3E9EA 3OAAD 1F6WA 3PRJA 4IOLA 4M9ZA 2XZTA 3QW4B 5ITZA 1HORA 3UF0A 3DZIA 1RR6A 4WN3A 4BVKA 1RHMA 3HFGA 3A26A 2QZ4A 1SHTX 3LPMA 2ZE7A 1VBFA 3E82A 5B58T 4B5LA 3Q8KA 2ZRJA 5FBVB 1YI8A 4MKFA 4GMHA 3IC5A 2PM8A 2ZI7A 3W34A 1V16B 4ROTA 2W83A 1G8AA 3VU0A 1JW9B 4MMXB 2SCUB 5KU7A 2PS3A 2QR5A 3QPCA 1P0FA 3KZXA 3HK2A 1JDSA 4J43A 2GPAA 3MPUA 3U40A 1EFVB 5EHZA 4DLRA 1Q11A 1SBTA 2WYWA 1KVRA 1D7OA 1XXLA 4YJ2B 3T1OA 1KMCA 3BE4A 3HACA 1FC0A 4X93A 2X3FA 5DXFA 3IMFA 4X66B 2IX3A 1RC8A 3O8DA 5KTRA 4NVRA 4UNQA 3B8HA 2NT4A 3U80A 2GUWA 5EQFA 3QE9Y 2V1UA 5E2BA 3LGAA 4R7GA 4DY4A 1YDHA 2GCPA 2BFCA 1AUVA 2ZRMA 4K1LA 4AZ3A 3FOFC 5U4QA 7GPBA 2OLJA 3RYCA 3H18A 4AW9A 1LB1B 1LRLA 1XEXA 4HXGA 4GX5A 4QJ4A 4O2AB 2QNBA 4GM0A 1Q3HA 3TDNA 1NN1A 4N5IX 2B92A 5K3OA 1KBOA 1PL8A 3HR8A 5BWBA 2JLRA 2OD7A 3G7NA 1VSQA 3N6VA 3OI7A 1FRVA 4C1BA 3QX7A 4HLUC 1I0LA 2Z6UA 1XNQB 1U7ZA 4RVDA 2Q0HA 1EBBA 4OMUA 1TXGA 1E8DA 3ETHA 4ZVRA 3UAZA 5AUNB 2OCKA 1Y8CA 1G0NA 4JLNA 3H8WA 1C5KA 2DKNA 4MQFA 1RLTA 2YWEA 1Z36A 3U61B 5HNKA 1Y5LA 4HGRA 4IH1A 1SRRA 3AP1A 4RU1A 4J2OA 3OQIB 2NUTB 5TPZA 4ASUD 2VDWB 1DKPA 1BS2A 1J2UA 1KK2A 3KXLA 4YI3A 3ZY4A 5E4YA 3QBVA 5JD5A 1EUDB 4G37A 1AQUA 3THWB 2BGTA 1Y8ZA 2OV8A 3KJZA 3SR3A 1FUEA 4DADA 4NDZA 3FSGD 1RJ9B 3SLGA 3SC6A 4C3VA 3BC1A 2J31A 2P5SA 4HGPA 4RTMA 2HK9A 1E6MA 2GLTA 5JYBA 3NIFB 3PUKA 4GPEA 3NHFA 4DNXA 3GARA 3I5XA 1GQFA 1MOQA 5L7TA 3C6ZA 1LNQA 1AQ6A 4PXYA 3ZGZA 1X77A 1F2TA 1ZH4A 4OGFA 5CDGA 3CBGA 2AMJA 1PW7A 1YR8A 5C3MA 5LYJB 4HDRA 3KT0A 2RH9B 4C4YA 1TL7C 4XW2A 5DGXA 3D4LA 1L5RA 1KK1A 3LW7A 3N2EA 2H59A 4KFSA 5JDCC 5DEOA 5IJZA 4U6NA 1SR8A 3OZFA 1C2TA 1VL8A 1L7QA 3BD8A 4P7FA 3SEAA 2WNHA 3D6NB 1AH2A 1Z5WA 1XG5A 3FAZA 3SSAA 2O3RA 1A82A 4B6JA 3PGXA 3WIBA 1XF1A 2QIOA 5AM3A 2XJ4A 1TZJA 1R5NA 3UWSA 3G49A 2YXEA 2YZ2A 4FI3F 3A1DA 2DRIA 2YVKA 4AJLA 4RQAA 2ZAOA 2YVLA 3WLSA 3REGA 3PL1A 2F2TA 2BTEA 4DKXA 3A6GA 2OCGA 5TDHA 2VIIA 4O2AF 3KQOA 5SYNA 1WXIA 3VTZA 1Z5OA 1KC1A 2P35A 5GZ3A 2WYHA 4P3XA 1G59A 2HM7A 2VZLA 5GONA 1SU8A 1A71A 4Q05A 1ZGAA 1NONA 4YJFA 