5THQA

Comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
248
structure length
248
Chain Sequence
b'LGLRGKKALVTGGSRGVGRGVVLALARAGVDVFTCYREESDASASLARELKQLGGDHHALRADLADPKQIAELFQEVGRRFGTLDVVVNNAGVISHVPYAELPVAEWQRIVDVNLTGAHLVIQHAIPLLGDKGSVISIGSKSSEVGIPLRAHYTATKHALRGLTRSLAKEYGRSGLRFNVLALGVVETEELHALPDDERAEMTKFYSTKTALGRLGTPDEVAGAVAWLASDLSRYVTGATIHVDGGIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-ACP reductase
publication title Comprehensive Analysis of a Novel Ketoreductase for Pentangular Polyphenol Biosynthesis.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Oxidoreductase
total genus 93
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5thqA00
2AQ8A 4RPHA 1WZEA 2OOSA 1MLDA 1ONOA 3V5NA 3VKVA 1O6ZA 2GASA 2HRBA 5CAEA 5FI3A 2NTJA 3CE6A 1XKQA 3RKUA 1Q7BA 3VZQA 1VJ0A 2YHIB 4R5HA 4N7RA 5BSEA 5JC8A 1DRUA 2Y67A 2EGGA 4PLVA 1C0KA 3K31A 1I01A 2GYYA 3DMTA 3E9NA 3DB2A 4U0JA 4XGKA 1JN0A 1HE2A 3OMLA 1GV0A 2J3KA 1JWAB 2OHXA 4MPDA 2CFCA 5B4UA 1PWZA 1Y7TA 4GX0A 5B4TA 4FJ2A 1UP6A 4ESOA 2WWRA 1F0YA 4HFRA 2RH4A 3QA9A 3G49A 3RUAA 4AJ2A 4IXTA 1NP3A 4RLHA 3ADPA 1N9GB 4HNHA 3IC5A 4JNKA 3TFQA 3DHNA 4J4TA 4YPOA 2C7VA 3GT0A 4OQZA 2VYND 3VHRA 2BD0A 4M54A 1QMGA 3Q0EA 3ZWVA 2ZCUA 3GRKA 4ZA2A 3ONDA 3FI9A 5DZSA 2CVOA 4XYBA 4HV4A 3FD8A 3JQAD 3MJ4A 1WMAA 1DSSG 1UZLA 1Y5RA 2EV9A 3V1UA 3N7UA 3KZVA 3PXXA 1PL8A 2ZJ1A 5DNAA 4WNCA 5TSDA 4J1SA 1FDSA 4ILKA 4YRDA 1OMOA 1YRLA 2O50A 3PTZA 1LLDA 4CMEA 4BO2A 3ZHBA 1VRWA 1ZZEA 3WYEA 1HDOA 2VYVA 4Q39A 3DWFA 1QYCA 3SBOA 3LVFO 2JCYA 2CY0A 3ZV5A 1B0AA 2O2SA 3H9GA 4CUJA 4L4RA 4NFHA 1K3TA 3KETA 2I99A 2VUUA 3HWRA 1T4BA 1Y5MA 3NDRA 3GHYA 4D0RA 5AXCA 3KO8A 3OETA 4YA6A 5F1KA 1LBEA 5G0UA 1MB4A 1C1XB 3E6AA 4RL6A 4GMFA 1VSUA 1IHXA 1XHLA 1LSSA 3AUUA 4OGWA 1DRVA 1EMDA 1X13A 2O7QA 1AHIA 3TJRA 4EJ0A 4GLLA 1G0OA 5FWNA 5EQDA 4YQYA 3WLFA 1PGOA 3QQPA 1N7GA 3R3SA 3ROPA 2Q46A 1PGJA 5CDSA 1ZEMA 1ZXBA 3F46A 3L4BC 3JTMA 3MJCA 5F1OA 1DC3A 5J23A 1KS9A 1E3IA 1DDOA 1FMCA 4XX0A 3AM4A 3LZ6A 1J6UA 4NU6A 4BS9A 1DB3A 3DQPA 4EJ6A 2WJPA 1PR3A 4KDFA 3SJ7A 1FDTA 4EUFA 1W73A 4D41A 4AJJA 1BW9A 1B3BA 4LCEA 1LQUA 1ZK3A 1WAMA 1VJTA 1YDEA 2ZYDA 3M2TA 4MIOA 4P4GA 4AJOA 5JW6A 4NHEA 4RGBA 1MFPA 4DA9A 2C2YA 4M55A 3D64A 5L51A 2Q2WA 2EW8A 4TVBA 1PZGA 4J43A 2OBYA 4R54A 3AM3A 2GZ1A 1WW8A 3I9JA 2PFGA 4CLRA 4TROA 4Y8VA 4JGBA 3BMQA 1ORRA 3RC9A 1N8KA 2FZWA 2VRCD 2JFGA 4MINA 3UXYA 1ISHA 1KEUA 1VL8A 4TVOA 3VZPA 4Z9YA 2NU9A 4K28A 2W90A 1K0UA 1ZK4A 4PLZA 1X1TA 1RM3A 1Z74A 4E2YA 3TL3A 1M75A 3V1TC 3WMWA 1J49A 3T4EA 2YHUA 3KYDA 2Y68A 4E2WA 2B83A 1ZFNA 1JAYA 4I08A 2QZZA 1ULSA 4UVHA 4AG3A 3SLKA 3FNHA 3U4CA 1YQDA 3NKLA 1SMKA 3PFWO 3FRJA 5T5QA 5KOIA 3H4VA 1U3WA 2E48A 1YOVA 3B20A 3G0OA 4RPJA 3QVSA 5CDGA 2OO5A 3F9IA 4Z3KA 1JKIA 3JSAA 4XJSA 4MIEA 1E0DA 1EDZA 3BHIA 3H9JA 2B37A 3DBLA 3OJEA 4L75A 4FQ8A 3VPFA 1I3MA 2CUKA 1BVUA 2FN7A 2R6JA 4UAGA 1DFHA 2OXIA 4J7XA 4LVCA 3ZWAA 5I9LA 4I5DA 5L45A 1A7AA 3PGXA 3ZWPA 1GYQA 3L4SO 4L8VA 5TQVA 3E9QA 3RQSA 4AJPA 3L4BA 1I3NA 3ANNA 4QTZA 3LC2O 1ZO8A 3L6DA 2IRWA 2WYVA 1BXGB 1P44A 1JAXA 4MVJM 1LSJA 2VQ3A 1ZK0A 3JQ7B 1LU9A 1P1FA 3DFUA 1E6WA 3I9MA 3QHAA 3AUTA 3C1OA 3I6QA 1VE9A 3OECA 2ZIZA 2DT5A 2H6EA 3D5QA 4H15A 4MP8A 3W1VA 9LDBA 1ML3A 1MA0A 4BQPA 2NU8A 4OJNA 2YV2A 1JA9A 1PJLA 4PLCA 4A03A 1LDYA 3ZI0A 2DFDA 3AOEC 1UDCA 4WCDA 3P19A 4M49A 4D43A 4PCVA 4KQXA 1DLJA 1HE4A 4J1NA 2Q1WA 3GA0A 4PZCA 2O3SA 4D79A 1YGYA 3WICA 1B2LA 1OAAA 1VI2A 3OICA 3HFGA 2B69A 2QRLA 1Q2XA 1CETA 3AW9A 1I2CA 1U2DA 2BFMA 5A04A 4J7CA 4BUCA 5TJ9A 2R00A 5IDXA 2DUUA 4ROSA 1SBYA 1QR6A 3IMFA 3W6ZA 2FPIA 2X0IA 2Z5LA 3BMCA 1IZ9A 5F3RA 5A3JA 4ND1A 4AFNA 4D42A 3AU8A 1F8GA 1T26A 2F1KA 3I4FA 3ZV3A 3HHPA 2XF8A 1CIVA 3K2BA 4MKXA 1HL3A 3FR8A 4CMKA 4ZRNA 4UREA 3GGOA 4WJZA 4R1TA 1SZJG 2ZB4A 3RIHA 1BTOA 3CSDA 1PZHA 3GNSA 1CJCA 4FCCA 1EFKA 1T1RA 1HYHA 2D3TA 3H2ZA 1YO6A 4FFOA 3ETDA 1WWKA 2PGLA 3DBRB 4YJHB 5GZ6A 2PY6A 4BNXA 2ZTVA 4IDFA 3ADOA 2OFPA 1T2DA 4RVHA 4YAEA 4XYEA 4GI2A 5CDTA 3RFVA 3DZFA 2C59A 3WB9A 4FJ0A 4TRRA 1GD1O 1H9AA 1ZSNA 2O4CA 3D4PA 4YAKA 3GN1A 2ZTLA 4BB6A 3D3WB 4DGSA 3WYBA 2ZKLA 1EQ2A 2DTDA 3E5RA 1YL6A 1BDMA 3ZU3A 3GFBA 4HBGA 1UJMA 1PJBA 4PG8A 3KYCA 3QE3A 3ICCA 2OL4A 3DMYA 2YHIA 4GQAA 2Z95A 1U8XX 3UCEA 4DC0A 1YDWA 3ZCXA 1TB4A 4J91A 3MOIA 4YYZA 2PTGA 2VTDA 3D3EA 4E5PA 3NAQA 1FJHA 1E3SA 1CYDA 4PRLA 1B3RA 2HMUA 1ISIA 5AOVA 3TZHA 3MZ0A 1GAEO 4KUHA 1ISFA 3HZZA 4KWHA 4RZHA 4AJ1A 5KCZA 1I2BA 4DREA 4EEZA 4J6FA 5HS6A 1YB4A 4GBJA 1UXIA 2HK7A 3IOYA 2B5VA 2JHFA 1UDAA 3ASVA 2VUSA 4RVDA 4ALIA 4BO9A 4U5QA 3PWKA 1R4NA 2JAPA 3C7AA 1PR9A 3F5SA 5KKCA 1Y81A 4BO0A 7ADHA 1E7RA 4R5MA 4FFNA 1NVGA 1N9GA 2AE1A 2JKVA 2OP1A 3EVTA 5A1TA 1GYPA 3ZWMA 4TKMA 1K89A 4IDGA 3INTA 4ZRMA 3BHMA 4FD3A 4W99A 3O26A 3ONFA 5BT9A 4O1MA 4HWKA 4ZHSA 1UR5A 3EVNA 5U4QA 3C1AA 1V9LA 3MWDB 4A0SA 1SOWA 2E49A 4C4OA 1K5HA 2E6UX 1OFGA 1SEVA 2QYSA 4N18A 4BGUA 3ZWYA 4IXWA 2G5CA 1R0LA 1QP8A 4X54A 1ZK1A 5JY1A 2QIOA 1NVTA 4YACA 1V8BA 3JQ9C 3OIGA 2A4KA 1PJ3A 2PZMA 1NHGA 3EZYA 1PGPA 3R3JA 1JTVA 5A3VA 2Q45A 5ITVA 4IY1A 1C3VA 3WR5A 3OQ6A 5BR7A 4LK3A 4NIMA 5HM8A 3PPIA 