5THQA

Comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
248
structure length
248
Chain Sequence
LGLRGKKALVTGGSRGVGRGVVLALARAGVDVFTCYREESDASASLARELKQLGGDHHALRADLADPKQIAELFQEVGRRFGTLDVVVNNAGVISHVPYAELPVAEWQRIVDVNLTGAHLVIQHAIPLLGDKGSVISIGSKSSEVGIPLRAHYTATKHALRGLTRSLAKEYGRSGLRFNVLALGVVETEELHALPDDERAEMTKFYSTKTALGRLGTPDEVAGAVAWLASDLSRYVTGATIHVDGGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-ACP reductase
publication title Comprehensive Analysis of a Novel Ketoreductase for Pentangular Polyphenol Biosynthesis.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 93
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5thqA00
2I3GA 3G17A 2O3JA 2B4TO 4Y6SA 3IAHA 1NAIA 3K9QO 3KB6A 3LDHA 3TJRA 4K26A 1P3DA 4NK5A 4HX5A 3WYBA 3D7LA 2IODA 2ZTUA 4M1QA 1QLJA 3LC1O 1HYGA 1GCUA 1TXGA 4UREA 3JQ6A 1Y8QA 2Q4BA 4ZQBA 1T2FA 5A05A 3SJUA 4YAGA 1LQUA 1PU2A 5ADHA 5AXDA 5MDHA 3ENKA 5HBRA 2J8ZA 5IDXA 2IEDA 1R4MA 1ISIA 4HWKA 2D8AA 4AJHA 3ZU3A 3AM4A 3VKVA 4QECA 5G2OA 3GDGA 3HDJA 2YUTA 4YEDA 3QP9A 2V6BA 2FWMX 1JVBA 2O50A 3K96A 1UDAA 3AWDA 4GLLA 4MKRA 4MVJG 4CMIB 3WJ7A 4ALJA 1LRKA 3GEGA 5DOVA 2Q1UA 3ROPA 4YRDA 3JQAA 3PYLA 4FCCA 1IPEA 4BNFA 4PLVA 4RVDA 4UVHA 1PQPA 4DA9A 4JJFA 3QRWA 1OMOA 3GMSA 4R5MA 5KCZA 4BNXA 4WOJA 1PGPA 4CR8A 4FFMA 3QWHA 1UDBA 3FR7A 1HWYA 1IY8A 1I2ZA 1B14A 2NLOA 3K5PA 3MTJA 2ILTA 4XX0A 3VDQA 3SVTA 5KJFA 3I6QA 5HRUA 1XG5A 1PX0A 2Q99A 1C14A 1GFSA 2CVOA 1N5DA 4U7WA 3GUYA 1GADO 1JLLA 3OIFA 1T26A 3ON5A 4J9VA 3A4VA 1E3IA 3KYCB 3VH4A 4EGFA 3JYLA 2Y68A 3DTTA 2ZYAA 5CPBA 4NBWA 4UVGA 2Q2QA 1H9BA 4J3FA 4I08A 5EMHA 4EZBA 1YKFA 1Z7BA 3F9IA 2O3SA 4DIBA 4UUOA 4W99A 1M6HA 1N7GA 4CMIA 2UUOA 2GASA 3HN7A 1PJSA 4NG5A 4KQWA 4RVHA 3WX0A 1DRWA 3GA0A 1K6JA 1Y5RA 3ZNOA 3IC5A 4BV8A 1ZH8A 3IKTA 4E5PA 5C7OO 1GD1O 3RVDA 2VZ8A 1MV8A 2BMAA 3RUFA 4CM8B 1DC6A 4YJFB 2ZJ0A 5GZ6A 2ZTLA 2ZCUA 4RZIA 3WGOA 4RPGA 1KVSA 3FTNA 3W6UA 2EF1A 1XKQA 5CP8A 3VDRA 2W2LD 3IJPA 4WUVA 1O0SA 4RDHA 2NQ8A 1DLJA 3KYCA 2DBQA 3DEYX 2H5LA 3C8MA 3FSRA 4II3A 3DBHA 5L7WA 4R3NA 1E7QA 4IZHA 4DRYA 2IYPA 3QVTA 3DBLB 3AFNA 2YHIB 3RIHA 5IDWA 4EITA 5L4NA 2BGLA 3BZUA 2FN7A 1XLTA 2ZJ1A 4E6PA 4XDYA 4HADA 4FFRA 4LCJA 2TMDA 2VUSA 2GPTA 3BTUA 3EZLA 4PG5A 4F46A 2CSUA 4G65A 1A72A 5DULA 1M67A 4B8WA 1YB1A 3E03A 5I7VA 4BV9A 1IHXA 4RPHA 4ILKA 4DTIA 2VNSA 3ITKA 4H16A 1LXCA 5TS3A 4Q3AA 2HKIA 2JFHA 3QHAA 5JCJA 5GMOA 4CM8A 1LDYA 4WLVA 4YJFA 4AFNA 4LMPA 4OQZA 1KERA 2ZB8A 2PKRA 1VSVA 2EXXA 3HJAA 3PYXA 2F1KA 3WGYA 5FEUA 3F5QA 4MKZA 4OH1A 2BFPA 1DDOA 4HV4A 4A5OA 2PKQO 4E33A 4UAGA 4QSMA 5KJ6A 4RF5A 2GLXA 3U0BA 1TEHA 3ORFA 2WD7B 1HDRA 1NHWA 4EW6A 4K6CA 4DYDA 4NBTA 4B7CA 4UVIA 2PH5A 1EDOA 2NVUA 2WD8A 1VLLA 4CODB 4OOEA 2CVZA 3N74A 5B1YA 1KIFA 4I5DA 4XYEA 1D3AA 3I3OA 1KEVA 4IMPA 3TZKA 2W98A 2PTGA 3VPSA 1MG5A 2EP5A 4R3WA 1V35A 5EERA 1NPYA 3GY0A 4Y98A 1C0IA 3GK3A 4WLEA 1I2BA 4B4UA 4GSKA 4CV0A 5A5EA 1ML3A 4XR9A 3DOOA 4GI2A 2X0JA 5JY1A 3H9QA 5CAEA 3AUSA 3KEOA 1H5QA 1SCUA 3F47A 3G0OA 1I10A 3H9JA 4BO1A 4Q3DA 4XQ9A 1C1DA 1YBMA 2CZCA 3DZBA 1ENZA 3HHPA 2JD0A 3T7CA 1Y9EA 3M1AA 4FJ1A 4PLWA 2XAAA 1HETA 4A03A 4AICA 5JY6A 2PY6A 1PS9A 3RI3A 4JIGA 3ZHZA 4U0JA 2WD7A 4RO0A 4R16A 4BNUA 4YJDA 3KRTA 1L7DA 4BGUA 2UAGA 1ZMTA 4L74A 2O7SA 2C29D 3S2EA 4A26A 2Y0DA 4CLOB 3HWRA 3MJVA 4QFCA 4TRMA 4YJHA 5DNAA 4A7PA 2D0IA 1NQ5A 4L8VA 3R0IA 3UN1A 2Q46A 3RUIA 4YAIA 4GH5A 5HS4A 2P9EA 3FBGA 4CMGA 3PJEA 3TL2A 3OM9A 2HO5A 3QVWA 2YW9A 2R2GA 2DBVO 5HS6A 5L40A 1HL3A 5ER9A 4RF3A 1C0LA 4J90A 1SAYA 1B8VA 2W2KA 1H6DA 1EQUA 2UVDA 2IEBA 4LSWA 4NJOA 1K0UA 2YDYA 1HSOA 5BNFA 1UP4A 1YQXA 4HP8A 3GG2A 2IDZA 2E49A 1Z7EA 1PJCA 2J3JA 2Y93A 4YR9A 2WEKA 4R9SA 3I4CA 3WS7A 4D44A 5JE8A 3AY6A 3O8QB 2X5KO 1X7DA 2V7PA 5CDUA 1E6UA 1FDUA 4LRSB 4D3DA 4MOWA 3NT5A 3WXBA 2OO5A 1V3TA 2NU7A 5TIIA 3OICA 1O9BA 2HUNA 3RASA 2VWHA 3PEFA 4N5LA 4FB5A 5DT9A 1QKIA 3DZJA 2YQ4A 3TNLA 3P2YA 4FJ2A 4DC0A 4CLOA 2PV7A 4AJ2A 4E31A 1W6UA 1YO6A 1YJ8A 1C1XA 2XPCA 1VC2A 2QRJA 3V5NA 4U5QA 3CZRA 4L75A 1U2DA 3IIEA 2JCYA 1X13A 4GX2A 4JLWA 2GDZA 4BO0A 2JJYA 1DO8A 1EBFA 2E4AA 4XR4A 1ADFA 4YT8A 1BRMA 4PRKA 3OFSA 1ZBQA 3UOGA 3WSVA 3DHEA 4NH4A 5H83A 1E3SA 3JQ8A 4CM9A 2B83A 2GF2A 5DP2A 1HE4A 2HRZA 4U6SA 1PL6A 3NX4A 3UVEA 5T5QA 4JJGA 4TVOA 5CHEA 4DLAA 1PEDA 1I8TA 1GQ2A 1V3VA 4K6FA 4UEOA 4EJ0A 1BXGB 3KO8A 1LDGA 2C0CA 4IJVA 2VHYA 1CYDA 4IXTA 1NM5A 4PG4A 4E30A 3U49A 1U3UA 4MP6A 4G5HA 1UXIA 2W90A 4FFLA 3VPXA 1AHHA 1YQGA 1EUZA 5EQFA 4RGBA 5BSEA 2B37A 2X23A 3JCZA 3HB4X 3FRJA 1E1MA 1FF9A 3JQEA 1R66A 2Y99A 5G0SA 4LN1A 4QT0A 2Y0EA 3RFTA 1T2AA 2HRBA 4DQUA 4ONEA 4E2XA 3JYPA 4NFYA 3EC7A 1E92A 4FSHA 5TRTA 5BNTA 3RBVA 5ICSA 1FMCA 3I6IA 4NK4A 1CQJA 1UAGA 2EKPA 3FNFA 9LDBA 4DMMA 4J1TA 2FOIA 2BI7A 4PLCA 3JV7A 1J6UA 2W8ZA 2AQKA 5JDCA 2DM6A 1MP0A 1NWCA 4KQXA 5A9TA 4D46A 3C1TA 1MXHA 1FDTA 1BXGA 1GUZA 3DBVO 4YRAA 4JNKA 3TFOA 4TVBA 3GHYA 4FW8A 4E3ZA 5L45A 2AW5A 3WMXA 2PK3A 2D2IA 1Z82A 1RWBA 3GF4A 1YOVB 4NFSA 2QQ5A 2VOJA 2CDCA 1SOWA 3P5SA 4RVUA 3DR3A 3PHLA 2PD3A 1XQ1A 1U5CA 1HZZA 4D0SA 3MZ0A 4QTZA 4UVEA 4LMRA 3FD8A 3EY4A 5F1PA 5F5NA 2AXQA 3UCEA 5BNIA 2ZTVA 