3TI9A

Crystal structure of the basic protease bprb from the ovine footrot pathogen, dichelobacter nodosus
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
341
structure length
341
Chain Sequence
APNDPSYRQQWHYFSNYGVKADKVWDRGFTGQGVVVSVVDTGILDHVDLNGNMLPGYDFISSAPKARDGDQRDNNPADEGDWFDNWDCGGYPDPRREKRFSTWHGSHVAGTIAAVTNNGVGVAGVAYGAKVIPVRVLGKCGGYDSDITDGMYWSAGGHIDGVPDNQNPAQVINMSLGGDGDCSQSSQRIIDKTTNLGALIVIAAGNENQDASRTWPSSCNNVLSVGATTPKGKRAPFSNYGARVHLAAPGTNILSTIDVGQAGPVRSSYGMKAGTSMAAPHVSGVAALVISAANSIGKTLTPSELSDILVRTTSRFNGRLDRGLGSGIVDANAAVNAVLGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine protease
publication title S1 Pocket of a Bacterially Derived Subtilisin-like Protease Underpins Effective Tissue Destruction.
pubmed doi rcsb
source organism Dichelobacter nodosus
total genus 125
structure length 341
sequence length 341
ec nomenclature
pdb deposition date 2011-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3ti9A00
3LPAA 1MPTA 1SUEA 3I30X 3TI7A 3VYVA 4B5LA 1C9JA 3PRKE 2QTWB 1OYVA 3DW1X 5FFNA 3D9QX 2PYZA 4GI3A 1SBHA 4FONA 3Q5GA 3F7OA 5I9SA 2B6NA 1BFKA 2WV7A 3SICE 1AF4A 4RYDA 5B1DA 1SIOA 3D43A 4OMCA 4YN3A 2PMWB 4CG0A 4CFYA 4OMDA 3GCXA 1WMFA 4DWWA 3VHQA 1GTG1 1HT3A 3A3NA 3GT4A 2ZWOA 4NE9A 2E1PA 2X8JB 1SIBE 1CNMA 1ST2A 1SUDA 4JP8A 4NE7A 1T1GA 2HPZA 1AV7A 1R0RE 3PTLA 3DWEX 2V8BA 1GNSA 1SUAA 4KB5A 5CW1A 1YJCA 3DDZX 1AK9A 2PWAA 1R64A 1WMDA 1WSDA 1KDZA 1SELA 1OT5A 3LPCA 1TK2A 3F49S 2PQ2A 1Y3DE 3DYBA 1KE1A 3DE2X 1EGQA 5JXGA 4K8RB 1AH2A 4WOCA 1AVTA 3QTLA 2Z2YA 3I2YX 3CO0S 3DVQX 1S01A 3LPDA 1TM7E 2ST1A 2Z30A 5K7SA 1BE8A 4DJ5X 3BPSA 3A3OA 1SBNE 3ZXXA 1XF1A 5ARDA 5ARBA 1GT91 5JXJA 3H42B 1SPBS 4H6WA 4WOBA 1NLUA 3AFGA 3DE6X 3DW3X 1LW6E 2XRMA 1KDYA 1GTJ1 1SCNE 2IY9A 3TECE 1SBCA 1TM5E 4AKTA 1SBTA 4KPGA 1TM1E 3F7MA 3BX1A 2W2NA 3VTAA 3GT3A 3QFHA 2WWTA 3HJRA 4M1ZA 2TECE 2ID8A 2Z56A 2DP4E 5AQEA 1BE6A 1AU9A 3EDYA 5ARCA 1TM3E 2IXTA 5JXIA 5FBZA 3WQBA 3A3PA 3WIVA 3TI9A 3EIFA 1V5IA 4ZOQI 1Y3CE 2ZRQA 1P7VA 4MZDA 1WMEA 2SBTA 1GNVA 3EE6A 1ZVJA 1NDQA 2ID4A 1C3LA 1VSBA 1GA1A 5JMOA 2Z2ZA 1YJAA 3VSBA 1P7WA 3DE5X 1Y1KE 1GA6A 4DZTA 2W2QA 3L1KA 2DUJA 3GCWA 1PTKA 2Z58A 1T1IA 5JXHA 3DE0X 1PEKE 1SCDA 2Z57A 1SCJA 3OSZA 1DBIA 5AVJA 4AKSA 2PRKA 2PKCA 3UNXA 1EA7A 2GKOA 4NMXB 3WIUA 1SN7A 1IAVA 3Q40A 1SH7A 3WHIA 3QMPA 1BFUA 1CSEE 4ZARA 1GA4A 1V6CA 1Q5PA 2WUWE 1KE2A 1THMA 3AJ8A 2DQKA 3DVSX 4OV6B 1R6VA 2G4VA 1SUCA 1IC6A 2P4EA 1C9NA 3I37X 4C3VA 1GCIA 3DE3X 2XTJA 3T41A 1Y3BE 1MEEA 4CFZA 1S02A 1SCBA 1ST3A 1Y3FE 1PFGA 1SUBA 4LVNA 2W2MA 1TM4E 1KDVA 1GTL1 2W2OA 1TECE 5AVKA 3SQOA 2SECE 3BGOS 5B1EA 1Y48E 3VV2A 1YU6A 3P5BA 4HVLA 5FAXA 1JEAA 4J94A 4H6XA 3I34X 1Y4DE 1SCAA 1SUPA 2WUVA 1OYOA 1SIUA 2X8JA 1NDUA 3DE7X 4BWGA 3ZXYA 1AQNA 1Y33E 4I0WB 1DUIA 2ZWPA 1TO2E 1BH6A 4C3UA 1T1EA 2Z2XA 3LXUX 3CNQS 4KG7A 5SICE 4HX2A 3DVRX 1Y4AE 1ZVKA 1YJBA 3DE4X 1WVMA 4Z2AA 1SBIA 1SVNA 2SICE 3DE1X 1S2NA 1P8JA 5AMXA 2SNIE 4LVOA 1Y9ZA 2W2PA 1A2QA 1PJ8A 2PWBA 1TMGE 4H6VA 3AJ9A 1TO1E 1UBNA 3VV3A 2HD4A 1BJRE 1C9MA 1Y34E
chains in the Genus database with same CATH superfamily
1UXIA 2CJWB 2GEKA 1V95A 3E53A 1RRFA 4UBIA 2H2GA 3I30X 3WRXC 3GA0A 3JD2A 1MAHA 4KO3S 4WI1A 3KWMA 3MMSA 3HU3A 3N0XA 1T5HX 2UUBB 2QJOA 3FOEC 4YJ3A 3QUAA 4INPA 2ET6A 1Z28A 5K3SA 3D8SA 4PFKA 4HB3A 1W94A 4PG4A 2DHRA 3UAGA 3H2JA 4QVKA 3F6BX 3CX8A 3MELA 5IT5A 2XZDA 4XGQA 4HLDA 1DKOA 4DB4A 1DAFA 3H6GA 3K71B 1QF7A 1FFDA 2WG0A 4HX9A 1LV8A 2QRMA 2OPBA 4KCGA 1SKBA 1QVZA 3C5WP 4AF6A 1YB7A 1S96A 3QYJA 4B3IA 4CMKA 4M1MA 1BE1A 3I3SR 4OGGA 3LKDA 4UMEA 4ENRA 1GZ3A 4J76A 3R0ZA 1UWVA 3C98A 1QG2A 3GG9A 4HFJA 3SIWA 2P9EA 5EKSA 1K7YA 2HGSA 3TDNA 3KSZO 4RKQA 2ZYSA 2OORC 2UYQA 4S1VA 3GMSA 4AXXA 3PGLA 3RHFA 5C8YB 2G5CA 3H9JA 1DIBA 2VTVA 2SCUA 3MRSA 1QVWA 4P4SA 1EJ2A 3GELA 2OM6A 5CVCA 3FOFC 1VCIA 1E1DA 2QLBA 4EOGA 3GYBA 4DAOA 1LPOA 3KDAA 2XKAA 3AHEA 2A0YA 4BB0A 1MVNA 1XJQA 2HMAA 3DZKA 3EVZA 3HR4A 4OHPA 1FPMA 2P6NA 2X3FA 3LK7A 3HFRA 3MIIA 3PLNA 4CMGA 4XSHA 4TZ0A 2OAQ1 2YHUA 3ITEA 1H1DA 1MQ9A 2CLCX 3CO5A 5EE5B 1RJ9B 1NVKA 3JQGA 4AY4A 3ZKWB 3FUWA 5IUNC 4R1LA 4P54A 4WV3A 1QKJA 2W2LD 5JADA 1RQLA 1ZJ4A 2HA5A 1HMPA 1HE4A 1C0IA 1C8BA 1GNLA 3HUUA 3IUEA 3L6OO 1NWHA 2E7ZA 2I4NA 1T5TA 1XELA 4GI5A 4LWQA 4MRRA 4UMVA 2NSYA 5EHXA 2R8XA 1CUGA 1IEQA 1Z74A 1XQXA 5DHPA 1VLQA 2CMFA 1GNSA 3MJ4A 1KVQA 1MDBA 4TQGA 3ZS8A 5AM2A 1OH6A 2B35A 4XFKA 4BBPA 3ISVA 1YTUA 1E64A 4XUCA 1S3GA 4QNRA 4BVFA 2WSBA 3AEUA 3FYHA 1A9ZA 4PV7A 4XWYA 4DUGD 1CDDA 2ZBUA 3Q7IA 4I1UA 1WE2A 3M9WA 4WK4B 3ZE7A 2O7VA 5A4FS 4R0NA 1R16A 3AP2A 1OWOA 4D81A 2PZKA 2GHQA 4MW1A 1RYDA 3PHJA 4MI1A 3ZU2A 2J0EA 4OHOA 1VA5A 4IX9A 4UOEA 5K0TA 1LX6A 1OBFO 1NULA 2P9GA 4MS4A 3R9XB 4RETA 2VJBA 2H3HA 4HDRB 3NRJA 4R54A 3TLGB 2XECA 1GR1A 3S2EA 3OWOA 2XGJA 3FSGA 1S1MA 1GUYA 3Q7RA 3RGGA 1JQBA 2X14A 4Y67A 2ZUUA 1CRQA 5JI3E 3CVOA 2AR7A 5FQNA 2O7RA 1GYRA 3GN1A 3O38A 1N5LA 3NOOA 1QGYA 3W7AA 3LPCA 3HG7A 4FKMA 4C6RA 2PXCA 4UJ3A 1LBIA 1KY5A 1ZY2A 1QM5A 5EP3A 5HFNA 3LWZA 2BN4A 1L8XA 3EIEA 2IV3A 1EGQA 1N9GB 1X42A 2HCRA 2R1TA 3VJRA 2JLVA 1KDOA 4K8RB 1VTKA 5ULLA 3VU8A 3H84A 3D7KA 2QM7A 2YWEA 1RE1A 