1U1GA

Structure of e. coli uridine phosphorylase complexed to 5-(m-(benzyloxy)benzyl)barbituric acid (bbba)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
245
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Structural basis for inhibition of Escherichia coli uridine phosphorylase by 5-substituted acyclouridines.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 84
structure length 245
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u1gA00
4JWTA 5CYGA 4WKBA 2XRFA 3KVVA 1Z36A 1Y1RA 3P0FA 1TCVA 1K9SA 3EUEA 1G2OA 2OXFA 2H8GA 3FB1A 3F8WA 3K8OE 1VHJA 3C74A 1A9PA 5F7OA 1U1DA 4MARA 5EUBA 5F73A 3ONVA 1RXYA 4TXHA 1A9QA 1PR1A 1SJ9A 1JP7A 3DDOA 1U1FA 5B7PA 3TL6A 3NM5A 1ODIA 5EPUA 3BL6A 3EMVA 2HWUA 4DARA 4QFBA 4NS1A 3E9ZA 3NBQA 3UAWA 3K8QA 1VHWA 4ECEA 2AI1A 4BMYA 4YNBA 5B7NA 1Q1GA 1CG6A 4BN0A 1CB0A 1YR3A 4RJ2A 4G8JA 2P4SA 3GGSA 4GLJA 4TYMA 3QPBA 5CCEA 5EFOA 1RR6A 3KU4A 1YQUA 1JPVA 3DPSA 1Z35A 4UC0A 3SCZA 1SQ6A 2Q7OE 5B7QA 1PR6A 1Z37A 4GMHA 1C3XA 1XE3A 2ISCA 1VFNA 4OJTA 1ULAA 4NY1A 4QAQA 3FOWA 5CXSA 1JDUA 3O4VA 1TGVA 4QASA 3PNSA 1RXSA 1RXCA 2RJ3A 2OECA 4DA7A 4OGKA 1PR5A 1OV6A 4F3KA 3PHBE 4E1VA 1JE1A 3MB8A 1Y6QA 4F3CA 1SD1A 4FFSA 1T8RA 5I3CA 3P0EA 1RSZA 4PR3A 1OTXA 1ECPA 1JDSA 4LZWA 4X24A 3NM4A 1A9TA 4TXLA 5F7XA 5KB3A 2HSWA 4OEHA 1B8NA 4LNHA 2HN9A 3OOHA 3UAZA 1ZL2A 4QARA 4OY3A 1T0UA 2QTGA 3NM6B 4M1EA 1ODLA 3IOMA 1FXUA 1Y6RA 1NW4A 5K1ZA 4DA8A 1A69A 3ODGA 1V2HE 4L5YA 4TS3A 4TTAA 4K6OA 1JDTA 4G89A 4M7WA 1Z5OA 4YJKA 1LVUA 4MCHA 5CYFA 3T94A 1PKEA 2A0WA 5F76A 1LV8A 3KVRA 2BSXA 1Y1QA 1RXUA 1RCTE 3EUFA 1QE5A 1PWYE 4EARA 4D8VA 3D1VA 1U1EA 3DJFA 4TXJA 1A9SA 3OF3A 3FAZA 3LA8A 1V41E 1V48A 3E9RA 4WKCA 3FNQA 1WTAA 4R2XA 3KVYA 1Y1SA 4GKAA 4LDNA 3UAXA 3E0QA 4LNAA 3OPVA 4L5CA 5F77A 3UAYA 3GB9A 5IU6A 1SD2A 1Z5PA 4DA6A 1NC3A 1PR2A 2AI2A 2QPLA 3DF9A 2I4TA 2AC7A 4NSNA 5FAKA 4H1TA 3INYA 2QSUA 3FWPA 2A0XA 3FUCA 2HRDA 1YRYE 4WKNA 1U1GA 4M3NA 1OU4A 4DA0A 1T8WA 1K27A 1V45E 2OC4A 2OC9A 4D8XA 1TD1A 4DABA 1RFGE 5C80A 4JP5A 4BMZA 1YQQA 1OTYA 4R31A 1T8SA 1ODKA 5F7ZA 3LGSA 3OOEA 1PK9A 3OZCA 4L5AA 3EEIA 1YBFA 3OZDA 5CXQA 4G41A 1ZOSA 4OF4A 3IEXA 1PR4A 4TXNA 4KN5A 3KHSA 4MCIA 4I2VA 4IP0A 4R2WA 5DK6A 4D98A 2AI3A 4YO8A 1Z5NA 4DANA 4TXMA 1Y1TA 5ETJA 1OUMA 3BSFA 4WKOA 1NC1A 4F2PA 4LKRA 1VMKA 5F78A 1Z39A 1OVGA 4BMXA 3UAVA 3BJEA 1TGYA 4QATA 5CCDA 3U40A 3UT6A 4D9HA 1JDZA 1PF7E 4L6IA 5B7GA 3ENZA 4DAEA 1TCUA 1Z38A 4F2WA 3OZBA 4WKPA 1PR0A 1M73E 2I8AA 3LBAA 1V3QE 2ON6A 3BGSA 1JYSA 2QDKA 4TTJA 1A9OA 1T8YA 4OGLA 4QEZA 1ULBA 2QTTA 3OCCA 4L0MA 4U2KA 1RYZA 1K3FA 3O6VA 4P54A 3DP9A 1V4NA 1RT9A 1I80A 1LX7A 2PGAA 2GUWA 1Z33A 1JE0A 1JDVA 4TS9A 4D8YA 1A9RA 1U1CA 1N3IA 4PNPA 1Z34A 2A8YA 1PBNA 1PW7A 5F7JA 4TTIA 3KUKA 3OZEA 4GLFA 4EB8A 4F1WA 3PHCA 4DAOA 2B94A 1B8OA 4YMLA 1PK7A 5IFKA 3PNPA 4JOSA 1ODJA 2IQ5A 5JPCA 2A0YA 3MMSA
chains in the Genus database with same CATH superfamily
3MGKA 2WP8J 1MTZA 2ZYGA 2QX9A 4CETA 3GLHE 2AH5A 5FEMA 4FC7A 1KVTA 4TV9B 4U7FA 2ZSAA 1SU7A 4KXNA 4PCUA 4F4DA 4DV0B 3CW8X 4M0FA 1YMUA 5DDIP 3UWMA 4QBGB 2W7TA 3U7HB 3KWJA 1XJ0A 2GCPA 1HYHA 1PYOA 2FEPA 4RF2A 1D3AA 4H6WA 2Q2VA 4LOKA 3S29A 3VHRA 2P6OA 1TEHA 5JMWA 1TLLA 2X9NA 2HQ1A 2OEPA 3BHJA 4W8GA 3RIEA 4CIDA 1PNOA 4M8LA 5JJKA 2Z57A 3D6AA 2VDUE 5A6VA 5AW2A 4HMQA 2BGIA 1ZMTA 1JNYA 2XGSA 1I0LA 4OPMA 1A4XA 2IUSA 2DHRA 2RGUA 3DLCA 1TKAA 3FLAA 4G36A 5J2TB 1D0VA 1DCTA 3HUFA 2J6HA 3TJMA 4ZAFA 4J07A 4QDTA 3WFIA 2C7PA 5BOVA 3VVMA 1ZOPA 3DTTA 2WNSA 3AVPA 3FVTA 1FJ2A 2PSFA 1ORDA 2J4CA 3CEJA 1YFKA 3HUEA 4O4HB 1A71A 5JAUA 2WHPB 4LK3A 4Q21A 4JCOA 3D6JA 3LLMA 1GKUB 3RS2A 1RRKA 1YJCA 3VPSA 1S1MA 2AHOA 2VYQA 3E9ZA 3GFFA 4NESA 2YJNA 5JWOA 2WAMA 4EHNA 1RCUA 3AUKA 2YHIA 4EHAA 4TM7A 5JJBA 3MMXA 5TB5A 5DB4A 3TJRA 4HDCA 1XU7A 4ECEA 3FVWA 1N6PA 3I34X 2WAYA 3O74A 4MB2A 3U31A 2OWEA 5KPJA 2XXAB 3VO8A 3IT1A 1EP1B 2FOIA 3D6VA 3JYQA 4JYPA 4RYDA 5JAMA 5F1YA 1P0QA 2FU5C 3E3AA 4JHXA 5HJ5A 3FNRA 1GPH1 1T4CA 3ZWKA 5FOQA 2ERCA 3H0EA 5JHGB 1OY1A 4IHKA 5DSZA 5FTMA 1DEKA 5BORA 1JA0A 5JSYA 1ORVA 4AIRA 2FG6C 1TYAE 4LGVA 2VSFA 4C2UA 3GXOA 3R8CA 4G8JA 2YZMA 3OZSA 1YKFA 3DB2A 1ORRA 3PHGA 2HBZA 3GP5A 4I5FA 2JASA 1KYIA 1YKGA 3IP8A 4DA4A 3QPBA 1XCBA 2PQ6A 3QVXA 4EPTA 1X39A 3GD5A 4RH0A 1NYRA 3TLBA 2V6JA 4YYEA 3ZXYA 4BWYA 3C3CA 5F4ZA 4WOPA 1X8JA 1KDOA 1ZN7A 1Z6GA 2HNKA 3FTFA 4ANFA 1GSIA 2JVJA 4BRWA 5LLSA 4FLMA 3WDMA 3ZXIA 5KC9A 2I6TA 3SHTA 1OLUB 4NI5A 4E14A 3AETA 4KRXA 2Q3CA 2ZYDA 1NYQA 3WGUA 2IEGA 4DRYA 1VMIA 3HN6A 5DCLA 4FFNA 2PUDA 1OREA 2GBLA 1OHHA 3W5CA 1XE3A 4I8IA 1F4LA 4EO7A 4A92A 3R7FA 2ISCA 3BMOA 2QVYX 1U9IA 4G2TA 2WVJA 2ACVA 1OYWA 3HADA 4TQ9A 2W43A 1GCOA 3JZFA 4QAQA 4RPGA 3ZY6A 3NMUF 2DQKA 4EHFA 1VRWA 4GICA 3PUJA 4LJRA 3HFJA 4RA6B 4ETWA 1B43A 1LK5A 1M66A 1CVRA 5CXSA 5ECGC 4X60A 1KH3A 2JIQA 3N0WA 3PRKE 4LDPA 4PG6A 1UMDA 4ZK2A 5BSEA 2GRJA 3SDZA 4HQ6A 2XUHA 1E4OA 5GPBA 2ZXFA 4GECA 1Y5LA 4G5QA 5FO0A 4COKA 1KL7A 2OECA 5JSFA 1W88A 2H48A 2GR9A 3LW8A 1VI2A 5DZSA 3RG2A 3WLRA 3A6DA 2OGUA 3SX2A 4F3KA 5AW0A 3SS8A 2FJUA 1SHUX 8AT1A 3R0JA 3H5VA 4D6XA 4LV8B 