4MQMA

Crystal structure of antigen 85c in presence of ebselen
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
280
structure length
269
Chain Sequence
RPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
publication title Mechanism of inhibition of Mycobacterium tuberculosis antigen 85 by ebselen.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 103
structure length 269
sequence length 280
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mqmA00
3L1JA 4MWSA 1O6FA 1PV1A 1X2EA 5DNWA 1VZ2A 1R3DA 3WL5A 1USWA 1BRTA 4X6YA 3MGAA 5JD6A 4QDTA 4JUIA 3I2GA 3UUEA 4ZGBA 3DLTA 2V96A 4H7HA 1QO7A 2VAXA 3W06A 4IO0A 3F8SA 3DJYA 4DMFA 1R50A 2RHTA 1CUEA 1EDBA 1MNAA 3B12A 3LCRA 2RGUA 2ES4A 2HIHA 4BAGA 4WFJA 2QJRA 1WHSA 3I2FA 5IVHA 1FFAA 2BUCA 2HA6A 4BDTA 4L3WA 3WK4A 3C87A 1CFJA 2OLEA 2J3DA 3ICVA 1QZ3A 5CT5A 3D3NA 3O4IA 4N8DA 1HLGA 3M83A 5LP1A 4KJXA 3ESAA 4Y2XA 2QTBA 2ZJ7A 4X95A 3VDXA 4FBMA 4KYVA 5ALXA 4EA6A 4DNQA 4QA9A 1LPPA 2WIDA 4YASA 1Q84A 1WHTA 4G1FA 3TRDA 1A8QA 2XMBA 4BRSA 1WM1A 2GZRA 5E4YA 1UK6A 2XUQA 3KD2A 3ZV7A 3K6KA 4P08A 3R3VA 4X92A 3IUMA 3DD5A 3NOXA 1YA8A 4KAAA 1CPYA 2ROQA 1CUIA 3LLCA 3WQHA 4B85A 2OAGA 4OYYA 3C5VA 1Y7IA 4RPCA 4KR0A 3SC2A 3DKKA 4YX9A 2XLBA 5EIEA 2RI6A 1TAHA 2PM8A 3DYIA 3CXUA 1J2EA 4OU5A 4GI1A 3VISA 3LIIA 3BF8A 1CUZA 4QZVA 5IVKA 4A5SA 4DIUA 2WIGA 5ALLA 1CQWA 3UUFA 3FYUA 3EQ8A 4HVTA 2K2QB 3D2AA 3LIPA 3H2JA 5CURA 5I7UA 2AJDA 4BVKA 2C5FA 2H7XA 5AI6A 1UXOA 2ORYA 3U0VA 3S8YA 5K5EA 4W1QA 3FYTA 5DNVA 1H2WA 3MUNA 4I19A 1QOZA 2OCGA 5A7GA 1VZ3A 1AX9A 2JGFA 2FJ0A 1ODSA 3GROA 3BIWA 1JMYA 1H2XA 5KWIA 5A71A 5CT4A 2RIPA 3AILA 3WL7A 3WL8A 5AIAA 3K2IA 4RNCA 5K3FB 2ONCA 1DQZA 2W22A 3C43A 2PL5A 3R0VA 4KE8A 4RE5A 5ALQA 4EZIA 1NX9A 4X6XA 1YB7A 5ALNA 3UMJA 3SWWA 1XZMA 3H2KA 4AN1A 2VEOA 2GBIA 3C6BA 4H35A 1BN6A 2BAGA 1ODCA 3KSRA 2WKWA 5JAOA 5D6OA 1WCYA 1U2EA 1IUPA 1JMKC 2Y1KA 3A70A 5HF9A 2PSFA 1OILA 5HF5A 5K3EA 2WU4A 4YK7A 1UKBA 1XZLA 3H04A 1XLWA 3BF7A 5JZSA 1DWPA 1W4LA 3O4GA 4BYMA 3G0IA 5AKZA 1TIBA 3CCBA 5DYWA 2QR5A 3VJMA 1PJAA 4Y2JA 2PPLA 1Q0RA 2VATA 2IIVA 4ZWNA 3ZI7A 2ZYHA 1ZD4A 4PSUA 4BATA 5EIAA 1TQHA 4X97A 4QLAA 4TVKA 2O2IA 2QKYA 5AM3A 4AO7A 2I3ZA 3WA6A 1E8NA 2H7CA 2VSQA 5JADA 3DNMA 4BP8A 3OPMA 1GKLA 4X00A 1XRRA 3FBWA 1P0PA 2E3JA 1RWQA 2XMZA 3O9MA 3IBTA 3FSGA 5A6VA 5FUMA 1DX6A 1AGYA 3MUOA 3VKFA 4HRYA 1LPOA 1K63A 1LPAB 1RYYA 3B5EA 4UHHA 2WJ4A 3O95A 1XZBA 3E1GA 5T4FA 4N8SA 5AHXA 1XRLA 4FNGA 4Q34A 4ARAA 4C87A 1MX5A 2H9YA 1BEEA 3RM3A 4ZV9A 1J07A 1THTA 2H7YA 1U8EA 4UBMA 4E46A 4OPMA 4J7AA 2OQVA 4B83A 4EY6A 5FKJA 3NGMA 4QWWA 1QONA 3PFCA 1YCDA 5LZ8A 4HXEB 3FWHA 1NU6A 1HDEA 3BE8A 2G5TA 2XLCA 3D4LA 4H7KA 4W1SA 2VF2A 4DSZA 3DYVA 3QMVA 5HFNA 2GZSA 2BCEA 1MTZA 3KOOA 4F21A 3O0DA 3M81A 5DYYA 1C4XA 3H2HA 2HL6A 2QXTA 2C0QA 3D2BA 4G9EA 1ZI8A 3DL4A 3SX4A 3Q0TA 5AKEA 4WFKA 5EI5A 4OSEA 1JT2A 1CUAA 4DM7A 3FOBA 3KDAA 1EHYA 2WHQA 5C8XA 4BAUA 2X5XA 4OU4A 4FBLA 3WKDA 4BE9A 2WHPA 1SFRA 1ZD2P 4ETWA 2ACKA 3IB3A 3WJ1A 2WSLA 1CV2A 3G02A 2YASA 1XLVA 3IUQA 4C6HA 3C45A 1E3QA 1BEZA 4CG1A 3STYA 4ZRDA 4NS4A 3OC0A 1CQZA 4F60A 3HZOA 2ZSHA 4LYDA 3QITA 2YYSA 4OB6A 7YASA 4GDMA 2I3DA 5CH5A 3VJLA 3O9VA 3B3QA 1ZICA 2G5PA 5AI4A 1F0NA 4B9AA 4X85A 3IULA 4F5ZA 3IA2A 1CLEA 2QXUA 4BTVA 3FVRA 4X94A 4HXGA 3RK4A 3X3HA 3FCXA 3O4HA 2CB9A 5JIBA 5JZ9A 1MX1A 5DYTA 1CUVA 3G0GA 1FFBA 3W05A 3C5WP 1CIJA 1TCBA 1XZKA 4Y2RA 2Z8ZA 2AJ8A 2PSJA 2JEZA 2QRUA 3VJKA 4G4JA 2YH2A 2WUFA 3IVMA 2Z8XA 3STVA 3H2IA 4HRXA 2XMCA 5CH3A 2WFMA 1EXWA 1VA4A 5AJHA 2QZPA 3FYUC 3WA7A 1GPLA 3E4DA 4BCCA 1UK7A 5AO9A 2WM2A 3STUA 2JIDA 1ETHA 1UKAA 5CT9A 1XZGA 3R40A 5HK8A 3PE6A 1CUWA 4Y2SA 2Y2VA 4XJVA 3DQZA 2R11A 3R41A 4C89A 3FCYA 5AM4A 1GXSA 4PSDA 2GYUA 4U2GA 2WIKA 4CCYB 2WFZA 1XZFA 1HL7A 4AQDA 5ALGA 4UBKA 5AK5A 5CXUA 1XZDA 2VQ6A 4HZGA 2VTVA 5CBKA 3AZPA 5CXXA 2OG1A 4XIIA 1JU3A 2HU5A 1XZJA 1XZAA 4DGQA 2CBGA 2BUBA 2B61A 1E89A 1EA5A 1VE6A 2XB6A 3G9XA 1VA5A 4WY8A 3G9ZA 1ZI9A 4MJ3A 4WDQA 5ALSA 2QM0A 4GWLA 4GXNA 3W9BA 2HU8A 3V9AA 5ALIA 1YASA 3I2JA 4JYMA 5JAUA 1DINA 3QYJA 1E5TA 4E11A 4G4IA 5D3KA 4V2IA 2XUJA 4JNCA 2WUEA 2JGKA 5ALFA 4H7DA 1LBSA 5HFAA 3OTQA 1GZ7A 4QWMA 1AUOA 4UBIA 5ALUA 2GBFA 1P0IA 1UWCA 2WU3A 3KWJA 3KXPA 3HJUA 3I6ZA 4HTAA 1FJ2A 4OCZA 3WWCA 5ALVA 3EF3A 1LZKA 1CUGA 1DU4A 1Q83A 5EGNA 2PUHA 1WPXA 4CCYA 4QNNA 3HSSA 3QMMA 3QPCA 2QUBA 3N0TA 4J0CA 4IQ4A 3V1MA 3PF9A 3FAKA 5ALYA 4OD0A 1K8QA 5K3CA 2BFNA 1QIKA 3D7RA 3WKBA 3FLEA 4ARBA 1JJFA 2WUDA 2B20A 5HQ3B 3VVLA 1TCAA 5KBYA 3WK5A 4E14A 1WB4A 4MEBA 5DWDA 5AKXA 3IDAA 4J0JA 2DQYA 2PBLA 3R3UA 5YASA 1DX4A 4CG3A 2ZVDA 1GPKA 1VXOA 1XQXA 4J3JA 3H19A 4B84A 4UFPA 4IH9A 4Q3OA 5AI8A 5AM1A 3BXPA 4BCDA 3DL7A 4P92A 3WKAA 1U4NA 2WJ3A 2OXEA 2ZJ6A 2XE4A 4Y2QA 5AK6A 3VVMA 4U2BA 1VXRA 3L1HA 4G8BA 4XWGA 4FLMA 3ZPXA 3IURA 3MVEA 1JJBA 3W9UA 1S8OA 4CG2A 4H7EA 4KAFA 1DWOA 1CUYA 4BZWA 3VXKA 1CR6A 4JH0A 4EY5A 4WFIA 4QDZA 3GUUA 4IH4A 1SOMA 5A7HA 1CEXA 1LPBB 4G8CA 4DNFA 5ALOA 5BOVA 4LIPD 1QIEA 4X93A 1IZ8A 1H23A 3WK9A 3GZJA 3PICA 4BVJA 4O08A 5K3DA 4FLEA 3WLAA 3ZLUA 1BCSA 3ANSA 2D5LA 5JD5A 3WYDA 