3FR8A 4BKQA 4HFMA 1DEHA 1T2DA 1GL3A 1SB9A 1SMKA 2DBRA 1EUDA 2AG8A 2FMUA 1O94A 1X15A 3E9NA 3PLNA 3R3JA 3PIDA 5K6AC 2C20A 5IN4A 5AOVA 1PJ2A 4XYGA 1U2GA 5FI3A 1JN0A 3MWEB 3OJ0A 2XF8A 2BD0A 1PJLA 1BMDA 3TN7A 5C5IA 2C5AA 2RH4A 4NNJA 1ZSVA 1VSUA 2QRKA 4RORA 3BA1A 1EE2A 1WPQA 2CF5A 1U3VA 1XU7A 8LDHA 2X9NA 1ZXBA 1NAHA 1WDKA 4E4YA 2Y1FA 1ISFA 3EGOA 4B7XA 2C59A 1IB6A 2C07A 4IDCA 1N2SA 2D5CA 2UYYA 4I8XA 3KEQA 3KYBA 4YWJA 7ADHA 3HE3A 4IDAA 1B3RA 4CMAA 5L4LA 4JX8A 1HDYA 3LF2A 1UZNA 3BYZA 4YCAA 3RUAA 2D4AA 4N18A 1U1IA 5JCXA 4IS2A 4AVYA 3STHA 1EQ2A 4FGWA 4B79A 1DXYA 3U4DA 1C3VA 4ND5A 4E32A 3CH6A 1DOHA 4XYBA 1WDMA 4BNJA 5KTKA 1T24A 1N92A 1E3WA 4CQLA 4YA6A 4ZQEA 1GZ6A 3RUCA 5DDIP 3VZSA 1I01A 5KVQA 4B8ZA 3ZWCA 4NFHA 3RWBA 4RLSA 3RROA 4FGSA 5JAIA 5G0WA 3NTRA 5EINA 3TZQA 3X2FA 3I9KA 4JJIA 3SXPA 1KY4A 3JQGA 3ZN2A 4MPDA 4YQZA 5L4SA 2C2YA 3IKVA 3JYNA 4HUJA 3Q3CA 2E6UX 1BGVA 5IZCA 3LC2O 1HLDA 3A9WA 1YL5A 3Q6IA 3TL3A 1P77A 1W73A 2JKVA 5A9SB 3ITDA 3QLJA 1EZ4A 2Z1MA 3GMDA 1ZJZA 1GYRA 4YYZA 3OHSX 3VC7A 1U5AA 3QVOA 3V1TC 5CG1A 1DPGA 2DKNA 2Y05A 3F5SA 1CRWG 1H9AA 1GTMA 1NPTO 3SJ7A 4PN3A 3KSDO 5LDGA 4MKXA 4BNIA 4QEDA 3D5QA 1P1KA 3Q9NA 4W4TA 3R6DA 4CV2A 2FR8A 1AE1A 1V8BA 4A0SA 3BTSA 3UGKA 1ZIDA 1GR0A 1N1EA 1A4IA 4J1NA 3PJGA 1PJ3A 3O4RA 5I8WA 4TRJA 3EVNA 3KHUA 4G81A 3RKUA 1G0NA 1PZHA 1RM0A 1ISHA 1YDEA 2X9VA 4JBHA 2RIRA 5TT1A 3LU1A 3K6JA 2PNFA 4J4TA 4BNTA 4FJ0A 2OGUA 3L6DA 4AJJA 1ULUA 1R37A 4EI2A 2AEFA 1LUAA 2O4CA 1D7OA 1Q0QA 1RJWA 5K6AA 4RQTA 3R1IA 1DSSG 2ZYGA 3ST7A 2Q3EA 1RM4A 4XA8A 5BQFA 1OBFO 3K92A 3C7DB 4PLPA 2FSVA 5JMPA 1GZ4A 2OMEA 2Y67A 1Y6JA 2X22A 3QW2A 4XJTA 4L4XA 4R1TA 1HZJA 4R1NA 4WK6A 2RHCA 3OECA 1E7RA 3A14A 3M1LA 4DGSA 5JAZA 2X58A 3LYLA 2FZEA 3NV9A 4FC7A 1GYQA 3VH1A 5DCYA 4GMGA 3E8XA 1MG0A 1J4AA 5CEFA 2W2LA 4IPTA 1B15A 3JD0A 4TROA 1JAYA 3ZGYA 2OFPA 3H9GA 3BMQB 3F3SA 3K73O 4GVXA 1QV6A 1TB4A 4ZJUA 4CMEA 3VHRA 5TLSA 1P0CA 1PWZA 4CM4A 3E5RA 3EZYA 4YBZA 3GT0A 1OAAA 3GGGA 3RUDA 3SBOA 2GD1O 1I5RA 3PI7A 2Z5LA 3ZWXA 1UJMA 4Z9XA 3W4JA 3UCXA 1JTVA 3C1OA 3E82A 1HXHA 3JQFA 4J7XA 5LDHA 1LSJA 4KWHA 4PVDA 1K5HA 5AYVA 3NEPX 4PZCA 2E37A 4XDZA 1U7HA 3BHMA 1P74A 3GUCA 3VOSA 5JXWA 3H65A 3CMMA 1QRRA 3PHHA 3TFQA 5LC1A 1SEVA 2EEZA 2VT3A 3V2HA 4KWIA 2YQ5A 1O5IA 1KVQA 4GVLA 2HCTA 1U28A 4NI5A 2HLPA 3G1UA 2GO1A 4PLHA 3EYWA 4P38A 2VZ9A 4XIJA 4Q3BA 4UUPA 1LBEA 1X7HA 3PGXA 2G0TA 1K6IA 4Y8VA 3WDSA 3BMQA 4R1UA 3RFXA 4BKUA 3I9LA 4YDRA 4MIYA 1EVJA 5COBA 1HLPA 1MA0A 1Q0LA 4QO8A 3RBZA 3H5NA 4D3FA 1M2WA 3IP3A 3WYCA 1N8KA 2X1HA 4BUCA 3GVHA 2QIOA 3ZWVA 3WNQA 5T8KA 3ZHXA 1E7MA 1LEHA 2B69A 3DONA 3L4BA 2B35A 1WAMA 4BO4A 3WQQA 3GC6A 6ADHA 4WLNA 3GVPA 5G4LA 2JFGA 3LQFA 5ENVA 4F3YA 3GRKA 4BNZA 3A06A 5HTOA 3DWFA 4CM1A 1U4SA 3H9UA 2VHZA 4KOAA 3ZHYA 4J2OA 4Q3EA 4A10A 3ETGA 1ISGA 4AL4A 3D4OA 4KUHA 3GN1A 1ONOA 4CLEA 2C54A 4M54A 2V6FA 1GQQA 4HXYA 2BGMA 1ZJYA 1DC3A 1PJTA 4P4LA 4CMJA 4MVJI 2B4QA 1EVIA 3AI1A 1HYHA 2GN6A 1ORRA 5KJEA 2OBYA 4Z0HO 4Q39A 1SB8A 4BMNA 3QWIA 4YT2A 1E77A 4ZN6A 2E48A 3G3EA 2DTEA 4I5FA 3INRA 2FPPA 3NDJA 3BAZA 1EK5A 2Y66A 3HUDA 4DWVA 3BMOB 4DPMA 1Q7GA 2O23A 4LVUA 4IJUA 5IJZA 4JGBA 2PD4A 3EUWA 3T7EA 5FWNA 3FNHA 2DPGA 1M66A 1QYXA 1VL8A 2OORA 3GNTA 3PJFA 1FK8A 4GSLA 3RAJA 2Q45A 1UH5A 2AE2A 4M55A 3BIOA 4Z6KA 4ND4A 3PFWO 4J7CA 5KJ1A 4RZHA 3ONDA 1LC0A 1DB3A 1HRDA 1NWHA 1KBZA 3ANMA 1HDXA 3EK2A 3CINA 3DOCA 4NZ9A 1GAEO 4Q3CA 2AG5A 4ZICA 1EE9A 5C3MA 5HM8A 2VYND 4XWYA 4IGEA 4PRLA 3DZHA 1K6XA 2PA3A 3GVCA 3TPCA 1UZLA 1I0ZA 4PLTA 1UAYA 1ID1A 4DLBA 1HE2A 1P9LA 4GWGA 4BQPA 1YRLA 3B6ZA 1PSDA 3OJEA 4BHTA 4CM5A 3JD4A 4GQAA 5H81A 4R41A 1PJQA 2DU8A 2VN8A 3F4LA 2CDAA 3I83A 2IZZA 3U9LA 3B1FA 4EUFA 2DVMA 4DYVA 4BNNA 4WASA 1ZXLA 3PJDA 5HA5A 3U3XA 3T4XA 1EVYA 1Z74A 4OOFA 4XCVA 4EEZA 4TKMA 1YONA 2O3QA 1GCOA 3WWZA 2NVBA 5JNLA 1LI4A 1R0KA 3GDFA 2WSBA 3PDUA 1BDMA 2NADA 4DIOA 4AJIA 2HK7A 2G76A 2I67A 2Y1GA 3NJ8A 3GHHA 2GZ1A 3WLFA 5A3VA 2Q2VA 3NRCA 1DC4A 3I9NA 3DMTA 1ADCA 5TSDA 2PGDA 1LJ8A 5EL0A 3UKOA 1IHYA 4RQUA 3H8VA 3KSZO 5AVOA 4CL3A 2XXBA 3MJSA 4EUEA 1ZK0A 5DZSA 2UUPA 3GRPA 5FF9A 4BO6A 4WOKA 1B26A 3S55A 2HMSA 3PQDA 1WVGA 4B4OA 1B0AA 1PJ4A 5A9RA 1I3KA 1Z73A 1EEHA 1E0DA 3GQVA 1LU9A 5C7IO 2FPIA 5JDIA 2ZKLA 4DREA 3B20A 2Z1NA 2VQ3A 3HQ4O 3ZWYA 2NTNA 4JN6B 1PR3A 5T64A 1YJQA 2VHWA 3LK7A 2I5PO 4O5OA 3MJ4A 2TMGA 3PYMA 1R0LA 1UXHA 3VTFA 1YBVA 2JFFA 4R5HA 1GYPA 3DBLA 3GNSA 4OSPA 2YHIA 4O1MA 4NMHA 2RCYA 3LLSA 3PDJA 5A1TA 2AHRA 4G2NA 5KWEA 1E6EA 3P2OA 3OJOA 1E5LA 2I99A 3Q2IA 4BB5A 2EJWA 1HDOA 4IS3A 3UAGA 3H2ZA 2DAPA 4GKVA 4W82A 3VZPA 4LW8A 3IDSA 3IJRA 3NT2A 4QX6A 3G49A 2HK9A 2UDPA 3KTDA 4PZEA 3RCBA 2OP1A 4B3HA 3WGTA 4XIYA 4NBUA 4WLFA 4MP8A 1YS4A 2BFAA 3AU8A 1R12A 4FIZA 3L07A 1R0SA 3UFXA 3RUEA 1EUCA 4XQGA 2IZ0A 1IUKA 4PLFA 4O63O 4I9UA 4YTEA 1NQAO 3T4EA 4RJTA 3ZV6A 4YT5A 3DOJA 1PS8A 2I65A 4FOOA 3ZWPA 2J6IA 4E2WA 2NM0A 4PG8A 1R15A 2Y1DA 5JDCC 3WBFA 3PP8A 4MVJM 4Z9FA 3IP1A 4R51A 1PL8A 2CUKA 3AI3A 3Q9UA 2G82A 4RVFA 3Q2KA 4XGNA 4DVJA 1EBUA 3TRIA 1DJNA 2AMFA 5B4VA 2ZB3A 2H63A 3RD5A 3WNVA 1U8FO 4YAJA 4EJ6A 1SC6A 4P4NA 2ZIZA 1LLQA 4R54A 4KUGA 