2X9GA

High resolution structure of tbptr1 in complex with pemetrexed
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
publication title High-Resolution Structures of Trypanosoma Brucei Pteridine Reductase Ligand Complexes Inform on the Placement of New Molecular Entities in the Active Site of a Potential Drug Target
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 94
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x9gA00
4J49A 2JHGA 2VUUA 1NPTO 4B7XA 1A27A 4Z9FA 1U2DA 2A35A 4IZHA 4XRGA 1EBUA 2HU2A 2NQTA 4MVJG 4Q39A 1U28A 4ND2A 5C7OO 1WDKA 4OO3A 3UW3A 1WZIA 3QJ5A 4R1NA 5G0WA 5KJ1A 3Q9UA 1BXGB 4Y98A 4YACA 1DLIA 2QQ5A 4CUZA 3MOIA 3HN2A 2VNSA 2BF7A 1JVSA 2DU8A 3S2GA 2DAPA 2C82A 1XIVA 3H5AA 3LC7O 1DHRA 2DUUA 5KNLA 1OC2A 3NKLA 4NI5A 1A7AA 2VTDA 1Y6JA 2ZTLA 4TZTA 1NX6A 3NJ8A 5FYDA 1V0JA 5I9MA 4JX8A 5I8WA 5A9TA 2VWPA 1C14A 5JCJA 3DAGA 1K0UA 2JD2A 1D3AA 3ZWNA 3RUDA 2OL4A 4B3JA 4PLZA 1ULSA 2GR9A 2CDCA 3WDSA 1NBOA 3D4PA 1LNQA 4J16A 2P91A 3ONFA 3WBFA 3IKTA 4D7AA 5BSFA 5ILGA 4OXKA 2OHXA 4BMNA 1GV0A 3UOGA 3ZNQA 3OICA 1CF2O 2B5WA 2OXIA 3WGYA 3KLMX 3ZWOA 1H9AA 2C07A 3CKYA 4AJ4A 2PGLA 3NEPX 2GPTA 2EKLA 2ZB4A 4TRNA 4IINA 5TQVA 3LC1O 1RWBA 1LSUA 2BGMA 4BNYA 1LC3A 4AICA 1VPDA 1EE2A 2GZ3A 4TRJA 3U4DA 3V2UA 5ADHA 1MP0A 3ZU3A 4YBZA 4E2WA 4JBGA 1NWCA 1TVEA 2Z1MA 1G0NA 1LJ8A 4YT8A 5C5IA 4FOOA 4RLHA 1DC5A 4BNFA 3U09A 4AJNA 3WTBA 5A1TA 2ZQYA 1GPJA 1B16A 3GEMA 3JQAA 3X2EA 5JS6A 2B36A 2PH3A 4E5KA 1I3NA 2NSDA 3L6DA 3WJAA 2Q45A 2HMWA 2ZJ1A 5JNLA 1GY8A 4UVEA 1WAMA 4WE3A 2AMFA 3RD5A 1BXKA 3CZRA 2CMDA 3S2IA 3CMMA 1SPXA 1P3DA 4PCVA 3I9OA 4CUJA 3KTDA 3LF1A 1U7HA 5J23A 1XLTA 3LQFA 4JXKA 3RBZA 2RHCA 3PJFA 3KSZO 1YB1A 3K9QO 1E0DA 2PTGA 4W7HA 4XDZA 