4LMRA

Crystal structure of l-lactate dehydrogenase from bacillus cereus atcc 14579, nysgrc target 029452
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
312
Chain Sequence
KGINRVVLVGTGAVGCSYAYCMINQAVAEEFVLVDVNEAKAEGEAMDLSHAVPFAPAPTRVWKGSYEDCKDADLVVITAGLPQKPGETRLDLVEKNAKIFKQIVRSIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSARFRYMLGEYFDIGPHNIHAYIIGEHGDTELPVWSHVSVGIQKLQTLLEKDNTYNQEDLDKIFINVRDAAYHIIERKGATYYGIGMSLLRVTKAILNDENSVLTVSAYLEGQYGQKDVYIGVPAVLNRGGVREILEVELSEDEELKFDHSVQVLKETMAPVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of L-lactate dehydrogenase from Bacillus cereus ATCC 14579, NYSGRC Target 029452
rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase 1
total genus 101
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lmrA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4lmrA02
5JPIA 2IODA 2WM3A 4FFLA 2WD8A 3DBRB 3OIFA 3QP9A 3OH8A 2OBNA 4RVSA 4CODB 2PD4A 1LSOA 2UYYA 1PJBA 2OHXA 3W6UA 2EEZA 3SC6A 1R0SA 2VUSA 1E77A 3FN4A 1LLUA 5TGDA 1YOVA 3OETA 1LRJA 5KIAA 4MPDA 1B14A 3DZFA 1ZXBA 4BB6A 3M1LA 4IDDA 5I9MA 4S1VA 2B4RO 2XXBA 3RC9A 4EDFA 3IJRA 2Q49A 4YTEA 1F8GA 5TF4A 3H3FA 3GAFA 1YOVB 2PNFA 3QWHA 5THQA 4P38A 1U8FO 5HM8A 3G3EA 4C7KA 1T4BA 2BELA 2P9CA 2WWRA 3I6QA 1HDYA 2H9IA 4PG6A 3GN2A 2X86A 1DB3A 2QZZA 4I5GA 4TQGA 1NXQA 4YT5A 4DQVA 3LLVA 2UAGA 3I4FA 5BNTA 4RVGA 3VDRA 1R4NA 5L4NA 1ZH8A 1K6JA 1RYEA 2C2YA 3I23A 4I1IA 2RIRA 1UXIA 1LQUA 2AQIA 2B4QA 3ZU3A 5KWEA 3AI3A 4OM8A 1P1FA 1IYZA 4LN1A 2JCXA 3GG2A 4M89A 4AJIA 3ICCA 3PJDA 4TSKA 2IXBA 3KSDO 2OL4A 3A14A 2EP7A 1VE9A 3LYLA 4NHEA 1RYDA 1EQ2A 2PR2A 3GA0A 3MJ4A 1NPYA 2ZIZA 3QWIA 4U8GA 4RZIA 4MDHA 4M8SA 4WOKA 2PK3A 3S2EA 3VZPA 4CM4B 3EZYA 4AFNA 1HLPA 2HLPA 1U28A 1YL5A 4E3ZA 4QFCA 1CETA 1MXFA 4WCFC 5F5LA 2YY7A 5B1YA 3GPIA 5KKCA 2YQ4A 1DJQA 3GEMA 2Y66A 2ZYAA 3AFMA 4TKMA 3HB5X 3Q11A 4FPXA 3U49A 2X0NA 4X54A 1N7GA 1E7RA 1GEGA 4AJ2A 5BSFA 2POQX 2NVBA 3TWOA 4J49A 3U3XA 2B36A 3H4VA 2Q4EA 3KETA 5MDHA 5G0SA 1WXDA 1BXKA 1E3WA 3UW3A 4CLDA 5KJ1A 1C0PA 1RJWA 5DF1A 2J3HA 3BZUA 3KLPX 2Y0EA 1GYRA 3LT4A 2VNAA 4J9VA 4XGNA 4AG3A 1UP6A 2DU8A 3GPDG 3F6YA 2HAEA 3DBHA 3RUEA 2C20A 1YB1A 3FHLA 3NT4A 3EW7A 4G2NA 2VOEA 1GUZA 1HKUA 2FZWA 1GQQA 4HUJA 1PEDA 4BO3A 1XU7A 4XD2A 5L7WA 4WLEA 2RCYA 4IZIA 3JQ8B 1SMKA 4OHUA 1OZAA 1U5CA 2O7SA 4XDYA 1IZ9A 1XEAA 1E5QA 5JLAA 1B26A 3LK7A 3ROMA 1R37A 2G76A 1PS9A 4J4TA 5A02A 2J5RA 1YXMA 1U3WA 4YBZA 4FFOA 4MVJG 3L07A 2D5AA 1ZNQO 4L75A 1M75A 4GVLA 3KM0A 4IIUA 4BNWA 1PZGA 3QY9A 4CV1A 4GBJA 3X2EA 3FD8A 1OAAA 2BGKA 4I5EA 3AU9A 1BSVA 1PWXA 3F4BA 4BNYA 2Y05A 3DFZA 2JHFA 2W8ZA 4CMJA 1AXGA 1BVRA 3ZV4A 1ULUA 4A73A 4CM9A 1V3TA 5IAAA 2CVQA 5TJHA 1R0LA 4R54A 4XIYA 2NUAA 4CLEA 5ICSA 2C5EA 4UVDA 3D7LA 4OIMA 4QUKA 3DZKA 3OIDA 4A5OA 3GFBA 3ZW9A 3AOGA 2C0CA 4YACA 3P19A 3AJRA 4QTZA 4MVJD 3BMOB 3HDYA 3UOGA 3ZHYA 4FQ8A 1P9LA 4M55A 2AQHA 2GN4A 1DRVA 2VZ8A 1NX6A 3GC6A 4GX2A 1KEUA 4KOAA 1XELA 1P44A 1NPTO 1JU9A 2YJZA 4J1NA 1EUZA 4DUPA 3EK2A 3D5TA 3HQ4O 3BTSA 1KERA 4LISA 4ZQEA 1DLJA 2G1UA 2PGDA 3CZRA 3NEPX 4DVJA 1QYVA 1GUFA 4UEOA 2RHRA 4PIVA 1ZJYA 2G0TA 2X9NA 1X7HA 3P7MA 4TVOA 3FNHA 3LF1A 2CMDA 3IS3A 3OMLA 4U0JA 4ZQGA 3JQ7A 4ZQBA 3RFTA 7MDHA 5BSGA 2EW8A 2WMDA 4YRDA 3MEQA 4E5NA 1I3MA 3JD3A 3H5AA 3HN7A 4IQ8A 3NX4A 5C7OO 2YDYA 3LC1O 4OYRA 4QT0A 4RPLA 1K5HA 4U0KA 5I7EA 1LC0A 4I9HA 2FSSA 4ZU3A 4WCDA 3RC1A 2DPGA 4XYBA 3WGOA 3F46A 5A1TA 5JMWA 4QO7A 1S6YA 3BYZA 2HUNA 4E33A 1EDOA 4YAKA 3TN7A 2DTXA 3JQAB 1C3VA 4O59O 1QYCA 1XA0A 4CLRB 5HRUA 4ALIA 3INRA 4OOEA 4OQYA 5EQFA 5ENDA 3JV7A 1F17A 4PG4A 5JCJD 2HCTA 3GMDA 1DIRA 3JD1A 1KVQA 3TZHA 2HMVA 2GASA 4GSLA 3FPLA 4PLWA 1RWBA 3AM4A 4FD3A 2PWZA 4XKJA 2VYVD 3M6IA 4CUZA 4NBUA 4J91A 2D0IA 4B3IA 1C1XA 1T4DA 2HK9A 3GVPA 1SB9A 3U09A 2PKRA 3ZWMA 3D3WB 3RBXA 1UZLA 1MLDA 4PZCA 1I32A 4BGEA 4E2XA 2EIHA 4NU6A 3WGQA 3H5NA 3LQFA 1ZBQA 5JYEA 3ETDA 1E6UA 2JAPA 5JO9A 2AG8A 2VCYA 4YAIA 1MFZA 3QVXA 4J16A 4DIFA 4PG7A 1PQUA 2I6TA 1BXZA 1LC3A 3A06A 3KUXA 2A4KA 4E32A 5U9CA 1A7KA 1H6DA 5A06A 1DC5A 3TOXA 3TF5A 1RPNA 2AEMA 2FSVA 2JFGA 3HJAA 1LJ8A 4D79A 3VPFA 1C0LA 4UVHA 3U4CA 1PL6A 3MJSA 5A03A 3L6DA 3ZI0A 4QEDA 2Y68A 4BNNA 3FR7A 2V65A 4O63O 5JAIA 1L7DA 3F9IA 1PJQA 1R4MA 4R3WA 3UH1A 4CM6A 4L8VA 2QG4A 3JQBA 4NQZA 5A9SB 3JYNA 2JCVA 4KDFA 5GZ1A 3RSHA 3PRJA 4ZJUA 2WYWA 1E6WA 1GCOA 3AU8A 2CVOA 1E6EA 5IXSA 4YT4A 1LLDA 2Y67A 4KMSA 3GGOA 2GD1O 4WASA 3L9XA 3S8MA 1O8CA 4PZDA 1ULSA 2EHDA 4ND3A 4CM5A 3KYCA 5DBIA 1PR9A 1ZK3A 2H63A 3WWYA 3GRPA 1DC4A 2OMEA 4XYGA 1Q7GA 1XHLA 2Y1FA 3LT2A 3CMCO 4J2HA 1B2LA 1C1XB 1KEVA 3R6DA 4CMIA 3INGA 3TFOA 3WGIA 2DBQA 1E1KA 4PRKA 5DOVA 2CZCA 3W8FA 4MP3A 3PQFA 4P8RA 2NLOA 3ON5A 4I8XA 3VZRA 4E21A 2C07A 5C5IA 2BKAA 4RGBA 2GYYA 1GYPA 2V6FA 1GTMA 1UXKA 1XR3A 2XPCA 4FGWA 4Y6PA 1NR1A 4Q3EA 5CP8A 5COAA 1NAHA 1OBFO 4IQGA 4WJZA 3WGHA 4HFNA 4CLRA 5JC8A 1QKIA 3V8BA 1LUAA 2Y1OA 4J7XA 1JAXA 2Y99A 1DXYA 4UUMA 2O50A 2AXQA 5TSDA 3K8ZA 1BVUA 3JQ6A 1R0KA 3PWZA 3VTFA 4PRLA 4J7UA 2O3JA 4W7HA 1PZFA 2NNLD 1WP4A 2R2GA 3CXRA 3TQHA 5ES3A 4AJPA 3C3XA 4YB8A 1NNUA 3KTDA 4GKBA 5B37A 1X1EA 2BFPA 3ENKA 2BFAA 4BMNA 