3DXFA 3HB5X 1QMGA 3TOXA 5DOZA 3AJRA 1XQ6A 3AUTA 2YJZA 3UCFA 5EN4A 3UHAA 5L53A 2A4KA 2LDBA 1V0JA 3NKLA 2JD1A 5TNXA 5BSHA 4R01A 2BGKA 1IYZA 1BVRA 2NACA 4FN4A 2CMDA 4L0QA 3U5TA 2NQTA 4JCOA 3SLKA 3LZ6A 2PGLA 1AN9A 4HFJA 4KDEA 5T67A 3S2GA 1U8XX 5BT9A 1WW8A 3HG7A 1GUYA 5ILGA 5FFFA 1NVTA 4GAEA 4B3JA 1KETA 4OIMA 4LSMA 1P44A 2RBEA 4D79A 3AUAA 1GU7A 1ZKMA 1GUFA 2CF6A 5ITVA 3C85A 4TRNA 1ULSA 2DC1A 3GGOA 1WWKA 5JYDA 4FS3A 3WTBA 2QRLA 3FNGA 3PGJA 4CMHA 4YB8A 4CPDA 1PS0A 2ZQZA 4GKBA 4TRRA 5EIOA 2GZ3A 5JFOA 4CLXA 3PLRA 1YE3A 4O6VA 3VH3A 1PGQA 1CWUA 4DBVO 3WGZA 4L4SA 2Q50A 1V3UA 1LNQA 4W9NA 2VTDA 2JD2A 3O8QA 1U4OA 1Y9AA 3RJ5A 2JHFA 4B4VA 5T6BA 1F12A 2O3UA 1DJQA 4X54A 1WZIA 3OQ6A 5I7FA 3ADOA 3DZIA 3M2PA 1ONPA 2NU8A 4MVJP 4BKPA 5C7LO 3PFFA 1PGNA 1DIGA 1NASA 1G6KA 5U4QA 4AJPA 2GN4A 1A4UA 2HQ1A 3PHJA 1GZ3A 3L0DA 3F4BA 4JP2A 1QR6A 4OXYA 3IUPA 3DO5A 3I23A 4ITUA 5IZCC 3ZNPA 4MDHA 1IL0A 3L4SO 1KEWA 3DZGA 3PRJA 1WZEA 2YV1A 1PR9A 1JU9A 3AW9A 1U3WA 1UXKA 2J5QA 3GR6A 1J0XO 4ND3A 4U0KA 4E13A 2C5EA 2EERA 4BKOA 5CDGA 1YB4A 3E18A 1IZ0A 4IQGA 5KJCA 2VRBA 3RC1A 3JQ7B 5IZ4A 1G1AA 2NV6A 4KDFA 1UXGA 3GVIA 3GZNB 5A06A 4ALLA 1PZEA 3W6ZA 4I9NA 5L7TA 3PHGA 3L6OO 5DCUA 3SEFA 4BO7A 1YBAA 4I9HA 3WIEA 5T57A 4EUHA 1T4BA 4GBJA 3W8FA 4N7RA 2CD9A 2Q1SA 3GOHA 3E9MA 3QE3A 4J1SA 1SBYA 4ND1A 4OHUA 5JO0A 1A5ZA 2G5CA 4K9DA 5U9CA 1EFLA 3G79A 3GLQA 1YQDA 3JYOA 3U62A 3DTYA 1AHIA 2GUGA 3JQBA 1PQWA 2BLLA 3LC7O 3OSUA 3PWZA 4RVSA 4YPOA 5B12A 3DHYA 2VHVA 4XEHA 2X6TA 3LT4A 1HT0A 2ZTMA 2H6EA 4FD3A 3PZRA 4IDEA 4BNVA 1E1LA 2HMTA 5B4UA 2X8LA 3V2UA 4K28A 1X1TA 5G0UA 1E7YA 1W8DA 5JW6A 5A04A 2O2SA 4J4HA 4YAKA 2CDBA 4RLHA 4OO3A 5EJ2A 3PIIA 3WGQA 3PWSA 4RL6A 1Y5MA 4URFA 1EFKA 4CQMD 1PL7A 3D3WB 4BNKA 5BR7A 1A27A 3JQ7A 1ZCJA 3CSDA 2AQ8A 4ZQFA 3I5MA 3GZNA 2GNAA 3FN4A 3NT4A 4RCVA 1XR3A 2AEMA 1D8AA 4TZKA 4D7AA 5CDSA 5JC8A 2EKLA 1LLDA 1TI7A 1F8GA 1YOVA 3KBOA 3U4IA 2OOSA 4KZPA 4H15A 2O3TA 1BSVA 3VPGA 4EBFA 3FNEA 3IOYA 1O89A 4XYLA 3V1UA 1CDOA 1Q0HA 4FBGA 3HN2A 4UULA 1BTOA 4CMEC 2Y1EA 3BMCB 1Y8RB 3ASVA 1D1TA 1RPNA 1E3JA 3H6KA 3U4HA 4D3SA 5L95A 1PGJA 5U1PA 1A7AA 1H6BA 5F5LA 5KVCA 5EQDA 1T1RA 2EW8A 4XYMA 1HE3A 1CJCA 3JQFC 2B5VA 4INAA 2ZB4A 3CEAA 1DBVO 5DCWA 4CUKA 1WP4A 4WKGA 3DAGA 1RYEA 3K2BA 1ARZA 2A94A 4ZQGA 5F21A 1ISJA 4QUKA 5I8ZA 1BWSA 3KM0A 3RSHA 4FFNA 3B70A 1O8CA 4ZVVA 3DB2A 3KVOA 4FQ8A 1JDJA 2B0JA 3K31A 4AJNA 3ABIA 4NJMB 1DAOA 4DPLA 4OL9A 3DQPA 3I9JA 1KS9A 3BMNB 1P45A 4BMVA 2NUAA 5BSFA 5THQA 3BMCA 5A03A 1Y8RA 3I9MA 4LISA 4BL5A 3IMFA 2O2YA 1VE9A 2IZ1A 1F17A 4NQZA 5K9ZA 1G0OA 2PKQP 3PXXA 2VUUA 3ULKA 2X86A 3ZHBA 4BNWA 4UEKA 1XEAA 1UDCA 3LLVA 2VNAA 2IYOA 5T8KC 1ZK2A 3C7CB 3A28A 1I24A 3L4BC 4J16A 5THKA 1U3TA 3MOIA 4CMKA 5IXSA 2ZQYA 4YVFA 4XB1A 4PZDA 3AI2A 5TGDA 4HKTA 7MDHA 1EMDA 4IDGA 4Y67A 4BO3A 4WLOA 1ZSNA 2R00A 4R9RA 2GYYA 2Q2WA 2VYNA 5JMWA 3PK0A 4ZRMA 1P1RA 3ZH2A 4U6QA 3GEMA 4ZRNA 4NU5A 4NJMA 4W7HA 1LLCA 1M6WA 1JAXA 4J0FA 1XA0A 4J1QA 4WCFB 1DIHA 3ANNA 3FWZA 2VZ0A 1ZZEA 2QHXA 5A9SA 1YB5A 3CMCO 3LF1A 4CL8A 4B7UA 1EK6A 2X0IA 4GWKA 4J0EA 4CUJA 4BNMA 1WMBA 2HJRA 1GEGA 4F6CA 1AXEA 3QJ5A 3GNQA 3H5RA 5I7SA 2GR9A 1VM6A 4Q9NA 3UH1A 1QG6A 3I4FA 5IDYA 1HEUA 2WDZA 3TWOA 3H3FA 4FPXA 4JQCA 4R4JA 2P9CA 4NU6A 1XSEA 4YJGB 1Z45A 2OP0A 3QWBA 5DBIA 2WTBA 4WEQA 1S6YA 1R16A 3RC7A 2NWQA 4XRRA 4WCFA 3TZHA 5IXYA 2VCYA 3GGPA 2WYWA 2Q1TA 4PGFA 1B16A 1VL6A 4D42A 1YXMA 3INTA 1XELA 1NFRA 1KEPA 4IDFA 4YXFA 2FR0A 2WMDA 1XIVA 4Z3DA 3VTZA 3CKYA 4YQYA 2WYVA 1IOLA 3WFIA 5COAA 1TA4A 4HY3A 2PR2A 4MVJH 4XKJA 4J43A 1E3EA 4IIUA 5CFZA 2V65A 3RFVA 4AJKA 5EESA 4AJ4A 1M76A 1HTBA 1MB4A 1NR1A 1NYTA 2UV8A 1MFPA 2DTXA 3QIVA 1ZUD1 2RAFA 2J3KA 3QY9A 5TC4A 3M2TA 1O6ZA 3QQPA 4GX0A 4ID9A 5TQVA 4DMLA 3ZWOA 1NTOA 2Q4EA 4TZTA 1LRLA 1LDBA 3ZU5A 3HADA 4XQEA 1DRVA 1BW9B 3DZKA 3AOEA 4YRBA 3ZWAA 2YDXA 3H4VA 3ENNA 5ENDA 1EDZA 3OETA 4FOSA 2P2SA 4RDIA 4CMBA 1JQBA 2FP4A 2NVWA 1J49A 4BNLA 3V2GA 3H2SA 2P5UA 3DMTC 1R4MB 5IG2A 3KYDB 1JA9A 2BHLA 3ETDA 5C37A 1GPDG 4QO7A 3FI9A 3F46A 2ZCVA 2X5JO 3HFGA 1Y7TA 1LTHR 2I9PA 3WYEA 2EP7A 2JCXA 3E1KA 1X14A 3KETA 2R6JA 2VT2A 3H5AA 4II2A 4UVDA 4XGKA 3JTMA 4BQRA 2PLAA 1UUFA 4IDBA 3WGIA 3W8EA 4IY1A 1QV7A 1R4NB 4GPD1 2C7GA 3QVXA 2VYVD 1AUPA 1JKJA 1OC4A 2P4QA 3FCOA 5JDIC 2HU2A 2FPGA 1E3LA 4J49A 3NGLA 1MUUA 1ENOA 2V6GA 2J3HA 1NHGA 3EAGA 3WQSB 1P1FA 3OBBA 4WNIA 5JYEA 4LRTB 4EYEA 3K8ZA 1BW9A 2P91A 3W4IA 5L7YA 3N7UA 1BXZA 1KVRA 2DPHA 3A1NA 4GLOA 2AQHA 1YL7A 4Y6RA 5TX7A 4PVCA 3NDRA 3W8DA 1WLYA 2O4UX 4CLDA 2EV9A 3GAZA 4IUYA 4UUNA 2O7QA 3GZ4A 3HSKA 4QQRA 1RKXA 2OXIA 4OJNA 4P4GA 3KZVA 3KYDA 4B3IA 3DHNA 3M6IA 5L51A 5L9AA 2YZ7A 1I36A 1YL6A 4O0LA 4DC1A 1DLIA 4HFNA 3WICA 5JSFA 4FDAA 5LCXA 4IJWA 1H93A 5I9LA 2ZK7A 2P9GA 1KVTA 1MXFA 2EGGA 1B2LA 2J5RA 1K89A 4U8GA 4YT4A 3DZFA 1TLTA 5IFLA 1XU9A 5AQ1A 4OM8A 3IUSA 1R4NA 1FDVA 1KYQA 1ZO8A 2J3IA 2BFOA 3Q11A 1VL0A 4WJZA 5ES3A 2B36A 3ROQA 1O95A 3TOZA 1K3TA 4GX1A 3UXYA 1PTJA 4E5KA 3C3XA 4N54A 4D45A 1RM3A 4RPKA 4CV1A 2EKQA 1UXJA 3RC2A 2F00A 3W1VA 4NR0A 3OIDA 4Z3KA 3ROMA 3LT0A 2BI8A 1JWAB 2HK8A 2QX7A 4I5GA 2DFVA 2CNBA 3BMOA 1BHSA 