2X9GA

High resolution structure of tbptr1 in complex with pemetrexed
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
publication title High-Resolution Structures of Trypanosoma Brucei Pteridine Reductase Ligand Complexes Inform on the Placement of New Molecular Entities in the Active Site of a Potential Drug Target
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 94
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x9gA00
3LSYA 1FK8A 3NDJA 1SO8A 4J43A 1Z7BA 4GI2A 2B5VA 5AOVA 3S2IA 1DSSG 3RC1A 1R4NB 3HB4X 3K31A 3FNGA 4JN6B 3LT2A 3PGXA 2O3UA 2QX7A 1KVQA 3PHLA 3F4BA 1RM0A 3I23A 1UZNA 4L4RA 3BAZA 2BRUA 3LLSA 4J1SA 5L53A 3ZDFA 1A4UA 1LEHA 1Y8QA 3IC5A 4IJVA 1E6EA 1E3IA 4NMHA 2J6IA 4OKNA 1X1TA 3SBOA 1EVYA 4XR4A 4QO8A 1GQYA 3FSRA 3WNQA 5L45A 3MJCA 3AY7A 3FI9A 3WQQA 1XG5A 1DJQA 3TFQA 3ROQA 2GZ1A 1BHSA 4MP6A 3FRJA 5G4LA 2B37A 5B4VA 4E5MA 2YDYA 2YW9A 3I1JA 4WPGA 1GEEA 5A3VA 3BTSA 4GAEA 4PCVA 3ZWOA 4J1NA 4B7XA 2P91A 4IPTA 3ZI0A 3RJ5A 3LQFA 3G79A 1PSDA 3ANLA 1E1LA 1I5RA 2W2KB 2DTEA 2YZ7A 1XELA 2HJRA 4S3MA 2FPPA 5A04A 2DPHA 3HDQA 3HWRA 4W9NA 3CKYA 5DCUA 4BO2A 2ILTA 2EJVA 3LU1A 5A05A 5IZ4A 3KHUA 3WOHA 2PKQP 4ZICA 4M55A 1P1KA 1VSVA 3K9QO 3WIDA 4K1LA 5TQVA 1AHIA 3MWDB 1UXKA 3ZHZA 4FCCA 1XIVA 4PG6A 4OL9A 4YRAA 1WZEA 1KVTA 4WCFC 5T8KC 3IQDB 5LC1A 3D3WA 5JCJA 3UVEA 2DC1A 3WGOA 1PJCA 3NDRA 2JJYA 3BMNB 1UDBA 2DAPA 2PTGA 3JQ8A 4J16A 3UW3A 4MDHA 1HL3A 2WTBA 1E7QA 4MVJH 5HA5A 2V6BA 2D4AA 4RPGA 1PTJA 1P45A 4EW6A 1DFHA 1HF3A 1NR1A 4CLOB 1ISGA 3MTGA 2CF5A 1B26A 1YJ8A 1JAYA 2HMUA 3DTTA 4IQ0A 2Q45A 3I6QA 1KVSA 1QYXA 4OXNA 4TKMA 2FMUA 3DTYA 1C3VA 3PYMA 4Z3KA 1MV8A 3E1KA 1DAOA 3K96A 1T26A 2YHUA 4NBWA 1BVUA 1MC4A 5A1TA 3M6IA 1KS9A 3E18A 5EL0A 2YV1A 1P3DA 3PQFA 2EIHA 2JHFA 4CM4B 3BMCB 4YJGB 5AXBA 4HADA 3HFGA 3ZWCA 2Y67A 2DT5A 2B0JA 4NU5A 4ALJA 1B15A 1CQJA 1YQGA 4KDEA 3W8EA 4AJPA 1C14A 4RV9A 2VN8A 3OBBA 4XKJA 3ZHXA 4RVSA 4O5OA 3C1AA 3IAHA 1H2HA 4RVGA 2DU8A 3HNPA 4A10A 1I2BA 1P1HA 1XQ6A 3JYOA 4IZIA 4JBHA 4WOJA 2GZ2A 5MGBA 3EDMA 3AI3A 4XQCA 3WWZA 2P5UA 3HN2A 3NV9A 4FOSA 4E5NA 1BW9A 3FTPA 2IDZA 2VRCD 2DKNA 2EXXA 4LN1A 4NJMA 2RH4A 4TZKA 2P4QA 1P1IA 1ULSA 4OKIA 4U6QA 3W1VA 1OFGA 1DOHA 3JYPA 2HK9A 3PPIA 2ZQYA 5EESA 1JDJA 2JHGA 2OP1A 1GL3A 4E30A 4LRTB 1XDWA 1YQDA 3DMYA 1PX0A 1UXHA 4PLPA 1DBVO 2WEKA 5T5QA 2NWQA 4BMVA 3I6IA 4PZDA 5DCYA 3TL3A 4BNTA 3H5AA 1LUAA 3G1UA 3QLJA 2NVUB 4PLCA 2X0NA 4ND5A 5EN4A 5G4KA 4ALIA 5CAEA 4HKTA 2OOSA 4XB2A 2QQ5A 4W9NC 4W99A 4L76A 3GR6A 1LNQA 3GN2A 1V9LA 4DMMA 3JCZA 3M1LA 1HETA 1Q7CA 4WE3A 1X7DA 1YVEI 3OF2A 4CQMD 4MVJI 1DO8A 3HHPA 4OQZA 3MWEB 4DPMA 1WDLA 1UXIA 3UCEA 3VAZA 2W2LD 5L7YA 5CFZA 1HLDA 4WNCA 2HRZA 3GHYA 1ISMA 1CETA 1RYEA 4C7KA 5FWNA 3CH6A 4GX5A 4R1UA 4WEQA 2C29D 1HEUA 3RC2A 1DRUA 1G0NA 1GU7A 1V8BA 3DB2A 3OQBA 4FGWA 2X4GA 4ONEA 1WVGA 2E49A 4HNGA 4ZQEA 1PWZA 4GLLA 2VYND 3UH1A 1T1SA 4BGVA 3RC9A 1NAIA 1O6ZA 3NT2A 4OMUA 3QWHA 3AOEA 3Q1LA 2OBNA 2O4UX 3P7MA 2GASA 4Q3AA 3GPIA 5ILOA 4J91A 1GDHA 2UUPA 1NVMB 2VHXA 3UICA 4NH4A 2C2YA 1E7RA 2I5PO 2IXAA 3HADA 2YHIA 3LLVA 3V2HA 1DFGA 3TOZA 2WYVA 5L7WA 4HV4A 4YRDA 4U8GA 1VSUA 3BMOA 3PK0A 4RVFA 1OAAA 4D7AA 1C0KA 3DZKA 3EVNA 4UUNA 4JXKA 3QWIA 4DLBA 1E3EA 2O7SA 4F6CA 2X86A 5KVQA 4RQUA 1IB6A 4YAKA 2IZ1A 4I5FA 1ONPA 1T2FA 5JAZA 4UEJA 1BGVA 4KDFA 1BDMA 2HKIA 4CL3A 4XZ3A 1E5LA 3HE3A 4BMNA 4XD2A 1WPQA 1U8FO 3NEPX 4TRRA 4CMKA 1JWBB 3FNHA 4ZQBA 1YQXA 1YGYA 1AXGA 3HB5X 3BTOA 5I8ZA 3LF1A 3LC1O 3JYQA 2AW5A 4XYEA 4RJTA 1VPDA 3A1NA 2B36A 3GFGA 4JBIA 5H83A 1E7YA 2CDBA 5IZCA 1DRWA 4YT8A 1Q0QA 5I7FA 5MDHA 1U1IA 3CMCO 5A9TA 1ARZA 1HT0A 1HYHA 1VJ0A 2CSUA 5C3MA 3O8QA 5A4DA 1T24A 3SLKA 1T4DA 4BGIA 4XYLA 3QA9A 4M49A 2VYVD 3ZHBA 3Q11A 5C5IA 1NBOA 4FGSA 2IZZA 6ADHA 4L75A 1Y8RB 4AJJA 3HDJA 4MJLA 4YAGA 3QSGA 1SPXA 4GH5A 1GUFA 1PQUA 3NGLA 3FBTA 1PJ4A 1ADGA 4IDAA 3DBHA 2Q4BA 3QVTA 4BKPA 3WGGA 1E1MA 1SBYA 3MTJA 5DF1A 2VRCA 4R16A 3PEFA 3FR8A 1PS0A 1LU9A 1Y6JA 1ZJZA 1RM5A 4Z9XA 3U0BA 1H9AA 4IXWA 1T1RA 3JQAB 1MXFA 3N58A 3IJPA 4RLHA 1P31A 1IY8A 4NU6A 1V3VA 2NACA 1ZCJA 3CMMA 2TMDA 2AQIA 1U5CA 3EVTA 3T7CA 5C7LO 1D7OA 1PGPA 3KZVA 1UDAA 5T64A 3EAGA 4YA6A 3VKVA 4AJKA 4BNLA 3GY0A 3N74A 4FJ2A 3CINA 4ALKA 3DOJA 5H82A 4OSPA 3AOEC 4BKUA 3R3JA 3S2EA 3DMTA 4FB5A 3GVCA 4MOWA 2VOJA 5ER9A 4YEDA 3MJ4A 1C0PA 3ZNPA 1J5PA 3OA0A 1XYGA 2BGLA 2JFGA 3ASVA 2J5RA 2IEBA 1NFFA 3PHJA 3NX4A 1IZ0A 3VHRA 5DNAA 3GMDA 4F3YA 2NVBA 1D1SA 2V7PA 5CDSA 4XB1A 1PIWA 2O23A 3JSAA 3RIHA 3T4EA 4DQXA 1LSSA 4R3NA 3WDSA 2ZB7A 3RWBA 1XU9A 4UUMA 1Q7BA 3VVBA 1DHRA 1DLIA 1P1JA 2H9IA 4OIMA 4DTIA 5DZSA 4RPJA 2C7GA 3ABIA 1PJSA 3PTZA 1B3RA 3ANNA 2X7HA 3GDOA 2X9VA 2AA3A 4E5KA 5LDGA 3VOSA 1ZIDA 2Y1CA 5BSFA 5I9NA 1VJTA 2Y0DA 3BYZA 2IEDA 2WE8A 2JFHA 4KMSA 5AVOA 4ZRMA 1U4SA 1MC5A 5IZCC 2B4RO 5G0TA 5A9SB 1TVEA 2UDPA 3WJ7A 4AJNA 2X5JO 4IQ8A 3SJUA 2BLLA 2QHXA 1YO6A 2ZQZA 3UUWA 1YKFA 4E4YA 4ITUA 3VZPA 2HDHA 1O9BA 2X0RA 1DHTA 3F3SA 4PZEA 3PIDA 1JU9A 3DZBA 1N7GA 4WK6A 3T7EA 3ZU4A 4N54A 4CLXA 5CDUA 1C0LA 3R6DA 3IOYA 1R4NA 4UUOA 3ZN2A 4IGEA 4AJ4A 1Y5MA 4I5GA 4LVCA 4BNKA 