2D2IA 2NTNA 1V6AA 2PZMA 3WFIA 4EEZA 1NYTA 5LDHA 1M2WA 3P5SA 1GEEA 1GQYA 3F5SA 4D0RA 1KEWA 3JQ7B 3RFXA 2NQTA 4AJHA 2ZB3A 4YJFB 4N18A 2C59A 2VUUA 4II3A 5AXBA 3EMKA 2O23A 3RUDA 4MVJF 2GN8A 5ER6A 2GGSA 1V3UA 2H6EA 3CIFA 3HUDA 5CDGA 4IMPA 3DZHA 2P5UA 1E5LA 2P68A 1H6CA 1VL8A 1ORRA 3ZH2A 1CERA 1VLLA 2D5CA 4LW8A 2HSDA 3OECA 2E82A 4NI5A 2DBZA 4WLVA 3T4XA 2GUGA 4CMHA 2RH8A 1JW9B 1V9LA 1GR0A 3KB6A 2JFFA 3ZNNA 4BS9A 1E1MA 3PGJA 5TRTA 1CRWG 2EV9A 3KXDA 4OXNA 3WB9A 2DC1A 3DBLA 2I65A 4YDRA 3EAGA 1SC6A 4I9UA 2VRCD 1EVJA 2Z5LA 3O9ZA 1EE2A 4JJIA 2WTBA 1Y9AA 4IJVA 1WAMA 1J0XO 1NM5A 4L4RA 1FDTA 2VRCA 4RO0A 4XQEA 1K0UA 1ZFNA 3B1JA 1BDMA 2E37A 1U4SA 4BNVA 5A5FA 3AK4A 1PJSA 1RKXA 5DCWA 1GV0A 1P33A 2X1HA 2HDHA 3KYCB 4J2OA 4LGVA 1L1FA 3VHRA 4XGIA 3OP4A 4L4XA 3WLEA 2IE0A 3I4CA 2P4QA 1FDSA 1G0OA 3DHEA 4TRJA 1N92A 5B12A 4MVJI 4B8WA 2ZTVA 1CEQA 1Q0LA 3DMTA 4FCCA 4QSMA 1BRMA 2FZEA 2Q1WA 4DBVO 4PFJA 1U3TA 2B35A 4N5NA 3UKOA 2OGUA 3H9GA 4HNHA 4DIOA 4J43A 4JP2A 1YS4A 3BXXA 4YA6A 1G0NA 4BB5A 2VT2A 1I2ZA 2NWQA 2JL1A 3M2TA 4RORA 2FR0A 1IULA 3V5NA 1LSJA 5JNLA 1M6WA 3W1VA 4BNUA 1IOLA 2B37A 4W9NC 3PP8A 4P22A 4J4BA 1O5IA 1D8AA 1U3VA 1HSZA 4GX1A 4YAEA 4CLXA 1R16A 4B79A 3VVCA 1E3WB 4FJ0A 1KC1A 4TKLA 5IDXA 3FSRA 2OUIA 1YQGA 1Q7BA 2X4GA 4CLOB 5T6BA 4QQRA 3NT5A 2E6UX 8ADHA 1U8XX 1X7DA 1TB4A 3KLMX 4WNIA 3ZDFA 2VHVA 1I30A 4IM7A 4MVJH 4B4VA 1Z82A 4GMGA 3U62A 3KYDB 5EMHA 2NVUA 4YRAA 3GEGA 4BO2A 4CPDA 1NWHA 3OM9A 4F3YA 2Q1SA 2HRZA 4IIVA 1ZUD1 4YYZA 1TVEA 3H9EO 1EVIA 1I24A 2X6TA 1I33A 3DZGA 2Y1EA 1X0VA 3MTJA 5KJEA 4IS3A 1E7QA 2VHXA 4NPCA 1R66A 3NKLA 4U6QA 4UUNA 5IN5A 4BKUA 1E1LA 1R6DA 3TSCA 4ALJA 4R5MA 4LRSB 4OGWA 3LZ6A 1EK5A 1VSUA 1QYDA 3ZGYA 1F0YA 1PL7A 2BLLA 4FJ1A 1ZW1A 1BWSA 5KVQA 3LDHA 1DSSG 1NQOA 4O6VA 1GU7A 1UDAA 4D0SA 4IS2A 4CUKA 3JYPA 2YUTA 4QO8A 3UF0A 1I8TA 1ENYA 4NBTA 4CQMB 3MJCA 1LSUA 1V8BA 1LLQA 1ZJZA 1NVTA 3G1TA 4JK3A 4YJGB 2J5KA 3VOSA 3VPXA 2Y1GA 3SLGA 5COBA 3LU1A 1IE3A 2QRJA 1SAYA 1TT5B 3Q0EA 5ADHA 4YT2A 3BMNA 1ZEJA 3IDSA 2DTEA 3QA9A 3JQ9C 3V2GA 3D64A 3HDJA 1SB8A 1A4UA 1BW9B 1YJ8A 4RLHA 4WLOA 4DTIA 2VYND 4KQXA 4PLFA 4OO3A 1T2CA 4E0BA 5L4LA 2OORA 3BMQB 3QRWA 3BTVA 3GFGA 2VWGA 1VL6A 3K30A 9LDTA 1PL8A 2Q99A 3RVDA 3WYCA 3INTA 4BNGA 1NBOA 3UCXA 3VTZA 2H5LA 1LNQA 4XB2A 1PJCA 1HYGA 4DMMA 2D8AA 1DFIA 2EJVA 5DNAA 3H2SA 1HTBA 2X8LA 3EZLA 3H2ZA 3K5PA 4DMLA 4QXMA 4L76A 5F21A 2A9FA 3JCZA 1A4IA 5JCXA 3JYOA 1WDKA 3OSUA 1Y8QA 3L6OO 4TMFA 4J0EA 4HNGA 1ZZEA 1JKJA 4ID9A 5DBGA 1P1KA 4MO2A 2VHYA 3EVNA 3TPCA 2Z95A 5TT1A 1W8DA 1YBMA 1QORA 1GCUA 1PJLA 2BFOA 5L3ZA 1O6ZA 4I5FA 1YL7A 2GSDA 2DFDA 1EFKA 5DCYA 2YW9A 1T2EA 3E9QA 4XR9A 3VKUA 4F6CA 1ZK4A 4FFPA 1YRLA 4CL3A 3TFQA 2TMGA 5KVCA 3DTTA 1P1JA 1HRDA 3NJ8A 3V1UA 2X58A 4BNIA 3WBBA 4E6PA 4RQTA 3L77A 4HWKA 3AY3A 1LU9A 1KVUA 3I1JA 1DIAA 5TQVA 4A10A 4EJ6A 5CG1A 1SNYA 1N7HA 3VPSA 4PLHA 4WLFA 4RQUA 4GLOA 4R01A 3DAGA 1Y5RA 3WDSA 2HMTA 4FOOA 4CQLB 4F46A 3LT1A 2CVZA 3ZV5A 4NR0A 2IYPA 4FW8A 4N5LA 4EUEA 4BO4A 4YJHA 3MJEA 4YR9A 3BA1A 4RPKA 1E3LA 4NBVA 3SX2A 1Z7BA 4KZPA 1N1GA 3X2FA 1Z73A 4OOFA 3SVTA 1D1SA 3EY4A 3WGZA 1Z75A 2YFHA 1N5DA 4XB1A 1I2CA 1J49A 1VKOA 4WLNA 4D3SA 3DBHB 4DREA 4MJLA 4JP3A 1MB4A 1PIWA 8LDHA 3C24A 4R16A 1ZKMA 4I5DA 1QG6A 3E5MA 4R1SA 5DULA 3FBGA 4CV3A 1N1EA 4MVJE 5IZCA 3OJLA 3GVXA 2JCYA 2AEFA 5G4LA 1DRUA 2B83A 3OJEA 3DMTC 5EESA 1IPFA 3D1LA 1ISMA 4ITUA 1X15A 1XDWA 2PH3A 3BIOA 4OXYA 4FFMA 2BD0A 5EERA 1FMCA 1I5RA 4YVFA 3KOUA 3HNPA 3ROQA 3FPCA 1HLDA 4NFHA 4IJUA 1JKFA 4E2ZA 1P0FA 1YQDA 2VWQA 3H9UA 2HK7A 4P4LA 2DM6A 4JX8A 4PVDA 1Q2XA 4ND2A 1GY8A 3AOEC 3ITDA 4K28A 1GV1A 3OIGA 2NV6A 2GLXA 3EUWA 3COSA 3FR8A 1XGKA 3HN2A 3SBOA 3W4KA 3ONDA 3CUKA 3PFWO 4ALMA 3VZQA 4D44A 2OP1A 1EEHA 1Q7CA 4Q3DA 1NTOA 2DTDA 2HQ1A 1C14A 4HFRA 5DBFA 1YGYA 2NU6A 3D4PA 1LDGA 2NU8A 1R4NB 1I01A 3DL2A 1T25A 2W4QA 4ZRMA 3TJRA 4E31A 3BMCA 2PFGA 5JFOA 5JDCC 5G0WA 1U2DA 1KVRA 3TDKA 2NTVA 1LRKA 2DPHA 3DZIA 2A35A 3GY0A 1H2BA 4D3DA 2PH5A 2X5JO 2GZ2A 3GN1A 3ZNOA 3QVSA 2DVMA 1ZXLA 4FS3A 2IEDA 4ROSA 4XQGA 4HX5A 4J7CA 1UDBA 3K2EA 4PLVA 1IHYA 5FWNA 1UR5A 1EFLA 1G6KA 4I08A 1I36A 3ZV3A 4W6ZA 3VDQA 3C1AA 1X14A 4B4WA 5K6AC 4R69A 3DC2A 4BNXA 4DA9A 4BL5A 1ZSNA 3WSVA 1XU9A 3TZQA 4CMCA 1IZ0A 4JBHA 1XWFA 2O3TA 5J23A 3SJ7A 1T1SA 5KKAA 4B4OA 3ZHXA 1E3JA 2F1KA 3CKYA 4AJOA 3W8DA 1EVZA 3FNGA 4ALLA 3F3SA 1YKFA 2PLAA 1YONA 4HY3A 4WEOA 3NDRA 1H94A 2OO5A 2GNAA 4KWHA 3V1YA 4ESOA 3PZRA 4F6LA 5JMPA 4BO6A 2HMSA 5JO0A 3ST7A 4Y9DA 3GDOA 3QVWA 1O0SA 4R4JA 2BI7A 4RL6A 4OMUA 2QYTA 1EUDA 1N2SA 1QSGA 2O3UA 2BRUA 3ADOA 1JTVA 1GADO 1VL0A 1NWCA 4Z9YA 4A26A 1KVTA 2IZ1A 1GFSA 5G4KA 3WSWA 5BT9A 4E5KA 3EHEA 1P77A 3V1TC 4NNJA 3H65A 3DTYA 1P1IA 1PGOA 2IYOA 2C5AA 3RCBA 3MZ0A 3OBBA 3ASUA 2IZZA 4Y6RA 4NBWA 4FGSA 2IXAA 3AFNA 3NYWA 4Z9FA 3K96A 5JS6A 2DLDA 1ADBA 3TL2A 1DIGA 1OC4A 3VKVA 3PEFA 5B4VA 3WLFA 3BAZA 3DB2A 2C2XA 4DLLA 2NVWA 4NJMB 2D3TA 3ZWXA 4R1TA 2RH4A 2WE7A 3FWZA 1PTJA 5MGBA 1IB6A 5ER9A 1U5AA 3VAZA 2FR1A 5I8WA 1D7OA 4WGGA 2Q2WA 3H9QA 4XYEA 1EDZA 3TRIA 3G1UA 1Y1PA 4LCEA 3NDIA 4W4TA 2RHCA 1ZMTA 1WMBA 1ONNA 3OFSA 4KWIA 4NDNE 5GMOA 4BV8A 1OOEA 2Z1MA 