4I5EA 1KOLA 4BNYA 1BXKA 1MC5A 1T1SA 1Q7CA 3EVTA 3QA9A 4ZU3A 1U9JA 3PZBA 4E5YA 3DBHB 2DBZA 4Y6PA 3TF5A 3D4NA 1F8FA 1LSSA 1YGYA 1MLDA 2HMWA 3AM5A 2B4RO 2A35A 4HFRA 1BG6A 3GFGA 3JQ9A 2D3TA 5KIAA 3GFBA 2FSSA 4BNHA 6LDHA 1LDEA 2QG4A 2B5WA 4PFJA 1CF2O 4IJKA 2WE7A 2Q1WA 3CIFA 3PWKA 2BH9A 1XHLA 3BTVA 1AGNA 1HDCA 1ENYA 5G4KB 1V9LA 3E9QA 4BMSA 3RJ9A 4S3MA 3TZCA 4A73A 1IULA 2XOXA 4WCDA 1SPXA 4CR6A 5FI5A 3AU9A 3JQDA 2NNLD 5AXCA 3UF0A 1L7EA 3P19A 5TJHA 3NJ4A 3DMYA 3C1AA 3NGXA 4J9UE 5JC1A 1F0YA 1W0CA 1ZEMA 1PWXA 1MGOA 3ETEA 3L9WA 1IZ9A 2NSDA 5JLAA 5AXBA 1H0KA 3GAFA 3WMWA 2GRAA 4JP3A 4WE3A 1ZK1A 1C0PA 5GZ1A 3D0OA 3DAPA 4FFOA 1B8UA 4FR5A 3L6EA 1CEQA 5B37A 3WTCA 2NVUB 4TQGA 3QVSA 2X4GA 4MO2A 4DQVA 5I9MA 3TSCA 5IN5A 4JBGA 4KTVE 1IPFA 1YH3A 3K30A 4YACA 1ZMOA 5MGBA 2GN8A 4CQMB 2QYSA 3QWAA 1QYVA 2YFHA 2AE1A 3ZW8A 3MJTA 3FPLA 4IGFA 5G4KA 4IBOA 1ADBA 4L9RA 4W9NC 3FTPA 4R1SA 3KUXA 2PZKA 5DBFA 3IQDB 4XRGA 1FDSA 3HDYA 3ZNNA 1NFFA 2Z95A 1Z75A 1VJ1A 3MJEA 1C1DB 4NBRA 3WBBA 4E2YA 3UICA 4OMUA 2I3AA 4M87A 1H2BA 3D4PA 4NBVA 4ALNA 1P31A 2IE0A 2YV3A 2X7HA 4MVJD 5KOIA 4DUPA 4BB6A 2BKAA 3VPFA 5G0TA 1NPDA 1B3BA 4F45A 5B4TA 1F06A 1DHRA 1XYGA 4C7KA 4J91A 4MVJF 2I76A 1OI7A 1YVEI 1C0KA 1T25A 1QSGA 2VWGA 1JKIA 4IDDA 4YJHB 1HSZA 2VRCD 3HFSA 1E5QA 1NNUA 3NUGA 4JBIA 2JHGA 2EJVA 3MJCA 1QP8A 4OKIA 4ZA2A 3RBXA 4CQMA 1UP6A 3ZW9A 1N9GB 4RV9A 3WGGA 1YWGO 1ZSYA 3E6AA 1X7GA 2WE8A 2AEJA 3W4KA 1L1FA 1SEPA 4WLUA 3OH8A 1ISMA 2W2KB 5ICMA 2YFQA 4OGWA 1HF3A 2DTDA 2QYTA 2VHXA 3KV3O 3TZ6A 3GEDA 3FBTA 4JROA 4DXHA 1Z6ZA 2HJSA 4ROSA 2I6TA 3LSYA 4L76A 3EDMA 4IINA 3AY7A 1K2WA 4UEJA 3IS3A 5BSGA 4P8RA 1CETA 3NTOA 3O38A 4ZD6A 3UUWA 1LSOA 2CFCA 1D4FA 3OA2A 4OXKA 3ZU2A 1KC3A 1JW9B 4W7IA 2IXAA 3NYWA 1A71A 1MX3A 3JQBC 2J5KA 2OZPA 2IRWA 5KNLA 1NBOA 3JQAD 2JAPA 4H3VA 2PZJA 3LT2A 1C1XB 2NU6A 3AK4A 2GZ2A 3OEWA 2PZMA 1VJ0A 4E12A 2PZLA 2P4HX 2YY7A 1N9GA 1XWFA 3FPCA 2BRUA 4N5MA 1I2CA 4Q3NA 4ESOA 1PZGA 2A92A 2WJPA 2E82A 3EHEA 3R3SA 1QORA 1S7CA 3N58A 5JAMA 5JPIA 1LRJA 2BF7A 3JQ8B 1LX6A 3SLGA 2I66A 1NQTA 2POQX 1LSUA 3SC4A 4C7JA 3QSGA 3DL2A 3PQFA 1RM5A 1B8PA 3ICPA 1DFGA 4ND2A 3L9XA 2EIHA 4M89A 1NX6A 1P0FA 1UP7A 1ADGA 3UW3A 1XGKA 3OP4A 4M8SA 5AXAA 3ZDFA 4B4WA 1VI2A 1F14A 3FHLA 5JBIA 2G17A 1WNTA 2GN9A 3B1KA 3ZWBA 1GV1A 2OUIA 3D5TA 4BKRA 1Q1NA 4OSOA 4J6FA 4PCVA 3Q1LA 1GY8A 3MWDB 4KTTE 4DIFA 3PQEA 5FYDA 1NP3A 2C82A 2PWZA 2Y0CA 4D43A 1E1NA 3DBRB 1VKNA 4MIEA 2AQIA 2VWPA 2GSDA 1QYDA 3H3JA 3VVCA 4LGVA 3OF2A 2GGSA 4EDFA 4HNHA 4LCEA 4BVAA 1W4ZA 3DFZA 2P5YA 2CVQA 4IQ0A 1T2CA 2D1YA 3WG9A 4PLZA 5TT0A 2D59A 1E7SA 4JK3A 2EWMA 4PG7A 1WMAA 4E0BA 5CPFA 2ZATA 3VVBA 9LDTA 3OJFA 3ZZNA 2WM3A 3GPIA 3BXXA 1SNYA 1V6AA 1SZJG 1KY5A 3DAFA 3P7MA 2ZYDA 1TT7A 3G1TA 3RQSA 5GZ3A 3ZU4A 4M49A 4XQCA 1SO8A 1ZK3A 5CEEA 4NDNE 3V8BA 2X0NA 3ZV5A 4BNGA 4O59O 4PLGA 4WGGA 1DIBA 3KLMX 1BVUA 1E6WA 1FJHA 1NVGA 1QXSA 1J5PA 3F1LA 4J4BA 3ZCXA 1Q7BA 4E21A 4NHEA 3O03A 4S1VA 3PPIA 4XGIA 2ET6A 2GCGA 1T2EA 4XD2A 3DBRA 4N5NA 3WWYA 1WXDA 3D1LA 2PFGA 1QLHA 2C7VA 8ADHA 1VJTA 3JQCA 4AJOA 1GV0A 5JCJD 2HDHA 3RU7A 2SCUA 3AM3A 1M75A 1LDNA 3F6YA 4NPCA 4QFDA 3ZV3A 4ZHSA 4J2HA 3ONFA 2VTEA 2R00C 4GGPA 1I3NA 1GDHA 1KEUA 1UR5A 1X0VA 3E48A 1XCBA 1DC5A 4D0RA 1OZAA 4BOYA 4EEXA 2VWQA 2A9FA 3VZRA 3IL2A 1H6AA 1GQYA 2JL1A 3O26A 1VRWA 2WYUA 3C7AA 4QXMA 1SOVA 4AG3A 1ZEJA 3H7AA 2YHUA 2XXJA 2HMUA 4GL4A 1DAPA 2PGJA 3AUUA 3WLEA 2G1UA 5HWSA 2DUWA 4BO2A 1IE3A 2AA3A 4PLYA 3MTGA 1R6DA 4MINA 3GN2A 1HDGO 1TVEA 1OFGA 3DDNA 3HDQA 3ZI0A 3LT1A 3NDIA 1Y1PA 4FC6A 3FWNA 3VZQA 4CUZA 1KC1A 4CM3A 2EHDA 5JO9A 4ZGWA 1DFIA 5DF1A 4GX5A 5DBGA 5F1OA 3CE6A 1LLUA 1Q2XA 1E3WB 4CQLB 3AFMA 1ENPA 2EGHA 3VH2A 4RPLA 1A7KA 2JCVA 5CDTA 1RYDA 4R68A 5J23A 4DPKA 5A02A 4WCFC 4DQXA 3CXRA 4OAQA 3FF4A 3QWFA 3JQGB 4BGVA 3NAQA 4PIVA 3B1JA 2OBNA 3AOGA 3GDOA 5GY7A 2LDXA 2BELA 4CV3A 1P1IA 5CG2A 3ONEA 1BDBA 4L73A 1D1SA 1EVZA 4LVCA 3Q0EA 5KVSA 2CY0A 1DIRA 1HYEA 4XJSA 3VAZA 1UZMA 1NFQA 2EW2A 3I52A 4MVJE 3S1LA 5A5FA 4EJMA 3D3WA 5DP1A 3TDKA 5IDQA 3MEQA 3OIGA 3WB9A 3OA0A 1JKFA 2NTVA 4CLHA 1LDMA 2HSDA 2O3RA 4A27A 3K2EA 2VYVA 3OQBA 4YAEA 3H9EO 4WEOA 2Q49A 5IAAA 1A9ZA 1I32A 4ALKA 2VOEA 1DFHA 3QV1A 2YYYA 2Y1CA 3WOHA 1LC3A 2X9GA 4ZQHA 3JD2A 4UUMA 1Y81A 2NTJA 4IM7A 3WFJA 2X5OA 3ASUA 4PG6A 1ZK4A 2NU9A 1ZVMA 4CR7A 1MFZA 3SC6A 4L4RA 2JAHA 4W6ZA 3GH3A 2OL4A 2DQ4A 3AOEC 2RHRA 4HBGA 4Y9DA 3S2FA 4OXNA 2D5AA 3WQRA 1HDZA 4RPJA 1P1HA 1FXSA 1PQUA 1QYWA 1A9YA 5F1KA 3F1KA 1FDWA 2HMVA 3ROKA 3D3EA 4TSKA 4M86A 1NQOA 4TWRA 4KMSA 3EW7A 5KKCA 2P68A 2H1SA 2FR1A 4DBZA 5TJ9A 1NXQA 3HNPA 1PZFA 4CLRB 4DL9A 1ZW1A 4AJ1A 3HDHA 5F3RA 1TT5B 4WNCA 1PIWA 2V6MA 4TMFA 4BGIA 3PTZA 4BO5A 1X0XA 4RF2A 4KP7A 1I33A 1OC2A 1P1JA 3I1JA 3S8MA 4CM9D 4IMRA 3BMNA 3OEYA 3RC9A 4BO9A 3WSWA 4FFPA 4KUEA 5JAQA 1ONNA 4GGOA 2X0RA 1KVUA 3COSA 2FRDA 4XZ3A 3I9OA 1AXGA 4MP3A 5ITWA 1XDWA 5COQA 3V1YA 5IF3A 4AJLA 3KXDA 3VKUA 3JD3A 1DIAA 3PVZA 5K0ZA 1DHTA 2DLDA 4CM4B 3MCVA 4RVGA 1GPJA 2C2XA 3OJLA 1DRUA 5KKAA 4RF4A 4Z9YA 1B7GO 1HE5A 4CJXA 3JSAA 4Z0TA 2FY8A 1I3MA 4BS9A 2W4QA 2IXBA 2VUTA 4MJLA 3JD1A 3RU9A 4LK3A 3U09A 4C4OA 