1LC0A 3STTA 5A5VA 4A8JB 3QVVA 1U6IA 2G9UA 5JXWA 3R6GA 721PA 1U2RA 5LLDA 4G0QA 2J3QA 3L7OA 5KU7A 1TZ2A 1DO2A 1MD9A 1FZTA 1MF7A 3ZZTA 2ZYHA 1T36B 3AGPA 3DDZX 1CZNA 221PA 4BWFB 1OTXA 1CIVA 3DMPA 1OA0A 3EGOA 4PX9A 4FR0A 2GPNA 2QRMA 4A2WA 1K3TA 5SY4A 2IZZA 3I83A 1MO4A 2B5WA 2Q6TA 2WHEA 3H18A 1MW9X 2H11A 2HA0A 4JP3A 4E1BA 4NOMA 2ATCA 4KQ1A 1LW7A 1R12A 3C70A 3IUJA 4DQUA 2FPKA 3FMPB 3WNDA 4DSUA 1B8NA 1L5VA 2DFNA 4OAQA 4ARIA 4MUEA 1C9NA 4XYEA 2I65A 4NZPA 4H0CA 3QQ5A 1LI5A 3IXLA 4F6LA 4MXDA 4OTZA 4S0XA 4UQLA 5IG2A 3LVBA 4IDEA 1J49A 5DOVA 2EKZA 4B84A 4BO5A 5FWNA 1DINA 1HF3A 5G4KA 1LZLA 1I13A 2I4IA 3NM6B 4D3ZA 3TW8B 3JQPA 3FYDA 4M0EA 4HVLA 3P52A 4LRYA 3T1OA 1G6OA 3O95A 1MZPA 3TZEA 4FFBB 1BN7A 2IRWA 3IUQA 2J87A 4L8WB 4P82A 1AKWA 3I1FA 3TL3A 4PSVA 4YP0A 3RHFA 4YRKA 3PFWO 2OB2A 1NV9A 4C3ZA 3DL2A 1XJQA 1IEWA 1GTJ1 3DUFA 1KY5A 3ODGA 3OPNA 4QXQA 4Y9TA 4A16A 4DCCA 4ZTZB 2VNKA 4Q47A 1PUJA 3PQFA 5ALHA 3TRJA 1D5CA 3EXEA 4E11A 1BMTA 1N25A 1ONBA 3K5IA 3MZ0A 1LBTA 2YHSA 2QD1A 4UD2A 4KBGA 4IIEA 3E9CA 1FTSA 5CVCA 2O7QA 2ID8A 1MCZA 1KYQA 2WWIA 1W5TA 2HA3A 3ZD7A 2CMDA 4PNZA 3HUUA 1NBWB 1R8QA 2XMQA 4MTLA 3HO8A 1PJTA 1ADJA 4QODA 1E2GA 3BA6A 2Q9AA 2AFHE 3RLIA 4BEVA 4NV3A 5JATA 2G28A 4C22A 3AL0C 2OO3A 3NNNA 5DTJA 5EP2A 4EG1A 1YZLA 4UHCA 4N7MA 1M74A 5IC5A 1ONSA 4Q01A 1X42A 4YUYA 1Q22A 1DAHA 2P79A 4OHFA 1XMXA 2ZYAA 3AVTA 4LF9B 5LQCA 1RXUA 4QSHA 4BMOB 3ZVMA 4UREA 4YDSA 2JCSA 1N2IA 3KFVA 5JNSA 1DBRA 2DUWA 5F35A 1ZW6A 3HP4A 3DZKA 2OXRA 3R5TA 1MJNA 4O8CA 2PK3A 5IC6A 4AUMA 5FULA 1P80A 2P90A 2I4OA 4XDZA 3TGWA 1X2BA 2X0DA 4JLMA 1G2IA 1N92A 3CJQA 3ROQA 2WY2D 1DXHA 3QU4A 2ID7A 3WQHA 2X4LA 4NC9A 4CMGA 5AI0A 4CW7A 2QTZA 3T3HA 4D56A 3DVRX 5CD1A 1UIRA 4CFYA 2GK6A 5C1DA 1QDUA 2J3HA 3PK0A 1M2JA 4OJNA 4C4XA 1RFLA 3ZK9A 3LK6A 4ICIA 3H0KA 5I7EA 4ZZ3A 3P71T 4D25A 4I0WB 2B30A 3P9QA 1O0BA 3Q8WA 2YY5A 4H4DA 4PXSA 2AVNA 2QAIA 3ZHZA 4QPCA 3WRXA 3VU8A 3TZLA 3E0QA 4AJKA 4LNAA 4R8RA 2HT6A 2QZ4A 1B8PA 2HWKA 4PRLA 4WINA 1SULA 1IHYA 3L8ZA 4D8UA 5L3SA 3G0HA 1FFYA 3UOWA 1KI7A 1FYXA 1WB9A 1EJ2A 3HI4A 4XVQA 1UM8A 2ACWA 2RKBA 3DO5A 1ACMA 2OO7A 2AOTB 3CBQA 3JAWB 3QELB 4QGAA 5IU6A 5JJIA 1OAAA 4RORA 1PVVA 4FIDA 1ZUHA 2JW5A 3BXFA 3MWYW 1A4RA 1QFSA 2ZJ8A 1L5OA 1E2PA 2E4WA 4JXKA 2G1PA 1W46A 4YPOA 1UBJS 5KJEA 3BCUA 4HDOB 3V3KA 4DDMA 3HSSA 1UINA 2HA7A 2VCHA 3MWGA 5CFRA 3LC2O 4NARA 3HRIA 4ZOLA 2J6CA 1QH1A 1Q44A 4DEXA 5K0GA 2IHBA 4MKRA 2X9QA 4ZCMA 3MRSA 5T64A 4BE9A 2H4ZA 1ZWKA 2QRNA 5JO9A 2P9TA 3L40A 4Z0HO 3NHFA 2R8EA 1NJ8A 4Z5XA 1C7QA 4UEOA 4QO7A 1JKJB 2AUNA 3OP4A 3AIMA 1KK1A 5BSMA 1HLPA 4DBLE 1U5BB 4L74A 3RWOA 3VNRA 4EO9A 4BMZA 3G2HA 4QUAA 4V0QA 1M9NA 1P0FA 4DW8A 3LPDA 3HCWA 3NAQA 4IXWA 4RCYA 1UWLA 4FWIB 4JLSA 4R9UC 5ALWA 5ITZB 4L73A 3JATB 2COUA 2J0EA 3U3OA 4EUEA 1YWGO 1KJJA 4HQRA 4TQUS 1S2NA 2ZXEA 2W2NA 4MHSA 3HNRA 3QMWA 4BNGA 2QMQA 1HGXA 2Q5HA 2ZRHA 3L6DA 2ZWAA 4J4BA 5ER6A 5D1NA 3OZDA 4JSTA 3OQIB 4WA8A 5K0LA 3K92A 2QL7A 2J46A 4CDNA 4FDLA 1M6YA 3VRHA 4FFVA 5HSGA 2GUGA 1JAHA 3DOHA 3QYAA 4OCZA 1ZD9A 1DOHA 3CUEF 4U7GA 3RYIA 3R0IA 3JQRA 2PZEA 1OLXA 2WJ3A 1GZDA 2O8VA 4LRSB 4TWZA 3BSWA 1X0VA 1X7GA 3G1TA 4N01A 4UU1A 4BAGA 4BX2A 4CI0B 5JEEA 3RTGA 1FS6A 4YV0A 3U7RA 4LJ7A 2H6EA 3NHZA 5FB3A 1BJRE 2BFFB 4FGSA 3TOVA 4ZCRA 4RULA 1EJ6A 1WXDA 4NMHA 3UMGA 1QH8A 4YMTA 4Z6KA 3THWA 4EF4A 4XDGA 1NUQA 5B1IA 2QQFA 4LRQA 4PZUA 2G04A 1SZJG 2Y92A 1JKXA 1KVRA 2YW2A 3HEMA 3P9SA 2IIVA 4JELA 4N3GA 4ZEVA 5KHLB 1QMPA 3GF4A 2DQYA 2X15A 1R6DA 3JD0A 3QTTA 4XH9B 2HFKA 3CE9A 5JCOA 1EUZA 4NZNA 4HF7A 4YO8A 3ZE7A 3CSDA 1Y6FA 5KCMA 1ISPA 3UXHA 1CJCA 2ZI6A 2PKWA 2YZ2A 4N39A 5EE5B 3BDIA 5L4NA 4JB0A 1JIXA 3F1KA 3BSFA 1Q3KA 4QYWA 2YQZA 4A36A 3MJCA 2W6NA 2DECA 2VI5A 3H5AA 4MUYA 5KTTA 5IVHA 3A6FA 5ED0A 3PKZA 1OXXK 2GKGA 3N05A 2WVAA 5FPSA 3PFGA 5FLKA 1FYWA 1PDVA 1M75A 4ENUA 1OBVA 2DEUA 2Y1DA 1C3LA 5LCXA 1PEKE 4UM7A 2VF7A 1W1WA 4QG7A 5CW2A 4GSKA 1ZRSA 2Y4OA 4M9UA 3CWCA 2X1MA 4H6PA 4ARSA 1Q95A 1XZCA 2F62A 3VSCA 1E2KA 5IT0A 4L6IA 3WRYA 5HWSA 1BE0A 2OBMA 3OH8A 5IYZA 1VECA 1TA9A 2BFDA 2EKPA 3NIBA 4TZKA 1QHHB 3RSSA 3LXRA 1WULS 4BV8A 4C05A 3A8TA 4BDSA 2Q28A 1AU9A 2Z09A 1BCSB 3WFJA 2BM8A 5C7IO 3I2HA 4K6HA 5T57A 3VISA 1OQAA 2A0FA 2ZI5A 2R6DA 2GCOB 3H16A 4GP7A 2B8WA 4YJ2F 5CFNA 2QAGA 5P21A 2IH4A 2VJPA 1WMAA 4U63A 3OLYA 4JK3A 4BBJA 4HUJA 3MTGA 1BQ4A 5KTKA 4V2UA 5IAGA 1SC4A 1E4EA 3LNCA 1EFTA 1JRLA 1T6BY 2W6CX 2M6SA 3GQBB 3NG1A 5KDLA 4BAUA 2AJDA 1GPYA 3KXIA 4CL2A 3WL6A 3LI2A 1ESDA 1MOPA 2NIPA 2Q5QA 3FROA 4YCMA 4Z3OA 3H3JA 2BHNA 3ZI0A 4EA8A 1P0IA 3BDAA 3NDRA 1GL6A 4RV4A 1PJAA 4IS2A 2VNSA 5KNLA 3O4FA 2YJ6A 4QEZA 5EMKA 4E51A 3AEYA 5JG7A 5AVTA 1RHMA 3LH5A 4OI4A 2RGDA 4NBTA 5F9FA 1ZNWA 3MOIA 2GI4A 4BFTA 1KI6B 1FUUA 2FE1A 2XYQA 2XQIA 1HZZA 4HDSB 2FJPA 4OVKA 1DGQA 3KYJB 4CWAA 1PI3A 3N07A 4R8MA 4TWJA 5HKKA 2V0GA 2GXAA 4ARBA 4BMDA 1E20A 3A36A 3WISA 1NOJA 1GAJA 4KVFA 1DAPA 1TZKA 3MMZA 5DPMA 3LCJA 4EF6A 5AM2A 2DSTA 3O8NA 4XUCA 3LQ4A 1BH6A 1D5WA 3D8BA 2W4IA 2GCEA 2JHAA 5C81A 4AO8A 1NNLA 1PWEA 3GX1A 3S1AB 2WIAA 2BN4A 1EBUA 2ODNA 1I3NA 2XDQB 2FW9A 2X4GA 4TV8A 1PGQA 