1U1GA

Structure of e. coli uridine phosphorylase complexed to 5-(m-(benzyloxy)benzyl)barbituric acid (bbba)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
245
Chain Sequence
b'SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQAETMKQTESHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Structural basis for inhibition of Escherichia coli uridine phosphorylase by 5-substituted acyclouridines.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 84
structure length 245
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u1gA00
4TXLA 1WTAA 4BN0A 1VHWA 4F2WA 5K1ZA 1TD1A 1RXSA 2A0YA 4OY3A 3OZDA 5F76A 3OF3A 5B7QA 1V41E 4IP0A 3E0QA 1NW4A 1PW7A 2AI3A 1SD1A 1PR5A 4FFSA 4M7WA 3ENZA 3NM6B 3O6VA 4I2VA 4MCIA 1RR6A 4L5YA 1V45E 4TTJA 4QASA 1Y1RA 1YQUA 1PKEA 2I4TA 1U1CA 1A9OA 1ODLA 1ULBA 1U1FA 4YJKA 1U1GA 3OZBA 5C80A 3ONVA 4L5AA 4BMXA 4WKBA 4EARA 5CYGA 2HRDA 1PR6A 4QAQA 3BSFA 3EUFA 2A0WA 5F7ZA 1Z33A 4D8YA 1A9PA 4OGLA 1RYZA 4G41A 4OJTA 1JDSA 3C74A 4D98A 1PR2A 4BMZA 1JP7A 4R2XA 4GLFA 1YBFA 3FOWA 4NS1A 4EB8A 1TCVA 3PNSA 3KVVA 3SCZA 1PF7E 3KVYA 2HWUA 3PHBE 3UAXA 5JPCA 4QEZA 3MMSA 3OOHA 3FB1A 4PNPA 5F7OA 1OVGA 3GGSA 1OTXA 4L0MA 4DA8A 1RXCA 1SQ6A 4MCHA 1K9SA 2QSUA 1RXUA 3FUCA 4TXJA 4DAEA 5KB3A 4JP5A 1V3QE 3OZEA 3TL6A 3DP9A 5B7NA 2XRFA 3O4VA 2GUWA 3E9ZA 3KUKA 3K8OE 4M1EA 1OTYA 4RJ2A 2RJ3A 4LKRA 3MB8A 4PR3A 2Q7OE 4TS3A 4G8JA 4BMYA 1CG6A 4G89A 2P4SA 1Z39A 4E1VA 1C3XA 4DA7A 3E9RA 4UC0A 4GKAA 5EFOA 1ZOSA 1Y6RA 1JE0A 1PR1A 4D8VA 4MARA 4OGKA 2ON6A 4DA0A 1K27A 3INYA 1PBNA 1T8YA 4LNHA 1T8SA 3T94A 1A9RA 1TCUA 1Y1SA 3FWPA 1JDVA 4WKNA 1SD2A 3EMVA 3BL6A 5EUBA 1ODKA 5F78A 3OCCA 3LBAA 1YR3A 5I3CA 4TYMA 1A9SA 4NY1A 3ODGA 2OXFA 3DF9A 2AI1A 4TTAA 2HN9A 3UAVA 1B8OA 4P54A 1RSZA 1PR0A 1Z34A 1T0UA 4F3CA 5IU6A 3IEXA 1U1DA 2A8YA 4ECEA 5CYFA 2IQ5A 1JDZA 2OC9A 2ISCA 4D9HA 4X24A 3PNPA 4R31A 1Z5PA 3EUEA 4DABA 5DK6A 3EEIA 1VMKA 1ODIA 1OU4A 4GLJA 3DDOA 5B7GA 1A9QA 5CCEA 1A9TA 4JOSA 1Z5NA 3PHCA 1RFGE 1Z5OA 1OV6A 3P0EA 4DAOA 5CXQA 3OOEA 4YO8A 4D8XA 1SJ9A 1T8RA 1LVUA 1I80A 1K3FA 1T8WA 1VHJA 2AC7A 3NM5A 5F7XA 1PWYE 4L6IA 4NSNA 3D1VA 1N3IA 3NM4A 1YQQA 1Y1QA 1A69A 1Y6QA 4R2WA 1YRYE 1PK9A 4OEHA 3U40A 5B7PA 3OZCA 1RXYA 3KHSA 5CCDA 4WKOA 2H8GA 1JDUA 4TXHA 4M3NA 1U1EA 1PR4A 3GB9A 1Q1GA 1Z35A 3BJEA 1NC3A 4K6OA 1Z37A 4WKPA 1XE3A 1OUMA 5F73A 1TGYA 1V48A 1B8NA 1Y1TA 1ZL2A 4YNBA 2OECA 1VFNA 1TGVA 3NBQA 4TTIA 4OF4A 2QDKA 4LZWA 4KN5A 1QE5A 1NC1A 2AI2A 2B94A 4TXNA 5IFKA 1V2HE 2PGAA 1JE1A 3KU4A 4JWTA 1FXUA 3DPSA 4QATA 3K8QA 5FAKA 1ECPA 4GMHA 4LDNA 4WKCA 1RCTE 3IOMA 5ETJA 3UAZA 3UT6A 1LX7A 1V4NA 4L5CA 4U2KA 1PK7A 5F77A 2QTGA 1LV8A 2OC4A 2I8AA 3UAWA 2A0XA 3BGSA 3FNQA 3FAZA 3LGSA 4YMLA 3P0FA 5CXSA 2QTTA 4F3KA 1Z36A 5F7JA 4DA6A 1ODJA 4DARA 2BSXA 2QPLA 4LNAA 4F2PA 1ULAA 2HSWA 3QPBA 4F1WA 3UAYA 3F8WA 1M73E 3KVRA 1JYSA 4H1TA 1JDTA 4DANA 4TS9A 4QARA 4QFBA 1JPVA 1CB0A 4TXMA 5EPUA 3LA8A 1Z38A 1RT9A 3DJFA 3OPVA 1G2OA
chains in the Genus database with same CATH superfamily
5L6MB 4FW8A 4DCSA 4MP3A 5AW3A 1ZCAA 5CDGA 2JAWA 1CQPA 1Z75A 2Z08A 3DNFA 1XROA 4EG3A 2IJGX 4RMJA 3I92A 2YY5A 2YYYA 4G5QA 5FOUA 4HEA6 3H7AA 2OYRA 1FU8A 3JWGA 3TD9A 4LJAA 5KVAA 1LA2A 1E0KA 4OUKX 1GILA 1RPZA 1L7VC 3OZDA 4ZYXA 5EHXA 1VKRA 4G4GA 5MFZA 2V6MA 2X7HA 2CY0A 2QJOA 2PDAA 2Y1XA 1KAMA 2G07A 2ZTHA 3H16A 5JCJD 5FBZA 4AMYA 1E0JA 3EF1A 2JFYA 2W71A 1KVTA 3TOCA 2B7CA 1GT6A 1YVRA 4J91A 3KOYA 2KYRA 5L3QA 4IIBA 3ZXIA 1FBNA 3E22A 3FBTA 3MQ2A 3Q9LA 3K5PA 1F4PA 1KYVA 2Q0HA 4PZDA 2CCKA 3T3GA 4G0QA 4EVSA 4TKLA 4B7CA 4BZZA 3W3AD 2QRHA 1WUJS 1YRQA 3IMFA 2BGLA 4ZYVA 1DBIA 1UADA 3QTTA 3SFZA 4TZKA 1XLTC 1GKIA 1IN4A 5K4GA 1Q3KA 4RL6A 5AVXA 2VJMB 3VPAA 1GFIA 2MMGA 1MXHA 3AJEA 3TINA 3KE9A 2IYFA 3VDXA 4M7OA 4ZMRA 2CEKA 1PGPA 2HCRA 3BHMA 2BPOA 3CNHA 1A27A 3E9EA 3OZBA 3URKA 2XQVA 3GGGA 4ND7A 4PAWA 3HDJA 5BVGB 2IH2A 1U8ZA 5TGZA 2BONA 1R4MB 1U0OC 1EP2B 3LHDA 1T2EA 1PT8A 1FJGB 4BO4A 5AJVB 1HDYA 1U3FA 1LEHA 3QGMA 4QQ8A 3DOEA 3M1YA 3EY9A 2BV3A 4ANFA 3T1TA 2NU9B 1IMOA 3NOXA 4W1PA 1AKYA 1EGVB 4UVHA 2DB3A 4KXYA 3FTCA 1GNSA 2DFVA 2NO7A 1E2PA 4CGYA 1XYYA 1KKMA 3U7IA 1UKEA 3NBUA 2I55A 5IC5A 1DINA 5KHOC 2ZGVA 1PQUA 3WTCA 3KQHA 1U2DA 3P9SA 4E5YA 1EJ6A 1NXXA 5E3HA 5L4SA 2H7CA 3ANSA 1DWQA 4JD5A 2K5UA 1TI7A 1SBCA 4ECAA 5IPFA 2JFOA 3UMSA 3EQ7A 3VPCA 2FUCA 3PQFA 4G09A 2QRGA 3C8ZA 4IG4A 1X8XA 4R2XA 4UTOA 5KYXB 1TZKA 3HJCA 3THWB 1P8AA 3CMMA 3F90A 2NAPA 1QVRA 3DQQA 3ZDDA 4S1NA 4PXSA 2HLNA 3BXOA 5CTAA 5HBRA 3MUEA 3HACA 4ARSA 5FUYA 3KVVA 3KR9A 3ODPA 3GFVA 4S2UA 3TFOA 1EUYA 2VZ0A 3E9QA 5BWOA 2PSJA 5EJ9A 2OWDA 5EJEA 2HTFA 2RK3A 2IWRA 3MMSA 1HFWA 1NQVA 4CR7A 1BOFA 1INLA 1WKBA 2XVMA 3KALA 1E3MA 1QBGA 1JSZA 4WOKA 1BDHA 3E7XA 3N70A 4XLLA 4RD6A 3GRCA 4R16A 3AG6A 4B40A 4RGVA 2P65A 3KQQA 4RLQA 5D51S 3ZHXA 1JFTA 5J4VA 2ERXA 5K8LA 1OXBB 1M67A 2OMKA 2QF7A 1U2ZA 3P9QA 4L0MA 5JYDA 5HPYB 2SNIE 3ND6A 3OLCX 4FPXA 5A3SA 3KOWA 2FCRA 2HAEA 3EIOA 4WESA 6GPBA 1QTRA 3HJBA 3MSXA 5GV8A 3D7SA 5A6SB 1T29A 1XJCA 4MQ4A 1MO5A 1AKNA 2GYWA 4ZOLF 3VYWA 2JW5A 1KO5A 1LQTA 4O4LB 2NTNA 2QD2A 1SCIA 5FTLA 1K08A 