3SU8A 1ATIA 2EBWA 2O7VA 3B9QA 4YROA 2W6CX 1NBAA 4QVIA 1P3JA 2BP7A 4FJ2A 1YCHA 2G70A 3VZPA 4OLAA 1GGEA 5D3ZA 4DM7A 5IJ9B 2EFJA 2O9JA 4RSHA 2XRYA 3A9CA 1TMKA 4K2AA 1QIIA 1NFFA 1R64A 3EMVA 3W8EA 5J58A 4X20A 3HDJA 1YK1A 4HAVA 2X8JA 3W6ZA 5IAGA 4EARA 2HRBA 1D2HA 1NXXA 4YJ3F 1BE8A 5AI0A 4W9MC 2ACEA 1JDTA 1T6XA 1ZIDA 1ABEA 2PJZA 4A0FA 3WSTA 1BA3A 1VIVA 1WXQA 2P78A 3A1EA 3DMFA 4FJ0A 4OSPA 4RF4A 4XX0A 4YAWA 4AQDA 1WAMA 3SZUA 5C51B 3U4AA 2IHYA 2AOXA 1AMNA 3TSYA 2PNJA 1G8MA 1MH1A 2BM9A 2WWWA 4OJMX 2GBGA 1QP7A 2DPHA 1HO3A 4Q7JB 2UXBB 4BLQA 2Q9AA 1CFJA 3H7IA 3OBIA 2ZRLA 4NRDA 4P4TA 3NTLA 4RD4A 4QUGA 2ASEA 5A3JA 4HS4A 3V1TC 2IHUA 2RK4A 4O59O 4BFXA 4DKJA 3TN7A 4OLFA 2JRLA 3UBMA 1IYZA 1SPBS 2C2BA 2K7ZA 4P1ZA 5I7RA 2MSNA 2DFTA 5HZGA 3RIEA 2OXCA 1POXA 1HM5A 1XA4A 5DXJA 1DX6A 2ZBGA 1O6CA 3R0VA 4Q19A 5BRNA 3ULKA 4ARSA 4R0MA 4UE6A 4XRGA 2MSKA 5KMGB 4OF4A 4XVHA 1E79A 1PJ2A 4DFDA 4TTIA 1NMYA 3UTCA 3NBKA 1A9RA 3FUCA 4CKWA 3FWZA 5G3YA 1EQUA 4BNFA 4G26A 4UU0A 2AFIA 3AQ4A 1CEYA 4KQ2A 2CDBA 4NYMQ 1KF0A 3BIJA 2Z2XA 4BXOB 3BCRA 1J21A 1KY4A 1U1FA 2EARA 2EWVA 3M2TA 3OOYA 3PFKA 4GMKA 4KWHA 3MJCA 4XR9A 4LOAA 3W2EA 4JOQA 3OPXA 1IEWA 2EQAA 1II8A 5MGBA 4W8OA 4YK7A 2CLKB 2WIGA 2YWCA 1SB8A 3QZUA 3TJRA 5HW0A 1MDFA 1RWOA 5CNMA 3CZRA 5BYBA 3AU9A 4MP3A 1ADGA 2ZUFA 2A2ZA 5DGIA 4B34A 4BASA 4WNYA 3EEQA 4N0QA 2J0QA 3WRXA 3DE1X 4XLTA 3WK5A 1VPVA 1HBJA 2IHTA 4F8JA 5IVPA 2QM0A 4OAPA 1U8FO 2Y1WA 4B8WA 4C6TA 2QI9F 4AN4A 5G0TA 3UY4A 1L6RA 4JBHA 2C9YA 1SZDA 3B1JA 4M8LA 3UAYA 1JFTA 2J0UA 3HB0A 3GGCA 2P6OA 2CYBA 4LYHA 3WK9A 3NH6A 3ONDA 4FDVA 1CZHA 4LRWA 2X5NA 5CVUA 2ZB4A 3K5IA 4BVLA 4M0DA 4EB0A 1SVLA 4BFTA 3I04M 1EHIA 3ZWCA 2BZ0A 2PVPA 2VJYA 3HA5A 5K03A 1FQKA 5FORA 2BSXA 2JHCA 1XZQA 4JJ4A 1ESDA 1D2EA 1OWNA 4Q3EA 1VM6A 1NDQA 3OZSA 1U0HC 3N8HA 3TW8B 5LLDA 3VA7A 1Q77A 1X1EA 1B1CA 1WUYA 3COSA 5DJ5A 3I5MA 1U0LA 5E2AA 3A2KA 4LN1A 1PAUA 3L84A 2WLTA 4KVFA 4KN5A 1Z0JA 1QX3A 4RPHA 3C4QA 2CMGA 2VAPA 3L0IB 4FFOA 5JY6A 3ERCA 4TV8A 3X1MA 4B45A 3KEFA 1ZRSA 4RD2A 2IVFA 1KTIA 1CVLA 