4LMRA

Crystal structure of l-lactate dehydrogenase from bacillus cereus atcc 14579, nysgrc target 029452
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
312
Chain Sequence
KGINRVVLVGTGAVGCSYAYCMINQAVAEEFVLVDVNEAKAEGEAMDLSHAVPFAPAPTRVWKGSYEDCKDADLVVITAGLPQKPGETRLDLVEKNAKIFKQIVRSIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSARFRYMLGEYFDIGPHNIHAYIIGEHGDTELPVWSHVSVGIQKLQTLLEKDNTYNQEDLDKIFINVRDAAYHIIERKGATYYGIGMSLLRVTKAILNDENSVLTVSAYLEGQYGQKDVYIGVPAVLNRGGVREILEVELSEDEELKFDHSVQVLKETMAPVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase 1
publication title Crystal structure of L-lactate dehydrogenase from Bacillus cereus ATCC 14579, NYSGRC Target 029452
rcsb
source organism Bacillus cereus
total genus 101
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lmrA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4lmrA02
2HK9A 3KZVA 1GQ2A 2EKLA 1ZO8A 4XB2A 2ZTMA 4RLSA 1O94A 4MP6A 4PZEA 3U49A 3OETA 4R1TA 2RCYA 3RU9A 3GEMA 3RD5A 1QYDA 1MUUA 2YDXA 3OJ0A 1NPTO 1DC6A 4O6VA 4YR9A 1SOVA 5C5IA 1ENZA 4R01A 3JQGB 2G0TA 3RIHA 4WLNA 3KUXA 4CV2A 5F5LA 3S8MA 5IFLA 2AEFA 2VYVA 3LYLA 3JCZA 3S1LA 4HV4A 3V2UA 2PGDA 3PIDA 3OF2A 4BKRA 4DIFA 2WE7A 1H6AA 2HCTA 4NIMA 3VC7A 2B0JA 4KMSA 2AEMA 3TDKA 3DOJA 1WAMA 2EXXA 4XZ3A 2JFHA 1J0XO 2JCYA 3WGGA 1FDSA 3LVFO 1CF2O 1H93A 2WSBA 4F3YA 1B0AA 1MP0A 4I5FA 2CF5A 2YHUA 3ZDFA 1UAGA 5B37A 4YT8A 1PJCA 5B4UA 4YT2A 4UVDA 1YVEI 2FR1A 5C7LO 2X0NA 1P77A 2GUGA 4FD3A 3WICA 3RFTA 1JTVA 1U7HA 1ZK1A 3JYNA 2ZTUA 3NT5A 1GEGA 4MPDA 3SBOA 3W8DA 4ITUA 3AI3A 1HSZA 2P9EA 3GNTA 3GEGA 3MJ4A 4CM1A 2XXBA 3A14A 4J9UE 3N7UA 1ZW1A 4YWJA 1LSJA 3HHPA 1U3VA 3KOUA 2VOEA 4GL4A 2HJSA 4OKNA 1KVSA 1X1TA 2I9PA 5F3RA 2EWMA 2X8LA 1GD1O 4FQ8A 4S1VA 4XRGA 3HDYA 4NR0A 1QSGA 3PFFA 3TN7A 2V65A 4J0FA 2VNSA 3JQCA 3WLFA 5L4LA 1EE9A 1W4ZA 1KVUA 1M75A 1A7KA 3EZLA 4CLRB 5IZ4A 2E6UX 3Q6IA 2PA3A 1UR5A 2ZYDA 4BMSA 4YT5A 2EJWA 3GA0A 5JSFA 2A4KA 2EIHA 5JE8A 3GUCA 1VPDA 4YPOA 4J1NA 3DZJA 1R6DA 4NBRA 3CUKA 5CPBA 4BNTA 1E1MA 1MC5A 2Q1WA 2D3TA 2EV9A 2PZLA 3NTQA 4O59O 5IDQA 2E4AA 3GH3A 1F06A 5G4KB 2NM0A 1JKIA 1D1SA 5KOIA 4OH1A 4WGGA 1BSVA 4G65A 4FSHA 4C7JA 5JCJD 1UDBA 3IL2A 1GFSA 5KJEA 3P5SA 3QWAA 3GVCA 3L6OO 1ZJYA 4CM3A 5F1OA 1T2CA 2HAEA 2Y0CA 3FPLA 3FNEA 4J43A 2OUIA 3WFJA 1DOHA 1KC1A 2VWPA 3WTBA 3JQFC 4G5HA 5I9NA 2VYND 1AHIA 4UEKA 3NUGA 3ITKA 1LDMA 1LUAA 1XG5A 2BGLA 3JQ8A 4PLPA 3LSYA 1XQ1A 3VZPA 1R12A 3KYDB 1R4NA 2O3QA 3EVNA 4GWKA 2ZCVA 4GLLA 4YACA 4YEDA 4BOYA 1U1IA 1V8BA 4TRMA 1Q1NA 5EERA 3AU8A 4XKJA 5TSDA 4EJMA 1YL5A 1XU9A 1K6IA 1P3DA 2YV1A 3H9EO 3FCOA 3DAGA 4IUYA 1YE3A 3BMNA 3G49A 5F1KA 1WNTA 4U6SA 1TLTA 1N9GA 4GKBA 3EHEA 1P1IA 4HFJA 4NU5A 3TPCA 5JDIA 1T2FA 2NSDA 3O8QB 2P5YA 3L6EA 5CEFA 2W2KB 4QO8A 3WYEA 2Q1TA 3U4HA 3KHUA 3ZHBA 1AN9A 1NPDA 1CERA 1XEAA 3KB6A 3RVDA 3ZU2A 3LF2A 1PZGA 4W99A 4AJLA 4J0EA 2Q4BA 5DOZA 2VRCA 3BTSA 5DCYA 1QLJA 4NJMB 2GD1O 2G82A 4D3FA 1PSDA 2C7VA 2R2GA 4BKUA 2V6GA 4M49A 4E2WA 1M6HA 3IC5A 4CQMA 4GWGA 3RBVA 3OMLA 3OIDA 2BGMA 3DMTC 3Q11A 2PKRA 4FJ1A 5BSFA 3GZ4A 3K6JA 4TROA 2QQ5A 1XGKA 5T67A 4B4WA 2POQX 1GAEO 3AU9A 3MEQA 1Z74A 1B3RA 4PLCA 4BIIA 2Q49A 2DU8A 4BHTA 3VPGA 3BAZA 5JLAA 2O7QA 5GY7A 1HE5A 4LK3A 4GX1A 4RVGA 1J6UA 5DP1A 3H8VA 3UKOA 3A4VA 1DPGA 4UULA 1Y6JA 5HWSA 1H9AA 2B5VA 1KY5A 4XRRA 5A9SA 5CEJA 3OQ6A 1UZLA 5BT9A 2QZ9A 2UUOA 2EJVA 3PQFA 4NBVA 1L7EA 2DQ4A 1Z73A 3LZ6A 4IZIA 4H15A 1SNYA 4J1TA 4I5GA 4MINA 2EERA 4DWVA 3C7AA 1B3BA 4YVFA 4GLOA 2R00C 3EYWA 1ADBA 3GGPA 4HFRA 3ETGA 4QO7A 3DBHA 1ADCA 3PJDA 2C7GA 1T4BA 4J91A 4J49A 1F14A 4I1IA 5IDYA 5I7VA 3F5SA 4MVJM 1LDEA 3HZZA 1P1RA 5KJ6A 3ORFA 1R37A 1BDBA 4Q3NA 3RC2A 4RCVA 1C0KA 2P91A 4YJFB 4DC0A 3VPHA 5TF4A 3KM0A 3MWEB 1JQBA 4RPHA 3RI3A 1QYVA 2I3GA 1I0ZA 1RM4A 4GX2A 1I01A 4OO3A 1K6XA 3NT4A 4RPKA 1CIVA 4C4OA 4BB6A 3RROA 5EIOA 2EEZA 1EDZA 5KJFA 1GZ4A 4E6PA 4B8WA 4YAIA 1E7SA 3LC1O 1HYGA 1VL8A 1EMDA 2JHGA 4IQGA 1R4MA 2NWQA 3BTUA 4NMHA 4KQXA 5B4VA 1NQ5A 2C59A 3PK0A 4WLOA 2VRBA 2C2XA 1IZ9A 2H9IA 3K8ZA 3WXBA 2CDBA 3U09A 1W73A 3ASUA 4GPD1 5L4NA 3C85A 2QYSA 4DIOA 4XCVA 1LLUA 2FPPA 1JAYA 4HNGA 4FIZA 1QV6A 3W8FA 3AUSA 2YYYA 1I3NA 4IDBA 2NVUA 4PLHA 2OBYA 4PG5A 4IIUA 1DJQA 2BLLA 2X0RA 2O2SA 3GNSA 3PLRA 1YONA 3LU1A 1LC0A 2RBEA 1IHXA 3PI7A 5THKA 1F8FA 4IS2A 4XR9A 2H6EA 1AUPA 1P0FA 5AOVA 4J2OA 2IYOA 3BMCA 3OFSA 3RC7A 1UP7A 3DL2A 4ZN6A 4I8XA 1E0DA 4Z6KA 4XGNA 3ZWCA 3UH1A 3FF4A 1X7DA 3W4IA 1MXFA 3WJ7A 2ZYAA 2AG5A 1VC2A 1B15A 5DNAA 3AUUA 4CJXA 1P1JA 2IEBA 4WNCA 4YB8A 4OOFA 3QVXA 2JAHA 1P1HA 1SB8A 4DBZA 2H5LA 4DQXA 2UAGA 3DAPA 4FFNA 3R1IA 3KEOA 1X7GA 4HX5A 5IAAA 4XA8A 5C37A 4J4TA 1YBAA 4NFYA 4OQYA 4FGSA 1C0LA 3KV3O 3D5QA 1PU2A 4MIOA 3DZFA 2AQ8A 2O48X 4XGIA 4NJOA 4QQRA 2PD4A 2GN6A 4KUHA 3H65A 5HS4A 1W0CA 3ZWBA 1ARZA 2JAPA 2XAAA 4YJGB 4YJHB 2C20A 1NX6A 1HDZA 4BNIA 3OM9A 4DQVA 3INGA 3UXYA 4PRLA 5CDGA 2H1SA 3VZRA 2WM3A 1YQXA 2DAPA 4IY1A 4BNLA 1OFGA 4BNYA 3LLVA 3CZMA 4HP8A 1HKUA 1JVBA 4RVSA 3K73O 5TLSA 2P9CA 1D1TA 3BMNB 2WMDA 4IZHA 3KSUA 4O0LA 2Y1GA 4OSPA 3K2BA 2B5WA 4TRRA 4BNMA 1F8GA 3NRCA 3L6DA 1IUKA 5IN4A 3DBLA 4UUMA 2HU2A 1ZSNA 3G0OA 