4UUMA 2O2EA 1AUQA 4ZEXA 3SG0A 2JGAA 5H70A 3WGZA 1GQFA 1UJBA 3IJPA 1XFDA 4LZPA 2FNAA 2YX1A 3B1KA 4RX1A 4XJVA 1W4LA 4AKSA 2ZJ1A 3X1XA 3KYDB 4RIGA 1J0XO 2D74A 2AFHA 2RHOA 4GBED 4I4TF 5KREA 4BNKA 4O4LA 1FFSA 2YDYA 2XGOA 2RI0A 4D74A 3AB7A 2O3RA 3O4HA 1IDOA 4Q3CA 3RHTA 3TO5A 3GLIA 1NUHA 2NVOA 2ZSDA 3PHCA 3JARB 2REBA 4MP6A 5EQFA 5CLQA 4B76A 3RFCA 2H4XA 1NU8A 2G9VA 2QQ0A 3D31A 4JP8A 5A6SB 3KQUA 1UPXA 2V9PA 3A04A 3C1OA 3WYNA 1Y4ZA 2WD7B 2HNBA 2PGOA 5CITA 3A4TA 2WVGA 2QE6A 3L7AA 2HSGA 2C04A 3UYLA 1UOPA 3NOXA 1OB2A 2BL4A 1TDJA 2PBZA 3O0TA 2FEOA 1GDHA 1U7DA 3G5UA 2RGRA 5BWNA 3GT0A 1TQHA 3N6VA 2WTMA 2B7CA 1FC0A 5DN9A 3IOBA 3IAXA 3EZ6A 3HKDB 3WGYA 3MD0A 5FRDA 1AHHA 2HO5A 3OIUA 3OF5A 3RJ5A 1STOA 3AZPA 3MYRA 4PO9A 5EVCA 4GZ3A 4XKJA 1G2OA 5H81A 3WSWA 3WYBA 4ZYTA 3FB1A 5CGZA 3IR7A 3PDIB 4Q4JA 1UBEA 1L8AA 4ZJZA 5CVTA 1I2DA 1BRTA 1SOAA 1ZX1A 4LHZA 1KGDA 3Q9LA 1F8GA 1T8TA 4R3WA 3RS3A 1NTRA 2AOWA 1VKJA 2B99A 4CXMA 5F7OA 3A10A 3NTRA 4Q18A 4IHAA 1JUDA 5CPFA 3MPOA 2XF2A 5D5QA 1A2OA 3AV0B 4ZO9A 1ISHA 4JDPA 4BB6A 4GI7A 1RXYA 4GVLA 1RRGA 2ASVA 4HFMA 4A6PA 3V7UA 2GM4A 5KX5A 2I71A 3BSSA 2EQ5A 2Y2UA 3UMMA 5ALNA 1Y1KE 2X2EA 1QGED 3R5FA 1WSWA 4PQRA 3HDHA 3BSYA 3K9CA 3UC5A 3O1IC 1XKXA 2IGTA 4WN3A 3LIPA 1LVHA 4YJ3B 5DCYA 5EZYA 1ZL0A 2C9CA 1E98A 2KPOA 2VP9A 3CV3A 2B4KA 3ONDA 3PENA 4HCJA 4B7AA 5M2QA 2PT7A 1AS3A 4XZ3A 3D6MA 2JD2A 5LBIA 1ZK1A 2NZXA 3HYRA 3NRJA 1MB4A 1ZJJA 3M6AA 3K8QA 2YVQA 4HJXA 2V6IA 1U2EA 5I4KA 1LBEA 1E7YA 1YHZA 3AUFA 3OFKA 2O0HA 4MMYB 3HCDA 2NAFA 2D8AA 1SXIA 3MTAA 4JROA 5EGSA 2Q8NA 1MT3A 4C4TA 1OLSB 1KO4A 2VK8A 1VYUA 3GU3A 1K9VF 4P7FA 2D2VA 4DSAA 3GP8A 2JFQA 4Y2VA 3TZHA 4BO8A 4MA0A 4ZQIA 4X64B 3PC7A 2AA3A 4C88A 1CG6A 2YS7A 2A5YB 4FXPA 5EMLA 3UAOA 1IRIA 5EHGA 1IY2A 5ALLA 3EOZA 1YZFA 8GPBA 1JJVA 2IZ0A 2YJZA 2JJQA 3SY8A 4LCEA 4RVUA 1TMOA 4C7KA 3Q98A 4BJHB 2CVFA 5H4GA 1QIIA 5KOYA 3EJ6A 1MVLA 3U7JA 4CQLB 1COWA 2JD0A 2J08A 3OECA 5BYBA 4Y2JA 4IEIA 3S7ZA 2ZJ4A 3UJ3X 1E7WA 2AVDA 1ZIOA 3OFSA 2EHDA 2WJ6A 2WA1A 1QRRA 4LN1A 4DJAA 2RB5A 5SZHB 3M7IA 3UQYS 2ZRJA 2ZVQX 4A8HA 4CF7A 4G8DA 1GQ2A 4LYHA 4MJLA 3W7AA 3QV2A 2BFEB 3WB0A 4XJSA 5B30A 4YROA 1C3XA 5FBKA 1I0IA 1M2FA 2D54A 5BUZA 4ZAVA 4R05A 3DEJA 3I58A 3WLLA 4BP8A 2AN9A 2P3OA 4KQJA 3IOYA 1WCIA 4LY0A 4M9XA 5TPZD 4AMGA 1K68A 4R84A 1ISJA 3CX6A 1ND6A 4X92A 2DU8A 3F9RA 3UWSA 1YB1A 1HI9A 2LV8A 2P9QA 1PSDA 2ZSIA 1XKTA 4AWBA 4BCCA 3U7FB 3PEYA 3F0TA 2EFEB 5DOZA 2AJCA 4ITRC 3K5WA 2M6RA 2QW8A 4HR7A 5A2GA 1D0IA 1NY5A 2J0UA 2RG1A 1BMQA 3V4FA 1FLVA 2UKDA 1GRCA 2A4KA 3DEAA 2XVZA 3N2EA 3TD6A 5EMNA 4LOIA 2XX3A 4YX9A 3B70A 3NFYA 4NIMA 4EAAA 5IWCA 4WA7A 5HZKA 5TGZA 1FSFA 3PQ7A 1AKVA 1DIAA 4YRNA 3U3DA 1E5LA 2B61A 1VE6A 4N5HX 4P33A 4DXAA 2XGGA 1CYDA 3BIXA 1SXJA 4TLAA 2XCTB 4CM6A 3D3NA 4Z9YA 3WIEA 1DRWA 2R62A 5AVWA 5IUJC 1E3MA 2C1EA 1BGXT 1IY8A 2CLOB 3DEFA 4OK3A 4UBNA 1GNVA 1DVRA 1B00A 3CVYA 1SD1A 4AWXA 3L93A 2JFYA 1UL1X 5DV9A 3FOFC 1F6WA 3RFTA 1MB0A 2J7PA 1L7XA 3P0EA 1C1YA 1H8HD 1P8JA 4Q66C 1F8XA 4EB3A 3BMXA 1ZD3A 2V3WA 4US0R 1ZHFA 4I55A 2ID4A 1B73A 1WV0A 2F1JA 4MQFB 1LBIA 3P94A 1GNQA 1IHDA 5I5GA 3HY6A 3MNFA 5F7XA 5FWYB 4G4SO 4HS9A 1KZ1A 5F21A 5I7SA 5LQKA 4ZREA 4YWHA 3GRVA 1ISMA 1JIIA 2CLKB 3N74A 2ZYIA 2WU3A 1D9ZA 1X1QA 3GAAA 2VJKA 2C00A 3DH0A 3FLBA 1QV9A 1J39A 2A9RA 1JHMA 3I92A 2DLNA 4PVCA 5C31A 4JKOA 5LWHA 1L4NA 1AGRA 2I7TA 3N6XA 3VO2A 4TRMA 3LHDA 3QX8A 4L9SA 4QARA 3U1BA 3QOXA 4JB2A 4PINA 1ODLA 1PJSA 2EJWA 3DB1A 5HQJA 3R9KA 3W78A 4NYIQ 1A0OA 4LHYA 2ZVJA 2VRWA 1P1RA 3AR3A 1XA0A 1XVUA 1UQUA 2F3RA 5ALFA 1SQSA 5JXHA 1LW6E 1LLFA 2D4AA 2XRMA 3L8EA 3QKRB 3SICE 3P0IA 5K05A 4UD6A 3VR6H 1IN5A 4RH3A 1X6VA 2VZ0A 1YQDA 3IQGX 4GSYA 4R3NA 3FSGA 3NPMA 1PYGA 3I01A 2G1KA 1QQ6A 4C21A 3OSUA 1KK3A 2BCGY 1FP2A 1U8XX 3DEHA 3P96A 1N0VC 3U9LA 3EW9A 2HIAA 3N0XA 1QVWA 3ODPA 4ITUA 2RKOA 3AP3A 4PAWA 1N7IA 2ZUTA 3ZC3A 4FB4A 1UQRA 1HUQA 4O4JF 4OMDA 2PJUA 5CGQB 4ZQHA 1M1NA 3LPCA 5GGXA 1NBEA 3W8NA 3GPDG 1Z0KA 3BMCA 4JP2A 4EB6B 4KLNA 4KZPA 3QVKA 3E4DA 4K28A 2BFBB 5EPEA 4UNRA 3R6WA 1XF1A 2H2GA 2IW3A 3E15A 5LP6F 3HR7A 2OKGA 3QF4A 1FY2A 3QXGA 1E3LA 3QLJA 4NCHA 3UO8B 2DG2A 5DGTA 4DVGA 5C8VA 2V03A 3HBMA 1C9JA 4K46A 3Q0TA 2WB2A 1N57A 2CUZA 2BSXA 2UVPA 4D0GA 4RHTA 2OAP1 2WAAA 4MJ3A 3T4PA 2W6OA 5E6SB 2Z5VA 3K0SA 3GJZA 5LYYA 2GZ3A 1P0PA 3A4LA 3KTDA 3EG5A 3CPHA 1MC1A 2Y77A 3C5HA 3PGVA 3X43A 3W77A 3ZZNA 1USGA 4V0ME 3LDFA 4AFNA 2HCJB 3SVZA 1JHDA 4LXIA 4F93B 1RI4A 1UFQA 2EKLA 5LMZA 5CA1F 3REFA 4CF4A 5HFJA 2IIBA 2CJYA 4L3OA 4DUGA 2V8BA 1WX1A 5JXJA 2XXJA 2BDEA 2AUMA 2QN7A 3D4PA 4HRVA 1SHTX 3OQJA 2GCNA 3IQWA 4GOKA 3LDUA 2V3VA 3ICPA 3M89A 3KKKA 1WD5A 3ROZA 3OM8A 2B2CA 1IZ0A 1PJ2A 4C0SA 4RKEA 1NXVA 1CF2O 4BJ6A 4MVJD 3O4JA 1DRUA 2WZDA 4F4FA 4DMMA 1HQYE 1QRTA 4LX8A 1PNTA 1JVNA 2JGIA 2VJBA 1N9GA 3V9PA 1U3TA 1PR2A 3AEUA 3NO4A 4DV2B 1GY8A 1C41A 2DUMA 1F3LA 4GYJA 1NVVR 3T3OA 3GAZA 3QOWA 4LGCA 4PZPA 3CZ4A 2H2IA 2VFAA 1RD4A 3ZNOA 4ARCA 2L2QA 2GRUA 1LLDA 1P4GA 1VCNA 4JVSB 5AKYA 1UJ2A 1P19A 5IHXA 5LUBA 3V4SA 3V4ZA 3L49A 4ZVQA 3UK1A 1WPQA 1G3MA 5FI1B 1KYVA 4CM3A 2WKPA 2BGTA 1FE8A 