3TI9A

Crystal structure of the basic protease bprb from the ovine footrot pathogen, dichelobacter nodosus
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
341
structure length
341
Chain Sequence
b'APNDPSYRQQWHYFSNYGVKADKVWDRGFTGQGVVVSVVDTGILDHVDLNGNMLPGYDFISSAPKARDGDQRDNNPADEGDWFDNWDCGGYPDPRREKRFSTWHGSHVAGTIAAVTNNGVGVAGVAYGAKVIPVRVLGKCGGYDSDITDGMYWSAGGHIDGVPDNQNPAQVINMSLGGDGDCSQSSQRIIDKTTNLGALIVIAAGNENQDASRTWPSSCNNVLSVGATTPKGKRAPFSNYGARVHLAAPGTNILSTIDVGQAGPVRSSYGMKAGTSMAAPHVSGVAALVISAANSIGKTLTPSELSDILVRTTSRFNGRLDRGLGSGIVDANAAVNAVLGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease
publication title S1 Pocket of a Bacterially Derived Subtilisin-like Protease Underpins Effective Tissue Destruction.
pubmed doi rcsb
source organism Dichelobacter nodosus
molecule tags Hydrolase
total genus 125
structure length 341
sequence length 341
ec nomenclature
pdb deposition date 2011-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3ti9A00
3VSBA 1JEAA 3DWEX 2X8JA 1KDYA 2DQKA 4K8RB 2DP4E 2ID4A 1Y3DE 3DE3X 1YU6A 1SN7A 4NE7A 1TM4E 3OSZA 1THMA 1DBIA 1C9JA 1BE8A 1GA6A 3QTLA 4Z2AA 4KG7A 1WMEA 1WVMA 4OMDA 5JXIA 2P4EA 4HVLA 1AQNA 4ZOQI 3ZXYA 3WHIA 2Z30A 1Y33E 1SBTA 5ARDA 1TM5E 3VV2A 4HX2A 1PEKE 5ARCA 2GKOA 2Z57A 1AF4A 1V5IA 5JXHA 1SIBE 2IY9A 1C3LA 3AJ9A 4DZTA 1KE2A 1BFKA 1LW6E 1BE6A 1TMGE 3AFGA 2HD4A 5JXJA 4H6VA 1WMDA 1PTKA 1HT3A 2PYZA 1Y48E 5AQEA 1A2QA 3GT3A 2SNIE 3H42B 2IXTA 4GI3A 2X8JB 3WQBA 3ZXXA 1S01A 3EDYA 3CO0S 2HPZA 2G4VA 4J94A 2Z2YA 2WUVA 4LVNA 1BFUA 2W2MA 4DWWA 3TECE 5AVJA 1TM7E 2PQ2A 3SQOA 3F49S 3BPSA 3P5BA 1TECE 1T1EA 1Y34E 3DE7X 3DVSX 1T1IA 3HJRA 3TI7A 1TK2A 2PRKA 3QMPA 1UBNA 2PMWB 2B6NA 1BJRE 1Y3FE 1AK9A 4JP8A 1AU9A 1MEEA 4C3UA 1TM1E 3VYVA 4WOCA 3AJ8A 1SUEA 2XTJA 2QTWB 1CNMA 2V8BA 1XF1A 1OYOA 1AVTA 4FONA 3L1KA 1SIUA 1NLUA 4CFZA 2WUWE 1Q5PA 2DUJA 2PWBA 3QFHA 2SBTA 3DW1X 2Z2ZA 1ZVJA 3D43A 3DE4X 3TI9A 4CG0A 3PRKE 5B1EA 4KB5A 1T1GA 1GNVA 1NDQA 1SELA 1VSBA 1TO2E 4M1ZA 1SCDA 5AVKA 3I2YX 4C3VA 3SICE 2XRMA 1SUAA 2Z58A 1YJBA 1P7VA 1SVNA 1GCIA 3T41A 3LPDA 1Y3BE 5I9SA 3VV3A 1GTJ1 1SBIA 1Y4AE 2ZWPA 2ZRQA 3CNQS 1SBCA 2Z56A 4MZDA 4RYDA 1SCNE 3A3PA 1DUIA 3LPCA 1C9NA 1EGQA 3EE6A 3DE0X 1R0RE 1GNSA 3LXUX 3LPAA 1SUBA 1Y4DE 4NE9A 1EA7A 4KPGA 1SIOA 3DYBA 3Q40A 1GT91 4ZARA 1MPTA 1ST2A 4CFYA 1SCJA 5AMXA 3UNXA 3DE6X 1AV7A 1C9MA 4I0WB 4AKTA 2SICE 2WV7A 2ZWOA 3VHQA 3EIFA 3A3NA 1GTG1 2TECE 3WIVA 3GCWA 1SUDA 1SUCA 3VTAA 5FFNA 3A3OA 1R64A 3F7OA 1IAVA 3DDZX 3DE1X 5JMOA 2PKCA 4OMCA 2PWAA 3BX1A 1BH6A 1S02A 2Z2XA 1Y9ZA 1OYVA 1YJCA 1GA1A 2ID8A 2W2OA 1Y1KE 1TO1E 4AKSA 3Q5GA 3DW3X 4H6XA 3PTLA 5CW1A 1NDUA 1P8JA 1KE1A 4LVOA 1Y3CE 3GCXA 5FAXA 2W2NA 1S2NA 5SICE 3I30X 1SBHA 1SCAA 3BGOS 1P7WA 2E1PA 5K7SA 3F7MA 4DJ5X 1CSEE 1YJAA 4YN3A 1IC6A 2ST1A 1OT5A 1R6VA 5JXGA 2W2QA 1AH2A 1GA4A 1SUPA 5ARBA 3DE5X 5FBZA 4OV6B 2WWTA 3DVRX 4WOBA 1KDVA 2W2PA 1PJ8A 3I34X 3I37X 1ZVKA 1SH7A 1SCBA 1V6CA 1PFGA 4H6WA 3WIUA 3GT4A 1WSDA 4BWGA 4NMXB 3DVQX 5B1DA 1TM3E 4B5LA 1GTL1 1KDZA 1SBNE 3DE2X 1ST3A 3D9QX 1SPBS 1WMFA 2SECE
chains in the Genus database with same CATH superfamily
1YQ9A 4OYLA 5D8DA 3TTUA 1N7GA 3P52A 4DY6A 4YMGA 1P0MA 3DXXA 4W5HA 3GOQA 4XIJA 4BNWA 2ILTA 3IIIA 3BRSA 3T0FA 4WJLA 1MAAA 4GOKA 5DIFA 2BMFA 2AEJA 2PYIA 3ULKA 2Y0EA 1V1MB 1ECLA 2ZAGA 3A6JA 4FSXA 4K9LA 4RORA 1PR5A 2G9UA 4O02B 4OMUA 1BWSA 2Y1CA 2IEBA 1ARZA 1R2QA 3I42A 1OGJA 3IPCA 2HWUA 4K9OA 4AECA 3THSA 1HORA 2QRVB 1ZBQA 1C9JA 2E7ZA 1GFIA 1KYVA 1W5FA 5HM8A 1VCMA 1FYEA 2BGTA 2C5SA 3OOEA 4K9PA 2P3QA 1CUFA 1X1RA 1Z33A 3P9KA 4EM6A 4PLVA 3O6VA 3K0CA 1A96A 2MSCB 5JCOC 3PLRA 1J33A 1GPLA 4XPIB 4L9SA 3FNRA 5ALHA 3A1UA 3WBJA 3GNLA 3WHLA 1P1KA 2H5JA 3E4CA 1OAKA 2Y4OA 1DAKA 2FKAA 4J16C 4YRZA 4RCZA 3WHIA 1Y33E 4TL7A 3ILSA 2ZSHA 3UF0A 3HBLA 4H1VA 5J63A 4ND8A 2NVUB 3ZS8A 3GUCA 5CVUA 2XJ4A 5FWAA 3PNSA 2NAFA 3QYJA 4ZT7A 2V7VA 1NVDA 2EC5A 2IHNA 1CS4C 1MC4A 1RTKA 3C24A 3O4VA 3OCWA 4LXHA 5FNVF 4AO8A 4BNFA 2A0FA 5BVGA 4LTDA 2HSJA 4LXIA 1R9NA 5BXQC 4EGAA 4EHBA 2PUFA 3D1LA 4GPZA 2GD0A 4U0KA 2AN4A 4Z0TA 1QTIA 2QPOA 3V2IA 2QW0X 5LA6A 2EBHX 4M0UA 1JT9A 2Z5GA 1BFKA 4XASA 3QVVA 1KFEB 3Q0IA 4FLEA 4HDCA 2PMCA 5C5IA 1CPYA 3S1AA 2FG5A 2DBVO 4EAQA 4PFSA 3ICOA 2VVTA 3E9NA 2P2YA 1UZUA 4O6VA 3OQNA 1J2UA 2ODBA 3BRWA 2HBZA 3H3FA 5KYXB 1DIAA 5LC1A 3RRXA 3NTQA 3TW8A 3U39A 3WLIA 4HUJA 4B43A 2Y1GA 3U3JA 3ZC3A 1THTA 1J1UA 3A6GA 1MJGM 3HBNA 3UGKA 4RCVA 4F2DA 1UQUA 3GGCA 2Z2KA 4TKVB 2Z95A 2ZM5A 1BW9A 2I55A 1L0BA 1CJUC 1QNLA 4K81B 1X80A 1YE8A 1E9VA 4M1OA 4HQKA 1U1FA 3KJNA 2A4KA 4HPWA 4BWYA 1ULAA 1QGAA 2QD2A 4HQ0A 2J6BA 3OZWA 1E5QA 3AM3A 2JGIA 1KF0A 4UE2A 3GRAA 4QJBA 2VDVE 1KZ6A 1BDBA 1RJDA 1U81A 5D7BA 4U3JB 4P3KA 4CQMB 1K06A 3JVIA 4NYJQ 5H3HA 2R0QC 5HKLA 3TQFA 4X97A 2X8JB 5EP4A 1XD2A 2YHUA 1T4MA 2DCUA 4IEEA 1IOWA 3VSCA 5HCUA 3EDYA 2P9CA 5LMUB 5KWSA 3BMCB 4MP6A 4PPGA 4MGHA 1L5MA 3D8UA 3KQOA 3J81A 5TT0A 3IQHX 2JVIA 2PGDA 4EG5A 4ENRA 4JKOA 4PZUA 1N4AA 4GOND 2FP4A 4JU8A 1F3LA 5DNWA 3V4ZA 4JBNA 1X9HA 1KZGB 4EL0A 3DF7A 2B1IA 1W4LA 2W2MA 3TAUA 2HSGA 2REBA 3OIYA 2XBUA 3BDIA 3IX7A 1FYVA 2C61A 2Q0QA 3N0RA 5EUBA 5EHQA 4ZXFA 