5T8KA 4EDFA 2CVOA 1E3SA 4FGSA 2EEZA 3HZZA 3ASUA 1ZZEA 4CMJA 1G1AA 2XXJA 2YQ5A 4BO2A 4PZCA 4M55A 1ENYA 2E48A 4YA6A 5L7WA 3SVTA 2Q4EA 1ZFNA 1HXHA 4LCEA 3JQAB 4OKIA 4KMSA 1T2FA 5JO0A 3H2ZA 4J90A 4MP6A 5JDCA 4AJOA 4N54A 2DT5A 1HETA 4PG5A 2YDYA 3GOHA 1FDTA 2XAAA 5CFZA 1KIFA 3JD2A 1ZW1A 2Y1CA 3CSDA 4Y8VA 1DRUA 3ASVA 4DLAA 4XIJA 2LDBA 4CR7A 5BNIA 2PKQP 2G76A 1PSDA 2G17A 1QV7A 4DPKA 4HV4A 2J3HA 2FN7A 5TX7A 3UCXA 1LRKA 2GUGA 1E1MA 2VYVD 4O5OA 3O26A 4L75A 1VKNA 3GAZA 4UVIA 4LVCA 3GZ4A 3OJEA 3GGOA 4DVJA 2VTEA 1QSGA 2CF5A 2OBNA 1LSOA 3RU9A 2HQ1A 5MDHA 4RQTA 4DYDA 3F5QA 3DHNA 4FBGA 1I3MA 1SNYA 1HE5A 2BFAA 3GUYA 3U9LA 3OSUA 2NU8A 3MTGA 3DBVO 4CMAA 5BSEA 4XB2A 3K30A 1DBVO 3K2BA 3RSHA 1ENOA 2PK3A 3UGKA 2J5QA 1R37A 3MJVA 1R16A 3TOXA 3FBGA 4ZVVA 1ISMA 4CPDA 3I83A 4XJTA 1ISGA 3GRKA 3TFQA 4R41A 1I24A 4IMRA 4RPHA 4ZQGA 1HRDA 1V6AA 3C85A 2O7QA 3Q9NA 2ZYDA 3WYCA 3DL2A 3I9NA 4WLVA 5A06A 4EJ6A 2YDXA 1D4FA 2QHXA 2X9GA 4PG7A 5JLAA 3EW7A 4NG5A 3VPFA 4W9NC 1KYQA 1PL7A 2O7SA 3VOSA 2DBRA 4TRMA 4R1UA 2ZTVA 3NTQA 1IZ9A 5HS4A 1SCUA 2IXAA 3GLQA 2VHVA 4CMHA 2O2SA 5U4QA 4XEHA 1CYDA 1GYQA 1DFHA 3VC7A 4WLOA 2C5AA 4BNWA 5FWNA 3JQ7B 1JKIA 3WG9A 4B4UA 2POQX 3AJRA 1ZNQO 4AG3A 1PJBA 1U8FO 3U0BA 2VHZA 5IN5A 1OMOA 1UXHA 4BKQA 3FNGA 1E92A 3R1IA 1F14A 5G4LA 1GZ6A 5KJCA 4PVDA 5A05A 4BKPA 3KB6A 4UUOA 2NVWA 3PXXA 3SXPA 3DO5A 4UEOA 4CMBA 1NPYA 2D0IA 1B15A 4RF3A 2C20A 4IIVA 1I01A 2YFQA 1AXGA 1E1LA 1I36A 3PYMA 3QWBA 3GY0A 3JYQA 3L6EA 2EW8A 4PG8A 1DHTA 2FPPA 1V8BA 3ADOA 1PQWA 1GYPA 5TRTA 1TI7A 5L7YA 4WLFA 4RF5A 5THKA 4RVSA 4Z0HO 2X4GA 3LYLA 4HFRA 1J4AA 4C7KA 1Y8QA 3VZPA 4CM9A 3N7UA 1KERA 5DDIP 1YDWA 4Y9DA 4BO0A 4CLDA 1CIVA 2E37A 2P4QA 3LF2A 4TVOA 3GPIA 4WCFA 4YRBA 1FF9A 3AFNA 3PJGA 