5AOAA 1UOPA 3S2ZA 4PQEA 5BWCA 3Q8WA 3W04A 1CUHA 1AZWA 2DQZA 1JJIA 1XZHA 3C6XA 1CUFA 1GKKA 2ZYIA 3R3ZA 3D0KA 3A6ZA 2WTMA 2AJBA 3DCNA 5HKAA 3FLBA 5E2IA 2WHRA 3QM1A 1ZD3A 5A62A 2QMQA 4Q82A 1JFRA 1K4YA 1BU8A 1Y37A 1QIIA 4CI9A 4S0XA 4OB8A 1J06A 1UOOA 2WIFA 1F0PA 4E15A 4Y7DA 3PF8A 3D2CA 1X70A 5LLSA 2WG2A 3NUZA 5AH0A 5E4TA 2ECFA 1C7IA 3WYNA 5AKKA 3WK6A 1P0MA 4B0OA 2BUAA 3A2NA 3FNBA 5T4EA 2JGJA 4LKOA 4HAIA 1GGVA 5BWBA 3ED1A 3I28A 4MEAA 3HACA 4FHZA 5AICA 3E3AA 2WFLB 2QS9A 5EHXA 1FFEA 2OAEA 5AM5A 3NWOA 3F9CA 4C4YA 4ZV7A 3BWXA 2OGSA 3EIOA 2WG0A 5K3FA 4A16A 3R3XA 1DT3A 5ALHA 4H0CA 4WJLA 2BGNA 4PNZA 2B4KA 1EI9A 4N5HX 4L9AA 5J3JA 1ZJ5A 5AM2A 1XKTA 3AFIA 3FSGD 4AN0A 3QH4A 4UBLA 4B80A 5ALMA 3HXKA 5JD4A 4QE3A 2CEKA 1SCQA 3EBLA 1AURA 3IUNA 5EHNA 4CCWA 2QJWA 4UHEA 4Q3KA 1VE7A 1XKLA 1IMJA 1KU6A 1ZIYA 4QDUA 4GW3A 1A7UA 2AXEA 3GELA 3W2TA 4H7IA 1G66A 4FTWA 1HKHA 5ALTA 4J0DA 2G63A 2I78A 5AKYA 3M3DA 1FFCA 2O2HA 4WDRA 1MAAA 4AB1A 2XMDA 2HFKA 2WFLA 1YA4A 5JZBA 4BE4A 1MT3A 4KE6A 4UHBA 1W1IA 4XVCA 3DOIA 1LLFA 2JEYA 2HA0A 1CRLA 3GA7A 3QPDA 5JASA 5DLPA 4DNOA 1ISPA 5KWJA 4OYLA 1YSCA 1TKRA 1XRPA 1D07A 1CUUA 1WB5A 1R4ZA 5ISMA 3PUIA 4X3CA 5T4BA 4WY5A 2QOEA 4X6UA 1Z68A 2JBWA 2VJAA 4EBBA 5CT8A 5EFZA 2VT7A 5JANA 1EDDA 4B6GA 2DHCA 3AIOA 5AIBA 1UT6A 4N5IX 1BE0A 1K5PA 2HA5A 4K6HA 1XQWA 3G0CA 1UFOA 4KAJA 2DCMA 4G5XA 1MU0A 5AI9A 1UK8A 1ACJA 3STTA 4I3FA 4EUSA 3GFFA 2JGIA 4F0JA 1CUSA 2DR0A 1CUBA 2ZJFA 2VT6A 1ZOIA 3F96A 5SYNA 1GQSA 5EHQA 3G0BA 1HBJA 4U2CA 3BJMA 5DNUA 4FFVA 1EB9A 2R8BA 4ZXFA 3I2HA 4NMWA 2OGTA 1AMNA 4D9JA 4B7ZA 1UOQA 4OB7A 1ZIXA 3DOHA 1ORWA 3C70A 4U2DA 3AZOA 3WIBA 1QGED 2OCIA 3A2LA 5ALJA 2GBCA 5ALZA 2X76A 1SCKA 3PI6A 3HLKA 4DTCA 4WCVA 2VA9A 4J0GA 2GYWA 1HPLA 4Q3LA 4EB0A 5JAPA 4H18A 4BTLA 1EVQA 5LZ9A 4P93A 5JAHA 1JKMA 3G9TA 2HA7A 4UBNA 1VLQA 3WL6A 1ZGCA 3WMRA 2HU7A 4B81A 2G4LA 3QPAA 2D0DA 5D3ZA 3QZUA 1QIDA 4KRYA 4TPKA 5C81A 2Z3ZA 3RKSA 1EINA 1LPSA 2Q0XA 1ZJ4A 1K6EA 1EVEA 2XQIA 1QIFA 2HA2A 1R9MA 1DWQA 3C6ZA 5CTAA 4I4CA 3JYHA 1WOMA 1XRNA 2O7VA 4CFSA 3I6MA 1R1DA 2HRQA 4BVLA 5DTJA 4K6KA 5LIPA 2Y2UA 1JI3A 1DTEA 2AJCA 5AM0A 1YAHA 4J0KA 2JGMA 4IHAA 2HDWA 4L0CA 4FOLA 2PU7A 3R3WA 3H18A 1YR2A 1QIMA 5AKHA 3RLIA 4X90A 3HYSA 3PUHA 3AIMA 1Q0ZA 1A8UA 2QUAA 3CCCA 4B82A 1MPXA 2I03A 3STXA 3WWPA 4BRZA 3L1IA 3LP5A 3WK7A 5HF8A 2V98A 4MYDA 3WWEA 1T4MA 1EX9A 4W9RA 3ESCA 4DMCA 1NU8A 2O2GA 1AC5A 2UZ0A 1LBTA 2XQGA 4C01A 4UBJA 1IVYA 2EDCA 4LXHA 4Y2VA 4C88A 5I9IA 4H7FA 1ZD5A 1N5RA 4BB0A 5I8PA 5JALA 4CIAA 4M0EA 5FP0A 3FVTA 1E8DA 4GHWA 2JGEA 3H2GA 1H2YA 1CUCA 2HA4A 2OQIA 2Y6UA 3WJ2A 4Y2UA 4UHFA 4PO3X 4PW0A 1TCCA 5CT6A 3C8DA 1MO2A 4MXDA 4LXIA 2ACEA 4G9GA 4M0MA 3SK0A 1B6GA 5SYMA 2P8SA 4K5QA 1ODTC 2IX9A 3G0DA 3WWDA 5FXMA 2NW6A 2HA3A 2XMRA 1N1MA 2PSDA 5FRDA 1L7QA 3HC7A 3ZLTA 4FNMA 1XRQA 1W6RA 3ESBA 2J4FA 4KRXA 3FLAA 3I1YA 1BS9A 2EEPA 1R88A 3ICWA 3FYUB 2X8BA 3O4JA 3I1IA 3G8YA 2XDWA 4OUKX 1LGYA 1EH5A 3GBSA 2OGZA 3I2KA 5BV7A 2XUPA 4UHCA 5C8VA 3OG9A 4DMKA 4GLBA 4PV7A 1XQVA 1CUDA 1X2BA 2C5GA 3U1TA 4FDMA 3IIIA 5AP9A 4B0PA 1F6WA 2XMQA 1QJ4A 3DKRA 1EK2A 1F8UA 2QVBA 2RONA 2XMSA 1XRMA 4KE9A 5FPQA 3TEJA 2V97A 3TJMA 1ACLA 3I6YA 5HQ3A 5HZGA 1BROA 5AI5A 2XUKA 3ANTA 4QDXA 3HRHA 4DYHA 4EY4A 5D7BA 4TGLA 1BN7A 2ZSIA 5E4JA 4YPVA 5JATA 3PFBA 3CN7A 1QFSA 1BCRA 1T2NA 1XZEA 3JW8A 3BDIA 2RAUA 3STWA 2XUDA 4J0IA 5LYYA 5JARA 2ZYRA 4Q1VA 5IKXA 1YAJA 1WPRA 2HHAA 4FMPA 2WIJA 2CUTA 5HK9A 2Z5GA 1QIGA 2PSHA 2XQJA 4AO6A 3QVMA 3BL8A 1VOTA 5HCUA 4MQLA 4U2EA 3OURA 4BC0A 5C7YA 4CIBA 4K6GA 3DEAA 5EIHA 5F4ZA 4HS9A 3ILSA 4AZ0A 4BC1A 4DSAA 5IVDA 1DT5A 1E66A 4X91A 5ALKA 1QE3A 3BIXA 3ZWQA 2OPHA 5FDFA 5ESRA 1XLUA 2WJ6A 1GQRA 4M0FA 5DTIA 3V48A 3F97A 2XUHA 5A7FA 1QTIA 3WZMA 4X71A 3YASA 5DJ5A 4BBZA 1XZIA 1Y7HA 1EK1A 1C7JA 4G4GA 1UK9A 3R3YA 4DMHA 1IZ7A 1UKCA 4K2AA 4UBOA 2VJDA 4H7JA 5AK3A 4BP9A 1EDEA 4Y2PA 1N8SA 2YXPX 2RHWA 2PX6A 5JYCA 3WZLA 2WUGA 4Y2TA 4Y9SA 1CVLA 4FFWA 4PF1A 2DFPA 2HRRA 4G8DA 2Y6VA 5K3AA 1SCIA 5AKGA 5CW2A 5IH7A 2XMGA 1A8SA 2V9ZA 4EY7A 3V1KA 1SC9A 3EQ9A 1GT6A 1LZLA 2C58A 2HADA 1I6WA 5ALWA 4DNPA 5HF6A 2DHEA 5AKLA 2WILA 4X7BA 1MX9A 3G7NA 3N2ZB 3AJAA 2OCLA 3KWFA 5LKAA 5LZ4A 4U2FA 1DQYA 1JU4A 2HFJA 2BKLA 3WKCA 2GBGA 5CMLA 1OXMA 1CUJA 4GECA 1XQYA 3T4UA 5CRIA 4J0HA 1QFMA 2XI4A 4KACA 2BGRA 1AQLA 5CH8A 2H1IA 3OOSA 4FWBA 1G5FA 4NVRA 2DHDA 4BDSA 4W1RA 5C8ZA 5LZ2A 2WQZA 2W6CX 2PU5A 2CMFA 2IITA 4L72A 2XUAA 1L7RA 1M33A 4MWTA 1FFDA 1WB6A 3BDVA 3DS8A 4MYSA 3TGLA 1P0QA 4H77A 5LZ5A 1TK3A 3PDCA 4AZ3A 1OCEA 2WHPB 4UUQA 1IUNA 1G42A 1UZAA 3E0XA 2XUFA 3WKEA 2PKYX 2XUIA 4GEGA 1U65A 4B9EA 4IH1A 2XQKA 5LKRA 4AMYA 5FV4A 4JYPA 4W1PA 1VJ5A 1H2ZA 4PSCA 1YS1X 2XT0A 4UHDA 3T52A 3ESDA 2C4HA 4W63A 5AKIA 1ORVA 1G4HA 2DSNA 2FUKA 5IVIA 1J1IA 2PUJA 3H17A 3V1NA 2BJHA 1QO9A 5K3BA 2WG1A 5AI0A 2QT9A 4ZREA 3C6YA 2FJPA 5FLKA 4DLNA 4XX1A 3IUJA 4RGYA 1W75A 1KEZA 4ZI5A 4LHEA 4Y2YA 1PFQA 4RE6A 3H0CA 2C7BA 1W76A 1XZCA 4J03A 5AKJA 1QIHA 4QLOA 3F98A 4KE7A 3V1LA 4AO8A 3WWOA 4A23A 2VAVA 2AJLI 5AOCA 5AK4A 3AINA 5FOQA 3ZLVA 1W52X 2WTNA 3JWEA 1XROA 3HEAA 1CUXA 4UFNA 