2I4IA 4WIAA 1H22A 2RHGB 3PITA 5CVJA 3IO5A 1NQVA 3WOHA 3ZIAA 3VR6A 1V16B 5IF3A 2NQ2C 2Q5FA 4XR9A 4KQJA 3FPEA 1DTSA 1T4BA 2VT3A 2PH3A 2M2IA 3RRNA 4EPYA 1FYFA 4PBSA 5CLFA 4QO7A 5C9ZA 3THXA 2O2JA 5L3ZA 1ZIOA 2C2BA 4MVJG 5F7JA 1T43A 1PHRA 2PQMA 4BBJA 4RSMA 5G2OA 2HEIA 3QV1A 1V71A 2P75A 2Q5LA 9ABPA 1Q16A 2XA1A 4YR7A 2O8CB 2YWDA 4REQA 5G1OA 2WU4A 3TOZA 3ONEA 3AERA 2WAXA 3OQVA 1F4LA 1OAOA 3VISA 5CLQA 5I8WA 1TTTA 2ID9A 3U4GA 1CR2A 2G5GX 1COZA 3MRTA 4HPWA 5AW2A 3ETNA 3I0ZA 3GLFE 1RHJA 2B5WA 5JDCC 5LZ9A 4Y2HA 3JAKA 5JFTA 2NZJA 2IRWA 1WR8A 1BMFA 4BYMA 2J6BA 3RSZA 1S7CA 4I1YA 5K3CA 3FOZA 2HBRA 3K96A 4EJSB 2X0RA 5KQRA 1H2BA 2EYUA 4Q1VA 4B1FA 4BNKA 1OXUA 1DBWA 2BGIA 3L6CA 3D7NA 2V7XA 2G83A 1T5BA 3D6MA 2AFHA 1FS6A 1GUZA 2FOXA 1QU3A 1JLRA 3WLIA 3E3OA 1V9LA 1HYEA 3K9LA 1RWBA 4W7HA 1LZKA 4MYSA 1SKMA 3KALA 1KRXA 4IZHA 3P0FA 4XVCA 1TYCA 1AGRA 2A1UA 4OXKA 2P9ZA 4FC6A 3ETLA 1NA5A 4GI7A 4KNYA 4FYYA 2FN8A 1MAVA 3WWPA 5I7HA 3GJSA 3ZW8A 1S8OA 2HLHA 5GOTA 3CT6A 1HLFA 1O89A 3BK7A 2CLLB 1GFSA 1OX4A 4PTYA 1JB1A 3DZ8A 4G8BA 2ESRA 1M34B 2EJBA 4JYPA 2PZEA 1NHWA 1P45A 3RABA 3UMVA 4ZJYA 4YAUA 4LC1A 4J6FA 4G4GA 4XD7A 4CMHA 2HSJA 3FMFA 5FPTA 1AB6A 1U3CA 1Z2DA 1LPPA 1XNGA 5IVIA 2Q4OA 1X3SA 4EF6A 2VF4X 1YUMA 2XR1A 4AURA 1R3DA 2NIPA 2W2NA 5CCDA 3ZOZA 5E1OA 4FKZA 4MP8A 1DU4A 1TKAA 4OB6A 5JY1A 4OU4A 1FX1A 3HKBB 1EVKA 1E6MA 3K3PA 3ZE6A 2IXDA 1WF3A 2CXPA 2PT9A 1K5DA 1Y1TA 4D46A 1FTWA 2ZWVA 1J2JA 3MLAA 1JFTA 5TVGA 1OREA 2A5FA 2X5NA 3UHOA 4JV5B 2BFFA 4FSXA 4BFWA 3BMCB 2Z8YA 4GYKA 1D6MA 1A3CA 2E4ZA 3U49A 1Z7EA 3WB1A 2EU8A 4Z4QA 1OZHA 2PGOA 3MC1A 1MTOA 3WXMA 2XCQA 3SWWA 4ZCPA 3FUTA 5K0LA 1E2LA 1OZAA 2CYBA 4DA0A 4D26A 3O31A 3P1JA 1E1RD 3P0IA 3BBPA 1F4PA 3F9CA 1WCXA 4C14A 3UJBA 3J80A 4TXNA 3CYFA 5AVVA 2IXTA 3D5EA 5JRZA 2AYYA 4G0NA 2V55B 1BCSB 1XDBA 2FWAA 3A70A 4XVRA 3ELBA 2WVAA 2YFHA 3IH5A 1TOAA 2JL1A 1VXRA 3PQ5A 3WR5A 1KOLA 1CYEA 5AJZA 3IP3A 1T9ZA 4A03A 2CFRA 2IVZA 3IOBA 2FF5A 1F9EA 4BJ1A 5JYBA 1RAGA 1Z6QA 3VYRB 3WAGA 1KKUA 1RT9A 3MMNA 4K6GA 1PFYA 1WXIA 3CLTC 5FA6A 4OYYA 1XPJA 5TJHA 1WDWB 2AFVA 1VIYA 2I7TA 2NQ8A 1S3IA 2G0AA 3OJLA 4WE3A 1DIGA 5EIFA 1XZMA 3VKVA 4O4IB 3VOAA 2O23A 4EZBA 4TXHA 1WXWA 3KV1A 4D0RA 1QG4A 4RTKA 5AHOA 1YFKA 2ISSD 5ALFA 4RVDA 3RI3A 3UF0A 1O95D 4BGVA 1TIPA 1L4NA 1DQNA 1FUUA 1NXWA 1JEQA 1QMPA 4FJ2A 4WN3A 4CLRB 1H6BA 3JRXA 1DGQA 3Q6IA 4E5KA 3V5NA 5IAJA 4M0MA 3NGXA 1KDTA 1B6SA 3TKLA 2Y1XA 1OY1A 3LWDA 5LQDA 2MSKA 3OT1A 4K5QA 5BRJA 3C3KA 3ZWNA 4M1EA 5I9LA 3C4VA 3R3YA 3F2VA 4RYLA 3IJ5A 2CXXA 4KDCA 3VPSA 4Y2XA 1TKBA 1UZNA 3V8QA 3PHBE 1R0XA 3TNJA 4YUAA 1QQAA 5JYEA 1BS9A 5JHGB 1L5RA 2UZ0A 1SY7A 3CLKA 1Z6AA 2NU7A 2QE7A 5FIUA 5HJ5A 2VQSA 3O2JA 2FQYA 3U0BA 9MHTA 1UQRA 4YHBA 2CHFA 5FBWB 1E79D 3R20A 4U7FA 2ERXA 2FOLA 4YQYA 1KY2A 3QFFA 3WIBA 1W59A 2I67A 4FFRA 2WU0A 3EARA 3KOXA 4QGBA 5AVJA 4AY2A 3JQEA 4HLCA 4A6XA 3K70B 3M2PA 4ND8B 2H2FA 4Z3KA 2VH5R 2Q2QA 1EM6A 1N6PA 2FJPA 4HD8A 4ZQBA 1E7MA 4ZU6X 5HFJA 2IF2A 3RRXA 1MW8X 3FG9A 4U00A 1U99A 2NU8B 4OFBA 4E03A 3DZBA 1BXRA 1JMYA 2XNHA 4D4KA 1FZTA 4FFPA 4QUEA 3TQRA 1JHUA 1XXHB 1OTYA 4FT4A 4GKAA 2ZT8A 4KBGA 1L9KA 3AEYA 1RYYA 3H5TA 1NBEA 3EEYA 4W8GA 4RXTA 5DASA 5ALJA 5DSZA 3N0TA 4JUBA 3CBQA 4D9GA 2RI1A 4D25A 1Y7HA 4MW4A 5AK6A 1UFVA 4KFSA 4YRRA 4BLUA 4UASA 4HAWA 4X1IA 4JL8A 2ZBDA 4J2OA 3GK3A 1Q5PA 5ALRA 3EXEA 2ZCUA 4MCIA 2IHJA 4D92A 1T0PA 4FB5A 3UPUA 4DF3A 4LCBA 4DL9A 4CEIA 2H17A 2I76A 3JYQA 1PJ2A 1F3LA 1PV1A 1M7HA 2AW3A 2ZB4A 4PO9A 1YL6A 2GCEA 2AYZA 4YP6A 5HUHA 4HFMA 4BPBA 3ESXA 1J09A 2VPPA 1Z9BA 2XGSA 3OUTA 2XQVA 1OIWA 1PJCA 5F52A 3A9WA 1KYYA 2QTRA 1QG6A 2CLHB 5HNKA 3U4QB 2J1LA 3I2IA 4C0BA 5E4FA 4PPQA 1QFXA 1MR3F 1RRGA 2FPLA 3N70A 1KSFX 4WLEA 5HRCA 4RY2A 4CIVA 1A98A 2BZ0A 2EEZA 3AF1A 3EQZA 3MCVA 3P2KA 1K3UB 4DEVA 4DG5A 5H8WA 4ZK6A 3IPRA 1MW9X 2GZ3A 4HP8A 3SJZA 2OWEA 1HG0A 1BYIA 2AH5A 2X1MA 4HQOA 4MB0A 5J2TA 4B0PA 4RCYA 4NDAA 5KNBD 3RRYA 3QEMB 3D6TB 3C3BA 3ORRA 4OJTA 3F1LA 5DGHA 4FCTA 5IJXA 2IU3A 3TPFA 3UMCA 4ENVA 2AUNA 2XYPA 4C7XA 8MHTA 1QH8A 3WBFA 2QRGA 3TQIA 5U9CA 3CB4A 3OEEA 1ORIA 3I8XA 2EZ9A 3G8YA 3JQ8B 4BFTA 4BNTA 1ECGA 1JYFA 1QWOA 2AS0A 1XVLA 1POWA 3JWGA 3JZFA 4PSDA 2BRUC 1NXTA 3LC1O 3VNQA 4J16C 1K08A 3WB2A 2CHUA 3ILVA 5D84A 2QP9X 4B3RB 2Q4DA 1Q2XA 2D2FA 2O8BA 2PKQP 5P21A 1J5XA 1JSRA 3MHPA 3NHYA 4QOJA 2IU0A 2RKOA 2P0AA 2BFPA 4LUCA 1K9SA 4QD3A 1SHLA 3A1CA 5CBPA 5JD5A 3H1GA 3I2JA 4G97A 3JAMA 4ZQGA 3DLBA 3QXXA 4Q3DA 5LU8A 3I9NA 4HB2A 2V98A 4EA7A 2BZGA 2FR0A 5FXMA 1SMKA 2F8LA 1W2WB 3PNBA 4RIIA 4AJ1A 1DJPA 5T8KC 5IJWA 3DMDA 2J9GA 1GQQA 2Z1MA 3BKWA 1RQXA 2W9XA 3ID6C 2WMOB 4KE7A 4X3OA 2ZRJA 1LDBA 1AS0A 2WSLA 2XZTA 2ZBEA 1OB5A 4WD3A 1PIWA 1AZLA 1QHIA 2JZCA 5DM70 1M6VB 4MI6A 3D02A 1BS1A 1US8B 5EG5A 1CPYA 1JDJA 2AZMA 4LRWA 3JSXA 1C1YA 2R97A 1IJEA 2ZWPA 3ZWVA 1QZTA 1TW3A 2ZM6B 2RGAA 5FI3A 4RTSA 4MV8A 3ICEA 4ND6A 4BMXA 4EP1A 2O2HA 4OJYA 3ZWMA 3NETA 2RHMA 1U6IA 3COWA 1UBCA 1BKYA 1H2RS 2B2NA 4MR8B 3LHDA 2BIFA 3Q88A 4XW2A 5DX1A 3U48A 1O0BA 1QP4A 4XVHA 5UKDA 5I9IA 3H13A 1HFKA 1RHRA 4HZUB 5EZYA 1KSHA 3T7IA 4R98A 3KP1A 2G9NA 4NVRA 3UH1A 4E94A 2XT9A 2IQIA 1GLGA 5IKMA 4UUNA 5AHXA 4UBNA 1M67A 