4LMRA

Crystal structure of l-lactate dehydrogenase from bacillus cereus atcc 14579, nysgrc target 029452
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
312
Chain Sequence
KGINRVVLVGTGAVGCSYAYCMINQAVAEEFVLVDVNEAKAEGEAMDLSHAVPFAPAPTRVWKGSYEDCKDADLVVITAGLPQKPGETRLDLVEKNAKIFKQIVRSIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSARFRYMLGEYFDIGPHNIHAYIIGEHGDTELPVWSHVSVGIQKLQTLLEKDNTYNQEDLDKIFINVRDAAYHIIERKGATYYGIGMSLLRVTKAILNDENSVLTVSAYLEGQYGQKDVYIGVPAVLNRGGVREILEVELSEDEELKFDHSVQVLKETMAPVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase 1
publication title Crystal structure of L-lactate dehydrogenase from Bacillus cereus ATCC 14579, NYSGRC Target 029452
rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
total genus 101
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lmrA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4lmrA02
4BL5A 1PWXA 4BNYA 4CM7A 1YBVA 3U5TA 1P1KA 4GX0A 4IDEA 2NADA 3WXBA 1C1XB 1PZHA 3ADOA 1QV6A 4NZ9A 1ULUA 2Q1UA 5CG1A 1DC4A 1DFGA 1YBAA 3VH4A 1HYGA 2WTBA 5A3VA 3ZNOA 1B14A 5MDHA 1VKNA 1LDMA 2CMDA 3GEMA 4YT8A 1Z45A 3DHEA 4RPKA 3GY0A 1VJTA 1XHLA 2A4KA 3DFZA 3PGXA 4IIUA 4Z0TA 2EKQA 1LSOA 3QWFA 2JKVA 4GLLA 4JBIA 3QP9A 3LZ6A 4A7PA 2GSDA 4YTEA 4KWIA 1BGVA 4PLPA 2VT3A 4R5MA 1A4UA 4KQXA 3ZHBA 3JV7A 5FI5A 4MIEA 1X14A 3DEYX 5TSDA 4PZEA 4QECA 3PLRA 3Q11A 4RL6A 1GYPA 3GAFA 1I33A 4YQZA 1WVGA 5JDCA 1JA9A 1Z75A 2J3HA 3JYNA 3OJEA 4BNHA 5HS4A 3R6DA 5I9LA 3RUDA 1LLDA 2DVMA 4LCJA 3QHAA 3UHAA 1ONOA 2ZB4A 3PHIA 1Z82A 3EW7A 3WOHA 4TROA 4YAJA 5AXCA 1QG6A 3MJCA 4ZRMA 1BHSA 1PWZA 3AM5A 3GVIA 1T2CA 4W9NA 2OZPA 1UZMA 1LRKA 1I8TA 4KTTE 4OH1A 1C1XA 1VE9A 1SOWA 3QJ5A 4OKIA 4DBVO 2B4TO 1BG6A 3I4CA 3BTVA 3HWRA 3L6DA 2VNAA 3VKUA 3TFOA 2DTDA 5AXAA 1GFSA 3FI9A 2WD7A 1LDBA 3OH8A 2P4QA 2YHIA 4YACA 3U4HA 4DPLA 3WICA 2Y05A 4XGIA 1EK6A 2PGLA 2RHRA 3KBOA 1RYDA 2WSBA 2PD4A 3BTUA 3GOHA 4XYEA 3VKVA 2AQ8A 3L6EA 3WYBA 1PJQA 3JYQA 1H6AA 2CF5A 2UUOA 2PZLA 4OAQA 2J5QA 4OXYA 5B4TA 2VWQA 4F46A 3AUUA 4E5YA 3W4IA 4K6FA 4RVGA 4ND3A 2FR8A 1XR3A 2HAEA 1YB1A 2B4QA 5DCUA 2EP5A 2VYVA 4BKOA 3K92A 1EMDA 2FSSA 1XU9A 2NVBA 1LU9A 5EN4A 4ZD6A 3QE3A 2O4CA 1LQUA 1PZFA 4K6CA 1PGJA 1T1RA 1E3EA 3C85A 4JN6B 3ONDA 3NTOA 4UUOA 4MVJD 4RVSA 1LDGA 2NM0A 4WASA 3EHEA 3PWSA 4I8XA 1KETA 1B7GO 6LDHA 4XYGA 1Y1PA 5C3MA 1KVQA 4CJXA 3IDSA 3I6IA 1EFKA 2NU9A 5CEJA 4CM1A 1KYQA 3PJGA 2NU6A 4D3SA 1UXJA 3IJPA 4NK5A 3GZNB 1K6JA 3GR6A 3KSDO 5TNXA 1FDWA 3UUWA 1ENZA 3V5NA 3QW2A 3NYWA 4BNVA 2X22A 5F3RA 3UKOA 2B35A 5B4UA 5L7WA 4MP8A 2G76A 4E0BA 4WEOA 3RU9A 3R3JA 1QLJA 4INAA 5CHEA 2UUPA 3JYOA 3GQVA 3S55A 2ZCUA 3D0OA 1I0ZA 3OECA 1KBZA 4Y6RA 1PIWA 5F5NA 1ENOA 2B5VA 2HLPA 5HWSA 3GNSA 5IAAA 5J23A 3ONEA 4LGVA 1PL7A 2XAAA 3K73O 2QX7A 3CH6A 1YQXA 1I3MA 1NASA 1EQ2A 2QRJA 5KJCA 4M49A 3WGQA 4MVJM 4IPTA 1WWKA 3DMTA 1C1DB 4MINA 3DMYA 4RQUA 1VKOA 3CE6A 1G0OA 4MOWA 2X5JO 3NEPX 5JDCC 2YFHA 3PWKA 1WPQA 3V1TC 1ORRA 1RKXA 3CIFA 4QXMA 4WNCA 1DC5A 2D59A 3BMNB 4G2NA 3EGOA 2GZ1A 4RPHA 2ZQYA 4B4OA 3TZHA 4OYRA 2DQ4A 2PNFA 1LBEA 3EK2A 4NFYA 1MX3A 4MP6A 4YRAA 4NHEA 3EC7A 1MB4A 4XR9A 1TI7A 3AM4A 2ZIZA 3E9NA 2D5CA 3LVFO 3OJLA 3HHPA 4DLLA 2FR0A 3ZV3A 1CERA 2OBNA 2Q2VA 1LSJA 3WWZA 5JAQA 4AJNA 4WCFA 4YRBA 1GAEO 1E7RA 1GEEA 3U3XA 4IXWA 3PVZA 4YDRA 4XEHA 1U8FO 2YZ7A 3Q2KA 4ZVVA 3NTRA 3TSCA 3GHYA 4AG3A 2DFDA 3DAFA 1BTOA 1EVJA 3P2OA 4Z9XA 2YQ5A 4GVXA 5LDGA 4OOFA 3D3EA 2E48A 1NR1A 1ZNQO 2DM6A 3H7AA 3GEDA 4IJWA 1HETA 1B15A 3WLEA 3RAJA 4GGPA 1B0AA 5FFFA 2P5YA 1QYDA 1P45A 3H3JA 2Q2QA 1WAMA 2AE2A 2FZWA 1MGOA 3QVTA 4PGFA 1XDWA 3JQGB 4IY1A 2ZYDA 1JLLA 3BMNA 2ZYGA 5BSFA 4I5GA 4AL4A 1S7CA 4DYDA 2BH9A 3D3WB 3E03A 5A05A 4AJEA 4MJLA 4D79A 3OSUA 2OGUA 1EE9A 1I36A 2I76A 1P33A 2EGHA 3C8MA 1LSUA 1UH5A 3PJFA 5TS3A 1IHXA 2IXBA 2BELA 4BOYA 2YV1A 5ADHA 1EVYA 3GDFA 5G4KB 2W4QA 2VN8A 2Q49A 3X2EA 2J3KA 2QYTA 1JQBA 2DTEA 3MTGA 2YDYA 4LW8A 3O8QB 4CMEA 5CEEA 5GMOA 3GPIA 5DNAA 4EI2A 1PJSA 4NU6A 1KY5A 1Q7CA 4I9HA 2TMDA 1H94A 5CFZA 1Y5MA 4UVHA 2QG4A 4CR6A 1P0FA 1PGOA 3WJ7A 4TRMA 1I2CA 4BNFA 1EDOA 5COBA 3PXXA 4E30A 4YQYA 3OEWA 3RASA 5KWEA 4KTVE 4L0QA 2AXQA 4W7HA 3ANMA 1DC3A 2J5RA 2Y67A 3UCXA 1SO8A 1LDEA 1N8KA 1CJCA 3LLVA 5JCJA 1P9LA 4TRRA 1JW9B 5AVOA 1ZBQA 5ICSA 4WCDA 4HNGA 3WBBA 1YQDA 1T1SA 1YL6A 4LMRA 2EHDA 4OJNA 4YJGA 1CYDA 3GGPA 1SB9A 4U8GA 5FEUA 2BGKA 1YB5A 3T4XA 3PFWO 3LT4A 4L76A 2VUTA 3UOGA 3WTBA 2Y1GA 2FPPA 4DWVA 5C5IA 1BSVA 2QIOA 2Y0DA 3DMTC 4YCAA 5G0TA 8LDHA 4NBUA 1YGYA 4LK3A 5A02A 4A10A 5G4KA 2PFGA 3WGHA 5DP1A 1WDKA 2NWQA 4ND2A 4DXHA 4W82A 3O8QA 1GL3A 1WMAA 3UAGA 2W8ZA 3LC2O 4ROSA 5EESA 4M87A 4EJ6A 1QXSA 3TL3A 3TOXA 3ADPA 1C0LA 3KHUA 2H1SA 4WLEA 3IKVA 1LRLA 1P1FA 3ZWOA 2CDCA 4O63O 3M6IA 3JTMA 1PJCA 2GYYA 1B16A 1YRLA 3A9WA 4BV9A 4TZTA 5DOVA 3LT1A 1H0KA 2JL1A 1SEVA 2FSVA 5JS6A 4XX0A 2H9IA 2GNAA 4PLVA 2A94A 4WCFC 4A73A 1V3UA 1BVRA 2DBRA 3QWIA 4QSMA 3GG9A 2RIRA 3F5QA 2DU8A 3GUCA 4MVJF 1EVZA 3WSWA 4MVJI 1QV7A 1LC0A 1LDNA 2AQIA 3RBVA 4ND5A 1UDAA 4B3HA 4CMAA 1PEDA 3UVEA 1SB8A 3BMQA 1HE3A 3DZJA 4HKTA 4XDZA 5EMHA 1GZ3A 3HNPA 4H7PA 1QYCA 2EKPA 4E12A 1I2ZA 1ISJA 5COAA 1KS9A 