3PHJA 1M76A 3IKTA 3G5AA 4JBYA 1MQ8B 1TFUA 2AK3A 1RFGE 1G7CA 2BEVA 2GARA 4F5WA 3CGGA 5FV4A 2HLDD 2JJ8A 4KIWA 4ZQBA 4P38A 2JLRA 4MTCA 4EJFA 4GM1A 2NNWB 5EJAA 3ENWA 4L76A 4OI0A 3R3UA 4HB3A 2CDCA 4EQZA 4JYCA 3H9BA 4UQPA 3E84A 3RFFA 4DEYA 1VE1A 4RS3A 1MPTA 1K6JA 4AF7A 2FR8A 3OZCA 2PS9A 3SP1A 3COZA 3ZN2A 1H8ED 3DFFA 2VO1A 3NAMA 1BJKA 4I08A 3U4GA 1OX4B 1YBFA 2DPGA 3F3SA 4NAUA 2WFLA 4FUQA 4MVXA 2C1XA 4HWRA 1QF6A 2IUFA 2MT9A 1DBQA 3RGGA 3SJUA 4MVJI 4R83A 1NJ1A 1OZAA 3DO6A 2VDMB 2YNMC 1ZICA 2JFWA 3MHPA 3QWAA 3WRWA 4F71A 5KOJB 1ESMA 1Y81A 1XKLA 1RU3A 3BPSA 3DVAA 3AM3A 5IM5A 3WSTA 1RYBA 4HDKB 4J76A 5KWEA 1S2DA 1VYTA 2G08A 3AJAA 2UZ1A 4HNTA 4M55A 2Y93A 2DWCA 4KW7A 3T0IA 1SKAA 2ZCVA 4KLZA 2QI9C 1M7HA 5EXPA 1DIHA 1KAEA 2V59A 1X1AA 5B3JA 2OLKA 1C3EA 1BFUA 1SKBA 2BFOA 3E81A 4IGAA 3RD5A 4X44A 3DDUA 1ZM2A 1WDLA 1NF2A 4MIKA 3HB0A 5AWFC 2H1RA 3HZRA 3LFTA 1T10A 1M54A 2I4NA 2PVSA 3G8AA 1E5QA 2F3PA 3IVAA 3QKSB 1UZNA 3F97A 9ABPA 1WF6A 1RQXA 1N4AA 2H5JA 5D3MA 3H97A 1QGDA 3X3HA 5HFAA 2ODQA 5BPFA 2Z2IA 3WX0A 2WMNB 3HB1A 1E58A 1I5EA 4HZUA 4JUIA 1MX3A 3WQQA 1XZ8A 4X7RA 2I6FA 4AZTA 4BV9A 4H1WA 2C3YA 2P4EA 2D2FA 1XD2A 4G0OA 4NK5A 3AIKA 3OBIA 1F2DA 1QQBA 3I2GA 4M49A 1QUEA 2AR0A 3I2YX 3O2QB 2PR2A 4CV3A 3NHRA 1TQDA 5BUQA 5I7UA 3BH0A 1ZAKA 2I6QA 1Y8CA 1VGRA 1OFVA 2XOXA 5CFQA 1TGYA 1NXXA 1W4BA 2AMYA 5EXEA 5JD5A 1ABEA 1XLTC 3N2LA 4J9VA 4L9AA 1E2IA 2J07A 1DIOB 4Q03A 1SCUA 3REOA 2VAWA 3G9TA 4OHCA 5AVYA 4CEJA 1PVOA 1T4BA 5C4IA 1KEPA 3KC2A 3I1JA 4QICA 2H3EA 5K5EA 1BXGA 4ZAWA 1R6XA 3QBEA 5LKRA 2VDQB 4XGQA 3C3PA 3NYQA 4UHKA 5EFZA 2X8JB 1QK4A 1ONPA 3KFLA 1G7TA 1QIEA 2C83A 3LRXA 1L5NA 2EFYA 1Z8HA 5KYVA 3ZU3A 4ETMA 5AVQA 1QHEA 1KS9A 2YV5A 1BO6A 2C29D 2CDRA 1Y3HA 3N0VA 3FWKA 4O33A 2UYOA 5GZ3A 3QTBA 5K4AA 2FSSA 4CLDA 2Z2YA 4MX8A 2XITA 1DCFA 1BCRB 1WEKA 3VYRB 3EF1A 5ICGA 3T9CA 3ZDDA 2R5NA 4JMPA 1SIUA 3PQ3A 4BLVA 4GXNA 1UWVA 5DGDA 2COKA 2H5LA 2L19A 3GMSA 3IQXA 4HGYA 2VSQA 2H52A 3VR6A 1NG9A 4YJHB 2HHJA 4LRXA 3H83A 5SZIA 3BMNA 1GAEO 3OZXA 1YKSA 2CNKA 1H93A 1CZLA 1NJ2A 2VOEA 2QSJA 1L4FA 4P2BA 4MHTA 1CETA 1GAWA 1LPAB 1VB3A 3QOYA 5YASA 4MW9A 4L08A 4D42A 1QR6A 1O8CA 1RHJA 4HQOA 2GHRA 4P54A 3IOCA 1ECLA 2XMRA 1V4NA 3QWHA 3I04M 1RT9A 5JNTA 4GPBA 1AUPA 1QOPB 4GL4A 5EQDA 3E7DA 5EINA 4CTNA 3N5KA 2HL6A 2ZVDA 5CTAA 4JBWA 3A7DA 4A0HA 4B4UA 1PU2A 3JSAA 4NCJA 5L45A 1K1EA 4OSEA 1TF7A 1JSRA 2SBTA 3R75A 2DH6A 3WIBA 4MV3A 5IBPA 3KQYA 4FDTA 4XYBA 1YF3A 1SBQA 2JC3A 1ORIA 3GGPA 3LXXA 4GBJA 3AVXA 1P0MA 1V8OA 1IXZA 2EV9A 3OZGA 4S1WA 4TYQA 2ODBA 3A1NA 3UIEA 1U1CA 4ER3A 4GOLD 2P67A 4F84A 2O8FA 1O77A 1NWCA 2GWHA 2EKBA 2JFZA 3TQTA 4W9NC 4ZDJA 1Z34A 5JQWA 1DCMA 1WG8A 1E66A 3H2IA 3UY4A 3TECE 3S5JA 1WUTA 3NBFA 3ADKA 2ZB2A 3EFOB 4YRJA 2O3SA 4OYYA 1K7CA 2C2YA 2W6ZA 1ZSVA 4AMUA 3AGQA 1EUQA 4QXOA 4CLRB 5KDOA 2QTBA 3KKPA 5DHSA 4PXAA 1EEHA 4KPEC 3N2GB 3QPWA 2FMUA 2XA9A 1XHLA 2HU2A 2QUHA 4B7XA 1EQUA 1FCJA 3FVVA 1GKLA 1P75A 2BDTA 1D7AA 1IHPA 1KZYC 5DCUA 4NNJA 2PRKA 3BXHA 2NZUG 1WVIA 1ZCFA 2DOKA 3TR0A 1UAGA 2CB0A 1E9AA 2EP5A 3NTVA 5BSWA 4QOJA 4U6QA 4TV9A 1EDBA 2I9KA 3I6QA 2KWIA 4KDRA 4E2FA 2FG5A 1PJ3A 5FNVB 5A03A 3CRQA 1ODTC 2P5YA 4EWLA 3DF9A 1FFHA 3LRPA 3EDCA 3BRWA 3MMSA 1MX9A 1SCKA 1XX6A 5DGHA 2FMHA 4AW9A 4DN6A 1T4GA 4WLUA 5EIHA 4ZQFA 1OXUA 2M6LA 5E6RB 3GGDA 4TMKA 5CLFA 2XDWA 4H15A 2OM2A 4WKGA 5EJIA 1M8JA 1EG7A 1HO3A 2K4MA 2PWYA 2WILA 3HYCA 1V1MB 5JNUA 3F8WA 4Z3DA 1KZ6A 1NFFA 3PDWA 4B8WA 4M9QA 4CKEB 3VKUA 2MSCB 4EO4A 3L8HA 3L9WA 3QBTA 4P3OA 5JMOA 4IMRA 5AFSA 2J3DA 3MGCA 5HILA 1AOXA 1N6OA 4W5OA 2HK8A 2ONKA 1SAYA 2O6LA 4LC9A 3FTCA 3DNFA 4IXNA 1G9TA 2Q3BA 2XE4A 1F4PA 3QV1A 4X0EA 4O4HA 5AHOA 3USES 2WHPA 2OY0A 4RV5A 4RZQA 3M1AA 1L4GA 3AR2A 2C2MA 4JIMA 1VJRA 4NYJR 1CY4A 3VR3A 2A33A 4GU5A 4O2AF 5AK6A 3H1FA 1S4QA 2XMPA 3AC0A 3X1JA 4XGRA 4M7PA 3D0QA 1W85A 3VR2D 1L7RA 1CKEA 1IUPA 1H3FA 1ZIXA 1ZGCA 3QIAA 5LBUA 4F6RB 3ZJTA 2EYQA 3B7WA 1J33A 3UYKA 4QXMA 3WS7A 4C0XA 2XXAA 1KZ7B 2XMZA 2IIPA 4MVJG 1PR9A 3E70C 4QGFA 5LZ5A 3AMVA 2FX3A 1XQ9A 2B5VA 3K31A 3F6PA 3ZTTA 2WJZB 4CM1A 5K8TA 4OFBA 2CFCA 1O9GA 1XQ1A 2J7KA 4L1KA 4ZZIA 2WU1A 4FXOA 1I94B 2AOXA 1QYIA 2UYHA 5LXTB 1LDYA 3R3JA 4IDQA 3WDKA 3KZVA 1Q1GA 1L5FA 2EU8A 2Y0PA 3PEEA 2XLCA 4I8DA 5HGXA 3CGWA 3G9XA 1IJBA 2FPSA 5EY5B 4EUKA 1W59A 1YDHA 1F8UA 3IDAA 1O0CA 3CSUA 3FTNA 3LXUX 1GA6A 5JJ5A 3OQBA 1GPKA 4P92A 5H59A 3MTIA 3L7CA 3Q15C 1BGVA 1Z6TA 2ZWMA 1ZNQO 5AUNB 4Z49A 2IELA 3QWFA 4MITA 3NV9A 5K51A 3KUCA 3AVVA 1I7NA 1UKAA 2WTXA 2IT1A 2DBVO 3F9CA 4P93A 5BMVF 1P77A 5TE9A 3LBNA 1GFIA 3BULA 3ZHTA 4DQXA 2E5FA 4KIJA 3WYAA 4J0IA 4P6VF 1UEIA 1VHLA 3UC9A 4TWBA 4YRMA 5M5BA 2H59A 5BNIA 2OXCA 4IYJA 4LRUA 3UFBA 2C03A 2WUVA 4Y6LA 4P22A 3FJYA 1PR6A 1U80A 2ZLBA 4HEA1 3GRUA 3UWDA 4BO4A 2LD4A 3RU7A 4B4DA 5A05A 2A58A 5A2QA 1OFUX 1KMCA 1JEOA 1QM5A 1FJGB 1N8NA 2VNJA 5NULA 4RJJA 3WA6A 1UK9A 2ZVPX 4M98A 4MGIR 4QYIA 5EIEA 3KEFA 2XCOA 1X1EA 2V58A 3V33A 4CNQA 5MF6A 5E3HA 4DCOA 3AU8A 3FMGA 5CT6A 2O5VA 2Q45A 4NQZA 4OA5A 3ESQA 1YBMA 5C51B 2QQ5A 4BNZA 2QRHA 4AY3A 1E94E 2E2WA 2F48A 2JAQA 4KB5A 3FOWA 1ESNA 5LQNA 