4XIYA 1C0PA 4ALIA 3DC2A 5TF4A 2W8ZA 3VH3A 3W6ZA 1PEDA 1AHIA 1KEVA 2OO5A 2PD6A 1ISJA 2X5KO 1NAHA 2VZ8A 1M76A 1HSOA 2PD4A 3D3WA 4NBUA 2DBQA 4OKNA 1GR0A 4PZDA 3EZYA 2ZJ0A 1GQYA 4BB5A 1KC3A 1UDCA 3GEDA 4UUPA 1G6KA 1T2DA 2J5KA 2HK9A 4XD2A 4XYMA 2XPCA 3P2OA 1P1JA 3GGPA 4RPKA 2QZZA 4NU6A 4WGGA 3VDQA 5G0VA 1NR1A 1Y8QB 1U4SA 5EPOA 5HA5A 4XX0A 1BSVA 4UVDA 3WGQA 2IDZA 1I2ZA 5JY6A 2PLAA 1EVIA 4WCFB 4J4HA 2DC1A 3ETDA 3PHGA 4BO3A 1QYDA 5GY7A 3QIVA 4RO0A 1C0LA 3F4BA 4GL4A 5EMHA 2HMUA 3PPIA 5KJEA 3OJLA 3GRPA 1PJ4A 3PI7A 3D3WB 3B70A 3EMKA 3HUDA 3C7CB 5K9ZA 4OIMA 3DR3A 1QXSA 5DBIA 1ZIDA 2HK8A 1P44A 3LC2O 3SX2A 5A04A 4LSWA 4MVJA 4IGFA 3DBHA 5LCXA 3HDYA 3V1YA 4IDAA 1PL8A 1N1EA 5FI5A 1R0SA 2QIOA 2Q4BA 3DOOA 3R0IA 2Q2VA 3RI3A 3TOZA 3IP1A 2PH5A 2O3TA 3RFTA 1YONA 4YT2A 1YL6A 3D4OA 1AUPA 4IY1A 4TKMA 2GRAA 3W4KA 3QQPA 3Q11A 2FWMX 2C5EA 1FDUA 3PK0A 2J3JA 2W90A 4RLSA 4YAIA 1WDLA 4CQLA 3MJTA 5JC1A 5CEFA 2PFGA 3I23A 4FDAA 4RQUA 2W2LD 2ZYAA 4D46A 2VWQA 4J1TA 1VL8A 3HDJA 4FCCA 4R51A 1U3VA 5KKAA 1NQ5A 3H65A 3DBHB 3PEFA 3EHEA 2DLDA 1B3BA 3VPSA 1B3RA 1O95A 4FW8A 3AY6A 3QWFA 4N18A 4F45A 2VUTA 3BMQA 1X1TA 2ZQZA 4AJIA 1P74A 4F6LA 2NV6A 3WGIA 1Y8RA 1T4BA 3PHJA 1HE3A 5DP2A 1E7QA 1QKIA 1GQ2A 3BMCA 4QQRA 4IJKA 4A5OA 1T26A 4WOKA 4Z0TA 1P0FA 1QRRA 1ZK2A 2NU6A 3TL2A 5JAMA 1CWUA 3PYXA 4GX5A 4TROA 3KM0A 5IZCA 1KS9A 2YFHA 5CHEA 5BT9A 1XU9A 1DAOA 5KKCA 1EUCA 1XWFA 2Q99A 4IS2A 3A9WA 2NNLD 4J0EA 4QO7A 1QLJA 4D42A 4MIYA 1S7CA 1E3EA 1I2BA 3INTA 1VKOA 1TXGA 3PHIA 1B0AA 3G1TA 4A2CA 1HKUA 5GMOA 3PIIA 2YQ4A 4UAGA 3BMQB 3TJRA 2HRBA 1E7SA 4KDEA 4HADA 5EQDA 4BNGA 4AJHA 1EDZA 1E7WA 4B7CA 4MKRA 4CUKA 2XF8A 1ISFA 3CZMA 3OEWA 1Y8RB 1CERA 3UF0A 4KDFA 4XB1A 3FHLA 1YE3A 4DIFA 2Z95A 1U1IA 4Z9XA 