2VNSA 1Z75A 4KUEA 4N5MA 4WK6A 2CVZA 1V3UA 3E03A 3ITDA 4L73A 5G0TA 1C0LA 5A02A 1GUFA 1E92A 3CPSA 1T2EA 5TT1A 1U2GA 1P0CA 3A4VA 4RDIA 3DEYX 2Y66A 4BNTA 4WOJA 2Y93A 4JBHA 4UUMA 2IXBA 4W7HA 3AUAA 1AHHA 1KEWA 3KEQA 1CWUA 5THQA 2IEDA 4R3NA 4EW6A 1T24A 4B3JA 1SPXA 2B0JA 4B3HA 1EE9A 1I5RA 4UUNA 3F4LA 3WTBA 4AJLA 1X7HA 1YS4A 3OH8A 3VDQA 1M67A 5BSFA 1C1DA 5I8WA 1GV1A 4K1LA 1KVQA 4RDHA 1NX6A 1BRMA 1A4IA 2QQ5A 1U5CA 5JS6A 4Q3BA 1KETA 5IDWA 1BW9B 3A1NA 4ITUA 4ND5A 4W6ZA 3RVDA 4ZQEA 5IZCC 2AW5A 1ZW1A 4FDAA 3HUDA 2O3QA 4GWGA 3FWZA 4R68A 3RAJA 4CQMA 4DLBA 1F17A 2JCVA 2PZJA 1J0XO 3RUCA 4RPKA 1LTHR 2GUGA 4BO7A 3WBBA 4IBOA 1UAYA 2HQ1A 3PJEA 1H93A 1EVZA 1WPQA 4BL5A 3SJUA 4DRYA 2P4HX 2C29D 2AHRA 2NNLD 1XG5A 1FDUA 3FNFA 3R0IA 3WGZA 1NR1A 5GY7A 1VLLA 3FN4A 1ZKMA 5DP1A 2YQ4A 4EZBA 4F46A 2X9NA 1AN9A 5DP2A 3E1KA 4P4LA 4EDFA 4OQYA 4XEHA 3KTDA 1E77A 3KB6A 2W2LA 3KYDB 1PGQA 4OM8A 5CDUA 1QSGA 1NWCA 3C8MA 2G76A 2HUNA 4CPDA 5A9TA 3UH1A 3V2HA 3PRJA 4BNNA 4L0QA 5L4LA 4CMIB 4GSKA 4JROA 3LQFA 3K92A 1QV6A 4BNIA 3I6IA 1OC2A 4IQ0A 1U7TA 1GZ3A 1M6HA 4R01A 3VAZA 4BNJA 1ARZA 1NQOA 5BNTA 1YOVB 3S55A 4M1QA 3M2PA 1Z45A 4NK4A 4XR9A 4QFCA 2NQTA 4NI5A 4U6SA 3PDUA 5GZ1A 4DVJA 4JJIA 3N74A 4MIYA 4PVDA 2BH9A 3DBLB 5DDIP 4E12A 1S7CA 3RUHA 3U0BA 3EZLA 3GHHA 4R3WA 4IDBA 3KM0A 3PIDA 2WD8A 3DDNA 5T67A 3V2UA 1LJ8A 1BWSA 3V1YA 4YAIA 5EL0A 4OAQA 3GUCA 3H3FA 4UVIA 1VM6A 4M89A 1HLPA 4NR0A 4XJTA 1OZAA 2VTEA 3GFGA 4TKLA 3PP8A 5ENVA 3RC7A 1L1FA 4N5NA 4GWKA 1N1EA 3F1KA 2GZ3A 2RAFA 5JMWA 4F3YA 4DPMA 2G82A 4DIOA 4IZIA 1YKFA 1BXGA 1HDZA 3WGGA 1ISGA 5COQA 4W82A 2YJZA 1UDBA 3JQ7A 5IZCA 3OQBA 5JLAA 1NWHA 5DBGA 2IYPA 5JPIA 4BQRA 1ZJZA 1TEHA 4F6CA 1DJQA 3G1UA 1E7SA 1HE3A 3M1AA 4WLUA 2QX7A 3RUEA 2WTBA 1LX6A 3UAGA 1E3LA 3GG2A 4IMPA 2I67A 3IS3A 1DBVO 3DMTC 1NXQA 2W2KA 2GD1O 3MTGA 1LA2A 4LSMA 2H63A 3KSUA 3ZV6A 4PN3A 1NAIA 3OQ1A 1NPDA 3ZNPA 4NQZA 4CM5A 4Z9XA 4YT8A 1X0VA 1ZMOA 4NZ9A 5HBRA 3SEFA 5I8ZA 2PZLA 4CMCA 1WNTA 3OEWA 4YXFA 2JD2A 7MDHA 5IG2A 3X2EA 5L9AA 3WS7A 4ND2A 3PK0A 1GCUA 1SEPA 1W6UA 3WQRA 4J4HA 3U9LA 1A7KA 2GDZA 4W9NA 2P2SA 1NNUA 2VWQA 4XRGA 3OP4A 3I9LA 4BNKA 1LRLA 1XR3A 2Y99A 5BQFA 2YZ7A 3S2GA 4IMRA 3GC6A 2ET6A 2W4QA 3UCXA 3L07A 3ULKA 5KJ6A 1E5LA 3K5PA 2BGKA 3INGA 4BNWA 4FB5A 2PNFA 2A35A 3GDGA 1E1NA 1E5QA 1E7WA 1YE3A 4J3FA 4D7AA 1UXGA 3CMMA 1NAHA 5EPOA 4IUYA 1E3EA 4FC6A 4CLEA 3B1JA 4J0EA 3MTJA 1S6YA 2AQIA 4KOAA 2D8AA 1GPDG 3A14A 4BO4A 1I0ZA 4CMEC 4LSWA 1QRRA 4S1VA 2AA3A 5JE8A 3B1FA 5IZ4A 4DXHA 3AFMA 4CMJA 3WDSA 1ZSVA 3Q11A 4XYLA 2D0IA 4IJKA 4YJGA 1UP4A 2O3RA 3IL2A 4J9UE 4BNFA 6ADHA 1ZSYA 4J2OA 3WIDA 2I3GA 1QYVA 3D0OA 1YB5A 3WG9A 3F3SA 3OHSX 1LLUA 2HK8A 4TMFA 1P74A 1GL3A 4BMSA 1BVRA 1KY4A 3DTTA 2X0JA 4PG4A 5HTOA 3BTOA 2UV8A 3ANLA 3D5TA 3UUWA 1XDWA 3D3WA 3ZWNA 3LLSA 2JAHA 2VUTA 3KYCB 5EJ2A 3SC4A 1NR7A 4NJOA 4R1UA 5JDIA 1NFFA 5JMPA 4M86A 3JQGB 1V0JA 3C7DB 2FPPA 4I9NA 2AG8A 3L77A 5JNLA 1I3LA 1Y9EA 4FPXA 4A7PA 1XQ1A 2IZ1A 3C85A 3HNPA 3LK7A 4FIZA 5G4KA 2NTVA 2B35A 4TRNA 3ZU5A 5JXWA 5C7IO 4II3A 2EHDA 4FGSA 1DIBA 2I3AA 2ZYAA 4IIUA 4E2XA 3PQFA 5T64A 1Q7CA 1BXZA 4MVJF 3ZN2A 1MC4A 1LNQA 4PLPA 1DHTA 5T57A 4UUPA 2BFAA 1PL6A 3CZRA 2YUTA 1R4NB 3N58A 4IGEA 4YBZA 4E31A 4DL9A 2Q2VA 3QSGA 4YT5A 1E7MA 1YWGO 1SO8A 1DPGA 1PSDA 1J5PA 2I76A 3INRA 1LDEA 3KSZO 3MJEA 4CM9A 5K0ZA 2EJWA 4ZQBA 2X23A 3UF0A 2VN8A 4PLGA 2VNAA 4XKJA 5IDQA 5JFOA 2HU2A 3FF4A 1P45A 4E5KA 1QLHA 3GMSA 3P5SA 5C7LO 5IAAA 4O5OA 4II2A 2Q49A 2J8ZA 4RO0A 4A73A 1QLJA 4MVJA 3QWIA 2X1HA 1T2FA 2NVUB 4ZQHA 3QVTA 4MDHA 4R51A 5JAMA 5G2OA 2DTEA 3GVIA 5KVSA 2AQHA 5KJCA 3W8DA 1LQTA 2AE2A 4NG5A 5TGDA 5EMHA 4G5HA 4IDEA 3AY3A 4Y9DA 2NLOA 3ZHXA 2E37A 1A5ZA 2HSDA 1UP7A 2GRAA 4HP8A 3OA2A 2YYYA 4XDYA 3HSKA 3WWZA 3RBXA 4L4XA 3P2OA 1R12A 3ZWCA 3NX4A 4WLEA 2FHSA 1RYDA 1ULUA 3ZNOA 1L7DA 4YAGA 4BO3A 3RUDA 3QLJA 3S2FA 1NASA 3PDJA 5KVCA 2XAAA 2XXJA 1QYXA 1U1IA 4KWIA 1IPEA 3O9ZA 2WMDA 4EYEA 3GGGA 2WD7A 4EBFA 4HXYA 3RROA 2C0CA 4Z3DA 5HS4A 5IN5A 3QWFA 3TNLA 3JQDA 3GVXA 5EINA 3CMCO 2DAPA 4J7UA 1U3TA 4UEOA 1HLDA 4U8GA 2PGJA 1TA4A 2O48X 3O4RA 1C1DB 5THKA 3PHJA 1E1LA 2X4GA 4Q3CA 4BO1A 1H9BA 1P9LA 5A05A 2QHXA 3WSVA 3DFZA 6LDHA 1NPYA 2CF6A 3GY0A 1XGKA 4CQMB 4PZEA 5U1PA 3WGIA 3P2YA 4DBZA 4Z6KA 4LW8A 5CHEA 4PLWA 3QJ5A 3PLNA 1H6DA 3OIFA 3TSCA 4AJEA 3HADA 2B4TO 4JBGA 3NTRA 1UZNA 2BI7A 3JQ8A 2DUWA 1YONA 1TXGA 2YV1A 1UXKA 4ND4A 1WDLA 3JQAB 4S3MA 4IPTA 4YJFA 2ZB3A 2GR9A 2BFOA 4DMLA 2FZEA 1HXHA 1PS8A 2QW8A 4PZDA 5T6BA 1O8CA 1PS9A 4TRJA 3LT0A 4ND3A 3JYPA 1B8VA 1ADFA 1EEHA 2X22A 3F1LA 3WNVA 5CG2A 4AJNA 3JQCA 1AXEA 5K9ZA 5A9SA 3DHEA 1K2WA 1PS0A 4YQZA 3IDSA 3RFTA 2R00C 1ZCJA 3AOGA 3KSDO 3PQDA 4CMIA 1U5AA 3JYLA 4WNIA 4XD2A 2PWZA 3ZHZA 2YFHA 4WPGA 1RKXA 1GQQA 2H1SA 3ZWWA 2IZ0A 5I7SA 1Z82A 4LVUA 4G81A 1KVUA 4BKQA 1WDKA 3JV7A 3TZKA 3VC7A 1M76A 2VWPA 2DPGA 3E82A 5GZ3A 5L40A 4BNUA 1GU7A 4IDDA 4TRMA 3OBBA 2IXAA 4NJMA 1X0XA 3B70A 1GY8A 3NT5A 4K9DA 5A5FA 1IPFA 2P5YA 4QO7A 2BGMA 3IP1A 4YT4A 1LC3A 2EKLA 3RUFA 2GN4A 3JCZA 2DLDA 1UUFA 4OSOA 4QEDA 2Y1GA 2CDAA 3L9XA 1B14A 1ZXLA 3I5MA 2RCYA 3F47A 4HKTA 4XWYA 1H5QA 4RQUA 2JCXA 