4DPLA 5TX7A 3DZGA 3DZIA 4OAQA 5DBFA 3JQFA 3K96A 4DXHA 5AXCA 5I8ZA 4CMIA 4JBIA 1ZMOA 5LCXA 2GYYA 3BYZA 2VTEA 1M66A 5K9ZA 3B1KA 3NAQA 3S2FA 1UP4A 1M67A 1PGQA 3F46A 1TI7A 3GK3A 3QY9A 3PLNA 3R6DA 1Q7CA 2EW2A 4OXKA 1NR7A 2O2YA 2V6MA 3FI9A 4N7RA 4PLFA 1B14A 3V2GA 1YRLA 3ZNPA 1KVRA 2B4RO 3PYXA 4R69A 1KYQA 2O3UA 4PVCA 3GAFA 4J7UA 4YAKA 4JQCA 2HKIA 3KYCA 1IOLA 1HYHA 4E21A 4AJ1A 4JGBA 3ZWPA 2F00A 2F1KA 3D3WB 5COQA 4MVJP 4B3HA 2OHXA 1KOLA 5DP2A 4INAA 3DMTA 2PGJA 3A06A 3PZRA 4E0BA 1I2BA 4PG6A 1X13A 1R0SA 2EW8A 2C29D 3PHHA 4GKVA 1U9JA 1PZFA 2E49A 4YTEA 1C1XB 1TT5A 2NVWA 1E6WA 2V7PA 4MVJH 4BO9A 5JYEA 4BNHA 1UXKA 3ROKA 3ZNQA 1E5QA 4ROSA 3W1VA 1DC3A 4IXWA 4YRBA 1PS8A 3RC9A 4CLDA 5JNLA 2GGSA 4RJTA 3SVTA 5A05A 2VZ0A 4IJUA 2GSDA 2X9NA 4GBJA 3CTMA 1B8UA 3Q9NA 3G79A 5CPFA 2FZEA 3U4IA 4LRTB 2D1YA 3JQ7A 4LVUA 5A5EA 2IZ1A 1PS9A 2XXJA 4J16A 3ETEA 3TWOA 4DIBA 1DHTA 3JSAA 1AGNA 3OJLA 1HDXA 1ISJA 4FC7A 2J3JA 2EGHA 4P38A 4E2YA 1GYPA 2R00A 1UAYA 5L4SA 3N58A 3JQ9C 3JQEA 3LC7O 4RVFA 3GC6A 5JMWA 2LDXA 1XU7A 3I9LA 2X5JO 1ENYA 2WWRA 3KEQA 5AXDA 2Q2QA 4BO3A 5FFFA 3NX4A 2VT3A 4OJNA 1QV7A 4N5LA 5HS6A 1EVYA 1NP3A 1CJCA 4ZQGA 4XQEA 4FBGA 1ZVMA 3OJOA 4XIJA 3BIOA 4XR4A 4UVEA 2ZB8A 2HO5A 1CDOA 4GMFA 2W2LA 1F17A 2G5CA 2DT5A 4W7IA 3RUFA 4BMVA 4ALIA 2A94A 4IMRA 2FR8A 4R68A 2DBQA 4U0KA 3SC6A 2QX7A 3GY0A 4FFPA 4LSWA 1V9LA 3FNHA 1U3UA 4PZCA 4Q39A 4CMEC 2AQKA 2Z1NA 1X14A 1E5LA 1EBFA 1HDCA 2X5OA 2O50A 1Z6ZA 3ICPA 4RF4A 2H63A 3RC1A 5BQFA 1SEVA 3E9MA 3H9GA 4UUOA 1DXYA 4Y9DA 3WB9A 2BRUA 4NPCA 4B4VA 4TRJA 5AXBA 4CM8B 3H2ZA 3HUDA 3GG2A 4JROA 2PKQP 3M2PA 2OGUA 3RJ5A 3PZBA 3GGGA 4K6CA 2UV8A 1GZ6A 3KYBA 5FI3A 1JWAB 5FWNA 4WK6A 3AOEC 3NJ8A 1HEUA 1I24A 3L4SO 3VOSA 2QRKA 2WYVA 4CMAA 3DWFA 4RDHA 3H5AA 5KWEA 3KBOA 3HSKA 4Z0HO 3QHAA 4IXTA 3RWBA 4JK3A 4WJZA 1P1FA 3C7CB 2EF1A 4W9NA 2ZCUA 4L8VA 3M6IA 1WDMA 4MKXA 5I8WA 4M87A 2BHLA 1LA2A 4J4BA 4NI5A 5T57A 3E9QA 3C1AA 3QJ5A 4ID9A 3GZNA 2QYTA 2RHCA 2W90A 1E1KA 1YGYA 3ZH2A 4WCFB 3BMOB 2YQ5A 3W6ZA 3I6QA 2DUUA 5I9LA 2WJPA 3FR7A 4D42A 3MTGA 4MP3A 1JLLA 1C0IA 4CV0A 3HE3A 1ULSA 5C7IO 4R16A 4R1SA 1TB4A 4KUGA 3ZZNA 1Y9AA 3HJAA 4TRNA 4U0JA 4CMIB 4IDFA 2NQTA 2B69A 1YB1A 3WGIA 4MIYA 3V5NA 1NFRA 3DB2A 4ZQEA 4BNJA 1EQ2A 1DB3A 2DVMA 1ONPA 3CSDA 2Q4EA 2JCVA 3JD1A 4HADA 3AY3A 2W98A 3E5MA 4XYMA 3GVIA 5JAMA 4EEXA 2DTXA 2UYYA 4ZQBA 1D7OA 2J5RA 5KVVA 4DC1A 4FOSA 1LI4A 2AXQA 3OQ1A 2PWZA 2YY7A 5JMPA 1JDJA 4DRYA 1ZNQO 2C0CA 5THQA 1BMDA 2W2LD 3VDRA 4P22A 3ANLA 4EBFA 3IKVA 1VJTA 1PL7A 2NVBA 3KYCB 2UVDA 3TSCA 4AJ2A 1WPQA 5CFZA 1MG5A 3HB4X 1PGNA 1GEEA 2R6JA 1JAXA 5KCZA 3UHAA 4J1QA 5KNLA 1YDWA 3M1LA 3E6AA 3QVWA 4E30A 5U9CA 1U5AA 3K5PA 4RDIA 1C1DB 2WD7B 3OA0A 4OKIA 1WDLA 4RO0A 1OMOA 1ZSYA 3AM4A 2VHZA 1VJ1A 3RCBA 4E13A 1LSOA 4FJ0A 1P9LA 2OP1A 1ZK0A 3GFGA 2Y93A 2CZCA 4E2ZA 4II2A 5A04A 3H9QA 3RBXA 2E82A 1DHRA 4Y67A 5HRUA 3DEYX 5JAQA 4DLLA 5IDWA 3AY6A 1GCOA 3U5TA 3MZ0A 1ISHA 2O23A 1Q0HA 4NBUA 1C14A 1LEHA 3ZHXA 4JJFA 4O5OA 2OP0A 3JD0A 4L76A 3ZW8A 1AE1A 1DAPA 1KERA 3A28A 4XQ9A 4EEZA 1FF9A 1BW9A 3FPCA 2O7SA 1EUCA 5COBA 1TA4A 1M6WA 1ENPA 1O0SA 2XOXA 3JTMA 3GN1A 4OHUA 1IZ0A 1I10A 4Z0PA 3H6KA 3RUIA 3ENKA 1BXZA 3EAGA 1E7YA 1U8FO 4RPJA 2X22A 1PL6A 3Q3CA 1SAYA 1G6KA 1GQQA 2IXBA 2CUKA 1ONNA 3MJSA 4CQLA 2YJZA 4MVJD 3VVCA 1IB6A 1PJSA 1X0VA 2PZKA 5JO9A 1U3TA 3DFUA 1E3LA 4R1UA 4UEOA 5L9AA 3BMQB 3LT0A 1RYDA 2HRZA 4YRDA 3ZWMA 1ISIA 1WLYA 4EDFA 3JD3A 2XF8A 1GU7A 3TOXA 3WX0A 3KSZO 1Q7GA 4TKLA 4IPTA 3O38A 2QZZA 3AUAA 5L95A 1D4FA 4WECA 2XPCA 2Y66A 4KWHA 4PN3A 1QORA 3JQ9A 5F5NA 2A9FA 5CP8A 1NFFA 1YOVB 3AJRA 4PLZA 1Y81A 4G81A 3UCFA 4DLAA 4PG7A 4PIVA 4MJLA 1M2WA 1H6BA 1TEHA 3PP8A 1H2HA 2YV3A 2CMDA 1TXGA 3NV9A 5L7WA 2D5AA 3QE3A 1LSUA 2VOJA 1ZXLA 4H16A 4WPGA 3HDJA 5JFOA 2FN7A 1QR6A 3DDNA 3VTFA 1EQUA 3JQAA 4MKZA 1RYEA 4LMRA 5KKCA 1J5PA 1UXGA 2VYVD 2GN9A 2I99A 1Y1PA 2CNBA 1HETA 2VUTA 4N18A 1PS0A 3JD2A 5H83A 2FRDA 3T4EA 2A92A 3ZHYA 2VHYA 5CEEA 2GASA 5JYDA 1QYXA 1JKJA 4AJNA 3R3SA 1QYCA 3GAZA 3OJEA 4DYDA 2HMWA 4CMEA 4BQRA 3BXXA 4KOAA 1LQTA 3D1LA 1RPNA 3NGXA 3GUYA 3JV7A 1YBMA 3E9NA 4A5OA 3BA1A 3UUWA 4R3NA 1EFKA 3WSVA 1K3TA 4WCDA 2C5EA 4A7PA 3R3JA 1U4OA 4FN4A 5BSHA 1DRVA 3UFXA 2W4QA 5J23A 1OC2A 1DLJA 2PNFA 3GDGA 1KEPA 1YDEA 5DT9A 3ZWNA 2ZATA 4XYEA 4Q3AA 1HZZA 5BNIA 1IPEA 3ADPA 4CM9A 4G2NA 4CL3A 3AOEA 4RVUA 3DBVO 4JX8A 4E5KA 3F47A 1I2CA 2OXIA 3WLEA 5HBRA 1PL8A 4MP8A 3U4DA 5I7SA 2CSUA 3PGJA 4WUVA 1T25A 1E3SA 1PJ2A 4KTVE 4DLBA 4TZTA 1VE9A 4DQUA 3PYMA 2NTJA 1V35A 2AMFA 1VSUA 2D2IA 4IS3A 1Y9EA 4B7CA 1FXSA 1JVSA 7MDHA 1XWFA 2X58A 4TKMA 5H81A 2GERA 2IRWA 1YBVA 2DC1A 1R16A 2ZIZA 1YB4A 3D4OA 3VH1A 4U6QA 1U2DA 3A1NA 5EQFA 2BI8A 1JA9A 4DMMA 2I66A 1DFGA 1N5DA 4YYZA 1BGVA 4AVYA 5ITVA 2CY0A 3GLQA 3TZCA 2Q2WA 3DBRA 3X2FA 3DONA 1MV8A 1DFHA 4FFRA 1NPYA 5LDGA 1SB9A 5ICSA 1MG0A 1LC3A 1KETA 4Z3DA 5EN4A 4BV8A 2P68A 4D44A 1D3AA 3IOYA 1XA0A 1ISGA 4W82A 3OICA 1QKIA 3ST7A 3ZV6A 4XQGA 2BH9A 4FFMA 4P8RA 1A9YA 3BHIA 3PHGA 1MX3A 4BO0A 3JYPA 4B79A 4BO2A 2P4HX 5FEUA 3AOGA 3QP9A 4BL5A 3PJGA 4J4HA 4RVHA 5ILOA 3DOOA 1RM3A 4I08A 1ADGA 4R4JA 1HLPA 3O26A 3S2EA 1ZK4A 1DIGA 2BMAA 1CEQA 