3I6MA 1WDTA 1Y4UA 2LUOA 2C57A 1H94A 4DSTA 3E05A 1BXZA 1IL0A 2KLBA 2DFNA 4LXQA 4KLRA 4JP5A 3TSOA 3C97A 3L18A 1OIXA 2AMJA 5AI0A 1MDBA 1P3JA 4MVJI 4JLPA 2D5BA 4OH7A 4E2WA 1FF9A 3TL6A 3A36A 3IB3A 4OA5A 1A8IA 2DBRA 2FRXA 2I1LA 3P9PA 4UNSA 5HW0A 2JLUA 2VT2A 1RRKA 1V9CA 4NMHA 4WLOA 2R6DA 3E0XA 5DCLA 5B7NA 1QP0A 1KQOA 4PHGA 4INZA 4ND8A 1FX0B 3SXUB 4QXMA 3UA3A 1AKRA 2QP9X 4L2IB 3EQ8A 3LYLA 5T64A 3H5NA 4BGVA 1GQRA 3AFIA 4HGYA 5DRTA 4GVXA 4OXRA 3V1TC 1XJ5A 2GHRA 1QYDA 2G40A 1IIBA 1OW3B 2C9MA 3IUPA 4Q4DA 2ONCA 3A6DA 3BOSA 3SZRA 3V6LA 2IVZA 2FR0A 2GR9A 3JVDA 3OUTA 2A9KA 1AKTA 3Q6IA 1ZVQA 3ZE0B 3AJRA 4AF8A 2COUA 4OQLA 1OLXA 4Q3OA 4RZ2A 4OX9Y 1YGYA 5JNRA 1SC3A 4NZMA 1SA0A 1Z8HA 2Q7OE 3BICA 4MRSA 1ZN9A 4TS3A 2XUIA 2BTQB 3OKPA 1IB0A 2AH5A 3CSSA 4DLZA 4KPYA 1EP3B 3A6FA 3NNNA 4D57A 4MQEA 4Q3BA 2P2SA 1OB5A 5FOVA 1TTTA 3FFWA 3AEKA 1GZ3A 3H5LA 1FYDA 4I5FA 3VPSA 1Y5MA 3BE5A 4FYJA 1G55A 5GGXA 1V1RA 2PK3A 4EHIA 3DM5A 1NU6A 3EXIA 1FFCA 3B8HA 1P0QA 4YX9A 2QAGC 1D7OA 2JJ2D 1CBUA 2XWBF 3H9BA 2JRLA 1ZOSA 3ETJA 2PX6A 1VKNA 3AFNA 3N59A 1Y6RA 5KU7A 4XYGA 5TARA 4A16A 3C5EA 2PV7A 3GJ3A 2L42A 4JHXA 3RIXA 3DQZA 3AR5A 3PVCA 1N5OX 2EARA 5AW9A 2WVAA 4P5DA 1ZVMA 4BGUA 2I6XA 2EL7A 2QVXX 3JQGA 2GYUA 5FH9A 2OD9A 4NAVA 1MT0A 2O3RA 3ZK7A 1Z63A 4V03A 4A6PA 2FMUA 5CDUA 4E2YA 1NVEA 1BFDA 1PWHA 4KXUA 1GR1A 1U4NA 1XXHE 1WM1A 4M0EA 1XVTA 2DECA 5T4BA 3AESA 1NZDA 1UCFA 2RD2A 5G0VA 1EFTA 4PZUA 1JDVA 1LF5A 4AMUA 4S12A 4WKNA 3F7NA 2VLIA 2IZ5A 5EUBA 1QV7A 1Q7TA 1N9ZA 1JHYA 5JAZA 4R1SA 2XF2A 3FCYA 1IRIA 2L69A 1BX1A 5CHEA 4RZXA 1A9SA 3V4PB 3D8SA 4IJ6A 3N8KA 3DTVA 3NVDA 1PG5A 4F3RA 3INRA 4R8RA 1H2ZA 3TLXA 3UV7A 2X0NA 2HN9A 1DKNA 1H2BA 1ZI6A 2RHDA 3ZQ6A 1X77A 3BJRA 1RMTA 2FEWB 1HE4A 3RS8A 3MINB 3QXXA 1WMFA 4AP6A 2UZ4A 2OCXA 5HIIA 2EHDA 3A4LA 3W3AA 1R64A 4XRRA 2BLNA 2ZULA 2X1MA 2EFJA 2ODWA 2W6ID 4HJRA 1BX0A 4X1IB 1DHTA 1FTGA 3QUAA 5IF3A 4HADA 4EW1A 4S0XA 5BV8A 1C1YA 5AI4A 3P19A 2BE9A 3DHWC 2XKKA 2RDMA 4HH0A 3R0IA 2XBMA 1T0UA 2IXAA 4ZI2A 1C1DA 5IBQA 2OGZA 2PQ6A 2C9CA 2JS7A 1ILEA 3PR2B 5SY4A 2UDPA 4B33A 1OXXK 4JKYA 3V4OA 3WSTA 4KGZA 5JNLA 2ETVA 4FQ5A 3EC7A 2YRFA 2QL9A 3A2LA 4NG5A 1ZH8A 5AESA 2JD2A 3ZOKA 3DZFA 2PZMA 3DOIA 2LWIA 3STHA 1KAOA 1Z26A 2VT3A 3PIIA 5CM9C 1LCIA 5K51A 4EH1A 4EUSA 3DHVA 2I2BA 3H3FA 5DK6A 1OU4A 1FMTA 2RGXA 4GLJA 4OXNA 4X1KB 1W30A 4HDMA 4F8YA 1FLAA 3JQQA 5CP8A 2P2ZA 2D1TA 3IC5A 3W1EA 2AE2A 3WIUA 4BKOA 1EFAA 1VB3A 3VR0A 2RH5A 3GRPA 3ZVRA 1GCOA 4RK7A 3RK0A 2G7MC 2D3WA 3RSSA 3NORA 2IS4A 3FGPA 3WGVA 1MMFB 5CB8A 1TYAE 2R8EA 2UZAA 1Q2XA 3DDNA 3WGMA 4M1TA 4EO4A 1H4SA 3RSFA 2Y0BA 2NNWB 4QXOA 5GINE 3H05A 3HBAA 1L7RA 2FZCA 1U04A 2WD9A 3SZGA 3N0VA 4DBVO 4WE3A 2GKGA 2X8WA 4QO8A 4R3WA 3RQIA 2CT8A 1U8YA 4KE7A 4KUHA 4L57A 1H85A 1MTOA 1V1MA 1T9HA 3PVZA 4QTYA 2HK7A 4R2LA 2WKWA 3AFHA 3CRRA 3G0GA 4HLNA 5FI3A 2VK8A 3RYTC 4M89A 4Z4EA 2B5WA 4NSNA 3SP1A 3CLUC 1KBQA 4DQUA 1IEWA 3G5TA 2Q3CA 5KBYA 5M04A 1VPDA 1D8TA 1YC2A 4HFNA 3SSNA 3U49A 1VLJA 2W6QA 2Q5HA 2CLIB 3HJAA 4UFOA 4XKJA 2GAIA 1AF4A 1GGNA 1QE3A 1LLQA 1TRKA 4NARA 3SLKA 2ZR0A 1HY3A 4EJSB 2VDMB 2C9ZA 4TSFD 2EWVA 4CM1A 4QECA 1ZINA 4DTCA 4E08A 2QXTA 1OC4A 3NASA 3V7WA 2PJRA 2BFCA 2WYHA 5CCXA 3ESQA 5G02A 4GRIA 3UBMA 1S7GA 2FV8A 4CM5A 4YY3B 4QM7A 3UXEA 3PUYA 1WUHS 2PU7A 4XEUA 5HS6A 5FO0A 4K9PA 1QQ5A 4ZC1A 1SCUA 1D2MA 3KXIA 2OM6A 1P72A 2ZJ6A 4RYDA 3UT5A 4BU1A 4O5AA 3GFFA 1OH6A 3AQIA 4NIMA 1DAEA 2R3SA 3ZU4A 4DRXB 4TXHA 3FCXA 2CFIA 4BYMA 1AV6A 4PIPA 3WIOA 4KJZA 2R5FA 1E2IA 5EP2A 4LDPA 4N4AA 5JSYA 2IPXA 1T1JA 5ESWA 1G6HA 4BKUA 3V48A 2V5UA 4BEJA 5C1IA 3SVZA 1ZGJA 2FX3A 4N54A 5CU7A 5CJ2A 5EWMA 3DUFB 3TGWA 1WZCA 3HCFA 3OT5A 3PXEA 4JITA 1OXKB 2R8PA 4XWWA 4IM7A 4S1PA 3BH6A 3QKSB 3GJQA 4ZGGA 4LY0A 4AO6A 1G2IA 3EZ2A 4BNJA 5JS6A 3DC7A 1VLQA 2QBYB 2R25B 2ZE5A 4RW0A 1BW9B 3L8HA 2GN6A 4BNLA 4O8ZA 4YQEA 4MGHA 3C7KA 5HXAA 4CF4A 2VDUE 3DE3X 1OWMA 5AJXA 3MMXA 2HJ9A 2NWQA 2QIOA 1L4UA 3JWEA 5TVKA 3U13A 4DDWA 5REQA 4ZRMA 3C14C 3E4DA 4QPZA 4CDNA 3WJ2A 5H7XA 3RK1A 3SIWA 4DLVA 1BROA 3GVPA 2PRJA 2YWEA 3KKPA 4KR3A 2BHLA 2FKAA 3PGVA 5LDGA 1N2CB 5KOHB 1RKQA 3N2GA 2B94A 1LC0A 3IE2A 4C0WA 2K7FA 1T13A 1W85B 4KACA 2GWRA 3CZAA 2JJ2A 3GHYA 2RMKA 3IT3A 2EKZA 4RFSA 1AUVA 5BN3A 5KNBA 4F72A 1JEQB 1LPAB 2CDAA 1NDHA 3B7PA 3DTTA 1DARA 4FP9A 3KSBC 2Q1WA 4BO0A 2C4UA 4FHGA 5FWDA 3IHTA 1BMQA 1XK6A 2AZ4A 3D6HA 1L1RA 1RI2A 4FNGA 5K6AA 1K75A 3LBNA 4QVIA 3BX1A 5M2QA 1ADJA 4N9QA 2CSUA 5DH9A 4YAOA 2JFGA 4LF8B 3COJA 1JFLA 4GX1A 4OTZA 2CXPA 3A9RA 5IDXA 2ZU6A 1JRLA 1N6HA 2QL6A 3ZWCA 3W4KA 5THXA 3MXTA 1C2YA 4K6MA 5I3ZA 3QJ5A 4FDTA 4H16A 1EXNA 1MJ5A 1SOMA 3WMGA 4AX8A 4CYMA 4MDHA 5U9CA 4IV5A 1KEUA 2EU8A 4ILEA 2GEFA 5KYYB 4KV7A 2R751 3P0FA 4U9UA 5EERA 4LTDA 4F45A 4YMUA 3DZBA 1PQYA 3CWZA 1E6EA 1Z6XA 3T15A 1AZSC 1JEDA 1UBTS 3JWHA 1Y4ZA 1TQHA 2WC1A 3WLQA 4F85A 4Y2YA 2BSXA 4B3BA 8GPBA 2IA5A 3Q9NA 4CPDA 1XMJA 4H08A 4F2PA 3H87A 1SHJA 3CX6A 4Q3AA 4MHTA 1YVDA 2B5VA 4TKVB 1ORWA 4JV5B 5DW0A 3BMNB 3CNLA 5FBKA 2WFLB 2RBEA 1A7UA 4KITB 2PH3A 4A8JC 5F51A 1MA3A 2Q27A 4B4VA 2EQ5A 1XEFA 3IQEA 1OFVA 5K3FA 1APBA 4JLBA 