4XYMA 1BXGB 1PS0A 2VUUA 3VC7A 4AICA 5TLSA 4WUVA 1IOLA 2FHSA 3AUAA 4MP3A 1GYRA 3IUPA 4LN1A 1PJTA 3PLNA 2QZZA 4JP2A 2WYUA 3GGOA 3ZV6A 4WLFA 1A9YA 5I7EA 3AUTA 3CMCO 5BSHA 2ZATA 3T7CA 3KYBA 2B5WA 2O3JA 3DWFA 2Q1SA 4JX8A 1ZMTA 5JPIA 4UUMA 3QLJA 3VVBA 4B4WA 1GTMA 3Q1LA 3NDIA 3HDYA 2OXIA 1LQTA 2OO5A 4YJHB 5BSGA 2Q4EA 3RROA 3EDMA 3DO5A 5TX7A 3GMSA 4CMEC 1YL5A 4BNUA 1U9JA 1JKIA 5I8ZA 8ADHA 1NAHA 1Y8QA 4PLTA 5T8KA 1EUDA 5F5LA 1Z73A 3GAZA 3ETEA 4C7JA 3RCBA 1I01A 4CM9D 2P4HX 4KWHA 2W98A 2G17A 2ZKLA 3NX4A 4EUHA 2O3SA 4J90A 3JD4A 1JDJA 2CZCA 1XWFA 1R6DA 2Y0CA 2BI7A 1HE5A 5G4LA 1DFHA 3RJ5A 4U5QA 3LC1O 4U6QA 4CMHA 4CQMD 1VL8A 3ZHXA 1BXGA 2J8ZA 4BKRA 2FMUA 4IXTA 4ALLA 4BUCA 4DIOA 5B1YA 3GUYA 1ZH8A 5U4QA 2JFGA 1M6HA 5F1OA 4NFSA 5T5QA 1NR7A 1RYEA 4H16A 2HJRA 4NFHA 4R3NA 2UAGA 4XB2A 5CAEA 3GK3A 1YOVA 4E32A 4RVHA 4BNIA 1LEHA 2HMUA 3O38A 1XSEA 3L4SO 1CEQA 4BGVA 3W8EA 1UR5A 2WM3A 4U0KA 4OM8A 4PG5A 4LVUA 2PH5A 4BO1A 1PS8A 4CV0A 4N5NA 2ZQZA 1FDVA 2XF8A 3WNVA 4XWYA 1UZLA 1C0PA 1KVSA 1YDWA 2ZTMA 3I9JA 3VH3A 1Y8RB 4QT0A 4CMIB 4DMMA 3JYPA 4FFPA 5KJ6A 3DAGA 3OEYA 1KC1A 3U4IA 1W4ZA 5A9SB 4ZA2A 2BFPA 4BNZA 4OL9A 4EYEA 1Y81A 4CODB 2VZ9A 3MZ0A 4E21A 3RBZA 3F5SA 1QYWA 1FF9A 1LI4A 2NQ8A 2DAPA 3GN1A 3K30A 1V0JA 2C59A 4MO2A 1I3NA 4AJ1A 2GN4A 3ROMA 2DPHA 3KEOA 1XCBA 5A9RA 2D4AA 2HQ1A 3PHLA 1NAIA 4P4NA 4Z0HO 2B0JA 2X0NA 1B8VA 3TF5A 3SVTA 3VPHA 3MOIA 5TRTA 1A72A 2R2GA 1MXFA 2DLDA 1Z74A 2C5EA 1HE4A 4J16A 2XXBA 4U0JA 4NBVA 5EQFA 4PIVA 3OA2A 4L74A 2EF1A 2CDAA 3H4VA 1JKJA 4JROA 4CPDA 5JYEA 4XQGA 3UH1A 4TMFA 3BMOB 3JD0A 5BNTA 2IDZA 1B8UA 2EERA 3DBRA 1C3VA 4BGIA 2VWGA 2IE0A 2J3IA 3DBVO 1NWCA 4FFOA 1O0SA 1H2BA 4AJJA 4CMIA 1Y8RA 2O3QA 5TQVA 3MJEA 2DKNA 4YB8A 2R00A 1EBUA 1JKFA 3ENKA 1HF3A 3VPSA 2HRBA 3FWNA 3SXPA 4YWJA 4Z9YA 1GPDG 3EUWA 3GH3A 4BNNA 5TF4A 3RBXA 3FPCA 4J7UA 5IN5A 4NBRA 3FN4A 2D1YA 2C0CA 1WDLA 1Y6JA 3Q9NA 4FFRA 4UEJA 4IDBA 4WLUA 2FPGA 3FTNA 3ZWWA 1PQWA 1K6XA 4P4LA 1DDOA 3TWOA 4P4GA 2VRCD 3WGYA 2B37A 1ZKMA 2AG5A 3KVOA 1GQ2A 4DA9A 3RD5A 1E7QA 2NSDA 4J7XA 2GR9A 4WEQA 5IDXA 4FC6A 5FYDA 2NV6A 3DXFA 4FSHA 1NVTA 1H6DA 3BMOA 3VDQA 2O7QA 1G6KA 5I9NA 3IIEA 3GMDA 1HDYA 1A7KA 1XLTA 1ZZEA 3DZBA 4NI5A 4BNGA 1X7DA 2JCXA 4I5DA 4IQ0A 2NU7A 2VYNA 3HDQA 2HK7A 1E0DA 2DTXA 1LUAA 1HL3A 1NNUA 4HY3A 4RORA 1V6AA 1F8GA 3CMMA 4A0SA 3MTJA 5IDWA 4Q3NA 3DZFA 3TN7A 1DAPA 4WLVA 4J2HA 5L45A 3PZRA 3INRA 1P1HA 1M66A 5CDSA 1E7MA 1LX6A 1A4IA 4IZHA 1ZSNA 4RQTA 2JJYA 3PP8A 5HS6A 4PVCA 3GRKA 3NDJA 5JO9A 2CVZA 1DHRA 3DZIA 2EJVA 3GGGA 5JAZA 1GV1A 3W4KA 5EJ2A 3MWDB 2VRBA 1NX6A 3PIDA 3ASUA 1C0KA 4YAEA 4OHUA 3H9JA 5BR7A 3D7LA 2BF7A 3PWZA 4JLWA 4OMUA 4OSOA 5A06A 1ZK3A 1J4AA 4NJOA 4IGFA 5TJ9A 1N9GB 2DUWA 3HZZA 3P5SA 4MVJH 4FJ0A 1BDBA 5L40A 5DOZA 5ER6A 2Q50A 4BHTA 3GVPA 3V1YA 3R1IA 2EKLA 4H15A 2GCGA 3FWZA 1HWYA 4GWKA 5K6AA 2Q2WA 3ENNA 3WSVA 1M67A 4NK4A 4P38A 4MIYA 2NU8A 2RCYA 1H2HA 3MWEB 3GF4A 1ENYA 2NVWA 1WP4A 3Q6IA 3FSRA 4Q3AA 2Q46A 4CM5A 2GLXA 4ND1A 2DC1A 4R3WA 1CRWG 3JD3A 4E13A 3WGZA 3KETA 2O3RA 3ZU3A 2IZ1A 4W99A 4KP7A 4RDIA 1YONA 3C1AA 4XQEA 4ALJA 5L4NA 1T4BA 1BWSA 1BW9B 1LLQA 5AQ1A 2IODA 1PL8A 4PVDA 2R00C 3A06A 4Y67A 5TT0A 4GQAA 4ZU3A 4FDAA 4S1VA 4CUZA 5L95A 1BXZA 1YL7A 3H5RA 5CG2A 5JNLA 2Q3EA 3FTPA 1U5CA 2BMAA 2ZB7A 4JNKA 4II2A 2ZB8A 4LVCA 4O6VA 4EEXA 4ND4A 5A03A 1CF2O 1DIRA 3QVOA 3U09A 3FRJA 1GEGA 3QV1A 1M2WA 1D4FA 1ID1A 4CM4B 1LLCA 4EJ0A 1N9GA 1T2EA 4N5LA 5AXDA 3ZH2A 3VZSA 1V3TA 1S6YA 1NM5A 4PLFA 4XJSA 5THQA 4Q9NA 4BO8A 1D3AA 1UP4A 1VC2A 2Q45A 3VH2A 3C3XA 4PZDA 4U7WA 3SJUA 2EW8A 2O3UA 4LRSB 3VPGA 3BMCB 2CD9A 1OZAA 3ORFA 3L07A 4IGEA 3RFVA 1VM6A 4AVYA 4Y98A 4GGOA 2OOSA 3GC6A 4BKUA 2ILTA 2X86A 3QIVA 4L9RA 1K0UA 3KO8A 1TLTA 3LK7A 1LSSA 2G1UA 3HDHA 5MGBA 2JHFA 3IMFA 4R01A 4AJIA 4Z3KA 3LT0A 3I9MA 4PG7A 4R1UA 3DHYA 1ISMA 1U2GA 4ESOA 4J0FA 1FDSA 1VPDA 1KEPA 1VI2A 3B1KA 3DONA 3QWHA 2Q1WA 4IMPA 1PJ3A 1C0IA 1KEUA 4L4SA 2I3AA 1TB4A 2WMDA 4CLOB 5BQFA 5IXYA 1Q0HA 5DULA 2J5KA 4W6ZA 4XCVA 3RKUA 2PKQP 5EQDA 5CPBA 4ZQGA 1RWBA 3ZWCA 3NUGA 3TPCA 3OIDA 1KC3A 3JQAB 4IS2A 1PQPA 4O5OA 5L51A 4RVUA 5G0WA 2BFMA 1IUKA 3DOJA 1A9ZA 2Y0EA 3WB9A 1T2AA 4XIYA 4II3A 3GNTA 1KVRA 2X9GA 4PZCA 4B7XA 1BMDA 2B36A 3BMCA 1NVMB 3H9GA 1GADO 1O89A 2VUSA 5AXBA 1F0YA 3VPXA 1DFIA 3AU8A 3GPDG 3DHNA 3HFGA 4D42A 1K3TA 2BGLA 3ZU4A 5G0SA 5GZ6A 3DOOA 3BHJA 3MOGA 3WX0A 1F12A 1H6CA 3CUKA 4IQ8A 1ZK2A 1H93A 2YUTA 5DZSA 4I1IA 4RZHA 4RVDA 1VRWA 4R4JA 4KDFA 3DZKA 2HK8A 3PDUA 2HU2A 1AGNA 4WECA 1OC4A 1PS9A 1WZIA 4Y6PA 5K6AC 3IUSA 3Q9UA 4MVJP 5T67A 2X6TA 1IULA 1X0XA 3DZGA 3FHLA 3QWBA 2PH3A 1AXEA 3B1FA 1VL0A 2VWPA 1CIVA 4N7RA 3ZI0A 4B4VA 3G0OA 2D8AA 2VZ0A 2VNSA 4TSKA 2IZZA 4HADA 1P0CA 3ZV4A 1DRVA 4XKJA 3STHA 3GZNA 3NRCA 1HT0A 3HDJA 4M1QA 2YW9A 3P2YA 3GRPA 3W4JA 2BLLA 2PV7A 1I32A 3F46A 1K6IA 4W9NC 4XRGA 4OQZA 4FBGA 4J0EA 3PRJA 4BMSA 4MVJG 3ICCA 4KMSA 5JY6A 3IKTA 1P44A 3RSHA 2NUAA 1CQJA 2F00A 1L1FA 4EJMA 1MFPA 3MJ4A 1X1TA 1QYXA 4XIJA 5L4SA 1G1AA 2QZ9A 2HUNA 4ALMA 3IAHA 3L6OO 2PWZA 3VOSA 3BXXA 2AA3A 3D5QA 3ZN2A 4EBFA 1SOVA 3UN1A 3I9OA 2PA3A 1ADFA 1NHGA 4DGSA 4YPOA 3C24A 4HXYA 5JAIA 3LQFA 1C1DA 5JO0A 4IDFA 