2H4YA 1YQUA 2Q3HA 2ZR7A 3L7YA 3UUGA 3GYGA 2I3BA 4PV7A 1SH7A 4BMNA 3SZRA 1Z06A 2A78A 2C96A 4Z4HA 2BMJA 5B6PA 4K9LA 2ASVA 1QIEA 1Z13A 2P3SA 1NMSA 1RWKA 3DTVA 3FJOA 2IHZA 5TS2A 5KC8A 3AVWA 1YBAA 1XCJA 3CJRA 3BZUA 2WP0A 4JEHA 3SF8B 1TZMA 3ER8A 4AD8A 4WXHA 4J9UE 2C2MA 3LT4A 1QIFA 4AN1A 2QJOA 3CISA 1WZ2A 2GYYA 4IFBA 4Z9FA 2ZTUA 1QE5A 1WMDA 5SZKB 4LXGA 4WCFB 1U8YA 2ARKA 1FBNA 2NLOA 3K31A 3VMFA 5BSKA 2DWOA 3TJZA 2DECA 1O8CA 2X6RA 4Q9IA 2P9BA 4KQKA 3DGEC 4G4GA 1LF5A 2F3QA 3FCXA 4ABTA 1YONA 2F9FA 1OLUB 1WHTA 2JNWA 2XYHA 4HYQA 1NM5C 2D7JA 5IYZA 1N5JA 4D0LB 1FP1D 2J6IA 2Y93A 3ETCA 5JECA 2HV9A 1GLGA 4IIJF 1XPUA 4M0UA 3I28A 4E08A 1B14A 2UUOA 5HM6A 4WERA 4IIUA 3W2FA 1RJGA 3I83A 3K0HA 1DDGA 3BWXA 3CLVA 3EG9A 3TQOA 5LU8A 1L7OA 1Z25A 2HO5A 2A9RA 3KAQA 3PYXA 3R5XA 1A69A 5K1ZA 3V7NA 4AO6A 5BW5A 1K6XA 2Y1XA 4EF4A 1VG9B 5AKLA 1LTKA 4URWR 4YP9A 2IXAA 4QAQA 4A91A 1A4IA 4DNOA 5D87A 4PCUA 4YCCA 3L4EA 5LQCA 4DV3B 1E3DA 1SXJE 1JI3A 4AJ4A 3VI3B 3GOQA 4XQCA 1C3JA 3NHMA 4F9TA 2WC1A 3VR4A 4UOQA 4I3HA 5JI3E 3KNZA 4MQEB 4YMVA 1BWRA 3LQFA 4RIIA 4R9UC 1EKXA 1KJWA 2XVAA 4ZEWA 1HL7A 4X6YA 4ZCSA 2AXEA 2D2XA 4BGDA 1EGVB 4PS1A 1CNFA 4F46A 4MRAA 1BJKA 1JIJA 3E9ZA 3LFHA 1C9NA 1QP0A 2NO9A 3HJAA 3TD9A 4JLSA 1LC3A 4HLCA 2XNSA 3DAFA 3GFQA 5EWLB 2C84A 2FZGA 2QTTA 4FLFA 4MVYA 4RD0A 1TF2A 3WS7A 4A4DA 4MUJA 5AVSA 4KR2A 3IEMA 1NVUQ 2W2LA 4WDRA 2JFWA 1HE3A 1YMVA 3GUUA 5BWOA 2O1SA 3F5FA 3Q72A 3QOFA 3LPNA 1U1DA 2QYHA 2B30A 2OBYA 4R2MA 1XNRB 1JTEA 1DG3A 1XRRA 5BPHA 1P2VA 4XYLA 3MNFA 5BSEA 5C18A 3O4RA 3Q87B 4Q1BA 3EEOA 4GI2A 5DCUA 1K06A 5GM1A 2IBSA 4GH5A 5LKAA 5GZ6A 1ZAYA 5JD6A 4RCVA 2IDJA 1HRDA 2JKYA 2EC5A 4NCIA 1FW6A 1BNCA 4KLCA 1BD4A 4YQZA 1TMYA 2C5SA 4RAOA 1XAGA 4PVDA 2WM3A 4DG9A 3NRCA 3GJQA 2I4TA 3T3OA 1GFZA 1M2OA 1T1GA 3OOEA 1RD4A 3CEMA 3M81A 4B4VA 5HIAA 5CPFA 2OSBA 5D1HA 2WIBA 5NLLA 2JGDA 2OCAA 1DJQA 1SUIA 4ZQEA 1P74A 3OT1B 1LLFA 3X2FA 2X41A 4RAQA 3X1KA 2NU9A 2EKLA 1LK7A 1H4VB 5TMDA 2WSSD 3E1GA 1FOEB 4N0EA 4EYEA 1FA9A 2B4QA 3UUEA 2LDXA 3ROXA 3K3PA 1Q57A 3FI9A 3PE6A 