5THQA

Comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
248
structure length
248
Chain Sequence
LGLRGKKALVTGGSRGVGRGVVLALARAGVDVFTCYREESDASASLARELKQLGGDHHALRADLADPKQIAELFQEVGRRFGTLDVVVNNAGVISHVPYAELPVAEWQRIVDVNLTGAHLVIQHAIPLLGDKGSVISIGSKSSEVGIPLRAHYTATKHALRGLTRSLAKEYGRSGLRFNVLALGVVETEELHALPDDERAEMTKFYSTKTALGRLGTPDEVAGAVAWLASDLSRYVTGATIHVDGGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Analysis of a Novel Ketoreductase for Pentangular Polyphenol Biosynthesis.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-ACP reductase
total genus 93
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5thqA00
1XQ6A 4XYBA 2O23A 3QVXA 1Q2XA 1VI2A 1R4NB 4LMPA 5KVQA 3WSWA 4TVBA 1Z73A 3SC6A 4DBVO 1BSVA 2AW5A 4E3ZA 1PX0A 1V6AA 1C1XA 1XDWA 1DSSG 3IAHA 2X5OA 3VAZA 3KV3O 4Q39A 3MJSA 4UVGA 4YEDA 3I9JA 4HBGA 3MWEB 2IEBA 2PGLA 4RL6A 4ALLA 4EYEA 3PIDA 2FZEA 3GGGA 1IL0A 4J9VA 5EQFA 1PZEA 3LLSA 4TZTA 5JE8A 3DXFA 3K2BA 3VC7A 1HWYA 2V6GA 3BMCA 2X22A 4KDFA 4CQLA 4ZN6A 3KLMX 3RD5A 2A92A 1R0KA 1S7CA 1TXGA 1YBAA 5J23A 2RBEA 3C8MA 4B7UA 1ZK2A 5JO9A 1BHSA 4IDBA 4XKJA 1E1KA 1X0VA 3I9LA 2WD7B 1PQUA 3PHGA 4JIGA 1CWUA 3GAFA 4ILKA 3W4JA 4O6VA 5KJEA 2VOJA 4OL9A 4DGSA 5L51A 4YA6A 1YONA 1B16A 1GUYA 4RJTA 4MINA 3VTFA 1MG0A 3O9ZA 3D5QA 2VUUA 1EVJA 3PHJA 4FFNA 4NG5A 4EUHA 3FRJA 4AJHA 5ADHA 3L0DA 1WZIA 2P9CA 5C7OO 1R37A 5I7EA 2CUKA 4DTIA 4E33A 3BHIA 3I1JA 3JQ8B 3VZQA 2FY8A 1QYVA 3K5PA 5DZSA 4BNLA 1YH3A 1VLLA 3K31A 1HYGA 2Y1EA 5BNTA 1HTBA 2IXAA 4PGFA 1A7KA 1YL5A 4YT4A 1X7GA 2JKVA 4U7WA 2AQIA 1O94A 4HP8A 3WYEA 4LN1A 4KWIA 2VRBA 5L3ZA 4QEDA 4J2HA 4XQCA 1P1RA 1E3WA 4NPCA 4YAEA 5DP1A 3JQ7A 3VPSA 1V0JA 4I1IA 1I33A 2W2KA 1KYQA 4FCCA 3HJAA 4ALKA 3LVFO 3ZHBA 1T26A 4TMFA 4LVUA 3EHEA 5IG2A 4J7UA 3GNQA 1X14A 3OEWA 4E2XA 5JYEA 1Y6JA 4HADA 3I5MA 1SOVA 2Q99A 3L77A 3MJ4A 3E82A 1OI7A 4J0EA 1NASA 2VHVA 3RI3A 3GFGA 3I9NA 1CERA 1LX6A 5BNFA 2DVMA 4BNWA 1DRVA 1QYWA 1UZLA 2GD1O 4G65A 4B4OA 3TWOA 5I8WA 3I4CA 1W8DA 1HYEA 1ONNA 4NU5A 3GGOA 3U0BA 3G1UA 5JCJA 3ZWAA 4DREA 4EDFA 1Q7CA 4B7XA 3PJFA 3F1KA 2BFAA 1FJHA 2PR2A 1MUUA 4GVXA 4DMLA 1O89A 4XEHA 3IUSA 1T2CA 5ER6A 5BSHA 4IXWA 4N7RA 1FK8A 1PL6A 3NEPX 4NZ9A 2HAEA 1Y81A 1DJQA 2CF5A 4I9UA 3ZWBA 1Z7BA 2DBRA 4IDEA 4M87A 3EK2A 4GWKA 3NT5A 3WXBA 1RM0A 3WR5A 1I3NA 4BNHA 1YJQA 2Y93A 3INRA 2OZPA 2QRJA 1VKOA 5KTKA 2X9NA 5CDYA 4PVCA 3OETA 1I3MA 1KEUA 1GUFA 5GMOA 5JCXA 1R66A 1IPEA 4XIJA 3MEQA 4OSOA 4E21A 4IJUA 5FI3A 2X5KO 1WAMA 5K6AC 3JD4A 3QHAA 4IINA 2AG5A 3MOIA 1NR1A 2ZB3A 5HS6A 5JO0A 3I52A 3DHEA 2NM0A 4PZDA 5LDGA 2YFHA 1KBZA 4IDGA 4I5DA 2O50A 4E5PA 3RBZA 4GX5A 3O03A 1E3JA 5B12A 2Q50A 3JD2A 1TI7A 3KYCA 3U4CA 3F6YA 1MC5A 2GZ3A 5DCYA 8LDHA 1OOEA 3LLVA 1HKUA 5JLAA 8ADHA 5L7YA 1GR0A 3LC2O 4CMKA 4Q3NA 4PN3A 3GN2A 3WTBA 3F46A 1YVEI 1DLJA 3GAZA 1O95A 2VUSA 3F1LA 1VE9A 4PG5A 4AJOA 3ZWXA 1MGOA 1PJ3A 3AJRA 1K0UA 4OQZA 2J5RA 1QRRA 3KYDB 4G5HA 2R00A 2YDYA 1EVIA 4P8RA 4XWYA 2NTVA 4HKTA 5DBFA 1KY4A 4EZBA 3HDHA 1DFIA 2IXBA 3GRPA 2YV2A 2QYTA 3JQAB 4D43A 1P1FA 1VJ0A 2ZYDA 3W4IA 3LC7O 3VPGA 5ER9A 1C0KA 1NP3A 4NBRA 2NADA 3NJ4A 1EK5A 3NTOA 1ZJZA 3PJDA 3RU9A 3DR3A 3WYBA 4RF4A 3JYNA 4QQRA 4AJJA 4CUKA 2Y1GA 1GPDG 3RC2A 3RBVA 4WOJA 5K9ZA 2DBZA 2VT3A 2WD8A 3DQPA 2O48X 2W2LD 3H3FA 4MVJE 4ND4A 5DBIA 4BO6A 3TL2A 5COAA 1P1KA 1ZEMA 3AUUA 3FR8A 3TOZA 4MVJH 1HSOA 1ZCJA 2DBQA 3JQDA 4Q3BA 5IDYA 1MXHA 4XRRA 4ALNA 4FC6A 3PYLA 1I30A 3H4VA 1EDZA 4I9HA 1OC2A 2RAFA 3JQBA 4YRAA 2O3TA 3PLRA 3QVOA 4OXNA 1GZ4A 1SEVA 4L0QA 5COBA 3KEOA 4BNYA 2E48A 1E3EA 3GUCA 1T2AA 2H5LA 1B14A 1YO6A 4FS3A 2ZQZA 4TVOA 5MDHA 1PGOA 3JQBC 4UUOA 4P4LA 2C7VA 2I66A 3FWZA 4TKLA 1SB8A 3UCEA 2PZJA 4R4JA 1ULUA 5A03A 4I5FA 2OBNA 1EEHA 1HDZA 5HS4A 2W8ZA 4BNXA 1CF2O 5JY6A 2P9GA 5TSDA 3RFTA 5EIOA 1H6CA 2GDZA 1N5DA 4W4TA 5IZCC 3M1LA 1DC6A 3AFNA 1VC2A 5EMHA 2FN7A 1H2BA 4CLOA 5CP8A 5BR7A 1Y9AA 3C3XA 5T64A 1LDBA 3JQ9A 3IUPA 4RPLA 2JD1A 3NT4A 2OMEA 3PHLA 2AEFA 1R6DA 4D3SA 2BELA 5GZ1A 4GLOA 4DVJA 2VUTA 3ZNPA 5T6BA 4YJGB 3U4DA 1Y8QB 3NKLA 4B4WA 1PWZA 4RDIA 4E30A 5A3JA 2W2LA 4ITUA 3RUIA 5CDSA 5IDQA 1P1JA 4MVJI 4TRMA 4E5YA 4XGNA 3D0OA 2VHXA 2HK7A 1ZXLA 3EUWA 3G49A 2FWMX 2OGUA 4MJLA 3BMQB 4JBGA 3TZQA 3ZWPA 5L45A 4BUCA 1UXJA 2YW9A 1GQYA 4J4TA 5LC1A 4BS9A 1D1TA 5GZ3A 4XJSA 1HE4A 3DFUA 1DIRA 4L75A 3WBBA 2P2SA 3JYPA 1Y9EA 4QECA 1ZSVA 3TOXA 1LEHA 3ZHZA 5TRTA 1JTVA 3DZHA 3K8ZA 3ZW8A 4MDHA 4NR0A 1PL7A 3BMOB 1VM6A 3CINA 1Z7EA 4CM8A 3FCOA 1BVRA 3VVCA 3DBHA 3GF4A 1KETA 3U4HA 1J0XO 1LXCA 1V35A 2ZCUA 3ROKA 1B3BA 3FF4A 3DOOA 2DQ4A 4IM7A 4A10A 4E5KA 2NLOA 1GCUA 1OMOA 2GERA 3GDFA 3M2TA 3PPIA 4HUJA 1PEDA 1KERA 2OP0A 1UDBA 5A1TA 2B5WA 2P5UA 2VHWA 3PZRA 5TLSA 2YY7A 3ADPA 1ONPA 1VPDA 1O9BA 3D3WA 1HXHA 1I32A 1X7DA 2WSBA 3QSGA 1YB1A 4BNMA 4NJMB 1YWGO 4WE3A 3ENNA 1E7QA 3GHYA 3JQGA 3PDUA 3AM5A 2Y1OA 3WB9A 1X1TA 4WEQA 4E13A 2C82A 3DBHB 2AXQA 4Q9NA 1T4BA 3R1IA 4LW8A 4OGWA 2GZ1A 1PQWA 3QIVA 4DIFA 2HMUA 2B5VA 4BNNA 4AJNA 4FFOA 4N5MA 1UJMA 1A9ZA 1DDOA 1FMCA 4NU6A 3F5SA 1EMDA 3AI1A 3GC6A 5ENDA 2WYVA 4JN6B 3A28A 3HN2A 2OXIA 1R0LA 1UR5A 4HNGA 2VWQA 3A1NA 3PJEA 4W9NA 4FC7A 