4B2IA 3R7LA 1X1DA 4YJGB 2O2CA 1KMMA 2SICE 2BFBA 3V9PA 1JTEA 3WKCA 1HQKA 1FU7A 1HQCA 4R7GA 3UUWA 4D9CA 4DR7B 3ZK7A 1DINA 1M2HA 3H2IA 4AAYA 1OJLA 2JLZA 4EX6A 3OU2A 4HDKA 1I3LA 1WB4A 4Y1EA 3S68A 4OHUA 2J30A 4OQXA 2BBOA 4IJUA 2QORA 2EL9A 2HTFA 4PZLA 4RNDB 1N2GA 1GPH1 1K0UA 2JFYA 2J0UB 4LRYA 1LZLA 2ZANA 2RHTA 3BMNB 4ZVOA 2QT9A 3O8QB 2RHOA 1DUVG 1XTIA 1XQ1A 3A4IA 4A8PA 1G5PA 4M54A 1TVEA 1OD6A 4K7JA 3TSCA 5DGDA 2HRBA 3ZCVA 2CD9A 5LL6P 1PJZA 4KXNA 4GEKA 1EWTA 1FE8A 2EX4A 2APJA 4XIGS 1GL7A 1VLLA 2IU6A 2RCNA 4GRDA 1I14A 1Q0SA 3UOGA 4Q15A 2BR4A 3HZHA 4EG6A 3O0DA 4MW9A 4UUBA 2Q2VA 5EHQA 3NUQA 5DHSA 4NY1A 1RXIA 1ZOLA 3GAZA 4B6EA 4AQYB 3IQWA 4EAQA 4NEQA 1OLSB 2PYZA 4BNDB 3KHTA 4MUKA 3HPRA 3HKEB 1WXQA 4PO1A 5C3UA 2GBLA 4JVSB 2WF8A 2H9IA 2EQAA 3P26A 2CXTA 4MEAA 4CEHA 3F7OA 4MUNA 5I9SA 3SOPA 4GEGA 3CSDA 2IE8A 3SICE 1ZC3A 2WJHA 1T5IA 3QY9A 1J0XO 3GLFB 4BX0A 3LSYA 1PJ4A 4X8LA 3X43A 1AHNA 1KETA 1JEYB 1XVVA 3OZGA 1VJDA 3EH1A 4BU0A 4TKVA 3BGSA 5KYKA 3V4PB 4R1QA 2C5SA 1JSLA 1WV0A 4Z7JA 2VJOA 1RJWA 4OQQA 2XTAA 1V8DA 4DLAA 3A2KA 2QZJA 2NV0A 2X8WA 4WUTA 3K9NA 3ER6A 3D3WA 2GLTA 3HY6A 3O8BA 1ZNXA 1QCCA 3PE6A 4C05A 3GGPA 4MI9A 1W49A 3LDAA 5AW9A 1QHYA 2H4HA 2W71A 3G1WA 1QC5B 3FOBA 1WXEA 3MCUA 4HGYA 4MGIR 4I3GA 4FW9A 4CN9A 1EFLA 3DAHA 2ZYUX 4JQSA 3U7QA 1QYCA 3FI9A 5TXGA 5HKLA 2WG2A 3AJDA 2FZGA 2BBSA 1Z3CA 5FNVB 1ZSYA 2VKQA 3ZTYA 2LD4A 4X97A 1CHNA 3USES 1YWGO 4F7DA 4UCQA 5TQ0A 2NXNA 4RV5A 3F7NA 2R8ZA 5FYQA 4LZZA 1HV8A 2R87A 1DT5A 1M6NA 5JS2A 1TK9A 4RTLA 1XZLA 2DPGA 4M99A 1P91A 3QI2A 3KJZA 3LLUA 1DWQA 1NSYA 4LOKA 1JJFA 4EAAA 1W36D 1NQOA 3G0OA 3LECA 4R05A 2W6JA 3IHTA 3P5SA 2C83A 3ZDFA 1YAJA 2FQ1A 1JQLB 2OZLA 1BDMA 1MTZA 4C5CA 4R1TA 4D4HA 4R2JA 1BA3A 2OGSA 2YJGA 3BK2A 3GEDA 4BO5A 4NXNB 2X7XA 1YQ9A 1W46A 2QD5A 4WA7A 2ZJAA 1D1PA 1BX3A 5FNZA 3MNFA 1U1EA 1IDN1 3E7DA 2DBRA 1VSVA 2TMKA 1MJGM 1JV2B 2CLIB 4FMDB 1W9HA 1XRJA 1FX0A 3EPRA 3L8ZA 3O8LA 4Q0MA 1NM5A 2QLNA 1H94A 4WZBA 3KD3A 1CJCA 2OVFA 3A1TA 3GX1A 3L8FA 5JAPA 2DLCX 1DO0A 1JVBA 4P80A 4KZKA 4CPDA 3OM8A 1B23P 1P0PA 2QX8A 2EX1A 2CZGA 3VSDA 2ZRMA 1R5BA 4FHDA 4XJTA 2QRVA 4Z0NA 5H1YA 4J3JA 4BQEA 5A7FA 4L3WA 2Q45A 1R6UA 1ID8A 4ZGGA 1KF0A 1NNUA 2UVDA 4MP6A 2OD9A 1R7RA 2YJ5A 3BKXA 4COOA 1JT2A 4EKGA 5KKCA 3PLAE 1NR7A 3L1JA 2ECKA 4RIEA 1QGDA 5FI0B 4IV0A 3T5DA 4EYOA 5E38A 1J8FA 2FG5A 3PD7A 4MB6A 1U7PA 3DBLA 3RODA 3P9KA 3SR0A 3A05A 4B3MB 1UOOA 2I33A 4EECA 3CUWA 3QTLA 3FHLA 2OFFA 4FNOA 1XPUA 2QTBA 3EXFA 4LDAA 1RJDA 5JSZA 2JVJA 4G8DA 4JP2A 5G0TA 4K9RA 3JCZA 1BO6A 1KI4A 1U5BB 2WYVA 2GEBA 3IEVA 3IAUA 5CX4A 3RSFA 2VT7A 1CR6A 1M1XB 3K0CA 2AKYA 4JUFA 4OATA 3F6SA 1QGED 5H70A 2R44A 2CUKA 3CNOA 2YWFA 1ZA1A 3IERA 5IPFA 5B36A 1DKNA 1ZH8A 3E23A 1ZK2A 3F5DA 4OHVA 3MS4A 5IBPA 4KGXA 4N54A 2QI9F 3DR3A 1DWPA 3B52X 4A0RA 1KHTA 2EFJA 4D8YA 1P9LA 1SBNE 2V7BA 2JRLA 2ZTMA 3Q7PA 4TV9A 2OV8A 6YASA 4R81A 4L78A 4NU0A 3WLTA 1JKIA 1CV2A 2DULA 4Q7LA 3EWAA 5FWYA 2BFEA 3EGOA 2VDKB 2YS7A 1P0CA 4BX9A 4CIWA 4DT1B 1VBFA 4CMJA 2H11A 3CS3A 2D62A 2I55A 2OFXA 2PTHA 1L7BA 3CLRC 4QDJA 1OC2A 3DUWA 3MTQA 1HXHA 4WERA 2F9LA 4GBGA 5C7LO 1PR0A 3FFTA 4PTLA 2QTNA 1T3LA 4O4HF 4N9WA 5D3MA 3DQPA 4LF5B 4D9BA 1IOVA 1RI3A 2FPPA 2I7XA 3AI7A 4BVLA 3FJ1A 2F43B 4DCNA 2XRMA 4NDNE 3R9IA 2IH5A 2J9ZB 5DJ5A 5JQGA 2ADOA 3CSSA 2CVQA 1ATIA 1SCNE 1VHJA 2Y0DA 3F6EX 1E1KA 3KLOA 2J46A 3FFWA 3QBVA 3P94A 4WXHA 1DAOA 1U0JA 4D3YA 4MRPA 4ZTZB 4GDFA 4PO3X 3ZCTA 4FOOA 4L27A 1PZFA 3TE7A 1M1UA 4GDMA 4G8JA 4GZ6A 3INYA 3ZI7A 3KB1A 1RHQA 2NO0A 2YXNA 1CVLA 2CBZA 4PZCA 1OIXA 4YI5A 4EKDA 2AKEA 4B44A 2BUCA 1AY0A 1P6QA 1UK9A 3LCMA 4DCUA 3G02A 4MPDA 3V33A 4LZNA 3DBRA 5H0IA 5K05A 4BO6A 2WWTA 3D4OA 4BMVA 3BGIA 1XD9A 1E1CB 1LI5A 3FGZA 3NASA 2WQZA 1N2HA 3Q0EA 1UDXA 2MYPA 4FCVA 5ALLA 1HE8B 2MINA 2C4KA 2RC5A 3A9SA 1OWMA 4DQDA 4CKWA 3PA6A 3GOHA 4A8HA 2IEDA 8ADHA 1QDEA 2OKCA 1AURA 2OO7A 2QAGA 4U8GA 3VI4B 4CHGA 5LWQA 4V0OA 3M5CA 1CLEA 1ZN8A 5G1NA 4ZVRA 4DBLE 4WLFA 5T6BA 4DC1A 3L41A 3PFWO 3UGJA 2ACWA 3U5TA 2ZJ4A 4ZVSA 5K8TA 1FW8A 1MB4A 1RTKA 3KSUA 4MCAA 1QFYA 3FF1A 3G2MA 4U7JA 5AVXA 2J31A 2LBPA 4ZREA 4Y6PA 5M04A 4EDFA 4N0EA 2CCGA 3ITDA 1R9MA 4ZO6A 3S2SA 1Z3IX 2FEPA 1R0BA 3OFVA 4RY9A 4M0UA 5DTRA 5LB4A 5KX5A 5KQLA 5D7NA 3TLMA 5JAOA 3BF8A 1C9EA 1CZUA 2GF2A 1USVA 4RGQA 3KYDA 2XNDA 4ZHQA 5KOIA 4JOSA 2R48A 1RM5A 3MW8A 2XY4A 5TJ9A 1E2NA 1Z4OA 1XDGA 3RNLA 1ACLA 1XP8A 3KVRA 4TT3A 5BN5A 4P5DA 1WY7A 1Z6YA 4IJMA 4C88A 5A4JA 3ZWCA 2JFFA 1SQSA 2KYRA 4EF5A 4I50B 4ZI7F 1Q21A 3M4YA 4HRVA 5A5DA 2KPOA 3VDNB 5JZOA 3OJEA 4ONEA 5A3JA 4NV1A 1W0KA 1I7SB 5DGCA 2FU5C 3BWDD 3VKWA 1AK2A 2C9CA 2WSSA 1KVRA 3AV3A 2JB9A 3WRWA 1ZN7A 1VRWA 3HDJA 1JDPA 5K0SA 3N7AA 2Q1YA 2YMLA 5HUQA 3HLKA 4RNCA 3OPYA 4H3HB 3EXG2 1D07A 1S2LA 2J5KA 2Q9BA 1TX4B 1VRCA 2Z58A 5G0VA 3TD9A 4EMTA 4H6PA 1U1DA 3LUGA 1YI0A 3T7CA 3UJ6A 1KJWA 4QU8A 1VL1A 1I3NA 4WLUA 1EFAA 4KVFA 1M1YE 2A7XA 2HQOA 1F20A 3ELWA 1R0ZA 3OQJA 3PJGA 3PZBA 4IOMA 3A32A 4U1RA 5FFFA 3V8VA 4YRIA 1UJ2A 3QWIA 4JENA 4S24A 3VGPA 2H92A 3K1YA 1NNEA 4RJKA 1DIAA 4P7BA 4MUIA 5FTMA 1ZBQA 3LD9A 1CUHA 1JDUA 3MGAA 5B3LA 4TYQA 4FLEA 3QPVA 1J06A 1RXUA 4RDHA 4RK5A 4TV8A 1KO4A 2EERA 2XCRB 