4ZU3A 3PYMA 5F5NA 1I8TA 3RCBA 3K73O 1C14A 2AEJA 1KC1A 4BMNA 2A94A 3WLEA 1UZMA 3GRPA 3F4BA 4C7JA 2W2KB 4PIVA 3L9WA 4CLDA 5BSHA 1D1TA 4IQGA 3WQQA 2Q1UA 1P77A 3GNQA 3EDMA 2D2IA 3NRCA 2ZTMA 4YEDA 1HETA 2AMFA 2E4AA 4EUHA 4HADA 1N2SA 2X0NA 1PJ2A 4L4SA 3OJOA 1I3KA 1R37A 1SCUA 3PFFA 2X6TA 3AFNA 2NUAA 3IJRA 4NBRA 3WGTA 4A5OA 2EXXA 3DBVO 2NM0A 3KVOA 5HRUA 1W8DA 4AJHA 3F5QA 1NFQA 2I5PO 4OOEA 3RJ9A 3L0DA 2GF2A 3KV3O 3MOGA 2NACA 1W4ZA 4TQGA 3VVCA 3AUSA 2EF1A 3C7CB 4XIJA 1Y8QB 3ZDFA 2DM6A 1VL0A 2J6IA 4AJ4A 4IIVA 3CIFA 3GGPA 4MVJH 5EERA 1F06A 3ZGYA 1GQYA 1HDRA 3DZIA 4Y67A 2CF5A 4BOYA 1LDNA 2O3JA 3EUWA 5JO0A 3WSWA 5L3ZA 3T4XA 1EVJA 3UKOA 3E5MA 4DMMA 3H8VA 5DBIA 4CM4B 1ZEJA 3UFXA 1DOHA 5CEJA 1YL5A 2ZB8A 4JP3A 4BGVA 3EGOA 4YJGB 5JYEA 4H16A 5TX7A 5I7VA 1I36A 2D1YA 4PLTA 4P38A 2W8ZA 1KVTA 4YCAA 4Z0HO 4B4WA 4B7UA 3MEQA 2NTNA 3FR7A 5L4SA 5ADHA 4HNGA 2NWQA 3EYWA 2OP0A 2EGHA 1ONNA 3H9EO 3NDIA 2HMSA 3KBOA 3DAFA 4E4YA 3IUSA 4HY3A 4CMAA 3AU9A 5JCJA 3W4IA 1BXKA 1KVSA 2VYVD 4OSPA 2H5LA 4B3IA 1PU2A 2UDPA 3LF1A 3ZNNA 1I24A 3JQGA 2B36A 4FJ1A 4RZIA 1RM0A 1ZMTA 2X5OA 4IS2A 5G4KB 3T7CA 3Q3CA 1I30A 4FFMA 2D5AA 3VH2A 1K6JA 1V3VA 1T4DA 1BDBA 1YL7A 3IKVA 1DRWA 1KOLA 4O0LA 3I1JA 4JQCA 2POQX 2I9PA 2EW2A 3W8EA 2PK3A 3QVWA 5JSFA 1ID1A 3ABIA 4IZHA 4BB5A 4LCJA 4WKGA 2PLAA 4Y6RA 1EE2A 5L7YA 3GDOA 1AXGA 3NTOA 4XDZA 4UUOA 4XQCA 3ETGA 3HE3A 3PHLA 4R16A 3RFXA 3V8BA 4WEOA 2PGDA 1HWYA 4GSLA 1H6CA 4FSHA 1KBZA 1NPTO 4R1NA 3BIOA 2B5WA 4PFJA 4RLSA 5B4VA 1A27A 5CFZA 2I65A 1V3TA 3KLMX 4R4JA 5B1YA 1GUZA 1MFZA 3K6JA 5L4NA 2VHXA 2ZTUA 1HDYA 1EZ4A 1AUPA 2NVUA 3K9QO 2V6FA 4J2HA 3U4IA 5B37A 4G65A 5K6AA 2ZJ0A 1GEEA 1O9BA 3K2EA 1P31A 2X8LA 1H94A 5ILGA 3VZRA 3IUPA 4LMRA 2C2XA 4QECA 2VOJA 1KVRA 5F21A 4I5GA 5JDCC 2CNBA 2X9GA 2Z1NA 4D0SA 1H6BA 3GF4A 4P22A 4URFA 2QYTA 8LDHA 3WGYA 3AI3A 2HKIA 1LDMA 5LC1A 1HYGA 1A9ZA 1BG6A 2V6BA 1DC5A 3ON5A 5AYVA 5IJZA 3LDHA 4GKBA 4K6CA 4MKZA 1P1IA 2WD7B 2V6GA 4IS3A 4WECA 3TPCA 4ZGWA 1G0NA 3T7EA 4CV1A 1LLCA 3IJPA 4BNGA 4I1IA 4N5LA 2FR1A 3ORFA 4AJIA 4OXNA 4RVFA 1SOVA 3WGQA 3LT1A 4XYMA 3IKTA 2EG9A 2A9FA 2Y0DA 3CXRA 4E5YA 5JY6A 4K26A 4A10A 3DAGA 3OA0A 4HFNA 1SB9A 2CZCA 4QO8A 1FF9A 1I10A 2O4UX 3JQFA 4FGWA 5JO9A 4ALJA 1GR0A 1RJWA 1HSOA 4XYGA 4JJFA 1DLIA 3CZMA 1Q1NA 4B79A 4D3FA 4F45A 1Q0LA 3ASUA 4MP6A 3GMDA 2VZ9A 4IGFA 3LU1A 3NJ4A 1SC6A 3CUKA 4HX5A 4CUKA 4WUVA 3CINA 4EEXA 3PEFA 5KTKA 1R16A 1LRJA 1YXMA 1PQUA 2HRZA 2VYNA 3JQ8B 3OJ0A 3OSUA 2WEKA 4DPLA 3VTZA 4NBWA 4QX6A 5IF3A 5C5IA 4YJFB 5HA5A 2VHYA 3BMNB 4JN6B 4EGFA 5COBA 1F8FA 2FP4A 1DJNA 4NMHA 3JQAA 3ZU2A 4YTEA 1NBOA 5F5LA 2DTXA 2PZKA 1GFSA 4D45A 4WCFB 2VWGA 1MC5A 3FTNA 3AJRA 2C20A 3BTUA 3TRIA 4DIBA 4D46A 1GUYA 3EHEA 4CLOA 1PJQA 3MWEB 2YDYA 5A9SB 3KRTA 5U9CA 4W9NC 1LSUA 5JBIA 4K6FA 4TZKA 5T8KC 3GH3A 4FOSA 2F00A 1U9JA 4BGEA 1ENZA 1PQPA 3FBGA 2HO5A 2W98A 1MXHA 2Z1MA 3GDFA 1Q0HA 3A06A 3WJAA 3HB4X 1ADCA 3FNEA 4Q3DA 5H83A 4RVUA 2X5KO 5JDCA 4DIFA 5LDHA 3QIVA 3IQDB 3WOHA 1CQIA 3H5RA 1R4MA 4IJWA 3RBVA 4QT0A 2VZ0A 2X9VA 1XWFA 3DZKA 1FK8A 4DUPA 3GOHA 1XA0A 1DIGA 1N7HA 3LLVA 3QW2A 4YAJA 5FI5A 4JK3A 3VH1A 4NJMB 1XYGA 5IXYA 2GCGA 3QV1A 5IXSA 4P4NA 3SX2A 3NEPX 3CH6A 4ZN6A 3OF2A 4BNZA 3FSRA 4A26A 2P68A 2QRKA 4XZ3A 4ZVVA 2O7SA 4JCOA 3E18A 1IOLA 3Q2KA 1MG0A 8ADHA 2EEZA 4MOWA 4Q3EA 2JJYA 3PWZA 2WYUA 1ISMA 1B8PA 3CEAA 3DBHA 4LISA 1EUZA 3ENNA 2Y1FA 3S8MA 1K6XA 1VPDA 1WP4A 3BA1A 3FTPA 1MGOA 3NT4A 4NPCA 4RF5A 4JP2A 4E30A 4WOKA 3DZBA 5AXDA 2HAEA 3FWNA 1PJ4A 3DOJA 5TLSA 1LI4A 5JDIC 3SLGA 1FDWA 4ID9A 2DBZA 4CMBA 1QYWA 4BO6A 4NH4A 3UGKA 2B4QA 2C5AA 3RU7A 1KYQA 3AI2A 2ZQYA 1TT7A 3QRWA 4YWJA 3JD4A 3VVBA 1A9YA 4B4VA 2NSDA 3E8XA 4EITA 2X0RA 3GN2A 3I4CA 4LGVA 5ICMA 4IJVA 2OGUA 2VRCA 1PEDA 5DCYA 2IYOA 1EBUA 2OBNA 2O23A 3F6YA 4FFPA 5ER9A 2GLXA 4BNYA 1DAPA 4MKRA 3DO5A 3ZH2A 3BYZA 1WVGA 3COSA 2WM3A 3I23A 1MX3A 4B7CA 4DYDA 1NYTA 5T8KA 5FF9A 3JQBA 4OO3A 1RYEA 4DPKA 1GDHA 1XSEA 3O38A 4JX8A 1NQAO 2FR0A 3DL2A 1QXSA 1X7DA 3RBZA 5JAZA 4CV0A 4W4TA 2G0TA 5L7WA 4MVJP 1SAYA 3VPSA 4JJGA 1O5IA 2GZ2A 5KVVA 1Y8QA 2D59A 3L6EA 3W4KA 3DTYA 4DC1A 1L7EA 3I9OA 1EUCA 4I9HA 5MGBA 3U3XA 3TF5A 5CEEA 3ICPA 1GPJA 2Y1OA 1FDVA 3KLPX 2AXQA 2FMUA 4PG6A 1YBMA 4PLFA 3HN2A 2GN8A 3LC1O 5DF1A 4AVYA 4E2ZA 1BGVA 3NGLA 3JD1A 2GN6A 2FOIA 3AWDA 3BMOB 1KERA 3H9QA 3QWBA 4CL3A 4CM4A 3SVTA 3W6UA 4CM8B 4UEKA 4ZQGA 1F14A 1T1SA 3Q2IA 5MDHA 3ZU4A 1UXJA 1SNYA 5DCWA 4DTIA 1EVIA 5I7EA 3KYBA 2WDZA 3FCOA 3RASA 3JYOA 4YB8A 3O8QA 2DVMA 1T2CA 2GGSA 2JFFA 2PD6A 4I9UA 3ROKA 4AL4A 3TFOA 5TJHA 2EP5A 2P9GA 3VTFA 3I52A 1D4FA 2YQ5A 2IDZA 4Z0PA 4PRKA 1LUAA 2ZQZA 5BSGA 5AQ1A 2NU7A 3GEDA 4Q3NA 5KWEA 2G1UA 4FR5A 1OC4A 3V2GA 2DC1A 1P0FA 2I66A 4GX1A 1GTMA 1JKFA 1DFIA 1DIAA 2C5EA 4FW8A 4UVGA 3ZW8A 5GMOA 3GUYA 1LDGA 1JU9A 2UVDA 2WYWA 4U6QA 3Q1LA 1ZBQA 3C24A 5TS3A 4FFLA 4MVJG 4U0KA 3PWSA 3D4NA 2PR2A 1H6AA 2J5RA 4GKVA 1I32A 3WIEA 4DLLA 2HLPA 2VT2A 1YQGA 2BMAA 4CQLA 4UVEA 4YRAA 4ZJUA 1VL6A 4XIYA 1CERA 2XXBA 1OOEA 1HRDA 1UH5A 5A5EA 3A9WA 3PJGA 2DU8A 2BHLA 1A72A 4BNVA 2SCUA 1FXSA 3GEGA 4DBVO 2IZZA 3H6KA 4D3SA 4E5NA 1NQTA 1IZ0A 3ONEA 2GO1A 4NNJA 4A27A 