1VL0A 4CL3A 1BMDA 1JVBA 1NQAO 5FEUA 1I3LA 4CV0A 2V6FA 4GSLA 4CR7A 4IQ8A 1E5QA 3GOHA 2PNFA 9LDTA 1IE3A 3UICA 3WGGA 2DUUA 1IB6A 2YHUA 3WGHA 2DC1A 4BVAA 1P74A 4W7HA 4J1NA 3D4PA 1U2GA 4DLBA 3LT0A 4L9RA 1UXGA 5CDUA 2Q1SA 5GZ6A 4GKVA 4UEKA 4PLTA 1E5LA 4IQ0A 2GCGA 2J3JA 4OO3A 3UGKA 4CLRB 4BNIA 2NVWA 4L4SA 4M54A 3HZZA 5DOZA 4J4BA 2ZQYA 3G79A 1JKIA 1NHGA 4UVIA 3P2YA 1PJSA 1E3WB 4XJTA 3VH2A 1ENZA 2VWHA 3U49A 1JLLA 4TROA 2FZWA 4FSHA 4FW8A 2PLAA 2CFCA 4ALJA 4EUEA 1KS9A 1C3VA 3IP1A 4RORA 2OBYA 4A03A 4H15A 4IS2A 3OA0A 1NWHA 4DIBA 1ZW1A 4WLOA 4QFDA 4D41A 1H0KA 2IZ1A 4GX0A 1ISGA 4R9RA 4Z0PA 3HQ4O 1Y7TA 5TT1A 1O5IA 1HDCA 2TMDA 1IUKA 2HLPA 2AQKA 3A14A 3WOHA 3ZV3A 4D42A 4FFMA 2C5EA 3AUAA 3IL2A 2UUPA 4BO8A 4RPJA 3B1KA 1AUPA 2B35A 2HMTA 2YV3A 3LSYA 4MIEA 2Q2VA 1LQTA 2GYYA 1YBVA 3JQGB 3VPXA 1XG5A 2ZK7A 4YJFA 3RWBA 4EJMA 5JY1A 1NXQA 1DIBA 1GDHA 1GAEO 4RF2A 1ZSYA 3ZU2A 2Q1TA 3L4SO 3OJLA 4BKOA 4BO4A 4L4RA 3GUYA 4BO9A 4A5OA 3WWYA 1IHYA 4GMFA 3AM3A 2NV6A 2DTDA 4MVJG 1QSGA 1J5PA 2IRWA 4CV1A 5L7WA 4XQEA 1DIGA 1PJ2A 4TRRA 1WP4A 4OSPA 3G0OA 1JU9A 1DC3A 3E6AA 3GPIA 4TRJA 2EERA 2NU6A 3E1KA 3ZZNA 1W4ZA 4IIUA 4YJHB 2E82A 2I65A 4CV2A 3WJ7A 4IJWA 1TT7A 2JJYA 5JC1A 1R16A 4FGSA 1P3DA 1T4DA 4WK6A 3L4BA 1RM5A 2EW2A 3CMMA 3RQSA 4JBHA 1W6UA 3AW9A 1XA0A 5THQA 2EP7A 3H9JA 3O26A 2IYOA 3ZHYA 2D5CA 1RM4A 1XQ1A 1U8XX 3PJGA 1U1IA 1UDCA 3ZW9A 3K2EA 3ASVA 2EGHA 2YZ7A 1BWSA 3GGPA 3LDHA 1G6KA 4MKRA 1AE1A 3KYDA 3S8MA 1Q0QA 3WSVA 4YT5A 2PGJA 4PRLA 2WE8A 1NWCA 1FDTA 3CIFA 3OMLA 3TZCA 5HA5A 2PV7A 2WYWA 1GYRA 3AY6A 2RIRA 4QTZA 2PD3A 3WLFA 1F8FA 1Q0LA 4WASA 5G4KB 3ADOA 1HETA 3OP4A 4K9DA 1UDAA 1KEPA 2O3QA 1BGVA 1YOVA 3F3SA 3S55A 4M86A 1WLYA 3QWHA 3M2PA 4HFRA 3OJOA 3VHRA 1AGNA 3DWFA 4LISA 5A9RA 4EGFA 1I2BA 2J3IA 1V3UA 1HEUA 2Y67A 3IJPA 3W8FA 1MX3A 1DC5A 3PQEA 1Y5RA 5BSFA 4J6FA 3EZLA 3GR6A 1CRWG 1UZNA 3AUTA 3QE3A 3ZV6A 2CVQA 2B36A 5JXWA 1R4MA 3AY3A 4URFA 2HK8A 3ABIA 4ALMA 2ZTVA 5U9CA 4F3YA 4E5NA 3LF1A 1U3WA 1EFKA 4KTVE 4UULA 3B1FA 4ND2A 3WYCA 1ZIDA 3K96A 2PD4A 4FOOA 1MC4A 2VZ9A 4Q3CA 1UAGA 2FR0A 4IZIA 5L95A 4YXFA 1E3LA 1EVZA 1YXMA 5T67A 1NVGA 4E12A 2GN9A 4YACA 2Y99A 3DZBA 3BMNB 3GEDA 3AI3A 4O0LA 3TZ6A 4IGEA 3KUXA 4WNCA 3KO8A 5EN4A 5COQA 5JSFA 1NVTA 5DN9A 4EJ0A 1LA2A 3K73O 4ZGWA 1NX6A 2CD9A 4S3MA 2F00A 3K92A 3C7DB 2D4AA 2IDZA 2VHZA 1XYGA 4J7XA 1JWAB 4IS3A 3TPCA 3LU1A 5ILOA 3NJ8A 3HG7A 4IDFA 4CMAA 1PJTA 1LSUA 3JQ6A 3PP8A 2CMDA 4R5HA 3OQ6A 2H9IA 1PJBA 3WGZA 5KJ1A 2UV8A 1NFFA 1K6XA 1NHWA 4NNJA 4YYZA 3OF2A 3UN1A 1QMGA 1E6UA 4EJ6A 3R0IA 1RPNA 5FYDA 3UOGA 4BO5A 1QYCA 4RV9A 5IN4A 3UVEA 4BKPA 1A72A 2CY0A 3NGLA 1LTHR 2O2YA 1WMAA 4QXMA 2PZKA 3HN7A 5B4UA 1I24A 3WBFA 4NI5A 2OL4A 5FWNA 4BNZA 3C1OA 4J1SA 3PZBA 3KTDA 3CZMA 4J4HA 2ZB7A 1UZMA 4RVGA 3DO5A 5BNIA 2R6JA 3T4XA 4IMPA 1PGNA 1NTOA 1RYEA 5KCZA 1K6IA 1G0NA 1HLPA 1TLTA 4DPKA 3VH3A 2Q1WA 5JBIA 5TF4A 2I99A 3GHHA 5L40A 3VVBA 1NNUA 5I8ZA 3M1AA 1N2SA 4ZRMA 1LRJA 1YQXA 1NQ5A 3ZCXA 1JW9B 3I6IA 4CMIA 1UXKA 4W9NC 5JMWA 3WWZA 3WNVA 3BMCB 2DFVA 3QVTA 4FJ0A 5IN5A 5DT9A 3DONA 4O63O 2A94A 4KUGA 4B4UA 2PY6A 4FR5A 5A5EA 2NU9A 1FDVA 4GGPA 3QJ5A 2QZZA 3Q6IA 3HFGA 3C24A 3C7CB 5DNAA 1IOLA 2YJZA 1ISHA 4GX1A 1V9LA 1X0XA 2VRCA 3GFBA 3HDJA 4XZ3A 4KQXA 4CM6A 5CDTA 2Z95A 4E6PA 2I67A 3VKVA 1WNTA 3FBGA 1VKNA 3RUHA 1Y8RA 2I76A 4L76A 1LRLA 4J9UE 5DCWA 4ONEA 1GYPA 5T8KA 2W90A 2BFPA 5DP2A 3GEGA 2HU2A 1R0SA 2ZJ1A 3BHJA 4TKMA 3ST7A 4M55A 4I5EA 5JDCA 4XA8A 1CJCA 3P19A 4F6CA 1XELA 2EGGA 4J16A 1RYDA 3AK4A 1I2CA 3MTJA 2W4QA 2BGMA 4CM9D 4OH1A 2R2GA 3WX0A 4PVDA 5KJFA 1E1NA 3WIEA 2DTXA 1B8VA 3RAJA 1EBFA 1NR7A 1HL3A 4UUNA 1SOWA 2A35A 4HWKA 4GMGA 4OMUA 4NBWA 3DZIA 1U4OA 3RC9A 1H6DA 4XB2A 4CM4B 4WLUA 3SJ7A 1ZUD1 4GQAA 3L07A 3MWDB 3NDIA 3MJVA 3QQPA 2EG9A 4OOEA 3EVNA 4E2YA 3UAGA 4XGKA 3ZWMA 5IXSA 4BHTA 3V8BA 3QV1A 4RDHA 2OFPA 4S1VA 2HQ1A 4B4VA 3LYLA 1TB4A 2W2KB 5A9SA 5BSEA 4RQTA 2DTEA 1V3VA 2PWZA 2Q49A 1J4AA 3L6DA 4E2ZA 1EUDA 4YAGA 3ONDA 2EKQA 1HDOA 1JVSA 3ZWNA 2FSVA 4NJOA 2J3HA 5I9MA 4Z0TA 1BG6A 4WCFC 3V1YA 3NT2A 4W7IA 2HSDA 2VZ8A 3QA9A 4GSKA 1UUFA 3PRJA 2I3AA 1QLJA 1PIWA 3FTPA 3AM4A 3GLQA 2VYND 1ISFA 3FPCA 2YHIA 3LK7A 3R3SA 2WTBA 1IY8A 3LZ6A 4QO7A 4RLHA 4AJ4A 2G82A 2Q45A 2R00C 3PWKA 3S2GA 4XYGA 1L1FA 3W6ZA 1PU2A 3LC1O 4DQUA 5EESA 1NFRA 4XYEA 3S2IA 2P5YA 4NBTA 1RJWA 3C1TA 4JP3A 2JCXA 2O4UX 3UCXA 1P45A 4FN4A 3IOYA 3T4EA 4AVYA 1W0CA 4QO8A 2ILTA 4ND3A 1O0SA 1AN9A 4GL4A 3C1AA 2RH4A 4NHEA 3JQAA 3WQSB 2C54A 3Q9UA 5JAIA 5HRUA 3KM0A 5F1OA 3AOEA 4Z6KA 4WCFB 2FRDA 1UP6A 2HK9A 4L4XA 1SEPA 3KB6A 3E9QA 1N1GA 5I7SA 1XKQA 5A9TA 1X1EA 3BYZA 1U7TA 4BMNA 5IXYA 4PLZA 1PS0A 1KIFA 1TT5A 1GY8A 1B2LA 4Z9FA 2NWQA 4BGEA 3HB5X 4IQGA 3TN7A 4NFYA 2VNSA 5AVOA 4BV9A 1C0IA 1EZ4A 4N18A 3WS7A 1JAXA 1HDXA 1T2DA 2DPHA 2JFFA 3FSRA 2I9PA 3IP3A 1O6ZA 4ROSA 5BSGA 1ADGA 3RJ5A 2EJVA 2Y05A 1KOLA 1XWFA 1HT0A 2Q46A 4BO2A 4J3FA 4RZIA 4KZPA 1H93A 1E3IA 3DTTA 3ANMA 5KJCA 5TNXA 3SC4A 3KSZO 1DHTA 4GVLA 4GKBA 1RM3A 1LLQA 4PLWA 1GUZA 3EC7A 1PSDA 3MZ0A 2RH8A 1IZ0A 1N1EA 1E7WA 5CEJA 4BGVA 2ZTMA 4NFSA 2Y66A 3EMKA 3PQDA 3DMYA 4K6CA 1K6JA 3O8QB 3SXPA 2GLXA 2V6BA 