1SEVA 4KUHA 1A9ZA 1O8CA 4D42A 1PS8A 5L9AA 4P4NA 2GN9A 5K9ZA 4L4XA 3GDGA 2BELA 4NIMA 1LX6A 4Z9YA 4ZD6A 3TZCA 3H9EO 4RL6A 4Y6SA 1ZFNA 3SC6A 2VHWA 4R41A 1R15A 4YACA 4CQLB 1O5IA 4JK3A 3U3XA 4QO7A 3CIFA 3UXYA 3RBVA 1PU2A 1KETA 4CV0A 3WYEA 4AL4A 2E4AA 3ZNQA 3JQFA 3E5RA 2VYVA 2G5CA 2UUOA 4GMGA 2NSDA 1P33A 3JV7A 2DUUA 4GBJA 4BO9A 3RKUA 5DT9A 4HX5A 3SEFA 2D5CA 3RU7A 3UF0A 1EVZA 1D8AA 1E7MA 1QXSA 2I3GA 2W2KA 2FZEA 5ICSA 4IMRA 4IJWA 2VHVA 3FBGA 3V1TC 2E48A 1Z73A 4Z0HO 1XGKA 3EUWA 5DBFA 1I3LA 5F1KA 1PZFA 4MP3A 5C7OO 3GOHA 2DUWA 1H5QA 1XA0A 1KEWA 2J3IA 3AI2A 3P2OA 2YV3A 1T2EA 1JLLA 3BTVA 1PGNA 4XDYA 4NHEA 1NNUA 2VOEA 4RPHA 1AGNA 3BMNA 2J3HA 3OJEA 3RFVA 4IIVA 1HDYA 4RZHA 3ZCXA 3FPCA 3C24A 2PNFA 3V2UA 1ML3A 3ITDA 4BO3A 4EJ6A 3NT5A 4IDEA 3TSCA 4CLOA 1M76A 1TT5B 1NAHA 4BNNA 4EUEA 5L95A 3CEAA 3M2PA 3IJRA 4YRBA 2AE1A 5B1YA 3NJ4A 2Y93A 1EEHA 1DIAA 1V0JA 3BZUA 3PDUA 3AY3A 2W8ZA 4Q9NA 5BR7A 2GN8A 4FPXA 4XJSA 4G5HA 1AE1A 1EVJA 4W4TA 4CM4A 3WSVA 1JKFA 1PJ3A 3BMCA 3ICCA 1K5HA 3ZU5A 5KJ6A 5EMHA 3GG9A 3JQGB 1ZBQA 4CMAA 2Q1UA 1DPGA 3PXXA 2VWPA 1NFRA 2XOXA 3QW2A 1FJHA 2RHRA 3JQBA 1U2DA 3OJOA 5BT9A 4YJFB 1QLJA 4B7CA 1HE5A 2GUGA 1U7TA 3OH8A 4BB5A 4CMEA 2EGGA 3GVPA 4MIOA 1RYDA 1X7HA 5IDYA 3I9NA 2O2SA 2PD3A 5AXAA 2I76A 1S6YA 4XGKA 1CJCA 2PY6A 2CMDA 1LC3A 4AFNA 2PFGA 3JQFC 1D3AA 3KYCB 4QSMA 1FDVA 4AJOA 3ICPA 4CM3A 4J7CA 1UXGA 3KLPX 4P4LA 3GNTA 2PGDA 4BQRA 1X0VA 4CPDA 1YBMA 3TL2A 5JCJD 2G0TA 1P1RA 4HBGA 2H5LA 3MJSA 4DYVA 5CP8A 1HTBA 1ZXLA 4WOKA 5ICMA 5JC8A 4CM9A 3AM3A 1OI7A 3GDFA 2LDXA 1K3TA 1P1FA 3JQ9A 4RDIA 4BNJA 1WWKA 1P0CA 3AUAA 5DBGA 1LJ8A 5ITVA 1NR7A 4BO4A 5A9RA 1Q2XA 3WGHA 1SOWA 3B1JA 2VUSA 4XX0A 3QVWA 4R5HA 2PR2A 4BIIA 3V8BA 2Q1SA 3ZV5A 4EEXA 3V5NA 3LZ6A 1IHYA 4CMBA 4LCJA 3E9NA 1XQ1A 2OORA 4BV9A 1F17A 4FFLA 2VT2A 1DJNA 3RJ9A 1I01A 3JD1A 4E0BA 3GH3A 1ADBA 4JLWA 2HK8A 4BO5A 3DBVO 2ET6A 3ZW9A 5JY6A 3VPXA 3VZQA 1EE2A 2ZATA 4ID9A 2Q2QA 4CM8A 1V6AA 2PKRA 1FF9A 1E1NA 4BNFA 3UFXA 1P44A 3NKLA 3OQ6A 5IXSA 2Y99A 4FIZA 1BVRA 2FP4A 1JTVA 3S8MA 1X14A 1HSZA 2G1UA 3WIEA 4BO7A 1Z6ZA 3DQPA 2VWQA 4XWYA 3Q9NA 4XRGA 5TC4A 1GD1O 3D4NA 4J1TA 4HP8A 3BIOA 5DCWA 1MP0A 3F1KA 4ZU3A 4GX2A 1HZZA 2DBRA 1A7AA 3F47A 4IS3A 4TMFA 5KOIA 1LQTA 3I5MA 3KYDA 2OUIA 3ST7A 3X2FA 3TDKA 2UAGA 4IXTA 3WXBA 5DP2A 2YY7A 3Q3CA 4RVDA 5IDXA 4D45A 3WYCA 1JAXA 1WAMA 3WFJA 2PLAA 1XSEA 4C4OA 1EK6A 4GL4A 2ZIZA 3ROMA 3PJFA 3WS7A 2BKAA 1X1EA 1ENZA 4CMEC 3AUSA 1U8XX 4TZTA 2OO5A 5EQFA 1LLUA 3ONDA 1QYWA 2HMTA 1FDSA 1KBZA 3BHMA 1SB8A 3A14A 4GSKA 1PZHA 2ZCVA 3OM9A 4IBOA 4IY1A 1ZNQO 2E6UX 4J9UE 4JX8A 2HU2A 4YT5A 4CL8A 5A06A 4EI2A 2R00A 5JO9A 1CRWG 1A7KA 2AQHA 4E6PA 5GY7A 3PHIA 3K5PA 2EHDA 3AW9A 3BXXA 3I52A 4TKLA 3HQ4O 1LTHR 1L7DA 5DN9A 4D3DA 4Y9DA 4W7IA 4IGFA 1R0LA 4XQGA 3ONFA 4ZRNA 3TZQA 4OOFA 1LDNA 4HFNA 1NQAO 2YFHA 1R66A 3G0OA 4ZJUA 1Y9EA 2EP5A 2QRJA 4O63O 1W73A 4WLNA 3JQ9C 3PFWO 4YJHA 1WLYA 4KWIA 3DHNA 3GFBA 2O3SA 4WCDA 5JC1A 3JTMA 4P22A 2RHCA 4OJNA 3BMQB 4MP8A 5G0WA 3UN1A 3ENNA 1PZGA 1E0DA 3PYXA 4JGBA 5HTOA 4W6ZA 1QV7A 1QG6A 1ZSVA 3H4VA 1QSGA 4XIJA 4XQEA 2C07A 2SCUA 4E31A 1IULA 5COBA 4UVHA 1SAYA 1VKNA 4GQAA 1YWGO 5JAMA 3DBLB 4E5PA 2O3QA 3JQAA 1IL0A 7ADHA 2VZ9A 1IE3A 4R1TA 3ORFA 4CR7A 4YPOA 2HMWA 4XEHA 4AVYA 2Y66A 4R68A 5F3RA 5EPOA 2ZTLA 3OJ0A 4J90A 3VH4A 5KIAA 1NASA 3HDYA 1U5AA 1N9GB 2IYOA 1GYRA 3GUYA 4PVDA 2PD4A 4ZHSA 2D8AA 1D4FA 2I65A 5IDQA 2NV6A 3K8ZA 3DOCA 8ADHA 1EBUA 1SOVA 4GMFA 2C0CA 3WYBA 3EZYA 2EW8A 4CM1A 3I9KA 3DBRA 3IL2A 4IDFA 4BO1A 1VJ1A 2CD9A 3IIEA 2V65A 4BO0A 3QIVA 5JYEA 3DO5A 1I32A 3PFFA 1CYDA 5B12A 1DAPA 3GGOA 1OBFO 3DAPA 3JD3A 1N8KA 4M54A 2WYWA 4L0QA 3R0IA 3ZWBA 1X15A 2QRKA 5IJZA 4B8ZA 3JQCA 5IAAA 2Z1MA 3K6JA 1YONA 3K2BA 4IDDA 2EV9A 3H65A 1YRLA 2AMFA 2EKLA 4P38A 4MO2A 1PZEA 4KWHA 3D0OA 1HYEA 3ZWPA 1JKJA 2R00C 2C82A 4XGIA 2JD0A 4XR9A 4E33A 1GYPA 4I9UA 1Q0HA 3SLGA 1AXEA 1G6KA 2DFVA 3WGYA 2PZKA 1Q7GA 2BI8A 2Q2WA 4G81A 2NQ8A 5B4TA 1E6UA 2FZWA 4QECA 1OC2A 1Z74A 3C7CB 1T25A 2OZPA 4D0SA 1ADCA 3C85A 2QG4A 4FC6A 3GAFA 3OEWA 3ZU2A 4Q3NA 4B3IA 4PLYA 1ZUD1 3RUDA 3D4PA 3BHIA 2XAAA 4H7PA 1HKUA 1IYZA 4CUZA 3AU9A 4Z6KA 4QX6A 1IOLA 3L4BA 4YQZA 5THQA 5CDGA 4TROA 4PZCA 1SC6A 1FXSA 4CJXA 4TRJA 2AXQA 4X54A 1DEHA 2Q3EA 1WZIA 1FDTA 1B2LA 4QEDA 4RF3A 1EDOA 1LSOA 2QIOA 4R1NA 1J0XO 1L1FA 3I9OA 4HY3A 1QP8A 2V6MA 2FSVA 2BGKA 3DZGA 1LLDA 4Q3BA 4CQLA 4DC0A 1MX3A 3D3EA 3OETA 3CTMA 1ZH8A 3O26A 2Y1EA 3LK7A 1UZMA 3KB6A 5F5LA 3UCXA 4Z9FA 1R0KA 1Y7TA 4INAA 4U6SA 5TT0A 1XHLA 3VPFA 1FDUA 4BNYA 3U09A 3F9IA 2B5WA 3D5TA 1ADFA 2WJPA 1U9JA 2EKQA 5JLAA 4QFDA 2OMEA 2NM0A 2QW8A 5HBRA 4EZBA 1QORA 4CR6A 4KZPA 5CPBA 1YB1A 4GPD1 1NWHA 2D5AA 3TRIA 2NQTA 4NBUA 1U3UA 4FD3A 5DULA 4FQ8A 9LDTA 1SMKA 4GLOA 1NWCA 1P74A 1PR9A 2F1KA 3F1LA 5DOVA 4QXMA 3PWSA 4XA8A 3GG2A 4GSLA 2O4CA 4MVJP 4EJMA 1NVGA 5JAIA 1SZJG 3FR7A 4L9RA 4AJ1A 4FDAA 4HUJA 1WDMA 1I3KA 3W4JA 5ENVA 3E6AA 4BB6A 5F1PA 1CIVA 4XJTA 4U5QA 2X9GA 1GY8A 1RWBA 4NFHA 3VH1A 2PV7A 4PIVA 1A4IA 3ZNOA 3B1KA 4HXYA 5CEEA 2NTNA 4MVJF 1JN0A 5KJ1A 1EUDA 1O94A 4H3VA 4OHUA 4CUJA 2O50A 3G49A 1K0UA 