2O48X 2H9IA 4CLRA 3ZWWA 3ADPA 3GPDG 1E1KA 3SX2A 1TT5A 3LVFO 4BGEA 3INGA 1VKOA 4BO8A 3ANLA 4E2ZA 4P22A 2PD6A 4GMFA 4JXKA 4IIVA 5ILOA 1I30A 4A2CA 3HZZA 1ZFNA 3ZV4A 4ALMA 1JVSA 5A4DA 1OOEA 2YV2A 3CUKA 5CEJA 3L77A 3EMKA 1T4DA 1NVMB 1N1GA 3KSUA 1LA2A 3BTOA 4WPGA 5A3JA 1N7HA 3X2EA 3OMLA 3WIDA 1JWBB 1VPDA 4CM6A 2QZ9A 2RH8A 5KVVA 1CERA 3D64A 2BFMA 3C24A 3CPSA 4OKNA 4Z0PA 5I7EA 4IXWA 4IQ8A 1HKUA 4K1LA 4TKLA 5L3ZA 4AJEA 1LQTA 1U7TA 4ALIA 3RKRA 3ZNQA 3BHIA 5H82A 5TF4A 5EPOA 4H7PA 3U4CA 3BHJA 4R69A 3VPHA 3NTQA 3RUHA 1NR7A 2GERA 2DT5A 1X1EA 1I3LA 5JS6A 3WJAA 2PH3A 2WWRA 1QYCA 2QZZA 5DN9A 4YJGA 3JQ9C 4HNGA 3WGHA 3ICCA 4F6LA 5G0VA 5I9NA 2FZWA 4DLLA 4IZIA 3E5MA 3PHIA 4I1IA 2DUUA 3GVXA 1MC4A 1E7WA 3JYQA 3TQHA 1Y8QB 2EG9A 1CIVA 3CTMA 1YDWA 2FHSA 3OQ1A 3DC2A 3AY3A 3KLPX 1H2HA 4NIMA 3ZWNA 4BIIA 2HAEA 1H6CA 3KOUA 1GEEA 3S2IA 4MVJA 4D41A 1H94A 3CZMA 4E5NA 1WDLA 1CQIA 2ZB7A 1PJBA 5CDYA 2OHXA 2DFDA 3O9ZA 1ZNQO 1P33A 1PGOA 4J7UA 5ER6A 2Y1OA 4CM7A 3GG9A 4E5MA 3DFUA 4CMCA 2VRCA 3JQAB 3ZWMA 3MOGA 4MIOA 4WECA 4XB2A 4OYRA 2QW8A 4OQYA 3WR5A
chains in the Genus database with same CATH superfamily
4Z54A 1VB3A 4PBTA 2P3QA 3AERA 2A86A 2VJKA 5JBQA 4G56A 5LLTA 2JIZD 4BLWA 3TJRA 4K26A 4NK5A 5I4BA 2XUGA 5E6RB 1R6AA 3HHEA 4EHAA 1CUJA 1Z39A 5DM60 1XV5A 3H0CA 4XPIB 1NP7A 5J58A 1PK9A 3A2NA 1HYGA 3HBJA 1GU1A 3SVZA 2OBXA 5JALA 1KBQA 2AX4A 1NG1A 1Y8QA 1GG2A 1P81A 1CPYA 1MDFA 1TYEB 4WESA 4OQLA 1YHYA 5A05A 1G291 4PSVA 5MDHA 4JAVC 2J8ZA 2PCJA 3EFEA 4L4UA 2WAYA 2C4NA 1R4MA 2PIAA 5J5VA 5J1SB 4HWKA 3B85A 3H1PA 4YONB 3VKVA 1NJ6A 5G2OA 3GDGA 3HDJA 2EW1A 1TUBB 2E4WA 1QOPB 2V6BA 3DDHA 4ZO9A 1C3OA 3DE2X 1SOUA 2JLQA 1QGAA 2D8MA 1UDAA 2D00A 5J1TB 3NV7A 3OPYI 5LDDC 3GLTA 4AT1A 2BEVA 1LRKA 2XDWA 3P9CA 4D0NA 1O5OA 4O2AA 2Q1UA 2QMUA 4YRDA 4FHCA 4FCCA 3ROPA 4B3TB 4BNFA 3TOCA 1E3TA 4NTZA 4UFPA 1UKBA 1YJCA 3ZOKA 6YASA 1OX4B 3THRA 4DA9A 2O5EA 2PX2A 1VHTA 1AM4D 4JJFA 3IPLA 3HJRA 4XWGA 2HI0A 5EMJA 4B33A 5HQ3B 3BWEA 4A4DA 2PUTA 1UBUS 1L8XA 3VNVA 4FFMA 5FOSA 4NXMB 2PL3A 2BCGY 3B2QA 1HWYA 3DULA 3R24A 1DBPA 4UXHA 1I2ZA 1E2FA 3QNWA 4FDUA 4CKEB 1EXNA 4IH1A 1GCGA 3IMCA 3UGTA 3O94A 3GUYA 3T9BA 2O7RA 4DXAA 1JLLA 3ON5A 3D4LA 4DC9A 3NDBB 1SG9A 2W22A 3JYLA 4CE6A 5BUCA 2Y68A 1Z5UA 2XUFA 3SBEA 4NBWA 5M3BA 4OX9B 2ZOSA 3OE1A 4H1UA 4YCMA 4RCZA 5GOZA 5C1OA 2WWIA 1Y1QA 3FBWA 4RNCA 4CKBA 4EZBA 1V6CA 3O75A 3D6VA 1JEDA 1SK8A 1Z15A 1ZC3A 1NV8A 1TKAA 2P2ZA 3W90A 4O2BF 1GTSA 4URYR 3O90A 5EUQB 1VE7A 3D7NA 1J24A 4BNDB 1MVNA 1N0HA 1N9ZA 4NYJR 2R1ZA 3HN7A 4IG9A 4UFOA 4KQWA 4RVHA 1DRWA 1JSLA 3UMSA 2AXEA 3IULA 4G5GA 4KR9A 3EWIA 4QUDA 1QANA 2XY4A 1HG1A 3KKKA 4CG1A 1K6JA 1YKGA 3IC5A 4BV8A 2VLBA 4RAOA 3LXRA 1ZITA 4WSOA 5ALJA 1NBAA 3SR4A 4E5PA 3DPUA 1GT6A 3L6RA 2R48A 1GD1O 2AFRA 5DIFA 2VZ8A 2XOEA 2I0FA 3I34X 2O5RA 4JJ8A 2JGRA 4YJFB 5FLKA 1OB2A 1QP0A 3GLFB 4TV8B 2BRUC 4QICA 4J3NA 1MAUA 3FTNA 3M6UA 3KJIA 5TY0A 2ZR7A 3W6UA 5J4YA 2DB3A 2NYUA 4BP8A 2W2LD 3IJPA 3RRMA 4PPQA 1F0PA 4JB2A 3LHFA 3QJYA 4ZOLF 3DEYX 4KVAA 5AVRA 4H0CA 3W6NA 1P7YA 1IY9A 5L7WA 2QUAA 4PYRA 4HTFB 1YA8A 4KZKA 4J0IA 3ZD8A 3OIVA 1YNOA 1YFKA 4A1OA 4IHQA 3C0KA 5MN5A 2JHPA 1SBIA 4MVWA 2G28A 3AFNA 3TTYA 3OF3A 4NE7A 5EP1A 4CIVA 5L4NA 3N07A 3V00A 2QVCA 5EWJB 3SIXA 2FN7A 2ZJ1A 4E6PA 1Z13A 4FFRA 4LCJA 2NZJA 2VUSA 2GPTA 2EFEB 3DBOB 4QUEA 2NG1A 4QSHA 4BWYA 3AR4A 2AJDA 3MIZA 2NMVA 2HHCA 1M67A 1ONBA 2A0XA 4B8WA 3AVQA 4KQKA 2DETA 3E03A 5I7VA 4BV9A 4KQ1A 5BV2P 1GKLA 4DR4B 1T2VA 2C3OA 3CEHA 3FPJA 2XUOA 2HIHA 4JUFA 2A2ZA 1HT1E 2KJQA 5K6RA 3OLVA 4QXOA 1LXCA 2JFHA 3CLVA 5BQ3A 2ZZMA 4GR5A 1RSZA 1P18A 1Z29A 1XX6A 1XDZA 1U0LA 3CR7A 4OQZA 2ZB8A 2IOYA 2EXXA 5HPYB 1F38A 1RXYA 3HJAA 5BUSA 2CD7A 3PYXA 3KJEA 3BGWA 4QVGA 3A1SA 5ALUA 3VKWA 1YIOA 4OH1A 1TKBA 3MQ2A 4FILA 4D8WA 2Q7OE 2VQFB 3LQ2A 4L6CA 2FCAA 2PKQO 4E33A 2Q2OA 4UAGA 5BP7A 4QSMA 3T3NA 3PDCA 1ZM9A 2GJ8A 2GLXA 2Y6UA 4A8JA 5TPWB 3KLOA 3BH7A 1HDRA 1NHWA 4EW6A 3OZRA 3LDGA 3H86A 4NBTA 4V38A 1JIKA 1WCYA 2WD8A 1B00A 2ZYHA 5DASA 4CODB 1KKLA 2O0HA 2RGEA 3GCWA 3N59A 1AIPA 4FXOA 2DE0X 5A2GA 1KIFA 3LRTA 1D3AA 4BFUA 3NXKA 2ZE5A 4X84A 5HG0A 5LZ7A 4IMPA 3TZKA 4C4ZA 1TRHA 3EOZA 5EC8A 3VPSA 4PYKA 1L5NA 2EP5A 4DEYA 4YPFA 2H07A 4G36A 1U0NA 3RK1A 4YGXB 5ADUS 4MUGA 3GK3A 5D3MA 3RFUA 3IBCA 2ZWVA 4DHEA 3B1YA 3SD7A 1HNNA 2XTNA 4KLNA 4GD3Q 3H97A 3DOOA 5JY1A 3HJTA 4OJMX 3IOMA 3UWKA 1F7UA 2XB4A 3VU9A 5CAEA 5IHXA 3AUSA 4A2WA 4LF7B 3H9JA 2NUBA 3R6TA 2PEYA 1EX6A 1RI4A 3MD9A 3HHPA 2I2AA 3QU5A 4TKUA 3FUTA 1FX0B 1NXWA 2NPIA 1E2MA 1E9EA 4ZKEA 5UKDA 3NIFB 3OZVA 1HETA 4A03A 3K0BA 2PX4A 4DR2B 5EGSA 1F4VA 3W2TA 3BXFA 3C6YA 3PDWA 3BEOA 4P86A 1XCOA 3AKYA 4U0JA 4X85A 1S1CA 3ZHZA 1ZD8A 2OBMA 4M60A 2JKYA 1L7DA 4U2BA 2GBPA 2HXGA 1T6NA 1DOAA 3N0WA 4YJDA 4L74A 4L8YA 2C29D 3IEMA 2Y0DA 4CLOB 1GG8A 1VYUA 1KK0A 4RDXA 3R7NA 4G9BA 2ZSDA 1HBJA 2EGUA 4BVGA 4YAIA 3SNHA 2R60A 4A8TA 4HF7A 3M7IA 2P65A 2V7QD 4FGLA 3SHTA 4F5DA 1JEAA 4G84A 4AZSA 3QLEA 3OM9A 2HO5A 3QVWA 3W5DA 2OKCA 3W04A 5L40A 3JALB 3D43A 1JILA 3IAS6 1X7XA 3SR0A 1B8VA 1V71A 1I4WA 1O7JA 5ANRB 2OHJA 4KWEA 3R7WB 3IALA 1N5JA 4NF2A 2AF3C 2G80A 