4JLWA 4CMKA 5C3MA 4KUEA 2ZJ1A 3FTNA 3LC7O 4A0SA 3VPHA 1B3BA 4K9DA 2V6GA 2DUUA 4IZHA 2B5WA 2QRKA 3DOOA 4XQ9A 4AL4A 1NQAO 3E82A 4J1TA 5I9LA 1KBZA 2CD9A 2AMFA 3T4EA 5JW6A 1PJTA 2P9EA 4P4NA 4ZICA 1B8VA 2GDZA 2HMUA 4LVUA 1ADCA 3DBVO 5IG2A 3I9JA 1QP8A 2ZTLA 2XAAA 3ONEA 5CEEA 3K2BA 3OEYA 5FI3A 1MP0A 3DDNA 4QX6A 3AM3A 2X9VA 4BKRA 1CQIA 2DKNA 1HYHA 2PV7A 3ZCXA 3ZN2A 2WE8A 4HKTA 4KTVE 4NU5A 2Y93A 5A9TA 3DMYA 1IPEA 5CEFA 1Z7EA 4DGSA 2PKQP 3ZWCA 4N7RA 3NJ4A 4HV4A 4KQWA 4WNCA 1HZZA 3CINA 4EGFA 3GRKA 2NM0A 1KEPA 3L4BC 3Q6IA 5EPOA 3RUFA 2JHGA 4FFNA 4N5MA 4IXTA 5IF3A 4HBGA 4MVJA 5IZCC 1SZJG 4EYEA 4S3MA 4CM9D 4IDBA 1B7GO 4BNTA 1UAYA 3IP1A 4MINA 4R9RA 1I3NA 3GVHA 3ZU2A 1E0DA 4UREA 3PHGA 3IAHA 1P0CA 6LDHA 1I0ZA 5CAEA 1PGJA 2O4UX 3VH4A 4DRYA 3RUHA 1SBYA 1X0XA 1Y5MA 3CSDA 5TJ9A 3DAFA 3H9JA 3BHMA 3O38A 3DONA 2ET6A 1T1RA 3O4RA 3NT2A 5EQDA 3PYLA 3RI3A 1UXHA 1LSSA 5DDIP 4HP8A 2LDBA 4XZ3A 4BO0A 2FMUA 3WMWA 2IRWA 2YYYA 3RC7A 4ALNA 5BSEA 1MGOA 5G0UA 2W98A 3AOEA 4GSKA 4ZGWA 2EKLA 1HDOA 3QWBA 4URFA 4EEXA 1MUUA 1LDMA 2HJRA 3WQRA 1FK8A 1LDBA 4RCVA 4XDZA 3MJVA 1T2AA 1DO8A 5ITVA 2NSDA 1NFQA 1A9YA 2X0IA 1D1TA 1WVGA 3IKTA 1SO8A 1H6BA 4YQZA 4PVCA 3RIHA 4DPMA 3QE3A 4NK4A 5DCUA 1OC2A 4MKZA 2YQ5A 2ZK7A 4Z3KA 1GD1O 4UULA 3IC5A 2VNSA 5JSFA 2B5VA 4FR5A 4XYMA 2J3JA 3RBZA 1Q0HA 5CDSA 3GMSA 4AJ1A 1NP3A 1CF2O 3PJEA 2VYVA 1U7HA 3Q2IA 4EITA 3B1FA 2DQ4A 1TEHA 1C1DA 4FN4A 4OL9A 4CM8A 2ZQZA 3F47A 4XA8A 1EE9A 2W2KA 5CDUA 1GPJA 1YBAA 3WX0A 1B15A 3ZWPA 2GZ3A 3KSZO 3GNQA 1O94A 3O8QA 5JCJA 3FWNA 4YWJA 1A72A 2YV3A 5CG2A 3P2OA 4GLLA 1W73A 2D1YA 2HO5A 4YQYA 2PZLA 4BV9A 3IMFA 3PXXA 4Q3BA 1B8PA 1E7SA 1WNTA 1GZ3A 5EJ2A 2CF5A 1DHRA 1B16A 3PLNA 2Q2QA 5TNXA 4E2WA 4OSOA 3Q1LA 5DP2A 2HK8A 3MTGA 1CYDA 4ZRNA 3PGXA 4ND5A 3DR3A 4E5MA 5CFZA 3WFJA 3JQAD 1HEUA 3UCEA 4PLGA 4MKRA 3JD0A 2UVDA 4R41A 5L53A 1N8KA 4BNHA 5CDTA 4HADA 4RF4A 1DEHA 1EQUA 4QFDA 4DPLA 4F45A 5C7LO 4QECA 2D4AA 3WG9A 3JQCA 5F1OA 2VQ3A 4FSHA 5FI5A 2VRBA 4XYLA 4A2CA 3TZKA 5C7IO 2YZ7A 1O89A 3E03A 1FDWA 4GX0A 2C82A 4O5OA 3ROPA 1YJQA 1PX0A 1LX6A 2I67A 4R1UA 2Q50A 3CE6A 1HETA 5EINA 3TZCA 4IINA 3MWEB 2YDXA 3NTQA 3BMCB 4NJOA 4R51A 4R1NA 5I8ZA 2Q1TA 4FC7A 1XQ1A 1DAOA 3I9OA 3RKRA 2Q46A 1LDEA 4BKPA 4Z3DA 4HXYA 2P5YA 1I3LA 4BMVA 2HKIA 4AJJA 2GZ1A 3ZZNA 1Q0QA 1WMAA 4JIGA 2XXJA 3ETGA 3GVCA 1LI4A 2PA3A 3AUAA 5TC4A 1ZSVA 3GLQA 4CM1A 4RPHA 2O3QA 4AJKA 2VTEA 2UV8A 5T64A 1HDCA 1QR6A 5BNFA 4WCFB 3WYEA 2RAFA 2XOXA 4FJ2A 3RROA 4G5HA 2DAPA 1MC4A 4CV2A 4CMBA 4D46A 2YHIB 2FPIA 3Q9NA 2VN8A 4NH4A 3WWZA 3NTRA 1Y8RB 4FIZA 1P1RA 2RBEA 3HDHA 3JQFA 5AVOA 2JFHA 1ADGA 4G65A 3ZU4A 2JKVA 4JROA 3DAPA 1BXGA 5HWSA 4EI2A 2IZ0A 1DHTA 3IUSA 3LLSA 2I76A 2W2LD 4GMFA 3L4SO 3RFVA 4J4HA 3ZNQA 4GPD1 1ADFA 3B1KA 3AUTA 4XR4A 5IXYA 1HE2A 4XRGA 3ZNPA 4L74A 4BNFA 1U2GA 3WQSB 1PR3A 2ZQYA 4Z9XA 5L7TA 3HB4X 4BO8A 1KVSA 2GF2A 3RWBA 5A04A 1ISFA 1FF9A 3R3SA 3GHYA 4CMAA 4PLYA 3DHYA 2EG9A 1UZNA 2PZKA 2PY6A 3QWAA 1L7EA 1TT7A 3DEYX 5DP1A 1J5PA 1PS0A 4GAEA 1QLJA 4KUHA 4RLSA 1VPDA 5CPFA 1O95A 4II2A 2G5CA 3QQPA 4YCAA 4CMGA 2I99A 5K6AA 2FHSA 4ZVVA 1VI2A 2E49A 3JD4A 3WOHA 2CDBA 1UUFA 3DZJA 4R5HA 3AY6A 3WJ7A 3FRJA 5DOZA 1Y9EA 3OJFA 4RZHA 2P2SA 4JBGA 4BOYA 5JAMA 2GRAA 4PLCA 2LDXA 3KHUA 6ADHA 4M49A 5G2OA 4DYDA 5B4TA 2WD7B 3VH1A 1DFGA 4FFRA 2O48X 2BGMA 4DQUA 3AWDA 4Q3NA 3SLKA 1A71A 1EMDA 1H9BA 5T8KA 4OSPA 3UUWA 3R1IA 4L73A 4MP6A 5TLSA 4D45A 4XIJA 3A4VA 1XKQA 3QWFA 3H8VA 4FB5A 2JD1A 4EBFA 1AUPA 4GKVA 5H81A 4JJGA 1P74A 4IDFA 4EUHA 1M76A 2ZB4A 3AI2A 2VWPA 3G0OA 3RKUA 4B3HA 4MP8A 1HWYA 4IGFA 1E7WA 4L9RA 2QQ5A 1PSDA 1Y8QB 3G49A 3WXBA 4RJTA 3Q2KA 4AICA 5G0VA 2X23A 3NGLA 5JC1A 5KJ6A 4NZ9A 3PYMA 4XEHA 1UZMA 1B3RA 3TL3A 1JAYA 2ZB7A 5AXCA 5TT0A 1CDOA 3CPSA 3NUGA 2HMWA 3CH6A 2OBYA 5IDWA 2C7VA 2GR9A 2GCGA 3PDJA 1XQ6A 1AHIA 3BMQA 4ONEA 3UCFA 1N9GB 2YV2A 5CHEA 3L6EA 4RF2A 2AHRA 1E7MA 1BW9A 2W90A 3FNFA 2DFVA 1KC3A 4OXKA 5IZ4A 1TT5A 1ZMOA 4XGKA 1JLLA 4IPTA 4ZQFA 3KEQA 4WLUA 1ZK2A 3DOJA 2FRDA 1QRRA 1WPQA 3E1KA 3G79A 4L0QA 3ZU5A 1KS9A 3NRCA 4XJTA 3MWDB 2QZ9A 1UDCA 4JNKA 2Q3EA 3UGKA 1XIVA 3HE3A 1GPDG 2CSUA 3ZWVA 4CUJA 4PN3A 2PKQO 2EGHA 2V6MA 1EBUA 3WNQA 4L4SA 7ADHA 3MCVA 3DOCA 5ITWA 4UEJA 2ZYGA 3C85A 1D3AA 2X5OA 3RUIA 3ZWNA 2P9GA 4GGPA 4GI2A 5L51A 3ROKA 1YB5A 1NVMB 3D4NA 3BTUA 3OQBA 4WK6A 2AW5A 3FF4A 3TZ6A 4IQ0A 1BGVA 3C8MA 5KTKA 3K92A 1U4OA 4C7JA 5T5QA 1ZVMA 3L4BA 2BH9A 4HFJA 2X0RA 5ICMA 3OA2A 4BMSA 2EKQA 3JQGB 3KRTA 3K73O 2ZTMA 1KY4A 3KYDA 1LRLA 4KP7A 3FBTA 2C29D 1DIHA 3PZBA 1GAEO 1AGNA 2WDZA 1DIBA 1YE3A 4CLHA 3PHHA 1FXSA 3Q9UA 3VC7A 4PG5A 1GZ6A 2CFCA 5F1PA 4YXFA 5I9NA 1GYQA 1LA2A 2NTJA 5DZSA 1B0AA 2R6JA 1UXJA 2HJSA 2PGLA 3QHAA 2E4AA 2HU2A 3QLJA 3C7CB 5HA5A 3WGTA 3I83A 5HS4A 3SXPA 4WECA 3A28A 3EDMA 4PLPA 2OXIA 4BQRA 4PG8A 3C7AA 1T2DA 4LMRA 1HSOA 1HDXA 1SOVA 5BQFA 1VRWA 4FBGA 4YT8A 5F5NA 5ENVA 3PIDA 4NG5A 2VYNA 4KDEA 1M6HA 4XX0A 1KIFA 3LC2O 2J3KA 1ZCJA 2JD2A 1MC5A 2X5KO 3B20A 3ENNA 2X7HA 3ETEA 4YJHB 4ZN6A 4JGBA 3WIEA 2PD3A 3H6KA 3NGXA 5C37A 4CQLA 4BO7A 3ANMA 3W6ZA 5JY1A 1A27A 1F12A 1UP7A 2BF7A 5TIIA 4RVHA 1VC2A 1JQBA 2QRLA 4OKNA 5AYVA 1AN9A 3ZHBA 4AJEA 