2VVTA 4XYEA 3HWWA 2IYOA 2R8RA 4LZNA 1SKMA 1E3EA 2P2CA 1MJ5A 3DDHA 2K6GA 1ZW6A 2AW3A 3NH9A 4LWOA 4PN3A 2XWBF 1GTMA 4XAQA 1J2RA 3FSJX 5F21A 3K1TA 4WQMA 3BDVA 4I5FA 1T0IA 3ZHBA 4F2DA 3O5AA 1HR0B 4E46A 4PFQA 4EKYA 4HFRA 2G28A 4HNVA 3K9HA 4GM4A 4YRIA 1CQIA 2I34A 2GGSA 3R6GA 3IUSA 3QUAA 4HX9A 4AKGA 1Y7TA 3GNQA 3IRVA 5P8WA 2O0HA 3VPHA 4JL8A 4X3CA 2DUJA 1COWD 4GNRA 3GLFB 1KK3A 2XKJE 4DA6A 4M38A 2ICAA 1A76A 1G0OA 1P0QA 2HMAA 4J0CA 4AUEA 1U28C 1YDEA 5AI8A 5AW4A 1DXHA 2LIPA 5EHXA 2JAOA 3KB6A 1RAGA 2XX3A 1DX4A 4UNPA 1NIPA 4GYKA 5EQTA 3MWDA 1I14A 4NJOA 4OQLA 5T6BA 2B1GA 3GLHE 2UKDA 1CSEE 4A92A 3U60B 3HCDA 4KUGA 2XRZA 2R9VA 1Y8RA 3LC2O 3UAOA 2BEVB 4QDZA 4LF5B 1WLSA 1Y80A 3C6BA 1G21A 4YBRA 3O3OB 1OBVA 3OEEA 2FZCA 3NGXA 1FFHA 1D4OA 3IJRA 1PTJA 5DBOA 5LP6C 4YFVA 4N39A 1KJIA 1U0BB 2BGJA 3PQ5A 5IBPA 3PC3A 4D74A 3PC4A 1RI5A 2PMKA 5D3QA 1GKLA 1CEQA 3FCYA 3CURA 3NBFA 3BTUA 4EEKA 1I1OA 2H54A 3SF8A 5B3LA 1ZVVA 1RYNA 1TAUA 1FP7A 1XCOA 3KLOA 4DUPA 1SCDA 3L5OA 4JJIA 4ZVSA 5AT1A 4HEA6 4LXYA 4XIYA 1UF9A 2G7ZA 4PYNA 4EFMA 5TLSA 3TUZC 3SM3A 4L6AA 3BSFA 1QZUA 1NRJB 3W8RA 4ESVA 3C8MA 3ND8A 4H6VA 3W7VA 5J23A 5T4FA 1EX9A 3DA8A 5BV2P 2JB9A 3KCNA 4IGFA 1UKZA 3TOSA 2Y6VA 2P9TA 3MLAA 1PYGA 4RA6B 3N7UA 5E8JA 3V97A 3VPFA 5BMVB 3DHEA 2GAIA 2H9YA 1C9JA 4IH4A 4XUCA 1YFZA 3WP0A 1E4EB 2ZRBA 3KWJA 4M0KA 3T0IA 5HRAA 3QEMB 5JS8A 3LP6A 3OLVA 4LHVA 3GRVA 1GRRA 4CEJB 4Q3NA 4WCDA 1IVNA 1D4FA 3FHLA 3R9IA 2CXUA 4PIMA 4YVFA 4IVQA 1XLWA 3OD1A 1ML3A 3Q7IA 1XZNA 1R6AA 5LVAA 5EXSA 2FB9A 1QYVA 1A5ZA 3DCIA 3M0EA 3PBKA 4Q4JA 1U6IA 3ZV3A 2KX7A 3QEAZ 5CTJA 3QVSA 2ZT5A 5EJ9A 2HNAA 4WKCA 1JT9A 3BE6A 3NNDA 5CP8A 4BO3A 4Q9NA 2N46A 1YKFA 4PW0A 4C05A 3R3WA 4MVJH 1XZFA 3RNOA 4RIHA 3BHIA 1EFLA 1BRMA 4PRYA 2XUOA 1IM5A 3D2AA 4DDHA 4ZTUB 1CK4A 1QH8A 3T1HB 2IFTA 3PUVA 1T8SA 5JJBA 3I01M 1WNTA 5EL0A 2LPMA 1RQNA 1PJRA 1ZKDA 4DE5A 4CFYA 1NR1A 3GJ5A 3EC7A 2GK7A 1QRAA 2D1RA 5FOQA 1HF3A 3D6TB 3BXFA 3HJBA 1NE2A 3NIBA 4DM4A 1N6LA 1ANKA 4J4BA 5B64A 1U6KA 2ZT6A 3G2PA 1N9KA 4IILA 1NVEA 5FL3A 1I4EB 