3RI3A 5GY7A 3WGOA 5HM8A 2OP0A 3E6AA 4IJKA 1Z7BA 3OMLA 3E1KA 3FR7A 3L0DA 2CFCA 3KTDA 5DP2A 1UXKA 3HADA 1YS4A 5EPOA 4UULA 4BO2A 1HSOA 4GVLA 3WG9A 1K2WA 4X54A 3GN2A 2GDZA 2C5AA 3JQAD 4ZQFA 3GZ4A 2V7PA 4G5HA 2EXXA 4DIBA 3E48A 3ZNNA 3RC1A 4ALIA 1K5HA 2JCVA 2PGDA 5DT9A 4WK6A 1I24A 3GNQA 4BNTA 4YXFA 1N7HA 1VLLA 1YDEA 3Q0EA 3CZMA 1ZXBA 4FGSA 5K0ZA 1DJNA 3E5RA 4OOEA 5C7LO 3GDGA 3PYMA 1NP3A 2H63A 1F17A 4I9NA 2HO5A 3ZWMA 4B8WA 2W2KB 5KJFA 3TL2A 4Z9FA 1ADGA 1N2SA 5KKAA 3DBLB 2E82A 3G79A 3BZUA 4F6LA 1D8AA 2WYWA 2PKRA 3D4NA 3DTTA 1E1MA 3M2TA 4B79A 3AI2A 3PGJA 3TNLA 2GN9A 1FJHA 2IYOA 1ML3A 2X1HA 4XDYA 1GD1O 2AQKA 3ZNPA 1NPYA 3PHJA 4IJUA 2JFFA 4E2WA 4QUKA 5F1KA 4BB5A 1JU9A 4ZQEA 1AN9A 5LCXA 4BQRA 4DC1A 3GT0A 4NDNE 1NYTA 1UAGA 2QYSA 3FNEA 3R0IA 4GMFA 3VVCA 1E3JA 3JQGA 4XGNA 4ALKA 2WYVA 1GPJA 3M1LA 3D3WA 1P74A 1B3RA 1NFQA 4FJ2A 5JSFA 3V1UA 3KOUA 1R4NB 3AW9A 3ZWVA 1EZ4A 3PIIA 2CSUA 3DBHB 1ZK0A 4Z3DA 4CL3A 5K9ZA 5JLAA 2Z5LA 1HDXA 3BHIA 3EYWA 3I9NA 6ADHA 2PZKA 1E92A 3KLMX 2GASA 1QR6A 1ZEMA 5DBIA 4DLAA 4D45A 4FCCA 2BFAA 3L9XA 4CQMB 1Y9EA 2DFVA 2WJPA 4LISA 3I3OA 2W2KA 3HSKA 3H9QA 3HB5X 3MEQA 4O0LA 3FBTA 3TOZA 3WWYA 3INTA 4CLEA 1DLIA 3BHMA 1NHWA 4IQGA 2VOJA 3PI7A 7MDHA 2AEFA 1XU7A 3VPFA 1N5DA 2CVOA 3EZYA 1Q0LA 3AY6A 3I52A 3MJSA 1DOHA 4H3VA 3AY3A 4JJGA 3F47A 4PLCA 4FD3A 2PR2A 3NGXA 4A5OA 1ZUD1 2Y1DA 1SEPA 3ROKA 3S1LA 4AJ2A 4RF4A 4R41A 4NNJA 1WXDA 1P77A 1AXGA 1ISGA 3C1TA 1WNTA 2O7SA 1R4NA 2OL4A 3DBHA 5L3ZA 3W8DA 2FPIA 2X0JA 4Q3CA 4CM9A 3NGLA 3C7CB 1QORA 1ZSYA 2QHXA 4QO7A 2YFQA 4UEKA 5I7VA 1JVSA 4DRYA 4PRKA 3WIEA 1XQ6A 3GFBA 3BTSA 5KNLA 3ROPA 1LNQA 4BGEA 3AWDA 3UICA 4JK3A 4KZPA 4WE3A 3TZKA 1W8DA 3GVXA 3L77A 2PKQO 1SBYA 3WFIA 3F4LA 3I6QA 4E33A 1FXSA 1GUZA 1NPDA 3MJVA 4PG8A 1SC6A 3DZHA 3AOEA 2HMSA 3COSA 3R3SA 2IEDA 4AJHA 4YAIA 3U62A 1U3UA 3P19A 1PX0A 2E37A 3D64A 2NTJA 1YWGO 1P1IA 5IZCA 1ONNA 1DBVO 4F3YA 2Z1MA 4BO3A 4M89A 4CM8B 5T6BA 1IE3A 4YT2A 4E2YA 2P9CA 2EG9A 4FW8A 4R51A 5GZ3A 2J3JA 5EERA 2PY6A 1WW8A 1WLYA 5H81A 2D3TA 2G82A 3OFSA 1O95A 5U9CA 3WNQA 1U7TA 1SPXA 1LXCA 4OIMA 3WJAA 1BVUA 4D44A 2NNLD 1T26A 1XA0A 4NMHA 2GUGA 2IXAA 3OA0A 4RDHA 4FPXA 3GA0A 2OMEA 3JQ7B 4QTZA 1CWUA 1E3IA 4Y8VA 2EIHA 3RUIA 3TRIA 4BKQA 1B3BA 4HFJA 1IZ0A 2SCUA 2B69A 4ZQBA 1HDGO 3A4VA 5DDIP 4ZJUA 4ILKA 2VQ3A 4KQWA 3RQSA 4DC0A 1LA2A 2B4RO 4L75A 4A27A 3K6JA 1O94A 3PJDA 3QY9A 5L7YA 3OHSX 4NPCA 5BT9A 3IP1A 4CQLB 3BIOA 3D5TA 1OI7A 4NBTA 3IC5A 4UVDA 1U1IA 2P91A 1P3DA 3U4DA 1NTOA 1P31A 3KXDA 5ENDA 1EVIA 1NQ5A 1L7EA 4UVEA 4YJHA 1R0LA 4CM8A 1R66A 1Y9AA 3PDJA 3INGA 4XJTA 4EZBA 5B4VA 1D1TA 3TDKA 4DTIA 3ZNQA 3HE3A 2DUUA 3F1LA 3NJ4A 3ITKA 4R9RA 1R12A 3F6YA 3NT4A 1HDZA 4OQYA 4E5KA 4NJMB 2PD6A 4JBHA 3ZCXA 5H82A 3AFNA 2PTGA 4RO0A 4XZ3A 2C20A 3CTMA 3H2SA 1QP8A 1PSDA 3V8BA 3ZWYA 4BB6A 3JQ7A 2F1KA 1OBFO 3KUXA 5JDIA 5IJZA 4LCEA 1N7GA 4LSMA 4MVJE 3PJEA 1KEVA 4M54A 4TVBA 5JW6A 1E6UA 5ITWA 4D0RA 1JVBA 1U8XX 1F8FA 4CMCA 3G1UA 5KVQA 1CETA 2BFOA 5A9TA 3Q3CA 3RC9A 3JQDA 4HFNA 1NFFA 1R4MB 4CQLA 4FOSA 4FN4A 2RH8A 4PLGA 4RLSA 2W90A 2I5PO 4PN3A 4ZGWA 4UEOA 4E3ZA 2IZ0A 3AK4A 1ISFA 2ZK7A 3SEFA 2QRLA 3KYCB 1YXMA 4B8ZA 2DBZA 3OQ6A 1XYGA 2PD3A 4CR7A 2JD1A 1XIVA 3KZVA 4LSWA 1ARZA 1A5ZA 1HEUA 2W2LA 3PZBA 1EUZA 1KY4A 2OP1A 5KVCA 5U1PA 4DLBA 4K9DA 4RPGA 3H65A 3ZWAA 5CDTA 3ZV5A 3CPSA 1DSSG 3DR3A 2AMFA 3W6ZA 4NQZA 3TQHA 4MKXA 3WFJA 5KKCA 1KVTA 5L7TA 4YR9A 1R37A 3IS3A 3QVWA 4EITA 4MIOA 1FK8A 5A9SA 1ZJYA 4FIZA 1R16A 4L4RA 2QW8A 4IM7A 4J1NA 2YV3A 4KUGA 1NWHA 3KLPX 2X9VA 1TEHA 1VSUA 2CVQA 4XYBA 4ALNA 1TXGA 2I3GA 3VHRA 4ITUA 5TGDA 4CMGA 4JJIA 5T8KC 3JQCA 1I2BA 4L4XA 3UFXA 4KDEA 2JD0A 4OXKA 2R6JA 3WMXA 3EAGA 2G0TA 3GDOA 3IL2A 2YY7A 1AUPA 1R4MA 1ZMOA 2PZJA 1CQIA 3JQBA 1BRMA 1M76A 1MC5A 1MLDA 1D1SA 4CM6A 1DB3A 1NQOA 2VHYA 3RFXA 5A5FA 3ICPA 1DEHA 1UAYA 3O03A 2VZ8A 2PGJA 3KYCA 3H3FA 1B2LA 2FOIA 4GAEA 3OJFA 3ZU5A 1V8BA 5ES3A 3JCZA 3DFUA 3ON5A 3HB4X 1LC3A 1NBOA 4JP3A 4JGBA 2X9NA 4CMBA 1GQQA 3F4BA 3WIDA 3DOCA 3I83A 4A2CA 4QEDA 3LDHA 2D2IA 4GMGA 2Y93A 4BNXA 5A5EA 3LLSA 1PZEA 2RBEA 4XGKA 1W6UA 3H2ZA 3ETDA 1I30A 2ZYAA 3ST7A 3K2EA 5BNIA 3OQBA 4YT4A 1GCOA 1T4DA 3UGKA 2D5AA 1UXHA 3QVXA 3ZWXA 4J6FA 5KVSA 3ANNA 1HKUA 4DPKA 1GDHA 1LDYA 4RLHA 1Q7GA 2VWHA 1VL6A 4UVIA 5IZ4A 3K96A 3AJRA 5TT1A 2E6UX 3AI3A 3H5NA 2VHZA 2E49A 1EUCA 3S2FA 1KOLA 3VTFA 2B83A 4J1TA 1IB6A 3GG2A 3LT2A 1YBMA 4WKGA 1YJ8A 2JAHA 3AU9A 3FNGA 1U7HA 3S8MA 2VHXA 2OHXA 5I7SA 1ADBA 4R1TA 2X23A 1X7HA 4JXKA 5HRUA 1DIBA 2DBVO 2O3TA 1WMBA 2OBYA 3WBFA 9LDTA 2VT2A 4LMPA 1ZO8A 3WLFA 2X7HA 1TT7A 4XYLA 3MJTA 5ITVA 4TKMA 3L4BA 4GBJA 1YH3A 1NFRA 3RVDA 4IDGA 5G0UA 3I1JA 2C29D 1GY8A 2Y66A 1XQ1A 3H8VA 2FWMX 3K8ZA 3BAZA 1X1EA 4GWGA 1GR0A 1A71A 2JHGA 3ABIA 3KYDB 5G2OA 4IINA 4F6CA 2WD7B 1HDCA 4QQRA 2YHIB 3OIGA 5JAMA 4G65A 3KM0A 2TMGA 3GHHA 1WZEA 3E9MA 1E1LA 4URFA 3TZCA 1PGNA 2VYND 3I9LA 5HA5A 3UCEA 2VHVA 1E7YA 2WEKA 1X7GA 1MP0A 2WD8A 2ZJ0A 3KEQA 4FFLA 2GPTA 2HMTA 3AOGA 4R1SA 4W7IA 4E5PA 4R9SA 2YQ4A 2O23A 4YAGA 3FF4A 1B8PA 4R5HA 4MVJA 5ER9A 4FS3A 5B12A 1DIHA 4CMKA 1IY8A 3BTOA 4E31A 3O9ZA 2A92A 4N54A 3RUCA 1G0NA 1DRWA 1TA4A 1X15A 4NH4A 1MG5A 