1R4MB 3DFUA 1KOLA 3K92A 2CY0A 4B4UA 1YJQA 4M87A 3OMLA 4MKRA 3ASUA 1Y1PA 1ZVMA 3H3FA 3GVXA 3L4SO 1K6JA 1UP6A 3PIIA 3O9ZA 1WXDA 4L8VA 1XR3A 2ZYAA 3PP8A 2PKQO 3C8MA 4UVDA 3OQ1A 1QV6A 1G1AA 4IQGA 4J49A 5EQDA 3BA1A 1U28A 1DC5A 4J6FA 1LXCA 1RKXA 1VE9A 3M2TA 3NTQA 3PJDA 3QHAA 4XCVA 4ZGWA 5BSHA 1F8FA 1U4OA 2WYUA 3OIFA 4ALMA 1I0ZA 2VHZA 5ITWA 4J2OA 3MJTA 3AK4A 4R9SA 3ZWYA 2B69A 4PLWA 3K73O 3HJAA 3PHHA 5BSEA 3ZZNA 3L4BC 1ONNA 4XRRA 1ISFA 2HRBA 3NGXA 4QFCA 1X7GA 4QTZA 4EDFA 1E77A 2NTJA 3IMFA 4NQZA 2B35A 5ENDA 5L7TA 5I7VA 2E37A 4K26A 1H6DA 4R69A 4KUEA 2XPCA 4M89A 4PLHA 2EKPA 2OBYA 2NU9A 5K6AA 4YTEA 1QMGA 1E3WA 2A4KA 1LDYA 3V2GA 4JP3A 3AWDA 2IZ0A 3KYCA 3U4IA 3WTCA 5JDIA 1ORRA 4FFRA 1UAYA 1C1DB 3GEGA 4H16A 1KERA 2WMDA 5T67A 2WE7A 3SJ7A 2PH5A 4JBGA 1XWFA 4PLFA 4IDBA 1NTOA 3C1OA 4RVHA 3QWBA 4IS2A 2BFPA 3S2GA 1FDWA 2O3TA 1PWXA 1Q1NA 3L6EA 3D3WB 5TNXA 5KJCA 2ZK7A 3RUFA 2OGUA 4O1MA 5FI3A 5TGDA 3GEDA 3JQ8B 5U1PA 4JP2A 2Z5LA 3H2SA 4IMPA 3E9QA 3WJAA 3AUTA 1BXGA 4BGEA 1YOVA 4R54A 4ZQHA 5L4NA 1W4ZA 1R16A 1ZSNA 4XDZA 1UXJA 1ZEMA 5F21A 4A27A 4PG5A 3WTBA 2PGLA 1A5ZA 1EFKA 3WGZA 1PJ2A 3ETDA 4GKVA 2Q4EA 2RBEA 3WMXA 4D41A 3UCFA 3ENKA 4GVLA 2P9GA 3WGTA 2B4TO 2P5YA 2WD7A 4D3FA 3WG9A 2GRAA 4M8SA 5F5NA 4CUKA 4NBRA 4IIUA 1F0YA 1UZLA 3EYWA 1MB4A 4D79A 3GZNA 3VPHA 3ZNNA 1PS9A 1NHWA 3D64A 2GGSA 4NBTA 3U4HA 1OMOA 1UUFA 2Q1TA 4R1SA 4EGFA 4EUFA 2EP7A 4ESOA 4CMJA 2HMVA 3H8VA 1I3NA 5BNTA 3PGJA 5KWEA 3JQEA 3ZHYA 1YBAA 5TS3A 3RAJA 2DM6A 1C1XA 3PI7A 4FS3A 1HE4A 4MVJD 1XCBA 2POQX 1CERA 3AFNA 3ON5A 5I8WA 2P9EA 3QE3A 1H6BA 1HE3A 4NJMB 1LDEA 3NDIA 1LRJA 1PQPA 4J4TA 4A2CA 3KSZO 4FFOA 1A71A 1YE3A 4DGSA 2UVDA 4CM9D 4BNGA 1GUYA 4CV1A 2VHYA 3HUDA 1IZ9A 1GZ6A 3LC2O 1PGOA 1H6AA 3QV1A 5GZ6A 3GLQA 4L73A 1IUKA 1E6WA 1U3VA 5IN4A 3IS3A 1UR5A 3INTA 4MKZA 2EF1A 3DEYX 2D2IA 3O38A 5K6AC 2NU6A 1ZSYA 1V3UA 3GGPA 2Q99A 3KTDA 2GF2A 4LCEA 1B14A 4RORA 4ND4A 1WDKA 1LC0A 1SEPA 1V3TA 4GKBA 1S7CA 2AQ8A 2VUUA 8LDHA 5JDIC 1CQIA 3GRKA 1NPDA 5DP1A 2W4QA 1B3BA 4BKQA 1U3WA 3EC7A 1TEHA 2JAHA 3PLRA 4C7JA 3H7AA 1EVIA 3FNEA 1U2GA 2C5EA 5CDTA 1J49A 2BMAA 3DMTC 4KQWA 2O3JA 3CPSA 4LVUA 4DMLA 4CR8A 1LDMA 5FFFA 3ULKA 1NM5A 4AJ2A 3ZW8A 1KIFA 2J5QA 1BXZA 2CVOA 4R51A 4MIEA 2NVWA 1XLTA 2QYTA 3H9GA 2R6JA 2V6FA 2WM3A 2YFQA 2ZYDA 3BMQA 5CG1A 1B8PA 1VI2A 3COSA 4IDCA 1ZK2A 4NPCA 5DBIA 5I7SA 3DC2A 4PRLA 4HFJA 3SXPA 5JBIA 3V1YA 4S1VA 4E2YA 4LISA 4OOEA 1QYCA 3PQDA 4EITA 4TVBA 2D3TA 5AXCA 4F45A 1KC3A 1LLQA 2JCYA 3PZRA 1IPFA 2FSSA 4WLFA 3OSUA 2HK7A 1ZMTA 2AG8A 2HMSA 2R2GA 3LYLA 2GO1A 3VZSA 1HDXA 2PD6A 3BMOB 4RPKA 3INRA 2Q46A 3VH2A 3TFOA 3KBOA 4QQRA 1PGJA 4A7PA 4NK5A 1PEDA 2BHLA 1DB3A 3CXRA 3GUCA 1B8UA 4XGNA 4LRSB 4UVIA 3U9LA 2GCGA 4Y98A 1ULUA 2CDCA 2DLDA 1VL6A 4O59O 5JS6A 2GZ3A 1MLDA 3RBXA 4BOYA 4I1IA 1W8DA 1HDGO 1O95A 3NJ8A 3AJRA 4B8WA 5ADHA 4IUYA 2EWMA 3TQHA 5KJEA 1H93A 3N7UA 5A02A 1E92A 3JD2A 3NT4A 4YJGA 2JCXA 3E82A 2C20A 4D43A 3PHGA 1HLPA 1LSJA 4O0LA 2XXBA 3KUXA 3KO8A 2VNSA 1JVBA 3EK2A 3QJ5A 5TIIA 3X2EA 4I9HA 4IDGA 1AUPA 4A03A 2E82A 2Q1WA 4WLUA 3AU8A 5TJHA 1DIRA 3WLEA 1JKIA 2Y0EA 2YUTA 1EQ2A 1KEUA 3FNFA 2VZ0A 2Y1OA 4G2NA 3GNQA 1NQTA 2GYYA 3OHSX 3ZV3A 4FC7A 3H5RA 4CLRB 5A3JA 4BNMA 5T6BA 2QZ9A 3DBHB 2OXIA 1LDGA 1QKIA 4MVJA 3ZV6A 4UEOA 3WWYA 1PJLA 3JQAD 4ZN6A 1GAEO 4E12A 4YB8A 3L6DA 2VWGA 1HWYA 2VNAA 4XQ9A 3PRJA 1K6IA 3MJEA 2NVUA 1EQUA 3P5SA 4NDNE 4DC1A 1D1TA 1Z45A 3I9LA 4FFNA 3C7DB 3W4IA 3MZ0A 2P2SA 3QVXA 2XF8A 3WR5A 2VCYA 4ND2A 2V6GA 4FR5A 4W82A 5HWSA 3RUIA 5I9MA 3RROA 4DIFA 3KM0A 1J6UA 1BMDA 1YB5A 2DTXA 1U3TA 4P8RA 3UOGA 2CNBA 2O48X 2DBZA 5L51A 2B4QA 3PDJA 1ZO8A 1NPTO 1EUZA 5IF3A 1GFSA 4AJIA 2BFAA 4YXFA 4CQMB 2X0JA 2Y68A 3U62A 1MUUA 2FOIA 3CUKA 2F00A 2J3JA 4I5DA 1OOEA 1JVSA 1RPNA 2EW2A 5L3ZA 2DQ4A 4E21A 3FHLA 3CZRA 3H3JA 3GVIA 1NFQA 1T2CA 5JAQA 1RM4A 1VRWA 1H9BA 3G17A 2B83A 2PZLA 4OSOA 3I9JA 2FPGA 2NADA 4RQTA 4RPLA 2GNAA 4PN3A 4EYEA 5U4QA 1GCOA 2I3AA 1JWAB 5T8KA 3STHA 3ITKA 4PGFA 1E3LA 2IE0A 3MOGA 4DUPA 2I6TA 3RU9A 4MVJM 3GMSA 4ND3A 3Q6IA 3C3XA 1WMAA 2RIRA 2HJSA 1VKOA 1MFPA 1Q0LA 1O0SA 1E3SA 1YL5A 2WSBA 3RVDA 1I8TA 4WGGA 3H6KA 3D7LA 1GQ2A 3E8XA 4PLZA 5HS4A 3VTFA 1TA4A 2CF6A 4MIYA 1DFIA 1Y81A 5JY1A 1KY5A 1HDCA 5TLSA 3IKTA 3AM4A 4ZQFA 3JQBC 3OEYA 2X6TA 3AM5A 3DOOA 3G3EA 2JFFA 4WNIA 4Q39A 1I36A 3I9MA 3L77A 4NG5A 1AHHA 4PRKA 4XYGA 5KJFA 2BD0A 4CLEA 1OC4A 2YQ5A 3JYNA 3S55A 3KLMX 3W4KA 3VKUA 4YQYA 3W8FA 5KCZA 2G17A 1E3JA 2P9CA 4J2HA 3GAZA 4ZVVA 2EEZA 2X8LA 3E48A 1B8VA 3RCBA 5FYDA 3W6ZA 1N2SA 2HO5A 1R4MA 3E9MA 5G0SA 3QP9A 2UV8A 3F4LA 4YWJA 3D1LA 4IM7A 4TWRA 5G0UA 3ETEA 2Q2VA 1P77A 3WQRA 3SC4A 4D0RA 3GHHA 3FWZA 1HSOA 3IP3A 4BS9A 3OIDA 2CVQA 4JJIA 3U49A 1ID1A 1E1KA 3GA0A 4JIGA 1Y8RA 1NQOA 1XEAA 4BV8A 4K28A 4Q3CA 4RGBA 1EDZA 1Y5RA 1I33A 4DPKA 4PVCA 1UP7A 2FWMX 2I99A 1J4AA 4CMIB 1RM3A 2X9NA 1LDBA 1PJBA 3GPDG 4BHTA 1JA9A 4KOAA 4YR9A 4OQYA 3HFSA 3TZKA 1L7EA 4R3WA 4K9DA 1H94A 2JCVA 4XIYA 2C2XA 5JPIA 5CDYA 1BXKA 1XKQA 2I66A 3LVFO 3HG7A 3KYBA 4AJHA 1IHXA 4DVJA 2NU8A 1LSUA 2DFDA 3H2ZA 5F1OA 3WNVA 4CLHA 1TI7A 3GF4A 3FTNA 5LDHA 4RO0A 