1UOQA 4LDJA 4IJKA 2JLXA 1NBOA 1U0HC 4PBRA 2C5LA 3OQVA 5KS2A 1EZZA 3KAJA 5CG2A 2I76A 3L6OO 2JKYA 2XMDA 4X6UA 2WIAA 5EPUA 1XQ1A 4MVJG 4RA9A 4B3DA 4ONEA 2VF4X 3IDAA 2IDZA 4ERXA 1KJWA 1EK1A 4OBWA 4PFSA 3GDWA 4FYIA 3UXYA 5ELXA 3BD8A 4ZC8A 1WTAA 1T1GA 4XVUA 4K7JA 3KBBA 1JDNA 2YWCA 1EWYA 2ROQA 1CY1A 3MWDB 1U3VA 4FLFA 1IY0A 4UHFA 2JPDA 5KQRA 1KKUA 3M34A 5ICFA 1XB2A 3PE6A 1Y8QA 2HFKA 5AKLA 4AN0A 4YMHA 1GU0A 1EE9A 4M86A 4BLTA 1MP0A 3DFMA 2HBYA 2CXNA 3AONB 3E0QA 4BZPA 1HI9A 2B36A 2QLFA 1SD1A 4B47A 3COYA 2PKEA 3RU9A 1U7PA 4AYTA 1Z4KA 1XNGA 5K3SA 3H9CA 1EUDB 4H2DA 4ZU1X 3UJNA 4AL4A 2HDHA 4ZANA 3EWSA 3RABA 3AB7A 1GU7A 1WNTA 2ZSAA 4KGXA 4K2HA 3N87A 2O3JA 1F60A 4BNIA 5LZ5A 2CDCA 1ECJA 1K6JA 1CUEA 2VHZA 4JBYA 3LCUA 1NN3A 1B8VA 1DFHA 3HGQA 4TKZA 5TS3A 1PG2A 1R00A 3N6RA 1C9NA 2ISSD 1PTJA 1QO0D 2OPBA 1DEHA 1GP2A 3OFVA 3KKQA 2IWHA 4W5QA 2HH9A 3DAPA 3LL4A 3ZDQA 2WWWA 1FLVA 1U1CA 2NN3C 3KKOA 3ND8A 2EKDA 5HQJA 2C03A 3RWOA 5KYNA 4Z9BA 2VTDA 1TCAA 3OICA 3SEAA 4YVFA 1LNSA 4KAAA 5CYOA 4OLBA 3CWQA 3HMQA 2RKOA 2C2KA 2AMLA 2QW0X 3C6QA 3FKSD 3O9VA 5FLKA 3RV4A 5KTTA 4BKQA 4I50A 4TSFA 4QUGA 4GI7A 2X8JB 1R8XA 4DWVA 3U3OA 1NURA 1Z07A 1PJBA 4FC7A 5J1TB 1TVEA 4QAQA 5E4TA 2P27A 4ZI3A 4XASA 3WKEA 3TRKA 5C4IA 3RADC 4C7OA 1X7ZA 3JQ7B 1NF2A 3UGTA 4QPNA 3L05A 1NRIA 3RQSA 4Z4CA 1PNTA 4OP1A 9ABPA 2FFRA 3CRQA 1H8HD 1JT9A 4OK6A 4WAUA 1GV1A 3D1LA 3ORHA 4GUAA 4HLQB 5H9VA 4BCDA 4EPYA 4OGLA 4DA9A 1ZGCA 1MDFA 2WVGA 3EXG2 3FLEA 2J48A 5IS2A 4KYVA 1IUKA 2Q99A 4KVZA 4Y6PA 2IC5A 2CV0A 3BSSA 1CY7A 3HDQA 1RZRD 1JKJB 4K9LA 4L6CA 1JL3A 2CBZA 3N2IA 3Q8KA 1PJRA 4PIVA 3ANMA 4RV4A 1S6YA 4ENRA 1RC1A 5KU1A 3W06A 3P0JA 4QICA 4Y7DA 4G85A 5DTRA 3PQCA 4B31A 3HXPA 1RWMA 3VPGA 3N28A 4JB8A 5T67A 4GLBA 2BD0A 3UC5A 4CKCA 1EIZA 1YBFA 2HSJA 3K9NA 1NI5A 1TCVA 3THXB 4JUDX 3L8CA 4CGZA 4DSNA 3PSHA 5HEKA 1LBIA 1ZBDA 3PI6A 3OCZA 3D7NA 3L7KA 4TTQA 1CJBA 1CQJA 1KIMA 3SC4A 1IXRC 4Z1MD 5JJCA 1DQSA 2UXBB 5CD9A 5I9IA 3X2FA 1F48A 2W2KA 2Y1WA 1X38A 2H2IA 3I64A 2N1BA 4RKFA 1C8BA 2A5DA 3UYKA 1FP4B 2HMAA 4M0PA 1B0PA 2V3VA 3M1LA 3GA5A 1QHNA 3G2IA 1N9KA 1GNRA 2OAGA 3M81A 4OXIA 3ZVLA 7MHTA 2FLWA 2W2MA 3UMFA 3ER9A 2AG8A 2GD2A 2UVDA 4XWAA 5L7YA 4G5FA 1Q22A 1FVFA 3BWCA 3T7DA 2IS2A 5K0JA 3R8CA 3RYIB 1RXCA 3SQOA 2NV6A 4IHJB 5AOCA 1I1QB 4C4PA 1H0SA 1RQLA 2A57A 1YFZA 1EE1A 2H2FA 1QS0B 3V7FA 1K7SN 2WPDD 2Z5FA 3FYUC 5CX1B 4BVAA 3R9XB 5JJIA 1ZL0A 5KIAA 4B80A 2Q50A 3QA3E 1PZGA 2HIMA 3PLNA 2NVOA 2P91A 2O7RA 1ENPA 5CVUA 1Q0SA 4W7IA 2DEUA 3QFFA 3GDFA 2CLFB 4HPJB 4NI5A 1B73A 1XZAA 1Y5RA 2VP0A 4HQKA 4DLXA 4N3NA 1R6TA 5KTSA 4PRLA 4WQMA 4WBNF 3KV1A 4TTPA 2H85A 4J1SA 3VU3A 4AQDA 2C1EA 4A4DA 1MJGA 1V71A 2R8BA 4N5NA 3G1WA 4P3OA 5LFAA 2E48A 1Z12A 1SVSA 4X66B 4I4TB 4Y2JA 1S0UA 1YB5A 2B61A 5CLGA 2AQ8A 2GFIA 4FGKA 2I33A 3HCRA 5F5NA 2XQIA 3U3MA 5F9FA 3HUTA 1Z5GA 3PGMA 1M1YA 2QR3A 5HQ3A 2YOHA 4CL2A 3BF8A 1E8NA 3WL4A 4D1YA 2TMYA 3IQXA 4A73A 3FAKA 3BVPA 1L8AA 1QQ6A 4O2AA 2QL7A 1DDOA 4F5EA 1W2GA 1DJNA 2COEA 3G5UA 3PE4A 2BCEA 4MV1A 4UD6A 5HGXA 2FMKA 1MTZA 1D2HA 4WFKA 4EA8A 4QLBA 2CDNA 4KPGA 1IDOA 5JSUA 3ZY6A 3SF8A 3PCTA 4B46A 4CIYA 1YE3A 3U1BA 4PWYA 3TS1A 1RYHA 3IUJA 4IQ0A 1MAAA 3N07A 3PUVA 1W5AA 4Y9TA 3VKGA 5HFJA 1I1OA 4ZJPA 1QTQA 5I47A 4IWNA 4LYEA 1QONA 1XX6A 2F90A 4BMYA 4DJAA 2DT5A 3V4VB 3EQZA 8ADHA 2EG9A 4UQPA 2E6KA 1FDIA 4Q9DA 3AHHA 5AKZA 5A4DA 1SC1A 5EFOA 3TOZA 1T0HB 1W35A 2AVNA 4EFKA 3AP2A 1RYYA 4YHHB 4QOFA 3JW8A 4V0RA 1NBIA 3OA2A 1SCBA 1O8BA 3CLHA 4GM1A 4PLGA 1EYZA 1AZTA 3RS2A 1T2VA 4DA0A 1DKQA 2FQWA 3INYA 4Z2AA 5I8PA 3OQJA 2ZRPA 5DT9A 2BI7A 2HLPA 1KJ8A 4BL5A 1XCOA 4LNHA 3CUUA 3T7JA 3V80A 1PFVA 5HF8A 2PEYA 2A7QA 4E6PA 3P8ZA 1A9RA 2CNLA 5DDIP 2O7VA 5A4JA 1WP4A 1QDLB 1ZQ9A 3EXFB 2QUZA 1RXIA 3LBHA 4BGEA 4ZK2A 3NJ4A 2V9PA 2PUWA 4G5SA 4HWOA 3ZE2B 5C51B 1XF1A 1XXHB 1FX1A 2IDMA 4MS1A 1AMNA 1MO6A 1YSCA 4FMDF 1DT5A 3KVOA 1AKEA 4HYTA 4P3NA 3S40A 1I3OA 3OOWA 5JSFA 4HZGA 4C7MA 1J5PA 1WVGA 1I0LA 2Y99A 3OBIA 4RIGA 4RSHA 3RKSA 3TLYA 2VDWA 2OO5A 4P4SA 4MIYA 1HBJA 5IM4F 3ODGA 1F2VA 2JGIA 3B70A 4MVJP 4L9AA 3OZGA 1GKKA 4MA4A 3Q3EA 4Q1VA 2XDYA 5TX7A 5K6AC 1ZH6A 2IODA 2F3TA 3B9PA 3RROA 1J2UA 1KAHA 2ADMA 1AXRA 1YJBA 4WW0A 4WOCA 4P54A 4UDYX 4FUTA 4CMCA 1W5BA 3EBOA 3IVAA 4HD8A 3IKLA 4M1WA 2BEKA 3RHSA 4Z3DA 3MOGA 2ZQYA 2GK3A 1PCXA 3TK1A 3L1UA 5FBVB 2QNBA 1CZRA 3SVTA 1P0CA 2GN1A 3FPCA 5ICSA 3DMRA 1JSXA 1G21A 4G0XA 5CLHA 1T8PA 3NYIA 4RD0A 1GO2A 3BE4A 3FKSA 1H5UA 1LW7A 2Y0CA 3QLVC 1JLSA 4FU0A 1X3SA 3KHKA 4P4LA 3TQTA 4PBTA 5JV5A 3P0RA 5BWMA 4WOPA 1HYGA 2DPMA 5KSYA 1BC5A 4MLPA 4BVLA 4BPBA 2GPAA 2WIFA 5F64A 1I6WA 4ZYTA 3DEHA 3NRCA 2ORED 4AZVA 1QGDA 3WKCA 3R3VA 4D9HA 3GUYA 1JA0A 2QR5A 3Q7QA 2ZR7A 3ITEA 4C01A 2B20A 2EDAA 3EUEA 3KYBA 3EZNA 3NHRA 2J4CA 1ZJZA 2XT9A 3E3LA 3WAKA 1KP9A 2AV6A 3D81A 5B7GA 4UM5A 1U3TA 2LIPA 5CH5A 2HLDD 4Q15A 4GYYA 3QE9Y 1UMCB 1K7FB 1OCEA 4PQGA 5KUTA 1ESMA 4HFMA 2W4MA 4HPWA 1F17A 2M6SA 1CWUA 4NMWA 2XDQB 5KJFA 3RVQA 1D6JA 1WS6A 3AEUB 3DDHA 2NVUB 3EW7A 3CX4A 4I5IA 2D2XA 1M1ZA 3Q3JB 3ZHYA 4GM0A 4E5UA 5KOJB 4MW2A 4C0XA 4BNKA 1N2IA 3F4BA 1ISHA 1NBEA 2OUKA 1T5OA 