2CSUA 3UBMA 1XJ5A 2CLCX 3VPGA 4CM4B 4KKVA 1EWKA 1CJSA 4QASA 3B8EA 4WGFA 3VZCA 3EWNA 5GVSA 4WXMA 2CEKA 5B1SA 3PNSA 4A8JA 4BKQA 2RJ3A 3N75A 3QSYA 1JHRA 4WH0A 1SCQA 4YTEA 3SDBA 2FPGB 4X20B 1C1DB 3NATA 1PR5A 5C3UA 1XVVA 3WNCA 3EODA 4HD8A 5TR9A 1OBHA 2VA8A 1LU9A 4XARA 1T36A 3WC4A 3A1UA 4UM9B 1E9VA 1E64A 4L8FA 1TVKA 3CF2A 3CX8A 1HOXA 1KE2A 1JT2A 1C2YA 1Z6ZA 4PFKA 1RLIA 4ERNA 3LJKA 2C82A 5HTOA 3LGAA 3H4MA 2PUAA 3HTXA 5ADWA 5KYTA 1AQUA 4HAIA 1XHEA 3CMMA 1JPNA 3L0OA 2HLNA 1N5DA 3NEAA 3NDPA 2HMSA 3N87A 4QBIA 1RJEA 4X24A 1YAHA 4AF8A 4BTEA 3BDVA 5C8DA 1ID8A 1MB9A 4ER7A 2BGGA 4DLRA 5EMJA 4PGMA 4UVHA 4FOOA 3L84A 1X86B 2IXDA 2NO1A 3LSTA 2QS9A 3L7DA 3RSZA 3T7SA 5THQA 4B2PA 1JQBA 1WZCA 5ES4B 3L0CA 1Z6AA 4B6RA 1T2UA 2VBFA 3B2NA 3EZLA 4O4IB 1YU9A 5A4KA 4IXTA 3TW8A 5C5DA 5I45A 4K1LA 4FFBA 3LX5A 1T0UA 2IPLA 1MJGM 4JY7A 4IRMA 1RIFA 5I9LA 3AVUA 2R2GA 4UVDA 2W6QA 1RQNA 5F33A 4C0JA 4FDMA 4Q9DA 3NYWA 1UMCB 4X65B 2SNIE 3A6HA 2A9VA 1Z6YA 2WIGA 4S12A 1L4LA 4S3MA 3BM5A 3G88A 4Y67A 4ZOBA 4RMNA 4JITA 3NOVA 4X91A 3U17A 1JG3A 2ISQA 2Y0CA 4QNNA 2NAPA 2YXPX 4Q9HA 3TLGB 2OFWA 3QX3A 2BD0A 5TX7A 5I4BA 2FEXA 1M72A 1QLJA 2DJIA 4XWGA 5AOCA 3QEBZ 5LQDA 1FYDA 3N5CA 4E2YA 1K8RA 2YIDA 2AZTA 1YJBA 1P7CA 3L7BA 4BNWA 2Q2OA 4OHOA 1RADA 1TIKA 3LV8A 1Y8RB 4LAFA 3ZK8A 1Q1BA 3QKIA 1OX6A 1ZM7A 3Q7PA 4P4SB 5G3YA 4EVQA 1BIFA 3WSVA 1L5SA 3K3PA 1C50A 4Z7QB 4ZYZA 1R0CA 3ITNA 3ZXSA 1YS6A 2XVXA 5CYFA 1J8QA 4IVRA 1H69A 4J4HA 3TG8A 5M7EA 2YS6A 2ECPA 1K6IA 2SKCA 2ZTHA 3HGQA 5CP8A 5TPWB 1NZJA 4DL9A 3R3VA 4UTVA 5IKMA 2FWPA 4E30A 3L6UA 1N9KA 3OWXA 4QTTB 5D8DA 4FHDA 1RWPA 1Y9DA 1YR6A 2PCJA 2G6TA 2UZ3A 1UQTA 3QHQA 2W2QA 4LC0A 1XL0A 2NV0A 1T9ZA 5ARBA 2VP2A 4LHEA 1J6UA 3IT2A 1OZFA 4Q9IA 3U6KA 4H6VA 5CK5A 1PWYE 4W5HA 3SJCA 2MSNA 3TCXB 4R8KA 4Z4GA 3TXAA 2QN3A 1U5AA 5I4CA 3OF3A 2GM5A 1B7GO 1ZCAA 1K8QA 3R6TA 3SXPA 5KYGA 2OD2A 1LWNA 3P26A 4QT4A 1U3UA 1Z7GA 3RK0A 4HAOA 3RBXA 1RW4A 3EVDA 3O9VA 4NE9A 3R9WA 4KK4A 2VHVA 3E9EA 1BVYF 1Y1SA 3K1TA 3ZE0B 3QMPA 3ZHYA 5A4JA 4YAOA 4WADA 3VUFA 3EULA 5DBOA 2AOTA 4O63O 2VHYA 3EVTA 3QELA 1P0CA 5IJZA 1XKQA 1EX9A 2ATEA 4UE6A 4B85A 1X7YB 2P11A 1U9IC 2J45A 3IPCA 1IULA 5JALA 3OOJA 4E15A 4ALKA 4D4MA 3SHOA 3NTLA 5KJFA 1T34A 3DGFC 3HVHA 5CUQA 3KVOA 3GUYA 1QIJA 4KU4A 3I9V6 4PAOA 4WCFB 1DAKA 4BLRA 1HXHA 1SD2A 1Z5PA 3ONWA 4IV0A 1RLMA 1IB0A 4LBWA 2P3SA 3QVLA 3NUZA 3E3MA 1OTHA 2QSUA 5ICSA 3BXGA 4JOQA 5EJFA 1NLZA 2HRDA 3CJRA 1KKUA 1NM5A 2HR1A 5CEEA 2IHYA 2BGNA 1NQVA 1JKJA 1V5WA 1Z68A 2JGKA 2VDOB 1MIOB 2WINI 3EIEA 4N7JA 4M1QA 4DOMA 5ABPA 2O2XA 3ZDCA 1U5BA 4M1SA 1H05A 1O5IA 4M0MA 2EZ8A 3N2KB 1OH5A 3UMBA 2EZUA 4AKTA 2NO9A 1OF1A 4D9BA 5ITZA 3N9IA 2AV6A 4COOA 2I80A 3JATA 1SBHA 1P74A 2PO5A 1XAIA 1B23P 3IULA 4QUKA 3KD2A 4WLEA 1UFOA 3O0DA 3I76A 1DE0A 1HA3A 2D5AA 3I2KA 3AWIA 4N9QA 1ESZA 3RRMA 1I4TD 2EQAA 3OQIA 4TUYF 4PHFA 1NXSA 1TJ4A 1XNHA 1D4FA 1MO3A 3W4JA 2X2FA 3P5SA 1P31A 4QUDA 1B0UA 4MYHA 2N47A 2FB9A 2FSUA 3K1AB 4Y6OA 4UM5A 1GNLA 4Z9AA 2F43B 5IZ4A 2FKNA 2ICAA 3A0RB 4N9WA 1G66A 2BFFA 1Q14A 4GW3A 4L50A 4U5XA 5C1OA 3DZHA 4EM6A 2P2LA 3UXEA 3F3YA 3BXPA 3CKLA 3DLHA 4MIEA 1KRXA 2DBRA 2BM9A 2OCIA 5GONF 4PYKA 3TKLA 3RWMB 3R8XA 3J81A 3KX2A 2ET6A 3UCXA 2NYVA 1R2QA 1CJBA 1YZQA 3BYZA 5GWXA 1YZUA 3IQHX 2Z9BA 4U9UA 1HTBA 1KJWA 1JDNA 2LWIA 2WFZA 5JFGA 3O47A 1CJMA 4WXHA 2IS2A 3TTYA 5IBQA 4X93A 4I4TA 4KPFC 4XWWA 1MXFA 2ZR8A 4RHCA 2EJUA 4YAEA 2Y99A 2C4MA 1Z06A 4BO0A 3EGXB 4LOAA 3LY7A 2YXLA 4ASUD 2C2XA 2G36A 5FIUA 2AJTA 2QM7A 1YRHA 4J7XA 3F4LA 2JZCA 2UDPA 3G2OA 4RIFA 4LVOA 2P8SA 4G8BA 2XVAA 5AXDA 3PFIA 2DAPA 3QX9A 4ZXPA 1NUPA 2O1WA 5LB4A 3P0RA 1NASA 2XQVA 1OBFO 3QW2A 5FTJA 4INAA 3TQIA 5TMDA 1GDDA 1RRCA 3OJWA 4YREA 2IXTA 5A71A 1OVGA 1O54A 2PUBA 3D0RA 3PIRA 2ORIA 3TXXA 3BCHA 1ILWA 4Y0AA 5LQAA 1HV8A 2V5UA 3AHJA 4WL0A 3KWFA 3SF8B 3H4IA 2P7HA 5CIQA 3TCKA 2FZ5A 3CN7A 5K3EA 3JWJA 2ATXA 2X76A 3LTNC 1QHHA 4M9SA 1I2ZA 1ZSNA 1BWRA 3LDHA 2OORA 1AURA 1BS2A 1BCSA 5AVSA 1UPTA 3VC1A 1WXEA 1X1DA 3PR1A 4KMMA 3IEMA 1M2WA 1I10A 4LXYA 1AJEA 2G82A 4Q7MB 3ZV5A 5CB8A 1Z38A 2GCOA 3VHXB 2BUBA 2H1IA 2PLWA 1L2TA 3BFKA 3NOOA 1W19A 2VRBA 3NWOA 2F9LA 3OZBA 1W4ZA 4IXMA 4XOIA 1E6LA 1M73E 4Y2SA 3RARA 1LPMA 4MGZR 2OSVA 1CY0A 2PMDA 4FOTA 1BE1A 2DPMA 1D2RA 3GQBA 4MPPA 4WZ6A 5CJJA 5L6MB 1R0YA 2W70A 2R5FA 1LB1B 3TIVA 1XRQA 1Y80A 2ON6A 3K6RA 4GPTA 1AG9A 1Y5MA 4P5DA 2RH5A 4Z86A 3SEQA 2ZM5A 2E18A 2IF2A 3IQZA 2I4LA 1XCJA 3CEMA 5IH3A 1UKBA 3GT3A 3AB8A 1CZKA 4ZCTA 3CS3A 1NBOA 4A0GA 1Z08A 4F3TA 4DCUA 4EITA 1T2CA 3HB9A 2IDZA 3DBVO 4HPJB 2MCFA 2O0LA 5T6BA 1RCFA 1Y9EA 3ZWCA 1YMQA 5BR7A 1KI6A 5E9AA 3U80A 5FPYA 3SSOA 4HDSA 3WRXC 2WE7A 5LWQA 4OGFA 4P3KA 2ILVA 2JJMA 3ZQKA 2NO5A 3Q3JB 3CLTC 3EPPA 4TLLB 4YK7A 5GJWC 3I30X 1M2NA 2A5JA 3EZNA 3HPRA 4RL6A 3RC9A 3ZHBA 5CB0A 5F23A 3JRNA 2DFVA 2VVTA 3TPCA 4A4DA 1XRNA 5HJEA 3H4VA 4YXFA 2YZKA 2JFVA 3IALA 5BT9A 4F12A 4IF6A 2ONCA 5KDDA 3GJSA 4AN1A 1DPGA 2AYZA 3NHLA 1XZKA 2CXOA 3DMTA 3S1AA 2YC4C 4BWVA 3BHIA 3H99A 3W3AA 3RUDA 4HQFA 4JQCA 4OB6A 4CKYA 5IT5A 3PPXA 1YDEA 2GVZC 3BWEA 5KKAA 1NW6A 1I1NA 1Y48E 4R9SA 1QXSA 