4KMMA 3RYHB 2YDYA 2I6SA 4UBIA 5HJ5A 3DWGA 3OQIA 3LM8A 3WRVA 1ZYUA 1VBMA 1Z7EA 2J3JA 2Y93A 1YACA 4OK6A 2QM0A 4B44A 4YR9A 2P77A 5JE8A 1U3CA 1WTAA 1XRMA 4ZO7A 4DARA 1QIIA 2VK2A 4NENA 2Y9MB 3CB2A 1Z28A 5FPTA 3KLNA 1CQZA 2VSXA 2FTKE 1V3TA 3NT5A 5LQJA 5FPYA 3EGXA 2NU7A 1M2HA 3QEJA 3OICA 1P6XA 1WR8A 2HUNA 4WTOA 2VWHA 3PEFA 3P5BA 3RASA 3VQTA 5EWLB 1YZNA 4MTCA 1GZSA 1QCDA 1QKIA 4ZU6X 2FQYA 1LWNA 2C4TA 3SYRA 4JYPA 2IUYA 3UJ3X 3KE8A 1OXMA 5IULC 5K8LA 4P0TA 3U3RA 4AJ2A 1T9BA 3ANYB 4IH9A 4I55B 4KDCA 4P36A 4M1SA 5IBPA 5YASA 1YO6A 4M88A 4X5OA 3UHFA 2R7MA 1N5LA 1U8AA 2JVIA 4U5QA 2BBWA 1TA0A 1YE5A 3OO0A 2Q28A 3M6WA 4X0EA 4M0FA 4WQMA 4I4TB 4BO0A 1DO8A 5CU7A 1EBFA 3IUEA 3RVPA 4QYTA 3T3DA 5JG7A 4CKCA 2C78A 2CDNA 3AF5A 1Y4ZA 4TOIA 2F8MA 5SZHB 5JU6A 2EZ4A 1A9SA 4PCLA 3N6RA 2B83A 2GF2A 5BRNA 1HDEA 2BF4A 2HRZA 3B6JA 3KCNA 3SAJA 1LVGA 2WW8A 4JI6B 3WMRA 1PL6A 4C7VA 5J2TB 5TQJA 3DV2A 2J7KA 4Y6OA 7MHTA 4ZV4A 4IVRA 3NOQA 4S04A 1WBBA 3BUSA 4M0MA 4YRLA 1SG0A 2JS7A 2OUKA 4DLAA 1I8TA 2N47A 4BNTA 1BXGB 4QHTA 3V7YA 5HKAA 3KO8A 2WJIA 1OFTA 1JPNA 2C0CA 4IXTA 4WNAA 3EXFA 4AP5A 4CG3A 2ZUUA 1U3UA 3NW9A 4HR7A 1YUBA 4G5HA 2GI4A 4MDYA 4I4CA 3U49A 1QKJA 5C5EA 1REQB 4KR3A 1YQGA 5CVUA 2H11A 3NHUA 3PNBA 3CLTC 3HA2A 1GSOA 2X23A 3ODGA 1XLWA 4KWTA 4U63A 5EEHA 1FBTA 2VF8A 3HB4X 1OA1A 2NOAA 4YDHB 1R8SA 2WT4A 3IIMA 4MR8B 2IWHA 3FOZA 2HT6A 1RWNA 2C57A 1DQRA 5G0SA 4NYJQ 3FIJA 1E9SA 2ZRQA 2P9TA 2WM2A 2QPTA 1WSBA 1SUWA 3KKEA 5EEGA 3RFTA 5BT8A 2UXBB 4UMFA 2Z57A 5CFOA 3GGSA 4DQUA 4ONEA 4G41A 4YIKA 4B6SA 1S2MA 5ICSA 5BNTA 4N5HX 4B6GA 3NOVA 2D0OB 4WT7A 3D3QA 3Q7EA 2VT6A 4M22A 1RFLA 4NK4A 2EKPA 1T6XA 3GV0A 2N75A 3QKSA 9LDBA 1U8CB 1XZQA 4J1TA 4R31A 1APBA 2DHQA 1D9XA 3HYSA 1M8FA 1QFZA 1FP7A 1KZ6A 1ZAYA 3NIDB 1VDZA 1HFJA 2Q29A 4LZWA 4TV8F 1MW9X 2BKEA 1TKRA 5I3ZA 4NU0A 2DM6A 1MP0A 2O2DA 2PWAA 3ZI7A 4EBBA 4KQXA 5AVVA 1X19A 3KJGA 1GUZA 2AR0A 1TFUA 2VF5X 3BBLA 3NRJA 5L45A 4FW8A 1F2TB 3TSYA 1LPOA 2AW5A 4R2LA 3WJ7A 3ER9A 3RFCA 3AMVA 2XTAA 4MQBA 3GF4A 2X14A 1YOVB 3B6MA 2FRDC 2QQ5A 5AW8A 1W2HA 3FNQA 2AS0A 5FNVF 2VOJA 4W1RA 2F2TA 3DR3A 3PHLA 1W88A 1HZZA 1KYVA 3MZ0A 1B8OA 4WKOA 3K4PA 3LUAA 5AI9A 3FD8A 4LPKA 5F1PA 5F5NA 2PMWB 3GELA 3UCEA 1O57A 2HSGA 1CYEA 4ZVPA 4IKPA 5JVDF 4HFMA 2W7TA 3OX1A 4Y2VA 1DEHA 3PKIA 2WKRA 3PLNA 3BXZA 1EUDA 4V3CA 1VIMA 5AI0A 1EUYA 4Q4DA 1CUCA 2XVAA 3PIDA 3R5HA 2C20A 1DQYA 2WAAA 2R85A 3F5MA 2FW0A 4YAOA 1ACMA 3PHBE 1G9SA 2C2ZA 3MCUA 2PAFA 2ZBEA 1A9TA 3PUZA 4KO3S 3OZGA 4Y9SA 1N8NA 3KD3A 3DBIA 2C5AA 5CYOA 5K3DA 3QVGA 3GX1A 1DJPA 1TJ4A 3GRVA 3NC0C 1QTQA 1PO7A 1AUQA 3CIOA 1EE2A 5CURA 1YS2X 3VU3A 3WHLA 3CG0A 5HF8A 1LB1B 3L5OA 2ZJ5A 1UKVY 1WDKA 4MV0A 4OTZA 4Y0VA 1N2CE 1FLVA 4QREA 1E2EA 2HQRA 2CXNA 4PSUA 5HF5A 3A8TA 1Y80A 4I8XA 2RC5A 4P6VF 3KEQA 4U8HA 3KYBA 2NUAB 1BFUA 1YS9A 4IDAA 5B1DA 2P69A 2G36A 4RD2A 3Q7RA 5DW3A 4MJ3A 3BS4A 5EMMA 3DUFB 1DG9A 4ZYZA 4JX8A 3U81A 4HGNA 2F1RA 4YCAA 4N03A 3U4QB 2ODWA 4HSEA 4AXXA 5JCXA 1IMOA 2GDJA 2OD9A 4MPPA 3OAAA 3B6KA 1WY5A 5M04A 1EQ2A 4FGWA 4JI7B 3OPNA 3HA5A 1DXYA 2ZUEA 1KI9A 4M4SA 3BIJA 3GJXC 4E32A 3E9RA 2ISSD 4XYBA 2PUHA 5FOTA 1VXOA 3HK2A 3UT5A 4LBZA 2BBOA 3A31A 4JELA 4QNRA 2DF8A 3LGSA 4YA6A 1GZ6A 3UWDA 3VZSA 4TVSA 5KTOA 1DBRA 1J7JA 2O1XA 1JHPA 1N2JA 4ENRA 3HH8A 4RLSA 4AAYA 3RW9A 2IELA 3HUUA 1NI3A 5A3SA 5JAIA 2UYHA 3NTRA 5EINA 2O8VA 1Z47A 3D0KA 4TLEA 4XLTA 4JJIA 4MRPA 4ETNA 1EJ0A 3FSEA 3JQGA 1P73A 1RQGA 1K8QA 4K2AA 1CUXA 4MPDA 3IKVA 2QL7A 4HUJA 4MCJA 3Q3CA 1V9SA 2IYUA 3VZBA 3B7WA 5ITZA 5AFSA 1GO2A 5EUCA 2R66A 4L5YA 2RGXA 5EKXA 3ITDA 3TLCA 4MUAA 1MB3A 3PPYA 4FE4A 1P5JA 1NDUA 5CX4A 3EPRA 4YYZA 2YUIA 1WZUA 3EH2A 1L7RA 2B8JA 3CWCA 4H3HB 3VC7A 1D0SA 2X2FA 3LOPA 3C3PA 3E3LA 3H0KA 4LXYA 2YZ2A 1KZHA 1D0IA 1IONA 4FU0A 1GTMA 2BCEA 4U7FA 1WSWA 1F7VA 5AI5A 3O4VA 4BNIA 1ABBA 3F5FA 3LUBA 3D5QA 5DHPA 4FR2A 4O1IA 1TPZA 4ZDKA 1XNGA 4L3OA 3R6DA 2FR8A 2O2JA 1IUPA 2E4ZA 3LY9A 2PFSA 2HBZA 4A0SA 3BTSA 2JJQA 3L46A 1ZIDA 1GR0A 2Z43A 1GPBA 1QH8B 2IYWA 5I8WA 3AVWA 2Y77A 3KHUA 2V58A 4G81A 4X1OA 4H6VA 3RKUA 1YDEA 4V0SA 3PD7A 3OEED 3PB3A 2ZG6A 3AUYA 3F97A 3LU1A 4OAOA 4EPRA 1WU8A 4J4TA 1G17A 2Q6KA 4AJJA 1ICEA 1R37A 4FYVA 2AEFA 1RP1A 3EVDA 1LUAA 4Q47A 2OB2A 1GGFA 4WKPA 2B1GA 1WCXA 4M7PA 3TTUA 1D9ZA 3AHFA 1Q0QA 1IEWA 5K6AA 3F3KA 4RQTA 3R1IA 2ZYGA 1JEYB 2OCYC 2B94A 1BS9A 3ST7A 2H7XA 5AIBA 3DKPA 4I6JA 5DK4A 5BQFA 1RXWA 4G0XA 4X65B 1NI4B 5BYJA 2FSVA 2QLTA 1BGXT 3D9QX 1YA4A 1H1LA 1JRLA 2G83A 2Y67A 3FVRA 3E9ZA 3L7DA 4HDKB 4MXDA 1HZJA 4CF3A 4DXDA 2Y1WA 1TIPA 2XA9A 3FOCA 1QH9A 5GV7A 2RJ3A 3A14A 2BM1A 4UQOA 5DTIA 3NPMA 4RJJA 3WRYC 1CIJA 4LXGA 4OBWA 4W1SA 3OX2A 4RTLA 2REBA 2VHTA 3LYLA 4O29A 1YS7A 2A9KA 4JJZA 1E5TA 3FLBA 1MABB 3QTTA 2BGNA 4FC7A 3MAGA 2YRXA 4GYJA 1MG0A 5EIBD 4OQPA 4UBNA 1J4AA 4GUAA 1Y3FE 2W2LA 2W6MA 1DVRA 1GPUA 1WHTA 3H9GA 1DOZA 4RW0A 3F3SA 3K73O 4TWZA 5J2TF 1J0DA 1XRLA 2Z8XA 4HLDA 2FKAA 2AD1A 2O5VA 4FEYA 4NV0A 5DKFA 2R8XA 4OUDB 4R7ZA 2VNIA 3ASZA 4K6GA 4ZT4A 4EHBA 4YBZA 4M1MA 2IBTA 2PPVA 3BD8A 2CLHB 1I5RA 3CVOA 3DW1X 2HRRA 3R3ZA 4KW7A 4LTDA 1JGTA 2HV9A 3M4XA 4WHMA 4BZXA 3ZWXA 2ECPA 2FUNB 