4D42A 1K2WA 5A4DA 5AXDA 1BHSA 4E13A 2IDZA 3WMXA 3STHA 3HFGA 3K9QO 2AE2A 2ILTA 1GZ4A 1PGQA 4PZEA 3PFFA 2ZATA 4UVIA 5F3RA 3GG9A 1E92A 3DZBA 3PHJA 3WNVA 3RU7A 3DQPA 2JAHA 1LTHR 4K6FA 5CDYA 1MG0A 3QIVA 2Y1CA 3KBOA 1NVGA 4DLAA 4ZQHA 1ENPA 4N54A 5L45A 4R3NA 1NPDA 5ILOA 4XCVA 3H5RA 2GN9A 2CF6A 2UDPA 4DQXA 3DBLB 4GGOA 2FWMX 1ARZA 1UP4A 4RV9A 4FC6A 1HXHA 4GH5A 4O1MA 4JQCA 1LXCA 4U5QA 4A27A 2C7GA 3K6JA 3ZV6A 3WS7A 2WD7A 1MV8A 1BMDA 3QSGA 1AXEA 1DC3A 1XYGA 2VZ0A 1HDZA 1E3IA 4RF5A 3IUPA 2X0JA 3BHJA 4D41A 1DDOA 4Q3CA 4E5YA 4EUFA 4ND1A 3CMMA 4CR6A 3GAZA 2Q1UA 2X9GA 4H3VA 3EGOA 2BI8A 1QV6A 3GF4A 1VM6A 1CJCA 5JAQA 1ID1A 1X1TA 4DC0A 4YJFA 1ZIDA 1NR7A 1K3TA 3G17A 4RDIA 4UUPA 4IJWA 4YEDA 3ZHZA 5GZ3A 1DJNA 3BMNB 3LVFO 4A7PA 4CM3A 1M67A 3U0BA 4RVDA 3JQ9A 2FPPA 3NV9A 3JQBC 4E5PA 1FDVA 1Y6JA 3ICPA 4TRNA 4K1LA 4YJGA 5IDYA 1HYEA 4CR7A 3NDJA 4IDAA 1JDJA 3FI9A 4B8ZA 5BNIA 2QX7A 4CQMA 3OA0A 3PYXA 4B4UA 3W4IA 2EXXA 1BTOA 3NTOA 3C7DB 1XSEA 4ZA2A 4UVEA 4DYVA 1ISGA 4CQMD 5B4UA 1QYWA 1KOLA 2OP0A 5K9ZA 4BUCA 4TVBA 1X13A 5I7SA 2GO1A 4GVXA 3EC7A 3GGPA 2O2SA 1VJTA 3IQDB 4D7AA 2EJWA 1BXGB 2BGLA 5I7FA 3ZWOA 4RVUA 3WBFA 1Z45A 2J3IA 3JQGA 3EYWA 4BNKA 2O7QA 2QIOA 4CMIB 5EN4A 2YHIA 5A9RA 4MIEA 4W9NA 3KVOA 1J4AA 1DOHA 1IY8A 1PWZA 3W8EA 2NVUB 4Q9NA 4WUVA 5L95A 3GDGA 3HZZA 4DIBA 3WGGA 1BDBA 3U5TA 1NAIA 3TOZA 1HE4A 3MOGA 3DWFA 3WIDA 3IL2A 4DWVA 1H0KA 3H3JA 3UFXA 3JQFC 2G82A 4M1QA 3M1AA 4BNLA 2D59A 1XCBA 1GL3A 4CLOA 4BIIA 3WGYA 1YL6A 4BHTA 4MVJM 5EL0A 4PGFA 3E5RA 2Q45A 3A1NA 3ITKA 3JYQA 5TS3A 3PHIA 1VJ0A 1WDMA 3PJFA 4G81A 5T67A 3QVTA 3E6AA 4R9SA 3U4IA 1R4MB 1YDWA 2WJPA 1YVEI 1EZ4A 2OOSA 5G0TA 1H5QA 1B8UA 2UUPA 3D4OA 1F14A 1U1IA 4I9NA 5A3VA 1JA9A 3VVBA 4WKGA 3PI7A 5KCZA 1WZIA 2NU9A 1GUYA 4AJ4A 2FY8A 1PZHA 1KETA 1HE3A 3OICA 2VT3A 1YH3A 4GL4A 1K89A 2B4TO 4RDHA 1HT0A 1SCUA 1A7AA 1MXHA 3PHLA 3ABIA 1C0KA 1N9GA 1EK6A 2ZTUA 4M87A 4WOJA 3GK3A 3SC4A 1TLTA 3ONFA 2IEBA 1P45A 5FF9A 3F5QA 4JXKA 3WR5A 4Y98A 1GQ2A 1KYQA 4Z0HO 1QYXA 1SEPA 1P1HA 2WEKA 3TNLA 1WDLA 5HBRA 2ZYDA 3RBVA 3PWKA 4Q39A 2ZB8A 4IBOA 3UHAA 1MG5A 3GEDA 4RF3A 3GNSA 3PTZA 9LDBA 4NIMA 5CPBA 5H83A 1IL0A 3RU9A 1HF3A 1ISIA 5U4QA 3N58A 3T7CA 4R68A 5JY6A 3UICA 2BHLA 2J8ZA 1JVBA 5T8KC 2JJYA 1T2FA 2P4HX 1ZK1A 2I9PA 1VKNA 1LDNA 1TI7A 2A94A 4IMRA 4TWRA 3WJAA 1A9ZA 3GHHA 4BNZA 4CV0A 1BG6A 4Y6SA 3RQSA 3JD2A 4DXHA 1JWBB 4IDGA 4YPOA 3PLRA 2J6IA 5KVSA 2GERA 2WYVA 5U1PA 4XRRA 2YV1A 4BGVA 1W4ZA 1UXGA 4J1SA 3WTCA 4MKXA 3I6IA 4JCOA 4PLZA 4DPKA 2AQKA 3ASVA 3BHIA 1K6XA 1QXSA 3N7UA 3IJPA 5JYDA 3OJOA 5AQ1A 1U7TA 2P91A 4IJKA 3LT0A 5COQA 4E2YA 1WLYA 4BKOA 4M54A 1E3EA 4RPJA 3UN1A 1SEVA 1ISJA 1AHHA 4U6SA 1RM3A 2EERA 1VJ1A 2YHUA 3ANNA 2UUOA 5LCXA 1LQTA 1UH5A 1NHWA 3PVZA 2NU7A 4K6CA 4UEKA 4YJDA 3I9LA 2EGGA 3UXYA 1V0JA 2R00C 3ULKA 2B69A 3D5QA 1U3UA 2B0JA 4D43A 5IN4A 4KUGA 3L9WA 5JAZA 3R0IA 3E9NA 3QJ5A 3OQ1A 3ZWWA 1GDHA 1NQ5A 2NADA 3RC2A 1ENZA 3S1LA 2QW8A 5JDIA 1E1NA 3AI1A 3RJ9A 1KY5A 3ANLA 4OJNA 1PGPA 4J6FA 3S2IA 5KOIA 1P3DA 2CUKA 4W82A 1ZEMA 4CMEA 3T7EA 2YFQA 4BKQA 2FPGA 3V2HA 2PD6A 3V2UA 1IUKA 2V6BA 2VZ9A 3ADPA 5CEJA 4MIYA 2GN6A 4Z0TA 1Y8RA 4GQAA 1YO6A 3S55A 1I2BA 3H7AA 1OI7A 1R15A 1PJ4A 1X7GA 3HG7A 4YAJA 1V35A 4W7IA 5IFLA 5GZ6A 4J90A 1CWUA 2AQ8A 3O26A 4UAGA 3LSYA 4WCFA 5A5EA 5KNLA 4JBIA 5BSHA 3CZMA 3LF2A 1Z74A 3KYBA 2NQ8A 4TZKA 4MIOA 3RUCA 5FEUA 2VWHA 4E4YA 1YQXA 3B70A 3JQ8A 4NMHA 4CL8A 4DBZA 4JJFA 4LK3A 4TRRA 1PQWA 2PGJA 3A9WA 4BO5A 5A9SA 5K0ZA 4OQZA 4IUYA 5H82A 3QVOA 4AJLA 2PTGA 4XJSA 3KZVA 4JN6B 4TROA 4UVGA 1QLHA 2XF8A 4D3FA 1EUCA 1M66A 2Q4BA 3PK0A 3GH3A 1Y7TA 1Y81A 3PIIA 4INAA 2PZJA 2FP4A 3AY7A 4BO1A 3W4JA 4B7UA 4IGEA 1F8FA 3UAGA 5IJZA 4KTTE 3I3OA 1Z6ZA 2R00A 3DHNA 2VOJA 4H15A 3S2FA 3R3JA 1DFHA 2BFMA 4ZD6A 5ILGA 4OH1A 1HE5A 3CEAA 3L0DA 4WE3A 5L7YA 3HSKA 3GGGA 1OFGA 2NACA 5JDIC 2EW2A 3AUSA 5I7VA 4K26A 1LDYA 1XG5A 1YB4A 3U9LA 2Y0CA 5HS6A 1CQJA 3B6ZA 4NJMA 3D3WA 3CTMA 4GWKA 4BQPA 4RPGA 3K31A 3GUCA 4O0LA 1T26A 2VHZA 3KO8A 4IY1A 4XWYA 1WWKA 5EIOA 2VHWA 3ZWYA 3M2PA 3I5MA 3IIEA 1S7CA 1UJMA 3JSAA 2QHXA 4NK5A 3QV1A 3GZ4A 4BGIA 3QW2A 4U7WA 4NFYA 2EP5A 2FR8A 5T57A 3SJUA 2I3GA 4XQCA 4DLBA 4EJ0A 5L4SA 3VPGA 3JQAA 3OQ6A 4FDAA 3VH3A 1ONPA 1SPXA 3O8QB 5L40A 4LCJA 3IKVA 5HTOA 1DC6A 3Q3CA 2BMAA 3UVEA 4PLTA 1ZK0A 3GVIA 2W2KB 3PPIA 4NFSA 3I9KA 4H16A 5A05A 4CM8B 1C1DB 1PJ2A 1LBEA 3GNTA 1ISHA 4BNJA 4M86A 3RUAA 3MOIA 5JBIA 3DO5A 5JXWA 1PQPA 3C1OA 1K6IA 3I9MA 2AG5A 2WYUA 3VH2A 3ZWAA 1E7YA 4GWGA 1YWGO 3WTBA 4LSMA 2SCUA 3EVTA 1ML3A 4BVAA 2OFPA 2O2YA 1DBVO 4IDCA 3KSUA 2DBRA 4Q3AA 1H9AA 3RJ5A 3PQEA 1HDGO 1JWAB 4Z0PA 1PGNA 1HDRA 4MOWA 1C0IA 1D4FA 1PJ3A 4B7CA 4BNMA 1I3KA 3C1TA 2I66A 4J9UE 1UAGA 5KVVA 3DFUA 3GDFA 2ZCUA 3WQQA 3VZSA 2EWMA 2I5PO 3BMOA 4J0FA 4W99A 2F00A 2O3RA 4ZHSA 1ONOA 3DBRA 4WEQA 2CY0A 3U4HA 4B3JA 1XLTA 1EBFA 2ZJ0A 2OZPA 4ND4A 2EF1A 1W0CA 2O3SA 1LLCA 5LC1A 3I9NA 4E30A 5KJFA 4LRTB 3PWSA 5THKA 1MFPA 3DXFA 3PQDA 4CR8A 4CM7A 1VSVA 1O9BA 3GZNA 4DL9A 2QYSA 4WPGA 4LSWA 5L9AA 3E8XA 1NFFA 4IXWA 3E18A 2GPTA 1H2HA 3AUUA 3BTOA 3HHPA 3E9MA 1H93A 2W2LA 3I52A 4EJMA 1A5ZA 2V7PA 2TMDA 1JVSA 2EKPA 1IHXA 3OEWA 