3ZU2A 2CNBA 3H9QA 5H82A 3S1LA 3VKUA 5JW6A 4U7WA 4ZRNA 3A28A 3V8BA 1I3KA 3GH3A 4NH4A 4E30A 4URFA 1EFKA 4DMMA 5L4LA 2E4AA 1HE2A 2LDXA 2RH8A 2PA3A 2IYPA 2QG4A 3C1OA 4B8WA 4ND3A 3DHEA 2V6MA 3FRJA 3ZWCA 3SC4A 4BQRA 3M2TA 1KEUA 3QVXA 1XDWA 4NBVA 4CQMD 3JQFA 2EERA 3QVOA 4FQ8A 4Q3NA 5GZ6A 1PL6A 1RM5A 1PGOA 3SLGA 4E12A 4R3NA 3BYZA 1P33A 4J43A 5JAIA 3RIHA 5ILOA 1H93A 4MINA 3SJUA 4O59O 1ZH8A 2VN8A 4H16A 1K6JA 1NWHA 3ADPA 5T6BA 4EZBA 4P4LA 1BVUA 3PQDA 2YUTA 3ETGA 1DIBA 4INAA 4B7UA 3QVWA 5COAA 4P8RA 4ESOA 2WYVA 1YJ8A 3HDHA 1YJQA 4EUEA 1LLCA 3ABIA 4N5NA 3UKOA 3S8MA 3ZNOA 4DYVA 3U5TA 3ZI0A 4U0KA 1HLDA 3DTTA 1HDCA 1GZ3A 3DBRA 1O94A 1GEEA 1F06A 2PKQO 1ZSYA 4R5HA 2BLLA 1T2EA 3CPSA 2WTBA 4MKXA 3KSDO 3V5NA 3GDGA 2AG5A 3W1VA 2P5UA 3OETA 2Q3EA 4W7IA 2X6TA 1LSSA 1BRMA 4BMSA 1ADBA 2C7GA 3D5QA 1N8KA 4PLTA 1XYGA 1R66A 2X9NA 4Z9YA 3IUSA 1NVGA 1PR3A 3WWZA 3RFVA 3COSA 3OJOA 3I9KA 2JD0A 3PHHA 3PZRA 4MVJE 4WOJA 4IQ0A 3DWFA 1Z73A 2Y1DA 1MXFA 3JQFC 1KBZA 3TRIA 2EKQA 3QWAA 3WBBA 4BO7A 4YCAA 1EVYA 1X13A 1QLHA 3KRTA 2OFPA 2EJWA 3DAPA 3DBRB 4GAEA 4BHTA 3T4EA 4FJ1A 1X0VA 1PJ2A 1TT7A 3Q0EA 3VH2A 2IZZA 3FWNA 4M89A 2Y99A 1O6ZA 2H5LA 2P2SA 3AU8A 3ZU4A 1RPNA 1LBEA 4YJDA 4YT5A 3V2GA 3AM3A 1ZBQA 3TWOA 2G82A 3I6IA 3HDQA 2Q1TA 4D3DA 1TB4A 4BKOA 2JKVA 4YDRA 2WSBA 4DUPA 4I8XA 5IF3A 4E2YA 4RDHA 3UUWA 1LRJA 4ITUA 2RAFA 5IDQA 3Q2IA 1GPDG 2R6JA 4ALLA 5F5NA 1QP8A 3QW2A 4G81A 4BNMA 1HSZA 4ZQHA 3MEQA 4K26A 3WNQA 3GVCA 2AEMA 3EUWA 2E6UX 1PZEA 3VVCA 4PLGA 3PQFA 1GUYA 5I9NA 4N7RA 4LISA 3PGXA 4IJWA 2ZCVA 1O8CA 3BTUA 1NFFA 4KUEA 3RKRA 5BSHA 4G65A 1UZNA 1YS4A 2AE1A 4NPCA 1UUFA 3GAFA 5DULA 4PLCA 3E6AA 4DIOA 2D1YA 4BKUA 5AXDA 2YHUA 1ARZA 2UUPA 4XYLA 3IUPA 4GGOA 4ZHSA 3BMNA 4AL4A 3DQPA 5DNAA 