3ZD9A 4TXHA 1RM0A 1R6XA 2W8ZA 3OEYA 2Q7OE 5CFPA 5AW2A 4R71A 2DWQA 4ZHSA 3QEBZ 1JWBB 2HPVA 5CLHA 3UXYA 3WMRA 1P6UA 3LK7A 1ATZA 4HS4A 4LRUA 5I4IA 2PZLA 5B6IA 1A5TA 2IIBA 1NJGA 4RVGA 2E4UA 2YICA 3BAFA 3NYIA 5CT9A 1OFUX 5DH9A 1B00A 4BRWA 3R75A 1I5RA 1U6JA 2FX5A 1WCYA 3QELB 3H1TA 5A5FA 1DCTA 2B61A 3PQ2A 4CL3A 2H6EA 1I4EB 1RWWA 1L5HB 1NNLA 5BOSA 1TPZA 3D7LA 5H83A 3T5BA 2B6NA 4B6QA 3QOWA 4TL8A 1MA0A 2BRUC 5K5EA 3WADA 2C1EA 1ZBDA 2AR0A 2DFVA 2X42A 1RXSA 1NVVR 3AKZA 3G0BA 1NVTA 3UB4A 2YXPX 4CQMD 1DV1A 5IK2A 3KQHA 3IERA 1WCV1 2UXCB 2I4NA 3C6KA 2O6HA 3OMLA 5TMEA 1C1XA 3UAVA 4V1CI 5L8VA 2PUAA 2XTJA 4O2BB 3P97A 4DNPA 1CDEA 1GAJA 4WBNF 1J97A 2YYYA 5KKNB 4XB6B 1BXRB 3SAJA 4F21A 3H3XA 1ENYA 4WFJA 4JJ4A 3ZW9A 2IDKA 1VL0A 3U3KA 3GZNA 3MMSA 4M1KA 1D6SA 2MYPA 4XWAA 4HZIA 4NAVA 1REQA 2ZS9A 3UJ9A 2W42A 3BIWA 3KTFA 4XUGB 1V26A 2EKLA 3KLOA 1WY7A 3MTDA 4OL0A 3CJQA 5AYVA 4MPTA 3VR6H 2WUWE 4INJA 1PR1A 1Q3TA 1GQYA 3A9CA 5A5VA 1S1MA 3A31A 2JLYA 3SQXA 2OY0A 4DVGA 3D4OA 3QLVA 3M1LA 4PSDA 2A94A 4EJ2A 3M4YA 2GNAA 2PFSA 2O52A 4KXVA 3SQLA 4RGYA 1NVGA 2NU8B 3NVDA 3DEIA 2ZYSA 3LF2A 1E1MA 4I1SA 4LPSA 4FHFA 5DTEA 3I58A 4C30A 1WVGA 2I22A 3ZPXA 2XWPA 3QWIA 3TO5A 5KNDD 2Y99A 4QICA 4NAUA 3B3AA 4QHTA 5L95A 1C3EA 3ZV3A 5H82A 5JH7A 4RHFA 1VXOA 1M72A 5A06A 3JTEA 5TY0A 5D5PA 1ISIA 5AKJA 4BLPA 3WL8A 1T1GA 2AK3A 2VSOA 1GNVA 2JGNA 2G7ZA 4A6PA 3JYHA 1AKVA 3SBXA 3ZHVA 1TF2A 2YN2A 4OQXA 3S3TA 3NW9A 5BPFA 1NXOA 5C52B 5IKEA 4N8EA 3C4JA 2G25A 4LS3A 1WNTA 2X4GA 4XOIA 3GPDG 3OP1A 2C77A 3G79A 1E9CA 1N5MA 2NXWA 4I50F 1B6RA 4R7GA 1LRLA 4HXYA 4RTQA 2Y0CA 4ND6A 2VAVA 2XCQA 3WKBA 1TNDA 1NNSA 2VTEA 2XRMA 5E38A 5JATA 5DXFA 1SXJC 1AS3A 3P2OA 1FOEB 4O4JB 3MHTA 1NSTA 3HMQA 1X1AA 1ZJYA 1A9ZA 4FMDF 1VA4A 3IP8A 3LRXA 1OQAA 4U9IS 2AR7A 2JNWA 5I3ZA 3NBQA 3UVEA 1M2WA 2EDCA 1TLTA 1QHFA 1R15A 2GFQA 1A9PA 2VBGA 2ZIWB 4O0MA 5TEVA 3UMYA 1ZGJA 2RHBA 4BPBA 1S2DA 2EW8A 3KT8A 1ZI8A 2R8YA 1K92A 3UGQA 3UAZA 1OR8A 2DPMA 4OGKA 1B3RA 2VP2A 3BWEA 4K6MA 4OFZA 5FPQA 3TFQA 3LX5A 3F3SA 1SBCA 4LHWA 1FX0A 1VG9B 2A1UA 3KB8A 2F8SA 2VCEA 1DADA 4NU8X 2P5YA 1X3SA 2EV9A 3MSXA 4RUKA 2NUTA 3G9XA 1XELA 3TMAA 3BQNB 3TQRA 4YRMA 2G4CA 3B3FA 1FVXA 2NQ8A 2VYVD 1VPEA 4RJ2A 1Z5PA 2B7LA 2EW2A 3RSFA 4CYMA 1MG5A 2XA1A 3HBAA 3ZHTA 5IKMA 1TE2A 3VPHA 3OQOA 3H11A 2NNWB 3A26A 1D5CA 3C87A 1UKZA 3KJXA 2VZEA 1QO0D 3PVCA 1I2DA 3LXUX 4EPXA 3SC3A 5JC8A 4RFSA 4WKPA 2C2GA 3G5UA 4XIFA 3QMWA 4IIFA 2RG7A 1M6VB 4TWZA 3GLUA 5IDVA 3E82A 4Y1RB 4NICA 4LF5B 4I1RA 4JSRA 4EJSB 1U8CB 5JWHA 2JCBA 2CBZA 4EA9A 3ONEA 3EXEA 4YAIA 5BV1A 3ZLUA 1YKFA 2ZJ0A 5EZYB 4CEHA 1MT3A 5IABA 3VTZA 2AFRA 1Y9EA 2BM0A 2HA6A 3Q40A 1IEXA 1QNFA 4B32A 5BRAA 3RVDA 4M0PA 4KO1S 3SBEA 3RTGA 2G36A 3DCNA 3G49A 1KOFA 3HKCB 4F1WA 3TM5A 1QVRA 5SY4A 3EVCA 3DV2A 3UJCA 5FYQA 4CLOA 3F0TA 1WMAA 5DTQA 3UA3A 3COPA 5DM1A 2QUIA 4MPJA 1W25A 2VP9A 1NBEA 3ZI4A 4D43A 4H1TA 4F96A 5E6SB 1U8ZA 3MCZA 4IKEA 4P3OA 1MIOA 1KERA 1ULZA 2V7EA 4XIYA 5E8RA 3TLAA 4E7OA 4L5BA 3AUKA 1SAYA 3GMTA 3PC6A 3PHGA 3V3KA 1TVCA 2QVXX 1R6TA 3KJFA 1JUDA 4KAXA 4X63A 4LKOA 1DEHA 5M29A 5EIEA 3BA1A 2HF9A 1D2RA 1AZTA 1FRQA 1VLLA 1T3SA 2P7IA 3H86A 4HS9A 3SZLA 3VKGA 1LK0A 5K8CA 1DV2A 5FPYA 3N8KA 2JK0A 1G16A 5C18A 4E13A 5DRTA 3AF6A 4ZVKA 1TA9A 1NRXA 3FLBA 1BS1A 2P9ZA 4OKIA 1ESDA 4V0KA 1A71A 1GNQA 1VL1A 2XD4A 3L0PA 3LQYA 5IMSA 5BSHA 4H1UA 3OY7A 1JHOA 2CEAA 3SF0A 2W58A 4RIEA 2PVPA 3RVOA 1W2WB 4FOSA 2ZVQX 1S02A 4QECA 1P1CA 3TQCA 4CCAA 1A50B 2DEUA 2BEJA 2QGFA 3ZUGA 1M0EA 1MAWA 1U0JA 3K5IA 4I3GA 4LJ6A 4TRNA 1C4WA 3N74A 3IUPA 3L1IA 5D00A 3C3XA 1TXGA 3DQZA 5C8DA 4EELA 2WG1A 1PN3A 3FPKA 2E0IA 1JR3D 1POWA 2ODEA 4R01A 3TL3A 4PG5A 4Y8VA 4BMZA 1DT5A 5DOVA 4E22A 2B78A 2I99A 4UMFA 5SY6A 1KPIA 1QYWA 4JR0A 1RHUA 1EA5A 3RKRA 3TQIA 4KRGA 2P30A 2G09A 4RV5A 4BZZA 5IZCA 2Z6QA 4NZNA 1RP1A 4B9AA 1EESA 2CZQA 4P08A 4O33A 4GPAA 3A4NA 4DBZA 4OKSA 2QTBA 1ZMRA 1BNCA 2HUNA 3V2UA 3IAXA 3P2EA 1E1LA 4K3VA 1BSVA 3HYRA 2J3HA 2WYVA 1PJ2A 1ECGA 1MF7A 2V6MA 2PH7A 2VOEA 1G21E 3D2BA 4LRTB 3I0ZA 3ZJYA 5BNTA 1QF6A 2FWIA 3LUJA 2EZUA 5CTJA 3C7TA 3NONA 5BVHB 3PR1A 3VC7A 3CN9A 4FFLA 3PHHA 4YIHA 1JE0A 3R2JA 5CGZA 1Q6ZA 3JAWB 1AN9A 2H08A 2ZAYA 4JENA 3ZDQA 3KZKA 2O2GA 2ZSUA 2VHJA 3BGOS 3L6EA 1KI6B 2YXEA 4UC0A 4KLCA 4AZWA 2J3DA 5K7SA 2WB4A 1SQ6A 1J06A 2C2YA 3FPHA 1Z2NX 3CZ9A 4IIXA 1KY4A 2CGEA 3QWHA 4HQNA 4ZO6A 2MINA 2NXCA 3BK1A 4I9UA 4ZVVA 3IEIA 1IE3A 4IJ5A 3VHXB 5BSFA 4YY3B 2JFFA 4K6FA 3G8AA 5H0IA 1F6BA 2RK6A 3H13A 4GE0A 3RI3A 1JDPA 2JLSA 2CMHA 2O0JA 3RQIA 4NBRA 2XCSB 3EQ9A 1U2ZA 4WUTA 5K0FA 3GY0A 3TR5A 1W1WA 5BMVA 3TVDA 4R5MA 1GHTA 4OMFG 3V2GA 2VTBA 3V9AA 1UAGA 1P77A 3H0EA 3V97A 2VP4A 2WP8J 1QSGA 4JP5A 5FBZA 1QH0A 2CJWA 3W2EA 4AN1A 2NO4A 3DOUA 3H5VA 3HWX1 3NHAA 3WJ1A 3AR6A 5AXDA 3RS2A 3ZWBA 3VGJA 3D7RA 1Z12A 3F2VA 3F5FA 3LC7O 3VYWA 2GCOA 4K8OA 1XTBA 2VRBA 5ULLA 4HDNB 1VI6A 4IJVA 5JMPA 3SR3A 1VSQA 5CAEA 3GFTA 1AE1A 3PDIA 2C98A 3AFOA 4PXYA 2E5LB 4KFTA 2JA2A 1LX7A 2I6XA 2E55A 3TTXA 3QEKA 2VK8A 3U6KA 2XTMA 5GIOE 4QOGA 1E3EA 1E3WA 2Q6OA 2X5OA 5CBPB 3LGSA 1T5SA 4MV0A 4RV9A 2HF7A 4IDCA 4UU8A 4MR7B 4PPYA 4Y0NA 5JCJD 3GT4A 2IW1A 1U6KA 1G7TA 2JIZA 3G8CA 1AURA 