3TI9A

Crystal structure of the basic protease bprb from the ovine footrot pathogen, dichelobacter nodosus
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
341
structure length
341
Chain Sequence
APNDPSYRQQWHYFSNYGVKADKVWDRGFTGQGVVVSVVDTGILDHVDLNGNMLPGYDFISSAPKARDGDQRDNNPADEGDWFDNWDCGGYPDPRREKRFSTWHGSHVAGTIAAVTNNGVGVAGVAYGAKVIPVRVLGKCGGYDSDITDGMYWSAGGHIDGVPDNQNPAQVINMSLGGDGDCSQSSQRIIDKTTNLGALIVIAAGNENQDASRTWPSSCNNVLSVGATTPKGKRAPFSNYGARVHLAAPGTNILSTIDVGQAGPVRSSYGMKAGTSMAAPHVSGVAALVISAANSIGKTLTPSELSDILVRTTSRFNGRLDRGLGSGIVDANAAVNAVLGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title S1 Pocket of a Bacterially Derived Subtilisin-like Protease Underpins Effective Tissue Destruction.
pubmed doi rcsb
source organism Dichelobacter nodosus
molecule tags Hydrolase
molecule keywords Serine protease
total genus 125
structure length 341
sequence length 341
ec nomenclature
pdb deposition date 2011-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3ti9A00
1SIBE 1BE6A 1SN7A 4RYDA 3T41A 4CFZA 3TECE 1PJ8A 1C3LA 2ID8A 4GI3A 2WUVA 3HJRA 5FAXA 1WMFA 1BFUA 2IY9A 1R64A 1SPBS 2WV7A 3Q5GA 1SUBA 3VV2A 3EDYA 1GTG1 2HPZA 2PWAA 1C9NA 1DUIA 2X8JB 1SCDA 3GT3A 5ARDA 1DBIA 1NDUA 1YU6A 2QTWB 2DUJA 1GTJ1 1YJBA 2XTJA 3SICE 2W2OA 3WQBA 5ARBA 1LW6E 2Z30A 1TM5E 1WMEA 2B6NA 3ZXYA 1MEEA 2SICE 3WIVA 4DJ5X 1AH2A 1VSBA 3LPDA 1Q5PA 4NMXB 1HT3A 3L1KA 1GCIA 1SUPA 3DVQX 1GT91 1AK9A 1THMA 5JXJA 5FBZA 1T1IA 3TI9A 4DZTA 1Y3CE 3UNXA 1SUAA 2W2PA 1SCJA 4H6XA 3DE6X 3VTAA 1S2NA 4MZDA 3GT4A 1WVMA 1YJCA 1KE1A 3GCWA 1SBCA 4ZARA 4HVLA 5SICE 1SUCA 1XF1A 2ZWOA 2W2MA 1PTKA 3SQOA 3VV3A 3ZXXA 3AFGA 1BE8A 1BJRE 2SNIE 3DW1X 4H6VA 4B5LA 1SCBA 1P7WA 3OSZA 4H6WA 5AMXA 1KDZA 1ST3A 1Y3BE 3DW3X 1AU9A 3I30X 5JXGA 1Y33E 2IXTA 1SBTA 4KG7A 4WOBA 2DP4E 4WOCA 2SECE 1IAVA 1TECE 2PMWB 1PEKE 5AVJA 2ST1A 1ZVKA 3QMPA 4AKTA 1SH7A 1TMGE 2V8BA 3BGOS 1P7VA 1SBIA 2PWBA 3DVSX 3PTLA 1WSDA 2TECE 3PRKE 5ARCA 1A2QA 3CNQS 4I0WB 4JP8A 1UBNA 1Y34E 3LXUX 1TO1E 1TM4E 2HD4A 4Z2AA 1Y4DE 2X8JA 3D43A 1SCAA 4OMCA 1JEAA 3I2YX 1OYVA 1KDYA 3DE4X 2W2QA 5CW1A 1V5IA 4ZOQI 5JXIA 1SUEA 3QTLA 1TM1E 3VHQA 1MPTA 1SVNA 2ZWPA 3D9QX 3DE3X 3CO0S 1AVTA 1AF4A 5JMOA 2DQKA 1CNMA 1Y3FE 1T1GA 1GA1A 3BPSA 1NDQA 4KPGA 4OMDA 1OYOA 1TO2E 2SBTA 3A3PA 4NE9A 5B1EA 3F49S 1BFKA 1SUDA 2GKOA 2ID4A 1TM7E 2Z2ZA 1EGQA 3DE0X 1NLUA 3DE1X 2WWTA 4KB5A 4AKSA 3EE6A 3QFHA 5AVKA 1BH6A 1Y48E 1Y1KE 3Q40A 1T1EA 1EA7A 2Z58A 3A3OA 1GTL1 1KE2A 4CG0A 1ST2A 1Y4AE 2Z57A 2ZRQA 2Z2XA 2W2NA 1SIUA 1SBNE 2PQ2A 1PFGA 1Y3DE 5K7SA 2XRMA 3AJ9A 3I34X 4C3UA 1S01A 3F7OA 3AJ8A 5FFNA 3VYVA 1WMDA 3BX1A 3DE7X 2G4VA 5I9SA 3DWEX 3WIUA 1TM3E 5B1DA 3P5BA 3DE2X 4DWWA 5AQEA 1SELA 1GA6A 1GA4A 4BWGA 4J94A 4LVOA 1P8JA 2E1PA 2Z56A 3LPCA 4CFYA 3DYBA 3DVRX 3H42B 4YN3A 3WHIA 3F7MA 3VSBA 3LPAA 1TK2A 3DE5X 1C9JA 1Y9ZA 4FONA 3A3NA 3TI7A 4C3VA 1GNVA 2P4EA 1CSEE 1V6CA 2PKCA 1IC6A 1R6VA 2PYZA 3DDZX 4K8RB 4NE7A 2PRKA 1AV7A 1S02A 1YJAA 3EIFA 2WUWE 2Z2YA 3GCXA 4M1ZA 4OV6B 5JXHA 1R0RE 1SBHA 3I37X 1SIOA 1AQNA 1SCNE 1C9MA 1OT5A 1ZVJA 1KDVA 4LVNA 4HX2A 1GNSA
chains in the Genus database with same CATH superfamily
5T4EA 4WNYA 5CDFE 4B31A 2ZR7A 4QLOA 2MYTA 2GSWA 4U0KA 1BFUA 1T5HX 5BQXA 4HXEB 2GN0A 4LV6A 3KVOA 3TCXB 1J49A 3GT3A 4ENUA 4EAQA 3KE9A 4M86A 1FVFA 1IY9A 1M83A 2Q21A 1N2CE 2AEMA 2VLBA 4X94A 1PQYA 4RHTA 1KRWA 2W4IA 4BLVA 1K9SA 3QWBA 2YY6A 1KTIA 1S8AA 2C5EA 2DQSA 4IFEA 4JFRA 4XQGA 4ECAA 1W52X 4NBUA 1W2HA 3W8EA 1RKUA 2PCLA 3MLBA 3RJZA 2E5FA 4RELA 5DLDA 3ACCA 4CUKA 2GUGA 3NONA 3B1ZA 3MTIA 3GEGA 4JNCA 5DPMA 1IJEA 4N6OA 2JIMA 1U2GA 4BXOA 2ZVDA 4XM2A 1TYAE 2QRVA 1RJWA 3RBAA 4MV8A 4JBNA 1DQNA 1IBRA 1N57A 1XTKA 5JD5A 1FQWA 3NU1A 3U37A 4OQLA 2HDNB 5JNTA 4PSUA 1FP6A 1V16A 1XKTA 5DYWA 5TB5A 3S2IA 4XSGA 5HRCA 3TNFA 5F2OA 1J0CA 4C22A 4BO6A 2FRDC 4GLOA 1HEIA 1EHIA 1CUJA 2AR9A 2QT1A 2FVYA 3EWIA 2V6GA 1LVHA 4NZMA 3N2KA 3KUXA 5DT2A 1GL3A 3FBWA 1EWVA 3K72B 3MTEA 1FUUA 1QKKA 2FR8C 1E2KA 2QRVB 5AYVA 3ZXSA 4U2BA 3P8ZA 5AKLA 3ZNOA 2AN1A 4EPXA 2V74B 5INTA 1PR1A 2IIQA 3TQFA 2IH2A 3KZNA 3F3YA 2H5IA 3FDFA 3GH3A 1O95C 1X39A 2WJVA 1X7XA 4Q5IA 1JA1A 5H68A 3TE7A 1L4KA 1QU2A 3UC5A 1K9VF 1FNMA 2DQYA 2HEGA 2QX4A 2V7WA 4NE9A 5FLYA 1USWA 2R87A 1US8B 4MI3A 5G1PA 2P79A 4J2OA 1R6UA 3WDKA 2OBLA 4QQNA 1Z4IA 5LPNA 3NEYA 4YH1A 4R83A 4N5IX 3UENA 1Y6FA 2YWFA 3MRVA 1TF7A 1TD1A 4G0VA 2ZTHA 1QV7A 3CXRA 3CLHA 3R23A 4L57A 2IYXA 4TQ9A 4JJKA 5EHIA 4J2HA 1GTL1 5BMVA 3GPIA 4LXQA 3O0DA 1PJZA 1XMPA 4JSYA 1B6SA 5DTQA 3QPUA 3F47A 4JBYA 3DC7A 4J1TC 2XB4A 5IM5A 2HBYA 2BLLA 4DV4B 2ISSD 5ALJA 1HEUA 3MC1A 4YQYA 3R20A 3K15A 1QS0B 1FP1D 4K3UA 4MEAA 1QG4A 2FFQA 4AFNA 4IDEA 4ZI7A 3G2MA 4EHLA 5BQFA 4ISBA 5K3SA 2VQFB 1IHPA 4HNHA 3VGJA 1EMDA 1JL3A 4UMVA 1Z28A 4HVLA 4RVFA 4Z9AA 2Q0XA 3O38A 2QJFA 3H7IA 1QE0A 5L4SA 1BWRA 2EKBA 1U1DA 5A4IS 3NJ4A 3WB2A 1GU1A 2DJ5A 2GCOA 1JXMA 5D5QA 1JI3A 1GGEA 2OT3B 2V6JA 4LSMA 1T15A 3E7WA 2ZI6A 3H11B 3I2KA 1HETA 4L5AA 1JDJA 1CDEA 4X5OA 1NZJA 4UUAA 3UUWA 1T9GR 2Q3FA 2VYND 2E4WA 1W0JD 4PLYA 4KIWA 3OZUA 5A0VA 2EG9A 2G5GX 3M5PA 3ZVRA 3I61A 4HN4B 1YIAA 1O6CA 4PHHA 3TNLA 1FNSA 1JHZA 1PZHA 1OKKA 2IUSA 