1K89A 3V1TC 4GBJA 3PIIA 5HM8A 1TVEA 4OYRA 4TQGA 3JYLA 2UVDA 1NAIA 3VH4A 5AQ1A 4OJNA 4R01A 3WTCA 3T7CA 3OECA 2FPGA 4YQYA 2O3UA 3UF0A 4RF5A 3PYXA 3T7EA 3HHPA 5CHEA 3QLJA 2IYPA 5CPFA 2XF8A 4B8WA 5GY7A 2PGDA 1ISJA 2D8AA 1ZXBA 3EDMA 4UVHA 4BB5A 5T8KC 2E4AA 1O8CA 3CZRA 1T1RA 1ISMA 1N9GB 4J49A 3IIEA 3ETDA 1JKFA 3N74A 1HSZA 3H9QA 1FXSA 3CPSA 4XB1A 1BXGB 2OP1A 3I9MA 4CJXA 3AOEC 3DZKA 4KOAA 1SNYA 1ZEJA 3ZWYA 4RVUA 1LSSA 2GR9A 1P0FA 5C3MA 1XSEA 1ZK0A 2C5AA 2PZLA 3I83A 3F4LA 3FR7A 3SLGA 3RROA 5CFZA 3COSA 3JQ8A 3HFSA 4IBOA 1F06A 2P9EA 3Q1LA 4D3FA 3PHHA 1I3KA 2X5JO 4INAA 1E0DA 3TFQA 5A06A 2X86A 3RKRA 4WGGA 2DKNA 4M89A 2EEZA 3IDSA 4R54A 4HY3A 1LJ8A 1E1MA 5TJHA 3RU7A 4W99A 1UXIA 2NVUA 4Q3AA 4XQGA 3TQHA 3MOGA 4MKXA 5EPOA 4WKGA 3H9UA 5HWSA 1Z75A 4PLCA 4CODB 4II2A 1ZBQA 5G0WA 1XEAA 4B3IA 4RLSA 3Q2KA 4MP3A 3VOSA 4IXTA 1BW9A 2HRZA 3A4VA 3QWAA 1QYDA 4L8VA 1YJ8A 1T2FA 3GZNA 4CMGA 2YYYA 4DC1A 1OZAA 1C1XB 5IF3A 5TS3A 4KP7A 4ZRNA 4LMRA 3GNTA 1X15A 4ZQHA 4O59O 1ML3A 3EVTA 3S2EA 3RUAA 1CETA 1ZH8A 3I4FA 4PZCA 3GA0A 4R3NA 2BFOA 3F5QA 4J0FA 3JD1A 1XU7A 4O5OA 4OIMA 4BB6A 1L7EA 1N7HA 1UP7A 5ITVA 3GT0A 2C2YA 3CSDA 3JQCA 2CSUA 3GDGA 5BQFA 2AE1A 3L6OO 3AUSA 4CUZA 1LQUA 2FOIA 1EUCA 2EV9A 3FNGA 3GG2A 4Y6RA 1HDGO 1DIAA 4Z3DA 4PG8A 1NBOA 3ZV4A 1DFHA 4RCVA 4CQMA 4HFNA 1B26A 2Y1FA 1R15A 4DIOA 2RHRA 3ETGA 5DBGA 2GASA 3ZHXA 3UKOA 1I01A 1PJQA 1VL8A 3D4OA 3ZH2A 2C0CA 3RASA 4CLRA 2JCYA 3LF2A 3QRWA 4YCAA 1BRMA 1DHRA 2UUOA 3O4RA 1T1SA 4J90A 1H2HA 5EQDA 4CMEA 3KHUA 1SAYA 2O7QA 4HFJA 1HLDA 3E8XA 3H2SA 2J3KA 4RPKA 3IMFA 2C2XA 1E7RA 4AJ1A 4MOWA 2CDCA 3OIDA 3B20A 4R1TA 1EDOA 4A26A 3IKVA 4CLOB 2OO5A 1EE2A 2X58A 2BGKA 2NTJA 3PEFA 2DU8A 3NTQA 1EQUA 1VJ1A 4IDCA 3ULKA 1LDYA 3CH6A 1B7GO 4CQMB 1ONOA 2E37A 1MXFA 1MG5A 2ZB8A 5G0VA 1GFSA 1KEVA 2C29D 4TSKA 3O8QA 2XAAA 4I08A 2CNBA 4DYDA 3JQ7B 5A05A 3W6UA 3DL2A 3ICPA 4GX2A 3A06A 4RPGA 3OIGA 4UUPA 3AFMA 3QVWA 1LDGA 3P7MA 2HUNA 1OC4A 1PS9A 1BTOA 3MJCA 3TFOA 1K5HA 2BLLA 1Q7GA 1FF9A 4NK5A 4BQPA 4JP2A 2GGSA 3PGJA 4RVFA 1QR6A 2RCYA 4CQMD 3PQFA 4PLVA 1JN0A 5F5NA 4R1SA 4MIOA 1YL6A 4WLVA 1M66A 2X1HA 1YGYA 4RVHA 3KBOA 3ZN2A 1U8FO 3QY9A 1P0CA 3PFWO 4NH4A 3UHAA 4DYVA 1SCUA 1JAYA 2E6UX 2FSSA 3JSAA 4GPD1 4JK3A 4F46A 1EK6A 2GPTA 3QWFA 1X7HA 1EFLA 4D44A 3WMXA 4U0JA 3DAPA 1JQBA 2Y0EA 2CZCA 4HNHA 4ZQEA 1CEQA 3U09A 4CQLB 1EUZA 2B69A 2Y68A 2ZYGA 4J1QA 4I8XA 1A9YA 2NVUB 2AHRA 3FNEA 3ITDA 2G5CA 3UW3A 1LUAA 1PR9A 3E9MA 2HCTA 4CLXA 3DZGA 5FI5A 3JQAD 3OHSX 4E31A 4YT8A 3JQEA 1ENYA 1G1AA 1GQQA 3MJEA 4PG4A 5B4TA 3CMCO 4AJIA 3QW2A 3GVCA 5JCJD 5EERA 4EUFA 2WWRA 1XIVA 2Z1MA 3INTA 4CM3A 4IY1A 1NPYA 3NDRA 2ZTUA 2V65A 2WMDA 4PLHA 2BHLA 1N7GA 3E9NA 2ZCVA 2YHIB 3GK3A 4LSMA 4XR4A 5H81A 3HNPA 4R68A 1M75A 2X6TA 2VYNA 1KY5A 2ZB4A 2OOSA 4IJVA 4A73A 1NPTO 4JGBA 5IAAA 5JYDA 4D0RA 4OKIA 4R51A 4C4OA 4M49A 2NTNA 3CUKA 3V5NA 2G17A 1QP8A 3ZWVA 2QQ5A 4MVJM 5F1PA 1SPXA 2YDXA 4L73A 3FTNA 4QX6A 3WIDA 5A5FA 3GNSA 4YDRA 3FBTA 3DMTC 3X2FA 1HYHA 4YBZA 2VWGA 4BGUA 2EXXA 1N8KA 4LCEA 4IIVA 1U5CA 1HDYA 2O7SA 3NYWA 3IJRA 3WGOA 4CMHA 2GZ2A 4F6LA 3V2HA 4I9NA 1I0ZA 4B3JA 4K26A 4XDZA 3WGYA 5BT9A 3HWRA 3GDOA 3HADA 3B70A 3KLPX 5CG2A 3CE6A 3OFSA 3KSDO 1GEGA 3D1LA 3PWZA 1KVSA 2PTGA 4QT0A 1BDBA 4NBVA 3DC2A 3X2EA 5G4KA 1PGQA 3TZKA 4ESOA 1KVQA 4Y8VA 4ZVVA 3KOUA 3UXYA 4LRSB 2JFGA 4D45A 2AQHA 3OJEA 3PXXA 3GZNB 4FBGA 5JMPA 1YOVB 5LCXA 1GPJA 1OAAA 3TJRA 4O1MA 9LDBA 4PG7A 3DFZA 5F1KA 4KWHA 3WQQA 4DXHA 1P1HA 1U3TA 3BA1A 5EJ2A 3RKUA 3GN1A 3RBXA 4W82A 4CMJA 6ADHA 4JJIA 1GTMA 4Y6SA 1U28A 3HB4X 3RCBA 2QYSA 4AICA 2D1YA 2GO1A 3JQFC 1GL3A 2TMGA 4E5MA 1I36A 3D3WB 3GVHA 1Q1NA 4Y98A 2DBVO 2GNAA 4PG6A 1ADBA 1VRWA 2NVBA 4CMBA 1XR3A 4XGIA 2EKLA 4YRDA 1EE9A 4ZQFA 3FNFA 3KVOA 1QKIA 5C37A 5CG1A 1S6YA 4B79A 1VL6A 3QWIA 3SVTA 3BHMA 5ITWA 1A4IA 3DZJA 4QUKA 4CM8B 3F9IA 1AHHA 1FDUA 2LDXA 3ZWWA 2HMSA 4AJPA 1E7SA 2I6TA 1GQ2A 4Y9DA 3AU8A 3BTSA 2ZKLA 1QORA 5KOIA 3V1UA 5DULA 4TZKA 2NNLD 2OHXA 3ZWCA 1IYZA 4DA9A 1I5RA 1Q0HA 3TNLA 1DEHA 3LT1A 5IJZA 3HDYA 3OEYA 1T2EA 2AEJA 1NPDA 4UEJA 4F45A 2Q4EA 4R69A 3FN4A 3H9GA 4AJEA 5L4NA 2VT2A 2Z1NA 3N58A 3ZGYA 2NSDA 4MKZA 2PH5A 2VZ0A 2B83A 3D3EA 1DO8A 3UUWA 4BMVA 5AXAA 3DDNA 1ZNQO 3DB2A 4MP6A 4UVDA 3TL3A 5L9AA 1ZK4A 1MFPA 2DLDA 1F14A 1F17A 3DBRA 4YJGA 2XXBA 5KKCA 4AJ2A 5AXBA 3NGXA 1SBYA 5KVSA 4BO0A 3U4IA 2JHFA 1IULA 1ORRA 5B4VA 4J7CA 1NFQA 4UEOA 3WICA 3TSCA 3CTMA 3INGA 1C1DB 3E18A 5JAQA 3TDKA 1AXEA 1M6WA 4CM7A 2JD0A 4JNKA 5EINA 4CUJA 3FHLA 4CM4A 1GU7A 3H65A 1ID1A 3RVDA 4XYLA 1DB3A 4NQZA 2JCVA 4NDNE 2X0NA 1QG6A 2FPIA 3SX2A 2JHGA 4PFJA 3ZNQA 3LQFA 3CEAA 2EW8A 2J6IA 4OHUA 4DBZA 4GGOA 4C7KA 2EIHA 4RQUA 2AEMA 2VN8A 3GQVA 4KQWA 1E3SA 4BNFA 1C0LA 4BO7A 1ADCA 1E6WA 3GZ4A 2B37A 4M8SA 1F8GA 5EL0A 1XCBA 2C07A 3H3JA 1BXZA 4R1NA 4NMHA 4K28A 3D4NA 1Z82A 4BMSA 2DPGA 5C7IO 5I9LA 3VPHA 1U4SA 2Q3EA 1B8UA 4RZHA 2YFQA 3CXRA 5TX7A 4KTTE 3GVPA 1F12A 2VYVD 4YT2A 4MVJD 1Z74A 3TZHA 2V7PA 4U0KA 2Z5LA 1MV8A 3TF5A 4HX5A 1WDMA 4IGFA 3B1JA 3G17A 3BZUA 3WGQA 2QX7A 1D4FA 5A04A 1SC6A 1ZMTA 3C7AA 1D8AA 1DAPA 1A71A 3DAGA 2HRBA 4IDDA 5TJ9A 1YBMA 1ZJYA 