1VJ5A 1FYVA 1FFXB 1R3DA 2E85A 1R66A 3OKCA 1D8AA 1I80A 5GZ6A 5JWRA 2Q2WA 1NKTA 4ZOLB 3OZFA 1FVXA 1Y3IA 3RTCA 1IOZA 1WVMA 4C3UA 1EJ0A 5EP4A 5DBHX 4Z1MA 4TVKA 3DHEA 4P86A 3ZQ4A 5LQDA 1W1WA 5DBIA 5JOQA 4L8FA 1UPCA 4KWIA 2J3EA 4YI3A 1ZBQA 1YDEA 5J2TF 4G9GA 2ZLBA 3SS9X 3TSZA 4F6RB 2VDNB 2FPWA 2UUBB 1UZAA 1J0CA 1U28C 2QNRA 2VP2A 3W5VA 3AEXA 4RQAA 2ZRHA 4CL3A 1KIFA 1J2RA 3GFGA 4UCQA 3VYRB 3SOPA 4ZCIA 5LSAA 1XYVA 3IIJA 2EQBA 2Y2VA 3QWBA 3JWJA 3G2HA 4MUIA 3BA1A 5CITA 4PYLA 4BO1A 1SKUA 1N5RA 4BX0A 2DETA 3FTFA 1PQWA 4N01A 3NGLA 1L7DA 1T5IA 3D1JA 4R8MA 2R5NA 1VMAA 2B9EA 2WSYB 1KDRA 3N2YA 2C3MA 1PTJC 1JN0A 1RXYA 2YBEA 4HEQA 4HRVA 1B0ZA 4AKHA 4KR0A 4MI6A 2ZBQA 3L02A 3RAEC 1X80B 3KETA 3C3MA 2XB6A 1S89A 1ODTC 3GFQA 4HWSA 4QRDA 5EMKA 3SS7X 3A6PC 2VPXA 4UUNA 4OREX 5FFFA 3WBJA 4V0QA 3CZ5A 3DF7A 1LK0A 3F4KA 2WWIA 4P4NA 4XFDA 3UTCA 1SWWA 3W5UA 3WL3A 3ZU3A 2L0XA 3EGEA 4YCBA 5IZCA 4GX5A 4OJQA 3ZNPA 1QIFA 1XMPA 3DNMA 2P6RA 1J8YF 3GRVA 2AZTA 2CEAA 2JBAB 2M1ZA 5TJHA 2XA1A 4AXBA 1ZD8A 3E1GA 3QE0A 4KYUA 4MRNA 4ZZ3A 4NVRA 3SR4A 4GR4A 1N3LA 3CLSC 2G5GX 4URHA 2VHVA 2REQB 1N57A 2X0DA 3RFXA 2BZSA 3EF3A 1QRUA 1YTUA 5EN4A 1LW6E 3EXAA 4BXOA 2ZW9A 1FW8A 1D9ZA 3Q3HA 3UJ3X 2GN8A 2ATXA 1G42A 2HADA 2GOYA 3HJUA 4GGOA 4ZQEA 2PMEA 2R87A 2ZITA 3HB7A 1G9SA 2C2OA 5KQGA 1J0AA 1T9CA 3F78A 1TYEB 2FHPA 2JGNA 3KELA 2GBFA 3K32A 5JYBA 2NO5A 2J33A 5EIWA 4DYHA 2PXAA 2PT9A 1X1RA 2PHZA 2GASA 4QTZA 1CR1A 2J9FB 2YZKA 1WCXA 3TRJA 3CTMA 1K0UA 3EUWA 1Q1EA 2BEWB 4RHTA 2D1YA 4LF6B 3KU4A 3OIWA 5CPFA 3LNCA 1V7PC 3V34A 1ZRSA 1KYTA 1HTTA 3I42A 1YR2A 2GXQA 1FXUA 1G7RA 4G01B 3I9KA 2CHGA 4HQ6A 6NULA 3ZIUA 1D0SA 1Z8DA 5LXTF 1DCKA 1J07A 3RRJA 4GZ5A 3KSRA 5FAKA 5ALTA 5TQ2A 4Y2TA 1VQ1A 4JBLA 4WNCA 2R1VA 2IEBA 4EY8A 5I4BA 1V4NA 1PJZA 5IX8A 4X62B 2ZIAA 3CN7A 3I12A 3QNMA 1GG8A 4HO1X 3LT0A 3RRNA 1M0SA 1M72A 1XKLA 2C8JA 3VZDA 4Q4LA 2YC2C 4OBEA 3G6KA 4D4MA 3CJRA 1LRLA 2FW8A 3QLUA 3AVTA 2ALJA 2CL5A 2G0AA 3L0CA 4PCAA 5DM60 4DUGD 2IZ6A 2MR6A 2RH9B 4ZO9A 3NMUF 1POXA 1QNLA 3FDZA 3H8SA 1CKEA 1OAKA 1TM3E 4YGYA 4L72A 4HBZA 2JGFA 4Y6LA 4ASUD 5KTRA 4GH5A 1C41A 3GT0A 2YW9A 3PKIA 1S8OA 2O2HA 2ZSJA 3LP6A 3PGA1 4MS3B 1Y4DE 5A9RA 3ZZUA 1CFZA 1ULAA 2JLQA 3ETCA 4JI6B 3C3BA 4BKPA 5JVDA 5DNAA 2YN4A 3UH0A 2DY1A 3R3HA 4QTUB 4TMFA 1C2TA 4MVCA 4P22A 3T3PB 3C7DB 1N5KA 5JAMA 4R1TA 4A36A 1W1IA 5KWSA 1IJFA 3IODA 3KWLA 4A2QA 5D85A 1WJGA 1JEAA 4IRXA 5ESXA 3S2IA 5HHTA 1U81A 3TQFA 5ADUS 3LO5A 1BJTA 5LDDC 2VK1A 2GF9A 3BJMA 4L1KA 2WVHA 3VR4D 3JX9A 5IAEA 1RWVA 2HM7A 3R3UA 5CB0A 2ZTSA 2WICA 1IHXA 1JZTA 2VPWA 4IDBA 4NICA 1HEUA 2QDXA 2DR0A 4EI7A 5A06A 3E9NA 4WVFA 5AD1A 2VATA 3KEOA 1MFPA 1OFTA 1Y1LA 2FUEA 2OHVA 4XCVA 3WOHA 2RCNA 2NG1A 3ICWA 4ZYYA 3AO0B 2PZKA 3DO6A 2XGOA 3HYCA 5AM0A 5E6RA 4TXLA 2GAOA 2W7TA 3CPJB 3LI2A 4L95C 4CG0A 4G4SP 4YMVA 2WJ3A 5IN5A 3CZPA 4LZPA 2NZYA 3RT1A 3NV7A 4BNMA 2A4MA 5ED0A 1TD1A 1O96B 4KMRA 4ZWNA 1QORA 4M9SA 4WVLA 5CEEA 1M2EA 1TLTA 5PGMA 2HIHA 2RAFA 1G20E 3O8QA 3DONA 3NW9A 3F6YA 3U0BA 5EL0A 2HLDA 3MQ4A 4IRUB 2VQEB 4HVCA 2BY4A 2NMVA 1HTWA 3QELA 1Z0FA 5ALIA 4AT1A 4F5YA 4GMDA 1LQUA 4L5JA 1PR5A 1UDWA 2YQ4A 2ZJ3A 4QA9A 5FUQA 2O3TA 3IQHX 1LTKA 1T6YA 1T25A 1DEKA 5E9WA 5LZ7A 1GNLA 4XTCS 1BDIA 3VQTA 2G72A 1IEXA 3V32A 2G8LA 2IU0A 3K70B 2GEDA 3GT3A 3LL7A 3AI3A 4Y6GB 3UKJA 3EFBA 3CNOA 3HTXA 4R1QA 2R8RA 3QMPA 4PS1A 3SYKA 4WMLA 5BSTA 1ONOA 1PKEA 2D13A 3MPUA 2YMLA 4RKWA 2BF7A 3LC0A 5CB4A 5JI3E 1ACMA 4D8TA 4GP9A 3THSA 1KAEA 1URPA 3M49A 4BZWA 4UTPA 3NHJA 4BNZA 3AJDA 3ND5A 1BTOA 2GYVA 3ZBPA 3LQKA 1RCUA 1RD4A 3QXHA 4OQYA 4ALMA 3QYAA 1FTYA 3FRHA 4U7WA 3WWPA 2OO5C 3LHIA 2A1TS 1EK2A 1UZLA 4HAYA 4PYNA 1YT5A 1N7GA 5DB4A 1SK9A 1XI2A 4WKBA 4BEVA 2X9NA 3KDPA 4JJKA 1FS5A 4P3PA 2VJOA 3BFJA 1KGDA 3DA8A 5K3BA 5LMZA 4OKIA 1Q1ZA 4ZV9A 1O0BA 3WXMA 3TMAA 1BAPA 1E7WA 2C98A 3OI7A 4N0DA 1AIPA 3R0QA 4ZYLA 4I4IA 3TIVA 1P19A 4CMIA 5HM8A 1CUVA 2NQTA 2NUPB 4R8SA 2QRKA 2XKBA 3K6RA 1LWNA 4QOJA 3SEFA 1AXGA 1ZN7A 3AKDA 3GUHA 3IBCA 4LCEA 2ZPAA 2QTRA 4V24A 1Y3BE 4NK4A 1ESZA 1GPWB 2B3DA 1KU6A 2FEOA 1FDWA 2JAOA 4EHHA 1ZM2A 2RHWA 3AU9A 4Q6WA 5CK4A 3NDBB 1TT5B 2HPHA 16PKA 2P9GA 5AW4A 5CA0F 4TTVA 1MXFA 1A76A 3DCJA 2AUMA 1YR6A 4YQZA 3R5JA 3V8QA 1X8LA 3GEMA 2GTHA 2CHEA 4JK3A 5JFTA 3GBSA 2J3DA 4JIMA 4RSRA 5JQGA 1P75A 2ZUBA 3F67A 1KP2A 1SUBA 1S4MA 2W6NA 4LZLA 4UBKA 3W5IA 2ZE7A 5IJ0A 2Q3EA 1WX1A 4MINA 3U61B 4HLDA 5JPCA 1FMFA 4H59A 1N9GA 2GN0A 3P5SA 3THYB 1RACA 4LMAA 2ZT6A 3IEMA 4CKEA 2ZSKA 5A02A 4I2NA 2ZU0C 3AU8A 3C48A 4DSOA 3LBFA 2JGDB 4OM8A 5FOXA 1MABA 2QJRA 2GAFA 5I7WA 2VLBA 2WSSD 2JG3A 3MT9A 3HUUA 4J7CA 2ECPA 2WTMA 2P4UA 2X2PA 4KNWA 4OL0A 5J5VA 1OIVA 1QH0A 1YUNA 3OTIA 4XEHA 3S2SA 1JILA 8ATCA 2PYZA 4FS8A 1O6BA 3GCXA 3THOA 5CYFA 3HSYA 2Q7DA 2Y6VA 3ROQA 4G2NA 3PUXA 2IXBA 1KAGA 1ZYUA 4L8GA 3CEHA 4OV6B 2DTXA 1V2GA 4UULA 4WCFB 1KORA 1OT5A 2B7LA 4HEA1 3K1JA 4EKNB 1Q7BA 2V3WA 1U11A 3BGOS 2XAUA 3G2MA 2HYDA 3PJDA 3GJ6A 6REQB 2C2WA 3GN1A 4YEDA 3HJFA 1PJQA 1VTKA 1XZLA 1O87A 2IYVA 3UFXA 1FJXA 3ECSA 5DU2A 1RJEA 1U4OA 4L4ZA 4UNPA 2CCJA 3DEYX 3H86A 4UATA 3RTEA 1UXOA 1BEZA 2PZJA 1IK4A 1CS0A 