5A3JA 1DAPA 3PJGA 1G1AA 1NHGA 2J5QA 1P31A 3MJTA 1DRWA 4Y67A 2FN7A 3F1LA 5DT9A 4PCVA 3KV3O 3S2GA 3GOHA 1YBVA 4Z6KA 1E3SA 3O03A 2ZKLA 3FNEA 4CMEC 2DUWA 3ZWBA 1AE1A 2DBVO 3RD5A 4TZTA 4ILKA 4EZBA 3JQDA 1TXGA 3D3EA 1FDUA 4FOSA 3IP3A 4LMPA 4OKIA 4UUOA 5GY7A 4YRBA 1U9JA 5BR7A 1ZO8A 2CNBA 1WZEA 2G17A 2CDCA 3OHSX 4Y8VA 1YDEA 3AM5A 3F1KA 4BGUA 2AE1A 1R12A 1Q1NA 5KJCA 4H7PA 3F4LA 1DPGA 2E48A 3NAQA 1WW8A 4MVJP 5JDCA 4AVYA 1V3VA 1OMOA 2I3AA 1HZJA 4A03A 3HDQA 2X22A 3P2YA 4J3FA 1PZEA 3FCOA 5FYDA 5JE8A 3HADA 3ORFA 1JKIA 1ENOA 2CDAA 2HRBA 3GQVA 4C4OA 2FOIA 3GR6A 1DLIA 5AXAA 3PDUA 3JTMA 4CJXA 2DT5A 3OF2A 4YAGA 2AEJA 1J6UA 4AJNA 3RASA 2Z1NA 4NBRA 5AOVA 5DN9A 5TX7A 2Q2VA 2VUTA 3KEOA 4LVCA 1EVYA 1RM5A 1F06A 1HL3A 1MX3A 1TA4A 2A92A 2H1SA 3U4DA 3FTPA 4CM4A 2O4CA 3SEFA 4OAQA 3WICA 1T24A 4GX5A 3GT0A 4HFMA 1H6AA 3WYBA 3AW9A 2AA3A 3GUYA 4ALKA 1PU2A 1LEHA 3N74A 3RAJA 1PS8A 4IDEA 2JD0A 4DC1A 1NQTA 1ZSYA 2VTDA 3JYLA 3ZW8A 1W6UA 4BO9A 1NASA 1JN0A 1I10A 2WSBA 4P4GA 5G4KB 5IDQA 5FFFA 3GZNB 1RM0A 3E48A 5LDGA 2C54A 3OJ0A 1NFRA 4RVFA 1MA0A 1QV7A 1QMGA 3HWRA 4TRMA 1RM4A 4E12A 2Y0DA 1SOWA 2Y1DA 3JQEA 4J1QA 4EW6A 3HFSA 5F1KA 3IOYA 3D0OA 4B7XA 1CIVA 1FJHA 2ZCVA
chains in the Genus database with same CATH superfamily
3IE0A 1L5YA 1WSDA 4REQB 4WKPA 2F43A 3QP9A 1II9A 3OH8A 2OBNA 3HLTA 3V8NA 4EYSA 1J20A 1Q6YA 3RFFA 4B6EA 1LSOA 2UYYA 4ZTUB 3HZOA 4N40A 2AC7A 1Y33E 2AV6A 3BXHA 1IN6A 1H1LB 1W1UA 1C4KA 1YOVA 4MZXA 2R7KA 4RPIA 2Q4TA 4LCBA 5KIAA 1UDWA 3EQZA 4XLTA 3EA0A 1VIYA 3PC4A 3DZFA 1NMQA 3UWOA 2E18A 2OSBA 3GBSA 3F8SA 3RNOA 5JRJA 2PUAA 3KT8A 3O8BA 1LVGA 3O9VA 2P30A 2H06A 4TKUB 3QUTA 3KQSA 4DEYA 4B6OA 2JB9A 5EHNA 3THYA 1NDHA 4IUCS 3W3AD 1U0BB 1WZCA 2FXVA 5TF4A 4DJEC 2PNFA 1E94E 3QWHA 4BU1A 1UOOA 2R7LA 3GFOA 1BE6A 1N5MA 3AHEA 3B9QA 4ZVKA 5HM8A 1U8FO 1ZNWA 1YJXA 3G3EA 3M5WA 3QENA 4NHOA 4YJ2B 2BELA 2P9CA 4D6XA 1Y6FA 3LYAA 2CCGA 2X4IA 3K16A 3NCHA 3PXUA 4PG6A 4REQA 2WI8A 4DR6B 1UBSB 2X86A 4UBLA 5DNYB 2A5DA 1A9TA 2YKGA 1BS1A 3TPZA 5AHKA 3I4FA 4QYTA 4RKWA 4KO8A 4RVGA 5BNTA 4DV7B 4CIAA 2AKEA 1T9BA 5H16A 5IBPA 1Q77A 1K6JA 1RYEA 3I23A 2GXUA 5REQA 3IDAA 3UGQA 5HQ3B 4YIHA 5BYAA 1WULS 2O8EB 3NEJA 5H7XA 3IOMA 4HH3C 4IFIA 1C9MA 3CGWA 3IIMA 1E6LA 4M89A 3GG2A 5DTJA 4AJIA 2DWUA 4G4SP 2BBTA 3FPBA 1XD2A 5AJZA 3C8DA 1GSOA 5FL3A 3P94A 4D56A 1QS0B 1Z7GA 2ODNA 2PE5A 2C3MA 1K5DA 2ORED 3DTNA 3VUFA 4Z9AA 3NMUF 5FTKA 2F1HA 2WHQA 4WOKA 4RD1A 1KL7A 2DG2A 1ZIYA 4MDHA 5LP6C 3T38A 1TGVA 5J40A 2OV3A 4BEVA 3WGVA 5JYCA 2CFIA 4Y9SA 2WM8A 4CM4B 3B13B 4LXXA 3GLGB 4Y0NA 2C1ZA 2IHZA 5KX5A 1MXFA 4WCFC 5F5LA 3LMKA 3R24A 2ZYAA 3ZEIA 1Z5ZA 3AFMA 1CDEA 4EPWA 1SPBS 2X0NA 4D3XA 1XA4A 4DSOA 4X54A 3INYA 5DJ5A 2VAPA 1P7VA 2WMOB 4R71A 1N7GA 1RI4A 2ZUBA 3NM6B 4AJ2A 2PL1A 1OLSA 5BW8A 1OQAA 1EP2B 3CZCA 1TCCA 3ME5A 4MV5A 4LJ6A 3LKVA 2CV1A 3TG2A 3QFSA 1XD9A 4M9SA 4I36A 3LPNA 5MDHA 3SKVA 5IKOA 4C4TA 1EWYA 1R5BA 1XAGA 2Q9BA 1VE5A 4X24A 4ZEWA 5BYBA 2GO7A 1NRJB 1W0JD 1TM1E 3IAM1 1JG7A 4K9NA 2JFPA 3RGGA 3UW3A 3F4KA 5KJ1A 1F7UA 4OB7A 1CZUA 4ABYA 4I4CA 4PY2A 2V7BA 3BCUA 2FP4B 2F59A 2V7XA 4E03A 5DF1A 3A0RB 3O8OB 4XTCS 3SJCA 2VNAA 3KJXA 3X1DA 2DU8A 1M7BA 3AB8A 3DBHA 4CFZA 1YB1A 1O6BA 1UPXA 1S7GA 4V24A 3JAKA 4TUYF 3N7AA 3PXAA 3PL1A 3E9RA 1FBNA 1VIVA 2PX3A 1GCAA 4KNYA 1E2PA 1KXJA 2FPSA 4QEZA 4Q1VA 3V4RA 5DSZA 1GQQA 4HUJA 1E4OA 3TOVA 3V9PA 4EG8A 4AAYA 2IS4A 4Q3KA 4KC0A 4XD2A 5L7WA 2QJTA 3ITNA 4C0AC 4ARCA 1G8JA 2F3UA 4DZZA 1TKRA 3BSWA 2FJUA 2P4UA 3H1EA 4WFIA 3TQSA 3W2FA 1QHSA 2VK8A 3RVNA 4LNUA 1TC1A 5A3SA 3BFVA 1PE0A 1AJEA 5DX8A 4ZVTA 1HNXB 3N53A 4O2AA 2G76A 4J4TA 1VPTA 1C4XA 2VK2A 1GNPA 1YXMA 1XDDA 2RC6A 2R1VB 1N6NA 2VK1A 3U1TA 4HNAB 4MVJG 4QKQA 1XZPA 2GM9A 2ENWA 4OUDA 4JI6B 3U9SA 3UV3A 5CDHA 4L75A 3AZQA 2D1QA 1YAHA 2V59A 4GVLA 4LRUA 1OSNA 421PA 1Y7HA 5BWLA 1P4JA 4Q0MA 3THXB 3FD8A 1AKVA 2R6FA 3AU9A 1ABEA 1EVKA 1Q5PA 3M89A 4RTJA 1VPWA 1L4GA 3F4BA 1E2EA 3T34A 3IR7A 1AKTA 4L2IB 4IF6A 1F2VA 3VV2A 1AXGA 4CMJA 2J1LA 1LCIA 4HSGA 5CBPA 5JQGA 3BE4A 2AZDA 2CVQA 5AVWA 5TJHA 1R0LA 1SOMA 3QLVA 3O2QB 4AIRA 4CLEA 4F4HA 1N8TA 4UVDA 1O94C 1R0BA 4ZIRA 4Q1AA 4GP6A 5M04A 3TKAA 1WCIB 5KZMB 4ITVA 5I7OA 3HI4A 3NBUA 3HU5A 5EZYB 3C3CA 5K45A 4DIDA 4I4TF 1GRNA 4UFNA 1P7CA 5ALHA 4GI1A 4MVJD 2JHAA 2A84A 4PGMA 4DMRA 1SQGA 1Q17A 3GX1A 3ZHYA 2JGDA 1THMA 3K1AB 3DF9A 4M0MA 2C4NA 2CJWB 2GN4A 2C7BA 1JMKC 1NX6A 1VL2A 3HO8A 1BA3A 2QI9F 1N2OA 1P44A 2O2GA 3R3HA 2NU7B 1KZ4A 2Q2NA 1JU9A 1YD7A 1Y5IA 3NHWA 1EUZA 5BOSA 3EK2A 1KI7A 3D5TA 5F2OA 2DQZA 4LISA 1L8OA 3LQYA 4ZQEA 3CZRA 2OQIA 3NEPX 2WU1A 1AMNA 2NTEA 4DA6A 3NFRA 3GD7A 2Q8PA 3GLHB 2X9NA 4J2TA 3QVGB 4TVOA 4F5YA 3FNHA 3KUDA 2BKXA 4JYPA 1YMQA 3R0ZA 3PCXA 2R25B 4M3NA 4PCLA 3CVWA 4DJTA 7MDHA 2J3DA 5K09A 3OWHA 1OT3A 1R5OA 1QO0A 2HNKA 3FPHA 4E5NA 2ZZNA 2EHJA 3SNKA 1AQIA 1I3MA 5HIKA 3BWYA 3PSAA 1TZKA 2GETA 3C4JA 1QIDA 1KGSA 3KL2A 4AI6A 3F0TA 4FZJA 1AV7A 2Q5HA 4MGHA 3D2LA 3I8XA 1TUBB 3GJ5A 4OGFA 1Q3HA 2B34A 2BM9A 1MZVA 1SJ9A 4I50B 2J32A 4Y2SA 2ZSDA 5H68A 5KVAA 3F46A 3VHXA 5JU6A 3BYZA 3MT9A 2HUNA 4IDHA 2WWIA 3PNSA 3DQQA 2ZRJA 1DV2A 4YAKA 4ZEVA 4RD2A 1QYCA 4CLRB 3LGSA 4N1AA 