4LMRA

Crystal structure of l-lactate dehydrogenase from bacillus cereus atcc 14579, nysgrc target 029452
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
312
Chain Sequence
b'KGINRVVLVGTGAVGCSYAYCMINQAVAEEFVLVDVNEAKAEGEAMDLSHAVPFAPAPTRVWKGSYEDCKDADLVVITAGLPQKPGETRLDLVEKNAKIFKQIVRSIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSARFRYMLGEYFDIGPHNIHAYIIGEHGDTELPVWSHVSVGIQKLQTLLEKDNTYNQEDLDKIFINVRDAAYHIIERKGATYYGIGMSLLRVTKAILNDENSVLTVSAYLEGQYGQKDVYIGVPAVLNRGGVREILEVELSEDEELKFDHSVQVLKETMAPVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase 1
publication title Crystal structure of L-lactate dehydrogenase from Bacillus cereus ATCC 14579, NYSGRC Target 029452
rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
total genus 101
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lmrA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4lmrA02
1KEVA 5CP8A 1MFZA 5A05A 4CLOB 4WEQA 1MLDA 3L07A 3P5SA 1RM3A 1Q0QA 3LT4A 5L7TA 3NDIA 3ANNA 2IEBA 1EUDA 3BMNA 3WGQA 4Y67A 1P1IA 4GX0A 2P2SA 4IS2A 4E31A 1NAHA 3RJ9A 2DQ4A 3DOCA 2PGJA 3KYCA 2PZJA 3RC9A 2CDBA 1DSSG 3ORFA 4HWKA 4LW8A 3U9LA 2QQ5A 5CEFA 3NJ8A 3ON5A 5C37A 4PRLA 3A9WA 2X1HA 2ZJ1A 3IUSA 1XWFA 3COSA 4GX2A 3WGHA 1M76A 2GUGA 3NAQA 1AHIA 5A4DA 3KYCB 4XJSA 4YJHA 4H16A 2VTEA 3DC2A 1DC4A 1O8CA 1T4BA 3ADOA 3GGPA 5JXWA 4LSWA 4HP8A 5B37A 1WDKA 4JGBA 5H81A 4NMHA 4G5HA 4W99A 4NBTA 4W9NC 1U4OA 2A94A 3K5PA 5IDQA 3ZW9A 2O50A 4YJHB 1DC6A 1NQOA 2EW2A 1XLTA 2BFPA 3GFBA 1YO6A 4XYLA 3RASA 3RBZA 2OBYA 4NFHA 2X5JO 3WYEA 3F4LA 3GY0A 4CMIA 2YV3A 1BVUA 1Y8QA 5KKCA 2ILTA 4LVCA 3R6DA 2EGGA 4PVCA 3O38A 2DLDA 4LRTB 1JWBB 4XB1A 1CERA 4CLEA 1NHWA 4GAEA 5EINA 4CODB 3PZBA 1UAGA 4IY1A 1SOWA 3OJOA 3OA0A 4MVJF 3P2OA 2BLLA 2VOEA 4CMIB 1AXEA 1LSJA 1DAPA 1Y8QB 1QR6A 2Q49A 2VNAA 2X9NA 3X2EA 2Y0CA 4YAIA 1E5LA 5DNAA 3Q3CA 4GLLA 1PJBA 4IQ8A 2EP5A 2NVBA 5COAA 5U1PA 5LDHA 3HWRA 4MVJD 3ZN2A 4J1SA 3E82A 4R68A 4KP7A 1Y8RA 3E8XA 1WPQA 3OFSA 4J2HA 4L9RA 4UEKA 3GEMA 4YEDA 3SJ7A 3VVBA 3ZGYA 4R3WA 4AJIA 1B16A 3O4RA 1U8XX 4P38A 2X22A 3UUWA 1I01A 3ZNOA 1QXSA 4CV0A 1QLJA 2Y1OA 3EZLA 1X1EA 3KYBA 3OQ6A 1EFKA 5I8WA 3D3WA 3VH3A 1JAYA 4PLZA 5JW6A 5JCJD 1R6DA 2FZEA 3AUUA 4BNJA 1Y8RB 1I8TA 2VWHA 5CPBA 1U7TA 3RBXA 4IJVA 4A5OA 3I3OA 4FJ2A 1VSVA 4J16A 2BGLA 3JQ9A 4BMVA 1UZMA 4D3FA 1JDJA 1N7HA 5G0VA 3QLJA 1N5DA 4MINA 3D3WB 1HSZA 1VM6A 2E82A 1DIAA 3DHYA 7MDHA 1HDZA 4FGSA 3I1JA 3LC1O 2IZZA 3PK0A 1C1XA 4LK3A 1TVEA 3VZQA 2VZ9A 4XZ3A 3I5MA 4LSMA 1ISIA 4P8RA 1BXGB 1QV7A 2NADA 2OP1A 2G76A 1QP8A 4GBJA 4KUEA 5KJFA 4XQEA 4DXHA 3DL2A 3DTYA 2YV2A 1DPGA 3L9XA 3ABIA 3D5TA 4M55A 1QYVA 3SBOA 2UV8A 2NU9A 1DIHA 3DZKA 1PJTA 2DTXA 2DU8A 4JQCA 1P33A 4AJ1A 1ZKMA 1PU2A 3RQSA 1MXHA 3RFXA 1RM0A 4BS9A 1N2SA 3CSDA 2PKQO 2VRCD 4FFPA 4O6VA 2Y1CA 3G1TA 3DOOA 1FK8A 3H4VA 1I0ZA 2PFGA 1HYGA 4CMJA 3F6YA 1T4DA 1CJCA 1WLYA 4JNKA 3WLFA 2AG5A 1EZ4A 4B79A 4CUKA 4PN3A 3VPFA 3H5NA 1KERA 4WASA 2CVQA 3GG9A 1K6XA 4IDDA 4NHEA 1DBVO 3BAZA 2HAEA 4ZICA 2C29D 3ZNNA 5KJ6A 3VPGA 2AQKA 3WYBA 1UZNA 4NK4A 4KUHA 5KVSA 3OM9A 1MXFA 3INRA 3K2BA 3F47A 1SEPA 3C85A 5L40A 4WK6A 3KHUA 2HJSA 3F4BA 3FPCA 2I76A 3GNQA 4CLRA 5I7VA 5LDGA 1EE2A 3C1OA 1Y81A 2A9FA 3ONFA 1JN0A 2IXBA 3K9QO 2GZ2A 1JA9A 4D43A 3BHMA 5DF1A 3TPCA 3WR5A 2V6FA 4LCJA 1PGJA 3GUYA 2VRBA 1N1GA 1Z74A 3GDFA 4YAKA 4B4VA 2ZB4A 1XCBA 4CLRB 2HU2A 3FWZA 5T6BA 5JY6A 4LMPA 4AFNA 3OETA 2CD9A 1EK5A 4B3IA 3WQRA 5JAMA 2NWQA 3LF2A 3BHJA 2B0JA 2ZTLA 4RPKA 3EDMA 4FR5A 4BO8A 1NFQA 3FTPA 3IUPA 3K2EA 3VTFA 3NYWA 1G0NA 3IMFA 1J4AA 2ZTUA 5ENVA 1PL8A 1WP4A 1QG6A 1GZ4A 2QIOA 1MGOA 1PZHA 3QVOA 3RROA 1A9ZA 2DBQA 3JV7A 5F1PA 5KJEA 4R9RA 2D5CA 3LLVA 4ND5A 4E2WA 5L9AA 5L95A 3GHYA 4QTZA 5DZSA 1PS9A 4EUFA 1DFHA 3HJAA 4BKOA 3M2TA 3RWBA 1QV6A 4G81A 4IUYA 1BRMA 3ETDA 4DVJA 1EMDA 2H1SA 2ZJ0A 1IY8A 1HZZA 3DBHA 2HMVA 1GEEA 3GAZA 4R1NA 5IN5A 3C1AA 1ZNQO 3WB9A 1O6ZA 4L0QA 5CG1A 2FOIA 3MJSA 1TT5A 1VKOA 2BHLA 1C14A 1EVZA 3ZDFA 1B3BA 2HCTA 3RKRA 1NASA 4E2YA 2P4QA 3I4FA 2A35A 2Y05A 1VPDA 4D46A 3DBHB 2VT3A 3GMDA 5JMPA 1V3VA 4XR9A 3LC2O 4S1VA 2PK3A 1JAXA 1I24A 3AFMA 3AI1A 3U62A 4CM5A 3TSCA 1TT5B 4F46A 2PZKA 5EESA 3ITKA 4ZD6A 4YA6A 3QSGA 2J3KA 2C7VA 2NACA 3DAFA 3PI7A 4UUNA 4I5FA 2BI8A 3FF4A 2CDCA 2JJYA 1E3LA 1YONA 1C0PA 2OMEA 4NFSA 5BR7A 1GYQA 4NDNE 4PG7A 5I7EA 2NV6A 4DBVO 1I3KA 4XIYA 1A5ZA 4OQZA 3I23A 4R4JA 4WGGA 4XDZA 3WJ7A 3GVCA 1EQUA 5I7SA 2QZ9A 1ZSVA 2J3JA 4MJLA 4B4WA 4QQRA 1HKUA 3RD5A 1E7MA 3NGLA 4F6CA 2I3AA 2Q99A 4KUGA 1TXGA 1XU7A 3HE3A 1T24A 2OORA 1M66A 2J8ZA 1IZ9A 4QXMA 3EYWA 2GDZA 4NNJA 4GQAA 1M67A 4UREA 3H3JA 4LISA 3TZKA 3W6UA 1HDRA 2G5CA 2X4GA 3PLRA 3E5RA 4CV3A 2HO5A 5COBA 4PLTA 3QP9A 4HX5A 3GR6A 4YQZA 1FDUA 3IJRA 1OC2A 1SO8A 4D0RA 1C3VA 1F0YA 2CF5A 2WD7B 3IS3A 4WLOA 3SJUA 1XHLA 1PR3A 3HG7A 3GVHA 2VYND 3B1JA 4R01A 4TRRA 3UCFA 4BNYA 2CMDA 5ER9A 4ZGWA 1RWBA 4FW8A 4E13A 4D41A 3RUCA 2B37A 3D1LA 2FWMX 2Y66A 1V35A 2D4AA 4XJTA 1WZIA 4PCVA 3K96A 2AQIA 3PFWO 2DUUA 3WQQA 1UR5A 1H5QA 1T25A 1XQ6A 2DBVO 2O3QA 3RFTA 7ADHA 5AXAA 4IIVA 2Q1SA 1YL5A 2W2KA 4M49A 1N1EA 3FSRA 3VKVA 4CM1A 4TWRA 1GV1A 3TN7A 2QW8A 3Q11A 4XWYA 