3ENKA 3ZWXA 1ZIDA 4E5MA 1HT0A 3FHLA 4WCFC 5KVQA 2Y0EA 5AXAA 4CQMD 4CMHA 1VJ1A 1TLTA 4DYVA 4GX2A 2VHWA 4B7XA 3D1LA 2PA3A 1IB6A 4L9RA 1XEAA 1ZJYA 3HDYA 2DBQA 1SB8A 3WNQA 3H7AA 4QXMA 4YJDA 3U09A 1QV7A 4KDEA 1JDJA 2FPGA 5H81A 5DCUA 1Z7EA 2DFVA 5LCXA 4ALKA 1A71A 1V35A 2RIRA 4BGIA 3GAZA 4BV9A 4DWVA 1ADBA 1PGNA 3HB5X 3QY9A 1HTBA 3G1TA 4OYRA 2AQKA 2HMVA 4MP3A 2W2LD 4OXYA 2OMEA 4BNHA 2XPCA 2NVWA 4RVGA 4LRSB 5FFFA 5L95A 4Z9FA 4Q3AA 4J1QA 2PH3A 4OH1A 1B15A 1E6EA 3RC1A 4BIIA 3ROMA 4BKOA 1R66A 5CDYA 2CSUA 3GK3A 1N1GA 1E3WA 2ZK7A 3WFJA 4YDRA 4BV8A 4CMGA 3I83A 3ZHYA 4DQXA 5I9MA 4RV9A 2ZATA 3FBTA 4RF4A 3TOXA 4JBIA 1MV8A 2EKPA 3BXXA 5I9NA 3E48A 1R0KA 3OFSA 4ALLA 5CG1A 1DIRA 3MCVA 3GAFA 3VPGA 4OXKA 4O6VA 3GVPA 3RKRA 4CM6A 1PX0A 1RPNA 1XU9A 1QYDA 2J5KA 3QVOA 4GVLA 1P33A 1EK6A 3PHGA 1G1AA 1E7QA 1T25A 1CEQA 4GGOA 4J1TA 4OMUA 2CD9A 3G17A 5BNFA 4XGIA 3BMNA 3NTQA 5DOZA 2C82A 1HSZA 1UAGA 3G3EA 4D3DA 4EJMA 5C37A 2J5QA 4CJXA 1ZK2A 1B8UA 2LDXA 4WCFA 4CLOB 4B4UA 3PLRA 5A03A 3DXFA 2O2YA 4ZD6A 4HUJA 4WLNA 5CPFA 1H2BA 2HJSA 1JQBA 2HJRA 2DQ4A 2NV6A 4R9RA 3X2FA 2CVQA 3FPLA 3NV9A 4N54A 1GZ4A 4KTVE 2V7PA 2GERA 3QWAA 5CPBA 4EI2A 1Y8RA 4ALNA 4WEQA 3OEYA 3H2SA 3BTSA 5G0SA 3WXBA 4LN1A 3RU9A 3EK2A 4JIGA 2P5UA 2O3UA 1X7GA 2C7GA 2IE0A 3ETEA 4GLOA 1R4MB 1EFLA 2AEFA 3H5NA 2C54A 1U3VA 4WE3A 1HEUA 5I7FA 1U8FO 4YR9A 2FSVA 1UXHA 5A9RA 3U5TA 2PKQO 2OUIA 2RHRA 1GCOA 4HFMA 3NJ8A 1DEHA 2O3TA 3S1LA 3BAZA 4BNMA 3W8FA 1IUKA 1PJTA 3C3XA 1Z73A 1LSOA 2BI8A 3M6IA 1EK5A 3IIEA 5EESA 1XQ6A 3LT2A 3R6DA 3HDHA 4H3VA 4WLVA 4XQGA 3ROQA 4UVDA 5TC4A 4QUKA 3S2EA 4ONEA 2X7HA 3SC6A 5HWSA 1YQXA 1TI7A 3DBHB 3MJTA 4NU5A 3MJVA 1HKUA 5G0VA 1RM5A 1EVYA 1XELA 1GADO 3GR6A 3KXDA 4IM7A 4AJKA 1T2AA 2VHZA 3JYQA 5FYDA 3EC7A 4MJLA 1M66A 1O89A 2D5CA 3GG9A 3I9NA 4CL8A 2BFPA 4GX5A 1NQ5A 1TT5A 4UEJA 4ALMA 4NFYA 9LDTA 1D3AA 1KIFA 3QWHA 2X86A 4HFJA 5B12A 1HDCA 1G6KA 4FOOA 1M6WA 4XR4A 5ILOA 2EKQA 2BLLA 4MVJE 3I3OA 4YVFA 2Y1DA 4AICA 1Q7GA 3HQ4O 1O0SA 1LEHA 3DZGA 3PGJA 2Q50A 1A4UA 1E1MA 1WLYA 3BTVA 3BHJA 2RH8A 3PYLA 4TZTA 1XIVA 3FNGA 3I9KA 3RUIA 2GN9A 3GZNB 4GH5A 3PI7A 2EWMA 1HF3A 3TL2A 3Q9NA 2NADA 1OI7A 1ENOA 5IN4A 1MUUA 4LMPA 4CLHA 3UW3A 2QG4A 1ZNQO 4J16A 3GVHA 3PHHA 4RF3A 3D7LA 4I5EA 4KTTE 1P1JA 4BVAA 4E32A 4CR6A 1VKNA 1NM5A 5KNLA 4YT2A 4Y6SA 4L76A 3JQEA 1CDOA 3EW7A 3ZZNA 4KMSA 5ES3A 4J90A 2I6TA 2PKQP 4J0FA 4KZPA 3PHIA 4OHUA 4U7WA 2NQ8A 4P8RA 5TT0A 5K6AC 2DKNA 1D8AA 3K30A 4CM9D 3HDQA 3W4JA 1E1KA 1MP0A 3BMOA 3WGHA 1TVEA 4CM8A 3LYLA 3VH4A 1U7HA 4TWRA 1KC3A 3HJAA 2HK9A 3DOCA 3AI1A 3VH3A 1HYEA 3O8QB 1I33A 3Q6IA 1U3UA 2OORA 4MVJD 3STHA 3BZUA 2NU6A 1QORA 3DZJA 2TMGA 4RPGA 4NK5A 5BNIA 4XQ9A 1YB1A 5G0WA 1DC4A 3P7MA 2CMDA 2Q4BA 1DO8A 3OJLA 4XGNA 4UULA 2X58A 2PV7A 4GVXA 3UICA 3RI3A 1NVMB 1ONPA 2CDCA 3DC2A 4CODB 4CM3A 1P1RA 1RM4A 5JAQA 4XQEA 2FR8A 5ITWA 4J4BA 3TN7A 4PG7A 2Y1EA 3LSYA 1NFRA 4MO2A 2J3JA 4BHTA 3VPHA 5F1PA 1C0PA 4CR8A 1ENYA 4WLOA 1CQJA 1EDOA 4TSKA 2QZ9A 2J3IA 3JQFC 4KQWA 5FEUA 5JYDA 2V6MA 3IP3A 5KJEA 3ZW9A 2G17A 1XCBA 3ST7A 4B8ZA 1X15A 5CEFA 3KEOA 2AEMA 5TRTA 4CQLB 3NT2A 2LDBA 2VRBA 4IDCA 3VOSA 2VCYA 1WZIA 3HFSA 1CRWG 3PZRA 3ITKA 1YJ8A 1M2WA 2BF7A 3AOEA 1DFGA 1E7YA 3RWBA 1U28A 2EJVA 5DT9A 4M8SA 4E13A 2PKRA 1IHYA 1LRKA 4NFSA 1H0KA 1GQ2A 1XLTA 3TWOA 2Q3EA 4BO5A 3H9UA 1KY5A 1WMBA 3U62A 3GEMA 3VPXA 1KEVA 3TZQA 1Q0QA 2WSBA 3UHAA 4E6PA 4J9VA 2PD3A 4QQRA 2BELA 1PTJA 3WFIA 1PQWA 1YBVA 1ADGA 3KHUA 5JCXA 4BNLA 5EIOA 1BSVA 1O95A 2P4QA 1E6UA 3DOOA 5IFLA 2EERA 4ZICA 2Y0CA 4FBGA 2GSDA 3O03A 1Y1PA 4O59O 1EBFA 5AVOA 3PQEA 4CM7A 5C7OO 4R69A 3ZWOA 2UUOA 1ISJA 3WX0A 5A06A 1VC2A 4XRRA 3UCFA 3U4HA 4OKNA 1PWXA 1NTOA 2P91A 4GL4A 4FS3A 2ILTA 4NBUA 3GPIA 2C07A 5JAIA 2VOEA 4Y98A 1LLQA 3RC2A 1IE3A 3DZHA 4EUEA 2DBVO 2HDHA 5KIAA 4BKUA 3ANMA 1LDBA 3DHYA 4XB2A 1E3WB 1P1KA 2VWHA 5AXBA 4RQTA 2ZB7A 1YBAA 2Q1SA 1JVBA 5EN4A 2CDBA 3H65A 3U4DA 1R6DA 1DHRA 4LRTB 3EY4A 3H3JA 3IAHA 1C1XA 4PG5A 4F6LA 4FC7A 3GQVA 2Q99A 2VHVA 1U4SA 1J4AA 1D1SA 3HN7A 4GPD1 1DC6A 2BRUA 4OIMA 1JVSA 2OZPA 2TMDA 3PZBA 4XCVA 2YFQA 3ZV4A 2Y1CA 2ZYGA 2HCTA 1IYZA 3MJSA 1ZH8A 3ZWBA 4BKRA 1VSVA 3TQHA 4KP7A 1Y9AA 1IL0A 2YY7A 3VKUA 4I8XA 2YDXA 5JC1A 2BKAA 5KJFA 2FSSA 4CV2A 1C0IA 3JD0A 4E0BA 2HMWA 1Y6JA 1X14A 4FN4A 3JD2A 3DONA 4Q9NA 4Z0TA 3WBFA 4BMVA 1JWBB 1EQUA 3LF2A 5TIIA 4DQVA 2JD1A 3GPDG 4A2CA 2UAGA 3JQBC 1B7GO 4CLRB 2XOXA 4JLWA 2E82A 4W7IA 1HE5A 3NDJA 1Y8RB 2J3HA 3BMQB 5TF4A 2P9CA 2Q1TA 4B8WA 1AGNA 3JYNA 4L74A 1HDXA 3AY6A 4GMGA 4XA8A 4CUZA 1RWBA 2Q2QA 5DBFA 5A4DA 2FY8A 1PJCA 3NUGA 1JLLA 4PLHA 3NGXA 1HZJA 3QP9A 3G79A 4PVCA 4IQ8A 3JQ9A 3GLQA 1I2ZA 2YV3A 5EQFA 3TOZA 5CP8A 3EAGA 1E3JA 3B1KA 3QVXA 2DPHA 5ER6A 1N92A 2EIHA 4OOFA 4WASA 2WE8A 4XB1A 5ENDA 1PZEA 2DBRA 1DXYA 3PJDA 2X5JO 4O63O 1AE1A 5IDYA 2YW9A 4ZQFA 4RJTA 3Q9UA 1V6AA 3AY7A 2HMTA 1W0CA 3CKYA 5H82A 3M1LA 3A28A 2VT3A 3OJFA 3PYXA 1PL7A 2VZ8A 3JQ6A 1F12A 1KEPA 4E21A 3VDRA 4C7KA 3LT4A 1JW9B 1WDMA 4RPLA 4G2NA 4J49A 2PH5A 1U4OA 1TT5B 2EP7A 2IODA 1MXFA 5LDGA 2WE7A 3GZ4A 3PJFA 4E3ZA 1B26A 5ICSA 4GAEA 2P9EA 1PJSA 1H2HA 5DOVA 3R1IA 1LXCA 2UUPA 1OBFO 4GGPA 