5LDHA 1UP6A 1LU9A 4BUCA 5ADHA 4EJ6A 5H82A 3N74A 4I5EA 1UH5A 3LDHA 3MWDB 5KVQA 2JKVA 4M54A 1E3WA 3VPXA 4M55A 4ONEA 3W4KA 3JQAD 5G0VA 3ZCXA 1IHYA 2Q1SA 1A72A 1O8CA 2VZ8A 2GZ1A 3R0IA 5DCWA 3QWIA 1BHSA 3HB5X 5L51A 4IGEA 1N7HA 4BO8A 1PGPA 3ICCA 3E82A 1DFIA 1ZCJA 2B4QA 1N2SA 4RQTA 4E3ZA 3PHLA 3KVOA 2GNAA 3QWBA 3VZSA 5FYDA 3RAJA 4XDYA 3NYWA 4YXFA 2X0JA 4XJSA 1LRLA 3TNLA 4BKPA 4CM4A 4TWRA 1PGOA 3PQEA 5GZ1A 4CLOA 2GZ3A 4GGOA 3QVOA 3SC4A 1MFZA 1E7RA 3ZNOA 1ADFA 3AFMA 1KY4A 1V3VA 3ZW9A 3U3XA 1QYWA 3QRWA 3UOGA 1W6UA 1DJNA 5T64A 4IDDA 1PZEA 1EK6A 5AXAA 1TT7A 3OECA 4BO1A 2VRCD 2CVOA 4QFCA 4F6CA 5AYVA 2P5UA 4IBOA 3DOCA 4RF3A 1PJLA 4UVIA 3TJRA 2DBZA 4CPDA 2X7HA 4CQMD 4F46A 1GCUA 3M2TA 5BSGA 2DFDA 1L1FA 1DIHA 1ZUD1 4IIVA 4BMNA 2J3IA 1HF3A 3VPSA 5IF3A 1ZSVA 3WMXA 4R1NA 1DSSG 1GL3A 2X9GA 1HL3A 2C82A 3I9OA 4XQCA 4ZQFA 4JXKA 4ZA2A 1MGOA 1EFLA 1EK5A 4W9NC 2YV2A 3NTRA 2RAFA 2J5KA 2ZB7A 2X23A 3H5NA 4MO2A 4PLVA 4RORA 3C24A 2D0IA 5JDCC 1B8PA 4EZBA 1AXEA 2WEKA 4Z9XA 4AJHA 5BNFA 1PJTA 4ALLA 1NM5A 3NTOA 4NFSA 4CM6A 3Q9UA 4HFMA 3W6UA 5G0UA 4RPGA 4HBGA 4JNKA 1YH3A 3F4LA 3KXDA 5EESA 4EYEA 3ONEA 1GR0A 4L4RA 2JD2A 2Y67A 3ONFA 4UUNA 3L77A 4CMCA 1SC6A 3GT0A 2YFQA 3JQ8B 3B20A 4KDEA 4N54A 3C8MA 4NFHA 3ZWOA 1WZEA 1R4NB 4BO6A 4E5MA 4B3JA 1WMBA 1ZXBA 1LBEA 3F3SA 3QVSA 4BO4A 4R9RA 4Y6PA 1ULUA 2VHVA 3P2YA 2GN8A 3HN7A 1B2LA 1NHWA 4GH5A 5A02A 4F6LA 1R15A 3U9LA 2IXAA 4FW8A 1LRJA 4XGKA 1J49A 2YZ7A 5JW6A 1Y8QA 2V6BA 1N9GB 1I8TA 4LGVA 2VN8A 4IDCA 1FK8A 4KWIA 3ZV3A 3F5QA 4X54A 4CV1A 4ND1A 3S55A 2HK8A 3VH3A 3RUDA 1BWSA 3TZKA 4QEDA 5CG2A 3UN1A 4GSLA 1O95A 5CAEA 5DBIA 3W4JA 3VPFA 3ZU5A 3GOHA 3PEFA 1K89A 4N5MA 1WXDA 4U7WA 2PZJA 4ZRMA 3LK7A 4NQZA 4ZU3A 1GUFA 3RUHA 3VKUA 4P4NA 3ZWVA 4D3DA 5ER9A 4CQMB 2X0IA 3NDIA 5ES3A 4DPMA 3SXPA 1Q2XA 4IQ8A 1DC4A 2BFPA 3ZI0A 1ISFA 1NVMB 2PLAA 2GR9A 4J9VA 5K6AA 2OORA 1YKFA 3PIIA 1VSVA 5KVCA 1H5QA 4OXNA 1HDRA 3PPIA 5TGDA 5DBGA 1GTMA 2TMGA 4UVGA 3CEAA 1FMCA 1QMGA 1QG6A 3L9XA 3I52A 2Z1MA 3L9WA 2RHRA 1U2GA 3PJFA 4ZVVA 3IJRA 5JS6A 4BGUA 1NNUA 1UDCA 2O3JA 5A9SB 5KJCA 3B70A 1XYGA 2GF2A 3DBRB 1SO8A 1B26A 3NGLA 3OA2A 2IYPA 3V1TC 3Q2KA 4XYBA 1LDGA 4TMFA 5AQ1A 3JQGA 5JY6A 1X15A 1ZJZA 1GYRA 1HE2A 3DBHB 3OIGA 3TL2A 2YW9A 1GQYA 3HFSA 5IDXA 4TVOA 3GG9A 5JAZA 1HE3A 2AE2A 4IJVA 1ENOA 2I65A 4HUJA 4RVDA 4R3WA 2OOSA 3HDQA 4UVHA 3M1AA 1KVTA 3IDSA 3PWZA 4LVCA 4K6FA 4CV3A 5DZSA 9LDTA 4FDAA 2VZ9A 3RFXA 2HK7A 4JJIA 4I9NA 5L45A 4JJGA 3LQFA 2C2YA 5L7YA 3AM5A 3DMYA 5F1PA 5C7OO 3WTCA 4FR5A 5ENVA 4MVJE 3K30A 5TT0A 4GQAA 4Q3BA 3WWYA 1ZK2A 2NQ8A 1Y7TA 4M8SA 1ZFNA 2RH4A 3QW2A 1UJMA 3MCVA 1L7DA 4XDZA 1CQJA 3I4CA 4DVJA 3HNPA 5ER6A 2ZTLA 3FNGA 3NJ4A 1PZHA 3OJFA 3O9ZA 4WOJA 1R4MB 1IULA 2J3KA 1RM5A 4RLHA 4JCOA 4IDAA 1NFQA 4PFJA 1PQUA 2PD6A 5CDSA 1Y5MA 4CM4B 1EE2A 3GN2A 3PYLA 1ORRA 1GUZA 1NR1A 3K31A 5CHEA 5TQVA 3D5TA 1HDOA 3IQDB 3NT2A 3QSGA 4L73A 2NVUB 1JW9B 2OMEA 4PVDA 3EZYA 3DZKA 4BNKA 3FWZA 3GVXA 4CM7A 4YDRA 3WGTA 3BMCB 4U5QA 3RU7A 3DHEA 1YJ8A 2AG8A 3EVTA 4LSMA 2BFAA 4PLGA 3UCEA 4E5NA 3CPSA 3JYLA 1UUFA 4MVJF 3G3EA 2WYWA 4II3A 4XYGA 3VZQA 3FN4A 2EKPA 2CD9A 2DLDA 3INTA 4QSMA 3S2IA 1P45A 2HUNA 1CETA 1LTHR 1KBZA 2FOIA 3KLMX 3L0DA 4CUKA 2VQ3A 2ZK7A 5ICMA 4DGSA 1KEWA 2HDHA 4GI2A 3H5RA 3ROPA 4EI2A 3ONDA 4BGVA 5IG2A 5G4KA 1G0OA 2WYUA 4WNIA 5G2OA 1T2AA 4ALJA 3WGOA 5DF1A 1A27A 3VH2A 4AL4A 4CODB 4BKQA 3SLKA 1VLLA 1LXCA 3JD4A 3EUWA 3DXFA 1IE3A 1E92A 4IM7A 3CMMA 2YDYA 1H6DA 1SPXA 2B83A 2NU7A 3OBBA 2QRLA 1WW8A 2PK3A 2Y0EA 2GPTA 4J2HA 5KVSA 1MXHA 3JQ6A 5A9RA 3ROQA 1OOEA 4NDNE 1I32A 3ZV5A 3WQSB 3GPDG 4B8ZA 4IJKA 1ZIDA 1SMKA 3RJ9A 3FD8A 3KYDA 5JDCA 1NYTA 1PR3A 2Y0DA 4OQZA 4B4UA 3CIFA 4K9DA 3INRA 4LMPA 4AFNA 3C3XA 4BNNA 1V0JA 5G0WA 4CR6A 1PJ4A 2UDPA 3H9JA 1ONOA 4ZD6A 3DBLB 4BV9A 1HDYA 1VI2A 4MOWA 2J6IA 3WWZA 1T1RA 2IE0A 4BNVA 3QVTA 3P2OA 4PG4A 3E18A 3H7AA 5T6BA 2BI7A 2BFOA 4XD2A 3O8QA 3AI2A 3H9UA 3S2GA 3WNQA 3WQRA 1EVJA 1A9ZA 2I76A 4Y98A 2NLOA 3DHNA 3KTDA 4I9UA 3DR3A 3JYOA 3DC2A 4YBZA 3PDUA 3OIFA 3VDQA 3H4VA 1ZEJA 3SJUA 4NJMA 4CMBA 4DREA 3OEWA 3GRPA 2HMUA 3I23A 1FDTA 5FF9A 1BVUA 1HSOA 1F12A 1DO8A 1HWYA 4BB5A 1NBOA 1XQ6A 2I3AA 2NTNA 4LW8A 4PLWA 3I9MA 4LCJA 1BDMA 1WZIA 2Y1CA 4WASA 5DOVA 1GY8A 1EVZA 3CE6A 3MOIA 3Q0EA 5TS3A 4QECA 2PD3A 2PKQO 3QIVA 1X0XA 4AG3A 4OYRA 2NU6A 2WD8A 3VHRA 3WYCA 1GV0A 1ZKMA 4RZHA 1VKNA 2P9GA 4CMJA 4D79A 5B12A 1GZ3A 4Z3KA 2FZWA 1LQUA 4WLVA 3VVBA 2ZTVA 1U28A 4A26A 2CDCA 5JCJA 2AQIA 1U4SA 1O5IA 1GPJA 4J1SA 4JN6B 4DTIA 5FI5A 4D41A 4QT0A 3RQSA 1C3VA 2BKAA 1U8XX 1YL6A 4Q3DA 3GDOA 4WKGA 1TT5B 1O89A 3GF4A 2D59A 4OGWA 4XJTA 8LDHA 4FFLA 2VYNA 2FP4A 2SCUA 4E31A 1T4DA 3ZV4A 4A27A 3I9KA 4YQYA 1KIFA 2PR2A 4PZDA 1YS4A 2NU9A 4BQPA 4PRKA 3TOZA 3QQPA 4BNZA 3ADOA 2PY6A 2P2SA 4WLEA 2Y1FA 1VL6A 1W8DA 1EUDA 5KKAA 2Z95A 3KSDO 5CDUA 5IJZA 3JQ7B 4YJFA 3ZWYA 2WTBA 3CH6A 3GPIA 2EHDA 5IN5A 3MOGA 1UXJA 3WQQA 1NWCA 4TSKA 1AXGA 4E5YA 1P74A 1SEPA 1A5ZA 5U1PA 4HNHA 2JFFA 5HTOA 1BG6A 1UDAA 4TZKA 4AJPA 3ZNNA 4ESOA 3NDJA 1PQPA 2PGLA 1PWXA 4D0RA 2EP7A 4JP3A 2D5CA 1H6CA 1Z82A 3WMWA 4BNXA 3COSA 4XYLA 5CDYA 1LNQA 2EGGA 3C1TA 3IUSA 2X6TA 4Q9NA 3EK2A 