2C0PA 1A88A 1EB8A 2LIPA 4UPDA 1YB6A 2JGLA 2PVSA 4QDOA 2JF0A 1MNQA 3H1AA 4LYEA 1MJ5A 4FLFA 3H1BA 3AZQA 4KEAA 1MAHA 3HI4A 3C8HA 4EHBA 4P9NA 1B41A 3LS2A 2FX5A 2CJPA 2B9VA 3DDUA 4INZA 1AKNA 2VJBA 5ALDA 1ZGBA 4UFOA 3AUKA 3D5EA 1E8MA 1QIJA 3AIKA 3BJRA 1XFDA 1LNSA 2O7RA 3A2MA 4BZZA 5EHZA 4EY8A 1LPNA 4BAZA 1HQDA 5T4HA 3QBJA 3D59A 3WI7A 2OCKA 3RARA 4NZZA 4ROTA 4C4XA 5HKBA 4JEIA 3K9BA 1GPNA 3WK8A 1THGA 5LZ7A 1R9NA 2J4CA 3QMWA 2GYVA 2WLSA 4C4ZA 3M82A 5AOBA 4N8EA 6YASA 2VJCA 2PSEA 2EDAA 1YS2X 4AXBA 5H3HA 4HXFB 2XQFA 1RP1A 1QTRA 4GBGA 4ITVA 3OM8A 2CKMA 1O6GA 4BCBA 2CZQA 1N5MA 4QEKA 2Z3WA 4FKBA 3P2MA 2HM7A 3G9UA 1MN6A 3EQ7A 1L7AA 1ZI6A 4LXGA 3F67A 1FSSA 1KU0A 4Z49A 5KREA 3I2IA 4AMZA 1IUOA 4MQMA 1VKHA 2ZYSA 5FPPA 4Q05A 5A2GA 4AX4A 1LPMA 3HABA 2XUOA 1H22A 3WIOA 2J3QA 1TRHA 2XUGA 5ALPA 1QLWA 3CN9A 5ALRA 5ALEA
chains in the Genus database with same CATH superfamily
1VP9A 2SKCA 4RVCA 3RNOA 4HDMB 3MIZA 3NH9A 3WV4A 2GN4A 2I0FA 2VHUA 4CXMA 1EM6A 3SBOA 1ISGA 3O7WA 2MIIA 3U56A 1YBVA 1Q77A 4I99A 3WL5A 3L4JA 1USWA 2B4YA 3DZJA 2MR6A 1Q11A 4ZDIA 1BRTA 3QW2A 3AOEC 1BJKA 1UMCB 5FWDA 2QM3A 4Q4JA 3RS9A 3BAFA 3HU2A 4S1OA 1RZRA 3SBEA 1KEVA 3ZE0B 5JCZA 4WKPA 1TVMA 4TV8F 4YIKA 2FVXA 2W2VA 4F4IA 5A6VA 4YHHB 3MJEA 3C7TA 2Q3EA 1P4GA 4FWTA 1SQFA 1Z5WA 1ZKMA 5FTKA 3I2GA 1FLAA 3QUBA 4ZGBA 2QNIA 1KMNA 1OBVA 1UZMA 1FU7A 2I7TA 2P90A 5B3AA 4H7HA 2H51A 3LUBA 3P4UA 3GP3A 2C7PA 4DXHA 2CGEA 2IODA 3TLCA 3WWZA 1JQLB 1VRCA 3ETJA 3TLGB 3ADBA 1CUEA 4PR3A 4ERXA 4KVAA 2ZJBA 4MUXA 2FMTA 3LCUA 1MNAA 4PC1A 4Y2HA 1RWVA 2GTPA 3B12A 4L75A 1MGPA 4BMVA 2CDNA 3FR8A 4I8IA 3E8SA 1MQ9A 3LBFA 4TL8A 4LXXA 4BAGA 5BPHA 1O6CA 3GPIA 4BL5A 5EJ9A 3TNJA 2ZJAA 4GC5A 4L1KA 5TEWA 3B8EA 2HA6A 1GG2A 5B30A 1U7XA 3W6PA 3LT1A 5DN9A 2QXYA 1ISFA 1H69A 3C15C 1E3DA 2RHOA 4G1VA 5KSZA 3GGSA 3SYNA 1DJNA 1QFZA 3BIFA 2J32A 1KDYA 3Q0EA 4EG3A 2CWDA 3WNQA 3ICVA 1JSLA 1QZ3A 3CG0A 3IUBA 4UAVA 1OFUX 3WYFA 4UQLA 3GFRA 3VZCA 4YRIA 3DKVA 3RU7A 1H0SA 3FE2A 1GQYA 3DE1X 3LPAA 2RC6A 2IXTA 1KFEB 5HPYB 2OTCA 3MJCA 4A10A 3ZWXA 3SGLA 4PRYA 5D3MB 5A4DA 3DZKA 3LHSA 4ENQA 1J7KA 2R00C 2QTBA 2JGRA 4B3BA 4PFSA 4BBJA 3C85A 5IN4A 2CFCA 3A32A 4ZVQA 4EPXA 2X8JB 1RKXA 2H0RA 1A82A 4ZVNA 4ZCRA 5IZCA 4FBMA 1EUDB 2V65A 3LKBA 2FK7A 2ZXUA 1PYDA 1JIIA 2NX2A 4Y2GA 5C37A 4QA9A 1NJ2A 1U81A 3BZUA 2C4NA 2Y1FA 3TRDA 3QX9A 3PDIA 2A35A 4P34A 4M4SA 1K5GA 4PX5A 5JE8A 2FLWA 1DJMA 2P9GA 1ZY2A 1YACA 2NO7A 2A3NA 4BRSA 2DPHA 2XA1A 2VHZA 2I29A 1P4HA 4EBFA 3RTEA 2GZRA 2WTXA 3DVRX 3R7BA 3BMOB 3CNQS 2XUQA 4PFKA 5BPFA 4RCYA 3K6KA 3N5KA 4F46A 1VSBA 1SVKA 3MUEA 2X7XA 3VPFA 3RV4A 1TYDE 5IBCA 1NJ1A 2DX7A 4WOPA 3R3VA 1L5NA 4RV4A 3ER9A 1SVOA 3NOXA 2HMVA 1Y34E 3EZYA 3RIHA 3M33A 3Q5DA 1DDIA 2KLHA 1CRQA 2JEOA 2ROQA 2ZSFA 3ETHA 4QOGA 1N3YA 3U4HA 5JNTA 1E3MA 3GRKA 1FP7A 1WL8A 1WUHS 1YZFA 5JJ5A 1TGVA 2AZXA 1K6JA 1FP6A 1O5TA 1PYGA 4I36A 2VHQA 2VL7A 3WQHA 5JXIA 3WLKX 4U6NA 4R31A 3T8YA 4PANA 1GUBA 4AU1A 1SZJG 1Q3HA 5EE5B 5JZVA 3G2HA 1ZXBA 2NQ8A 2QLMA 4FT2A 4DLAA 3C4QA 1UP6A 3GRCA 5AW3A 4GLJA 1XPJA 2A0WA 3LFUA 2FPRA 2JHPA 1PL8A 5K8LA 4PX2A 3QEMA 1Y7IA 1RQLA 1UEXC 4NFLA 4RPCA 3OT1B 4ZRMA 2X8LA 3UAWA 4HUQB 6GPBA 1FDWA 1DIHA 3D5QA 1XTBA 1ZH8A 4YX9A 3E9CA 4LMAA 5EIEA 4RU1A 4YPFA 3I01A 3LHIA 4D3XA 2NMVA 3ORRA 3CXUA 2F1RA 3OE5A 4OU5A 4UAGA 2O3RA 1N0UA 5H7XA 1SHUX 4F6RB 1RHMA 5HBGA 4QOIA 4H0FA 1E5LA 1W0KA 1Q20A 1E1RD 1AIPA 3U3OA 4G0NA 2B4RO 1FUYB 3RT7A 5BQOA 3SE0A 2WIGA 1WEHA 4RKQA 4EI8A 1CQWA 5FHQA 1N5DA 1I7PA 2P69A 4Z1MA 3ZKWA 1YB5A 1FUUA 1LS1A 3HR4A 4HVTA 4CUKA 3TG8A 1CJSA 3IBYA 1SU4A 5FTWA 4NHEA 4RX1A 2JCVA 3QUAA 1Y5IA 2CV2A 4WXYB 2GCGA 2OFWA 4WCDA 5I7UA 3AL3A 4BVKA 3SS7X 3UMRA 1L5YA 4NBTA 2R62A 4RPJA 5DXAA 1I80A 1OBOA 4QOSA 5M5BA 3M8KA 5AI6A 2J3JA 3JWIA 4QGAA 3K0SA 1E79A 4I4TB 2ORYA 1NPTO 1E9CA 1XEAA 2PIDA 1JR2A 1VI6A 1Z2EA 4KSYA 4W5JA 4P54A 3IPAA 1US8A 4KQHA 5DNVA 1H2WA 4GYKA 1HX7A 4LJKA 1NR5A 1QOZA 1NMYA 2OHOA 2F9FA 2K5UA 4GM0A 5A7GA 3I73A 3KJNA 1WNTA 1FF9A 3D3EA 1GHTA 1WAMA 1ODSA 3A1NA 3PD7A 3QX8A 4MKIA 4YRLA 3OPQA 5EERA 5FL3A 2HPHA 1AB6A 1WMEA 2QN9A 1LJUA 2QDXA 2R48A 5CB4B 4J0FA 5KNBH 4X1YA 1TM4E 5LXTF 4RTJA 4RADA 3ZV6A 1JKXA 1H2XA 3S2GA 5A71A 5M7EA 3TBFA 1PR9A 1XU9A 4XDYA 2HK9A 2NXJA 3WL8A 2B8JA 2Q5EA 3WRYC 2NSDA 2ZUSA 3IKVA 3K2IA 4H6VA 3DZCA 4RD6A 4HDQB 3QVOA 1BD4A 1Z2PX 5K3FB 5BR4A 1VDZA 3MIIA 1G64A 1L7XA 3NWEA 5LQJA 3THWB 1PK9A 2DY0A 4KGXA 1DQZA 4KXVA 3V42A 1U0BB 2ON6A 3L8EA 4CL2A 5ENVA 2W22A 4UQPA 1Q15A 3R0VA 2AEJA 4G26A 1HQCA 3UA3A 3KQYA 4RE5A 4S35A 5ALQA 2GILA 3HDTA 1YB7A 4TV9B 5JS2A 2A30A 3SWWA 4LF8B 3AETB 3FNRA 1XZMA 3R09A 3ZGNA 3D4IA 4YWJA 3C6BA 4Z9YA 5BYKA 2FQ1A 2HY7A 3ZWAA 1RI3A 1Z74A 4JU8A 4BFTA 2Z95A 3NTOA 4W9MC 1IMOA 4IGEA 1KY4A 1N75A 2YS6A 3QEAZ 4PHCA 1SKYB 2E4XA 3G8AA 3PJEA 4RZUA 3I23A 3MSCA 3LDFA 4HQNA 3DE5X 1FRZA 4DNXA 3ONNA 1NN3A 5D6OA 2LE0A 1P1KA 2FHSA 2GZHA 1FQJA 1WCYA 3GDOA 3PRYA 5FOXA 3GUHA 2Q6IA 1IL0A 3MS7A 3Q6NA 4YCSA 3LRXA 5KX5B 1APBA 3VR6A 4JK3A 4F4CA 2H2HA 1JQ3A 2Y1KA 4Z4FA 3IIKA 1GRVA 5JLAA 1A27A 1TAUA 3WRXA 1U4OA 4XYEA 2TSYB 4POAA 3QVJA 3MWEB 4MS1A 