5IDWA

Crystal structure of an oxidoreductase from burkholderia vietnamiensis in complex with nadp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
225
structure length
225
Chain Sequence
MKTVLIVGASRGLGREFVRQYRRDGWNVIATARDDASLAALRAAGAHAHALDIAQPEQIAALGWKLDGERLDAAVLVSGVYGPRTEGVETIGNEDFDAVMHTNVRGPMQLLPIVLPLVEDARGVLAVVSSRMGSIADATGTTGWLYRASKAALNDVLRIASLQTRHAACISLHPGWVRTDMGGAEAAIDPETSVTGMRRVIAEAGADVSRANGRFLQYDGVELSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Crystal structure of an oxidoreductase from Burkholderia vietnamiensis in complex with NADP
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
total genus 87
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5idwA00
1HZJA 2O3QA 2D3TA 3WSVA 2J3JA 5CG2A 5KJ1A 3NUGA 3RKRA 2DT5A 1E3SA 3IC5A 3TZCA 2Q45A 2VNSA 3ZHZA 4QTZA 1T25A 4NJMB 5JSFA 1Z45A 4UEJA 1ULUA 4ZN6A 3QVXA 3WBBA 3RUDA 3JQFC 1HT0A 3LQFA 1JVBA 1Y8RB 2ZTMA 4AL4A 3I4CA 4IMPA 3BMOB 4MP3A 3VH1A 3GAZA 2XOXA 2GN9A 1EFLA 3FN4A 5GZ3A 5AQ1A 2E37A 3VHRA 1V3VA 2IZ0A 1PS8A 1HEUA 3OA0A 4Z0HO 3A1NA 1OFGA 1FF9A 3E5RA 3FNGA 4J2OA 1JWBB 1XYGA 1H2HA 4DLAA 1U3VA 5JYDA 4QQRA 1DIRA 4E2WA 5EESA 3ZN2A 2WSBA 4J1TA 5I8ZA 3UH1A 3S1LA 2EJWA 4NU6A 1B7GO 2Q99A 5H81A 4YWJA 3LC2O 2X6TA 4UUMA 2IDZA 3VH2A 2DFDA 3JTMA 5K6AA 1I8TA 1DJQA 3WTCA 2NUAA 3GK3A 3P2OA 5F1OA 1EQ2A 2BKAA 3ZZNA 3FBGA 1NFRA 3L4BC 2PZKA 4RZIA 3RUAA 3TQHA 2GD1O 3GPIA 1NYTA 2JFHA 2OBNA 2JKVA 1KEPA 5EINA 3NDRA 4FJ2A 5TJ9A 1KC1A 3GY0A 4RPHA 5JO9A 3D4OA 3L6DA 4PG6A 4GKVA 1YO6A 2HMVA 5JAQA 2RBEA 5CG1A 4YDRA 3K8ZA 4DBZA 3CZMA 5B4VA 4CQMA 4PIVA 3Q2IA 1SNYA 4OHUA 1B26A 3PZRA 4TZKA 5IFLA 2F00A 3AM3A 3ICCA 2O3UA 2A9FA 3NGXA 2PZLA 3M1LA 1WDKA 3AK4A 4Z0PA 3QV1A 4PLPA 3TL2A 3OHSX 4YCAA 4ESOA 4EJMA 3Q3CA 5U9CA 1F12A 2Q2WA 2EWMA 2WM3A 1ZW1A 3ZHYA 2HCTA 1GPJA 4JP2A 5DF1A 1T2FA 3CEAA 1E5QA 2AW5A 4HUJA 2F1KA 3O4RA 1YOVA 4B8ZA 2NVUA 3DTTA 3UKOA 2O23A 1ZMOA 3VVCA 3BTVA 4KOAA 1WDLA 3FBTA 4I5EA 5CEEA 4LK3A 4PLZA 2HRBA 1H6BA 3JSAA 1O0SA 1UP7A 3D64A 2YQ5A 2H6EA 1ZUD1 1NXQA 1L7DA 4D42A 4X54A 2CD9A 1DOHA 2E82A 3FHLA 1OC2A 2X0NA 2AE2A 3C24A 2PH3A 1YB1A 3WIDA 1MG5A 1HETA 3GEMA 1MC5A 2JCVA 1G0NA 2ZB3A 4WOKA 3SC4A 3U4HA 2DLDA 3A4VA 1MFZA 3I9MA 2PY6A 1BG6A 4GI2A 3EMKA 3GVHA 4UULA 4AJEA 1IE3A 2WE7A 4WECA 3TL3A 1CF2O 2J5RA 3I4FA 4R1NA 4Z9FA 3IIEA 1ZJYA 1BXKA 4IQ8A 1U7HA 5GZ6A 4CMIA 1CJCA 4E5KA 2P9CA 2EHDA 4U6SA 4B3JA 1N5DA 2X5JO 4WLOA 2LDXA 4L4SA 1E1NA 3KV3O 3HB5X 5B37A 1I3MA 2A94A 1N9GA 3RBVA 1D7OA 2QG4A 3GC6A 4PLYA 1VRWA 3SBOA 4BO4A 1NX6A 1F17A 1XA0A 3PI7A 3PTZA 2PA3A 5TSDA 3PGXA 3JQBC 3L4SO 3WGHA 2NACA 3AI1A 4XJTA 4NMHA 1KIFA 4D43A 2ZTVA 3VKVA 1HDRA 1X0XA 3CH6A 4TMFA 1VPDA 2O3JA 1ZH8A 2P68A 4MJLA 2CF6A 1BVRA 3PVZA 4BO9A 4YB8A 1WMAA 3PGJA 2VN8A 1J49A 5AXCA 5BR7A 5A05A 1MX3A 2QX7A 3Q6IA 1TT7A 5DOVA 3JD2A 3IKTA 2WWRA 3MJSA 2QYTA 4E2YA 2DBZA 2VYVD 4MIOA 2J3KA 1YDEA 5DCYA 2FZWA 4FOOA 1DB3A 2HU2A 2DUWA 1GPDG 2Q1WA 2Y1EA 3PHLA 3KYCB 5JDCC 5U1PA 4Q39A 2E6UX 2A92A 3AI3A 1GUYA 4PN3A 3WB9A 3K96A 1GZ3A 3QSGA 4FJ0A 5BQFA 4WCFC 5IF3A 5DCUA 1TLTA 4NIMA 1VL6A 1V6AA 3ADPA 3L6EA 3QLJA 4YAIA 1UZLA 4E5NA 3ZU4A 3CMMA 2XPCA 1UZMA 2I65A 4XIYA 1U3UA 4I9NA 3H7AA 3WR5A 3H8VA 2FSVA 4LCJA 2DU8A 4BV8A 1OC4A 4YJFA 1ZEMA 4MVJH 1BWSA 1B15A 2JCYA 4BNJA 3GVPA 4INAA 5F21A 3KUXA 2D0IA 1QV6A 1LBEA 3V5NA 3LF1A 1LDEA 2R00A 4HFRA 1C3VA 1DRUA 3G17A 3PP8A 3E9MA 1U3WA 1DJNA 3RC1A 4QO8A 4OMUA 8LDHA 3QE3A 1TT5B 1EBUA 4GL4A 1Z7EA 3O38A 3ORFA 5JCJD 1DHTA 5A9SB 4WOJA 3MJEA 4B8WA 2VWGA 4C7JA 1NAIA 3WLEA 3RAJA 3TNLA 1JKIA 4FFLA 1NASA 1P0FA 1P44A 2B5WA 3AFMA 1EE9A 4PG4A 1ZK0A 1Y9EA 3X2FA 3ASUA 1JVSA 4M86A 3RASA 4HWKA 2HO5A 3HNPA 4MDHA 4BGUA 3HZZA 1DAOA 4MVJI 1PL8A 1P3DA 5IXYA 4QFCA 1WZIA 1GQYA 2D5AA 3H3FA 3GDFA 2WTBA 3DZBA 3BHMA 2HKIA 1T2DA 3NT2A 1YL7A 3QWHA 1QV7A 3M2PA 5JMWA 1WPQA 3VDQA 2FPIA 3KLMX 2QRJA 3FWNA 4BHTA 2GLXA 3QY9A 4BO7A 5AXDA 1B8PA 2R6JA 1T1RA 3ETGA 4RF5A 4URFA 3TPCA 2XXBA 4E31A 3VPXA 2V65A 3RI3A 5L4SA 2VTDA 1ZKMA 3UCEA 3EZLA 2VHXA 1IL0A 4BNTA 4ND1A 1DFHA 3MJTA 3VZQA 4GH5A 3RFVA 3WGOA 5L95A 3ONEA 4D0SA 4J7CA 4NNJA 5TIIA 5L53A 1GQQA 3PHHA 1DSSG 3H5RA 1I32A 1SPXA 4FFOA 5F5LA 4PG5A 4YJGB 1BXZA 4PZCA 2B4RO 3IDSA 4MVJE 1EK6A 1CWUA 4G2NA 3LLSA 4FPXA 1PQUA 1KY4A 1E7QA 2HQ1A 4R16A 1AXEA 5KVSA 1Q7GA 1WW8A 3QWFA 2HRZA 3QP9A 4GSKA 1N7HA 4JN6B 2O3SA 2FOIA 2VNAA 1LA2A 3AOEC 3PLRA 1BGVA 4CLOA 1GR0A 2H9IA 2Z1MA 4EJ0A 2GPTA 3VDRA 2J3IA 3U0BA 3I9LA 5DCWA 1PR3A 5I7EA 4K6FA 5LC1A 1LLDA 1QYDA 4NBVA 4H7PA 1OI7A 1U9JA 2C0CA 3TZ6A 4GKBA 4OQZA 2GCGA 3RWBA 4IDFA 4RZHA 3GA0A 3NDJA 1OMOA 1TXGA 2Y0EA 3N58A 1XQ1A 4ALJA 2VOJA 4R4JA 4B7XA 3NTQA 3MJ4A 4GGOA 2ZK7A 2ZYAA 4DQXA 4IZHA 3I23A 4BMNA 2DQ4A 3FNEA 4BOYA 5AXAA 3IUPA 1CQIA 1UDAA 1PGOA 2B83A 2NTJA 3JD3A 3I9KA 5DP1A 2CDBA 4NHEA 3DBLB 4R1UA 4ALNA 4AG3A 2P9GA 3GNTA 4YR9A 3IMFA 1VKNA 1CDOA 4DIOA 3MTJA 2G76A 1Y8QA 3ZH2A 3RUIA 1F14A 4CMIB 1YB4A 1P33A 3W8DA 1SOWA 2RHRA 3RFXA 3Q9NA 2BELA 5K6AC 1DC5A 2OOSA 4P38A 1PGPA 1ENPA 4HFNA 3H5NA 4IY1A 3TN7A 5CDTA 1Z73A 5TLSA 4II3A 2NTNA 1MUUA 4D45A 4P22A 1DAPA 3INGA 1GAEO 4FBGA 1V9LA 1FDWA 2GZ3A 4QT0A 