2JHGA 1ZUD1 1DIHA 4JXKA 3UN1A 4PLYA 1NHWA 1GZ6A 2R2GA 5JCJD 2JL1A 2D4AA 1N5DA 1PZFA 1YVEI 3L6OO 1P3DA 3GZNA 4R41A 1WXDA 4DQUA 4NDNE 3PVZA 5L7TA 4H7PA 3RJ5A 1K6IA 2UYYA 3U49A 2FRDA 3K96A 4R1SA 1IULA 3WGOA 3FPCA 3LC7O 4I5FA 1ENPA 4FFRA 4INAA 4R9SA 3TZ6A 5KKAA 2RBEA 4OL9A 1D7OA 3VZSA 3B6ZA 4CV3A 2IEBA 4OKIA 3AK4A 1JKJA 3C1TA 2JD0A 5COAA 4CR7A 3D4OA 3OIDA 3OM9A 4M87A 2FWMX 3K8ZA 4PGFA 3JD3A 1HDGO 3WJ7A 4BKPA 4WGGA 4BO8A 3WMXA 1BMDA 1PIWA 4YRBA 3E9MA 1P1HA 1GYRA 3DR3A 1QG6A 3SXPA 5DN9A 2ZCVA 4QFDA 1EUDA 1LC0A 2H9IA 1R0SA 5TNXA 1ZVMA 4NBVA 4Y6PA 4RF2A 3BMCB 3GVCA 1BHSA 2B4RO 2GNAA 4IJUA 1Z6ZA 3DAPA 5DULA 3TZCA 3UVEA 5L53A 1Z7BA 1X1EA 4E33A 3ZNQA 3HG7A 4CM1A 4CLXA 3KOUA 3KUXA 5C3MA 4B4OA 2AG5A 3EMKA 2JFHA 2V65A 4RVSA 1DAOA 1MG5A 1CF2O 1YH3A 3WTCA 1QKIA 3RSHA 3WQSB 2QRJA 5KJ1A 2NVBA 2GPTA 2A92A 4QSMA 1XU7A 1HZZA 2Y05A 4RORA 4IDAA 3CTMA 4D44A 2PD4A 4MVJI 4RCVA 3AM5A 3TDKA 4IINA 3RD5A 2RHCA 1VKOA 3WWYA 1GEGA 1IY8A 3S2IA 3H5AA 4DLAA 3HDJA 1YJQA 3DBRA 4YJHA 4WLFA 2Q4EA 3NYWA 1O94A 1B16A 1R15A 3UOGA 3WYCA 2BGLA 3PIIA 4KUGA 5G4LA 3GNTA 4NBTA
chains in the Genus database with same CATH superfamily
2AQ8A 2OOSA 3HCNA 3MMNA 1ZD8A 1MABA 3DWGA 1O6ZA 3DUFB 4K40A 2HRBA 4UQOA 3PGLA 1L5HB 1V96A 1ZUNA 2GNOA 4I55B 1NULA 3RKUA 2TMYA 1Q7BA 3VZQA 1Z35A 1VJ0A 4IQ4A 3DULA 4OLFA 4ZDKA 4OSOA 4YJ2B 2G71A 3MGGA 1CRQA 3AT1A 1A88A 2EGGA 4RBNA 3RVPA 4EG6A 1WCIB 1XEWY 3GLGE 2YVUA 4OL0A 3DB2A 3IMEA 4XGKA 2XCRB 1JN0A 2JGDA 4ZZ1A 1M2NA 2WDPA 1GV0A 3OMLA 3T1QA 2X4DA 4LKRA 4ENQA 1WSAA 3PQ2A 1AZTA 3TXAA 2CFCA 1SC4A 3JTEA 1Y7TA 3TCKA 4EUSA 2O0KA 2MINA 1E2DA 4ESOA 3OQPA 1RXEA 4GDMA 3IFSA 2NXEA 2Q5JA 3E8SA 4D56A 3IAS1 1UC8A 2RH4A 4AF7A 3RUAA 2H16A 1AN0A 2R6FA 3FWHA 2IGBA 2Y3IA 3ADPA 4JUCA 3V8PA 3C5WP 3USCS 3T5CA 1P39A 1JKMA 1RMYA 2BHSA 3LO8A 1FDOA 3NOVA 3QLUA 2IYSA 1OBCA 1GL9B 1Z16A 4TKUB 2FN9A 1DJMA 2VYND 3C5CA 3VHRA 2BD0A 3B9QA 5DCLA 2YWCA 2HI0A 3GUVA 3K6SB 4ZA2A 1NW6A 1P8AA 4OM7A 2DGDA 1NDUA 1QTRA 1ZLXA 3JQAD 3QUTA 5E9QA 2EV9A 3EF1A 2YWEA 3T41A 3N7UA 1CRPA 2A0WA 1MB2A 1VJDA 5DNAA 4X45A 2Y2VA 4WNCA 1FDSA 2OV3A 2X2FA 4L4ZA 2P6MA 3MCUA 5JXIA 3Q4GA 2O50A 4R8KA 2YXDA 3PTZA 4URXR 3QKSB 3L4JA 5HW0A 1GLGA 3U26A 2VA9A 3G0CA 2LIVA 3MERA 1VSTA 2VJCA 1MX1A 2X6QA 5DHQA 2B82A 2GXSA 3LX6A 2H5JA 1WULS 3DWFA 1O54A 1YS9A 4KE8A 1JI3A 3X1DA 4NV0A 3HU2A 1RP7A 1YZTA 2A9RA 2PIDA 4JOSA 5B3AA 3L93A 2JW5A 4EJSC 4GXQA 4ETNA 3KETA 1XQ9A 3HWRA 3KVNA 1RBZA 1OTYA 2VDKB 4P34A 3G59A 5EQJB 4KGVA 2OE2A 5F78A 1QQ6A 4IHJF 4HDKA 4YA6A 5IJ0B 2OYRA 3TUZC 1G2QA 1LBEA 2PGXA 4LDNA 5G0UA 3KAJA 4GMFA 4RL6A 1VSUA 1UEXC 1XHLA 3UTCA 3KEMA 4OGWA 4LPKA 2CXPA 3AR4A 1OAOC 4H1HA 1MZVA 4J0QA 4WOCA 1JAZA 3TJRA 2JGKA 5FWNA 5LMUB 5EQDA 4J76A 3SHQA 1A9PA 1NV9A 4YQYA 3HBAA 4MHOA 4EGAA 3BL5A 3N6XA 4YJ3A 3RPEA 5CBKA 5GVSA 1PGJA 3UPTA 6NULA 2VPWA 1ZXBA 3L4BC 3VC1A 4JYMA 2DB3A 3E4DA 1J99A 5G1NA 2VF8A 2YZ2A 2AOWA 3NXKA 1VJ5A 3FYUA 1HORA 3HKEB 2NXJA 5JSZB 5DSTA 3ZGVA 4AY6A 4A8JA 1W35A 1X9GA 4NU6A 4IHJA 2CBXA 1L5NA 5TY0A 4BS9A 2P1RA 1UWCA 2WJPA 2IH4A 4B6FA 3SZMA 2CE2X 1R0ZA 4B0OA 621PA 3S1SA 4J7AA 4MW6A 1W73A 4IRMA 3ZJUA 1NRIA 4Q1VA 1BW9A 1E79A 2AZDA 3RAGA 1J0EA 2CNDA 3QBTA 4LCEA 1WAMA 4R1LA 1CUEA 4XDHA 4AJOA 4NHEA 4RGBA 4BLRA 2PSEA 4DA9A 2C2YA 5BO5A 4INOA 4QPZA 4D9JA 5L51A 5E9JA 4ML3A 3HJGA 2W70A 5JVDB 4MPPA 1P3Y1 4IGIA 3PI6A 5AOCA 2IP1A 3AIKA 3LHSA 2WLTA 4Q4LA 2GPBA 3RRBA 4CL0A 1ORRA 2FZWA 3RRNA 2RGGA 2YWJA 1VL8A 1M72A 5IHPA 3A6HA 3VZPA 4B3RB 4Z9YA 3ZXYA 4MGZR 1G5IA 2EWVA 3M9XA 1DG3A 2VA8A 2X19A 1X1TA 2Y6UA 1NVVQ 4X66B 1M75A 1P18A 2GDJA 4GD3Q 1VGQA 3QVMA 1L5KA 5AP9A 3TBFA 1ZFNA 1CLUA 4DA8A 4E2WA 4EPWA 1JAYA 4FCVA 4B6JA 4CYMA 3SZOA 4FYXA 4A6EA 2FSFA 4UVHA 2D62A 2IOQA 3DV2A 4QPPA 3FNHA 5U4XA 3T7DA 1W85A 1XK6A 2BF4A 1JEAA 4U9HS 3U4CA 1G3IA 1KK2A 1T36A 5JFGA 1GLVA 1DTWB 1P4GA 3CF4A 2AFIA 4EJFA 3GBVA 1NURA 2ODBA 2YWGA 3O91A 3U37A 3QVSA 4KE6A 3WL5A 2IYVA 3KT0A 5FO0A 4RHUA 3ZBPA 3JSAA 3LTEA 4CEIA 4DV6B 2OEPA 1EDZA 1W49A 2QZSA 2YXEA 3H9JA 2Q4RA 1W0KD 4FQ8A 4PZYA 1WBJB 2FN7A 2O2ZA 3VPFA 1WDWB 2F8SA 2F1IA 3OMXA 3I61A 1BCSB 3DEJA 2JGRA 4LVCA 4MS1A 4XE5A 3ZWAA 2G9ZA 5BNZA 4ZOLF 4Y6GB 3C0KA 3PGXA 5CNMA 1CS4C 1GYQA 2DUNA 2YVQA 1B0UA 3OCUA 4EG0A 1V37A 1S3IA 2R7KA 3PPYA 4EGQA 1YU9A 2FF7A 4Q7MB 1Z5WA 5TQVA 1OFHA 2I6FA 3E9QA 3KZKA 4URYR 1XRJA 3H13A 1JDSA 4GP9A 3RIXA 4AJPA 1C3OB 4LHWA 1X8XA 2CL5A 3ANNA 2J7PD 3OD5A 2ZUEA 1ZO8A 1CQPA 1FS4A 1QAOA 3L6DA 4PPYA 3T34A 2WYVA 4DJDC 1FFXB 1M0WA 1BXGB 1P44A 1XRQA 1UMCA 3N76A 2HHCA 2CZQA 2NX2A 1PKEA 1R0WA 4RJKA 3DFUA 1JI0A 4YGYA 1YQWA 2IW1A 3I9MA 3QHAA 3PA6A 1MQAA 5E6RB 3BPSA 3U3KA 3NBAA 1PJ8A 2DT5A 1TM3E 3CSSA 2FYTA 1E1CA 3V3TA 4MP8A 1WB9A 1Z5VA 1PVVA 3SSOA 3UK0A 3BRWA 4IXNA 4ZOLA 3KDAA 2YV2A 4BFCA 4L3VA 2FEWB 2GCPA 1E1DA 1NBHA 1LDYA 2D7CA 3BXFA 4JA0A 2OK7A 4AMGA 5EG5A 4KXFB 5AKYA 2Z08A 1TTHA 3ABOB 4N49A 1TL7C 3TXYA 5HM6A 3HPQA 2PH7A 5BSTA 2VDWA 3EVFA 4C87A 4KYUA 3IVGA 2DPYA 3F6SA 3T4PA 2P8JA 1EGMB 1JKJB 3WAJA 5D51S 4YRNA 2O3SA 1CDDA 3ZOZA 1F6BA 1UANA 1TPZA 1Q14A 1UJBA 1KJ9A 2W6MA 3EEFA 3HR7A 4FGJA 3HXQA 4ND6A 1J06A 3KE9A 4G86A 