2X8JB 3DAOA 5GPBA 4TLLB 3MBOA 2GZ1A 1XTJA 3H9QA 1CRQA 5REQB 4B7AA 1A27A 1E2FA 4MRAA 3RSGA 1F12A 1Y1RA 1M1NA 1NI3A 1G38A 2WTAA 1N5JA 2J3LA 3GBPA 1J2EA 4TMTA 2J9XB 3W9SA 1RKBA 3H0CA 1E2QA 1LCIA 2CNLA 2VSOA 1OAKA 3Q15C 3QXGA 3JASB 4FWBA 1GCAA 4UULA 1DV1A 5EKUA 1WCIB 4BE7B 4KC0A 1NNUA 4ZYTA 5FV7A 1YJCA 5HF9A 3DTTA 4NU6A 5KYKA 1QH9A 5EJAA 1UKZA 1SO8A 4CM4B 3LQ4A 3GJXC 3HHEA 3DL7A 1GSAA 2ZJBA 1FX0B 2YFQA 2D2VA 3V1MA 4F3RA 1ZK1A 4FN4A 4JMLA 2GTIA 3ENNA 1RRMA 2OK8A 3UAVA 1O96A 3O47A 4HWKA 4GG1A 2ZKIA 2XMZA 2JIRA 5F2KA 5K0ZA 3K05A 4YEDA 1QANA 4OHOA 4BEJA 4JV5B 4F3NA 2EBHX 4S12A 1RQ7A 4EJMA 3FF1A 3W7AA 1HYEA 1SC1A 3KIPA 3PIIA 3E4DA 1E5QA 3HYLA 1IWPB 3DTYA 1E69A 5B3JC 1C8VB 1QM5A 3Q7RA 4WL0A 2GO7A 2YNMD 2UVPA 4FYHA 4OQEA 5IMBA 4I5GA 2JIQA 2PEYA 4ZVUA 1IZ8A 2DWUA 4MKHA 4J1NA 4B6OA 1ZITA 2GLTA 4AMVA 2PMDA 2ZSEA 2EBUA 1QZUA 3Q0EA 2TMKA 3O4VA 3OPNA 4XB6B 1TIBA 2ZPTX 4LBZA 5CR9A 1AZLA 1PR9A 5D3MB 1SVOA 4MGEA 1T29A 1VCIA 3BB1A 1OYYA 1BX0A 4C30A 3T5GA 4PCAA 5B2EA 4QASA 4HTFB 1JA9A 2J41A 3T1OA 4M0DA 2GKOA 2HQSA 4BO7A 3KRTA 1ZCZA 1RLTA 4QXQA 4ENVA 1YI0A 5LXTB 3SJZA 3QM1A 1CZKA 4Q4AB 3E1GA 4CE6A 1Q50A 1U2QA 4Y6QA 8AT1A 3FGPA 3D2BA 3O93A 1U3WA 2WB4A 2XI4A 3PICA 2QSYA 3HB4X 4IF4A 1F7VA 1M1YB 2PSDA 5ITWA 4GLLA 3LSTA 3FM9A 2VRCA 4MLPA 4OD0A 4Q4HB 1SG0A 1U3CA 5JRJA 1Q21A 3F5SA 3ZLTA 3C6MA 3DV0B 4CNBA 2C2XA 3F7OA 4RCZA 4TV8A 1E1RA 3AM4A 4TV9F 4EAAA 3HI4A 4HVAA 1L3IA 3IXLA 3OCCA 2VJPA 5ESWA 1QRSA 2GM5A 1NTRA 4TTQA 3EC2A 5DTMA 1E64A 1GGVA 2VT3A 2EJBA 2YJ6A 3W5JA 3RASA 3PXGA 4D1YA 3LBFA 2H52A 2HKIA 4MV9A 1I8TA 3U9TA 1T2CA 4J94A 4KQ6A 5KVCA 3LMKA 3RBZA 3DA8A 1N1GA 3M83A 4C0QC 3OIGA 1GZ4A 2FX5A 3DE5X 2OCKA 2PGJA 2C8VA 3AI3A 4FCVA 4O2AF 4P35A 3U4MA 4ZGWA 2HF9A 3LDUA 4K6KA 2VSQA 4UHFA 2OXTA 1ISGA 4FSDA 4KEAA 5AW8A 4WJKB 3ZW7A 3AFNA 4N3GA 1DO0A 3C24A 3CLSC 3T94A 4L15A 2W42A 2J09A 2Q3HA 4ZOAA 3UMBA 2C00A 3GH1A 4OXKA 1DBPA 3WLMA 1BE6A 3OTHA 4JP3A 4N3AA 1KY5A 4UHDA 2I4LA 4WGGA 4V1CA 3M82A 4P1ZA 3CA8A 4BNYA 2IHYA 4PX3A 3R7WA 3OE7A 1EB9A 4IS2A 2H85A 2C7PA 3R76A 1JN0A 5C80A 3WGTA 3VM6A 3I73A 4KXUA 1E0JA 3CUUA 1OHHD 1TCUA 4PG5A 3LA6A 4I3FA 3UGJA 1WMBA 2XUPA 3OX3A 1D2EA 1LNZA 1ZK4A 4IH4A 1QFMA 3VI4B 5IU6A 2F00A 2GJAA 1L5FA 2QXYA 3H1EA 4C01A 3GJSA 3DYIA 3UKOA 2WTUA 1JXAA 2X19A 5J4LA 5DNDA 4BFCA 1JR4A 2DPMA 2G7MC 2QW8A 3HCOA 4HDSA 4RSGA 2ZYGA 5LU8A 4C7KA 2GPBA 3A04A 4UAUA 1U3FA 3O5AA 4FWIB 5F5XA 4AY5A 1NLYA 1U8CB 5JS2A 5LMCA 5L3SA 3IHKA 3HP7A 3GUZA 1U4SA 1PZXA 1IMOA 2EL7A 3SSNA 4KJZA 4YXFA 2OO7A 2Z0MA 3GUCA 1JFFA 1QRTA 4IWXA 3ROEA 3D6HA 5IASA 5DW3A 1BE0A 1A8IA 2H31A 4GUAA 2D2IA 2B4KA 1BRTA 1T9ZA 3DEHA 5DNAA 5F12A 1LQUA 2TECE 2XTZA 2IGTA 3ZJ5A 4I0WB 1QOQB 1W0KA 2G5TA 1XMJA 2CMFA 2VDJA 2BONA 4DSZA 3HB5X 3ORFA 3JY6A 2YZ7A 4CM1A 2EWVA 4HN2A 1I13A 2HPVA 3BK7A 3ZDRA 2HH9A 3F3SA 4ZYVA 3L49A 3TXAA 1UMDB 1GUDA 3SN6A 3ZEIA 4KHPB 1J1UA 5JTTA 2I65A 3EG9B 3SF0A 3F7NA 4CCYA 3CLTD 3AL0C 1T1GA 1X86B 2IKQA 3A4IA 1WU7A 2GXSA 4RD3A 3F1LA 4AJJA 2JAPA 1DS6A 3UWMA 2O8NA 2RHDA 4IDBA 4B73A 2C0QA 4WUTA 4BLWA 1QP7A 1U3VA 2C29D 2OV3A 3CRQA 3V33A 4E03A 3STWA 4EEZA 5BSFA 1OAOC 4WK0B 3VR5H 1Y48E 1Z16A 2A5FA 2GPSA 3OQJA 4KFTA 4W7IA 2E5LB 4QM6A 4QXRA 4BO8A 2EFJA 4YT2A 1H3FA 4K88A 1NT2A 2V58A 1RWMA 1RYBA 2UUOA 3C3AA 3ZZ0A 1H93A 1X1QA 4D82A 1X6VA 2XRMA 2FZGA 1VE1A 3KU1A 3LZCA 4L4YA 4X63A 5TVGA 1TKRA 1W30A 1Q74A 2D3WA 2MSDB 2NQ8A 3R24A 1JDZA 4URYR 4Y7CA 1HYHA 2JVJA 4MULA 4GRAA 1U28C 2RE8A 1GN8A 2NXJA 3S2GA 4AQDA 5T3UA 1DIHA 2PKYX 4PCLA 1K68A 1ZD1A 3NUGA 4MV1A 3DEFA 3G9ZA 4R8LA 2DUUA 5DCWA 1Q2XA 3CEJA 4RPCA 5BVHA 3K5PA 3GLHB 4LJRA 2CJXA 3NDBB 2DCUA 1RFGE 4PC6A 3OFJA 4BDSA 1ZGCA 3FMOB 3ON5A 4G56A 2DULA 4RW0A 2PUGA 3ZQ6A 2WYHA 3M4NA 3KUUA 2QGNA 1EP9A 3AKDA 3BXZA 4BMSA 3CWZA 5ICSA 2AJTA 2HA4A 3ESYA 4KPFC 3WJ7A 1YAHA 1MLDA 3D7LA 4CM4A 2Z8XA 1IJFA 2WHPA 2PWYA 1XJWA 3PNLA 2ONJA 1Z3CA 2PBFA 4YUZA 5DCYA 1S1CA 1KBOA 4LV8B 1M72A 2II6A 1ULTA 4ZOLF 2BE9A 2YDXA 4GZ5A 1R9JA 1V1MB 1DUIA 5F78A 3DGEC 1XEXA 1I24A 1U81A 3Q9SA 4GLJA 3IMGA 4BIMA 4E0BA 5LIRA 2HV8A 2XA2A 2G80A 4BN0A 1GZ7A 3HU1A 2A7XA 2OENG 2C2OA 2ODWA 4JI6B 2CLLB 3ZU5A 3C3PA 5TRTA 4LGYA 5HTKA 4KK3A 5BR1A 2D6FA 3ZCXA 2HB6A 1IXYA 4YO8A 4LF5B 4PZDA 1E3TA 3RRNA 4A92A 1KJYA 1PJ2A 1QHYA 4PTLA 2DKOA 1Z4QA 4Y6GB 3GJTA 2WY2D 3ZGNA 4TTJA 4CIBA 1FY2A 1HMYA 5YASA 5HYVA 2B25A 4LA4A 1T9KA 1PS9A 1Z9BA 4QTUB 2Z8ZA 3WGYA 3G8DA 2ZIEA 1W19A 4TWBA 3LNTA 1WG8A 2DR2A 3ONNA 3RADC 3AUKA 4HB3A 3U4HA 4MO2A 4NABA 1JDPA 5ICEA 2F3RA 3OU7A 4TN1A 3UB2A 4QG3A 1ZK3A 3QUSA 1WE2A 3BZWA 5EXPA 4UPVA 1Y4DE 3G0GA 4QOFA 1JEAA 2RGDA 3DE4X 3DB1A 4CLXA 3QYFA 5BXQC 1GARA 4R54A 3J7TA 3PA6A 1A76A 1I5OA 1CJUC 5B6PA 1GT6A 3N3BC 4FOTA 2UXCB 3SHFA 4GICA 3OZ7A 4NYMQ 3IC5A 3I9V6 4QOGA 2FW0A 5FP0A 1YDMA 2PIAA 4FHCA 1XQ1A 5HUQA 2FVXA 2R86A 2VKQA 4UXIA 3PXXA 1KZ9A 3ZHRA 4CRWB 2O2CA 1KRHA 1IB0A 1HDXA 2AB0A 2REBA 2YBEA 4IH9A 1U9JA 3NGMA 5AVKA 1G8HA 4ZIRB 4Q9AA 2V0GA 1I4LD 3AF4A 1T3ZA 2QUJA 4MYCA 4F04A 5KDOA 4QEZA 1QYRA 2R44A 2R1TA 2WMOB 5FUYA 3FSGA 3WNZA 2ZIVB 3ND5A 3KQWA 5ADUS 4YA6A 2C1ZA 4LFAB 1NBEA 2J45A 1NMYA 2V8OA 4NJOA 3HH8A 1N0IA 4TTTS 3PE4A 3GQVA 1Z3IX 2G83A 2L17A 