2VH2A 1JQJC 4KCGA 5AHOA 2CUNA 1ILWA 2AOUB 5EGSA 4H1WA 3RQIA 3T54A 3WJ1A 2F8SA 2JC3A 2H7YA 3G5UA 2E4UA 1XEXA 1KVQA 4YCCA 2QTAA 1IAQA 3KB2A 4X5OA 4I4TA 4PLWA 2QR2A 3DE2X 4FD3A 1U7DA 3TEMA 1YAJA 4BEWA 3RTBA 3B6JA 1RLIA 2QMQA 5EWMA 3TJMA 5F77A 4EPRA 4CUZA 5J4KA 4J91A 5E7MA 3ODGA 3W04A 4AU1A 1Z6YA 4IJQA 4JSRA 3F7MA 4B9EA 4BDSA 1TFUA 3ZJUA 3ZCTA 3M1YA 3KD2A 3EEIA 4D4MA 2Q3JA 3VR2D 2GJAA 3CZAA 5T4BA 2V9CA 4NU6A 4IO0A 5EHXA 4LK2A 2JI6A 2CHQA 3OY2A 1AM4D 2WFAA 3HCWA 3PPYA 2GZHA 4UM5A 4ARAA 1ZXXA 4R40A 4ZAYA 1UIMA 1F8YA 1GL6A 3ETDA 2VXOA 4RL4A 5JYEA 5JO9A 2XMPA 4RETA 1MFZA 4PCUA 1R27A 4JR2A 1KR5A 3KOWA 3MCAA 4PG7A 3VR6H 4ARZB 1LC3A 1P4GA 2A1TR 2AT1A 1IJBA 2SHKA 1F60A 4MUGA 5I45A 2FG7C 2W4IA 4KLCA 1LW6E 1PG0A 1H6DA 5A06A 1OLUA 4EY7A 3PQ5A 1QF6A 4UXHA 1N5LA 2XB9A 4MQBA 4XUDA 2DHQA 4KKXB 1LJ8A 4LDRA 3IIIA 1C0LA 1WZNA 1XZLA 4TMVA 4UU1A 3UT0A 2PUBA 1WOYA 4DNXA 4TVKA 1DMSA 3ZV7A 1FUIA 3S2ZA 2C9BA 2BEJA 4G5GA 2ECKA 3C5CA 3K4HA 3FB1A 4P53A 4F4FA 5JC8A 3BXEA 3F9IA 4BX9A 5JAIA 3E5NA 1SGWA 3QVLA 1L4BA 2JDID 4UUAA 2QG4A 1OLUB 1JHYA 3T3HA 5A9SB 3OZXA 4RULA 3GQBA 3OPQA 2WHXA 4TUYA 4KI0A 3RSHA 3PRJA 1O08A 4AMGA 2I8AA 3O6VA 2WYWA 2CW5A 1E6WA 4DSZA 5A5GA 2Y92A 3LGXA 1Z0DA 4OHXA 3AU8A 3IEVA 4OQ4A 3GV0A 3A9VA 5AESA 2VVTA 3DLBA 3OI7A 2DE0X 1G2QA 1E2MA 2OCXA 2ZSFA 4D8UA 2P9TA 3L9XA 5KVQA 3UA4A 4JJ8A 2FZLA 3K0CC 1I1HA 3AY0A 1ZK3A 4MVXA 2ID4A 1PFUA 3PQ8A 3WWYA 1DC4A 4ARIA 1BZYA 1FMTA 4WA7A 3DT9A 4XXHA 4JGGA 3LT2A 3PFHA 3UK7A 3TOCA 1YRBA 3HR8A 4BAGA 1OA0A 2YVAA 8ABPA 3TFOA 4PO1A 4MV7A 1SUAA 2REBA 4R84A 2INGX 2CZCA 4GBMA 5F12A 2DSNA 5DLQC 4I8XA 1F6WA 5DM70 2NYUA 1NU8A 2V6FA 1U3GA 4I1OA 1GTMA 2AFVA 2XPCA 1RWQA 4FGWA 2YNMA 2FI1A 2AG6A 3MLAA 3R3WA 3KQMA 4BGDA 1Y1QA 3OKPA 2YASA 5G3YA 2OORC 2R8XA 4HFNA 1GA6A 1K2VN 3OZUA 5AP9A 4UM7A 2VZLA 4DR7B 5DISB 3X1JA 5IHPA 4EJFA 1F0PA 2YNMD 2QROA 3ZHVA 4EUKA 1RU3A 3K8ZA 5K4AA 5AKXA 4DAEA 2CCKA 1OTHA 2AS0A 1N2IA 2IYRA 1JFRA 2JIOA 4PPGA 4YO7A 2O1WA 2XZDA 4M22A 5ALOA 3UK1A 4LBZA 1WP4A 1MX9A 3TQHA 3KQPA 4H0NA 1QWSA 4ESEA 4YRIA 4GKBA 1X1EA 2J6CA 3ENKA 1GGJA 1R0CA 3U4GA 2PZMA 3C0KA 1NN5A 1F3OA 1U0EA 4JZYA 1M2WA 1PHPA 4TX1A 4UDXX 4ZT4A 4EHDA 5J1TB 4D0RA 4D3YA 2ANCA 1K1EA 1KEWA 1P2BA 2GDJA 3RFXA 4RYLA 3FJOA 4M1WA 1RXUA 1CUAA 2C59A 4II3A 4JUIA 5AXBA 2J07A 4ZMSA 3AKZA 4XVUA 1W85B 5ER6A 1RRFA 2IWRA 3CIFA 3QEJA 1ZD1A 1O9GA 3HUDA 3SKXA 3NBZC 1RAAA 3C2QA 1E5LA 2IVZA 3UG7A 5AVZA 2P68A 1TAQA 1H6CA 1VL8A 1ORRA 3T5PA 1H23A 2D5CA 5BVGB 3KZMA 4Y7DA 2QRVB 4PEVA 2IUFA 3HNOA 4OHRA 1G9TA 1BE1A 4X1KB 2CYBA 2NZXA 1FRVA 3BD7A 4XLLA 3SN6A 3ZQ6A 4CMHA 1SC1A 2HQOA 1G8FA 1JW9B 1V9LA 2GZSA 2QENA 4P81A 2JFFA 1CG6A 3JZMA 4P4SA 5FULA 5AK3A 5HF6A 2R7AA 3PGJA 1OYYA 4YP7A 3V1LA 2EV9A 1U8ZA 4W1SA 1TM5E 3KXDA 3JPWA 1K8ZB 2G06A 2VIIA 3CRMA 1YACA 1S3FA 2BWJA 5LZ5A 3EAGA 3JZFA 3QIAA 5HK8A 4ZIRB 3EXHB 1S2LA 3A6ZA 4HDOB 1PFYA 2LD4A 1IDN1 1BD3A 1BQEA 1JR3A 3OO1A 3W6PA 1EE2A 3CW2A 4JJIA 4H7IA 2XMGA 3WRWA 1W7AA 1Y9AA 3EN0A 1WAMA 2VYCA 4BLRA 2XUAA 2XTJA 2PWAA 2YWGA 5IBRA 1I7DA 1E89A 1M6VA 3NHMA 3PD1A 1E9CA 4GBED 2HUPA 3SQMA 3G82C 4H6PA 1SVWA 3K72B 5A5FA 3AK4A 4A8TA 3WAKA 2F3QA 1RQ7A 3R2JA 4YRQA 1BE0A 2R8EA 2X1HA 3C3YA 4J2OA 1L1FA 3D6TB 3IO5A 3OP4A 2B98A 2MSKA 2VXYA 1I6WA 4GC9A 3WLEA 3I4CA 3Q88A 5JSUA 3UJNA 1FDSA 2P35A 3KKZA 4UJ3A 2F8LA 3JPYA 2H0RA 1N92A 3NETA 4TRJA 5B12A 1ZGHA 4CTKA 1Q0LA 4DBVO 2WILA 1JJ7A 4FCCA 1BRMA 2FZEA 2XUOA 4JCCA 4EUSA 4PRYA 4ZCPA 5LB2A 4QHTA 2VQDA 2B35A 1UBJS 5CW2A 3UKOA 2OGUA 5B1IA 2B8JA 1KKLA 3COWA 4J43A 3DE4X 5KU1A 4NV1A 1CVRA 1X1CA 1YS4A 2HDOA 2ISSD 1ZYUA 2R48A 3BXXA 3EWIA 3GJ0A 4ZCLA 4CZ2A 2YJGA 5KC9A 4HAVA 1Z8NA 3V32A 1F5NA 1X9HA 3M2TA 4RORA 1H2AS 2YHAA 1IULA 2FR0A 1SUBA 3GEEA 1LSJA 3PF9A 4KMOA 4Q21A 4BN5A 5JNLA 3ESAA 2D06A 3W1VA 3AERA 3ZDEA 3L4EA 4L85A 4N49A 4F1WA 3IP5A 1ETHA 3PP8A 3VOTA 2WJIA 1NUTA 4HRVA 1C50A 4H0CA 1SUPA 3BXFA 1Y82A 4MLZA 4Q1CA 4J4BA 2HF8A 1D8AA 2Y77A 1HSZA 1GCIA 3WY9A 1R16A 2J3EA 2FFQA 3GUHA 3W3AA 4FJ0A 3IAAA 1QZZA 4TKLA 2OUIA 3VC2A 2IGTA 4CLOB 1D0IA 4ZVRA 3RFUA 2J7KA 1USVA 3NT5A 5H02A 1NP6A 1KZ7B 1N3BA 1U8XX 4HQRA 3GT3A 2M1ZA 1VG8A 1T1EA 2F90A 1X1SA 1Q20A 4WNIA 3BFKA 2VHVA 3ZDFA 1I30A 4DE5A 1LX7A 3A9SA 4BPRA 1HL7A 1CSEE 1SVIA 2CMKA 4P2GA 4PTLA 4O8ZA 4ITRC 4OY3A 4Q1FA 3S27A 3EZ6A 3JSXA 3OM9A 4F3YA 2Q1SA 4ECEA 2Q07A 3KWLA 3ZDRA 4OI0A 4DSTA 1OAOA 1E3MA 3CH5A 4LZZA 1QH9A 3AF4A 3LKZA 2BFEB 1XQXA 1I33A 4V0LA 3D6FA 2FXIA 1X0VA 1HEYA 2FEKA 4DILA 1XEXB 3M9LA 4H60A 3WAGA 2RJNA 1LS1A 4IS3A 4OJYA 3CIOA 4U6QA 5IAEA 2IOFA 1Z6XA 3GDWA 2GD6A 3PNQA 3TVTA 1H2ZA 1OA1A 1NXOA 4BKUA 3ZHUA 4RA6B 3E1SA 3O7MA 4CE6A 4LRSB 4LJ7A 1QVRA 3ENQA 1XT6A 1WPXA 1VSUA 1Z16A 2JBHA 2Q6TA 4IGAA 5K3FB 3KALA 3QY0A 1SK9A 3ZGYA 1Z6QA 2XLCA 1BWRA 1KYYA 2WG2A 2IYSA 3DXXA 2IIPA 3H4IA 3LX8A 1NQOA 1E62A 1ZM7A 1A4RA 3ML1A 3VFDA 1EGAA 2P6PA 2ZIVB 4UBKA 2UYHA 3CNOA 3JYPA 1NQWA 1L6IA 1YC5A 3NV7A 4NBTA 2X0KA 4NULA 2IOQA 2VZEA 2I6GA 3QLEA 3MJCA 4JLUA 4Q4CA 2C4VA 2ZJBA 1LSUA 3IPYA 4I50A 4PCAA 1ZGCA 2A3RA 2QTVA 3SC2A 3V7FA 1T3HA 5A0VA 3VPXA 6NULA 2CLCX 2Y1GA 1AZTA 4N39A 5AI9A 3LU1A 2J4FA 4BFCA 1IE3A 2QRJA 4AZ3B 