5IDWA

Crystal structure of an oxidoreductase from burkholderia vietnamiensis in complex with nadp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
225
structure length
225
Chain Sequence
b'MKTVLIVGASRGLGREFVRQYRRDGWNVIATARDDASLAALRAAGAHAHALDIAQPEQIAALGWKLDGERLDAAVLVSGVYGPRTEGVETIGNEDFDAVMHTNVRGPMQLLPIVLPLVEDARGVLAVVSSRMGSIADATGTTGWLYRASKAALNDVLRIASLQTRHAACISLHPGWVRTDMGGAEAAIDPETSVTGMRRVIAEAGADVSRANGRFLQYDGVELSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Crystal structure of an oxidoreductase from Burkholderia vietnamiensis in complex with NADP
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Oxidoreductase
total genus 87
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5idwA00
4GKBA 4M49A 1GPJA 2HRZA 1MFZA 4EYEA 1U8FO 3W4JA 3PQDA 3X2EA 2W2KB 4B79A 5I7FA 1G1AA 1C1DA 4FGWA 4NBWA 3TL2A 1QYWA 2X9VA 3AUAA 3RBVA 4B4WA 4YBZA 1GYPA 5IN4A 1EUZA 3I4CA 1UUFA 1H6CA 1J5PA 1NASA 3D1LA 4HFRA 3QWHA 2EKQA 2X9GA 4QUKA 4O1MA 3QWBA 5DCYA 1R4NB 4EUHA 2GZ3A 3UUWA 4GX5A 3LT1A 4BGIA 4EITA 2RBEA 1T24A 3GOHA 3GAZA 2P91A 2I5PO 4XQEA 4I5FA 4BKUA 3M1LA 2X4GA 4IDDA 5CG2A 5B12A 4YQZA 1MXFA 4N54A 1ENZA 3PQFA 2AEJA 3ZU5A 4YT2A 1ULUA 4BUCA 1IL0A 4WKGA 3JQFA 1P0CA 3OIDA 3WQQA 1DIRA 3C3XA 4DLBA 1QYXA 2HJRA 4XEHA 5I9NA 3DBHA 5JE8A 3RVDA 4M8SA 4II2A 3KSDO 4Q3BA 5AXCA 3V1UA 5IFLA 3JQFC 5CEEA 3WSWA 4M87A 1N2SA 5JMWA 4J1SA 1LTHR 1GEEA 3WDSA 4UUNA 2X86A 4JXKA 4B3HA 4G81A 2ZYDA 3LYLA 2O3TA 3HB5X 3U4CA 3DWFA 2HMSA 1EQUA 1I10A 5J23A 2ZATA 2YHUA 3G1UA 4WLUA 1ONOA 1FXSA 1DHRA 2W2LA 2VN8A 3R1IA 1B8VA 3EHEA 3KSUA 4CM1A 4KTVE 1WW8A 2P9CA 2O4CA 3V8BA 3VH3A 4BB5A 3V2GA 4BL5A 3PWSA 4L73A 2XPCA 3JQGA 4H3VA 1XU9A 3CKYA 2JAPA 3DONA 4JGBA 2RCYA 3PGJA 3VZSA 3K96A 3S1LA 4M54A 1KC1A 4CR7A 1HLDA 2ZK7A 2VYNA 2PV7A 2O4UX 4FW8A 3UICA 4GI2A 4GGOA 5KJEA 1RM5A 1N9GB 3NGXA 5L4LA 3IKTA 1V8BA 3JD1A 3C24A 4EI2A 1KEPA 1WNTA 1NFQA 3FTNA 3PJFA 3AUSA 2NU8A 1ZJYA 4IXTA 3T4XA 2CNBA 5JYDA 4FFMA 1O8CA 1ADGA 1XLTA 4HFMA 4ZRMA 1BW9A 4URFA 5A04A 3GHYA 1YDWA 2EJVA 1LLQA 4I9UA 4Y6SA 4FSHA 3VZRA 1TB4A 2NNLD 3KSZO 1ZEJA 2G0TA 1HZJA 4IJUA 4U7WA 2NWQA 1YVEI 2FWMX 4R5HA 1W0CA 1YOVB 1ZK3A 5JCJD 1PGPA 4CQMA 3R3SA 5T5QA 3FNFA 3GPDG 1ONNA 2P4HX 2ZQZA 1B14A 2GLXA 4FFOA 5DN9A 2X58A 4BIIA 3F1KA 1DHTA 4IDBA 2POQX 4NR0A 4NDNE 2DFDA 2DC1A 1DEHA 1ULSA 3N7UA 5DP1A 4YAKA 2BH9A 1P9LA 3TSCA 4Z9YA 4CLHA 5T6BA 1ADFA 5TC4A 4RQTA 1CJCA 3ENNA 4Q3DA 2PZKA 3TL3A 4P22A 1DJNA 3NJ8A 5G4KB 3E82A 4CMAA 3NJ4A 1U8XX 1T1SA 2W8ZA 4R3NA 2HJSA 3E5RA 1PJ3A 3WYEA 3MTJA 5K0ZA 1IYZA 3QRWA 3RUHA 1R4MB 4BV8A 1BVRA 4Q9NA 1QSGA 1E1KA 3HWRA 3IMFA 3DAFA 4XD2A 1LI4A 1D3AA 1UXIA 4GWKA 3V1YA 1EFLA 5FI3A 2CUKA 3RJ9A 3IKVA 1NP3A 3AI3A 4NPCA 5A3VA 1U28A 4O6VA 1BGVA 1ML3A 4BGEA 3KYCB 4MP6A 4E33A 4U0KA 4L0QA 1ISGA 2VUTA 3GR6A 4DTIA 5JYEA 3AM3A 3E6AA 2V6FA 1PS8A 1W8DA 4J16A 4A2CA 3DEYX 3AI1A 4BNZA 3VH2A 3OHSX 2X5OA 1B8UA 1R66A 3ASVA 1ZXLA 5ICSA 2D5CA 2FSSA 1Q0LA 3D0OA 4RF3A 4XRGA 2HMVA 5ILOA 1BVUA 5K6AA 1V0JA 4MVJE 4FJ2A 5TGDA 4DPLA 3WGGA 3O38A 5HM8A 2CMDA 1CWUA 5L53A 3DAGA 1IB6A 3A14A 2O3QA 3FNEA 5K6AC 4ALNA 4AJKA 4WASA 3FRJA 4XCVA 2PWZA 2ZTVA 3CSDA 2EP7A 1NAIA 4IUYA 1H93A 4LMPA 1ZJZA 2HO5A 1HDGO 3OIGA 3G1TA 4B7CA 1EVJA 3NTOA 1AE1A 2PKQP 1Y6JA 2LDXA 3IIEA 2QIOA 1B0AA 1I8TA 1Z45A 4GKVA 5F5NA 1DIGA 3GPIA 4A10A 4Q39A 1NQTA 3H2SA 4M86A 4X54A 3KEOA 3ONEA 3HFGA 4Y98A 3D3WA 3UW3A 4GVXA 1UJMA 3GEGA 1EVYA 1HDZA 2B5WA 4IY1A 3VPHA 1XQ1A 2GN8A 1U5AA 1HTBA 3VKUA 2AE2A 5A1TA 1BXZA 1UXJA 3PXXA 4YEDA 1GYRA 3GQVA 2DBVO 3H5AA 5L9AA 2VT2A 2D3TA 2VYVD 4MDHA 4WK6A 4BNVA 3H9QA 1GL3A 4WNCA 3HG7A 3AOEA 4ZQBA 4RPLA 5COQA 3DFUA 4ND5A 4R1SA 2IODA 3QWFA 5BNIA 4CLXA 1Z74A 2QQ5A 4CLOB 3F6YA 3AOEC 4R3WA 1BMDA 2B4RO 2VRCA 3OP4A 3V2HA 5L4SA 1H2BA 2OORA 2P4QA 9LDTA 2HMTA 3KB6A 2PR2A 4RO0A 4A7PA 3QIVA 4NI5A 1K3TA 3DZJA 2NQ8A 5EINA 4NBTA 1VKNA 4P8RA 1PJ4A 2EXXA 1F17A 1U2GA 4YJFA 1OBFO 2X0IA 4A03A 1E7YA 1RM4A 1SMKA 3HNPA 1Z82A 2HU2A 3H5NA 4EGFA 3UCEA 1AXGA 4F6CA 4QEDA 4XGKA 3ROKA 4E5YA 3PIDA 1I0ZA 2WWRA 1E7RA 2UV8A 4LCJA 2VHZA 4PLTA 2WD8A 4LVUA 1GV1A 3H7AA 3O8QB 1BXGA 3I83A 3G49A 2WE7A 1OFGA 2OBYA 1O95A 2IZ0A 2X0JA 5JAMA 4FN4A 4FFNA 5U9CA 3ETEA 2WD7B 2X5JO 4Y6RA 2PH5A 3I5MA 5KTKA 5KVVA 5EQFA 1LQUA 3KYDB 4E2ZA 2DLDA 1U3VA 1NR7A 1P1JA 3GZ4A 3EK2A 4NNJA 1JWAB 2HDHA 5JAZA 4GX1A 4PLHA 4OHUA 1Z73A 4FC7A 2DBZA 2I9PA 3HHPA 4CPDA 1VC2A 4DYVA 3QVXA 2CD9A 1CETA 4R1TA 5IJZA 2P9GA 4NMHA 1G6KA 4BNGA 1Q7BA 1YJQA 2DU8A 1TA4A 2YY7A 4U6QA 5KVCA 3HSKA 4O0LA 3WJ7A 2C7GA 4KWIA 1E92A 3OFSA 4RVDA 4W82A 4AJJA 1FDTA 5GZ6A 4WCFA 5JC8A 3U3XA 1JVBA 3GGPA 1DC3A 1QORA 1ZFNA 4U0JA 2BI7A 2O3RA 2XAAA 1RWBA 1C0LA 3PZBA 2C82A 4QTZA 3ZWNA 1YWGO 4WCFC 4R01A 1T2EA 4ZQGA 3WICA 1E77A 2AW5A 2BKAA 2X0RA 3OJLA 3E8XA 3EVNA 3L4SO 1NYTA 4PLWA 5MDHA 3EGOA 3U62A 4ZICA 2RIRA 3IS3A 2Q1SA 3NYWA 4D79A 4W7HA 4WCDA 4Z9XA 5CG1A 1DSSG 1A4IA 1HETA 4M55A 4NU5A 3EW7A 3JYLA 5IZCA 4S1VA 2QRJA 5AOVA 3TZKA 5T8KC 4RVUA 2IZ1A 4KDEA 1QXSA 2AEMA 4RDHA 4YCAA 4C7KA 3IL2A 1C1XB 4CM8A 5IZCC 3LQFA 4RF5A 3LT0A 3C85A 3WBFA 2JHFA 4RF2A 2HRBA 5ENVA 4IZHA 1DDOA 4IZIA 4B7XA 4OXYA 