4FYKA 2FH5B 4CDGA 1IVYA 3NRCA 4DNXA 1N0IA 2HIMA 1TRHA 1FNBA 3B9QA 3O8OB 3OPYI 5DLDA 4JDUA 1E6KA 1YMVA 3TH5A 4ARZA 3WFZA 4IDCA 4Q03A 3ELDA 4FZJA 3CY6A 3DD5A 2JAWA 3E22B 2Q49A 2FG7C 2WWRA 1IXZA 2HKIA 4OLFA 1XMXA 4ZARA 2JZNA 2XXAB 2P9YA 3QELA 3C5HA 2GMWA 3R2JA 3H2HA 4L5IA 2QLJA 5JSFA 1UFQA 3IAEA 1HDRA 1U5CA 4DV7B 4TTSA 5E9WA 4INAA 3SYKA 1O9HA 1OBHA 2Q5QA 2ZRNA 1M76A 4I4IA 4WY2A 3SSAA 3N0VA 1KE2A 5DM4A 4E1VA 5DHFA 4CMEA 2H2AA 3U60B 3HFSA 5AKXA 4G2NA 4LG1A 1U80A 1VRVA 1XYYA 1Y8RB 2EFHB 2R6HA 3OX4A 4PS0A 3SBXA 4ZIRA 4QEZA 1LK0A 3PEEA 2WFLB 3OLQA 2DQKA 5HE9A 1MEJA 1PV4A 1G59A 5BURA 4HQRA 2CD7A 5DCYA 3S1AA 5EIBD 3ABIA 4HTFB 1R6VA 2AA3A 3ZBPA 1EXDA 5D5HA 1J0BA 4G4SO 3DPIA 2VI5A 3ETDA 4KMMA 1ZMOA 1JG4A 2PSDA 2O59A 2XOEA 3UJPA 3BJEA 1DFIA 4TVKA 4WKGA 2FFHA 1MHPA 3DMGA 1KDPA 2ZSIA 1Q74A 4JOBA 1EFVB 2X0KA 2YOGA 3LUCA 3M7IA 5FUYA 2OCGA 4DWVA 5IKPA 5KSWB 1M1ZA 1I2DA 3EFOB 4LSZA 3KSBC 2XDQA 4XKJA 4CFZA 4ZOCA 5LUAA 2HMUA 1W1IA 4OCZA 3FOWA 1TFUA 2EBHX 4G01B 4ZQHA 3REQA 3ZWYA 1OX5A 1TECE 2YQ4A 3PR3A 3SEAA 5F33A 3PPVA 3USZA 4C3OB 1QV9A 4ZRMA 2OXFA 1J97A 1BMFD 3O8NA 4KW7A 1JHOA 3C1OA 4V0SA 1PRYA 3THWB 4J4TA 2V6JA 1Y48E 4JGIA 3TG2A 3LNTA 1K63A 1XHEA 3I2HA 1N5IA 2O1WA 1IXSB 2XJ9A 3BE8A 4Q21A 4ALJA 1UBMS 3ZIDA 4JYAB 1JEAA 1G4HA 1WTCA 3N74A 4MWZA 4O29A 1SVIA 4EY7A 1L0BA 3IVGA 2V0GA 1ZUHA 4ZAGA 5HR5A 3NTLA 3ORHA 2WWGA 4E46A 4WY8A 2WABA 1CY6A 1UF9A 2NO6A 1LKZA 1V7PC 2X5KO 3B2EA 4G09A 3RVSA 4AX8A 3OKCA 3WLAA 3HBJA 2ZYRA 3U3XA 3K8QA 2ZCVA 3SHTA 3C6YA 4AJ2A 1B42A 2WD9A 1A04A 1H1TA 5F51A 2O54A 1R4MB 2PT5A 3MXTA 5JS1A 1JF8A 5F7XA 3DYVA 5MN4A 5K8JB 5A3SA 4ND4A 3KBOA 4JJ8A 4G5XA 1D5WA 4MXDA 4XD7D 1R10A 1SFRA 1XLWA 3CRRA 1OMOA 5E4JA 4EY4A 2BH2A 4QX6A 2PKWA 3ED1A 1UZAA 2ZDGA 3MILA 3PQCA 3V9AA 5ALWA 4RVGA 2BGRA 4AY3A 4KPEC 1RR6A 1KJNA 2CKDA 3ECCA 4GICA 3FWHA 2ZREA 3G8BA 4GNRA 2O0MA 4KG7A 4LVUA 1TUEA 1UKEA 3NT2A 5CFPA 4TPKA 1NLFA 3J81k 1IMOA 2X22A 3O4HA 5A9RA 1VSUA 1JIUA 2DWOA 3P52A 1KKMA 3TQTA 3EPHA 2BGKA 1P8JA 1XA3A 2PYDA 3JQQA 1JDVA 3THYB 4WINA 3CVYA 4BLOA 4RWEA 1BWSA 4MV0A 1WIWA 3RTGA 5AP9A 2VIIA 4BXOB 4IP0A 4X1YA 5AESA 1XVTA 3VSEA 2XWPA 1A96A 3FBGA 3LX5A 1UDWA 3P9SA 1YFJA 1XAGA 2B82A 3IUQA 4P4LA 2QROA 3QVGA 1TJ4A 5ENZA 2NXCA 1E1NA 4QFDA 3ONDA 3U4CA 1AHHA 1TZBA 2BF4A 3R5KA 3S70A 4DCSA 4NAUA 2OBXA 2DQZA 1GSAA 3ZHXA 4YV7A 2FXIA 3OI7A 4EGSA 1KIMA 1IJFA 3SQDA 3IP7A 4W1QA 1SJ9A 3DOJA 3EEQA 2VOEA 4N7RA 4DCGA 5K0CA 1Z0JA 1M8FA 2PLFA 4G07A 4MITA 3UJAA 3BTUA 1S4QA 1A8PA 2VBCA 1ISGA 1BCRA 5J43A 2FN3A 1N5JA 1P2UA 2ZRPA 3ZDYB 2JFUA 3QEOA 2BMEA 4IMPA 4J0JA 2DERA 5CYOA 2CHEA 4AJKA 1ZOIA 2J41A 1JIQA 3S28A 5AW8A 3KZCA 3TAUA 1AIPA 3DW1X 3O91A 2W8ZA 2F3TA 1A7JA 1LC0A 4XQGA 1MOSA 3HPQA 1J1ZA 2RGNA 3MWJA 3UMJA 5AKEA 4MUGA 5I4BA 1GPNA 2M6RA 4B74A 3VI3B 3KVYA 4TWRA 4ZEWA 1LLCA 4I55B 3AKCA 4HN2A 2A30A 2AOWA 2HFKA 2ACKA 1GRVA 1AF4A 3B6KA 4FKBA 3C7DB 4ZAFA 4OPMA 2X5XA 3HN2A 1RCUA 1UBFA 4RPGA 3W3AH 1UEXC 2H0RA 3I0NA 3N8NA 4ZMRA 2KHZA 1PG0A 3DLAA 4IXWA 3MWKA 2XWSA 5FPKA 1N33B 2AFIA 1BDBA 4KODA 2B9EA 3U7RA 3H99A 3OETA 2NV2B 1HTBA 1YQWA 2BUBA 4M89A 4WAUA 1MAUA 2HJVA 3OQNA 4RA9A 1JLKA 2IOYA 1NLYA 4KV9A 4EPVA 3AGPA 3HDGA 2UVPA 3TR0A 1GTG1 2NNWB 4F56A 4N82A 4EL5A 1TUBA 5CDGA 5F98A 2OV4A 1QLWA 2OCAA 1F2UB 2RH9B 3K9FC 2QE7D 5EZQA 2WA2A 3PGVA 4FFWA 4IHJA 4IMRA 1UC9A 4RAOA 5C1DA 5KDDA 3LUPA 4CLXA 3R3JA 1P1FA 3LF1A 3AR8A 1PJ3A 1XTJA 1JUDA 2XCUA 1Z4NA 3QF4B 4Q93A 2R6GA 2KBEA 1GRQA 3EXIA 1MFPA 2I3AA 3K35A 1E2KA 4G1BA 4UCWA 4F8YA 2DBYA 3KLBA 1NURA 1SZJG 3BHJA 4L0QA 4OHCA 3GLRA 4MTLA 2LZ0A 5DP2A 3KZMA 4IEIA 3NV9A 3RS2A 1IQPA 3I39X 2XNKA 2YZNA 4EVIA 3CWQA 3RKUA 5HOQA 1XQWA 3DDWA 2D13A 4HDSB 5IKEA 1XZIA 3LHFA 1RJFA 2VSQA 4J07A 1L7OA 1ZWLA 3DWEX 4TTVA 5ITZA 2IEAA 3SDBA 3Q8LA 1ZMXA 3UHFA 4FSHA 3L5OA 13PKA 3SXJA 4HR7A 1ZCAA 2M6KA 5HQ3A 5FO0A 4PY2A 1RXVA 1MN6A 2EHJA 3QVVA 1CETA 5AVWA 2B69A 1ZK3A 2JGIA 2PQ0A 3DHVA 3GUVA 4MWBA 4L5CA 1BXZA 4CQLA 4QASA 1AK9A 4NCXA 2DZDA 4JEMA 4DTCA 3KTFA 4FQ8A 3QVSA 2NUPA 4F84A 4IIJF 4ILKA 4RC9A 2I9KA 1FDUA 1PW5A 1SG0A 3MMXA 1JNYA 3PJDA 1LXCA 1NMEA 3MG9A 4URHA 1QIFA 3OA0A 3NQ41 1KFBB 4Z0TA 1Y9EA 3T15A 3B3AA 3L0DA 4XIIA 1YRAA 1X80A 4AT1A 1GPKA 2IS6A 1V1RA 1K2WA 2YY7A 1KIAA 1JL3A 2BC9A 3S44A 4XX0A 1FRVA 4BGEA 1H93A 2R6JA 3TB4A 1DZIA 1T8WA 3AW9A 3F49S 2J67A 4BDSA 2HUNA 1SO8A 4O2RA 1DAMA 4G0WA 3AZOA 5AO9A 4XASA 1E63A 4QGSA 2W6NA 3D3KA 4OYHA 3M4NA 2QR2A 4YJ3B 3FPBA 1N92A 1V1MA 3O47A 5EXSA 2CLKB 1K6IA 4REOA 3V2HA 2OCIA 2PMFA 3PUXA 3VJKA 2JFGA 3VGJA 4EVQA 4KQ6A 4I4NA 3OE7D 1D4AA 4I6EA 1TQ6A 3C45A 3KEGA 3WAKA 3EEOA 1WUYA 4KIFA 4FFSA 2HO5A 5KNDA 1ZP6A 1C30A 1P1HA 2DRIA 5D3ZA 1EHIA 3OEED 4WBXC 5ES4B 2FUEA 2P67A 2QUBA 1C3JA 4IDAA 4NBSA 1IEXA 3B5EA 2J48A 4Y1GA 1P31A 4LXHA 3WLMA 3HL0A 2ZRDA 2B98A 4ND1A 4LV8B 4J0IA 2DHEA 4OU5A 2ZPTX 3OOHA 3MUFA 5F73A 3BDAA 4CCYA 5LR6A 1L2TA 3SZUA 5K7SA 5KTYA 5C37A 4QPZA 2QMUA 3GDOA 4DRXA 4NEHB 1P0QA 1XC7A 2HHCA 1HYHA 1JRLA 1Y3HA 2HF2A 4JUIA 5IKOA 3FUXA 4CT5A 5G3YA 3U16A 3VJMA 1BZYA 4AJIA 3KEMA 3A1NA 5FX2A 4P4SB 2SCUB 3FE2A 1YB1A 4LS3A 2FLWA 2C1XA 4YJDA 3U7GA 2R7AA 4NU8X 3ZHVA 2GN8A 4EATA 1CY2A 1WXXA 4CGZA 