4FFRA 5G2OA 1E6EA 1LDYA 5JCXA 2IEDA 1ZSVA 1T25A 4DTIA 4XRRA 2X5OA 1UDAA 1ENZA 4HBGA 1Z7BA 5L40A 1BG6A 3Q2KA 2WD8A 3IOYA 1PGJA 4U0JA 3CIFA 4XCVA 4TRRA 4I5GA 4RZHA 4IQGA 3GC6A 1X7HA 5JAZA 2X86A 3C24A 1KVQA 3OJFA 4GSLA 4E5YA 1NR7A 2H1SA 5JFOA 2NUAA 1Y81A 4DQXA 3HQ4O 1I0ZA 1DEHA 3F6YA 1XQ1A 3AY7A 1I30A 3B1FA 1OFGA 3WS7A 1E6UA 3TFOA 1FDWA 3GG9A 3BMNB 4HFNA 5CPBA 4PN3A 4UULA 4GLOA 3IIEA 1Q7CA 1W8DA 2CDBA 1DAPA 1UJMA 4NQZA 3WB9A 2IZ0A 3VH4A 1EZ4A 1E77A 1GL3A 2QZ9A 3L9WA 3ZNPA 4I08A 5I7SA 2GLXA 4OMUA 2UUOA 2DBVO 2BMAA 1XG5A 3W8EA 1K89A 4A0SA 2GASA 2CF6A 4WLUA 5F1OA 4BNKA 1IPEA 4YVFA 4DREA 2EXXA 1B8UA 8ADHA 5B4UA 4BKRA 3STHA 1XA0A 1SO8A 2EGHA 4FJ0A 4EBFA 3PDUA 2R2GA 4K28A 4D79A 4XWYA 4YB8A 1ZK4A 4BNUA 2CD9A 3GR6A 1MV8A 3RFXA 3FNHA 1V3TA 4BVAA 2CSUA 4MVJH 4J1QA 1A71A 4AVYA 2O50A 3PTZA 5IDXA 2ZB7A 3U3XA 3HJAA 4N5MA 3QVSA 4J1SA 2CVQA 1QYWA 2VT2A 5JE8A 1NM5A 3BMOA 3KEOA 4WCDA 4IXTA 3ROPA 3LT1A 2G1UA 3OQ6A 5B4VA 3DFUA 5ICSA 1LRLA 1Z7EA 3WQQA 4R68A 1NYTA 2HO5A 3G17A 4OYRA 3MTJA 3WYBA 3ZV4A 1EQUA 4FOSA 1VSUA 1R12A 1P1IA 3H3FA 3DZBA 1ID1A 4E5MA 2X7HA 2O3UA 2VWGA 2PZMA 3GZNA 3N74A 4PFJA 4YEDA 3TZCA 4IDDA 3L77A 1LDGA 1WMAA 3PVZA 4CLEA 1MG0A 4BMVA 4PLHA 5T57A 1DJQA 2AQHA 3GNTA 2WE7A 4I5FA 5IDWA 3HB5X 3WQRA 4RVUA 4IDBA 3JCZA 1WDMA 1YGYA 3MOGA 4OXYA 3BMOB 2O3QA 3PP8A 1XU7A 1NTOA 5JO9A 2NTJA 5AXAA 4GKBA 2JFGA 4OQZA 5EIOA 1Q0HA 2EG9A 1B26A 2I6TA 3NX4A 4J7XA 4ALNA 5A9RA 1KEPA 4TVBA 3DB2A 4BO6A 4CM5A 3OM9A 5DCYA 4P4GA 4J7UA 3ZWXA 4YAKA 1RM4A 4Z6KA 2GZ2A 1G0OA 5ES3A 3IS3A 5L4SA 3GZNB 1E3JA 5K0ZA 4A10A 2D5CA 3DOCA 4Z0PA 3MZ0A 5AXBA 4JCOA 5BNTA 2FR1A 1JAYA 3QWHA 1HDRA 1W6UA 2Q50A 4CM4B 1IUKA 5A4DA 2IZ1A 1VL0A 2NTNA 3TL3A 4MIEA 5KJFA 2OUIA 1DRWA 3K92A 5AXCA 