2XF2A 3CEHA 4YDQA 2PGIA 4RJ2A 4AKIA 3ZUPA 2WWVD 2O8DA 1PR4A 1OLXA 1WHTB 4QSMA 1KFBB 5IAAA 3O94A 2FKAA 1JHXA 1OI7A 2O1WA 2WU3A 1VKJA 1I0IA 1Z35A 1IUNA 5EPOA 4ZQBA 4FM9A 2AN9A 2YRWA 4TKMA 3JR3A 3PR3A 4YAEA 3NTUA 3IT0A 4DADA 4Y2YA 5K4GA 4EJ2A 3OMXA 2G4CA 2JRLA 4WA8A 3VR1A 5J4KA 1TZKA 3RUCA 3CF6R 3HU3A 3GLHE 4IS3A 4ZPJA 3W5VA 1A4IA 3EZ6A 4HX2A 3GLVA 1NC3A 2AJLI 4HYTA 3IDSA 3WWOA 4AX8A 3JAMA 5GVSA 4OSOA 4E5VA 1XQYA 5I8WA 3LFHA 1E79D 2OO5C 3JARA 2AL7A 3L7LA 1RWWA 4BGIA 4BNVA 3BXEA 3NUZA 4RIHA 4ZQHA 5BT9A 4C04A 3GGJA 3ZDAA 1F1BA 4YJFB 4YFVA 5LZ9A 2GLUA 2D8AA 3A2NA 5D84A 1G41A 4BEWA 4F1KA 3IUPA 4D9NA 1RWPA 1WMEA 2I8CA 2ZRNA 3HSKA 1CUIA 3JVDA 3N3AC 3QYJA 2H2HA 2PH7A 2WG2A 3BWMA 4RGQA 4Z7NB 5KYXA 3L07A 2IS1A 1ZZEA 1GCIA 1V96A 3C8UA 1Q22A 1R0ZA 3TG2A 3PF8A 4IRMA 1T2UA 4MPRA 1XFAA 2IJGX 2I4RA 1F60A 1RW4A 2HHAA 3EGOA 1GG5A 1ZA2A 1WDLA 3TRFA 2HK7A 2OE2A 1TA4A 4RC9A 4EUSA 1NYLA 3VMFA 4DT1B 2PA0A 1WU8A 1J33A 1MB2A 2BEKA 2REQA 3K0EA 4L74A 3V8QA 2IXBA 1RWNA 2GK7A 1GPWB 1XZBA 2DY0A 4KPUA 4M0UA 3OIWA 1EDBA 1FBTA 1Q0SA 2EARA 3LJKA 1EAMA 4H16A 5A3JA 5LM3A 1EDDA 1CDOA 1CJKC 3A27A 2GPNA 2EX0A 2AN3A 2WR8A 3M2PA 4R0VA 3RUDA 3TQSA 3VYTB 6LDHA 4EIWA 1ZMXA 4N6NA 2CVOA 1U9IA 3EZXA 4INOA 1XAGA 3GA7A 3IB3A 1XALA 4X54A 4DM3A 4EKDA 2KLBA 4F2GA 1C4OA 1VHJA 2V9CA 5FAKA 1VJRA 4HQLA 5JY1A 3RFUA 2H1IA 4KTTE 2WMDA 3LBNA 4YT8A 3PC7A 4IXMA 4ZWNA 1RQ2A 3JSXA 1M2NA 1FXUA 1W96A 2NXCA 3A9WA 3QTLA 4HR7A 5JIBA 5JYBA 1TE2A 4DEYA 4P33A 4FTWA 1TK9A 4JODA 1S4QA 1WZIA 1OWPA 3DNPA 4YHBA 1C8BA 3X1ZA 3ANNA 2WF7A 1T3SA 1U8YA 2PKQP 4O8CA 4PQEA 3JZIA 3HLKA 4OJMX 4F72A 1KI8A 4NJMB 1Z0AA 3GZ4A 5F1OA 5CAEB 3D6JA 4MP8A 4NE2A 4D4IA 1CY7A 1VQ1A 4P4LA 4RFVA 3TQCA 3IV6A 1VSUA 2FX2A 1BDBA 2G9NA 1HL3A 4V0SA 3GLFB 7MHTA 3D3JA 3FNFA 1ZN8A 2ZUBA 1X8LA 2CY0A 4QNNA 5IX8A 3N2YA 2H1SA 1UBKS 3EVFA 4H4EA 3OQBA 4F71A 4GPBA 5EQJB 4W9MC 1M2OA 3DAPA 2J7PD 4P36A 4I8DA 3LX8A 2BVNA 4HTFA 1FYVA 1UPBA 4MEJA 4KAXA 2PUJA 3LGXA 2QPOA 4EABA 5A04A 4P7KA 1U0HC 3UK2A 3WFIA 4EG5A 3QI7A 3HWSA 1D6SA 3WDMA 3IP6A 2J9ZB 1V9CA 3IALA 4BVEA 2NADA 1E1CA 1RXCA 4TMFA 3A6EA 3TDNA 2X2FA 1PQUA 2X42A 5KJEA 3M4YA 3QVSA 1J7JA 3TI7A 4B6SA 4EGFA 2NXNA 1PJSA 4E5YA 2OV1A 3RS2A 2NWQA 6REQB 4UEOA 1GQRA 2AOTB 3VX4A 4CQMA 3LCRA 4DWVA 4GX0A 4YMGA 4HXFB 3K5IA 5JUWA 3BA1A 5H1YA 3IUJA 2PKQO 2ZT5A 1GTVA 5ITZB 4HMQA 4P3KA 5JU6A 4CM5A 5FBLB 3UT5B 3HK2A 1GR1A 2VJCA 4OJQA 3L6BA 3F9CA 4GPZA 5BV0A 3E8SA 3QKRB 4GWGA 1N7HA 5B2ZA 3AKEA 3D3WB 1SHTX 2AMFA 3C43A 3WZLA 4AJHA 4LTNA 1YAJA 2PLNA 4ZK2A 3JAWA 4FHZA 3PRYA 4IOMA 4N9QA 3I5AA 3VAYA 5K3CA 3ZWBA 1V26A 2CL7X 1F3LA 1KZ7B 1MO5A 1JI0A 1Z2PX 2Y2VA 3WRXA 1KJ8A 4TLCA 1FFSA 1ACJA 2WYIA 3DZFA 4GRIA 4TS4A 1CLEA 3H1PA 3JZFA 4OU5A 1SKQA 4TROA 2FN9A 3R8FA 1DTWA 2SICE 2YCLA 5FA6A 4BQEA 4LHZA 3VZCA 4DNQA 2J6BA 3QTTA 3H1FA 2VTEA 3WXBA 1A7AA 3FZQA 1P18A 4U2EA 1UJ6A 1U8XX 2B5VA 4ZIRA 1WSWA 3SXJA 1Z22A 3WMRA 2BHTA 1FSFA 1W46A 1WVMA 2A9PA 5LMNB 3UAXA 3WKDA 2N46A 3LECA 3GXBA 4DV0B 3DMHA 1B2LA 3KT0A 2P78A 3QEMB 1FK8A 3PU6A 5GZ1A 5CEEA 4C29A 4RU1A 4YP1A 1R8QA 1XMVA 3KZKA 4AI6A 3Q5DA 5CT9A 3OPQA 1SBTA 3ROQA 2D0OB 4K6OA 4NX2A 2PYIA 4YK7A 4DY6A 4MVJG 5DIZA 2OAGA 2DH5A 1KKUA 4NBRA 4F1JA 2F3SA 2YV1A 4JLDA 5CFZA 3GFBA 3M33A 1JEQB 4AJ2A 1XYYA 1E1CB 4P58A 3HXQA 1N0VC 1O9GA 3BGVA 4X8LA 4W99A 4A8JC 4E5MA 2C96A 4UEKA 5EJEA 3EVDA 3GLTA 5IFKA 1FTNA 1ZH8A 1RQXA 2MYPA 2C03A 3LDFA 2N75A 1E9DA 1IH8A 4A91A 2VQDA 1WLSA 2O9JA 5K6TA 4CKEA 1E18A 3QEKA 3A26A 3RKRA 1Z4NA 4RSRA 3OOHA 3GEBA 1K75A 5C4MA 2JJQA 1WUHS 3HKEB 3SVTA 1MB9A 3U7EB 3I6ZA 3JD0A 4LMAA 5EZSA 5J9FA 2GHIA 2Y1WA 3RC1A 1G20B 2FUG1 3HJFA 2TMYA 1QCZA 4MVJH 3AFMA 1PNQA 2VUIB 2CMHA 1JDNA 1UOOA 4EB6B 2G9ZA 3IA2A 2BR3A 4FGZA 2G63A 3BD8A 4RKQA 1BXGB 5JR3A 3L0PA 5KQSA 3A31A 5K05A 2Q5EA 1VLLA 4GMXA 4M99A 4NDNE 4XPIB 4ZAWA 1KNQA 1SIUA 1X14A 2R6JA 3VDQA 2JD2A 1UFVA 3V4PB 4ASUD 5K7SA 4QJ3A 3ZLVA 4PAGA 5JMPA 2WTXA 2EX1A 4D9JA 3DWFA 2F43B 2O0JA 2ZBGA 4FCWA 1QORA 3T7TA 2AQIA 2DGDA 3VH3A 4KUEA 4RBNA 1COWA 1RQLA 3F96A 4DE5A 2H2GA 3KPJA 4OU4A 1OBOA 2J4DA 3LYHA 4RMHA 3H2IA 4WKPA 4HQ6A 5LL6P 1OWMA 3EFOB 3ZD8A 4C3VA 4RDXA 1O54A 1WHSA 2ZYRA 3TJRA 4MRPA 2R97A 1TPZA 2HJWA 2O1SA 1UT5A 1NVFA 1UXOA 3HBLA 1P9OA 3OURA 3KBOA 3A25A 4NMWA 3OLXA 5DM2A 3V9PA 3ZV5A 3KEMA 2PS3A 3NGXA 1C9MA 5C46F 2XNKA 1EGHA 3RVSA 3TOZA 5L3SB 2OSBA 1GNSA 3HKBA 3MTAA 4O2RA 5B12A 4GW3A 2CCJA 5JSZB 5KMGB 3HUUA 4KV7A 4MQFA 3A36A 1ZO8A 2A0YA 2QZSA 5CIWA 4E21A 2WIFA 5CK4A 5K3FB 2AG6A 2XDAA 1L7VC 2GBPA 1E4OA 3LLVA 5D01A 4YT4A 1T8PA 5B1HA 5LA6A 3PHGA 4IJ6A 2ATIA 4QBGB 3TM5A 1HM5A 3SICE 3DLPX 4HK4A 4Q7QA 2HYDA 1ESDA 4N5NA 1RCTE 2I9PA 4K81B 4ASUA 2X5NA 3GMDA 1OLSA 4IIDA 3EZFA 2P2GA 3PEYA 4ND6A 3DMFA 1NAIA 3P27A 5LOVA 4LDZA 3BWDD 3U40A 1MP0A 3L7OA 1ZP6A 4F97A 3TNYA 4BUZA 4Q47A 2XZPA 2JH9A 3ROXA 1PR3A 4YCAA 4BVFA 1D4ZA 4V38A 3THYA 2XNDA 3R3JA 1NPYA 4Y1GA 2GX6A 1SVSA 3AK4A 4WZBA 3HHPA 2XUAA 1HLFA 1M54A 4K05A 3CVUA 4X71A 3QENA 2NW6A 1ZY2A 2HSEA 2W4QA 2A2ZA 4RULA 4YRKA 4AJIA 1GJRA 1AKEA 1G9XA 4CLEA 3NX4A 1R50A 2FX3A 3QFFA 5TPWB 2FUCA 4DJAA 1TFUA 1WSDA 2E4UA 3DHYA 3SFZA 1ZJYA 1R0KA 3QLVA 4Q3BA 1U1EA 2WUGA 4HDKA 