1P1HA 2OMEA 3ABIA 4YAJA 3ZWBA 4DPKA 4IBOA 3FD8A 1F8GA 2NM0A 3ADOA 2I3GA 2GD1O 3D3EA 3KEQA 2PH3A 3V2UA 1KERA 1OC2A 5DZSA 3ZWMA 1YB5A 3E9QA 4FR5A 5BR7A 3ONFA 4ZGWA 1WZIA 4GPD1 1CRWG 2GASA 2WTBA 1U3WA 3TZCA 3UHAA 4PZEA 2J6IA 2BLLA 2FSVA 4MVJI 3T7EA 1UH5A 1H2HA 3WGTA 3IQDB 4E6PA 4XB2A 3SLGA 3NDRA 1NPYA 2Y1GA 4J43A 4ZQFA 4BNTA 5JY6A 2EERA 1X0XA 4BGUA 1B3RA 3Q3CA 4BQRA 2PKRA 3SC6A 3CE6A 3JYPA 4E0BA 1NNUA 3I3OA 5BNFA 1GY8A 1V3UA 2CSUA 3H2ZA 1H94A 3UF0A 1PSDA 4IGFA 1U4SA 3ZDFA 1EEHA 4JQCA 3ZV4A 2NTJA 2G1UA 1A7KA 3ZV5A 2WM3A 1VRWA 3ASUA 4Q3AA 4AG3A 3PFFA 3RFXA 4GH5A 5ITVA 1OOEA 4JROA 1DFHA 3RKRA 3QSGA 1E3JA 4WPGA 2ZTLA 1LSJA 3MJEA 2EWMA 3FPLA 1U4OA 6LDHA 5KCZA 2Y66A 4G65A 4NG5A 3RUCA 2J8ZA 1U9JA 1FJHA 1UDCA 3BMQB 3SXPA 3WLFA 1HF3A 3ZV6A 2P68A 5T64A 3OQ1A 5COAA 3K2EA 5HS6A 4R9SA 3JQBC 1YKFA 1VI2A 1YS4A 4XGIA 4NQZA 4IIVA 1DLIA 1GDHA 1GFSA 2EEZA 4TQGA 3C7DB 3EDMA 5CFZA 2DVMA 5CP8A 4EW6A 5CDSA 1HE3A 1DC6A 2VZ8A 1EUDA 1O94A 4IDFA 4JX8A 4MPDA 4S3MA 1A9YA 1O0SA 2CY0A 1QKIA 4YJGB 1CERA 1V6AA 4ID9A 1AHHA 1LRLA 2LDBA 4XQGA 1A72A 5JW6A 3WSVA 1DFGA 1DFIA 3UFXA 4IDEA 3ZU2A 4IS3A 1EMDA 3S55A 1GAEO 4TKLA 3KZVA 1Y5RA 3DMYA 5I9LA 1FDSA 5L4NA 1NQAO 2C59A 5BNTA 2WEKA 1LLUA 5GY7A 1LDEA 1E3EA 2V6GA 3JQ6A 2NV6A 1R12A 1LSOA 4YAEA 2F00A 2VCYA 2PGDA 4OXKA 2Q46A 4HFJA 3WWYA 5A9TA 2O23A 3HN2A 3H9EO 1TVEA 2HCTA 3VPXA 3ZWOA 1SZJG 4Q3CA 4HV4A 1Z6ZA 5ENDA 4FQ8A 1KEVA 4PRKA 4ZRNA 2OL4A 1P3DA 2JL1A 5THQA 5G0VA 4RPKA 5TF4A 2ZB4A 1KVSA 2CZCA 4J9VA 3UKOA 3WXBA 3ZCXA 1PQWA 3GN1A 4XYBA 2D59A 4BNIA 4PG8A 2OBNA 1GZ6A 4DBZA 1EFKA 1GQ2A 3FNHA 1Y81A 4D3DA 3L77A 1L7EA 3AFNA 1C1XA 5GZ1A 1T1RA 3K5PA 3LU1A 1ENYA 3E9MA 3I23A 5EPOA 1X15A 1T4BA 1SOWA 1QP8A 3I1JA 4E31A 4WE3A 3EMKA 2NTNA 5GMOA 3ZWPA 5BSFA 3RC2A 5CDYA 4BHTA 5MGBA 1R0LA 2VHXA 4YQYA 3DBVO 3W6ZA 2FPPA 1PQUA 3ZW8A 4QFCA 1B7GO 2SCUA 3GG2A 4XQCA 1NWCA 3DMTA 1NBOA 1VJ0A 3FWNA 3ITDA 5L40A 5A9SB 4DQUA 2G82A 1IUKA 5FEUA 4A26A 4DUPA 4CL8A 4BV9A 4PLCA 1CYDA 3AUTA 1ISIA 1GUYA 1YL6A 1N1GA 5TT0A 3DMTC 3TOXA 1GR0A 2DFVA 3JQ7A 4U8GA 4QO7A 2O2SA 1XHLA 2YW9A 1SEPA 2VHVA 3FR8A 4WOJA 4KMSA 3DBLB 4DQVA 2ZJ0A 1SC6A 3QA9A 4J49A 4CUZA 4BO8A 3ANNA 2O7SA 2I67A 3DFZA 1DIAA 4XA8A 3JV7A 4DLLA 3K31A 1KIFA 3F5QA 3LT2A 4CM9A 2HLPA 4XIJA 4JCOA 1K2WA 4J2OA 4CM4B 1UAYA 4XR4A 5TS3A 4HP8A 2X8LA 4M89A 3EY4A 1EK5A 2GO1A 1SB8A 2FY8A 3KUXA 4LGVA 2EHDA 2X9NA 4IIUA 1F0YA 5F5LA 3BMCA 5U4QA 3IJPA 3IAHA 1ZK0A 3BHMA 3JYQA 4IPTA 5HTOA 1JAXA 2TMDA 5CDTA 1Y9AA 1HKUA 1VLLA 3WNQA 4TRJA 3GLQA 3AM4A 4CM9D 4XX0A 1H5QA 4MO2A 3M6IA 1W6UA 3VDQA 1H9AA 1HSOA 2DTXA 5I8ZA 2XOXA 3STHA 4D45A 4INAA 5CPBA 2AE1A 3GVPA 3HQ4O 4CQLB 1WXDA 4IGEA 2DTDA 1HE4A 3GFBA 3SX2A 1W73A 3B70A 4RF4A 5LDGA 4DIOA 2JFFA 1QR6A 3CH6A 3S8MA 3ZV3A 2Y93A 4PZCA 4ALLA 3ANLA 1PJ2A 4RPGA 3ZNPA 2JD2A 2NVBA 5L45A 1G0OA 1HL3A 3PHIA 3ZWAA 4BKRA 1I2ZA 1KS9A 3W4KA 4WOKA 3WGZA 5B1YA 1JKJA 2D2IA 5IZ4A 3KO8A 3ZZNA 3CEAA 4L4XA 3JQ9A 3RUIA 3GUYA 4GMFA 4MVJP 4AJIA 1SO8A 2NVUB 3PIIA 3EYWA 2VWPA 1N7GA 5CDUA 3QWIA 1LRJA 4UEKA 3DR3A 3JQ9C 1Q0HA 4GSLA 1PZHA 4I8XA 1SNYA 4YB8A 2ZQYA 1XQ6A 3BMOA 4NU6A 2OZPA 3O9ZA 4DYDA 2NACA 2Q4BA 5HA5A 5JO0A 4RVGA 2GDZA 3RC7A 4YAIA 4RVHA 2BGLA 3RUAA 2OO5A 1PGJA 2RAFA 5DBIA 2IE0A 2TMGA 3COSA 4YJHB 2DPHA 3DL2A 2BELA 1BSVA 1VPDA 3H4VA 5AYVA 1F12A 2QRLA 4YJDA 2R2GA 2EKPA 2IRWA 3DAPA 4I1IA 1N92A 5IAAA 2VNAA 3CMMA 2IDZA 1NVGA 4JBHA 1E7QA 3MJTA 3ICCA 5L7YA 1EDZA 5ER6A 3Q2IA 1ZIDA 3RKUA 3ZWCA 1T2CA 3AY7A 4ONEA 3NGLA 3ITKA 4OSPA 4UAGA 1D7OA 1U7HA 1X7HA 4HXYA 4CMIB 4BMVA 1I3LA 3DHYA 3L6OO 4ZVVA 2CDAA 4U5QA 5JCJA 1Y8RA 4HNHA 5JLAA 3A06A 4GLOA 1X1EA 1LDMA 3O4RA 4CM3A 4TRMA 2BGMA 3W1VA 4Q3NA 3VH1A 3H65A 4PLYA 2FOIA 2YHIB 3DXFA 4Z0PA 4ZD6A 5KWEA 3IP3A 1QYDA 1KVRA 3DTTA 1EZ4A 1NTOA 8LDHA 1D1TA 4AFNA 4DWVA 1WWKA 2YDXA 3DBLA 4HWKA 1WMBA 2ZYAA 3AJRA 3Q1LA 1TT5B 1CQJA 3JD3A 4JIGA 1NFFA 3NTRA 2NLOA 7MDHA 2HMWA 5KIAA 2ZCVA 1U3TA 4BNYA 2JKVA 3OA2A 4GX0A 1B3BA 4Y8VA 2JD1A 1HE2A 3H9UA 4E5PA 3IOYA 3L9WA 4PFJA 1EQ2A 2O3JA 4DXHA 1HSZA 5EQDA 3RAJA 5C37A 4GMGA 1VL0A 4XWYA 5I7EA 2A9FA 4OH1A 3T7CA 4KUHA 1DXYA 3ROPA 1SAYA 1PEDA 2W2KA 1VL8A 3OH8A 1HDOA 3LLVA 3IJRA 2C54A 4YT5A 3BXXA 3LF1A 1O89A 1UP4A 3DB2A 3GMSA 1ZCJA 1JKIA 1R0KA 2P2SA 1UDAA 3I6QA 4MVJA 3ADPA 3L9XA 4BNLA 1LDNA 2DT5A 4WUVA 4Z0TA 4XB1A 1ZK1A 3MOGA 3AOGA 4ALIA 3JYOA 4ZN6A 1R4NA 3H3FA 1B15A 4JK3A 4LCEA 3MJ4A 4CLRB 5B4VA 5HBRA 1DAPA 4FCCA 4KQXA 4E5MA 4TRNA 1NX6A 1U3UA 5JDIA 2HK9A 2AMFA 3GVXA 3PLNA 4PN3A 2XXJA 4IJVA 3GF4A 1UZNA 3ZH2A 1GADO 2H9IA 3RBXA 4D44A 2W98A 4MVJD 5EJ2A 4E13A 2I6TA 3LSYA 2FN7A 4IDCA 2X6TA 1LSUA 2QG4A 4LISA 2FRDA 5JDIC 1DLJA 3GNQA 2VTEA 4PGFA 3DQPA 1K5HA 3G17A 3TZ6A 1ISJA 3LVFO 4Y6PA 2E48A 3ZNNA 4AJOA 4CM7A 1YBAA 4J7XA 5LDHA 2QW8A 1XIVA 3WG9A 3DZFA 1Q7CA 2RH4A 4R51A 1JTVA 2OP0A 2J5QA 1E1NA 7ADHA 2DUUA 4J1TA 3VHRA 5C5IA 4CR8A 1AXEA 2BFPA 1PZEA 4GQAA 2FHSA 1YL5A 2PGLA 1HDXA 3DBRB 3GDFA 2C29D 3HB4X 1LA2A 2NVWA 2EKLA 3IUPA 4YRBA 2PK3A 1RM3A 3ZI0A 1IHXA 1IOLA 4MOWA 3FHLA 2Z5LA 3NAQA 2YV2A 4DC1A 4DRYA 3JQCA 2DAPA 4XYEA 1XDWA 4LN1A 4HKTA 1KEUA 4RV9A 3ST7A 3KTDA 4UEJA 2CDBA 1WDKA 