4YAJA 5DDIP 4EUHA 3IIEA 3GMDA 4LISA 5U4QA 4DBVO 1PR9A 2AA3A 3ZWAA 2VWGA 1JWBB 4E2XA 4DYVA 3GEDA 4L4SA 4B7UA 1CQIA 2ET6A 2QIOA 1LDNA 1E7MA 1XELA 1E7QA 2HQ1A 4ND2A 2QW8A 1A4UA 4D46A 4FCCA 3T4XA 2OL4A 3FHLA 2B36A 3KETA 1Z75A 2J3HA 4YJDA 5A3JA 5A1TA 3OH8A 2X9VA 3F9IA 3I9JA 4WEQA 4BNWA 4P4LA 3AW9A 3EY4A 2NUAA 4RPLA 5B4TA 4B3IA 1SCUA 3WR5A 2ILTA 2VWQA 4FB5A 5IZCC 1T24A 1GV1A 4IQ0A 2DBVO 3WIEA 1E3IA 1A71A 4IINA 2HRBA 1UZMA 1UZNA 2FSSA 3D4PA 2BELA 1I2ZA 4PCVA 1IYZA 4M1QA 3HQ4O 4RZIA 4NK5A 4XX0A 4B4OA 3U62A 3ABIA 4J7CA 1OI7A 3OP4A 2G1UA 3ASVA 1KEVA 4L0QA 1OBFO 1ML3A 3PHIA 1T2EA 3ROMA 3PFWO 2EP5A 4NZ9A 1PWZA 2X5KO 4WCFC 1U7TA 1HTBA 1QRRA 3UF0A 5G0TA 3VH4A 4D3SA 3GHHA 9LDBA 3JQBC 3C7DB 1E1LA 1D8AA 1LLQA 4PLTA 3AUTA 1YWGO 4WLFA 2JJYA 4YJGA 4YJHA 3X2EA 5K6AC 5ILGA 1JU9A 5I9MA 3PQDA 3RKUA 2AEJA 5HM8A 3O03A 1FDVA 1HXHA 3B1JA 4D45A 2FPGA 3QV1A 2NU8A 4J3FA 1UXHA 2NTVA 3DZBA 4R41A 3L4BA 1K2WA 4AJJA 4L74A 1NHGA 3GZNB 5EMHA 3TQHA 4M89A 4WLUA 4GX5A 3PWSA 3GVHA 3RUAA 1E6UA 4OM8A 3UAGA 4WOKA 4AJIA 4CL8A 3LF1A 3K9QO 3B1FA 3RUCA 1EBUA 4OIMA 3IKTA 1E7WA 1M76A 4OSOA 4BNFA 1Z7EA 2Q2VA 1LLCA 1PX0A 2IDZA 4ZJUA 1ZK3A 4B7XA 4L75A 3LC2O 4DL9A 3ZU3A 3HWRA 3FWNA 5F21A 1LX6A 2FPIA 1I3LA 4HWKA 4CMHA 2O4CA 2JD0A 3ZHZA 3D64A 1YL7A 1VM6A 2HMTA 1R0KA 1AHHA 3RKRA 3WG9A 2IODA 2P4QA 2QG4A 4U8GA 1Q7BA 4A0SA 3QLJA 1WDKA 5EQDA 2I67A 3RUEA 3UW3A 3P19A 4UUPA 5T8KC 2ZJ0A 4AICA 1EZ4A 5TRTA 1YXMA 2HMSA 5AVOA 1ISMA 4Z9FA 2QRJA 2X86A 3Q2IA 4ND5A 4ILKA 4P4GA 1LJ8A 1Q0LA 4ZRNA 1WP4A 5JBIA 5A4DA 2O3RA 4J7XA 1O6ZA 3QWFA 2V6FA 3WGZA 1PJQA 3I9NA 2E48A 2AE1A 3NDRA 4IDGA 1EVIA 2NADA 2ZJ1A 1BVRA 2ZKLA 5BR7A 1J4AA 4ZQHA 1BXGA 1XCBA 4YAGA 2PH5A 1LSSA 4LN1A 3IJPA 5EJ2A 4EW6A 2CVZA 3WIDA 1K5HA 3D3WA 5JPIA 3PJEA 2VCYA 4EGFA 2OBNA 1DRWA 2YHIA 3K2EA 2G17A 2BFMA 1OZAA 4LCEA 5A5FA 1PJBA 3OHSX 1MB4A 2Z5LA 3PHJA 3D7LA 1H2BA 3V1YA 4H3VA 3GQVA 3WGYA 1BTOA 3QWHA 4GAEA 4BKOA 1FDUA 1C1XA 2IEDA 4MIEA 1PEDA 4IGFA 3MJVA 3TZ6A 4YRAA 3DQPA 1DLIA 1QP8A 3DTTA 4ZICA 3WFIA 3V2HA 4D43A 1WMAA 1XKQA 2LDBA 4AJEA 2PZMA 4HXYA 2O4UX 3PDJA 1BW9B 3FTPA 3PTZA 1EUZA 1ZH8A 3FRJA 1ID1A 3PGXA 3WDSA 1GADO 1XLTA 1LDYA 5G0SA 1E77A 4KUEA 4ALMA 1KEUA 4CR8A 5IXSA 3D0OA 3LLSA 4QX6A 4QTZA 2HLPA 3IP1A 2Q46A 4E32A 4Y8VA 1SOWA 2VNAA 2W8ZA 3CKYA 1B16A 3RASA 3H3FA 1Y8RA 4N5NA 3IMFA 5JAIA 1CRWG 2FY8A 1N7GA 3DFZA 3ZWXA 1IL0A 3EMKA 4E33A 2J8ZA 3EW7A 4CQLB 1V3UA 2Q50A 2VTDA 1DAOA 1WVGA 3H2SA 4URFA 5L40A 3TZHA 3EC7A 4CM9D 2NACA 1CWUA 1DBVO 2Q99A 2AQHA 3AWDA 3H3JA 1E3EA 3G1UA 3MJTA 3T7CA 4JBGA 3ZWWA 5G4LA 1K6JA 3TF5A 3T7EA 4JIGA 2FR0A 3GVPA 2ZYGA 3U0BA 1NQAO 1DEHA 3VTZA 5KTKA 2JCXA 3D3EA 1XSEA 4AJ4A 3I5MA 4HKTA 4FFOA 2X4GA 4L4XA 1T1SA 1FJHA 2WDZA 1XDWA 4MVJG 2DPGA 3TFQA 1VRWA 4DA9A 4UEJA 4O1MA 5DCUA 3ENNA 4I9HA 3AI1A 1RKXA 3ANNA 4EJ0A 1I33A 5L3ZA 2B35A 4LRSB 5A9TA 1H9BA 3JQAB 5KJ1A 5EL0A 1EDOA 3FBTA 4NHEA 4CM8A 5MDHA 2AW5A 4L9RA 1G0NA 1I3KA 3SJ7A 1NVTA 3W8EA 5CDTA 4JP2A 2VHWA 4GGPA 4O63O 3TFOA 3WYBA 4Z9YA 2DUWA 4F45A 3CXRA 3AK4A 2CFCA 4GSKA 1ZEMA 4YQZA 2G76A 3UCXA 2PH3A 2DKNA 3GDFA 3I83A 2FSVA 4EITA 1X1EA 3BTVA 4FPXA 4EUFA 4D7AA 2YFHA 4DMLA 5IZCA 2HMVA 1H94A 1NQTA 1B8VA 1HLDA 3B6ZA 3ANMA 1NVGA 1P31A 2RH8A 3D4NA 1LDBA 4H7PA 1I3MA 1GDHA 4JBHA 3F4BA 1T26A 3MTJA 2GN4A 3WBFA 1SBYA 3DAFA 4PLYA 2Y99A 4J6FA 2ZB4A 3ZGYA 5TC4A 4WE3A 2Y68A 1KC3A 4KP7A 3LT2A 3OSUA 1QXSA 3PXXA 4DPKA 1OAAA 2DTEA 4R9SA 1BRMA 5GZ6A 3K92A 5JXWA 2OFPA 4NBWA 2IZZA 5BSEA 3WGHA 4W4TA 2PV7A 5T5QA 4KTTE 1YO6A 3WJAA 3I3OA 5JY1A 4WCFA 3BMOA 1KVQA 3RSHA 4XEHA 5TJ9A 2A35A 3JQBA 3UICA 2ZQZA 1V3TA 3JQDA 2CDAA 3A9WA 4GVXA 4CR7A 1QLHA 2FWMX 2WE8A 3WOHA 3V1UA 5JC8A 4W7HA 2E37A 1P1KA 3E03A 2VT2A 1PGJA 1T2DA 2JHFA 5CG1A 2FHSA 1S7CA 1TVEA 2Y05A 4HY3A 3LT4A 4BNGA 4ALKA 1PIWA 3DO5A 4BNUA 3DTYA 5TJHA 1RJWA 2DFVA 3UGKA 1H0KA 2DPHA 2Y1OA 3ZN2A 3IUPA 2DBRA 4FGWA 2C54A 1Z7BA 1HE4A 4ND4A 5K0ZA 4IMPA 1YQGA 4I5DA 4YA6A 1MFPA 3I1JA 1Z45A 2HJRA 1FDWA 3CZRA 4Q3CA 3AM3A 1PQWA 1I30A 3C1OA 1E3JA 4KDFA 4E5PA 4OOEA 1N92A 4BGEA 2HSDA 5MGBA 2DTDA 4A03A 4BS9A 2J5QA 5B1YA 3PVZA 4RF5A 6LDHA 4OXYA 3HFGA 4K1LA 3VAZA 1BXGB 1SZJG 4YAEA 1DDOA 3HDHA 1I5RA 5A03A 4DUPA 4ZGWA 4AJKA 3GNQA 1DC5A 4OMUA 3PRJA 5TNXA 3JYQA 4CLEA 2B37A 2VWHA 4BGIA 3IP3A 3ON5A 4NG5A 1HYEA 2FMUA 2TMDA 2YUTA 2CVQA 2YHIB 4J90A 1C1DA 1MLDA 2WD7A 4YCAA 4MKRA 2JD1A 3WSWA 1A4IA 1XR3A 5T8KA 3ULKA 4Z0TA 5I7FA 3E5RA 1E3WB 3DZHA 4HFNA 3FR8A 1PTJA 4CUJA 1RWBA 2ZB3A 4NBTA 3ZU4A 3KO8A 4FJ2A 3E48A 3L07A 4Y6RA 3CINA 4NK4A 4CLXA 2AHRA 2CF6A 3HN2A 5LC1A 2O3SA 3IS3A 5I7EA 1R0LA 1X7HA 4IJWA 3SX2A 1E1NA 1U3WA 4UAGA 2DM6A 3RBZA 1VKOA 2O3TA 2ZQYA 1HDGO 1BXKA 4E12A 1Q0QA 1C0PA 1ZMTA 2PFGA 1Y5RA 4MVJI 2RIRA 1YQDA 1EEHA 1IPFA 1NQOA 5HA5A 3Q1LA 4RV9A 5DULA 1WWKA 2Y1DA 5A3VA 5ITWA 4CLOB 5KIAA 3KLPX 6ADHA 4CLHA 5C3MA 4OL9A 2C07A 3BZUA 3DHYA 4PG8A 2YQ4A 4W6ZA 5JCXA 3SLGA 4K26A 1P33A 3AY7A 2NNLD 1MC4A 4R5MA 3MJEA 5BNTA 1Y8RB 3SEFA 5L7TA 2Q1UA 1OC4A 4FOOA 1K0UA 4A73A 1LLDA 4MDHA 4WEOA 1JN0A 2I6TA 1DIRA 5IXYA 1HT0A 3WGQA 3F1KA 4IDEA 3I4FA 3OEYA 2Q45A 3FNFA 3WS7A 3FSRA 4A2CA 1V6AA 4CLRA 3IAHA 4R5HA 2GDZA 2VHXA 1NAIA 