3LHIA 5C8ZA 3WA7A 2Y1DA 3QLJA 3ZQKA 2FA9A 3DF9A 2I91A 3M3DA 5LNK1 3D3WA 3AZQA 3JD2A 1FFSA 1CBUA 1PGQA 2HBZA 2W11A 2ES4A 3GFTA 3INNA 3RG8A 2QI9C 1CZKA 4PG6A 2DWPA 1GZVA 1MGPA 3FW1A 3FY4A 2CE7A 2QPTA 1KI9A 1Y3DE 2P7IA 3MT8A 3P0RA 4BNLA 2AX3A 4D9BA 1Z2OX 2EG5A 3WRWA 4F4UA 1R6XA 5IYZB 4PRZA 4MUHA 1G98A 3G6KA 2X58A 1L5VA 3DEAA 1XJCA 2ZPAA 2ZSFA 3HBJA 4ILEA 4D8TA 1B16A 2WJHA 4GOJA 3H3FA 3VSBA 1J9ZA 2Z9CA 3P5BA 1XBTA 4LX0A 1FFBA 5BMVF 1SIBE 1XA0A 4P32A 1NG9A 1TD9A 2PMDA 4L85A 3RVDA 1KQFA 3K2EA 1NMZA 4EX7A 1ZGHA 3OM9A 5ES3A 2OHGA 2ZIUB 3IGFA 1V5GA 4LY3A 4G63A 1IXRC 2WT4A 1YAHA 3OZ7A 2NV2B 4IS3A 4P81A 3P97A 1JHMA 1P73A 4K88A 1C8VB 4Q4AA 4UZEA 4URXR 5G2OA 4AUNA 3Q88A 3ML1A 4CIXA 1PZGA 3BRWA 2HTEA 3JAWA 3M6IA 2IWHA 1KXZA 1ULUA 1OASA 2Z43A 4ARZA 1DEXA 5F1OA 3SZOA 4JXJA 4G8DA 1CEXA 3M4ZA 4GKKB 4V0SA 3VDNB 3WDSA 1MV8A 2QM7A 5AVJA 5JBNA 1RWNA 2O0KA 1FYDA 4MQBA 1XLTA 5HSGA 1DCMA 2PBRA 5ARBA 3JWJA 3VKUA 1DX9A 1AS3A 2VAMA 4DM3A 1G41A 1XDDA 1ZL0A 2CYAA 4QGSA 4TKUA 4CM4B 2WEKA 2OD9A 4P0TA 1PT6A 4DHEA 4GUAA 3NBXX 1WPRA 4HQKA 3RK1A 4QATA 4DMRA 1U4NA 3MIZA 2XE4A 1BW9B 7ADHA 3A9VA 4LZOA 3E4DA 2PQ0A 3L1KA 2QRUA 2HYDA 4ILKA 4LQDA 5CT5A 3HEAA 4IH9A 4P58A 3WLEA 5JO0A 2Z1NA 2X23A 1V8BA 5IUKC 9MHTA 4AKSA 2TMDA 1ZGCA 1KSFX 3ZOKA 3B6EA 2QMEA 2SECE 4PYRA 4RGBA 1EZ1A 4FDLA 1EVEA 4WGGA 4C0JA 1KHTA 4CM5A 1WPGA 2SICE 1KQOA 2F43A 5FPHA 4HAXA 1C50A 5LUBA 3TCNA 3TNDA 4RW0A 3ZWMA 5KX5F 3ZDQA 1FF9A 1L5MA 2XXAB 1ZNXA 5DISB 3T5CA 1IZ7A 1UPTA 1DKOA 4C6TB 2WE7A 1WF6A 1R6TA 1Q0HA 2IYAA 4XB1A 3CR7A 1Z2NX 2ZS7A 3PUXA 3URMA 1X7WB 1I3LA 4BNYA 4RENA 3U4QA 1T9ZA 1KZGB 4NICA 3QBDA 1XTQA 4Y1GA 4QFDA 4B2IA 2VRNA 2QTWB 3PX7A 4DA4A 4Z4IA 2FOIA 3IP5A 1G7SA 1Y9AA 2VCYA 1NW9B 2ZT7A 2XUKA 3P94A 4CIBA 3TSOA 1PR3A 3K8ZA 2UYQA 3V2GA 5L53A 1OT5A 4P3OA 4XZ3A 2I8LA 4INPA 1VJ1A 3HWX1 4MEAA 3GRUA 1Z6XA 4B0OA 2C94A 3SEFA 4K40A 2AUMA 2FEKA 1F6BA 3NKLA 5J4VA 3MFQA 3IUYA 1PGJA 3CJQA 2KI5A 4ZD6A 1S2LA 2H2DA 2AEJA 3FXAA 5BUSA 4Z9XA 4RJ2A 2D62A 3L6CA 4CEJA 1DKLA 2B4YA 1Y1KE 2OVBA 1QGZA 