1G0OA 1HZZA 3FTPA 1JDJA 4B4VA 1MP0A 1LRKA 4J4HA 2VZ8A 4NH4A 3NDIA 4CR7A 2OMEA 4PZEA 1MXFA 2AHRA 5KJCA 3CINA 4GMFA 2AQHA 5JCJA 4BO5A 1GYRA 4L4XA 4CM9A 1BRMA 1YB5A 3V8BA 5F1KA 1C1DB 3KSDO 3B70A 5BSGA 3E1KA 3AOGA 3FRJA 4BB5A 3WIEA 2B4TO 1GADO 1QMGA 3QVWA 2VWQA 4GVXA 2ZYDA 3FF4A 2ZTLA 4N5NA 4A10A 2P4HX 4BMSA 3E6AA 4KWHA 4PFJA 2VTEA 2NU7A 1PEDA 3UUWA 3OQ6A 4M54A 3H9GA 4RV9A 1DIBA 3JQBA 2HLPA 4RPLA 1PX0A 5LCXA 4IDCA 1BHSA 1HKUA 1UZNA 2X1HA 3BIOA 4IIVA 3WICA 4DC1A 3KO8A 3OM9A 4EZBA 4BO6A 1DIGA 2IYPA 2PNFA 2EGGA 2NADA 2X22A 1NR7A 1C0PA 3GQVA 3EZYA 3PZBA 1ONPA 1UJMA 2NM0A 5F1PA 1FDVA 4PRLA 3BYZA 2JD2A 2GERA 3BHJA 3W6UA 1H93A 2BFAA 1K5HA 2UYYA 2GF2A 4UVIA 5A1TA 1QSGA 1K0UA 3H9UA 4L4RA 5JW6A 3OP4A 4XWYA 1E6EA 5CEJA 4H15A 3U5TA 4IDGA 5JAMA 5IZ4A 3HQ4O 4D3SA 3F47A 4J49A 2ZCVA 2HJSA 3TWOA 1YKFA 2DUUA 4E12A 1DDOA 2YDXA 1GUFA 2WJPA 1W8DA 4QX6A 5HBRA 3V2GA 1VJ0A 3B6ZA 4ID9A 4YJDA 5COQA 3RSHA 3S55A 5ITWA 3R0IA 1PWXA 3OIGA 4RCVA 9LDBA 3C3XA 1VE9A 1Z6ZA 5B12A 3ZWVA 1KBZA 3I9JA 4QXMA 2V6BA 3QW2A 1WLYA 4RPGA 1YRLA 3GDOA 3IJPA 1LU9A 3WMWA 1ZK4A 2B4QA 4GPD1 1RM3A 3C85A 1NNUA 3R1IA 1QR6A 2E49A 1U28A 2Q1UA 1QORA 2AEJA 4BGEA 3TF5A 4YT5A 4NFHA 3D0OA 3LT4A 3QWBA 1GD1O 4MIEA 4UVGA 1GZ6A 1V0JA 2WMDA 2FMUA 2FHSA 3JYQA 1RM5A 4XR9A 1ZSVA 4U0KA 1GTMA 3QA9A 2DVMA 2PH5A 2Q1TA 5EPOA 2DTEA 2EP7A 3SX2A 3GGOA 3F9IA 3STHA 3VZPA 4XKJA 3GGPA 1O89A 2GZ2A 3H2SA 2VZ0A 5CAEA 2QW8A 2PKRA 1D3AA 4Q3AA 2W2KA 4YT8A 2QZZA 5JC8A 1DHRA 4M1QA 2GUGA 2VHZA 4D46A 3E82A 2GYYA 5KKAA 1PZEA 3E18A 1V3TA 3ON5A 1Q0QA 1R4MA 4LCEA 1IZ9A 1A4UA 4J16A 2ZKLA 2CDCA 3BTSA 2VUUA 4WCDA 3SEFA 3ANNA 3GN2A 3OECA 2CVZA 1EUCA 2IEBA 4BKPA 3PPIA 2WD7A 3D5TA 1YQGA 1MG0A 4NK5A 4B3IA 1UR5A 4FDAA 2NU9A 3PYMA 2VQ3A 2ZTUA 2CVOA 3HN2A 1K89A 4R9RA 2R00C 4FFMA 5CDUA 3FNHA 3AFNA 1E1KA 1PGQA 4YTEA 4RLSA 3GZNB 4RF3A 1H6CA 4LMRA 4GAEA 1N1EA 2RCYA 4WNIA 1P1HA 4CV1A 1JAYA 3K5PA 1XCBA 4JBIA 1N2SA 5K0ZA 3JQAA 4AJOA 3EUWA 4IDDA 1ZVMA 4H3VA 4DGSA 1YVEI 3RKUA 4NFYA 3VPFA 2Q50A 4UREA 3PHJA 1GDHA 4YACA 4YQYA 1ZXLA 3VC7A 4BGIA 4RQTA 1KVSA 1LXCA 1V8BA 1XIVA 1N92A 1T4DA 4HP8A 5C7LO 3CSDA 4CMHA 2B5VA 1ZZEA 3DZGA 2BHLA 3D3WA 4CM5A 4A0SA 2RHCA 1C0IA 3RIHA 2GR9A 1WZEA 1SBYA 4TSKA 5LDHA 5TS3A 1Y81A 2Y68A 1AXGA 4ZQHA 3AOEA 2QYSA 3G0OA 1YL6A 5IZCC 1LSJA 5ADHA 1HDYA 3L9XA 1QP8A 2JHFA 5ES3A 4XGNA 3ZWBA 1X14A 2O7QA 3FI9A 4FFPA 4F6LA 4I1IA 3WGQA 3OSUA 4NU5A 4L76A 3ZHBA 1ZFNA 1HL3A 4D79A 1R0KA 3QRWA 3E5MA 1R4NB 3BTOA 3OFSA 3P5SA 4Y67A 2LDBA 3NX4A 4Z9YA 3KSZO 3DBRB 4W7IA 4CM6A 3T4EA 1AE1A 2QIOA 4LSMA 5I9NA 1P77A 4IDAA 1XKQA 1A4IA 2SCUA 3IP1A 3O8QA 2D2IA 4KQWA 3KB6A 3WQSB 5BSEA 1KS9A 4YJHB 3OQBA 4UVDA 2OFPA 3GFBA 4XYEA 1RPNA 1LDYA 3WXBA 2Q4EA 2EG9A 5HTOA 4FN4A 1DC3A 4Z6KA 4CLRA 1LRJA 2C29D 4A03A 2DKNA 4CM4A 2PGDA 4ZQBA 3I6QA 4I08A 3W4JA 5C5IA 4FC6A 1LQUA 4ZGWA 2HDHA 3DFUA 3ZNOA 4J4BA 3QWAA 3L07A 3LVFO 1ZO8A 4TROA 1RYDA 4FD3A 4B4UA 2BF7A 2FR8A 1WNTA 4BQPA 4J7XA 5KNLA 3RC7A 4R1SA 4D41A 4F6CA 1BW9B 1ID1A 2VCYA 2VRBA 3I6IA 4XA8A 3VTZA 2D4AA 3ETEA 1HDGO 1ONOA 1L7EA 2CFCA 4KQXA 2IEDA 1YH3A 2C54A 2P5UA 1AGNA 3F3SA 2FPPA 5IN4A 5COAA 1DIAA 3KM0A 4N5LA 4CM8B 2WDZA 3JD0A 5EIOA 4I5DA 1IZ0A 5KCZA 3I83A 4BO8A 5L45A 5BNFA 2O7SA 1UXIA 1M66A 1RWBA 4BUCA 5I7FA 1Q0LA 4E2XA 1PZGA 5HM8A 3HFSA 3JYLA 4KMSA 4I5GA 2BRUA 3KLPX 4PCVA 3GOHA 4MVJD 2X5KO 3SXPA 1EUZA 4UVHA 4XDYA 3UAGA 3ENNA 2OP0A 2QRLA 2EXXA 4IJWA 3E9NA 3C8MA 2EIHA 4DPKA 3PIDA 4ZA2A 4R01A 3ZWNA 1O5IA 1I3NA 4R41A 3WGZA 3DZKA 2JFFA 4HKTA 3WLFA 2GO1A 2G1UA 4IXTA 4WCFB 2Q46A 3WWZA 2I67A 4DVJA 4GWKA 1ADGA 4QSMA 5DT9A 3KYBA 4IGEA 5EQFA 2EJVA 2AQ8A 4E13A 5CP8A 4J6FA 5A03A 1LX6A 1Z82A 2NSDA 1H0KA 3ST7A 3E9QA 4M87A 3ZU2A 5ITVA 4DIBA 4Q3EA 4XDZA 4CUZA 2G5CA 1EFKA 4Q3NA 1C1XA 1HYGA 1DPGA 4BNZA 2JJYA 4BKQA 3S2IA 3JQEA 3KYDA 3LC7O 1M6WA 3G3EA 4KUEA 3UN1A 5A9RA 3C7DB 4NFSA 3JQGA 3ZWWA 2CSUA 5TJHA 3N74A 1LUAA 2EP5A 3PYLA 4AJ4A 1IB6A 1RYEA 2O3TA 2YZ7A 3DMYA 4U7WA 1NR1A 1FDSA 3PQEA 4LW8A 2Y67A 4NQZA 5EJ2A 1EEHA 5DBFA 3DAGA 4DPLA 2DBRA 4Q3DA 3RU7A 1U1IA 5KJ6A 4ALMA 2G82A 3L9WA 4FC7A 3PJEA 3V1YA 5TNXA 4RDHA 4RQUA 3DHEA 3PXXA 4P4LA 4Y6SA 3T4XA 4NG5A 1VSVA 2C07A 2HMSA 4UVEA 3MWDB 4MKXA 5JNLA 2YQ4A 1HDZA 2FP4A 5CDGA 1WVGA 4J0EA 2DTXA 1CRWG 3AY3A 1HYEA 3EDMA 4PG7A 1ML3A 2IE0A 1PR9A 1XEAA 4P4NA 1HE4A 3DFZA 3JQ8B 1E92A 2ET6A 2Q1SA 2AEMA 2WD7B 2W2LD 3ASVA 2IXBA 2BI8A 4OIMA 1ZCJA 4GLLA 1NVMB 5IAAA 1DLIA 4GQAA 4BO1A 3BMQA 3GPDG 5I9MA 3LC1O 1CERA 5T67A 4AJLA 3PRJA 4BV9A 1RM4A 5GZ1A 4IQGA 5G0WA 4P8RA 1I2ZA 4XZ3A 3DB2A 2PZJA 2YY7A 3BHIA 2I3AA 4RPKA 2P9EA 1YQDA 5AOVA 4FR5A 1NFFA 3A06A 1H9BA 2AXQA 4MVJM 1YJQA 1T2EA 4IDEA 3U09A 5L4LA 4OOFA 3JQ7A 1E3WA 4MVJP 2PD4A 1FDTA 3LYLA 4J1QA 4QO7A 1LJ8A 4I9UA 4L0QA 4RVFA 4DLBA 2AG5A 2HSDA 1HDXA 1DRWA 1E7MA 1XU9A 1KETA 1D8AA 1HWYA 4IBOA 2HAEA 2YHIA 3FPCA 4RVUA 1UXGA 4IS3A 4HADA 5T64A 2FN7A 1W6UA 4D7AA 1ENZA 3D3WB 4KDEA 3H2ZA 2X0JA 2UV8A 4WPGA 3N7UA 1MC4A 3BTUA 4ND5A 4G81A 1GV0A 2YFHA 2NTVA 1LSUA 3MOGA 5FI5A 1K2WA 1QXSA 3F1LA 3C1TA 4WNCA 4JCOA 2Y1CA 3VH4A 1QYVA 1LDGA 3DBHA 3KEQA 4ZQGA 4CM9D 4Y6PA 2IZ1A 2VZ9A 1PJ4A 3CPSA 4KTTE 