4XZ3A 4ZK6A 3A1WA 1GQQA 1OFUA 1WULS 2WDZA 1ADJA 3TAUA 3NOQA 3ZEAA 2POCA 3JYQA 1ZW1A 1OYVA 2JGNA 3JWHA 2XRYA 4J1TA 2NU8B 1N5MA 3DL2A 1M1XB 5AJYA 4UM5A 2EEZA 3ZTWA 1Y4SA 2V65A 1V7ZA 3EG9A 4K6HA 4JJ4A 3CLUD 1L4YA 3HB7A 1ZMBA 3GUYA 1TZMA 3H9CA 1ZH6A 4EGCB 3UA3A 2O7VA 4US2R 2QUKA 2YZMA 4KBFA 3L6OO 4KXFB 4BCCA 3R6TA 2VDWA 3JQBC 4G4GA 1NSYA 4YMVA 2ABWA 3PPYA 1Y1KE 1XU4A 4KO8A 4O63O 4LCJA 1RM0A 2W2LA 3D7KA 3VNRA 1U9IC 3O21A 3GEIA 1DVRA 3GJ8A 3AW9A 4NCIA 4C3UA 4PGMA 1GQSA 1BXRB 1KZ4A 2TSYB 2ZPUA 5DZSA 2NUAB 4Y2JA 3GYGA 4HC4A 1Q0RA 1E5XA 3GJRA 2B21A 2XUFA 5EWMA 3EBPA 4O6VA 4E11A 4JZYA 2JH3A 1Y1TA 4J7CA 2QNBA 3NAZA 4PC1A 2WIKA 4PEVA 4IJKA 3G2PA 1PL0A 1ODJA 1ARZA 2XZTA 2AIRA 3JQ7A 4X1KA 2O5VA 2CT8A 2YHIB 2P5TB 3T0FA 1OIXA 4MR9B 1EXWA 3K8OE 4JVSB 3JVEA 2IYOA 5H3LA 4KZKA 3HL4A 3LVQE 3O8QA 1M8GA 4MWCA 2VZLA 3A3YA 3AIIA 2CLFB 4TZ0A 3RBXA 2FEKA 1ZD2P 1PEDA 3RUPA 3VBCA 1X0XA 4TTIA 1G5PA 1PSDA 1SVLA 2O07A 3BJZA 3PCXA 5TQ2B 5HR5A 2DKFA 2PLFA 2RCNA 4TZKA 1VI5A 1V5GA 1FQOA 2W2TA 4RPIA 1KYIA 3GZTB 4G3XA 1A7KA 4M9UA 2ZZNA 5A5FA 2HQRA 1CRLA 3E2PA 1TQDA 1M1UA 4BQIA 3W5AA 3WIEA 4OQZA 2YYAA 2B98A 4TRMA 1KC1A 1K5HA 1W4RA 1TGVA 1RPJA 2E9SA 5KTTA 2NU6B 1NKSA 3QFSA 5ELLA 3R74A 3ZVMA 4BFSA 3ZXYA 1XUOA 1C3EA 3WLIA 2G1PA 3THWA 3ZGZA 2GSDA 3LOQA 3V46A 1KS9A 3HE3A 3NHBA 4B3FX 3A6LA 1KFEB 4Q7KA 1J21A 3LP8A 3ZNNA 4XLLA 2YWGA 3LKDA 3ZY4A 3ONFA 3FAKA 4XQ9A 3RU2A 1DP4A 2HWKA 5TNXA 1CQIA 2COUA 4E31A 1ML4A 1EXMA 4MA4A 1BJRE 2CEKA 2GK4A 4F2WA 3ZY3A 3TSCA 1ZLXA 1A88A 1AGNA 2EZUA 3HCNA 5ULLA 4TT3D 2A1TS 1T9GS 1EQ2A 2GPJA 1KMIY 3DB2A 3VTZA 1I2ZA 5KSOA 3ZVKA 3HFGA 1QQ5A 5LP6C 3CF0A 2ATXA 4RTRA 1D2CA 1F51E 1PL7A 2A0WA 2JI4A 1L7QA 4U3JB 5B1IA 2D7JA 2DFKB 2A9OA 1U0EA 2EGHA 2NQ2C 3VPDA 1FFXB 3OJFA 4JQCA 4DDMA 5BNZA 1QPZA 1QLJA 3C3CA 3QBDA 4U8HA 1UAAA 3VU9B 2R0QC 2ADOA 3G2OA 4KBGA 2IYUA 2Q2QA 2YY7A 3ZZNA 3A9VA 4F7DA 3D6FA 3LV8A 2IA5A 1PK7A 3KSDO 4MYTA 1IHXA 4M0PA 1GLNA 1GOTA 4ETIA 1XTVA 1RYDA 2RBEA 3E5MA 4O1IA 4XIJA 3KPVA 1JF8A 2R1VB 3KVVA 5C7YA 4NSNA 1NBMD 2ZSDA 4F6RB 3EYWA 5F64A 3JD1A 3EGWA 3WY9A 5IVHA 1CZUA 5H9WA 3AG6A 4PO3X 1FFCA 5HF6A 1IZYA 1DXQA 1GRQA 3DDNA 1BYIA 5KYNA 5CHYA 4DXDA 2YXEA 3I58A 3MILA 4J0EA 5DP2A 4WINA 2VS1A 4B17A 1P8AA 4D02A 5JWOA 2OWDA 1QTRA 4YMWA 4M83A 2WA1A 4X7MA 3SY8A 3I0NA 5A3VA 3IUBA 3BJRA 2QI9C 3WNVA 1IUOA 2EZ9A 1WEKA 4FCCA 2VYQA 2OP0A 2WWXA 1U5CA 3F97A 3IP9A 4L0CA 1Z7BA 4WAUA 5AWFC 4OUDB 5HFJA 5B37A 2XBLA 3TKAA 2GBGA 5TY0A 4E1BA 3OCWA 3R7FA 1PYOA 1ZOIA 2WD7B 1XGKA 3B1VA 4OYHA 5SV2A 3UBMA 4DIEA 1BJKA 2EBFX 3EH1A 3FKSA 1Y42X 3LGSA 1W0CA 1UOQA 3FPFA 5LC1A 3BFPA 2O2EA 2PWZA 4TPKA 5C34B 1T9AA 3NCHA 4ANFA 4OHRA 4AMBA 2JFOA 3LNCA 3H42B 1L5VA 3QG5A 2UYGA 1LB1B 1OBVA 1Q1ZA 4Q03A 2QAGB 5LQAA 2QTFA 4QREA 2PT6A 3QPDA 5EIOA 1IC6A 3Q8MA 5E3JA 1J2YA 4NE7A 3RT1A 5DWDA 1BX3A 1TYZA 2VC2B 4HQ0A 3RJ5A 1X9GA 2AW5A 4W4TA 4CODB 5LN1A 1I9CA 1JHUA 1X1CA 3S0JA 1ODCA 2VQEB 1MKYA 1PE0A 4WACA 1EFPB 1QHSA 2ODAA 1LTHR 4KLRA 4D8YA 3IQGX 2FOXA 2GEUA 3ASYA 4YMHA 3ZD7A 4GMDA 3FAZA 3M6UA 2CSXA 2NO5A 3P97A 4B3DA 2CLSA 1PWHA 1CZNA 1HH4A 2B6HA 3EQ7A 4QNMA 3KHKA 3Q6MA 2I8LA 4WY8A 3TPFA 5ES4B 2DG2A 1KO8A 1LF0A 1SZCA 2IY7A 4QPNA 4NQZA 1D0SA 1DBIA 3M7IA 3QU5A 3LLMA 4I3GA 4ZO6A 1TIKA 5IC4A 3K7EA 3GLFE 4LE1A 4GWKA 3AEUB 2BDUA 3INYA 1G8JA 4B3JA 2AF3C 1L7RA 4GUDA 3QWIA 4KSYA 1ATIA 1DT3A 1DKOA 1N3LA 3AUSA 3OF5A 4JR2A 4K86A 1E9SA 2BCEA 3TOVA 4I5DA 4Q66C 1UJ4A 1CHNA 1TL7C 5LOVF 2UUCB 1S4MA 1XCGB 2FMHA 1NI5A 1XA4A 3GT0A 2GQ0A 7REQB 1YCHA 3IIEA 4YXWA 1ISSA 4JLVA 4BFLA 5K5EA 1JDVA 2V3WA 3QXXA 4C6HA 4EJSB 2GLXA 3QUTA 3KLPX 1HT0A 1WUKS 2C04A 3L0YA 3R5KA 1D2AA 1ULZA 2A9KA 4U5QA 3OSUA 4DMLA 4EMTA 5JXGA 1L2TA 4B82A 2B4YA 2EU8A 2HQBA 3KE8A 2ERXA 2HXGA 2MR6A 4P92A 4RKEA 6Q21A 3ND6A 3P32A 1Z45A 5AHOA 4BVAA 1AJEA 3R0ZA 3FPLA 3AWDA 2YWJA 2QTAA 3OBIA 4YV0A 3ILSA 4LZOA 4CDGA 3PDUA 3GVHA 3H3FA 1E1YA 1WLYA 1OAOA 4K9RA 4FGUA 1YDEA 4DQKA 4W6ZA 5FIUA 2L19A 1DFIA 4LOJA 4HUQA 3H5RA 2RC5A 5I7RA 4B6QA 3F6EX 2ZCVA 4ILKA 2HCBA 1KJNA 2FLKA 4I14A 3ESCA 4HRVA 1Z08A 4WDRA 4YJ3F 2KQUA 1BW9B 1GDHA 4BC0A 4E33A 5JMOA 1GA1A 1NJGA 3ES9A 3KXPA 5HKAA 1JBQA 1HGXA 5ES3A 3JSAA 4OQMA 5IJZA 1GVHA 1F20A 4OHZA 5AXCA 2H5LA 3PQ6A 3N2GA 2WZCA 4RO0A 3TYXA 3GHYA 2ZJYA 5AVQA 1DU4A 5JV5A 2PUAA 1V8PA 4Q4AA 4PG8A 1OB2A 4W7SA 4JJ6A 2VSNA 3D54D 5A1TA 5EJ8A 3C3WA 2EERA 3OC6A 2G36A 3BK1A 1F8UA 1OE0A 3QVOA 1ST2A 5C4IA 4BE9A 3SX2A 1UXKA 1JG7A 2JAQA 5EKDA 9MHTA 3G0CA 5IXSA 3T4XA 1UWCA 3AHCA 1OIVA 1AF7A 2IIVA 5KAPA 1OR8A 5ALOA 5A1JA 2CHFA 3EQ8A 1UL1X 3ZGLA 1P2UA 3ZCTA 4FUQA 3PUXA 3AF6A 2JHFA 4GX1A 1RKQA 3OFNA 1LDYA 3UXEA 4W1PA 4D9BA 5TLSA 4PGHA 3FVTA 5A3SA 3DMNA 4A8JB 4CEIB 1D2HA 1GEGA 1YRQA 2FEOA 2FW6A 5DYNA 1OYWA 5CDUA 1XDUA 4MIOA 2CXUA 4R8SA 5IUKC 3L05A 4J9VA 5AM2A 2VRCD 1EHYA 2C4MA 1USUA 1DTEA 2O57A 1E2MA 3I42A 4DQ0A 4YUXA 1X38A 2V7UA 1UC9A 4M1ZA 2VPPA 3MJFA 5T64A 1M6VB 1SK8A 3G0DA 1P19A 1OZGA 4U7PB 2FDCA 5CTJA 1KAOA 1EUYA 5K0LA 2NZ2A 4JI0B 1U2DA 2BM1A 4Y0NA 3RODA 4RZIA 3GRFA 4G63A 4LQLA 4RYLA 4C3ZA 3HBFA 1J6UA 5E1OA 1E1RD 2GF2A 1WUIS 3NV9A 4O2AA 2E5WA 2FQYA 2JJ2D 1G3QA 4QWWA 3LTNC 5EQFA 2QV7A 2CLOB 5D5PA 1JILA 