4J2HA 4YJHA 3TZHA 3OETA 4OJNA 1U5CA 2PZJA 3GN2A 2VYVA 3K6JA 4BNUA 1C14A 2GF2A 3DO5A 3PHGA 2BFAA 1TEHA 4Q3EA 3TPCA 4OXNA 5A02A 5H82A 2WYVA 3GDGA 4AVYA 2AQIA 2NTVA 4N5NA 3EC7A 4IDAA 1UP7A 2PY6A 4JJGA 3BHJA 3JYNA 1OI7A 4I9HA 5KKCA 3EZYA 4DVJA 1N9GA 3WR5A 2J3IA 4YA6A 3B1JA 1SBYA 1ONPA 1PS0A 1BXKA 1MV8A 3LC2O 1ISMA 3F1LA 4PG5A 4Y9DA 5ICMA 4NJOA 4PIVA 4CUKA 5EMHA 3DTYA 4CMJA 3ZHZA 2HK8A 2J3JA 3UAGA 2DM6A 3DZKA 2Q2WA 3K30A 2GZ2A 4AJPA 3BYZA 3RSHA 4OQYA 2B69A 3ZWWA 1P44A 5IF3A 3GAFA 5F1OA 5K9ZA 3I9NA 3QJ5A 4JP2A 1I33A 2I99A 3H6KA 1NHWA 2AEFA 2NU9A 2OP1A 2PKQO 2Y0EA 3K9QO 3QE3A 4JN6B 2RH8A 2VOEA 1LDBA 2WE8A 1YOVA 1D8AA 2FZWA 4XRRA 1E0DA 1PGOA 2D1YA 4J9UE 1E6WA 5DF1A 1YL7A 4FGSA 3VAZA 4EEXA 1P33A 3N74A 3PI7A 3S2IA 2NQTA 3E03A 1JAYA 4QT0A 3D5TA 1C3VA 3F3SA 3I4FA 4QQRA 2G5CA 4NK5A 1QLJA 1HE5A 3OQBA 3E18A 3LK7A 3UCFA 2Y99A 4BO0A 1FDVA 3TNLA 4GL4A 5G4KA 2VZ0A 4I9NA 1KBZA 4PLZA 2GR9A 3HUDA 3TQHA 3W8FA 4J1NA 3JD4A 1MFPA 1Y1PA 3OECA 4BMSA 1QMGA 3X2FA 1I2BA 4OKNA 3TFQA 3DZGA 2DKNA 1R4MA 2JCYA 3AM5A 1MG0A 1GYQA 3SC4A 1L7DA 3NUGA 2JHGA 1Q2XA 4DPMA 1ZXBA 1ZNQO 3G79A 4NJMB 2VUSA 1R0SA 4BNFA 1MLDA 3MTGA 5TX7A 5TSDA 3RU7A 3U4HA 3NT2A 2YDYA 3JQ8B 3PTZA 3UGKA 3KYCA 3GDOA 3HADA 4LMRA 4E3ZA 2H63A 3ETGA 5FYDA 3L0DA 3U4IA 1Q0QA 4L9RA 1MGOA 1KYQA 4MKRA 1N1EA 4UUOA 5DULA 1A5ZA 3B20A 4B3JA 3ZWXA 3PHLA 1NFRA 4EBFA 4YR9A 3ENKA 1O9BA 5TQVA 4D46A 3UCXA 2DUWA 4FOOA 1SB9A 1DAOA 3D4NA 1I32A 4YVFA 2GYYA 3DZIA 4P4GA 4BB6A 2GSDA 5FFFA 3I52A 5JMPA 2BHLA 4XDYA 3WIEA 3WYCA 4YYZA 4YWJA 3GNSA 3Q11A 2Q49A 3QQPA 1W4ZA 3VKVA 4CMHA 1JKFA 1PGQA 3D4PA 3QVOA 4YAGA 2H5LA 4UVIA 4MVJM 1T2AA 2ET6A 4MKXA 4L76A 1B26A 4E4YA 5ITWA 1PR3A 1JDJA 3U4DA 4D0RA 4AJLA 2PGJA 5B4TA 1BTOA 1PS9A 3I6IA 4XYLA 4DA9A 4LRSB 3W6UA 3ONDA 4NFYA 1I3KA 1P1KA 3R3JA 3OMLA 1DRWA 2I76A 1E1MA 1VE9A 2X5KO 4QECA 3ZGYA 1LC0A 3VPGA 4B3IA 2AQ8A 1B2LA 1CIVA 4J0FA 2Y1DA 3FSRA 1A71A 1A4UA 4CMGA 5EIOA 1UP6A 2FR8A 1P74A 1IPFA 1PQPA 4LVCA 2CFCA 2VHWA 3BA1A 5CEJA 4F3YA 1UDBA 4IJKA 4NBRA 4CM6A 4PCVA 5JDCA 4K6CA 1TI7A 3DOJA 3Q9NA 1E3WB 3NDIA 1BDMA 1PZFA 5TT1A 3WMWA 4N5LA 5G2OA 4EEZA 1WP4A 3QY9A 1FF9A 2HKIA 3NT5A 1MP0A 4UULA 1DPGA 1VJTA 1MUUA 3H9GA 2DBRA 1RM0A 5JNLA 2GN9A 3L6DA 4CLOA 1C0IA 1KY4A 2D0IA 1LXCA 1Y8QB 5B37A 3RBZA 3LZ6A 1ZKMA 3JTMA 1I24A 3D4OA 3ZU4A 4QXMA 4BO9A 3ZN2A 4E21A 3INRA 2OUIA 4L75A 4L74A 4XJTA 1EVIA 4I5EA 5FF9A 3T4EA 3C1TA 2QYSA 3GZNB 3PFWO 2PD4A 4II3A 1KVUA 1OC4A 4FBGA 4FD3A 2EGGA 2R6JA 1GEGA 4RVFA 3Q0EA 4R5MA 2VNSA 5H83A 2EJWA 3SJUA 5KVSA 1V3TA 4UUPA 3PDUA 2VOJA 2Q2QA 4OMUA 2B83A 4BNKA 3OM9A 1XEAA 5L3ZA 3PJGA 3VH4A 1BRMA 1TT7A 3C7AA 3G0OA 5CAEA 4NH4A 5DP2A 1UXHA 3O8QA 1R6DA 4BNJA 4UVGA 2D5AA 4BNXA 3OJ0A 4H7PA 3WTBA 3FF4A 4ALKA 4WNIA 2VWQA 3RQSA 4NFSA 1PL8A 1WDLA 5A06A 1JW9B 5DBFA 4EDFA 3AK4A 4E32A 4BO7A 1BG6A 2WD7A 3RFVA 1CQIA 4A73A 4PVCA 4D43A 3G3EA 2GN6A 3AW9A 1QV7A 3SEFA 1HZZA 2WYWA 3KYDA 5JBIA 5IXYA 4DLAA 1C1DB 3L6EA 1JWBB 3VC7A 3GEDA 2AG8A 1WPQA 3L4BA 3VVBA 2FPGA 4WGGA 4JJIA 5BSHA 3QVWA 2PD3A 3RJ5A 3QHAA 1UZMA 3WGQA 4ZHSA 2JD0A 1JVSA 4K1LA 4TRRA 2HK7A 1NVMB 1YE3A 1GD1O 4O63O 4TZTA 4YDRA 1UZLA 1FDWA 1SEVA 1D4FA 2AA3A 4C7JA 2Y67A 3MJVA 3D7LA 1E7MA 1ZMTA 3TRIA 4GX2A 3LT4A 3WB9A 4J4HA 5T67A 1F8FA 1IULA 1C0KA 2FR1A 1LEHA 4XR9A 3U09A 5EL0A 4XIYA 1PJTA 2Y68A 2Q50A 1HDRA 4FOSA 5FI5A 4J7UA 2R00A 3DBHB 3PK0A 1GV0A 2IXBA 3RIHA 3U9LA 1DOHA 1Z7BA 1NAHA 4FDAA 4ND1A 3K73O 4F45A 3BAZA 1U2DA 1UXGA 1Q1NA 3Q2KA 3EAGA 3MWEB 1EBUA 3CTMA 1LQTA 4LW8A 3NV9A 2R00C 1PU2A 2IXAA 2YFQA 5AQ1A 1FK8A 3UOGA 1KY5A 4B7UA 2PFGA 5JSFA 5IDXA 1LNQA 4C4OA 1SPXA 4EUEA 4R69A 4IINA 4CMEA 3DHNA 5DOVA 5HRUA 1XWFA 2QZ9A 4TROA 2GUGA 3DHEA 1LX6A 4RZHA 2NU7A 3KXDA 3VTFA 4LSMA 3WWZA 1J4AA 1I01A 2JFGA 4I5GA 4UVHA 1GCUA 2V7PA 1T4DA 4IQ8A 1EE2A 5TNXA 4P4LA 3P19A 4A27A 3FPCA 1TXGA 3PHJA 3KLMX 2EGHA 1PJCA 4B4UA 1YONA 4A0SA 1ZBQA 2VT3A 3AFMA 4MIOA 3WGIA 2DTEA 1HDYA 1NQOA 1I5RA 5DT9A 4JJFA 2C0CA 1Y8QA 2JCXA 3UN1A 1PIWA 2Z95A 3R6DA 5DDIP 2Q4EA 1F14A 4MIYA 3GFGA 4R4JA 1WDMA 4ND3A 5TRTA 2ZTMA 2FR0A 1LRKA 1PJSA 3NKLA 2J3HA 2Q1TA 4R16A 1QLHA 2FP4A 4RJTA 4F6LA 1YBVA 3WYBA 4HADA 3FN4A 4BVAA 1H6BA 2UUOA 3WBBA 1X1TA 1GTMA 2CDCA 1BW9B 1YBMA 3DOOA 5KJ6A 3KVOA 3LF2A 4BMNA 4FC6A 2Z1NA 4CL3A 1M6WA 3PQEA 2VTDA 3JQAB 3KLPX 4GSKA 4HFNA 3KRTA 3MEQA 3MCVA 3QVSA 4BKOA 4OYRA 2EW2A 3BMQA 4CQMB 1XSEA 5KJ1A 4PG7A 4Z3DA 2DPGA 4ZJUA 1V35A 3SBOA 1XA0A 4B8ZA 1KVTA 1LU9A 4CLDA 5U1PA 1WVGA 4XKJA 5JAQA 2OOSA 4OO3A 1G0NA 2NSDA 5JO9A 1R16A 4ZQHA 3L07A 4BNNA 3TJRA 1I2CA 1LSSA 2Q1WA 4YJGA 3W8DA 1EVZA 1RJWA 2AHRA 2B4TO 4R9RA 4B4VA 2ZB8A 4J0EA 4ZQEA 2PD6A 4RORA 1R37A 2BGKA 2B35A 3Q6IA 2FMUA 1E3IA 1VM6A 1EUCA 1YH3A 4BO3A 3NEPX 4D3FA 1MG5A 1HYHA 3BZUA 5JCXA 3HDYA 3OF2A 3C7CB 3ZHYA 1K0UA 4BO1A 4RPJA 2B37A 1IHYA 1B8PA 2QZZA 2W90A 3S2EA 3LC7O 4O59O 5F1PA 5C7LO 4MVJG 5C3MA 4MIEA 2Y1FA 3PRJA 4J7CA 1TLTA 1T2DA 3H8VA 5EESA 3WLEA 3GH3A 5AXDA 1VJ1A 3MJSA 3GK3A 3HN7A 4F46A 4FIZA 1YQXA 1LLCA 5TJ9A 3GA0A 4JBIA 2XXBA 1RPNA 4PLVA 2IEDA 5A03A 1O6ZA 3PEFA 2GPTA 2WSBA 3F46A 4BS9A 2UVDA 4TVBA 3EUWA 4AJHA 1KOLA 3OSUA 1A27A 4NHEA 2DQ4A 1UR5A 