2Q99A 4GPD1 1OMOA 1SNYA 1OC2A 4IIVA 3RFTA 4CUJA 3HN7A 3CZRA 1U4OA 2IRWA 5I9MA 4DBZA 2VOEA 1QSGA 4DIFA 5IXSA 4AJPA 3FCOA 4RGBA 3KYDA 3JQBC 3EVTA 3UCFA 4E5NA 1TVEA 4MKRA 4E6PA 1T2FA 2GGSA 1R15A 1I3KA 4IBOA 3CINA 4J3FA 4R68A 3W1VA 1GU7A 2LDXA 4PG6A 3HJAA 3GLQA 4CLXA 1PGQA 5ENVA 3UW3A 3WGGA 4CLRB 2JAPA 3HN2A 1HYHA 4NIMA 2NVUB 3ZWPA 1P1RA 2XOXA 1VJ1A 2DT5A 2HJSA 1HE2A 2VTEA 4Q3BA 4O1MA 3CSDA 2X0RA 2BGMA 1BW9A 3OF2A 4TRNA 4WNIA 1E1KA 2NTNA 5FWNA 2OUIA 3I5MA 3JD1A 3W8FA 1N92A 2QQ5A 4CV2A 4CLDA 4E4YA 1EDZA 5T64A 2O2YA 2UV8A 2AQHA 4BNMA 4S3MA 3H9UA 4QX6A 4WOJA 3ZGYA 1E3SA 1YB4A 4YT5A 4RF5A 3OJ0A 3V2GA 1YVEI 3FNHA 1PGPA 3KSZO 4CM4A 2FRDA 2BKAA 2GN6A 5JC8A 4A26A 4XQ9A 4I5FA 4M55A 5CPFA 2JFHA 2EGGA 4FC7A 4DPMA 5G0VA 1PZGA 1PJ2A 1RPNA 1XELA 4YAKA 4JCOA 4UUNA 1NVGA 1DO8A 1DC6A 3D4OA 3NDRA 1KEWA 1EFLA 5A4DA 3L4BC 1T2DA 4BNKA 1UP6A 4BMVA 2X8LA 3TZQA 5EIOA 4BIIA 4JIGA 1GUFA 1EE2A 4DREA 1E1NA 2P5UA 1X13A 3JQFA 4FOOA 4CLRA 2X4GA 1NQTA 2NVUA 5COQA 1DHTA 2ZTLA 3L9WA 2O48X 3K31A 3O4RA 1IZ9A 1M75A 3GVHA 3WR5A 4IUYA 4WCFB 1ADCA 5ILOA 4PLYA 4HNHA 2AE1A 2Y1EA 4C4OA 2P9GA 1DAOA 3WDSA 1HDOA 1GUYA 2VYVD 4GSKA 2GERA 3AUSA 4FB5A 1M6WA 3I4FA 4EUEA 4CLOA 1HZJA 4BO9A 4QFDA 3VH1A 5KVVA 1E77A 2ZCVA 1WDMA 4YJFB 3DB2A 4GKVA 1JAYA 3M1AA 3H6KA 3OIFA 3UF0A 1DLJA 1N1GA 4CL8A 1XGKA 3F9IA 2I65A 5TIIA 5F1PA 4DYVA 2D0IA 2XPCA 3JQAA 3Q2IA 3RIHA 1SAYA 1O8CA 4J1QA 4RF2A 3RU7A 3U9LA 4GSLA 3WGTA 2AEJA 3CEAA 1IHYA 5I7FA 1DIGA 1RM0A 2EWMA 3B20A 4IDAA 3DTYA 1EEHA 4FGWA 4U6SA 4WJZA 5L4LA 3IP3A 2WDZA 1HDRA 1MUUA 3TJRA 4AJ4A 1H9BA 1DPGA 2NTVA 4NBWA 5GZ1A 4J91A 3M2PA 4FFMA 3BA1A 4B3JA 1E5LA 1W73A 5DCWA 3HFSA 4B7UA 4RPJA 3WMWA 3ZDFA 1W0CA 1JWAB 5JCXA 4J2OA 3G49A 2GO1A 4O59O 4CR8A 2X58A 3VZQA 2ZB3A 5T57A 1ZEJA 4D3DA 1GYQA 4PRLA 2GD1O 4HWKA 5L53A 4J9UE 2Y68A 1ISHA 1O5IA 3B1JA 4RZIA 4WLOA 4TZKA 4HX5A 4OSPA 4RCVA 1LTHR 4BO0A 3FR8A 4IMRA 4BNWA 2CF6A 2J6IA 3EZLA 4XR4A 1MG0A 4YJFA 3PHHA 1ZFNA 1Y5RA 4NR0A 3FNFA 2X5KO 5ICMA 2POQX 1C14A 4I9UA 4N5MA 3OETA 4Q3DA 3NTQA 3LF2A 1GCUA 3PFFA 1QLHA 1UDCA 3KSUA 1Z7EA 3DL2A 4YJGB 5JXWA 3G3EA 1MXHA 3OQ1A 3DC2A 4RJTA 1ZW1A 3PK0A 4TVOA 1PJLA 1X0VA 4YRDA 1XEAA 4DQXA 3ZHYA 5HBRA 3UXYA 3LU1A 3OM9A 4JQCA 5C7IO 4ZHSA 4D41A 3P7MA 4Q3EA 3ZU2A 1L7DA 1QMGA 5IG2A 5KJ1A 3WQRA 1IPEA 3I23A 4P22A 2YYYA 4E5MA 3H5AA 2AHRA 5B37A 5LC1A 1HZZA 2Y99A 2CNBA 3OBBA 4W4TA 4EGFA 3JQ9A 5DBFA 1MC4A 4RPLA 3I9KA 1V9LA 1RJWA 1T24A 2VHWA 3A14A 3WQSB 3E18A 1OFGA 2G5CA 3PTZA 2VTDA 3E5MA 4WPGA 2I9PA 3BYZA 1YE3A 3ZWNA 3JQFC 1JAXA 4YBZA 1ZSVA 2HK9A 4ZRNA 4BV8A 2FZEA 3ZZNA 4CV3A 1E3WB 2FY8A 1PR3A 1UXIA 5CP8A 3VZRA 1PR9A 3W6UA 3SBOA 5JFOA 3DQPA 3PEFA 4YYZA 1E6WA 4K28A 4B4UA 2FR1A 2Q4BA 4TQGA 4Z6KA 5THKA 1BXKA 3WQQA 4BO6A 4AFNA 2WWRA 2P9EA 2CUKA 4ONEA 4BGUA 1ULSA 5LDHA 2HDHA 5FI3A 4B3IA 1ZXLA 5KOIA 4G81A 4Z0PA 1EBFA 4TKLA 4TRJA 5DBGA 4UREA 3K2BA 3T4EA 3DBLA 3BMQB 3PYXA 4YA6A 3N58A 3VDRA 4ZN6A 1UXGA 4DQVA 4LRTB 2UYYA 1CDOA 5ILGA 4DQUA 3IOYA 5KCZA 2GN8A 1HLDA 2OORA 3RC7A 4UUPA 1IL0A 3EMKA 3LYLA 3AM3A 3JQEA 3LSYA 2GRAA 4IDCA 2BRUA 4AJLA 2HSDA 4EW6A 1DXYA 4YEDA 4D0SA 3AY7A 1YJQA 4HFRA 4DL9A 2ZTUA 1UP7A 3A1NA 1JN0A 4Q39A 3SLKA 1ISIA 3N74A 1K89A 3CKYA 3HG7A 5BNFA 3ZW8A 1I10A 3SLGA 4J7CA 4UVGA 3ANLA 2V6FA 5AYVA 4CUKA 1V35A 1E3WA 4HV4A 3WS7A 5CDGA 3GFGA 3QSGA 4ID9A 4IZIA 5JCJD 2I66A 3RJ9A 3E82A 3OP4A 1I3LA 3ETGA 4AJOA 4BVAA 1HXHA 2WE7A 3OJOA 2E4AA 1J0XO 1IYZA 2NLOA 3U4CA 3QRWA 2PZMA 1FDUA 5H83A 1Y8QB 3MCVA 2EV9A 3QVSA 4OO3A 1SZJG 4AJKA 4CLHA 5HTOA 3DDNA 1PJ4A 2GF2A 4NU5A 5KJEA 4CQMA 4HFMA 3NJ8A 2Q1TA 1PTJA 3TZ6A 1LRJA 4OKNA 1ZCJA 2PLAA 3KV3O 2YDXA 4J1SA 4DUPA 5F21A 4ZICA 2ZTVA 1A27A 4HP8A 3IQDB 5CEFA 1OAAA 3RUAA 4FR5A 3V2UA 4YJDA 4EUFA 1E7WA 1KVUA 2ET6A 3E8XA 4M86A 2CY0A 4J49A 2OFPA 2HRZA 4MPDA 3G1TA 1QRRA 4CV1A 1Z6ZA 3S2GA 2JD2A 3ONFA 1DJQA 1E6EA 3JQ8B 4GH5A 4GI2A 1TT5B 2O50A 2CDBA 2Y1CA 2V6MA 3SX2A 4BNLA 2BI8A 1EK5A 4FQ8A 1OOEA 1PL6A 2EEZA 4IDDA 1YOVB 1MA0A 1YO6A 3ZW9A 1GQYA 3SC4A 2C2YA 1Q0QA 1JWBB 2C7GA 1SMKA 2C07A 5CDUA 1ZVMA 2BD0A 3PQDA 4GX5A 5DF1A 4R69A 1AHHA 4D46A 1Y7TA 1ZK1A 2WE8A 3F3SA 4I5EA 3JQ9C 2RHCA 1RM4A 4DMLA 1J49A 4L8VA 1KIFA 3S2EA 3RUFA 1PU2A 2GZ3A 3N7UA 1R0SA 2EP7A 3PQFA 4D3FA 4QO8A 4WLNA 2IYPA 4R1NA 1J6UA 3SJ7A 2LDBA 4R54A 3S2IA 5JMPA 3WYCA 1XG5A 5A3JA 4D43A 4IJVA 3QWAA 4L73A 4RF3A 4A03A 2I67A 2AEMA 3HQ4O 2Y1OA 3H9EO 5IF3A 4JJFA 5AOVA 1H5QA 4E2ZA 2UVDA 4EEZA 2V65A 3B70A 3C7AA 3G17A 5DCYA 2PK3A 3JQ8A 4HBGA 2C2XA 4XRRA 4PCVA 3C1OA 1TT5A 4QFCA 3QA9A 1AHIA 5A04A 5FF9A 3AFMA 5I8WA 1UZNA 4GKBA 4GX2A 4TWRA 1ZK4A 1DRUA 3F1KA 4PG4A 3X2FA 4CMJA 1HYEA 1U3WA 5L9AA 1RM5A 3HUDA 4WOKA 5KTKA 2GZ2A 1UJMA 3AI1A 2HMWA 4R16A 3KB6A 2YV2A 2P68A 1U28A 4GX1A 1XKQA 5BSEA 1MV8A 3DBRB 3GEGA 1UDBA 2I6TA 1SCUA 4OXNA 4XB1A 5C7OO 1U4SA 3RKRA 4E2XA 5EL0A 2HCTA 2IEBA 3NAQA 1T25A 1V3VA 4GLOA 4PLZA 1R0KA 4MDHA 5JC1A 3LF1A 2VCYA 2VRCA 1GZ6A 1U5AA 4FFNA 4N18A 1ENPA 1U2DA 3NT2A 3A28A 2RAFA 4XA8A 5CDYA 3ITDA 2X5OA 4J43A 3JYLA 5IFLA 1FMCA 4KUEA 4BO4A 1D7OA 2BHLA 5TJHA 1J5PA 2JCYA 2QRKA 1O6ZA 4BKPA 3E9QA 4RV9A 1QYVA 1GV0A 1ZJZA 2EJWA 3EY4A 3LC7O 1F14A 3RUEA 3B6ZA 