3ZW9A 3LPLA 3ZKWB 4BLUA 3UHPA 3KT8A 4BNZA 4EB3A 3N2KB 3SLRA 5DRYA 1C80A 4LBVA 1P9LA 1XIVA 1YVRA 1OC2A 3BREA 5DM1A 3L7DA 3RVLA 3S2YA 3SMQA 3WDLA 1HSOA 2OZEA 2MSCB 1DKLA 3NJ8A 3IHTA 5AK3A 1OLXB 3STUA 5F98A 5AKKA 4JCOA 3WL3A 4DV7B 4IAOA 3RJTA 3B5IA 3ANMA 1XELA 4N9WA 1R8SA 1T9HA 5I48A 5HJ5A 2ZQ5A 4CL3A 5FOQA 1VBMA 2CUZA 2FV8A 1RQRA 4L2IA 1NXTA 5HFNA 3RCBA 3VYSB 2JVKA 3HKDB 4JI2B 3K70D 1KGDA 3WS7A 1OI2A 1EJ0A 2E6UX 4MUFA 3DEZA 1DC6A 1NVDA 2OLKA 3WOVA 1ORRA 4G9EA 1G8PA 1ACMA 5SZIA 1H22A 2E2WA 4QYTA 1N2HA 1P9NA 2C98A 2KLHA 4HGQA 4RA9A 3OKAA 2VAMA 3EF1A 5DNVA 1WS6A 4KQ2A 4UUQA 221PA 2JJ1D 2R79A 3CV3A 2G06A 2F48A 1GZDA 3R3ZA 1CVIA 2PT5A 3DSRA 3G7SA 3FZEA 3T4UA 1DTSA 1P0IA 4QO7A 5BNWA 2OQVA 1NMSA 2AJCA 4R81A 2OHFA 4Z49A 3GN2A 1H3EA 1E59A 1RXEA 2C4WA 4IL5A 4QVIA 9LDBA 1XLWA 3GDFA 3IP8A 3OF3A 1TZCA 1ZCFA 4XW2A 5DTRA 2R6ZA 1S8OA 3C15C 4XFDA 3VPCA 1BFKA 3IV7A 3KR2A 4B33A 4FNAA 2NZXA 3GOHA 2PVPA 3Q98A 4W5HA 5BO5A 1KJWA 1R4ZA 1EINA 4ND8B 4BN4A 1G0OA 1JVSA 1VHWA 3AY7A 1BU5A 1P81A 3L8CA 4RH3A 4ZCQA 3RWOA 3WWDA 4A0RA 5IJ9A 3WGIA 3EWAA 5EC8A 2FPXA 2F8LA 4AECA 1II8A 4BNJA 4XCVA 5E6SB 1GRCA 1NPTO 4XWAA 4EFNA 2GAFA 3L4SO 1DZIA 3MRSA 3ZWOA 5FL7A 1YRAA 1NVKA 3OU2A 2NO1A 4KO2S 1XPRA 4MUIA 2D1RA 3A1DA 2FUKA 4AMGA 5AOCA 4WVLA 4E5KA 3LUKA 3JQDA 4NIMA 1L6RA 1O6FA 4ZT7A 3SZOA 3RR2A 2QHXA 4TYNA 3JAKB 4D3FA 3ELWA 3KKPA 2VHJA 1M74A 1U7HA 4D3SA 1LQ2A 1HYBA 1ZLYA 1YC2A 4FDTA 2VK1A 1P91A 2C8JA 3E3AA 1CRZA 5F33A 3OQHA 4AMYA 2Q45A 3BZUA 3EXFB 4JQZA 4Y6SA 3Q7SA 3TRDA 3VC7A 4XYLA 3F2VA 2YVKA 5B4TA 5HRUA 3SIPA 4E2WA 3HDQA 5EZ6B 1DRKA 3BCUA 2ECOA 1SVIA 3GIDA 2RI0A 4INPA 3K0FB 5EJ4A 3CM0A 3O4RA 4QULA 5EJ6A 4KE8A 2GPWA 3GRCA 5I4BA 5GJCA 1RZUA 4J1QA 4MB0A 4FFSA 5LCXA 3LY9A 2G1KA 1N0HA 3VR4A 4HQNA 1RVDA 2XYVA 3GCGA 1TJPB 3OIFA 3O9VA 4H7JA 5FULA 4LOHA 1SKUA 1UINA 1EJ6A 1WXWA 1JIKA 2MJLA 4KNWA 2ZJ7A 1DDOA 4G84A 1W8IA 1N6IA 2Q29A 3L18A 4J0JA 4EHBA 3G0OA 5T57A 1QVWA 3P2IA 4TS9A 2O8CB 3MWEA 5AHRA 3GLHA 2QLTA 1M67A 3TI9A 2FQWA 1RPNA 4B09A 3KQVA 2FP4A 1GQFA 3DOHA 5EEHA 2H51A 1VP3A 2IODA 4PO8A 5AUNB 3GUVA 1FDWA 1O0SA 5KNDD 2BFFA 2LCIA 3GI1A 2JDIA 2ZE6A 3MRTA 5JWHA 4IIJF 4I8IA 2CFTA 2KBEA 1Y3AA 2RH4A 2Y4OA 3IDZA 3WSVA 2XT9A 1O3YA 4LCBA 4MARA 3UT0A 1V8BA 4LWQA 1K08A 1MABA 5BXYA 3SQWA 3X0DA 3CKYA 4HGYA 1W75A 3AOEC 4B3IA 4KFSA 4Z4HA 3W4IA 2ZSUA 3GCDA 1DWOA 3N5CA 3I92A 4RY0A 4TZ6A 4NYJQ 4JUDX 2VP5A 3OM1A 4ZOLA 3QMPA 3DXFA 4IVQA 4Q9HA 5E9WA 3PD7A 3C3DA 4L8GA 1RAFA 3ITKA 4OQYA 1DEHA 1JFFB 1YKFA 4EW1A 2AG8A 3PHHA 3QE4A 4KR3A 1IM2A 1X8KA 5ALWA 4EMBA 1MJGA 4TMXA 5JVDF 4Z2AA 4GPAA 1JR3E 2O2DA 4UJ3A 1H6BA 1N4AA 3W2GA 2E0IA 1OVGA 1PGOA 1T8RA 1Q16A 1X9IA 1KDPA 3DNFA 2GN6A 3QKSA 4LI0A 5B53A 1Q6ZA 3COSA 1LH0A 4MYDA 4W82A 3UC9A 2RSLA 3ZPXA 4KPGA 1QVZA 1W94A 4WV3A 2ZUTA 4OI0A 2G17A 3R7SA 1WDTA 5KX5A 1KI6B 1H8HA 4HLCA 1W88A 5A03A 5C1OA 1V3TA 4HN9A 1G17A 1P4RA 4KLNA 3V6LA 4CIDA 2FW9A 3HB0A 4GL2A 4DLVA 5FFMA 2IFTA 1FE8A 1GG8A 5AJZA 3HCCA 3EBOA 1XP8A 4JYCA 4G5XA 1EU1A 3HCAA 5J59A 3ROMA 8ATCA 2MMCA 3A06A 1Q19A 3AOGA 4HNGA 5T7BA 4MW0A 1YS9A 3AJ9A 1XCJA 821PA 4LHVA 2OLJA 2W6JD 2C9MA 4WXRA 4IQ8A 4IV0A 4N03A 4E6PA 3K1ZA 1JLRA 2QM8A 2WB2A 3U44A 1Q0UA 1XZNA 3AU8A 1KVRA 4D6PA 5KNCH 1V1RB 1DKRA 3AR3A 4GOMD 2P90A 4H3HB 1IJBA 3KVRA 4B45A 3H9GA 2B4AA 4Z9XA 4DMCA 2VPTA 1HDEA 4I5FA 1XF9A 3FOAA 3M5DA 4IKEA 3FRIA 3MUEA 1YXMA 3A1VA 1QGOA 3C3YA 2A57A 3E48A 2B9VA 1UKVY 2NZ8A 3MSXA 4KQJA 4XIFA 4DCJA 2ZR0A 4JJEA 1I2AA 4Q05A 2HA6A 3LHFA 1X1RA 1YMUA 4RABA 4AS1A 3WBJA 3TOSA 4W9RA 1Z0DA 4WQMA 1V25A 3CNEA 2Q5HA 4C7BA 1NV8A 2W71A 1HNNA 1I33A 2DFNA 1MZVA 3HBAA 3OM9A 4LOIA 4ZAFA 3TBFA 1DQYA 2XNDD 1ZUHA 1HKHA 1OV6A 4N49A 4GFDA 3V8NA 2YL2A 5EIXA 2OB1A 2WUVA 3MPUA 1AS0A 3SZRA 4LSGA 1PKEA 3OZCA 1MRZA 3BXHA 1VL8A 2VP2A 3VPXA 2BDEA 4URZR 4C78A 1M2JA 3II6X 3ZZMA 5JROA 3K0AB 4FD3A 4GMKA 4DREA 1YR7A 4KHZA 2DUJA 2YICA 2DFLA 1YJBA 4DIDA 5AUOB 2Z3ZA 5EJ7A 1YBMA 3WGNA 4BWVA 3NHAA 4YRZA 1BGWA 1CQXA 3Q8LA 5DX1A 4XVUA 4C6TA 2NO9A 2OV2A 1FTGA 3OZEA 3H1BA 3OPYI 1VCMA 5IVPA 4YR7A 4KRFA 2O3SA 1GGMA 1JKJA 1CF9A 2R6R1 3FNEA 2ZREA 5EPEA 1ZHHA 3BA6A 1EBBA 1UEIA 1YONA 2VWGA 1X7WB 4QXAA 2EWMA 3OKPA 5CDHA 2EVWX 4TMVA 1T4CB 2O5EA 3OX2A 2O0LA 2YJNA 4D3ZA 3U2QA 2A67A 3ZDZB 4DJFC 4ZYYA 2W6CX 4QRHA 1IM8A 5K0CA 2H3HA 1UK9A 2HSJA 3F6SA 3MGGA 1G18A 5A5VA 5C8YF 2CDNA 3NHWA 1OFGA 4XWTA 1J97A 5DK6A 3UN1A 3UPUA 4WLUA 4FEGA 3TVYA 2QP3A 2XADA 3VKVA 1HFJA 1OI3A 4AKTA 5I5EA 1G6Q1 1R8JA 3AOEA 2BEUA 1RP7A 3B7GA 4HAYA 1G5QA 1MGOA 2RHBA 1A7UA 5DHSA 3HR8A 3O1LA 4ZC8A 3PDIA 2ID7A 1TM4E 1CEYA 1I6MA 4EI9A 1MU0A 1OVMA 1GFIA 2P3SA 3A37A 1PJBA 3L46A 1SCIA 1YZGA 3OCZA 5IPFA 5B58C 1QC5A 4MJLA 2NO6A 2VHXA 4PZ9A 1SUEA 2WILA 4XGNA 4B4VA 2HF2A 3I9KA 4PRYA 5EWMB 5TJ9A 4AF6A 2AUMA 4IO0A 1QHHA 3SD7A 3X1KA 3ENQA 4BFVA 1VCNA 2OORC 1Y8RB 4NCHA 2AX4A 2JLSA 1DWPA 1X7ZB 2WWTA 3TINA 4Z51A 2SKEA 3N8IA 2WZDA 1BH6A 3D0QA 1EX9A 5C8VA 1QZZA 3O1JC 3BT7A 2C94A 4D0LB 4Y2QA 5KX5B 3ZGOA 4DDKA 3JAKA 4M0LA 1JHYA 1ONOA 1EB8A 3AEQA 3MTGA 2PQ2A 5HQTA 2ZXFA 4G0ZA 3K6SA 3KDSE 4RK5A 1NVBA 4J6FA 4QSHA 5IT9A 1I3CA 1TAQA 5KS2A 5A62A 3IIJA 1VOTA 3PKJA 3U3XA 5JS8A 1N2CB 3NBXX 4ILEA 