3WXBA 3ZV6A 4I8XA 4ALMA 4DPLA 1DHTA 4RCVA 4A26A 3AU8A 2DTDA 2CY0A 4R5HA 5EJ2A 3CEAA 4QT0A 4JBGA 3F3SA 1GL3A 4MPDA 4XR4A 1KOLA 3LYLA 1EUZA 2RCYA 2C2XA 1V9LA 1YB1A 1AE1A 4OIMA 4OXKA 3NJ4A 5G0TA 3H3FA 5U4QA 3CUKA 3H2SA 3AJRA 2F00A 5JDIC 4NJMA 3IAHA 3IIEA 5CDUA 2XOXA 2AEJA 2NU8A 1Y9EA 5K0ZA 1GD1O 5TSDA 4NBVA 3NKLA 1EBFA 1R12A 4YJFA 2DPHA 4DYVA 5IZCC 1ADCA 2HLPA 2ZIZA 4U8GA 2YQ5A 5JBIA 3FD8A 3P19A 3K8ZA 4HFNA 1LSUA 1R66A 3INTA 3RKUA 3LDHA 3KZVA 4Z9XA 1SMKA 1NXQA 2TMDA 3RUFA 1EDOA 2ZKLA 2JCYA 2VWQA 4XDYA 4YJFB 2X7HA 1DJNA 3ETEA 4PLHA 3H5RA 4D44A 2NNLD 4U7WA 3WNQA 4OO3A 3S8MA 2BELA 3TRIA 1U2GA 4RF5A 5KOIA 4BHTA 3RJ5A 3UOGA 3PYLA 3UKOA 2Q50A 3AW9A 3JYNA 4Q3DA 4TVOA 4RVSA 3MWDB 4IGEA 5EL0A 2A92A 3T4EA 3PRJA 5T8KC 1U4SA 3H9EO 3L77A 3WBFA 2I99A 2Q1WA 3AFNA 3UF0A 3KSUA 4W4TA 4RV9A 4B4UA 3PHGA 3LSYA 5DCUA 4GWGA 2C7GA 9LDBA 1RPNA 3FNGA 2PR2A 3C7CB 1YE3A 3WGIA 4R1UA 4YDRA 2DBZA 1YXMA 4J1NA 4OOFA 4CJXA 1MB4A 4NU5A 3AUTA 4LMRA 1GU7A 2DM6A 3G79A 2DFVA 3PGJA 1EK6A 1CYDA 2FMUA 4P4GA 4ESOA 4PG5A 2NM0A 3DDNA 3B70A 4NFYA 4R51A 2VYVD 2FY8A 4FC7A 5KIAA 4XGIA 3ONDA 5DDIP 4A27A 4AJ2A 2WSBA 1CRWG 3DFUA 4F3YA 1T2CA 4ZQFA 4MKXA 3WG9A 3PHIA 2DBRA 2P4HX 2B5VA 1SPXA 1PZEA 3BYZA 3N58A 3PJEA 2UUPA 2WEKA 1V3UA 5IZCA 2D8AA 4PVDA 2I5PO 1R0LA 1F12A 1YL7A 4A10A 2Y0EA 3DTTA 4FDAA 3KRTA 1TT7A 1ADBA 1PJ2A 3D64A 3OIGA 2GSDA 4NIMA 3TL3A 1R37A 3RU9A 1KVRA 4NBWA 3KSZO 4Q3NA 4Q3CA 1A4UA 4FFLA 4IZHA 1ZXBA 3TFOA 4XEHA 1ORRA 4KTTE 5L4LA 4QSMA 4Q3EA 4AJEA 2GN6A 4ZN6A 1RYDA 4E21A 4GLOA 4GVLA 3EK2A 3AI3A 4M54A 1EE9A 3Q9NA 1R0KA 2O48X 4PLCA 4PG8A 2EXXA 3RIHA 3P7MA 1ZBQA 4YAJA 2I67A 1P1HA 3EUWA 3PYMA 1JKFA 4B3HA 4DTIA 1K6JA 1G6KA 1YB4A 1LLCA 3VOSA 4A03A 1HYEA 4RGBA 2H6EA 4NI5A 4TZTA 3ZCXA 1PTJA 4LVUA 5IFLA 1YJQA 4EEZA 1ML3A 4Y8VA 3INGA 1I2CA 1CQJA 3JYOA 1UAYA 3ZWAA 2GZ3A 5JCJA 2VNSA 3JD0A 3I52A 3KLMX 3KV3O 3PP8A 4HUJA 4XQGA 1N7GA 2EV9A 3GDOA 3ZWCA 3R3SA 4M1QA 1F14A 4MIEA 1PWZA 1D4FA 3V5NA 4YRBA 2IDZA 2QRLA 3M1AA 3UXYA 4BNZA 1ZO8A 4BNFA 2CFCA 3GEGA 4C7JA 1E1NA 4OSOA 1KS9A 3GDGA 3JQ8A 5DN9A 1LLDA 3WWYA 3PVZA 2QRKA 3R3JA 3ROKA 3KO8A 3GZNA 5EPOA 1QKIA 3RUIA 3KYDA 3LT1A 3JTMA 4BNHA 1GY8A 2EERA 4IQ0A 3DAPA 5ICMA 4BQPA 4CQMD 3VPXA 1OOEA 3Q2KA 4M8SA 4DA9A 1ZH8A 4BNNA 2OBNA 3CE6A 3JQ8B 5CDYA 5JAIA 3OA2A 1A71A 3H9GA 5TT0A 2P91A 3GZNB 3VVCA 1K89A 2IZ0A 3DFZA 1JKJA 4GSLA 4IPTA 4MKZA 4U0KA 1BXZA 3KYDB 4D3SA 5L51A 2VZ0A 1FDVA 5JO9A 3UW3A 3AWDA 1LTHR 1SZJG 1DRUA 4LGVA 3PJDA 2W4QA 4M86A 1CDOA 2BGMA 2PH5A 1H6AA 4YVFA 5B1YA 5HS6A 1MC5A 4ZJUA 5AOVA 2IEDA 3ZU2A 3AI2A 1X1TA 1ENZA 3JD1A 4EJMA 4KTVE 4F45A 1B3RA 2AHRA 2Z1MA 1YBMA 4CLHA 3GRPA 4BO5A 1E3EA 1NWHA 5THQA 1XSEA 4ID9A 4UEJA 1XIVA 3RC2A 3L6OO 1R4NB 2PY6A 4RPHA 1Q0LA 3L6EA 1MA0A 4HFRA 1R16A 3K92A 5I8ZA 3GPDG 3QV1A 4K26A 1X7GA 4G2NA 3ZV5A 1NAIA 5IN4A 4BMSA 2WTBA 3MTGA 3PWKA 4ALJA 1JWAB 3Q1LA 3IJPA 2IRWA 1HE3A 3G1UA 5L4NA 3ZV4A 3OJEA 4OM8A 1HTBA 4YT4A 1H94A 5G0UA 2ZCUA 4BMNA 1XA0A 2OZPA 5TF4A 4DBZA 5A03A 3S2FA 3ZWNA 4J49A 4YCAA 1P1RA 4GMGA 1EVJA 3OEWA 4AVYA 3CINA 4XIJA 1YKFA 1IUKA 3BTVA 1ZUD1 5L4SA 2C5AA 1ZSNA 2P9GA 5ES3A 4AL4A 1XGKA 3ANMA 3L4BC 4TZKA 4DMLA 1GCOA 1A4IA 1QORA 1Y5MA 4J2OA 4CM3A 4CM4A 3JQ9C 3ZHZA 1I33A 2PZMA 2ZTVA 4YBZA 2BF7A 1R0SA 1PZFA 3V2GA 1P77A 4K9DA 4K28A 4WPGA 2EKQA 3GVXA 2O7SA 2WYUA 3V8BA 1YQGA 4UVGA 3H8VA 1CETA 4IXTA 4IDBA 4CM4B 2B35A 2P9CA 4RVDA 4CMEA 3RI3A 1PQPA 3TF5A 1GQQA 2Q2WA 4BQRA 3FCOA 3PTZA 1PJQA 1UJMA 2JHGA 4O63O 5L3ZA 4DL9A 4YXFA 2P5UA 1GQ2A 5EQFA 2VHXA 1PL7A 3CMMA 1P1JA 3WSWA 4N5NA 1YGYA 1J5PA 3GVIA 3H2ZA 4ZRMA 2BI7A 1Y9AA 3DONA 3PJFA 3PDJA 1EDZA 1DRWA 4UULA 2IODA 4PIVA 4BOYA 2EIHA 2Q4BA 1LDBA 1OI7A 1ZK4A 4IDCA 3SLKA 1U5CA 3U0BA 1UP7A 1ZSYA 4OQYA 5T67A 3OJFA 1Y1PA 1G1AA 3PWSA 1HETA 4B3JA 1GZ6A 5JYDA 2CDAA 2C2YA 4UVHA 5DCYA 3HZZA 1LU9A 2QYTA 3W1VA 1ULSA 3PZRA 4FFMA 5ENDA 1PWXA 5C3MA 4XRGA 5EIOA 3F5SA 5BNFA 1Q7BA 1KEUA 1NHGA 4YB8A 3BMCA 2Z1NA 2B4RO 1GFSA 2J3HA 3QVXA 1PGPA 4OGWA 1BG6A 2GPTA 4E2XA 1AHHA 4BNVA 4N54A 4E4YA 1UXGA 4J7XA 5IXSA 1ZIDA 2D2IA 4BL5A 3L4BA 2OUIA 2X0NA 3SXPA 4Z3KA 3S55A 1GUYA 2FZWA 1BXGA 1JVSA 3KEOA 4E0BA 1X15A 1NFFA 3PGXA 4DMMA 2C59A 1E5QA 3BMCB 2ZATA 2W8ZA 3EC7A 5TC4A 1NP3A 4JN6B 1P3DA 2DUWA 2HRZA 3C7AA 3HADA 1DLJA 4DLLA 3I83A 2Q1UA 1U1IA 5AXBA 5IDXA 4MVJE 2NU7A 4Z6KA 2C20A 5JNLA 5K6AA 5HWSA 3U09A 4S3MA 3BTSA 1ONNA 3UAGA 1ISJA 2VN8A 2DFDA 1QYWA 3AUAA 2YJZA 1TEHA 3DO5A 4CR6A 1S6YA 1HWYA 4CL8A 5CDGA 3WYCA 4XGKA 5A5EA 3WFJA 3DR3A 2Q3EA 4WLFA 4PLGA 1XKQA 4PG4A 4RZIA 3JQAD 2O3RA 1Z82A 4OHUA 4UVEA 4IMRA 3WFIA 1LDNA 2VYNA 1H2HA 3LLSA 1ZK1A 3VH1A 1YQXA 2PD4A 4W7IA 3MOGA 2YFHA 3GQVA 5FFFA 1NR7A 4R5MA 1WMBA 3NX4A 2RH8A 4RLSA 1ZK0A 5T57A 4RVUA 3GVPA 4CUZA 5L7YA 1HRDA 1LDGA 2EF1A 4BV9A 4DC0A 1UDAA 4R41A 5IDWA 2B69A 1QYDA 4MDHA 4CR8A 4DIBA 5A1TA 2CNBA 2Q45A 3MJVA 3WSVA 1K6IA 1U7HA 2E48A 1B8VA 4KDEA 1GDHA 1I5RA 1F06A 3AY6A 3N7UA 5GZ6A 1GUFA 3NEPX 1F17A 4AJLA 1DC5A 3G0OA 1X7DA 1DHRA 4E6PA 3CIFA 1U5AA 4DRYA 3LZ6A 3H9JA 1I2BA 1UXHA 1MG0A 4WLEA 2G82A 4L73A 5B4UA 2FPPA 1E3SA 4OYRA 5KCZA 1BHSA 1N92A 4L4SA 5TQVA 1P74A 4XYMA 3ZNQA 2ZYAA 4IZIA 4W82A 3WMXA 