3E3OA 3RH0A 4D9GA 1QR2A 3U3RA 1W93A 1E7RA 2CY0A 1R3UA 2OT3B 3I6YA 5BW8A 3KJHA 1E1NA 1KEUA 3TLXA 1SCQA 5F9HA 3IUSA 2BONA 1M2EA 3MJCA 5E7QA 4BO3A 3NHLA 4BFYA 3PE3A 2M6SA 2CVPA 2ZWAA 3K0BA 1MPXA 1U04A 2YKGA 1C4KA 5JCOA 4MW6A 3PHCA 1OPXA 5KU7A 1X1EA 4GYJA 1T0UA 4QWWA 4YRAA 4QAJA 4A91A 1PZNA 4KCGA 2HT6A 4OJNA 1OFVA 1Q0QA 2XUDA 3PCTA 5BSVA 2CV0A 2I7XA 2NG1A 2JLRA 2B3TA 1Y5LA 2QU7A 3IIKA 1WUTA 4I4TA 1EU1A 4CG1A 4DMKA 1S3SA 4J16A 5AUQA 5K8IA 3EVTA 1YZTA 2JGEA 5DTJA 2XB4A 2QD1A 5LL6P 4F4HA 4L5CA 4Q1DA 2YVKA 2CNWA 1OI7A 5TPZD 1U0BB 2C1XA 2ZXFA 3SMQA 5E95A 2PPLA 4P4LA 1JSXA 2G5CA 2GO7A 3GLVA 2OSBA 3OJEA 4IXMA 4MDYA 4MUAA 3WYCA 2VQDA 4ETIA 1XWWA 3ZCSA 3U4IA 1E1DA 1JEDA 4YRJA 2V4MA 1Y3DE 4X1OA 2QXUA 2VUIB 2WZCA 5EA2A 2IPMA 3DE3X 4JKIA 5BORA 7REQB 1D0IA 5KSWB 1SN7A 2VJPA 2ONZA 3SGLA 2NZVG 2VRWA 3R7NA 2V6IA 1O7JA 1YNOA 5G53C 4N40A 3ZGYA 1TIKA 1CY0A 1V41E 4NL4H 1TQ4A 1BE8A 4B6OA 2RJOA 3ABZA 2IZ6A 1GGNA 1SGWA 1K88A 2YYAA 2ZJZA 2Q62A 2PBRA 5FHRA 1GKYA 1IZ9A 4L2IA 2F1RA 2ZRLA 1TQHA 2GZDA 3OCXA 5HIMA 2A84A 3C4VA 2K2WA 2CXQA 4FYXA 1H4TA 1F2VA 2UDPA 2ZB8A 3B1VA 5CB0A 3AL0C 2JD2A 1RU3A 1N7IA 4GBED 3SDBA 5TT1A 5CPBA 3L6RA 2MHCA 4E1BA 2CE2X 2D3WA 3OM8A 3Q9LA 1FFXB 2I8AA 2H65A 3KOYA 1O87A 4J75A 4M1EA 5HIIA 5AVWA 1EE1A 1IPHA 1W49A 1JFFA 2P6PA 3AIOA 4H4EA 1SBTA 1EG7A 4OHCA 5CX1A 4X7RA 3B1KA 1H4SA 1Y1PA 2C78A 5JQGF 1JU9A 1YRAA 4ABTA 1Z38A 3RIMA 1QFXA 3C3WA 1Y6ZA 3FNEA 4FUTA 3L77A 3LQRA 3A4LA 2FMHA 2BMEA 1FDVA 2LV8A 1OHHD 5JANA 4DN6A 4NDAA 2JZNA 2OCDA 3TOCA 4UTNA 3RSHA 3TE7A 4FFWA 3JSAA 3ONNA 3HKBB 1T25A 1D6MA 3AHIA 3M9XA 4KSCA 3NHUA 3ZI7A 2A14A 1GZSA 4LBZA 1PDOA 4P36A 3M6MD 1LBIA 3CKLA 4AZ0A 1UJ6A 4V38A 1T1RA 3MG9A 2D06A 4Q1VA 1V1RA 2YN0A 2IPAB 4F46A 3OHPA 2WJJA 2BM9A 3B89A 3UMVA 4YBZA 5LMNB 4B6PA 3KTDA 1M2FA 2DAPA 3ZTWA 4K6KA 3ZJ4A 3E9ZA 3N7UA 3ZQKA 1Q12A 1R6BX 4DG9A 2IVZA 4C7XA 4TN1A 5EUMA 4CKBB 3IMKA 4E3ZA 4PX5A 2HD4A 2NPOA 4N7BA 5EQTA 3WTCA 4BGEA 2UYCA 3WNDA 1FXUA 1M2HA 5CNKA 1EHIA 1U7HA 2JAHA 4K9SA 4NZ9A 4L6CA 2WAAA 4YPFA 1YB5A 1YZQA 3EIOA 3K2EA 1OD6A 3RIEA 4QBHA 3UOGA 4A92A 4CKXA 1HQYE 2QM0A 4UEKA 1F7VA 3AF0A 3STWA 4QTTB 1DOZA 3E0XA 2XI4A 2PSHA 3WOVA 2GXUA 4LF7B 4JAVC 4LYJA 2Q3MA 3GCZA 1GYQA 2FEWB 2JLWA 5L45A 1NHWA 4JA2A 5IJ0B 4EX7A 3OC0A 1CCWA 2I76A 5BYJA 1A2QA 1P73A 3WDMA 2VPIA 3AXSA 1J9GA 3RS5A 3G82C 3EUWA 1IXSB 1E6MA 4HZUB 5JCXA 2HCTA 1F6DA 1FW8A 3JYQA 1KK1A 4HLNA 4CCSA 5C81A 3ND8A 5K0BA 3VR5A 3J7AC 1KO1A 4D4KA 2C99A 2H7YA 4HRYA 2ONYA 3JRWA 3ZKWB 3WO1A 1M1ZA 4XR4A 4OA5A 2O7VA 4FR0A 4K0RA 4C21A 2YIJA 1KK3A 1D2AA 3OE1A 3VVLA 4GOMD 5KTMA 3AI2A 3LX6A 1N3LA 2B1JA 4PPQA 1UAAA 3M9LA 3N7AA 2F3SA 2DHDA 2VT6A 3AW9A 5M2QA 2G4VA 2XCIA 4DIDA 3RYTC 2IZ0A 3TR6A 3CXRA 3P9NA 3K94A 4KIUA 2H0QA 1BX0A 4HH1A 1NW9B 5LD2B 4C2UA 5TPWB 1FVOA 3CLSC 4J0FA 4AYTA 3COJA 2RJ3A 1N0HA 3KUXA 1RYDA 3FOAA 1GQ2A 3MAJA 2JATA 2WABA 5CT6A 4MUEA 4EB0A 3WAGA 3Q4GA 4KO2S 1YQXA 4MMXB 4BZXA 5KSOA 4XCXA 4I6EA 4BFXA 1IAQA 4PHFA 4NONA 1SHLA 3GLGE 4AC9A 1TLLA 1UZLA 3RC3A 4BU1A 2YZKA 2WOJA 1JPUA 3RV3A 5AJVB 1VI5A 4BLOA 1V16A 4LDZA 5LZ9A 3U44A 3FNBA 2RJNA 3GLSA 2G6TA 3F9IA 3SBOA 3NJ8A 4DTCA 4ZJUA 3UGJA 5C51B 5F3DA 3PNYA 4L0MA 1ZISA 4BNUA 4CDGA 3IEXA 3IALA 1W5EA 2Z4RA 2ZJOA 5GPBA 3B85A 3BBPA 3GU3A 5KJCA 5G4KA 3IL2A 3ODPA 3CUSA 2CNNA 1W85A 2YL2A 2L2QA 2W6QA 4KKVA 2QUHA 3H75A 1LC3A 3WLSA 1RZRD 1KRWA 3GDGA 2IRWA 1T6XA 3CLHA 1I7SB 1DKUA 3LCVB 1F3OA 1FQWA 1TRHA 3AJ8A 4PXAA 1QDLB 4JJ8A 2WE8A 3F4BA 4KK3A 4PSAA 2Y76A 2I8LA 4PRYA 3HDHA 2JHAA 4FLMA 3UV7A 3NDBB 4A3SA 4GNRA 3CGWA 3EVAA 2OFWA 3HG7A 3BOSA 5L7YA 1IZ8A 1RCFA 1TEVA 4EUHA 4IMIB 1FP4B 4TTTS 1BYUA 2ZZNA 4FYHA 2OAQ1 4M37A 2WD9A 4ARUA 2RGDA 3M1AA 2WWHA 3U81A 1P91A 4TVKA 4HAUA 2O0MA 4L5JA 5FI3A 3ASYA 4ZRMA 3O95A 1OMOA 2Z09A 1R12A 5CA1B 1GNLA 1NJFA 1D2GA 3B12A 3ZX5A 1MA3A 2ZB3A 2XUKA 2R1UA 2E6KA 4ZAFA 4TUYF 2J0EA 2M6KA 1OZGA 4XYGA 1HEIA 1J7JA 3LT5A 4YV1A 5T7BA 2CUZA 2B9EA 1H3EA 4V3CA 1V7QA 4BMSA 4OXNA 1JRLA 3D3WA 4M36A 4P1ZA 4ZC8A 4DCTA 1MJ5A 1I4TD 3IESA 2D13A 1O3YA 4EW6A 4Z0PA 2I2BA 2GTPA 4HEA6 2VFAA 2V45A 4G2TA 5LOVF 3E05A 3QTTA 1DWQA 3V8RA 3OUUA 1CUJA 4GVLA 4EO9A 3T7KA 2QM7A 2ONKA 5K3BA 4GKVA 2W8BB 2OP1A 2B30A 1SCIA 1G55A 3WGHA 4RTKA 2NTYC 1HMPA 1UJNA 4XTCS 1UWLA 1EVKA 3SNHA 2QVCA 2BV3A 3I9V1 3JVVA 4NOMA 3S2FA 3AEKB 1PR6A 3LBAA 4FEAA 3BZWA 3RVLA 2XLCA 3DAPA 3DDCA 2GLTA 4GZ3A 4YAJA 2X6TA 2XUIA 2YV5A 1A4XA 4U2GA 3TD9A 2Z04A 3F1KA 3G7NA 3K8OE 3S8MA 4W8GA 1XZEA 3NR2A 3RS0A 4RKFA 1YJBA 4AO7A 2P2CA 1JHRA 2EFCB 1RYYA 5GJWC 4Y1EA 3V8EA 2R87A 4X6UA 3CY6A 3PUVA 4ES6A 3DMGA 2IOHA 4HRXA 2C7VA 4QDTA 2H7VA 4AVYA 1WXHA 2FN3A 4LDPA 2EGUA 3K31A 4P83A 5IMBA 1U5BA 3I0NA 3QJYA 4K9MA 3CCBA 3AF5A 1L5OA 3EXFB 4KL8S 4UD6A 5CCBA 4KBGA 2JJ2A 4RJJA 3T95A 3EDMA 1GGHA 3L8HA 4UHDA 4DUPA 2OMKA 4J0DA 2IXBA 3CB2A 4EF5A 3DFKA 3LGAA 1HF3A 1N5LA 1WMBA 2POQX 4FSDA 4JLDA 2ZRKA 1NOIA 4KQJA 4PNHA 2JGJA 1PG5A 4P5PA 1YS9A 5HSGA 1C0LA 1EZ4A 4I1YA 4NCXA 3ZGOA 1QWSA 1TO6A 3RYFB 1NX9A 2FUNB 2MWMA 5BSRA 1PT7A 5T4FA 1ZXLA 2PHZA 2RGRA 1NI4A 4U4AA 4QJIA 1JDBB 5AP9A 3DD1A 3ZZ1A 3R5JA 3R76A 4F91B 2BI8A 2IYOA 4LZAA 5IXSA 2C2MA 4JH0A 2WPDA 1R4MB 1FJXA 5HQ3A 