4X9XA 5JANA 1BU5A 2UYGA 4CMBA 4MA0A 3PC6A 3RVPA 3ILSA 3DNPA 3U4HA 4LC0A 1FNDA 1LDMA 3K1TA 3GA7A 3PEFA 1UBUS 2XRFA 2PHZA 3JQGB 1KVTA 5JXJA 3FCUB 3CUKA 4RPHA 3HCEA 1ABEA 2WIJA 5GADl 5AUNB 5CCXA 2NYRA 3B2NA 2Q1SA 4ZQFA 3J81A 4DADA 2FXVA 3OJOA 3WGHA 4A9AA 4YXWA 2F6RA 3DE6X 3SXUA 4E15A 1BEZA 4E13A 2IEYA 3AUFA 3ROPA 3SX4A 2OKGA 2XCOA 4WCDA 3L0YA 1YRLA 3DMRA 1M2KA 3BN3A 4QJ4A 3Q87B 5LXTF 2HYDA 3BXZA 4ARCA 2CJPA 1NW6A 4K6OA 2UUOA 2QRPA 3TECE 3AEUB 4OJNA 4XIFA 3NP9A 1RWQA 3JQBC 4TN1A 4WLOA 3WRYA 3RFFA 2FZLA 4MQUA 4AYXA 3T1TA 5AUPB 4RU1A 2PRSA 1GU7A 4EFLA 4LEIA 4LYHA 4OF4A 1V3UA 4ATNA 1SEVA 3WL5A 5HKKD 5EJ8A 1N3BA 2RFLA 3ANSA 1OF1A 4MS4B 4F93B 2AUTA 1C4KA 1TVCA 2RH5A 1WP9A 1A76A 1NPTO 2ZTUA 4NZMA 5ALMA 6LDHA 4W5WA 2PZGA 2RE8A 2JRCA 1XZNA 1VI6A 3EQ8A 4NE2A 4P3NA 3C6XA 5FBRB 2DP4E 4GOLD 5FUVA 2IYEA 2VDWA 1N25A 2CHVA 1OX6A 1NGSA 3ONWA 4L95C 1NI4A 3IUPA 1Z56C 2X9LA 4GWGA 4U39A 3O3CA 3MZ0A 4J0KA 1I6MA 5K8CA 3MMPA 2J3QA 3HKCA 3M89A 3NC4A 4ZJUA 1AU9A 4HPXB 4CLDA 5JEDA 1F2VA 2R1TB 1U2QA 1M2NA 3IJPA 3TJZA 5ARCA 1IOLA 4ID3A 1P8AA 4OKIA 3UK7A 2I1VB 3D3JA 3G9ZA 3Q2OA 4ZCQA 1Q7TA 2LDBA 1X3LA 3ZI0A 1NZDA 2FPXA 3HCRA 3IR5A 1DAIA 4URWR 5JXIA 4PICA 3TOXA 1SURA 2CJYA 4IVQA 3PT5A 4RCZA 3VYTB 1E0SA 1EINA 4UHBA 5AK3A 2ZQZA 3AVPA 2CFSA 2GHTA 3ENQA 1CX9B 4KO8A 4MUEA 3UBMA 2OGUA 2FW0A 3THXB 1SU7A 5WRFA 2NPFA 1O9BA 3RGWS 3TZ6A 4C6HA 1W88B 1UXOA 3QXSA 1BGVA 1D1SA 1AD2A 1L1FA 4KC0A 2EP5A 1ZJJA 2HQBA 3COZA 2O8NA 5DM1A 2SBTA 3HB0A 1I7NA 4REQB 5EIHA 1GNVA 3UFBA 2WYHA 3LW8A 3AERB 4RLFA 4I8XA 1NHGA 3CXRA 1QWSA 3AWIA 2JFXA 3DT9A 4U3JA 3LUDA 1XLVA 4IPTA 3AYXB 5JR3A 2V5UA 5CR9A 2GVNA 5J59A 4FI3C 1FU8A 5TMEA 1Y63A 2QN2A 3JAKB 3O73A 4LQ4A 2IY7A 3GGJA 4DMUB 3HB9A 5LBTA 4EEZA 4W6QA 1Z0DA 4NZZA 4F3RA 5K5EA 1RAHA 4N5NA 4JEIA 2XB4A 3L6UA 1LDNA 3LH5A 1D8AA 1GA6A 4RTPA 1NUHA 3R3HA 3GNQA 4IF6A 2YDXA 1U28A 1E69A 2AFHB 3G17A 2SKEA 4HB0A 4LAFA 4N7JA 4RGBA 3RS0A 2W6QA 5FWXA 3U13A 5EZ6B 4LX8A 2C3PA 4G85A 1U7DA 2JLCA 2JAQA 4V24A 4OL9A 3QUBA 4YCSA 1AMNA 3E3NA 2XMPA 4L5JA 1T1IA 1WZCA 2YUTA 1ZC4A 2A1UB 1M33A 2QG6A 3BORA 4TTPA 1V6SA 2RHHA 3O4GA 4UBLA 1UH5A 4UNPA 3SGLA 3ZZ1A 2PTGA 4OLHA 5BYKA 5JXWA 4FNMA 3C8ZA 4YUVA 3RSSA 3V6LA 4S2EA 1CUDA 3A1VA 3RD5A 5FV4A 1OX4B 4JU9A 3QX7A 1UXJA 3OH8A 5DX8A 3S2UA 1A4UA 4DQVA 3ZD8A 5LQCA 3PJEA 2VCEA 1IUPA 4WCFC 1JZSA 2W6JD 4PBTA 5AXBA 3AJRA 3H1TA 3UMYA 1YIOA 2Q28A 5CNKA 3BSWA 1C7IA 1T6ZA 2PUJA 1ISPA 1NW9B 3K8OE 3P2OA 1USUA 4QXQA 4IOKA 4RK1A 1A5BB 2P41A 3TZBA 8LDHA 1U0GA 3HI4A 3PYMA 2V5VA 4FB4A 4L9AA 2HNKA 1SN7A 2HHHB 2HHJA 1SH7A 3R41A 2FPUA 3HP7A 3VNAA 1O1YA 1AQIA 2IYLD 4L8WB 2VDJA 4M8KA 3TD2A 4DV0B 3HNOA 5ILGA 4CZ2A 4E70A 4PXAA 3T3GA 4RGYA 5BSVA 1XJWA 1U0FA 4QUHA 1ZNYA 1ZJ5A 2BFFB 2H06A 2PVSA 5I7EA 5KYTA 4QLAA 2HMWA 3AW8A 2WUDA 3N2EA 4DJAA 5HPYB 1KK0A 4J4HA 1FQOA 1W76A 1P9WA 2IYUA 3IL2A 2DM6A 2H8GA 2R7NA 1M9NA 3DXXA 2G04A 1KSGA 3LT5A 4DMRA 3WRXA 4PTZA 1MAWA 1J24A 3ANTA 5GVSA 2I0FA 4BRWA 5BSFA 3ULKA 1QGZA 3TOVA 1KJJA 4FLFA 4M87A 1X15A 3E5NA 4EPWA 4CG3A 5K3FA 4DYVA 4URXR 4NJOA 3G68A 3TX2A 2PZ8A 1TZCA 4BX3A 3MCAA 1HDYA 4YVFA 2XTJA 3I01M 1JSXA 1U3FA 5BWBA 3C5CA 2QRUA 2ZAIA 1NF9A 5JMWA 1JSZA 3TFOA 1I9GA 1YDEA 1UFKA 1Y3FE 5GV8A 3UQZA 4I4TF 3QP9A 4KYVA 3S6JA 3IAXA 3ZHSA 3MB8A 4PZEA 3DNMA 4YUYA 2JCVA 1JEQB 2PVCA 4W9RA 3PD0A 2OK8A 1TU3A 3GJ4A 1KQ3A 1EP2B 1NVUQ 1NVDA 2EBWA 3B13B 3P0EA 4JYZA 4W4TA 3DLTA 2OORA 4PLWA 4UCFA 2I3GA 3WLJA 5IULC 2P9HA 5LQAA 2PS3A 5BWOA 3TSWA 4BXOA 3SEFA 2ROQA 4TZKA 2IIPA 3OT1B 1X38A 1CIJA 3EG5A 4FOTA 4O02B 2JIDA 1Q6YA 3FNRA 1NLMA 3IVCA 4OXIA 1F48A 5DNUA 3SK0A 2WHQA 2QUJA 5FAXA 3IMGA 1ODCA 1FDTA 3DLIA 1DV2A 4WJKB 4DCPA 1JBKA 2WT8A 4RFVA 1GGNA 4X24A 3AY7A 5KOJA 1Z5GA 1QRSA 1WSWA 4FGJA 4PSAA 5C35A 1UT6A 4KIWA 4X6XA 4CTOA 3EX7C 2JAUA 2X7HA 4PAGA 2NU7B 4W63A 1BN6A 3N9IA 4R41A 3WB0A 4WJLA 4MWGA 3FMOB 4A8JC 1NFFA 2IZOA 2VZ8A 3L7DA 4URZR 3HL4A 2ZBRA 3GUYA 4X7MA 2PSSA 2A1TR 3BCUA 4QBTA 7MDHA 3LZCA 3TQQA 2E5FA 1KZGB 1W0JA 4KEAA 4INZA 1DEKA 5CXSA 3Q72A 1H2ZA 2OBFA 1ZGGA 3UK2A 3GUCA 5ITWA 3RVBA 4AMBA 4QG3A 4K6FA 3S8YA 1BXRB 4MTCA 3IQGX 1K27A 3COSA 1JA9A 3LY8A 4Y6RA 1HKHA 3QE9Y 3P32A 2WLSA 5A6VA 3IBCA 3EH2A 3W8NA 4DLBA 3WBJA 2B34A 3ESZA 1E94E 4RORA 5HCUA 4HX2A 5SY4A 2B8JA 1DDOA 3EUEA 4C0WA 1UMDA 2NTNA 2RHRA 1YJBA 3E3MA 3VPAA 3CKLA 1NKSA 1SVNA 2GB4A 4UU0A 3W8FA 1JDBB 3WO0A 3R8CA 3LBHA 2P35A 1SQFA 1YNSA 1JXQA 3KWLA 1V4VA 2DCMA 2ZUCA 1WVIA 2GGSA 3NFRA 4X1IB 5H68A 2DUWA 1W4LA 5JD3A 2WWXA 4XSVA 4X54A 5DOVA 3EXEB 4LVOA 3OJWA 3N7UA 4PCUA 2HIGA 4QOSA 2W2PA 4ZT3A 3RVNA 4FNAA 3I6QA 2FZKA 4DKJA 4IIGA 5KVVA 1W4ZA 1ZH6A 4AL4A 2XYHA 2WA1A 3DBHA 1E92A 2IPXA 4ZT2A 4IG4A 1M0SA 3MB5A 2CB0A 4IO1A 5AM5A 3WLNA 3ZY4A 1ESEA 2F1JA 2P3QA 2ZJ3A 3QYAA 4FEGA 1BJRE 4KDFA 4BVAA 3KQVA 5LLSA 2OZVA 1YMQA 2VQ6A 4GL4A 1YQXA 1XZJA 3AJEA 3HE3A 4W8OA 2ZUDA 1IZ9A 5BNZA 2W0SA 3M3DA 1N8KA 3TI7A 2J3LA 1NG9A 1D0VA 3F3MA 3OQPA 4YAEA 1Z6XA 3VR4A 4QHYA 4UULA 4TLEA 5J2TB 1D7OA 1ETUA 1TYDE 4TWJA 1AM4D 3BJZA 1WB5A 2B20A 2QTWB 1IRIA 3KKKA 4YROA 1Q7EA 5HIMA 3UGQA 3IXLA 4EHFA 2NU6B 4TT3D 4EW3A 2ZVDA 3IKJA 1PS9A 1P1BA 1ULBA 2ZWAA 3FF4A 3OEHD 3QQPA 3AL0C 3OZ7A 