2F1KA 2EJVA 3WJAA 4EJ0A 4GSKA 3ROPA 1ULUA 3ANLA 3QRWA 5A04A 1WW8A 4JBIA 1ZXLA 1U3WA 4WOKA 3VH4A 1PS0A 2FP4A 1LC0A 1AN9A 1DIGA 1D3AA 3PJGA 1LDMA 1YDWA 4YRAA 1W4ZA 3ZZNA 4NBRA 5DOZA 2AQ8A 6LDHA 3RC7A 3FBGA 1VL8A 2GASA 1D1TA 2VHYA 3ZWYA 4NQZA 1Y6JA 5L53A 1ISFA 1MV8A 1TA4A 3NDRA 4EBFA 3IP1A 1FMCA 1G0OA 2EEZA 1N9GA 1U3UA 4CM7A 3GZ4A 4H7PA 2GRAA 4RPLA 4N18A 4YTEA 4J4HA 3GHHA 1J49A 1KBZA 1E7YA 2QYSA 4TMFA 3MOIA 4E33A 3BTOA 2B4QA 5EN4A 3ZWBA 3NGXA 1X0XA 1LSSA 3GLQA 5C7LO 2UVDA 1VJTA 3PIIA 1N9GB 3QE3A 5TNXA 3WDSA 5IG2A 3DHNA 3TDKA 4BKRA 3T7CA 4MO2A 1PGNA 3PFFA 3VC7A 1HE4A 3NTRA 1FF9A 1XYGA 2JD2A 2JCVA 3IKVA 8LDHA 4G65A 3O03A 5HBRA 1ENPA 1HE5A 1PL6A 3RU7A 2VWGA 5BSEA 3WTCA 4IXWA 4DQVA 1PS8A 4BO4A 3LK7A 4X54A 1HDGO 2PKQP 1E92A 2NUAA 4BNGA 2NVWA 4GKBA 3BIOA 2HMSA 4RPGA 2D3TA 1O5IA 5CFZA 5JAZA 4UAGA 4II3A 2EJWA 2LDBA 1NX6A 3ZH2A 2OOSA 4KDFA 3JYQA 4AJHA 4GL4A 4HBGA 2PNFA 4YT2A 2PKRA 4RVHA 3RBVA 4ALKA 1I10A 4I1IA 4O5OA 1DFIA 4GX1A 2D0IA 3RCBA 4B8ZA 2VYVA 2PLAA 4RLHA 1GTMA 3LT0A 3EAGA 3ZU3A 5DBIA 4GMFA 2BKAA 1L7DA 4KQWA 4MP8A 2I66A 5A3VA 5FYDA 1R4MA 1NVGA 2JHFA 4ILKA 3DMTA 3EVTA 3PIDA 5A3JA 1NPTO 3LC7O 3NV9A 1VI2A 4J7UA 2R2GA 4BNUA 1KEWA 3I9MA 5HTOA 4N5LA 4D45A 5JE8A 5HA5A 8ADHA 2WD8A 1BVRA 3WX0A 1NNUA 5MGBA 5BQFA 3A1NA 4ITUA 2CVZA 2WD7A 3WGZA 5IAAA 3PQFA 2YYYA 1R4MB 2YQ4A 4TKLA 2NTJA 1KIFA 1A7AA 3AM5A 3EY4A 1M6WA 4QECA 4A2CA 1WDLA 3JQBC 1N8KA 3M6IA 4BIIA 3WGOA 2JD0A 2EG9A 3JQCA 4F6LA 3GK3A 3MJTA 4TRNA 1KVSA 1NQAO 4ZVVA 5TIIA 5JYEA 3JD3A 4J0EA 4L4RA 3WMWA 2O3TA 4WCDA 5H83A 5G0SA 4RO0A 4OSPA 1BDMA 4B4OA 4PZDA 3UH1A 4CPDA 4XB2A 3L6DA 1R15A 4CMBA 1PJLA 1E1LA 2X6TA 4AICA 4UEOA 4BKQA 3DZBA 1W6UA 1P31A 4FBGA 1BSVA 3S2GA 3ZWOA 3E6AA 2GR9A 3TZQA 3QJ5A 5ILOA 4PZEA 1CF2O 2Q46A 1OC4A 4LN1A 4M87A 3RUEA 5DBFA 4I08A 2DAPA 1B15A 3WGYA 2Y93A 9LDTA 2WWRA 2IE0A 1Q1NA 3NUGA 3VPSA 3K31A 3GOHA 1PJ3A 3MWEB 1W0CA 1CQIA 4LCEA 3FHLA 4CQMA 4K6FA 2WJPA 4BVAA 2VT2A 4W7HA 5FI3A 3TFQA 5GZ1A 2D5AA 3W4JA 1PSDA 1NPYA 3JCZA 4Q3BA 3H6KA 5GY7A 2B36A 3EVNA 1C0IA 3VKUA 4ZHSA 4R54A 3RC1A 1Y5RA 2R6JA 4MIOA 1ID1A 1LSOA 4HY3A 4OAQA 4J9UE 4CQMB 5IZ4A 5DULA 3RUHA 5AYVA 3I9LA 1AXGA 1WDMA 4BKUA 1PJCA 4RQUA 4YJGB 1EBUA 4JP2A 1IE3A 4EEXA 4ALLA 4MOWA 4HFJA 3JQBA 1XR3A 3U4CA 3GRKA 2BRUA 4CMKA 1V6AA 5CHEA 3VZSA 4EW6A 2PV7A 1SCUA 1JU9A 3RVDA 3GMSA 1ZJYA 1MG5A 4CM9D 2FRDA 1HE2A 3WOHA 5JCXA 1S7CA 1KVTA 4R1TA 3KOUA 4DQUA 5ICSA 3P2YA 3U3XA 1HF3A 4GPD1 4MVJG 2YHUA 1X7HA 5TGDA 4RQTA 4DIFA 1HDOA 2JD1A 4ZQBA 4NH4A 1GAEO 4OJNA 1E3WA 4INAA 4ND3A 1KVUA 3HN2A 3M2PA 4XGNA 4C4OA 2ZK7A 2DPGA 3ASUA 3T4XA 1WWKA 2YDXA 4O0LA 4CV2A 1KEPA 1VC2A 4J0FA 3DMYA 3N74A 2G1UA 1WMAA 2RH4A 1X13A 2LDXA 4BNXA 1T2FA 2HRBA 1IHYA 3FWNA 3QHAA 1QYXA 3O8QB 1E3WB 5ADHA 4IGFA 1VL0A 1NQ5A 4J1QA 2O4UX 3LU1A 3I9NA 5BT9A 4D0SA 1X14A 3A4VA 5COQA 1E77A 4GH5A 2DC1A 1LRKA 4CQLB 4PLVA 3GN1A 3T7EA 1DLIA 3QVTA 1E7QA 2NU6A 5EQDA 5TLSA 1IULA 3A06A 5F5LA 4JJFA 1NBOA 3BMQA 2H63A 4Y6PA 3SVTA 4J43A 4JK3A 2HJRA 5B12A 4JX8A 3LVFO 3QWIA 1YOVA 3STHA 1ISGA 3DBRA 4E32A 1QRRA 3IQDB 1T1RA 4EJ6A 2H5LA 3HDJA 4L75A 4L4XA 3WTBA 3C7DB 3VAZA 2GN8A 3DBLB 1Q2XA 5G2OA 2QZZA 5BNTA 1CEQA 3OIFA 5HS4A 3BMQB 2SCUA 1KYQA 3WGTA 3AOEA 4EITA 4AJPA 1GPDG 3KBOA 1YOVB 3SC4A 3UFXA 3DBRB 4R3NA 4P4LA 3SX2A 3QVSA 1DOHA 3C24A 2C54A 2J3IA 1M75A 1AGNA 2NTVA 4MVJA 4RDHA 1ZMOA 5KNLA 4RF4A 1GYRA 1B8UA 4PLWA 5B4VA 4IMPA 5IDYA 1Z45A 3L9WA 4L8VA 4RL6A 4WJZA 1A9YA 2FR1A 3E18A 4ND2A 5DBGA 3ST7A 2FHSA 3WS7A 4E5YA 1NVTA 4OL9A 4B7UA 1K3TA 1XELA 5TX7A 3PHJA 5G0WA 2GNAA 4XQ9A 3RUAA 4FFRA 3MJ4A 5G4KA 1KY5A 5F1OA 5IF3A 3E9QA 1T2EA 2P9EA 3FNEA 4DPMA 1O94A 2Y1DA 2HMWA 2X0RA 1QYCA 3EHEA 1XQ1A 4DC1A 1E1KA 3R1IA 1KVQA 2AQHA 3GEDA 4II2A 4RF2A 3OICA 3AM3A 1IHXA 3WQSB 4JCOA 1P45A 1K5HA 5G4KB 3ZHXA 2X86A 4Y6SA 4BUCA 3IKTA 1TI7A 1YRLA 4EZBA 3TWOA 2XF8A 2CZCA 3UHAA 1Z75A 4FC6A 4KQXA 2Y0DA 4BO6A 3JQFC 1XG5A 1LUAA 3AUSA 2JFFA 3ZI0A 3BHIA 4R16A 4A0SA 3OQ1A 4YR9A 3DZGA 2CSUA 2GF2A 3GFGA 4IJKA 4CMEC 1XEAA 2OXIA 2WMDA 3C1TA 3GGGA 4IJWA 1H6BA 2J5QA 5L45A 3HN7A 1M6HA 1DRVA 2Y99A 2C0CA 1R4NA 4ZQEA 2BD0A 2Q2QA 2VRCA 4YQYA 1IB6A 3JQAA 4XD2A 5BNIA 4BNKA 4XQCA 2V6MA 2D1YA 3NT5A 2JAHA 1L7EA 4TRMA 1U3VA 3W8FA 1VRWA 3D3EA 4PG6A 1WNTA 2X58A 4BNLA 1GADO 1B0AA 5ILGA 3GUCA 4TKMA 2ZB7A 1L1FA 3O9ZA 4CUJA 1H9BA 2E4AA 4AG3A 1B26A 5DT9A 3JQAB 3D7LA 4I9NA 4B8WA 1HDYA 4GGOA 5JAQA 3EMKA 3FTNA 2Q4EA 3QWAA 4IJUA 2Q1TA 1CWUA 4H15A 4D42A 3B1KA 4L74A 4IDEA 4UUPA 1OMOA 3GG2A 1DAOA 1PX0A 2QRJA 4QEDA 1DIBA 1DC3A 3CKYA 4MKRA 1ONPA 2C07A 1EUCA 2CF6A 2O4CA 5JO0A 1Z6ZA 4BGUA 4Q9NA 3TQHA 3F5QA 1RM5A 1YH3A 1A27A 2VCYA 4D7AA 4O59O 4PGFA 1E3IA 1C0KA 2IYPA 2PH3A 3ZWWA 2JFGA 1ZVMA 3B1FA 2VUUA 2ZYDA 4TQGA 4DIOA 3KEQA 2O2YA 4WLVA 1P1FA 3RUDA 2ZQZA 1HDXA 5ER6A 1ZEMA 3JSAA 1ZMTA 3Q0EA 5KWEA 3O26A 5A9RA 4E3ZA 2JFHA 2VQ3A 1LDEA 2PGLA 2RBEA 2G17A 4RVFA 4A73A 1GPJA 5F21A 1YB5A 3JQFA 1E6EA 3IP3A 3NT2A 5FI5A 1Y7TA 4TROA 1X0VA 2CUKA 3PDUA 4WCFA 3WICA 4QX6A 3BMNB 4A7PA 1H6CA 2PWZA 4MVJM 2FN7A 2I3GA 3SEFA 1LLQA 3G3EA 1IPFA 5K6AC 1WZEA 4J7CA 4NBUA 1UDCA 4KOAA 1SAYA 3QWBA 3QA9A 3DQPA 1PZGA 2OO5A 4DREA 3RAJA 