3CPSA 2B6NA 3KYCB 3OUUA 3R5SA 1M0SA 1TXGA 4BNTA 4HNSA 5AVXA 1T2NA 2DTEA 2VPWA 3DPUA 4D8YA 3DBRB 2Z8XA 3KYDA 3OLXA 4Z7JA 3TN7A 2VSYA 4D8WA 1RWXA 4GWKA 5DE3A 2ZT6A 1BGWA 3IC5A 3OICA 2WSLA 4PNPA 2ODWA 2FFRA 2B4AA 5AIAA 3WMFA 3ES9A 2Z98A 3DFMA 1KQOA 4DMUB 3GLGE 1QP8A 1Y33E 3JZAA 1O9HA 2OZPA 3P9CA 3C4JA 4FBGA 4OU4A 4QD3A 2FX2A 1NVVQ 4RQUA 3GA7A 1IY1A 1M3SA 3JARA 4WFJA 4AJLA 4NBKA 3V8RA 1G5QA 3AV3A 4V2IA 5LIPA 1JV2B 3DPIA 4JJKA 5IF3A 5MHTA 3PR2B 5K0TA 4DAOA 2BUCA 3E82A 3D8HA 4P9NA 4OQZA 1T1IA 3X1KA 2DY1A 4MCAA 5AKGA 3SLGA 4B5KA 2GEFA 2QRVA 5K3SA 4ZVRA 4Z1MD 4DR4B 3N7TA 3HKDA 1HT3A 1E2NA 4XDYA 4DCPA 4FTWA 5BN5B 1Z75A 4WNYA 1V7PC 3OWHA 5JT1A 1F5SA 1AXEA 3H9QA 2FXVA 5KOIA 1QKJA 2D6FA 2F64A 2GNAA 2YR0A 3VZRA 1FP4B 2PLAA 3PDIA 4LRWA 3GA0A 3EB9A 4QQKA 2VYNA 3O9MA 2Z2ZA 4DIOA 1E89A 3GIDA 2O2HA 3ZD8A 1BA3A 1W9MA 3DFKA 2XUKA 3E1GA 3PB3A 2RSLA 4IAOA 1I7DA 2IS4A 5KWVA 3II6X 3S8YA 2H8GA 3KUDA 2WR8A 3D4OA 1ST3A 2D13A 3RRXA 4XR4A 4YASA 1KK2A 2IZ6A 2POCA 3QUCA 3E1SA 5B55A 1I2MA 3ELBA 1U1DA 2ZBUA 1KY2A 1WXQA 3FH0A 1LD3A 1Y42X 1KIFA 3DD1A 2I2FA 4X6LA 4NP6A 3WE7A 5KKNB 4B4KA 1F3OA 3N76A 4LIPD 3GY0A 4J43A 2XHZA 4UOQA 1F06A 5ICFA 1J8FA 1HT1E 4YJ3A 3ISJA 5FTWA 2EG9A 1LWOA 1MEEA 4NYMQ 1SJ9A 3VMFA 1PGJA 4HAVA 4RCVA 4YUZA 4MQUA 3ZKAA 1OXBB 1QO9A 3OZRA 4UTZA 2F9MA 5EPUA 3VI4B 3B6MA 5CA0B 2XOKA 2VUHB 2JDIA 1WB4A 4PZ0A 2HWUA 3D6FA 3P4UA 4BU0A 3QPCA 3WRYC 5LPNA 1R00A 4GR9A 4E3ZA 3Q5GA 5AW5A 1NI4B 1NDUA 2YN0A 4G01B 5KTNA 1TUBB 2WWFA 1VKHA 1AZSC 1XEXB 3U4DA 5KS2A 4E6EA 1YOBA 4MP3A 1A4IA 4R0NA 2XEXA 2ZZKA 3OMXA 2H3HA 4L0QA 4XFKA 4UZEA 2DZDA 1P2VA 2VLIA 4XSVA 5HE9A 1KPHA 3W5BA 4A2QA 1M33A 1T3TA 4HWSA 1WBBA 1U9CA 3BJRA 1V43A 3BGOS 2QAGC 1XMIA 2Q29A 5DBGA 4FX2A 4FGJA 3WGTA 2IC5A 5C8ZA 4TTQA 2RB4A 1CJUC 2Q1TA 4FPXA 2PZJA 1L7MA 4V0RA 2O3QA 1YR3A 3O7WA 3OIYA 2ZYVX 1PYDA 1FQJA 3EMBA 3MN1A 3ND5A 1BS1A 2L69A 2PAFA 3GEHA 2C9DA 1LKZA 3NDJA 4LWOA 4BWGA 2QXUA 4C3UA 3WDLA 1XMOB 2WF6A 3SBEA 1ZJ5A 3E5MA 4I9HA 2Z6QA 4YLYA 1TVCA 3HHPA 4L0DA 4UZFA 1ZEJA 3KU4A 4FEEA 3K8ZA 4UC0A 3OQNA 1YUMA 1HDZA 3FBTA 3ZCSA 1AN9A 4FZJA 2BFEA 1BEEA 2IYNA 2QENA 3V6MA 3G8DA 5BMOA 5KEIA 4RTSA 1QU3A 2WYHA 2FPRA 5I7OA 1UANA 3QE3A 4F2HA 8LDHA 1HZZC 3QLEA 1Z47A 1A4UA 3OOWA 3SNKA 1ODCA 2YJTD 4M2LA 4NHOA 1X7XA 3LKBA 3MT9A 1CF9A 3RT1A 5HZGA 2YWDA 3MIIA 3B7PA 3R5XA 3G59A 1YNSA 2OV2A 3DMHA 3H5LA 4CR8A 4PIPA 3SGLA 2EZ9A 4KAAA 4B1FA 1Z12A 2C4UA 1RI2A 1X1TA 3FN4A 1I51A 4J3FA 1YK0A 3KQSA 4MVJM 4GMFA 4E31A 4BAZA 1N6HA 3INTA 3ZHQA 3MTDA 1PQUA 2JIRA 4G67A 1T6NA 2APJA 5THKA 2ZM6B 5D7NA 2XBUA 3CRZA 1QX3A 4WFIA 3JQQA 2FVXA 1JHPA 3ZWQA 2FUG1 3K15A 3SQOA 3E18A 1V8DA 3L4EA 4FLEA 2JCYA 2N42A 5DJ5A 3DBHA 4FGWA 3UCFA 4DJEC 1DJMA 1FOEB 1E4YA 4RVSA 3SJZA 3H5IA 4OGKA 4P5EA 3WMEA 3KDPA 3E4CA 3PCRB 5G0SA 2P9ZA 1O96B 3EQ7A 3L0PA 4EG8A 4CL0A 1JQ5A 4AS1A 2V65A 1UDCA 2ZBDA 1VJCA 3NZEA 4KIGA 4BGIA 3B7GA 4DWVA 1ZJZA 3JALB 1EFVB 2AT1A 3JTEA 2CHGA 2P8JA 4KQIA 4YRTA 2R2AA 1Y5IA 4MQFA 1CNEA 5FWYA 3H3XA 1EVKA 1F8FA 1MXHA 3GK3A 3NYRA 5EQTA 2XTAA 3C5VA 1PSWA 1HE4A 1Y7LA 2R8RA 5D1HA 3F46A 4IKEA 5JPIA 3KLNA 1AN0A 1TAGA 2QLLA 2DCUA 3PXDA 2XDYA 4V39A 2ANCA 4OGWA 2A92A 5KI6A 4YHBA 4E2ZA 5IXYA 3EYWA 1PFWA 2QVXX 5G0UA 1HYQA 4OGGA 2ZROA 2P9EA 1ZOLA 1GPUA 3MCTA 4M1TA 4F85A 4YPVA 2CBGA 3I6YA 3S27A 5JECA 4MUIA 5HHTA 2CNLA 3IH5A 3KKLA 3IDFA 1R5BA 4KPYA 2YHUA 1L0BA 4E32A 4ZAYA 1HRKA 4ZTUB 4CIWA 3KBBA 2JAWA 3KJFA 2EJVA 4G65A 4QT0A 3AR5A 1E8DA 2EAUA 4PQEA 3W0LB 1QS0B 4IS3A 4BPRA 4CQLA 1J5XA 3LZCA 4RCZA 3K20A 3H2SA 5HBGA 2FPLA 4KX5A 3ZGLA 5AVVA 4P98A 3GDOA 5LU9A 4QBTA 3HRKA 4CE6A 3QKRA 3AHCA 5DTRA 5HIMA 2NV2B 2F1HA 3QUSA 3ZR4B 1Z5GA 4N48A 1YBHA 4H3KB 4FNMA 3G0DA 4R8VA 3O8DA 1F1JA 3MUFA 3L7MA 3HKCB 3MILA 3NDBB 3CH6A 3ETEA 3VVLA 2Z30A 3ZV4A 1J5PA 3NORA 1WDKA 2VBGA 2W2KB 3HYTA 2BMAA 4RPJA 5JJLA 1P7ZA 5HF8A 1I3CA 1KXZA 5LZ4A 1TTQB 1J06A 1E0SA 1ONNA 1XEWX 4PWYA 5AW9A 1AQYA 3AEKB 3UKOA 2XKKA 2O05A 5IJAA 4AYTA 2IH5A 4EB6A 2IEAA 2X22A 1E2HA 3IXMA 2BFBA 3ZV3A 3ISVA 1WXXA 4HN4B 3UW1A 4LZLA 4CTKA 1ZVMA 4DBLC 3I53A 1DLIA 1GARA 2CDNA 4M76B 5C7LO 1TD9A 1XWIA 3OKCA 1UBGA 4XCXA 4XDHA 3ESZA 4BGVA 3PWKA 4O0LA 2V4MA 1JFFB 4B3SB 2IZ1A 3N2NA 3JYLA 3IEKA 1J2YA 4RLHA 1WY7A 2HCTA 2REXB 1N2CE 3LHIA 5E6SA 4B45A 1SBCA 1ZNZA 2OCGA 4LOHA 4CDRA 5F64A 3X1WA 2F8MA 1XK6A 1F5NA 1SRQA 1OWLA 1U8EA 2EJCA 4R7TA 3FPGA 4WOBA 1FXWA 2WIJA 3LFUA 5ESRA 1ZVJA 2GBFA 1UKYA 3ZIAD 1JNXX 1S02A 4KL8S 3JXEA 4JQYA 4P34A 1M2VB 1SFRA 3NFRA 2GTPA 2E5LB 1TPYA 4PLHA 4POAA 1L1RA 4DV1B 1THGA 2KW5A 3BHNA 5IDVA 4ZGGA 4BQIA 3OTHA 4O29A 4LZJA 5TRTA 3UB3A 1CLUA 3JQCA 4F86A 4F3RA 4DLSA 2PEZA 1WMFA 3E9RA 3AUAA 4XD7D 4AROA 4CI9A 2FJ0A 4OXKA 4BNXA 4YV7A 3UT0A 1FFCA 3O92A 1HDOA 2EDAA 1KH1A 4DPMA 1TJ3A 4L4RA 1QMGA 1IJKA 3VU3A 2COEA 2GXSA 3S81A 1AE1A 4Y2PA 1MX5A 5G0TA 1QUFA 3T7KA 2Q4EA 1KR5A 4CLEA 5I6DA 2XNDD 3IB3A 3R3WA 2PSHA 1JWBB 2HCBA 4YJDA 3UAYA 4TKUB 2B4TO 3UHFA 2EFGA 3DTVA 4G85A 4IZIA 3WKCA 1ZY2A 4D9EA 5HIAA 3PA8A 5FUBA 2O8DB 1NU6A 1V37A 3A1WA 4LMBA 1II0A 2XVYA 5H83A 1EZ4A 2X41A 4BLOA 2ECOA 2ZRPA 2AC7A 1TK2A 3L41A 