3M3PA 1NVVR 1UJMA 1ZN9A 1CX9B 4HN4B 4MR9A 3UCXA 1L8AA 4KMOA 1JFFB 1XMQB 2I4RA 1AUXA 4FN5A 1CZRA 1MOZA 1QHHB 4JV5B 4PZCA 4BIMA 1DQNA 1IJEA 3DMGA 1A95A 4X95A 3CYFA 4WDRA 3WB1A 4FIDA 3VOSA 1S3IA 3LGAA 4V2IA 2UVPA 3MCTA 3KT0A 1QRRA 3PHHA 5C5DA 4YJ3A 2C2KA 3FFXA 1X9GA 3NBZC 4QGGA 2P30A 3O6VA 3OKAA 2J09A 2QZJA 4GVLA 2HCTA 5LQSA 5SV2A 5SY9A 1FSPA 1NZDA 5GADl 3MS4A 5BV8A 4RGQA 4RIHA 1A4RA 1DEOA 2ENWA 4Z4QA 1K6IA 2DWPA 3WLQA 5DNDA 4DSZA 1N33B 4MIYA 1EVJA 5LZ9A 5CIQA 2JPDA 2IZ5A 3IPAA 1ZGJA 3ONNA 5IUKC 2ZJ3A 4QYSA 1VE5A 5FH9A 1YR3A 3GT4A 5K0SA 4D3FA 1NSYA 4W7SA 2VG8A 4Z8YA 3UV7A 4E3WA 3PLAE 3WYCA 3RVRA 1G5FA 1IIRA 2WNHA 1GSAA 2FI1A 2XVZA 4IHAA 4BZWA 4OXQA 3D1VA 2EBWA 4TWBA 2GZRA 1E7MA 1LEHA 3ZHXA 3RTAA 2B35A 3VVLA 3S7ZA 6ADHA 2JIMA 2WLTA 2NV0A 3FGOA 3P9QA 1DAHA 3OHPA 4QXRA 5EXSA 3KKOA 1GKUB 3RVQA 4B6OA 4DY6A 2JFGA 2Q5QA 3GOQA 3ZIAD 1CRPA 2PUJA 5CDFA 1QVZA 5HTOA 2JJ1D 3L92A 3DWFA 1W8IA 1GPAA 3H9UA 1G63A 1VYHA 3M6XA 4UASA 4C78A 1AF4A 4LQ4A 3U3JA 1I2DA 3KR2A 1L3CA 3OU2A 4NKRA 2PLWA 5J2UB 2EKZA 2WIJA 3O84A 5L3VA 3ETGA 4AL4A 4PAQA 3D4OA 3N6VA 1S2OA 3L8YA 1DJLA 1JSRA 4TL9A 1Z0UA 2AFHE 4HZGA 2PM8A 1AZTA 4IDHA 2BJVA 3IUMA 3JAKA 1I4OA 4CLEA 1BO6A 1GQQA 2Q7XA 4HXYA 4BBAA 1PJTA 4P4LA 3L1UA 1DTSA 4MVJI 3S8YA 2B4QA 3BN3A 1EVIA 2GN6A 3VSCA 4B9EA 1ORRA 1Q50A 3GWZA 5A4AA 4F7DA 3OZXA 3QE9Y 4BP1A 2REQA 1SB8A 4Q39A 3W79A 4BMNA 4Q4LA 4RHYA 4ZQIA 1SQSA 4BWVA 3WRXA 4DM3A 4DLXA 2ZSFA 3O4GA 1H22A 2DTEA 1S2GA 3JZMA 5BN1A 1MHPA 3NDJA 1ZH6A 3E2MA 4CFZA 3PC6A 3U4MA 3HUDA 2JAWA 1MNAA 1GRCA 3BMOB 2IQIA 1U81A 1AQYA 1Q7GA 1W0JD 2CFRA 3ZQJA 2OE2A 4HAYA 4ESEA 5IJZA 2IV7A 2WVJA 2YN2A 2V7QA 3AKZA 3TZEA 1DT3A 3ES9A 4HBZA 2HL6A 4UBLA 1FK8A 4M1YA 5DWQA 3RAJA 1P7PA 3ZX5A 1UH5A 4MH0R 3N2IA 3TD6A 2GBLA 3BGSA 4K40A 4M55A 4Z6KA 4J7CA 4JB8A 5FL3A 3JATB 5LR6A 4IO0A 5J4HA 1JSCA 1NWHA 1KBZA 3ANMA 2F9LA 4IEEA 4AURA 2RJOA 4X7RA 2QRVA 2A0WA 5FUVA 3ABOB 2V7WA 3ZIDA 4ZICA 3IPRA 2OSVA 5DM1A 5FPKA 5HM8A 2ZE8A 3K9FC 4TZ6A 3OLYA 4TV9A 3QKWA 3D6MA 1K6XA 1IIBA 1JXQA 4PSKA 1VLJA 1KMHB 1RR6A 2AMJA 3CGGA 1ZM4A 3ADDA 1RYHA 1HTWA 1UZLA 2YJGA 4PLTA 3STYA 1FQKA 2D5LA 1N32B 4EYKA 2G72A 2M98A 3AH8A 3DDSA 3BGIA 2QR5A 3EZ6A 4DLBA 4M21A 5IM4A 4KQFA 2QGFA 3PEEA 2II6A 3PNLA 2G5PA 3HCAA 5FBQB 5IYZA 1YRLA 5KNCD 2BTQA 2KW5A 2CKDA 3B6ZA 5DM70 4F9FA 4ZO6A 3IEKA 3CZCA 1L8LA 2K5UA 2QY6A 5G1PA 3K05A 2K87A 2NXWA 3L1IA 2C4WA 1LPNA 3LHDA 1BHJA 2DU8A 2W8BA 3F4LA 3HXPA 4FZ3A 4G63A 2RK3A 3MJDA 2IZZA 2PGIA 4W8HA 1UJ6A 2ST1A 1ULZA 2PT9A 4EUFA 5M2QA 3OPXA 2HWKA 5KQGA 1HQCA 3PJDA 3COVA 1WUYA 2COUA 2NO9A 4CEIB 3V34A 4JBLA 2XSZD 5GQSA 3ZCVA 4EEZA 2XBLA 4BZZA 2O3QA 2VRWA 4I4NA 1NW5A 3K1YA 1GCOA 4I5IA 5A2QA 1TNDA 3T9FA 4ZI3A 1LD3A 1CR1A 1NC3A 3HYRA 4A16A 2O8DA 3PRYA 3GDFA 1CCWA 2WSBA 5IM5A 2NADA 1AK9A 3N75A 2I67A 3NJ8A 4MV4A 5DM0A 1NW4A 1SUCA 2RKOA 3GHHA 3KJHA 3L43A 4NATA 5AKGA 2V03A 5AWFC 5D6NA 2G25A 2IIBA 4BX0A 3I9NA 3ZJYA 3IBSA 5GONA 1L4EA 1Y6FA 1ADCA 4UHDA 1T0JB 4GR9A 4TL6A 2L82A 2HJVA 1LJ8A 2WJ4A 4KC0A 1X1SA 4QOFA 2BTOA 5BRJA 3ITNA 3I72A 3H8VA 1ODLA 2QNRA 4W9MC 4XW2A 1GGJA 3FMFA 3LW7A 5DZSA 4MCAA 4KITB 1Z0AA 4U2EA 4ZI5A 2O8CA 3W9SA 1B26A 2WILA 1H2ZA 2HMSA 3PQDA 4I8IA 1WVGA 5CGZA 4B4OA 1PJ4A 4C6RA 2LGJA 4F5WA 5A9RA 5JCZA 1EEHA 3KQMA 1OWOA 2XECA 2QQGA 3OVMA 1E0DA 4B82A 5C7IO 1RZUA 3PICA 4DADA 4RY9A 3KNZA 3G9UA 3UOAB 3HQ4O 1ZM3A 3B53X 2NTNA 4JN6B 1H2EA 3PEUA 1P4GA 3IXLA 1EK0A 1YJQA 2VHWA 3W3AD 4RHEA 4O5OA 3MJ4A 2FETA 3OESA 3PYMA 3CHYA 1N5OX 1KFCB 1JJ7A 2YBDA 4JR1A 3VTFA 1I1QB 4B76A 1FDRA 4HNRA 1RPTA 1UQRA 3HCOA 2OR3A 1FFAA 1XRNA 3GNSA 1QBGA 5KAPA 1WCIB 1CSEE 1KZ9A 2YHIA 3R7BA 4NMHA 3VMFA 1N36B 3L0ZA 2ODTX 1NURA 4G2NA 2YIVX 3EXEA 1CP3A 2OG2A 1E6EA 2ZIWB 1D6JA 4LXTA 5KWEA 3OJOA 4N41A 3MBOA 2FHPA 1E5LA 3O0TA 5BO5A 3SHVA 3WIVA 4US2R 1NVVQ 1HDOA 2PHZA 3P8ZA 1GNSA 2OYRA 3UAGA 3IBFA 1T6ZA 1TCUA 2AIRA 3QVMA 2A1IA 3IQWA 3LY8A 3VZPA 5CT5A 3UMYA 3IQZA 3IDSA 3NT2A 1JJAA 5ELMA 4AMBA 5CFNA 2MDTA 2XZPA 5HKBA 2FFBA 3GD5A 1V11B 3I1FA 2OP1A 1MX9A 4TTPA 3O1LA 3C5HA 4XIYA 3AB8A 2P2GA 3BILA 3KD2A 4YLYA 2ZIFA 2ADOA 1E99A 1H4TA 1R0SA 3UFXA 1C4KA 2R1TA 1N2GA 3AX6A 1G3IA 2RC6A 3FRIA 1JJFA 4O63O 4I9UA 2AJ8A 1NQAO 3LUHA 3T4EA 2PMBA 3CEMA 4KG7A 3DOJA 1SQGA 2YXLA 4OGLA 5JI2E 5E9QA 1K5GA 4PG8A 4AF7A 2J59A 1T5BA 2CL0X 1Z0DA 2Y1DA 5BQPA 4EYGA 1GVNB 1UPUA 2JH3A 1V4BA 2GD0A 3JRNA 3PP8A 4IIXA 1WB4A 1R6BX 4LOIA 4QHYA 3N5CA 3RVMA 3K1AB 2H2DA 4NCJA 2HCRA 3T8YA 3Q9UA 5F64A 1JHOA 2G82A 2UUAB 3IMEA 4P81A 3OTHA 4XGNA 1WZNA 3EBPA 3VX3A 2ZS7A 4FYYA 4JL8A 2PS3A 3TRIA 5CA0B 4AMVA 4MUYA 5CT6A 4W5WA 3RD5A 4YAJA 5EA2A 3SIPA 4P4NA 3VR3D 3DG9A 3GLIE 2VNHA 1LLQA 4R54A 2V0GA 1EK2A 3WLRA 3TOXA 1NATA 5DE3A 3AUTA 2YJZA 3DP9A 3G9ZA 3UCFA 1IY1A 3GLHE 1ECLA 3ZHQA 2FUCA 5L53A 1P2UA 3NIBA 5J2UF 3QPVA 5LBUA 3QXHA 1J2EA 2JD1A 3EGDA 1X1RA 4TMTA 5BSHA 3AF2A 2NACA 2ZYRA 4HEA1 5C1PA 2H48A 1CJKC 1KH3A 2XMSA 4L0QA 5GAJA 2NQTA 3UPDA 3I01A 5GGYA 4XJVA 3WISA 4ZCPA 1LPBB 2DR0A 2H1LA 4NONA 5FCDA 2IYRA 3DYBA 1DAMA 1R5BA 4M1OA 3RRYA 3S29A 3R8FA 3EJWA 4C04A 1WJGA 4CTKA 3A6GA 1E98A 2OLKA 3ANXA 1SZPA 3CLRD 3HJUA 4POAA 