1HLPA 3OBBA 3VZRA 1E1MA 4WCFB 5FEUA 4NR0A 1LI4A 2YUTA 2AXQA 4OKIA 4FQ8A 1T1SA 3JYPA 4JXKA 1WVGA 1LRLA 3W8EA 1FDTA 1JQBA 4UVIA 5JDCC 2I65A 2IZ1A 1DB3A 1VE9A 2O3SA 1I3MA 4FFOA 3HQ4O 3G17A 3F46A 1A7KA 1LQTA 4FOSA 1O9BA 1GYPA 1VJ0A 3KTDA 2H9IA 2QX7A 5AXDA 3Q6IA 4K6CA 3CMCO 2HK9A 3I6IA 3QY9A 3HUDA 1Q0HA 4DPKA 3E9NA 2EKLA 4PZCA 5T5QA 1V3TA 2V6GA 5F3RA 3KB6A 1DJQA 2UYYA 3D0OA 2O3JA 4FSHA 4MIYA 4XRRA 5CPFA 3H9UA 2EGHA 2Q2VA 5EERA 4OH1A 4HKTA 1MC4A 1H2BA 2HKIA 2VZ8A 5J23A 3I9KA 3JQGA 4Z3DA 2FSSA 1J0XO 4JJIA 1E3JA 5KVCA 1ISMA 3I9JA 4J4TA 1H9AA 2HQ1A 1YBAA 4PRKA 4R9SA 3SC6A 1Z73A 5JC8A 2WM3A 4J9VA 1UP4A 1VLLA 2W2LD 3AM4A 4PLYA 5JLAA 3D4NA 3WIDA 1GR0A 3FBTA 2VHVA 3ADPA 4OMUA 4J6FA 1T2AA 4BGEA 4CLDA 3W4IA 4RJTA 4E5MA 2ZQYA 3JQGB 1BMDA 4I5GA 1RM4A 4NZ9A 1P44A 3S2EA 1EQ2A 1ENYA 4Z9FA 4GKVA 4BO2A 2HK8A 4GI2A 1U9JA 4BNMA 1ISHA 3OQBA 4ZA2A 3HFGA 3PHLA 1D8AA 1LC3A 2V6BA 4ROSA 2X5KO 5B4TA 4KWHA 3S1LA 3WWZA 3V1UA 3DWFA 1NR1A 4PLFA 1K0UA 1CIVA 2AW5A 4M89A 3U5TA 3FI9A 2JL1A 3GF4A 3GNSA 3R0IA 4B7XA 5A02A 3JD4A 3PEFA 5JSFA 3GN2A 2Y1EA 4JBHA 5DP2A 1ZCJA 3WGGA 4TRJA 4DLAA 3OP4A 2B5WA 4W9NA 3OMLA 4Z9YA 3VZPA 3PQDA 3EW7A 4P22A 4WE3A 1BW9A 2POQX 5TS3A 1ZW1A 2G0TA 5JDCA 4CM8A 3FN4A 3GC6A 4JJGA 3ENNA 2PGDA 4U0JA 4DYDA 1LA2A 4IDAA 4BO1A 3IDSA 3HB4X 5EMHA 4JLWA 4FOOA 5LCXA 5AQ1A 5THKA 1SNYA 2A4KA 1ONOA 3AY3A 4J3FA 2HK7A 1BW9B 1C1XB 1I36A 2RAFA 3V2UA 4EGFA 3TZHA 3SLGA 4CM8B 5ITVA 4YAEA 1W73A 3Q2IA 3UVEA 3BXXA 1OBFO 4Z0PA 1LRJA 1NPDA 3DHEA 3MCVA 4CMHA 4NJOA 5KVVA 3ZW8A 3OECA 1VJ1A 3OJ0A 2J5RA 1FJHA 2P68A 3E48A 1FDWA 2GD1O 3OSUA 4MVJH 4URFA 1DO8A 2FR8A 1NTOA 2OHXA 4FPXA 1LEHA 3BZUA 4GGPA 2QG4A 1MUUA 3UICA 4J1TA 1QLHA 1M2WA 3QW2A 2X0IA 4ZU3A 1UXJA 2J5KA 2V7PA 4DWVA 2EP7A 4YWJA 1PR9A 3KUXA 2UAGA 4EUHA 4BGIA 2V65A 2NSDA 2YFQA 1OAAA 5DP1A 2HMTA 1JW9B 5TRTA 3AK4A 2PD6A 3VH2A 3PYXA 2P5YA 4UUOA 1V8BA 3DMTC 3ETGA 1B2LA 1ZK2A 2O3UA 4E30A 1PJ4A 3AU9A 3FNFA 2VHZA 1LNQA 4BB6A 4I9UA 4BO0A 5CAEA 1EVYA 1VSUA 3A28A 4C7KA 1P9LA 1RJWA 4QO7A 3ZWMA 3F1LA 5FF9A 4Y98A 2GO1A 3ZNPA 5I7FA 4D79A 2WYWA 3H5AA 1PQUA 3PXXA 5KVQA 4CM9A 3WIEA 3ZHBA 1U3TA 1KY4A 4YPOA 1GEGA 1EFLA 2DKNA 3QWFA 2ZYGA 3UCXA 4BO9A 3ITDA 1IL0A 1QSGA 5TJ9A 3OEYA 1AUPA 1Q7CA 4Q3AA 2GGSA 2W98A 5A9SA 4KMSA 1BWSA 1DDOA 3K6JA 3PHHA 2DT5A 2I6TA 2BH9A 4OOEA 2XAAA 3ZHYA 2HDHA 4DGSA 3UGKA 3KM0A 1WAMA 2OP0A 5AVOA 4KWIA 3ZV3A 1FDSA 4E5NA 3DB2A 3I9OA 3GH3A 5A9SB 5I9NA 3DZFA 4DLBA 1DIRA 2HUNA 4JROA 2RHRA 1UXKA 1KETA 3PWZA 4BNTA 3DZJA 3JQDA 3VPHA 5CEJA 1E6UA 4D3DA 2NTNA 2XXJA 4QFCA 4TSKA 5DOVA 1YS4A 1UZLA 2DTEA 4BNIA 4RDIA 2WDZA 2BGKA 5KTKA 1MP0A 2Y67A 3FNHA 1YBVA 2BFAA 1HT0A 3GPIA 3RSHA 1ADFA 3ZWXA 3W4KA 2XPCA 4XCVA 6ADHA 2WE7A 4ZQGA 4AJNA 5CG2A 4IDGA 3DEYX 3PLNA 1LXCA 2UUOA 4WOJA 2E6UX 4ND1A 4CMGA 2EWMA 4XA8A 3VTZA 5C7IO 1ZJZA 1UH5A 4U6SA 4OKNA 4EI2A 3NDJA 4IDFA 5ITWA 4CM6A 1HL3A 1ZEJA 3OIDA 1B8PA 2PTGA 3HHPA 5DCWA 4GVXA 3F1KA 1U28A 4WKGA 1LDYA 5JS6A 1PQWA 1IYZA 3ONEA 1MFPA 1IPEA 1I3LA 2YDYA 3NTOA 2EW8A 5MDHA 2X23A 1PIWA 5JC1A 4L76A 2HSDA 4OXYA 5GZ3A 4AJOA 2ZCVA 4QUKA 4J91A 4ZRNA 3M1LA 1TLTA 4YT8A 3IC5A 5CDTA 2Z95A 2EHDA 1FXSA 2WE8A 3W8DA 4ALNA 3AOGA 3JQEA 3ZWVA 4I5DA 4P4NA 3V1TC 1D1SA 3H7AA 1LX6A 1C1DA 2AE1A 4HV4A 4BKPA 5I9LA 1WXDA 3QWHA 1T26A 5TJHA 1NFRA 2X9GA 3A14A 4U6QA 2ZTMA 2AG8A 5JMWA 2VOJA 1JVBA 3NT4A 1I32A 1B14A 3K30A 4HNGA 1DFGA 2E49A 3KSDO 4FCCA 5CDSA 2GYYA 2TMGA 3CZMA 1C1DB 3NRCA 1HSOA 3B6ZA 2OFPA 1GCUA 1OFGA 1PEDA 1W8DA 1HXHA 2YV1A 1ZK3A 2IYOA 5LC1A 3HNPA 5BSFA 2VUTA 3JQ6A 1HLDA 3TZCA 4E5KA 5CEEA 3HDYA 3WNVA 4BV8A 3CPSA 1I3NA 4R1SA 4YJGA 5BSHA 1GZ3A 1E7SA 3OF2A 1UUFA 1PGQA 3DOJA 1NM5A 2X5OA 3VHRA 4YAGA 4XYEA 1LBEA 2VWPA 4TVBA 4HXYA 4KZPA 1ZFNA 4Z0TA 3TZ6A 2W2KB 4FJ1A 1VL6A 1MX3A 2YHIA 4WUVA 1HDCA 1LLUA 4IIUA 3ROMA 3GT0A 3HFSA 4UUMA 3DZHA 3OJLA 4RORA 5T64A 1I30A 2PZLA 4IQGA 1Z7EA 3RFVA 5JPIA 2JCXA 5G4LA 3AOEC 2B4TO 4OXNA 3VDRA 3FPLA 5TT1A 1SB8A 4LRSB 3TNLA 1F8GA 2UDPA 4I9HA 4WEOA 4CV1A 4JP3A 2YHIB 4CMAA 4FFNA 2B83A 1TB4A 2X8LA 1SB9A 1Z7BA 5U9CA 5A9TA 4BGVA 5BSGA 3BA1A 4RZHA 3LF1A 3L0DA 1BTOA 2E37A 3S2IA 1A72A 4NJMB 4ZQHA 1P1KA 2Y1GA 2WYVA 1YL6A 3NTQA 4ND4A 4NG5A 3O8QA 4HADA 1IOLA 3BMOA 3OHSX 4IINA 1GQYA 1E7RA 1GV0A 3JQ7A 1NYTA 3TL2A 2ET6A 2CVOA 4DQXA 2NQTA 1ENOA 3E9MA 1SBYA 2XXBA 2FPIA 4FN4A 1HYHA 4FJ0A 4WNCA 3C3XA 3I6QA 3I4CA 4CQLA 3WBBA 3G49A 3U4DA 4BO3A 4EUEA 3E5MA 3KXDA 5KJ1A 1UDBA 1C0LA 2O2SA 4B7CA 1P0FA 3BMOB 4CL3A 2GLXA 4YT5A 3JQ7B 3UCEA 3ZWPA 1JKIA 5C7OO 3HSKA 2RIRA 2YW9A 3OH8A 2GCGA 4Y6RA 4R69A 2BFOA 3QQPA 2VTDA 2X0JA 2Y68A 4YJDA 3AY7A 1H93A 3PPIA 1HEUA 1ADGA 3EZYA 2GZ1A 3DBLA 4ONEA 1EVIA 4RVGA 4BB5A 4J4BA 1NVMB 2FR0A 4NU6A 3CH6A 5L7WA 1YWGO 3FRJA 4I5EA 4AJJA 3MJEA 2GERA 3MEQA 1PJSA 1GUZA 2Y1FA 4O1MA 2R00C 1NQTA 1OZAA 4Q39A 2AE2A 3ZU5A 5A06A 4QFDA 4NK5A 5AXCA 4FGWA 2AEMA 2FSVA 1VKNA 2RHCA 2Z5LA 3GNTA 4CMCA 4H3VA 3KVOA 3F9IA 3LQFA 1BDBA 1O95A 2GN9A 5I9MA 1RKXA 3WLEA 3CZRA 5JDIA 2AMFA 2X9VA 2ZB3A 3ICPA 1PGOA 1SEVA 2EKPA 1YQDA 2VUSA 4IM7A 2JKVA 3X2FA 1UXIA 4FS3A 1E7WA 3TOZA 1SOVA 4WLUA 5H82A 4AJKA 4EDFA 4EYEA 1LJ8A 5K9ZA 4NPCA 3ZU4A 4YYZA 2BMAA 1JTVA 