4EEZA 2O3JA 5U1PA 4XQ9A 1D1SA 3I9KA 2UDPA 2BH9A 4OXYA 2QIOA 2B0JA 4NJMA 1PTJA 1U9JA 2Y1DA 1PZFA 4FGWA 1ENPA 1QLHA 3IQDB 3ZDFA 2JD2A 3MJTA 5FF9A 3W4KA 4CMIB 4DLLA 3PHIA 2VTEA 4XR9A 1CQIA 4Z0HO 1BW9B 1GCOA 4NFHA 5L4SA 4WECA 2AMFA 3DBLA 4IDAA 2WJPA 2GUGA 1PQPA 2VYVA 3CKYA 3ORFA 4QSMA 3VZRA 4YAJA 2UYYA 2X4GA 5DCUA 3HUDA 4G2NA 4E4YA 1PS8A 2UAGA 2PFGA 1VSUA 2CDBA 2B4QA 2H6EA 5MGBA 3VZPA 1LC0A 5TT0A 3WQRA 3Q3CA 4BO3A 4KUEA 1HZJA 4YJHA 4XCVA 3A9WA 4U5QA 3GH3A 4X54A 4DPMA 4PLFA 4YAIA 2VNAA 1ARZA 2GRAA 1LLCA 4FB5A 2WD7A 3VDRA 1KVUA 3EW7A 5B37A 3OICA 3GEMA 4JCOA 1YE3A 3V2GA 1I10A 4G81A 4H16A 1R4NA 3ANNA 1ZO8A 3PK0A 2AE2A 2IE0A 5G0UA 3JYQA 3VKUA 1JA9A 3H5AA 5FFFA 4DRYA 4D46A 3DZFA 3BMOA 2BKAA 2NUAA 3E48A 2E49A 5JS6A 1A27A 1Y5MA 5K6AA 2C20A 3KYBA 3FNHA 5IZCA 1GYQA 3V2UA 4BQRA 5AXDA 1HE3A 1P31A 2D5AA 5G4LA 4YPOA 4M1QA 4Y6PA 2WE7A 2P91A 3DOJA 1IZ9A 1WVGA 4J2OA 3AI2A 3U5TA 1WWKA 2I3GA 3IS3A 3AY7A 4HXYA 2HJRA 3K6JA 4YQZA 2ET6A 2EF1A 3RFXA 4YRBA 3G3EA 2PKQO 1PWXA 1ZZEA 2GN4A 4AJKA 4DQVA 5AYVA 4FOSA 4HFMA 1I8TA 4XD2A 2BFMA 1R4MB 1QV6A 2G0TA 2BGLA 3U9LA 1CDOA 1LBEA 1LC3A 2YV1A 4BNKA 5A02A 4WCDA 3BTOA 5IFLA 2X8LA 2ZYAA 2BMAA 4ALIA 4LGVA 3I23A 3RC1A 3FD8A 3F4BA 1GZ6A 3PFFA 3SBOA 3ZI0A 1XGKA 3DMTA 1YS4A 2IZ0A 1H94A 4IJKA 3BMNA 2IODA 5IZ4A 1HE5A 3NDJA 1UH5A 4MPDA 3JD3A 4FFLA 4AFNA 3ICCA 1GZ3A 4CMCA 1KEWA 4OM8A 1Y8RB 4ND1A 4BKQA 5KNLA 5TQVA 3M6IA 1H6BA 4KDEA 1HDRA 1KC1A 2GN6A 3Q9NA 1IHXA 3RC7A 2F1KA 2VCYA 2VQ3A 2NQTA 1KC3A 3SLKA 4R9SA 2FPPA 5JAZA 4CLHA 1ZK1A 1QV7A 3WFIA 7MDHA 1B8PA 2GN8A 2PK3A 3BTVA 2GF2A 4H3VA 2C7GA 2H63A 5THKA 4DC0A 2BI8A 4YAKA 2C59A 3DTYA 3WJAA 6LDHA 2YUTA 3GPDG 5DDIP 5ICSA 4NK4A 4ZQGA 1PL8A 4CLDA 4Z9XA 1LDMA 4RVDA 4RF3A 3BIOA 3H6KA 3PLNA 2QZ9A 3VDQA 4D79A 2A4KA 1NVMB 2QG4A 1TA4A 4KUHA 1CQJA 1AXGA 3RUDA 4DMMA 3JYOA 3B6ZA 5JPIA 2NACA 3WG9A 2D0IA 5F3RA 3IKTA 4MVJA 4LRTB 1SB9A 1MP0A 2Y0DA 3W8EA 3HSKA 1ZKMA 2JAHA 4WNIA 5U4QA 5C7LO 4A0SA 3GVXA 3Q11A 2AQ8A 3C85A 4MVJF 3U3XA 2X9VA 3WLEA 4DWVA 2X9GA 4LVCA 2V6MA 4FIZA 2ZATA 5TC4A 3RJ9A 2GSDA 2EKPA 3JD0A 4FJ2A 4E0BA 3VTZA 5I7VA 2O4CA 2PA3A 2VTDA 4PZEA 2PZMA 1PJ4A 3PGXA 2J8ZA 3OH8A 1UAYA 3I3OA 2B4TO 1UP4A 2POQX 2VOEA 1LRKA 3E5RA 4OAQA 3TRIA 4D0SA 1B3RA 4B3HA 3L4BC 2DAPA 5AXCA 4WPGA 3SJUA 4WJZA 3ASUA 4UUMA 4FFPA 3NTRA 4J91A 1U3VA 1WZEA 1N92A 4MVJP 4BO1A 2G1UA 7ADHA 3D64A 1H5QA 4JJGA 1TEHA 2VWPA 4YWJA 4BNUA 1H9BA 4I5GA 4YB8A 3RIHA 2AG8A 3BMQA 3KZVA 3LT4A 2CVZA 4IPTA 4R16A 2QHXA 1A4UA 1KVTA 4L74A 4FJ1A 2JFHA 2YQ4A 3ITKA 3KSUA 4CL8A 1DFGA 4UREA 2O3RA 4MIYA 4OOFA 3ROPA 1XLTA 4XDYA 3L6EA 1C14A 4E32A 3PI7A 3I6QA 4XIYA 1ZMOA 1MA0A 2FR1A 3DOCA 2X0IA 5TIIA 4KMSA 4YVFA 4A7PA 1SMKA 4J43A 1CYDA 1P77A 3JQ9C 1NAHA 3D7LA 4P22A 1AHIA 3EGOA 5F21A 3OQBA 3WGIA 3AU9A 4EW6A 4ZJUA 2J5QA 1WMBA 5ES3A 5JAMA 2QW8A 4PIVA 1BDMA 2WM3A 1OBFO 1DXYA 5CPBA 3BAZA 1U2DA 3LT2A 2FP4A 1DIHA 1M2WA 2Y1CA 4FDAA 4CR6A 5C5IA 1GEEA 3UCFA 3H9EO 2EHDA 3DHYA 4JROA 1E92A 4R3WA 1M76A 1M67A 5DOVA 4II3A 4WUVA 2A9FA 1WDLA 3KRTA 2WYUA 3E5MA 4W6ZA 3H5RA 1NQOA 3KXDA 1DBVO 1GV0A 1X13A 1R12A 2HDHA 4D7AA 4ID9A 3GG9A 2QRKA 4QFCA 1ISIA 1P1IA 2DT5A 3PVZA 1V3TA 3NV9A 4DUPA 4R41A 1B15A 4P4GA 1E77A 2FHSA 1HE2A 4CR8A 5HTOA 1NM5A 3KEQA 4ZICA 1DJNA 2P68A 2HMVA 3EAGA 4D3DA 1DAOA 3HE3A 3GY0A 3GMSA 3NAQA 4P38A 3ANLA 1E6EA 3WNQA 1C1DA 4R5MA 3N7UA 1EQ2A 4OQYA 3AWDA 2O2SA 2PKRA 3GRKA 3KYCB 4BV8A 2P4HX 3DBRB 1HZZA 1QXSA 1YRLA 2EP5A 5HBRA 1ZVMA 3JCZA 1F0YA 1LU9A 3DBLB 4EEXA 2FR8A 1YDEA 3L9WA 4JLWA 1BVUA 2Q2QA 5CDGA 2FMUA 4PRKA 4J1TA 3WGTA 1A7AA 3D5TA 5CEFA 4BIIA 5A9SB 3K9QO 4BKRA 4WEOA 1LDEA 3ZU5A 3ZU4A 1C0PA 3GVIA 3P5SA 3GMDA 1J49A 5CAEA 5JW6A 3ROMA 1LLDA 1U7HA 3RFVA 2SCUA 2EJWA 4WLNA 2NU7A 4P4NA 4YTEA 5KKAA 1Q7BA 1LLUA 1Z45A 2BI7A 1YDWA 2RHCA 2VHYA 3H8VA 4LK3A 3H7AA 4WLFA 4ZU3A 4R1UA 1E7YA 3ZV5A 2W98A 3EZYA 5DF1A 3ENKA 5JDIC 3O38A 4FQ8A 4BNTA 1HRDA 3PDJA 4BGIA 3AOGA 2LDBA 4DL9A 1LNQA 3OIFA 5T5QA 5JNLA 1ZFNA 4GLLA 5KVCA 4BNGA 4XX0A 1JWBB 3I9OA 1V8BA 4BL5A 2ZTLA 4BNVA 2NU8A 3DEYX 5JDCC 1Y8QA 1DC4A 2X0RA 1DOHA 4CV3A 3KETA 3Q0EA 4XYMA 1PJLA 4ZA2A 4AG3A 1ULSA 4FPXA 1RWBA 5JFOA 1ADFA 4K1LA 1EBUA 4Y67A 2Q1UA 4UVEA 4K6FA 5JDIA 2YQ5A 4TWRA 4ZHSA 4GWGA 4JX8A 4HV4A 1PZHA 4BKUA 1K3TA 4GH5A 3UH1A 1P9LA 3ONFA 5KWEA 3HDQA 3R6DA 1BXGA 3ZU3A 1WXDA 3OA2A 1MB4A 3U62A 2D3TA 5G0SA 2AA3A 1VSVA 3PTZA 5T57A 4LSWA 4EBFA 5IDWA 1PR3A 2BD0A 4Q3EA 4WOKA 2CF6A 1KVRA 1QYXA 3VH1A 5ILGA 2HJSA 3PWSA 3NRCA 3EYWA 2PKQP 4CLEA 3NX4A 1IPFA 1ENOA 4OXKA 2Y0CA 3UFXA 4YR9A 4IMRA 3MTGA 3OBBA 3MCVA 1NQTA 3BXXA 1GD1O 1PJCA 4DQXA 2DUWA 2XPCA 3ROQA 3W8DA 2Q2WA 1XHLA 4PLYA 3RUCA 3S1LA 2X23A 3ZNOA 1DRWA 1LDNA 2BRUA 5L4LA 1G0OA 1A5ZA 1YL7A 2D59A 2P4QA 4A2CA 2CVOA 1MLDA 1SZJG 4BNJA 4MO2A 4CM1A 2HKIA 3BTUA 2D2IA 1NYTA 2WDZA 2XXJA 3WFJA 3FPLA 3ETEA 2WEKA 3H5NA 3PYMA 3SEFA 1LSJA 4RGBA 5JC8A 3G1TA 4GI2A 3WMWA 1CIVA 1HF3A 2XOXA 3VZSA 4LCJA 5H82A 2IEDA 2X0JA 4XRGA 4ND5A 1BXKA 4C7JA 3QVSA 3NUGA 3JTMA 1M6HA 3H2ZA 4RVSA 4AL4A 4NIMA 5A3VA 5KJ6A 3OM9A 2IZZA 1WPQA 2PH3A 3OSUA 2B4RO 4PLPA 1DRUA 1T24A 3ZWOA 5I9NA 4N5NA 5L7TA 3FI9A 4PLGA 1YB5A 