3O7WA 3LPAA 3WBJA 1PL0A 4KBGA 1Q50A 4MW1A 2XUHA 1E7RA 1NN5A 1WF3A 1X94A 2CVOA 2ZU6A 3KZNA 2G6TA 2JLCA 5FJJA 3BIOA 4C4SA 2AQKA 1PI3A 1AOXA 3KKNA 4KXVA 2VHWA 3EASA 3W90A 1JLHA 1J8FA 4JEUA 4R5HA 2EJVA 1ZNWA 1G38A 4BO5A 1ZJJA 1QGUB 2OB2A 2VDUE 4KMRA 4V03A 3GVCA 4HDNA 3DL4A 3GQVA 2VF2A 3MINA 3T06B 1TKRA 3GJYA 1G9TA 4YONB 5TMBA 1LH0A 3CSUA 3L9XA 3IP3A 3AHGA 1ZM7A 5C5CA 5HHTA 5E9QA 2OV4A 5JCOA 1D1QA 4TRNA 4HH3C 5KYUB 1F4VA 1GEGA 3JD3A 3FCEA 1MD9A 1YMUA 2YFKA 3IT1A 3LW8A 4I1YA 5BN3B 4HDSB 4OMDA 1DZIA 4EA8A 1XD9A 3KEGA 3FR7A 3ZCRA 3HSYA 1BIFA 5JD4A 4MULA 3GD5A 1IHUA 2D0DA 2Q3LA 3AW8A 4Y9UA 5AXDA 3ROGA 3JQGB 1B26A 4ERNA 2ZJ4A 7REQB 2D5BA 4I4NA 4QYMA 4QYSA 4QT4A 3TGWA 1GPH1 3GRCA 3HXMA 1B8VA 1MNQA 3L07A 4RWEA 3KZMA 4RXMA 2ZR9A 4CM8A 4CV1A 2MR5A 3D9QX 4GECA 1F06A 3VV3A 1N1EA 2VHQA 3AV0B 3C1TA 1KYVA 2O2JA 3PNMA 1UBFA 4GI3A 1Z3IX 1L4UA 3FVTA 3RSOA 1XCPA 2X8LA 4Q4LA 1XTBA 2GR9A 2UZ3A 3MGBA 3CX8A 2GN2A 2BFEB 4FJ1A 3DTVD 3PEYA 3TO5A 4WN9A 1YE8A 1K8YB 3L3BA 4FYIA 2G8LA 2DFNA 4MCJA 4PC2A 3HCCA 3K0CC 3GRAA 1H2ZA 5CDFA 4JK3A 3UXMA 3VHXB 1OB2A 2FW9A 1X1BA 2IUFA 2P3LA 3NJ4A 1L5YA 1ZCBA 3WLFA 3GLFA 4EX6A 1SBYA 1EBUA 4PAMA 1EWKA 4JZKA 4AJ9A 3HJFA 2AMLA 1OBHA 3F5SA 2O59A 5AW6A 1S8AA 3CLHA 3VR4D 4R8RA 1PV4A 1RYZA 2PT7A 3VDMA 4A0GA 3K0BA 4CLDA 1YRQA 3AESB 4X7PA 3KG2A 4D4MA 5J2TB 3PUYA 4HDOB 4R05A 4I3GA 5D8DA 1QQ6A 5A5EA 4J0QA 4BLUA 3GZNB 3P71T 1VE6A 5FKJA 1D6SA 1FFAA 4OAOA 3R75A 3AF3A 2WJIA 3MAGA 4IO1A 4B8ZA 4C08A 3IAAA 1VGRA 4RD6A 4JBLA 2HJ9A 3L8MA 2ZYUX 4CT5A 1T5BA 2Q9UA 3G85A 4KHPB 3W3AA 1KVTA 1D2AA 1TJPB 1GG5A 3U81A 3FZEA 3S27A 3BQ9A 5E1MA 2WHPB 2X0JA 3P27A 4NMXB 3TLMA 1UKEA 4AKEA 2GXAA 2Q6LA 4QT0A 5LQRA 2VG8A 5JVDB 3FNRA 4L8LA 2ZIAA 1Z4MA 1XRPA 5HJ2A 2GDJA 2HJHA 2ZUCA 4IDEA 3RK4A 2O8EB 3MW8A 3LNTA 4D81A 5AVYA 3R5TA 4RDIA 1V39A 1ZOIA 2J4CA 2B7CA 1XUOA 2NSHA 1C0LA 3BVPA 3R3ZA 5EMKA 1FMFA 1JE0A 4CL8A 4YXWD 4C4ZA 2QORA 1LBTA 1Y3BE 2I6FA 1FLAA 4X00A 2OHFA 3AUJB 2MSWA 1JTVA 4UNIA 3DC7A 2XI4A 3EW7A 2WJ6A 3PA6A 1G55A 1V4VA 3SHFA 3TDKA 5D3KA 