1B7GO 1SC6A 4MVJP 2NVUA 5IJZA 1DEHA 1K2WA 3CTMA 4N7RA 1QMGA 3MTJA 3FR7A 4IBOA 4J90A 5IXYA 3LT2A 4ALIA 1KC3A 3KLPX 2C5EA 3BTUA 3HB5X 2PD3A 2FPGA 1KC1A 1RYEA 3ENKA 4AJ4A 2BFMA 2NVUB 4XYBA 4W6ZA 3DZIA 2OL4A 1O0SA 3MZ0A 3V1YA 4CR7A 3IL2A 2W2LA 1ZZEA 3E1KA 1YJ8A 4HNHA 4Y9DA 4MVJI 3DAGA 4RPJA 3U49A 1LQUA 1E0DA 3TOXA 4Z0HO 4GX5A 1D7OA 2W90A 4K1LA 3QIVA 1P0CA 5T8KA 4E12A 5JY1A 4FD3A 2OGUA 1XU9A 3Q9UA 3HDHA 1XDWA 2YZ7A 4PLPA 2QHXA 3ASVA 3DBVO 2J6IA 5A5FA 1H0KA 4MP3A 4E2ZA 2AA3A 2JAPA 3DXFA 5F1KA 4E5PA 3GAFA 1BXKA 4PFJA 3EGOA 2ZB8A 3JD2A 4IS3A 2I9PA 3MJCA 4JIGA 3ULKA 1YDEA 2R00A 4WCFC 5KKAA 5FWNA 1Q7GA 3IOYA 4FB5A 4QO8A 3TJRA 2O7QA 1IZ0A 1F8FA 3CXRA 2AEFA 3ICCA 1U8FO 3W6ZA 3GGOA 1JLLA 3KETA 2GN4A 1HZJA 1EEHA 1T2DA 1UP6A 3K73O 4U5QA 2IXAA 3C8MA 3VDQA 3H9QA 1YVEI 1BGVA 3UN1A 3L4SO 2PA3A 4HFMA 3V2HA 3ROQA 5C5IA 1H6DA 3B20A 5JFOA 1NWCA 2HMUA 5F5NA 3PQEA 1U2DA 4XYGA 1J6UA 4WLNA 4WNIA 3D4OA 3U4IA 4UVDA 4FIZA 4WECA 4YRDA 1DXYA 2DVMA 2NLOA 4N5MA 3QVWA 5GMOA 3JYLA 3H65A 4BNWA 3U4HA 4CLXA 4CLOA 5HM8A 1E6WA 5KJCA 4YACA 3D5QA 1I2ZA 5HRUA 1ARZA 3GA0A 3D4PA 4XX0A 4DUPA 4GWKA 2VHWA 4BO7A 2O23A 4MP6A 1O89A 3HDQA 4XKJA 1V0JA 2NQ8A 3FR8A 2D59A 2C82A 4RF3A 2YY7A 3E03A
chains in the Genus database with same CATH superfamily
2I3ZA 4TT3A 2F9MA 5CP8A 3ZJTA 1KOGA 2X3YA 4YY3B 4CLOB 2PH7A 1YIAA 4I55B 1XKLA 4OXRA 1PNQA 2I4TA 3NDIA 3ANNA 1P7CA 3HDVA 3NM5A 3EVAA 4G8CA 4KH0A 2V4UA 1Z0FA 1F6BA 4IQ4A 3REQA 3WGQA 1LLFA 4Y9RA 1D2CA 5CB4B 3UBTA 1VPWA 4RVCA 4TXMA 3VR2A 1NAHA 4ZT3A 3WQBA 4JC4A 4WQMA 4S1NA 3HO6A 2BBTA 4REQB 3RC9A 2CDBA 2QRVA 4C6RA 3BFVA 1C3OA 2Q6OA 5IUNC 3G2OA 5C37A 1M73E 5M34A 2WJ4A 4PRLA 2C0QA 5IVHA 1KHTA 1RLUA 3FCXA 2A67A 3EZXA 3NHFA 3KJFA 2HK6A 3GJ7A 3K9WA 2PRYA 1IOVA 3GWGA 3TVYA 3ZE8A 2GUGA 5EKTA 3S2YA 1RFGE 1SOAA 2J7KA 2DBYA 4WVFA 1AHIA 2V1XA 1X3SA 5A4DA 4H16A 3BIXA 1J8FA 1DC4A 4LC1A 3PQ7A 3ILYA 4F5EA 2ZRCA 3FPBA 4HAIA 4LSWA 4MKGA 3FLBA 5DX0A 3K0CC 4GU5A 3S5JA 3A32A 4JGBA 4GEGA 3A8TA 3THXA 2V7TA 2VJMB 1TRHA 4Q4CA 2GBPA 2ZZNA 4NBTA 4K3VA 1QG4A 2A0KA 3O4VA 1YA6A 1L8OA 2Z3ZA 4OQPA 4BAZA 2O50A 1W0JD 2PS9A 4YJHB 4B17A 2EW2A 3IB6A 4ERXA 3L4EA 1ZCBA 3OCJA 2IUEA 3AVQA 3KS9A 4JB0A 4K2AA 3EVFA 3FPEA 2OBYA 2W6ZA 3DYVA 3JAKA 4OSEA 3GLHA 3WYEA 4ZANA 3DEJA 1KZ1A 4HR7A 5KKCA 2OFXA 4NRDA 4QOSA 4KO1S 1QH1B 1NI4A 3O38A 4M53A 4XB1A 3EISA 4ME6A 3UGTA 4CKYA 4C7VA 2A9QA 2Q4OA 4BP1A 1Z35A 4FW9A 3HN6A 1ESDA 5EINA 2HREA 1DEKA 2Q3CA 2CT8A 5DRYA 4X8MA 2GZMA 2HSJA 2PZBA 2RFLA 5EUMA 3P2OA 3IKJA 5CFRA 2VOEA 4BATA 5IJ0A 1VXOA 4I6GA 1LSJA 2YUIA 4CMIB 3A4LA 8AT1A 1QR6A 2VNAA 2R7AA 4PSUA 3X2EA 2Y0CA 5BMVB 1VB5A 4M36A 4F3CA 3IEVA 2DWPA 1YD7A 3QKTA 4IQ8A 4KOEC 1PV1A 4EJ2A 2G83A 1V48A 4HDKA 3V6MA 3ZI7A 3I2HA 4QFMA 1QHNA 4R68A 4LWOA 4MRRA 1W44A 3F67A 3NNDA 3E8XA 4J2HA 1Q91A 1D03A 1RRMA 3OFSA 5AI6A 4EW1A 2XBMA 3ZGYA 2O19A 3BJIC 2KMLA 2H4FA 2OXCA 3CSSA 3P0RA 3C14C 3GCXA 3UUWA 3KFLA 2C78A 1I01A 1MRZA 3S28A 4CV0A 1O77A 3WGLA 2OTCA 3TPZA 1TAHA 1BOFA 2H17A 3GRZA 2Y1OA 4PICA 4F06A 4CIYA 3IR6A 3OQ6A 5FPPA 1EFKA 1QC5B 3R7FA 2RARA 2P6OA 2VDPB 4PLZA 5GOTA 3EAQA 3TZLA 1VLJA 2G40A 3R24A 4R8LA 3VVMA 3BSYA 3RBXA 1TCUA 2CXNA 2BFWA 2H2DA 2PQ0A 3M4XA 1JFFB 5ECYA 4FJ2A 4L5IA 2VNHA 1UPCA 2BGLA 2JDIA 3AW8A 3JQ9A 4J16A 4Q6WA 5GAJA 1KO5A 3X1WA 5KO2A 1GLVA 3WBKA 4R8VA 1XWIA 1JIUA 1FDOA 3ZCUA 3KHKA 3QLVC 3U44B 2E82A 1Q11A 2ZQ5A 2IOFK 3MUNA 4C4ZA 3DMNA 4GRAA 4QODA 1HDZA 5J4HA 2RHHA 3AL2A 3BM5A 2JW5A 4LK3A 2Q7DA 3V3TA 4XZ3A 2CSXA 1L0BA 4P84A 2VP4A 3F8SA 4P8RA 1QV7A 1P9RA 1X7WA 3GEIA 2VRWA 2XMPA 2OP1A 3WE7A 1UKYA 4G97A 5CVDA 2GWHA 1K7SN 3NATA 5LUBA 1JB9A 3VBEA 4EG1A 3DTYA 2YV2A 3I30X 5J3JA 1GSHA 1V11B 3SBOA 1SD1A 4KO8A 5EPEA 4QPZA 1GKLA 1NC3A 1QFXA 2GM9A 4OK3A 3WY9A 4DEVA 4CDRA 1SURA 2ID8A 1V7QA 2OR3A 2PL5A 1JMVA 1TX4B 1P33A 1Z34A 4MKHA 5E1MA 3VJKA 3RQSA 4YXWD 3IAM6 3PI6A 4YJ2A 2POCA 2Z9BA 1RM0A 1TU3A 2GFHA 1YKGA 4R8MA 4BS9A 3CSDA 4K9OA 5JV5A 4I9GA 2GD0A 4NBLA 2PKQO 4ZAWA 4PWYA 2EZ8A 4AY5A 2PFGA 1CZHA 1JECA 5BWMA 3OPYB 1T4DA 1XA3A 1H3EA 5K51A 3HABA 2NU9B 1ZL2A 4X71A 3VPFA 1V1MB 5EKDA 2XX3A 4DCGA 4A16A 2JAUA 1UBSB 1B43A 1FFHA 4WASA 3KSRA 3KOWA 1UBRS 3CLRC 3L5KA 3VJMA 1DCTA 4IYRA 2H65A 1DKLA 1E96A 2MYNA 3IEXA 5P21A 1XAIA 4ZICA 4HZUA 3ZNNA 3S1AB 4E94A 4HXGA 4U2FA 4WKNA 3BWMA 2ZWOA 5JAUA 4BX8A 3PC3A 4KUHA 5KVSA 3OM9A 3INRA 5DTQA 3EFEA 3HJRA 4HGPA 1XJCA 1N3YA 3K2BA 4WGFA 5KQPA 5ARDA 1EFUA 3AVOA 3A6LA 4GPTA 3TOCA 5L40A 3R76A 2QPAA 4ZEXA 2IITA 6NULA 3L7BA 1VXRA 4BQFA 3BDIA 1KRHA 4FNMA 4JBXA 3SM3A 5B6PA 4CLRA 5IF9A 4X8HA 3LPMA 3C1OA 1DC8A 1KMHB 4LYAA 4Q7MB 1WD7A 1Y81A 2D0PB 3ONFA 4FMPA 2HWWA 4MW7A 4AJ9A 1OROA 1UAAA 4LECA 2FUG1 2KWIA 4D43A 4PNHA 2XOKA 3N53A 4WBSA 1HEIA 1VGQA 3TPCA 5KDOA 1ZR4A 1WXXA 4LCJA 4PQRA 4RGYA 4FUQA 2WSSA 4GM1A 3LTEA 4P4SA 5E4TA 1N1GA 1W94A 1Z74A 5AFSA 1RI4A 3FWZA 3ZJUA 1TZMA 1ODLA 4Q66C 2GZSA 3UQYS 5JY6A 2PN1A 5I4BA 1ZOIA 2HGZA 3LXXA 1ICEA 2HHLA 3DDUA 3NIWA 3QYPA 4I1RA 4OHRA 4FZJA 4B3IA 1EVLA 5ALVA 3L5OA 5DO9A 2VQDA 4RDCA 1E99A 3LF2A 3WQRA 4D9GA 1WSAA 5DHPA 2B0JA 4RPKA 1U98A 3W2IA 1QIJA 1SRQA 4FR5A 4MA5A 1SVMA 3FTPA 3VTFA 2YJTD 3IV6A 