3STHA 4JQCA 4FFRA 1DLIA 1TT5B 1W73A 3DAFA 4BOYA 2PD6A 1SO8A 1H6AA 1FDWA 1EVYA 1JDJA 1XU9A 3OJFA 3Q2IA 1J6UA 1PGJA 3OJ0A 4MP8A 1MFZA 1PGPA 5H83A 1H9AA 4WCFA 5CEEA 1D3AA 1D7OA 4H7PA 4YJFB 4Z3KA 2QRLA 1U3UA 4YJDA 1YB4A 4B8ZA 4EI2A 1LSOA 3FWNA 5F5LA 2EWMA 4JBIA 4ZD6A 2HO5A 4TRNA 2X7HA 2NQ8A 3K30A 3WDSA 4WLEA 4RO0A 1L7DA 5B1YA 3RSHA 2ZJ0A 2DFDA 3ON5A 3L9XA 1UXHA 1OFGA 3DHNA 2JL1A 1FDSA 5KVVA 4PCVA 2O3SA 3W1VA 4NBUA 3QP9A 1ZSNA 4U6QA 1U5AA 2BF7A 4Q3DA 1YQGA 5IDXA 2H1SA 4U8GA 4RPHA 1GV1A 4AJLA 4CM9A 1I2ZA 5LDHA 2G76A 2OORA 4IZHA 3RUEA 5TGDA 5G0TA 5ICMA 5KIAA 1WW8A 1E7MA 1RKXA 2I5PO 2DM6A 3JQFA 1K2WA 1WDKA 3JV7A 4UAGA 1T25A 1N9GA 3ONEA 4GAEA 4E2WA 3F47A 2CDAA 4Z9YA 3RUFA 1DPGA 4EITA 1YKFA 4A27A 5AOVA 1PZGA 4CMEC 1JKJA 3S2FA 4U6SA 4ZQBA 2OUIA 3QWBA 4OKNA 1LI4A 4IUYA 5K0ZA 4N5LA 4DPLA 3DBVO 3OQ1A 3ZNNA 2Q4BA 2ZIZA 3EY4A 4FD3A 4DLAA 1E1LA 3VPFA 4JJFA 4JXKA 1YQDA 1P44A 1Y1PA 1B0AA 2HMWA 2JAPA 3R3JA 2VRCD 5G2OA 1GADO 1ZK3A 1P33A 5L53A 1VJTA 1Z6ZA 5I7FA 3IC5A 4CM5A 5ENVA 3P2OA 4B7CA 3E03A 4CPDA 5A4DA 4N54A 2J5KA
chains in the Genus database with same CATH superfamily
4QTUB 3IEPA 2J3EA 2O23A 3D8UA 3QVXA 2FG5A 4RHFA 5KVQA 4PHCA 3WSWA 3BCUA 2AW5A 1KYZA 3PLAE 4DXAA 4FMDB 4UDXX 4INZA 1Y5NA 1DZIA 2NPFA 3VAZA 3FUVA 4CEIB 3MJSA 1G9TA 4L95C 1OBOA 5JPCA 2R5WA 4XDHA 3BSSA 3H11B 2GAIA 2F6RA 1P29A 3DGFC 4TZTA 3LLSA 5DYTA 2SBTA 2V9PA 3B52X 1JX6A 3DXFA 4JWTA 4X6UA 3NQ41 4LBYA 3B3FA 3BMCA 3NU1A 3G5TA 4WN9A 3TB4A 3HJCA 1NXOA 2Q3LA 3BCSA 1BNCA 3MILA 4JT8A 3QEMB 1T5LA 1LVHA 5AK5A 3TTTA 1DKMA 2WZDA 5EP1A 4KYVA 5C1DA 4M0EA 5K7SA 2XTZA 3M70A 4ZN6A 3D7KA 3KLMX 4JJKA 2PN1A 1YU6A 4HDSB 1WMDA 2XZPA 4IYRA 4CEHB 2ZSIA 1TXGA 4KODA 1Z0ZA 4EVSA 4B7UA 1KR2A 5JO9A 1YZ3A 3ME5A 4GZLA 4Z4GA 1E1KA 1X0VA 2WJGA 2WD7B 4DABA 3UXHA 2MSCB 5EKUA 1XC7A 3OU6A 4HAYA 2VOJA 5CM8B 5KZMB 5L51A 4YA6A 1YONA 4QULA 4CGYA 3QEJA 1P5ZB 1DXQA 1HFJA 1PFVA 1USGA 4GR5A 1XNQB 2VUUA 4NG5A 5DSTA 4FFNA 4EUHA 3FRJA 3GP3A 4AJHA 4DG9A 3VZCA 2NP7A 2QLJA 4IHAA 3CJTA 4C29A 2P9CA 5C7OO 1R37A 4E33A 3BHIA 3I1JA 5GVSA 3KR0A 1ZOSA 1ZUNB 2ZJAA 5F4BA 2JBAA 4UPDA 1FFYA 4B6GA 3O2QB 4BNLA 1W7AA 5KAMA 1J7JA 1VLLA 4HPWA 1D2CA 3NMUF 4MGYR 2V55B 4LBWA 4TYWA 2HXGA 5FLXA 1A7KA 1N7IA 1X7GA 3ZJYA 1L4UA 4TL6A 1WMSA 4QPJC 1UPCA 5GIPE 1FP4A 1H23A 4MQLA 2VRBA 1SUAA 5IM5A 1TEVA 2C4VA 2ENUA 2R8BA 4QEDA 3MWEA 3AVPA 1QQ5A 4NPCA 4DR3B 2HA0A 5AKEA 3VPSA 3WMGA 3TW4A 1I33A 4RD2A 1AMUA 3HJAA 1PZMA 3LVFO 3ND9A 4Z4EA 2AG0A 2OG1A 3EHEA 3ADKA 1UOPA 4DDTA 2Z6VA 4HNVA 2J0EA 3GFSA 4G1VA 3DLAA 4JUIA 3LCVB 3VAAA 3DYVA 4BLPA 2QT1A 3L43A 3FKSA 3OIWA 4J0KA 5I3CA 3UBTA 2JHPA 4R1OA 1O9HA 4E2XA 1A9RA 2ILVA 3G0BA 3MC1A 1CUAA 2FA9A 5J58A 3K1YA 4PN7A 2QR5A 2Q99A 3NTXA 2WABA 4ME6A 3RRNA 5CB4F 1KJWA 2VHVA 3KP1A 3VR6A 4I2VA 4DMKA 3IEIA 4IXNA 3I01A 5MFZA 1RAGA 3TE6A 1GA1A 3RREA 2DVMA 4AN1A 4BNWA 2E1PA 2NZVG 3FVVA 3ROZA 4B4OA 4Y6OA 4A1FA 2DSNA 3TWOA 5I8WA 1Z4QA 1M0EA 2HJWA 2LP4Y 3WK6A 1HYEA 2CXSA 3BXOA 1DOZA 2CUZA 4F5YA 2GBLA 1OTXA 1T13A 4MUEA 2AZTA 2XT9A 4QYIB 4POAA 3DMDA 3PJFA 3D3JA 3F1KA 4BGDA 5A2GA 1WEKA 1FJHA 1N9ZA 3EEQA 4LVOA 5IH3A 3UT0A 1JDBC 3CNQS 2D7JA 3WI7A 1L1RA 1O89A 4TS3A 3ZIAA 4Y2JA 4KKXB 4JWKA 5I45A 3QYFA 3W8NA 4WBNF 4OHFA 3IUSA 1T2CA 2HNKA 1PUJA 2VJBA 3O2NA 5ER6A 2EOAA 2YRXA 2O8EA 4IXWA 3H5LA 4N7RA 4QASA 2CLIB 2LCFA 2I1LA 1DWPA 2ZYTX 5LQJA 3FYUA 4NOLA 2PRJA 5EJFA 1BCRA 2AH5A 1OGJA 2NV0A 4WXEA 2VAMA 1UBMS 1Z7BA 1C29B 4IDEA 1YQWA 3EK2A 3WXBA 4Q7QA 4JBNA 1UZAA 1R6UA 1SG6A 4MNTA 4BNHA 2Y93A 1FYEA 1GPAA 3JR3A 3G82C 2QRJA 1VKOA 4FZVA 5I4CA 3AUFA 4DLTA 1P1BA 1TD1A 2GM9A 2BKEA 4PVCA 1TGYA 1P80A 5GMOA 2QVLA 4L50A 1XXHB 5JCXA 1K3FA 3MLBA 4NICA 1H0SA 1LW6E 3VUFA 5FI3A 3WK9A 4C7MA 1WAMA 3TEJA 5K6AC 3JD4A 1WCIB 4RK6A 3QOXA 4GG1A 4IKOA 4RELA 3VC1A 2ZB3A 2GJ4A 2H1WA 3AF2A 3CNBA 3D2BA 4W7SA 4ZVOA 3SJCA 2ARKA 3D7RA 3HY4A 3CPHA 4EM6A 2OKGA 3DTNA 1W93A 4IDGA 2PGNA 1O96A 2OVBA 4O4JB 2O50A 4E5PA 3K16A 1JEQB 2A3NA 3A32A 4JVLA 4KQMA 4MWZA 3BGVA 1E3JA 2IIBA 3O03A 4K5QA 4MWBA 3RVSA 3KYCA 1I13A 3F6YA 1BVYF 1MC5A 1QFSA 2N47A 3M83A 3LLVA 5ALXA 4S1WA 5TDHA 1EXDA 3UK1A 4ETWA 1GR0A 2GTHA 2XCQA 3F6EX 3BEOA 4CMKA 4PN3A 3T1YB 1MW8X 1NMYA 3WIOA 4D56A 3OKAA 3F46A 1TQ2A 5CIWA 4G4GA 1Q7RA 5FFNA 1O95A 2AKAB 2C98A 1VE9A 1SIUA 4MVXA 4N48A 2IX9A 1C9MA 1MGOA 1GZ5A 2WIFA 1K0UA 2A6PA 2J5RA 3PUJA 2JATA 4GEGA 4KNWA 4PYIA 3ZVRA 1QRRA 1KYVA 4HQ0A 5CX1B 1OI2A 3IVAA 4GGMX 2R00A 2YDYA 3GJYA 1OXXK 4HBZA 4P8RA 4F6RA 4HKTA 3W6OA 2ODBA 1M2OB 3B8EA 3ZIDA 4EZBA 2QR2A 3BKXA 5K5EA 1DFIA 2YV2A 1CY8A 3C5HA 1ORDA 3IURA 1Q7EA 4HCJA 3B82A 4MYRA 1U28C 1SXPA 2L2QA 3FOCA 3WLSA 1C9EA 3VPGA 1B0ZA 5GINE 5KYKA 2C0PA 4YUZA 1IQUA 1SXJD 4HZUB 2BDUA 3G5UA 5JLJA 2B8EA 3QKRB 2WVHA 1VDZA 3JYNA 4G5FA 3PE4A 2CFSA 4XH9B 3ISVA 2J7PA 2Y1GA 3FKJA 5DASA 4AKTA 2CMKA 2PM8A 1W85B 2VP6A 3ETCA 1TVCA 5F5XA 3SYLA 3TZBA 4KX5A 2G72A 3DQPA 5IPFA 3VSDA 2ZUFA 3RYTC 4W1PA 1JSCA 3G2PA 4DBLE 2QG6A 3FR8A 2ZBRA 3TFWA 3VR4H 2FPPB 5J43A 2W2VA 3R3WA 1GTJ1 3TOZA 2WSLA 3A10A 1HSOA 3F8TA 3PUKA 4L6CA 4PZYA 4DSOA 3WJ1A 1EP9A 1JKMA 1FP1D 3HO1A 3TVDA 1KZGB 4O4IB 1EDZA 