5JFOA 2QRJA 4J0EA 4LYDA 2Q1TA 4UD2A 1SCKA 3T0IA 5IJ9A 3AZPA 2CWWA 2PUHA 2E85A 2OV1A 4KDCA 4TLEA 3RFFA 2HOQA 3OICA 1HDEA 3R41A 1SCUA 4OQNA 1P18A 4I9HA 1OVMA 2PTGA 3KKNA 1O9GA 3PRYA 4UNQA 1WP9A 4Y2UA 3HRHA 5CA0A 2AGVA 4ER7A 1VHDA 4UAGA 4DXDA 1F0KA 4MR9A 4Z9AA 3D2CA 1PNOA 2C5FA 4ZAWA 5HFNA 3VX3A 2PLRA 2A9VA 2N1MA 3UM9A 2VQ6A 1YDWA 4GKBA 5AM0A 4E15A 3S55A 1AUVA 3TTSA 2DERA 1E4EB 2DR3A 2ORYA 1CJCA 2XB9A 3PDCA 2C5EA 1SXHA 3ET4A 3FFXA 2GYVA 4R8VA 4MRSA 5BQFA 1JJBA 1S9HA 2CLFB 2IUFA 2PZJA 4Z99A 4YWJA 4AMZA 2XXAA 3ROKA 3NHSA 1H9AA 3GN2A 4B74A 3I2GA 3RGWS 4JLOA 2TECE 5TMBA 3R3XA 1L5NA 4CEJB 1VZ2A 1OVGA 2JFZA 3AM5A 3GFBA 5E1BA 1R64A 4JFRA 3WXBA 2BEUB 1PD1A 3FTQA 4CLDA 4QG3A 1TYDE 5JPDA 1V5EA 3F7OA 3H83A 5EEHA 3A6EA 4C4YA 3A1SA 3JYPA 3I52A 3QUCA 1NATA 2EZ8A 5FL3A 3WLFA 1OU0A 1T0JB 1P3DA 4U1RA 4ZI3A 5JE8A 1B3BA 3GVIA 4OMCA 4WZBB 1G2OA 2BEWB 3TAHA 1UT8A 4G1FA 2RC6A 3Q3GE 3M3DA 3THOA 1EIWA 1BD4A 1Z73A 1ZI6A 1ZZEA 3QLUC 1I3KA 1GPJA 1YGPA 3U4AA 4AKGA 4IFEA 4FFVA 4MV3A 2W2LD 1OXXK 3X1JA 2HJGA 4P4TA 1JVNA 2IT1A 1UFVA 4L0DA 3R3JA 4HBGA 4M8SA 3QEJA 4Y9SA 1H4QA 1Q7EA 5F1PA 1OWOA 2VSQA 5AW8A 2DFTA 3U7HB 1F12A 4NFHA 4L28A 3UIEA 2O2YA 2V7PA 3OF3A 4ZYTA 1TIBA 3TLGB 3ZOZA 4IQ0A 2MJLA 2ZSAA 2X5KO 3BF8A 1J1IA 1P9RA 4KNVA 4ZYVA 1N6LA 4BNDA 4JX8A 1KJNA 3IOCA 2LVBA 1KPHA 2FSPA 4NJMA 4UDOA 5AW0A 3HNOA 4IVNA 1UXKA 3PC8C 3QPWA 4KQGA 1Y8AA 5FLEX 2NXNA 2ZIXB 4BO6A 3S6JA 1HT0A 2CVZA 1EX6A 3HHEA 3VNSA 1NDUA 1C14A 1FE8A 4CTMA 2Q2OA 3D3QA 1RYBA 2B2NA 4J3FA 5ERGB 3AFIA 5AIAA 2ECOA 5EL0A 3R7SA 4YASA 3RC8A 1XEFA 4KJZA 1RHRA 9ABPA 4UAVA 3H84A 2IUYA 1JDTA 3IPAA 4RDCA 1QP8A 2EATA 2JHCA 4B3BA 5BWNA 1WUIS 1QRAA 2G06A 5CT5A 1LPPA 3ZDYB 4HX5A 1CNEA 1Y3CE 1XXHE 1C3XA 4HD8A 3SEZA 4MR8A 2XUGA 3WLNA 4CF5A 2VLIA 4Q9NA 2W2NA 1E1KA 1S2NA 2NX2A 5L3ZA 1EE2A 1RQLA 3PNVA 3ST7A 1H3NA 5BSWA 2JL1A 2M1ZA 2VI5A 5GM2A 4B34A 1FLDA 4R4JA 3RKUA 2IODA 5CYGA 4HJXA 2DFPA 3MXTA 2H2GA 4MYCA 2V55B 3ZWYA 2A58A 2Q0XA 3VDNB 4GP7A 1JPVA 3Q8WA 1KMIY 4K26A 4L95C 4TRRA 3AONB 3M9WA 4AULA 2WLSA 1AS2A 4I8XA 1Z6TA 1Q2UA 1ZH8A 2QRLA 1FYXA 3UK0A 3P0EA 3RGGA 1G60A 2YINC 4E6PA 3U80A 3OLCX 2R4UA 3W3AH 2O8BB 2BDUA 1KXZA 1PFVA 4XA8A 1F1JA 1P1JA 3WWPA 1GPNA 1ZESA 1IUPA 3LF1A 1ANKA 1UWVA 3P0HA 1QH1A 4ZQGA 4WA8A 5EIBD 3BXOA 3NNSA 3OA0A 1SXJE 3GEBA 2JGMA 1HRKA 2P2ZA 4GR4A 5DBFA 4B8WA 4YREA 3SHWA 2WJVA 2JIQA 2X19A 5F3WB 2BGRA 4PZPA 2N75A 3MRVA 3WYAA 4WKNA 4KPFC 1U7PA 5T5QA 3AMVA 4Q15A 4DCOA 4ENVA 3OQIA 1RFLA 1I7DA 2PD3A 2C8JA 1F8UA 4L5IA 1SCBA 3H9QA 4MTLA 1T6ZA 1JSZA 3WK8A 1WQ4A 2RGWA 4NV3A 2ID9A 2D4HA 4ATNA 1RAGA 1T9GS 3DB2A 1T35A 1V3UA 4DSUA 4XWOA 4XIGS 4R05A 5F21A 5K9ZA 5LSAA 4GU5A 4JV5B 3GV0A 4ZJZA 5B7NA 3JQBC 3H1AA 1TOAA 3QVUA 3GBVA 5AJXA 4D8WA 3CE6A 3VZBA 4JYMA 5DHTA 4OX9B 4CM7A 3R74A 1KQPA 4HDKA 1VJCA 2IDZA 2RKOA 1JJVA 1G66A 2WU4A 5H59A 1QRSA 3GBSA 1WCIB 5IFKA 3T4UA 1RPAA 5AKIA 1VL2A 1EFCA 4RNDB 3VKFA 1RRPA 5JTTA 1H1DA 2XJ9A 3PZBA 2G9ZA 5FBVB 3B36A 2WTAA 1NQWA 1QRDA 3N39C 1L4NA 3T38A 2GSDA 2FUCA 1QHSA 5IYZB 3CA8A 4Z4EA 3MCWA 3L92A 1RP7A 4JK3A 1LJLA 1RBYA 1MJNA 4TTRA 4WNAB 1Y9JA 3JVDA 5WRFA 2C8KA 3AR9A 2ZSEA 4XKJA 3JARB 1V4NA 3KKOA 4UXHA 5KKAA 3T7DA 4OUKX 3PQ7A 1STOA 2PZMA 3QUAA 1TC1A 1XZKA 1ZNWA 3C5CA 1SBNE 5JARA 2R2GA 5AKGA 2Y9PB 1I0IA 2FN8A 5J4HA 3MGAA 1Y5IA 3QKTA 2GAOA 4IJKA 3QE4A 4US1R 4CI0B 5BNWA 1N36B 3I2JA 1POXA 5C3UA 2R6CA 2F1OA 4P3YA 3KB2A 3P0IA 5ICSA 3PG5A 5JW6A 4R0MA 3QVKA 3QX3A 3HYLA 1PQUA 4IR7A 1KDYA 3VVBA 3NRJA 3F6YA 1CUHA 2C2WA 4IEFB 5EKTA 3PX2A 1YASA 4PVDA 2JJMA 1USGA 1AUQA 1YTUA 5JAMA 3ZXIA 1GL3A 5HK8A 3VC1A 5CBKA 3AG6A 1XTTA 3FYHA 4NX2A 1NHGA 2FXIA 2QTHA 3CE9A 4KQHA 4TSRA 4DW8A 4IGEA 3D2AA 3DM5A 3WFIA 3D3NA 5KDDA 3HCRA 5KNBH 1W87A 3C7AA 1THMA 1QU2A 3JQFC 3H6KA 3LLMA 4J2HA 2HMUA 2Y71A 3E5NA 4QTUB 3D3EA 4J6FA 3PGA1 1UM9B 5JS8A 3MQ2A 2P7HA 1Z37A 4EQ6A 1VGQA 3GA7A 2GF2A 1CLUA 1DXHA 2ISCA 4G5FA 1K4KA 3B9QA 3WIOA 3X3HA 5EJ7A 5AW6A 3I04A 2ZR7A 2EGGA 3IP7A 4ZCMA 3QOXA 4I1UA 2DKOA 2PS0A 3OLXA 4Q9LA 4YRBA 4IOLA 3LMKA 1GEEA 4EF6A 1D9ZA 1FSPA 4BO7A 4L3VA 3E35A 5GVRA 4I66A 1PT9A 4O2BF 3HZHA 3MMXA 4J29A 1J2JA 2PMFA 3FCEA 5EMKA 4BO9A 2FZ4A 4CKWB 4N0DA 2A1TS 5C7OO 3RVMA 3IJEB 4DQXA 4ICIA 1M75A 3LNCA 2YJGA 3S1SA 1P61B 4UTZA 1DDOA 3EODA 1KVTA 4IF4A 2QYHA 1QVVA 2B2CA 1CJKC 1K6JA 3KDPA 2NIPA 2JFYA 5A9RA 3R9XB 1JAIA 5ARCA 1NNEA 2R8EA 2VJNA 4BVBA 2HCFA 1K6IA 2QSZA 1E98A 1XJQA 3BE4A 4RS3A 3KQLA 2J87A 4R0NA 1O8BA 1NU6A 2OZLA 3EVDA 4DM4A 1DP4A 2QMZA 4QVIA 3RNLA 5JXHA 3B8HA 2V98A 3DTVA 3KO8A 1E2MA 1XEXB 2BE9A 4O1MA 4O25A 4OYRA 2BBSA 3TWOA 4RTJA 3N76A 3LPNA 1UDCA 4FJ0A 3LH5A 2PZFA 2PKQO 3LCRA 3V9PA 3ZQUA 2QSUA 2VF2A 3BJIC 3VTKA 3H2IA 1KL7A 1E8MA 1XU9A 5FNVA 4B79A 1ONBA 2GS9A 4MK4A 1OZHA 2H2AA 7MDHA 1BX3A 2DFKB 4LISA 1Z4OA 2XCUA 1IY2A 4PLTA 2IFTA 3T54A 5JXJA 2YNMD 4ZZ1A 3SFVA 1Z7EA 1XOIA 1IFXA 3QEMB 1EUYA 5KTSA 3FN4A 4UUPA 1ZYUA 3DC7A 4TXNA 5FLKA 4XDZA 4XGIA 2YOGA 2YJ5A 3EISA 4J1SA 3FKQA 1D4OA 4ETWA 2WJGA 4MUNA 4YAOA 4ALLA 3FWPA 1C80A 3LKBA 2D54A 1KMQA 5DTMA 4AMUA 1EEHA 3Q7PA 3AP2A 2QN1A 4HRAA 4Q82A 3ROMA 4QTXA 4AY4A 3I5YA 4HQRA 1V35A 4O4JF 3CJTA 1FNSA 1K2VN 4BFVA 5K8LA 2X5NA 3QKRB 