4YYZA 1SOWA 4QECA 2QRJA 3NUGA 4I5EA 2B4TO 1BTOA 4L0QA 5HS6A 5HRUA 2JJYA 3G49A 3AM4A 1WVGA 3GQVA 3AFMA 2FZEA 1IL0A 3TF5A 4Q3CA 2JL1A 1Z45A 2P9CA 4PZEA 4YWJA 3VDRA 3GHHA 1ZUD1 3ROKA 3ZWAA 1HYHA 3OHSX 2X9VA 1NASA 2I3GA 5LDGA 5AOVA 4E31A 4NJOA 3BXXA 2GCGA 4W9NA 1EEHA 1DIAA 4PGFA 3RBXA 3AUSA 4EJMA 5JDIA 2AA3A 4MOWA 2BFPA 5EESA 1XQ6A 3OMLA 1H2BA 3AI2A 2RH4A 5GZ1A 5JXWA 1K2WA 5F3RA 1E6WA 4NBRA 2QYTA 4FN4A 4YRAA 2NTVA 4Y6PA 3DXFA 5A5FA 2BD0A 1RM3A 1Z74A 3F47A 4R69A 3AW9A 1N5DA 2J5RA 1UAYA 1DC3A 3PWSA 5JYEA 4AJ2A 1EQ2A 5L53A 4GX2A 1P1HA 3GEGA 4UEJA 4NFHA 3GFBA 9LDBA 1DC6A 2FRDA 3U4CA 4XZ3A 4XQEA 4E13A 2C2YA 3HHPA 1H2HA 1O89A 3QRWA 3SC6A 3E18A 1JWBB 3NT2A 1D8AA 4KP7A 2X0JA 1GDHA 4BS9A 2QX7A 4IXWA 4NBWA 2VRCA 1OOEA 4XA8A 6ADHA 1JA9A 3DBLA 3JQ7A 1PJ3A 4TWRA 3LT2A 4EW6A 4CM8B 3KO8A 5HM8A 4JBIA 1M75A 3KBOA 2G0TA 5B4TA 1FJHA 1U3WA 2I65A 4XQ9A 5B37A 2R00C 3TZ6A 4DC0A 1KVUA 4X54A 1KC1A 1YL5A 1UXKA 4GX0A 1CQIA 4WLNA 1ZMTA 4BOYA 3OP4A 2BHLA 4D3SA 2D8AA 1WW8A 1IOLA 5JDIC 3IL2A 1MC4A 1KETA 1UP7A 3IKVA 3KYBA 3GK3A 2QW8A 2Y0CA 2TMDA 4FPXA 4EEZA 4J3FA 1KEWA 4DIBA 1QYCA 2HJSA 4W6ZA 4LRSB 2GN9A 3UAGA 3H9JA 4HNGA 4GMGA 1CETA 3UCFA 5L95A 4Z3DA 3DBLB 2X0NA 4QXMA 4K6CA 1C1DA 1CJCA 2GN8A 4CV1A 3L4BA 5C7IO 1AGNA 1UP6A 4A26A 1P1RA 1A4UA 4JQCA 3E5RA 1JLLA 1XGKA 4RVHA 4MP3A 2C0CA 1PQUA 1W4ZA 2EJVA 2GN6A 5C7LO 3AWDA 4JN6B 5H81A 3PWZA 5LC1A 3JQDA 3K73O 1O0SA 3B6ZA 4WK6A 4DQVA 3VKVA 1GZ4A 1MC5A 1ISHA 4LN1A 2BKAA 1JKJA 3O03A 3HN7A 5KVSA 4HP8A 4YJHA 3RJ9A 5KTKA 3PGJA 4GLLA 2H9IA 4YJGA 3D64A 1C1DB 3GNSA 4UVHA 3ZHYA 3I9LA 1U4OA 1OZAA 1JTVA 4BUCA 4XKJA 1O9BA 5CG2A 3C8MA 3ROMA 1LXCA 1I10A 3DOJA 3I1JA 4E21A 1YWGO 3FTPA 3WGOA 2P9GA 4Q3AA 4PRKA 1X15A 3P2YA 1VE9A 3VTZA 