1OPXA 3C45A 4KEAA 3IEVA 2YOGA 2WMDA 3WGHA 2DR3A 1GQOA 5IUKC 4CKCB 5E2AA 4IM7A 4FI3C 4L7QA 2XVMA 1QYRA 3ONEA 3VZQA 1DC3A 2PSSA 2JFGA 2PJZA 2VJCA 4Y6GB 2WWTA 3JU3A 3C3DA 1Y6ZA 3M6UA 1SXJC 3K53A 2J9ZB 3DWEX 3PXUA 5HIIA 1U5CA 4W5QA 4FLFA 2HT1A 2QP4A 1GILA 2R1TB 3MCWA 5FFFA 3O4IA 2KB0A 1RBYA 4M0DA 1E3TA 3OT5A 4KV9A 1N5RA 1UJ4A 3VXKA 4EKNB 2W4MA 3EDOA 2VYVD 1ZRNA 2VH2A 4X7PA 5E7MA 4ZZ1A 4AI6A 2BYTA 1LLCA 2QW1A 3B6IA 3X1MA 2WYVA 4J16A 3TVYA 5K8JB 1TCAA 3K2QA 4XLTA 5AD1A 3ACCA 4HDKA 5CXQA 1XTBA 6Q21A 5AW8A 2SKEA 1R6AA 2JBAB 4JI8B 1T0PA 4C3OB 5AVUA 4P31A 3DHNA 3KJGA 4P80A 4BDTA 4PYRA 2IPMA 2VAVA 3IDQA 3OUTA 1Z07A 3KZXA 4EYEA 2Q1SA 2XNCA 3NBUA 3O8OB 3T52A 4PZLA 2V1XA 1WPXA 2D1FA 4XYLA 1PR4A 3KQPA 4KN5A 2CJXA 1GYPA 3QKSA 1Y3FE 4HQ0A 4KGZA 4RK5A 1P7WA 4Z53A 3R7WB 4IW3B 3WAKA 4UUNA 3R7BA 4EBFA 2X9GA 3RVPA 2CFSA 1E62A 3L07A 4JQOA 4MRVA 1Z4QA 1CUVA 1VCOA 1ID1A 2QRQA 2ZE5A 3L8MA 1BZYA 5FFMA 2ZRFA 4C9BA 1W49A 1JSZA 1Z5NA 1DRVA 1OBCA 4BEWA 3JPYA 4UTOA 5PNTA 3ICQB 3W9UA 2O7RA 5BSVA 1Y8ZA 1Y1TA 3VPBA 1E6UA 4S05A 1TJPB 3G7UA 5EMHA 3OLCX 2QR3A 2W83A 1I5RA 4H3SA 4KWHA 3GQVA 4UPVA 5DTQA 1G8AA 5ILQA 4BP9A 3OSZA 5BRNA 4BB0A 4EHKA 4KRYA 4CMAA 1W36C 3GJTA 5AKJA 3SHQA 4FM9A 2XSZA 2BY4A 3QVJA 4O59O 3NHUA 1QGAA 3FWYA 4GPZA 4KDFA 1Y8QB 4EL0A 5B7NA 5HM8A 3ZDAA 3PUVA 1QNLA 1V5IA 2Q2WA 4JI5B 3RV3A 1F17A 3QIVA 4ZVSA 1UEJA 1NL3A 2O23A 5A9RA 3O1HB 1TAQA 2MYPA 5CFPA 5KO2A 3EUWA 5HDQA 2DP4E 5AK3A 1F48A 2X8JA 2PKXA 2R1UA 2Q41A 1M6WA 4NRDA 4Q9AA 3X44A 4CMIA 3B20A 5KZMB 4KR0A 5JMPA 5GINE 1KOJA 1S5PA 4N0PA 1X3LA 4PHHA 4E5YA 3TLZA 2BEKA 1PNRA 4TQAA 4NBVA 1PR0A 5KSWB 4AQYB 2ZPUA 1WVMA 2KLBA 1C0PA 3VNSA 4KOAA 4F8JA 2IHZA 1BCRA 1Y9JA 4LZNA 1RMYA 5DHFA 1NN3A 1IN6A 2HSJA 4HAUA 2PD3A 2F3UA 5CM9C 1CZRA 3OC6A 1I24A 4JVMA 1QF9A 3HLTA 4YJHA 1B26A 2UVQA 1U1IA 2FOXA 2PLRA 2Q46A 2VRCA 1QGUB 1QCDA 4OXXA 2WJ4A 2QYTA 4X63A 3DEKA 3GLSA 3NCTA 3ZIUA 5AI5A 1JHUA 4NV1A 4TMXA 4D9FA 2NTEA 4M6WB 1SG0A 1RLJA 3BB4A 4B73A 4B74A 2MSWA 3LIIA 3ADOA 5L3QA 3QPDA 2BGUA 1ZFNA 2ZB4A 1SOUA 1YUBA 1T8YA 2FKAA 1U2QA 3EQ6A 3KO8A 4HYTA 2NSLA 2BCEA 4LWQA 2L17A 5EHZA 3QVWA 3MWLA 1GN8A 4MS3B 4HKTA 1DS6A 1OGJA 3CKYA 1TM7E 3OHPA 4GI5A 2IYUA 1SKQA 3K73O 3TLCA 3REGA 2NO7A 5IKXA 1LF5A 2GUWA 2Z3ZA 4NNOA 4BB9A 2OPHA 2WB4A 1KSFX 4RZUA 4Y2GA 3JWGA 4Y2QA 4B83A 4DCSA 3BJZA 4ZVLA 1XV5A 1WWKA 2RC6A 1JDVA 1RWKA 2NXEA 1YR2A 3HB5X 3OMWA 2FMFA 1PL8A 2I03A 5BQFA 3SLKA 1IE3A 3B8HA 2BGWA 2QMOA 1NVFA 1VHQA 1P9WA 1UJ6A 1GZVA 2B5OA 2BMEA 2KX7A 2W71A 3B6EA 2X58A 3DQZA 3ORQA 4LY3A 1G4AE 2PTHA 1DC7A 1G63A 621PA 1IG0A 4UEWA 3HYSA 2H5IA 4RMHA 4I81A 2C2GA 4C6HA 1MABB 2CHUA 4HX5A 2C2OA 1E96A 2Q5LA 2HRRA 1PBNA 1SUCA 1ZH0A 4ZVPA 3RAJA 2HIGA 3N2GA 4K6KA 4YR9A 1H2AS 2WD9A 1VZ3A 1AXRA 2ZSEA 4U7WA 3QX7A 2H5EA 1N2CA 2YRFA 1QH9A 2FR8C 3HE3A 4RLSA 3TDMA 1YR7A 4J91A 3OM0A 1L3CA 4ND2A 4NK4A 3ROFA 4F7DA 1FNSA 1VPEA 1BKYA 1EVLA 2WPNA 3MUNA 3W2TA 2AHRA 3IELA 3OJCA 2R25B 4HXGA 5BN4B 1QGYA 5FNVA 5HNKA 1TF2A 3GP3A 2FN9A 3V97A 1YIAA 4AURA 1PIWA 4LJYA 2FX5A 3HU5A 3W5IA 5KVVA 4G97A 1SKUA 1UZLA 2H1FA 4LXHA 3WLHA 2OSBA 1I3MA 1UC4B 521PA 4MUGA 5E6RA 1KQPA 4ROTA 1Y89A 1E9SA 2VT3A 3MWEA 5EJ4A 3A1CA 1ZI9A 5ALIA 3WLPA 1Z2AA 2MOKA 3GJYA 5B3JC 3W1VA 2VNIA 1V1MA 2HA5A 2SECE 2V4UA 3HH8A 3E9MA 3DL7A 4INJA 3PUZA 2ZB7A 3IP9A 3UQZA 3NWPA 4J2OA 1JEYB 3Q72A 5FPQA 1KETA 3L92A 3ZWPA 1LZKA 5GTDA 1JL3A 2H0RA 3GEMA 3H17A 2IK8A 1K8XB 4LYEA 5KPDA 2OXFA 3TUZC 2BKEA 1I9GA 1H85A 2AXEA 5K8CA 5FX2A 5CDTA 5JSUA 4D43A 3JRWA 2PQ0A 1XQWA 2J6IA 1X7HA 2UUPA 3QVMA 2ATVA 5ALQA 5AM0A 5IHPA 1U28A 3QBDA 4LZZA 3BVPA 5LQRA 2V7TA 1AY0A 2R79A 3LL7A 5TS3A 4NCBA 2OHJA 4LC1A 4HEJA 4E4TA 4TS1A 2IV7A 2O3JA 3M5WA 2PTGA 2XUGA 2I2AA 4QA9A 3N6RA 4HADA 5L3RA 2GZ2A 3GXBA 1JEEA 4GX0A 4ZEWA 4IY1A 1Q20A 1VHTA 5TGTA 3ROKA 1FJXA 3NVAA 2FLWA 5DH9A 3WLTA 3EMVA 2UXCB 2EL9A 3NAZA 4L4UA 1HR0B 3KUXA 4KR3A 2FP4A 2TECE 2V98A 1RYFA 4FONA 3MT8A 3GG9A 5AI6A 5EWJB 4YUWA 5EP3A 3NH9A 4L8GA 5EIBD 4ZU3A 2QJOA 2QTMA 3PXEA 3UAWA 1LRKA 1Z18A 4BQQA 3WWPA 4QKQA 5LXTA 5HKBA 3OIVA 4FEAA 4NU6A 4Q37A 1UDWA 1N9ZA 4KAXA 3IP6A 2AD1A 2JVKA 3PD0A 4XQGA 2JI6A 5EIAA 1L6IA 2GH1A 4NABA 4WLFA 5FOWA 1A72A 2QN9A 2WG2A 2OLJA 1SZPA 5EIFA 4A73A 5H80A 1RJWA 2O8EB 1TMYA 3MCAA 1WP9A 4A1OA 5JS1A 3I5MA 3KHTA 3Q6IA 4L6CA 2WZCA 2OCAA 4FILA 1ADBA 4MINA 3IAS6 5D6NA 3BAFA 3UK6A 5K3AA 3TIXB 5B2FA 3SHVA 4AUKA 1KGSA 1K92A 1DWUA 3IPXA 2FSFA 3Q9NA 1C7IA 4Q7KA 4BVLA 4DYDA 2WI8A 1EHIA 5IUNC 2NG1A 1NXPA 4DJTA 1P2DA 4MRNA 1GNSA 4OG2A 2TMGA 3H1BA 3GPCA 1F0KA 3BH6A 1JYFA 2VUTA 3GLRA 2ONYA 2W6MA 1YQUA 2NU7B 3ANXA 1KERA 3FTDA 1F1BA 2O0MA 3OX4A 3V8NA 1OH6A 1KMQA 1RQGA 4BASA 4FMCF 4PX3A 3KG2A 4MR7B 1DELA 2GMWA 3D4NA 1JLRA 4M8KA 1NLMA 1LK0A 1PT9A 3DMYA 4DBZA 5FUMA 4P3YA 4L4XA 1WDMA 2R60A 2G40A 2YQ5A 4IDAA 5LZ7A 4IOLA 2M6KA 2BH2A 4HL6A 3MGBA 4WXYB 2QZPA 1GG9A 3Q8XB 4R40A 2IX3A 2PXHA 1BMFD 4MLZA 3DS8A 1AQLA 3HL0A 3LBIA 4IQ0A 4LJSA 3TCNA 1M5UA 4LYJA 4CM4A 1SA0B 1TM1E 2DUUA 5HF9A 3K8YA 3VH2A 3OLZA 1KHHA 3DCJA 4LOLA 3CNHA 2H1SA 3D7MA 1V47A 2FPGA 1SVOA 3BK2A 1C1DA 3EDMA 3F7OA 4X20A 