3PQEA 1QR6A 3OA2A 3ZV4A 2G76A 5JFOA 4YBZA 1ISHA 3M1AA 3Q0EA 4Q3DA 4BKOA 4WJZA 1C1DA 3I3OA 3FWNA 4BKRA 1JQBA 2FR1A 4GGPA 2GLXA 3FN4A 4FBGA 1A72A 3DR3A 2X22A 6LDHA 4Y8VA 1H0KA 4CMCA 3ADOA 4BNWA 3ROKA 1UDCA 3IUPA 1UH5A 3B70A 2X5OA 3KV3O 5CHEA 4DLAA 1ZK3A 2AEJA 3MCVA 4OO3A 3U4CA 3T4XA 3TPCA 1PJQA 2P68A 2Y0CA 3JQ6A 3KETA 3KEQA 1MA0A 1VM6A 3P2YA 3EGOA 1LA2A 1EK5A 1I2ZA 3PJGA 2GN4A 4YJDA 1PL8A 3GEMA 1JW9B 4NFSA 3RBZA 2IYPA 1SNYA 3RUAA 4DRYA 3S1LA 5IN5A 1C0IA 3S2FA 2Z1NA 1K89A 2C5AA 3GRPA 4JQCA 4CV3A 4WUVA 1M67A 4N5MA 1ENOA 4I08A 3KEOA 4E2ZA 3K2EA 3B1FA 3D5QA 3F6YA 2AEFA 3WFIA 1GZ3A 5TF4A 1I24A 5TRTA 1NP3A 3NRCA 1TB4A 1KC1A 4EBFA 2ZB8A 1UAGA 1Z82A 5A9SA 3O03A 7MDHA 1Z7EA 4NZ9A 2C7VA 5EERA 5JXWA 1GR0A 2EJWA 1K6XA 2GPTA 3GQVA 4HWKA 4LSWA 4UEKA 2IXBA 1YL6A 4E13A 4TVOA 2J3KA 4BVAA 1N7HA 3ZWVA 1M6HA 5JDCA 4CMGA 3RUEA 2QRLA 4TRMA 4KUGA 4R5MA 5TSDA 2H6EA 2YYYA 4J0EA 2CDAA 3H5NA 2ZTMA 2GSDA 5ES3A 1F8GA 5U9CA 4II3A 2HCTA 1X13A 4B4OA 1HDOA 5LCXA 3RFXA 4JROA 3OIGA 5AQ1A 2YV2A 3H9UA 2ZB3A 2O3RA 3HSKA 2PK3A 3LT1A 5A03A 4YAIA 1ENYA 4KQXA 2FR8A 4B7UA 1QYVA 5I9LA 3TZHA 2TMGA 2ZB4A 4M1QA 3UKOA 5T57A 2PZMA 4ROSA 4F6LA 3O4RA 1KYQA 1PL6A 3WMWA 3DFZA 4CM7A 4E5YA 3DAGA 4DREA 1E7SA 4WKGA 3ROPA 1WMBA 3FD8A 3ZWAA 1R0SA 1PGQA 1HDZA 4W7HA 4XYBA 4B4WA 1DIHA 3ZWWA 9LDBA 2C54A 4G65A 4WCFB 3MOIA 4BNHA 1HZJA 3DZFA 2JD1A 4BO8A 1KY4A 1ISIA 1HDRA 4RF2A 2FN7A 2BFOA 4YAEA 5FF9A 4E2WA 5HRUA 5G0VA 3HZZA 4WLOA 2BGMA 4CM8B 2Q49A 2A35A 3JQ7B 2J5KA 4KTVE 3QVOA 4Q3EA 1QYDA 4L4SA 4E3ZA 3ZWMA 4I5EA 1GPJA 1NQ5A 4YCAA 5L4SA 1R37A 2CVZA 3GGGA 5DOZA 4U7WA 4D46A 4F46A 5B4UA 2GERA 1LBEA 2Y1FA 1ZZEA 1DC3A 3EZLA 4PFJA 2ZJ0A 1P0FA 2FR0A 4KP7A 1NHGA 5BNFA 5TJ9A 3VDQA 3TNLA 3NUGA 1GUZA 3AUUA 5HM8A 1WP4A 2RH8A 4LK3A 4PG7A 4CLDA 2HAEA 1I30A 2D59A 2HQ1A 4N5NA 1NPYA 2I67A 4OAQA 1HYGA 2OL4A 3KYDB 3C1TA 3B6ZA 5KVSA 3D4OA 5CEJA 3ZWXA 1SB9A 3A4VA 1N5DA 4NFYA 4WLEA 1GADO 5A5EA 1M2WA 4URFA 2X0IA 1TT5A 5KTKA 5L40A 4NR0A 5BQFA 4NI5A 2ZCUA 3ZH2A 3GNSA 4OGWA 2OHXA 3Q9UA 3UGKA 5JE8A 3SX2A 1ZMOA 1EBFA 1EMDA 2DBQA 4UULA 2O7QA 3BHJA 4K6CA 1Y8QB 2NUAA 3LT4A 1VLLA 2EERA 3DZIA 4GGOA 4A73A 4BQPA 1NVTA 3DAFA 5JDCC 5C37A 4J4BA 1P9LA 3LF2A 3OJFA 5IFLA 2JKVA 5H81A 4MVJG 1N1GA 1GPDG 2A94A 3PVZA 4K6FA 3GVHA 2JAPA 3L0DA 5ILGA 3JQGA 3H9QA 3RSHA 3WGQA 3QY9A 5I7EA 3RQSA 1UP4A 3W6UA 1WNTA 1ZJYA 4R9RA 4YJFA 4OYRA 4BMSA 1GQQA 3WBFA 1B16A 3EW7A 5AXDA 2XXJA 5GZ3A 2ZTUA 4CMHA 4HFRA 1MG5A 3AY6A 3VVCA 5GZ1A 4OH1A 1TT7A 4YJHB 1EUCA 2DPGA 3WX0A 1ENPA 5KVVA 1M66A 2Y05A 3AOGA 4CLRA 4OXKA 1PL7A 2GN6A 1DDOA 1GCUA 1EZ4A 3LT0A 1ZEJA 3IDSA 1YDWA 2GDZA 3VC7A 1W6UA 4R01A 3FCOA 4B79A 2BFMA 3CZMA 5DDIP 3C7AA 5ER6A 2BI7A 4GVXA 4DIOA 4A5OA 1ZXBA 1GV1A 5BNIA 2FY8A 3OFSA 1U7HA 3KOUA 1N92A 5COQA 5JSFA 4PLTA 1H6CA 1YH3A 3DZJA 4IINA 4FN4A 4WECA 2JL1A 2NNLD 3RUHA 1ZK1A 3EY4A 3TZ6A 4RZIA 3PWKA 4L74A 3KSDO 4UAGA 3ZGYA 4Y6PA 5EINA 4E32A 3F5SA 3B20A 3L9XA 2CFCA 4MPDA 4CM5A 1BWSA 4QUKA 3WQSB 4BNXA 2EGHA 4FFPA 3RKRA 1YXMA 4P4GA 3GZ4A 4EUHA 3IKVA 4R4JA 4ALLA 1HRDA 2RAFA 4B3JA 2ZYGA 1M6WA 4CQMA 3DZHA 5AYVA 3U5TA 2WWRA 3WGIA 3IP1A 3DBRB 1LI4A 4Z0TA 5BSGA 3KSUA 1QLHA 2W2LA 1KVRA 1BSVA 1BTOA 3PLNA 1YDEA 1OZAA 4ND1A 3TOXA 4BNVA 3WSWA 4DA9A 1QRRA 3VZRA 3GN1A 4UREA 1MFZA 5A5FA 2VRBA 4FOOA 1PR3A 5GMOA 2BH9A 2I9PA 3PJEA 3TJRA 2HSDA 4LW8A 3A28A 1EE9A 4J1QA 2YDXA 1T4BA 1LRKA 2Q50A 4D44A 3UAGA 2A9FA 1O89A 1R6DA 1LRLA 1IPEA 4YYZA 2VYNA 3DONA 4AJLA 1E5QA 4I8XA 5CPFA 2PWZA 2EG9A 4DBZA 1CWUA 1LLCA 4FJ0A 1KVUA 1ZK4A 5THKA 2ZJ1A 1BW9B 2UYYA 5HS6A 4MVJE 1DIBA 4KTTE 3JD0A 5IDWA 1H2BA 2A92A 1ONOA 4U0JA 1CEQA 2FPIA 3OJLA 5KVCA 4EJ0A 3R1IA 4BL5A 3F5QA 1B0AA 4N7RA 4WEOA 3RFTA 5IG2A 3KXDA 1NXQA 3DDNA 2Z95A 4ZQGA 2G82A 2NU7A 3INGA 4J4HA 3MJVA 5IXYA 4ZA2A 1E7WA 2ZKLA 3OECA 2OFPA 4II2A 5FI5A 4LGVA 5JNLA 4DQUA 2PH3A 2YQ4A 5G4KB 4IJKA 2QYSA 1DXYA 5COAA 1PQWA 2H1SA 3WBBA 3DHYA 4WLVA 4BUCA 1F14A 1GZ4A 4RLSA 2D1YA 1KEVA 2RCYA 3NTOA 1R12A 2IRWA 3ONEA 4GX0A 4ILKA 4QT0A 3QVSA 3OP4A 4YAJA 4AICA 3PYLA 2VUTA 1YS4A 3RI3A 3DHEA 1HXHA 1DLJA 3E03A 2X5KO 4U0KA 3TWOA 4E2XA 3A06A 3BTUA 4DPLA 1GTMA 1SCUA 4LSMA 4M86A 4RF5A 5CEFA 5JO0A 3K30A 4OXYA 4RCVA 1BG6A 4JJFA 2HUNA 3Q2IA 4CODB 3WICA 2ZTVA 3DL2A 3NTRA 3VPSA 3SVTA 3VPGA 4CMIA 2AG5A 4J0FA 1CF2O 3NAQA 1ZW1A 3FF4A 4JJGA 2H63A 1DRVA 3DBLA 4HNHA 4FFMA 3ZU3A 1Z75A 4DIBA 3NYWA 2YHIB 4RDHA 3H9JA 2OP0A 4BNZA 4Z3DA 2VT3A 2DBVO 4D3SA 3VTZA 1GYQA 2HLPA 3LDHA 3DXFA 3I4CA 5EIOA 4N5LA 3RD5A 1N9GA 4CV2A 3TF5A 2VZ8A 2AE2A 1DC6A 4YDRA 3GT0A 2NTVA 5KKAA 4A0SA 2J8ZA 4LMRA 1MXHA 4I9NA 2AHRA 5C7IO 3OICA 1WW8A 4PLGA 4UVGA 1X0XA 3KVOA 1NX6A 2D0IA 3F46A 2Y1GA 4JNKA 2GR9A 5K0ZA 2AQKA 4AJEA 4CM6A 1HE2A 4LMPA 2VWHA 2P4HX 4YT4A 1BDBA 3UHAA 4BGUA 4BNUA 2FRDA 2VTDA 3AI1A 1V35A 3ANMA 3QWAA 3TN7A 1BRMA 3IUSA 4DBVO 2W98A 1AN9A 2YJZA 4IZHA 2PA3A 4MINA 1F12A 3KRTA 4GX1A 3U4DA 2AEMA 3JD4A 2LDBA 4MKXA 2CUKA 3O8QB 3VH3A 3AFMA 2DTDA 3Q2KA 4DLLA 5CG2A 1F06A 1A27A 3WB9A 2X1HA 3L6OO 4UVEA 1GV0A 4Y67A 1TXGA 5J23A 3E5MA 5KNLA 4FSHA 2QZZA 1A9YA 3P19A 3A9WA 2C59A 4J7UA 3RASA 3L07A 