3UHFA 1OC2A 4YRAA 1K4KA 4AY2A 1FFCA 1SEVA 3L8GA 3HU5A 3ED1A 2FNAA 5MFPA 1I7NA 5BT8A 1F2UB 1ICIA 2PAAA 5JATA 1Z29A 2G3YA 3GUCA 5J3JA 1YO6A 2ZQZA 1NKSA 4ZI7A 2RFLA 4Q1DA 2I66A 3FWZA 2P2NA 3F4KA 4TKLA 5ESWA 1SB8A 3S40A 4D9EA 2OHHA 3AL2A 1YS7A 2CJXA 1AT1A 2UYGA 2C2WA 3PUZA 3UV7A 5C81A 3GRRA 1C3EA 5HS4A 1T36B 3H9CA 5HILA 2ZE6A 5M3BA 1CF2O 3MTDA 4A6EA 2VO1A 5B6IA 2P9GA 5EIOA 2AUMA 3AKCA 3O90A 1JEJA 3EMBA 1YCFA 2GDZA 4MRAA 1KJ9A 5JCOC 1N5DA 5IZCC 5JT1A 3UQYS 4JT4A 1NUPA 3L7AA 1VC2A 3HCWA 4HDQB 2BFEA 4UQPA 4CLOA 5BR7A 1Y9AA 2QORA 1XVAA 5T64A 2RB5A 4LHEA 4NZOA 5SICE 3ZW7A 1DGQA 1KDYA 1BKDR 3ZDBA 2BMFA 4PXSA 1R7RA 2QJFA 2AEFA 2VF7A 3EXG2 3NIFB 2RHBA 1NJFA 4DILA 5T6BA 3DE1X 2XMGA 1E0SA 1Y8QB 1C3OB 4FHEA 4RDIA 2PMCA 4HNRA 2W2LA 3CR7A 3R6GA 5CDSA 2N0SA 4M1OA 3G85A 2QUHA 4MVJI 4TRMA 3KJZA 2AB0A 3KQTA 2EDCA 3D0OA 3Q3EA 1YRQA 1RWNA 4ZEWA 3UMJA 4RTRA 4MJLA 1E0JA 2C3UA 3NNDA 3ZWPA 5L45A 1ACJA 4K0KB 4BUCA 2YW9A 4B3BA 2QT0A 4IHJA 4UMVA 5ECYA 2WAAA 1KEZA 3GA7A 1EFRA 1N57A 2P2SA 4FKBA 1ZSVA 3ZHZA 3S2SA 3UJ8A 1XL0A 4L6AA 3OLWA 1NXXA 3B1WA 1VM6A 4YYEA 5F3DA 1TTQB 2ZSHA 4YO7A 2IPLA 2WFZA 3LVBA 2O2GA 3U4HA 3NIDB 1A7JA 1V35A 4KAXA 1G8JA 2O57A 1Z26A 4TLLB 5I7WA 2GPNA 1F51E 4PYRA 4KGVA 2IYYA 4Z53A 1VGVA 1VHTA 3N8KA 4KQIA 4UD2A 4E5KA 1E69A 3M2TA 4EG7A 1AQNA 1YS6A 1B2RA 3BXEA 1VL2A 2YVQA 3KNZA 1SURA 2B5WA 2P5UA 3QU9A 5E6RB 3VR6H 3CJRA 3LKVA 4MJ7A 2PXCA 5J2TF 3KT8A 1MOQA 4LY3A 5H68A 2ZAMA 2WSBA 3S1AA 3KUKA 2A5DA 2HA7A 3QSGA 3QU4A 4G5YA 4Z4HA 3E22A 1WKCA 4BNMA 1QP0A 2LCIA 2B6NA 1G3RA 1O2DA 1C7IA 3DW3X 3GPBA 4IP0A 4OJTA 4UAUA 5KDLA 5KTNA 5LQNA 2AOVA 5JS2A 5KOHB 1N1DA 3OX4A 3LPAA 1E5TA 4MV6A 3V8MA 2WUEA 3DBHB 4CL2A 2AXQA 4DV3B 5GONA 4K9NA 1IUNA 2CHEA 4LW8A 2WQZA 2FEOA 3PPXA 2MIIA 3O8CA 4AZ3B 3QIVA 4J0IA 3JY6A 5DFAA 1Y89A 4YP6A 4HT3B 2OG2A 3L8DA 2Q5JA 4BNNA 1WCXA 4AX4A 4FFOA 4KR2A 4CI9A 3NBQA 1A9ZA 1DDOA 4QREA 4NU6A 4A0QA 1JH9A 3BQ9A 4BY9E 5P21A 1EMDA 5AW7A 3P4UA 3OBIA 1U1CA 3OUTA 4HLUC 1AG9A 1R0LA 3A1TA 1U0GA 2H1IA 3B9QA 3Q3IA 3WV4A 3LA8A 6YASA 1XMOB 3OG9A 3A1NA 1IWPB 4W9NA 2XB6A 2WTXA 3MAGA 4ZRDA 4CL3A 1RXWA 3K6SB 3TD6A 1W29A 2QE6A 5BR8B 2ZSDA 3BL8A 1Y7HA 3QENA 1FFDA 3FFAA 3FCSB 3QUAA 5K3SA 5CCXA 3VMMA 1XCGB 1U0BB 4JELA 2R8YA 4JHLA 1UBJS 2PNFA 2VPIA 3C5EA 3ECAA 2KB0A 3LXMA 4OHYA 3OX3A 4RH0A 4OA8A 3W3AD 4NZZA 2DC1A 4BVAA 3CUYA 5GTDA 2IUTA 2DQYA 2WPDA 2LBPA 3LG2A 4J1NA 1QF7A 1BX3A 3AGPA 3D4PA 3RVRA 3GLGE 4HWRA 4L9RA 4G56A 16PKA 4PE5B 4Q7MB 2XDQB 3RS5A 4LYAA 5CDUA 4K0RA 3C3BA 1E5LA 3VKGA 4D6XA 3SR4A 1XP5A 4BCCA 2NVWA 3JPWA 3SHFA 2QRNA 2IY8A 1IM5A 2QD3A 1YJBA 5FPYA 4C4SA 5JXGA 3AHGA 5J5VA 1ECFA 4M54A 3MQ4A 4QDTA 2FGKA 1OWLA 3ZVLA 2IH5A 4HB0A 3ZI4A 1CRQA 1CNFA 1JKIA 3G79A 2YYAA 4F72A 3QVUA 2YJ5A 4TMTA 4UVIA 1N6IA 4XJTA 3VH2A 1QQAA 3OTOB 5ESXA 1PR2A 4B5KA 1ZP6A 3K4QA 4ER7A 2V0GA 4Q4JA 2DG2A 2WIBA 1MJNA 3DT6A 5B58C 2G9NA 4FSHA 3OU7A 4ZI5A 4FW8A 1R0ZA 1XDSA 4BB9A 2PLAA 3E8SA 1T9BA 3IUMA 3AJ8A 4BN0A 2O07A 1KS9A 2JVIA 3IP1A 4RORA 1HV8A 2OBYA 4GXNA 4H15A 2XNCA 2XYQA 3I2IA 4A03A 5HF8A 5IWAB 1EFUA 3GFRA 4G9GA 4KIUA 2PQMA 2IZ1A 4GX0A 3IE0A 4Z8YA 4EG8A 1ACLA 4ZKDA 3HQ4O 3MGCA 5JALA 2IUUA 3EXHB 5TT1A 4CKZA 1HDCA 2TMDA 5KX5A 4KB5A 3FG9A 4GRDA 1ZITA 4RCZA 4DGQA 3EXEA 4FFMA 1V48A 2C5EA 1G21B 2NYAA 3FVRA 5AW5A 1VMIA 1QH8A 2GAOA 4PC6A 1BMFD 4BJ6A 1JAIA 3DLPX 4R9VA 5J47A 2G09A 3LVRE 2F3PA 1E20A 2HMTA 1NF2A 2OILA 3HYRA 3LSYA 3M33A 3N2IA 4EYOA 1C9NA 5H4HA 4X8OA 2ZSFA 1UK7A 5H5JA 1CBUA 1XG5A 5JU6A 3A2KA 1IDOA 1NXQA 1U7UA 5HCUA 2DKOA 4X24A 3ZZMA 2Y6VA 2VSQA 1IUPA 5EFOA 2E5FA 1G9XA 3OJLA 3R0QA 2HW8A 1L4YA 1VLVA 3KVYA 3PC8A 1N2CE 2REXB 4K6OA 5CT6A 3AM3A 2VJQA 1JEYB 2MDTA 4G1CA 5ALIA 4I55B 2IRWA 5KNBA 1TTTA 2E4XA 1OB2A 2KWIA 1Y1LA 1DIGA 1PJ2A 4JX9A 2IF0A 3EAQA 3NBUA 3JZFA 1WP4A 2XDYA 2ECKA 1JU9A 3QKUA 4RIGA 1D4OA 1QHFA 4LV5B 3QVMA 2NO9A 1ZD8A 4ZJYA 3OKCA 1WZUA 2DCUA 2LCQA 5HIAA 1JEAA 1NVWQ 2CLEB 3IEKA 3G9XA 3L6UA 4WDQA 5AVVA 5I9IA 4NXMB 3WJ7A 1O96B 2JJYA 4RAOA 4ZO4A 3W1WA 5JC1A 2ISCA 3FSGD 4FGSA 5AOCA 4CHGA 2P77A 4D4LA 4EY4A 1CUZA 1T4DA 2VP0A 3V3TA 1AV7A 4ISBA 4TYYA 1RM5A 4D0GA 3DG9A 1KH1A 5EKTA 3BE4A 3FPGA 4F1WA 1JHPA 1JSLA 4R7TA 3UOAB 1KYWA 2P3QA 4M1ZA 4DNOA 2OYRA 1Y6QA 3O95A 1D6JA 5CHYA 5EC8A 2IZ7A 1A1VA 2D5CA 1RM4A 1XQ1A 1AZTA 4XD7D 4BEVA 4D9FA 3M5WA 2VJMA 3I73A 4LF6B 1BWSA 2Q4DA 3GGPA 3W2IA 4HVLA 3UAVA 2HPZA 1AVTA 3KYDA 4B44A 1NJ6A 4M0MA 3BK2A 1RRGA 4RQAA 4JP8A 3ZG6A 2PGJA 4DWJA 4KITB 2WE8A 5AUOB 4L57A 3AF6A 4YRIA 3TZCA 2A9PA 3FAKA 4GXRA 5HA5A 4DADA 2PV7A 1GYRA 3AY6A 4M1KA 4Y1FA 3I1FA 3BG5A 4WASA 3ZE8A 4KMMA 3ADOA 1C7RA 4MSUA 4QOHA 4LDRA 1VKZA 3GJRA 1A5AB 1V4VA 3OP4A 4K9DA 4KBYA 3T35A 5AM5A 4HDMB 1KEPA 2WLSA 3AB8A 5C31A 1Q77A 3WGKA 4KBFA 5FUBA 1T6XA 3UG7A 1LI5A 4ZTUB 4BX9A 1H8HD 3DP9A 4IIBA 5PGMA 4QVIA 2HLNA 1DI0A 2PZBA 4H18A 2Y2VA 4IKPA 5A9RA 1I2BA 4GDFA 1J2RA 2AWOA 5IVKA 3T3OA 1GSIA 4BRWA 4MLCA 4D02A 1MJFA 1MX3A 3HI4A 1XCMA 4LYEA 1N5IA 4EHDA 1DWUA 1ZDMA 1Y5RA 2G9UA 4G1MB 4RY9A 2HBQA 1DTEA 3GR6A 4NENB 1RSZA 3ER8A 4GOKA 3A1CA 4G63A 2QVZX 4F71A 5C1PA 2J3QA 3EISA 3O74A 3I45A 1CDEA 2CCGA 1K8RA 2K7ZA 