1UWLA 1E58A 1TT5B 4FINA 1MEOA 4GD3Q 3UC5A 4CCYB 4RJJA 4RFVA 3D64A 3ZVMA 1SB8A 1QH1B 2W43A 4DTIA 1HR0B 3EQ6A 3T9CA 3NP9A 5L4LA 4OBWA 1VHQA 3BTVA 1W46A 2Q9CA 3HK2A 9LDTA 1GG9A 1NW7A 3QPWA 2G88A 2E4ZA 4OI2A 4UMFA 3WYCA 2XB4A 4DCUA 3L7KA 1NBOA 3Q12A 1W2WB 2H5LA 4FYMA 4XX1A 5EQJB 3BFXA 3VTZA 4DMMA 4LNHA 1GPUA 4ZGGA 5DNAA 3ASYA 2LTAA 3HJRA 4FYKA 3EZLA 3K5PA 3ZLUA 3HY3A 1EFPB 3HXLA 4DRXB 5JFTA 5JZBA 1CW2B 5E7QA 4PYMA 5FPKA 5K5EA 1TEZA 3OIWA 3IP8A 5CB0A 3FPKA 3DHWC 3R3UA 3L6OO 4K6MA 5AHRA 4EI7A 1IXRC 3BJRA 2M6LA 1EUQA 4EFKA 3L01A 1ZZEA 3H1BA 1BJKA 4WN3A 4AXBA 2IYQA 1P1KA 4HQ6A 4MO2A 2VHYA 1OFIA 3TPCA 2EBUA 1S8AA 3CJRA 3QPVA 2QWXA 1G59A 4MB6A 3PQ6A 1XKLA 1UBTS 1E59A 1GCUA 3I3SR 4K0RA 5FOUA 5L3ZA 4AD8A 4D4HA 2BP7B 2P2CA 1EFKA 5KQGA 5IAKA 5FORA 2YW9A 1NBHA 1WXQA 3B52X 1IZ8A 3E9QA 1ORTA 3EUAA 3NGMA 4I7EA 2QQFA 1AZWA 1HQCA 3NM5A 2VSQA 2R751 2FW1A 1V11B 2TMGA 3PEWA 2F1IA 2JAQA 3D3KA 3RLFA 1FNMA 1PFQA 3T7AA 3DTTA 5JNTA 1VJ5A 3WA6A 5DM0A 1UK7A 1J56A 2EVWX 2V8OA 3W8RA 4D8TA 3HVKA 1NI3A 1UDRA 3AESB 1ATZA 4RQTA 1WKBA 2CHVA 4YJKA 3EOBI 4EJ6A 2ZIXA 5JQGF 1DIAA 2QUZA 5CG1A 3EVGA 2WF7A 4HNAA 4KSBA 1KY2A 1US8B 1HI9A 4BU0A 3EB9A 3KHSA 4OQPA 3BQ9A 1N7HA 1UFRA 5C52B 4PLHA 4S1TA 3LFUA 4R1OA 1RYHA 4GSYA 1H66A 4KVZA 4RQUA 3WDSA 3L92A 4D57A 5K8VA 1EFRA 1V4NA 4F46A 1NQUA 2P6UA 3IJ5A 1AU9A 1BS9A 1V5IA 2QTMA 4WXHA 2IYPA 3ZGVA 3KYIB 1OV4A 1ZD4A 2YFYA 1J23A 4FW8A 4JYMA 4URYR 3FPSA 4Q9LA 1RRPA 4X7PA 4YJHA 3OCZA 4XE5A 5EXSA 3SPXA 4RPKA 2IHUA 1E3LA 2IW3A 4P0PB 3SX2A 1N1GA 2H8GA 3ND9A 4FGUA 1GIAA 5K03A 2B6HA 1NXTA 1HE8B 4OV6B 1QK5A 1I2CA 3OLXA 2LBPA 4B2YA 4MJLA 5DNCA 4RIIA 5EXXA 3WIUA 2VUIB 2E7ZA 1HZZC 2H2AA 3CISA 4EYOA 4WOPA 2ECFA 2FPXA 4E7PA 4QJ3A 2XT9A 1I7QB 4J3JA 2QE7A 1QG6A 3G8YA 1D03A 2HWKA 4M98A 4R1SA 4XUCA 4CV3A 4FLMA 4HDMB 1SBCA 1HDIA 1Z13A 3RTAA 3H5VA 1ZN7A 3V4ZA 3JU3A 4X95A 1XF1A 3TKYA 3VAAA 4A8HA 1V8ZA 1DRUA 2VAXA 3DMTC 4AZ0B 2IJGX 4KACA 4I6JA 5EESA 4COOA 2FKAA 2VXBA 1NZDA 4TT8A 4EKIA 2Q5IA 3CNBA 3HJFA 4DCOA 3L43A 1OKKA 1XDWA 3FIUA 5EKSA 3BRWD 1JR4A 3L04A 2W6NA 1KWGA 5IJWA 2BD0A 5U4XA 3WKCA 1I5RA 1Z63A 1XMVA 4AZTA 1O6GA 2EX0A 3AEUA 3U7GA 1I4TD 3D2AA 4WTOA 1CE8A 4B6FA 3P2MA 4DLKA 4P93A 1ESEA 5D5PA 4C20A 5C9ZA 4X62B 1GAWA 5C1OA 2GAAA 4F12A 1CF4A 3W9BA 1YR1A 2RB4A 1P0FA 1YQDA 1WEKA 1Y42X 4I8DA 3UT6A 2DM6A 2PWYA 3OF3A 4JX8A 4NSNA 3IUJA 2DPMA 1NIPA 3QF4A 2QLTA 2QRQA 3G68A 3WYNA 2WPDD 3AOEC 4J76A 2Z9DA 1PFVA 1Q1QA 4K28A 3DYIA 3RS2A 3V97A 1SXIA 5AUPB 3DUFB 1XPJA 4HWOA 2QQ0A 3N2ZB 4K9LA 5TIIA 2H29A 3GXOA 4FCVA 4C9BA 3SFZA 4PF1A 4CF5A 1XGKA 5K99A 2JI8A 4M0KA 3SBOA 1EAYA 4F2PA 1GLVA 6Q21A 4MROA 1F6BA 2P77A 2O52A 4UEQA 2H65A 1W88A 3VZQA 4ALMA 4D44A 5BMOA 1NNEA 3OZDA 2HCBA 4HFRA 2VQEB 5DXAA 3B9PA 1Z2OX 3D4PA 3UMJA 1C7IA 4QVIA 1DV1A 1I01A 2CNWD 2XMCA 3DL2A 4N6NA 1CPYA 2HJWA 2W4QA 5HIMA 2N9UA 1SIWA 2YXBA 4KE6A 3NVKI 3FLBA 3ETCA 2FX2A 1U2DA 1KVRA 3NHSA 1I2MA 4JL8A 1DADA 1JJFA 3KJHA 4KXNA 4NDAA 1N4DA 4QASA 1H2BA 1S8OA 3AMVA 2ON6A 4RW0A 3AFOA 2GZ2A 2JGNA 4QREA 3LBIA 4YCMA 2CEAA 3QVSA 3ZCSA 4YJ2A 1ZXLA 3AF3A 4XQGA 5KQSA 1QONA 4G5SA 3VMFA 3I0ZA 2Q3DA 5H3CA 1UR5A 3QEKA 4KEAA 1WVMA 2WNSA 5L6LB 2OA0A 2PKCA 3IT3A 4O5AA 3LUHA 4JUBA 4AF6A 4BVLA 3C1AA 1RLMA 4B4WA 3CR8A 3GCDA 3UUFA 3CR3C 4R9NA 4RKFA 4O2AF 1OI4A 4EAAA 2JGKA 1NF9A 1COZA 2WAOA 2PJZA 2JAXA 2YVKA 3TMYA 5BN5A 3RJTA 1P7PA 4U1RA 1E3JA 3GARA 4A0RA 2JLQA 2NIPA 1GTJ1 3CRNA 5FPSA 4K46A 1C8LA 2W11A 4AMZA 2PA0A 4Y2RA 3K6SB 4GMKA 5C5CA 3DEKA 3FE2A 2A0KA 4HY3A 2D7DA 1JLSA 5ITZB 1DWOA 1DU4A 1JEDA 1LI5A 1RJFA 1SVMA 2QD3A 2X7JA 1CJUC 3CWCA 5JMPA 4Y9DA 3ST7A 3GDOA 1DWQA 4ML3A 4R4JA 2BI7A 1Z26A 3AR7A 4RL6A 1KAEA 2QYTA 3VR4A 3EISA 2O3UA 3M1IA 1U6IA 1U0FA 4N0DA 1PJRA 1VL0A 2QX8A 3WLSA 4A26A 4C3VA 3ANSA 2WWWA 1QRAA 4ZVLA 1FEZA 5G4KA 1NN1A 1YDFA 3WSWA 5FRDA 3LQKA 1QCYA 3V1TC 3W2IA 2ZYUX 3DTYA 4C87A 4MUMA 2P41A 4RD3A 4IV0A 2C5AA 4FZRA 1NUAA 2FPKA 3IAEA 4Y6RA 1PKEA 4FR0A 3ZY3A 4NNOA 4FGSA 2IXAA 3VNBA 2DPXA 2HM7A 1BJRE 3PUVA 4MYUA 2ZANA 5AM4A 3CEPB 2XKKA 4Y2JA 2HD4A 2DLDA 2CVFA 2QTCA 4K6KA 4V0RA 4YB8A 5ALGA 1OC4A 5F9MA 3TL2A 5J2TA 3VZDA 3DKPA 2ATCA 1BE8A 4QTTB 3VKVA 5A0TA 4K9RA 1VP9A 3DB2A 2PH1A 4V2UA 3OCUA 1RWNA 4G37A 4MYDA 4GP9A 2Z5FA 3O84A 1VCHA 4NJMB 4E94A 3E9EA 5MGBA 1O57A 1IB6A 1WUYA 1U5AA 4I1VA 3VAZA 4G5OA 2FR1A 4F8EA 5BWBA 5FFNA 3UENA 3H9QA 4A2WA 4XYEA 4BLUA 3H5TA 5IWAB 2VPXA 4TT3D 3TRIA 3ZCQA 3B1ZA 1Y1PA 3ZD6A 2PBLA 3CF4A 2Z1MA 4J75A 2HQBA 4JLWA 4CMKA 2CT8A 1FFYA 2ZJ1A 2RHOA 4FLFA 4XLZA 2R6GA 1NR5A 2IOFK 3A3NA 1E6KA 4A0SA 2V6GA 4ZKDA 4IZHA 2QRKA 4X61A 3DOOA 4XQ9A 4B2IA 1VRCA 3MM4A 1C80A 3KUUA 4J1TA 3BK2A 2R7NA 3ROZA 2NT4A 5FBKA 1JFSA 2N3ZA 2CZGA 4I1UA 1Z62A 2GDZA 1QVAA 2HMUA 2YWDA 4BVHA 1X7ZB 4FGLA 1Y4AE 2VYQA 2XT0A 3PF8A 2CJPA 3G0CA 2OV1A 3DLCA 3DBVO 4L0MA 5HILA 3I9JA 5IG2A 2ZTLA 4F38A 5KNCD 4KPYA 4LXYA 2HXYA 3U3OA 2IZOA 2CLHB 2N75A 1ZVJA 3B5IA 3K2BA 3QUAA 4GG1A 4DUGA 3U3JA 5C46F 4QX6A 2X9VA 1AZLA 4F2HA 4NS4A 1HYHA 3ZCXA 3ZN2A 1CZKA 2RGGA 2WE8A 4HKTA 2C92A 1H0HA 1WG8A 4NCKA 2EL7A 3UMMA 5EWLB 1Z22A 2NP7A 2BMWA 1EJ0A 1PFKA 4RDXA 1XCMA 4WADA 4FKBA 4KQWA 4ASUA 2C9DA 3BERA 