2O2YA 1TLTA 1K2WA 1RJWA 4DXHA 4DYDA 5G2OA 3HDHA 4H15A 1VC2A 3JQDA 4PG8A 4NBVA 4TRNA 3FPLA 3R3SA 3ETGA 1ZK0A 3QQPA 1E3WB 1YL7A 1LQUA 1PJTA 1YBVA 2PZJA 3EMKA 4GWKA 3RC7A 1YB4A 4HFMA 3PZBA 1UJMA 2X23A 5JW6A 4PLVA 1T2DA 2NLOA 4UUPA 4AG3A 2CZCA 3ZWNA 3PWZA 4RVUA 1N1EA 4DQVA 1Y9AA 2WD8A 3JYLA 4JCOA 4WASA 4A26A 1MG0A 1W0CA 1I10A 4YVFA 5JCXA 4J7XA 1MGOA 2BF7A 4Z0PA 2DVMA 3L9WA 4XYMA 4PG4A 2FHSA 1I2CA 4B4VA 1XU7A 3QRWA 4TSKA 3HN7A 2Y1DA 2PGJA 1I3MA 1NYTA 3CE6A 3GC6A 1BXGB 5TX7A 2VQ3A 1YOVB 2GD1O 2X58A 1DIGA 3I83A 5L4LA 1DC4A 5B37A 2W90A 3GK3A 5TT1A 5FEUA 1KEPA 4NJOA 4RF4A 4GWGA 3W8DA 4OM8A 3I4FA 4WCFA 3VDRA 3LC7O 4DWVA 5JYDA 4BO6A 5KKCA 2WD7B 1ISJA 1EFLA 4ALNA 4Y6RA 4DL9A 1FMCA 5JMPA 3CSDA 1ZKMA 3MEQA 1M75A 1G0OA 3JQ7A 3WLFA 3EHEA 3GZNB 1T2AA 2VTEA 4EEZA 3RUCA 1VL0A 5EJ2A 4TQGA 1VL8A 1GEGA 4YT2A 4O6VA 3ADPA 3QWFA 4FJ1A 4NNJA 5JMWA 4NK4A 4J9VA 2JD2A 4FW8A 2IODA 2WDZA 3G1TA 4N18A 1CDOA 4J3FA 1B7GO 3V1UA 1C1XB 3DWFA 4BNIA 4B3HA 4IJUA
chains in the Genus database with same CATH superfamily
3QOWA 4LQCA 4EZEA 3NDJA 2A5YB 4UNRA 3SS7X 4L72A 2B5VA 1NOIA 4KAFA 3S2IA 3S3TA 4FKMA 3RC1A 1R4NB 4K0RA 1NT4A 2RKOA 4K7JA 3ER9A 3PC8C 1W2HA 3FNGA 3LT2A 4BYGA 4Q01A 4MICA 4B3RB 1KVQA 3PHLA 3EFOA 2CVHA 3QQ5A 3F4BA 4XDHA 4FB4A 3RVPA 4L4RA 4BP3A 5IHXA 2XGJA 1Z39A 1NQVA 3OOHA 4KQHA 5L53A 1FQOA 4JB2A 3W5AA 1U0NA 2H7VA 1ZNWA 2H1LA 1P4GA 1IU9A 4GC9A 1QRUA 3SBOA 1X1TA 5CXXA 4C7VA 4QVIA 4GU5A 3WNQA 1NJGA 1RMQA 1UQUA 4KSYA 3ESRA 5B7GA 3NTUA 3ABSB 5FYQA 3CH5A 3TFQA 4D3XA 2CFRA 2ZXUA 2GZ1A 5IASA 4RIHA 2IJGX 4RIGA 3FRJA 4YPFA 1M34A 5G4LA 3N28A 2B37A 1X9GA 2OLEA 4E5MA 2H2HA 1N6LA 1L7OA 2AXPA 2BFEB 5A3VA 4ZT5A 5KDOA 1IOZA 3FLEA 3LGAA 3DM9B 3SZUA 5FLEX 3ZWOA 3ZI4A 2UKDA 4B76A 4RM3A 5CDHA 4TVSA 2P91A 2C4HA 3JVIA 3NM5A 4CQNA 2XUHA 1Q1QA 2CL7X 1VGRA 1MJ5A 1UODA 3NR2A 4O3FA 3RJ5A 2PE5A 1NP7A 2Z5FA 1ELOA 3UKJA 4X6XA 4LXIA 1U0RA 2D62A 3GLHE 1E1LA 4LA4A 3RYIB 4ZU1X 1ZL0A 2W2KB 4TV9B 2DTEA 4W8OA 1GFZA 2YZ7A 1BXRA 2HJRA 2IGTA 1QC5B 2DPHA 1RWQA 4UPDA 3C8UA 3ANSA 3HWRA 2ZUTA 2A5GA 3EWIA 3BWDD 1V16B 3M6LA 2HQSA 2ILTA 5C8VA 3OOSA 4WFQA 4AS2A 1OBCA 4US1R 5IZ4A 3KHUA 1PWHA 2DUJA 4RTSA 2BVNA 2HCRA 3OU6A 1VSVA 3M8KA 3P2JA 4FKBA 3T35A 3TXXA 4JI2B 3JWJA 3U44B 3BAFA 3KQSA 2OCAA 3W5SA 4DMHA 4FCCA 4PG6A 4Y0AA 1WZEA 2Q5IA 1QOZA 2ZRDA 1XN4A 4WCFC 2VTKA 4UMVA 1WVMA 1MCZA 1GTSA 2H29A 5CFLA 1KQPA 4QJ3A 3D8HA 2J3QA 2UZ1B 3BMNB 4G5OA 4LKOA 1TU4A 4BWVA 4JXXA 3QLVA 4MWOA 2AL7A 4HSEA 4MVJH 3CVXA 2V6BA 3CEJA 1TQ4A 4RPGA 1PTJA 4EW6A 2P6NA 2IXTA 1JFRA 1HF3A 5ALEA 3WLSA 1ISGA 1POWA 1TCVA 3MTGA 2CF5A 2CLKB 3P9IA 5B30A 1JAYA 5F12A 2D0PB 3N8DA 2VEOA 2V58A 2NW6A 4EB6A 2IDMA 4OBWA 3O95A 1KVSA 2HFKA 1ZVJA 1F48A 2JFYA 2YC2C 2BZSA 1GG8A 3ACDA 4MQFA 2A0UA 4OXNA 4H3HB 1IJBA 1P8AA 4TTTS 1AV6A 4I50F 3KQTA 1R8XA 4Y1RA 1F2UA 2Q28A 2QMYA 2FJPA 1BS9A 5AJXA 4BWFB 4BU0A 1U4NA 3S2UA 4DBLE 1G6Q1 1RQPA 1BVUA 3AV3A 1MC4A 3CNLA 1M2EA 3Q4GA 1OASA 4JT9A 1KI8A 4EI7A 1ZM3A 3QMWA 5TEWA 1M2OB 2N1BA 2EIHA 1A8QA 3DZCA 3GJXC 1XF9A 1KK2A 3LOUA 2A3NA 3UMBA 5AXBA 2YBDA 3D8SA 3DEIA 5DN6A 4X62B 2P9TA 3DV2A 4C4XA 3EISA 5AHOA 4RSGA 3PFBA 4Z0NA 4NU5A 3T3DA 4ALJA 1M2KA 1WB9A 3MMNA 4X1YB 3HV0A 2CSXA 1U6IA 1YR7A 4KDEA 3W8EA 3CLUC 3E61A 3OBBA 4I6GA 3L49A 2PZ8A 1N1DA 3L8YA 4LYEA 3IAHA 4AWXA 3PJRA 3ZDDA 1JJIA 1ZUIA 3NWJA 1I2BA 2ZS7A 3BD9A 2IFTA 3JYOA 2AFHA 3TSAA 2DZDA 4WOJA 4Q1VA 5EJAA 1SUSA 1ZVVA 1H23A 2DQYA 3T4PA 3WWZA 2P5UA 3NV9A 3QUAA 4FOSA 3F74A 2VRCD 5CXQA 2IU6A 1E9VA 5KINB 1W5TA 2JIBA 2QTWB 1TJ3A 4QUGA 1KXZA 4BC0A 2BBTA 3V4RA 2ZI7A 3QXHA 1CY7A 2PX8A 2QL5A 3GX1A 3OLVA 1KPHA 4J94A 4ME6A 2XOKA 1JDJA 5LBUA 3NHBA 5DNVA 3BA6A 4AN0A 4NNPA 4E30A 5JSZB 3TLKA 1XDWA 4Q5IA 4QUHA 1YQDA 3DMYA 2NZUG 1PX0A 2YRFA 3OE7A 2WEKA 2Z3ZA 5AJHA 2CEAA 4BNTA 3HNOA 5DCYA 1O57A 3H5AA 4K87A 3CONA 3QLJA 3QUBA 4UPVA 2FEOA 3KB2A 1E1CB 3EGVA 4GBMA 4XPIB 3RSSA 4C89A 5K0LA 1ZRNA 3A8TA 2O7NA 4IOLA 4W9NC 2ZRLA 4NE2A 3U3MA 1IDOA 1O0CA 4GGMX 1E9DA 3FAKA 1EPUA 3O6VA 3M1LA 1HETA 4JUCA 3H1EA 1JJFA 4WE3A 4XB6B 4MPRA 4XX0B 5BN1A 3MRXA 1RLUA 4ISBA 4PYRA 5THXA 4L4YA 2AVDA 4IIEA 1WTCA 4PAWA 1WDLA 4NOMA 4DPMA 1GZVA 3PF8A 4RHUA 4BFVA 2PMKA 2F8TA 2MCFA 5FBHA 2XDQB 1E6KA 3T12A 3SHQA 3DKVA 5CFZA 1HLDA 1UPXA 1VDMA 5EI5A 4C3OB 3FWPA 1L5QA 4G9EA 4F60A 1AZLA 1J5XA 3GARA 2BSQA 4J3NA 4C2UA 1JEQA 1ISMA 2OCDA 2TSYB 4C7KA 5FWNA 3CH6A 4GX5A 4R1UA 4MV7A 3TTVA 3ORYA 1XMVA 2GAOA 1Y63A 1NSYA 2FPMA 3L40A 3OIVA 1NF2A 2I7VA 2RAVA 1DRUA 5CB4A 4Z1OA 4URYR 3KKOA 5DEOA 2WMYA 3EPRA 1WVGA 1UBCA 2HA2A 3HYTA 3ZQ4A 1RR6A 4RPIA 4QPDA 5KU1A 4YJ3B 1OQAA 3ZE7A 1QH8B 2P1DA 3FDXA 2XUJA 4PC7A 4Z1MD 4LJ8A 2FZVA 3Q1LA 3KS9A 4UJ3A 5E6RA 4G09A 3P7MA 2JEOA 5ILOA 1FDIA 2C92A 2UUPA 3STXA 4E14A 1WS6A 1EXMA 3EQZA 2NZVG 3VJKA 4C3ZA 3OT4A 2VHTA 1VLZA 3ROXA 1TF5A 2PV0A 3AF5A 5JV5A 4M9XA 5KYGA 2DHEA 1UFRA 5C52B 3GUVA 1TCAA 3LLVA 1TM3E 1DFGA 5FA6A 3TOZA 2WYVA 3I62A 3KL4A 1EGQA 4DWJA 5F4ZA 2F17A 4H7DA 1Q20A 3UEOA 3LI2A 5F7XA 4U8GA 1SU6A 1CS4C 2R5NA 5ALFA 3WLQA 5IJ0A 1MQAA 1EGAA 2FGJA 4L02A 3NNSA 4ETMA 3JSXA 4RZ3A 4BY9E 1J56A 3OZXA 