2EQBA 5ILGA 2NU8B 5JH7B 3C41J 3MGBA 3F8SA 1NVTA 2PGXA 1ML4A 2R6AA 4GAEA 4F9TA 1ZOSA 2BAGA 4KGZA 1J1IA 5EUMA 2ZSUA 2ZR8A 3CZQA 4B5KA 5E3IA 4M1WA 1FSZA 1GUFA 1EX7A 1QC5A 3GJTA 3WIUA 5JYDA 1T1IA 2RE8A 1J70A 5LSAA 1IBLB 3MHTA 3RLIA 2QTVA 3FNGA 2AK2A 1HE8B 3V55A 3VAAA 1UPBA 1V1RB 4CMHA 3ZK7A 3JASA 2BBSA 1G21E 1XYYA 2J9FB 1G8HA 3TZLA 5FRDA 5BQXA 4CLXA 4DG8A 1IHDA 4V02A 3PPWA 3GUHA 3WGZA 5HIAA 3FMVA 2P90A 4ECAA 2P9QA 2OBFA 5A0VA 3VFDA 2O14A 5LN1A 1BOOA 5J4KA 4F2WA 4J94A 6REQB 2GM4A 3DOHA 3KVYA 4W9NA 3ZY3A 4RTOA 3O8QA 2OGZA 3KSRA 3OZ7A 4LEIA 3RTEA 1PVVA 1Y9AA 3E3AA 3RJ5A 3ZHRA 5JNWA 2JHFA 1BKYA 4TUYA 5JSHA 5F73A 1PN3A 3N0RA 1ZOLA 3PCRB 1EXMA 5I7FA 3OEEA 1DKRA 2OM6A 1AXRA 3NAMA 4LC1A 4ZIRA 3S3TA 4BKPA 3IBGA 4OA8A 1WMSA 4C4XA 2OAQ1 4ARZA 1NASA 3A1DA 1Q92A 3TKLA 1CUUA 1NW6A 4AJPA 3GPBA 2H4ZA 1UDWA 4EK9A 5TVKA 3PHJA 1GZ3A 1FYDA 2E4UA 1GZ7A 3F4BA 3HKBB 4N0DA 2REXB 3LYUA 2HNBA 2DYKA 3S81A 3IUPA 3IOBA 1Z5NA 4NL4H 1B4DA 2BDUA 2G4CA 3PFNA 2G7ZA 1T8UA 4ITUA 1E2LA 4Q01A 2X42A 2J87A 1IL0A 3FFBA 1KI1A 3TQFA 3DZGA 3PRJA 2O8FB 3M49A 3UB3A 3R44A 4GMHA 1WZEA 2P6PA 2GPWA 3AW9A 5BW4A 1JU9A 4YRNA 3K35A 4JL5A 5AW2A 4MS1B 2MSEB 5EFZA 4GKKB 4QD3A 3ZY4A 3DS8A 4EMSA 2PT7A 5E7JA 1O0CA 3IJEB 3EOAI 1JG4A 2W2NA 5LBIA 3UMJA 5DNWA 3TEJA 1PT8A 1YB4A 4M7OA 2I54A 3VYWA 4KO2S 2JI4A 4F97A 1XQ9A 5BURA 2VRBA 4QQ8A 3GBSA 2XODA 1W94A 4M9RA 1ESMA 4CNBA 2OGSA 3WNBA 2WNIA 3E2IA 1KAQA 3OZBA 3CU5A 1RHQA 1RWPA 2N42A 4PCUA 5FUWA 1JMKC 5L7TA 4HX9A 3FAZA 1N6IA 4OYHA 2K6GA 3WNDA 4BO7A 2A78A 3IOEA 4EUHA 1FP6A 1UT5A 2WF9A 4X71A 5DNVA 2J5BA 4HN2A 1NVAA 3Q3JB 2QTWB 1A5ZA 2G5CA 3FHJA 3H0EA 4GOLD 4HAWA 4JC8A 1SHJA 4MB6A 1L5RA 4LY3A 1EFLA 3G79A 3N2KB 3OIUA 3ZE1B 2WUGA 2FLKA 4F4HA 3L40A 4INJA 4C0SA 3OSUA 4B31A 4RVSA 5D1NA 1ZD9A 3DHYA 3UXMA 2BMFA 5ALWA 2XZLA 2J08A 2HQSA 2R8PA 4BNVA 3A6FA 1E1LA 2B25A 2H06A 2HMTA 2OZLA 3NWOA 2YHAA 4E51A 4K28A 1MB2A 1NUPA 1X1TA 2EYUA 1GNRA 1W8DA 4A3SA 3O74A 4RHFA 2O2SA 5AM4A 2Q5OA 1IM8A 3NC1C 5A04A 5JNTA 1L1RA 2I87A 2OQRA 3WGQA 1YZLA 4G8CA 3WYDA 1R88A 3CW2A 2I7DA 2Q5LA 2WKPA 5BR7A 4BNKA 1A27A 3JQ7A 2P75A 2XE7A 4LRXA 2AQ8A 4DR6B 3HCCA 1JHUA 1SXJE 2JFQA 3GZNA 2P0YA 4X6YA 1YJBA 2HA3A 2HU7A 3QUTA 4RCVA 1XR3A 2YFKA 4JYMA 4TTRA 4ZVQA 1I2MA 3AR3A 2QMQA 2EKLA 1ADYA 1LLDA 3KBOA 1F8GA 3PNQA 1M2EA 3QELA 4BJHB 1BSVA 4U9IS 3IOYA 4TL7A 4EBFA 4B2YA 4YC7A 2DWUA 2VDNB 3HU3A 5IAGA 4UULA 4FBGA 1I5EA 4OHMA 5T4HA 1XPOA 3DEAA 3CTPA 1AQLA 1Y8RB 1GL7A 3DR5A 3GFRA 5CH3A 5DWDA 3RHZA 2EZTA 1Z6AA 3NZEA 1RPNA 5DT2A 1ND6A 1MX5A 4N12A 3U4HA 3OT1B 5KDOA 3CPEA 4Z7OB 1PT6A 3QUBA 3QKIA 1EHCA 4KGDA 5F5LA 2V3VA 3ZIAA 1TADA 4MW1A 4X8MA 4XYMA 1GZDA 2WJ3A 2JJ1A 3FOWA 5EPEA 3TR5A 3ZVKA 4KE6A 4EB3A 1VL5A 2YIMA 3V4OA 2QX4A 1J09A 1FFBA 2FN8A 3LUDA 1WP4A 1W7AA 3AVXA 3CF4G 4NOLA 1WBJB 2HSEA 3UGQA 3CPHA 1RYEA 4JSRA 1QVWA 4LJ7A 3EG5A 3OC6A 3DYIA 4LPSA 4QQFA 4QUKA 5I8ZA 1FFSA 4QYMA 4NOKA 1J2JA 3QPAA 3RSHA 3O8LA 2OESA 3P2KA 1TD9A 3SC2A 1WBDA 1GZHB 2Y6VA 1SM4A 5KDLA 5KYXA 1A5SB 4AJNA 1QFMA 1CBUA 1L1EA 4WBXC 5C1IA 1B6GA 2NAPA 2WIKA 3KTFA 3SXJA 4ZZ1A 3P9SA 3UZUA 5ADVA 4BAUA 3HWSA 1Z5GA 2PTHA 1P45A 3BMNB 2VA8A 1NMSA 4INPA 1RRGA 2JDID 3ND8A 5BSFA 4R83A 4H08A 1C8KA 4YMWA 2G67A 4CT5A 2FW6A 4I8DA 3VPBA 4NXNB 3VR1A 1PJZA 1VE9A 2IZ1A 2W42A 1TEXA 1W0JA 3BL6A 4H1TA 2ZIGA 4NQZA 4OYLA 2FMKA 2PKQP 2RAPA 3KWFA 5K9ZA 5CA0F 1RZ3A 1UDCA 5T8KC 1ZK2A 4UTZA 2QLMA 3C7CB 1I24A 3H5VA 3L4BC 1O87A 2A7XA 1L9KA 1AKUA 2D74A 2VFAA 4J16A 4U6NA 5THKA 4BMOB 4EAAA 4EJFA 4EL0A 1PAUA 5BSWA 4ZOBA 5HVNA 1GN9A 1GVHA 3URKA 4FGJA 4N3NA 4PZDA 1R9MA 1JH9A 7MDHA 1KQ3A 4IV5A 3GU3A 5NLLA 3RVNA 2EWWA 4A91A 3RVJA 2CK3A 2JBAA 4WKCA 1OBCA 1SURA 3ESAA 3V7NA 5B6PA 4R9RA 2FPKA 4XDGA 1OZ0A 2Q2WA 2UYCA 2FPSA 4ETWA 2A0YA 2HBYA 3DVSX 3KXKA 3PK0A 1SD2A 3GEMA 4RJIA 1UL1X 4NJMA 5LIPA 3PUHA 2E89A 3OP1A 1Z4JA 3N05A 4YUAA 2XGJA 4DLSA 4PNPA 2RHBA 1SFRA 3B5EA 4JQZA 3P2MA 5F7XA 5AVXA 1ZZEA 4CWAA 5J3JA 1M2OB 1VFPA 2HJ9A 2QHXA 7AT1A 2BFBA 5JH7F 1T9GS 3BL5A 2QVLA 1TJNA 1UBEA 3LF1A 3QBJA 2FFAA 4TN5A 4D9KA 5KNCA 2F8TA 4CL8A 3PQ3A 2FSHA 1EK6A 2WR8A 4J0EA 4KGXA 4KR0A 4RA9A 2KPOA 2RIPA 5HF6A 3KYIB 5SYAA 2AX3A 1AXEA 1EWQA 2WD9A 3H5RA 1I5OA 4CVNA 4ZCLA 3H99A 4IXDA 3V42A 5ILQA 3M89A 4LYEA 3TIXB 1QG6A 3AF0A 3WWCA 3I4FA 3STWA 4G1EB 1F20A 3ZDEA 5KMGA 2IPLA 5CXXA 2XSZA 4U7PB 1Z3CA 2WDZA 1FYXA 2BFNA 3CC8A 4FPXA 5EHXA 4C0LA 4E5VA 4GXTA 2BSAA 4C4SA 4ES6A 3QTBA 4WXPA 4AMZA 3ZCQA 4BX3A 1N8SA 4N40A 2IXGA 4FLMA 1CUIA 3EPJA 3A4NA 4L28A 4R1MA 4DLZA 4XRRA 5EZYB 1X7ZB 1M1YA 4RFVA 1HOTA 1VLHA 3MFYA 1AKQA 4GQBA 1RWKA 4J03A 4JVSB 1NN1A 1QIDA 2QB5A 3DVQX 4KN9S 4Q1CA 4R2XA 1K75A 4YMIA 3P9PA 4DMGA 4PGFA 1DP4A 3OLWA 4M1TA 2QF7A 4A6DA 1OH6A 3W5IA 1AKNA 1KEPA 4Z9AA 2WFLB 1WSDA 4ZOEA 4IXNA 5EY5B 4N0MA 1E2IA 1MIHA 2HW8A 3FVVA 2WYVA 1IOLA 2PMFA 1M6VB 4QDUA 1XVVA 4O4JA 5AOBA 3H42B 4MVJH 4XKJA 3UV6A 4J43A 2HHLA 2QUJA 4WW0A 5FWXA 1UDXA 2Z2ZA 3OJXA 5EI5A 2GCEA 2PH7A 4AMYA 5EESA 4C22A 5EP2A 5IJ0A 3UJNA 1M76A 3HCPA 1KDTA 1NR1A 1P6UA 1YJXA 1ICIA 1M34E 3EFOB 1R0RE 4NLLA 2RAFA 2J3KA 3W3AA 3N8HA 4GX0A 4IAOA 4ML3A 4UTXA 5DGIA 1KMIY 1W46A