4B7CA 1FZQA 4IS2A 5BN4A 4CMIA 1EUCB 3QYAA 4EY3A 4I1VA 3WL3A 4BLWA 3JALA 3CINA 1KI3A 3HCBA 3THYA 1V11B 4J9VA 5JFTA 3O38A 1FRZA 3NVKI 4NBKA 3K16A 4F5ZA 2GETA 2IY8A 4AP9A 4C7OA 2X1VA 1I0LA 1GSHA 3A2NA 2EZ4A 3OJCA 5IF3A 4B35A 1VKRA 2HF2A 4OSPA 3S29A 3UB3A 2WYUA 1SRQA 3X43A 1J42A 5BSMA 3C39A 3EDOA 1W4RA 2NPFA 4YRPA 4DE5A 3ED1A 5MN6A 4I3HA 4UJ3A 1L4EA 1BOOA 2GN2A 4YJFB 4D3DA 2ZBPA 2AZTA 1K8RA 3EZ2A 1XQ9A 5ILGA 1GP2A 2BLLA 4Q48A 1BXGA 2GVNA 4WD3A 3UCFA 4BFZA 2D0PB 3TECE 1GD1O 3HGTA 1ESZA 1VE6A 2BFFA 3K6JA 5FRDA 3A36A 2J8ZA 4QGBA 3IV7A 4IJWA 4NS4A 5HKAA 3R3YA 4HWPA 3PWKA 3B6EA 1OXMA 2EQAA 2JGDB 3A1CA 2H2FA 1NPYA 2PIDA 1TECE 3SSNA 1IUOA 4YA6A 4RA6B 5BNZA 3KEOA 5KVVA 4RHUA 2GK6A 2DY0A 5ALXA 2V6BA 1FVHA 3COWA 3A9WA 3A1EA 5ELLA 3D3JA 1SA0A 1U0GA 1NBIA 4K46A 1E92A 1QHYA 4YRQA 5ED4A 5EZYF 2EIHA 3U56A 1QFYA 3QMPA 3D64A 3D6FA 1KH3A 1ZN9A 3HGMA 2PBLA 5HM6A 1DTWB 1E99A 3HN2A 2JJ1A 5H1YA 4N18A 5ALWA 2RHOA 4UULA 4RSRA 2R6DA 3HUDA 3RAEC 5ICEA 3TVYA 1HEYA 3EEIA 4CMEC 1HH4A 1GKIA 5FL7A 1D8TA 2ZZMA 1C9YA 2H4ZA 4X1IB 1N8KA 3T5CA 4B82A 4XWWA 3MGBA 2E89A 1JZTA 1L5RA 2J7PA 3FPBA 2YY5A 3B1WA 4JCOA 4QPJC 4TKMA 3UO8B 4Y6SA 4EITA 1KZ9A 1C9DB 2ZUFA 4I99A 3K9GA 2FHSA 2FQWA 3DV0A 4LOHA 1DKPA 1WKVA 4OJTA 1WXGA 4CR6A 3M4JA 4EKYA 3BE6A 1SIUA 1IQPA 3ZWQA 4R2XA 1EXMA 1ORVA 2BFOA 4NG5A 2ZTSA 3G7SA 2ZUTA 4F7DA 2XA9A 2YZNA 1U3GA 3PFIA 4LJRA 2MSDB 1T4BA 4EMTA 4WBNA 3DAYA 2PKXA 3LX4A 2V58A 1VJGA 1PNTA 1RJ9B 1FSGA 1GRVA 1KVSA 1XZMA 4GOLD 4GVXA 3ZDRA 4CT5A 2OPHA 3A9UA 2CLCX 2G8NA 1UKEA 1VG0B 2OKCA 1E3SA 2HBYA 1QLWA 3BWVA 3GPBA 4IYRA 2EHJA 4D99A 4N8DA 3AFNA 5T4BA 1BCSB 3CVJA 5CUQA 4WY2A 3E5MA 1QX4A 4BB5A 3FDFA 4ESVA 4XCQA 1EB8A 1HEUA 2QW1A 4HO1X 1CERA 3KSAC 1X1CA 1NA5A 1JIJA 2YOHA 5KQPA 4COKA 4KB5A 1LVHA 1PLKA 4TLLB 4P86A 2IHJA 1RIIA 4D96A 3NP9A 4DLZA 1MQ9A 1VIMA 2IYZA 3OCCA 1GRQA 1AGXA 4EYOA 5LVAA 2FJPA 3ZE0B 2I1LA 1TEXA 3INYA 1LGYA 1GKUB 4X20A 3PVSA 1XZHA 5CG1A 1GQOA 1US8A 1Q21A 4Q1AA 2Q5CA 1UT6A 3FCCA 1R74A 3QXSA 1A1SA 4F3CA 1NLYA 4CU5A 4RMJA 3C41J 3UAOA 1SQ0A 4K5QA 2G70A 2ZIZA 1JHXA 5B4TA 2V1XA 3JWGA 1D2EA 1UMDB 1LTKA 2G88A 4KI7A 4YX9A 5EZQA 2WSIA 1ZVQA 5JDCC 5KWJA 1GPBA 4UDYX 4QIHA 2QN7A 3A6HA 5KOIA 3U3MA 3EBPA 1J0AA 2HA3A 1I4LD 2GYYA 2R1ZA 2X3UA 3DZIA 3RYIA 4DR4B 1NVEA 4NABA 2V0CA 4XIIA 1L8OA 1SBIA 2XE4A 2ZWPA 3LLSA 4I50A 1X7XB 2HI0A 2FOLA 4NQRA 2NO1A 4NBSA 3CZAA 4PTLA 5ICCA 4DHWA 4YMVA 1Z68A 3PNPA 1U65A 2YRWA 5KYYA 4A0QA 3AGPA 4WCFC 4F5WA 4ACBA 1MORA 2O2EA 3D7KA 5HA5A 3NOOA 5KMGA 4A9AA 2A5FA 1R9JA 1AQJA 2MYTA 3KQKA 2R5FA 3WLOA 3SSAA 2QWXA 4UE3S 1DPGA 3L1VA 1HDRA 5B3JC 2XDAA 1O6FA 1MVLA 2Q27A 4JGIA 2LE0A 2IELA 1QOZA 3A1FA 3K0EA 3EH2A 1Y4DE 3QXCA 5EWLA 3OCYA 2JBHA 1JA0A 2G28A 2QB5A 5CP8A 4FC6A 4G1MB 5H68A 4ENWA 2RHDA 4DLYA 3QLUA 1SXPA 2TS1A 5ELXA 1AUPA 3DYBA 4G5QA 3T7AA 3HTXA 1OI3A 1SXGA 1IHOA 2L18A 3KAJA 4MQFB 4R1TA 4LNUB 2DPXA 4RHEA 3L05A 4BUCA 1UMKA 5JTUA 4Q3CA 1GT91 2QTNA 3V4LA 5GZ3A 3PQ8A 1BU8A 121PA 4KN8A 2M98A 4RPHA 5JPIA 2ZIUB 2D1YA 2JF0A 1TZCA 3PDWA 1Q1ZA 2BD0A 1FTWA 1Z6ZA 1G0NA 4JWKA 1AV7A 421PA 1AQ6A 3K1JA 3K73O 4B3GA 2AZDA 1WV1A 1LDGA 1HBJA 4Z0NA 2ZBGA 3UJ3X 5AW1A 1B76A 4KRXA 1Z7WA 1N2EA 1DKNA 2OVFA 3LV8A 4CKCA 2Q8NA 4FZVA 1GV0A 5IZ4A 3PC8A 2AXQA 3NAMA 4FFMA 4ZO7A 4IQGA 1KIMA 2JCSA 1FMFA 4LSMA 2OR3A 4LDAA 5BQXA 1BOFA 1L4FA 5AI8A 4MVJD 3DHWC 1XMIA 1MAUA 3UHJA 2JA1A 5AJZA 4YAKA 2OYCA 3HXQA 1A69A 2ZI3A 3OESA 3WGYA 4Z3OA 5L40A 1B42A 4YP0A 4OIMA 3HUUA 4JQCA 5TE9A 2EFHB 2DBQA 3A2MA 1JEQA 5K4AA 2PWAA 2VZ9A 2X7HA 2X9GA 4LC0A 1AN0A 4KITB 4ZQIA 2FPPA 1JSRA 3MOGA 4Z1OA 1Y82A 3DZ8A 1Z2EA 3D5TA 5JO0A 1KWKA 1KSFX 6ADHA 1WHTA 2YW2A 2RH8A 1DG9A 1JMVA 4G0YA 1XRSB 3A8TA 2N46A 1HPLA 4MV5A 1PQPA 2QTFA 3EG9A 3G0DA 4RKYA 2CDNA 4QM6A 1NQ5A 1QAQA 4NZOA 2OAP1 4NOJA 4NPCA 2VT7A 2VRCD 3G7UA 1F2UA 2DCMA 1TO1E 2ZK7A 2G9VA 1Q0SA 1IQUA 4RWZA 5FPHA 1E0DA 1RQPA 3O1LA 3OF5A 1JEEA 4ZOBA 3UANA 4JJ6A 4DC1A 3HNRA 2V9PA 2NYRA 4Q7JB 4UQLA 2YJTD 1AXGA 4B71A 4ITRC 3N07A 1K5DA 1CDDA 1JIVA 2Q2WA 5KTYA 1JLLA 1QE5A 2C2ZA 3CBGA 3RVKA 3WL6A 1VPDA 4KP7A 2HMYB 5HZHA 1N6RA 3BGIA 3QVLA 1KZHA 3OTOB 3DEKA 4Z4IA 4KVZA 2D59A 5SYNA 2P2LA 2BFNA 3ZVMA 4RL4A 5K6RA 2O8EB 1N8SA 5BMOA 4MA4A 4MPDA 2JEYA 3WJ2A 1EM8A 4IQFA 3IBTA 3ER8A 3Q6NA 3MWGA 5F7JA 3EMVA 2A6PA 4G5RA 5LWQA 3FYTA 4H2DA 2AOVA 1Z4JA 2FSFA 2F00A 3ZNNA 1WBJB 1EVEA 4KC0A 4OXQA 4MWDA 4PZLA 1WTAA 4RQBA 2IYUA 2HLHA 2WFLA 4QDKA 1JXQA 4EG7A 3IAEA 2Z6VA 1JS1X 2RGXA 1ZM2A 5ADWA 3JQBA 3C5EA 1FDIA 4ILEA 2F3QA 2CJXA 5AHKA 3VR4A 2X4DA 3SKXA 2O2JA 4Z4FA 3TOXA 1H5UA 3RFCA 4X90A 3W8RA 2ASVA 5KI6A 1U1DA 1WX1A 2BKUA 3GUUA 3DV9A 1EWQA 2AJBA 2VF7A 2ST1A 1ADYA 1OT5A 4Q05A 1JV2B 1RCTE 1W4ZA 4HR7A 4XD7D 3WK7A 4HVCA 1OFHA 1ZGGA 1FUIA 4TV9B 3TTYA 2YV1A 3ZU5A 2OHGA 2WYHA 4DV2B 3U60B 3VPSA 2W2QA 3RASA 1Z0IA 4AMBA 1PW7A 4ML3A 4BE9A 1SXIA 3BWXA 1X87A 4X7PA 1P19A 3X2SA 4JI4B 1CRLA 5H8WA 3TSAA 1V9SA 4PLYA 3HL0A 4OV6B 1L5FA 2D1FA 5JD5A 1ORWA 3KEQA 1N2BA 1EEXB 3P94A 5AK5A 3SHVA 3WLRA 1NUSA 3BCSA 1W0JD 2YDYA 3BMXA 4DLRA 4Y0AA 2QE7D 1XFAA 4D5EA 5TGZA 4L50A 2BZGA 3LC0A 1NQVA 2EFYA 4EDHA 1II9A 3GLFA 4X94A 1WIWA 1E0SA 2CHVA 4N3GA 4D74A 2DPGA 