5U4XA 3RK1A 2PQ6A 3IMFA 4H1VA 1J4AA 3JZMA 3ZHUA 3OHPA 2P41A 3T15A 1E2IA 2PLRA 1K75A 2AOTA 4OP1A 2XZPA 5TVKA 1XLUA 1P6UA 1QFZA 4G0YA 3AEQA 2NMVA 4H08A 1PZHA 3CUYA 3QVOA 3ETJA 1A9ZA 5H80A 2ZRQA 3PSAA 1U7WA 4WY5A 2XA1A 4DLSA 2P69A 2YFKA 4ND5A 4E2WA 2FZ5A 3H05A 3AJ8A 4B83A 1TIKA 3AX6A 4IHAA 2EBUA 4LJ8A 1I1HA 4MW6A 1AUVA 1PS9A 1WB5A 5D3ZA 4S2EA 1A4XA 1XTJA 1XKXA 3HJAA 3UWOA 3QYFA 2MSLA 2G4CA 3VKGA 1BRMA 1AD2A 1CYEA 3PC8A 2WHQA 1IY8A 1HZZA 1ONBA 1RYZA 1SKAA 3BOSA 1WCV1 3NUQA 1YCFA 2GCNA 1OWPA 5KMGA 1O6ZA 4X0EA 3OLCX 2QZJA 3NIGB 4Q9KA 5CG1A 1K4KA 2IYUA 1VKOA 4IP0A 4JL6A 1EVZA 2GN1A 4PW0A 4UJ3A 2WI8A 4BQQA 2WSMA 4RXUA 1A8QA 2OKCA 1NASA 3JYHA 1M6EX 1QH0A 3I4FA 3WMFA 2A35A 2IF0A 1OXKB 1P19A 3SF0A 4EM6A 2GHQA 3FH0A 3WHIA 5T7BA 1H2RS 3ZS9A 1N5LA 1VPDA 2FEMA 3DBHB 4WN9B 4DUYB 2C3YA 1QRTA 1E2DA 1UKBA 1V9CA 3LC2O 3W3ZB 3ZCTA 5H3LA 4XFDA 4HWSA 4B6JA 3AC0A 4CM5A 5JQWA 3TSCA 3FZYA 1FRQA 4C0WA 2G0NA 4ZGGA 3FGZA 1NM5C 5AJZA 3KD3A 1LJLA 2B6HA 2G7ZA 3Q87B 3VRHA 1I4EB 3NWJA 4EKYA 3KQQA 1EKXA 4TTRA 3DAFA 4E14A 2E3JA 4I5FA 2BI8A 1N0HA 1ZD2P 3DXXA 3FHJA 3DFFA 4NFSA 1B76A 2CYAA 3QUSA 1GYQA 4GLBA 4N65A 3JZAA 4PG7A 4UD6A 5CTAA 3GPBA 5DBHX 5AT1A 4ZV9A 3MA0A 4O08A 4EX7A 4F9GA 1TQ4A 4OQZA 2W6NA 2CEAA 4XDZA 3WJ7A 1TIBA 2YWEA 3DCIA 5DKFA 3UK0A 3UMSA 5I7SA 4HEQA 4WD3A 3T1TA 1HKUA 4L8WB 1KFKB 5K7SA 4IVRA 3OZCA 3TAHA 3HLTA 4JWKA 4F6CA 2I3AA 2G5GX 2H2AA 4UUQA 1NF8A 3HE3A 2IV2X 3ZQUA 2WM9B 3DV2A 4OHOA 1T8UA 4O4JA 4YCSA 2IP1A 2FVXA 1IMOA 3C70A 2ON6A 4MRMB 2BZ0A 3ZXYA 1NDUA 1ZH0A 2XUAA 1ZHOA 4LHSA 3EYWA 4EY5A 3AI7A 3ABRB 1Q83A 1AZWA 2QE7A 3NOXA 2WHPB 1CNFA 4N7JA 4PXSA 3VSEA 3D2AA 2X4GA 5EEHA 5GQSA 1PK8A 1B4DA 5HE8A 4X66B 1JHOA 1U0JA 2HO5A 3FAZA 1L3BA 4WCVA 5COBA 4PLTA 2OLJA 4BE4A 2FEXA 1PV2A 2ZRJA 4YQZA 5KYWA 5LQNA 4TLEA 1OC2A 2CLIB 4D0RA 3LPNA 4CTMA 3WL4A 1F0YA 1XNQB 2HA0A 4WLOA 1XHLA 2X9QA 3HEMA 4HPWA 3OTGA 3FHOA 3ILSA 2Z9DA 1T1IA 1KJIA 4FHZA 4TRRA 1KYXA 4FE7A 4LOIA 4P82A 5ER9A 2OYRA 2GM5A 2O2DA 1A2OA 4QGBA 3QUCA 4V1CI 2DZDA 4XJTA 1ZVJA 3K96A 3O47A 3AXTA 3LDUA 3PFWO 3IVAA 3WQQA 1T25A 1CK4A 3EC1A 2X7XA 1ZQ1A 3PGVA 3UK6A 2CNWA 3PQ4A 2NZVG 7ADHA 3E15A 5AXAA 4OHPA 3ZQ6A 2FJ0A 4OCZA 2QTHA 5EE1A 1SA0A 3CNEA 4M49A 1B6RA 1ECLA 4O4LF 4TS3A 2HPZA 2QW8A 5EE0A 4MH0R 5BVHB 2XB6A 2ZETA 4I8XA 4MS1A 4ALMA 1Z06A 1BQEA 2YASA 5E0KB 4HDRA 3KE9A 4GI1A 4A26A 3TGLA 1SG9A 1KMNA 1DX6A 1HFJA 4RIIA 2DTDA 1DJOA 4NLLA 2CY0A 4R5HA 3P2MA 1CDDA 3I6YA 5ILQA 2H08A 2A0YA 2LIVA 1Y8ZA 3A1SA 1H2AS 1EP2B 1LPNA 4FONA 1XUOA 4FX2A 4K6OA 4QT0A 4UCQA 1VRCA 1A7UA 4XR4A 5EFZA 1KOLA 2NNWB 2RCYA 2OCKA 2AX3A 5DASA 5KHLB 2HMAA 4EYKA 2V5VA 4DJFC 2FHPA 5G3YA 3HXKA 4Y2SA 2YV4A 4OXKA 1K66A 3KOMA 3NJ4A 5G0TA 4D6XA 1JEYA 3CF0A 2F1HA 5U4QA 4C89A 3OOYA 1MJHA 3LQQA 1T9DA 1PTKA 3L79A 2EL9A 3I1YA 5G1OA 3IIEA 2ACKA 1W46A 3TTSA 2IVFA 3RSOA 5AW3A 4LYGA 4GDFA 3JVIA 1KDRA 4ZDKA 4NBVA 3NKLA 4G07A 5D5HA 3K9GA 4WESA 5IZCC 1YTUA 3I28A 5CB8A 4B6FA 1ADCA 3IEMA 2V7UA 1T0HB 1XPUA 3CURA 1SOMA 1KI8A 4U8GA 3UAZA 3PA8A 1OZGA 2C2KA 1GNVA 2IHZA 2YQ5A 1CVLA 4NABA 4EJFA 1TTQB 1R6AA 3PB3A 4HFNA 3INTA 3FVVA 3K9BA 4NBKA 3SZUA 3QSYA 2QVGA 3OI7A 3K71B 4Z9XA 4Q1CA 1YJAA 3F2VA 4EABA 1D5WA 1FOEB 1FSZA 2HBQA 1AU9A 2TMDA 2ZKLA 2OQVA 3R8FA 2IV3A 4YJFB 1WLSA 5F2EA 2X7HA 1DJNA 3ETEA 3QTLA 1ZD8A 3SY8A 1VSBA 4A2PA 4D44A 5C8VA 1V5EA 4BLWA 2F43A 5EKUA 3V80A 5A6SA 4UDNA 2NTYC 4KIUA 2UVPA 1WETA 4G1UC 2IUSA 1QIDA 4BHTA 1AKQA 2BBSA 2FZ4A 6REQA 4L95C 3T9FA 5LYJB 2GPAA 2GQ0A 2QLMA 4LJ5A 3NR2A 4OAPA 3AV0B 3SFTA 1TFRA 3ADDA 4EKGA 3JATA 1NUPA 4PHFA 1NGSA 2XTNA 3PRJA 1QDUA 3H9EO 3GLSA 2A4MA 3L77A 1F6DA 1SVWA 5KTMA 1L7XA 3AFNA 4AWAA 3KSUA 4W8GA 4RV9A 3QFCA 2VA8A 1E61A 3M6LA 5TMEA 5LBIA 5TXGA 5CFNA 3U16A 2LUOA 4GGMX 1RRKA 4GWGA 5LA6B 2C7GA 2EGUA 4EB8A 1ANKA 2PS0A 2XMBA 2XW6A 3UNXA 2VHJA 1YXMA 4IX9A 4CJXA 3HLYA 3AG5A 1MB4A 1QTIA 1R18A 1UPUA 2BFEB 3RADC 2O5EA 1E0AA 4LMRA 5AI5A 3ADCA 1JU3A 1JLRA 1V1RA 1WUJS 2C8KA 1CYDA 2CFTA 2FMUA 2C3UA 1ECCA 2C98A 2Q6VA 4Q4HA 3BRWD 4ESOA 5K8TA 2NM0A 3ESBA 4UTPA 1F60A 3HCOA 2FY8A 4H60A 4O2BF 4C07A 4FBLA 5DDIP 1RAFA 2WSBA 3WL3A 2J41A 1A8IA 1T2CA 4MKXA 4QJ4A 4M1TA 4H1UA 4D1YA 1EFRA 2FAXA 3ZBTA 2WEKA 1QQTA 1U8CB 3R5XA 3FVTA 4TMYA 4QL3A 4UNPA 4AT1A 1FS6A 1OH8A 2Y0EA 4A82A 3KB1A 1M6NA 2V7VA 5FKJA 4GP7A 1E32A 1U2DC 1JPVA 2HADA 3ZD8A 4Y7DA 3KC2A 1M72A 1KO8A 2WT9A 4NAUA 3H2GA 5FULA 2AKEA 2BKXA 1QCCA 3KYJB 3O4JA 2GI4A 2VNIA 3GD7A 1DV2A 4GOKA 4HXEB 3ICEA 2YOHA 2RDMA 4Q3CA 2R96A 1TCAA 2G9VA 3HKCB 5JSZB 2GMWA 3A9VA 3K09C 3RFFA 5E6UA 1IVNA 1TK3A 2GN6A 3QVGA 4ZN6A 5K99A 4PNEA 3P26A 5BR4A 1C7JA 4M99A 5HF9A 3MSCA 3VSDA 2A1UB 4GVLA 1BCRB 4GO1A 1MB9A 3TMYA 1JBKA 3C5HA 2QY9A 1SCBA 3Q9NA 1RXCA 1R0KA 2O48X 5M3BA 2PX0A 4LNAA 1J24A 4PM4A 3UUEA 1P1BA 1ZBQA 2JGIA 3O82A 3EUWA 1T5TA 4K86A 4QU0A 4RYDA 5B2EA 3WRXA 5B57C 1K6JA 1M2FA 5CIYA 4E7PA 3IJEB 1L4FA 3O3NB 3D2LA 4M0PA 2XQGA 1HYEA 4NVRA 2H6EA 2AKAB 3N7AA 1R8XA 2IHNA 4KPYA 4LVUA 1KAOA 2QPOA 1CY8A 5B1SA 3KKQA 1XD9A 1OE0A 1EXMA 2X1VA 2H07A 2VJYA 3JVDA 4X7MA 5IVIA 2VNSA 3LUHA 1XB2A 4AZSA 1E79A 5EIEA 4ZOAA 4LBYA 1PT6A 3ZWCA 3I6BA 4M1QA 2CFRA 4LF5B 2WWFA 4MIEA 