3WOHA 3LLVA 3EC7A 1U5CA 1IOLA 4OH1A 5JXWA 3ZWOA 4C7KA 1LDBA 4L74A 2AE1A 1NVTA 3EW7A 4XX0A 3ZU5A 4O63O 4EUFA 1I2BA 3KXDA 1YBAA 3ZNQA 1GCUA 3PHIA 4MVJA 4LSWA 3BAZA 3WJAA 3UFXA 3AW9A 2NNLD 1DFIA 5IZCA 2VOEA 4M49A 1HE5A 3TFOA 4JX8A 3MZ0A 3SC6A 1VKOA 1GEEA 4R68A 5EERA 4XRGA 2XXJA 3AUSA 1D1SA 1I30A 3L77A 4O5OA 2Q2QA 5A04A 1QLHA 1N8KA 3ANLA 1A72A 1BDMA 1EUDA 3RJ9A 3EY4A 3HE3A 3KRTA 4U6QA 3DMTC 4AJPA 4LRSB 1A27A 4R1TA 3F5SA 2I6TA 1WXDA 1H6AA 3IQDB 2DBVO 5JFOA 4BNNA 5IDYA 1NM5A 5DBGA 3RVDA 1E1MA 4O1MA 5KVQA 2PWZA 4DLLA 3EAGA 6ADHA 1ZJZA 3I9NA 1M75A 3WMXA 2IXAA 1ZK3A 3NGLA 1LLCA 2CF5A 3V2UA 4IPTA 3TFQA 4BNLA 5KJFA 3KSUA 2PZMA 3VKUA 2EKQA 5IDQA 3DBVO 3IOYA 4CQMB 3ONFA 3FCOA 3A14A 1YBVA 1NBOA 3B1JA 1P9LA 1M6HA 3GEDA 3RBXA 1I3LA 3UCFA 3KTDA 4NBTA 4BNGA 1R37A 4PRKA 2Z95A 4K26A 4GLOA 4JBHA 1IPEA 4OL9A 4IQ0A 5JLAA 1UXHA 3IKVA 5TRTA 1GU7A 1JW9B 1YE3A 3ONDA 1YXMA 5CDSA 3ZDFA 3INTA 1EVIA 1T2CA 2JCXA 4RVHA 1WWKA 1PS0A 1YOVB 3OH8A 2X8LA 1PZHA 2Y1FA 4FFRA 2NVUB 1I36A 2Z5LA 4ROSA 2UUPA 1B8UA 4DRYA 1MLDA 3FWZA 4Y9DA 4J3FA 3CXRA 2CZCA 2Y1DA 4FOSA 2PV7A 5G4LA 4BKRA 4RF4A 1PJSA 1E6UA 2W2LA 1R0LA 1ZEJA 3M2TA 4FW8A 2JAHA 3AU8A 4TKLA 3WYCA 1X7GA 2B0JA 4IM7A 1ZSNA 2CMDA 1L1FA 1OOEA 3VOSA 5L7WA 1X7HA 4RF2A 4GMGA 4PG8A 4RVGA 3GGGA 4CMKA 4YT2A 4DBVO 4CLDA 2WYVA 4DIFA 1F8GA 3JQ9C 1EVZA 5JY6A 1EVYA 2IYOA 2ZIZA 1KVRA 2YV2A 3HWRA 5A06A 4MP6A 4K28A 2AQIA 4NZ9A 4XB2A 2G0TA 4B4WA 2C2YA 3FSRA 1P1FA 3U4IA 3JQGB 3DZJA 1ZNQO 5HWSA 4YA6A 4ZD6A 3NTRA 4Q3BA 4NDNE 3WFIA 1K6XA 4AVYA 3O26A 2X86A 1M67A 4AJHA 1JA9A 1N9GB 3K9QO 3OF2A 2O3RA 1UXKA 3RUFA 3GH3A 1E7YA 4WLVA 4YRAA 2FPGA 1PTJA 3H6KA 1KEWA 1Z74A 2NQ8A 5DOZA 4EI2A 2AG8A 4R51A 4CMAA 3CE6A 1JQBA 4DTIA 1P74A 3OIDA 4LMPA 4NJMA 4XJSA 2ILTA 3D4PA 4FGWA 4E0BA 3EYWA 4LGVA 3JQAD 1Y7TA 4MOWA 3DOCA 3OA2A 1KVUA 2O2YA 4AJIA 3FR7A 1E6WA 3BMNA 1WMBA 1VSUA 5K9ZA 1Y8RA 2GN8A 4J1NA 3INRA 4BNYA 3BMOA 1LC0A 5C37A 4NPCA 2EF1A 5KTKA 3I5MA 1SB8A 1KERA 3MEQA 3G1UA 4G5HA 1K3TA 4JQCA 4LRTB 5TQVA 3T7CA 5JYEA 1UDBA 4S3MA 2I76A 5BSFA 4MINA 3EK2A 2ZATA 1LLQA 2X23A 1T2AA 4IDBA 4OXNA 4WJZA 3S2EA 4RVDA 3NYWA 3KVOA 5COBA 3ANMA 3ABIA 4R5HA 3JQCA 5G4KA 3UF0A 5MDHA 4YAGA 1LSOA 1U4OA 2ZJ1A 3PHGA 1NTOA 4D0RA 1X0VA 2YV1A 4IINA 5TC4A 1JN0A 3ROKA 4XIJA 3GHHA 1VI2A 1VM6A 1TEHA 2VYND 1XSEA 3RUHA 2FY8A 1ISGA 1SCUA 2IRWA 4NBRA 3CIFA 4FJ1A 4W7HA 3OETA 2D8AA 4MIYA 3UHAA 2EW2A 1NQOA 4XQEA 2GDZA 2O4UX 4ND2A 3P7MA 4YJFB 3H9QA 5F3RA 5L4NA 3S8MA 3R6DA 3VH3A 1UP6A 3DONA 3K92A 2HMWA 2VUSA 4XEHA 4CR6A 3VPGA 3U49A 3U3XA 3PK0A 4JNKA 3RCBA 4B7UA 3DQPA 5CDYA 4PLGA 1IULA 4CR8A 2Y1OA 4O0LA 2DBQA 3FNFA 1W73A 2VRCA 4DREA 1EZ4A 1U3TA 3JQ6A 2WYUA 4HNHA 5HS6A 2EKLA 1MXHA 3SLGA 4AJ1A 2NLOA 1KEUA 1PGNA 3M1AA 3TZHA 3VPHA 3PQFA 4K1LA 4CMEC 1DIHA 1UAYA 2Y99A 4UUOA 4CL3A 3B1FA 4AJNA 1PL7A 2OHXA 4OOEA 3VZRA 1LLUA 2H63A 2D1YA 2OGUA 1C0LA 4GGPA 5EQDA 6LDHA 4D3FA 4L9RA 1AUPA 1P1IA 2DPGA 1H94A 2VWHA 4Z9XA 1O9BA 2FR0A 3K73O 1UH5A 1X7DA 3OJFA 4QEDA 1E7WA 3U4DA 3OJLA 1A9ZA 4L73A 5DP2A 4B7CA 4BNKA 2Q2VA 2V7PA 1T1SA 3OQ1A 1RM0A 4E21A 3PEFA 4KP7A 3PQDA 4JJGA 4OSOA 4CLXA 2BGKA 4CQLA 2YDYA 3TSCA 4HFMA 1BSVA 4LN1A 3I9OA 1LEHA 2HK8A 1S6YA 1X1TA 1O6ZA 1J0XO 3GMDA 3KEOA 3DWFA 4FFNA 4CUJA 1ADBA 1BMDA 4NK4A 1AHIA 5IN5A 4IXWA 1XGKA 4N18A 4BKUA 4CV3A 5BSHA 3A28A 3H3JA 4XQ9A 1XQ6A 4LVCA 2I9PA 2GZ1A 2PKQO 3GMSA 4U5QA 2C5EA 1KY5A 5TX7A 2GRAA 3JD1A 4GWGA 1B16A 2BD0A 1HDOA 4RL6A 3D5QA 1UAGA 1SZJG 1PQPA 3CZRA 1W4ZA 5DZSA 4FGSA 1B8VA 4MP8A 1ISJA 1MB4A 5L3ZA 5A3JA 1YQXA 2Y0DA 4E6PA 3ZHXA 4FCCA 4AFNA 4HBGA 2DM6A 5JC1A 5ILGA 3GLQA 1ZSYA 5BNIA 2C7GA 4NJOA 5JE8A 2JL1A 4PLCA 1P45A 1PJ2A 2EKPA 1PWZA 2P2SA 2YHUA 2ZQYA 3DMTA 4XGKA 3RFTA 4BNHA 1GUZA 4I5FA 4CLHA 4J2HA 4CLOB 3AUAA 4EITA 4EJ6A 2B36A 2J5QA 2PGJA 3FR8A 5A9TA 2O50A 3GFGA 2GSDA 1FXSA 1G6KA 1PL6A 2A35A 3Q0EA 4RPJA 4B79A 4J9UE 5GY7A 2X9NA 5T5QA 1JWAB 4JK3A 2CY0A 3ROMA 3GNSA 2YV3A 1DRVA 3IS3A 4YQZA 3H5AA 1KEVA 1JAXA 2FSSA 1EQUA 3SVTA 3VTFA 3AU9A 1GFSA 2I3GA 4KTVE 1BVUA 5G0UA 4EYEA 3PWKA 3UICA 3HB4X 4J7UA 5ENVA 1UDCA 1R16A 1E3EA 3H9JA 4W9NC 5ER9A 2OL4A 4BNFA 4CMCA 2BFOA 8ADHA 1T24A 3RU9A 4CLEA 5KIAA 3ZGYA 3DC2A 1D4FA 4R5MA 1V3UA 4E33A 3C7AA 5L40A 1E7RA 3DZFA 1DLJA 1GL3A 4R3NA 4XB1A 2PLAA 5A4DA 1MV8A 4U8GA 4YAKA 4J91A 3AJRA 2JFGA 2EW8A 1Y8QB 2VYNA 3OJ0A 4EEXA 1NPYA 3ROPA 3WG9A 3W4KA 3W6ZA 1DO8A 4Q3CA 4GBJA 3I52A 1XLTA 4BKOA 4OKNA 3NAQA 4XRRA 1Q0HA 2AMFA 1EE2A 1YS4A 3W4IA 3HDHA 2UDPA 5I8WA 1E3IA 3HDYA 3RQSA 1X1EA 1TT5A 3C1OA 4Y8VA 1PJTA 3GN1A 3NT5A 3LT2A 5A9SA 5L9AA 3MTGA 4YRDA 4BNWA 3R3JA 4DL9A 4RVSA 1I33A 4WEQA 4TWRA 1HTBA 3T7EA 3Q1LA 3JQ9A 3RD5A 3KOUA 4YVFA 3ZV5A 1VC2A 4AJJA 1O8CA 2J6IA 3IJRA 4B3HA 1QRRA 2W8ZA 3AUTA 5I9LA 1OZAA 3BMNB 4MVJF 3AUUA 2V6MA 3D4NA 3H9EO 3TOXA 1U5AA 4P4GA 3SJUA 1WP4A 4BO2A 3JYPA 1K6IA 4EUEA 1DC4A 4RO0A 3JD4A 1E3JA 3PYXA 1U7TA 5T57A 5JBIA 3ZWAA 4MVJG 4BVAA 3P19A 5IJZA 4EGFA 4CPDA 3KHUA 2GN4A 1A7KA 4II2A 3TZKA 4HXYA 5H83A 5G4KB 2VHVA 1JKJA 4L8VA 3CKYA 4PLHA 2ZB7A 4ONEA 3GRKA 1F0YA 3QIVA 2X0RA 1T4BA 4LISA 3MJVA 4YRBA 1H2BA 4W82A 2C2XA 1CEQA 2FWMX 1PJBA 3ETDA 4XR4A 2ZCUA 4CUKA 