1U1IA 2IYOA 5G0UA 3RFTA 4B8WA 2AQKA 2G17A 2P5UA 2Y1EA 3GG9A 2A4KA 4FFRA 5AXAA 5DCWA 3D5QA 4XDZA 3UXYA 1QV6A 2B4QA 1K6XA 5JPIA 4P38A 5ES3A 3ETDA 3BTOA 1ADCA 1KEWA 1JN0A 4IS2A 4PLFA 2A94A 1DIBA 4W9NA 1RKXA 5BQFA 4UVEA 3P2OA 1D1SA 4RQUA 5TIIA 3ZNQA 5A9SA 5L51A 1IZ0A 3I9JA 3FI9A 4W9NC 1Z75A 3PJDA 3OEWA 1E7SA 3A28A 5CDGA 1DRVA 1T25A 1QYVA 4XJSA 3D3WB 3E5MA 4AJ4A 4KOAA 2BD0A 5A9RA 2W2LD 1I3MA 1DJQA 1IY8A 2YFHA 4P4NA 4AJNA 1WZEA 1PTJA 4KTTE 3WGYA 2QX7A 3I9KA 3F47A 1NVTA 3UH1A 3TN7A 3BTSA 3TOZA 5JXWA 2PLAA 4OOFA 3F5SA 2NADA 3GGGA 4LRTB 4E2XA 1YJ8A 4BQPA 1P1IA 3WGOA 5A4DA 1OZAA 1QYCA 2HQ1A 3VPFA 1HWYA 3ZW9A 3F4LA 4R1NA 3B6ZA 3ICPA 3ROMA 2VWGA 2CVOA 4Y67A 2C7VA 1F06A 4FB5A 1B16A 3AY6A 4CM4A 3OJOA 2GRAA 3JQAA 4DMLA 4J1QA 4BNHA 3ORFA 2VYND 3WMXA 5THKA 1ZZEA 3OJFA 5IDWA 1T2FA 2D8AA 2P9EA 3ROQA 4KZPA 4XZ3A 5DNAA 1ZK4A 2QHXA 3PJEA 4IJWA 2YYYA 4E5KA 1HT0A 1K6JA 1P1FA 1PJBA 1S6YA 1YQDA 1EE9A 2Q3EA 2Z1MA 3JD0A 3P2YA 4XQ9A 5AVOA 4DC0A 5ER9A 1Y7TA 2JFHA 2Y0CA 2FZEA 3AU9A 4IQ0A 4YJFB 4CODB 2VWHA 4MJLA 3GRKA 4PLPA 2GNAA 4FFLA 1E5QA 2UDPA 3ZHBA 3TZQA 3JQAD 3OQ6A 5I7SA 4IMRA 4Z3KA 2V65A 3GC6A 1OMOA 4CV2A 4HY3A 3K8ZA 2Q1UA 4ZU3A 4CQLA 2Y0DA 5DCUA 5G0TA 3IUSA 4CQMD 4MINA 4NIMA 4OKIA 5JY1A 2X0NA 4QSMA 4E2WA 2YV3A 3E48A 1YO6A 3I9MA 4K9DA 5HS4A 1BXGB 3IDSA 4WLFA 3RASA 3TDKA 1NR1A 1X7GA 5IDQA 3HE3A 3RC9A 1HYGA 3GHHA 4ILKA 5IG2A 2ZTUA 3CZRA 1M76A 1ENPA 1GUZA 1VKOA 1XU7A 4G2NA 5KVQA 3KOUA 4TKMA 1E1LA 4NFHA 4BOYA 5ADHA 5F1KA 2GGSA 1YB1A 2ILTA 4OM8A 4DIFA 3U5TA 2NVUA 1X14A 5A5FA 1V3VA 2G76A 4UUMA 2O50A 5G0SA 3HJAA 3VZPA 4W99A 2CVQA 4DIBA 3PVZA 3O03A 4R68A 4D42A 4Z6KA 5A5EA 1MB4A 1VSUA 5IDYA 1ADBA 1DB3A 1M6HA 4G5HA 4HX5A 1ISFA 2PTGA 3QVTA 4YRAA 5KKAA 4WCFB 1IPEA 1X7DA 1A9ZA 2WYUA 3PDJA 4RZIA 5G0WA 5BSEA 4MP8A 4PRLA 1HRDA 2W4QA 4U6SA 4PG4A 4A5OA 1NM5A 1E3LA 1AHIA 2C5AA 4OL9A 3E1KA 3FTPA 4AL4A 3M2TA 2A92A 3KM0A 3CIFA 1IE3A 1L1FA 1BWSA 4L8VA 3GEMA 2C20A 1GQYA 5LC1A 2XF8A 5TLSA 2WDZA 3BIOA 3SVTA 3N58A 3INTA 2C07A 4CMIA 1QRRA 5IN5A 1EDOA 1PGNA 4TWRA 4CV0A 1ZO8A 4TVOA 1PWXA 1EBFA 3EVTA 3FBTA 3LC1O 1ZH8A 3O26A 5LCXA 1M67A 2O7QA 4BKQA 2UUPA 2I65A 3OEYA 4TSKA 4YT8A 4RDIA 3LLSA 4AICA 5JS6A 4CM8B 4CV1A 3M2PA 3EZLA 4JLWA 4AJEA 2YHIA 3KYBA 2GZ1A 4DGSA 4IXWA 4BO2A 2ZCUA 1E6EA 1DRUA 4K6FA 5JFOA 1ZK2A 4MVJH 3BHIA 4MVJF 3VTZA 3CUKA 3INGA 4GAEA 4PZDA 4NBVA 4WJZA 1HDCA 1H0KA 4E30A 1TT5A 4QFDA 5H81A 6ADHA 2UAGA 4I5DA 1P45A 5L7WA 2EG9A 2B36A 4L4SA 4ESOA 3FBGA 1LUAA 2I66A 1CF2O 3CZMA 1ZVMA 1XYGA 4PLGA 4RPHA 4XYMA 3ANMA 3S2GA 4UVDA 2GERA 2J5RA 1NHGA 3E9NA 2VZ9A 4MKZA 4W7IA 4RVSA 3QLJA 1SCUA 1NPTO 1KETA 3F4BA 2E6UX 4GVLA 3RWBA 2EIHA 5DBGA 4FFPA 3NRCA 1LJ8A 2BI8A 1ORRA 1M2WA 2NUAA 3GVIA 3PZRA 4ITUA 3OICA 1I36A 3R0IA 2I3AA 5CHEA 1ENOA 1GUFA 2J3KA 1K89A 3W4IA 1WLYA 3ZNOA 1MC4A 2AG5A 3QP9A 2C2YA 1I3NA 4EJ6A 2E4AA 5I9MA 3HZZA 1H6AA 4BKPA 4NBUA 1MXHA 5AXBA 3C1OA 3S2FA 4AJ2A 4CLRA 5KJFA 3GVCA 3RU9A 5KJCA 5L7TA 2X7HA 4ALJA 2VRCD 1LLDA 4CJXA 2F1KA 4OAQA 4YTEA 1PWZA 1HYEA 2JCVA 3WQSB 3PLRA 3VDRA 4R1UA 3WOHA 2Q2VA 2C5EA 3DZHA 3F9IA 2ZB3A 5EN4A 1U7TA 3GMDA 4W4TA 1GPDG 9LDBA 1LDGA 3HFSA 4WLNA 3WIDA 1GZ4A 2WMDA 2QYTA 3B1FA 4PVDA 3CINA 4CMBA 3PYMA 3I9OA 4IQGA 4L4RA 3D64A 3PWKA 4WEQA 2NU6A 3AI2A 5TJHA 2BRUA 3DBRA 5C7OO 1LC3A 4YXFA 2HMUA 1WMAA 3GNTA 1E7WA 1T26A 2ZIZA 3V1TC 3JCZA 4EJMA 3OBBA 4D7AA 4EZBA 2B5VA 3IC5A 5F3RA 3WJAA 5ILGA 1C0PA 2AXQA 2ZB7A 3QV1A 2H6EA 3VPSA 2BF7A 1M66A 4KDFA 2VUUA 2Y1CA 4BGVA 4BO5A 4J6FA 4M1QA 3NX4A 1ZUD1 4OOEA 4LK3A 2IEBA 2PA3A 2YQ5A 4WEOA 1E5LA 4RLHA 1SOVA 2ZYGA 2YJZA 3WS7A 2CF6A 4E2YA 2OXIA 4D41A 4Z9FA 4FS3A 3A4VA 1AUPA 4FJ0A 2X22A 3DOCA 4HBGA 1YDEA 1DBVO 1FMCA 1NPDA 1EK6A 3AUUA 3PP8A 2J5KA 4KP7A 1Y5MA 5T8KA 1I30A 3VZQA 3PHHA 3WQRA 3H3JA 3WX0A 2EP5A 4OSOA 1VL6A 3K92A 2FPIA 3OJEA 4XGNA 2PNFA 3AWDA 4CMKA 3P5SA 1JU9A 4JP3A 3GUCA 4BNWA 1X0VA 2VQ3A 2OHXA 4UREA 5JDCC 2O3UA 1GU7A 4CM5A 4NZ9A 3M1AA 4TZKA 2IYPA 3MOIA 2YZ7A 4XYGA 4E5NA 3RUDA 2O3SA 3BMNB 4FPXA 2YUTA 5L95A 2E82A 4DBVO 1JA9A 3K2BA 2GN4A 4TMFA 3B1KA 2O2YA 3LDHA 3PYLA 4D3SA 3JSAA 4GWGA 4YACA 4KUEA 3WNVA 5JC1A 2OGUA 1FDUA 4J4TA 4O5OA 4W6ZA 3DDNA 2RHCA 5I8WA 2H1SA 3BTVA 1GCOA 1N8KA 3MZ0A 4KQWA 3QWAA 3JQ7B 5I7VA 3BTUA 4ALMA 2HSDA 4ROSA 1PZGA 2GCGA 2IZZA 2V6BA 2CF5A 5GZ3A 4N18A 1ID1A 3KHUA 4R41A 3TFOA 3GT0A 3PYXA 1XR3A 1NQ5A 3JQDA 3RUEA 1DC5A 5T57A 1JQBA 3P7MA 2Y1OA 4RGBA 3A9WA 3FCOA 4YRDA 5HWSA 2PZLA 1YB4A 1V9LA 4RL6A 3WFJA 4E12A 2B0JA 2A35A 5C7IO 1KC3A 2C2XA 2ZKLA 3NDJA 1CEQA 1PL7A 3ULKA 3CXRA 3VOSA 4IMPA 1R15A 5F21A 4JBGA 4OQZA 4Z0HO 5A05A 1UAGA 1P77A 4NJMA 4CMCA 3GGOA 1BDBA 1ZW1A 4BO4A 3JQBA 4EJ0A 1HXHA 3BMCB 3H5RA 3JQ8A 1VSVA 2Y05A 2BMAA 3FR7A 4WLOA 2YV1A 3WFIA 4R54A 4IM7A 1P31A 4ND4A 5JAIA 4BO6A 1AGNA 3JQEA 1PL6A 3L4BC 1NXQA 3GRPA 5BSGA 3RC1A 2EF1A 1N7HA 2BFMA 4GLLA 3HDQA 4JNKA 2ZJ1A 3KV3O 3RUFA 4FJ1A 1HLPA 3DZBA 1PJQA 3H9JA 3KETA 2HUNA 2EW8A 1PJLA 3U0BA 3MJCA 3C8MA 3RD5A 2QRKA 1IZ9A 2YQ4A 5CEFA 2EV9A 2P5YA 3RCBA 1E6UA 1ISHA 5CPFA 3FWZA 2VRBA 3NT4A 1RYEA 1M75A 3SLKA 3PPIA 2HAEA 3VVCA 3PWZA 4MP3A 4OIMA 3FNGA 5IXSA 4NK4A 2E49A 1JLLA 5FWNA 4KUGA 