2GCGA 1HZJA 4CM5A 3UVEA 4RGBA 3VKVA 2GO1A 4JLWA 4C7KA 3OQBA 5EPOA 1CYDA 4K28A 3WNVA 5ENDA 2D8AA 2D4AA 4RL6A 3G1TA 3CMCO 3GGOA 3WBBA 2BGKA 3BMQA 3FBGA 3KRTA 4RF2A 1YB5A 1VL0A 1N1GA 1LRKA 2NV6A 4TVBA 3LT1A 1HRDA 1ZZEA 4XIYA 4GVLA 3L4BC 4BO7A 5TIIA 5TT1A 2X1HA 4ND3A 4BO5A 4UREA 4TQGA 1B7GO 1A7AA 3E1KA 4CMKA 2GZ2A 3ITDA 3BHJA 3MJCA 4R51A 1YOVA 4QXMA 4EUEA 3F6YA 1F0YA 3G17A 5GZ3A 1JKFA 2BD0A 1G1AA 3ETDA 3NEPX 2PTGA 3P7MA 1R66A 3GMSA 5JDIC 1IY8A 1O9BA 1I36A 4XWYA 1DRUA 3EGOA 1P44A 3O4RA 4CMGA 3F1LA 2VUSA 1NTOA 4NH4A 1YJQA 3QA9A 4RQUA 1NASA 4ALNA 4KZPA 3FTNA 4A10A 4AJOA 2C5AA 2JL1A 1N1EA 4M86A 5DN9A 1PJ3A 2IZ0A 4FS3A 4QFDA 1N8KA 2GLXA 2OZPA 1Y8QB 3GRKA 3GHYA 3BTOA 2I5PO 4E4YA 5JO0A 4PGFA 2B4TO 1VJ0A 3HADA 3GR6A 3HG7A 2Q3EA 2BF7A 1DIAA 4XB1A 1UXIA 1E6EA 1S6YA 1NWHA 2EG9A 3NKLA 1GYQA 4KQWA 3TRIA 5JC1A 1RM0A 2W2KA 3GFBA 3RFVA 3U4CA 2VUUA 4Q3EA 2EKQA 3BHMA 4Y6SA 4ZHSA 7ADHA 3TZQA 5COAA 8ADHA 5A06A 1NAHA 3EDMA 4D0SA 2GRAA 3AFNA 5L53A 2Y1EA 3TL3A 4MVJA 4NNJA 1MA0A 3E8XA 4GMGA 4YT4A 1KS9A 4QUKA 3I6IA 1U5CA 1ZBQA 1GPDG 4R54A 2OO5A 2UUPA 4NU6A 2JFGA 3V8BA 4S3MA 1DIBA 2QHXA 4GX0A 5GMOA 4BVAA 3STHA 1P0CA 3PWKA 1NXQA 1XIVA 4CUZA 1XHLA 5EINA 4FC6A 1GUYA
chains in the Genus database with same CATH superfamily
1D4ZA 2HK9A 3JAKA 1Y1KE 3KZVA 1GQ2A 3MINA 3RG8A 1W0KD 4NLLA 1FNMA 1NMXA 3LM8A 3MD9A 4GYJA 1C3LA 4RLSA 5DSXA 4BAGA 2QMOA 3K5IA 2A1TR 3LW8A 4FBLA 4MP6A 4QREA 2WQ6A 2C2ZA 2RCYA 3ZLUA 2QK4A 2BEVB 3MT8A 2ZR7A 3CX4A 2YDXA 2BUBA 3GLGA 3OJ0A 3QUBA 1BS1A 1XJQA 1ENZA 2PWPA 3TCKA 2Y27A 3SIPA 1FDIA 5J2UF 5IFLA 2JK1A 2VYVA 1XZNA 1XP8A 2QG9A 1P7PA 3WI7A 2PUFA 5EJ8A 2C2MA 4TWIA 2SHKA 3J80A 5F2EA 4DIFA 1EEXB 2O6HA 3LWDA 4UM5A 5ED4A 1CKEA 5D5PA 4ZCQA 5IEJA 5LOVA 3OM8A 3TDKA 4CCSA 1DE0A 2EXXA 1DS6A 4TTTS 3BL6A 4N0DA 3LY9A 4XIGS 5JARA 4NABA 5FQNA 2EZ4A 4ZHQB 5K45A 2RK6A 4PYIA 3ACCA 1NZFA 1G2QA 1YZVA 2QU8A 3W06A 3WGLA 4UMFA 5DXAA 3ZDFA 1Q91A 1QRUA 1U6IA 5H4GA 1XVLA 1MAHA 2LUOA 3CVYA 1SXQA 4M46A 2P90A 4UVDA 1FRQA 2Y6VA 3Q10A 1QZUA 2F2TA 1MAUA 5AO9A 1YVEI 3H2KA 2RJOA 4WY8A 3NTUA 1P77A 3WICA 1M1UA 4MQEA 1E61A 4WK2B 5M34A 2PUGA 1XC7A 3EXG1 2BTEA 4MPDA 3FLEA 1IQ0A 1YJCA 3TR0A 3T1YB 3LA6A 1ZUHA 5I9TA 2GAJA 2XBUA 3F8TA 3GEGA 3HPQA 3LX5A 2XXBA 2LD4A 2Q1YA 5F33A 2ZI5A 2CEAA 3H13A 4JVMA 1W76A 4F3TA 2C5FA 4L8WB 5SZJA 1P8JA 1EB9A 2VDRB 3IQEA 4Y1RA 4KQ2A 4YWJA 2A33A 3KOUA 3NHAA 2VBFA 3KTOA 3X1XA 3M9XA 2XODA 1LZKA 1LB1B 5F3RA 4IDPA 2EWMA 5LMUB 1JPJA 3LFTA 3I0ZA 4GBGA 4PO3X 4S1VA 2GNOA 3OPXA 4E5UA 1WW3A 5K7SA 1WXWA 3HDYA 1POWA 1YS7A 3O3OB 3BSSA 3S5UA 4L95C 3FB4A 3TN7A 5CB6A 3HH8A 2VNSA 4FHZA 5DTJA 3GX1A 4RD3A 1EE9A 5EWJA 4UHEA 4TX1A 4X41A 4DABA 1JG4A 1E1CA 3NALA 3DYIA 5IZ4A 4KFSA 2PA3A 1A2OA 1UR5A 3JATA 3VRHA 3R9WA 2GI4A 1TVMA 4BMSA 3CLTC 3IAEA 3QMPA 1T36B 2A1TS 1YI0A 2B8NA 3DEFA 3GUCA 2NXWA 3EEIA 1E64A 2YYZA 1U31A 5JXJA 1EH5A 2VDJA 2CBZA 1JUDA 3QG5A 3CUKA 4EECA 2WQ7A 1RR6A 1E5VA 1V5WA 1DRKA 3QBDA 2V7TA 1E1MA 4OHWA 1M2OA 3E7FA 2D3TA 4PPFA 2Z9CA 1KK1A 5I4KA 4O59O 4DUYB 1ZD1A 4KWTA 4ZOLA 3ZY6A 4TV8A 1F06A 4CEJA 3HVJA 1M3SA 4U1RA 4XD7A 3DLIA 1VI5A 3MSXA 2VDQB 3OTOB 2H4XA 3ZV7A 3A70A 1JG7A 1M8FA 4RHEA 3UEOA 1MQ9A 1WHSA 1BSVA 1WPXA 1DTEA 4G65A 2ZJ5A 4FSHA 4YP6A 3RTCA 5EIAA 4C7JA 2ZSIA 3KE8A 4MZXA 4PW0A 1EX7A 1AJEA 1EFRA 3R8XA 2Q5JA 3MT0A 2XGMA 1BE8A 4Q4JA 3FTFA 3S7ZA 4CM3A 2FWJA 3IXMA 1ZVKA 3IB3A 2NU7B 2YY6A 2QLNA 2JB9A 3FNEA 1KFKB 3RRFA 1DOHA 2VWPA 3WTBA 4RMIA 3RS0A 4HNQA 3W05A 2C95A 5ENZA 4ZI2A 4RQBA 3VDXA 5I9NA 2VYND 1IOZA 2GWHA 4Z1MA 4G3XA 1LUAA 5A3SA 4FE7A 5C9ZA 2GK3A 2PG3A 3KB2A 1QHSA 4F5ZA 4EIWA 3E61A 3M4JA 4JLMA 3GV0A 4GLLA 3O7WA 4ISBA 2AHOA 1QHIA 4YACA 1ZM2A 1V8BA 2VO1A 4N6GA 4YEDA 4YMIA 4AS1A 4KRFA 1JHAA 1KGDA 2XUDA 3V6MA 4PWZA 3VYTB 2G72A 3QE2A 4AT1A 4EJMA 1YL5A 1EWTA 2KM1A 1WOMA 1QOPB 1T10A 4IUYA 3FCOA 3DAGA 3G9UA 1D9ZA 3BMNA 4PGGA 1SFRA 2O8VA 1RVV1 5F1KA 2A7XA 2ZSDA 4LDNA 2IKQA 1N9GA 1SVLA 3SX4A 4UPEA 2ONJA 3EHEA 1UBTS 4M21A 2HDWA 3FFTA 2I3BA 2NSDA 1I94B 3NAMA 3QLTA 4MR9A 5IT9A 5DNYB 3ZHBA 3KHUA 3QTTA 1RAEA 1JFSA 4I9FA 3TW6A 4QJ3A 3SU8A 3ZU2A 2QOEA 4W99A 1PZGA 1NUAA 3O8OA 4J0EA 4TXHA 3IDZA 5DOZA 3EDOA 4YPFA 2J46A 2PQ6A 4RX1A 4F7DA 1ODTC 2GD1O 1US8A 1ZCZA 3TBHA 1SZDA 4O4HB 4AX8A 1Z0IA 2PJDA 3QOWA 2C7VA 3OTGA 3TQIA 2HU8A 3QHQA 2R2GA 4BKUA 4M49A 4OGFA 3DQQA 1M6HA 3P4XA 2Z6VA 3CO5A 4KAFA 4AKTA 3KAPA 2YNMC 2BGMA 3QOYA 3VHLB 1KZ7B 2PKRA 1Z88A 4NE7A 1EA7A 1Q83A 2XDWA 3K6JA 3QEKA 4KW7A 4TROA 2WWYA 5E6SA 5T67A 3DEZA 3DNPA 4LVNA 1NI5A 4B4WA 3G2PA 3DLBA 1HPLA 5D1NA 1SUWA 4EW3A 2WG0A 1W4RA 1WUYA 1ZMRA 3AHJA 3I2IA 3OT4A 4PNPA 4QOHA 4TMXA 4IGIA 5FIUA 3SF0A 3VPGA 3X1DA 2R9VA 5JLAA 1BJKA 1PSZA 5GY7A 3LDUA 3BF8A 4LK3A 4GX1A 4RVGA 1J6UA 1J9EA 1FP4B 1YTLA 2PWBA 2OLEA 3PQ4A 1TEZA 1MNQA 1C4WA 4UFPA 1WHTB 3DCJA 1Y6JA 4CKZA 4FQ7A 1XE3A 3B6EA 3GNLA 3RS5A 1FFCA 1U4NA 5DM70 5JYCA 3AP3A 4G0OA 3W77A 4DJAA 3PQFA 2QM0A 1NQWA 2DQ4A 5AUQA 4H15A 1K06A 4A8HA 4I5GA 4QNMA 4DWVA 1J97A 1Q3TA 1Z5GA 2MR5A 1AUXA 3KZCA 3UWPA 1EHIA 1U9ZA 3AESA 3DWEX 3EXG2 4GLOA 4JT9A 2WJGA 3K09C 3M9WA 4YRTA 4HDSB 4BFSA 2ZXEA 3OCCA 1DUSA 1E4EB 1T4BA 1ZI8A 2C7GA 2HA5A 