4E5YA 1HSZA 1B2LA 5CHEA 3DZIA 1BDBA 3GR6A 1SB9A 4NBUA 4ZRNA 3RC2A 1QYXA 4K6CA 4OKIA 2V6FA 4ZHSA 4GVLA 4JBGA 1PU2A 4MO2A 2IODA 5I7SA 1PJCA 1NPTO 1DEHA 4JXKA 4BO0A 5CFZA 1S7CA 2RH8A 1ZK1A 5A5FA 5LDGA 1XHLA 1SAYA 5CPBA 1B14A 1LRLA 2HK9A 4CM1A 2WEKA 3Q11A 4YJGA 4A27A 3HJAA 1LTHR 1Q7BA 1ULSA 4NR0A 3TRIA 5ILOA 2P5YA 3PIIA 1I5RA 4JGBA 4ZQFA 3BZUA 1IHXA 3NRCA 4JROA 4PVDA 1ISMA 1Z7BA 4R54A 4WLNA 3PDJA 3PFFA 4WLUA 3PLNA 4OAQA 3JYOA 4WEOA 3LDHA 4YXFA 3NTOA 3TZQA 2X0IA 3ITDA 2RH4A 3W8FA 2PD3A 3GAFA 1E0DA 3G1TA 3ZWPA 2PK3A 2WYWA 4FS3A 1NP3A 1XU7A 4KUHA 3WS7A 2D5CA 5T8KC 3X2EA 5U4QA 2W4QA 3O9ZA 3PFWO 3AI2A 4BL5A 1IUKA 4FSHA 4J90A 3F4BA 1HLPA 2VWPA 4K9DA 4CMJA 2Q3EA 1GYPA 3U62A 3WGTA 2DAPA 2VHWA 1A9YA 1YJ8A 4ALLA 1KOLA 2PD6A 3JQDA 4OM8A 3OICA 4CQLB 3UOGA 3RROA 1NHWA 4TRJA 2Q49A 4UUPA 4R9SA 3S2FA 1EDZA 2UVDA 5G0TA 3DBLA 4CODB 2FR1A 5KJEA 1HXHA 3WYEA 4JP3A 1T26A 4DXHA 1BXGA 2W2KB 5ENDA 4RJTA 4CMEA 1RKXA 3PJFA 2WD8A 3QVTA 4WKGA 1Q7CA 4YPOA 3FTNA 4BNUA 3HG7A 2JHGA 4EBFA 4TRRA 1DXYA 4YEDA 1C14A 1C0KA 1DFGA 3WQQA 1R4MB 3HUDA 3V1UA 3ZWXA 4UEOA 2B37A 4BB6A 4BMVA 4R3WA 1SOVA 3JYNA 4ZQEA 3QJ5A 3LZ6A 1E7SA 1U4SA 5L7YA 3TJRA 4IUYA 4BS9A 1ORRA 3F5QA 4OXYA 5B4UA 5HS4A 4N7RA 4G65A 1ZK2A 2CUKA 3WBFA 3ZI0A 1NPDA 4XQGA 1E3LA 4ILKA 1HYHA 1UUFA 3D7LA 3IP3A 3MOIA 3RC9A 5B1YA 3PJGA 1I10A 3W8EA 2P91A 2GASA 4PLVA 4NBWA 2Y0CA 1SC6A 2C20A 4FQ8A 4QUKA 4UEKA 4WUVA 1JTVA 2AA3A 1C1DA 4N54A 1PSDA 3JQAB 3M6IA 3ULKA 3ROQA 3QVOA 1IYZA 3NT4A 1X15A 3MJCA 1CIVA 2R2GA 4OSPA 5EL0A 2BFPA 1ADCA 2YUTA 2ZB4A 2HUNA 1OAAA 4W4TA 4F3YA 4YT4A 4IS2A 1XDWA 1YBMA 3DR3A 3L6OO 2E4AA 3RJ5A 1TA4A 1X13A 3GVIA 5G0VA 3WGGA 2Y66A 4XYBA 4CMBA 3K6JA 3IAHA 4IGFA 2BGLA 4JLWA 3ZWMA 4DQVA 1TVEA 1YDWA 4E5PA 4DQUA 3GDGA 4DUPA 3DDNA 4U0JA 4GX1A 5IDXA 1NWCA 5KOIA 3DHNA 1B0AA 5DULA 3ZV3A 3AM4A 2YYYA 1ARZA 3ENKA 3KZVA 3LT0A 5L51A 4WASA 1SEVA 3TDKA 3V2HA 4OGWA 1HLDA 4MKZA 2EERA 2X5OA 5G0SA 2G17A 2W98A 4YBZA 5C3MA 2RAFA 1KYQA 5FF9A 5B4TA 4YAEA 2OBYA 2QHXA 1EVJA 1KVQA 2ZJ0A 2OP1A 4FIZA 4O6VA 3DOOA 4E32A 4DMMA 2IZZA 1ZXBA 4W9NA 1CQJA 3HSKA 3ICPA 3WNVA 3O8QB 1E5LA 3UXYA 3K31A 1EDOA 4IMRA 2VT3A 3ZW8A 1LNQA 1QLJA 1H5QA 2JAPA 4KWIA 2TMGA 1F06A 1HDCA 5KWEA 3S2GA 1Q1NA 2V6GA 3DXFA 4GX0A 3WQRA 4W6ZA 5JAIA 1HRDA 3G49A 4CLRB 3W1VA 2D59A 3ZWYA 5JDIC 5IXSA 4PLTA 4CM4B 4KZPA 1LC3A 1E77A 1ISHA 3OBBA 4CL8A 3ZNPA 7ADHA 3CUKA 3D1LA 3DEYX 3Q9UA 4CM3A 1GQ2A 2J5KA 4M55A 4DA9A 5JAZA 5TT0A 1HE3A 5J23A 5FI3A 2BI7A 4QFDA 3EHEA 2QRKA 1QKIA 3GUCA 2FZEA 1TB4A 3E8XA 1GCOA 1PJQA 4EEZA 1H6DA 4Y98A 4RORA 3WNQA 4BQRA 3AY7A 3JCZA 3QVSA 3AWDA 2FRDA 4PGFA 2O2SA 4TQGA 3I1JA 1HF3A 3IUSA 1PJ3A 1U8FO 1Z75A 4GSLA 1YWGO 3SJ7A 2RIRA 2VRCD 3NJ4A 3ZV6A 3VAZA 2X7HA 3GF4A 1I0ZA 3OEYA 4AICA 2UAGA 5L7TA 2DFVA 1SO8A 3WSWA 3OJOA 4S1VA 4XGIA 4IJUA 4HV4A 1JU9A 5KVVA 2BFMA 3JQFA 1U8XX 4Z3KA 3JV7A 1I2CA 2I5PO 3HFGA 4M89A 1NVGA 3BMCA 4CJXA 3DZHA 4ITUA 4DYDA 3Q2KA 4J9VA 1YONA 3HHPA 5KVCA 2XF8A 1ZMTA 4KUGA 2J3HA 3GUYA 1HE2A 4CMGA 5I7VA 3K2EA 2Y93A 3F4LA 4ND4A 2ZB8A 2QZ9A 2X58A 3F6YA 1PQWA 3HN7A 4DWVA 5HRUA 1OBFO 3GG2A 4TVOA 3H65A 4IZIA 4EDFA 3GZNA 1KVTA 4HNGA 3G79A 7MDHA 4I9HA 3ZNNA 1MGOA 3H4VA 3L4BA 3QQPA 3E48A 5ER6A 1BTOA 1LDNA 1J6UA 5C7IO 3PWSA 3HDJA 1O94A 4XD2A 2OO5A 3EGOA 1TI7A 2A4KA 1Q2XA 1C1XB 1LSSA 4D3DA 2B35A 2HJRA 1N7GA 3B20A 4MPDA 4BNXA 1Y6JA 3KYDB 5JCXA 2DPHA 4PLWA 2ZQZA 5BT9A 2JD0A 2VYVA 4H16A 5DN9A 1P1KA 3NEPX 4GX2A 5A5EA 5JPIA 1R66A 4GX5A 3SLKA 3ZW9A 4DC0A 3HDQA 5KKCA 3I3OA 1E1LA 2PGLA 2C5AA 5AXBA 5FFFA 3VVBA 1XR3A 4RDIA 3U9LA 3WJ7A 1N1GA 1LQTA 1BXGB 1M2WA 4IJKA 2ZYGA 3U4CA 1Y5MA 2WE8A 5HA5A 3WYBA 4ZU3A 2HK7A 3HADA 5AVOA 5T8KA 3ITKA 3GZ4A 4WK6A 1QG6A 4BNMA 3E03A 3WX0A 3RUCA 1R4NA 4XQCA 4YAJA 4OO3A 3UGKA 1GYQA 1VLLA 3DBRA 2H5LA 2OUIA 5G2OA 1GEGA 1QYCA 3K2BA 3NJ8A 4XYMA 4ND3A 3GRPA 4PZDA 4W99A 4RLHA 3WGYA 5F5NA 4TVBA 1ISFA 3MWEB 1XWFA 4YJHA 4A5OA 3NV9A 3BMQB 3LSYA 3CTMA 4E2ZA 3A9WA 4IJVA 1HSOA 5FWNA 1I3KA 1P0CA 4WLFA 2BLLA 4UUNA 1O95A 2TMDA 5ICMA 1IY8A 4HX5A 1EMDA 1MA0A 4E4YA 1NAHA 3L0DA 3DAPA 4AJ2A 4E3ZA 4TZTA 5TF4A 1MFPA 3DTYA 5IDWA 2DC1A 1DBVO 4QECA 3VPSA 4XYLA 3JQ7B 1E3WB 3F46A 2P4QA 1CYDA 3KETA 4RGBA 2BGMA 4C4OA 2NU8A 4DPMA 1R12A 3B1KA 1B3BA 4BIIA 1LDMA 1P1RA 4OYRA 4WE3A 1BW9A 3RUEA 2YHIB 5A02A 1SEPA 1GV1A 2CNBA 4E5MA 1GZ4A 5THKA 2PKQP 3OMLA 1Y9AA 4Y6RA 4CM8A 2NVWA 1NHGA 4A26A 4A2CA 4KDFA 1Y1PA 2UUOA 3UCXA 5JMPA 1IPFA 5AYVA 4DYVA 5A3VA 4J0FA 4Q9NA 3CMCO 1CETA 3DL2A 4AJKA 1UXJA 5CPFA 3LF2A 1QYWA 3BA1A 3DBHB 2OZPA 1NQ5A 4DMLA 4ZJUA 3DAFA 5THQA 4EUHA 2I66A 3OJEA 1PGJA 3D3EA 3PJDA 3ZCXA 3AY6A 4ALKA 5JDCA 1AN9A 1I01A 3PDUA 4M8SA 1YL5A 4YYZA 2OORA 3NKLA 5BNTA 1YGYA 1R15A 5JS6A 4J1SA 3GT0A 1WAMA 2JD1A 2C59A 3GHYA 4LVUA 2OXIA 3P2YA 4WCFA 3ZU3A 4Z0TA 1J4AA 1PZFA 4XYGA 1NQTA 1V35A 2GGSA 1PS9A 3DO5A 3KBOA 4A73A 5EMHA 3BXXA 3DHYA 1F8FA 2POQX 1I24A 3AM5A 3GEGA 9LDTA 5H82A 4WGGA 5GMOA 4J43A 1JKFA 3QWIA 3V1TC 4ALIA 2C82A 2VUTA 1U2DA 4OJNA 1P1JA 1W0CA 4PVCA 3C1AA 1FK8A 1R6DA 3ZV4A 1EBFA 1NWHA 2NU6A 1WDMA 4BO3A 3FD8A 4R69A 2NV6A 2Y05A 5IG2A 5DNAA 3WGIA 1JLLA 1SMKA 2AQKA 4CQMD 4O59O 3R3SA 