3LU1A 3PIRA 3OTGA 4O63O 1FDOA 2NM0A 1YBAA 2YRXA 4TSRA 4UDXX 3B6IA 1VB5A 2JAPA 4LECA 1C2YA 4QPPA 4U9UA 4YALA 4BO4A 1XZLA 3TKAA 1IXYA 4NR0A 1XLWA 3T7CA 1W4LA 4KFUA 1GPDG 1H2BA 3DZFA 3O4GA 3OO0A 4FMCF 4HPJB 1UJCA 2R5FA 4IRUB 5AKZA 1NM5C 3CCBA 2ZB7A 1N5IA 3D4PA 3DMTC 4GZMA 4QVKA 1PJAA 1ZN7A 3GAFA 3PNQA 1RAAA 3JAWA 2RGNC 4Y2JA 2PPLA 2EL9A 2PMCA 4RZ3A 5DASA 4DJ5X 4EJ0A 3F6YA 2QE7D 4ZWNA 4CRWB 5DGCA 1M3SA 3SX2A 2RARA 2BP7A 3I9NA 4BNDA 4EFNA 3WGGA 1VSVA 5K6AC 4BATA 4EGJA 3EMVA 1DWUA 3QY0A 1P3Y1 4GOOD 4I66A 5EIAA 1ID8A 1Z88A 1N1GA 3R5SA 1N2OA 2GK7A 4ON9A 1FUEA 4TVKA 2CL7X 1M74A 1L5SA 4BV9A 4JP2A 4B6PA 4PC6A 2I3ZA 1YV9A 2H5JA 2ZIEA 3GV0A 3WA6A 4CMEC 4Z4GA 3TW6A 3HVRA 3H8JA 4J6FA 3A3PA 4Z0TA 1Z5OA 2QSZA 4OHKA 5JADA 3DNMA 4P86A 4D25A 5GGXA 4NABA 4Y6OA 2VOJA 4DRYA 2AFRA 3OPMA 1L1RA 4FSDA 2XHZA 9ATCA 4ZJYA 1XRRA 1M0EA 1XVLA 1OGIA 1Z4JA 1NFFA 2QTHA 3OPYI 1AKUA 3V00A 3E84A 3MRVA 3ST7A 3CLHA 2XMZA 5CA0B 3C24A 2EKLA 3OQNA 1B8PA 2DF8A 2XCQA 4EJFA 3IBTA 2OLJA 1DX6A 3TOZA 4ICIA 2Q1SA 2PZEA 3HYLA 3FHTA 1F8YA 3HFJA 2ZBUA 1VCMA 3IOCA 2HSEA 3MUOA 2ZJ1A 3MT7A 1O8BA 3AUFA 1QKKA 3Q7SA 4GOXA 3FUUA 3HUFA 4RXUA 2DBQA 1Y1KE 4PPFA 2XZDA 1JDZA 4OXNA 4ANFA 3DLBA 3L0YA 5F9HA 3GO4A 4FEAA 3D1LA 3U4GA 3FW1A 4MSUA 1P5ZB 2ODTX 3V8PA 4UHHA 4AZVA 5FTMA 2WJ4A 2WB2A 3O95A 2V55B 3S6JA 5SY6A 1NVVQ 1XZBA 4QEDA 2QPOA 2FSGA 3O1JC 1F06A 2QW0X 4TVBA 4Q34A 5TMBA 4DQUA 4E4RA 1QAOA 1G2OA 3D4BA 3TK1A 2VUSA 3K96A 2JIQA 3DNFA 4DANA 2BRUA 3LV8A 1THTA 5A5DA 2X8AA 4BNJA 3NOQA 1ZH4A 2H7YA 3B1JA 3HCBA 2J5QA 4RHFA 4KQGA 4J7AA 1DNPA 1HDYA 2OQVA 1D2NA 4QHYA 4MTLA 2CL6X 3ZE8A 2JIRA 2HUNA 2P5YA 2PRZA 3D3KA 3KBOA 5EP4A 3NJRA 4JKIA 4MR8A 4F93B 3A7DA 5FI3A 1KOGA 2ZEJA 1R0SA 2WYHA 4HXEB 4R1NA 2IPMA 3ZXIA 1D4FA 1JLSA 1VL8A 2V0CA 4UOQA 4MWCA 5EPOA 4EKIA 1GSHA 1R8JA 3NDRA 4P31A 3H6HA 4BQPA 1H8HD 2DT5A 4N9QA 3F9IA 3QQPA 1USKA 4YA6A 4OQFA 4YRBA 3GD5A 1C9YA 4IIFA 2YWGA 2BFFA 4QULA 3DV0A 1W87A 1BEUB 2R6ZA 3EA0A 3Q6MA 3DYVA 4LEIA 4CBVA 4CNQA 5KB3A 3OJ0A 1NW8A 1HA3A 4UEJA 1HMYA 4GM1A 3AC0A 4A6PA 5KOJA 3QKSA 2WSBA 2IZ1A 4YMGA 1XKXA 1RRCA 16PKA 3JSAA 4OQ4A 5DISB 4Y1GA 2BHSA 2HYDA 3WMEA 2W2XA 4E1AA 1E1DA 3FPJA 3O0DA 4ESVA 1B73A 3M81A 3PQ8A 1E3EA 1AH2A 3JV7A 4RD4A 4BWYA 3KPJA 4IWNA 2XODA 2A84A 2AQKA 1N9GA 2OK8A 1TTHA 3AIIA 1YZHA 3QG5A 1O4VA 1Y8CA 4KYIB 3F9RA 1J49A 5FI0B 2X77A 3VDNB 5AWFC 1ZI8A 1FVXA 1K08A 5JT1A 4M9CA 4L73A 2XKKA 1DVRA 4HUTA 5H70A 4H08A 3S27A 5IARA 3CEPB 1KBQA 1GAEO 5AVOA 3VYVA 4C4TA 4K9OA 4OJMX 2KJQA 4G41A 4CTOA 1AMOA 2R8RA 1ZG3A 3W5SA 5HOEA 4RTOA 4JYAB 2OZPA 1CY2A 2ZJ3A 4IP0A 4YN3A 5IK2A 4BNGA 2PCJA 2Q6LA 4PG6A 4AX8A 1VC2A 2X5XA 3WKDA 4BVFA 4DBLC 3EXHB 4X1OA 3EWNA 5IAOA 1DKNA 3AVYA 2C9CA 1OHHD 2Q9UA 2J67A 1OB5A 4FYJA 6NULA 3K20A 4WXEA 4QUJA 3M9XA 4K9NA 3ICPA 1RQ7A 1ZJZA 1RD4A 3USZA 4DCPA 1VECA 3EGDA 3AKZA 2IZOA 2NG1A 3MERA 2IEGA 3SF0A 4ETWA 1U80A 2ACKA 2V4ZA 1LV7A 2VUIB 3EQ2A 4E5MA 3N2GB 3QLUC 1YK0A 4GPIB 3UOGA 3EGWA 1ONBA 3BC1A 2ZSBA 3PXUA 3G02A 2R7NA 5HS6A 1HYEA 3RS2A 1XLVA 4TUYB 1XT6A 4H3HB 1PQPA 3BD8A 4C6HA 4AZTA 5A6SA 4GKAA 4DDWA 3WDKA 1E3QA 1QGZA 2XRMA 4CG1A 4IIDA 3U3RA 1RLUA 4KSBA 4Y6LA 1JW9B 3OC0A 1CQZA 1C7FA 1LI5A 2FP4B 3ZVKA 2AJTA 1P9RA 3NBQA 5HS4A 4E7PA 1JXQA 1GZ5A 2GWRA 4MIOA 2I3DA 3B1KA 2VO1A 4GSKA 5B1DA 1I6KA 1TE2A 2JI4A 2W11A 3CSUA 2FW8A 3O9VA 3MD0A 4HX9A 1M1NA 4CM6A 4JV5B 2VN8A 3LC2O 5AVXA 5G4KB 1XDZA 4D4GA 1F7UA 2OYCA 4IOLA 2VF8A 4L5BA 4YI3A 3S2EA 3SJCA 2YZKA 1SVWA 1RHKA 5DHSA 3S1AA 4S05A 1ZESA 4FX5A 1NG1A 5LA6B 3FOFC 1M7BA 1H2RS 3GT4A 5DWVA 2QXUA 4BTVA 2AXQA 1ZGJA 4GVPA 1OWMA 1PO7A 3S8MA 3GJXC 5CYGA 1NT4A 5JR3A 4OKNA 1W2HA 2CUKA 3S99A 3VFDA 1S2IA 2KMLA 1JEYB 1GEEA 3DBHB 4M98A 4A2CA 1HZZC 1IJEA 2ZBRA 1DFHA 3RK4A 2E6UX 1LLDA 3KT0A 2FX3A 1VMEA 3AVXA 3O4HA 3H4IA 5BW6B 4EP1A 1XCGB 2IT1A 3ZZUA 4QPZA 5JIBA 1Z2OX 5JZ9A 2O57A 4RFSB 2D3WA 4XASA 2FUCA 2D2EA 1MX1A 3SZMA 3G0GA 1LQUA 2B7BA 3DR5A 3KR9A 1GNPA 2V7BA 3CJRA 4RH1A 3ZE7A 2W2NA 1QHHB 1TCBA 1XZKA 3FIJA 2IHUA 4Y2RA 2AJ8A 4AKIA 4BNNA 4ECAA 5FORA 1JILA 3R77A 2IW3A 1TO1E 1YH3A 3L79A 1NP6A 2DWUA 2QRUA 3K5PA 4X54A 4H31A 3L7JA 1SPBS 2HQSA 2Z09A 5K0NA 2G7ZA 4CEIB 2O8DB 2WJZB 4IDOA 5KVVA 4HN9A 2VYND 3CX7A 2VOEA 3P94A 4DMUB 3SQWA 1DOAA 3QEOA 3SJZA 1U0GA 4JMLA 4YRNA 1CY4A 3IXQA 5EJFA 1KEEB 1ZUIA 1CJMA 2J6IA 2WFMA 4Y0NA 1EXWA 4I0WB 4L51A 1LH0A 2W5UA 4IRMA 1VA4A 1U7UA 4M9SA 3SZLA 4D97A 4XAQA 2V3VA 3SF8A 5LUAA 4BXOA 1TI7A 4C2AA 4MNTA 4KBGA 3DUFA 1VYHA 1N7IA 2NO6A 1WMBA 2IA5A 2ZSDA 4OOFA 1JSZA 4L76A 4P82A 4RQAA 4EYGA 1NXXA 9GPBA 2I76A 5LOVA 4YAJA 1PG0A 2BF7A 4WESB 3GCWA 4ZO7A 5AR1A 3V4SA 1R0RE 3DVAA 4ZZIA 5CFOA 4KN6A 1FMLA 3L1VA 1I7LA 3PPYA 4MR9A 3RS4A 4CWAA 3LCCA 1NBMA 1QE0A 2WWTA 1V7CA 2NUTB 2VJPA 3OCJA 4N9WA 3U3DA 4HAOA 1P4RA 3GEGA 1Z5PA 4GYYA 4LJ4A 3HUDA 2QX9A 2C78A 1C3OA 3FZGA 2O9JA 4WKOA 4LYHA 3ZWYA 3LY9A 3RFVA 4RORA 3IEVA 4JJFA 1DRKA 2PAFA 4KXFB 4L7VA 4C89A 2X7HA 2B2XA 1SBNE 4WBNF 1XCBA 3CUEF 4IVPA 2GYUA 4I9FA 2WIKA 3CPJB 3DE0X 2JGDA 1DAPA 2ZITA 3HYTA 3IFSA 2QRMA 1NVWQ 2C7VA 3TTWA 5JG7A 4O4HA 4AQDA 4UBKA 2FE4A 2R86A 3OHMA 3ZBPA 1KKLA 