3OVMA 1YMUA 1EK2A 1N2IA 5ALEA 2FUKA 4UPDA 1QH8B 1I6WA 4P3YA 4IUYA 5COQA 4CI9A 5FL7D 2C95A 2Y1LA 3IPLA 4CGYA 1W0KD 3K6KA 3JQ7A 4FGWA 4QBFA 1JHMA 3BWXA 4A0FA 2WSSD 3QG5A 4CI0B 4EFNA 1R15A 4Y18A 4W9MC 3C3CA 2VH2A 4MQBA 5JAIA 8ABPA 1YBMA 2JGDA 2WRZA 2O8BB 2Q8NA 4HTAA 1HDZA 1AS2A 4EF4A 2BEWA 2HK6A 1ADJA 2W2KA 2V97A 5E6RB 4DIKA 2KJQA 3PGXA 5EZSA 5JDIC 1WF6A 3KC2A 1N7JA 4OMDA 5C3MA 5CBPB 4DWWA 3PNQA 2HDWA 1NATA 2IGTA 2OBLA 3SLRA 2BMDA 2XMSA 4IDHA 3MPUA 4HNUA 1H3FA 1T9AA 1YKFA 1ZGHA 2BYTA 4X63A 2XIQA 2AMFA 4DIMA 1M2VA 5DHAA 3WSTA 1T0IA 2HO4A 1LTQA 4O8ZA 3N2ZB 4TQUS 4DQKA 1LRKA 3BERA 2XTZA 3SQLA 1A8UA 2JCSA 3T5GA 3GD5A 1NXXA 2P9JA 4JKIA 1HYQA 2G1KA 1GADO 1UBRS 1Z2AA 2QSZA 3IEXA 3NOVA 4MO2A 5HIAA 2CBGA 2W8BA 4KQCA 4QDXA 1XU9A 3CF2A 5GJVC 4CCSA 4EVSA 3KT6A 5KWIA 2XLCA 4TM7A 1GITA 2BMAA 2WYWA 2XVYA 4K81B 3MAJA 1JEDA 3M9XA 1ZZGA 4FMCB 2E1RA 4PLGA 4P86A 5EZYB 5D6OA 3GW8A 2O2XA 2OHFA 3KT8A 4IZ6A 1RYBA 2VPQA 2VWGA 1PWEA 1Y42X 1GKYA 2IXFA 1FJ2A 4K1XA 5CLIA 2N75A 3KU1A 4IDGA 4GOMD 1TCAA 4FFOA 4MKXA 2A5GA 2BFBB 1PQUA 3ORQA 4YT5A 4OP2A 3BQMB 1P3Y1 2NSJA 5C8YF 1WP4A 3QJ5A 3FTQA 5HG0A 3KR2A 4BRUA 3EXAA 1QK3A 2GNAA 2ZRAA 2ZYWX 1S0UA 3A6FA 1GNRA 4JX8A 4HDKB 2ASEA 1Y8CA 3GRCA 4IFEA 4R8SA 2HSEA 5DVZA 3AHHA 3RUCA 3GEGA 3TIGA 5CD1A 3NTXA 4ZO9A 4QVGA 3S40A 4F12A 1H6CA 1T9KA 3QMWA 4FQ7A 4KPUA 1ENZA 4R2IA 1WSDA 3ZU6A 2VZLA 4BGUA 3RYTC 1O77A 1IHPA 2GM4A 1J2TA 3WWDA 1E3WA 2ATCA 4JA0A 1ZS9A 4F5EA 2HQ1A 1MC1A 1NYLA 4G65A 3D31A 1XMOB 2HB6A 4YDQA 1D2NA 2ISQA 3ISJA 3AY0A 3L92A 1CUYA 4I7EA 4ZP1A 5JV5A 4OFWA 2IHKA 3ZVKA 2P5YA 3RWMB 1T6XA 1K5PA 4AG5A 4EA8A 2GJ4A 1THGA 4A6EA 1Y3DE 3ZR4B 1KE1A 4DCTA 3F97A 4MKRA 4Q05A 3H4IA 1WXGA 3O4RA 4DARA 1NBMA 3E9DA 2IX9A 3FOAA 2CHQA 2WF7A 4CIBA 1CR1A 4G5FA 3RTCA 2W4IA 1H8HA 3EVFA 4MW7A 2WICA 1H6DA 4RZUA 2Q6TA 3I62A 4D80A 1ELOA 2C2GA 1PL8A 5A2GA 1KJ9A 1TKCA 3I2GA 1KO5A 1EWRA 1L5VA 2IIQA 3UFXA 3W2HA 2O07A 3A9CA 3ZDQA 1Y0BA 4C4XA 4ZJPA 5J47A 3K6RA 4PQEA 5BQ3A 4CEHB 2IBMA 4K6KA 1WUIS 4PF1A 1X7GA 3PI7A 4AW9A 3MWDA 4KNWA 1SVOA 1F6WA 3O0TA 3RNOA 1WOMA 4RO0A 3NORA 2W6MA 3EIOA 2YN4A 5KS2A 3E82A 2MR5A 3OWHA 2GNOA 5BW6B 1L1EA 4UE6A 2VTEA 4TKVB 4FGLA 2QDXA 3DEFA 5DTMA 5GM1A 4H0CA 4RBNA 5IBRA 4XQ9A 3INGA 4IO0A 1NN0A 3I04M 3PL1A 4NC9A 5AKYA 3IP5A 1LI7A 2HF9A 1NRXA 3RRMA 4J1SA 1OHHD 3QX8A 1ZAKA 2A5LA 4Q47A 2WZBA 1FNSA 2PVPA 1GAQA 3DC7A 4LDJA 4C0SA 1PHPA 1ZIDA 4G86A 3ZXXA 3CZQA 3TFQA 1C7QA 3L7AA 3B9PA 4PG5A 2EGGA 2X2OA 4D3ZA 1E5LA 4IOLA 4EBBA 1KERA 1EDOA 2IHBA 2CMKA 2B0CA 1G4AE 2WG1A 5KINB 4BFYA 4NZ9A 1EZ1A 1JU9A 2PXAA 5CH5A 4AP5A 3G1TA 3SNKA 4BRZA 4TYYA 2QW8A 1T1SA 2WZDA 3LOQA 3D7RA 3PQ8A 2BY4A 5B53A 3U7QB 4YRGA 4Y98A 5JS7A 3M34A 2YXPX 1ZI9A 5CPFA 2BGTA 1IBLB 1NVBA 2AOTA 4UMDA 2PE5A 3CX4A 4OBWA 5EWJA 5TQ0B 1P29A 2QE6A 3ROGA 4B2LA 1CFJA 5TX7A 4YK7A 1PL7A 3DW3X 3WK4A 2O8EB 3H7AA 1O6FA 1ULTA 5I7FA 5A0FA 5G1PA 4IRUB 3EHEA 4J0DA 2XI4A 3E18A 2QYTA 2JJ8A 4Z8YA 5F5LA 4C4SA 2L82A 2QTTA 4HQFA 5I5EA 1XYGA 3KKEA 4EUNA 4GZ5A 3DBIA 4AD8A 5AKKA 3GLIA 5EUQB 5ICCA 1VPVA 1W35A 4R1NA 4MVJF 4L8FA 4TRNA 2IYFA 3E4CA 1UKBA 2OZLB 3E03A 3EQ7A 3CE9A 3HWX1 5C46F 1ZCBA 2MT9A 4JT8A 1F51E 3O7WA 2IYVA 4OL0A 2P6OA 2PUHA 5J58A 2X8AA 4KO1S 3BXFA 4NBKA 5HM6A 4M4SA 2AQIA 4MIOA 4EHHA 9LDTA 3I1JA 2GCGA 2W6CX 3JASA 1VLMA 1QTRA 1PEYA 1FX0B 2WJAA 2X58A 3KQMA 3PUZA 4WZBB 1PS0A 4ZEMA 3GLQA 4NI5A 3E8MA 4HEJA 4PLVA 4Q7JB 3HKDA 1FTSA 3ZE1B 4DMFA 4LCJA 1T6NA 1KNXA 2GN4A 3HDQA 3R09A 3IHKA 4RJTA 5FUBA 2YXDA 4I36A 1P7PA 4M8LA 3CWZA 1YSCA 4I1IA 3BFPA 1BE6A 1C50A 2QRVB 4GPBA 4IHAA 4NMMA 1QZZA 1HE2A 3M4ZA 4BWYA 1I30A 2XD9A 1IU9A 3LX8A 5DEIA 1I7LA 1STOA 1CC1S 2V3VA 3BDIA 1R8XA 3R77A 2HRRA 1UIRA 1WD7A 4DCVA 2H9AA 4H31A 4OQEA 4E5VA 4J6EA 4FBLA 1PS8A 4X66B 4MYCA 3SZMA 4PC7A 3TK1A 3VPHA 1M83A 2RGUA 3AB3A 2V0NA 3DBLB 3GGOA 4YUZA 2EP7A 3IHLA 2XNCA 5GQSA 3RUFA 4OLAA 2FF7A 3FDXA 5HKAA 5KTRA 1F0YA 3EXFB 1QTNA 5JSZB 3EVBA 3H2SA 1E9RA 3ENKA 3HR8A 2VNHA 4D4IA 3AJAA 3L7LA 5K2OA 1S3SA 2ZQYA 4FK8A 2LV8A 2YV3A 3QUTA 1QPBA 3AM4A 2ZRQA 4GR9A 4E22A 2ZETA 1ZBDA 3LVQE 4P7KA 1JFRA 3ZBTA 5HQTA 2J5RA 3HCDA 1YULA 5B1HA 4BN4A 1YQTA 4Z1MD 1FYDA 1NF3A 5EJ6A 4PGMA 2BRUA 1MXHA 3DZGA 3I9FA 3H1AA 4QA9A 1NYQA 4J16A 4XI9A 1Z07A 3D6NB 3NO4A 4J0GA 1N77A 1NPDA 4X00A 3RREA 4DLPA 4K2HA 2EL7A 3CV3A 5AVTA 1KBOA 3LLVA 3WLQA 3L6RA 3NIGB 2YIDA 1EIZA 1SRQA 4OHFA 2VXOA 4C04A 2YWRA 4M1QA 3UKJA 3AIMA 3QOXA 4TV9B 2B37A 5KHAA 3KJEA 1ML4A 5FWYB 2AFIE 2D5AA 3MCZA 2FUG6 2PRYA 3BTOA 4ME6A 4LRUA 5CYPA 1Y98A 2BFEB 4TVBA 2A0WA 5AKGA 4Z7NB 1X1TA 5IUJC 3W9UA 3GRUA 2PFGA 1CG6A 1PZNA 2W4QA 3H18A 3DE5X 3SQWA 3K9GA 5T8KA 4BGDA 1MPXA 2J5QA 1GILA 1NVEA 1YNOA 2IWRA 3A7EA 3LCUA 3OIDA 1DJMA 4LZPA 1KXJA 3WLRA 5IUKC 4PLTA 2P6PA 5C4MA 4RDCA 3E1KA 2CXQA 5FPPA 421PA 5D3MB 5DK6A 1N7GA 2IUFA 5BN1A 3GP8A 2FPPB 5I4CA 3HUTA 4R1PA 2ZUEA 3ZZUA 1P33A 1U2RA 1OAKA 5HA5A 1SCDA 5JQGB 4Q01A 1VYVA 5CEFA 2BELA 1MABA 2JIPA 3A10A 1KQGA 4I4CA 4Y2VA 1SCJA 3EMVA 5C18A 1VL8A 1H5NA 1RAFA 1NJFA 2J7PA 2R11A 4UPVA 1OFTA 3K5WA 5CYFA 5KPJA 1U0EA 3B1VA 5KNCA 1W36C 5K8VA 1FSFA 1KP2A 2C7OA 3UHAA 3PUHA 1QYVA 1WNTA 4OJQA 2AUMA 1VYHA 4OA5A 4JITA 3RVJA 