2V6BA 3OICA 2UDPA 5KIAA 1VJ0A 2EW2A 1HLPA 3SC6A 3VZPA 1U3TA 4PFJA 1E7SA 4EDFA 3VAZA 1Q2XA 4PLWA 3ULKA 3WTCA 4JBGA 1GZ4A 4NJMA 3AOEC 1H6BA 2DPGA 2RH4A 4YVFA 2C7VA 5JYDA 1I5RA 3K9QO 1LJ8A 3CXRA 4XQCA 3FPLA 5IDQA 4J4TA 2H5LA 5IZCC 3RUHA 2FN7A 5IN4A 4M8SA 1A7AA 2NACA 4BQPA 4BNJA 4DVJA 1IPFA 5JE8A 1LLUA 3C7DB 3EVNA 1YKFA 4FJ1A 3ZWBA 4K26A 4Y6SA 4K1LA 2Y1FA 2Z1NA 3DAPA 3D4PA 1F06A 1KERA 1QKIA 5JMWA 5A1TA 1Q7BA 1ZIDA 3WGIA 1BDMA 2O2SA 1RM3A 3JQ6A 2XXJA 4UAGA 4BO7A 3PPIA 1FDTA 4BS9A 5JY1A 3WYEA 3JD2A 4I08A 2Z95A 2A35A 1NXQA 4KOAA 2YJZA 3ROQA 1P1JA 3NV9A 5TC4A 5EINA 2AG8A 4Y9DA 3V2HA 9LDBA 1DIAA 4D7AA 3NKLA 4MKZA 3GVCA 3PYLA 4J9VA 1U3VA 2NQTA 2YHUA 4NG5A 1O9BA 2HKIA 3TFQA 3JSAA 3NT5A 1YQGA 1E3LA 1AE1A 3PQEA 1HTBA 1NQAO 1NPTO 1PQUA 3ZHZA 4P8RA 4GL4A 2W2LD 2ZJ1A 2FP4A 1EQUA 2V6GA 1B26A 4XD2A 1PJBA 3U49A 1E5QA 4KUHA 4BMNA 5JBIA 4RVFA 2C54A 4HUJA 2I99A 1HRDA 4CM3A 4WGGA 1Q1NA 2DBQA 1H9AA 1JTVA 3RWBA 4OGWA 3O26A 4BO5A 3ASVA 1UUFA 4IS3A 4J4BA 4PLHA 7ADHA 4C7KA 2AW5A 3IJRA 1HSZA 3QQPA 4ZQHA 3U0BA 2O4UX 2P2SA 3KRTA 3PHGA 3VTZA 4J4HA 5DN9A 1ONPA 5IDYA 5C37A 3T7EA 1N1EA 3FBGA 1MFZA 2C82A 1VSVA 4F45A 3FD8A 3K5PA 2HMVA 3D1LA 3RC2A 2H6EA 5JDIC 2X0IA 2A9FA 4B7CA
chains in the Genus database with same CATH superfamily
9ABPA 2PMCA 2F9FA 3J80A 3D8RA 4IDEA 4EYQA 2NADA 4CW7A 4NZ9A 1RRVA 2ISSD 3N07A 3U7GA 2Q1UA 1HBJA 3IESA 4X85A 4XVQA 5CG1A 3R5XA 2R8BA 3S68A 1HYGA 4PPGA 4R2WA 5A3VA 3SVZA 3ZNOA 4YHHB 3B6KA 4K05A 4CI9A 2P62A 1H8HA 1N2EA 2OMKA 2CMDA 4ETMA 2PR7A 4TKZA 3GEMA 4LTMA 1XTTA 4YT8A 2FMHA 2CXRA 3JALB 3E2IA 4W8GA 1J39A 1C9DB 1UKEA 3DDCA 1VJTA 1XHLA 3DFZA 3Q8XB 1YDGA 4RPKA 5C53B 4E94A 1MB9A 1LSOA 3QWFA 5I5GA 3V2IA 4EO7A 1JBQA 3K9FC 3T1YB 3HB0A 3HXTA 1TO2E 2VG8A 3RU2A 1BGVA 2VT3A 2XQIA 4JU8A 1ZY2A 3ZHBA 4W7SA 1V2GA 1H2RS 1OPRA 2Q0SA 1X14A 5EXPA 3DWGA 2QOEA 4QFMA 3LWNA 1NVEA 3ABOB 3Q8KA 3FXAA 4F4UA 4P4UA 4QECA 4CCSA 3Q5EA 3Q11A 4G3XA 5DI3A 4RCYA 2YVLA 3RV3A 3UV7A 3N6VA 4JLNA 3GAFA 1U7WA 2QLLA 5A5GA 4YCBA 3RT9A 1Z75A 2GNPA 4BNHA 2ZKIA 3SMQA 1LLDA 2VF5X 4LCJA 4HXEB 1QM5A 3BK1A 5AJYA 4Q18A 4RFSB 1Z82A 2M1ZA 1LWNA 3SHFA 1OAKA 2QL7A 2OXRA 3NBAA 4FFDA 3A6JA 4ZEXA 5DHQA 3IOEA 2B25A 3FPEA 4RZXA 4POOA 1QG6A 1B42A 1T4MA 3LTNC 3FB4A 2QJRA 3BDIA 3AM5A 4W1RA 3WSTA 2HYDA 5D7BA 1KFCB 3T9EA 2B7LA 5D3QA 3SR4A 4DHEA 1LRKA 1PT5A 2DXIA 3GZJA 3SK0A 3I5XA 1VE9A 2G4LA 3K1TA 1BEUB 1SOWA 3GARA 3MSCA 3HWRA 1L4HA 1DAEA 1VKRA 1QTIA 3QVKA 3CRQA 2R6GA 5EIFA 1NLFA 2FMIA 5AXAA 3AP3A 4QODA 3FI9A 3SDSA 2ZVPX 3JY6A 4MGEA 5AFSA 2C04A 2H4WA 2NU6B 3KUKA 1Y4UA 3OH8A 3SY8A 1NW5A 2P9BA 3CUWA 2QQGA 1QANA 3QUCA 4KRXA 4B84A 2HADA 3EDYA 4FOTA 3HVRA 4AQ7A 2O54A 2WAOA 5DISB 2RHRA 2QJTA 4C03A 2WSBA 4KXXA 3BTUA 5AW8A 1HE8B 1KKUA 1M34A 3CYFA 4ZVRA 2AH5A 4ZI5A 3VKVA 2WG2A 1EZ1A 4DDVA 3EEBA 1CRQA 4JT9A 3T12A 1IWOA 3U4MA 3B7WA 1B8NA 3JYQA 5KPDA 1NLYA 5JFGA 2Y27A 3FFBA 4DJEC 2J5QA 5B4TA 1BX1A 2VWQA 2KB0A 1ECFA 4MMZB 4DUZB 3AUUA 5AVXA 4FBLA 4K6FA 1FUUA 3VZDA 1XR3A 4PYQA 3SKXA 5B57C 1QJ4A 3E9ZA 1B74A 5DNYB 5DCUA 4N4AA 3R5JA 1SWVA 3D6VA 4NZMA 3K92A 1NKVA 1NNSA 2BCEA 1L7NA 1LU9A 2VP2A 3BL5A 5C4GB 5HW0A 1C7QA 5DHSA 1UC5B 2R68A 1QLWA 3LX6A 5J5VA 2R751 5IC5A 5K3FA 1E62A 4MUFA 4XTCS 3KSRA 1PGJA 3L7OA 5C52B 2K2WA 1AKYA 2VXCA 2FWRA 4K40A 4J1TC 2PWYA 2YIJA 2H54A 2ZS9A 1LDGA 4MVJD 3RVOA 3PWSA 3WE7A 1JDTA 3TLKA 2YXNA 2YZ2A 5IJ0B 1Y1PA 2YMLA 4CJXA 2IHVA 3IDSA 4U7TB 3I6IA 4YRRA 2MOKA 4B3DA 3K0FA 4WMLA 3PJGA 3R4CA 2NU6A 2GJ9A 1UXJA 4ZMSA 2UYCA 3IJPA 4JJ6A 3V80A 1V8FA 3TNFA 4GRAA 5B58C 2EATA 4OM7A 4B83A 1KYWA 1R9GA 2HLDA 2WWIA 3PICA 3R23A 3WDMA 5EJ8A 5EE9A 4OJMX 1MV5A 1SN7A 1M2KA 2B82A 2EL7A 3EJ6A 4DUGD 1JQDA 3PG5A 4IVQA 2VYCA 1ECGA 1OPXA 3STXA 5BYAA 1KRXA 1QIGA 4XCQA 2QL9A 1UOPA 3OIYA 4K8RB 4MP8A 1GLVA 1WA5A 3G5UA 4ETIA 5L7WA 1U1CA 4MWOA 3RU9A 1BQ4A 1PYOA 5B1DA 1M0TA 2O7RA 4TOIA 4UTXA 5FUMA 3JYOA 5JIBA 1G2IA 4JJZA 2FF5A 4CEIA 1EFHA 4AY5A 3LPLA 2CNLA 4OHOA 2ODEA 1CR4A 4OJYA 5HIKA 5A71A 4H6PA 1FA9A 1T6BY 5F5NA 4B3FX 1ENOA 4ZHQF 2ZU0C 5IWCA 2NGRA 4JXJA 3H87A 3B3QA 3DEAA 3X1ZA 5IAAA 3TXXA 3A9UA 1EGHA 2EWVA 3ONEA 1PL7A 3K73O 3PEVA 1SHJA 2CL6X 4C7BA 4MQUA 2QRJA 1HI9A 1NASA 1EQ2A 4LZOA 5LQCA 1HY3A 2H2FA 3MPUA 5LIRA 4IPTA 3LO8A 2ZS7A 1MJGM 3RNLA 1HT3A 5DIZA 4PAGA 4WGFA 4D8WA 3IE0A 1R0WA 4M53A 3K0HA 4RQUA 4EY5A 3TGLA 2AOXA 2PGIA 1G0OA 4QGBA 3UT5A 2F1RA 4CHTA 4LJ6A 2X5JO 2OILA 3C6YA 3NHZA 4IF4A 5JDCC 1EDDA 3PWKA 2UUCB 4N7BA 1ORRA 4HJRA 4DXDA 2R6FA 3I09A 1SKQA 4O08A 5FTKA 1DC5A 1TZBA 3EGOA 4RPHA 3X1DA 3HKEA 4IV0A 1RQPA 5AWFC 5KNCA 2O2JA 2Q9UA 3BREA 1JVNA 2PNFA 1QO9A 4GRIA 4Q48A 3RS0A 4C4YA 4I8IA 2XKJE 4P3KA 4Y2YA 3VV3A 4EZIA 3DAYA 3NI2A 2WFZA 4HAOA 3RSZA 2WTUA 3S2ZA 4L2IB 2G9NA 2BI4A 1MB4A 3H1TA 3QENA 3QELB 3HM9A 3FUUA 4KN9S 3E9NA 2ZIZA 3LVFO 4ZTZB 3I73A 3HHPA 2FR0A 3DBOB 3VVMA 3WWZA 1LSJA 1Z4QA 3WISA 5AHRA 1GAEO 4C0QC 3TXYA 2PG3A 5A4FS 2R6AA 5A4AA 1YS7A 1GJRA 3LQYA 4YDRA 2VS1A 3LK6A 4XEHA 1SULA 3CQ9A 2JS7A 2NMVA 1KARA 1THMA 1DTEA 3T5DA 4QLOA 1ZM2A 4ZVLA 4NF2A 1QMPA 3MM4A 1FXWA 3W3AH 3GRRA 1CVLA 1N2IA 3P2OA 2A67A 1FY2A 4GVXA 1M5UA 2XRZA 4PO1A 1WDTA 2BM1A 4OOFA 5EPEA 