5KU1A 2AXNA 1N9ZA 3LQKA 2QRLA 4YRBA 1AK9A 5CYOA 5F73A 3CTPA 1V43A 3H75A 3UXYA 1XMIA 4BN0A 3GEGA 4C7JA 4I81A 1JH8A 1E1NA 4BYGA 3FRIA 1KPGA 5ESDA 1NW7A 3N3BC 2PXCA 1R9GA 2ANBA 1VBFA 2IPAB 3ZY3A 4D4IA 3O6VA 3OOWA 5B3LA 1QIMA 2D1FA 2IDKA 2FW1A 3LKZA 2YY5A 4ETIA 4AM8A 1GY8A 4IQ0A 3DAPA 3AJEA 3O8OA 4LYHA 3WLPA 1OX5A 4UQLA 5KTNA 4DA9A 2LR0A 5CFMA 1EHYA 1MT0A 1NQVA 1VGRA 2OBNA 1SXHA 2ZWVA 3CE6A 3JQ8B 5JAIA 4IIBA 3L7KA 4Q00A 1TEXA 1U2PA 3VV3A 1W7AA 2GF0A 5JEEA 5JUWA 2IU6A 1M1XB 2HCJB 3KYDB 5J63A 2GEVA 3NM6B 5L51A 4E1VA 4RK5A 1OFUA 2K4MA 3AWDA 3MW8A 4HT3B 4WA7A 4KR3A 2B4YA 1P2GA 3AHHA 1DRUA 4OXXA 4KRFA 2R5NA 2X6RA 3PJDA 2AD5A 4JOBA 4AN4A 2BGMA 3QXXA 2PH5A 3MT7A 2RGNC 1H6AA 4GP9A 3ESCA 5B1YA 3N0WA 3K0FB 1GOTA 2R8XA 4FP9A 4EG0A 3GFTA 3ISJA 3ZU2A 1PT9A 2AJTA 1ENZA 1NXTA 3JD1A 2G8LA 4H3KB 2P2LA 5GOZA 3R9IA 4EJMA 1B3RA 1JKJB 2P77A 4LXUA 1YBMA 4HK4A 2I7TA 4ZVOA 1CDEA 4BO5A 4CLHA 4LV6A 5DTIA 2P0AA 3K0EA 5ELXA 4MV6A 4ID9A 3FY4A 4UEJA 1XIVA 1VMAA 3OQIB 5BV8A 4CKZA 4DIMA 3VMFA 3L6EA 2CJYA 1R16A 2P9HA 3G89A 1JDPA 1CJKC 3QV1A 4X9XA 3T3DA 3ZV5A 4DF3A 3DLPX 4BMSA 3PE3A 2YOGA 4DV4B 2HJHA 3MT9A 5CDFA 3WDMA 3WXMA 2DMRA 5JNTA 5EXDA 2OPHA 2O1SA 3BORA 4ZQIA 2Q4DA 1UBTS 1A1VA 1PUJA 1G17A 2GRUA 3RVOA 2ZCUA 2H16A 2AF3C 2TECE 3OY7A 4PYNA 4BMNA 4EGSA 4PAWA 5CVEA 5TF4A 5A03A 3H4IA 1VOTA 4J49A 3S2FA 4MV8A 2ZOSA 4OHZA 3KZKA 4QUHA 3HACA 3R9XA 3I5AA 1OTYA 2BCGY 3K6RA 4DLVA 3CINA 2MYPA 3UOAB 1IUKA 3I04M 1LH0A 3N8DA 4KPUA 5F3WB 4LYEA 5KSPA 3CKKA 4DRXB 3PFHA 2GAJA 3QG5A 5LOVB 2P9GA 1T2VA 4P4TA 3BCUA 4TZKA 2BISA 2HZ7A 3OY2A 1A4IA 1NIJA 1Y5MA 4H3SA 1ZAKA 3JQ9C 3N2NA 5CDHA 3CW2A 2JH8A 2RGBA 1XTTA 3AZPA 1TPZA 1US8A 3AVTA 4ZJZA 4M88A 2FETA 4K28A 1KO7A 1KJ8A 2EKQA 4IXDA 4BBZA 3CRRA 2XDQA 1E4VA 1E9FA 2ZW9A 2NGRA 5K2OA 1TRKA 2HA2A 4LMBA 2R1ZA 4H0NA 1LK0A 4LJ4A 1ZVQA 3LFHA 5CX4A 2MIIA 5L8VA 4UVGA 2GK3A 5CNJA 1G7CA 3NBZC 4IXTA 1FQWA 4V24A 1M8PA 1Y48E 2B35A 4ZGBA 2OC9A 1VPVA 1KKMA 2IPLA 2VAPA 1EFAA 1PQPA 2IPOA 4P3YA 2ZIGA 2XZOA 1OHHD 4YXFA 2E4UA 1T0IA 1UBNA 2JHGA 3ELYA 5J9FA 4WZBB 1R0RE 1B2RA 3AKDA 2EX0A 2XTJA 3P9SA 1PL7A 1RJEA 1TMOA 3CMMA 4LF4B 4JAVC 2C8JA 3OLXA 4UM9D 3I61A 1OAOA 1YGYA 5CLLA 4ZRDA 5JZBA 4IF4A 3U7QA 1VL2A 3GVIA 3VR6A 3HM9A 2ATXA 4QRIA 4QULA 3KXKA 3L0YA 5IM4F 3DONA 2XD4A 1O6FA 4TTQA 5AM4A 4B44A 1HA3A 1DRWA 2XNCA 2ZAMA 1P4GA 5FPKA 4W7SA 2ZBQA 5GP1A 2EIHA 1Y3AA 1AUQA 2Q4BA 4O1HA 5DBEX 1ZK4A 3BD8A 3SLKA 3VZCA 1WOMA 3WBJA 4B7ZA 2DOKA 5T67A 1RW4A 1SHZA 1AA9A 1XHFA 1G1AA 4IJ5A 1XTIA 4TTJA 5HIJA 3B6KA 1I9CA 1FNMA 3LBHA 3LW7A 3NHBA 4G0NA 4JJAA 1BKYA 3LL7A 5DCYA 1CQWA 3W3AD 2OK7A 5DTEA 1ULSA 1YI0A 2FOLA 1JEEA 4FFMA 4PANA 5ENDA 1PWXA 1SPBS 3UJ3X 2W6MA 3U4QB 3CEHA 2PX4A 3DE5X 3OAAD 3KL4A 3GRAA 4TXHA 5EIOA 1YHYA 2JJQA 4CFYA 3O7MA 4O2RA 4H7KA 4YB8A 4XD7D 4Z9BA 4F8JA 5FDFA 4MDEA 1N2EA 3HYLA 2QMHA 1XMPA 1B1AA 2AFHB 3JWPA 4I8IA 5FBQB 4B47A 3ES9A 5HFAA 5B1DA 3RRMA 4E4YA 4J7XA 4CF5A 1Z22A 1DX4A 3ESZA 2Q5LA 2PIDA 5BQOA 3L4BA 3VNQA 2VBFA 4QGGA 4UNQA 1PUIA 3UAXA 4BL5A 3OQPA 4HAXA 3S55A 1GUYA 1TOAA 4M9UA 4W1RA 3TJZA 7GPBA 4BFSA 1X15A 4ENUA 4MRVA 3AUFA 4X6YA 4DMMA 4BZXA 4K1XA 4MEBA 1O96B 3OJXA 3VAYA 2HB6A 1ZD1A 4IF6A 1BWQA 3BMCB 3RB8A 4Q37A 3D3NA 2FDCA 2RKBA 2ZATA 4LJSA 2O0MA 2AJDA 3QOWA 2O14A 4QUEA 4V03A 1NP3A 3ACCA 4GZ3A 4JN6B 2FZLA 4BJHB 3JR7A 5BOSB 1XT6A 2CXRA 5H02A 1J8QA 2PX5A 4G5OA 1CV2A 1GSAA 3KLNA 2H2GA 5JNLA 2GLTA 1GGVA 2QMYA 1IG3A 2EKZA 2OHVA 4ML3A 3BTSA 4KPFC 1GRNA 4D0LB 1KZ4A 1OY1A 4DHWA 1G20A 2GPNA 2WLSA 2VSQA 1ISJA 5EP3A 2P6RA 5TQ0B 1JG6A 1ORIA 1RZ3A 2OZEA 3AUAA 4P35A 1TEHA 1AS2A 3QE2A 4R7ZA 2GEKA 3P0IA 4MV5A 1I2MA 1TA9A 3WYCA 2BEVA 1WXHA 3DR3A 4HDNA 4D9CA 2NU7B 4JLPA 3RYIA 4C3ZA 4CVNA 3HZHA 5I51A 2PKWA 1UBOS 1WUHS 2H4ZA 2RAVA 3H2BA 4LY3A 4OHUA 3RU3A 4CBVA 3CZ4A 4DCSA 4HLDA 4FCWA 1HFKA 4ZXFA 1ZK1A 2C57A 3O2JA 4IIGA 1CUWA 2Y6UA 3PNKA 3OLVA 1KR5A 1YBHA 2PD4A 4URXR 2YFHA 3GQVA 2I2CA 2YICA 4B6EA 1W88A 1T4CB 1WMBA 1U0OC 3CY6A 3NX4A 5C1IA 5BN1A 3SSMA 1HZZC 1ZK0A 4EEKA 3DKVA 3G2NA 4WSOA 4J0KA 1SVSA 4DC0A 4S04A 1LW7A 2I80A 3D7KA 3DCYA 3VI3B 3H1EA 3EPKA 3THYB 3OURA 1QYDA 1JLKA 5DFAA 4CR8A 1MV5A 5A1TA 3A3PA 2ZJ2A 4NJEA 3HGQA 5AWFC 1U7HA 3WSVA 1B8VA 5CH3A 1F06A 5JCZA 3N7UA 4D98A 4G0VA 2GJ4A 3DLHA 1X7DA 5FI0B 1U5AA 1CS0A 2HA6A 4O8ZA 2C1ZA 3IXMA 3IQFA 4AZ0A 4QBKA 3UTDA 3ERCA 3PD7A 4LOJA 4ND6A 4O4LA 5AW5A 1RAGA 2AIRA 2XSZA 3FHCB 2OAGA 3L7DA 4IGAA 4L4SA 1BIFA 1W5AA 4TT3D 1VLVA 4M7OA 1Q5PA 3O73A 2QAGB 2H0AA 5KPJA 4L3VA 4C2BA 4ZHQF 2EJVA 3WJAA 4BB0A 1W0KD 2PKXA 4B6SA 2R1VB 3TI7A 2QUAA 5B64A 1C9JA 5A04A 3JRXA 1GAQA 1ZXLA 1KBOA 1N6OA 1X74A 1DBQA 1Y6QA 2FG7C 2D62A 1PS0A 1OWMA 1F2UA 2XDAA 1GLGA 3VR2D 1XPJA 1OILA 3GFRA 2FPPB 1W4ZA 2OHHA 5EWJA 4FTWA 1X1QA 4NBRA 5GIPE 2JI8A 2ZI5A 3FZQA 4I2NA 5DOZA 2D6FA 2AQ8A 2B21A 3FOCA 3O8CA 2QRNA 1JNXX 3FPAA 3NIFB 3KLBA 4QTTB 5J4KA 2PRKA 4LF6B 4DGQA 1PF7E 4QYIA 5IULC 1JEDA 4NQZA 2EDCA 2O2GA 2IW1A 1W2GA 3Q41A 1FP6A 3EXFA 1EIZA 2QGZA 1WMEA 3TLXA 3SQNA 4DADA 4I14A 1RYFA 3ZIUA 4TYQA 2VP0A 1NBHA 1N9GA 1Q1GA 3LWNA 4LOAA 1IEVA 4H7PA 3A10A 2GRAA 4RPLA 4DXAA 2CCJA 3DW3X 4YTEA 3ZHQA 5CFOA 5AW6A 1J49A 1KBZA 