4BU1A 5KHOC 3T1TA 3RSOA 3O4VA 4LVCA 3AI1A 2RIRA 2WU0A 5E0OA 2MIIA 2IOYA 5K03A 3L6BA 4YXWD 3CPEA 2N9UA 3S2YA 3M1IA 2RONA 2WKWA 4LFAB 2P2YA 2WTBA 2Z9CA 3RT9A 5A1JA 1C8KA 1U7PA 2G8NA 1V9LA 2XZDA 3UM9A 4X94A 1AF4A 2A3NA 4R4JA 2YFYA 3PHBE 4BB5A 4Y2XA 3L6RA 5EJEA 3Q6NA 1XDDA 1JG4A 4EJ6A 4FHCA 3MSXA 5JY1A 1HNNA 2R11A 3RAGA 1WXGA 4RANA 4YAIA 5HZMA 5HM6A 1I2AA 4E5KA 5FAXA 1ZUNB 6ABPA 3ILHA 3W2IA 3MUEA 3FI9A 2LKCA 5H4HA 1E2JA 5I7AA 1IN8A 4AJ4A 4KOEC 3VZPA 1UXJA 1ZD2P 3GCXA 2QM3A 1Q6ZA 3KWLA 4TSFD 4P3XA 1M1YB 2QU8A 5KB3A 3FYTA 2B21A 4O4IA 2C2KA 1L6RA 1U04A 3EQZA 1YZGA 1C8LA 3NDIA 4HLDA 3UJPA 4BNMA 3WMWA 2I76A 1ZAYA 2GPJA 3HJCA 3I5AA 4EVSA 3P9KA 4ALJA 2ZBPA 2GN0A 4F5YA 5C8XA 2Q49A 2Q5JA 1N0IA 7MDHA 3E03A 3CB2A 4DC9A 4YIKA 2CVZA 1W47A 3HEAA 4G5YA 4AIIA 1A8HA 4DF3A 5BR1A 1UMCA 1MIHA 4X66B 3ZKWB 4B46A 3KEGA 4DLAA 2XYRA 1E3IA 1X15A 1Z0AA 3SIXA 1A1SA 4WASA 1MAHA 1OWPA 2Q8QA 2WNIA 3FSEA 4IX1A 2QP3A 5EC8A 1SELA 4LXQA 3WL3A 1OAKA 2XMGA 3PGA1 2Q9BA 3LM8A 4ZANA 4BN4A 4OQYA 3TAUA 2O2IA 2ZCUA 3FJ1A 1R15A 1DZIA 1EP2B 3THXB 2X1LA 2PH5A 3Q41A 1IM5A 1TW3A 3BL8A 4NQRA 1SUDA 2RGWA 4X1KB 3VO9A 5K0EA 2FFQA 4OHPA 1ZOOA 5T4FA 5LZ2A 1Y8RA 2PGIA 1KFBB 2V8OA 2VF5X 3E05A 4P4SA 3U3ZA 1OPRA 2H9IA 4X7MA 4D4LA 4E5NA 4FFLA 1RHQA 1JQKA 4K9SA 3RHZA 4CRWB 1JZTA 3LHKA 4OAOA 4OO3A 5BV8A 1SB9A 2FDCA 3QVTA 4EABA 3QXCA 1DQZA 5KTPA 5GP1A 3B1JA 3JASB 4EJSB 5TPWA 3ASVA 5ED4A 2M98A 4P36A 4NWIA 3DNPA 4EFKA 5KYNA 4LXGA 1UOEA 1ECCA 3A26A 3IR5A 4ZODA 4EY3A 4Q82A 1IOLA 2CVQA 3M9LA 3W2HA 3FVQA 4DIEA 1E3SA 3SX0A 3HMKA 3HLYA 2VTBB 1NMYA 2DTDA 1GTL1 1HMYA 3JS5A 3OTWA 4I50B 4JUCA 2AMLA 3OPYI 3T9AA 2XJ4A 2Z4RA 1TJ5A 3AFHA 5L7WA 2W8BB 4IWXA 2BGJA 1EGMB 1XP5A 1MHPA 3I9KA 4WXPA 4CQMB 2IYXA 5HF5A 3ZY2A 3EZ7A 5T7BA 2VSXA 2DJ5A 3WMRA 2O5EA 2F3SA 3FPSA 1KVSA 1PJCA 3ETLA 4KAFA 1J2EA 3M6XA 4HHEA 1G3RA 3CUTA 4OHVA 2PXCA 3UBTA 4BPBA 1E1QD 2WUWE 1E2UA 1WQ3A 4NULA 1HETA 1JJAA 1QVVA 4KV7A 3RBAA 3HN2A 4ND8B 4QUGA 1WOMA 4WDRA 5LQJA 1V41E 3T7CA 1M8PA 1UKCA 2BONA 2ADMA 1AQJA 5TJHA 4RK1A 1W0KD 3EZXA 4FR5A 5L4LA 3U5TA 3DAFA 4TLEA 4XCQA 3N8IA 4C4OA 1CUGA 2VUSA 4BZXA 1X7YA 3A6KA 3IKMB 4D9IA 3TEJA 4ADSG 4NZYA 4M7RA 1O5OA 4BKPA 4ZMBA 1QQ7A 1JDBC 4WCFA 3I9LA 2OFXA 4RE5A 4PQGA 4W5JA 5JVDF 1EX1A 5JY6A 5FPTA 1NR5A 4WLOA 5F4BA 4OP2A 3WB2A 4QZVA 3U49A 2QTHA 3KQQA 4QJBA 5A7HA 1U3CA 4NZOA 4EKIA 1V3TA 2ZWOA 4HUQB 5IAOA 4RTLA 2QLBA 4AJOA 2C99A 2BC9A 1Q1ZA 3E5NA 3IKLA 3LX8A 4KQEA 5DU2A 1OFUA 2VNAA 2QSZA 3IV6A 3QE2A 2O07A 1MIOA 2Q3LA 4IMPA 2I4TA 3I39X 5U4XA 2HJVA 5H3LA 3INYA 2YCBA 1VLHA 5CTJA 3LF2A 4PPQA 2PS0A 1NOKA 1NVMB 5E7IA 4WKNA 2LE0A 2BFWA 3IURA 4H1VA 3KQOA 1KYZA 1PWHA 4MLDA 4A8JC 3CU5A 1R5NA 4HS4A 4C4RA 3CF4A 4PFSA 5JAHA 1BWSA 2R68A 1HE5A 2NSHA 1L5WA 1Y1PA 3VAZA 3ZUGA 2PEYA 5EKDA 2MR6A 1ZIPA 2WG0A 4N54A 2V7WA 2JLYA 4RY0A 2VPTA 4Q4HB 1R3UA 4TMYA 3CEPB 4AXBA 1NX9A 4S35A 4YT8A 3P45A 2CBZA 5F5LA 1H42A 3K1AA 2ES4A 1YQQA 1JQLB 2AC4A 2R00A 1AUVA 2F43A 3W6OA 1IUKA 4MS4B 2VN8A 1BX1A 2X0NA 1WU8A 3ORYA 4ZP1A 1KMMA 3FHCB 1YXMA 4X1YB 2V7VA 3C7DB 3ECCA 3HDQA 2VUUA 3EEIA 1EM6A 3FLMA 2QROA 1LTKA 2XTNA 3C97A 3D1LA 3DLTA 3KAPA 4GEKA 3CEHA 4G26A 5I7HA 2MTBA 3L0SA 1AQNA 4L8YA 3MHTA 2JH9A 1X74A 2CLDX 2JJ1D 2V9CA 3ADCA 1RXWA 4NMLA 2I3GA 2Z83A 3GNTA 4XVRA 3D2CA 5MDHA 3N58A 1EVEA 3D7SA 3FWHA 3EZGA 5JXGA 3T3NA 4MEJA 5DXAA 2JI9A 5E9WA 3QMVA 3EFBA 1A9ZA 5AKIA 4F38A 4MICA 2NYUA 1J7KA 2ZS7A 3EZFA 3GMDA 5IM4A 1E0JA 2OFOA 3M4ZA 2B7LA 1XZPA 3RQIA 3T5AA 1E61A 4NONA 2GDZA 4I2VA 1L8LA 1E5XA 3A6JA 2A5GA 3Q9UA 2C8JA 2ZR9A 3P8ZA 3IMGA 4RIEA 1GSAA 3W8DA 3C7KA 3NAGA 4BNYA 4GG1A 2HHHB 3TLXA 4ES6A 1LPPA 2QVBA 3H2HA 5K2MA 3RFUA 1A7UA 1IZZA 1ES9A 2BZSA 2ZG6A 1IWBB 3ZWXA 2G09A 2FFHA 3UNXA 2JZOA 2ZYUX 3OTQA 1YJ5A 4PTYA 3PUHA 1BXKA 1VMKA 2C3UA 3HB4X 1V8BA 4MYDA 5B3LA 5K0NA 5FH9A 4B8ZA 2QX6A 1GA4A 3ZQ6A 3ICEA 2FF7A 3WYFA 5JH7B 4YH1A 5IJ9B 1ZXXA 2MMCA 2BUAA 2P35A 2PUVA 1PJRA 5LZ8A 3T5BA 4IBOA 1JG1A 1DKMA 2I2BA 1EE1A 1OH8A 1HQKA 2HEGA 2J4FA 3VHXA 1J09A 3KU1A 3K1YA 2BELA 1EK5A 1GFWA 1JR4A 2I5PO 1DKRA 2L18A 1P3Y1 4CL3A 2K5UA 4ZIRB 3ZJVA 1PF7E 3WGJA 5I51A 1EVIA 5HXAA 2CZQA 1QCZA 3GI1A 2YY7A 1U9YA 1GGVA 2FPPB 3UUWA 1UC5B 1FVFA 1Y7HA 1G38A 1XA4A 4GMDA 1VIAA 2J5RA 1MEOA 3MMPA 3SFVA 5J2UF 3QM1A 1VKOA 3U5ZB 1EMDA 3PGKA 3CRMA 4PYNA 1FTYA 1Z2DA 4W8HA 4X6XA 4I99A 3ZHSA 4BGEA 2IUUA 5KYUA 5ICMA 2O5RA 5CYPA 2ECQA 3MRTA 4BJ3A 2WT4A 5DEIA 3SYRA 4B75A 1TZBA 4D0NA 3LNTA 4LV6A 3HCCA 4O3FA 3SQNA 1A5AB 1E2BA 1M0WA 2VDWA 1RXVA 3VZDA 1Z0JA 2WMYA 3LVRE 4RS4A 1O6FA 2JIPA 1R6UA 2OTCA 4X95A 4QFCA 2R1VA 5JLJA 1SG6A 2OQ2A 1NP3A 1RJFA 3K71B 4R8SA 1ZINA 3GJRA 1W5FA 1ZVVA 4PG4A 3CX3A 3TEMA 3EIUA 5G3ZA 2IWHA 5JW6A 4PQFA 5K20A 1K7EB 3RTCA 5BR4A 3PYXA 3DDHA 3VC2A 3A1DA 1NXQA 1NBAA 1C4KA 2JIZD 2LDBA 5HBRA 3BT7A 3EQ9A 2ZUUA 3D3WB 5AT1A 3PPVA 2Y0EA 4Q1EA 3KYCA 2BTQA 3FCSB 3ZGXA 3UMJA 4ZVMA 3WJ7A 1K63A 3HGTA 4KTTE 2YV1A 5JBIA 4DHEA 5KOHB 2UYGA 2OFFA 3DBRA 4CJXA 1P5RA 1ZH6A 2BBSA 1MZVA 1PLKA 3IEPA 4WFQA 5CLGA 1NM5C 1JAXA 4PHCA 2HF2A 2PPLA 5DKFA 2Q7DA 5JD4A 1WKVA 2A5LA 3IUBA 4GIBA 1XXHE 4UTXA 3EXIB</