2IL1A 3DHWC 3KR9A 2IVFA 3OLWA 4JOQA 2NU9B 3SQMA 2XUQA 2PX8A 2XQKA 1P1RA 4B6RA 1R37A 3STTA 3HI4A 1TQ2A 2N47A 4Y2GA 5IP5A 4MICA 1UZUA 1ZN2A 2HIHA 1NMEA 4ERXA 1NNEA 1C0KA 2VDKB 3VPHA 1RWPA 2BFDB 3MS7A 3KM0A 1Y9ZA 3MWEB 1XYYA 1FSFA 3HM9A 3RI3A 1R0RE 1P29A 5KYNA 4XXHA 1I0ZA 5KNDA 4GX2A 2JNWA 1FQJA 5ALNA 1GSIA 4HN4B 5LMNB 2ZYRA 1CIVA 2HNKA 3OZEA 4BB6A 1F0PA 1T9BA 3RROA 3JAMA 4IYJA 4RADA 5SYAA 4D57A 2VJQA 2Z2KA 1EDZA 1WU8A 1FQOA 3LP6A 5GM2A 3FETA 1E9AA 4GR9A 4U2EA 5DWVA 4TS9A 2JVJA 4D56A 1HYGA 2R7AA 2QSZA 1R4MA 4NMHA 2N42A 3QVUA 3UMCA 3IMCA 2IP4A 4G63A 2X0DA 4WLOA 2X7JA 1XZGA 1OX6A 5HR5A 3LBHA 4TQ9A 5EHNA 5TY0A 3TJMA 4ATNA 1QMPA 4NY1A 3E7DA 3BM5A 4FU0A 2ZXFA 1WKCA 3QPWA 4IDNA 1P7YA 1FYDA 2QX6A 2XQGA 1IOVA 3DL7A 4FDVA 2FQWA 3OFNA 1K7CA 2FOXA 1JAYA 3NM4A 4MV0A 3S2ZA 4FIZA 4RQAA 4JWTA 3EBLA 1HH4A 1I3NA 1T4CA 4P4TA 1GXSA 3HV0A 4K9KA 5FX2A 3PLRA 4E7PA 1QU2A 3HJNA 1LWOA 4M4SA 1HEYA 2IWHA 3UA4A 2XX3A 3A2KA 3PI7A 1F8FA 2G3YA 4IS2A 1J7JA 2VPPA 5AOVA 1Q1QA 3UB2A 2JFWA 1IATA 4PQFA 3Q7IA 1G9XA 1QX3A 4I8XA 4ZRDA 1NG9A 3Q9LA 1CZHA 3LQKA 1FPQA 1ZG3A 1UAAA 5CBKA 4YROA 1KMHB 4PO8A 3WJ7A 2I7XA 3NOVA 2ZYAA 3HB7A 5BW8A 1IN6A 4DNPA 1JLRA 1B15A 2PSSA 2QY6A 2X42A 1KMMA 2QYHA 2ZVJA 3LVBA 3LUKA 4CJXA 1P1JA 4YCLA 4M9XA 5JQGB 2FCAA 4OOFA 1G8KA 5A2QA 5D84A 4RY8A 1V96A 1SB8A 1ORVA 2H5LA 5FOSA 4CNQA 4PHHA 4JLNA 5FBVB 3DAPA 4ZVSA 4TXLA 4FFNA 5IT0A 3MELA 4HX5A 4XA8A 2AT1A 2EFYA 1JIVA 3FFBA 1NVVR 3OZFA 4FT4A 1JDSA 3TMYA 1ZC3A 1OI2A 3BERA 3C5HA 4KXVA 4OHKA 2AQ8A 2F1IA 3EG9B 3EZ9A 2M32A 3IE2A 3ILVA 2IYLD 4PWYA 4F84A 4KE6A 1AUVA 1DQZA 2Z2XA 3H65A 1W0CA 1NXTA 1GIAA 1RHJA 1YZTA 2XAAA 4YJHB 2CZGA 3M6FA 2V5UA 5D7NA 1L5LA 2B98A 4U2KA 3U4AA 3W9SA 1J2RA 5I4CA 1HDZA 5I4IA 5KTSA 4PRLA 2Z83A 4D9EA 1F7VA 1H1LA 5F2NA 3VZRA 1RRCA 4ECAA 3EOAI 2G83A 1SQFA 5AKHA 2WKWA 3OESA 4UZEA 2WHRA 5B6PA 4F4UA 5BMVF 3SQXA 3A2NA 3LOPA 4ER6A 2KBEA 2VPTA 3ZDRA 4DR5B 3T61A 1WUHS 2PGAA 2YCBA 4IUCS 1GCIA 2RC5A 4MW5A 4RVSA 3VNUA 3N2GA 2P9CA 5BVHA 3BSYA 4B09A 3JQRA 2YS7A 1FVHA 2RGAA 3RYIA 3VOAA 2HEIA 3KSUA 4EMBA 3CQ9A 1GZSA 2WJVA 3K2BA 2IZ5A 3BD8A 1SOMA 3R5FA 4MUEA 1HT2E 2ZRCA 1F8GA 5IN4A 1KPHA 2WZBA 3DULA 3GWGA 3QX7A 3HCOA 1X1BA 3UAVA 1AQLA 1QGUA 2P9JA 4MI3A 1O87A 3N6XA 1ZSNA 2RHTA 3G0OA 3P2KA 4WL0A 1QX4A 4D3YA 4F9GA 5LFAA 5GONA 3RQIA 1OIXA 1PR4A 1TVKB 2P9TA 4H3HB 2Y8EA 3ZJ5A 3O2QB 4KQIA 3BWCA 1YA8A 2HSEA 4HF7A 4DXHA 3BJMA 1LKZA 1U5BA 2AFIB 2KW5A 3PC8C 1L8LA 1ZMOA 2RE8A 2ZQ5A 3GT3A 5BOSA 2VTEA 2YWFA 5K9ZA 2YH2A 3A6GA 3S2FA 4DZRA 3FIUA 2J9GA 4D99A 2YJTD 1LFAA 2C3OA 1KQGA 3FG9A 1X7XA 1OGIA 3NP9A 4FGUA 5FPYA 5GIPE 4KO2S 3QY9A 3E4CA 4RZQA 2JLXA 1D8TA 5LDDC 2G5TA 1DRJA 3SZ3A 2VQDA 2GK6A 2YJ4A 4CCWA 1E9EA 2J59A 1Q7CA 1G8PA 1XX6A 2KLBA 2GD6A 4OMDA 3T1HB 2FN8A 4OXXA 1XPOA 2WUFA 3FGZA 3PNKA 4HDOB 4PINA 4PLFA 4MI9A 1FTGA 4BFXA 2PSFA 1JTFA 4Q16A 4JKOA 5CX4A 1KVRA 3PYXA 4S12A 3TQTA 1Q50A 2O3UA 1MEJA 3L01A 4NBSA 4C4AA 1JKXA 1XLWA 2HKIA 4ZT3A 2XDYA 3KYCA 1JIIA 2C9BA 3FCCA 4D6PA 4JGBA 4KLRA 4JJAA 3DE5X 4Z8XA 5AVKA 1M9NA 2R86A 1G5PA 5COQA 1G3MA 5IC5A 4MVJP 4B3HA 1IXSB 1SZPA 1YU9A 4EHLA 5FWAA 3C6ZA 4XWAA 5CUQA 1KOLA 3N9IA 2OQRA 3Q3IA 1QO0A 4INAA 5B2FA 2YNMA 1X92A 2ZYWX 1VB3A 4L4ZA 3PZRA 4E0BA 3K35A 1I2BA 4RDCA 4WKPA 1R0SA 3PHHA 4GKVA 4I1YA 4JLDA 5EKTA 1PZFA 4W5RA 3OZSA 3W79A 2NVWA 2E4XA 4J94A 3DV2A 2UYGA 2BEUA 4X93A 3ZNQA 3UWKA 3FTCA 3EGIA 3QF4A 1P17A 3G82C 4GOMD 2OV1A 3GJ7A 4FOTA 1CP2A 2EBHX 3P26A 3UTDA 1G8SA 4UEQA 1PS8A 4KEAA 1JG6A 1FSZA 1XZDA 4RJTA 3O21A 4MLZA 2AFHB 2WKSA 4FKZA 4KI0A 3QUSA 3OJCA 2QTWB 4I14A 3ICEA 3TECE 2P9BA 4PYLA 2GSDA 2CL5A 2OWEA 4R9UC 3CTMA 1B8UA 5GQSA 2PKCA 1JJFA 1ESNA 4N47A 3UA3A 1FRFS 2AB0A 3DBOB 1NQVA 1OTHA 2FWBA 2QVGA 2LIPA 2VDOB 5DIFA 3N70A 4FE3A 3BE8A 4D4KA 3ETEA 4IDHA 1I2MA 1AGNA 3QNWA 4I2VA 3MWGA 2BFFA 2PX2A 1A8SA 1ML4A 4P38A 4OQNA 4UOEA 1XD2A 1UAYA 3K09A 3TLAA 3B3GA 5L4SA 4ER3A 1QTIA 5G41A 5B58C 3PTAA 1VKRA 2BDEA 2LDXA 1XU7A 5I4BA 3I9LA 3EF3A 2WWRA 1W2WB 2K87A 5AXDA 4OJNA 4TZ6A 3TPZA 3GARA 4N5LA 4ZO4A 1BOFA 3ZK8A 4AAYA 3PLAE 5JMTA 1CJCA 1E62A 1XQYA 3CVJA 4RD0A 4FBGA 1J21A 4D1YA 1UPAA 2CUZA 2GPJA 2WTAA 4XIJA 4XDGA 4QUGA 4UVEA 4EATA 1PR2A 1CDOA 1R7RA 1S4MA 1IEXA 1RIIA 1TUGA 2W2LA 3IB6A 3RFFA 5JWRA 2G5CA 3HDTA 4B87A 2GYWA 3P71T 1QTQA 1IVNA 2E85A 3OUUA 2A94A 4IMRA 1N4DA 4AX4A 2O2DA 5G53C 4Y2HA 3FNHA 1U3UA 3DDSA 3IIMA 4PZCA 1JHUA 4CMEC 1ISRA 1KEZA 2Z1NA 1UBOS 1X14A 3FX2A 1L4EA 2X1MA 4RF4A 3UAZA 2EYUA 3W5DA 3B9RA 3K0FA 2XBLA 4YJ2F 5CBPA 5A4AA 1AUOA 1SUBA 1PUIA 2ZJBA 3OQPA 4UE6A 2G4CA 3NCTA 2XCTB 4C7XA 4B4VA 2ZVPX 4BLUA 4ZK6A 1J39A 2PDAA 4YQFA 2B2XA 4AZ3B 5AXBA 3EEOA 4J0IA 4NEHB 1RYYA 3H2ZA 3KXKA 4PM4A 3HUDA 1KSHA 4BFYA 1T8RA 4JROA 4BE7B 3IV6A 2XGJA 3BIXA 4K46A 1NV9A 3A11A 3KVVA 4M1ZA 4ER7A 3CJRA 2IU4A 4K6CA 1GTVA 4X6UA 1Y48E 2B78A 3RYCB 3UFBA 2H52A 3DF7A 1GZ6A 4HAVA 1IMOA 4S1TA 1EFCA 3QBEA 3KLNA 3UHJA 2QXUA 4AKEA 1J5EB 1JSZA 4KWCA 3H0EA 1KZ6A 2JI6A 3AOEC 1ZISA 1HEUA 3C3AA 4EWLA 3LQRA 2FN3A 4PFQA 4CETA 2HT1A 3DWFA 3V55A 2FHPA 5CA1B 2OR3A 4BJHB 3QHAA 3HC7A 4IXTA 1I3CA 3RWBA 5K09A 2P9QA 3IAAA 3OPQA 5LYJF 5JJBA 3C7CB 1G20B 3IVRA 