4DMGA 4KO1S 5C8VA 5ICCA 2WHXA 1GN9A 5MFZA 1GNQA 4ZAXA 4EUNA 1SJ9A 2Q28A 1DC7A 5HTOA 4F12A 2VZ9A 5AOCA 5EJGA 3K05A 3OLYA 2A9FA 4FYJA 2Q4DA 4RSRA 1A4UA 4Q7LA 3BQMB 1N2SA 1US8A 1D4ZA 5L3SB 2Q41A 4V2UA 3C24A 1P0IA 5E7QA 1O6GA 2PZBA 3OFNA 3BSYA 3QJGA 4LBYA 5LZ8A 4K3UA 2I99A 3T95A 1KVSA 2ZAYA 1N8KA 2HDWA 2WPNA 5AKIA 1BN6A 1MENA 4HRAA 4FHCA 5AD1A 3QLUC 3OH8A 4KWEA 4QDUA 3QMPA 3DNPA 2YQZA 3A28A 2GPWA 3TLZA 1U2TA 3L7CA 2FPPA 4L4UA 4FX2A 4OXYA 3A58B 1RRKA 3NBAA 5EZ6B 4ETNA 1MAAA 1XL0A 4DQLA 4FD2A 3R4CA 5ESWA 4MV6A 3CB4A 1I7PA 2QX9A 3QVGB 4N5MA 4QU8A 2YRXA 1TIKA 4RIGA 5J4YA 4DAEA 4AI6A 1M7BA 3AUXA 3GA0A 3TOXA 1NUPA 2ZB3A 2PKWA 2D2FA 2H85A 3C8ZA 4ZO7A 4ZIRB 4TLCA 1QFZA 2VNSA 3DZBA 4WINA 4BLSA 4BLPA 3D8NA 2CJYA 3TTSA 3TK1A 2HF9A 2WAAA 1UBHS 3ABZA 1UFKA 1XLTC 1TEZA 3I8SA 4HOYA 3S2EA 3RRBA 5CM2Z 2JAUA 1L5QA 1L4GA 1RKUA 4LTDA 4TMKA 4R1NA 4NBSA 4ZXFA 1PYOA 3UK1A 3KJGA 2E85A 4XGNA 2XGJA 1MGOA 3PQ8A 1U2ZA 4L73A 3WFIA 3U7FB 2PMEA 2HCBA 2R68A 5IT4A 4IWYA 1APBA 3ACBA 2PJUA 4M0CA 5EQDA 2V8OA 4KR7A 2RHMA 2BC9A 4R5MA 4JOBA 1C1XB 4HGQA 4G0WA 2BL4A 2P1ZA 4AYTA 2O6HA 3FYUC 4FKZA 1PX2A 4AULA 2NG1A 2AJLI 1R2QA 3DXYA 3H1GA 1Y1LA 2EL7A 3HQ4O 1QIJA 5CBKA 5L95A 4GS5A 1HGXA 5DK6A 1E79D 2XTMA 4OK6A 5JR3A 4F4HA 3MD9A 5IWAB 3ICCA 5CT6A 2NZ8A 4BQFA 3CINA 4E15A 2BGKA 2G1KA 2NU6B 3GVXA 5KVCA 5HG0A 2NO7A 4RYLA 1UKAA 1UZAA 3DV2A 4M7RA 4J9VA 3L01A 4IGIA 2BLLA 3MAAC 4EB8A 4YX9A 1GSAA 1U7WA 2D7DA 3KOMA 4FYWA 5IDXA 5FOXA 2QMQA 3GLVA 3QHAA 1JUDA 3MJTA 5JNWA 1Z73A 4B09A 1AKRA 2HQBA 3ESQA 3HL0A 3UANA 2O05A 4FC7A 1WR8A 5K9ZA 4X62B 1GZ6A 1QKJA 4FKBA 3VX3A 4CMGA 1WQ4A 4WGFA 2WYVA 2HLNA 2V0CA 3PXBA 1LV7A 3GGJA 5IKPA 3H16A 3PJRA 3QVXA 3ZVKA 2JCYA 4HDKA 4IHJF 3ECSA 1JB1A 1JR3E 4IDAA 3ZY2A 3RARA 2QEQA 1QAMA 3WC4A 1UPXA 1FSFA 2IZ5A 1O0BA 2W4QA 1XN4A 1SQ0A 4KAJA 4S1VA 2GD2A 2RIRA 2F3RA 2OECA 3TL3A 1XRJA 3W4KA 1JWAB 3VBEA 5T7BA 1IMOA 4Y1RA 1T1EA 4AAYA 4RE6A 2B61A 3IULA 4MVJG 2C2HA 1CS4C 2Y1GA 2E2WA 3A6DA 4KIGA 4WH0A 2HEGA 2IYXA 1RDFA 4E4TA 2M6LA 3D4BA 3WMRA 2O54A 1ESEA 4XKJA 