5K03A 1A27A 3P9RA 4AJ4A 4LFBB 4YAJA 4KXFB 3VZSA 3Q40A 1E99A 5EUCA 4NFYA 4CN8A 2LCIA 1S5PA 1R66A 1E2IA 2C96A 2O5RA 3DBRB 3H65A 4OMFG 4MIYA 5DHRA 5GOZA 1L6RA 2ZYTX 3V1MA 1U2GC 4DVJA 3TZEA 3NZEA 2O0JA 3QU4A 2AX4A 2NSLA 2FEMA 1CEYA 5GIPE 2OO3A 4CNBA 1YJ8A 4K9QA 4GLBA 4WLVA 3SEZA 3O92A 4PXYA 1UM9A 3WS7A 1IBKB 4CKWB 1OW3B 3X3HA 4EHAA 2QTGA 4UM7A 1W29A 4ZO4A 4BZPA 2QAGB 2VK1A 1J7KA 2AR0A 2WUWE 4P4UA 5BNFA 4NAHA 1PSZA 1ZRHA 3QIVA 4DLSA 3WBBA 2VT2A 3VAZA 5CH3A 4IJ6A 2OBMA 4KXYA 4F4HA 4PCVA 3BZWA 4CLHA 4UTVA 5JCZA 4C4ZA 1NMXA 3H4MA 4LMAA 1WQ4A 1H2YA 3B6IA 3G3EA 4R9UC 3SG0A 3T7DA 4DSZA 4N40A 5A6SA 2BM8A 3N8IA 1OT3A 3D6JA 4FOPA 3RIXA 5ERYA 4POOA 1I5EA 2GJSA 5LXTA 1TEVA 2XUDA 3EZXA 3R7FA 3NP7A 2BAGA 1E59A 4DYHA 5KNDD 2KLBA 3TW8A 4NFLA 1DADA 1V48A 1GU0A 2DC1A 3DFKA 3IAHA 4JLWA 2WIFA 1IE3A 2BFDA 2XA2A 2ZB8A 5KX5B 3NCHA 2GPTA 2VUUA 3TEJA 2ZM5A 3PWSA 5AK5A 4AKGA 2Q0HA 4IDPA 2H2DA 3A4NA 3LO5A 5H59A 1KFKB 4YJ2A 3KYDB 4F5ZA 4ZHQB 2ZZNA 3PF9A 1W87A 3LA8A 4F8EA 2DY1A 2B2CA 2C98A 3FBTA 5BN5B 3L43A 4EYSA 4L9WA 1GPAA 1IUOA 3C3EA 3L8MA 3PEVA 4B4DA 4BFLA 4C2BA 1MQ8B 2JFWA 1LFDB 2POCA 2X13A 4QUIA 5K0FA 2W2OA 3LPNA 4X94A 2IIVA 4GLLA 3KTOA 1WXDA 4P98A 3L02A 4RM2A 5JE8A 4OI0A 3WMXA 3SC4A 4DA6A 5DIZA 1KBQA 1ZHFA 1Z8DA 2YHSA 4LF8B 3PEUA 4L02A 3ZGYA 1KMCA 3GGCA 4KFUA 5CXQA 4X84A 1XRLA 3O84A 4M7OA 2AZDA 1YOVA 4RQTA 4MWTA 3OPYB 3RUAA 1NG1A 3R8XA 4DVGA 4D0GA 3U9SA 2GAOA 3ZU5A 1RLJA 1OJ7A 3MJDA 4FGZA 3GJZA 4G41A 4BEJA 4ENQA 5KHLB 2JNWA 1EQ2A 2YJNA 3H4TA 4IY1A 1QE3A 4PG8A 1Y4DE 5I51A 3JSAA 1EXNA 1W93A 4YXWD 1ENYA 3O95A 1GDHA 3B2QA 3MCWA 1ZGAA 4JROA 3UWSA 1EDEA 1UWCA 3FCCA 3N8DA 4FS3A 5F1PA 4F5DA 3W1EA 4ZEVA 5KNLA 3LQQA 2C2YA 1L7XA 3JQRA 3G5MA 1A71A 1X7YA 1A7KA 4BKMA 1G1MA 4PCAA 5I7AA 2I2WA 3ZGLA 4BMCA 3LT0A 4DA8A 1CVRA 1CB7A 4F4FA 2FUNB 2N9UA 5EOVA 3S99A 4TV8B 2O2YA 4BWFB 1PUIA 1WS6A 2OPHA 5TQVA 5ALZA 4BO8A 2XCIA 2I2CA 2LGJA 1XSEA 4FEEA 4LF4B 5AVYA 1G3QA 5FLXA 3VPFA 4L0DA 3HB4X 4L76A 4E2WA 1KOFA 2FW9A 2NO9A 3PFIA 5KVCA 4ARZB 4W5HA 2P3SA 3REGA 4MX8A 3ZHOA 1L4LA 1PGQA 4IV8A 1IB6A 2DLDA 2Q3LA 1QCZA 1YE3A 4II3A 1UAAA 4RPKA 4IH1A 4WBNA 3GFQA 1ESDA 4J49A 4LRSB 3I1YA 5HJ7A 3TFWA 3LQRA 3WDKA 1ZPDA 1K8ZB 1MENA 2OP0A 2GD1O 1FQKA 3CA8A 4DM7A 3CPHA 4D9KA 3O83A 1EX6A 5DLQC 4KQHA 3RM3A 1KNQA 1LPMA 2FSGA 2JEYA 3R0XA 3FJOA 4IVNA 4ZIRB 4URUR 3GXBA 3K1JA 4ZQIA 4DGQA 2L69A 1L4MA 4HNAA 4QG7A 5ALOA 3UCXA 2QLMA 2VAVA 4P84A 1P61B 2QG9A 5CDUA 3IP6A 3S1AB 4HH1A 1XVUA 4QJ5A 4NS4A 4IDOA 2KQUA 3P97A 1FVHA 2J3JA 2PRJA 3B1FA 1ACJA 3ETJA 3IVRA 1IEVA 2XWJI 3WQQA 1Y34E 1Z22A 2Q0QA 2QN7A 4B7XA 3ET5A 4QRHA 4N0QA 1WSAA 5IABA 4MMYB 3J7AC 3ZHUA 3AEXA 4KE6A 1JU3A 2EKBA 4H1UA 2WWHA 2GDJA 1JHXA 3A2MA 3G2HA 4L1KA 3OM9A 3HJAA 2XDQB 4CDRA 3H87A 3CZMA 4CKEA 4LK3A 5HBGA 3OY7A 4S1PA 1I01A 4MPJA 3N0WA 3PX3A 1MXFA 4CQMA 5P8WA 2NGRA 1WMSA 4TYPA 5JIBA 1YVPA 1VG0B 1MORA 3SMVA 1NVAA 4DQXA 5J4HA 2ERCA 1Y6ZA 4WKBA 3KZXA 3ZNNA 4GI3A 9ATCA 1XG5A 4OHYA 3OBIA 3REQB 4KK3A 1PJBA 1I51A 2HNAA 4HDNA 1ZM7A 2P0EA 3Q5GA 4S2UA 5A5VA 3IBFA 1TC1A 3KZOA 3RHZA 3B38A 4BVEA 2B8NA 4RF4A 2ZEJA 2CNWA 3CRQA 1FYWA 1CUIA 2FSVC 1BHJA 1OV6A 2P2ZA 3D0QA 4GGPA 4Y0NA 2VYNA 5LZ7A 2IIBA 4UNSA 3QNWA 1GTMA 2PX5A 2RH4A 4OMCA 1JQ3A 3E84A 5EQDA 1Z2NX 4CG0A 1QE0A 1X39A 3HC7A 3ZC3A 2QZZA 1JECA 2RGRA 3Q2KA 2BDUA 4I08A 1GZDA 1K6JA 2DVMA 4J0EA 5DV9A 3MJTA 3GMTA 4XYGA 2RC6A 1C0LA 2ZWOA 3NHMA 5TQ2A 5DF1A 5DNDA 5IZCC 2RH8A 1PG5A 3HO6A 4N5LA 4P5PA 4KR3A 1UJMA 2D1FA 5JSYA 1L6IA 5TMBA 3N2KA 1AUVA 1JAYA 5ED4A 1LD3A 1Z45A 4QODA 2XB8A 1UPAA 5ECDA 3V4FA 3U3KA 3WNBA 4M8SA 4DLYA 3LK6A 4PC3A 1RQGA 1IAQA 1SCUA 1L5SA 2A33A 4JJFA 2G9QA 4Q3OA 3PNKA 4EVRA 2PY6A 1D2CA 4NNJA 2MSDB 3QU7A 4QULA 4WVFA 1UAYA 5AM3A 2EQ5A 2R1VA 5DMXA 3KCQA 1E7YA 3LPMA 1T2NA 1FP6A 1FZQA 1MF7A 4BNJA 3OZWA 3T9DA 1V5FA 1Y8QA 4NBWA 5J3JA 3UA4A 1PQPA 3OMXA 4DG9A 2PL5A 2I2AA 1B0PA 4G9EA 5TS3A 5H9WA 1Z17A 2H1LA 1K1EA 4G0OA 5TV2A 2NO5A 1OA1A 3ANYB 3RFCA 1KAQA 1B41A 4U7TB 1WO8A 5G3ZA 4AS1A 4XLTA 3HSKA 1OI7A 1BQ4A 2E0IA 1QJ4A 3D6FA 5LFAA 1AHPA 4HGRA 2VTDA 1OASA 4X3CA 3OZBA 3DPUA 3U81A 2IUEA 5DU2A 2DFTA 3OTGA 3VO2A 2Y71A 1D3AA 4EFMA 1N2OA 4K9KA 4X1YB 1CQXA 4JUDX 3PGKA 4UC0A 1YQDA 3GRAA 1AT1A 2C42A 1E1LA 4C87A 3QVGB 3WYCA 5HSGA 2DBQA 5BXYA 2UYCA 3OQIA 1KQNA 2DPYA 1PLJA 4U7HA 1QV6A 1BQ3A 1QRAA 3HBFA 5EIBC 3PKJA 4JWKA 1OXSC 2GJAA 5D7BA 1QORA 5LZ2A 5BOSA 2R66A 5FNVF 1KJYA 3V80A 4DS3A 1QIDA 1K7FB 1TK2A 2ACVA 4UVHA 3N5CA 2FI1A 2J0VA 2HTEA 3B82A 5D1NA 1E58A 5JHHB 3ASVA 2XOKA 4C4YA 4E6EA 4YRZA 3Q11A 1BCRB 5JAQA 1I94B 3ZUGA 3OO1A 2OK7A 3GEPA 4MGHA 3RKSA 3VZRA 4FXPA 3ZK8A 3ZY6A 1UDBA 1TA4A 5BUZA 4AJHA 2FJ0A 4B4WA 5EJ4A 2FZEA 4F3KA 1RYMA 4KN9S 5KUTA 3IR7A 1SC9A 4LOHA 3KDPA 1NVTA 1THZA 2B4KA 3PE4A 4Q1AA 4Y30A 2FDCA 3VO8A 1DQRA 3FGNA 1E32A 2WD8A 2XYGA 3H8VA 3JQDA 3PJRA 5CFOA 5CIYA 3EC1A 4JY7A 4Q5IA 4N76A 2CE7A 2FSUA 2FV8A 5L9AA 5ICFA 1W0CA 1RHKA 4EYEA 5DGTA 2BEKA 3CX6A 4KGVA 5ED0A 2V7UA 1HLDA 2Q5CA 1BOFA 1Y5IA 5FWAA 2MWMA 4UDXX 4M3NA 4U6SA 2AFIB 1WZEA 2PT6A 4DR2B 1YI8A 2GJKA 1TMKA 1KFEB 1ODTC 2G09A 5EE0A 3FFBA 4UAVA 2PUFA 3L4SO 4RA9B 3TLKA 3L1IA 4N0MA 3AIOA 2ZS9A 1M6YA 3MFQA 