4YMHA 4A8JB 2PRSA 2VQ6A 1W4ZA 2HWKA 2EGUA 2RG7A 3AUUA 4KITB 1SXJD 1NXPA 5CBKA 1FTGA 2A4MA 2VDKB 3CWCA 1GAWA 2Z2YA 1F0KA 2NSLA 2OG1A 3JALB 1JU3A 4L27A 4WCFC 1P8AA 2HU5A 3S2IA 5CDTA 1FU8A 2BCGY 4OJKA 1XZAA 4XTRA 3X1MA 3C48A 3IRUA 3QLTA 3BCHA 3LH5A 3OFKA 3QWIA 3CB2A 1VE6A 4PYOA 4HQRA 1JG7A 2E4UA 1ZI9A 2X4GA 1LTQA 3M5WA 4MJ3A 2I2WA 4WDQA 4Z99A 4BP3A 2EHDA 2QM0A 1UC5B 2XYHA 4JP8A 4X20B 4DTIA 3DDNA 4IDAA 5DBHX 3TTUA 4AJHA 1V4VA 4QXPA 3LUFA 4RYLA 5JRZA 5KQPA 2QTRA 1WVGA 4LOAA 5C8YB 5ALIA 2BHRA 1TLFA 1Z0UA 2QTNA 3NANA 4G84A 5IDVA 3K9LA 5BYBA 3UT5A 3OSZA 1Y1TA 3QYJA 3EUWA 5KDLA 1M0WA 2A33A 3DF7A 3RSGA 2QL5A 1E5TA 1RRPA 3ZDRA 4M6WB 1JA9A 2I91A 5CFRA 3K9FC 2DOKA 2F48A 1XNJA 2WUEA 4ENRA 2GNAA 4IMRA 1GOTA 1YE3A 3IMGA 2AW3A 3I9V1 4XA8A 5ALFA 1X87A 5AUPB 1MCZA 1LBSA 2HF8A 1G9SA 2V1XA 4E4TA 3M34A 3C3CA 3IKTA 3VI3B 1B15A 4RY2A 5HFAA 3ZGXA 1X1AA 3NTUA 3V8EA 3I53A 3UWKA 2GBFA 1DFIA 2XXJA 3U44A 3ZBTA 1BA3A 1SOVA 2WU3A 2F3RA 3PUVA 3QX7A 2D00A 2FG7C 4B44A 2BDEA 4YDHB 5IDXA 1KHHA 3OESA 6CHYA 1H4VB 4BIMA 3ZI4A 2I1QA 1Y1SA 3KE9A 1RMTA 2SCUB 4OCZA 4ZCQA 5AHRA 3SZ3A 1SRQA 5AVZA 1GWNA 3DTVB 3HVHA 3QFFA 1CUGA 4LBZA 3MPOA 3PHGA 4JL8A 2R66A 2OY0A 2VHXA 1I1NA 3EPKA 1DU4A 1QG2A 2ODEA 2PUHA 3LVRE 5EGNA 3PTAA 3A1CA 4BU0A 3ESZA 4V0SA 4CCYA 3HSSA 1DEAA 2RHMA 4OMUA 3PWTA 3U9TA 2AG5A 2D54A 2OESA 2QTCA 4LK3A 5IH3A 3UWMA 5KNCD 2GARA 4QRIA 5L7TA 1G8AA 3CF0A 4G67A 1UAGA 2NV0A 4NENB 3CVUA 4IQ4A 2HWWA 3N0RA 4M2LA 3CRW1 1DAHA 3V1MA 4KQFA 1KPIA 1NAHA 2ATCA 1PW5A 2O1XA 2GO7A 3H99A 4PX3A 4RVDA 5K3CA 4F2HA 1MJHA 1QIKA 1Y1QA 4DJJA 5GJCA 1KDTA 3ECAA 3TQOA 4YT2A 2P75A 1RM0A 2DKNA 3DMFA 4BFLA 1ZR2A 2WUDA 3OCVA 2B20A 3U4QB 2FF5A 3VVLA 1UAYA 3EBOA 4HS4A 4LY0A 4NDNE 1D4ZA 3KPUA 4C43A 4OI0A 2D2IA 3U4IA 5IXJA 5KBYA 4TYNA 3OIVA 4WUVA 2Q9BA 3FUWA 2W6PA 4KHZA 4X44A 1DLJA 1EK5A 2O2EA 3OZBA 5IJZA 2IXAA 4IIBA 4MEBA 5DWDA 5FWYB 3OFSA 4M55A 2CUZA 2VJKA 3R3SA 5AKXA 3NKFA 4GYWA 5LNK1 3P7MA 5KPDA 2WV7A 2DQYA 3GVIA 2BFBA 3IESA 1VRVA 1R0WA 2GA9A 1BCRB 3R3UA 1IZ9A 4O6VA 1NJ6A 1HFKA 4MA4A 4NNJA 2PKRA 3KL2A 2ZVDA 3CRVA 1KKMA 2ZW9A 4B34A 5EKDA 2VKTA 1GPKA 4PC3A 1ZKDA 1KYWA 4J3JA 1XXHE 1PGQA 2G1AA 4FFPA 2PZMA 3SC4A 4UEWA 1UDWA 3IP3A 1IDN1 5G3ZA 3OQPA 1HLDA 4KV9A 4EGFA 4D5GA 1TLTA 3ZQKA 1P80A 3IVAA 5JZOA 4QM6A 4ROSA 1Q0UA 4C4RA 1XUOA 3N28A 2R85A 2LWIA 3GUZA 5DFAA 1ORDA 5AM1A 2ENWA 3PC6A 4BCDA 4HAYA 3DL7A 5IJ0A 4OP2A 4ZVLA 3ZGYA 2OD9A 3MTIA 2HV9A 3U62A 5CYFA 2YFQA 4N0DA 2AIRA 3PKIA 1YBHA 4Y2QA 2HMAA 3IRVA 5FL7D 2NXEA 4DDHA 4MB0A 4C20A 5CIQA 1NULA 1S2MA 1W1UA 5IT9A 5JYEA 3TX6A 1VXRA 1DPGA 3HBAA 3LLUA 4IDPA 4HDKA 1BS1A 3R7WB 1TA9A 1E59A 5C9ZA 4U9HS 4TMZA 3H87A 4E5DA 1S2GA 2E21A 3MB5A 2JDID 3IURA 3ND9A 4K81B 5L4SA 1D1SA 2DUJA 3QPBA 4GP6A 2XCOA 3FWYA 2ODAA 4RZ2A 4E6PA 1UINA 3MVEA 1AU9A 1S8OA 2JH9A 2TMGA 1TC1A 2CLOB 2I62A 3C74A 2R8EA 4H7EA 2HXSA 3KU4A 4DCGA 1PL6A 4IV8A 3REOA 1WCIA 3PVZA 4ZAVA 1XBTA 3M3PA 3ROTA 4EPYA 5HIKA 1P81A 1ZEMA 2BFPA 3D6MA 3G3EA 4WL0A 5I7AA 3EZ2A 1CR6A 4EY5A 1ZGZA 2BR5A 1ZN2A 3CZAA 3JZFA 3WC4A 1C3JA 4M0KA 3SKYA 1XG5A 2HTFA 2EOAA 2ZI3A 2PY6A 5AW2A 2XIJA 3IOBA 4LIPD 3RTDA 1BQEA 1IY0A 2R1VA 3H1PA 3L4EA 4R2HA 4PYKA 4RA9B 4Q9KA 3ZY3A 1R6UA 3ELWA 2G70A 1Z7EA 4HD8A 3RS8A 4XB1A 5FPYA 3FUCA 2BV3A 1LLCA 3ID6C 1PKXA 3MJTA 4R9NA 4JLAA 2AFIA 3MAGA 3HM9A 3H5IA 4YRFA 1C1HA 1IXSB 1TD1A 2TRSB 4CT4B 4RHCA 4EUNA 4MR7B 4WADA 3WLAA 1FTYA 2D4AA 3FKSD 3P96A 1BCSA 4NJEA 4EDFA 3QXXA 1C3VA 3UJ9A 2UDPA 5M3BA 5AOAA 3WYDA 4UVHA 2UZAA 3UFXA 1XN4A 4MAFA 2PKEA 3A58B 2O2SA 1IE3A 2ZYAA 4XDGA 2F3TA 1TNDA 1YZUA 4PQEA 4WLFA 2AYYA 5BWCA 1JQJC 2G82A 3Q8WA 4O1IA 5ADUS 1BVHA 2E55A 4WXMA 1G8HA 4FYPA 4IM7A 2G88A 4WE3A 1C9EA 3VH1A 1X8KA 2PXCA 1D8AA 4FGSA 1FFXA 1XZHA 4EVSA 3GLKA 2EL7A 5D5HA 5KJCA 1TJYA 4CEJA 1ZM2A 3AVVA 1OA0A 1ESDA 4REMA 1VIVA 3OTWA 1GKKA 1SZCA 2YOFA 4DFDA 1NV9A 5GONB 3PNLA 5I4IA 2HMSA 3I72A 3K0CC 3L3BA 1U7WA 4RY8A 3EVDA 3QVTA 3SBXA 1QMPA 4PBTA 2AZDA 2GZ1A 3CZ5A 2GRAA 1NA5A 3KLPX 3VO2A 5HKAA 5KHAA 2Y05A 3L9XA 2C77A 5B4VA 1DJPA 3A1VA 2R6CA 1SD1A 2ZIUB 1WS6A 1VLLA 3EVZA 3HQ4O 3ONEA 4KPFC 3CUWA 5IYZA 1BU8A 1Y37A 2IUTA 2X2PA 4R2LA 1M1XB 4E13A 3T7SA 3DC2A 3DYBA 3SLRA 3MWFA 1M5TA 3ZCQA 1U0NA 1VPWA 3PWKA 4C9BA 1KZ1A 4AJ9A 1WD5A 4QBTA 2C8KA 4Q3CA 4RK0A 2X6TA 3NDJA 1BVRA 4IBOA 4MVXA 1WV0A 4JN6B 1MW9X 3PX2A 4I50A 4OAQA 2DETA 1P17A 3HL4A 4RK6A 5AH0A 5A1JA 3AY3A 3PXXA 3TLBA 1ESMA 1C7IA 2KLBA 2PZLA 5DW0A 4N54A 2X42A 5AKKA 2C57A 2DTXA 1X3LA 3NWPA 4V1CB 1B0PA 1L4HA 1TAQA 3GNLA 3EEYA 4DWJA 4L95C 5KO2A 2ODBA 2WWGA 1O1YA 4M83A 2O8NA 3UJ6A 3A2NA 1HDOA 3PENA 4PSAA 4F91B 1WY7A 4G65A 3N8HA 4O8ZA 1M5UA 4ZVPA 5K2MA 2PO5A 3FTPA 5DBEX 2VQFB 5T4EA 2JGJA 4QRHA 3EQ6A 3UGJA 1EFVA 4O25A 3GNQA 2F8LA 2PK3A 1E9RA 2N1BA 2ZI7A 3B7PA 1UJ4A 2C04A 1TJ5A 4KFSA 4MEAA 3HACA 3KZCA 4EVQA 3EULA 1NVMB 2G0TA 2LDBA 5HM6A 1TA0A 2JLXA 4EPTA 1ULSA 1XMSA 2BGKA 1E2PA 2XWPA 3FPCA 3KQVA 1QVWA 3SYRA 4HTFB 2QS9A 2VJMB 1N2ZA 4RQTA 4KUHA 5KJ1A 1HYQA 5KZMB 1S5PA 3IPCA 4RQBA 2W4IA 3L6BA 5REQA 1HKUA 4BWGA 3J81k 2HSJA 4DLRA 5CA1A 4IHJB 3U5ZB 2RHHA 1EQAA 4DJEC 2VWQA 