1DWQA 4KLRA 1W36D 5CB4B 2WMOB 4LJKA 4F3YA 2D1SA 4M6WB 1EFKA 4KTVE 1H05A 4OQPA 4ND2A 4UULA 1X9GA 2MCFA 3ZIUA 1TUBA 4M0CA 3VAYA 1RRVA 1G4UR 1MC4A 1TU0A 3EGEA 4FQ7A 4IZIA 3BVPA 1G42A 3SDSA 3ZHQA 4YXFA 4H1WA 4BFLA 3O4JA 4PX9A 4RVOA 1NVGA 3IXLA 4E12A 3GW8A 4KFRA 4QYTA 3BMNB 5IW8A 3R7WA 1JFVA 2LWIA 1B1AA 3S2UA 3DLHA 3VNUA 4RJIA 3SM3A 3HLYA 3TLZA 3REGA 2HDNB 4GNKA 4I36A 3UAXA 4B83A 4LE2A 3FTQA 4GKAA 1NVTA 4XCXA 3E27A 2CL7X 4EJ0A 4Y9RA 5KNBD 3URMA 1D8TA 3K9LA 4K9OA 3Q2OA 1KSFX 2X0KA 3H18A 3GCGA 2WC1A 3UMFA 3AEXA 4C0QC 2ZJZA 4S3MA 2XUIA 1QB8A 3W9YA 3PQCA 3ZDQA 3JARB 4C0BA 1JWAB 3A9VA 1GSOA 1O58A 4IS3A 5ILOA 5LNK1 5K09A 3HG7A 1XU4A 3P1JA 3IAS6 4NBLA 3TPZA 1T9GR 2AFRA 4HZUA 3PP8A 2CMDA 3OIYA 2JLAA 3OQ6A 5JJIA 1KK3A 3RVJA 1L7MA 4UUQA 2EBUA 2HA4A 2BBOA 3IA2A 4B0OA 3K3PA 2UV8A 1NFFA 1K6XA 2OXEA 4NNJA 3T99A 1U1EA 4CF5A 3UN1A 1XRRA 4UJ3A 5FL7A 4MWEA 4BFCA 5E7IA 4E88A 5FYDA 1NONA 4ZAZA 4MMZB 1FS5A 4QHTA 1TVMA 5IN4A 2DHQA 4BKPA 3NGLA 3QHQA 3PF8A 1VG9B 2IYXA 2QTVA 5EZYF 2PZKA 5BP7A 5TS2A 5HZGA 1QCZA 3A9SA 1Z68A 3NHZA 4NI5A 3K8QA 1FOEB 2BRUC 2OL4A 4BNZA 4CIAA 5FWNA 3PZBA 1JNYA 3G6KA 4EX7A 1X92A 2H2GA 1EUYA 1G55A 2VNHA 2ZB7A 1MO2A 1ZJ4A 3ESZA 3O4GA 4RVGA 2R6JA 4MUKA 1G291 2VDOB 5JD4A 3EZXA 4WKNA 2IEZA 4AUNA 3HCDA 2XF2A 4JGGA 4YX9A 1LCIA 3A0RB 4DPKA 1SXIA 4PAMA 1L5WA 3EMVA 5JBIA 4D4JA 2EWWA 1U4NA 1YQTA 3CEJA 4FOTA 1U6JA 1ABEA 3PCRB 3QF4B 1C7JA 1NQ5A 1HNWB 4HVTA 3AO0B 3V9PA 1UXKA 3D8TA 1JZSA 2ZUBA 3QTTA 4RETA 3AF0A 3P2EA 4W9NC 3W06A 1W5SA 5KOHA 4NTZA 3C8ZA 1QF6A 4B9AA 1OLXB 5BWMA 4YAUA 2M6KA 3DONA 1BAPA 221PA 3E5HA 4HGYA 1A9SA 4PC2A 3HYCA 5A5EA 2PGAA 4C4TA 1SHUX 2IIQA 3Q6IA 4GGPA 4XCQA 1N6NA 3BA6A 4DA4A 3ZQKA 1IOLA 2IZ5A 2V74B 3E2IA 3QF7A 3RVBA 4TXLA 4GX1A 3ADCA 1IBRA 1NW3A 3WKCA 4B6OA 4YRZA 3OQHA 1NVKA 5HOEA 1CJKC 2J32A 2GEKA 4LY9A 4XZ3A 3LFHA 1SCKA 3U13A 4E14A 3WADA 1RQ2A 1NJ5A 4E6PA 2VYCA 3FMPB 4MWOA 5CT5A 1UOQA 3EN0A 3VO9A 1X42A 1VKNA 5JRZA 3RUHA 3A6DA 1MB2A 1N6PA 3L82B 5HK9A 3VGPA 4WXMA 2H7VA 3OY2A 3FMIA 1C3XA 4G4IA 5DCWA 2ZJ3A 2P27A 2W90A 3N8IA 5CA0A 1RKBA 3ICOA 4P2BA 1CHDA 4AKGA 1NULA 4I5EA 5FWYA 4MW9A 1EFVA 5DHFA 1CJCA 2EGGA 2L42A 2NSYA 1HI9A 1VJGA 3Q7RA 1PT5A 1FMJA 2R3SA 2XCLA 4CL0A 3QEOA 4X97A 2CYAA 2W4QA 2BGMA 1WETA 4CM9D 1ULBA 4OVKA 2R2GA 1T4GA 5KJFA 2GYWA 3R6TA 3M6LA 5CW2A 1QP7A 2DTXA 1HQCA 1B8VA 2OB2A 3LZCA 4OHVA 4AF8A 1NR7A 4EQ6A 4PGAA 3D7NA 3T5CA 2EW1A 1IY0A 3W5AA 1RHKA 5FV4A 1QHYA 4OMUA 3CGGA 3PD7A 4ENQA 2VP2A 1L8OA 1H6DA 4XB2A 5AVUA 1W1IA 3SJ7A 4ZU1X 3VPCA 4OUDA 5AM4A 3SR3A 2H7YA 4GHWA 3N39C 2ZRQA 3EVNA 3UAGA 1I1OA 1LPAB 3JR7A 1TPYA 3V8BA 2Z57A 3LHDA 3UK2A 1H66A 4EB3A 2XYRA 3IAM6 4I99A 1BCSA 2PT6A 1TOAA 5DI3A 1AA6A 4GRIA 1FXWA 1I9GA 3IAM1 4B4VA 5E4TA 2PV0A 1QX3A 2ZRNA 2YFYA 4PINA 1TB4A 2JLCA 2H1LA 2ZVPX 1PG5A 2UVQA 4MIKA 4RQTA 4JI1B 2V6JA 2DTEA 2J7KA 2QRHA 1KU0A 1J4AA 4E2ZA 5LSAA 4MI9A 3DUFB 3CBGA 4LRYA 1T9ZA 2EKQA 2IPNA 3FCXA 5DWVA 2J3HA 4CT0A 4Z0TA 1BG6A 2NT4A 2PMKA 2Q62A 1EFRD 3BK7A 3F6SA 3CRQA 3QA9A 4OQDA 4DCVA 2GF0A 4P80A 3SM9A 3LTEA 3TTXA 5LYJB 3DFKA 4YRGA 3BAFA 1QRDA 3FTPA 1S2MA 2YIVX 5KSPA 3QNMA 5THXA 3LK7A 3P96A 1N4DA 3RTGA 1P0MA 1QZTA 4QO7A 4EKNB 1VMAA 3O4IA 5AIBA 2FTKE 2DUJA 1XMPA 1JZQA 1PU2A 4MKIA 3T0FA 4I55A 3D5EA 3Q9LA 1J07A 5EESA 4CBVA 4XYEA 5CVJA 2P5YA 4H3SA 1RJWA 4V1CA 3PUVA 3QX3A 5EHNA 1PQ4A 4JP3A 3TJMA 4WESB 2YVAA 4TV8A 3IOYA 2J9XB 3GUVA 3VNAA 1XZQA 4Q34A 1Y7LA 4QO8A 1IXYA 1C81A 3VX3A 2ILTA 3N2KB 4ND3A 1HG0A 3KTAA 1KF0A 1DJPA 3EWSA 2RH4A 4MVCA 4NHEA 5DYGA 4LFAB 3RBAA 5J2UF 1UPAA 3GB9A 4DY4A 4AM8A 3VQTA 2FRDA 2GNPA 3CLUD 4TQUS 1JXQA 2HK9A 3LFTA 2R7KA 3AP2A 3E9QA 3KB6A 1Z17A 4XSGA 2NPIA 1XKQA 4HG2A 4YHBA 5AJHA 1X1EA 4HDRA 3TE7A 4RABA 4Z1OA 4PLZA 1TT5A 3O5AA 1ZCZA 4IO1A 4WOPA 4CG3A 4IZOA 4Z9FA 3NATA 2NWQA 4BGEA 3HB5X 1Q7TA 3OM0A 1XZIA 2PTHA 3V5NA 5J4HA 4LY6A 2CLCX 3L05A 4FE7A 1PZNA 5AVOA 1PBTA 1LK5A 1VCIA 1HDIA 1LBQA 1SUIA 3AKDA 1R27A 3LHSA 5FI0B 2DPHA 1Y7IA 1RS0A 2I9PA 2HJHA 4DMCA 3FTEA 3QBVA 3RR2A 3HUEA 3QYAA 1ADGA 2GFQA 2QMHA 4HB2A 3FYSA 2ZYVX 1EP3B 1AB5A 4YROA 2Y05A 1EFHA 4GMXA 1KFEB 5E1BA 4XOIA 4BO2A 4RZIA 2VK4A 5ICCA 2DF8A 2XUDA 1H93A 3DTTA 3IOBA 4GC9A 5LQAA 3ANMA 1EUDB 3UKJA 2IDKA 3LM8A 4CTJA 5KJCA 1TIKA 2Z2ZA 5KYUA 1UT6A 3UAWA 1NGSA 1GUZA 1U3DA 1PSDA 1XZMA 3C3CA 2WIJA 3MZ0A 1IZ0A 4AZ0B 3J81k 3PD0A 4FVTA 1GQOA 4MPTA 5EXEA 1BN7A 1WUKS 2H4YA 2J4FA 4EX6A 1GTG1 1KAQA 3EMKA 1UM9B 3OCYA 4KXFB 1ZNWA 3BD9A 1K27A 2DY0A 2VAPA 2GMWA 3DMYA 5C8YA 1ZN7A 4MWCA 3SXPA 1QCYA 3BQMB 4M4SA 3SX0A 4UM8B 3H17A 2B6HA 4ZCLA 3GQBB 1ZRSA 4OYRA 3QXHA 2UVDA 3C2QA 5BYBA 3VH4A 4HYYA 3QNUA 3MWYW 1JFTA 1EINA 1E3QA 1X7XB 3C6QA 4NS4A 4IIGA 4OBXA 4LCBA 2ODTX 3KB8A 4QJIA 3OECA 4KMRA 4U02A 4WDRA 3VR4D 3FDZB 4ES6A 3CUSA 3UA3A 2FCAA 3UF0A 1S7GA 3PTAA 3DT8A 1RBZA 3EA4A 3OPYA 3PYXA 3HHPA 4H3HB 4RMHA 1YDFA 2RGNC 4PPQA 3OTQA 4ZJZA 1NBEA 5AVSA 5B6PA 4OJYA 2I80A 5CGZA 4B8WA 5HYVA 4MRVA 4HRXA 1ISJA 3A4TA 4BB5A 2YWCA 5CYFA 3GYBA 1K92A 4KQHA 1T1RA 3DFIA 4A15A 1N9GB 1JKFA 4ZI7B 4AAYA 2ZRGA 3PRYA 3J80A 4UZSA 3CPSA 3OQOA 4YI3A 4Q1EA 1KMQA 1B23P 2XNDA 2YWBA 4UUAA 1AN0A 