3T3NA 2ZJZA 3CINA 4CG3A 3GRKA 3K1ZA 5AJVB 4RHEA 3G5LA 3L4BC 3Q6IA 2D0OB 3B9BA 5EPOA 1I5EA 2JHGA 1XXLA 4FFNA 3U7JA 5A6VA 1QP0A 3BILA 6YASA 3DMFA 1SZJG 1SRQA 4QFBA 5KDLA 2BUCA 3WA7A 1E3TA 4Y1RB 1FW8A 3GFFA 3C97A 4IDBA 4N8SA 5FIUA 4IZ6A 4R9RA 1I3NA 2JA1A 2BE9A 2HLDA 4V1CA 4UREA 4MQEA 3O8DA 3OUZA 4EW3A 1PGJA 2O4UX 4TLDA 4ZOCA 3VH4A 5CAEA 3RUHA 2GVZC 2H57A 1Y5MA 3ZVKA 1F0KA 3H9JA 1CY8A 2X3UA 1G8SA 5AMXA 4QGAA 3O4RA 1PTJC 1LB1B 4MGZR 5BVHA 4OQDA 1Q1EA 4TL9A 1JKMA 1GNVA 5JANA 1UXHA 1WU8A 1YU6A 2BKEA 1ZUIA 2NT3A 3VO8A 5DDIP 4NAVA 3V2IA 4C0LA 4YRKA 2LDBA 1M6NA 1DX6A 1QO0D 3CN9A 3WMWA 5B7GA 2YYYA 3D6NB 1DXQA 2QL5A 2XZLA 4YHHB 2A9JA 2CV0A 2IYZA 1MB3A 1JPVA 1TD9A 3QU2A 5J2UF 3EGVA 2PXXA 2QJRA 1WQ4A 2EKLA 1EP9A 2WD9A 2OZLB 4URFA 5DYIA 5FCDA 2OEPA 1RXWA 4W63A 1LDBA 3WHIA 3VOAA 4QUDA 4ZDWA 3U6KA 5ITVA 4L28A 4FWTA 2NSDA 5I5GA 4E1VA 1Z4KA 1NFQA 1YRHA 1IXYA 2YY6A 3IEUA 5D8DA 1XB2A 3T6KA 1BFUA 1H6BA 4DPMA 1AZSC 1Y0BA 3DLPX 3OJWA 5IBQA 2ZB2A 5DCUA 5E9WA 3TW6A 2UUCB 4KR6A 5AM0A 1D5CA 1WXWA 1G291 3AEZA 4NOLA 4Z3KA 3ZZTA 1M6YA 1USWA 1VB5A 2EFCB 4HDRA 5JSFA 1JLRA 3D6MA 2J3JA 3EVEA 1Z6TA 1KAQA 3PGLA 1Q0UA 5SICE 3GMSA 4DJJA 5BOVA 3LQQA 5ED0A 5FUXA 5A1JA 1RHUA 4RZ3A 1ND5A 2D1TA 1NDQA 4FYWA 4KO3S 1R0XA 2DQ4A 4EHIA 2WT8A 1C1DA 2NSLA 3L2OB 5FUMA 3BB3A 1MRZA 3ZE1B 2PVCA 2H1LA 2RK4A 2C98A 2NO0A 2OUKA 4LJKA 5EIBD 3AH8A 4MRVA 2GZ3A 1DBPA 2ZAIA 3KSZO 3LP6A 4QULA 3T7SA 4DY4A 4B09A 3ZBQA 4LBWA 3O8QA 5E9QA 1QYIA 1H8HA 1WOMA 3FWNA 1A72A 3OCYA 4MK4A 5FPQA 5IH3A 3T06B 1YHZA 2DHDA 4RA9B 3X1KA 3ZE6A 1I4DD 1M83A 4BV9A 3U0VA 2KB0A 4YQYA 2WAXA 4UU8A 3L8YA 3A2MA 1UMCA 5HTKA 5K0CA 2BGUA 1QGYA 1QQAA 1H8HD 3PLNA 1IXKA 1UMDB 3N2EA 3H4MA 4WINA 1SHTX 1M2FA 4XWOA 4HDRB 1H3EA 4OSOA 2R7MA 3AKDA 4URWR 1FJ2A 2HK8A 3IV9A 3UBMA 3T3OA 4WVLA 4ZRNA 4R98A 5B58C 1VZ2A 3TUJC 4QG7A 4E5MA 5CFZA 5JH7F 2B3TA 3GLIA 1P2TA 1X19A 1HEUA 3UCEA 2GTHA 4Y2PA 5AKHA 1EK1A 3I61A 2HO4A 4PN7A 2UVDA 2AOVA 4YUYA 3T94A 1W36B 4U2FA 2G70A 3RRMA 1L7MA 2ZJOA 4YRMA 2JVJA 5DGTA 4H31A 5NULA 4FCTA 1ZGAA 4DWOA 1XJWA 1VL1A 2JDIA 2GD2A 1DEHA 2YVLA 3UUGA 3AUFA 5ELXA 1QKJA 2ARKA 2EARA 1X39A 2XV1A 4CKBB 4DPLA 2PKEA 4LECA 4HI0E 3A9TA 4NBNA 3GLKA 2DFKB 1QM5A 3RWOA 3WG9A 1KO8A 2O8FA 2ACWA 3G0DA 3W0LB 4M1YA 4G5QA 4HAYA 2YZ7A 5KYGA 1QHGA 1VTKA 3AF5A 4BVJA 1M1NB 1JXOA 4GX0A 4DY6A 4C5CA 4EENA 1YJQA 3CVXA 1AQLA 4M8LA 3AEQB 2QM8A 2Q50A 4MGYR 5EINA 3VU9B 4LZAA 3ZU6A 3MUFA 3MWEB 3BMCB 1EUCB 5F1YA 2IY9A 1TPZA 3PQ4A 3V4FA 4IHAA 1YIOA 3NPAA 1M2OB 4X7MA 1YZUA 3B60A 2AJCA 2VT7A 1T34A 2PSFA 4GC5A 2N46A 2Q46A 2YOFA 5AI4A 3WFZA 4WOBA 2IPLA 2ZRQA 2G6TA 2P5YA 2ZYIA 4OFZA 4P3OA 1TADA 3C3JA 4LMAA 4N0MA 4Y6OA 4AJJA 3K05A 4HCJA 3HYSA 4TLLB 1ZH0A 2XXJA 1W88B 3F7TA 4P5PA 1JFFA 4DNOA 1AKUA 3AUAA 3HCBA 3R77A 4R2WA 2AWOA 4LS3A 3LNCA 2Q3BA 2O3QA 5TC4A 4A9AA 5LQCA 3G2KA 1SR8A 1W44A 5GM2A 4BQQA 4JI8B 2VTEA 3EUFA 5ALMA 2ZR8A 3IB6A 2P6RA 1U63A 4UW9A 2XA9A 1YCHA 1Z4IA 4MEAA 4JLOA 1W30A 3E7WA 4NCXA 4R83A 1MENA 2OE2A 4PXAA 3U7QB 5KTRA 1BJTA 4GT1A 1CJKC 3NS7A 4WFQA 4WCFB 2XOXA 4IDNA 1A9XB 1EXMA 1Z8FA 3L1IA 3MRSA 4ZTZB 5EIBC 1SXQA 3FG9A 3HN6A 4ZU6X 2YHIB 2FPIA 4EFMA 1XVTA 1Z18A 1C9DB 3SBEA 1Y8RB 3D6JA 1TVCA 1E2NA 4CHGA 4KHPB 3K9WA 1ADGA 4ES6A 3J7TA 4G65A 4X44A 3KKMA 3ZU4A 1R0YA 2JKVA 2PVSA 3DAPA 3IKJA 1BXGA 2GZRA 2N1MA 3OE1A 4JC4A 4ZHQA 5HUJA 2IZ0A 4CIVA 2VYFA 3IUSA 5FBHA 4ZI2A 5LMUB 1XNJA 2NXWA 4X3PA 3L0YA 4KQIA 3VXKA 5CA0F 2HJ9A 5ITSA 3P4UA 4GPD1 4QRIA 3EZGA 3IEXA 4R7GA 3MTIA 1HLFA 1HE2A 1QZXA 4YS6A 1ODSA 3LL4A 4C21A 2ZRHA 3NO4A 1GZVA 3FDXA 2QTLA 4FDTA 1YZFA 5EIFA 3QX3A 1U3FA 3R7LA 3HB4X 3QM1A 3ILHA 2QR3A 4BO8A 8AT1A 3GYGA 3AZPA 4HDCA 2EQBA 4HLUC 3QE0A 3PKZA 5E9AA 3N2GA 1TQ8A 4H4DA 5KKNB 3NW9A 4FMDF 4YR9A 4D02A 2K2WA 2CXNA 5DP1A 4LWOA 3V7YA 3AM1A 1AGXA 2PGOA 2NZ8A 3EGWA 5EHZA 5L3SB 3MMNA 1THGA 1KEEB 2GEJA 1BYIA 5CPFA 1TUEA 4II2A 3FVRA 2RB5A 4QDOA 3L7NA 3DBIA 3R6WA 5K6AA 2FHSA 4ZVVA 1JJBA 1RMTA 1CVIA 1PK8A 2FZ5A 1U90A 2P2GA 3HV0A 3FUCA 1TIKA 2CDBA 5E6SB 4BUZA 1AK1A 1UUFA 2AN1A 5J2TB 4UHHA 2EFDB 2SKCA 1CUUA 1V16B 1GXSB 3HYCA 2WT4A 2YRXA 1XRLA 3RDPA 1Y9EA 4LXTA 4RTOA 2F55A 3N6RA 3HL0A 1Z34A 4JB8A 2I3DA 3R5FA 4DCGA 2NUPB 1QH0A 4HLQB 4NYIR 4DLPA 1V39A 2AHOA 4QUIA 3SZ3A 3VX3A 5HKKD 2NZ2A 2KPOA 5FD8A 1S5PA 4KH1A 4PONA 5DPMA 2Y4OA 1XD8A 1G42A 2Z43A 3CNHA 3L6BA 4O4IF 3GGJA 2XNDD 1MC8A 4TZ6A 1O7JA 3UUWA 2ZRNA 2R85A 3DZCA 3BG5A 3OLZA 5EOVA 5TLSA 3MMSA 2IP4A 2WJHA 4B7ZA 3CE9A 4N5IX 2GX6A 2YRFA 1FDRA 1PR5A 3W8NA 4AZVA 2Q7OE 3IHLA 3V46A 4G8DA 1P74A 1QH8A 4DOMA 1GRRA 4IDFA 1EINA 2VWPA 4FBMA 3G0OA 1YRWA 3RKUA 4B3HA 1QK4A 4L8WB 2E89A 4KPGA 1HK7A 2J7PA 2LKCA 4L9RA 3GUZA 1PSDA 5DLEA 4CQNA 1Y8QB 3G49A 4RJTA 5AIBA 2B6NA 1XCPA 1CJBA 3O91A 3EYAA 4P34A 2PBRA 4NZ9A 4B3XA 3M83A 4JBLA 1KMHB 2V3WA 1XEWY 3AGQA 1XZGA 1NVDA 1UZMA 2P9YA 2VXCA 3LDFA 3PR3A 4H6XA 1ABFA 2OG2A 1N2BA 5FOXA 2XE7A 1QQTA 1X3LA 1FNBA 4UNQA 1IM5A 2VATA 2XXAB 4QARA 3CH6A 2A88A 4D9KA 5CW1A 2GCGA 1L5GB 3RS9A 1AHIA 1T1JA 5JNWA 2Z5VA 2PMBA 1F48A 1TMOA 2IPNA 2YV2A 1H65A 5I3CA 2TYSB 3ECCA 3FYUA 3NH6A 2BEWB 1BW9A 4KE8A 3IVGA 3MWFA 4R31A 3IP9A 3D1JA 3DBOB 4KRF