4I6JA 4W9NA 1W9MA 5J58A 1GU0A 1MB0A 2W7TA 4LV8B 4RA9B 1VHQA 3HXKA 4X1OA 4Z9BA 5JCOC 2IIPA 1TO6A 4FFWA 4BRWA 3SMVA 2JAOA 3FCSB 5KWVA 2ID4A 1NXWA 1PI3A 1GA6A 2DFTA 3RRJA 5CLFA 1E1QD 3C1AA 3HJCA 3JASB 1VHTA 5IKOA 4LDZA 3EPRA 3WADA 2RHCA 5JH7B 2W90A 4BAUA 1EVQA 4QKQA 3R0VA 4YX9A 2QLMA 3ED5A 4D4MA 2ANBA 5K8CA 2FF5A 1ODKA 1X1DA 3A32A 3BMOB 1KYWA 2WAXA 2FPXA 3D6MA 3W6ZA 4AUKA 2O2JA 4DDHA 5I7OA 1FNDA 3GP8A 4OGGA 3MTGA 4TSFA 3BRWD 2V7QD 4OI2A 2FSHA 1CTQA 3BE5A 5EE1A 3ZZNA 4AN1A 3CEHA 3HA3A 2C5SA 2QT0A 1SHTX 1F20A 4IDFA 3ZHTA 4CGYA 1EAMA 3ZHQA 1YB1A 1HC7A 4RJJA 2BFWA 3L7JA 1HE8B 4W5TA 3DB2A 4MSUA 4ZQEA 3WB1A 1YBHA 4BNJA 5IABA 1R3DA 3B1WA 4DIUA 4MHTA 2JCVA 3CFYA 3N2EA 4OGLA 3A7DA 2FH5B 1PT5A 3FYUC 1CRLA 5FTWA 2P6MA 3QFRA 2XRYA 3D8NA 3HCAA 4HDNA 4QUHA 4LJSA 1CS0B 4R31A 4XJVA 5CH8A 5D86A 5BSTA 5B6JA 4UHHA 3WWDA 3ZI4A 1ZKDA 1W88A 4PYNA 4YMGA 3VO8A 5KVVA 1U7UA 5JTUA 3TGLA 5TE9A 3BGSA 4UOQA 2OHOA 2PWZA 2YY7A 3N7TA 2XUAA 5D1HA 2Y1KA 5ARBA 3PQCA 1BMDA 1NU6A 1H2AS 2YUIA 3C16C 3NWEA 4JU8A 4UM7A 3E8MA 2PX6A 5EKSA 4EBFA 4IWXA 1VJTA 2J5BA 1PL7A 1QK5A 1T2VA 2NVBA 1OH8A 1ZCBA 1R9JA 2UVDA 2FK7A 4TKZA 3RB8A 3OU7A 1MG5A 3PC8A 5T7BA 1YS9A 3HB4X 1XKLA 3K4HA 1GEEA 2UXCB 1QH8B 4ZV7A 5KCZA 4QAQA 4J1QA 3UOWA 2WF7A 4II7A 2R7MA 1S8OA 3E6AA 2O5CA 5FH9A 1R9NA 4CKCB 4EFDA 2DHQA 4LJKA 1NA5A 4U6NA 1K8XB 3RAFC 4ZKEA 1SK8A 2WD7B 3L8GA 5HPYB 1NBHA 1NW6A 3MTBA 1ZSYA 4LZJA 1MW9X 1VJ1A 3HDGA 3RCBA 5EMNA 2DLNA 4HQRA 4E13A 7REQA 2OP1A 3GFGA 1Y33E 2Y93A 4Y7DA 4K40A 4II2A 4P3NA 3SSNA 4BVFA 1N9KA 3C5VA 3M5WA 5BW4A 1R6XA 4GLJA 5FV4A 4KXQA 3RBXA 3VAAA 1DHRA 1NRIA 3O7MA 1X7YB 2IYXA 5MHTA 4HWOA 4JQOA 1MNAA 4CTOA 1EM8B 4KWEA 1J8FA 1GCOA 4WFIA 1HT3A 1SBCA 3MZ0A 3ZE2B 1OKKD 4XASA 5CX1B 4P58A 1KO8A 2J07A 1F6WA 4PZPA 3URMA 1Z08A 1X8LA 2BJWA 5FL7D 1N0WA 4WERA 1M72A 1X1SA 3ZHXA 3B6KA 3IOEA 3FOAA 4DAEA 3U7JA 2OP0A 4L16A 2ZRFA 1ZUNA 1AE1A 1KERA 1ZPDA 4G5GA 2ZP1A 5CB8A 1GNRA 2H92A 1DAEA 2A5LA 3UG6A 1DCFA 2NAFA 4TLCA 1K98A 3ZZUA 5KAPA 4EGJA 5DNUA 1KYIA 4D9FA 1TA4A 3LPLA 1H0RA 1TTHA 4Q1FA 2B34A 1ISPA 3H6KA 4TV9B 2DUNA 1AV6A 1QO7A 4YBRA 1EFHA 3HZRA 5AM1A 3DPSA 3H1PA 2R47A 1T9CA 5E9AA 2HYIC 5D5QA 2XUGA 1VGVA 1RPTA 2AYXA 4LYEA 1IQPA 1BFKA 1U8FO 5CA0B 5BSVA 2JH9A 4O2AF 3Q3CA 3EA0A 3VR6H 5FNVF 4E6EA 2BUCA 5MFZA 4PSAA 1RXSA 2CUKA 1IXZA 5CLQA 2GPYA 2E5LB 2HZ7A 4D5GA 2P2ZA 1IB6A 1PJSA 1CX9B 1L4UA 2C4UA 1J8DA 1OGYA 1U3TA 4ISCA 3DM9B 4A2WA 3DFUA 4LHSA 4R1UA 3IQHX 4RUKA 2QTGA 3BMQB 3LT0A 4BRUA 4YRDA 2AR0A 2Q3LA 2DX7A 4HVAA 4EDFA 2XF8A 1XRJA 4UW9A 1MKYA 2EFEB 1NXPA 1SVIA 2RONA 3KSZO 4RY0A 3O38A 3L43A 4REQB 2OYRA 4ZDIA 1RBMA 4BQOA 3AUAA 3PR3A 4K9QA 3RM3A 5YASA 2CVPA 1VBMA 3DXXA 4FMDF 2X3YA 1JDNA 2IYVA 1KH3A 4D3XA 1E6LA 1QORA 5F5NA 3C7TA 3IUBA 3BWBA 2JIPA 2GS9A 2FW1A 1BMTA 2FLKA 3K6KA 5CP8A 3V9PA 3IV9A 3ZCSA 3U4MA 1F3LA 4FYWA 1IHOA 3ZYZA 4REMA 4FE4A 4UNNA 4PIVA 1M2WA 1H6BA 5CCXA 1ORDA 3T1QA 2YWCA 1SA0A 2D5AA 5T3UA 4B76A 1LSUA 2VOJA 4LYFA 4EG4A 3H4MA 5A5GA 5IASA 4H16A 2G1PA 1VP3A 5AHWA 4ZYXA 1NYRA 1SXJE 5GPBA 2OZVA 1QR6A 2IEIA 3VV2A 1RHKA 4MXDA 2J08A 3F5FA 1EQUA 2QMQA 3ETCA 3VTFA 4A0GA 1CVLA 5KKCA 1J5PA 1UXGA 2HCBA 3IDOA 4ZIRB 5HYVA 2CUTA 4YP5A 3UMGA 1BNCA 2OCIA 2VUTA 4N18A 3JU3A 4L1KA 4P3YA 1L1RA 1YZNA 4LYJA 3WGUA 1F4LA 1IBCA 1ZRMA 3LHSA 4DCCA 1QYXA 4BFUA 5CEEA 2WF6A 3VJMA 4RJLA 5K0NA 4M1EA 2XCRB 4EB6B 4DYDA 2PBFA 3K1TA 4M76B 3SR3A 1YI1A 4CMEA 3A04A 4C0XA 1UJ5A 1Q6ZA 1QONA 4FK8A 5KMGA 1AQ6A 3BZBA 3ICWA 4EA9A 3GUYA 4JL6A 5FBKA 1W25A 5BYJA 1GNLA 4A23A 4BKMA 3IEVA 3CUTA 1GL7A 3PHCA 2YWDA 1ZOIA 2A30A 3TMAA 1QVVA 2EJCA 2JW5A 3D6UA 3ZTTA 2GM4A 4OFBA 4ESVA 1QP7A 3ENZA 4PXYA 1Y3AA 3G85A 1MU0A 1OLXA 3DZDA 4WCDA 2C5EA 4A7PA 3G2HA 1U4OA 3K9WA 3ZKAA 4EKIA 2PYZA 1EZ1A 2OO3A 2VZEA 3UFXA 3OTHA 3VR5A 4C0JA 2IS6A 3SC2A 1DLJA 1LS1A 1ZITA 3CR8A 4UBKA 3JALB 4U2GA 3WV4A 1CJVC 4COKA 2ZIFA 3KQWA 3LBNA 2Q0XA 4Y0AA 3PR2B 3U31A 1ADJA 1NW4A 5BN3A 4G2NA 1WV1A 4HNUA 1JX6A 4H27A 3AOEA 4XX1A 4OD0A 3BL8A 4E5KA 1PL8A 1XF9A 1MMFB 1RMYA 3OE7D 3WKBA 1KY2A 4WFJA 5JRDS 5KTPA 3CW9A 1CS4C 2XV1A 4GR5A 4WOBA 1IK4A 4F97A 3RU3A 1XVIA 3OQIB 2V96A 4BNDA 2H18A 1V35A 2NTJA 4UMVA 5EZYB 5JCOA 2D2IA 4U7DA 1W5AA 2ZBGA 1Y9EA 1XDDA 1FXSA 1DKLA 2E1PA 1JVSA 4IS3A 4KQMA 4NICA 4GKKB 1MORA 3H8JA 1Y37A 3R20A 3EBOA 2IRWA 1P0IA 1Q14A 2Z2IA 4BZQA 2JLWA 4KOEC 1R16A 4R2XA 1P2SA 1BD3A 2RHOA 1K1EA 1XXHB 1KHTA 4MGIR 2DPXA 4C29A 2Q07A 3A1NA 1YR7A 5EA2A 1D2HA 2BI8A 3RSFA 3WC4A 2I66A 3KFVA 4LDPA 4AZSA 1KWKA 4MB6A 1EWRA 4ZU6X 3WIOA 3GLQA 3B9PA 2Q2WA 3DBRA 3DONA 2QE7A 4YRRA 3E70C 1FNBA 2Q0SA 1SB9A 1MG0A 2FYTA 1O6CA 5AHKA 4AXBA 1YK1A 1YR9A 4PSVA 4BV8A 1CRPA 3GAAA 1D3AA 1ZHHA 4IHAA 1XA0A 4EI9A 4W82A 1NDQA 3P9ZA 1LK0A 4TKVA 4XQGA 2BH9A 2C04A 1VJ5A 4P8RA 3BHIA 1XZJA 2HF7A 3PHGA 1C50A 1ZH4A 2EZUA 5CT5A 3DLCA 4R2LA 4B79A 2OB2A 4QUJA 3AOGA 4A91A 3DLHA 1QPBA 1Z0SA 3EW9A 1WCIA 1RRMA 3IPCA 3PJGA 2NGRA 1E8MA 3H4TA 4QU5A 3AVWA 4R4JA 4JLUA 2GA9A 3FYUA 4G5FA 4LF5B 1HLPA 4ENRA 2V3VA 1YVUA 4OM7A 3S2EA 1QH1B 2PPLA 3CJTA 4C0AC 3UK6A 5GOTA 1KDPA 2O06A 5J4VA 5CYPA 4BUCA 3NVKI 3PNPA 4EJ6A 2Y0BA 5CW2A 4G5XA 3RBVA 1Z4IA 1UH5A 3LDHA 