1UP6A 4JQYA 3FYHA 3H7IA 5DP2A 2HWXA 2GUWA 3X0DA 5A4KA 5AOVA 3V4LA 3FPJA 2DLNA 1QIEA 4ASUA 2D7DA 1HQKA 5GVSA 2ZYRA 2ISQA 1TMYA 2OQIA 1U0JA 1MGOA 2EW2A 3AQ4A 1E92A 3BF7A 2C5GA 3BMQA 4LYAA 4MLDA 4ZEOA 4B2IA 4IWXA 2UVPA 4G4IA 3T95A 1T10A 4IDPA 3W6OA 3H2GA 3MUFA 4V0MA 4QGHA 1IC6A 3QNWA 2FFQA 1JEYA 1KS2A 3MILA 1CYEA 2YIVX 1I24A 2OAP1 3FTPA 1RXEA 2J1LA 3AHEA 4I46A 1YFLA 1P2FA 2ZB8A 3KOZA 4MVWA 1VOTA 3WRYA 5AM3A 5IF9A 4RVDA 2WABA 5LNK6 2YXEA 1AKWA 2W0SA 4NBTA 3O8LA 1D4ZA 1W49A 5T5QA 1L5GB 3VR4A 1ZICA 4DZRA 1E3JA 1Z29A 4KPUA 2HMSA 4IQFA 5E9QA 4DCNA 3PLAE 6CHYA 4TSKA 5HILA 3MEQA 1UM9B 3BWXA 3JARA 3PD7A 4M9RA 4QXAA 3UA4A 4R8LA 4PFJA 4W9RA 5ESDA 3DLCA 1ORHA 4M1OA 4UC0A 4CBVA 4F7WA 1Q0UA 1YZLA 3RH0A 3TOXA 1VSBA 1GCUA 1F2TB 4ZOEA 4EUFA 4J3JA 3MMNA 1CP3A 4IUBS 4FHCA 2OV3A 2PD4A 3GLKA 2ON6A 1DQNA 1GTJ1 1E94E 2IYYA 4Y6QA 4F4UA 1GD1O 3HKBA 1DBSA 2FW6A 2QN2A 3T99A 3VX4A 1DJMA 1CRPA 1P5JA 4N5HX 4E5DA 1NT4A 2BGGA 1EA5A 1O7JA 2YY7A 3A1VA 3I9MA 3LDAA 4FIZA 4EEKA 1HPLA 3ZVNA 1F2UA 4J7XA 1RPTA 1PDOA 2EFCB 4DV0B 3LHSA 5LP1A 4FBLA 4NEHB 3KDAA 3TG8A 4JBIA 1JQLB 3KKEA 3J81A 4HZUB 4UM9B 4DDMA 4L02A 3EFOB 4FOOA 1U5CA 4I66A 3ZN2A 3W5JA 4ZVTA 2NO4A 3LBYA 1ESDA 4WZAB 5DLEA 3RC3A 4YMWA 4LAFA 3HBMA 2OXFA 3QE3A 3VH2A 1ISRA 2EP5A 4D4IA 2HBQA 2CXSA 4EAQA 1GGKA 1ZDMA 4YJHB 2X58A 3BILA 2FWPA 3REGA 13PKA 1TUBB 2I99A 2Z9BA 4P36A 2DXIA 1DC4A 4YRMA 2Q5QA 5CT9A 4YJ3B 5LIPA 5EWLA 5TQ0B 4OQMA 4RY0A 2ZWPA 4BMPB 1QGYA 5HM6A 2VRWA 3DLAA 3UJHA 1DWPA 2FMHA 3I23A 1C30A 1JDPA 1UJNA 4LSMA 4JLDA 3DB1A 3L1IA 2JH3A 3KFVA 1DUVG 3U4DA 2H92A 3F3KA 3MGGA 4TLMB 1GITA 5JSHA 3K96A 3GRRA 1T5HX 4GZ6A 1RZRA 2DUNA 1U0BB 3TDMA 4BFVA 4L50A 3A4MA 4ZN6A 1ZJJA 1TQ8A 1VIMA 2QN7A 4Z86A 1X1TA 3DAGA 3RBZA 5BMOA 2C7RA 1JFFB 4M6WB 2FEAA 3I3OA 4FI3F 1UM8A 2QYTA 3OX1A 3O0TA 1PT5A 5PNTA 1Q44A 3ZD8A 1PZEA 5AVVA 1X1SA 2QV0A 4GBGA 4O63O 1M3SA 2PX3A 3WNBA 1LJ8A 1WETA 2YJ6A 2JGJA 2IIBA 5KDDA 1EFPA 2EC5A 1AD2A 5CDYA 3PJEA 3PR1A 4ZHQA 2EIXA 3TKYA 1YA6A 4HWPA 1G16A 5F2EA 1QE0A 1S9DA 2AOVA 3BWEA 5IJWA 2CN1A 3LUFA 3ZKWA 4R8VA 4F8EA 5L4NA 3RFCA 1SCQA 2IT1A 2Q0XA 3M6FA 1DIHA 3TKLA 3SIRA 3WZMA 3HR7A 1ZPDA 4K0RA 2G9UA 4MVXA 1Q0TA 5CXQA 3RGWS 1K8ZB 4JBNA 1IG0A 4OKSA 4JJIA 3UEOA 5E2AA 5JLAA 1U9IC 3N76A 1V25A 4CM3A 1B43A 2OV2A 4EJFA 3QA9A 2BR5A 3UY4A 1J23A 3AUFA 1QH8A 4L07A 2VPPA 3DWGA 4D6PA 4UU1A 1HSZA 3C15C 1CDZA 2ZB2A 4H6WA 1T8WA 1VSQA 2HQRA 4J9VA 4LUCA 1PV1A 1W0CA 3L0SA 3QF4A 1GRCA 3JTMA 3TIIA 4R4JA 4FLMA 3O4IA 5EQTA 1ORIA 5FV7A 3VDQA 5LDHA 2ECFA 2WT9A 2ODQA 2RBKA 4LRQA 4CQLA 2PL9A 2AXNA 5CT4A 3SMVA 4WBNB 2APJA 4DM7A 5IYZF 4Y6RA 1YQXA 2WSSA 3CO5A 2H5LA 3M6WA 1GG5A 4R40A 4KQWA 4LSWA 1OH7A 4YCDA 521PA 4F04A 1D1QA 2C9BA 2DSNA 5COQA 1HG1A 5EI5A 3HJRA 3ER6A 4CKBB 2AN3A 4CU2A 3ME5A 2C2YA 1V7QA 5EJ2A 2FUKA 2X5NA 3TLGB 3KUDA 4RVSA 5KX5A 2R8XA 2XZPA 3DJYA 4BATA 1DWUA 3K94A 1WP9A 3PC3A 4HVTA 3SGLA 2QENA 2Y67A 4M83A 4P38A 3PP8A 3ZR4B 4U7PB 2FRDA 1J1UA 1DPFA 3O1LA 4W5TA 4UEOA 3M5CA 1EHCA 4KQ1A 1I5EA 2EJWA 3H2YA 2B1GA 3ECAA 4HUJA 3C3JA 4LMBA 4HDRA 4TWAA 2VPTA 5SZKB 3AF4A 1CT9A 4XIGS 3L07A 3GDHA 4KJXA 4PFKA 4CFYA 4YASA 2R7KA 3O83A 3T9EA 4B3HA 3VZBA 1M6VB 1RI4A 1F51E 3D3WB 3E7WA 5KTOA 4AAYA 3KSMA 3TIGA 4V39A 2WHQA 1NW6A 3PFBA 2AN4A 4IZIA 1ZNQO 2OBXA 4PW0A 5FWXA 3X1MA 1DQPA 1XZHA 4P3KA 6YASA 1OFIA 2VBFA 5LQJA 2X4DA 3EGIA 1Z37A 2VQ3A 4MWSA 1QFZA 2X4GA 3GBVA 4ZQFA 2JLZA 2ZAOA 3I61A 1E1CA 3EXEB 1OUMA 4CHGA 1IAVA 3LDFA 4I9UA 4BQIA 2I9KA 3GUCA 3UHFA 4MMZB 4I5EA 1IG3A 1GZ7A 2LTAA 5T4EA 1KEKA 2JAQA 4B3GA 3AHCA 2BFEB 1LVGA 1U0TA 1U6JA 3OLQA 4YRBA 5MGNA 2HA2A 3AVOA 3DBIA 3RSHA 2X2OA 3PWSA 4EJ0A 3PX2A 1E2BA 1AXEA 5GM1A 1WZUA 5LD2C 1DX4A 2W22A 2Z5LA 1RYDA 1T8UA 2IUYA 2WUGA 4I3HA 1AGNA 2J3KA 4D3XA 4DVGA 2RH4A 3TI7A 1Q91A 2XBLA 4FGSA 1A7AA 1GTMA 4JB0A 2C3OA 4YP1A 1A9XA 5JJKA 2CJXA 3HV0A 5KSWB 2FG5A 1XP8A 2YV4A 4QX6A 3V4FA 3ONNA 3GDGA 4Q9AA 1YNOA 1NG1A 4FMDB 4IS3A 4RHXA 4QYMA 5LOVB 5BNFA 2DFLA 5EPEA 2C7OA 2HSEA 1WCV1 4YRZA 3U6KA 4QBHA 2A59A 2JD0A 4WJKB 2IUSA 4KQJA 3DPSA 4YUXA 3UMYA 1TM7E 1KQNA 4IUDS 3Q8WA 4OOEA 1X86B 4C6RA 2A3NA 2ZWVA 4CT0A 4NZOA 4MGIR 4PLPA 2XUHA 4UXHA 1NRWA 1QG4A 2A9OA 2KQUA 3UCXA 2FWJA 2WVJA 3WMXA 4BAUA 2OC4A 2A78A 2PKQP 4OHBA 1IPEA 1BWSA 4ZCQA 3S8MA 4YCAA 3QVKA 2JGLA 3LGXA 1KE1A 2GD1O 2GD0A 2MYTA 2OUIA 1UANA 2CKDA 3LGSA 4KHZA 2QTTA 4CM8A 4B4OA 1EFKA 5BQXA 2A86A 1BXRA 4PN7A 1U2SA 1QUEA 3CUSA 3VHQA 1YJ8A 1PV2A 2DQZA 4FFMA 2QGFA 3USCS 2XMGA 1TEVA 3S2GA 1OASA 2P78A 3KHTA 5FF9A 1R6AA 1Z8NA 3FYDA 1II9A 5TDHA 1KI7A 1KO8A 2D2VA 4M8IA 5DT2A 1S3FA 1DADA 3NKVA 2G25A 5I7AA 3CA8A 5ENVA 1FNCA 3PL5A 1TD9A 2I4IA 5A1JA 4LJ4A 4G5OA 2J9YB 1BMFD 3I4FA 1XPJA 3N2KA 4N5IX 4CV1A 2QAGB 2NNLD 3CEPB 4D45A 4QARA 1V9SA 3RLFA 5EWJB 1GRNA 2G9RA 5I9NA 4HNGA 4K6KA 3GRKA 2IEZA 2BDEA 3EMKA 3VR2D 4R54A 3IP7A 1F8XA 4KRYA 2XTAA 2QRLA 4LG1A 4Q9KA 2AJDA 4LYGA 1Z38A 4OHXA 1XNQB 1KERA 1YQWA 4QYIB 1J2YA 3PWKA 2GKSA 5EE9A 4BX9A 4HX9A 3HYNA 2VZEA 2ZRIA 3LP8A 4S1TA 5AICA 1P1BA 3BB3A 2AE1A 3JWIA 5KNDD 2KWIA 4RIFA 4DLKA 1DQZA 1UMBB 4B32A 2VS1A 4FBMA 1Z25A 1FNMA 4LVNA 5CW2A 