2YFQA 2O4CA 1EK5A 2YW9A 4I8XA 2DTDA 4BNIA 1NQAO 1ENYA 2X4GA 1GY8A 3WTBA 2VHYA 4ZRMA 2QQ5A 2W90A 3EVTA 4IIUA 5JDIA 1FJHA 1RJWA 2EEZA 1UP4A 4B4OA 4EW6A 2E48A 1PIWA 4CV2A 3LK7A 4HFJA 3EVNA 3GG9A 3DOJA 5TGDA 1FDUA 1R0SA 1K6JA 2CVQA 2H1SA 2X9VA 3BMCB 2YJZA 3UW3A 1VJ1A 3RBZA 1Y5RA 4UAGA 1LI4A 3LT1A 4TRMA 1ISIA 2GNAA 3JQ8A 1A7AA 4OXKA 3K30A 3GNQA 4JJIA 3MCVA 5DBIA 2NVBA 4BNVA 2EV9A 2EGHA 1FMCA 3UVEA 3WWYA 5EN4A 1M76A 4BGVA 2C7VA 3GVXA 2PTGA 3FPLA 3QHAA 4CM7A 1XG5A 4TRNA 4FB5A 1PJLA 1ZIDA 2B69A 5CEFA 3C7CB 4N5MA 3LU1A 3O03A 1VL0A 3F1KA 3KYCA 4WLEA 2Z1NA 4MKRA 1B3RA 2PFGA 2O48X 2Q4BA 4ZICA 4PLFA 3VZSA 4XCVA 2VT2A 4CV0A 3PWZA 1U2GA 2NWQA 3GVCA 1AHHA 1VJTA 2I99A 1KC3A 4NI5A 2GN6A 4Z3DA 2XAAA 4D44A 2AEFA 1A71A 2BH9A 1G1AA 4J4TA 1ADFA 4JJFA 3ADOA 2HMTA 4TKMA 3WFJA 3WDSA 4L75A 1ZBQA 1H9AA 2Y1GA 3OIFA 5JO0A 1IHYA 3TOZA 4ZVVA 5DDIP 4F45A 4JIGA 1A5ZA 1XELA 1DC6A 4OQYA 2NQTA 1ENOA 4F46A 5MGBA 2PR2A 2HMUA 1P31A 3COSA 5C7OO 3IL2A 4A7PA 2X9GA 5TT1A 5FEUA 1J5PA 3OEWA 5FYDA 2CDAA 1VL8A 5ICSA 1ONNA 3ZWCA 1NFQA 4HY3A 1D1TA 4E30A 2BMAA 5T6BA 5JY1A 2J8ZA
chains in the Genus database with same CATH superfamily
1B6SA 1GL7A 4Q82A 2J3JA 4C2BA 2JFYA 3LGSA 4OQPA 1RKQA 3VHXA 4P0TA 2VNSA 4G37A 5FTMA 4KRYA 2HTEA 3UAZA 1T25A 4NJMB 3Q7IA 4HQRA 3SD7A 2FSUA 4OB6A 1VLVA 2FN9A 4R2LA 3KR2A 4GYYA 5GJWC 4EZIA 1LVHA 2PCJA 4I1UA 1Z17A 2HL6A 4GD3Q 5E7IA 5EQJB 3RSQA 3QVXA 4B45A 4EVIA 3N75A 4B35A 2YJ6A 2DFLA 3RUDA 3LQRA 4RESA 1DPFA 2A9KA 4R40A 1BJRE 4UU1A 2OQVA 4AL4A 5FNVF 4EJFA 1ZESA 4C43A 4MW9A 2YNMC 3BRQA 3G8AA 4O1HA 4GPTA 3RSZA 3VH1A 4E03A 4GS5A 721PA 2E6KA 2GN9A 1EFLA 4F2WA 3SFZA 2NV0A 3C2QA 4PAMA 5HFNA 1VKRA 3VHRA 2HY7A 1V3VA 5IYZF 2AMVA 3DO6A 3OA0A 2GJ9A 3NHSA 2XRYA 3H2YA 3G5UA 4NYMR 4Y2SA 4AZ0B 5BN3B 4F4UA 5IU6A 3CX3A 4MJXA 2DUJA 1U3VA 4DLAA 5GGYA 5HKLA 2W42A 2PUGA 1DIRA 2VNIA 1E9DA 4EG4A 1NG9A 1I1HA 1FX0A 4E11A 3UH1A 5ALPA 2EJWA 3PQ7A 1UEXC 1IAVA 1MNQA 4YWJA 3W5CA 3VH2A 4D98A 3FSGD 2BUBA 4J0HA 1I8TA 1UZAA 4KQJA 4CE6A 5ICEA 3WTCA 5AHOA 3GK3A 1AUQA 3ZY6A 5BW6B 3S29A 3AESA 3JWEA 1WXFA 2BKAA 3L4BC 2PZKA 3G1WA 3SYKA 1ST2A 3I37X 2GD1O 5C32A 3GPIA 1NYTA 2QN9A 4OB7A 1KEPA 2VJAA 5EINA 2E18A 5TJ9A 3FMFA 2R6GA 1X3LA 3T0IA 4PZPA 3H99A 2VLBA 3HL4A 2OFFA 3LC0A 3L6DA 4PG6A 4PQGA 1UPCA 1YO6A 4GKVA 2H16A 5CG1A 3STWA 2WAMA 3FJYA 3K8ZA 4DBZA 2IYTA 3CZMA 3IDAA 5B4VA 5K3SA 2RC6A 1EVQA 4OHUA 2QZJA 4R2IA 2R6R1 4TZKA 5IFLA 4N47A 3UWSA 2BKEA 3ND8A 4YMTA 4TYQA 4Q48A 5JJCA 3KPJA 4KXYA 3M1LA 3SHWA 4EGSA 2SNIE 3BVPA 1DBSA 1QZXA 4PLPA 1BYUA 3TL2A 3NHWA 1RI1A 3IDZA 4DCCA 3K1YA 4KYTA 5FBZA 4ZI7A 3Q3CA 4DUGD 1YJXA 2C5SA 2Q2WA 1N2JA 4G3XA 2GESA 4QYSA 3BCSA 3JQPA 5IH7A 3ONNA 4CCAA 4ENWA 3GRUA 3ZHCA 4GXNA 4RV5A 3U4AA 1QOZA 3DTTA 1E5TA 2O23A 2NZJA 1CY0A 3N8NA 3H2GA 3OOHA 1C50A 3IESA 3QFHA 3BTVA 4MA0A 4RSMA 1VCHA 4DS3A 4P0PB 2ZUCA 4RZ3A 3LY7A 4OP3A 1HK7A 3NTLA 4P54A 4BLVA 3D4BA 1UP7A 2ZJ7A 4KW7A 2YJ3A 2QLBA 3L7BA 1T0JB 5CA0F 1ZLXA 3DZDA 3DKRA 3KOMA 1QG2A 3NDBB 5C9ZA 5ITZB 2PZEA 3MBOA 2VHUA 3C24A 3QX7A 5D5PA 2XOKD 2UUAB 3AV0B 1S3IA 2CXXA 1OXMA 2CMGA 1V2HE 2NAPA 2Y4NA 1SULA 1G0NA 1Z0AA 3SC4A 3U4HA 4F85A 2IYAA 1GNPA 5D2CA 1RWMA 2QRPA 1MFZA 2IEYA 1XRSB 3I1FA 5DYNA 1QLWA 4FYXA 1JYEA 4CQNA 3ESZA 2XRFA 3FOCA 3EDYA 3GVHA 1TW2A 1W4BA 5AKKA 5TE9A 3T7JA 3FTCA 1LKZA 1OBVA 4WA8A 4JGIA 4H3KB 4UU8A 3FOWA 4BEJA 4Z9FA 5LZ2A 2I2XB 1E98A 2HT6A 4HR7A 4L57A 4HYEA 1THZA 4DFDA 5K51A 3K0AA 4CMIA 1RMQA 2XXAA 5JEDA 3OPYB 2P62A 2P9CA 2PGIA 4DC9A 4F4JA 5IKXA 2EHDA 4U6SA 3F3YA 1N5DA 3HNRA 1JIVA 2LDXA 4KXXA 3HEBA 5F51A 5LP6C 1DAEA 3KV3O 4F9EA 3HB5X 5K2MA 4XSHA 3ORYA 2PMCA 3LA8A 3K9CA 1W52X 1I3MA 5AVJA 2H2IA 2QG4A 1VRWA 3SM3A 4FDVA 4BO4A 4KRFA 3TLEA 1HE8B 1BE1A 1NI3A 5JXHA 2AWNA 4ER0A 4YUYA 1VFNA 3CLRD 4K40A 1O4WA 2H51A 4NP6A 3L7CA 1RYNA 2PUDA 1V8PA 2H2GA 4MCJA 2AOWA 2WHPB 2ZTVA 1W87A 3L8ZA 2IU4A 4M0EA 4NZZA 2E55A 1XEWX 2JDID 2B30A 2XDAA 3A37A 3R3YA 4LZOA 5FI0B 2CNNA 1VPDA 3GBVA 1ZH8A 2F8MA 2DX7A 4GYKA 5JH7B 5KYTA 3TX2A 2CF6A 2JLYA 3T95A 4KWEA 1QFJA 4LOLA 4V2UA 1AHNA 1KKUA 4EB8A 1H8EA 3O3NB 5FWXB 1SUAA 5ARCA 1L1QA 3AYZB 4HUQA 4JEUA 1MRNA 1J49A 5AXCA 2W48A 4Z4EA 1MX3A 2DCUA 2QX7A 2BDEA 5DOVA 4H0FA 2WZCA 1A3CA 2W0MA 2AC2A 2QQEA 1C7EA 3MJSA 4RMJA 3ETNA 3WKBA 3LQKA 3MRSA 1Z6TA 1FTWA 2CN1A 3VYSB 2FDXA 5LP6B 2J3KA 2Q21A 3BB3A 2FZWA 2WHQA 5REQA 5CVVA 1DB3A 4IJ5A 3LUJA 4BRZA 1WIWA 2BW0A 2Q1WA 2R65A 1AK1A 1N5KA 2Y1EA 2Z4TA 3SN6A 3W90A 1N2CB 1P2GA 2PBZA 4MWCA 3KHKA 5FKJA 3QE9Y 2FUCA 4GKKB 1NP6A 1I7PA 2XUAA 4Q39A 3SDSA 4ZO9A 1EIZA 1XZIA 2B21A 3KD3A 5BWCA 5F98A 4WXEA 3SC2B 4FJ0A 1U9IC 2C2GA 3KXKA 1TLTA 5JAPA 3L6EA 5GOZA 3QLJA 2OOKA 2I4IA 4MV6A 2YVQA 2YL2A 3CLUD 2Q3MA 4QM6A 2ZUDA 1UZMA 2J9FB 3E3LA 4CW7A 2X4DA 2DH6A 4IJ6A 1R9NA 4I9NA 1H1LA 3H7AA 4X1YA 3VQTA 1A8PA 3DHVA 3MGBA 1QQ7A 2RKBA 3AMVA 3ESRA 4GQBA 5F73A 2FSVA 1WXGA 1Y1TA 5E0OA 2BEWB 2V7GA 3J81k 1EDEA 3NORA 3WK9A 2CK3A 1D9XA 1YCGA 1OC4A 1TMGE 2IITA 3DNFA 4G24A 3SICE 2PPLA 4MVJH 1VI5A 1ISPA 1UDXA 5F2KA 4AYTA 5BVGB 1IXSB 3C43A 3DOUA 1AS3A 2GH1A 3GVPA 3R3VA 3HBNA 2ZWAA 4INAA 3EN0A 4QOGA 5JAHA 1EIWA 2O8NA 2PJUA 4OFBA 