3MWDB 1UDRA 3B12A 3CU5A 3Q7QA 4KMRA 5KVQA 4EKGA 5FDFA 3JQAD 5CLGA 4DSUA 2XB8A 5JPDA 2HLNA 5BN4B 4GI5A 4W7SA 2H00A 2ZSBA 4Y0VA 5DCWA 5DK4A 1X80A 1R18A 3ZEAA 1N7HA 1SD2A 4V3CA 5TGTA 1Z68A 1J24A 3N8NA 5E8RA 1ZCJA 3CLKA 1JPUA 2O5RA 3LPDA 4MYHA 4RQTA 1QIDA 3DVAB 4C20A 2D1TA 2XITA 4I4CA 2RH5A 4JL8A 5KX5F 2VHQA 2BZ1A 2QTCA 4XDYA 3LIIA 5KYYB 4UBOA 1ZR4A 5JNWA 1LRLA 4FNAA 2OMKA 4MQMA 5GTDA 5AI0A 3EX7C 4BKPA 4TWRA 3PKZA 3PQEA 4ETMA 2PYDA 1YK0A 3QVOA 3EH2A 4UNPA 4XH9B 1MFZA 1E7RA 4G0MA 1FFXB 3ABQB 1ADFA 3AFMA 3ZNOA 5IC6A 3U3XA 3KOMA 3E81A 2XKBA 4NOMA 4I8DA 3PEVA 5T64A 4X63A 5J5CA 1Z2AA 5AOBA 1U2PA 2BKUA 2R0QC 4MW4A 4IDDA 1PZEA 4MW2A 3L8MA 1A8PA 1NXXA 1V5FA 2XYVA 1VIAA 2VRCD 2F62A 3L2OB 1RJFA 1HE1C 4F6CA 5IUKC 2M6LA 1SKQA 1UBRS 3C41J 4YUVA 1XAHA 4BN5A 3IPAA 1Z4QA 3AVPA 1OWPA 2EZTA 1QP0A 1NJFA 1PJLA 2PT5A 4IDQA 1OAOC 2ZRNA 4E14A 3L4KA 2HV9A 1GCUA 1EGMB 5TGZA 2UXBB 1LQ2A 4D8XA 2BSAA 4QARA 3HKEB 3DEJA 4IIVA 3J81A 3AB3A 3GCZA 3KUCA 2BL4A 5EWMB 1Z62A 3WMXA 1V8FA 2ZE6A 5ALOA 1HL3A 3I9OA 3LRTA 2PRZA 3PDHA 4JXKA 4ZQFA 3UT5A 2VH2A 2PMKA 4QM7A 4OQDA 2NO0A 2OZLA 2ZB7A 3N0VA 1E63A 2WUVA 1UKZA 4J0GA 4JEIA 4XPIA 5JDCC 1B8PA 2X13A 3RRXA 2SNIE 3RV4A 4AJHA 2F1RA 3LBYA 1J8YF 4MZDA 1QIMA 1XCOA 1E2JA 3DYBA 4MAAA 2NO6A 3ZTWA 3AVUA 3C4QA 3ER6A 4C3VA 1X9IA 2CYBA 3K6RA 3BILA 3L6RA 3PDIA 3W6UA 3X1KA 4JQSA 2W00A 5EESA 4W5NA 4IHJF 4G4JA 1ZAYA 3MJDA 1G6OA 4CHTA 5GINE 1FVFA 4QWMA 1M2EA 3ADBA 2E7ZA 4MYDA 2JD2A 2IFTA 5KZMB 3ONFA 4UUNA 4ZMSA 4JYZA 2ID8A 5TPWB 1NULA 3A9TA 3AUKA 3F67A 3QKSB 3DQZA 5JNSA 16PKA 4ZODA 1H3NA 4N54A 4FYKA 4B83A 2F3UA 3HKDB 4NFHA 4KG7A 2IT1A 1ZJ6A 1ZXBA 2HPVA 5AKXA 2OECA 1NLFA 5AM0A 1KEKA 2DT8A 1YDHA 4TT3A 1LPNA 1VDZA 3CF4G 3LL7A 3QVSA 4Y6PA 1ULUA 3E2PA 4X1KA 2W70A 1U8CB 1B2LA 1NHWA 3GL9A 1NVFA 1CFJA 6GPBA 1N6IA 2R6HA 3GROA 3U9LA 2IXAA 2OV3A 3MUOA 1LRJA 1WXFA 2VTBA 1EJBA 2JVIA 3TG2A 1JXOA 2QRUA 1TUIA 1WOYA 5G3YA 3OJWA 1KDVA 2BC9A 4H59A 2D0PB 5P8WA 1FFEA 4QBGB 4O4LB 1UBMS 1E96A 2GKGA 2ZSKA 4KV7A 5JWOA 3ITNA 3RAGA 3OWXA 4PHFA 4E4RA 1BWSA 4MLPA 4QEDA 2D13A 4YI5A 5CG2A 1S01A 2QJFA 2XTMA 1SVSA 3EFOA 3VPFA 3EGEA 3GOHA 4N5MA 5AJTA 1WXDA 2ORED 1NN5A 3FPAA 1NV8A 2MSWA 2V7EA 5BQPA 3RUHA 5KOJB 3E3NA 4Q1BA 4K9LA 1Q7EA 2H1CA 3LRXA 2AN5A 3L4JA 2A5YB 1XCMA 4Q1AA 3VJRA 2X0IA 3L92A 5ES3A 4ZAZA 5IKXA 1Q11A 1LI5A 4LBYA 1TOAA 4F96A 1Q2XA 1DC4A 1DG1G 1ISFA 4I2NA 3WK7A 4R7TA 1IRXA 3KHSA 2VXOA 4JXXA 3EC2A 4QNRA 5E1BA 4BXOA 4J9VA 2NSHA 4CIVA 1M1XB 5AMXA 3WL8A 3Q8XB 4NSNA 1RC1A 5JBQA 4AG6A 2CXOA 3ES9A 2PV0A 3DA8A 2JEZA 2XMZA 1NE2A 4TTJA 1X8XA 3L49A 4NYIR 2JIRA 1L8QA 1QG6A 3L9XA 9GPBA 2NZXA 3B6JA 1BAPA 2F3QA 4M1TA 5A71A 4BYMA 4DY6A 1P62B 3L9WA 1G8MA 1N2GA 1ZRNA 3G7NA 3QUAA 2DCMA 1D04A 2MINA 1JIKA 1S2MA 2KQUA 3HVHA 3BEDA 3MBKA 1PKEA 3PQ8A 4IH9A 4UDOA 5JS6A 1WUIS 4KBFA 1Y8ZA 1ZM3A 1IFXA 2DULA 1SCDA 5J4YA 2VSYA 3E8SA 2WA1A 1SHZA 1SO8A 3BB4A 1JSLA 2BKVA 3NGLA 2BEVA 4ZDWA 5D51S 5DM4A 5F98A 4P31A 1LDGA 2Q3MA 2R68A 2AKAB 4BTEA 2I62A 2I6FA 4D0NA 2A0WA 2GXQA 3A3PA 3C3BA 3R5KA 5CURA 1RMTA 2IEZA 1LPMA 1ZGAA 4L02A 2YW9A 1GQYA 3KQYA 2IGBA 1OV4A 2JEOA 3GG9A 2P3OA 5DNDA 1A8HA 2AE2A 5JAZA 2V6IA 1ENOA 1JEEA 5B36A 1C3OB 1WKVA 1XFDA 2Z09A 1RU3A 2ZYUX 2OOSA 1VHJA 3A6DA 1Y0BA 3A6KA 2BV3A 1PNVA 4V2IA 1KVTA 3WYNA 4AY4A 4YUXA 4PNHA 2HXYA 4LVCA 5JASA 5JNRA 1DXHA 3F3MA 2WI8A 5B6IA 2ZJOA 4DADA 2AX3A 3LQFA 1WULS 3A9CA 3WBJA 4ZHQA 2VJDA 4OFXA 3CONA 1KZ9A 4M9ZA 1WCXA 5U4XA 5JD6A 4OLAA 4FR5A 3UXEA 4MVJE 4N5HX 3WWYA 1ZK2A 2NQ8A 1USWA 3C87A 3MG9A 3MCVA 2OCAA 1KO7A 2I2AA 3UV7A 1F7UA 3K0SA 2XNKA 3FHOA 3NJ4A 3V4VB 4NCAA 3HB1A 1RM5A 4RLHA 2JIZA 1NFQA 1PQUA 4IIBA 1AS2A 2RH9B 2Q7DA 2ZI9A 3AJAA 1G19A 3H6HA 1RLMA 2QJRA 4JUFA 5CDSA 3Q3VA 1CUDA 3ROZA 3C98A 1TCBA 2UYQA 3EQZA 2X15A 4JWKA 4NFLA 4RVOA 4W1QA 5DHTA 5IJ9B 5F12A 1XMXA 5J40A 1H3EA 1XAJA 2GJ8A 3ZGVA 1L1QA 3I9V6 4YCCA 4IMIB 2GARA 2FPPB 2J09A 3K31A 5CHEA 5K3BA 3D5TA 1HDOA 4M60A 4UQPA 4PTLA 3IQDB 3QSGA 4E1VA 1EWKA 4MWSA 5B1IA 1ITZA 2NVUB 4JT8A 2PMCA 4NXNB 2OMEA 4Q9AA 2E21A 2PA0A 2JIDA 1O95D 3G9XA 3GLGE 1WM1A 3DMRA 4F7WA 2HR1A 3K0EA 2ZIAA 1TDJA 3FWZA 1WF3A 3MMPA 4RIGA 3BMCB 5DEIA 1W4LA 4TMKA 1E9FA 3U6BA 4Z4EA 4ARSA 5AUNB 2GKSA 2HA4A 4MVJF 1UUFA 3I04M 4FW9A 3WWOA 4RFVA 2WYWA 4Y6LA 2CEKA 3JPWA 1T36A 4QSMA 2VUHB 2HUNA 3K7EA 4EFKA 1LTHR 1I2DA 1KBZA 1GTZA 4RCZA 3S1SA 2FOIA 3TDNA 2FZKA 4Q1EA 4MAMA 4EI2A 1SPBS 4M88A 3R3YA 3WAKA 3LCRA 1T6XA 3T9BA 3UJAA 3U13A 4F2WA 3DKIA 1AZLA 2FDCA 4BGVA 3GFFA 3D3JA 1G0OA 4KK4A 4DRZA 3HKCB 1T3ZA 3OZUA 2QJWA 2H2WA 1BS9A 4OJQA 3H4IA 3LWNA 4ALJA 5C2JB 4D0LB 3AYZB 5JIBA 3RAEC 4CODB 4X6LA 3BK7A 4GXRA 5AK6A 3JD4A 2D62A 1U94A 1ZRHA 3EUWA 1OAOA 5CVVA 4ENWA 1IE3A 4KXWA 1QYIA 4X94A 3CMMA 1ZH2A 2CLCX 1NJ8A 2ZGVA 1G5IA 2B83A 2NU7A 1J09A 3GJQA 3OBBA 4QUBA 4RZUA 4J2HA 2GPTA 2WP0A 3R5XA 4JJ4A 3VTAA 2C61A 2X2OA 1EGQA 5JNUA 3ROQA 1OOEA 1UK9A 4NDNE 5EC8A 1I32A 3QTBA 2G9QA 1N5OX 2OQIA 3G9TA 4UDNA 3HFRA 3H2BA 2RB5A 2PUDA 1QS0B 2I03A 5IUNC 5JSUA 3B3FA 3FD8A 5JDCA 5LOVF 5JJKA 2FGKA 2W0MA 3UJHA 1RJ9B 3R76A 2Y0DA 4OIFA 4S24A 4B4UA 4RDXA 3GJXC 4FYVA 5JWHA 4AFNA 3ZDQA 3DW1X 1V0JA 4CR6A 1C7JA 5BWBA