3RI3A 4CUJA 3CMCO 2PZMA 3U49A 4AJ1A 1GZ3A 3WGHA 4DL9A 4I08A 1XCBA 3BMOB 3JD2A 2DBQA 1A7AA 3ON5A 4J4BA 4KWHA 3WTCA 4HUJA 3CPSA 2Q99A 1HEUA 2O48X 3TWOA 3TF5A 4QO8A 3UVEA 2OFPA 4DQXA 4WLEA 4LSWA 1MC5A 4YT4A 1DO8A 1DIHA 5KNLA 4GGPA 5EERA 2D4AA 4YPOA 2VHYA 2X1HA 1E3WA 4J3FA 1P0FA 4K28A 1ZMOA 3AY3A 4ZA2A 4CMEC 8ADHA 2JAHA 3JQGB 2E37A 1J49A 4ND2A 1K6IA 1XELA 1LDYA 1DC4A 1ZSNA 1PR9A 3AU8A 5COBA 1QG6A 1YRLA 1J6UA 4H16A 3DC2A 1N5DA 1Q7GA 1Z7EA 3BMNA 1XG5A 3ZWVA 1ZSYA 2BFOA 3MWDB 4HNGA 4BNMA 1YXMA 3V5NA 4N5MA 3OA0A 1CDOA 3HDJA 1RYDA 2WJPA 1H9BA 4GBJA 5A3JA 1Y8RB 4CR6A 5BT9A 2RHRA 1LBEA 4DMMA 2CVZA 1KVQA 4B4OA 4QX6A 3ZU3A 1YGYA 1X13A 1YQGA 3W8EA 1PX0A 3GZNA 1J0XO 3ZWYA 5KOIA 2X23A 3SJ7A 3PGXA 3Q9UA 3QW2A 1NWHA 4J91A 4N7RA 1OAAA 1WAMA 1H6DA 1GQQA 4CLEA 4DREA 4OGWA 4WLVA 4EUFA 4CV3A 1XGKA 4IDGA 1MX3A 1ZSVA 4RLSA 2JJYA 1ZEMA 3A1NA 3IP1A 3NTQA 1UXKA 5DOZA 3GVHA 4D0SA 2Q45A 1ARZA 2V6MA 1S7CA 1P1RA 4WECA 4RCVA 4UEOA 3HDHA 1O5IA 3I9LA 5B4UA 1XKQA 1MA0A 1E3SA 1AN9A 4PG6A 2UYYA 3C1AA 3ZHXA 3OIFA 3KBOA 4H15A 1Y9EA 4K26A 5G4LA 3GY0A 2AQHA 4J90A 1BHSA 3RROA
chains in the Genus database with same CATH superfamily
4GKBA 1QZTA 4YRZA 1O54A 4D9KA 1L5MA 3SIRA 4NV3A 3G5TA 2XMBA 3UJAA 1JFLA 2AG6A 1GRNA 5IAJA 4FGWA 2ZRKA 4KPGA 5AI6A 5K8LA 2DF8A 1GLVA 3DM5A 3U19A 2EEPA 1RTKA 2NXJA 2UYOA 2KJQA 2X9VA 4RVNA 3HR8A 3OFJA 3TBFA 1WW3A 1KMHB 1P6QA 3NDBB 4A9AA 5FV4A 3MGCA 1GYPA 1UANA 1Y3BE 3ROXA 2IS6A 2QTTA 5AUPB 4LYAA 2VYCA 4IR7A 1EUZA 3I4CA 1Z3CA 4ZARA 5K0CA 1P4AA 1Y5NA 2F43A 1NASA 2ZBEA 4IUDS 1CEYA 1GGFA 4E11A 2EKQA 1XEFA 3QWBA 3OLXA 4YP1A 5IUNC 3KPVA 4PZ0A 4EUHA 4DV5B 1AX9A 1E2FA 3H8JA 1H1DA 1LVUA 4RSGA 4IWXA 3U6KA 2OR3A 2DRIA 3HCPA 4PO1A 3DOHA 4OFXA 3T0FA 1JE1A 1J20A 1ORVA 3QFFA 3GAZA 4HB3A 2P91A 1XVVA 4N9WA 3KAKA 4MYCA 4QFMA 4ZAVA 4ZU1X 4JUDX 3WRYC 2GBCA 1U4NA 4N54A 1E4OA 4DE5A 2QLTA 4C0AC 1MX5A 4I2VA 1WMSA 1L5KA 421PA 2B7BA 1IL0A 3II6X 1RPAA 4Q3LA 3WQQA 2CT8A 2IUTA 1KDZA 4YR7A 2ARKA 1O2DA 3TSAA 1XTPA 4L7QA 3P4YA 4IDOA 4MB6A 3T99A 5IM4A 5ADVA 5AXCA 1FQOA 5IFLA 3JQFC 5DYYA 3K16A 4CE6A 2WAMA 3WIBA 2EFYA 5CEEA 5D8DA 3SVZA 1P8JA 2DUJA 1R0YA 1LTHR 3WDSA 1A5TA 4UUNA 3SQNA 4DS3A 2X86A 2O2DA 4DNXA 1LQ2A 4G81A 1T9KA 2H51A 4QXAA 4WXPA 3HB5X 4JSTA 3U4CA 3RM3A 1NBMD 4MV5A 1L7MA 2HV8A 2YHUA 1A7UA 1XZBA 2NZ8A 1JPNA 3G1UA 3HZOA 1P9NA 4FT2A 3AF2A 1PT6A 3A3YA 5J2UB 4AO7A 3SU8A 4ESVA 1PAUA 2PAFA 5CNKA 1F8YA 1VHDA 4ZOEA 2FJ0A 4OHCA 3BXZA 3KSUA 2IBSA 3K0KA 2O2ZA 4KTVE 4DANA 4IV8A 2DHEA 3SE0A 1ZM3A 2ANCA 1UBCA 5H4GA 2BGNA 2RAUA 3S2SA 4KFSA 4P98A 4K6KA 2WSMA 4O3FA 1E59A 2BEUB 4B8YA 4AWXA 4JL6A 4C0KA 1GCIA 2YX1A 5IMSA 1XU9A 3DONA 1XVIA 2RCYA 3MT0A 3O94A 4JELA 3PGJA 5F7JA 4R8VA 2DJIA 3TOCA 3W1WA 1KC1A 4BWGA 2QWXA 4C7XA 3PICA 5JNVA 3CPEA 1NXWA 3F5MA 4UATA 2PV7A 3DLAA 2CYAA 3RT1A 2WM9B 3F7MA 4ZOAA 3O3OB 4PYOA 2V6IA 3UJ9A 3ZDZB 1RM5A 1UOQA 3IPAA 1MJFA 3QENA 4C7VA 3JD1A 4FCTA 3ZLTA 1X92A 4GPTA 1KEPA 3K0FA 1NFQA 5AUNB 5BWNA 4B85A 1IMOA 2ZPAA 1R9JA 4Y2RA 2QG9A 3T4XA 3ILSA 4FFMA 5DM0A 2VBGA 2XUQA 3Q87B 3TI9A 3ZVLA 4C89A 4F9TA 1XLTA 4HFMA 1BW9A 1FFSA 1NUUA 4BBZA 2QLMA 2WNSA 3KR0A 1WCIB 4Y6SA 4HH0A 2QTBA 4LRWA 4K81B 4RA6B 3BN3A 1NVUQ 4X8HA 5FPPA 2NU9B 1CEXA 3KSZO 4QOJA 3U3JA 1WETA 2CMHA 4MSUA 3T9AA 5A6SB 1HZJA 4IJUA 4CKBB 1G3QA 1R4ZA 3GP3A 2F2TA 4L6IA 3Q8WA 2OCPA 4G5FA 1CNMA 5JATA 2C78A 2ZSJA 3R3SA 2JGIA 3GFPA 2G8NA 2P4SA 4Z99A 1DO0A 2P4HX 4KSYA 5DMXA 3T06B 2B99A 2GLXA 3N8HA 2H3HA 3W3AD 4HN9A 4GW3A 4X3OA 4BIIA 4M9SA 3RRNA 4BLOA 4EPXA 1CXZA 4IDBA 5UKDA 3VXKA 2DFDA 2DC1A 5DP1A 2WJGA 3CCBA 1OY1A 4KIJA 3LWBA 3TBKA 4AKEA 1C30B 2REQB 4DR3B 2HCFA 4Z9YA 4CLHA 3K7EA 3WB2A 1Q0PA 1ADFA 3OOWA 4RSMA 5F76A 1YVDA 2PQ0A 3ENNA 2FW8A 4R2WA 2FOLA 3V8VA 3L06A 3OZFA 5FNVF 5HDQA 1UKBA 5B7PA 3RAGA 1JG3A 2YXNA 1SWWA 4OGKA 3KOXA 3CF2A 2O19A 4YCLA 3T5MA 2W8ZA 4MV7A 4UCXA 5DM1A 1R00A 2HJSA 3E5RA 3IRVA 3MTJA 3VJKA 2R6R1 3LX5A 4QOHA 3PI6A 4Q9NA 1OAOA 4HTAA 1I7LA 4BV8A 5JH7B 1F20A 3DVAA 3TE6A 3IMFA 3OOEA 3AILA 3UO8B 2XZLA 2Y0PA 2ZIUB 4XD2A 3KQUA 5K8VA 1OT3A 2YIVX 3V1YA 2E7ZA 4EKNB 1EFLA 2CUKA 1FA9A 3OJXA 4NV0A 2Q62A 1NP3A 4NPCA 1OR8A 5B1HA 3FTEA 1ML3A 3AR5A 4MW9A 4BJ3A 3HJCA 2JLAA 3AFIA 3AESB 4OHMA 2XTZA 4NE2A 5CFRA 2QQ0A 5K0GA 4MH0R 3AM3A 3HK2A 2HRQA 1SRQA 1Y7LA 3P0JA 3QPAA 1W8DA 4UFPA 4B2YA 3DEYX 3EIWA 3AI1A 5LP6A 4DLXA 3VH2A 1L1EA 2O9JA 3JU3A 1Y4AE 4C78A 1TEVA 3ASVA 3UUFA 2X7XA 1IY2A 3IDOA 3O73A 4IIYA 4B80A 4Z49A 2BDEA 1ZXLA 5JJBA 1HM5A 3DTVA 5EKTA 4J16C 2ORIA 2HMVA 1W581 3Q0TA 5K6AA 1M1XB 1PJ8A 1V0JA 4DPLA 5TGDA 3M89A 1GGKA 4RDXA 2HU8A 1DQYA 2CMDA 3LPNA 5T4FA 1CX9B 3V97A 5L53A 2VQDA 3IDFA 1B8OA 3AR6A 3QV2A 4CHTA 1CUBA 1OLUA 2RARA 3FNEA 4E03A 1NKVA 1P5ZB 5EFOA 1ULTA 3PUIA 1NM5C 4XCVA 3U3RA 5D3MA 2J9GA 2ZTVA 5ALYA 2CLOB 4LMPA 2D2XA 1H93A 2ZE7A 3KE9A 4GPAA 1HDGO 3I2FA 2DT8A 5CVEA 4EYSA 5J4HA 1Z38A 3OCWA 1RAAA 2BAGA 2PKYX 5D7NA 3WKDA 1ZD3A 2BN4A 4RKYA 5AW4A 2K2WA 5M04A 2R4QA 1AE1A 3QXJA 1RI5A 1FLAA 4R83A 4E5KA 4M8KA 5BUCA 5EJ6A 3IIEA 3TL6A 4D9FA 1B0AA 1I8TA 1Z45A 1YAJA 3W90A 1TRHA 2ZXFA 3GPIA 1G19A 4A10A 5J47A 3KALA 2ZR9A 3OQMA 3ONEA 1G21B 2XLBA 