2NMVA 1VI2A 3L7OA 3EZ7A 3WL7A 3HFGA 1VIMA 1OX4B 2B69A 4FQ7A 2QRLA 3H1GA 3IB6A 3T61A 2GAJA 3BJIC 3AW9A 2YWRA 4GMHA 4J8PA 1GTZA 4GUDA 4YRLA 2PUGA 2IS4A 2IYZA 1FFEA 2R00A 3F98A 4H3KB 4ROSA 1SBYA 2FPIA 2X0IA 2B9EA 1NMQA 1TK2A 4JA2A 5H9VA 2YC4C 1I6WA 2IL1A 5ALLA 2ERCA 4KC0A 5BUZA 1QBGA 2H4FA 4ND1A 4C2AA 3IVMA 5DNUA 1O5OA 5AR1A 1BMTA 1F8GA 4AS1A 1N7JA 3OWOA 1NF8A 3HHPA 4YUVA 1NF2A 3CLKA 4ZCSA 1Q15A 2A2ZA 3AWIA 3QTBA 4MWBA 4NKRA 2IIQA 1ZC3A 2IGTA 3GGOA 4JYCA 1JMKC 2Y92A 2Q62A 1Y8ZA 2ZB4A 3MGBA 1BTOA 1YRBA 3D7RA 5KI6A 4DAEA 4LI0A 1X8LA 1CJCA 4FCCA 5HQ3B 4LPSA 3FSGA 4WBSA 2O19A 3H2ZA 2WUWE 3GV0A 2I1QA 4FFOA 4KO3S 5CVVA 3SK0A 4FHEA 1ZH4A 2NYAA 2AOTA 4CGYA 3LPDA 5ALHA 3A1UA 2ZTVA 1NVEA 4IDFA 4OB6A 1NMSA 2BEKA 2WIKA 1UBHS 4PZ9A 1G19A 2F4NA 1RLUA 3L7CA 3MB8A 1GFIA 3PX2A 2P9HA 3DZFA 3NVAA 1YOBA 3WB9A 2ID7A 1EFRA 2YIMA 1VE6A 4HQFA 1PBTA 4TRRA 2ZXUA 1K5DA 3QUBA 4LIPD 1G8MA 3NOXA 1MABB 1P19A 1O2DA 4ZANA 3PF9A 3EEBA 3D3WB 4KMMA 1ZUNB 1SGWA 1U7XA 3AFOA 1KGSA 1LK7A 3BXEA 1BDMA 1GQOA 4M9CA 3ZU3A 4O4LB 4HBGA 1UJMA 4B3FX 2JHCA 3O4JA 5EHGA 4RKEA 2OL4A 1SELA 2YHIA 3AF4A 4BVJA 3UCEA 3AZOA 3B6JA 4RQAA 2H59A 2PTGA 1PFYA 4GRDA 2ZSUA 3LP8A 4E15A 4ROTA 3NAQA 5KNBD 2I4LA 4JODA 3KTOA 2ODAA 4ZAGA 4QU5A 4EG3A 2J9FA 3BWYA 1ISIA 3TZHA 4D57A 1ISFA 2MINB 3HZZA 2GCNA 4PX5A 5IT4A 2FSUA 4I81A 4DREA 4JITA 4EEZA 5HS6A 1W47A 2P2GA 1UXIA 2BDEA 3M7IA 4JQSA 4B47A 3BGIA 3KZCA 1VKZA 1ZAKA 3KIPA 3K2IA 2BMDA 4DS3A 2QTNA 4OGFA 2JAPA 3C7AA 5SYAA 5TB5A 2IS2A 2G9UA 4FFNA 1N9GA 2OP1A 2XQJA 1CY2A 2XUGA 1EWVA 1E6MA 4XFDA 3N07A 3UV3A 4YYEA 1PV4A 1JJ7A 3INTA 3SVLA 2QGNA 3BHMA 5F2NA 2Z0MA 3F3YA 4W99A 1U6IA 3A05A 1IM2A 1IVYA 2XUPA 4O1MA 5TQ0A 4TT3A 4RV5A 3C1AA 5U4QA 1E2KA 4HXGA 4Y7CA 3KK0A 2QX6A 1K5HA 3QV2A 4LXUA 3PFIA 4BGUA 2NQ2C 4N18A 4ZOAA 3ZWYA 5J4VA 3PIRA 3UMYA 3E5NA 4JOBA 3ZIAA 1NW8A 4XB6B 2D1RA 2FFJA 2JZNA 1VIAA 1UCFA 2R6R1 2FK7A 4B7AA 1NVTA 1TMKA 3U7JA 4YACA 1V8BA 2JAWA 1O4VA 2VS1A 3CLVA 1PJ3A 2IZOA 1W4AA 5HP4A 4FWBA 1NHGA 1DWOA 3UMBA 1PGPA 3BK1A 1JQLB 1E89A 4RXMA 3LBYA 3ZE6A 1C0EA 4AKEA 4OQFA 1AUXA 1PFKA 3K8YA 3FFXA 4FU0A 3MGAA 5G53C 4IY1A 2JRCA 3BS4A 4HVLA 5BR7A 4NIMA 1Q50A 4PCLA 2BJHA 2XUOA 3PPIA 4HDKB 2ZETA 1OFIA 3KT8A 4KPGA 5CK5A 1Z75A 5BW6B 3TUJC 3PFGA 3A9CA 3GJZA 3I42A 2WT8A 3AX6A 3DS8A 1KH3A 2WHEA 5A02A 2XA1A 2OCKA 1GUFA 2VQFB 1E92A 3CPSA 3L84A 4LKOA 5GIOE 1IJBA 5TT1A 3A4VA 1P0CA 1X8JA 2Y66A 1K98A 3E23A 2V0GA 3WGVA 4N7BA 4H0FA 4J29A 2ZTHA 4Q9IA 4YJ3B 2JGJA 2QNRA 1T29A 1YMQA 4IX1A 2EC5A 4Y9TA 3ITNA 4HC4A 2OA0A 5THQA 4QAJA 4XPIA 4D9FA 4EW6A 4G1FA 2JAQA 3CU5A 3P9NA 3FYUB 4EVRA 1N32B 4XWAA 2X7XA 1XF1A 4UUNA 3F4LA 4Y7DA 1CUZA 3KXKA 1PTKA 3LAWA 4WXMA 4UZSA 4A8JB 5HKAA 1S3FA 2JFYA 2JVJA 4NYJQ 3GOQA 1Y7PA 1DMRA 4BJ1A 3WLMA 5JNUA 2Z9BA 4PYJA 5I8WA 4PAQA 3RFCA 1NX6A 1A4IA 2QQ5A 2ZRDA 2VSNA 3ZY5A 5JS6A 1BW9B 1XRMA 4ZQEA 4GWGA 4Q6WA 3HUDA 4UM5A 4YMIA 2NSJA 4R68A 2CC2A 5FCDA 5FNVB 4CQMA 5INTA 4C7OA 1RZUA 1D07A 4J3JA 1J42A 3RUCA 4RPKA 4BO7A 2YYAA 5JTUA 1U8UA 4IBOA 4KQHA 4QGHA 1A96A 1E4VA 1PP4A 1GGFA 3GT7A 3PJEA 4HWSA 1NKTA 1UQUA 1XZHA 4RADA 5DW0A 4BMCA 3FPBA 3SJUA 3VHQA 1FJGB 2RB4A 4NS4A 5AW9A 3WRYC 2IEZA 2NNLD 3GRAA 1JNXX 1CJTC 1YJAA 3K5IA 3K72B 3O83A 4G8DA 4RSHA 1MNAA 3R0IA 3TAXA 3WGZA 1J70A 3WP1B 3JASB 3FN4A 1KWGA 5DP1A 2WWTA 1IH8A 4M0PA 4EZBA 2ACVA 4YMLA 5I7WA 1TJ4A 1G8HA 3NANA 2XB4A 2XSZD 3DAOA 3GRYA 1P5FA 5DP2A 2B94A 5E4FA 4FWTA 4DHWA 2W83A 4XEHA 5AKLA 1WHSB 3KTDA 3THYA 5EYPB 3TE6A 4RCYA 1ODFA 1PGQA 3A3PA 3P5BA 1RE0A 5CDUA 1EUQA 1EA5A 2OGWA 4PS0A 3WLSA 2CVPA 1HEYA 1NUPA 3BRCA 3HSYA 3KEFA 5FOTA 4C7VA 1G6OA 1OY1A 1W85B 2ZJZA 1UWKA 3Q6MA 4TLEA 1AKTA 4CMIB 5M04A 2OILA 1VTKA 4JROA 3FOFC 3K92A 1T36B 1VPVA 4B3TB 4HN9A 5DNYB 1GZ3A 1QGOA 1M6HA 1XVAA 2AFIB 1ARZA 1FTWA 3GFVA 2LWIA 5EMLA 5EVJA 3W5SA 5KTMA 5D1NA 1Z5ZA 1HR0B 3O84A 1NQUA 4K6KA 3HCAA 2NQTA 3WYGA 5LBUA 3ZDCA 3ND7A 1TF2A 1VI6A 1DQNA 1XXHA 1VFPA 3AR2A 4KGXA 4U6SA 2C1XA 4G9GA 4J2TA 2R44A 2QN1A 3N74A 4QUJA 4UDXX 2GXQA 3SDBA 2BH9A 3X1MA 5HZGA 5HG0A 4KO8A 5HJ2A 3LY7A 3QI2A 3KPVA 1XMOB 4K0KB 4YMWA 4KHZA 2QVLA 3PIDA 3U5ZB 3UGJA 4MS1B 1WX1A 4UUAA 1LJ8A 3JPWA 1BWSA 3V1YA 4GLBA 4S05A 3AI7A 5C1BA 4HZGA 2PMDA 3BD7A 4JL8A 1GTVA 3OIYA 1OZAA 2PS1A 4KX5A 5A0FA 2QTZA 2VTEA 4DBLC 1SBNE 3GFGA 1WSBA 1YRHA 1UJ2A 3L1KA 3PP8A 1DARA 5ENVA 4NXNB 1L1FA 4IILA 3N8HA 1U2PA 1N1EA 2H4ZA 5JNSA 1N1DA 2EBUA 1SUAA 2V5AA 3CPJB 3IDQA 4TTAA 4LOAA 3CQ9A 3X1ZA 4DNQA 1UMCB 5DM0A 4EGSA 3AINA 4F3YA 5A6SA 1WB4A 2QD1A 5B7QA 4IZIA 3ORQA 1HDZA 1ZD3A 2WD9A 1G66A 3WGGA 1DS6A 1Z37A 3MCWA 3WKAA 1V7ZA 2FNAA 2YJZA 3DXYA 2X9QA 4W82A 4D4LA 9ATCA 1C2YA 5DBGA 2C2HA 2IYPA 1A82A 3NWJA 4FP9A 5IC5A 3TSAA 4BQRA 1ZJZA 3EQ9A 4F6CA 2UU9B 2I87A 2G9VA 3P0IA 4WOBA 2YV4A 1U0FA 4NU8X 1DBPA 3GDWA 2PSDA 2AIRA 2Y27A 2XRMA 1T2NA 1DELA 1YZVA 3IS3A 1OIXA 2OY0A 3EIUA 4HRYA 2Q7DA 5HQTA 2HPHA 1WUYA 2Y77A 1NXQA 2ZBVA 4X60A 3MTGA 5JJIA 2FVXA 5J4KA 4LSMA 1VQ1A 1MQ8B 1E3QA 4HEA1 1NAIA 4MI9A 1KDZA 3ZGNA 4PN3A 3HM9A 4AKHA 2XCOA 3MCAA 3E9EA 5D5HA 1NI5A 1ZLYA 2CB9A 4KXLA 4CM5A 5C1OA 1G5HA 3ER8A 4BLPA 2AJLI 1DQZA 1NXXA 3SEFA 3VUEA 1QH0A 