5KYUA 2I71A 3JALB 5B3AA 4U7GA 3LS2A 2IF2A 1JA9A 2QUIA 3HVJA 3R0ZA 4DS3A 2EQ5A 3L82B 4O3MA 1C9EA 3H5OA 5HZHA 1T2NA 3TRJA 1XRNA 3OCWA 3QNMA 1PJ3A 2GJKA 5IVHA 3DZGA 1IJFA 3T4EA 1EWYA 1QIHA 2O3TA 2Q6OA 2Z83A 3AETA 4DDUA 2HREA 4R3NA 1GAQA 4YEDA 1VCIA 1C4WA 3A05A 4KO2S 4EJSA 3JARB 4NZNA 3GT3A 5F12A 1IBCA 5FB3A 3BWDD 4CPDA 3GP3A 1IBMB 3ZKWB 4UHCA 5J2UF 1H1LA 4LZJA 5K0LA 4F45A 1EFHA 4S04A 2KE5A 2O2EA 4ENWA 3WZLA 2F55A 5IX8A 5I4KA 2RGBA 1MDBA 4LK2A 3AG5A 4ENUA 2RK3A 2NSDA 2O8EA 2PJDA 3AIIA 4P3YA 2Q8QA 1RHQA 1UFQA 3EE6A 5F3WB 3SQXA 2GM3A 5FADA 5H16A 2QRZA 2WG2A 2I5PO 3AVOA 3ENZA 3ZR4B 2PUCA 1FB5A 4I9HA 4WKPA 3A6FA 1UOQA 2V1XA 3QELA 3I1YA 2ONZA 2QTFA 2WHPA 4IDGA 4HP8A 4KH0A 2OFXA 3TM4A 3CV3A 1T35A 2PKQP 1H8HD 2ZRCA 2ZB2A 3N87A 5DX1A 5SZHB 3UWKA 3ZCUA 3SVLA 1MW8X 5I8ZA 3JRXA 5B3JC 4C4RA 5ESXA 2QVCA 2PRKA 3ZIAD 3RYCB 5I7AA 1HTWA 4Y7CA 4JSRA 1GCGA 2PKQO 3UW3A 3LTNC 2RI1A 2FGJA 5TPZD 1K7CA 4DA7A 1G1AA 3SYMA 3RFXA 1ZFNA 4IO0A 1Z0ZA 4NV1A 1R0YA 3BHMA 1SBCA 2FUG6 2H17A 2IYUA 1P5HA 3JD0A 3P2MA 1R0KA 2QVXX 3TTXA 3WHLA 4AICA 5LP6B 3G5AA 1KDPA 3AVTA 1ZIOA 3LC0A 5CNKA 4REMA 4OQEA 2WF9A 1TVKA 3C6QA 1WUIS 2JFYA 3S5UA 3OU7A 3TLGA 1QFMA 5CRIA 5FDFA 3K4QA 2P1RA 3DWEX 3L0DA 4JDUA 2II6A 4HVCA 1UBMS 1U8TA 3OO0A 2V4MA 3N7AA 4UVEA 3RGGA 5BN3A 2RK6A 2ERYA 2RI6A 4HG2A 4BLWA 1TUIA 2R7NA 4OHKA 1R74A 3UMSA 7MHTA 1WBJB 4EPXA 3I9NA 1RZRA 1G5HA 1N2HA 4KQCA 4DQVA 3ZLBA 3W0LB 2CFTA 4P4NA 1SWVA 4BKRA 1E6EA 2P62A 3ER6A 4UPVA 4BNIA 4QJBA 3L8FA 4YMWA 1XT6A 3SDSA 2A58A 3OFVA 3PEWA 4QQFA 2P65A 3EXFB 2JGFA 3BB4A 4N0MA 3M1IA 3QA3E 3PWSA 4FNOA 2B4RO 1IAVA 1PFVA 2VHVA 4M2LA 1R4AA 4G5RA 1AF4A 1DFHA 2CB9A 4KIWA 1ZM3A 3JQGA 2ADFA 3LKVA 2OOSA 5KYNA 4B6RA 1PEAA 2HX1A 1V3VA 3LHSA 2Z1DA 1EAYA 1ESZA 2CUZA 2OORC 3KKMA 3PD1A 3PENA 4KDFA 2QXTA 4HMQA 4DDWA 1GCAA 1JS1X 2BHTA 5F2KA 3LAWA 5I4BA 1BU5A 2VAXA 5DYYA 2FN9A 4HQOA 2GPNA 3N53A 4ZVTA 2XGSA 3OPVA 3L4JA 2VDKB 3T54A 1KKLA 3OT5A 3BA1A 1MXHA 3E8SA 3DFKA 2O07A 1OTHA 1XWWA 3CLTC 4MVJM 2CW5A 5B30A 2X0DA 4ND7A 2L42A 1MUUA 1SOVA