4KC0A 3LF1A 1LDEA 4QODA 4HFRA 3T9BA 1M1XB 1M1YE 3I6YA 3TEJA 1IQRA 4HWGA 3PP8A 2NP7A 3RC1A 1E1RD 1DJNA 2GZDA 4AZWA 2HJWA 2O0KA 4D0NA 2W6MA 3KKOA 2OZEA 2I6XA 1TT5B 4OL0A 3NHJA 4O4JB 2IDKA 1Z7EA 3PDWA 3O38A 3NXSA 4JQSA 3DFKA 2AD1A 4PYNA 1DQNA 3R7LA 3CNEA 3OZAA 3TW4A 1FYXA 3C7TA 4KGZA 5CH3A 2R1TB 1GXSA 3T52A 2VR1A 2PXAA 5KQRA 3MGCA 3PHBE 3VZBA 2F1RA 3WLEA 3O84A 4GI3A 4WJLA 3O8RA 2JI4A 1NASA 2B25A 2XI4A 2B5WA 1EE9A 3CZAA 4OXRA 4PG4A 5EP2A 2FN8A 2AN3A 2YYZA 3NETA 3K6SB 5J2UA 1OKKD 1Y9EA 5AJVB 1EA5A 5IP5A 4A4DA 3O95A 5BV2P 3DEHA 4G86A 3A9VA 3QELB 3LPDA 4BGUA 4RSHA 4BCBA 1PL8A 3ONWA 1I0LA 3BPSA 4JLPA 4EW3A 4Q4AB 3EZ7A 1P19A 3QNMA 3BUSA 3WRYA 4YCCA 1WZIA 3SXUA 1GQYA 1U3DA 3GDFA 2AYZA 3DZBA 2WUFA 3UWKA 1Q7TA 1YL7A 1TKRA 4UHKA 3CKKA 3V8RA 2IYWA 2GM9A 1WPQA 1Z6XA 4YLYA 1DWOA 3VDQA 2FPIA 3HYCA 3R5SA 3MWGA 2QZ4A 2JIPA 2RGUA 2QUKA 3N76A 3QY9A 4GT1A 4BO7A 2HBZA 1KI4A 5AXDA 3W1WA 1NDUA 2ADFA 4TTRA 3LX8A 1KGDA 1YU6A 1TCVA 1VLQA 1JSXA 2P1ZA 3K5WA 4TN5A 3COJA 2ORED 3F49S 3ZLBA 3HJCA 4R9NA 1V4NA 2PSDA 3VPXA 2V65A 5G1OA 5JZ9A 5L4SA 3QV2A 2OC4A 1XZQA 1W29A 4PFQA 1ZKMA 1AQJA 4QDUA 621PA 2VDRB 2VHXA 1IL0A 1ORTA 4ND1A 2F3RA 3ZK9A 1LVGA 1WSAA 2W4MA 2ZRGA 3MJTA 3WWOA 1JSLA 1SBHA 3SFTA 5FBVB 2EBFX 4D0SA 1IOZA 2R44A 3O93A 4NNJA 2DFNA 4I7EA 3WAJA 1KJWA 1EE1A 1K92A 1IQUA 3G9UA 5F5LA 2GETA 3RHFA 1UKYA 4EJSB 1SA0A 4XE5A 4XOUA 3OP1A 5JYDA 2ZBDA 2ZBGA 5CXXA 1LW7A 3NIWA 4MVJE 3AHDA 1EK6A 3FLBA 2ZIAA 3LLSA 1PQUA 2I03A 3BE6A 3EWAA 3K94A 4LJYA 2BY4A 4HTFB 3SQNA 4RCZA 1WW8A 3AL3A 3D8TA 2PKXA 1XTZA 1OHHA 1XMJA 4RL4A 1XMPA 2XRZA 4YUAA 1P9NA 5H3HA 2PUCA 1FFSA 4GSKA 5GIOE 3JSXA 2B20A 3F2IA 2O3SA 2FOIA 3DKIA 1LA2A 1L5HA 3V2IA 3V4RA 4I4TF 3RVPA 1XRJA 3U4QA 1BGVA 4GUDA 3Q7EA 1GR0A 1KIMA 2Q4DA 3DV0B 4LXQA 4CLOA 5K8LA 4LXUA 1RQ7A 3LCCA 4BP1A 1EJ6A 2J3IA 3G8DA 5H1YA 1QQBA 4AS1A 1A9OA 1PR3A 5I7EA 3DLIA 1QYDA 3B7GA 3P2MA 5D3ZA 5DGCA 1N34B 4A6DA 3O4VA 4KPGA 5EPUA 4GKBA 3U6KA 2FXVA 3QXHA 2RFLA 3RRNA 4ZI2A 4KN8A 4IDHA 2XZTA 4UDYX 1N6HA 2JCSA 5DIZA 5BO5A 3RWBA 4BFYA 3GA0A 3ZBUA 4H1VA 1KKMA 5FPSA 5G1PA 4B0OA 2QRUA 3CRW1 3KQSA 1KJ8A 2XNSA 1UKVY 3C39A 4WNAB 3JASA 5ES4B 2Z6QA 2R97A 3DTNA 4B7XA 1FUKA 2BSXA 3NTQA 4GGOA 3OE4A 2PIAA 3VYRB 4P93A 3EPKA 2CBZA 2XX3A 3O8BA 2BDUA 2JCGA 5DM1A 3FNEA 5CW2A 4BOYA 4CTKA 2JFNA 3PEEA 1FP2A 4F3CA 1UDAA 1JDBB 3HGTA 1N2ZA 5D6OA 1ZI8A 1FS5A 1Y1LA 4K87A 4S1WA 4R1UA 4ALNA 1P1CA 1SVKA 5A6SA 1JTFA 4DNQA 5EFZA 1P4HA 4Z4HA 3P9YA 3GNTA 4KWCA 1VKNA 2BM9A 5PNTA 1HY3A 4BX8A 4J1TC 3MTJA 1JVNA 1WBJB 3ZH2A 3U7JA 3V7UA 1F14A 1UFKA 4OQFA 4G0VA 4Q1FA 3GT7A 2IF2A 4YRKA 2A5GA 1N6PA 5K6AC 4HB0A 3TTXA 4YMUA 4P38A 1XQXA 3SBEA 4CHTA 6ABPA 4R9VA 3AVXA 2G1KA 2FR8C 1QONA 3H5NA 3ODGA 3CN9A 1F7UA 5LQSA 4C3UA 2ZRPA 3BD9A 1T9DA 2IBSA 3UB3A 3FVTA 3H8SA 4II3A 4U7TB 1NJSA 2NTNA 5B58T 1IBLB 4KV9A 4EF4A 2PKWA 3EVCA 1L5FA 3COYA 2YXLA 4P22A 4OJYA 1DAPA 5ALQA 3KP1A 5DSZA 5F7ZA 4D45A 2IS6A 2AOVA 3O94A 4TS9A 2I2BA 3ET4A 3QH4A 1JDJA 3QTLA 4MUKA 2ZBQA 4IUDS 2XTZA 2YJ5A 4RKWA 3VR1A 2GKOA 3LUDA 4RGQA 4CR7A 3FCUB 1ZM7A 2OMEA 4TTPA 5F4ZA 1F2TA 2IQ5A 3CINA 3IV7A 3OLWA 4BO5A 4AX8A 1D5CA 1GYRA 1XD2A 4MQ5A 1AV6A 2GFHA 1IQ0A 2CXRA 3UJDA 3P2JA 2VXYA 2DWCA 4PX3A 4LEIA 3E1KA 3FSEA 3SZOA 3AOGA 4BEBA 2QV7A 2BRUC 1GADO 1L8XA 2ZE5A 5E7JA 4EA7A 1JILA 2PEYA 3AEUA 2AI3A 4TPKA 3TXXA 4Z3OA 2OV1A 4BMSA 3B6MA 4ML3A 1G19A 3AP2A 3UWOA 1DBIA 4PFJA 4V38A 4YP5A 4QXOA 3UUWA 2ONKA 2C2OA 3TG8A 1WJGA 2HEIA 1GVNB 2H5EA 2PU7A 1EFPA 5DHPA 1Z56C 2UZAA 5NULA 1CJTC 4RV9A 3RT1A 2K5UA 5CW1A 3VR3A 2XCTB 1PX0A 1R0ZA 4R71A 4FHFA 1RXEA 3DEFA 3R4CA 1TCAA 3C7KA 4IIVA 4AUEA 2VSNA 2XWPA 2PT5A 3UC5A 5TPZA 2PNFA 4GR9A 1I4EB 3S1AB 3G0IA 3QVMA 1C0PA 2QQ0A 1U8EA 2PRZA 4YUVA 5JPCA 4QNMA 1ONPA 2I7TA 2HWWA 3L0CA 4ARCA 1MIOB 1C3OB 1UJMA 1UMBB 4OQMA 5BYBA 5EWJB 4G4JA 4G1UC 3O91A 5CM9C 1V45E 2Q8QA 2YV5A 3GGDA 1K7CA 4LF8B 3CCBA 4XWWA 3SZ3A 1NRWA 2X0KA 3BC1A 4G4SP 2BHSA 4I36A 1N0WA 2X8JB 3K0FA 3PKIA 2DFPA 5HNKA 3AP1A 2DBYA 4IGKA 4PZYA 5HKAA 3H9UA 3FCAA 4A6EA 1J20A 2K2WA 3QOYA 1M1NA 2YMPA 4JR2A 4U3JB 5IZ4A 1PK9A 1X80B 4D3SA 1LFDB 5C5CA 2XDYA 3B85A 2HZ7A 3QKSB 2QVLA 4G1CA 4K3VA 4ZVLA 3I12A 2OYRA 5IVDA 2DUUA 3HL0A 4E12A 1D2MA 5IJXA 5IM4F 3RF7A 1WMSA 1KY3A 1W8DA 3V2GA 4ID9A 2XYHA 4YJDA 5ITWA 3OIGA 1NZJA 3Q15C 2VNJA 3C3XA 3GLHA 1VE9A 3FLMA 4UBKA 5B12A 3UJNA 4EKGA 1RYBA 2JGFA 2ISQA 2CXQA 2W6IA 5JXIA 2GM5A 3BBLA 4LXHA 1DVRA 4O2BB 4C2TA 1KI8A 1YRLA 4NXMB 1ZK4A 4GFDA 4BPBA 1GGJA 4G89A 1Y82A 4XCQA 4B3XA 3AF4A 3Q12A 1QR6A 3H1BA 1DAIA 1NN1A 3OM8A 2C96A 3UYLA 3C98A 3FM9A 2PAFA 1QORA 1PVVA 4Q34A 3HCEA 4BGEA 1PNRA 4YT5A 1NX9A 3D0OA 3OI7A 4MIEA 4IG9A 2BCJQ 4P3YA 4UVGA 1P7CA 1M3SA 4NV3A 1RM5A 4U0KA 3NAMA 2Q9AA 4ETWA 3TIGA 3DMPA 2ZRNA 2P9TA 1NBWB 4A6XA 1G2OA 3L0IB 3GJ0A 2BZ1A 4EY5A 3DT9A 2GZ2A 3H2SA 3HB1A 4IQFA 5JRJA 2CLOB 2WINI 1Z16A 4F3KA 2C31A 1D3AA 4IVRA 5I9BA 4OX9B 3GP5A 2F8LA 1T4CA 4YT8A 2OK7A 2QZZA 2YHBA 1OLUA 1WZ2A 1UINA 3NWPA 4GOOD 4M1QA 2GUGA 3I8OA 2B3TA 1TZBA 1GAWA 1G8SA 3NB0A 4G36A 4X60A 1NF9A 2PQ6A 5SYAA 2QN6A 3E82A 1AO0A 4JYAB 1QDUA 1U0HC 3FE2A 3PNBA 4ENQA 3Q2OA 3ON5A 3N2GA 1CIJA 