1TZ2A 3STVA 1QFXA 4HSGA 3HVUA 4OY3A 4PX9A 4QTTB 5K05A 4QL3A 3DFUA 4HYYA 4RXMA 2Q4TA 1KPHA 2MSLA 1OX6A 2ORYA 1JQAA 5G41A 4IYRA 4EMBA 5J2TB 1PNOA 3FM9A 3EA4A 3KZKA 3TLKA 1KYWA 3H4VA 2EW1A 1PP4A 1RI3A 9GPBA 1HA3A 3DBHA 3E8MA 2VHUA 1QF7A 2GEBA 1KE2A 4LXYA 1XELA 3WZLA 4JNKA 1SBHA 1XTIA 5AUNB 1Q20A 3CGGA 2NU7A 2JIQA 3DBRB 2W6ZA 4DDVA 3RC8A 5D2CA 4BRWA 1GQOA 4BQQA 4UPEA 4PHFA 5GVRA 3CHYA 2I6SA 1T4CB 1JIQA 2C95A 2Q8PA 3OTQA 3ZWWA 4KOEC 2VJCA 4CHTA 5K0NA 1C4XA 3KP1A 4DRZA 1I4EB 5CW1A 4E5VA 1Y7HA 4HQFA 1W88A 2NYUA 4UEJA 1GUDA 4JEUA 5C3MA 4AQYB 5CIWA 3VGJA 1U1FA 3K9FC 1PN3A 2I2CA 2E18A 3T7KA 5DKFA 3DVAB 5AK4A 2WU4A 5AHRA 3ZCSA 3D6TB 1XMOB 1U1GA 2I34A 4EY7A 3W2TA 3EPKA 2D2FA 3TNDA 2J87A 1I6LA 1SKYB 4X61A 3M6UA 4JKOA 4MJ3A 4A2PA 1EEHA 2C5BA 3BCSA 2I7TA 1IONA 4IH1A 5E3IA 1G9TA 4ZIRB 4O4JF 2QG6A 3RUHA 2O4CA 4EF6A 1NBME 4YRJA 1QGUA 2C7PA 2PQMA 3TXYA 4CEJA 2ZRQA 4NV3A 3OPYA 1JVBA 2F6RA 2G9QA 2E9SA 3FFXA 1ILWA 5JBQA 1YTLA 3TVYA 2QN9A 3FZQA 4DYDA 3ICVA 1SUFA 1MAUA 2QU8A 4KN9S 4XR9A 1QZ3A 2QZJA 2FUG6 2LNDA 2MINB 3BRSA 3JQ6A 2G4LA 3C1UA 4FGUA 1W36C 2OV1A 3DSRA 1ZM3A 3HCBA 3ZV5A 5FHQA 5FL7D 1QBKC 2H1LA 3X1XA 4BV9A 2NO0A 1RDFA 4H1VA 5HJ2A 4O2BA 1E9VA 3EIHA 4LFBB 2V8OA 5BXYA 3WB0A 4J2TA 2FF5A 4LOIA 2P77A 4BMZA 2JA2A 3MVEA 3VISA 4KXMA 1C9KA 4F12A 2OESA 1JGTA 2ZYVX 1KSGA 4W99A 2D3TA 3NTQA 1V6CA 3FOWA 1NPDA 4OQDA 5JISA 1H2HA 1KJZA 3DCYA 4KE8A 5DM2A 1X7WB 5AVYA 5I6DA 3T5AA 3OLYA 3HCWA 3KEQA 4X93A 1E3EA 4ZI7F 5KMGA 1RWOA 2AJ8A 5LXTB 4PHHA 2B4TO 3IUEA 1QZXA 5BW6B 2B6NA 2HL6A 4AUEA 4NRDA 3ITDA 4EITA 1Y4SA 3JRXA 1GA1A 2QXYA 3K0FA 4XTRA 4DGQA 1AQUA 4GL4A 4EJ2A 1PL6A 3DBLB 4PNPA 4C5AA 1KI8A 5JZMA 3KSZO 3NQ41 4TLAA 5F7OA 3V4RA 3GGSA 1ORRA 2HQ1A 4K40A 3SXJA 5TRTA 4KREA 2O5RA 3OHPA 4JAVC 1JU9A 3TR0A 1JQ5A 2FZKA 2RB5A 5FUXA 1QIIA 2NT3A 4YRIA 4IMRA 4UHJA 1B4DA 4G0WA 4PG6A 2GTPA 4E7PA 1SQ6A 1UF9A 2R1TB 4C0AC 4DBZA 4RSMA 1R18A 3KQKA 3HYSA 4GSLA 1HE3A 1CEQA 2WMYA 1NKSA 3Q98A 3RREA 5F3WB 2O8EB 4GOOD 1ISPA 2UZ0A 1BYIA 2PGDA 4J49A 2CHUA 4N8DA 2F67A 3VVCA 5DM70 4KNYA 2E4XA 5BORA 1TO2E 3EISA 4BAZA 1ZCZA 1NQXA 2CK3D 2GRAA 2OL4A 3D6AA 4YDHB 5AHOA 4U00A 5TV2A 1Q7EA 1XTBA 2J5RA 2H54A 4K5QA 2NV0A 1KOLA 3NEYA 1BA3A 3QU9A 4Q9LA 5BSMA 5EE0A 4AJEA 3U7QB 1NBWB 1CDOA 1SCDA 3FG9A 4G5RA 4U0JA 5BW8A 5JDCC 4RJTA 1MV5A 4WI1A 3CW2A 1BH6A 5A03A 5DGDA 2OQRA 4NOJA 2PCJA 2F3PA 1YRBA 3I2KA 3WO0A 5H83A 4Z8YA 3IFSA 1PSDA 1U9CA 2FMFA 1VJ1A 1XA0A 4I99A 4Z5XA 3DS8A 3I28A 3LT2A 5J59A 4DDHA 1OSNA 2GHTA 3EG9A 2B4AA 5C1DA 1Y8RA 2R6GA 4RJ2A 4FLEA 5DLDA 3QXCA 3WRWA 1H6DA 4BDTA 1Y8ZA 4CV0A 4HXGA 2XQKA 4HUQA 1JPJA 4F97A 1XMQB 1NE7A 4G0VA 1DI0A 2IPOA 2UUOA 3RC9A 1QFYA 3QSYA 2YQZA 4X9XA 3Q8LA 1LD3A 1C4WA 5CFNA 3FPFA 3C45A 1BMFA 2ZVPX 3QMVA 4N7JA 4BV3A 4CIAA 1EK6A 1QYWA 3LZDA 3H42B 1C9YA 3OG9A 4ND3A 2ZBPA 4YXWD 5AW0A 5HK9A 1H5NA 4YUVA 1ZOPA 3DD1A 4B8YA 5LKRA 2WR8A 4BVGA 4DUYB 1SGWA 5C4GB 3ZXSA 3VR2A 3L7NA 4XLZA 2C2HA 4PRZA 2VH2A 4GMKA 4W9MC 1JWBB 5CT6A 5JU6A 2BELA 4KRXA 3W0LB 2ZKLA 3PXCX 1XDSA 2Q3MA 1GSOA 3AY3A 1H2WA 1U0RA 4RQBA 3QU2A 2WAAA 1BE8A 1NVKA 1PR1A 1RC0A 4NONA 3CCBA 3F1KA 3MJFA 1T3TA 2AG0A 2DQ4A 2CFCA 1KRHA 2AYXA 3C87A 2P1ZA 4TYYA 2I4NA 1M8JA 3B48A 4J4HA 3HJHA 4Y8VA 1I5OA 1N75A 4ZVMA 1Q16A 1YZVA 3V2HA 3AXTA 1ND5A 3RUCA 1Y1SA 4OSPA 4FNOA 3PVSA 4LK2A 4AWAA 3DTNA 2H4WA 3E84A 4JC8A 4OHOA 2X40A 2QX6A 4JHLA 5GOTA 2NP7A 1DRWA 4QDUA 5BSWA 1PGOA 1G4HA 1GNQA 1MBZA 2XADA 2ZANA 2VRCD 3FUWA 3UMCA 3OCCA 1OWNA 1E2EA 2WD7B 3LBAA 1DC5A 2OV6A 4MUYA 3T1QA 1HKHA 1N25A 2NPFA 3ZCUA 4OXKA 1UKBA 1X8KA 5T8KC 1L4GA 4QGAA 1AHPA 4EQ6A 1GFZA 2C29D 3B1FA 4RAQA 1DU4A 2W48A 4M4SA 4J16A 2QSZA 3GL9A 2HU2A 3LPDA 1RYFA 1SVOA 2FDXA 4WERA 3HY6A 5TF4A 4Q4CA 3L41A 5TNXA 3WL5A 4BIIA 5HKBA 4F91B 3I30X 5EIBC 3NH6A 4U7GA 2ORWA 1JDBC 3UK2A 2H7VA 4KYIB 1O95A 1NVDA 4JYAB 3C4VA 1NUHA 1RPJA 4W6ZA 4KX5A 1XG5A 1RE0A 3UOAB 1XQVA 2FSSA 3DZJA 2X3UA 3DZGA 1QHSA 3BK7A 4LX0A 1BHJA 3SDBA 3DMPA 3ONFA 1RRCA 2WLSA 5AOBA 2C2GA 1U3CA 4JB3A 1J20A 1U7ZA 5LUAA 5TY0A 4FFOA 1GSIA 1N8NA 2OC9A 5LC1A 3ZJ5A 4B6OA 4CIWA 2PL3A 5AW6A 4MIEA 5JXHA 1AO0A 1IQPA 1QKJA 3EQ2A 2EZ8A 2QTNA 3IESA 3BFXA 4LYDA 1ES9A 3KJGA 5DHSA 4UMEA 2FSIA 3E6AA 3TOVA 3GYBA 3Q40A 2Q4OA 1G19A 3ZXUB 4JGBA 4NYMQ 2QUHA 1EA7A 5FBQB 3PQEA 5AM2A 1ZLXA 1HEYA 2RGWA 5GIPE 2IP2A 3FZYA 2IE8A 1VCIA 3NDIA 4DPLA 2VJMA 3NRBA 5FL7A 2I62A 2FWIA 2B4RO 4PVCA 4JOSA 1LPNA 5JNTA 1T24A 1JQ3A 3HR4A 3IIEA 4EDHA 2ST1A 1GUYA 5CVTA 2YWDA 5BVGA 4H31A 3WNZA 3H2IA 3T7AA 1PKXA 2QAJA 5DGXA 2H65A 3GD7A 5K0BA 1TKRA 1UJCA 3AP1A 2GK7A 4YO8A 1TK2A 1TVCA 1IATA 1TO6A 1ZD5A 4MRMA 1JLLB 2K2QB 2OHGA 2NU9A 4YFYA 2NACA 2WMDA 3IH5A 1K3FA 3F74A 4FE4A 3ELUA 1GGEA 4J0IA 5CIYA 1UWVA 3KEFA 3WK4A 2KX7A 4RABA 1BWQA 4AN4A 4Y2XA 1YAHA 5EXTA 2H9AA 4L4XA 2CSXA 1GGFA 3I1IA 3MJSA 3NALA 1P1HA 5IBRA 3FTNA 1GGJA 3VKVA 2YYAA 3O91A 4Q16A 1V8PA 1A5BB 1BD4A 1P5HA 2O23A 1SXHA 1U8AA 1ZD3A 4E2XA 2Z8YM 4ZPJA 2FZ4A 1TX4B 2QI9C 2VJPA 4NDZA 4B6RA 1NQAO 1AK9A 5AM4A 5B3AA 3SDZA 5CDFE 4OUDB 2DQYA 3ZU6A 2VG8A 2WKQA 4K0KB 2H2WA 1ZITA 1ZR2A 5JJBA 3THWA 1BXKA 4YREA 3ORFA 5IH3A 2X8AA 