2UVPB 1UKCA 2Z3WA 1T3SA 2FPOA 2PBLA 2R4UA 3R76A 3TQCA 4JBHA 4JBXA 4NCAA 1TUBB 3T3HA 1KAGA 5DPMA 1U81A 2QMZA 4LTMA 5B2FA 2V4UA 2C0PA 3ZVRA 1B1CA 3T3MB 5EMKA 2X9QA 1EGHA 3DJYA 4IGFA 4IHJB 5B4UA 1G0NA 1E4YA 5JD6A 2VDMB 2CLOB 4FJ1A 4W99A 2ZRBA 4F04A 1DZ3A 4Q3NA 1ODSA 3WLFA 1U02A 2GFIA 5HM8A 1DCMA 1H65A 2G7MC 5AI4A 1I3MA 3W6PA 3EXIB 2IV7A 4F1KA 1QFSA 1WPRA 1ODKA 4J9UE 4B76A 3SC3A 2Q9UA 1LPNA 2ZATA 3H0EA 1I32A 2B83A 4RTQA 3E9RA 5K6AA 4FVTA 4DLNA 3E05A 4CXMA 1W48A 1IIRA 1N9ZA 4EB3A 4FWBA 5IMBA 4D43A 5ITZB 5KPDA 2IOHA 3LBNA 1I2AA 3C4JA 1KQFA 2HI0A 3NCTA 3MOIA 1KI6B 1MOQA 1E2EA 4N3GA 4IVPA 5L6LB 2WR8A 1WKCA 2P6MA 1XX6A 4NU5A 5EXEA 5LP6C 3ITKA 5HQ3B 3K6SA 1N2SA 4YT2A 3E5HA 1J25A 1PT8A 4AKTA 5KYNA 1U1FA 5CT4A 2FZVA 4XE5A 2XRZA 3N75A 5KDLA 4PYKA 1QNLA 2DFPA 2VJNA 2XV1A 3RS3A 4CQLB 4EYGA 2RBGA 1DOZA 1TM1E 1CQJA 1RVDA 3BX1A 3U3ZA 1J1UA 3ILXA 1JP7A 2NUPB 2BZ1A 2G28A 4F2PA 1H2WA 4JJ6A 1GCAA 3ER9A 3T61A 1RPZA 1YT5A 1Y7TA 4RY0A 2VNIA 5ES3A 4BTVA 3MAAC 3QFHA 3OLYA 1DBPA 5SYMA 2FSSA 2EWVA 2I6QA 3KQUA 4D4MA 1NJ8A 4MKHA 3S7ZA 2IH4A 3NHBA 4Y7DA 4Q3EA 3SBEA 1X80B 3NHFA 3OUUA 1V1RB 2AJLI 3B20A 3DZFA 1J8QA 4WFIA 5ALTA 1HOXA 4KPYA 4A36A 3IODA 1H5QA 1DDIA 2JJQA 4XX0B 4ZVLA 5NULA 5JJIA 1OBVA 2XE8A 5IM4F 1XEXA 2C0CA 1DLJA 1FFAA 3C43A 3K30A 1FMTA 1NQWA 2X1VA 3WK9A 5ADWA 3P27A 3IV7A 4X8OA 2DT5A 3KLNA 5DSTA 2Z8YM 3ZWKA 2LW7A 5JJCA 1GTZA 1CE8A 3PICA 1V1JA 4IL5A 1Z4MA 3CVXA 2YIVX 1V1MB 2WHEA 4RHFA 1NYTA 3CONA 4TTTS 5CDSA 1X8JA 5IEBA 3LUJA 2ZKIA 4WGGA 1CDOA 3VTFA 5IVPA 3AFMA 5DBIA 4RHEA 1CIPA 5I7RA 5E6UA 3GPBA 1C30B 4WXEA 1YVRA 1VP3A 3AKDA 1E89A 2QEQA 4CMCA 3VR3D 1J8YF 4ZOEA 1WV1A 1RC1A 3SBOA 2V1UA 3G89A 2GN6A 5KCMA 2OXEA 3EIFA 1CYDA 4WFQA 5FUQA 2L17A 4MDFA 2P2DA 3BD6A 1II8A 4OJKA 1QTQA 3L8HA 4MZDA 3TLYA 1XBTA 1A4XA 3FWZA 4CCYB 3DMFA 2AEEA 2M6LA 4P1ZA 3QE3A 1U98A 3VKFA 2F3RA 2WTNA 4AZTA 1KXZA 2QTMA 3ZD9A 1ES9A 4DRXB 4FFBA 5KWVA 1GRNA 1Z39A 1JQKA 5BN4A 2QMOA 2EKZA 1LA2A 3I76A 1X6VA 1E3SA 1FVOA 4LYFA 5HF5A 3KYCA 5EFOA 1EVYA 4UTRA 4YH1A 2I8AA 5HS4A 3STVA 5JMOA 4WXMA 3Q85A 3W3ZB 4PPNA 5KYYA 3AI1A 2V03A 5EGSA 1QB7A 1P4JA 1T0UA 1S2IA 1XDZA 2GZSA 2NU9A 2XZPA 3PCTA 4OXRA 4EBFA 5CMLA 4UTOA 1UIMA 3ORFA 3QF7A 2XBLA 5CDFA 3GQBA 4D0NA 1XU4A 1Z0FA 2QYHA 4MUFA 3DMYA 1ZQ9A 4RCVA 4PGGA 1VIMA 5J5AA 1EXMA 1D2AA 1H9CA 3V3TA 3KJNA 2OC9A 3T7RA 4ZYWA 2EX0A 3T7SA 3YASA 5JOQA 3ECSA 5JMPA 2CDNA 5LYJA 1G8FA 3OLXA 3SXUB 1DG1G 3P0RA 4OHKA 4C0QC 4AIRA 3KKNA 3G6KA 4LWOA 4OQYA 1Z5PA 3B6MA 4BYGA 1KK2A 2G5TA 4GI2A 4K6HA 3GARA 1H1LA 3STTA 2FJUA 3SF0A 3A4VA 3BHNA 4UTZA 4F3NA 1I33A 4LXQA 4TZTA 4Z6KA 621PA 1ENPA 4GU5A 3IPXA 3ZGXA 4DLTA 5JVDA 2YHBA 4KI7A 1WTAA 4KFTA 1QLJA 2FWMX 1VCOA 3FSEA 2XUJA 4LHZA 3V4VB 3VR5A 3C7CB 3NEPX 3DTNA 3NJ8A 3K05A 4UXHA 4I50F 5DFAA 4R4JA 4II2A 5IJ9A 3LI2A 3NEYA 2WDPA 3B51X 4PLHA 1JQJC 1SVWA 2EKPA 5C32A 4KWCA 3V4RA 2NMVA 2OESA 2IE0A 4E30A 4BVJA 1DQZA 2XEDA 3QMPA 1JBEA 1P4RA 4KQ2A 4EITA 3ZHYA 4DUPA 3IIEA 2C4HA 2VDWB 1NRWA 2PSHA 1PYOA 1NI4B 5MFZA 5DTJA 3JVUA 3TZKA 1TLTA 1P81A 3TXYA 4QKQA 1KZ4A 4XZ3A 1ZRNA 3G0GA 2Q3DA 2Q6LA 3HKCB 3QTBA 4RMNA 1U0TA 2X0IA 5CIWA 3V7WA 4EO4A 3R0JA 4RZ2A 2IS2A 1A8SA 3KHSA 4G1VA 4HLQB 4RL6A 4F2DA 2YRFA 5GZ3A 1ND5A 1R37A 2XXJA 2H2WA 1E3IA 2O0HA 3JWJA 3AHFA 4KXVA 3UGKA 4UD6A 4C0KA 4EFDA 1K3TA 4CF7A 3COPA 4I1OA 2WB4A 4R9SA 3UT5A 3TGPA 1EHCA 2GBGA 3CLTD 3UKOA 5EUBA 4ASUD 1YFLA 1FSGA 2CWWA 2BBWA 4EG5A 4AK9A 3ROTA 3EEIA 4ROSA 1C9NA 4FT2A 2B61A 2AF3C 3SZOA 1DC4A 2DPHA 3NX4A 4K9LA 1BQEA 1FOEB 1JH8A 2JFNA 4MVJH 1SD5A 3TF5A 2WQ6A 3CGGA 2DQSA 2GFQA 1XHFA 2ZBQA 1JG6A 1XD2A 2ZRFA 1L8OA 3VAAA 5CLGA 3ROXA 3U9TA 4E12A 4DIUA 1K6EA 2HCTA 2P5TB 3FOCA 3IRVA 1KH1A 2CVHA 2ZUVA 4BMYA 3RYCA 1S8FA 5IX8A 3I52A 3UMMA 3SHFA 5CURA 3DVLA 4H4CA 3N86A 1YS9A 4U3JB 3G88A 1UJNA 1T15A 4XM2A 3T06B 1JYEA 3SHOA 1IFXA 1RP1A 4WY5A 5FR2A 4Q39A 2FCRA 1KYVA 1JXOA 1RXSA 1O4WA 1CCWA 1Z4QA 2G7ZA 1V5EA 4HF7A 5ISMA 2NLOA 4OH7A 2ZSEA 5EHIA 1JG7A 4B47A 2O05A 2BHNA 3BL5A 3P96A 1B16A 3C1UA 1CY0A 1ILWA 3OQ1A 2QGNA 2CNBA 4BGIA 3GDWA 1CUUA 2RHCA 3HU1A 1P7ZA 5FWXB 2IGBA 1UJ6A 1ZM4A 1PR5A 3LFHA 1D2GA 3OMWA 3TM5A 3FPCA 1GZUA 1OKKA 1S4MA 1Z34A 2AR9A 3EOAI 3HUEA 2YJTD 4MV9A 5HJEA 2VYVA 4TKUA 3CNNA 3QPDA 4Z3OA 3BWEA 2CVPA 4L74A 1YJQA 4KBYA 3G23A 3CZ9A 2H4WA 1HBJA 3E0QA 3FYCA 3NYQA 1DV1A 4YUXA 5AW1A 3IDZA 2MSCB 2V1XA 3BILA 3G85A 4GPTA 3D6HA 5H5JA 5HCIA 4CR8A 4ZCTA 2HIAA 2MYTA 3TYXA 2WUGA 4ZYTA 5K3AA 3WQHA 1DEHA 5HWSA 4TUYA 1G41A 3R3ZA 1C9YA 2NNLD 4Y7CA 1B8VA 2GZHA 3RSHA 5LKRA 4B87A 2PUEA 3DVAA 4K86A 4QJ3A 1UBKS 2C9OA 3GLIE 5CT6A 2Q6KA 1CZLA 5A4DA 1XT6A 1T0JB 4KN6A 1VJ5A 1PJSA 3DR5A 3LMKA 4JP5A 3Q9NA 2QTAA 3QLUC 5FB3A 4BNUA 2CC2A 5I7OA 3IAFA 1HFWA 2ZCJA 4EJ6A 1LU9A 1L5WA 4IG9A 4W82A 1IN1A 2Z08A 4PC6A 1PFVA 2ILVA 1P4GA 1OFGA 1W581 3QH4A 5LQRA 3THRA 1PJLA 2JW5A 4HC4A 1LY1A 5IH3A 2D1QA 1D9XA 3RBAA 4MPRA 1YB4A 5JCOC 4N6OA 3WIDA 4UEWA 3FN4A 4FMBB 3S2IA 3HXMA 2PV0A 1J07A 3HWSA 5JO0A 1N3IA 1B8OA 1TMGE 5JZBA 5DO9A 3IQZA 1HE1C 1ZVMA 3TTYA 1K4YA 1MC5A 4X20A 4A73A 4YRNA 3TBHA 4EUKA 4NONA 8OHMA 1B14A 3AUAA 5K3FB 4F38A 2VH1A 3WGKA 3GLGE 2CEKA 1EZZA 2ZI6A 5IDQA 2ZE6A 1GTVA 1NXPA