4RD2A 5DWVA 6AT1A 2XTAA 3FZGA 3KAQA 4QGAA 2ZR0A 3EAQA 4EW1A 2BHNA 3EC2A 3FROA 1TQDA 3NIFB 2CDCA 3BTSA 4HEHA 1SXJE 4BC0A 2VUUA 1IATA 5C8ZA 4WCDA 3OECA 4M76B 2CVZA 2R68A 2IEBA 2OMKA 2GDJA 3D5TA 3RFCA 1JV2B 1M2VA 4BECA 3VSBA 2V1XA 2XBLA 4NK5A 4QBFA 3RVKA 1UR5A 5L3SA 2NU9A 4MDYA 4YRIA 2P75A 4KE7A 5LIPA 4UOEA 3P27A 3JPYA 4OM7A 5DYWA 1A9RA 3FNHA 4QGHA 4KQMA 1MU0A 3GFSA 4EYGA 1W96A 5FPTA 3VSCA 3VGJA 4KE8A 1J5EB 1NI4A 4LNUA 3RWMB 1Z9BA 4C3ZA 5ECWA 4LMRA 3SM9A 2AUMA 1YQQA 2HA2A 3KQHA 4WNIA 1NOJA 2V96A 5DGHA 1JAYA 2CWDA 3RV3A 2CCJA 1K68A 5BXQC 1ZVMA 4ID3A 3C3KA 1EDBA 2F90A 1P4GA 2FMFA 2PJZA 3PHJA 1X7WA 4LOIA 3VPFA 2I33A 3ZE7A 5E4YA 3TMKA 4QOIA 4RUKA 3Q0TA 1D6JA 2YICA 3ZC3A 5CB4A 1MVOA 1GFWA 1BFKA 5C7LO 3ER8A 3D8SA 2LCIA 2JGMA 4DIUA 2IELA 3DZGA 3U44A 3L01A 3L8EA 2AV6A 2ODEA 2Q1XA 2RHCA 1C0IA 2ASVA 1Q0ZA 2QTZA 1HFJA 4L85A 4R0VA 2CCKA 3FGPA 1KPHA 1SBYA 2FK7A 2C42A 2ZRAA 2QMQA 3PR1A 4FDLA 1Y81A 2H9AA 3PNYA 1G59A 4EYSA 1YL6A 2VDVE 3H2IA 2F43A 2LKCA 3WKCA 5D7NA 3VPBA 1A9XA 1N6LA 5EXXA 1QC5A 4U7DA 3FI9A 3FZQA 1ZR2A 3SOPA 2WJJA 4ER3A 4NU5A 5AHWA 2QL6A 3LA6A 2DSNA 3W5IA 4L76A 1ZFNA 2QRVA 1RMTA 4LC0A 5AKYA 1MEOA 3IQZA 4CIVA 2R3SA 3QRWA 4UCWA 2BFFB 3P5SA 2FHPA 3NX4A 1KYVA 4UNNA 4ZRDA 5EHNA 2HXSA 2UKDA 4B3DA 5DX0A 5GADl 1AE1A 1YUBA 1XKQA 3HO6A 2JFUA 1A4IA 5EIBC 1ODFA 5JCOA 3OKFA 3OPXA 4Z4IA 4NPAA 3IP1A 3KB6A 2WF8A 5HZGA 1TKCA 3OQBA 5HOQA 4UVDA 2ZJ2A 2IIQA 3Q7PA 4GRAA 2WUVA 4X5OA 3TLZA 1RPNA 4CCYB 1JHXA 1Z62A 1SKYE 5DASA 1G8HA 1ID8A 3LOUA 3H5OA 3W9SA 2YMMA 2TS1A 4DQLA 1MH1A 1ZA1A 4WZAE 4A03A 4F5YA 2OBMA 2PGDA 4CM4A 1M0EA 3WWEA 5LQJA 4I08A 3RS7A 3OLZA 3NFRA 3RQIA 1LQUA 1X8JA 1H69A 5BNZA 3PB3A 2WJ4A 2VDKB 3DPSA 3ZNOA 5BR8B 1JDUA 4UARA 3FFAA 4G56A 4J4BA 4YRRA 4CDRA 5A71A 4TROA 2GRUA 3RSFA 2CK3D 2H2DA 4FD3A 1E8NA 3EH1A 5TPWB 2NU8B 2C4NA 4HAWA 1WNTA 1E4OA 4ITRC 3NVMB 4D41A 2Z9BA 2XUDA 2WNIA 2JFOA 2VRBA 5LB2A 3VO1A 4DMRA 1AQ6A 3VTZA 2FCAA 5KNDA 1UMKA 2KYRA 3ETEA 2RB5A 4PC3A 4C2UA 3AGQA 3ELUA 2C54A 3OT5A 3HP7A 4IFBA 3EXFA 4NF2A 2VAPA 2AW3A 3F3SA 3LUPA 5IN4A 4IVPA 2IZ6A 3DTVB 5DRTA 4IOJA 4UPEA 2WDZA 1OAKA 1RE1A 3JD0A 5EIOA 3C3BA 4I5DA 1IZ0A 4OH7A 3D54D 1I2DA 2X19A 1S1MA 4EG1A 1P2BA 3HBJA 2C92A 3L7MA 3U7QB 2CLLB 3EXEB 4BU1A 3CUWA 4NOLA 2VA9A 1NQWA 3SAJA 1APBA 1LPOA 1JHPA 4IILA 5CCXA 5A4KA 3SMVA 2L2QA 2QPOA 3JYLA 4UM7A 1NDQA 5DO9A 2E5WA 3IO3A 2V4MA 2V6JA 4KMSA 4W5RA 3QU2A 1QAQA 2CV0A 3SNHA 3AR2A 4NBNA 5AH0A 4PCVA 3IT2A 4UATA 1E64A 1XKTA 3SEAA 2QX9A 1MJGA 1E2JA 1SQGA 2X5KO 1EUZA 3SXPA 4BE4A 3LAWA 3U2QA 3R4VA 2CJFA 3GEIA 1QF7A 3E9NA 1K9VF 1SGWA 2PSSA 4FUTA 4HO1X 1KYXA 2YFKA 3IAS1 2FG5A 2Q6VA 2W2VA 4BVEA 4LF9B 2BP7A 1YUMA 4R41A 1I3NA 2X1VA 2DJ5A 4BN0A 1O9GA 3PQ8A 4MUXA 1ZJ4A 4YP6A 4DEVA 5KNCD 4ASUA 3KR0A 5IPFA 3SX0A 2EYUA 1DAKA 1N0HA 3DLPX 2A9PA 4WK2B 2IOFA 2QAJA 1HT3A 3D8UA 4QSMA 4IGEA 2AQ8A 2AH5A 1S8OA 4RH3A 1EXVA 4ZEMA 4ECEA 5I7RA 4DCVA 2VQSA 3DVAB 2WMOB 5FNZA 1DDIA 2NSDA 4I6JA 2I6UA 3EBPA 3T5GA 1WNFA 4C0JA 3FRIA 1OI3A 4UQOA 4ZHQB 4M87A 3T35A 3RFFA 5ITVA 2CKDA 4MMXB 1TRKA 2ZJ5A 2O52A 3HRHA 1QGED 3NH6A 3OSZA 4Q3EA 4CUZA 4H1WA 1Q7EA 3AF3A 4LJ8A 1C1XA 4P5DA 3V4PB 2QVBA 2M6KA 2YWJA 4HLUA 4BKQA 1AQIA 1IB0A 1MT0A 2CE7A 9ATCA 3G3EA 1U8ZA 1EAYA 2IDJA 3HM2A 1PP4A 1SVSA 2H0RA 5KQGA 5FADA 3R5XA 1ZMRA 5KCMA 3S8YA 1G3RA 3NM4A 3U9TA 1ULZA 4AJ4A 4QIHA 1Q1GA 4DMKA 1TQHA 2VT7A 1KSJA 4U7WA 2AC4A 2LIVA 3R7AA 5JZMA 1V16B 3PQEA 1OHHD 2MYUA 4I50B 1KKLA 3RU7A 1UZUA 2WV7A 4ALMA 2G82A 4LYJA 4YP0A 5IMBA 1WCXA 3IE2A 1MDFA 3CNHA 3KU4A 4RDHA 4HDRB 3VKHA 4Y6SA 2I3ZA 1VSVA 4GICA 3P9IA 2IWHA 3LQ1A 4KFUA 2J0SA 4FCVA 1XKXA 1X42A 3T3GA 4I55A 3H4IA 4J0EA 1P29A 4I3FA 1Z4KA 1CRWG 3TVYA 1DMRA 1N6KA 3I9V1 1YSCA 3VSAA 2W0SA 1NKTA 2WQZA 3DFZA 3JQ8B 3D6JA 3RRMA 2Q1SA 1QQ6A 5DRYA 4JI0B 4ZREA 4ZEOA 3K5IA 1ZCJA 1LK7A 4GLLA 5F4BA 4GXTA 3K0HA 3TL6A 1U3FA 3SF8A 3SHVA 5AVVA 1UJNA 2C4WA 4PR0A 4E1AA 2PMWB 2F3QA 3STTA 1RM4A 3N0WA 1O58A 5G0WA 2VNKA 2ZDQA 3SZGA 3DB2A 4YV1A 2A4MA 3IJ5A 4RPKA 2VL7A 3HBMA 4NH0A 1NKVA 1KARA 1PR2A 1UBGA 2GD6A 3CF4A 2QTBA 3QQ5A 4FR5A 1NFFA 4OJKA 5JTUA 2XCQA 2H1RA 2V1UA 1FRVA 1H9BA 2AXQA 4AXXA 1ZIYA 4KVFA 1YJQA 2JGNA 1T2EA 5K03A 2RK6A 4HDQB 2YS6A 2QM8A 1IUPA 1E3WA 1QZZA 2AOTA 2HV9A 1X9IA 4RVFA 1LJ8A 4L0QA 3VVMA 5DTMA 2CNKA 1ESNA 3PXGA 3WHKA 2LTAA 1HDXA 3MS2A 4QUHA 3JWGA 4NCXA 1DRJA 2ALJA 4OQLA 1SD5A 3EPHA 2NMVA 1Z2DA 2QAGB 4KG7A 3L18A 5SY9A 2G88A 3FPCA 3MC1A 3LIIA 4K2AA 4RVUA 4QG3A 4IS3A 1IN7A 4W5NA 4PHHA 3L04A 4LRYA 1W6UA 3W3AA 1YMUA 3FVWA 1J7KA 1TD1A 2UV8A 1ECCA 2LWIA 2V7QA 4RFVA 4S1TA 4WPGA 1MC4A 3BWDD 3HVIA 4HNQA 1DWPA 1U28C 1XK6A 1WQ4A 3II6X 4ZXPA 2M98A 5BV7A 2JGEA 3Q8MA 2YFHA 3U3JA 2IYSA 1K2WA 4N03A 1HTWA 1QXSA 1Z6AA 1EK1A 2IUSA 4OMFG 1UBJS 1I7SB 5KSYA 2JLWA 5DHRA 3ZDAA 4XD7A 4D4GA 4S1PA 2Y1CA 4LQCA 1LDGA 4EK9A 2G3YA 4LZPA 2H7YA 5E3JA 4ZQGA 1T1GA 2F4VB 3GARA 1X9HA 3EIXA 4AMBA 4BRSA 5TMPA 4KDCA 3WOHA 2H1VA 1GLVA 1DU4A 3OZBA 3G6KA 3L5KA 4Q7JB 3T9CA 4DIKA 1DS6A 1DEXA 2QLLA 4UE2A 3ZWOA 2WFLA 4C7KA 5JXWA 2JFWA 3MT7A 4L74A 3LUBA 1NVTA 3WGJA 4HZGA 1N3YA 1NTRA 3KXDA 1SOMA 1YBAA 3GBPA 3UIEA 3ZNQA 3V8VA 4BMPB 4C4XA 