1G3UA 1AMOA 4ZZ3A 3PIIA 4FEGA 5A9TA 3D6TB 4LMAA 4QRIA 4GP6A 3E7PA 2RG1A 3IHKA 1ISSA 4EPYA 5CIYA 4MWTA 4P54A 1DZ3A 2YQ5A 3HFSA 1PFGA 4UTOA 4AWXA 4BX2A 1HNXB 4CMHA 2J3KA 3WWYA 4OLHA 2PUWA 2EDAA 4IAOA 2ORED 3A1VA 4L02A 4BN4A 1AJEA 2GCPA 2BFBA 3JQFA 1YQDA 1N77A 5EPOA 3TGWA 3AHGA 4KGXA 2C97A 1GGEA 4PO8A 5L3QB 3QK7A 2VDWB 1WLSA 5FNZA 2BP7A 4GM1A 4OHOA 9GPBA 3AO0B 1R8XA 3PXCX 3QBTA 4PX3A 3RSGA 1S3GA 2VAPA 2YY7A 2E87A 3EQ7A 5LMZA 3E03A 1YAJA 4O8ZA 3DONA 1IHYA 4TL9A 4U02A 4YLEA 1P4SA 4IIVA 3KG2A 1KOGA 4TS1A 3OZBA 4GH5A 3ECCA 4BV2A 3KJGA 2ZVJA 1JH9A 2PX4A 4DV7B 1XYYA 5B7QA 1RJWA 1AB5A 5H5JA 2CNDA 3TTVA 3VO1A 4C43A 2GAJA 1CEEA 3NQ41 3PXDA 2M6LA 2BC9A 3NHPA 1CQXA 2WHRA 3M0EA 4PSKA 4ZKDA 1UEJA 2IY7A 3AFMA 5CLIA 2GASA 2HCRA 4B3JA 2DPHA 1CB0A 2CJFA 5DNDA 4C01A 5IH7A 1TRKA 1KI2A 4TKUA 1NP7A 3AUAA 2ZJ8A 3DFMA 4X6XA 4GX1A 4BV8A 3EXIA 4KDEA 3CRMA 4TYPA 1FCJA 2WJWA 4LF9B 4OA8A 3SS8A 3RJZA 1FYDA 1GL6A 3O0TA 4AD8A 2DC1A 3BM5A 2OV4A 4J07A 4XQEA 5DBEX 1B7GO 3I1JA 3FLEA 1IHDA 4REOA 4YTEA 4UTRA 2Y67A 3N3AC 5KYTA 3AR7A 3LU1A 2HJRA 3U4HA 4DMLA 5LA6B 5EJAA 3T4PA 4RZIA 4HTAA 4EW1A 2GKGA 2J0UB 1RPJA 2O0KA 3QIVA 4K87A 1RVDA 5K3OA 3T3PB 4JJIA 1RYNA 3CPEA 2XRYA 4LHSA 3U4QB 2ZE8A 3AHCA 2R44A 2KE5A 3ORQA 3WKDA 1Q16A 1Q17A 1T3GA 3BIFA 3FFTA 5BYBA 1A8QA 1O54A 1C1DB 4GMFA 2OXTA 3N8DA 3TW8B 1P6XA 4ECAA 1FMTA 3SX4A 4GUAA 1U6IA 3FTDA 4RKWA 2DYKA 4FQ8A 3AETA 3TVTA 4EKEA 1NIPA 4J1NA 3BIOA 3VDQA 1T26A 1ZAYA 4JELA 2O7QA 3FZQA 4PRZA 1CDOA 4IRMA 1Q44A 4DNQA 1HKHA 2BISA 4EW2A 2X23A 2CXTA 4DR3B 2Z57A 3CNLA 1IWPB 3OAAA 4RK1A 5LZ5A 2R8BA 1XDWA 3BD6A 5LDGA 5CA1F 3KS9A 5DCLA 2OCIA 3GLIB 3W8DA 2PAAA 3COYA 3O47A 3G9ZA 4BOYA 1NPDA 2QM8A 3AEXA 4MIYA 5ITVA 4LRQA 1XD2B 2X8BA 1A8IA 5JNUA 4RXTA 2VKQA 2YHBA 3F67A 3DO6A 1NNUA 4HDQB 4V2IA 3V3TA 5JQGA 1H9CA 4BFLA 3N86A 1M2VB 2YHAA 3FH0A 3T3MB 1LW6E 3PNKA 5LZ2A 5AW9A 3KHKA 2PMBA 3RNOA 4F2HA 2CXUA 4JJ7A 2IE0A 4YAWA 5J5CA 4WIAA 4CPDA 3TAXA 3UK6A 1TYAE 1T5BA 3MTEA 2YOFA 4CMJA 4TVSA 3U7QA 3G0CA 1SBZA 1XLTC 2BM8A 2JIBA 3IDAA 4MS1A 4PR3A 5A7FA 3RVNA 4F8YA 8OHMA 1R6AA 2I2DA 2PYZA 2A57A 4PQGA 2X0NA 2I03A 1WEHA 4DA0A 1JT2A 4OF4A 1D07A 3RIHA 3V8PA 1MW9X 4FCVA 4E70A 1P75A 3P27A 3SXJA 1P1BA 4MJ3A 4BB9A 3TYXA 4EI2A 3BRWD 4QUEA 1LW7A 3CKYA 3TNYA 1DX9A 3X1XA 4JJGA 2F17A 4X1YB 3TPCA 1XYGA 2KM1A 4I5EA 2ZUWA 3DWGA 4F38A 2ACKA 3LCUA 1G18A 1LXCA 1AGYA 2IJGX 3PKZA 3PLNA 4JXJA 3VZCA 4ENPA 5L3SA 2P78A 2VPYA 3CRW1 1WZIA 3BQ9A 3LIPA 3HJFA 1DEOA 4M6WA 4QFCA 2ZJBA 3TBKA 3IUYA 1TAUA 3AESB 4M7PA 4RKQA 3NEYA 1DVRA 3OKCA 1PK7A 3MWDB 3RVQA 3B3JA 4Z7JA 2HA0A 2PVSA 4YR7A 4HH4A 4EA6A 3P96A 2W2KA 1E59A 5JZVA 1XTRA 1HE2A 2FY8A 1OI2A 3MTJA 2GBLC 2VDJA 4O3FA 4GG1A 3TR0A 3VO2A 3W0LB 4BIMA 4H7HA 1XRLA 4RD1A 2CCKA 1P1FA 4DDWA 3LCJA 3RRBA 1ZIPA 3A27A 4KN6A 2YMQA 3NGMA 1RLMA 2C3YA 4WMLA 3A9VA 4MVJH 3HXOA 4KR7A 3CPSA 2X3YA 2WV9A 3LUPA 1TUEA 4BECA 3I92A 3CZMA 1CUEA 2PQ2A 3IMCA 4QO7A 5GQSA 5JCPA 1PQ4A 3HB0A 4BE7B 1RM3A 1KO7A 1T0HB 3QPBA 1A4UA 2ONCA 2HPHA 1T1EA 4D9EA 2HLDA 1ETUA 1ULTA 2GXSA 2WM2A 3RRNA 2Q5IA 5JI3E 2YMPA 3H4VA 3R8XA 5CEFA 3AOEC 5CYPA 2FWPA 4DMRA 5K01A 4JT9A 4AMVA 5THXA 1C8LA 1SZJG 2CDCA 4K05A 2B37A 4ON9A 4PZZA 1NE7A 2O20A 1AK9A 2VK1A 5DNVA 4AN4A 1X70A 1TM1E 4RTPA 2RAUA 2UYOA 4H1HA 4AM8A 2AFHB 1XCLA 4R1QA 5LYYA 5JH7B 1W7AA 1DC8A 4ZEVA 4ZRNA 5C35A 5I8WA 3EEQA 1NZFA 4RLQA 2HO4A 3HNPA 4S1VA 2PLWA 2PKRA 2Q7XA 3OOHA 3NUGA 2X1LA 5PGMA 3QJ5A 1XF1A 4LRWA 4XI9A 4WZAE 3X1YA 3KR9A 2HHHB 1IY1A 4E5SA 1MB0A 1DAFA 2QD5A 3GXBA 4FFNA 4UM8B 2N47A 4JD5A 4E03A 4DMCA 2ZQYA 1XAIA 4OXKA 5IANA 3PUXA 2ZUEA 4Y2RA 1K9VF 4JXZA 2XOKD 2PDAA 3K4HA 4OQYA 4RZHA 5C46F 1MX5A 3EQ6A 3PEUA 1M3SA 2XZDA 3JASA 1S2MA 3EIQA 3K6KA 2QX4A 5A03A 2K6GA 3H5LA 3F6BX 5JDCA 3M3HA 4G0UA 4OJKA 1EX9A 4LW8A 1M1XB 1UDRA 1DE0A 4Q34A 3UCEA 1N1DA 1VKHA 3PIRA 4IUDS 1OX6A 2B5VA 4GLOA 2EFDB 3AM1A 3OQPA 3ZXUB 3SC6A 1XVAA 3CVWA 4FYPA 4JYAB 3GRZA 2IQ5A 3JQ7A 1XCJA 2C3UA 5DHPA 4Q24A 4AXXA 2VUSA 3YASA 4QQNA 4U6QA 3ZDDA 1U8EA 2WYWA 2XEDA 3INNA 1QQ5A 4V2UA 2VP5A 3HA3A 3N75A 1E2HA 2CHGA 2FRDC 3OLYA 3PRKE 4MTCA 4RQAA 5FUMA 4LYHA 1WSBA 1XKLA 2CFSA 4D8XA 3KKEA 3E1KA 4TUYA 5A9SA 5B64A 5K4HA 1VSBA 2CXRA 2ECPA 5GWXA 4EJSC 2GOYA 1XHFA 5B3JA 1U28C 2AYXA 4JP3A 1UCFA 3U1TA 2JKZA 3LW8A 1U1EA 4U5QA 5ABPA 2DHRA 1J07A 5UKDA 2WJ4A 5TDHA 2PL9A 3LWNA 1B1AA 4FFBB 4CIAA 3LQQA 1N2GA 4RFSB 1DRJA 2PT6A 2ZVPX 3UWDA 1CQZA 5ITZB 1MTZA 1DRVA 1QO7A 4MRVA 2OB2A 4J49A 1ORRA 4YJ3B 4ZCSA 5LQUA 1HZZC 3QF7A 1XRQA 5LOVA 2R60A 2I80A 5K03A 1R16A 1D2MA 3NIFB 1KZ7B 2D0IA 2HMAA 2ZRIA 2ZXUA 4CEHB 3ZE7A 3C4QA 1UFQA 4GVPA 4HFJA 4ZOLB 5HW0A 4C6TA 2WKRA 3PSHA 1I24A 3UENA 2FMIA 3LLUA 4CMKA 4JU9A 3C8MA 4JLPA 2JHGA 1RWBA 4RAQA 5ALJA 3V4PB 4BLTA 2D1TA 1EX1A 2AN1A 1NAHA 2XY4A 3N9IA 4FLFA 4K2AA 3RAPR 2QRKA 3FRIA 1G9XA 3WK9A 3FR8A 3UT5A 1ZXXA 4BYGA 2IXAA 1BJKA 3CKKA 1FUYB 3G1TA 3PNQA 1W88A 3O4HA 4LQLA 1EGQA 4ER6A 1I1QB 2C7RA 4FIZA 5LIRA 3WJAA 2LZ0A 2R7LA 3EY4A 2GPWA 4RZSA 2G80A 5M04A 4AY5A 1FC0A 1YD7A 1IUNA 2W22A 3GP5A 5GJCA 5PNTA 2NU7B 4EENA 4IMJB 5EKXA 3VAYA 3KQUA 4MB0A 2ZYIA 4YO8A 3ZQJA 2QNBA 4P2BA 1XIVA 4E32A 2HMWA 3C6ZA 4G07A 4N7MA 4NYIR 2QTRA 