1SNYA 2XD9A 2Q0XA 1EFPB 1O6CA 1O94C 2GR9A 3EJ6A 5J2UB 3HN6A 1XSEA 1ZK0A 4EJFA 5C3MA 1Z0IA 3Q9SA 5INTA 2FEPA 3OQJA 2OZLA 3RROA 4PTZA 4XLLA 3TX6A 1WTCA 4Y9SA 1RYFA 2X2OA 4GPAA 1PT6A 2AWNA 3HFSA 4XIFA 4IBOA 2FFHA 3PR3A 4CKWA 4DR1B 3K9FC 1G2OA 1YMUA 3B1YA 3K0HA 2YV4A 1HFWA 2UZ4A 4INAA 2OEPA 1E0DA 5CT9A 1T4CA 2ASVA 4DCNA 1CUXA 2C7PA 3MPUA 1VLZA 2GHQA 2FSIA 4X95A 1UWVA 5EEGA 1ADYA 4NKRA 5E95A 3I58A 5B5SA 1LPMA 3DEKA 4GI5A 1A8PA 3ORRA 2WJWA 2IYNA 5TJHA 3WLRA 1Q6ZA 1WF3A 3MYRA 3JU3A 2JLRA 2NVUA 4QVKA 3WA7A 1V95A 3IRUA 1G20B 1TQ4A 2XUFA 2ZU6A 4WKCA 5FOSA 5KWIA 1N34B 5BV8A 3TSZA 1MOSA 3KQKA 1FFWA 4ACBA 4F9TA 3DZ8A 2PSEA 1RAFA 2C3OA 1Z75A 4WKGA 4W8HA 2Q5HA 4M83A 4N65A 2P65A 3KJXA 1ZBQA 1ABFA 5DXJA 4NHOA 1OH7A 1XEAA 4H0CA 2VIIA 2G80A 5T4HA 4KQ1A 3LBYA 4OH7A 4ASUD 1E4OA 1MN6A 2Y1WA 2XITA 2G04A 3LGXA 1ZI6A 4H3KB 3LUGA 1N75A 4F91B 1ML4A 4R71A 4K05A 4I46A 1O8BA 4OJKA 1K7XB 4UOQA 1CJTC 1ZD4A 2OA0A 4DC1A 1OZAA 1BROA 2E9SA 1C1XB 3B36A 1P2FA 3TS1A 3DAHA 2JFPA 4BNDA 3CLUC 3ETHA 3D8RA 4K03A 5IF3A 1N5MA 2GZRA 1X15A 5CMLA 1MZVA 3AF3A 3IBSA 3DOHA 4XD7A 4WL0A 5CXQA 4X66B 3OESA 2ZBVA 3S44A 1XZDA 3CUEF 721PA 1ZH8A 2BFOA 3F5QA 4OIMA 1XU7A 3ABRB 2BFCB 5ITVA 1UP7A 1UINA 4F92B 5GPBA 3HB0A 2VF5X 4ZP1A 3MW8A 3U48A 2CSUA 1JHAA 2JIBA 2V7WA 4EGSA 5BQFA 4JXXA 3LCCA 1QAOA 5AHXA 3U4QB 3KT0A 2R96A 4Z3DA 1NBOA 1VLHA 1ZISA 1KKUA 1DFHA 2BOVA 4HNAB 3LCRA 3RT7A 2NO4A 2OBLA 2Y1FA 1NVUQ 1U0NA 1XN1A 2LVBA 3N8HA 4G23A 2BLNA 4J0QA 3MFQA 4UU8A 2RHRA 1KZHA 3RLIA 4EFLA 1KH3A 1OPRA 1DXOA 1BQEA 2NO6A 4TS9A 1L4BA 4F11A 3QFCA 2WLTA 3QOYA 3D4OA 1RADA 3RASA 1HTWA 4X44A 1J22A 5EXTA 4C9BA 4B73A 3LF2A 4CLRA 5CLQA 3WO1A 6AT1A 3U9TA 2J7PD 3SFZA 1DHRA 1PHRA 5EQDA 3Q12A 3FF1A 3I5UA 3G2IA 2EQ5A 3KHUA 1H8ED 2ZREA 3L02A 2H48A 3PL5A 2O7QA 4AWBA 4TXHA 3KUDA 2J3KA 3C3KA 3VHXB 5LZ2A 2GPBA 1MZPA 4LHVA 2C2XA 1E7RA 1A69A 2O2JA 2JAQA 2LXNA 2CDCA 3EVBA 3QUQA 4Z2YA 4AJ1A 4TMYA 1Q0TA 1BVHA 2EHJA 5D00A 4R1TA 3N75A 4A26A 3IKVA 4EJSA 1E1CA 4EQ6B 5EJEA 1D2AA 3RUPA 3V6MA 2CN1A 3EW9A 1EE2A 3ZHTA 1XZEA 4RDCA 2OQRA 4HN9A 1GRNA 3PEFA 4DJAA 1YDHA 2FZCA 1EQUA 1VJ1A 4IDCA 1U9IC 3ULKA 1A98A 4RIFA 3IUYA 4AWAA 1JR3D 3CH6A 2A0WA 4NDAA 4L16A 2C58A 3RS9A 2CV0A 1GFSA 1KEVA 2C29D 2W4MA 1M1YE 4TSKA 2XAAA 4I08A 1AUXA 2CNBA 3SQNA 4CQNA 3ICPA 3CUWA 3TYXA 2BIFA 3DLCA 4RPGA 4UUPA 2Z30A 3KALA 3QVWA 3P7MA 3SF0A 4BLOA 4OQ4A 1GPUA 1OC4A 2VJAA 5HKAA 4FGUA 3FYHA 3TFOA 2VUHB 3R41A 3FPFA 4CN8A 3PGJA 1QZ3A 2GBPA 3PB3A 1JV2B 1T1JA 3ROPA 1D7AA 4I9FA 2W0SA 2X1HA 3FSEA 4XEUA 1VIMA 5CJPA 2VHEA 1YGYA 4CKBB 4HGPA 2H59A 1SHJA 3JWHA 3PS9A 2OHJA 5BRNA 5EWLB 4NMWA 3TW8B 2OR3A 1TJ4A 4ITVA 1JIJA 1GITA 4QBHA 5EMKA 3QEAZ 1JAYA 1TO6A 1FFXB 4M22A 2E6UX 4JK3A 2DLCX 3B9RA 1CY6A 4EZIA 2NX2A 2ZI6A 5KOYA 4OM7A 2A88A 4D44A 2GYVA 3G0GA 5JQGB 4CXMA 3TW8A 3NG1A 4U0JA 4KIWA 3GRAA 3KIPA 1JQBA 1T3SA 4OHXA 3OZXA 4H35A 4MS4A 1T29A 4Q1FA 2JK0A 1LF0A 5EIFA 4JJEA 3A6GA 1FVHA 3FCYA 3R8CA 5LD2C 4HNHA 1OH5A 1XTQA 3Q3JB 3M3HA 4POOA 1T0IA 1IJKA 2XGOA 4J2TA 3FLMA 2CLFB 4J1QA 1N32B 3S27A 3ZKAA 3BHNA 3RF7A 3FNEA 4UKDA 5I3ZA 4HRAA 5D3MB 5FHQA 3DMRA 3L49A 3QGMA 5DPMA 3AETB 3ELBA 4L9AA 3QMMA 4MI6A 3ZIAD 2ONYA 1ODCA 3BWBA 4E31A 5AW1A 5HSGA 3CSSA 2RGGA 1GQQA 4F6RB 3L4KA 1E60A 4AJIA 2PS1A 1DPFA 3QW2A 3DF7A 1E6KA 5JCJD 1FFXA 2YHAA 1KOJA 2IYLD 2QN2A 1SU7A 3Q15C 2FGJA 1R5OA 5A5DA 5DIZA 1PKXA 3DS8A 2OHIA 1LWNA 5DX0A 4TXNA 1NPYA 2P40A 3I12A 1MRSA 2XECA 3F3YA 1FS4A 3UUEA 2V65A 2J0SA 5KSOA 4G0VA 4BFZA 4XR4A 5IHXA 1AURA 3GK3A 4H6XA 5H81A 1YR1A 3HNPA 3QLVA 1LKZA 1BDJA 3DE0X 4R68A 4WVFA 5FCDA 2I2BA 2FWNA 1F5NA 4G1FA 5D3KA 1X1QA 1KY5A 3CZAA 2OOSA 4JODA 4TS4A 521PA 1PR5A 1MAUA 5CITA 3IPXA 1CUCA 4O4JA 4MITA 1CJSA 5ICGA 3AUXA 5HJEA 1W47A 2FUKA 3CNOA 3VR5H 2PANA 3SSMA 1KI8A 2BFEB 4N0MA 5F1PA 5I9SA 2A1TR 4ZO9A 1C0EA 4EK9A 4Y2VA 1VPLA 1RHQA 1R9JA 3I6YA 5AW2A 5FHRA 2AXEA 4RACA 3KPYA 3WIDA 1ZRNA 4Q4HB 3WNDA 3KT6A 4YBZA 1U8AA 1OTYA 4X7RA 1JS1X 4LCEA 4L07A 3V4FA 4IIVA 3T1NA 4IIXA 1CY0A 1BXRB 2R8PA 1E1DA 3ONNA 1J9GA 1ZQ1A 4YGXB 4MQEA 1JBQA 2N75A 4CMHA 1SIOA 4HH1A 3FH0A 4TTJA 3KR1A 4TMZA 10MHA 3AHEA 5KUTA 1T8SA 4IVQA 4J3NA 5FV7A 4KGDA 2AYZA 3KLPX 3R3HA 4DV1B 3HEAA 3OFSA 1KS2A 1EAMA 2PTGA 4S24A 1GTVA 3M1YA 4B6EA 3CLTD 3E0XA 4BFXA 4NOKA 1XLVA 2IHYA 1OY1A 4Z4FA 3P97A 3V8RA 2J09A 5G4KA 2UXCB 3KAPA 4XUCA 2Z2XA 1KVQA 1T43A 2VPZA 1M2VA 4MRMA 3UXYA 1QONA 3SQXA 2RH5A 1JDPA 2JJ2D 4I1UA 1W76A 2Y4NA 3OJEA 4D45A 4KPYA 3SZGA 5JMPA 4EYGA 2WKRA 1GPJA 5F52A 2XWPA 1OAOA 5CYOA 1QANA 5HKKA 4K3UA 1V43A 3U4GA 9LDBA 3WLQA 3WLAA 3DFZA 1CPYA 1ESNA 2Z56A 3ZWQA 1GNLA 1COWA 1LY1A 1TJNA 2LIPA 1PF7E 1P75A 1GPNA 4FINA 2FFAA 4GPIB 4TTIA 3RKUA 4W82A 1VHLA 2X8WA 2IHNA 3PG5A 1ATIA 4JJIA 1GTMA 4KL8S 1KORA 2GTIA 4Y6SA 5H7XA 5K3AA 3U5ZB 1U28A 3GJSA 2I7TA 3HV0A 3K0AB 5HDBB 2D1YA 2GO1A 1EX6A 2ZLBA 3FNBA 3JQFC 5IU6A 4QQ8A 2G88A 3RV4A 1I36A 2R0QC 3SSNA 1CRPA 3FWHA 1ADBA 2ATIA 3OZGA 1NQUA 1G7RA 5DLYA 3NIWA 3SZUA 3WLOA 3ONVA 3G2NA 4HNSA 5F2EA 1WOYA 4BAUA 4OB7A 4GYYA 5G1NA 2XKAA 2Z1DA 4HX9A 3ZK7A 3CCCA 2OHVA 3KVOA 1I7SB 3EDOA 3ITNA 3AR7A 1PWYE 3FHJA 3QUCA 1VL6A 3V80A