4DR6B 4I36A 4JJZA 1I94B 2PZGA 2B5WA 1OJLA 1XQ1A 2GN8A 2J32A 3PEYA 4IILA 1D4AA 3ZBQA 1W0KA 4AJ9A 1BXZA 1BQ4A 1UXJA 2PPLA 2WKQA 2OGTA 4K05A 2BHRA 1P7WA 3NTVA 1NNSA 1XDDA 2ATEA 3OPYA 5FUVA 1XLUA 4QTYA 1GPKA 4YC7A 4BNDB 3K70B 1QIJA 5NLLA 2F3UA 2VT2A 4MDHA 1RHQA 2JCBA 2WSSD 1M34A 3QPWA 1GQOA 4ZQBA 4RPLA 1SZDA 3DFUA 1SCDA 2IODA 4R0MA 5B2ZA 3EN0A 2LZ0A 3PEEA 4V38A 2PXHA 4MJ7A 1PCXA 3F6YA 4R3WA 4KQ6A 1GSHA 2AN1A 1NJ2A 1UADA 3AINA 4BMYA 4DJFC 2P4QA 3FMOB 3ZE9A 3UQYS 3HKCA 4N03A 4H18A 2QNIA 4A7PA 1RE1A 4X90A 3DZJA 3E58A 5EINA 3ZU6A 3I5UA 2I4OA 3IQZA 2PFSA 1SCNE 1SC3A 1TKCA 1VKNA 4P8RA 3MG9A 1PJ4A 5AKHA 1F17A 4AXXA 5I5EA 5KU1A 4MUXA 1W94A 3KD3A 1E61A 1E7YA 1SMKA 4REQA 1ZICA 4I55A 4KKXB 5K51A 1M1ZA 1XN1A 4YCSA 2CJWA 2XI4A 3EXIA 3WAKA 4F6CA 4QEDA 4PHTA 4B87A 2CXRA 2PS1A 1NNI1 4POOA 4E5YA 3I2HA 3PIDA 5REQB 4FUQA 2REXB 1X1CA 3DUWA 1JIIA 1G98A 2F9LA 2P9QA 2P79A 2R8ZA 4BP9A 4C0XA 1SUEA 2K87A 5DHPA 4JUFA 2WQ6A 1X1AA 4OHBA 2J7KA 4Q4AB 1GV1A 5L3VA 2J85A 3OU2A 3R5HA 5TDHA 1JR2A 2GK6A 3B2EA 1ACLA 1Y3CE 3G49A 2GPYA 3RSQA 4Q9HA 4EGQA 1U9ZA 1PYGA 2OBYA 2RGNA 5JAMA 4FN4A 3ZIAD 4NS4A 2WD7B 2QTVA 2X5JO 3CB2A 4PINA 4IUCS 4DZZA 2GVNA 5JJLA 1IDN1 1OPXA 4F5ZA 3I5MA 5AJVB 5JU6A 4LNHA 4WZAB 2YXPX 2RSLA 5TGTA 2DQKA 2J7PD 4JL8A 1XPUA 5JAZA 3WRXA 1JWAB 2OZVA 1O87A 2XMPA 3H2KA 2WKWA 1P39A 4OHUA 9MHTA 1AK9A 4FC7A 5FLKA 4TMWA 2I9PA 3HHPA 3VR0A 4DIUA 2RHHA 3UJCA 1U2EA 2P9GA 4NMHA 3GO4A 4KV7A 5FADA 3RYCB 2W7TA 4BC1A 1TA4A 3T7KA 4EFKA 4GPBA 4WTOA 2IYUA 4WAUA 4U6QA 2VJMA 4LJAA 1YZKA 4O0LA 3AKEA 4W6QA 4C87A 2B2NA 2V7BA 4BZZA 2R8RA 4W82A 1ORIA 1E92A 1STOA 2MYTA 3EGDA 4AJJA 1W76A 1V8OA 2OYCA 2F4NA 3ZGLA 2HNKA 2PRIA 4JU8A 1DC3A 1QORA 3EFOB 2YC2C 2YW2A 4D3YA 5F23A 3V42A 1A9TA 3M6MD 4B47A 2B8JA 4WCFC 3WICA 4F2GA 3A32A 1XA4A 1PFUA 1YVRA 1GPH1 3IAS1 5DI3B 3WJ1A 4ENWA 5DHTA 6ABPA 4W5TA 2UYCA 3E8XA 5JADA 3I1FA 4LRUA 5H80A 3A6KA 3SAJA 3U26A 1IEWA 1Z4IA 3BQNB 3T4UA 4AWAA 4NYIQ 1BWQA 1Z83A 3K5HA 1TA0A 4Z9XA 3TZBA 4AD8A 2CHVA 4M55A 2MMCA 4NU5A 3QX9A 3LUBA 4QYMA 5JS7A 3FTFA 3L8DA 4R2XA 3IV6A 3M3HA 5G02A 4KYVA 1T0IA 1ZA1A 2IGTA 4ZALA 4NMLA 3O8CA 2QRJA 5AOVA 3WB1A 5LIPA 2MINA 4NBKA 1AS2A 2WWHA 5T8KC 4LI3X 4FE3A 3TZKA 4KDEA 5G3YA 4EYGA 1XXHB 4RZ2A 2A0FA 1C1XB 1E9VA 3PCXA 4CM8A 3V8RA 3GJ5A 1N5MA 5K3FA 4QD3A 4RF5A 2EJBA 3L5OA 2XB9A 3RS8A 1M5TA 2WF7A 4LE1A 4WHMA 3AR8A 3CY6A 2DWCA 2WMNB 2YRWA 3ABIA 4OXYA 4NESA 5AVYA 2B3TA 4IBOA 3G9UA 1F8GA 1KFCB 1TYDE 3HJGA 4WVFA 5K3SA 5L8VA 5FTMA 1WU8A 2GD1O 4JY7A 3SZLA 3VU3A 1TMGE 2PH3A 4F38A 3V2UA 1KERA 1NZJA 2J0VA 3B1VA 5DZSA 2IOFK 4RAOA 2NU7B 4B76A 2EYUA 2WJYA 4L2IB 2J59A 1FXUA 5D51S 4FR5A 4LYGA 3ROEA 3GT4A 1M2HA 1WZIA 1CRWG 2GASA 1KIMA 2JEOA 1JSXA 2WTBA 3GUZA 3OTWA 1GQRA 3UHAA 1X8KA 5J58A 2BLLA 4B35A 5B1SA 5IHXA 1JHMA 1JFFA 1H2HA 2ZE6A 4MQ6A 2HLNA 4NEHB 4ZMRA 5KYNA 1F48A 2GF0A 1S96A 1AKWA 2EERA 1RJFA 2BTQA 4D9IA 4Z1MD 2I4TA 4FDUA 4XAQA 2HYDA 1M54A 3LCJA 4ASUD 3IUYA 5BNFA 4ZVNA 4I99A 3H2ZA 2CSUA 1I5OA 3OKFA 3UF0A 4B6QA 3UAVA 2NO5A 3N75A 1EEHA 4OQFA 2Q7OE 3S7TA 2Q0HA 1U2RA 2G1UA 4RBNA 4UAUA 1NT2A 2JK0A 4OXRA 2GN0A 5BSUA 4JROA 1DFHA 2IUYA 1G5IA 2IYLD 2V8BA 4R1LA 2XWSA 4DR7B 2ATCA 3RRMA 1MT3A 1LSJA 1TDJA 5J4KA 4NE7A 1U4OA 1OZFA 2WWFA 3O2NA 4LZPA 3TB4A 3RUCA 4NG5A 3SQMA 1J23A 4XOUA 4EH1A 2OSVA 4F2DA 1FJHA 1EP1B 3AV0B 1EFDN 2IYTA 1CUHA 3ZS8A 4W63A 2DKOA 4O08A 3DCJA 5B6IA 4MI9A 4PR0A 4A36A 5H59A 3QXHA 3VAAA 5KHAA 5C8YF 3F0TA 1QRUA 1NMZA 2AFHB 3TIFA 4EFLA 5AKJA 4A2WA 2C1EA 1YKFA 4K0KB 1V43A 1YS4A 4IG4A 1PI3A 2CFSA 5HM6A 4NQZA 1GFSA 1ZMBA 1N0WA 2BEWA 2XDQA 4KWCA 3QEMB 3FFAA 5HKOA 3COVA 3F7OA 1KFJB 1HE3A 2QM7A 4JP1A 1U1DA 1QO0A 5CB6A 4RGQA 1M6VB 5CURA 1XROA 1A9YA 1OLXB 1QKIA 1KNXA 4HDKA 1DAGA 4JI0B 5FAKA 3KCQA 4JYPA 4P92A 2LDBA 4M1MA 2G25A 2GM4A 4UTPA 5JW6A 5JXGA 3ZY2A 4KAJA 4S1TA 1DFIA 5ALSA 3UFXA 3ZU2A 3S55A 5DNVA 2VNIA 4ACBA 3F2VA 1K7CA 4FKBA 5FIUA 2NZ2A 1NY6A 1X7YA 1HORA 2HF2A 3W5BA 1VP3A 1FDSA 4TYPA 1VIVA 2XTMA 4CTJA 1NQAO 3GFRA 1KZYC 2V7TA 4JITA 2WEKA 3AR9A 4LHYA 3KEGA 1CUWA 2F48A 2QUKA 3LHDA 1W48A 4AMUA 3JQ6A 3TGLA 1NXVA 3TBHA 2QUIA 2J4CA 3EOBI 3QUTA 4MO9A 2MIIA 1EH5A 1LSOA 4HC4A 4MWZA 3DB1A 4RK4A 1TZKA 3EF0A 4M8LA 5H70A 1UMCB 1JFVA 4OXKA 2Q46A 1KAQA 1CUCA 3UV6A 1F2TB 3WWYA 2VP4A 1XPJA 2O23A 1A50B 3X1MA 5AUOB 3QTBA 2OSBA 1TVEA 4LI0A 3ZKAA 2ZT7A 1GA1A 2XKKA 2D8MA 3ZWOA 4ZP1A 3SNHA 2IV7A 1U0BB 4HV4A 2H1OA 1K06A 2VAXA 1KEVA 4WXYB 2OO7A 2HWWA 2JL1A 3NHKA 1ZZGA 4WESB 3GL9A 2HLHA 5TF4A 4BAUA 4WY2A 3T5CA 4J9VA 3ZCXA 3AF4A 3EIFA 5ETJA 4P58A 4AZ3B 4PG8A 3NKVA 5HKKD 2XOEA 1SG9A 1T6BY 2GEJA 3L77A 1L7EA 3NVAA 4KXFB 4U9IS 5GZ1A 2RKWA 2EVWX 5JRJA 4DNPA 4NENB 1X15A 2OKGA 5HX7A 1HRKA 3KIPA 4ZYXA 4XLTA 2Q3FA 1G63A 1SOWA 1YV9A 3KR2A 4X7BA 3BGWA 1SVSA 1QP8A 1RMTA 3K5IA 1HURA 4LDRA 2NTNA 4ZC1A 5BSFA 3NIDB 3LXUX 3C0KA 1X1QA 2VHXA 4AZSA 4OJYA 1KQPA 5DTRA 2X8JB 1QJ4A 2FPPA 3K9FC 3EUEA 4H7IA 2O20A 6YASA 3AVPA 4Q66C 1TNDA 4YXWA 2FVYA 1F6WA 1QHHA 1QH1B 1SG6A 4FEGA 4GOXA 4ZVUA 2VPXA 4XTCS 3ITDA 1OBVA 4O8ZA 1YU6A 4D74A 5I7AA 2NUPB 3ET5A 3QFTA 4DQUA 2BFBA 4PM4A 5A9SB 2WINI 3K6SB 3F6EX 3N2YA 4R7TA 4DUPA 2FFQA 