4OGLA 4MB2A 4F6CA 1HFWA 1FFGA 1QM5A 1T0IA 3EWAA 3PGLA 1B73A 3DE5X 1Q14A 1IB6A 2AG6A 5K2MA 4RMJA 4I5FA 1T8RA 1N2XA 5K3SA 4YCSA 1IWOA 4ZO6A 3V6MA 5F3WB 1BGVA 5C5DA 5KQLA 1NBWB 1F0PA 1E94E 4BMNA 1DT5A 6Q21A 1WPQA 3IQGX 1T6YA 2V6IA 3NEPX 4ZQBA 4CMKA 4D9IA 1KSGA 1NGSA 1YGYA 1AXGA 2GZAA 2PBFA 3GEBA 1AQYA 3BTOA 3HKCB 3NU1A 1J1IA 3LF1A 3CNOA 5I8ZA 2X2EA 2CXXA 3LC1O 4ZT4A 4C22A 2G25A 5CK4A 2CLMB 3LDUA 4RJTA 4F85A 3K9LA 3DW1X 1F51E 1XZCA 3DZ8A 4YT8A 1YRWA 1Q0QA 5EIAA 1H85A 4A15A 5I7FA 1EWKA 1G5RA 1NU8A 2GLUA 3VDXA 3CMCO 2I4TA 1ARZA 2J33A 3NH6A 4D8VA 1KKLA 2QTVA 2CSUA 5C3MA 4FLMA 3GLUA 4BGIA 4Y2SA 1T9KA 5BV7A 3QA9A 2MSWA 2Q8PA 5BXQC 3ZHBA 3D3NA 2P27A 3ZHRA 4BVKA 2FR8C 5REQB 4PGGA 3ISJA 4FGSA 4UZSA 4DE5A 4K3UA 1Y8RB 5I8PA 3K9NA 1SPXA 4GOXA 1CVLA 1GUFA 3Q41A 1IAVA 5J4LA 1EJ0A 1ADGA 5LQDA 5IMSA 2RGBA 1QWOA 1Z6YA 2MMGA 4GNKA 1SHUX 4C4SA 1E1MA 1SBYA 1HQCA 2AG0A 1E1RD 5DF1A 1JT9A 4OQQA 5DXFA 3ESXA 4M38A 3VO9A 4PEVA 5JD5A 1LU9A 1A9PA 1JXOA 4Z9XA 2ICAA 1H9AA 4Y2HA 1Y4DE 4IXWA 4FFVA 4ZK2A 2FZLA 5M2QA 3W06A 4C0LA 2R85A 1T6NA 3FCUB 1X94A 3P9KA 1P31A 4RLHA 1IVYA 5CW1A 2IPLA 4ZPXA 1FXWF 1NQWA 1ZCJA 3MAJA 2TMDA 2J67A 2CL0X 3Q9LA 3I2GA 3ILVA 2IV3A 1SVOA 4MULA 3VKVA 1ML4A 1JJAA 4AJKA 2VSOA 5A0FA 3GY0A 1XCGB 4E15A 3BB3A 4TZ6A 4Y2GA 3HR4A 1KDTA 5IUKC 1W5BA 3QLUC 4N0EA 1QRAA 1OZGA 2PUHA 3EGIA 2ZBPA 4GOND 1XBTA 1YDGA 4LRYA 4YIHA 1T4CB 4Y2JA 2E1PA 3S2EA 5C18A 3GVCA 2QRHA 2WIAA 3KWMA 1E2QA 3OOWA 4KU4A 4BE9A 1CW2B 1TQ6A 1C0PA 2GXSA 4TVKA 3ABOB 2BM0A 1P3Y1 1PF7E 1MAVA 1XYGA 3EWNA 3OLQA 2BGLA 2JFGA 3ASVA 3N8IA 4J8PA 4PQGA 3PHJA 2QTMA 2R6FA 5TR9A 2AOUB 3VHRA 1RHJA 3FCCA 5DNAA 1H5UA 3KPVA 4UZEA 3BB4A 4YNBA 1C8LA 3VR2A 1QLWA 2H2IA 4G0NA 4LHWA 1PIWA 2I0FA 2ZE6A 3PD0A 2F43B 4OMDA 4WNAB 3S2YA 3RIHA 5IFKA 1CR2A 3MTIA 4R3NA 4DQXA 3VSBA 1N0IA 1XTTA 2ZB7A 3IRVA 4H0FA 3RWBA 3WRYA 5C9ZA 4G0OA 2JJQA 1L7XA 1NJ8A 2OCPA 4OK3A 2X3YA 1DHRA 2AOTA 1FEZA 1P1JA 3D8TA 4R9VA 4AP9A 2HI0A 3C70A 2WP0A 2WJ3A 3PTZA 1OF1A 1JS1X 3ANNA 2YWHA 4C4ZA 4LNHA 2AA3A 3SKXA 4E5KA 4XVCA 5LQRA 2QI9F 4X5OA 5I9NA 1XQ9A 2JCGA 4JUFA 3NRBA 3N7TA 3GRRA 1ND6A 2EP8A 3M5CA 3P45A 2IEDA 5GGYA 1UKCA 4AZ3A 2ZULA 4AX8A 2F1RA 1ZIOA 3TI9A 3WK8A 3ZD7A 5AVOA 1K6MA 1KI6B 2R8BA 1F4LA 1QBKC 1K92A 3ZDQA 1E4OA 1QE3A 1TM2A 1A76A 4B9AA 1TVEA 4R1SA 1A95A 2JFNA 4LXYA 5EPUA 2UDPA 3GGSA 3V46A 3WL6A 4U2BA 1CVRA 4NBKA 4N5DA 3ID6C 3JWEA 1YO6A 1RWOA 3UV6A 4PC1A 1AGXA 3VZPA 1T0HB 1UJ2A 4D99A 4LJRA 2G63A 1O9BA 2WUVA 4NF2A 4C5CA 3F3SA 5JSYA 5SZIA 3DZBA 1V7PC 1FNNA 2ZM5A 4M1SA 3O2QB 1WDTA 5AJZA 1ECBA 4XGQA 3V8QA 3GV0A 5EXTA 1P1CA 4IGEA 2W2QA 1EI9A 4RXTA 1YA4A 3IEKA 4YRJA 4AJ4A 1FNCA 1Y5MA 2YINC 3A6DA 4I55A 4DCJA 3L6UA 1O96A 4I5GA 4LVCA 1SEVA 4F4DA 1A9ZA 2QRZA 2D8MA 5JNUA 4TKVA 2HXGA 3GDGA 4KQKA 5DTIA 2IF0A 4L6AA 2BELA 2O2DA 3V4PB 1VBMA 3LVRE 4WINA 2QY6A 2EZUA 4Y6SA 3WC4A 1WP9A 4DW8A 2CV0A 1XXHA 2AMLA 2R97A 2AMYA 4R41A 2ZAGA 1R15A 1DG3A 4F7DA 4CQLB 4J0GA 3U3XA 3CIFA 5A62A 1M1YE 1RCUA 2GHTA 2YIDA 2C04A 4HPXB 1W44A 5JNWA 4H7HA 3O2JA 3LUFA 3EJWA 3AGQA 1GFWA 2G67A 3K35A 1PR2A 1MO3A 4DOMA 4R8LA 3M9XA 3AERB 4DCVA 4BO9A 2QNRA 4UNQA 4MQEB 1TYEB 2IW3A 3SEFA 2XMRA 3FLBA 4R1MA 3NP7A 4INZA 2CYCA 3FTDA 5D00A 5EIBC 3RU7A 2JATA 3TIGA 2V9ZA 4R8KA 4FBLA 1EVZA 1D8AA 3HGTA 5HCNA 2R9VA 2OBMA 2I3GA 3CVVA 3B7GA 4AZTA 2P9FA 3OCZA 5LNK6 4BUJA 4IMRA 3DCYA 3B52X 4HUQB 4Q48A 1N5RA 1IN8A 1E69A 1NUAA 1SXJA 1ST2A 2EYQA 4JUBA 2GQ0A 2I33A 1EGMB 1PZFA 2QRMA 3LP8A 3OPNA 4TOIA 5C7OO 1OPXA 4LHYA 4U3JA 1MQSA 3ZHUA 2L2QA 3C2QA 4RS3A 1Q6YA 1LVGA 1HNXB 4QAQA 3SG0A 5ALUA 3A1CA 3IQFA 4KJXA 3LIIA 1T2EA 3EIWA 3IULA 2DHRA 4P3YA 1PGNA 3KOOA 4XDYA 1RC1A 1H2YA 4G24A 2HA5A 1NNUA 2Y92A 4HAOA 4WY5A 2PKCA 3RRYA 3UV7A 1JA0A 3OZTA 3CLSC 1AGNA 3HJHA 3CSSA 4N5IX 3V2IA 3WWPA 1MAHA 3TAUA 4Q9DA 1XD8A 1HDYA 4RZHA 4B84A 1IXSB 2R4UA 3D4BA 3TCXB 5LZ4A 4UCQA 5KNCD 1ML3A 4BO3A 4N3GA 1MX1A 1U7PA 1Z15A 1NW6A 3C0KA 2WG1A 2GEKA 4JLAA 4BNNA 1C29B 2EFJA 3EIEA 4C29A 1KBQA 4OUKX 4UDNA 2XVXA 4BFYA 1EFTA 1XVLA 2XQJA 4NHOA 2GEFA 2VP4A 3HWSA 2RK4A 5SV2A 3CZPA 2R8ZA 1U9CA 4RVOA 1RAFA 3M2PA 5DW3A 3VU0A 2OILA 1G9XA 1RBYA 3NBYC 4YRBA 5B2FA 1TAQA 4KPFC 1E0JA 2Y93A 4NBSA 3O1HB 3VKWA 1V0JA 1DIAA 2DHDA 1S4QA 3CEPB 2I3ZA 4BVEA 3I5YA 3GPBA 5DX0A 2M32A 3DNFA 1T15A 3QNUA 4Z7NB 2G08A 4Z99A 1VDZA 1D0IA 5K0CA 4FEAA 1XLUA 4O4LF 2BM1A 1IZZA 2VF4X 4G5HA 4Q05A 3MGCA 1JKFA 1PJ3A 1T1IA 1XRPA 5I5GA 3UJ9A 5KJ6A 5EMHA 3A58B 1FUYB 2JLRA 3GG9A 4Z53A 2LXNA 3JQGB 2V4MA 4CMAA 3MBKA 4YRKA 3QW2A 1QQAA 2VWPA 1CULC 5KSZA 1NE7A 4TQ9A 1Z18A 2Z1DA 4HNRA 4ASUA 3LQKA 5C5CA 2FOXA 1HE5A 2GUGA 2RFLA 5BW4A 3HSYA 3K7EA 1VPVA 4CMEA 1R0ZA 1PJ8A 2EGGA 4R40A 5KTRA 2O0LA 3PF9A 1QQ5A 5L6LB 2EFGA 4JEHA 4DJEC 2ZR8A 3LPMA 5KNDA 1H0HA 2PD3A 1EG7A 1K97A 2ECQA 1NRWA 3EGWA 4RTQA 2WIBA 2B8WA 2PY6A 2AZDA 5FPQA 4K6KA 1DAEA 4AFNA 2ZRIA 2H18A 3P9XA 4YRGA 3Q0TA 3JQFC 3KYCB 2E1RA 5KS2A 1Q1ZA 1FDVA 4AJOA 1JFVA 3ICPA 5FBLB 1BHQ1 1MQ9A 2GKSA 3C8ZA 3KLPX 4WN3A 4P4LA 3GNTA 3AUJB 1P8JA 2G0TA 2CFTA 2H5LA 3X1WA 1R4AA 1ZGJA 1EFUA 1ESCA 4X84A 4BB9A 4MW5A 4D9HA 3QPDA 4I36A 1ZXLA 