2QTNA 3IBSA 3ZLUA 4LXIA 3VC1A 3OESA 1PO7A 4INOA 4LC9A 3UMSA 4Y0VA 3VR3D 3AW9A 3K70B 2VJLA 3K9BA 4UFOA 1PZMA 2VOEA 3TK1A 5IZCA 3VHQA 3G2JA 2YWDA 4HVTA 4JX8A 4JN6B 4V0OA 1TCBA 4HD8A 4MWEA 5EERA 3RS3A 2QL7A 3GFQA 4C78A 2J0QA 1D1SA 5TPZD 2IP2A 2QGFA 4WGFA 4ZVMA 3ENVA 2J9XB 1QLHA 5IKMA 5JQWA 3W5AA 1JG6A 2PXHA 2E85A 2ZWOA 3C4QA 1YI1A 1R3UA 2CNWD 3L93A 4ZAYA 4YP7A 5HKKA 2AN1A 3KRTA 2QL5A 5FWYB 2OO3A 2ODNA 3LKVA 4R1TA 1PV1A 1MZPA 4ZCTA 2AD5A 4M98A 1KI9A 2CGEA 1JHAA 5KVQA 4O1MA 3MINA 2W2XA 1ZJZA 1GSAA 2Z9DA 1H22A 5K3DA 1Z4PX 1M75A 4O4IF 3UT0A 1T3HA 3CJTA 1N2OA 2IXAA 3TR0A 1CZNA 2A5YB 1MEEA 4R1PA 4Y2YA 4CV0A 5KTOA 3WL8A 1RZRA 1JHZA 4DA4A 1LLCA 1HOXA 4DXDA 1W85A 4BNLA 4RMIA 3REQB 3UZUA 3VKUA 2EKQA 2Q6LA 1ZN7A 1CW2B 2HCJB 3DBVO 4CQMB 3CTPA 4MYDA 1FVFA 1ZOLA 1YBVA 2O59A 3RG8A 1G41A 3B7WA 5AICA 3IBFA 1NBOA 2I1VB 3EC1A 4Q02A 3B1JA 5FV7A 4QARA 1GNSA 3RBXA 1I3LA 1JYSA 3UCFA 2JEOA 3ZV7A 5LOVF 1I1NA 4H3HB 4NBTA 1N2IA 2HWXA 4XARA 1B00A 1XL1A 2Z95A 5IC5A 4GLOA 5IWCA 1TADA 4X7BA 1RAIA 4OL9A 4RXUA 5AKIA 5TRTA 4J8PA 2NPFA 3S4YA 4RTOA 4KQFA 4UM8B 4IGAA 4KQ9A 1NN5A 2C2ZA 1E1CB 1P8JA 3I2FA 1P91A 2JFBA 1WWKA 1YOVB 1D4ZA 2O2IA 3ER9A 2W2MA 5BYAA 5JQGB 1I36A 1ZY2A 2UUPA 3ZOKA 3UW1A 3L49A 4MAFA 1WG8A 4J3FA 1LWOA 1QDEA 1OZGA 3TOVA 4QFBA 1XZKA 2IL1A 3O5AA 4FOSA 2V8BA 2XWJI 3OF3A 4LCBA 5B7GA 3CSSA 4RF4A 3U4MA 1PR0A 3NOOA 3HCDA 5AJHA 3U19A 2IOFK 3K1TA 3M2TA 3AU8A 3FBWA 3GLKA 2R7KA 2YXBA 1X7GA 3KUUA 4K6HA 4IM7A 2CMDA 3V00A 4D8YA 5LKAA 4BMXA 4Q3KA 3ZK8A 2CJYA 1Y34E 2H2FA 3KOOA 4MQ6A 2H8GA 3NHPA 2Z8XA 1ZPDA 4CLDA 3BXZA 2GD2A 4C7VA 2WJZB 5JY6A 2B2XA 4CFYA 1GTRA 4NYJR 3EWIA 5K45A 5JECA 3HP4A 5AUQA 4ZYLA 4ESVA 3G82C 4KNYA 4MP6A 2O5VA 1TM1E 2P77A 2G1JA 3X1JA 2C2YA 3FSRA 3L1JA 1XN4A 2AVNA 2IVZA 3BT7A 1EQAA 4NAVA 2FUKA 1QU2A 4YI3A 2QSUA 5K3EA 2GTIA 4YIKA 4AVYA 1Q21A 2XDQA 2SKDA 3JATA 4YNBA 5EZQA 3MFYA 1FP1D 1KFJB 4AJHA 4CGYA 4QUAA 1XDSA 2BC9A 4IJMA 1R6TA 4HX9A 2O3RA 3HRKA 4LBVA 1WS6A 1UXKA 3C6ZA 3T12A 3RUFA 2NN3C 3X1ZA 1BGXT 2CKMA 1E7YA 3A6DA 3H0EA 2JJ2D 3P8ZA 1W76A 3KR9A 3Q40A 4RA6B 3TH5A 3DVRX 4ARSA 1EWVA 3ZHSA 5JI3E 1A2BA 2AG8A 4AZ3B 2PWYA 4E1BA 1JJIA 1RD4A 4HGYA 3EHDA 4MS4A 3AXSA 5CH8A 3RH0A 1PTKA 2ILTA 2HU8A 5F1YA 3T4PA 3PFKA 2SKEA 3F8SA 4KV7A 4TXMA 4B5KA 1FTGA 1ZRMA 4FE3A 4FYHA 2ZULA 1KSHA 3PENA 4HPWA 4LECA 4NE2A 3CLVA 2AWOA 4C6TB 5EP3A 3PC7A 2R86A 3UWMA 1XCOA 2GN8A 5TS2A 2FWPA 3OAAA 4Z99A 1RIIA 1U7OA 3AFIA 3INRA 1TYDE 3BMOA 4Y2QA 1JXAA 2VJMB 4AB1A 4QNNA 4JQCA 3TSOA 1K3TA 4QJ3A 4ZOAA 1ZHHA 3ZD7A 4LXYA 2VJCA 4RE5A 2JIMA 2Y76A 4JZKA 5BMVB 2ZATA 1LLQA 4MV5A 4XI9A 5AK4A 1HA3A 3PGA1 2Q4TA 2G36A 3S2EA 3DUFB 1ZLYA 1BDJA 2P35A 3ABIA 3EXHA 1BS1A 3ND9A 5G4KA 4P53A 3UF0A 1HFEL 4F60A 4YAGA 2GCOB 2YVLA 1P61B 2HIGA 5E9WA 1MOSA 4P3NA 4IINA 5TC4A 5IEJA 2AN9A 3ROKA 1VI2A 1VM6A 3QFCA 1T43A 3QVUA 2C57A 3GA5A 4V2IA 4KNWA 3ED5A 1OH8A 4NCAA 2QUAA 4P3XA 1SCUA 2RH9B 4NBRA 4U7GA 3IEVA 4B6RA 3OETA 2D8AA 4MIYA 4ZVPA 3KQUA 4G0OA 4WXRA 5EKTA 3ESCA 4RXTA 4FGLA 1L7OA 1P7PA 1H1TA 1OB5A 3U7IA 2O4UX 3I5UA 3KKMA 4KVZA 3B38A 1YCFA 4YJFB 2NTEA 4QUBA 1F0PA 4BVHA 2Z3WA 4B43A 2JZNA 2P67A 4NMXB 4G0WA 1UP6A 3K92A 2N3ZA 2HPHA 2Q3BA 3LUKA 3VPGA 1TGVA 4CIDA 1VRVA 3U49A 3NWJA 1PT6A 3LIPA 4ETMA 5AK3A 1CLUA 4F71A 3RCBA 5A0VA 4KKXB 4QDOA 1E99A 3DQPA 3BG5A 3O31A 1IOWA 3HXQA 5T41A 4LDAA 2YN2A 1PEAA 2ACVA 4EYKA 2TYSB 4EGJA 1RHMA 2WWXA 2G5TA 2OUKA 1U11A 3FNFA 1P2FA 4ZI7F 5KYNA 1ZA2A 1Z6YA 4IOMA 3WB2A 4JI2B 2XVMA 1EZ4A 2IZ5A 3JQ6A 2WYUA 3VJMA 1P0QA 3KDAA 1L5OA 1QVAA 4AJ1A 2NLOA 3NNSA 3OLYA 3DBIA 1KEUA 1N2EA 3AHFA 3A9CA 1JPNA 3EYAA 3L1IA 4LOHA 5GONA 4AG5A 3P2IA 1XDDA 3PQFA 3VPHA 3HUUA 3AVQA 4CMEC 3EEOA 1Q1AA 1LS6A 1NVVR 1UAYA 3DLAA 3UKDA 3B36A 4AECA 3AKZA 2FW1A 4JVMA 1E3QA 3CBQA 4PQRA 1A9PA 4FFBB 1QH1B 2C0PA 5ALKA 3CF0A 4D9FA 3ZDRA 4EDHA 3VJRA 1JFVA 5A7GA 2H63A 5EQDA 1NBMA 2RHTA 1AUPA 2Y9PB 4NATA 1Y3FE 2BBWA 1QIEA 3K73O 5LBUA 3PCXA 2QPTA 3N2KA 5KTPA 1U2EA 2IVFA 3OJLA 5DP2A 1UCFA 2R62A 1JEEA 4F3NA 2R8XA 4IXNA 4Q7QA 1T1SA 1Q6ZA 3G7SA 3R7WB 2XEXA 1VKJA 4AC9A 3PEFA 4UM9B 4B8YA 2PUEA 4CLXA 1ZI6A 4OSOA 4D81A 1KO8A 3JAKA 3T5BA 1QBGA 3TSCA 3I9OA 2J6BA 1KDRA 2W2OA 3RWOA 4N3BA 1RHKA 4CEIA 1O6ZA 5E6RB 1TZCA 2FAXA 2XOEA 4GMDA 1ADBA 1FVHA 2J6CA 3T7AA 1WDWB 2VIIA 5BSHA 1FFBA 1QVZA 3A28A 4DR6B 2O20A 4YBRA 4XQ9A 1F0KA 4ZCSA 1XQ6A 2I9PA 4O29A 2PKQO 2YWHA 2GXAA 1BHJA 2C98A 4LHZA 4U5QA 5AVXA 4TTQA 4IDPA 4TSFA 5TX7A 3OPYI 4W1QA 2OYSA 4MK4A 4KE9A 3PTLA 1ODTC 2P7IA 5C1PA 2BD0A 1X70A 3AKCA 2WIJA 1PQPA 3RANA 1BZYA 4EQZA 5CDFE 3BULA 1A2KC 1FCJA 1DRKA 5I3ZA 4MP8A 5L3ZA 1Y80A 4HGRA 2Y0DA 2RI1A 4BFWA 4YAOA 5UKDA 3DDCA 4FCCA 4AFNA 2HWKA 4JJEA 4X20A 4HBGA 4NV1A 2DM6A 3DV2A 4WVFA 4UNRA 3TAUA 5C2JB 5ILGA 1W4CA 3QLEA 4TM7A 1ZSYA 4NJOA 3KOYA 1XXHE 1QVWA 4YMSA 1C1YA 3RSCA 4PSAA 4UTVA 4DR4B 3OTGA 4P7JA 3PPVA 4MW5A 2DE0X 1PD1A 1QGDA 2BZGA 2EKPA 1Y4ZA 4JHLA 1B4DA 3HCPA 5E8JA 5MF6A 5HBGA 4O4LB 1TCCA 4DCSA 1QIKA 3A1WA 1C9KA 3EA0A 4I5FA 2GM3A 4EITA 1A77A 2FPXA 4EJ6A 2B36A 5JSUA 3GEPA 3IPAA 4ENSA 5A9TA 3VR5D 1H4VB 4YRTA 1G6KA 2A35A 3S7ZA 1UBNA 4JDPA 3F3MA 3VU9B 3S81A 1SXPA 2H8KA