1WRBA 1SXJE 3UENA 2O6HA 3AUTA 1GUYA 4LKOA 3S29A 2A59A 1XAJA 1Z5GA 1ACMA 3P9RA 1E9RA 2M6RA 3DMTC 4HHEA 3RV3A 3IVXA 1NUHA 5A6VA 1HT2E 3CX3A 4BVJA 1K0FA 4U8GA 4OK3A 1OI3A 1W36C 3S70A 5BSVA 2YW9A 1PE0A 4NZOA 4MW2A 3LZCA 1BDJA 3SICE 3C3AA 1JDZA 2VHVA 2ZDGA 3FR8A 1W4BA 3WK5A 3B2NA 3I0MA 3AHJA 3QU9A 1DADA 1SC6A 1MKYA 1S8OA 2QL9A 2Y71A 5G41A 3T7SA 3ZGVA 3DFZA 4BO8A 4CUZA 4QDZA 3O84A 1SHUX 2OYSA 4JI6B 5F2EA 4XFDA 5IAEA 3RFUA 1OB5A 3ND5A 2IKQA 1YIAA 2GZMA 2OGWA 2ISQA 3MWFA 3F5QA 4AZ0A 4XIJA 5AOAA 5KWIA 1VGVA 5TARA 4PAOA 4J2OA 2H2AA 4CCYB 1QTNA 4DC9A 1G5QA 2IUEA 1GPWB 3MMPA 1CUYA 4MCAA 5JV5A 2IU3A 2X8LA 1QK5A 3ICQB 3T1OA 2XB2A 4BVGA 1T0PA 1QFZA 2FY8A 3F4KA 4LGVA 4QEKA 4H1VA 4XOIA 1MU0A 4IIUA 1AM4D 3ADCA 4B33A 4R0NA 4FGZA 4DA0A 2FZ5A 1K4YA 4G1VA 3BMCA 3MYYA 3ZWDA 5ICEA 1MQSA 2WW8A 1ZK0A 5HTOA 4BY9E 3A9TA 2BEVA 3CWCA 5KO2A 4RY0A 1ESCA 2QMUA 3MTIA 3GA7A 3NW9A 4KQ9A 3UIEA 2OXRA 3H0EA 3E7XA 3OBIA 3S3TA 4BWVA 4XSGA 2XCRB 1L9XA 3S2ZA 4Q1FA 4X1YA 3CEPB 4QDTA 1VGRA 3GLQA 3AVUA 5DB4A 1IG0A 1FEZA 3EWNA 2DFTA 4U7TB 1KMQA 1JEAA 5C0OE 2ZG6A 2ZUCA 3GVPA 4DCJA 2ZIAA 2W8BB 2PWAA 1WXDA 3EIXA 4IGEA 1Z34A 1EKXA 5HK9A 1ISRA 1W73A 3KX2A 4PBSA 2Z43A 3VZDA 3LOQA 2MDTA 1GXSA 1T3ZA 4G24A 4P7JA 1NBMA 4L08A 2CJXA 3P27A 1N1MA 2ERXA 3S8MA 1FFAA 4CIXA 2Y93A 4PZCA 4DCOA 1TQ4A 3ANLA 3H05A 3Q3IA 1M10A 2EKDA 2OESA 4H59A 5AK0A 1E94E 2NVBA 4G0NA 1KZHA 1JI3A 3SYLA 4BJHB 4ZHQF 2WU8A 4X8MA 2HK6A 1WX1A 5KYWA 1CIJA 3IALA 4WOKA 1U31A 2ADFA 2W6OA 2VK1A 2IYWA 3LUCA 3ZGNA 2AOVA 2YWGA 1FYDA 3RS2A 4DUGA 5BWMA 2Y76A 4N5IX 2FOXA 4L4XA 3LY8A 3RYFA 5ALPA 4GMFA 3FCUB 3N2NA 1WO8A 4MV3A 1WULS 4MVJP 4KVFA 2ZSHA 2R1VB 3WL4A 4WZBE 2VWPA 3QWIA 4IW3B 1MPTA 4UEKA 4DA6A 2QV7A 3WSTA 1SVNA 5BV8A 3LD9A 5K09A 4RIEA 1XQ6A 2IVZA 4DYDA 3O1IC 2V7WA 2NACA 5DM60 3D8UA 1G6OA 5HA5A 1FYFA 1W4AA 2YWCA 2ZGVA 4H17A 3OIYA 1F4PA 4RVHA 2PBZA 5AW0A 3BD6A 3AVTA 1EVKA 5HF5A 4EUKA 2VQFB 4G26A 1G4HA 1GUDA 2V7QD 4UNPA 1EXMA 5DBIA 2D00A 2IE0A 2VDJA 1JQLB 5IXJA 5H1YA 4PPGA 2FQWA 3GJ8A 2DULA 1W4LA 2XXAA 2BELA 2BFDA 3U7QA 2NZJA 3PCRB 4DV7B 1HR0B 1F12A 4U7HA 1YHNA 2X0KA 2EKPA 2R2GA 4YJDA 2EX4A 4AMVA 1SUPA 1YF3A 4YCMA 2VNAA 4U2BA 1HMPA 2H48A 4FYHA 3TRDA 1A9OA 5GVRA 1K5DA 5FUMA 3W9YA 2G9VA 1H3EA 1EDZA 1ZOIA 3ZE1B 4Y30A 4ONEA 3MWDA 1T6NA 1D7OA 1U7HA 4HXYA 3ZQKA 4CMIB 3NIBA 1T6ZA 4Q7LA 3VQTA 2CDAA 4AY2A 3GLGE 5TQ2B 1Y8RA 4K9PA 2GJ9A 3M70A 3MTDA 5JLAA 1Q3KA 3NHPA 5GINE 1LDMA 1TKBA 3OKAA 2I4LA 1SD1A 3RANA 1QGAA 1P19A 1RT9A 5GOTA 3W3AA 2BGMA 1FFDA 1PEAA 3K35A 1GNQA 3L7IA 4BVEA 4O2BA 2WJ4A 3K71B 2CXPA 4C43A 3VH1A 4JYZA 5EIHA 2HWYA 3DW3X 5JD6A 3H65A 1N6LA 4PLYA 4Z0PA 1EFAA 3IP3A 1M8KA 3T3DA 3EGXB 1E2IA 1KVRA 3G2QA 3L8GA 4QXRA 3O4JA 5LKRA 4ZTUB 2QORA 1EESA 1E0JA 1ZRHA 4CYMA 1NTOA 8LDHA 3TRHA 1D1TA 4R0VA 4DWVA 2RGCA 3EEQA 2YDXA 3I73A 1BS9A 1WMBA 1BROA 2XCQA 4GG1A 1T4GA 4O29A 3AJRA 3PE3A 1F4VA 1CQJA 1TT5B 2ZAMA 1WPXA 2QL6A 1NY5A 2ES4A 1UXOA 1M1UA 1Y3FE 2NLOA 2PT5A 2ZBGA 1RZUA 3CNQS 3GJYA 4MGZR 1M73E 1ZJ6A 4YJ3A 7MDHA 3LUHA 3OOYA 3T5BA 3SJCA 3CRMA 1RPTA 3UYLA 3TXAA 3D54D 4DT1B 3ROTA 4IZOA 2Y1XA 1XZNA 3QNMA 2PRYA 3HGMA 3L9WA 3FGZA 3NRBA 4PFJA 4MS4B 4B6RA 3L7YA 4TS1A 2XUIA 4NULA 5EQDA 3B82A 2QN6A 4ER5A 1VL0A 1NC3A 2JDID 4NS1A 5CLGA 4PO9A 3SSAA 2IYQA 5MGNA 4XDGA 1AKQA 1RADA 3ELBA 2XUOA 4KUHA 1DXYA 5CXSA 3WLSA 4AULA 1SAYA 4DCSA 2EBWA 1E1DA 3BDVA 1LI5A 5FPSA 3HCFA 3MBOA 3OZEA 2OZKA 3GGDA 3SNKA 3JATB 3H11B 3OH8A 4EHKA 2ORVA 2P40A 4YT5A 3SJBA 4Y2JA 1O89A 1TUGA 3AHGA 3GMSA 2WWXA 4MVJA 4BNLA 1R0BA 1UBRS 2ALJA 5I7OA 1LDNA 2QGNA 5IM4F 2I87A 4XB1A 1O96B 4O4IA 3N0RA 1TCBA 2P9HA 1XMXA 3KFVA 1CF9A 1ZMRA 2BWJA 2WLSA 4EHAA 5C1DA 3AOGA 4V3CA 2BCEA 3R7BA 3PX7A 4OH7A 2B1QA 2XNCA 3KT6A 5BRAA 1XNGA 2QX8A 2XA2A 3B5EA 3BQMB 4FCCA 5DISB 3HCNA 3DMRA 1BU8A 1TQHA 3PNVA 4UFOA 3AF6A 3STYA 3H17A 2Y2VA 4JLMA 2X9QA 4Q4CA 1JFRA 2HK9A 4MI3A 3IESA 3C8DA 3PLNA 1S3FA 3UMFA 2ZETA 1UZNA 3GF4A 4GZ3A 1Y4UA 4Z51A 3MFQA 5MFZA 2H9IA 5BY2A 2PJRA 4B75A 4RANA 2JG3A 4MVWA 3LSYA 3PTLA 2FN7A 4AYTA 2BPOA 5D87A 1DLJA 4JLNA 1REQB 2VTEA 3GNQA 1HQYE 1BQEA 2ODQA 1ISJA 3CNOA 3LVFO 1RRGA 5FPHA 2EU8A 4CQNA 2GB4A 3H1GA 3EVBA 3GLFA 4ZQCB 1O6FA 1RHJA 2WIAA 5LJLA 4I3FA 1Q7CA 2WHRA 2FRDC 1UCFA 3UV3A 1JTVA 4R2HA 2J5QA 3SHFA 4PHGA 1OGIA 2DUUA 3BIWA 3GOQA 4J1TA 4XD7A 3VHRA 5I9IA 3ADKA 5AICA 1PZEA 5A7GA 1JHXA 4LMAA 5AHRA 1HDXA 1TMYA 3EXG1 1ZLXA 2PQ2A 2MSKA 1CY0A 1V11A 4HTFB 1NUAA 5D1NA 1FS6A 2CYCA 3I6YA 5ICCA 3BXPA 4M0PA 4ZI7B 5JWRA 2G8LA 1E2DA 3AYZB 3ME5A 4EP1A 3ZI0A 2IELA 1IOLA 4JLAA 4HS9A 3NHMA 3NAQA 1ODJA 1UJCA 3SX4A 4DRYA 1GTJ1 4LZJA 4KDCA 4MMXB 1C9DB 5DYNA 4XYEA 2ZR0A 3FDZA 4LN1A 3CX4A 4RV9A 5BOSB 5KQMA 1QMPA 3KTDA 2BR5A 3CLVA 2CDBA 4J2HA 4A1FA 1IEVA 2EFHB 3A0UA 2WU4A 3WJ2A 3OETA 3E9YA 1HE1C 1U5CA 1FMFA 3ZUPA 5HR5A 4FLFA 1JBQA 1S4MA 5KDDA 1T4CA 3K1JA 3K6JA 4RKFA 4HJXA 1YS1X 1C14A 2FKNA 2WSSA 3PFNA 3ZDRA 3N6XA 4DCVA 5INTA 1TEHA 1CLUA 3I2GA 4C5CA 4H6PA 2XCIA 3AVQA 2VA9A 3WA6A 2P67A 4N5NA 4AVYA 3D2BA 3MGAA 5E0KB 1FIUA 3D2CA 4YRRA 2F59A 5CA0B 1OI7A 3KWMA 4UPEA 4I9HA 1AU9A 4FYIA 4DVJA 1N9GA 2J3IA 3N8GA 1MB9A 4YA6A 1VQ1A 3B1JA 