3THRA 1G5TA 1ZU4A 1JFLA 5I6DA 3DE7X 4FT4A 2IU3A 1PS0A 1SC3A 3FDZB 4ZV7A 3OFVA 4FJ0A 3ZHSA 3WNBA 3BWVA 1W4RA 2I6XA 4A16A 5T41A 1JMVA 1XHFA 1DT3A 3D4NA 3W78A 2X13A 4AUMA 4UOZA 3UHOA 3QE3A 3OD5A 2JH8A 3OLVA 4WJLA 4LYYA 5EJ5A 1M2NA 3SJ7A 1ANKA 2B4KA 1DKLA 1T24A 2FSVC 3LCVB 2R8ZA 2RAFA 2XJ9A 3VZPA 3RFCA 4LRTB 1JLLB 1NR1A 3PI7A 3N2IA 4N5HX 4ZYXA 5IXYA 5CCXA 4L9AA 1FS6A 1DC4A 5AM2A 1K2VN 3BH0A 1XKTA 3CWZA 4AN0A 2D13A 1XCLA 5DGDA 2BMDA 3PSHA 5EJ2A 3SC6A 3UAVA 4B80A 1OZFA 1W5AA 5LDGA 3ZS9A 4BU1A 3NHSA 4RMIA 4BNMA 4ARZB 1FVOA 2CEKA 4BV8A 4NCKA 5I3CA 1P39A 4JKOA 1WRBA 1Y63A 5GINE 2CCJA 3CUVA 3HPQA 2EW1A 2GCIA 1UPCA 1RCFA 2GFQA 1PE0A 3IUNA 3UK6A 5E7IA 1XIVA 4AZWA 1M0TA 1FTSA 1HT0A 1V4BA 2O3QA 2IWRA 3A1EA 4D9EA 1BA2A 1VIMA 1L7EA 4M9UA 2GEUA 4WN9B 4YXWA 2AKAB 3MN1A 1IMJA 3JWPA 3RABA 3PGJA 1JRLA 1ZIYA 2IUFA 2WHXA 2JLUA 2HLHA 1D6SA 2EJCA 2ZPTX 4IINA 1SMKA 4BMNA 5CBPA 1R10A 2ZAOA 4ENWA 5FOTA 1E4OA 1O6ZA 2A9QA 2XBLA 3E05A 3D8TA 4R71A 1JR3D 2G0NA 4XWOA 5BRJA 3L01A 3UC5A 3U7FB 4GZ6A 4LJLA 3C3EA 2I4TA 3L49A 4HH3C 3DP9A 2QD3A 1QVVA 3BB3A 5AKYA 3UGKA 5EZSA 1MAAA 4JP3A 5ELXA 2TYSB 3K1JA 2Q5QA 4QTZA 2RKBA 2QGZA 4CZ2A 2YIDA 2B98A 2FFAA 2IZZA 1PS8A 3Q40A 4KE6A 4TQUS 3B5IA 3P2EA 3ZS8A 1O2DA 3DOIA 4XJSA 5HYVA 1HZJA 5A5GA 1PR5A 3CYFA 5JQGA 1CRLA 1KI9A 4M22A 2ODPA 3GA7A 3GGJA 4YLEA 1W88B 2ECPA 3NO4A 1GPH1 1FBTA 1T6XA 4COKA 2PYIA 2J0QA 5DLPA 4GP7A 1BFUA 1Z37A 2YFHA 3NEJA 3MCAA 2WOJA 5KOIA 1Y6QA 2OQ2A 3JATA 4E6EA 1Z56C 1Z34A 1TKRA 2B35A 3P0RA 4AKEA 4BJ3A 4QQRA 1P2TA 1QK4A 1D07A 2K7FA 3UCXA 2QTGA 2QBYB 4DIFA 2IHBA 4FN4A 3KK0A 3PJDA 4KVZA 3Q3IA 1RWKA 1JDPA 3R6LA 5JI3E 3K9GA 4GZ3A 2HW8A 4EAQA 3RFXA 4I2NA 4PLZA 1IYZA 1RLTA 5KYUB 4EX7A 3GRRA 3OKAA 4JI3B 1NUSA 4LHZA 5FNVB 1NAIA 3DONA 4F2PA 2VDLB 1DEKA 3OBIA 3E3NA 4EBBA 2PFKA 2JK1A 1MC8A 3LZCA 4L4YA 4S1PA 2X1HA 4J43A 1R27A 4JYCA 3TL3A 4YCNA 5FV7A 5H4HA 3H5OA 2OCYC 3AIOA 3CKLA 4G56A 1E9DA 3OQ6A 3RYHB 1KERA 1XMXA 2H0QA 1UT6A 7ADHA 3W3ZB 1TEVA 4WRRA 1WA5A 2GK3A 3KT3A 4LHXA 3QELA 1TJ3A 1ZXXA 1LW7A 4FHFA 3UJBA 4C21A 2IELA 3M6UA 3G0CA 2O50A 3EJWA 4U0KA 4X64B 4KAJA 2C8JA 3AEXA 1PJ3A 3KR2A 1DQRA 2C3OA 2X22A 4JLNA 2ZBQA 1VHLA 3NAMA 4J4HA 1H5QA 1UK8A 2PH3A 1DZ3A 5CAEB 3I8XA 1GGKA 3HKDA 3E35A 3OFJA 3K9HA 1SXPA 1EZ1A 1G3QA 3FIUA 1AZLA 4I3FA 4KMMA 4EYQA 4K87A 3L8CA 1BFDA 3GFFA 4U9IS 5ADHA 5DMXA 4QUAA 4O2BB 1VL5A 5IM4A 1SZPA 1ZOIA 4EH1A 5TGDA 4MYUA 2V5VA 3SFZA 4BO1A 4PLHA 2IY8A 3F96A 3TBKA 3IILA 1RAEA 1JSXA 1JQAA 1MENA 1P3JA 4EF6A 1WXXA 1L3BA 1GNVA 2V59A 2V4UA 2PO7A 4U2CA 4UZEA 2F64A 4CUZA 3A10A 4LXQA 1WULS 4DRXA 4NKRA 4YT5A 3A9WA 2C5AA 3HA7A 1T1EA 2PL1A 3C14C 5F2NA 3C3XA 1JPNA 3ILXA 4UQOA 3T3NA 3Q2KA 3BFKA 3EK2A 3ND8A 2C84A 4XFJA 2G67A 4FM9A 3H97A 2PEYA 3GZNB 4MV6A 3QQ5A 1HXHA 1ICEA 1V3QE 5HP4A 2P8JA 2Z1NA 3ZJVA 2X6RA 3I2HA 3W7BA 4D2IA 1N8KA 4EB6A 5BSGA 2CUNA 5IX8A 4QBFA 2ZBDA 1Z07A 3FUTA 5D6NA 1N36B 4ZANA 1AMNA 2BE9A 4IY1A 3WMWA 1G5QA 3MTBA 4D9JA 1FRFS 4R7GA 1EFPB 1B8NA 1C1YA 3FOWA 4QDKA 3WGIA 1FXSA 1ZIXA 5TE9A 2DQKA 2OYRA 3DM5A 4ZQFA 1UBUS 1SOAA 1K8YB 4INOA 1I10A 2HMTA 2MHCA 3MMXA 3U7JA 1BW9B 3ZJ4A 4DT1B 4YUWA 2ZAGA 2WICA 1PJCA 2SECE 1MAUA 3N6XA 3ODGA 4ADSG 3D6UA 1YJ5A 2Q1TA 4IL5A 4GQAA 4IHKA 2VDQB 5GZ3A 4DTCA 3ILYA 4WCVA 2I9KA 4KXQA 1YQDA 2VA9A 1KIFA 4RA6B 4FQ7A 1NY5A 2X7JA 5F2OA 3BCUA 5TPZA 3ORSA 3CQ9A 1JGTA 4YP9A 1ML4A 2ZUUA 2EBHX 3AMVA 3H5VA 4EB0A 5JAPA 4H18A 5JFOA 5LZ9A 5HRUA 3OFND 1LTHR 3DXYA 1RBYA 1KL7A 2NO1A 1SN7A 3FYSA 2EHJA 3FZNA 3TXXA 3VYWA 3TIXB 1HYHA 1ICIA 2DPYA 2HA7A 2KHZA 1Y1RA 2R1TA 3V3KA 3GVPA 3UK2A 4OHFA 2HU7A 4MLCA 5AJWA 3TZ6A 2X0KA 3HDVA 2D0DA 4IMJB 3D81A 3TSWA 2DLCX 3KR1A 3WHIA 3KOZA 5SZIA 1M8GA 2IP1A 3IP6A 4OKIA 1RRGA 1I0ZA 4IS3A 2VSXA 5FOVA 3JQEA 2HT1A 3T7KA 4GX2A 4A6EA 2FUG1 3C41J 2Z3ZA 2VJLA 2WZDA 3ET4A 3NG1A 4OF4A 4DR3B 4HXYA 1EU1A 1LPSA 1NVAA 3OUUA 5EYPA 4DCOA 4ZCTA 4Z53A 2PLRA 4NULA 2XCIA 2Y8EA 1XPRA 3KOWA 1ABFA 1JXAA 3OUTA 1XAGA 3KLNA 4RULA 1EVEA 2XQIA 1I4LD 3LQ1A 4G1UC 1LC3A 1JVSA 1XVVA 2TMKA 1R9MA 4QNMA 4I4CA 2LCQA 1L1FA 3G2NA 1SIWA 1SIOA 2BKVA 2VYQA 3SDSA 2GWHA 2UAGA 4KGDA 2WAXA 4P3PA 3IMCA 3T5AA 2Q5HA 3K6SB 3AHHA 4P0QB 4R4JA 4EQZA 5DNYB 1KTVA 1U2SA 4HV4A 3OZ7A 1HFWA 2HRQA 5IHPA 3DTNA 3OZFA 1KMHB 1QWOA 4IKOA 2BKEA 2J3LA 5EJAA 3X1DA 5LIPA 2GLUA 4B3GA 3WL3A 2X0DA 1DTEA 3K92A 3IERA 1QHGA 4GI7A 1WR8A 4IDDA 2JFUA 3KHKA 1R5BA 3F5MA 1K0FA 1QYXA 4K0KB 2HHJA 3JQAD 4YDRA 3U4CA 3ZZ1A 2WABA 3CLKA 5NLLA 5ILOA 5HTOA 1M8JA 2IBMA 2JGMA 1R6BX 3VYUB 4N39A 3GH1A 2X4LA 2W4QA 4WZBE 4FBGA 5CJJA 3FNIA 2P77A 4JR0A 4RTLA 2DWOA 1O7JA 3IQEA 2GGSA 2GN8A 2NVUA 3UICA 2RGXA 3GEDA 4CKZA 2PU7A 1NKVA 1B74A 1DG9A 1SULA 3R3WA 1FP2A 3H18A 4KAXA 1ZCZA 2ST1A 2Z6VA 1AOXA 2G83A 1BDIA 3OLCX 1XFAA 1NC1A 3URKA 3HYSA 4I5FA 1J9ZA 2ZUWA 5ENZA 3AIMA 1NZJA 1QHYA 1NOJA 2XOKA 4FSXA 1A8UA 1ZN9A 3NUQA 4LVUA 3R0JA 4LGMA 3HP7A 5TMDA 2WVHA 4JJKA 5J4VA 1YDFA 2Q3JA 2R44A 1U90A 3ENKA 3TQRA 2IQIA 1TEHA 2GCOA 4UATA 4EUFA 1VJ1A 4GKJB 1C4OA 1DUVG 1IG3A 1SUEA 1WMAA 3REGA 1Y9EA 4FQ8A 3WK7A 1PGJA 2AI1A 1SQ6A 1OZHA 2O14A 1CSEE 1ZITA 3N3BC 1FBNA 4Q1FA 4QGHA 