2PZLA 4FNAA 3ZZ0A 2HR1A 2XE7A 1WNTA 1II8A 3DOEA 3O4GA 3OEWA 1F8XA 3Q7EA 4RC9A 1Z17A 4S1OA 4YXFA 7MDHA 3RRYA 2QMZA 1W6UA 3I9FA 2WQ6A 4WZBA 1AURA 3U9LA 1WU8A 1UQTA 3WADA 3WZ2A 4C88A 2OR3A 3R5XA 1JAHA 2P2SA 1NNUA 3HCBA 4NCIA 1G6Q1 3FDIA 3H4MA 1FRNA 2JI7A 4BNKA 4B2YA 1XR3A 5THXA 5KNCH 1USWA 4P7GA 3V7NA 2YZ7A 4I6JA 4GKKB 1MOZA 2W6ZA 3GC6A 4IMRA 4OQQA 3ZXUB 3ULKA 1E5LA 1K92A 5JNTA 2FSPA 2NAFA 2PNFA 3R5TA 5JQGF 2C3PA 4ZTUB 2A35A 4HGPA 5A0TA 1E1NA 1E7WA 3F5DA 4ZOQI 4HN4B 2WBLC 4FLFA 3ZGZA 4LOIA 1JR2A 4D7AA 1UXGA 1QKJA 1W1IA 1NAHA 3W1EA 4PPFA 1NDHA 5EPOA 2AF3C 3ZKWA 4FC6A 4CLEA 3B1JA 2C9ZA 5IS2A 3MTJA 1QX3A 2ZRJA 1DADA 2QT1A 3A14A 1I0ZA 1DNPA 2EBHX 4HNRA 4V2UA 4RTLA 4OX9B 4LSWA 1QRRA 3UFXB 4DVJA 1A8SA 3M4XA 1G41A 3B1FA 2H85A 3PNBA 5EIHA 1KEEB 2AOTB 2HGZA 3KJHA 3WDSA 5C51B 5HBGA 1P72A 3CLTC 2QJFA 1ZNZA 1J23A 2B20A 3ZHTA 5GM1A 5A3SA 1V1MA 1XBTA 4KBYA 4M9XA 4BFZA 3WIDA 1J7KA 3HCRA 3NFRA 2E4VA 3EPHA 5JQGA 1Y4DE 4LS3A 3WG9A 1KORA 3HV0A 1LLUA 4TMFA 1MKYA 2GBFA 3ZIAD 3HA3A 4C7XA 4DLWA 5HTOA 2UV8A 5AUOB 4M99A 2QSUA 2GEFA 3G2MA 4JFAA 5DYIA 3MMSA 3UUWA 3VA7A 3FCCA 2WNHA 1DO0A 5FEMA 5EJ2A 3ORRA 3ESXA 1HQCA 4X71A 3HJFA 4H9GA 1XCOA 4ZYZA 1JT9A 1UT5A 3U2QA 4UM9B 2H3EA 2AX4A 3JQGB 3D3KA 5BYBA 4BLOA 2W6IA 2WF8A 2QTVA 1L4UA 2FPPA 4I9NA 4U6NA 5F2KA 1AJEA 1OH5A 2H5EA 1Y9EA 4RH1A 3SYTA 3C85A 3HNPA 4P82A 4PBSA 4TWBA 1V7QA 3F73A 5G4KA 3VHXA 2B35A 3CONA 5JXWA 1VSQA 3D8RA 2XMCA 4H18A 4RTOA 4EY5A 1R18A 4Q93A 4FGSA 2VDMB 5BN1A 1AZLA 4H6VA 2N0SA 4E2XA 3WZMA 5F7OA 2XZOA 3GJ8A 1BXZA 5TV2A 3UJHA 4QBGB 3ZTTA 2ONJA 2ATVA 3IRUA 1DHTA 1YQ9A 2FUEA 3G6WA 4PLPA 4YH1A 5FBWB 5T57A 3K9WA 1R0BA 2WPDD 2YUTA 3AKEA 3KJNA 2IHBA 3H8SA 3N58A 1D04A 2IYLD 3EQ7A 4POAA 4A0HA 2VCHA 4E31A 1E7MA 2XV1A 4MUIA 3LWBA 5KU7A 1PSDA 3IAS6 5FWAA 3W5IA 1FUIA 2WUFA 1GN8A 3MJEA 3QZUA 4BMPB 3LZDA 5EUBA 2CLKB 1EX1A 2EJWA 2X23A 1G3MA 1HM5A 2ADFA 3ADBA 1GZHB 2VN8A 3OQIB 3IEIA 5SYMA 1D6JA 2OCDA 3DLPX 4XKJA 2K7ZA 1QVRA 3OZXA 4RA6A 1V5FA 2ZE7A 5JFOA 1P45A 2DH6A 2DSNA 4XGRA 3G5MA 3GMSA 4KR7A 4ZT5A 1QLWA 2HCRA 3WNZA 4II2A 2Q49A 1DBRA 2XMRA 4NTZA 3WMGA 4D9MA 5G1OA 1QE0A 4PSCA 3ORSA 2X1HA 4F06A 5IABA 4RGVA 2PGIA 3D1JA 1MNQA 2NP6A 1Z0DA 5JAMA 2AYXA 3B3AA 3ESRA 3GVIA 3IIKA 3RYHB 2C9CA 3KQHA 4ZVRA 2R68A 3IAEA 5EMHA 2O6HA 1YFKA 3AY3A 3N2LA 1AT1A 1CIJA 1MTOA 5E6SB 2HSDA 3FPJA 5J59A 2WJ6A 1U94A 3NBFA 3D7MA 3HSKA 1FFBA 1Y42X 1CZHA 2CXXA 1IRIA 4L4XA 2M2IA 5EE3A 5GONF 3RBXA 5AVQA 4GRAA 5FTKA 5DHFA 4N8SA 4JMPA 3G68A 1E0AA 1ULUA 4EHLA 2BDUA 1E9SA 4WMLA 3WY9A 1CUFA 1C4OA 1VLVA 3QLJA 4JKIA 5AJXA 3PDJA 5KVCA 3O5AA 4G89A 3G7UA 2XKBA 3KB1A 4B8YA 1ZA1A 4D4HA 1IPEA 3O9ZA 2VFAA 4NCHA 3EULA 3MIZA 3ZXXA 2WD7A 1G21E 3D54D 3N2EA 2XAUA 4EBFA 7AT1A 4RIIA 4LBVA 5DHUA 4W5OA 4YP1A 3TNLA 3QWFA 3TH5A 4I1PA 4BLTA 3KOMA 5DYWA 3F5FA 5E3JA 1TTQB 4MRSA 4RIFA 2AC4A 2DAPA 1DOZA 1L4EA 2FE1A 2WP8J 4JL5A 4RE5A 1CVLA 1U3TA 4UEOA 4X1KA 5FBZA 3UAYA 1HLDA 5HFNA 2PGJA 4WERA 2C4VA 2PBRA 3BWCA 4Q47A 1S8NA 4UTRA 5HCNA 1K27A 1OV6A 4GHWA 5THKA 3PHJA 3C14C 5IKXA 4YN3A 1SR8A 2QZJA 3HHEA 4M0LA 2QV7A 3RNLA 4EUNA 1GGHA 2RK6A 5ELLA 1F3LA 2CK3A 1KA9H 4DLRA 4G63A 3GGJA 1Y4ZA 4IIYA 2VPIA 2J6CA 3CNBA 4Q0MA 4F5WA 4WZAE 4CQMB 2W2NA 3OE7D 3OLYA 4Z6KA 4DBZA 5KBYA 4LW8A 3HVIA 4WA7A 5CHEA 3TAHA 4XTRA 5ELXA 3ZD7A 1W4CA 1UK9A 2BAGA 1REQA 2HZBA 3ZLBA 4PLWA 2R0QC 2BFFA 3GPCA 4F96A 4D1YA 1TA0A 1UC9A 4JBGA 5CX1A 1YTLA 2XB2A 2MYTA 3CF4G 4EHNA 2WG0A 3FZNA 4ZDJA 5IKEA 3ZDAA 2DUWA 2V1UA 2I55A 3OMWA 4LRXA 1C7EA 1TXGA 3C3WA 1UXKA 4IFIA 4ND4A 4XUCA 4C78A 1FLDA 3IP9A 3C3BA 2GR9A 2BFOA 3EZGA 3TTSA 2FZEA 1HXHA 4G0ZA 4JEHA 4EX7A 5T6BA 1OLSB 1P4JA 1PS9A 3NNNA 4FVTA 2P75A 1ODSA 2A9KA 4N03A 3C6QA 4HUTA 1ZICA 4UDYX 2Q5FA 3CB4A 3GCXA 1B8VA 1ADFA 1TF5A 2X22A 3F1LA 3IHWA 1CFJA 4MQMA 4R40A 4Y6OA 2XT9A 3SF0A 3UZUA 1W5BA 3VR2A 3ZCRA 4AJNA 1Q1ZA 2MSLA 1AXEA 3MT0A 3QPAA 3UJ6A 5K9ZA 5CLHA 5A9SA 4OHWA 1K2WA 1PR2A 4RENA 3VXKA 6GPBA 2WV9A 4J0JA 4IJ6A 1U2DC 4X8OA 3R7AA 1WU7A 5DWVA 4YLYA 1ZCJA 5A4IS 1QZ3A 3WRXC 1SC3A 5IVHA 4MB0A 1ABEA 2IPLA 5FLYA 5H59A 3D31A 5BXQC 3D7NA 4UMFA 2FSIA 4PO9A 1ITZA 2IYEA 2QTCA 1CQIB 3C3YA 1BCRB 3GGSA 1TU3A 4WPGA 2H1SA 1L6IA 5F76A 1C4KA 1QG2A 4XSVA 4P3NA 4QKQA 2V7GA 4CQNA 4LVUA 2P62A 3KVVA 1CE8A 1XYVA 2Z2XA 1KVUA 2PAAA 3TW8A 4A15A 2EX1A 4TMYA 2FX5A 3TCXB 4G1UC 2H07A 4JOQA 3VC7A 1T13A 3E82A 4NZNA 1L5LA 4HDOB 3W2EA 1V16A 4OO3A 1GU7A 1NUHA 2PWBA 3EA5A 1HI9A 5HIJA 2CL6X 3JWHA 3FZQA 2MR5A 2V7UA 3GFSA 3I6BA 1LV7A 2JDIA 3NT5A 2E1RA 4JBXA 3T5MA 2SNIE 2JLVA 2P5YA 3M34A 3DE4X 1H2RS 1BX1A 3JARA 5B58C 4KIGA 3RTCA 2GN4A 2IU0A 3ZY4A 2PUEA 1XMIA 1LWOA 2FFAA 5A6SB 2N9UA 2ZSJA 3FPKA 1SXJA 2VPZA 2Z8YM 3L9XA 4NBNA 1EFDN 3IO3A 1GQSA 4HX2A 2HHLA 3N2YA 1W5TA 1UMBB 3JRNA 1H5QA 1N2IA 1M0EA 2QD5A 1U8YA 4P86A 4RQUA 3KAQA 6Q21A 5M29A 2FFRA 1ZOPA 3PYMA 3M0EA 1WZ2A 1KKMA 2ZBQA 3SS8A 3LWDA 2A58A 1EXNA 4DR2B 2JBHA 1QTNA 1ZCAA 2FUG1 2GT1A 1L7BA 3KCNA 1RQPA 5PNTA 3TGLA 3TSYA 3IKJA 1Z4QA 3HY3A 4UTZA 4A6XA 5J2TA 3AEZA 2LIPA 4QM6A 4HQLA 4F5EA 1JRLA 5DE3A 3RYTC 3WLPA 3WQQA 1XRSB 3DM5A 2Q1UA 4H35A 3V4LA 1QHYA 2FEMA 2XUZA 3EDMA 3T3HA 