2YWXA 3HLTA 4LNUA 1N3BA 2ZP1A 3RSZA 4CVNA 5H3CA 2V6MA 2YJTD 1LFDB 3OLQA 4PLGA 5EXTA 5GONF 5M3BA 3FH0A 3S2SA 4BDTA 3W5CA 2B83A 1C30A 3QTBA 4MUHA 1KPIA 3W1EA 3HY6A 5HQ3A 5HILA 3U31A 3WLHA 3R9XA 4CG2A 2HI0A 4BJ1A 4HDRA 4J0GA 4IWNA 5AM5A 1NNEA 5DFAA 4DZTA 2J3KA 1NONA 2PNFA 1T5BA 5DN9A 4HGRA 1IE3A 3GGSA 3GLQA 2IPLA 1XVUA 5AM0A 3S6JA 4A0HA 1WL8A 2HLPA 1NN1A 3ED1A 3EQZA 4YQZA 3V7UA 1P2GA 2YZ2A 2GMWA 4GI3A 5MGNA 1JLSA 1NN3A 4Q9NA 3TZCA 4D97A 4NBLA 5AKYA 5EAIA 3CC8A 4PXAA 2QN6A 3K96A 2DHDA 3LXXA 1HWYA 3RIGA 2H2WA 3OP4A 4UTOA 1EESA 1JIQA 3BIFA 4UM7A 4WWHA 2OAQ1 3L4JA 3G85A 2ZW9A 2KSQA 2NUTB 3SGLA 3VSDA 5K99A 5IYZB 2IBSA 4Y9SA 4N0DA 2QUBA 4X45A 4OGGA 5TVKA 3KSBC 3UNXA 4XEHA 4B7CA 1VM6A 1O03A 2VPYA 3JPWA 3CRNA 3QNUA 2GEDA 4GEKA 3SJAA 3SMVA 1QX3A 4JR0A 1E1MA 3ELUA 5FXMA 2J3QA 3JQPA 3K0CA 3NBKA 3SQNA 4CIVA 4WXMA 3UHAA 4DABA 3O75A 4DMUB 1DXYA 5FWYB 4KPUB 5EHQA 4PZLA 3INRA 3PDCA 5SZKB 5DNEA 1E8NA 4PPYA 2QN3A 3OPVA 3GJ4A 1XZHA 1N2IA 2OG1A 1NATA 1KOJA 3HJNA 3IEPA 4IG9A 3BBPA 5EUMA 4CWAA 1BE1A 1FNDA 3N6RA 5I7FA 4TLDA 9LDTA 3K9LA 4FLEA 3O82A 3ID6C 3DZHA 1BKDR 2NO0A 1KOLA 1K2WA 3RPEA 4MS3A 4DCUA 4LDJA 3V48A 4JC4A 2RFLA 3DBVO 4V0ME 3GG2A 3WGOA 4DR6B 5CTAA 1I1NA 2JZCA 3S27A 3U3JA 3CLSD 3LIIA 1D2MA 1RXVA 3R6DA 3SYNA 3MERA 4F4UA 3RKUA 3ZE9A 4X41A 4WA7A 1MPTA 2H4YA 2PKEA 5JNWA 1SZPA 1IHYA 3I12A 1JLLB 3OESA 5JYCA 2DTXA 2V1UA 1RAHA 2P1DA 1PVVA 1E32A 2QYHA 1FS6A 4J4BA 3U7GA 5DBHX 4QBKA 3C5WP 4YY3B 5ED0A 5IYZA 1Z75A 4UUMA 2F9MA 4FJ0A 5J43A 4HDAA 1S2IA 2DYKA 2HRCA 3NNDA 5H83A 4G5GA 4MKIA 4QPJC 4R1NA 2VFAA 1YZUA 3TVDA 3BSYA 3PC4A 3ZHTA 5A0TA 1H23A 1XLUA 1LRKA 5DCUA 4LRSB 5FPHA 1PZEA 4ZU3A 1YQQA 2WFMA 1BH2A 3SX4A 2RG7A 3BULA 4Q19A 1KSFX 4G0UA 4CU5A 1JQLB 3QEJA 4FBMA 1KO5A 2Q2WA 3QWHA 1BS2A 4Z86A 1IFXA 3ETGA 2ZIFA 4OHVA 1N2SA 3VNQA 5C1PA 3GPCA 2FE4A 2I29A 1BYUA 2HLDA 4KYIB 3RC8A 3CZ9A 2WBLC 1VMKA 1YB5A 2XHZA 3VNSA 1XQWA 1Q1GA 1ABFA 3LK7A 4HVCA 1EJBA 5JC1A 1KP3A 2P0AA 1V9LA 3QPAA 3GC6A 3QPVA 1YRWA 3O9ZA 1EUCB 1QX4A 3M49A 4YCNA 2PX5A 1H0RA 3BQ9A 2I3BA 1SAYA 3DBOB 3P52A 1VPEA 4KTVE 1AOXA 1HSZA 5CA0F 2F4VB 2TMGA 1O77A 3SC2B 1LV8A 1P0PA 3KYCB 1W581 3O03A 3UF0A 2NT3A 4N6GA 3CVXA 1Z5ZA 1H2HA 3EJ6A 3IT2A 2KX7A 1ADCA 2AZTA 3L01A 3T7JA 2YHUA 2ZWMA 2MMGA 1RXYA 1VECA 3OJEA 1P73A 2I78A 4XTCS 1T0HB 1RJDA 2WZBA 4J4TA 1BEEA 4RE5A 1F0YA 2C54A 4UUBA 3U1TA 4ND1A 1EVJA 2B61A 4K9SA 4DJ5X 4ER0A 1Q5PA 4WSOA 1N9GB 2N1BA 3DFKA 3EUFA 1TTQB 1A4XA 4P5DA 4PFQA 3BWBA 1EZZA 2VT2A 2YN2A 3PT5A 4O59O 3EXAA 4R3NA 3SYMA 721PA 5IAKA 4RESA 2MSKA 1SB8A 5HKKD 1J0BA 1YQTA 1E61A 1TMOA 2Q5LA 1KQ3A 1OKKD 2XUZA 4Q3DA 3RK0A 5LD2B 4ZXPA 2RH5A 2GPYA 4C89A 3EVGA 2CNWA 3WYCA 3F8TA 3FOWA 4GGOA 4PX2A 4X60A 3T6KA 4BPBA 3BH6A 2O7NA 1ZESA 3JRWA 1KVUA 5F1YA 1KZ6A 1AU9A 1NNSA 1RHUA 3HV0A 4F4IA 2ZJ2A 4OGFA 2XUHA 3CT6A 1U2EA 3CUYA 1GVNB 5CCDA 1Z8FA 1ZM3A 4IIJA 3F5FA 1SUWA 5JALA 1N3IA 4A26A 1THGA 4LJKA 4A2CA 2BGRA 4MAFA 4S2UA 4BUCA 1DB3A 3FMGA 2WTBA 1RBZA 1BWQA 1DAEA 2BMEA 4H2DA 4FZ5A 3T38A 3EXG2 5DVZA 5F2EA 1E3JA 1CY6A 5FB3A 2BGIA 3RIEA 3SVLA 4IIEA 1USVA 4G81A 1W6RA 4EGAA 2IYAA 5HQJA 2VZ0A 3DWGA 3R8CA 2ZSIA 4XR4A 3GNQA 4HL6A 5EHXA 1IIRA 1X13A 4NEGA 3VU0A 2PUVA 2Y1GA 4B7UA 2BEJA 1KDTA 1VRCA 3C8DA 4PR3A 5DLPA 3TX2A 3FUXA 3P20A 2ZU6A 2HIMA 3HZZA 3NTQA 4UHJA 5ESDA 4O25A 1R66A 4AWBA 1CY8A 4MCHA 5JANA 2XRZA 2PMKA 2VF8A 621PA 2O8BA 1IVNA 4EA6A 2HQOA 4DMMA 3L7BA 2HHHB 3R5FA 2NTNA 5FLEX 5AW3A 4EKNB 4QM7A 1UBGA 3CMMA 4HRAA 2XD4A 4J4HA 3CH5A 4TXLA 5IULC 3M4XA 5KX5F 2Y68A 4FFBB 1T3GA 2O4UX 2ZUSA 3LC7O 3OQMA 4QWMA 1BHJA 1MAVA 3KYDB 3OZGA 3AEKA 4RHYA 2OBBA 4BO3A 2HV9A 1XMIA 5HCIA 4LZAA 1TLTA 2I7XA 1V8ZA 2YIVX 5BR7A 3UAYA 2FZCA 2CW5A 2R65A 4IEFB 5I9BA 4DS3A 2J0SA 4UHBA 2VA9A 3JX9A 4L1KA 2FPPB 1WXGA 1ZUWA 2VDKB 4Q34A 4OP2A 4FNMA 1WCWA 2C5FA 3AC0A 3HXPA 2FN4A 4CQMB 1E5DA 2G1JA 1OU0A 3K5HA 4Y6PA 1H0HA 3C3EA 4I1RA 4IG4A 4OAQA 4P53A 1L8XA 5EE0A 3VSBA 3WFZA 3K8QA 3AINA 3VR6H 4AF7A 3MWLA 5KKNB 2JLAA 2ZVQX 4I36A 2PJUA 1NVAA 2WIDA 2HREA 5COBA 2HHLA 5BN4B 3T7EA 4BU0A 2D0PB 2RONA 4F5WA 3IEVA 2VHUA 3VR5A 4YV7A 1GAEO 1ML3A 1D1TA 4AY6A 3DVLA 4X1YB 2FQ1A 4HLNA 4AU1A 2H7YA 4BFXA 3PPXA 4CNQA 2IH4A 4KE7A 3THOA 5CDTA 2XXAB 2BBOA 1FJ2A 1P1JA 1TX4B 1VLJA 3HUDA 4J3FA 2IHBA 4NEHB 5C8YB 3WV5A 1UJCA 2P9YA 2XRFA 2HW8A 4MV3A 4J43A 4KH0A 2X8AA 3Q8KA 4O4HA 5JH7A 2CXNA 4U6QA 1EK5A 2ZYVX 4BV9A 3O8DA 1H9BA 1F6DA 3L0DA 5DT9A 2R11A 4HFJA 2IYWA 1L4BA 3BMNB 1TYDE 2NQTA 3SPXA 2ZUVA 1IY8A 1EFLA 3MJRA 1VMIA 1CFZA 1GAJA 4WK2B 1TJ4A 1WOMA 4NMHA 2FCRA 2ODQA 4UVDA 3PQ2A 3OU6A 3CJTA 2HCTA 1W48A 3I45A 3K09A 4W5WA 5T6MA 1SCJA 4DCMA 5AW5A 1RCFA 2BFWA 4LFBB 4C7OA 1GGNA 1B76A 1UP6A 5A9SA 1SUCA 2OBFA 4WW0A 5BN1A 4P7GA 3RSSA 1BKYA 1RXWA 2I3GA 1YQUA 4L75A 3RAPR 4G0NA 4MKFA 4EJSA 1PJLA 2DMRA 2HRQA 1CF4A 4E2XA 4CMJA 2BUAA 2QVLA 2FRVA 1SZJG 2WSSA 2YTZA 1B8NA 3N2ZB 1X7YA 4NZPA 5KOHB 4ALLA 1C0KA 3RC7A 5ALVA 2NTEA 4MXDA 1IAVA 4PNPA 1P6UA 1WSAA 3CB2A 1Z56C 3TQQA 1TD9A 2JHGA 2NYVA 5LZ4A 3W8NA 4B2PA 1E96A 1R12A 4XRGA 3WE7A 4ZHSA 1C4WA 4DUZB 2OCLA 4M9SA 5IJXA 1AA6A 1J39A 2XZLA 4X24A 3H3JA 4BMPB 2CFRA 1WHTA 4I46A 1W2GA 4RAOA 1PIWA 3FHCB 5D5HA 2EP5A 