3CUTA 1GZ3A 1MEOA 3ZWDA 4TTAA 5CT4A 4EY8A 5DKFA 4Q66C 2O2HA 4ZVTA 1GNTA 2ZUVA 1X74A 5B58T 3AJEA 1SHUX 1CY8A 3MB5A 1TB4A 2WM3A 1MPTA 4M9XA 4PSCA 3DBHB 1PFWA 4Z1MA 3W5UA 3PUZA 2PGIA 3PXGA 4NZPA 2W00A 4JLAA 5AKXA 4WLOA 5C7LO 3QVOA 4U39A 3IKLA 1GV1A 2ZWOA 4OK5A 1JJAA 2Q3DA 4GX0A 1YQUA 5EHNA 3WP1B 4N0QA 4IX9A 4M0FA 3DULA 1NF2A 1S2LA 2HWKA 1BA2A 2QVZX 2Q3JA 5K1ZA 2X6QA 1CWUA 3SJZA 1MENA 1FJ2A 2JG3A 4C2BA 1BU5A 3TNJA 4JT2A 4NWIA 5DLEA 2GFIA 1NW4A 3LHKA 5J5AA 3EARA 5I4CA 2DXIA 1N0IA 3VISA 1VYTA 5AUOB 1NQTA 1LPOA 3OQ6A 1MJHA 3R7AA 3FKSA 1Q1NA 4MV6A 2BZ1A 4EMUA 1DC5A 5BSTA 5ER6A 5B7PA 2VK4A 4XGQA 1B43A 2OLEA 2DULA 1FK8A 2OHFA 5IYZF 3VZDA 3ICPA 1C0KA 3BX1A 2WTEA 5AM3A 1O97D 4QC2A 1RKBA 3KLPX 3M7IA 3O5AA 1C9EA 4JBLA 2ODNA 4U8HA 5L51A 1MZPA 3DKPA 5KQMA 1UBHS 4CTNA 2ZYUX 4MQLA 3G0OA 8ATCA 4C4TA 3AUSA 1UOPA 4BGUA 4FR5A 4IG4A 2YFQA 3JCZA 4B40A 4LNHA 2WW8A 2JASA 5AK6A 1RBQA 3L01A 4D97A 1UQTA 3V1LA 2BGJA 4XX1A 2AHRA 4R69A 4WY8A 3D8BA 4MW2A 4XWTA 5CMLA 1ITZA 1EFPA 1WG8A 5JLAA 3A6LA 1TT5B 4EZIA 4YUZA 3DLAA 2R8XA 3MJEA 2MMGA 1TTPB 3BH6A 2WT4A 3O2JA 5L3RA 1GM5A 3KZ1E 1U7XA 2AZMA 5GONB 5JAZA 1TA0A 1A2OA 2XIJA 2H51A 5CW1A 1Z82A 3H5TA 5FV7A 2CHQA 4GYKA 4NENB 5LU8A 2H1VA 3DOIA 4FWTA 3ESYA 1XU7A 2PANA 3I83A 3FVWA 3L8CA 2R62A 1Y1TA 4IIDA 5D6OA 4BJ1A 5BMVB 1UMCB 4D3XA 2VTBB 3A0RB 2VNIA 4IPTA 4HLUC 2CJWB 2CHUA 3OZSA 4GOJA 4X3PA 2WVHA 1LQTA 1UXHA 1WXIA 4OXXA 3EXG2 3K05A 3KEGA 5JEEA 3KYCA 1TT7A 4QOJA 3QENA 4R2KA 4MVJP 4MO2A 3H2GA 3LYHA 3UTCA 1VIAA 3WIEA 3WLJA 4C14A 5CAEB 2MMCA 3HL4A 3HYSA 1SZCA 2EBFX 2H48A 4OGGA 5BN5B 4L8YA 5C2JB 1W48A 2P27A 5JNTA 1W36B 1VBFA 4HMQA 4MKFA 1G5RA 3FHTA 1R0KA 3EGOA 4JUBA 4LJYA 2D5BA 2G1AA 4KDFA 2UZ4A 1XEAA 1MH9A 1H93A 2ZYTX 3H17A 5A4MS 2C7BA 4NBVA 1MIHA 4YCLA 1P5ZB 3R7LA 4EBFA 4XPIA 2H59A 1E2GA 1ZIYA 3DHEA 1NMYA 2NVWA 1GUZA 3QG5A 4O2LA 3TNDA 1SHKA 4Q21A 3L0CA 3HEAA 4BJ5A 2F1IA 3GZJA 3HC7A 3KZMA 1K3FA 4ZTBA 3PIDA 4UCFA 1HLDA 4B76A 1DXOA 1XTJA 2H85A 2NZ2A 3WNZA 4FEYA 1XNRB 3ZGXA 4F9EA 1WUHS 2NVUA 1JG3A 1R9MA 1JHUA 3ZN2A 4QSMA 5GV8A 1ZJJA 1LBHA 4UU1A 1XJ0A 3QOYA 1X42A 4PCVA 1GG8A 3FGZA 3PI7A 5COQA 1KEPA 2VHTA 3DM9B 3IDQA 1OX4A 1PJ8A 1NC1A 2O1WA 4LXUA 3KETA 3DOFA 1HQKA 3I37X 3FYUB 5ENDA 1DIGA 4FGJA 4NQZA 1VB3A 3ID6C 3FFAA 3EA5A 3O8QA 4JOSA 1PAUA 3ZY4A 3K70D 1NXPA 3FMGA 4E5NA 5KDOA 1GZHB 3RLFA 1TJYA 4I4IA 2RK3A 1EFRA 2VDKB 4PQYA 4DNXA 2ECKA 1O08A 4WI1A 3EVNA 2BMWA 1AQLA 2W43A 4FZ3A 1CFZA 1X7ZA 1XZJA 2XR1A 1K1EA 3AHDA 3GK3A 1A4RA 1M7GA 2GPTA 2I1QA 4FHDA 4JQOA 4W9MC 1G6OA 1VE7A 5FH9A 4GBGA 2IW3A 2HQOA 3O7WA 4FFPA 5DW0A 3VTFA 3BXZA 2RGAA 5KYXA 3ZCVA 2JLXA 1TCUA 2XD9A 4V0NA 3DOEA 5IJAA 4HAOA 4EPRA 5DM70 5AK3A 3K6SB 3LWDA 3NXSA 3VBEA 1ISMA 3PGJA 4Y18A 2TYSB 4UVDA 5AXCA 2HCBA 1E7MA 3NDJA 4QD3A 5HF8A 3TRJA 4TKVA 5K8TA 5FADA 4RPLA 3WDSA 3ADBA 4EG8A 2XYRA 2QLTA 1OU4A 3OTWA 4EY6A 4RPIA 2HSZA 2RCYA 3E22A 1WVIA 3MBOA 2GN8A 1YS1X 3DDWA 4LMPA 1EBBA 1TKRA 2QTLA 2WU3A 3C3YA 4AG5A 2G9NA 3IR5A 4ZVQA 3RSCA 4U3JA 2FI1A 4I46A 1KTVA 4CQMA 2GCNA 4X61A 1FNDA 1T24A 3SC2B 5EE5B 3D4NA 2X8JA 4ZD6A 2NMVA 1SUWA 3OO0A 3R0QA 2F43A 3TIGA 4MI3A 3F8TA 3ORYA 4JROA 4P7BA 5JD3A 1JBKA 1E58A 1ZLXA 5BNIA 3BMCA 2OGUA 3FKJA 4U63A 3NGLA 1FP2A 1TJPB 4WERA 3HI4A 3LCCA 1OUMA 3ZLJA 2D5IA 3O26A 5IUKC 1UODA 2VJDA 3KXKA 3D6MA 1TEHA 3EJWA 2BDEA 1WD7A 3GPLA 5CFRA 1GA6A 1JG7A 1ZKMA 3L07A 3UMBA 4BQIA 1ZOLA 3C2QA 2D00A 2X9NA 4LXTA 1GGJA 2IYRA 4YFYA 4EUFA 2C2HA 2J6HA 1G291 1ABEA 1GAEO 3NRBA 5L53A 4Q0MA 4QLOA 5ITWA 5JWRA 1WZEA 4V0QA 4NYJR 1XLTA 1HI9A 2I3GA 4J6EA 3AC0A 1SHTX 4GMKA 5TARA 5KNDA 3DBLB 1XZLA 4HH3C 3TM4A 3L4BC 1OGYA 2FGKA 2PZBA 2WEKA 3GEMA 1VYHA 3NTUA 4N4AA 4NU5A 5AVVA 2O3TA 3QELA 3B6ZA 4ZJYA 1L5HA 5THQA 4EFLA 3QF4B 2VKTA 1B2LA 1PUJA 1E60A 3PE4A 3VJKA 4W4TA 3R6TA 4ZT2A 3LBNA 1A1VA 1BN6A 2OQIA 3VV2A 3A6DA 1RZUA 2VP6A 2Y0BA 3H2JA 3U40A 1RYHA 1YI0A 1EBFA 2CF6A 1MUUA 1YZHA 3AGQA 3D0KA 1GAQA 2EX0A 4BUJA 5K0GA 1Q2XA 3ZCRA 1XRPA 5J2UF 4H0NA 4JB0A 4KGVA 4HGRA 4O2BA 2IY9A 2MYNA 1BXRA 3NBUA 1YE3A 1KGSA 2TMKA 5AM5A 4BNGA 2GBCA 1KE2A 4EJ6A 5LD2C 2DFLA 5AIBA 2GBLA 5AJWA 3QU4A 3NHKA 2VPWA 1VSTA 1A27A 3C1UA 3RC9A 3O0DA 3JR3A 3ZCXA 2I6FA 5I47A 1Z18A 4LBVA 1O03A 3I72A 3IMEA 3ROQA 3AFGA 2HIGA 1CT9A 3CYFA 3MQFA 4DXAA 4F60A 3HSSA 1RI3A 1L3IA 2VPZA 4R7TA 4XOUA 4Z5XA 3I1FA 3TZLA 4PM4A 2VAXA 4MWCA 4ALIA 2GEVA 2WIKA 4Z9FA 3HLTA 3RS3A 2O7SA 3BCHA 3HUEA 2FE4A 4IRUB 621PA 2CSXA 2NU8A 3GMSA 1O5OA 1GPH1 1USVA 2Z9DA 2X4IA 3ZX4A 3K5PA 2OXCA 3VA7A 1U7DA 1CRZA 4PYOA 4DB4A 5JHGB 2D2FA 1JG1A 4CBVA 5ALDA 3R5HA 2C4MA 2C2BA 1P74A 1XZBA 3E7WA 4J2TA 4U0JA 3VFDA 1QO0A 4PICA 1V16B 1XL1A 4TLBA 2NTNA 4ZGBA 2YFKA 4PG6A 3EMBA 1UKVY 5FEMA 3W2FA 1JQDA 1VLZA 4TTPA 2BH2A 4LXGA 3WWDA 2QVBA 5C1PA 1H0RA 4OY3A 4UARA 2POCA 4QU9A 4BAUA 1CK4A 1KYZA 2MR5A 2A88A 1GL9B 4HT3B 4LYFA 5G4KB 2CDRA 4U7WA 5EZ6B 4FCCA 1RJEA 4NNOA 1SVKA 4M0EA 2WJ6A 5KQGA 2AVNA 4E14A 3WAJA 1OFIA 4IHKA 1QQ7A 1ZJZA 4QT0A 2J9ZB 2ZTUA 3M89A 5DWQA 4RETA 3ZHUA 3IVXA 4PHGA 1BFUA 3M1YA 4LG1A 4MVJF 1E32A 1Q91A 1QFZA 1XDUA 3OE7D 1N92A 3KIPA 4J0HA 4O4JA 5DGTA 2GN1A 4LDRA 4P84A 3SBDA 4DLKA 2B92A 2RHRA 3DOOA 3ENKA 2ZAIA 3O3MB 3C6MA 