4YMTA 4IVPA 1PYGA 2XAUA 4JVMA 3CZ5A 1ZNQO 2PQMA 5JPDA 1XLWA 3ZCPA 1IM8A 2K2QB 3OT1B 5KSZA 2UZ0A 4XGQA 2HH9A 3UK1A 3AB3A 3OUUA 2G07A 1KTIA 3RVNA 1KP2A 1NC1A 4NYIR 5J4YA 3ZJ5A 2CV2A 3FPKA 2IXTA 4DR4B 1T9AA 2HR1A 4GKJB 1VPTA 3EASA 1D0VA 3QVTA 5DHPA 1U8AA 2Q7XA 1UC8A 2V7VA 1Z5OA 4EMTA 1IG0A 1NLUA 1UFKA 1EWTA 2X4IA 2XGSA 3HCNA 5B1EA 5BNWA 1U2QA 1BVYF 3BXPA 4MZXA 3E03A 1JR6A 2HM7A 4L6IA 2JDIA 4W1QA 5A05A 4JOSA 1WF6A 5UKDA 4DCMA 4CIAA 1A8IA 4DLSA 4DR7B 1QDUA 1I36A 2XOEA 2EGHA 2YIDA 4IHJF 4L2IA 4YX9A 1YAHA 3VYTB 3SG0A 1R0YA 4WXMA 5CNKA 1SXJB 1OA0A 1J8DA 3LBIA 4RY0A 3T8YA 4BV3A 3TQQA 2XIQA 4KNWA 4KH0A 3GA5A 1G18A 2I2CA 4QULA 1RR6A 2AG0A 3G6WA 5IBPA 2YDYA 4HK4A 1AGYA 2VP4A 2XVZA 4BNDA 3P9RA 1JAHA 2PSEA 4EI2A 3AETA 1D0SA 1Q21A 3FJOA 2MU1A 3PKIA 5CFZA 4I1UA 2EARA 3PQ6A 2NPOA 3B1XA 1P0FA 3H0CA 3WJ7A 1RAIA 2BFFB 2F1IA 5COBA 3RYIA 4E30A 5J2UB 5BQXA 1BCRA 4OHCA 2ZVDA 2X5NA 4BP1A 4LZNA 3UYLA 3OVMA 3JAKB 5EFOA 3RASA 4L0QA 3OT1A 4W7HA 2RHJA 2FF7A 3ANMA 2VHCA 1PEKE 3AXSA 4UMFA 2YZKA 1Z6XA 5ALJA 1GLGA 3T3DA 2ZE6A 2O2EA 4AZSA 1N8KA 1RU3A 4FT2A 4HUTA 1HMPA 3LLVA 1LPPA 1CRZA 3MMPA 3LQ4A 1P9LA 1RQ2A 3QUBA 2HI0A 4TRRA 1JW9B 5ALSA 4P6VF 2BW0A 4CCAA 2XCSB 1OYWA 3DGFC 1W5TA 3IPRA 3DC7A 2WT8A 4IQFA 1IQRA 4YJGA 3ZS9A 1CYDA 2FSFA 3HRIA 3GGPA 3OLYA 5FEUA 5H9VA 2BGKA 2WKWA 4NBSA 1Y4ZA 1JA0A 1YB5A 1L0BA 3ICEA 3QLVC 1KS2A 5ALKA 4IFIA 4PZYA 1Z5WA 4W6QA 3LT4A 3O3CA 3P96A 2V7QA 2ZRBA 2HJGA 4UXIA 2Y1GA 2R3SA 3H5LA 5JEDA 2QIOA 2N1BA 5G0TA 5K2OA 2BUCA 4AKIA 2XE4A 2VPYA 1ABFA 1YGYA 3EPPA 3IBGA 2XBUA 3LKBA 4L95C 1HUQA 4PX2A 3MLBA 1T5BA 1WDKA 2NWQA 4HQ6A 1MORA 3LECA 4KLCA 4MVXA 4YMUA 3M3PA 1GSHA 3QA3E 3G7NA 5EESA 2XNJA 2F1HA 3T1NA 2NPFA 4HNTA 1FDIA 3TOXA 2QTWB 3KHUA 4ZO6A 3IBFA 5F5XA 2VPTA 4IHKA 2BFDB 1U1FA 4O63O 2R8PA 5HQJA 3SQWA 3OWHA 1ISSA 2V54A 2ZSDA 4OLJA 4LHEA 5J2UA 4DANA 1VPVA 2AMYA 4H27A 3D8HA 4HQLA 4ZZ2A 3JWPA 1BHO1 1W35A 1YIAA 3C5CA 3JAKA 2HBZA 5DOVA 2F90A 3FOAA 1IN4A 2IEZA 3SC3A 4UHDA 4F8YA 5JCOC 3E3LA 1BDHA 4HWGA 2G63A 5DNVA 3DS8A 4INPA 1YUBA 3GG9A 5KQPA 2XMBA 4L8WB 1H05A 4K46A 4MQLA 2HRQA 2DU8A 3GUCA 5KTMA 2WUWE 3MGGA 1EVZA 1ZIOA 5FL7D 4ZVMA 2O8VA 3ER9A 5IKXA 4MNTA 1MPTA 1Z5ZA 2AQIA 1JLRA 3BH7A 2O5EA 4OQXA 2VHTA 3IRVA 4IIJF 1PNTA 5AP9A 4Q1BA 4FMDB 4I46A 5DU2A 5ENZA 1L5OA 3IHTA 1ZJJA 4F3CA 4OHYA 4NABA 5EMHA 5FCDA 3DEHA 4RSHA 4XDZA 4MQ4A 4YROA 1QX3A 1NXOA 3HNPA 1AUQA 3AGQA 1TEXA 1JQ3A 3M4YA 1QH1A 3BKXA 1Q92A 1RYHA 4H6XA 4UM9B 1M7HA 1E9DA 4IWYA 5COAA 2OVFA 1VTKA 3G2JA 4G41A 1PDWA 1RAEA 1HM5A 2I62A 4TQ9A 4TS1A 2VUUA 5DSTA 3DE1X 5ITZA 2H0RA 1FFWA 2VT6A 3ZS8A 1XHFA 2CXOA 3J81k 1W581 2AI1A 2J9XB 4LN1A 1DTWA 2QZZA 2V59A 4MCJA 4AS2A 2C5SA 2BFDA 4WK2B 3AUTA 1XC7A 2ZATA 4M76B 1V16B 5KYTA 3T3GA 3HXOA 3OUTA 5JPIA 3DWFA 4E6EA 2E4WA 2OV1A 4UUMA 3QPCA 1L4MA 3B6JA 3QLJA 1D4AA 5ULLA 1Z06A 4QREA 4EL5A 2XNDA 3LKVA 2VLIA 1JLMA 2NUPB 2XUOA 4IF6A 1F7UA 3NVDA 4XSHA 3RROA 2EQ5A 1CY8A 2C98A 2ZAYA 4JGIA 3H7IA 3TIIA 4TLCA 1ZVQA 2AUTA 3JQRA 2KLHA 3GMSA 2WVHA 2NZJA 4NE9A 1JKIA 5I8ZA 4JBYA 5DHRA 1RWPA 4PLTA 6PFKA 3GIWA 3KC2A 1QZZA 3PGVA 1GG8A 4B5KA 4ZI2A 2V1UA 2G9VA 3HWSA 2A5YB 5M34A 3RYCA 4MLCA 2OV6A 4AC9A 1U8TA 1W0JD 1MH9A 3LWDA 1DEAA 3D6MA 4HLCA 1ZI9A 2W98A 2O8DB 2XUJA 2A86A 4I3GA 3R41A 5JMOA 2NUBA 5K3OA 4LF8B 1O6GA 1R6AA 2V0NA 2DH5A 2DLNA 1XWFA 2P4SA 3V4VB 3OTOB 1I6LA 4P4TA 4FWBA 2WBLC 1VMIA 5LVAA 2PKYX 3BJRA 5G4LA 1XT6A 3LRTA 2FPMA 2BEUA 1DFHA 1U2RA 2ZIFA 2ZIWB 4URVR 2UVQA 3SR3A 3AVWA 2BBTA 5SYAA 4GD3Q 4CQMD 3UPUA 4X0EA 3WLHA 2WHXA 4CQJA 4LOJA 1Z6GA 2J8ZA 1DP4A 1T6NA 4IXTA 4V0SA 2P69A 2P79A 3DF7A 3BJIC 3GUYA 1GKIA 1SUWA 4G26A 1M6HA 5U4QA 2ZJOA 3QXGA 3ZIAD 3OOYA 3C3WA 4GOXA 4R3NA 1ORIA 2C7RA 1WCYA 3K09C 3WMEA 3HCCA 4HLQB 1YOVA 5DJ5A 1GGJA 4E32A 1F3OA 3I2IA 1C3LA 1V16A 1NQWA 2HMUA 4KPUB 3TI9A 1NQVA 2H2WA 3HCRA 3W8EA 1UR5A 3KKOA 3R24A 5I7OA 1ZM9A 1Y6ZA 3F97A 2P75A 1E2FA 4YDHB 2MSNA 3I42A 4OM8A 2NUPA 2PH5A 5FWXA 2JLAA 1RBQA 3M82A 1NY5A 5DRTA 1YIDA 3RK1A 4G1VA 3G0DA 4U39A 4CV0A 2YHBA 2ZQZA 4W5TA 4JR1A 4Y9TA 3HJHA 3WNVA 4EY8A 4OTZA 4RZ3A 1UZLA 1KVSA 1IATA 3LHKA 4JC4A 2ODAA 5T3UA 2WOJA 3WWOA 2EGUA 4E09A 4FFPA 5KJ6A 4M88A 3D54D 4MWTA 1F38A 1TCBA 3L93A 3M4JA 4JLUA 1C4KA 2O8DA 4ZZ3A 4KIWA 3VV2A 3S5UA 1E5VA 4ZDKA 4L3WA 2ZITA 1K4MA 1ZAYA 4HGYA 3ACBA 3BD8A 4OL9A 3IT0A 4URZR 2WF5A 3LY8A 4E21A 5LQRA 2ZYSA 3KEGA 5KTKA 3F5SA 3FVWA 3K30A 3IDQA 4GF5A 1QFMA 1V0JA 3KOYA 4LJLA 3HU3A 3PPXA 3LYUA 4OP2A 1XCBA 1FS5A 5A9RA 5E7JA 4X63A 4P4NA 1DOAA 4XD7A 2B0JA 5DNCA 2G4VA 3SVTA 5GV7A 2XZDA 2XIJA 1P2UA 4Q4HA 3R7WB 4QVKA 4EG1A 2R2GA 1KH3A 1MXFA 2FSHA 2NVOA 3C5EA 3OC6A 4CFSA 4MYCA 1HE4A 3FM9A 2XXBA 3HDTA 1S4QA 2MR6A 4KPUA 4UZFA 3REFA 4W9MC 4A1OA 5H5JA 2XXAB 1JHOA 3QKSA 1PW5A 5JYEA 4WFJA 2IGBA 4DZZA 3BMOB 3JD0A 3RSCA 1BMQA 4EA9A 1Z12A 4MRMB 2RMKA 1MO3A 1L8OA 1VLQA 3O5AA 3UWMA 3N6XA 4B34A 5BN1A 1IXRC 2J3IA 1KBQA 1NWCA 3MCZA 5EMLA 1DJOA 2Q62A 1DKQA 1I80A 3HBJA 3BH6A 3R3HA 4TMXA 4L7QA 1CDZA 3OM1A 2J6BA 5B2FA 3F0TA 4E7PA 1JG3A 4U2DA 1MO6A 2DKNA 3AVOA 1U2TA 2R00A 3OOWA 3T15A 3ZG6A 3CISA 3ENKA 1HF3A 3GH1A 2HRBA 2Q0QA 4URWR 4YWJA 4E2FA 4RYDA 1A8HA 2JGDB 4BNNA 