2I4TA 1GRRA 1Q44A 3DO5A 3K32A 5I9IA 1L1RA 1QF7A 1LLCA 3SEFA 4PN7A 4W5TA 2AKAB 2V98A 3EQ2A 5ER9A 4TVKA 1UFRA 3RGWS 4O4JB 3FPCA 1RS0A 3IIMA 4QDXA 2PUCA 5EWLA 4B7XA 3DZGA 3NORA 3T7RA 4XM1A 4BEBA 2V3VA 2YVUA 3FR7A 2OGUA 4HQRA 4RM3A 4D56A 1E8MA 2XJ9A 3C3JA 3WNDA 3JZDA 3KU4A 2B1QA 1C7JA 4A8PA 2ZB8A 1JQEA 5HMMA 1MQ8B 1E89A 4G23A 1LZLA 3SS8A 2BMFA 3ANSA 5DU2A 4JUBA 3INNA 1TW3A 2G6BA 2YHAA 4K9PA 5JI2E 4OX9B 1T2AA 1WAMA 3EZGA 3NWJA 4TX1A 1C9DB 2ZFUA 3NDPA 1IY0A 13PKA 1E77A 1IPHA 4ERNA 4F3YA 3JS5A 4ZOEA 4B3MB 1EFCA 3PJGA 1FDIA 3VJLA 2HRZA 1A9QA 2QTGA 2P9TA 3ASZA 4GPD1 4B2YA 3M5WA 1SXPA 2VZ8A 4QD3A 4AZ0B 3I3OA 3BMQB 4CIXA 3NP7A 4E2YA 3HGQA 4UPEA 4OHXA 3KLNA 3OEWA 1NN0A 2C7VA 2P9GA 2QN2A 4PWZA 4QGAA 4G2TA 4U7FA 4AP9A 1TYBE 2CF5A 2QVXX 2X1MA 1E9FA 2G67A 2ETXA 2W58A 2WSMA 3L4BA 3OA0A 5GM2A 3CUEF 3GRVA 5BQ3A 5CG1A 3B2QA 3IPLA 3BTVA 3D31A 3A1UA 3NTVA 4L0MA 4X1OA 1O4VA 4C0HA 4YUVA 1NASA 4M7OA 3PUYA 3ZDFA 2EW2A 1XD9A 3KTDA 1Q6YA 3TTWA 2YY5A 1BEZA 3SJBA 5CA0B 1R64A 1DC5A 5KJFA 2B1JA 2RH9B 3WL6A 4F3CA 3SS9X 3E22A 2GASA 3SZMA 3TZEA 1DHRA 2HXYA 5CB6A 1Y8QA 2ZQYA 3GL9A 3V8PA 4QFBA 2BFOA 5C32A 1SOMA 2JLZA 2QM3A 1SC4A 5CGQB 3UAGA 3T52A 3DBRB 2PFGA 3TZLA 1H1LB 3SHWA 1DT5A 4D0NA 121PA 3B38A 1U3GA 2RB4A 3WBBA 2C5HA 2WPDD 3KTFA 3VTFA 4J49A 3ZXXA 3T61A 3OQVA 2FZVA 2OL4A 2FSUA 3PX3A 4MKXA 4OI2A 4TUYF 2EF0A 4QODA 3RUHA 4C43A 1ZU5A 5BV1A 4IXTA 1ADFA 2CK3D 2JASA 3SFTA 1AMOA 3IKLA 2ZCUA 3UWPA 2DTDA 1BCRA 5IM4F 3IPRA 4L6IA 3ICEA 3ESBA 2QSUA 3BJMA 2BGMA 4MTLA 1QG2A 2GESA 3G9UA 3GFTA 1KAQA 1DRUA 1HE1C 1QMGA 2FHSA 1GAQA 4PYNA 1BOFA 4Q4LA 1EVZA 2GBFA 3WKAA 4MPDA 3EPRA 4DMGA 3QLJA 4ZVOA 4GVXA 4KP7A 5AVTA 3D7NA 1P7VA 3KR9A 1FTQA 1OU4A 3QA9A 5KU1A 3PLRA 1VSVA 2OECA 4GLFA 1WXHA 3RAEC 1Y5NA 1AO0A 1OA1A 1OWOA 4K7JA 4C0JA 2COKA 1O94A 2IZ6A 1DAIA 1KI3A 2M1ZA 3TRJA 3ZY2A 2D1SA 2P8JA 3LLCA 2I54A 4PTYA 1SOVA 2W2QA 1T2EA 4PFSA 1EG7A 3VHQA 2VTBA 3H9JA 4YXWD 3PL5A 2X4DA 1A2BA 1NVGA 2ZJZA 3DWIA 3OFVA 5DHRA 4ACBA 1AZWA 5ALHA 2BTEA 2AYYA 2QVBA 3BIJA 5JDCC 3OE1A 1MW9X 3I52A 3WK7A 2KS6A 4ENPA 5GZ3A 3BHMA 3V4RA 1CDZA 3M89A 3GEMA 4YX9A 2WYOA 2G70A 4UREA 2PKXA 3LQ1A 3Q40A 3LOPA 3QHQA 1ZUNB 2IHUA 2CV2A 1VDZA 3KZMA 1M3SA 1G4AE 4JJ8A 4MUBA 1P44A 1WZCA 3TPCA 5MDHA 4O2AB 5B3JA 4JJ7A 2H1OA 1SXJB 2A5JA 3DM9B 1X7XB 3CYFA 5C3UA 1VHLA 1JIXA 3Q85A 1YR8A 2BCJQ 3V1LA 1Q14A 3ZQUA 2EP8A 4MWSA 1CUUA 1CP3A 1MXHA 3U16A 1FRVA 3OEEA 1HRKA 4MVJF 4NAVA 1NKTA 3EGXB 3WK5A 4ZTZB 1BVHA 4KR6A 3CVWA 4KXXA 3K2BA 1UADA 3U09A 1B41A 1JJBA 2XD9A 3P9YA 3RRJA 2B30A 2PWPA 1S3GA 2Y71A 3AETB 5BRNA 1PNVA 2ZJ4A 3IEIA 1R1DA 1WOYA 3FB1A 4BO2A 4OAPA 1BZYA 2AUTA 4IZIA 2VQSA 3C0KA 3SLKA 1R0WA 1AV7A 2AFRA 2V45A 4EMSA 3EXHC 2HR1A 3QU2A 4MQLA 4CGZA 5HG0A 1BXZA 1XTPA 2VDWB 3ZHVA 5DYGA 1M2VB 1JA0A 4I4TB 2CL6X 1QLWA 3UAWA 4JOCA 1E63A 2Y1OA 3LRPA 4ICIA 1WVGA 3ADCA 1HZZC 1NVMB 1C0PA 2FWPA 2GEFA 4UCQA 4HX9A 2PRSA 2GJ9A 2WIGA 1GKIA 1MO4A 1DEXA 3GDHA 5DTJA 3OTOB 3DF9A 2PWAA 4RDIA 3OO0A 5IJ0B 5CU7A 5MF6A 2ASVA 3TNDA 3FHOA 2O2GA 2QW0X 2X5KO 2YV3A 1QB7A 4WXHA 3M6IA 3WRVA 4IX9A 4JDPA 4X62B 1GZSA 1X42A 2LCFA 3DHWC 1OH7A 4JLUA 4FYKA 4EP1A 2W2PA 4DQXA 2R4TA 4C7JA 1KS2A 4ZZ2A 3DTVB 3OIDA 4ZDJA 1MO3A 5GQSA 2OCBA 5CLLA 1IWBB 3H5OA 3GPLA 2XYHA 2Y1XA 4KXVA 1QQTA 4ITUA 3WLAA 1QIJA 3DW1X 3P4UA 1E7WA 4M1SA 3I9JA 2OM6A 3CX4A 2ATVA 2E82A 1Z4OA 3DZIA 3E9QA 4QU5A 3ZWXA 4L6CA 4DQUA 3HYCA 5AW1A 4DZZA 3LD9A 4UU7A 3ICQB 3QHAA 3PHBE 4I3HA 2QN7A 4CG3A 3ITEA 2CJPA 3OFKA 1DC8A 4HS9A 4YCJA 1S7CA 2HN9A 5I01A 5K8UA 2O6HA 1ECCA 2ZJ3A 1ZJ6A 1IXKA 3B7WA 3BGOS 4K9DA 5NULA 1FXSA 2DT5A 3L43A 3SIWA 1YF3A 3N8DA 3ZYZA 4GOLD 3W3AH 2ZOSA 3SEZA 3ICPA 3KDAA 2NUTA 2Y76A 2CGEA 3Q3HA 1HT2E 1E79A 4I1IA 1EK1A 2QI9F 3FIUA 4KYVA 1MH9A 2ZUDA 5JNSA 3OZBA 5EWLB 1J9EA 2Z09A 1H66A 2IYSA 3TW6A 1EDOA 3TLMA 1VCHA 2C77A 4LQ4A 4UTXA 3FOEC 3D1LA 3FDIA 4AKHA 1ENOA 3G89A 3HY4A 1FJGB 1FU7A 3PJDA 3L8MA 3Q4GA 4XX1A 1OIWA 5TS2A 3WNQA 3FHLA 3FETA 4R69A 3HM9A 1B4DA 2EQAA 3EUAA 4D0RA 5LP1A 1BXGA 3KO8A 4KWEA 5BNFA 1P0FA 1WTCA 3SAJA 2AOTA 3QLUA 1QOPB 1VYUA 2QZZA 3ZLJA 4OVKA 3NT2A 1JQBA 3DZKA 5K0JA 1ZM2A 4IHJA 4LE0A 3ZK9A 4UE3S 1S3SA 1CS4C 2ZBQA 2EFCB 5DASA 2X0FA 4ZAGA 4TYMA 2YWBA 4H35A 4WY5A 4Y8VA 3RYCB 4BMVA 2FPWA 5FF9A 4OJNA 5LZ7A 4UBJA 4HCJA 1TQ6A 4XM0A 3TLAA 4KFRA 3WQRA 1CQPA 2D59A 3DLAA 5L4LA 4WHMA 3LWZA 4WXEA 1BTOA 2C9YA 2ZYAA 4QXOA 3WIUA 2GFIA 4UTRA 2DXIA 4YJ3B 4RPHA 1U2GC 4NU8X 3VR3D 2Q1WA 4ZI2A 5LP6F 1Z5OA 2PYDA 5KNBD 5KVQA 1H0KA 2ZBDA 1O0CA 1P5JA 5GMOA 5JE8A 3EB9A 3EEBA 3F0TA 4HDCA 5D1HA 2O0KA 4RACA 3ZIAD 3WGLA 1Z4MA 1S2DA 2UAGA 5EERA 2XW6A 1E0AA 1VJ1A 3DQZA 4B4OA 2C83A 4J75A 1NUQA 4Q9LA 3MQ4A 2WYUA 4YCBA 3X43A 5C8ZA 4CEIA 2MWMA 3P7MA 5TMBA 3QEBZ 4QBTA 3VSAA 4CMCA 3JWGA 1BG6A 6GPBA 4KQMA 2ZSKA 1BS9A 5FWNA 2DBVO 3PC8C 1XHEA 4O4IB 1I4OA 1Y1LA 4DIMA 2AQHA 1YWGO 1RQNA 4ZU6X 2GZMA 3DT9A 4JLJA 2X58A 5IW8A 4N54A 2CV0A 3AVXA 3AQ4A 4XR9A 2X77A 2Q9BA 3KKMA 4NFLA 4Q01A 2N1MA 2ZE7A 3L6DA 4P84A 3X2FA 1KJZA 4LISA 3NWOA 5BQOA 2V9ZA 1GYPA 1L4GA 3I6YA 1CJBA 2ZAYA 1KTVA 1YB2A 5G3YA 3L84A 3PKZA 3CZPA 2R6AA 1JMKC 5EJMA 5ED4A 1RTKA 2DVMA 2EAUA 1N6OA 1W76A 4Z9BA 2NVUA 1V47A 3NEJA 