4IDHA 3RG8A 4Z7OB 4TSFA 4UTXA 3O6VA 5JNLA 1TVEA 2V9CA 3PKZA 4Q3NA 1NU8A 2G9ZA 3EY4A 3U16A 4JSYA 1QH1A 2UZ0A 2J85A 4B8ZA 3B2QA 3EAGA 2XTNA 4QAJA 6LDHA 2RFLA 5BSWA 1KO8A 2BZ0A 3ZWDA 1MO6A 2ZIZA 3CLTD 1Y8ZA 4YRZA 1V7ZA 3KTOA 3LX5A 4C01A 3PR1A 3K70D 2IDKA 4OHBA 2BEVA 3V4VB 4CQMB 4NECA 4U7DA 1N6HA 4MI6A 1TDJA 1OX6A 1NPDA 1TMKA 1VLHA 3EUFA 3LWNA 2NSHA 1UZLA 4HGOA 4ZT2A 2IHKA 4BEVA 2HMUA 5I9IA 3RVOA 1AXRA 2IYOA 1XDDA 1ZD5A 2I8CA 3AF5A 4HNGA 4D3ZA 2NVOA 1Y3AA 3HVKA 3D0RA 3H1GA 3G23A 3PDIB 3DDSA 4ZCMA 1SK9A 1CZLA 2E89A 1CR2A 3O94A 5EQDA 1Z0DA 1XMPA 5DHRA 2I66A 2P9CA 2WKRA 3LUGA 3VR2A 1MZVA 2A1TR 3FOCA 3PSAA 1KE1A 1TYZA 2Y6UA 2ZGVA 4PO3X 4IDEA 4UHFA 4Y2UA 1SQ5A 4A4DA 3RS0A 3OA0A 4L8YA 3C8DA 3K9WA 4Y18A 3ZQ6A 5KNDD 5ER6A 1QH8B 1V1RA 1I2ZA 1NRWA 4URVR 2D1FA 3NEPX 4LXIA 5LQKA 3KSUA 2MSLA 3DFUA 3I52A 2JCSA 4G9GA 4IFEA 1KS9A 5J5CA 5EIBD 1U2QA 1B6GA 2A94A 3LKDA 5A4FS 5KTNA 5IG2A 4DMMA 5IWCA 4EKNB 3JRWA 1AO3A 2HXGA 1YL6A 1XK6A 2YV5A 1EESA 1OI2A 2D5IA 3NB0A 3ZX5A 2NW6A 3BL5A 3Q7EA 1L5QA 3L0IB 2ASVA 1YZLA 2FSPA 2GJSA 1DTWA 1NBOA 4LRWA 3PX7A 4C0JA 4D42A 2D7CA 1P9NA 1L7QA 3GRVA 1C3LA 1CZUA 1MG5A 4C7MA 3ADCA 2E9SA 4YH1A 3Q12A 3U4DA 3ZLTA 2JJ2A 1P0FA 4FNMA 4IZHA 4DEXA 5CPFA 5FEUA 1C0LA 2B8NA 4DIKA 1FTQA 1W6RA 2VWPA 2YL2A 5CK5A 5IABA 4GG1A 2BMEA 3ZNQA 1W47A 5BMVB 5E8JA 2GCPA 4ID9A 4LRUA 2VXBA 3NHZA 4K26A 1ZVVA 4RCVA 1NQTA 1QV7A 2HV8A 2ABWA 2LD4A 3IJPA 3JVEA 3OZSA 5AJYA 3V7FA 3QNMA 1R88A 1Q14A 4ZAZA 4XIGS 2XPCA 1H05A 3MJHA 4RMJA 3PA6A 3LQFA 4RVNA 2BDUA 3JQ8A 5DI9A 4F4UA 3KJIA 3OZXA 3AOGA 1LDYA 1YZYA 5EMKA 2Q1WA 5KJ6A 2C8LA 1EP2B 4D3YA 3C3WA 2NU8B 3G8YA 3L8GA 1W0JA 5DZSA 3L8ZA 2FEXA 4WY2A 4OUKX 3UOAB 1PF7E 3BMCB 1JFFA 1BOOA 4GMKA 4AG6A 4QGGA 2XHEA 4MUAA 4D81A 1VJTA 2EGHA 3ABOB 5ELMA 3ETDA 3WNCA 4EHJA 1S8NA 1KPHA 3M2PA 2UZ1A 1RFLA 1T9GR 1CZHA 4FZ3A 3U3ZA 3CZ4A 1NHGA 5BV0A 1MA3A 3B82A 2ZI4A 4J1TC 4UHCA 3V8RA 1B23P 4O2RA 4ZVSA 3SKXA 1LVUA 3NYRA 4LY9A 4LF4B 4YECA 1HGXA 1XQVA 4TTTS 4P3KA 1US8B 1NQOA 3LPMA 1G16A 4RK5A 4F8EA 1X2BA 1UDCA 4R8LA 2O8EA 1YS7A 4GLOA 4BHTA 2OHHA 2PV0A 4K3VA 4ZI3A 5IT0A 2EX1A 3IIIA 2XA2A 3IJRA 5AP9A 3B78A 1BTOA 2UVPA 3HU3A 4WLEA 4F3TA 4HLNA 1BXKA 4B0PA 1F6WA 3TECE 3C1OA 5FL7A 3SHFA 3H3FA 4XPIB 4BBAA 2FUEA 1QJ4A 3KLOA 3CZRA 1K8XB 1EK2A 2QVBA 2GTHA 1T2FA 5JBQA 2N46A 4GM4A 1XRMA 3TG2A 2Y0DA 5LP6C 5IT5A 4YO8A 3TEJA 2V97A 4XVHA 2P4HX 4LOHA 5DTEA 1OFIA 2CLCX 1K9VF 3GMDA 5HZGA 2YXNA 1BROA 2EFJA 1A5SB 4PX9A 1CU1A 5J4HA 2XUKA 2QQEA 1NUTA 3BE4A 3NV9A 1NNEA 2GVDC 4YAGA 2VZ9A 2I6SA 2FPWA 2B99A 2OXRA 3HRHA 3MQ4A 4P5PA 4TQAA 2PT9A 3OJCA 3QXJA 4LN1A 1XPOA 2HHHB 4TGLA 1EWTA 1BN7A 1RPNA 3QG1A 1JYSA 3WTBA 4BASA 1E9EA 3B6ZA 2B1GA 2ZSIA 3LC1O 4RVOA 4EMBA 4U39A 3D0QA 1NVVR 3ANMA 4NLLA 4YPVA 4ML3A 4K0RA 3EEIA 4XQ0A 4BNTA 4F4DA 1R16A 1B76A 4MPTA 5AVKA 3CN7A 3TTXA 1E4EA 3DZBA 4MPPA 3ZTYA 1FYVA 1T2NA 2YXLA 2R87A 4L28A 5JSHA 1L1EA 2CLEB 1MRZA 2F1JA 3DBOB 4XWYA 3BFJA 3BDIA 2RAUA 4J91A 2UZIR 4RIGA 1EHCA 4NMHA 3STWA 4J0IA 3LD9A 5ILQA 2VR1A 3U48A 1DBIA 4QX6A 2EWWA 2QUIA 4MX8A 4AF6A 4XIYA 1HLPA 1PZNA 4XRRA 3Q1LA 4E2FA 2QNRA 3BHIA 1V5WA 3PRKE 1U7HA 2P6UA 4NYIR 4CYMA 3ZK9A 1G55A 3R6DA 5L7WA 1BGWA 2CFRA 4D44A 5JSZB 4MS1B 3IE1A 2KBFA 2VF4X 5DNEA 4LVCA 3GFSA 4CKCA 1W5FA 2W93A 3TVYA 1KEWA 3SSAA 3A4NA 1D2CA 4N3NA 4D57A 3VHXA 2PSHA 2I67A 3IL2A 1OIWA 3LW7A 4FCWA 4HJXA 4IKEA 5CXSA 4ZEWA 3EGVA 2XQJA 4TKVA 1I5EA 3I64A 4AO6A 5KVCA 2IYAA 4HSEA 4OXYA 1T2DA 3TL2A 2WMDA 4GOJA 3JAWB 4H4DA 2G1UA 3L8DA 1M83A 2PZKA 2ZVQX 3ACBA 2CFOA 2FB9A 3JQ9A 1KQFA 1GTSA 4K6GA 5IFKA 2Q50A 1NW6A 2BP7B 4BNDB 2BPOA 3NHWA 3ILSA 3KPWA 3MJFA 4P2BA 1RLIA 1N9ZA 3WE7A 4B76A 1B3RA 1URPA 2OD2A 2VF7A 4GPZA 4TLEA 5JMPA 5IJAA 4CT0A 4MVJA 1B0AA 5CITA 1RABA 4Z9XA 3NHAA 2CNKA 4CL3A 5LDHA 1Z6GA 3H4MA 4NHOA 3K1TA 4J0EA 1ZQ9A 4UUNA 4B4DA 2FE1A 1C30B 3FR7A 3HZHA 3LXXA 5JPCA 5AW4A 4OHVA 3BPSA 3ZWQA 3EGCA 2Q0HA 3HHPA 4GPBA 3EARA 4UVEA 4XXHA 3UM9A 1YR7A 3OEED 3WJ7A 4IGKA 1JIUA 5G41A 2PUGA 1C1XB 3UJDA 5FDFA 1WQ3A 4MW6A 2WJJA 5ESRA 5ADVA 2HJGA 1N2CE 3H65A 3KUCA 2BEJA 4S12A 1QQTA 1N7HA 1TM7E 3M0EA 1M6VB 1QK5A 3QF4A 3DE3X 1FFSA 4RJTA 2UYYA 3HVIA 2ZRMA 3TLYA 2PYZA 1EFHA 2WNSA 4Z4HA 3YASA 5DBIA 2W6IA 2ZRNA 1I13A 4CDNA 3A1TA 1JEQA 3L84A 2PV7A 2GAAA 2DMRA 1FL9A 4Q1DA 4F38A 4DUGA 2BZSA 2WF6A 4G1CA 3ETCA 3SFVA 4ZT7A 3ZIUA 4A36A 4G4GA 5G1OA 4IDNA 5AVRA 1QGYA 1Z12A 4DCJA 5HG0A 3L7BA 5B53A 1F2TA 5EE9A 4BPBA 2D59A 2VJQA 2OD7A 3H1FA 5CX1A 5LD2C 4NS1A 3MA0A 1CS4C 4V3BA 1W5TA 2NXCA 1V5FA 2I80A 2GD1O 2ZBPA 1FB5A 1EM8A 2BN4A 3I8OA 3PWSA 5G4LA 3ZWOA 2DEUA 4A0SA 2PX6A 2XSZA 1ZM7A 2H1VA 3DB2A 2V7PA 3QLEA 1RJGA 2PUEA 1L1QA 4MYHA 2VWHA 5EA2A 2C5BA 1N2EA 1NTOA 2QNBA 3O3NB 4G89A 1L5ZA 4IICA 1YE5A 4R2XA 3RAJA 2NP6A 3E9EA 1A3CA 1U3DA 3N53A 4HBZA 5HDQA 1SWWA 4FDLA 4FFWA 5C0OE 4JI8B 1Q22A 2OO5C 4ZYUA 3H5WA 1ULUA 4PCUA 2DFPA 4CN8A 4F84A 1N5LA 2AG1A 5DXFA 3TDKA 1JKIA 2OBYA 2DLDA 3LE8A 3RODA 2H5LA 3KXLA 5CDGA 3D1JA 1K9SA 1SCIA 4LTMA 3Q2OA 5B2ZA 4R1UA 1RE0A 1EX6A 1SELA 4MR8B 2GKGA 2VHJA 1HOXA 3KPVA 4EY7A 1CY0A 2G77B 1GT6A 2C58A 2VWGA 4MYCA 3HA3A 