4A0FA 4E7PA 1FX1A 3O31A 4YCLA 1YS7A 2E4AA 3GP5A 4EUHA 1OZHA 5BOVA 2PS3A 2JANA 1A9TA 1ACLA 2X0NA 3OJOA 1I3KA 1R37A 1II8B 1ONBA 1QIEA 3KLBA 4C5CA 3HYNA 2IEIA 2B34A 3OZEA 4FILA 4NBRA 4MWSA 4WZBB 2GXAA 4NCAA 3DLCA 3R0ZA 5JQWA 2FGKA 3DBVO 3KVOA 3CX6A 2W37A 4FKBA 4JCCA 3RSCA 4AJHA 5MN6A 3F5QA 5AJWA 2B7LA 2ADMA 5ALRA 3I30X 3L7NA 1MO5A 2EGUA 2J9GA 1OB5A 3KV3O 1Q3KA 1PW5A 4AI6A 1Z4LA 3OZGA 4P3YA 2HJHA 3EGIA 2VF4X 3C7CB 1AHNA 2AI3A 4DEXA 1UJCA 2QE7A 3ZDQA 4AO6A 5FBLB 2WKQA 1FNCA 4CCAA 2XTMA 4RS3A 4KSYA 1QKKA 4P0TA 5EJFA 4E46A 2BEWB 2CXSA 1N5OX 3DDCA 4F85A 3EXFA 4Y2RA 3MC1A 1HDRA 1D6MA 5FB3A 3DDZX 3P9XA 4LXTA 4UU8A 4RM3A 1I7LA 5IM5A 4BOYA 3BC1A 2QMUA 3EUWA 2H29A 3WSWA 3FROA 3DF7A 2X0EA 4TMWA 4C3ZA 2XUKA 5CGQB 3T4XA 1V43A 1EVJA 1JZQA 2FCAA 2GQ0A 5J4HA 5FLXA 4G1CA 1CLEA 2ZBGA 3EZ6A 1S2NA 5DBIA 5JT1A 1CZKA 1XHEA 5AD1A 1GIAA 2C31A 4HD8A 5JYEA 1LTKA 4H16A 1S02A 5GOTA 1I36A 4GPEA 4B9EA 5I7VA 1V1MB 2D1YA 4PLTA 4TMZA 3T3PB 1KVTA 1NMYA 3ET4A 4Q9HA 4WN9A 1X70A 3QUQA 3QH4A 2AUMA 2CYBA 5DTRA 3J7TA 2FWJA 4QLAA 5C4GB 4DIKA 3EYWA 5CNJA 1EVLA 1KK1A 2OP0A 2NUPA 2EGHA 1XRNA 1JDNA 1ONNA 4FR2A 4RSMA 5H7XA 2C5HA 3H9EO 2IYNA 4YCBA 4DDWA 1W48A 1SBTA 4B3DA 3K09A 2GJ9A 2IPAB 1V71A 2QZPA 3IUSA 3L0OA 3PNYA 5JCJA 1U2GC 3W4IA 1UEJA 2VYVD 2ZYUX 4DWOA 3ZGLA 2GCIA 2Q3CA 1XJ5A 2HQBA 3UMMA 1E18A 2D2EA 2Q6KA 2UDPA 3HXKA 3MILA 2HDOA 1GKYA 2SECE 3PRKE 2AJBA 1XQVA 3LCJA 2Z2YA 4C1BA 3OJWA 1RM0A 1U9YA 1ZMTA 1PF7E 1JA0A 3FKQA 2X5OA 4IS2A 4OBBA 5G4KB 3Q3CA 1I30A 3T7CA 1JL3A 3VHXB 5DM4A 1ZRHA 3AEYA 5F77A 1WPGA 4BMXA 2HF7A 2ONKA 1T4DA 1YJCA 4U02A 1BDBA 4EGCB 2ZIWB 1KOLA 1BN6A 3BXPA 3FFBA 2ZGVA 2QTGA 4JQOA 4O0LA 4QFBA 3RSSA 2JG3A 2YWXA 2EW2A 3QU4A 5TS2A 3HFJA 3R9XA 3MOSA 2G09A 2WICA 4QRHA 3SNHA 3TW4A 4EHBA 2R48A 3U44A 3QVWA 5GPBA 3I5AA 2JS7A 3A0RB 4KNYA 3NC4A 5K05A 4LX0A 4IOMA 4BB5A 3DTVA 5C5DA 2PLAA 4JKYA 4Y6RA 3WK5A 1EE2A 3NW9A 1OIVA 4H27A 1WB5A 2P9YA 2PA0A 4B3BA 1BO6A 3QG5A 2OWEA 3C41J 3MMPA 3PHLA 1NXOA 4O8ZA 3V8BA 7GPBA 2OBXA 3CX3A 3QW4B 4MQEB 1KP2A 1D0SA 2YVLA 2QI9C 3M6WA 4RLSA 4Y6QA 4DLTA 5B4VA 3OO0A 1GZUA 2IXFA 5FAXA 3KJXA 1EI9A 4F4FA 2CLHB 2IELA 3GFTA 2E4WA 4TM8A 3I5UA 4PY2A 1FBNA 1I2MA 1J0DA 1HDYA 1TVCA 2NVUA 2XCUA 3K9QO 4N7JA 2RE8A 3BVPA 2ZWOA 5HZKA 2XVYA 3U4IA 4MGYR 5B37A 4G65A 2ZULA 2YFYA 5K6AA 2ZJ0A 1RZRA 3OIUA 1W8IA 3OFNA 3TNJA 1P31A 1OKKA 3L8DA 4C21A 7REQB 5DGIA 2D0OB 4K86A 4MO9A 3UM9A 5LKRA 1W94A 4HGQA 1XL0A 1EFVA 2CBGA 4FZJA 2Y1WA 3EOZA 1PD1A 2BJWA 2FA9A 3JZAA 1GNLA 3DDOA 2NT3A 4ZOCA 1BFDA 2VR1A 2I4NA 4LVOA 2X9GA 3WKDA 1H6BA 2BM9A 3G89A 4P22A 4UHDA 4URFA 1J20A 3TD9A 1SQ5A 3NM6B 4P6VF 2I9KA 4RD3A 1F8YA 5EEGA 3HJTA 3U3MA 5DLQC 3T15A 3CF2A 5IVIA 2CCKA 3NI2A 5E95A 1A9ZA 4A6DA 1UKBA 1XAJA 1DC5A 3PG5A 4KEAA 3EH1A 4BMYA 4TZ0A 5HNKA 1M33A 5BYJA 2G1AA 1P1IA 2WD7B 1N2OA 4ZGWA 1DTEA 4M0FA 3RARA 3UQZA 2XVZA 5BWCA 2VF7A 4URWR 5EZYF 4QJ5A 3FLAA 3OTIA 4I1IA 1TMYA 2BIFA 4Z8XA 2QM8A 5ARBA 4WBNB 4P3KA 4X1KB 3ZQUA 4ER5A 1K7YA 4RVFA 1SOVA 3G5TA 2RKBA 2FTKE 3BIFA 4EF4A 4QDXA 4XYMA 4PRZA 4L15A 2JI9A 2Y0DA 4E5YA 5JY6A 4K26A 3N0RA 4QC2A 4A10A 5HIKA 1K6EA 3GJ4A 4HFNA 1SB9A 2KM1A 2WFZA 4URZR 3JQFA 1WIWA 4LDJA 5JO9A 4ALJA 4XYGA 4M76B 3BGSA 4OHOA 1NU8A 1WM1A 3CZMA 1JH9A 2FPUA 1YQUA 4B79A 4URHA 5EE0A 4YMUA 2LCIA 3ASUA 4MP6A 1REQB 2VZ9A 2O8DA 2HD4A 5KQRA 1O96A 1D2EA 1AMOA 2ZUTA 2BFFB 3UOAB 1UK6A 4PM4A 4BJ5A 4EEXA 2B30A 1V39A 3PEFA 4RUKA 1SKUA 5CX1B 1M83A 2I1LA 5EZYA 3QU5A 1E2MA 1RTTA 2A88A 4QFMA 4DPLA 5EKSA 2Y0BA 2ZWMA 2XKKA 4NBWA 4MQ4A 1SD2A 1UINA 2VHYA 3OPYA 3CT6A 3GT3A 4MUKA 1VOTA 4PFKA 5DNDA 1GA6A 1F8FA 5HFAA 4YREA 4NMHA 2VT6A 4IUCS 4B3MB 1K5GA 2ATEA 5I4KA 2XT6A 1GFSA 4ZCIA 3STXA 2NZ8A 5IJWA 3FTNA 1LZKA 1PNOA 4B4KA 3AJRA 4TL7A 3UJ7A 4F6RB 1ICEA 1V25A 3GAMA 3MWEB 4PNHA 3FPHA 2E87A 5ICEA 4V0ME 1BD4A 3LYHA 1ZMBA 5EIAA 2P2ZA 3OZVA 5A9SB 3C6YA 4WDRA 3DL7A 3REQB 4K6FA 3T4UA 1Y33E 1KI9A 2I4RA 1GILA 2LR0A 1U9JA 2XA9A 1P4RA 4OJYA 2WWWA 4F3CA 5A7FA 1UBOS 3GDHA 3KAKA 2HNBA 1K4KA 4KXUA 3BK2A 3U9TA 3O2NA 1Q0HA 4DILA 2H4HA 4UUBA 3FNEA 1P8JA 2ANBA 2WABA 1QJCA 3BOSA 5JDCA 5LDHA 3QIVA 3IQDB 4C0BA 3LFUA 2WZDA 1M2JA 3H5RA 4PHFA 3TW8B 1OWPA 1R4MA 2PANA 3OQVA 3A11A 1XWFA 4YV7A 4YRJA 2MSDB 4RHFA 1FK8A 1L5WA 4C4AA 3GOHA 3IR6A 1V16B 3VOAA 3AUKA 1DIGA 3I0ZA 3QW2A 4QEZA 4D82A 4EVSA 1NRXA 2ID8A 4LJ6A 1MO6A 2W2TA 1YC2A 4FX5A 4WQMA 5DI3B 3ZS9A 4BN5A 5IXYA 2GCGA 1PR6A 4JUIA 5EKUA 3QV1A 2OKGA 1P7ZA 5IXSA 1YCGA 1L0BA 5CT6A 3SF8B 3OF2A 3JARB 3KZMA 1TM2A 3A25A 1O57A 1UC5B 2F1JA 1NJSA 3F9RA 3PFKA 3FGOA 1SXJB 4JCOA 1IOLA 4EMUA 4EQZA 1XZEA 2X41A 2WC1A 8ADHA 2EEZA 4MOWA 3HR4A 2FQYA 2VJOA 3PWZA 2A9QA 1IDN1 221PA 1U31A 1CJSA 3GJQA 3Q3JB 4FYVA 4DB2A 1S2LA 1T3TA 1HLFA 4JENA 1GM5A 4H7HA 4HLQB 1M1UA 1J2UA 1FDRA 1MGOA 1PL0A 4ZU1X 5KNDA 2HAEA 1PJ4A 3DOJA 4B6PA 5J2TB 1ZRSA 3A2KA 1EKXA 4CMBA 1QYWA 4MUMA 1RXYA 3QEAZ 2IWHA 3T3DA 4L0MA 2R8XA 1HDEA 2RK4A 4EHIA 4MITA 5K0SA 2XMSA 2FQXA 3QVJA 5DN6A 1TCBA 3TG2A 3QRWA 3EAQA 1SXIA 2EW1A 3JD4A 3W3ZB 3VOBA 2A5FA 1MRNA 3JZIA 2V8BA 4KACA 4XIIA 3MJDA 4PS1A 2OGUA 1PEDA 5DCYA 1B1CA 1UC4B 3EZFA 1EBUA 4HEA6 1VDZA 1VHJA 4FFPA