3ED1A 2BSQA 1FQWA 3ZVLA 1LTQA 4J7UA 2CWWA 1MVNA 2XQGA 5IN5A 5T4BA 4RZUA 4NBRA 3X43A 4JOBA 1NW6A 4FFRA 2OXTA 4BFLA 1G4UR 2YWHA 3R5HA 4WLUA 2FPGA 3EEYA 2ZSUA 4P4LA 3ZWWA 1OV6A 2ASVA 2B8TA 2BY4A 3U3RA 2X42A 2QN9A 5ALYA 1ZKMA 3NNNA 3OFVA 1NIPA 4B7ZA 5C46F 4QHSA 4GR5A 1XNJA 1E79A 4DA9A 1T36B 4X6YA 1UK8A 3RD5A 4PIMA 1UMCB 4D9KA 3R7WA 2H48A 3KWJA 1W0KD 3FTCA 2LVBA 2AFIE 4KC0A 2IUFA 3N2LA 4RBNA 2IY7A 5FYDA 2NV6A 1W5AA 3DXFA 4MUAA 1ZH6A 4IR7A 2JJ1A 4O29A 4X93A 4E1VA 4WBNA 4QVIA 1R5BA 1FTGA 1RPJA 3H5TA 4V3BA 2N9UA 3MHTA 4KE7A 2XXAA 2IV7A 2V9ZA 4L0DA 4C0HA 4NE2A 3BMOA 5CFNA 1K8ZB 3L1UA 3X44A 5IARA 3IUYA 4FS8A 4F1JA 4ZEWA 3L7NA 4Y2SA 4DMHA 1VMEA 4ZYXA 4ZARA 4BZPA 4I5DA 2ZJYA 1AU9A 1JH8A 2OQ2A 4HEA1 5F1YA 5JWRA 3R8CA 1K8YB 2G8LA 4YRZA 2WRZA 1CJMA 1N3LA 3AKCA 1G9XA 2PL1A 1DQSA 2BZ0A 1I6KA 3LX5A 3NP9A 1V6AA 5ITSA 1F8GA 5F9FA 2JCBA 2BBOA 2JGDA 4G1UC 1T91A 1RLUA 4A0SA 2RD2A 2AK3A 1A50B 2AT1A 4JYMA 3OTGA 3GLFB 1RZ3A 1I1HA 4MUMA 4MV6A 3KPJA 4BZWA 1U28C 4NHOA 1RW4A 2IELA 1M66A 3B8EA 2J08A 5TB5A 1GSIA 3VNUA 5JECA 1QCZA 2G9RA 3DCNA 1U2ZA 1P81A 1ZSNA 4K9KA 3THXA 2WVJA 4IUCS 4XWTA 1UFRA 4BVJA 1BQ3A 1MX1A 5JO9A 3LG2A 4RGYA 1T36A 2F9LA 3UB2A 4ZOLA 1Q3TA 1K4YA 2WYIA 1Y1SA 1GV1A 3W4KA 5EJ2A 4AYWA 4BATA 2FEXA 2VRBA 2ZJAA 5AHWA 3Q12A 2JI7A 1ZRMA 1T5DX 1C0KA 2QLFA 4MQBA 2QM8A 4JUIA 4WNAB 3ZDZB 4OHUA 5BR7A 4LF4B 1TOAA 3D7LA 3EYAA 3HI6A 4YR7A 5T4EA 1U9YA 4DARA 3LUCA 2H17A 2GB4A 3COVA 1NJ6A 2WIJA 1JDNA 4CYMA 4EHAA 5TJ9A 4F6RA 5DYNA 3P5SA 1AZSC 5FPSA 3ZDRA 5EKDA 4MVJH 3TR0A 2PE5A 1V6SA 4Y1GA 4A6EA 4BHTA 4L8GA 4ZPJA 3UMVA 5CA0F 1OA1A 1KI9A 1OTYA 2EBUA 4H15A 4P81A 5LR6A 3ZJVA 2GCGA 4DY4A 3CX7A 2JA1A 3CWCA 1H8ED 4R1OA 3W9BA 2N42A 3HLKA 1K3FA 3ENNA 1GVHA 3KK0A 4X20A 5EUBA 1D4OA 4P38A 4B3BA 3LGSA 1Y3HA 2VPIA 5EJ9A 5MGNA 1Z13A 4I7EA 1ENYA 3RM3A 1WP4A 3ZQUA 1E3DA 1AF4A 4UTOA 2R1UA 4CM5A 2GLXA 5LN1A 4X6UA 4BZZA 5KYWB 2Q4RA 4E13A 3WGZA 1UIMA 3LCUA 3GLFA 3OPVA 1TZCA 2D4HA 3ZU3A 2FUCA 3BG5A 1Y8ZA 2GPBA 1OKKD 4ZI3A 1VE6A 1NGSA 1Z6TA 1WG8A 4XEUA 3ZD6A 3ZHUA 3JR7A 4JJAA 2IPXA 1GM5A 4K0KB 2H2DA 1YONA 3MERA 3EZFA 4XSGA 5BWMA 4EVQA 3B60A 4ALJA 5L4NA 4S1NA 1LLQA 1WW2A 4UZEA 1SURA 1AC5A 4JWTA 5TGTA 4F56A 4K3VA 1PZNA 4HDNB 3DTNA 5GADl 4MRNA 4YUXA 1BXZA 3COWA 1GGVA 2XDAA 3TSZA 3VISA 4JNKA 2YRXA 1QWOA 2HFKA 4HMPA 4L5CA 1K97A 2GTIA 4O6VA 1OE0A 3V6LA 4E1AA 4EEXA 1DIRA 3QVOA 3DOFA 3SS8A 4TGLA 4D0LB 1K7CA 2XCTB 4RV5A 4DJDC 4R8SA 2D8MA 2RGYA 1XN1A 4N5LA 1T2EA 4RV4A 1M8KA 2YINC 4C0WA 3OKCA 1YK0A 5SICE 1V3TA 3ZH2A 1S8NA 4XJSA 3U48A 4BQSA 1X7YA 2DPLA 4Q9NA 4WA8A 3SFZA 1NI4A 3ZCQA 2EDAA 2OEPA 1V1RB 1VC2A 1Y3FE 3JZDA 4N40A 1DQPA 3HI4A 3PKJA 1O77A 4PZDA 2ONJA 3VH2A 5JASA 3KQUA 3FSGD 3OPYI 2EFEB 2GAAA 3G0BA 4JB8A 3DM5A 4OHMA 5FB3A 5IAGA 4EB6B 2IF0A 4Z4FA 3WKEA 4XQ0A 5T6MA 4BTVA 2QRMA 4DW8A 4RJ2A 1UEJA 3LZDA 3VU9B 2AWOA 2QZ4A 5KYWA 1FYDA 3QXSA 5KO2A 3H8SA 3A3YA 2GF0A 4HN9A 3LO5A 4L9RA 3DMRA 2D1TA 1A9XA 1E8MA 2FK7A 3LQ2A 4ENTA 1NBMD 2YWGA 1HTWA 3C8ZA 4BE4A 1OIXA 3GDWA 1FSSA 3EBOA 2GXAA 2FFAA 1DJLA 1KI4A 1KE1A 4KN8A 1NOJA 3GUUA 3BN3A 4P32A 3DHYA 1D2RA 3KFXA 2HHJA 4QT4A 4ESOA 3EEOA 3DDWA 1JHPA 1FDSA 5EZ6B 2C1EA 2OZLA 3B1KA 3NWOA 3DONA 5LB4A 4EZEA 5BR4A 2V3VA 4IMPA 5FOVA 1IY0A 1PVOA 1KEUA 1ZGGA 4PYRA 1N5KA 4CLOB 1YB7A 2EJTA 4TMYA 4HQOA 5IXYA 1BE0A 4DV0B 2BH2A 1PVVA 1XZQA 4W6ZA 3RKUA 2PKQP 5CPBA 3KB1A 5JARA 1E6CA 3NUGA 3GRZA 1MT0A 3FYHA 1AS2A 2X1LA 2IOYA 4EHIA 5ANRB 1PQPA 3NC1C 4D92A 4O5OA 3G6KA 5L51A 1PT7A 3IPCA 3L8MA 4K9NA 2CV1A 3DOJA 1U3CA 2C88A 3ZE7A 1T2AA 4XIYA 1DELA 4YNBA 2X9GA 3EPKA 4C0LA 2OD2A 4Q4JB 3D3JA 3AEQA 3MT0A 1NVMB 3PD7A 5AW2A 5CCXA 2X3YA 1O89A 5AXBA 4IOKA 4ZGGA 1EYZA 1I14A 5FO1A 4F60A 1DFIA 4UBKA 1IWPB 4E03A 4D42A 1CP2A 2HQRA 5JS1A 3MOGA 2JH3A 3WX0A 2V96A 4P7FA 1F12A 3SEQA 1H6CA 2FLWA 4U7GA 5WRFA 5EKXA 1H93A 2IUYA 1VPWA 5CDHA 3QEJA 2E0IA 1SBHA 3BICA 4RZHA 3FZYA 3T9FA 3MJDA 4US1R 3BE8A 2XUKA 2Q5CA 2HK8A 3T9AA 1N0UA 2CLDX 3NBMA 4HZIA 4NH0A 1CKEA 3Q9UA 1M73E 4UHEA 1IULA 1X0XA 3NHAA 3P4YA 2Z83A 3QWBA 3UM9A 4OV6B 1AXEA 2PUBA 1TPYA 2VWPA 4N7RA 5EZYF 1H85A 1UBOS 3EF3A 4MPTA 3ETJA 1NNLA 1R8QA 4ARZB 2IZZA 5KDLA 1P0CA 2PM8A 4F93B 4NU8X 2YJ3A 4WOBA 3STHA 1X1SA 3GZNA 3EMBA 1HT0A 2HSGA 3CRNA 1H5UA 3HDJA 3NRCA 4Z99A 1QPZA 1CYEA 5H3LA 1C4OA 4ASUA 1E1YA 1LK0A 2VTVA 2XB8A 2P5SA 1P7ZA 3EXAA 3HVKA 3NXSA 5B3AA 2ACVA 3IHWA 4MVJG 2MTBA 3WL5A 3U0VA 2QTZA 3WWDA 1X8XA 5JY6A 3IKTA 3OZAA 4XDHA 4N41A 2V7BA 4N3CA 4RCZA 1VRVA 1Z34A 2Q5FA 4EUKA 1B1AA 2NUAA 3EFBA 2C9DA 1CQJA 3PKZA 3FWHA 3KKLA 1L7PA 1DQYA 1G1AA 1YASA 3B5EA 4ALMA 3IQFA 1T35A 2ZJ7A 2QPAA 1SG9A 1T43A 1CUFA 3AXTA 2GA9A 1NIJA 3BXXA 5KKNB 1ZX1A 1P4SA 2G9ZA 3D5QA 3V8EA 1MGPA 2IF2A 1V4NA 1SOVA 3CH4B 3WRXC 4C3UA 4EBFA 4ENQA 5BWCA 3IQEA 1CUCA 2PA3A 3CEJA 4NCNA 5CLGA 4JXZA 2Q07A 2HRRA 4DGSA 5FLXA 1QHSA 1Z0KA 4MWBA 4HXYA 4UMVA 4R71A 2J3MA 4X8HA 3FPJA 2I4LA 3I53A 3MCTA 3OQIA 4FDLA 2ODPA 2GFQA 4R0VA 4YCLA 5JQGF 5M3BA 3QNUA 5AK4A 1Z7BA 2J9RA 3COPA 3OMLA 3E1KA 5IPFA 4PC3A 3K0EA 3KT0A 2CFCA 2LNDA 3PRKE 5G02A 5DP2A 3HADA 3N86A 1YS4A 3U3KA 4ARZA 1Q0ZA 2GFIA 1N5IA 1HSOA 1UBJS 3A3PA 3EFOB 3EVGA 4IOLA 3FGZA 