5KYXA 1BIFA 3GLFE 4XWGA 4M22A 3EGXB 2CXOA 3W5HA 1DXOA 1E79D 1IOVA 1N1DA 2CMFA 2G9ZA 1R10A 3EFHA 3EEQA 4HRYA 4K9QA 4MB6A 3VVBA 1THGA 3WLSA 5JNSA 3U6BA 1ZAYA 2F1KA 4RTOA 5G0TA 1IBKB 3NXSA 2CK3A 4YJ2F 2CCGA 5JD4A 5KKNB 5ER9A 4H3KB 1YOBA 2R7MA 3AR8A 1SUAA 3ZCXA 2DLCX 2MU1A 5JT1A 1Q1GA 1GA4A 5LBTA 2XUKA 4B85A 4PHCA 2EERA 4K9SA 4MKGA 2AK2A 2NUTB 2CKMA 3FI9A 4FNMA 4TUYA 1UBGA 2IPLA 1P4RA 1E2LA 3G2OA 4FMBB 2DKFA 3NHKA 5G53C 4UM8B 4WY5A 3L92A 4EIWA 2NU6B 1GPUA 2P9TA 4WXRA 2DUWA 3OZTA 1QXSA 3UB2A 2PIDA 5TQVA 1I3CA 3BXGA 1PYDA 3EDOA 4J2OA 4IHQA 2EIHA 1JJAA 2NSJA 3GLUA 3URMA 4ZDIA 2VYVD 3I1JA 1KJ9A 2QYOA 3B12A 4IH9A 1XWWA 4TN1A 4TV8F 3PCRB 3U4CA 1FP2A 2JAPA 3FLBA 1V4BA 5ICCA 1CULC 3S81A 4KEAA 3CQ9A 1P4JA 1SQGA 1SVKA 1WXIA 2NTJA 4PZLA 4PN3A 1WW8A 2FSVC 1Q7GA 3T5PA 4ZQCB 2VDPB 4M55A 4B73A 2BI8A 4KXNA 4TTIA 4JBWA 2WLTA 1PJ3A 2C5HA 4YDRA 3V8RA 2X0FA 3X1WA 4EF5A 2BDUA 5CFPA 2EL9A 4YXWA 1IM8A 2GQ0A 3FOBA 5SICE 5EZ5A 1U0GA 2EEZA 1W9MA 3QU7A 1QE5A 3UJPA 1XCMA 3C6BA 2ID9A 2FZWA 4EPVA 2XMRA 4GF5A 3FDFA 3QMMA 2O50A 4QG7A 5HZGA 3HXMA 2X42A 5TQJA 3KB1A 4ON9A 2J7PD 1FX0A 4UAGA 3SXUA 4TXNA 4BRSA 3KL4A 2ZJOA 4LQ4A 3IEIA 3WKAA 5LLDA 1TAQA 2Y1KA 3A4VA 4L7QA 3ZH9B 2VAWA 2H59A 3BKXA 3R3SA 2ACVA 2C9YA 2KBEA 4ZKDA 3WGTA 2E4WA 5E9JA 1L4HA 1PJAA 3KLNA 3LY8A 5CRIA 1J5XA 2OP0A 3VVLA 2OT3B 5JI2E 1JZQA 4AQ7A 2OQ2A 10MHA 4UE3S 3TLZA 4AURA 5F3RA 4CIDA 4IYJA 5CVVA 4MGEA 1Z6ZA 3HY4A 3LC1O 4PSCA 1FRZA 4QDJA 4M1SA 5IG2A 1XTVA 4F46A 2BTQA 5ABPA 1NULA 3REQB 3ZCQA 3PPYA 4L0QA 2O48X 4JSYA 3ZW8A 3NEAA 1RLMA 3DHYA 4WN9B 2VRCA 3FGZA 4KIWA 4NBRA 3FAZA 3TRFA 3PKJA 3W90A 2WWHA 2NUAA 1R15A 3WGOA 5CURA 4ER6A 5KNCA 3ZGZA 1A95A 4OAOA 1QG6A 1Z73A 2QY6A 2C54A 4LRWA 4HX5A 1Q1QA 1DKOA 2QTFA 1HT3A 4W82A 3ZS9A 3A1CA 3MIZA 2JFPA 3ZX4A 4YT8A 4US2R 1TU4A 2A1IA 2C59A 4YRSA 2PUCA 1RQ2A 3L6CA 4LYYA 2XD9A 4ZXPA 3WLJA 4IKEA 1M6HA 2QWXA 3PA8A 4UHHA 4XZ3A 2PBZA 1V6SA 1PV4A 5DULA 1Q21A 1YJ5A 1O03A 2VN8A 2WJIA 5SYAA 3A9SA 5KI6A 3KQTA 3VH4A 4CCAA 5ED4A 1JH9A 1XFAA 4P34A 3OQ1A 2WQ7A 2BKXA 4CF3A 4DUPA 5DM1A 3K8ZA 1ISFA 3G0HA 1E61A 1JG1A 1Z13A 3EDMA 1N7HA 3KYJB 3L6BA 3PI7A 5EKXA 3WR5A 3EY4A 2R68A 3ZPXA 4CN9A 3MJDA 1XQXA 1RAEA 5LQKA 1BMDA 2GMWA 4IF4A 2R97A 4IDOA 4YP9A 5HG0A 1R0WA 1BD3A 4O3MA 4F6LA 5AVRA 3HC7A 3WX0A 4DQLA 2JLAA 5HTKA 1E6KA 3JQ9A 3MINA 1I2ZA 4QDXA 1G0OA 4OLJA 2AEEA 2WIJA 2YMQA 1RW4A 4G5HA 5ERXA 4G4SO 1CZOA 1NVFA 4P92A 4PLCA 3RYFB 3ETLA 1WB6A 4X1IA 3ZGYA 3OF3A 5B7QA 3M5PA 1QYRA 2HHCA 4LRXA 4H7JA 4DDUA 4MK4A 3RYCB 2I80A 2Q6LA 1VBMA 1NY5A 2J9RA 1EBUA 2X1HA 1NW4A 2PWBA 3IRVA 5AK5A 2WIKA 3WWEA 1WIWA 4JYCA 3ZQKA 2PU5A 3TD6A 3IOEA 3HGTA 5IYZB 4XB2A 2VK4A 1A7KA 3RFUA 2X9QA 4MCIA 4JT9A 3TQRA 5WRFA 1V45E 3GP3A 2PX4A 4F4IA 2OBFA 2XT6A 1FW6A 3T52A 1CVRA 3JD1A 3WMRA 4ER3A 2HF2A 1Y1RA 3R7LA 4XSGA 2OZLB 2GZ3A 2ZRBA 2IRWA 3NYQA 4I1IA 1EVQA 1XV5A 2FW9A 2PLAA 2BH9A 2Q46A 4JR2A 4QUBA 5GONB 4H27A 2GF0A 4OH1A 4X1KA 2WHPB 4LI0A 4DCUA 3ELYA 1SXJB 2YKGA 2ANBA 5J47A 2V6JA 2LKDA 2V6FA 5CBPB 4YRDA 5F23A 1DIAA 5B37A 3IP3A 4MKFA 4YJFB 4CQNA 2XB4A 1Y6JA 1VIYA 3MXOA 4IIJF 4LJYA 5J3JA 5B6IA 1F8FA 2JIPA 4HB3A 4L0DA 1KZ9A 1PR3A 4RE5A 3WG9A 1UBSB 5DYWA 3TM5A 4YS6A 4AN1A 3OCJA 1FK8A 2PX0A 3MJ4A 4MW1A 4NZNA 4ENUA 3RIGA 1CDEA 3CH7A 3TBHA 2I1VB 2H07A 4NEQA 4J16C 1VHTA 1E79A 3SC6A 2IOHA 1Y34E 1HTBA 2CW5A 4N6GA 4ESHA 1KQGA 1O5TA 3IR7A 4BCCA 2PX5A 4KYTA 4AY4A 5JD5A 3B6MA 3D3EA 1OI3A 4KQHA 4ZT6A 5HSGA 5JH7A 3TG2A 3UUEA 4PZZA 3PNOA 5E8RA 4ZXFA 2WF7A 2OWEA 3BEOA 4JFAA 3GEDA 1O95C 2GZAA 3MCWA 4MW4A 3W7AA 3WZ2A 1XLUA 2DBQA 2HRZA 4DV7B 2BFWA 1YQGA 1SZCA 3B3JA 3M6XA 4ZEXA 4IY1A 1GQYA 3WY9A 3AKCA 1YV9A 4PCVA 1K97A 1JIVA 5CVJA 3DE6X 4I81A 4DGSA 3P4XA 2J85A 4TQAA 1SHUX 2V65A 3G2JA 1W2WB 2HRBA 4IINA 1HM5A 1JLMA 2HSDA 4P9NA 5LA6F 3V7UA 1ZMRA 1E9SA 3QW2A 1T9ZA 4CQMB 1OXMA 3UWDA 3VR6H 2VYVA 1IHUA 1CR4A 4RX1A 5AI6A 3SLGA 2XGGA 3DLIA 3VBEA 3Q4GA 4AX4A 3KAPA 2PTGA 3TIFA 3ESDA 3ZHRA 3CYFA 4IDDA 4S04A 1UC9A 2ZUFA 2ZRCA 3FY4A 2QVYX 3DEJA 1FP6A 3D8HA 4QLAA 3T4PA 3FXAA 1SVNA 4A9AA 4DRYA 1GDTA 1QF9A 3C6KA 2JAHA 3AUSA 1WY7A 4MVJD 4RZ3A 4R3UC 5D7BA 3SD7A 2OEPA 4CUZA 5IAAA 1E0AA 2Y3IA 3GEGA 1A4UA 1UJ4A 1Y7LA 4RLFA 4IV8A 4CMAA 1B74A 1CJUC 5EJMA 3U3JA 3SX0A 2J8ZA 2P1RA 1J8FA 3D7MA 3KOUA 3PGJA 2HIGA 4XFJA 2J5BA 1FUEA 5BSVA 3Q3VA 3FHOA 2J7PA 3U0VA 3MCZA 4HN4B 3ZVKA 3DUFA 1ZEMA 1DG9A 3G49A 3NVMB 3PC6A 1YMVA 1N2HA 5JEDA 3KQNA 1K9SA 5DI3B 3LQQA 1BG6A 2O9JA 2DH6A 3P1JA 1NVWQ 2L18A 3QKSA 4PWZA 3ILVA 1E6MA 2WDPA 4CUKA 7REQA 4P08A 3IUSA 4LECA 4TXJA 3WYEA 2CHFA 5KB3A 2QBYA 3KJQA 1BW9A 2YR0A 3D7KA 1HQYE 2JLBA 1DXQA 4DLSA 4V0OA 4EL0A 4B83A 4DQ0A 4K6FA 3NIWA 1NOJA 4QOGA 4BFLA 4LSGA 1WMBA 3DOOA 4X90A 1QB8A 1F20A 3E1KA 3M5WA 5I9SA 1AHNA 3PDIB 3MS4A 4CG1A 4CTOA 3GLHE 2ZYSA 4MUBA 5KHAA 3RKRA 1GVHA 5KOHA 1N2CA 2FQXA 1K0FA 3GRUA 4M1EA 1HK7A 1RVDA 2QR2A 1W85A 4L74A 5JCOC 1Y9EA 1IXSB 4MS4B 2XUGA 1XZKA 2K2WA 2IZ1A 3KWJA 2EBUA 2F62A 1JEQA 1C8VB 2L82A 4K9KA 5SY6A 3DKVA 3PRJA 1LJLA 4IDHA 3FE2A 5M7EA 5FLXA 3NX4A 3CM0A 3T3NA 4KAJA 3GAZA 4HXFB 5CVCA 2LPMA 3U1TA 5BQ3A 5KPDA 4W5OA 2LW7A 1VE6A 