1TB4A 5CUQA 4PINA 3T3HA 3TOVA 8ADHA 5F1PA 1S3IA 3T3OA 1TTQB 5FPHA 1X14A 2ZK7A 1B2LA 1UQTA 3IALA 4RSHA 5HF6A 3WIDA 3UCEA 4D98A 5K0BA 3V32A 4KPEC 1SVSA 10MHA 2CLIB 4ATNA 1O3YA 2BBTA 5LN1A 1NX6A 4WKCA 2BFFB 2VH5R 4HB3A 4ZC1A 5L3QB 2OP1A 1L4YA 3CGGA 3I5MA 3QU5A 4ZT6A 3AJAA 4DQKA 2Y9PB 3NHYA 2BFEA 5LKAA 3RFTA 3PIDA 4JGIA 2NUAA 2R7AA 3GN2A 3FOEC 2HFJA 1CJTC 2FUNB 5FO1A 1ESEA 2G9VA 2HIAA 2AV6A 2Y1OA 4GEKA 5DTMA 3RH0A 2RB5A 4X84A 1YGPA 5B2EA 5A05A 2J7KA 1KAQA 2IE8A 3SQNA 3FFTA 1WUJS 1Y6RA 2BKAA 3T94A 3CUUA 3K30A 4OUDA 3PEYA 4A5OA 2ZFUA 1T8RA 1XKQA 2JBAA 1MFPA 2MDTA 1GARA 4YNBA 3UMCA 5E6UA 3B2NA 1XMVA 1RPJA 3NM5A 3DG9A 1EZZA 2MYTA 1N9GB 1Q1QA 3T41A 5JVDA 4P6VF 5CRIA 5M2QA 1IEVA 3BVPA 2G6TA 1N0IA 1PI3A 1W0CA 3FGPA 2XI4A 4DV5B 1U6JA 3T7IA 4KACA 5JECA 3BEOA 4B5KA 4TMYA 3HBLA 5H80A 2H1IA 2CV0A 3BA6A 4PY2A 1S02A 3OOSA 1QRTA 3OE1A 1RE1A 5BSMA 4C7OA 3I42A 1DRUA 4EYEA 3DXFA 5A3QA 1QJCA 1U8XX 3B38A 1D2HA 4R6XA 3WZ2A 4E09A 3TM4A 2EZ8A 2W2PA 3NW9A 1WW8A 4QU8A 5GVRA 3V4RA 3T1NA 5CVCA 3IDQA 4OJYA 4RWZA 1L8QA 1U2RA 4BWVA 5LMNB 1U1DA 2PX4A 3HJBA 2O54A 2P9BA 1FDIA 2WTUA 4EARA 3TGLA 1OAAA 3HYCA 1P0QA 1U0SY 1OWOA 4DM4A 4D0GA 3ANYB 1B16A 4R7TA 5DDIP 1LSUA 1DXOA 1OCEA 3GEPA 3HZZA 3HA2A 3KHUA 1BDHA 1KBOA 1ZDMA 3LZ6A 2AG6A 3L07A 4JITA 3E0XA 2X0IA 5JUWA 4ZVKA 4F3CA 3LM8A 3UKDA 2XUIA 5E8RA 3QIVA 4LZZA 2FFQA 4AJIA 3AL0C 3PUYA 1QUFA 4B9EA 2IZ5A 1T1JA 3NC4A 5A5VA 1EEHA 2XQKA 3OY7A 3WHKA 1NDQA 4YAKA 1T9AA 4PYLA 2YNMA 2YHIA 5A6SB 4JYPA 2B69A 2GZAA 2POCA 5G0SA 1E1KA 2FRDC 3ZZTA 1LSSA 4ND2A 2XNHA 5EMNA 2QRKA 3EMDA 1RCUA 1OFUA 2XECA 1P1HA 1BWSA 2GDZA 2EIHA 4BKRA 2PFGA 3Q8XB 4BMZA 3M89A 4KXMA 2GD6A 1PP4A 3EZGA 3K15A 2PL3A 4MW0A 4S2UA 2EFDB 1XYVA 2QZ4A 4E3WA 4G0ZA 3S1SA 3T52A 1U1GA 2W6NA 2WE8A 3NYWA 4I6EA 2FR8A 4HJRA 1UKEA 4TVSA 1QPZA 4RF3A 2I2BA 2WD7B 1JEAA 1G4HA 2ZLBA 3LT5A 3MT8A 5AKIA 1M1NB 1YDMA 2FUKA 1RPAA 3CM0A 4YMUA 2OV4A 3CF4A 2HK8A 1JDBB 3CZPA 3AESA 5K3BA 3ZU5A 1ATIA 1EWYA 5AI0A 2DFKB 2GBLC 3S1AB 1JXOA 1Q1EA 4IILA 4M46A 4Z4IA 5B5SA 5ES4B 3JAMA 2MINA 4ZZ1A 3A1UA 1VMDA 4BVEA 4YJ3B 5FLKA 3TZEA 4HNAB 4DLNA 2QM8A 3ZHZA 1ZSNA 3HBJA 1F3OA 3IQGX 2XDYA 3CVVA 1W9HA 4D99A 5IANA 1HQKA 3E5HA 1VPDA 4ZVUA 1S1MA 3GCGA 4ZDKA 3K72B 3QKIA 3ZEAA 3LYLA 3SKVA 2A5FA 3FSEA 4RE6A 5DI3B 5DHFA 5C5DA 1XWFA 2CT8A 3PJGA 1P9OA 1Q5PA 3CEJA 4CF3A 1QIHA 5IVPA 1U98A 1Z29A 4JZYA 3AUAA 5BSKA 3NEYA 121PA 2FRVA 3DHYA 4RTPA 4AO8A 3V8MA 4GR4A 2ZUCA 1BE6A 1Z62A 3WWOA 1E2QA 6ADHA 2VRCD 4DPLA 3ZU3A 2VAVA 4GWKA 3RW9A 3KRTA 1YS9A 5FOQA 1W49A 1ZVKA 1WDWB 4KIUA 1ENZA 4L6IA 4M9XA 4R1MA 4UZFA 3GPDG 3V1TC 3T5PA 2O6HA 1YUBA 3JARA 3WADA 4DHEA 1YKFA 2PZGA 2VIIA 3RVJA 2C3YA 3SF8B 3E8XA 3T7TA 3IAS6 2FEPA 2I2AA 2B4TO 3JWEA 3DUFB 1TIPA 2Q21A 3QYPA 1L2TA 3HEAA 2PGIA 4OHMA 4B46A 4ISCA 4AVYA 2IDZA 5G0UA 4HF7A 2QD4A 2ZDGA 4UARA 4MP8A 4KWCA 1XTUA 1NUPA 2P65A 4PAOA 3DVAB 2JGLA 2PVSA 2XCLA 2GF0A 3OY2A 3HLYA 4QDOA 2R2AA 1JR3E 3JVIA 4HWPA 2E48A 4HDNB 4NAUA 3RASA 4N6GA 4GL4A 4LYEA 1PWHA 2BWJA 3OJOA 4KWTA 4OBBA 1F60A 3C6KA 1C3OB 4CKYA 4IEFB 2GEBA 1GCIA 4HAZA 1CJKC 4N7RA 2WSMA 2CNLA 3GVXA 2FN8A 4UE3S 5LP6F 4MPRA 2AE1A 4WK4B 2PXXA 521PA 1Z2DA 4V39A 1P2UA 1B93A 4MS3B 3W5JA 3QWFA 1O9BA 3EDCA 3L8FA 2Z5FA 5EJ7A 4MHOA 4OYRA 4ZQIA 4MRSA 4ZOCA 2JGDB 2CW5A 3MC1A 4YR7A 1R6TA 5C80A 4EZBA 2ZSKA 4O4HB 1WXIA 3BRWD 4EHAA 3CEAA 2CJPA 4Q21A 4NU5A 1M2JA 3R8XA 1P74A 3NOOA 1ZUNA 2YWCA 4KXUA 4Q9DA 3DDUA 2DFLA 3GGCA 5F77A 3Q1KA 2XGJA 1DHRA 3REFA 2EBUA 4M9ZA 3D5EA 1E2UA 2EZ9A 1JX6A 1IPEA 3RO7A 1CBUA 1YRLA 3VSEA 5K3SA 1OLXA 4YP1A 4EA9A 3OBBA 3G8BA 4DLKA 2ZE7A 1XFDA 5I9SA 1PDVA 1TQ6A 2BEKA 1UM8A 1LNSA 1W4AA 3FZEA 5J23A 1IB0A 4O8CA 3DBLA 1LPNA 2KB0A 2CNNA 2NTJA 4L4RA 4E5SA 1BNCA 1LK7A 2BGLA 4LZWA 2F17A 3AJEA 1M8KA 2J9GA 5ECDA 3IDZA 2QG6A 2QR2A 4H3KB 5AVVA 3TD6A 4YJ2F 4BO3A 4U7PB 4BJ5A 2O1EA 3RARA 2L0XA 4NZZA 2I87A 4G5FA 2AG8A 4LMRA 3UT5B 2C82A 3W79A 4YMIA 5FLEX 5HKBA 3UTDA 3GLIE 1U3VA 1RXUA 4AY5A 4CM5A 1CE8B 3RYCA 2HRDA 2QVCA 5LJLA 2FGKA 3O7MA 1NVTA 3ZE2B 2BLNA 3QGMA 1R9NA 2J4CA 1UWVA 3G9QA 4IFTA 4RC9A 3SHWA 3AFHA 5JTTA 3GRYA 4XDHA 2YR0A 1C7RA 4KQMA 2XADA 3CT4A 4LY6A 5TV2A 4C4ZA 2Y66A 4A91A 2AMJA 2VHYA 4N8EA 2VNKA 3H9UA 3DW1X 3RNLA 1FU4A 5CVTA 1K3UB 1YS2X 5K9ZA 4EABA 1ZUHA 2EG5A 2GT1A 4E03A 4YIHA 5L51A 4DB4A 4BNIA 4D8UA 5C2JB 3U44B 3FXAA 1HTTA 3HY4A 4GMHA 3W2IA 4J6EA 1E6UA 1XXHA 3OM8A 4HWRA 4ITVA 4ZK2A 2UUCB 4ZEXA 3JQRA 1QS0A 2QTVB 2CNWA 3EZNA 3P26A 2FETA 3F3YA 3P9XA 1KA9H 3INRA 3ROPA 3MBIA 2WNHA 3RWBA 4FKBA 2NT4A 3PEUA 4G85A 3G9UA 4IX1A 5ARCA 2D74A 4POOA 1JQ5A 3AF0A 4FZVA 1MN6A 1PFVA 3EQ7A 4M86A 4DCVA 1R0ZA 4HI0E 4BNKA 4EG7A 4ZI7F 5I9LA 4ZC8A 1KU0A 3UT6A 3BS4A 5HOQA 5K8TA 1S2LA 4UAUA 1YO6A 1KO7A 3WLPA 4NP6A 3ES9A 2YIJA 3JZMA 4R8VA 5DYIA 2WA1A 4RGBA 2PS3A 2Y1GA 2GI4A 4AMZA 1SCUA 1P31A 2LP4Y 2I2DA 3AEUB 1VLMA 3IR6A 5AHOA 4B2IA 3ZWMA 2WWYA 2R97A 2YOHA 2PKXA 4E2ZA 2OHXA 4O2AF 2RGYA 1IAVA 2ZUBA 3LLMA 4H27A 4N0PA 2PWPA 2JD1A 5FBLB 2ZE6A 2VNJA 4G07A 4UOEA 5A2GA 3L5KA 1YQEA 5F1KA 4PAWA 4O4IA 2BJVA 4PTLA 1W1WA 3K4PA 4YJHA 3TXYA 1SXHA 1V8ZA 1X92A 4N3AA 4NBW