2HJWA 4JYAB 2P67A 2SHKA 4CM9A 2H57A 1ZIYA 4ZT2A 1EB8A 1KJQA 4KN5A 2ZYRA 3SR4A 5IP5A 4EKGA 1P1FA 3C3YA 3IUBA 2GRJA 4BNJA 4D3ZA 1P0CA 3AUAA 1V96A 2IHYA 5DBHX 1JLHA 2C4MA 2HU8A 3H5VA 4JLJA 5DBGA 3UH0A 1VMIA 1Q2XA 3IVRA 1TO6A 1QU3A 1JH9A 4L0DA 2QUBA 3GYGA 4M0PA 1GRQA 3KPYA 1U7OA 4HUTA 1K6EA 1M6VB 2ZSBA 4LE0A 1XUOA 3C45A 3PPWA 1S0UA 3V8BA 1VL5A 1L2TA 1ORVA 3HZRA 1PLLA 3P2MA 3V5NA 3AVTA 4UW9A 1P4JA 2H7XA 5J40A 2YUIA 5EE1A 1VJGA 2X9LA 1F17A 1ZG3A 4FFLA 3RJ9A 1W59A 3JS5A 2CLOB 2JBAB 3JD1A 3MT0A 3TQRA 1RRCA 1IFXA 1CPYA 2A1UA 2DUMA 3GH3A 1RS0A 2WT9A 3G2QA 3KDPA 4PPFA 1JR6A 2SKDA 2B3TA 3KD2A 3BQMB 2OQRA 1UOOA 5IMBA 1EE2A 4WZAB 1OXBB 1Y42X 4EHFA 1V6AA 2PKRA 3N8NA 1KYTA 3CNQS 3OO1A 1P44A 4M37A 3NKLA 4DCNA 3I39X 3UT0A 1W581 3AX6A 3ZZTA 3KHSA 5BMVA 4EBBA 2FP4A 1MW8X 3S8MA 3AHIA 2FRDC 5I9IA 1X92A 1XVUA 4HGRA 2VWQA 1N6OA 4XRGA 5TC4A 5AKYA 1TJNA 1C30A 3WHIA 5LQCA 2PA0A 2R48A 4J1TA 5EA2A 2QNBA 4HP8A 1Z13A 3BIOA 5CLFA 3F1KA 1E61A 1GILA 3PPYA 4QUBA 5B3LA 4OU5A 4GX2A 4RTPA 2XVAA 1HZZA 2X2OA 1TUGA 3VR4A 3F47A 4KQCA 1KORA 2Q9AA 4LE1A 1FDRA 2Q6LA 2W2TA 2WWIA 1PCXA 5D7BA 5BVHB 4IVQA 2QTBA 3WXBA 1JB1A 3I9V1 3BWBA 4JYBA 2EKZA 4MPTA 5FUBA 4LOAA 3OPYB 2Z83A 4J0KA 2YWBA 3ZJVA 2V7TA 5CU7A 3DZDA 1O6BA 3D5EA 1WAMA 2R79A 4KH1A 4CDGA 2O2GA 1QFMA 2YW2A 4GL4A 3UUGA 2CHGA 3OUTA 4WBNF 3N2GB 1ABBA 3WS7A 4YROA 4GQIA 2DCUA 1BE6A 1X1EA 1RJGA 2D3WA 1JDZA 4DDMA 4E5SA 4DUGD 4PYLA 1WMEA 3HCNA 3WAJA 4HH1A 1QHNA 1QYWA 5HE9A 3SC2A 3MXTA 5EJEA 3FCEA 1PZHA 5FPPA 3OM9A 3H2IA 4CL8A 2R5WA 2XNDD 1WNFA 1A7KA 1M8JA 4LIPD 1WETA 2DRIA 5A6SB 4A4DA 3AW9A 5BYBA 4KG7A 3BXXA 3IBTA 2IXDA 3PL1A 2X0DA 5BUSA 1Q0RA 3KT3A 5BV1A 1CQIB 1XL0A 2ZUCA 1WHSB 1AB6A 3HQ4O 3I52A 5DN9A 4KFCA 2FP3A 1US8A 3DA8A 3LRPA 1R0LA 1KQ3A 1JG4A 4HEQA 4O2BF 5HJEA 5LUAA 4HO1X 4CCSA 2G3YA 4XQGA 2CWWA 3QMPA 2A67A 2FZGA 3HJUA 2JLSA 3TZQA 4LF4B 2F3PA 4D4MA 4HFNA 4ZT7A 4QARA 3BBLA 5AVVA 1R66A 3G0OA 4ZJUA 2P78A 1Y9EA 2HWXA 2EP5A 4GBGA 3SF8B 1XD2A 1W73A 4WLNA 4A0GA 5DNWA 1KFBB 4YJHA 4I1RA 1ZIXA 2GZMA 3EDQA 3G0CA 3LXRA 4FGLA 1SQ0A 4YP5A 2RHCA 3BMQB 2ERXA 3JY6A 2V74B 1J0DA 4MP8A 3UN1A 1BX3A 3JVDA 2O2ZA 4G97A 3B36A 3DH0A 3ENNA 3KALA 4Y2YA 3E7WA 1KARA 1Z6AA 3CRW1 1CUCA 4GZ3A 5CA0A 2LW7A 4S0ZA 4Y6GB 5LLTA 4CDMA 2PXHA 3D2CA 3TSOA 5COBA 5AI9A 2OORC 4UVHA 4CHGA 1SAYA 4G86A 3FZEA 3AR7A 1YF3A 2XZLA 5AKZA 5AESA 2OCGA 3RWMB 4E5PA 5CFOA 3NZEA 1QIFA 1DX9A 2YCBA 1IL0A 3E9YA 1LS6A 1Y1TA 2QN8A 3EFEA 2FUEA 3JQAA 3OG9A 1UC8A 1WF3A 3Q9SA 1Q6ZA 5LR6A 3W8NA 1KYYA 3P32A 4XEHA 2J7KA 3T0IA 3UMJA 2WLTA 4QXQA 2ZTLA 1LF5A 1ZH0A 1OBHA 4MAAA 3RAFC 5KIAA 2H8KA 3HDYA 1U5AA 4P7GA 4ENVA 4FSXA 1DU4A 3FOBA 3KAKA 3O4FA 2XT6A 3FPAA 3EIXA 1GYRA 5CHYA 4URXR 3A2KA 1WUKS 2H1WA 2XRMA 2PD4A 4KITB 2CK3D 1D4FA 2I65A 5IDQA 4EKEA 4KAJA 1YDFA 3B1YA 2NV6A 5EFZA 2XTAA 4CEIB 8ADHA 1PD0A 3N2ZB 1P5FA 4IOMA 3WLLA 1OTYA 5IKOA 2R1ZA 2FWIA 2EW8A 2OUKA 2UZ3A 1DARA 1KP2A 1OX4B 4HAYA 5ALXA 2DE0X 4B3FX 4G26A 1HRKA 2Z8YM 4QNRA 1ZM2A 4XEUA 3QIVA 4R2KA 1MN6A 4BNDA 4D57A 4FUQA 1T36B 2BKVA 3DLCA 1DKQA 1DAPA 2I54A 4KQ6A 3LGSA 5EXEA 3PFHA 3DAPA 1W76A 3JD3A 1L3BA 3UTDA 1N8KA 2WYWA 5F3DA 1DAIA 1FLAA 4LC1A 3Q8KA 3IUQA 2JGMA 4M1OA 1PVVA 4DDKA 2OO5C 2IKQA 4IIJA 5JCPA 4J76A 2Q7OE 4ND6A 2AMFA 3KNZA 2EKLA 3I4LA 3REGA 1AU9A 4KWHA 3R7WB 3ZWPA 1JKJA 2PLWA 3RW9A 3EOZA 2WHEA 3FE2A 4XR9A 3ZR4B 3ZCPA 5EYPA 3T3NA 1Q0HA 1W29A 1F4VA 3HYCA 5A1JA 1PFKA 1E1QD 2JLVA 2DFVA 2O52A 3RRZA 4MKFA 4RD0A 3ZBPA 4LV8B 5H3CA 5ADUS 2CMKA 3F9CA 5D3KA 3RHFA 3TLCA 3ZEIA 1AA6A 3BPSA 2HZBA 4G81A 3LW8A 3ZE0B 3OZSA 4M7WA 3YASA 4YRCA 3QEMA 1IQRA 3RS0A 4TLAA 2OZPA 2BZ0A 2XE6A 5EJ4A 1NV9A 3K5HA 3C85A 4LTDA 3GOQA 1E9AA 3OEWA 4AG6A 2I6UA 5HBGA 2PUDA 3II6X 4PLYA 1HI9A 1QF7A 3ZTYA 1HTWA 1Y4AE 4H7PA 4PS0A 2BGRA 1E98A 2ZSKA 3V42A 1E6LA 4EVRA 5H02A 4HNUA 5BP7A 4OAOA 1IMJA 3L18A 2JIPA 4QX6A 5THQA 5CDGA 5DHRA 1HA3A 1TAUA 3H5LA 4MUEA 3KXKA 4X54A 4B48A 1AKYA 5AUOB 1X7YB 3KE9A 1W1WA 1KZ4A 1WZIA 3I04A 4QEDA 1KE1A 4DJAA 3MT8A 3UK7A 1J0XO 3M83A 3RIYA 1ORWA 1TE2A 2ZPAA 1QP8A 2QPOA 3ZDAA 4YJ2A 2BGKA 1LLDA 1HFKA 5C7YA 3D3EA 3DEZA 3OJCA 4LOKA 3QEOA 4ZAWA 4Z9AA 2IITA 2Y1EA 2RAUA 3KB6A 1M2FA 1Z0SA 1RBQA 5F5LA 3ZE6A 1E2BA 4N3BA 5AJWA 4INAA 4MS4A 3OFND 3VPFA 3C4QA 1FDUA 5TGTA 4ARUA 1Z83A 2C9BA 3AQIA 1Q0UA 2FTKE 3W9UA 4Z86A 4AROA 1Z6XA 1MO4A 1Z6GA 2B5WA 1DQPA 1A7UA 1QGUA 1ADFA 3FFWA 2WJPA 2WSSA 3DOEA 1U9JA 4MWEA 4PAMA 2WINI 1RADA 2RONA 2YY5A 5AJUA 3ROFA 5EJMA 5C53B 2NM0A 2QW8A 2PRYA 4ZMRA 4OG2A 1UK7A 1RLJA 3VSAA 5CPBA 4PSCA 4U2KA 4AB1A 2D5AA 4QICA 3TRIA 1AKMA 1U3UA 3GU3A 4FD3A 1PNTA 3MM4A 3GLHA 2JLQA 4MMYB 4GOJA 3T99A 4K2AA 4GLOA 4YBRA 2C9DA 1FTNA 1MOZA 1P74A 1PR9A 1YBFA 2HV9A 5T3YA 2PRZA 1JLMA 1LB1B 1L4LA 3EZNA 1JE0A 2ZI6A 4R2JA 1EA5A 4X63A 1UIMA 3FBWA 3O84A 4X64B 4BFTA 3HCRA 4LHXA 1NBMD 2DFNA 3GLSA 3W3AH 1NVGA 3ZGNA 1YRBA 2F64A 1DXOA 5AVRA 1L5KA 3UJ7A 3FR7A 3HYSA 4AKTA 1WOYA 3FNBA 3AYZB 4MGZR 1TEZA 2BYTA 4MCJA 1DG1G 4PGHA 2ARKA 4CDRA 2YZMA 1CIVA 2VJPA 5F1PA 4ZOAA 4OTZA 1PAUA 3N5KA 4S1OA 2A0YA 1CP3A 3VH1A 4CKBA 3IUNA 2PV7A 1E64A 2QUKA 1YI8A 2G09A 