4RD2A 5A2GA 2DTEA 2EOAA 4LWZA 2IOFK 1P5RA 2NQ2C 1QRTA 3T5TA 1GU1A 1G5HA 5IANA 2IBTA 3HYTA 3D5QA 2FU5C 1HMPA 1W9HA 3NANA 4OMCA 2DBYA 3EARA 2DCMA 3C3AA 3ZDAA 3ROGA 1ZW1A 2ZJFA 4XYBA 4UXIA 2VYNA 3AM3A 1U63A 3IP8A 1C3XA 1RKXA 1QYCA 2EZUA 5KYYA 4BO3A 3HCNA 3Q0IA 3W2GA 4JQOA 1L7OA 3KXDA 3I6BA 2VNKA 2Y4OA 5ALYA 4NNOA 2PAAA 3GMTA 4DEVA 5H9WA 5IARA 1ZJWA 3WLMA 1HURA 1I4DD 4AKIA 3UHJA 1A9YA 1G2QA 5BO5A 2PVPA 2DFPA 3F2VA 2PMWB 2O2GA 3E5RA 3LECA 2PT5A 3AK4A 4TKVA 1R4NB 3QNUA 1HORA 1IN5A 1ZI9A 1ZOIA 3WWYA 1MKYA 2FJUA 2WFLA 3DPIA 3GVCA 3DKRA 4KQMA 3D6UA 3SZ3A 1NJGA 3UOWA 3ZZTA 1UKAA 1X87A 2DHCA 2RAUA 8OHMA 3F9RA 3T94A 3H13A 4NENB 4QDZA 2E89A 5C7OO 1J49A 4OFZA 4Q9JA 3NHYA 1LBEA 1ZN8A 3LK7A 1MF7A 4N8SA 5D7NA 4ZZ2A 4F93B 2GRUA 5I9TA 2XGJA 3M89A 2XYQA 3EGVA 3H4MA 4FJ2A 4O1HA 1M54A 2R1ZA 5F78A 5FQNA 1SUWA 1X42A 5LN1A 3KNZA 5EPOA 3STXA 4K8RB 5MN5A 3EOZA 4IX1A 4ED9A 3RJTA 3A8TA 3F8TA 2WE8A 3O7MA 4EG0A 4F2HA 3H65A 3TRHA 3AVQA 2AI1A 5JROA 1PZXA 4JJ4A 5LZ2A 2UYCA 3AI2A 3E3OA 3GU3A 4HMPA 2ZRNA 4XDGA 3VNUA 4O4JB 5IM4A 3ZXYA 4V1CI 3LZCA 1J56A 4H77A 2H18A 2PKYX 3WLKX 5LQNA 4NYJQ 4G5GA 3CLRC 2OA0A 1GCIA 1JKMA 3HUFA 3G2KA 1GNPA 1L8LA 3MWDA 3LPCA 1T5BA 3ILYA 4A2CA 3LUJA 4A5SA 2VH1A 5JY1A 1TA4A 3RRBA 5B1HA 4L5BA 4GQIA 1UT6A 4H4EA 1G5PA 3IT0A 4Q34A 4FKMA 4ALLA 4ALNA 1CE8B 1DBQA 2XRZA 5JBIA 2CJYA 3IPAA 1SB8A 4UTXA 3QY9A 3W6PA 1EUDA 1ONSA 3EA0A 1TW2A 1DBPA 1KRWA 3QPAA 4G1FA 4MUMA 6LDHA 1VJCA 3KPUA 4WK6A 1II8B 3LXXA 3RC1A 1JDZA 1U0EA 2FEKA 3SJAA 5L7TA 4N65A 3P9ZA 4R6WA 1DJPA 3NDRA 1GVNB 3CG4A 3ANLA 3N5CA 4MV7A 5EXPA 5IT0A 4Z4FA 1L0BA 1XTRA 3AM4A 2C4TA 5HMMA 3L7CA 4LVCA 4A23A 3NJ8A 2H2AA 2OBLA 1CRWG 1IXKA 1J2EA 4W9NA 4ZJUA 3WI7A 2OBMA 2OD2A 3NGMA 1U6IA 2W8ZA 1IULA 5CCEA 1G1AA 1K2VN 2VUHB 3A1UA 2XBUA 1CY6A 2IHYA 2PANA 2VQSA 3GGOA 3HKCB 2D1QA 4FGJA 5BW5A 1Q2UA 3VOSA 3A2MA 2CL6X 4G36A 3EC2A 4KWHA 2GO7A 3STWA 1RYEA 3P0HA 2AOWA 3ND7A 2X8JA 2R84A 1S1CA 1UXJA 2BUAA 2OVBA 4EGAA 1JAZA 4IVPA 1LZLA 2W2VA 3JQ9C 1SCAA 2BCJQ 2FEMA 2KLHA 1Z6AA 2CF6A 3CINA 3JQ7A 3SJBA 3MF4A 1YFJA 3V00A 3Q0TA 4R0NA 1RYNA 1EX6A 4EW3A 4F38A 1GTZA 1UKVY 2FDRA 3ESXA 2HUNA 4EYKA 1W47A 2Q6OA 1KA9H 1WLSA 5LNK1 4QT4A 1M33A 2GF2A 1SB9A 1V3VA 3LUGA 4ZV7A 3RFTA 4G0YA 4NECA 1JKJA 2DE0X 4ETIA 1NFRA 3GCGA 3WLPA 3RW9A 2VO1A 4QZVA 3KR1A 3NTRA 4FCWA 3CEJA 1C9JA 1NDQA 2YVLA 3IO3A 3O8OB 5FPPA 2JGEA 1IEVA 2W83A 3QBTA 4Q9HA 5ALPA 4PZYA 2CXXA 1PK9A 2HHLA 2P6OA 1Z06A 3FNEA 4OYYA 3ZGOA 1BCSB 5MF6A 3BQMB 3OJXA 3NWPA 1EWQA 4EX6A 1JQBA 3MLEA 1ID1A 3L0OA 3ANYB 1LLUA 1YA4A 4MAMA 1C7RA 1G291 3EG5A 1PG0A 3HA7A 3VSCA 4EG4A 1J6UA 4TS1A 4WK0B 4LC0A 4D9EA 2DWPA 3K6JA 2ZETA 3Q6MA 4HXEB 3BWMA 1U8EA 5F4ZA 4A8PA 5JJ5A 1O9GA 2H4ZA 5JSZA 1RBYA 3PQ6A 1YS1X 3T9DA 2QTAA 1P9OA 1FP4A 1EVLA 1PQ4A 3BGDA 3HSSA 2ODPA 3BJEA 3HWWA 2PUVA 2YHIA 4G07A 2EJBA 4IGKA 1VJRA 2R00C 1Q1AA 3CKKA 4HHEA 3SXPA 3KQSA 4HDSA 4F4FA 1WDLA 2RC5A 2HWWA 3BD9A 4K6OA 1S4QA 1ZISA 2J6IA 4G84A 4KQXA 5JSKA 1XHFA 4QBIA 2ZBRA 2CZQA 2WIDA 4D99A 2PL5A 4QYWA 3RYIA 1OH5A 2A5FA 2ZDHA 4TTSA 3AKZA 2BIFA 1XNRB 1HNWB 5I45A 4AP5A 5J4HA 1CQIB 1FJ2A 1QS0A 4GW3A 4A0HA 4EW6A 3FSEA 5CX1A 3R9XA 4UE6A 4DMCA 3AEYA 1UINA 5JNUA 4FHEA 5L45A 3NBMA 1GKYA 1Y1TA 3WDLA 2RGRA 1GPKA 2VF2A 2OENG 1SUEA 3MYRA 3QI2A 4EFDA 3KT6A 4MYTA 1ID8A 1NLZA 3AHIA 2LV8A 1WXGA 2QDKA 2QP4A 2WYUA 1E20A 3NOVA 3NZEA 5LPNA 2XCTB 1QCZA 2ZRAA 4KN5A 4EJSC 3AIMA 4UXJA 1C1XB 2C0PA 1SHKA 1W76A 1YIDA 5JLJA 1HMYA 1E7MA 4M21A 2E1RA 1A1SA 3AETB 2JFXA 1ZA1A 4PSVA 4BNYA 2HT1A 4R7GA 3TVDA 3ANXA 5EKTA 2VOEA 3ZI0A 1OFUA 3RG8A 4G0NA 3LA6A 3MJHA 1ZHHA 4NBSA 3R0JA 1L1EA 4MAFA 5AI8A 1NNLA 2X5OA 3SX2A 3K8QA 2QI9F 3HBFA 4DYVA 4DV6B 3EIWA 3COWA 3IUBA 4BVBA 1M34B 3ICQB 5HYVA 4N0MA 1DPGA 3BWDD 3HHPA 3GIWA 4ZEMA 5ETJA 3CVXA 1S8FA 1EM8B 3FSGD 1VCHA 4N3AA 3IBTA 4LY9A 1F0PA 3O8RA 3E03A 3MWGA 4QGGA 5FAXA 3V5NA 3VOBA 4ABTA 3MNFA 1K5GA 1YR7A 3L7BA 5FKJA 1CUAA 1EFLA 1UBEA 3BTUA 4UKDA 1MIOB 1CR2A 3PQ7A 1LV8A 4O4IF 4D44A 3OE7D 4UTVA 2EBFX 5EMHA 3LGAA 1P4HA 2XDAA 2CFTA 1AURA 2J3QA 2PKQO 2SECE 4U2CA 2O6HA 1AQ6A 3PQ2A 1GQFA 3VO8A 3KAKA 2XB2A 4Q37A 1PJSA 4JQZA 5DHUA 3GLGE 1N6IA 4QOEA 1WEKA 4HDNB 3N05A 2TYSB 4GR9A 5E4YA 5GY7A 5FBWB 3WYCA 2JEYA 2R8YA 5IKOA 4Y1FA 3ICPA 1UPTA 1FU4A 3S5JA 5MHTA 3WBKA 5AKGA 5JBNA 3WOVA 1BS1A 4XUEA 3VMFA 1ZVKA 3NIFB 4K05A 2HQOA 2ECOA 3IP1A 3WBBA 1UAAA 4QJIA 5EA2A 4L9RA 3CLTD 1GXSB 3N7TA 4FOTA 3ZHUA 3AVPA 2K6GA 1M73E 4DMHA 5BSFA 5I7RA 4X8MA 4BCBA 2VXYA 1L5ZA 4LJLA 5IHPA 2B6HA 4XAQA 3TEJA 1AUPA 1JYEA 4AJHA 1BWRA 2YV1A 5C31A 1XXHA 3DZIA 1COZA 3UT0A 4Q3CA 1YCDA 4D4GA 4L7VA 3AY7A 4MJLA 2CLCX 1OGIA 4JOQA 4TXMA 2XMZA 3AT1A 4C6TA 1P3DA 1A96A 1XF9A 3GVIA 1I2AA 3HYLA 4R9NA 2Z95A 5ADVA 4MV9A 1QHFA 1WSAA 2IXTA 4QYSA 4Y30A 4ZVOA 4DXHA 3EPLA 4F3TA 3N58A 4Q47A 1OTHA 1F9EA 2VP3A 4G1BA 4EWLA 4EYOA 1GEEA 3E2IA 3VBCA 3SE0A 2WU1A 4P0QB 1XRRA 4XX0B 1XKTA 4L4RA 1IZ0A 4FYMA 1MEEA 3G2QA 4H7PA 1F5SA 1LB1B 1M2JA 1DBVO 4J29A 4CW7A 3DGFC 3LOQA 1J9GA 2EJVA 4RH1A 3JQ8B 2OXEA 4Y98A 5H68A 3UTDA 2DBVO 4Q21A 5CH8A 4EEZA 2VDJA 4NPHA 3GJYA 1DJQA 3D6JA 4I5GA 1GDHA 2AI3A 1C7E