4E5VA 2YMQA 1X80B 3WG9A 5CGQB 3GN2A 5G53C 1E32A 1EA5A 5P8WA 2C5AA 1SXHA 2VDUE 4M0EA 4GI1A 4UD2A 5AHOA 4BUJA 1D4ZA 3LYAA 2EXXA 4I55F 3QOFA 3RU3A 3GGSA 3K72B 5JAHA 2OPHA 4YXFA 4QDTA 4IDOA 1N7HA 4PNZA 1VLLA 2KW5A 3GELA 1L1EA 4OK3A 4GHWA 3BSFA 1YSCA 2P6OA 3TJMA 4M37A 3T34A 4CTOA 5CVEA 5K0ZA 1DJNA 4OOEA 4K9QA 1K7SN 1QQ5A 3VR3A 5BT8A 3CF4A 5GQSA 3PYMA 1NP3A 4G1CA 4Q9IA 2J0SA 4D4GA 3MQFA 1A82A 3PWTA 2F6RA 5B3JA 1DT3A 1ZJWA 1ZD3A 2H63A 3AVQA 1DWPA 1FNMA 3A1UA 1N2BA 3AH8A 5EHIA 3TK1A 3W05A 3ZWMA 1CFJA 3MVEA 4B8WA 1BH6A 4X1OA 4EHHA 2EJUA 4LJ9A 3T1HB 5KKAA 3DBLB 1CZRA 5L9AA 1D8AA 2P40A 2X19A 2JIPA 2XD9A 3D4NA 1JXQA 4OYHA 3T0GA 1EDEA 3AJ8A 3AI2A 3HBMA 3PGJA 4G5SA 2CMFA 3IEMA 2J48A 1A8PA 3NC4A 3EGXB 2JW5A 1NF8A 2C77A 3U26A 3THYB 1YRHA 1GD1O 4LDQA 3ZNPA 3QMWA 3MCAA 3KFVA 3MIIA 3KT6A 4E2WA 4BLRA 1JXMA 5F1KA 2A84A 2C2MA 3GT0A 3H17A 1X94A 1NXXA 2JI6A 6NULA 1GPH1 3KXLA 5IK2A 3R0IA 4B2YA 1E3JA 3JQGA 2IZ5A 2Q4TA 1GNSA 2WYVA 4FE3A 1P8JA 4IVNA 1GPJA 3NBYC 3AEKB 4YP0A 3CRVA 3EFOA 3HCDA 3JPYA 3D3WA 3NONA 4PXYA 3U13A 3WRVA 1X80A 3E1GA 4FJ2A 5L6LB 2JJ8A 3LIIA 4YMLA 1II8B 4MO9A 4A2QA 4H60A 1E6MA 5DLYA 2RGRA 3AEZA 3FX2A 2IGTA 1D6NA 3L3BA 3ZWVA 1O6CA 2X15A 2CSUA 5IKPA 1HR0B 3DYVA 1RWWA 1FNNA 1LQ2A 1QHXA 1Y8CA 3BJMA 4Z3DA 4HC4A 2Z5LA 3HH8A 3BHIA 3EYWA 4DN6A 1SCBA 4BEJA 5SZIA 1FP4A 4X44A 4D9HA 5IEJA 1E63A 1UBEA 1ZEMA 3B2NA 3O8LA 4QU0A 4RIHA 4F3NA 4MGYR 1BA3A 5LOVF 2AOUA 1YF3A 5FNVF 4TV8B 4OP3A 4JAVC 3K16A 4KQ2A 3L9XA 1FTNA 2RHLA 3EIEA 4JJKA 3HCOA 2PRZA 2WJPA 1BCSB 1NBAA 4P33A 4X8LA 5DVZA 5FIUA 4D9BA 1SUFA 4IIDA 4YLEA 4KWEA 4FEEA 3H9QA 4ZOBA 2C4UA 1OHHD 3N0TA 3TAXA 2EG5A 3WWYA 2AI2A 3INTA 5BV8A 4MB0A 3PQ2A 5CFOA 5F4ZA 1C81A 4LXHA 3WBKA 1GG5A 2AEFA 1FNBA 1XU7A 2J6CA 3EGXA 4OGFA 1ZCZA 1MOSA 3QF4B 4MS4A 3OE7A 4WDQA 3THYA 1E1CB 2BE9A 2OHIA 5IHPA 1P3Y1 1DE0A 3IP5A 2I1LA 3ONVA 1B73A 5LU9A 3AF4A 5AKJA 3UJ3X 1A5SB 3LDGA 4A5OA 1P4GA 2W2PA 3DPUA 2Y1DA 1Z33A 2XRFA 3ROKA 5L3SA 1Q0RA 2OWEA 3A0RB 3A6HA 5GJVC 3CVJA 4BU0A 5BORA 3IBCA 3IQWA 1P77A 3I5UA 3HRKA 4TT8A 4EO4A 3FUVA 4DLZA 2G1AA 3NIWA 2VBGA 3I76A 4H59A 1II8A 4QC2A 4B1FA 1TAUA 1N5OX 2H3EA 4HH1A 2FDRA 4E7OA 1OF1A 2VK2A 1DO2A 3W8DA 1RXVA 2X0JA 3IR7A 1YV9A 1GGEA 4CM9A 1EP2B 1P0MA 1V1MB 4QO7A 1ZSYA 4HQ0A 4KDRA 2ZUDA 3SKVA 1IJEA 4TLAA 1JVSA 1TRHA 2VVTA 3VJMA 3R0VA 3IDOA 1P7CA 4RK6A 4ZT3A 1AQ6A 2PUTA 3U4AA 1IN5A 1WOMA 2Y1WA 3OPXA 3AWDA 4KZPA 3GCGA 4WE3A 4EATA 1EM8B 3RS7A 3ZTWA 1BCSA 3GVXA 121PA 4P31A 3L77A 4C1NA 5B7PA 1PEYA 1QPGA 2QTMA 1T0BA 1RLOA 3FGOA 4BY9E 3F8SA 1Z5PA 2VPZA 4B45A 3THOA 1GUZA 3DZHA 3AOEA 1KH2A 3JW8A 3S1AA 2B9VA 5BP7A 2IOFA 2R84A 2QD2A 1PK9A 1U3UA 2W2MA 4LJYA 3I45A 2IW3A 3SEZA 2AUNA 4LOAA 3QF4A 4PFSA 1VCMA 2ST1A 1OU4A 3EIWA 4QTUB 1E1CA 2AN5A 1YWGO 1P1IA 1O2DA 2GXUA 5IF9A 1QHIA 3IKLA 4ARBA 3J7AC 1J0EA 4I9GA 1F51E 3NBFA 4IAOA 1RJEA 1IE3A 1BWPA 4G0QA 1CD5A 1U1GA 2FUNB 1IVNA 4RDCA 3QNWA 1C9MA 1RAAA 4EDHA 4FU0A 4O1IA 2J3JA 4IH4A 3STYA 3OOHA 2EKDA 4MGHA 2XDQA 4U9UA 4R83A 3FTQA 1Z6AA 3MRTA 3CV3A 4ZHQB 2HJ9A 1CVIA 2VIIA 3P9PA 1Z88A 1BVUA 2X8AA 5EIWA 1FPQA 2NNLD 1FSGA 4X5OA 1BU8A 3GW8A 1J8YF 4N3AA 5AK3A 2GUGA 3AVTA 1Q0UA 4RKRA 2DPMA 3GA0A 1V1MA 2F8LA 2IYVA 3H2IA 5E2IA 5K0SA 2MSLA 1N7JA 1JDUA 1JHXA 3I2FA 3SJZA 3DLAA 4DWJA 4ZQBA 5ALLA 4ZJUA 1J06A 5AW9A 4ILKA 3V7NA 1TM4E 4FDTA 2VQ3A 3GEEA 3RQSA 3BWYA 3LY7A 4L5JA 4A27A 4ID3A 1XVVA 3GGJA 2WM2A 3E2PA 3PJDA 3QY9A 5L7YA 1AV6A 3OHSX 4NPCA 4JP5A 1XXHE 4JQYA 2Z2KA 4CQLB 1MQ8B 2BLNA 3PVCA 3EXHB 1GTSA 3W34A 2OR3A 2RK4A 3A6FA 4PPYA 1SU4A 6AT1A 1P3DA 1PF7E 4ERXA 4AQYB 2OCDA 4XM1A 4HWPA 5H59A 1OH8A 1P31A 3EDCA 1L4LA 2F8TA 3BILA 4CI0B 5F2NA 1SXJC 1N2CE 2PANA 1GTJ1 1YHYA 4IICA 1IEWA 2X14A 4KQFA 2RKWA 2KHZA 4RD4A 4TL6A 5B53A 4Q4DA 4GG1A 3HLYA 4GEGA 5B6JA 4EZBA 4GPIB 4ZVSA 5ALQA 1RKQA 1KDZA 4PQEA 3ZNQA 3HE3A 5DM60 3V7UA 4R8KA 4QTYA 1QPBA 3RF6A 4NLLA 3PNSA 5BMVF 4K9PA 1HDZA 3W8NA 4OQYA 4ZHQA 2PD6A 3FOCA 3VJRA 1HLFA 1E9CA 3TTXA 2WHYA 1CQXA 1RWKA 2NSLA 3AFNA 1QOQB 5CFQA 1NP7A 2JGMA 3H2SA 1QP8A 3ZWYA 1NBME 3R6TA 2F1KA 1OBFO 2QENA 4LGCA 3BAFA 4NZNA 5JDIA 3FYSA 2BTEA 4Q1CA 5LA6F 3T9BA 3TLGA 4LSMA 1IOWA 4EG8A 2WKQA 3O94A 1SKMA 4FHCA 1KEVA 5EGSA 4TVBA 3C6ZA 3IUMA 3H2YA 3UWPA 2QX8A 4AO6A 4NZOA 5LKAA 2IKQA 3M6MD 5M5BA 4LSGA 3QK7A 1EWRA 2SNIE 3G1UA 1CETA 4LGMA 5DFAA 1HC7A 5GJWC 3HMQA 3UA3A 4BC0A 4FWTA 4CCYA 1R3UA 4CQLA 4JX9A 1JJ7A 2RH8A 4FN4A 3EXHA 2GCEA 4J0JA 3RTGA 5H3HA 2C9BA 5BWBA 2G5TA 3KOWA 2Y4OA 4I3HA 3B7PA 2V3WA 4TQAA 1I6WA 1YJAA 1ISFA 2YJTD 3A2LA 1HNWB 1V26A 3D8SA 3NVKI 1V43A 4RHYA 4DA4A 2OVBA 1XALA 4B8ZA 2R7KA 3ZBPA 1J5XA 2WJ4A 4FE4A 2PD3A 1GAXA 4CR7A 4FQ7A 4D5EA 4KO3S 4LSWA 3V9AA 2CLIB 3EAFA 3I8OA 4D4LA 2EFCB 2RAPA 4RS3A 3UT6A 3VSBA 3DW1X 1JI3A 1P5RA 3OZTA 2NT4A 3GPBA 1WQ4A 1WXFA 5EHZA 4DLWA 3ROXA 3HABA 4XVCA 1WMSA 2XW6A 5AVJA 1OIVA 3UJHA 3W6ZA 4NQZA 4TSFD 3WFJA 4C7VA 5ALGA 3KSBC 5EWLB 2ZU6A 1R37A 5CK5A 4EITA 5A9SA 4FIZA 2VQFB 2JHAA 1Q5PA 2FZVA 4L4RA 4YJ2B 2FP4B 2FW0A 5A5VA 1KDRA 2ZYRA 3HO6A 3H1GA 1NWHA 1Q6YA 3K6RA 3KLPX 4IIYA 1XQWA 4WY5A 1TK2A 3T7AA 2CVQA 3VDXA 1RRFA 5KTRA 1E9VA 1Y6RA 3ZBQA 2QKYA 4JZKA 3JQCA 1XZPA 2ZBGA