4M1TA 4CM9D 2QLJA 1AZSC 4JT4A 4N7JA 4JI6B 2VZ8A 3F49S 1Y3AA 2OLKA 4I2VA 3AZQA 3VNBA 1DIHA 5B3KA 1G17A 2HDWA 1H0KA 3HDQA 3KFVA 3H7AA 4D2IA 4L6IA 1T2AA 4ZVPA 1LZLA 5DI3A 1T1IA 3A37A 2XKAA 3CX4A 3HJRA 5JALA 2XZLA 1I5OA 2CNKA 1D1TA 4XYLA 1Q77A 3AY3A 1XZCA 3A4MA 2PIAA 2PK3A 3DKIA 3Q6MA 3QFSA 5DFAA 4ZVUA 1OCEA 1MXHA 4B4OA 1ZDMA 3KKQA 2FRDA 4BVGA 3T1QA 3VPXA 3KAQA 2VJYA 3EPHA 3SC4A 1AGNA 3FZNA 3PD1A 1YUNA 2VPTA 1M6VA 4Y1RA 1J5EB 2EJUA 3A1DA 4BO4A 1HV8A 5ICMA 3WLPA 5IT4A 3UWMA 4ZEXA 5EZYA 2QQEA 1DNPA 3LJKA 3RARA 3VU0A 4CM6A 2DPLA 5A3SA 2ACVA 3RROA 4V1CB 4OI0A 1VLMA 1ZGAA 3ILXA 1JR3A 1Z5OA 3IR6A 1HZZA 1II0A 1ZIDA 3H8WA 1AV6A 1NLUA 1OASA 3VNRA 2H07A 3BDVA 1OZAA 3IIMA 2ZIVB 2GHIA 2JLQA 4LTMA 5BXYA 1LTHR 3EK2A 3GLHA 4YQEA 2GZ1A 4ER5A 4V02A 2A59A 3DNFA 1BO6A 5CLJA 2WHQA 4K1LA 3E5RA 3OJLA 1Q19A 4F93B 4N41A 4CIVA 1GG2A 1M34E 4HC4A 4D8TA 3OU6A 3WSTA 4LK3A 3EEYA 3OSUA 1SK9A 3ISJA 1TEZA 1U5BB 3SZUA 1JHPA 1MB9A 3BEDA 4ZAXA 4WASA 1N9ZA 4DQVA 3CR3C 1GZ7A 5FT9A 4L5YA 2RHMA 1JQEA 2AC7A 3ML1A 4I5DA 4OVKA 4TKLA 1T3LA 2O8CB 4KX3A 4X7MA 2YWGA 1JDBC 1QXSA 1ES9A 3BTVA 4IXTA 2VDLB 3HK2A 1X1BA 2DWPA 3KZOA 1NDQA 1F4LA 3E48A 3WGOA 2A0WA 1I1OA 2AOXA 3SHQA 1AQUA 1IRIA 4DT1B 2QPLA 4R51A 1GGFA 1VIYA 1ZM4A 4YR9A 4REMA 1R37A 3LDAA 3G59A 1AKUA 3OFVA 2R65A 3CPJB 2GERA 2YXNA 3ET5A 1ZN2A 5JJCA 3BVPA 3ZK7A 2JS7A 4G5GA 4Z7QB 1EBUA 1PFUA 2JLCA 4YP6A 1PGNA 1ZM9A 4Q1BA 1TCBA 4GKAA 1OAAA 5JCZA 4LGMA 3TOSA 3PJRA 1QG0A 4TMXA 1XTUA 2WG0A 1GPMA 2HNAA 2GHRA 2PRJA 1R0CA 4MVJG 4GPTA 4IX1A 2H17A 2C42A 2B25A 2QLFA 5CA0B 1VDMA 4QGGA 1NLFA 1YONA 2NVOA 1HTWA 1I36A 2ZWMA 4LXXA 1LLQA 4OFBA 5C37A 1H2AS 3OWOA 1U0SY 2G77B 3R09A 3Q3JB 4KR0A 1ZA1A 4MXDA 1WABA 4F5YA 1EFVB 2V7WA 2VHZA 4LTNA 2G71A 2YWHA 1Y9AA 2EBUA 1H2RS 3ETDA 2XWQA 5G3YA 2WAXA 2JI9A 3CEHA 2XKJE 3GJTA 3P4UA 1C9NA 2XH8A 5ERXA 1A9RA 2P4HX 3FZGA 3NDRA 2Z9CA 3Q0EA 1QHNA 2DFNA 2YQ4A 1DWUA 4RZQA 1KI8A 3T6KA 5JAIA 1I4WA 2OOKA 4X6LA 5ADVA 1J00A 5BWOA 2HDOA 1FSZA 5DCWA 5BVHA 2H3EA 3NHJA 3KPVA 1N2OA 3C1TA 4TV9F 3ROEA 3S2GA 4FDUA 5JS1A 5JCJA 4P7FA 3JAWA 3CWZA 4MV4A 1S8OA 3AR5A 6PFKA 4LDNA 1UC4B 1RXWA 3G3EA 3VR0A 3SHTA 5K0TA 2XMZA 3GFFA 1KI6A 1OXSC 1SIOA 1UBRS 4PIMA 3WYBA 4C04A 3QY9A 5JR3A 1T1SA 2G0AA 5HZMA 3ZVKA 1W46A 3EBLA 2VHCA 4TLCA 4P0PB 5JUWA 2ZS7A 1H1TA 5U9CA 1K4MA 1CX9B 3VHXA 3ZU3A 2WPDD 3ROFA 4AJLA 4LHYA 5ES4B 3VU9B 3PUJA 4C0AC 5EIBC 4OQZA 4F9TA 1TD1A 3L6UA 2OQRA 1F20A 4PFKA 1NY6A 3UMJA 2HRQA 2NQTA 1QMGA 3P9RA 3UXEA 1K3UB 4AKTA 3RV4A 2DGDA 2I6QA 4RHCA 4MI1A 4URZR 2XWSA 3HSYA 3KHTA 3KYDB 4US2R 4I1PA 1LPSA 1TJ4A 3ZBUA 3ZVRA 3RUCA 3O82A 2ORIA 3PGLA 4LJ5A 4LC1A 4TLDA 4UHJA 1JI0A 1G8HA 4II2A 4FGUA 4BNDB 2YJ4A 5HR5A 4NJMB 1JTVA 2QL7A 5TPZA 3M6UA 3X1ZA 3FI9A 3VTAA 3H8VA 1GRNA 2XRZA 4XSHA 5FFNA 3L7KA 1M7BA 3FPJA 2F67A 4N5MA 4ZN6A 1M54A 4RDXA 3DC2A 3R4VA 4G8JA 4KVAA 4RY2A 2Y1XA 3V00A 4Q93A 4HDNA 3OTQA 5B3LA 5SYMA 2AZXA 3ASUA 1BROA 3MJTA 4HLUA 4A5SA 4HJRA 1QOQB 2GBFA 3GCDA 5D85A 5H70A 3OPYI 5EHXA 2PKCA 5JMOA 1AKWA 4IMRA 5EMNA 1KMNA 3PNBA 1GUAA 3DAGA 5HRUA 4QVKA 3SXUA 4B4WA 3RJMA 1Q22A 2JBAA 1MABB 3BN3A 3IP5A 4LV8B 5EP2A 5KCMA 1M0WA 1C7QA 3KDSE 2NU6A 4ZQHA 3FTEA 2CMGA 4MR8B 4JYBA 4M8LA 4EFNA 3ODGA 4PFQA 3IB3A 3R3UA 1UJCA 1U80A 2C5LA 4R8KA 2E4ZA 4OU5A 2VJCA 1Y1KE 2JB9A 2PX6A 1OT3A 2AQKA 4FGZA 2C0PA 5GM1A 3LYLA 3W4JA 4AKSA 2IQIA 2P0EA 2PPVA 2UZ0A 3HXMA 4B2IA 2Y27A 1Y7LA 1NJ8A 4DQ0A 1AG9A 1Q0RA 4Q3BA 3ZDEA 1PV4A 3PKIA 2Y1OA 4HNUA 4LPKA 3U37A 4OQMA 1UADA 1Z36A 1Z0FA 3L18A 2ZCVA 2YWBA 2YFHA 2QUJA 3PXUA 5G1NA 5HFAA 2WKQA 3L40A 1RKVA 2WVJA 1OHHA 2FG7C 4AJKA 5A5EA 2XE8A 5HG0A 1E0JA 2I87A 4R8RA 2ENWA 2YH2A 1GSOA 1PJTA 3U62A 4ZMRA 2PUJA 1L7VC 1KY5A 2Y93A 5LA6F 2R6GA 2AQ8A 4Q3LA 5JO9A 3ZHSA 4GPEA 3LKDA 4ZMSA 2QYTA 2NXEA 5F33A 5FAXA 1W76A 2KSQA 3RUHA 2CXHA 5CXQA 4KR6A 7REQA 2PL5A 1RRMA 2X8AA 3I30X 3IUBA 3QKWA 3ZVLA 3E9CA 3KXPA 4CLRB 2E48A 1YI8A 3MRSA 1O6BA 3ASVA 4IFTA 2D62A 2VO1A 1NZJA 2X41A 4FD2A 3C5HA 2R8OA 1C7EA 2WDZA 1X6VA 4PG7A 1BEEA 4B3RB 3RYHB 4AF8A 2NZXA 1MCZA 2I3ZA 4YN3A 4ENUA 1N2ZA 1ENPA 4IH4A 4DRYA 3VZSA 1TZBA 5JMTA 4PS0A 5GJVC 1VI2A 3M83A 5EMHA 1CW2B 1TJ5A 2HZBA 2V6FA 4MEJA 4TPKA 2GN4A 3IAS1 2A67A 3WYGA 1QZZA 1SBYA 2OHHA 2PS9A 4JUFA 1WEKA 5KJEA 4AQYB 1G63A 2ZSFA 2IP4A 4J4TA 2DH5A 3W90A 2LBPA 3IAAA 1E1QA 1G4AE 2SKDA 3PPIA 3TLYA 2RHCA 1FFXA 1SB8A 3FBTA 3HCPA 4UFOA 3VVCA 3UPUA 1JR3E 1M67A 4II7A 2ZUSA 5JSZA 2H63A 3WL7A 3DMDA 2XNDD 1QHHB 3ZQ6A 5HIJA 3VR5H 1L7NA 3Q7SA 3P19A 1NW7A 4P4UA 4OK3A 1CHNA 2DQSA 2F3PA 5F7ZA 3LUKA 4CMGA 1AXRA 4D81A 1V3TA 2O2DA 5CPFA 1FQJA 1NT2A 4NFYA 3EGWA 4S24A 2PO7A 2ZBUA 3HY4A 4UVEA 2H57A 2AN5A 2IXFA 1OXVA 1A5ZA 1J8DA 1WPXA 3SX0A 2VDUE 1XTPA 3RAJA 4AS1A 2ODAA 4RAOA 3DQQA 5CJ2A 1DXYA 2IS2A 1BE0A 4JSYA 3G8YA 3S0JA 1P3JA 1L7DA 1XZGA 3AVQA 1I7PA 1Z6AA 2I67A 3HVIA 3DFFA 4N6NA 4YRSA 4B6JA 4WXPA 4YI3A 3REOA 5FBRB 1ZNYA 2OVBA 4N03A 4EYKA 1M1YB 3AILA 4UHFA 4DCCA 4C03A 1T0IA 4IXNA 4O59O 1JB1A 3RK0A 1ADFA 2F64A 3EZ7A 4NMXB 4L27A 4EO4A 3GX1A 2GJ9A 3O3CA 3DVQX 3C98A 3HSKA 4P98A 5AM2A 5ITZA 3LP8A 2CFRA 4BEWA 5KJ6A 3T0GA 4B5LA 3M2TA 4CE6A 4ADSG 1ZCBA 1ATIA 1CUVA 2YJ3A 1ULBA 5KUTA 2KBFA 1LRKA