2DUNA 2JGKA 1L5HB 1SBCA 3D3WA 3GFPA 3I2HA 3I9V1 4HAWA 5KNBA 3KLOA 2C9ZA 2N47A 2WIBA 5EJ5A 5L8VA 1Q57A 1EZ1A 5KSWB 4DA9A 1JNXX 4EHIA 4P2BA 5FBQB 2JJMA 5B2FA 4S24A 2GN8A 3CCBA 2FG6C 4MW9A 4QTXA 2DT8A 5DRTA 1WV1A 3IYLW 3X1MA 2Y1FA 2GHRA 4HKTA 4RKRA 1TMGE 4Q7LA 1SQFA 2HDOA 3Q12A 3M6FA 5SYMA 4ZKDA 1NI4A 3DTNA 1A9OA 4CU2A 5BUCA 4RF2A 4X6LA 3SHTA 1V5WA 3WWYA 2CJWB 2RG1A 2A1TR 3ZBQA 3TCKA 3DZDA 3EXG1 2J48A 5M5BA 5JISA 3I2YX 4Q00A 3RRZA 1Y6QA 4XQCA 2GH1A 3R9IA 1M0TA 4HY3A 9ABPA 4JB8A 4B32A 5CCXA 1L3BA 2JAOA 2JKZA 1CS0A 2XB2A 2AXEA 1R9MA 3DE3X 5JT1A 1U6JA 4OHFA 1BGXT 1UFQA 3CO5A 2OV4A 1O9BA 4RJJA 1E2BA 2JGEA 2ZYIA 1WXFA 4E22A 1PJCA 1TK3A 4UCFA 3G13A 1MX9A 5CJPA 4QFCA 4EK9A 4QUAA 1GQYA 1UDBA 3W7BA 1JSLA 3L0CA 2YV5A 1XT6A 4R2JA 4V3BA 4M0KA 1PFQA 1ESNA 1Y5RA 1KXZA 2Y77A 3CEMA 3HCEA 1DNPA 3E35A 1X94A 2AA3A 2F90A 3A3OA 2R8OA 1XTZA 4L6AA 1SC9A 3KSZO 4XUDA 1AUPA 5AVRA 1Z83A 4JLAA 5FV4A 1GKYA 2QUHA 4E32A 4PSDA 2WC1A 4PZ0A 4WN9B 1A8QA 1FZQA 1YZVA 5F52A 1IOZA 2LDBA 3OBBA 2QMEA 1ZGJA 1B8UA 1G8AA 1RC0A 5JVDA 2RJOA 4OSPA 3ZJ4A 5BV7A 3LF2A 1ZEJA 4PAQA 1UJ5A 4L16A 4MS4A 4ZVMA 4FXOA 4DRYA 4RLHA 4G9GA 5CXXA 4IXNA 1ZOPA 5I4KA 1ISMA 4Y7DA 5DLYA 4FLFA 1R16A 3RTEA 4PC3A 3ZIUA 4OHCA 3AO0B 4Y30A 2AKEA 2C7QA 1XVLA 1FF9A 3AF0A 1T8UA 4RQUA 5LDGA 5EZYF 1JWAB 3LHDA 1YJ8A 1E4VA 4K2HA 3SOZA 2FGKA 3UH1A 2RHJA 1X74A 2AF4C 5IS2A 5HF8A 2I3DA 4YP5A 3SS7X 3STXA 4Y9RA 3LCVB 4JUCA 5EHGA 3B3JA 1FA9A 4FKZA 2WOOA 3OUUA 4RK6A 4RV9A 4P5EA 4NARA 1YMQA 5HF5A 3VO2A 3MD9A 1B15A 1N2JA 2I0FA 3PVSA 1NQXA 3AUXA 3G6WA 4G86A 3I6MA 4HWOA 1VKZA 1KMCA 1KDOA 1JG6A 1GXSA 5I7WA 4CGYA 4S04A 3LQKA 3BGSA 3JD4A 4AG5A 2GF9A 1FTSA 1SUPA 1EX6A 4LYDA 1Y6ZA 2WF5A 3LDHA 4O0LA 1CJCA 1Q1EA 4HEA6 3QEAZ 4BNGA 4OYLA 1KAEA 1LK5A 3E5HA 3DEYX 3FNIA 1P2FA 3LOUA 4J0IA 4X90A 2QZ4A 4FQ7A 4EELA 5IWAB 4AZSA 2F6RA 1JEJA 3SR0A 3FW1A 1OFUX 3ZQJA 4UMDA 1Y5IA 1SXIA 3RG8A 1D2RA 4RQTA 3K94A 3O90A 4KN5A 3FDZB 4YJ2B 3E9EA 1F48A 4URWR 2R5WA 4IDPA 2IX3A 4N39A 1OW3B 2NSJA 1DQRA 1LQTA 1NP7A 3HDVA 4JNKA 4OMFG 3ZN2A 3F6BX 4HF7A 2MHCA 4M0MA 2WKRA 2P9FA 4U5XA 1QNLA 1QV6A 4GNRA 3I1JA 4QA9A 3U17A 5IM4A 4KN8A 1XRNA 4EKGA 1K4MA 1H9AA 1J0DA 3QUBA 5LNK1 4ES6A 4WH0A 3RK4A 1EX1A 3CZRA 1NMEA 3WBKA 5BVGA 2D1FA 5HM8A 4BXOB 3ZDDA 4LHYA 1Q0TA 1KAGA 4XDGA 4OHKA 4RFSB 3F2IA 3ZD6A 1E20A 4ND7A 1CYEA 3FFWA 4GR4A 1VZ3A 4ZOQI 1T2DA 4IMJB 4Z54A 3T06B 3ELDA 4TRNA 2FKNA 3LT5A 2D54A 4P4TA 4ZQIA 4PV7A 3ZE8A 4ZYWA 1XLVA 2IYLD 4G0WA 1P29A 2W6OA 4TL9A 3TMYA 4I66A 1J1IA 3GGDA 4BFYA 5CBPB 4M7WA 3DZBA 2CL5A 3IMKA 5BVGB 2JJYA 3OTGA 2A0FA 2UYCA 1UT6A 1HI9A 2WKPA 2Z2KA 2HLHA 4M46A 3EVAA 1ZAYA 2BSQA 2H2FA 1LPNA 2BEVA 1Z5VA 2W6PA 1F2TB 2QLMA 1QO0D 1OI4A 4GQAA 1EFAA 2EJUA 2GNAA 2RK6A 1D5CA 4OYRA 1KPGA 3RIXA 4FIZA 1EFTA 4LE2A 5BSVA 1YDHA 5HUJA 2Q4TA 2ZYSA 4E5NA 4ZRMA 1D7AA 1GU0A 2RGWA 3PI7A 2XB8A 1AY0A 4ZGBA 1EQAA 2G4VA 4HUJA 1N1EA 3QU9A 4WERA 2QW1A 1BMDA 4EO4A 1M66A 4BVKA 2Y4NA 4AKEA 3W5BA 1M10A 3IIKA 1REQA 2CLEB 3PNQA 3S5UA 2X0IA 3NKVA 4FVTA 4RD2A 3EDRA 4AROA 2E1PA 3ORHA 4QTTB 3P2YA 2EF1A 4PHGA 4D98A 2YJ4A 2CFSA 1DL5A 1NSFA 5DDIP 3IQHX 4AJKA 4II2A 1II8B 4DTIA 4KV9A 4OP3A 4POOA 2Y9MB 3AT1A 2EFGA 3BSSA 3F6RA 3E7PA 5DWQA 4F4FA 2IEBA 1Y63A 1B6RA 2VHQA 3HI6A 1VB5A 2HNBA 1QYCA 3C3XA 4RKFA 2UKDA 2FN8A 5LLSA 3FFBA 3UOAB 1JWLA 3O1IC 1REQB 4CKWA 4RTJA 4LJ6A 4QFMA 4CCYB 5HJ7A 4NRDA 3ANTA 1LJLA 5CYGA 3WHKA 4H1VA 5AW7A 1XVTA 1DX6A 2XWBF 4ZVRA 4J0KA 3DOFA 3EMKA 1TJYA 3CUTA 1TDJA 3EG5A 3N0WA 1YVPA 4AS3A 4RTNA 4OXIA 2G28A 3H5LA 4ME6A 2DFVA 2RMKA 4ZEXA 1KYVA 2BEVB 2CZQA 2W2XA 3IOCA 2YXDA 3G3EA 2J3HA 3D4LA 2MSEB 2ZIUB 2XCOA 1P1HA 4HJRA 4MJ3A 4ZO7A 2QRMA 4I55A 1ADBA 1GT91 2I33A 4ARZB 2JH8A 4U7WA 5HJEA 3L1JA 1GKKA 5ER6A 5JD6A 1X1TA 1C1DA 2VJMA 4WZ6A 3USCS 1JRLA 1FQKA 1V9SA 4WFQA 3F9RA 3QSYA 1U2ZA 3IULA 5CVVA 4HPXB 4M6WA 1VKHA 4NJEA 1E4EB 2O14A 2I2FA 4U9UA 3HZHA 4KVZA 1Z68A 2H4XA 5A9TA 1P7WA 4H6WA 1C7EA 4B9AA 3JWIA 1DADA 3QKWA 4P80A 5PGMA 4RQAA 3GG9A 4W8GA 5JD4A 5ERGB 3BD9A 2SECE 3L7IA 3CR7A 2C2ZA 2FHPA 3AHDA 3H2KA 2VWHA 3HR7A 3L7JA 3OZIA 3WLEA 4DXHA 5AJTA 4FKMA 2GJSA 2QL5A 4HWTA 4QAJA 4U6NA 5IP5A 4MQUA 4L50A 5B36A 1UK6A 2A3NA 1CDDA 4HZIA 3AHIA 2XUOA 5FBRB 5F7JA 2QOEA 2WLSA 2YS6A 5FOWA 1YHZA 3BWXA 5AK5A 3KEOA 2X2PA 3IBFA 2J3EA 1PTJC 4B84A 3LVRE 2PCJA 5JXIA 1CR4A 1EE2A 1ZICA 3RHTA 2D2FA 5FBKA 1NYTA 1E1QA 4LXGA 1D2GA 5IF3A 2RGAA 5FWYA 5KNDA 4ZQEA 3EW9A 1UJ2A 1YL7A 1SHZA 2IZ0A 3UGQA 4ENRA 4UARA 2BD0A 2QR2A 4D4HA 1PJRA 4PS0A 3OE4A 4DLBA 4OHPA 1MNAA 4I8XA 4REQB 2BMDA 2Q99A 3ZWWA 2RHMA 3S2ZA 2WT4A 2ZUWA 3SG0A 3V2GA 5C5CA 3W1VA 1EDEA 2PZEA 1JU3A 3NKLA 2QN1A 3AM3A 5AXDA 2H1WA 1NDHA 2XCLA 4L9AA 2PFSA 2W6NA 2Z58A 3JQFA 2CSUA 2PUTA 2JGDA 4ND4A 2Z57A 4ZTBA 1OFIA 2H07A 4IOJA 3VBEA 1MPXA 1PEYA 1TM2A 3I34X 1W4ZA 4D43A 1KOFA 2R00A 1PGNA 2C5LA 3ZJTA 4LHXA 4I4TF 3EAQA 3ZQ4A 2EHJA 2ZRMA 2NAFA 2VDUE 3LC2O 5C7OO 2FPRA 4JBLA 2DHRA 5B5SA 1I2DA 2A35A 4HEHA 4M1OA 5B1DA 3T1HB 1YIOA 2A8YA 2BTOA 4KL8S 2CNNA 3FTCA 1W25A 3PBKA 1A9SA 2Q9UA 1P45A 1AE1A 1YDGA 3O9MA 1UXIA 3VPAA 2XWSA 4LOKA 4CIAA 5CB8A 4GOKA 3KCNA 2ZIXB 5CM9C 1NF8A 4KK4A 1O57A 3NAGA 2PKCA 4UBLA 3Q3CA 4I1VA 5TV2A <