3IO5A 2Z3WA 4KI7A 1Z5ZA 1YVUA 1MV8A 3EXEA 3LC2O 3O4FA 5L3QB 3KPYA 4LPKA 4I6EA 4X8LA 4N48A 2HK8A 1T1JA 2J3JA 3BIFA 4V0MA 2VJQA 3UAGA 3F3KA 5BYAA 2Q2WA 3K30A 4A0FA 3ZWWA 3N87A 1G64A 1NVXQ 4FHCA 4CT4B 4L5AA 3SKXA 2ZWAA 3RYHA 3I9NA 4GI7A 2FPXA 3H6KA 2AEFA 2OP1A 1V8FA 2PKQO 2Y0EA 4JN6B 4KQCA 1MMFB 2QENA 1GZ5A 2RH8A 3H5WA 1Z08A 3IUNA 3NKFA 1X77A 2HHCA 4FQ5A 4NQRA 4S0ZA 1XTQA 1P80A 2EWVA 1RRFA 1ZIPA 1UWVA 1XZFA 1YOVA 1D8AA 1NL3A 4JCCA 3B6MA 5HPYB 1H22A 1RNLA 2D1YA 2EFDB 2RGDA 1E6WA 1Y1SA 2WFLA 2Z56A 4IH4A 5DF1A 1DBRA 3RS4A 1JIUA 2BUBA 2YVKA 3GMTA 3WQHA 5BUZA 1V1MB 1BX3A 4EEXA 3VAZA 1CJVC 3QVGB 4HDAA 5EE1A 3WDMA 4E4TA 3EEBA 3PI7A 4GC5A 3LGSA 3PFKA 5HOEA 4GZ6A 1A95A 3NVDA 3OOHA 3QUBA 3E03A 1PT9A 1IZ7A 5IEBA 1DEAA 3WWEA 2N0SA 4QT0A 2O1WA 2FFRA 4PQGA 1C3VA 3W5JA 1CIPA 4MCIA 4QQRA 5BORA 3ZIAA 1RXCA 4RACA 3CWQA 3ODPA 1V26A 1HE5A 2IIQA 3F97A 1ECLA 1UF9A 3T6KA 3SXJA 2NZVG 1PW7A 2Y99A 4KAAA 1V95A 1FDVA 2J7PA 2ZUUA 4GL4A 3TNLA 5LP6F 1U3DA 1ND6A 1FTSA 5AHOA 5IKMA 4GNKA 4XJVA 1K8YB 1C1HA 2PR7A 1TKAA 3NORA 3HUDA 3PS9A 1F3OA 2P6UA 1MFPA 3NHUA 1ZISA 3OECA 2YXDA 2ZSDA 4BMSA 3UA3A 3UGTA 4X44A 1HL7A 3FWPA 4OKNA 1JHZA 2B92A 3TFQA 3DZGA 1MPXA 1NBAA 4OJTA 3W5CA 1R4MA 2B1GA 2PGIA 4QIHA 3SC4A 1KZ7B 3KLNA 3RTBA 1Q2XA 3HJNA 2ZROA 4HDRA 2Q8NA 1T6XA 2OV8A 2YICA 3G79A 3K1TA 4WOCA 3KJXA 5FNZA 1R0SA 2FEOA 2MSWA 5E9QA 3HYRA 4KFUA 1N78A 1IIBA 2B8EA 3NT2A 4A91A 1E9BA 3JZMA 3UGKA 4WJLA 4LMRA 1XDZA 3EIOA 4H27A 5AR1A 3ETGA 3PUWA 4B45A 1N3YA 4UE6A 5D6NA 1KYQA 2VL7A 1N1EA 3FDJA 5FORA 3S40A 1YZFA 2O8BB 3WRXC 3DDWA 1VA4A 3D6TB 5DULA 1KZGB 2RAVA 3QF7A 2OBMA 2XSZD 3QXCA 3N2KB 4GC9A 4L4ZA 2I6FA 4R98A 5KWJA 4YR9A 1RKVA 3MWGA 3ENKA 4TWJA 4NCJA 3TMAA 4NY1A 3O3MB 1RBMA 3SHTA 4QE3A 4HVCA 4YRPA 1EGQA 1C4XA 1XE3A 2BFEA 3U0VA 4PX5A 4ZVLA 3V4ZA 2ZU0C 5EXTA 5I3CA 4L3VA 1QHEA 3TLKA 4C2TA 1F9AA 4NHOA 3E84A 1RYHA 1MO4A 3RS3A 1JQEA 1AD2A 5BMVA 1IB0A 2GSDA 4AY3A 2W42A 4GLJA 5BYKA 5AVQA 1XRLA 5JMPA 4Z9BA 2EG5A 3DQZA 1YJ5A 1L3IA 3REOA 4YYZA 2ODNA 4FTWA 4KITB 1E4EA 3R6TA 4A3SA 5LZ8A 2HADA 5TMBA 5F77A 1EP2B 4D1YA 3D4PA 3QVOA 4RA9B 1OF1A 5CJ2A 1PK9A 4DB2A 2XT6A 4F3NA 1QB7A 2OKCA 4FFWA 2CDRA 5C8XA 1MJGA 5ITWA 3S2YA 1JLLB 2QVCA 4D0RA 1LGYA 4D0GA 1KQ3A 4XYLA 1N5KA 1QFSA 1XKXA 5DTEA 1V96A 4FZJA 2ZSEA 3PPXA 3W6UA 2YL2A 1NN0A 2QLNA 1I3KA 1DTEA 2B34A 3R3JA 4Q4HB 3F7TA 3FVWA 5FR2A 1CY2A 2AX3A 2A7QA 4FVTA 1E1MA 3WHIA 4I19A 3CRNA 4P5PA 4WNYA 2FMXA 1LC0A 1QFJA 1JAZA 2XE7A 2C83A 1YUBA 2Y1DA 2AYYA 3FSRA 4KL8S 3RRXA 1UP6A 4N0QA 1P74A 4ASUA 4GDFA 4QUGA 1DRJA 2XADA 2CFCA 1YMUA 2VHWA 4HR7A 4IJKA 1IN7A 3VGPA 3A1TA 4PCVA 5JDCA 4I55F 4ZHQB 3G9QA 2ZREA 1FRZA 3ODGA 3VYUB 4E5SA 3NDIA 1T36B 1TF2A 1PZFA 1SBNE 2FAXA 2XTAA 3QFHA 4NEGA 4Z4IA 2H1CA 3M6VA 1JG4A 4EEZA 3QY9A 4JBLA 3AKCA 5CFMA 4BU1A 4AKGA 4OD0A 4R9VA 3W9BA 4UULA 5GIOE 1GRCA 1O97C 3GX1A 3C14C 4FU0A 3AJAA 1PG2A 1UKAA 4QWMA 1EM8A 4YMSA 2V0GA 1IMJA 5TMPA 3KB1A 1JXQA 2B7CA 5LA6A 3UY4A 4CLOA 4HN2A 4OGGA 1GAJA 1IVNA 2BISA 1KYIA 3C3CA 1T0JB 5LNK1 3JZIA 5B37A 3RBZA 3ELWA 3MWYW 4IDNA 4BTVA 3UJNA 5A0VA 3N2GB 4ND8B 3U81A 3X1YA 3S99A 3ZU4A 4BX0A 4EHFA 4X7MA 2DPLA 2FJPA 2XD4A 1TVCA 2JLRA 3INRA 2JFWA 1FYEA 5EP1A 2QZSA 3NBFA 4JZKA 2IU4A 4L75A 3DKVA 3SWWA 3HKEA 2OM2A 2QYSA 1M8FA 1H2YA 3U61B 2D0DA 4II3A 2V4ZA 1OC4A 1LS6A 4OUKX 2P11A 2XJ9A 3AKZA 5F3DA 2XECA 1K86A 1N2CE 2A67A 2EJWA 3SJUA 3BSWA 5EJEA 3EPRA 4RNCA 5CM2Z 4OP2A 2AZ4A 4JIMA 2GPJA 2ZFUA 4N8SA 1EWKA 2MCFA 5JUWA 1TUIA 2CDNA 4F1KA 1L7XA 5BQ5A 1MEJA 2ZW9A 4XI9A 3PVCA 4OMUA 3ZS9A 3DEJA 3HVIA 4B2LA 2RGGA 2FFAA 1TD1A 4FW9A 4BQEA 4D0LB 1KQOA 5DP2A 1RLTA 1F1BA 1R6DA 1WS6A 1DTSA 2JGDA 3A7EA 3NNSA 4M88A 2UZ1A 4FGLA 2NTYC 2C3YA 3ZDAA 2I34A 2WSIA 1PL8A 4QUBA 3ZCRA 4TLAA 1JU4A 5A06A 2EAUA 1P5RA 3UAWA 4E32A 1BG6A 4I9FA 1QV9A 1CQIA 4UTRA 4D43A 2B2XA 3SEFA 1QV7A 4RKEA 4FXOA 1MF7A 1MIHA 4JJAA 3KYDA 1B6RA 4IXNA 4YFVA 3W79A 4FNGA 1J2YA 4DLAA 3AUKA 3VC7A 2B98A 4FFSA 4JJ7A 4J94A 3IEUA 3L3BA 3L4BA 4WGGA 1VHLA 5HFNA 2Z5FA 2B25A 1SR8A 3NYIA 3UJDA 4BKOA 3H42B 4ZXPA 2XUPA 3R7LA 5ITZA 4FLEA 5BVGA 1M2EA 1T2VA 3PQ6A 4TRRA 3W06A 3QYPA 4EMTA 2VTKA 2HK7A 2A5LA 2HQRA 3GYBA 4O63O 4B0PA 4YGXB 2HB6A 2FLKA 3PVSA 1SEVA 2QN3A 1D4FA 2QBYA 2J6CA 4C7JA 3GEEA 1XU4A 1YBFA 2GM9A 3D7LA 3MJVA 2XGJA 1ZMTA 5K0JA 1B2RA 1IM2A 4JBYA 5IT0A 1WBDA 5CLQA 1M83A 1YK0A 1BCSA 1JDNA 3GJ4A 4MS3A 1GG8A 4G97A 4JLUA 4ENRA 4XVCA 2ZAYA 2FR1A 3IAS6 4QPCA 3IQHX 1G4UR 4JP8A 3R77A 3LX6A 5EL0A 4XIYA 5JG7A 1YFKA 4E15A 1NIJA 1DGQA 2O2XA 2GHQA 4FOSA 3SJAA 4M0DA 3VNUA 4GS5A 5HGJA 4NU8X 4A2QA 3IR7A 3OWHA 1UT6A 5LD2B 1MNQA 1GV0A 3PK0A 2XHEA 3EG9B 1DOHA 1ESNA 1VLVA 5CDHA 5T3YA 3MCAA 5FUWA 1U2DA 1Q1NA 1SUCA 1I7SB 3CTMA 3BKXA 1LQTA 1BE0A 3EG5A 4V0LA 4QZVA 2Z2KA 4ARIA 2VSNA 1EYZA 3H2GA 3I0NA 3IIKA 4RE6A 2QUJA 3WYGA 3IQEA 3RR2A 5WRFA 1KY5A 4B7UA 1CG6A 3EXHC 4YRIA 1LNQA 1Z0AA 2H17A 4HH1A 3RS9A 2AI1A 1U1CA 3OD1A 3N39C 5EJFA 1QF6A 1MJ5A 1SXJD 2E9SA 1RHUA 3BWYA 3WL8A 4R69A 1XDSA 2H31A 4IINA 4ENQA 1CS0A 1ZWLA 4CMEA 1H5NA 5DOVA 5HRUA 2W70A 1VJGA 4UEQA 5BXQC 1M0SA 4TROA 1UIMA 2GUGA 1MQ9A 5TPWB 3TW8A 2W93A 5FLEX 2JKYA 3H4MA 2F8MA 4NP6A