2AN1A 4DYHA 1U80A 5LU8A 1ADYA 3BJZA 3PQ2A 4DSZA 4TLLB 5B1HA 2XT0A 4HQ0A 2L69A 4HXYA 1UBKS 4PQFA 2G70A 1R10A 1UBUS 3KQVA 4MV9A 4BVFA 1JN0A 4EL5A 5KJ1A 1E8DA 4H3VA 4Y7DA 4PHGA 1VHLA 4S1TA 3X1JA 3FFBA 3EPJA 2E4UA 1JHUA 3QEJA 4FXOA 4YQEA 3HP7A 2VC2B 4YP6A 4N01A 2YJTD 4D4JA 2OO7A 3AF1A 2VF7A 1IM2A 3BXFA 2V5AA 5GM2A 4D9JA 2AZMA 4Z4GA 2KYRA 1S8AA 4HDQB 4R7GA 4R2WA 2HXYA 4IH9A 2NO7A 1Y34E 3LY9A 1G5FA 5L8VA 1PV4A 1B0PA 1NDHA 2PKQO 3HKDA 4UVDA 3UV3A 1EJ2A 4EFKA 4IQGA 4OM7A 1K66A 2V5VA 1TK9A 3VVLA 4KQ1A 2WM8A 3BA1A 1C7JA 1DC5A 1U28A 2ZSJA 3NTQA 4PINA 5HG0A 3M2TA 2YY6A 4ZGWA 2GTIA 1TU3A 1VHWA 3SI7A 1JSXA 1U4OA 2ZZMA 3NUZA 4ALMA 1I0ZA 4J2OA 4MEJA 3JXEA 5CIQA 1MAAA 1M34B 2WUWE 3K1TA 4TSRA 3K73O 1G5TA 2NTEA 3PHHA 1W25A 2NZWA 4M9SA 4KQEA 5B6IA 4KRYA 2O8FA 3AKYA 1ISFA 2W6QA 3NWBA 4CKCA 1ZC4A 3AR8A 1E2GA 4N6GA 4UBMA 4AAYA 2VJNA 1TFUA 2H7CA 4QTZA 5ICEA 3T1OA 3IMFA 3WNCA 1AHPA 2XB8A 2JJ1D 5I7VA 2QJTA 1VI6A 1OA1A 2PT5A 2GXQA 5TMPA 2XPCA 4HNQA 2BH2A 3SSOA 2JFZA 4NENA 4WI1A 1CS0A 3KAPA 3A9RA 4LHZA 2O8DA 2ZZNA 1E3WA 3FYTA 5ERGB 1LDYA 4MRMA 5EEHA 3P0HA 1KEEA 3SAJA 2FFJA 5LBIA 1CRQA 5SYAA 4G25A 1XFDA 2QA5A 3AONB 4YJ3F 1KY3A 1C1DB 1UAYA 3A1DA 1FZTA 3CLVA 1KERA 1L5SA 2DY0A 5T67A 3SC3A 3VKFA 5CIWA 2CV1A 2WE7A 5EMMA 3SJ7A 1P2UA 3B5IA 2PH5A 2BCEA 3OT1A 4BPBA 1XWFA 3IX7A 1SCNE 4Q1AA 4RVHA 3C1OA 1MV5A 1VP9A 2UVPB 4FYHA 1FDWA 4R1PA 2OBFA 3HXPA 3UWKA 2BE7A 2ZYSA 2AJBA 4R83A 5EKDA 4XIFA 3HB9A 1L4HA 3B85A 2ZK7A 3LKDA 2FQ1A 3WNBA 2YWCA 5C5EA 1TW2A 4YFYA 3V4FA 5FI3A 4I8DA 4EGQA 3RS2A 3EAQA 3PEVA 2L17A 1YR3A 3E2IA 3H2SA 5DTEA 2R8EA 3RIGA 4JGGA 3AUTA 3I09A 1YOVA 3A04A 4MV4A 4EA6A 2R6CA 1DUSA 1MJGA 1ZSNA 1W4ZA 2OG1A 2FETA 3M9LA 4A27A 3LCVB 3PVSA 1QHEA 1NQUA 1N5LA 3M3HA 3WMEA 4EB6B 1HEIA 1A5ZA 3VU8A 3EZ9A 1YJ5A 5JNVA 2XRZA 2DFTA 1PJ2A 4GKVA 4ZVNA 1WCIA 2Q4EA 2RBEA 4HATA 4HDKA 3ENKA 4Y1RB 1QGAA 3WGTA 4C0QC 1QO7A 4ZTUB 2B4TO 4GFDA 3J7AC 2V7QD 3B2EA 5ALDA 1Z47A 2GRAA 2PX3A 3EPPA 4M8SA 4UD2A 4NBRA 5EFOA 3UO8B 1SVSA 4G1UC 2IPMA 5CD9A 2A9QA 2D0DA 4M6WA 4D79A 3G0GA 5BUCA 3ET4A 4OIFA 1KO1A 1NHWA 4MEAA 3D64A 5K3EA 4EYKA 2J85A 1W1IA 2ID7A 1LJLA 4ESOA 5D3QA 4CMJA 4FLFA 3WDKA 2XD4A 2I1QA 2CLFB 1FVFA 1JH8A 3TLXA 2BC9A 2AXNA 2ZT5A 1DZ3A 5C81A 2JFBA 4HWTA 4O4IA 2Y3IA 2AFHB 4MRVA 3IKTA 4ZDWA 1OLOA 1HE4A 1YE5A 3BWYA 1N5IA 2VK4A 4MR9B 4ZVLA 4B2PA 4TYWA 1CERA 4REOA 3F3KA 4KB5A 1PHRA 2LUOA 2ZT7A 1UKYA 1JIVA 2HBRA 2PS0A 1HE3A 2EJUA 1R6TA 3L1KA 4L15A 3U7QA 5CFRA 3E7PA 2BL4A 4FFOA 4C06A 4WK4B 4AP6A 1IY0A 4HI0E 3RSLA 1GUYA 2WIFA 8OHMA 4JFAA 1WQ1R 1GNVA 2NSLA 3EBPA 3OLXA 4M0CA 3ESDA 5HGJA 1YTUA 1U0EA 3ZGZA 1PGOA 1FFWA 1R0RE 2AYZA 4POOA 2C2BA 1BYIA 3MRVA 3NNNA 4O2AB 2IS6A 2X9QA 4MWBA 5IN4A 2F8LA 3WDMA 2GK7A 1G4UR 1YC5A 4TXJA 5JOQA 3RJMA 2NU6A 5JTTA 1Y5LA 2FFAA 3I2HA 1U1DA 5HZMA 2LPMA 5CM9C 1CUHA 4FWTA 1WDKA 4ZI7F 1SEPA 4MTCA 4P08A 1MF7A 1UPCA 4Q18A 3VX4A 4NAUA 1CG6A 3TKAA 3VZBA 1BEUB 2Y1KA 4CEHA 4DLTA 5DP1A 2W4QA 3EC7A 4R2HA 3DKRA 5JYBA 3KSBC 5I4KA 2HLDA 1J20A 1QCZA 1YUNA 3NHKA 4G0QA 4C7JA 5IVPA 3OQPA 3FNEA 4YDQA 4L95C 4HNAB 4Y2PA 3KD3A 4C9BA 3VI3B 4DMLA 1AKUA 2B1IA 2LD4A 3K0FA 4AJ2A 2AKAB 1JDSA 2YH2A 3N8GA 4R51A 4OGKA 1E9CA 3IPXA 2CFSA 3NBKA 4AUKA 3U61B 1QF6A 3HWWA 3H9GA 3LOPA 3RT7A 2V6FA 2XH8A 2YFQA 3DMNA 3PVCA 3SF0A 1RYFA 5CG1A 1H2FA 4IDCA 3W7BA 1ZK2A 1VA5A 1U8EA 4NKRA 4P4SB 4WESA 5I7SA 2WQ7A 4Z4QA 2VJQA 2XITA 3F2VA 3AEUB 4AWBA 1R6XA 3V1YA 4HHEA 4S1VA 4CI9A 5E6RB 1LPBB 2XADA 1RTKA 2RGNC 4RZXA 2FPOA 3LDAA 2J7PA 5DIFA 4RLQA 5AKXA 4UFPA 2JCYA 1Z4MA 3AFIA 2J0SA 2OB1A 2G72A 1IPFA 1JALA 2RCNA 3MLAA 3VR5D 2GDJA 2JLCA 4TLDA 1Z17A 4FX2A 4G01B 2HK7A 2D5IA 3ND6A 4ZEXA 3RAPR 2R2GA 4Y2RA 2P2ZA 3PDIB 4IIDA 2JJ2A 4PYQA 5KQSA 2ISQA 1SKUA 1BD3A 4UUQA 1HDXA 3TVDA 5KWSA 3TW8B 3INRA 5AVZA 2VL7A 3VH2A 1YZKA 3WWOA 3ONVA 1LVUA 2TMYA 4QQRA 2Z5VA 1PEDA 3QPBA 1BWQA 1KJ9A 2A7QA 2Q3FA 3E7DA 3GUCA 3M1YA 4RDCA 3Q7EA 5A3QA 4I1PA 1Q91A 1NX9A 2GA8A 1G59A 3IO5A 4UVIA 4EQ6B 5E38A 5JS2A 3CZ5A 3HO8A 2CDCA 1VL6A 2E9SA 2GZ3A 3KC2A 2JPDA 1RFLA 1H2AS 3F6RA 3P4YA 4FSDA 3RBXA 4RTJA 1O95A 4G1BA 1UPAA 2AFVA 3NJ8A 3AJRA 1OZ0A 1N77A 2PS3A 3GJQA 4I2NA 5EGNA 3WGNA 2DERA 7AT1A 2PKEA 4ZANA 5HJ5A 3VOAA 1E92A 3NT4A 5A02A 3P9SA 2JCXA 2XMDA 3UK1A 1JU3A 3C15C 2C20A 4TKUB 1NJ6A 3LLMA 3KUXA 2YN2A 1CZHA 1KJIA 2Q1YA 1CE8B 2VNSA 5EJ5A 1JVBA 3EK2A 2PN1A 3QJ5A 4X7BA 1UFKA 3K5IA 5TIIA 3X2EA 3H86A 4I9HA 4WZ6A 1Y6QA 1J2RA 4IDGA 4KN6A 2H08A 1V5WA 2HIMA 3AU8A 3Q72A 4PICA 5TJHA 5GVRA 3UXEA 5CFMA 2D2EA 5A4FS 3FNFA 2G06A 3U7GA 1O0BA 1EG2A 4LVNA 3SFTA 3GNQA 4AG5A 1HDEA 4TWJA 4LF5B 1FNDA 3ZV3A 4OLFA 2ODWA 3THWA 1G2PA 4KYVA 1NNEA 1NN3A 2R96A 3EVCA 3QBDA 4YONB 2V6JA 1E2HA 5T6BA 3RANA 2Q4OA 1VHDA 2A1TS 2X19A 2WVHA 3OQIA 1LDGA 4FFWA 4O4JA 5D5PA 3WB1A 4IXMA 2FQYA 4M0MA 3NFYA 4UEOA 4FYWA 4BLWA 3RVNA 4JBYA 4AKHA 2PZFA 4W9RA 1GAEO 4LJKA 3S28A 2Y0PA 4E12A 3U7JA 4I1YA 2IC5A 3ODGA 1R9MA 1HWYA 2J9FA 3BB1A 1GAWA 4GLFA 2VNAA 4MHTA 3UK0A 1Z6QA 4KK4A 3GJ4A 1SVMA 3H5TA 2GZHA 2JLUA 1JHMA 3PRJA 1K6IA 4UFOA 5DGXA 1SVIA 3NAGA 4NDNE 1E5XA 5K0NA 4M8KA 4DC1A 1E18A 1PNRA 2VH2A