2XCLA 1H42A 2YIJA 1AK2A 1R0WA 4TMFA 3RAFC 4D4HA 2P8SA 3UMYA 4JFAA 5EN4A 4LXGA 2P3SA 1S4QA 3GBSA 5SY6A 3ZWBA 4DCOA 1BGWA 2P7IA 3IVCA 1GL6A 2COUA 3GA7A 4BECA 3WL7A 2RBKA 3R7LA 2CFOA 2FEOA 3C6YA 5CAEB 1SQ6A 5TNXA 3DHNA 4K9SA 1NVVQ 2V7BA 4JQOA 4MO2A 3T7CA 1PGNA 2VP2A 3T54A 4O1IA 3IKVA 4A0FA 2A5FA 8LDHA 1GVNB 1QFYA 3FFXA 4G65A 1MX9A 4OPMA 3OVMA 1ENPA 1HE5A 3WLMA 1FUYB 3EQ8A 4PBSA 3WTCA 1GNLA 1IIBA 1RQPA 1RLIA 5JAPA 3C97A 3LK7A 4P6VF 2CFIA 3WO0A 2MSWA 1E2HA 3SYLA 3HXTA 2IXEA 4RPGA 3VHQA 5BQPA 2ZBEA 5CFZA 3AWIA 1QF9A 2ZJ8A 1NX6A 2J7PD 4PYRA 3JYQA 3LUJA 3LZDA 2HZBA 4GL4A 4HBGA 2PNFA 4Q4AB 3RBVA 2CMGA 3IB3A 3W9UA 4AJHA 2BZSA 1CX9B 1L5QA 2WNSA 1VPLA 4I1IA 4AMYA 2H4YA 3I2KA 2JLSA 2CJFA 2D0IA 3NKFA 2QIPA 4XM1A 4B8ZA 3BREA 3QXGA 2NUAB 2XCOA 4RLHA 3ZBUA 3YASA 3ZQJA 3GLFA 3BWEA 4DA6A 4UXJA 4AS3A 1EFVB 5AVSA 1QE5A 5FORA 2JGFA 2GXQA 2VNJA 2XUGA 4D8UA 1WU7A 1V7ZA 5A3VA 1WTCA 1ORVA 3IPAA 3R6TA 3SD7A 4ZP1A 3KDSE 2J0VA 4KLAA 3X1JA 1KYTA 2SECE 3DMTA 3PXGA 3EVTA 2HWKA 4BAUA 3NV9A 5EP1A 1VI2A 3ZWKA 4BLOA 2GNPA 5B53A 4BFXA 1AX9A 1QOQB 1RADA 1YR7A 3LO8A 1QIIA 1MOSA 4N5LA 3T3GA 4D45A 1BVRA 1NNUA 3NDBB 4PSVA 3TQOA 3NAGA 4EA6A 1JJIA 3M49A 4N8DA 2L18A 4X1YB 3TB6A 3CBQA 4FYKA 2YWGA 1PD0A 2YYYA 3MWJA 4RABA 1Q7RA 4X1KA 3ZVRA 1B93A 4FDTA 4AUKA 5B7QA 1LS6A 2GLUA 2XCRB 3PTAA 1E2JA 1KIFA 1USWA 4W5QA 3A6DA 1CY4A 4WFKA 3HKEA 1N8KA 3M6IA 4FFBB 1L1EA 3B2EA 2IZ5A 4QUBA 2JD0A 2WHXA 1FX1A 1OLUA 1WCYA 3PSHA 2RI6A 5IM5A 4D0NA 4F72A 4TRNA 4Q4LA 1S2LA 2WFLB 4QHYA 1W5EA 3IV9A 5F1YA 3WK8A 4C0SA 5K8UA 5TVGA 9ABPA 1RKUA 2RC5A 5KNCH 1JI0A 2QLTA 2ZPAA 1P18A 3A1TA 3W5JA 1Y4SA 4D57A 3IE2A 4LZAA 5B5SA 2ZIXB 1KFJB 3TRFA 1SKBA 4J0EA 2WWVD 3LMKA 4HHEA 1W5SA 3D02A 1C3LA 4JHLA 4L4RA 5F7OA 5KNBD 2X41A 2PZAA 4G0WA 2E85A 1ISSA 3G88A 4FLFA 5G0SA 5LYYA 4EG7A 2CJWA 1EGVB 1JLHA 3C5VA 3KQMA 1RRGA 4N1AA 4R2HA 3N8HA 3RJTA 2G4LA 3UH1A 4B80A 4CPDA 4LTMA 1W4CA 3COVA 2NPIA 2G08A 4W5NA 1UOOA 1W6UA 1RKQA 1G8FA 3UG6A 3W2FA 4HYTA 1X1BA 2GR9A 1IOWA 3QJ5A 1FRZA 4ZI2A 2INGX 2YCLA 3L1HA 4LXYA 5ILOA 2ZUFA 1DU4A 2WICA 3OX4A 5ANRB 1OC4A 2RKWA 3L2OB 1ZM3A 4HB2A 3CF4G 2CLFB 4N7BA 3OHMA 1ESMA 3WGYA 2RBGA 4ZYYA 9LDTA 4WXEA 3SYRA 4BB9A 4BASA 3RSZA 3IODA 2ZXFA 4A6DA 3GOHA 4RYLA 3X1ZA 4HOYA 4B2YA 1SFRA 1Z0KA 3DAYA 3Q3HA 5FIUA 1W0CA 2CW5A 1CQIA 4ZIRB 1S8FA 4QBTA 4BWYA 5L3SB 5IJ9A 1VYUA 3FHLA 3QVUA 4K6FA 4CQMA 1EM6A 2Q5IA 3ROGA 3L8GA 5SV2A 2E2WA 3H1GA 4J75A 5GZ1A 1J23A 1KQFA 1S3GA 1IEWA 1DKOA 1KOFA 3EVNA 2VF5X 1C0IA 4ZHSA 2QN6A 5ALNA 1Y5RA 2DH5A 1KK1A 2HCFA 5EXSA 3EOZA 3E81A 3EMBA 4NE9A 4OAQA 2C03A 3TMKA 4B5KA 2WUFA 3URKA 3H2YA 4ATNA 1Z6TA 5SYAA 1XXHA 2FWPA 1ZICA 5DULA 4ZVQA 5C0OE 4V0QA 5AYVA 3RUHA 5JH7B 3DOHA 2OM2A 1WDMA 4E3WA 2ZJ6A 4JSRA 4RZXA 4N82A 2XUKA 5A1JA 4JP2A 4WXRA 1IE3A 1ONSA 4RSHA 4YUYA 2WSSD 2A0UA 5G02A 4Z8XA 3AYXB 3DNMA 2FCRA 4CMKA 1EK0A 3TTTA 3VZSA 1IY2A 4IHJB 1JSCA 3HEAA 4J3JA 3K1YA 4EW6A 1Z63A 1SCUA 1Y98A 4RHTA 3MWDA 3ROFA 5EZ6B 2JFXA 5FNVA 1ZMRA 2WTNA 1N5MA 1A04A 3U31A 4KE6A 1DAKA 2WP0A 1GUBA 2C4WA 3RJZA 2EIXA 1ZXXA 1KVTA 2PVCA 4DQUA 3P94A 4IV0A 2WFMA 3OZVA 4GPD1 5DXAA 4MVJG 5BXQC 3CLKA 3DDCA 3UMMA 3G6WA 2JAWA 2NZWA 3OPMA 1KO1A 1CB7A 1HDOA 2QROA 3I0ZA 2F1IA 5T4HA 1WKCA 1GAEO 1FPQA 4OJNA 1TW2A 1A3CA 3WRXC 4EKNB 1XNRB 2ZK7A 2DPGA 3EYAA 4RFVA 4TLAA 3ZPXA 4WRRA 5KPDA 4CV2A 2V98A 3LJKA 5C31A 2IH2A 5DHAA 1KEPA 1VC2A 4RK4A 1K2VN 1JMYA 2QN2A 3MN1A 3N74A 1CUHA 4OX9Y 4DMKA 2JFBA 5KWJA 2LDXA 2Q07A 1GDTA 3ECAA 4BNXA 4I66A 1DKNA 2FMKA 4ZC8A 3VDMA 1LF5A 3QHAA 1PNOA 3GDHA 4IH1A 1VL0A 3P0HA 4LDPA 3QITA 4QVKA 1LBTA 2DFPA 4X60A 3LO5A 4KXNA 4YRKA 1YFJA 3AF2A 4D0SA 1X14A 2AUTA 3KG2A 4NV3A 5COQA 3CJTA 3OJWA 2D54A 2P9ZA 5AVRA 3CRW1 1QGAA 2C4HA 3DPUA 3TD9A 4ZZ1A 2X5XA 1YQ9A 1E7QA 1ORWA 1VHTA 2NU6A 4V38A 2I7XA 1JIIA 3PC2A 4KMMA 1IULA 4RE6A 3UC5A 1CUDA 5IBPA 3JVVA 3ZDYB 5JJKA 2NUPA 1QZ3A 1NQXA 1MC1A 3BMQA 2H9AA 3OUTA 4YP0A 4Z4EA 1CJUC 3C3MA 4EHAA 1RPZA 1G18A 4JK3A 2QRPA 1N3LA 3LVFO 4JX8A 1TDJA 1HOTA 1YOVA 3S68A 4BUZA 4F85A 1FNNA 1FP4A 4G4SO 4WXPA 1QRRA 3ZBPA 4DUZB 4EJ6A 3AGPA 5HQ3A 1N33B 3GU3A 4L75A 2QJRA 3WTBA 2MDTA 1V16B 2Q21A 2SNIE 4OXQA 4YCBA 3VAZA 4CF3A 1FFYA 1F6WA 3RM3A 4UTNA 4X91A 2XNJA 3T0FA 1NUQA 1PDVA 3SIWA 3DVSX 4R3UC 1N2XA 4HAZA 3GX1A 1RE1A 1EZZA 3AOEA 4D74A 2J9ZB 1FFGA 4URVR 1UADA 3BRQA 4EMBA 2HBZA 3TQRA 1YI1A 3MMZA 3UFXA 4P4LA 3FSEA 3VHXA 2GBGA 1NXVA 16PKA 1SH7A 3C24A 4OI0A 1M75A 4UM9B 4GHWA 1NNI1 2RG1A 4RDHA 5KNLA 3QMWA 2IL1A 3BSFA 5FL3A 4UATA 4JXXA 4OUDB 4HDMB 4HQFA 4Q7KA 1NUTA 1O0BA 1GAJA 5CVJA 1KTIA 3DXZA 4WJZA 1H5NA 2W6JD 1A9YA 3E18A 4M0UA 4ND2A 2WWWA 3LH5A 4LZLA 5DBGA 4MDFA 4BRWA 4UM5A 3EBPA 3CRNA 2WD9A 2XTAA 3TVDA 4OP2A 4K8RB 1CUUA 2Q9UA 2VKTA 3GAAA 3Q5GA 1XELA 3IUBA 1Y1LA 4CKCA 1P80A 3FX2A 4LI0A 2ZRPA 1TQHA 4DEXA 1W4LA 4DLWA 1JG1A 3D8SA 4PNZA 3U60B 3OCZA 3MJ4A 4L8FA 1HE1C 2XA2A 3DUFA 3O4GA 5G4KA 1KY5A 2HCRA 1NONA 3QX8A 1NY6A 3E9QA 4ZEWA 3H1BA 4D8VA 4HRXA 1B0UA 1J25A 2ID9A 1ZH2A 1O94A 4RM3A 1YR1A 4O2AB 1GVHA 5IRCD 1AO3A 4J94A 4DC1A 5IX8A 1JILA 4P83A 4DPMA 1KVQA 2AQHA 3GEDA 3RS7A 2ZRMA 4Z5XA 2DPYA 3AM3A 4RTPA 1NXXA 4QOJA 1LF0A 4M37A 4I4NA 2Z5FA