3H9GA 1DDOA 2AEJA 5KOIA 2P4HX 2Y1OA 4HUJA 4MVJI 1GU7A 4LW8A 4TQGA 2Q1WA 2HMTA 3UCEA 1EFLA 1LEHA 1FXSA 2Y1EA 2GGSA 1MUUA 3L4BC 4RPJA 4YJHB 4GGPA 1DIHA 4K9DA 5COBA 4ZU3A 1EVJA 1U5AA 3OQBA 1ZK3A 4YJGB 4ZN6A 3OQ1A 4JROA 1EDOA 3PIDA 4QX6A 4GVLA 3BHMA 1WXDA 1PGPA 5JMWA 4M1QA 2WE8A 1CRWG 3O4RA 2B4RO 1NPDA 3MJ4A 2Y67A 1SMKA 2HUNA 4ALKA 4B4VA 1E3LA 2W2KA 4WNCA 3JQCA 5IAAA 1YOVB 3ZW8A 3FCOA 3JYOA 1PGQA 4UUNA 4II3A 3HFGA 2CUKA 3VPXA 1PJQA 4OHUA 3SLKA 4ZRMA 5TGDA 3ZH2A 5G0UA 4JBHA 1NVTA 1ZSNA 4IPTA 1L7DA 4R1SA 4BGVA 1ZJZA 2QYSA 3K6JA 4CMGA 3ANNA 2DPHA 4A7PA 4YQYA 5TIIA 1NHWA 3WWYA 2I9PA 5HTOA 2ZATA 3F4LA 3PQEA 3DHYA 1UZLA 2PWZA 3ONDA 4XGKA 1AHHA 1U9JA 1ZEMA 4BNHA 4WLEA 5A03A 1C3VA 2YV2A 1N92A 3O9ZA 3VH1A 1SC6A 3E03A 3HWRA 3M1AA 3K96A 1P1KA 4E5NA 2JHFA 2NU7A 2GO1A 1Y7TA 2W2KB 3WJ7A 2X8LA 1XELA 4GWKA 4DMLA 3OBBA 3VVBA 2AW5A 4BV8A 7MDHA 1SZJG 4ID9A 4RCVA 2YW9A 4DPMA 4Y67A 2WJPA 2O48X 3ZWWA 3ITDA 2ZTUA 2NVUA 3L6OO 3WFIA 4CM6A 3JYPA 3K5PA 2VHWA 2BI8A 3O8QA 1UDBA 3JV7A 1VRWA 1W0CA 2EP5A 2X0IA 3CTMA 3F46A 2VHXA 1KVSA 5F5LA 4EJ0A 1XKQA 2OZPA 4BO5A 4F46A 2YY7A 3A4VA 4CV3A 5ENDA 4F3YA 3UXYA 2FSVA 4PG6A 4L4SA 2NADA 2JAPA 2D4AA 2RHRA 5DOZA 1XR3A 3W8DA 5JCJD 4FC6A 4YQZA 2C7VA 1D1TA 4DGSA 1LSJA 1GTMA 3D0OA 4BV9A 3BA1A 5G0TA 1ONOA 3RUFA 1JDJA 1NAIA 1HDXA 2ZK7A 3JYLA 4LMPA 4OOEA 5TLSA 2BH9A 1U3TA 5FFFA 2NVUB 2J6IA 3RU7A 4KTVE 5JMPA 4C7JA 3PJDA 4CR6A 3F5SA 3RC1A 5JPIA 4TKLA 2VHYA 5ER6A 3O8QB 1NHGA 3OECA 5HWSA 4I9UA 2WM3A 2I5PO 2DVMA 3JQGA 3ZWBA 3ICPA 3ZU5A 5T67A 2C29D 4QEDA 3ZV3A 3DMYA 2AE2A 3DZJA 2FY8A 1E7MA 2DKNA 4M87A 4I1IA 4MDHA 1IY8A 3E9QA 4PIVA 4JP3A 4CL3A 3K2EA 3DZFA 4J9UE 3H3JA 1BW9A 4RZIA 5EINA 5AYVA 3ZV5A 4IZIA 1PJCA 3JQ9C 4IDCA 4GVXA 4JIGA 5EJ2A 3JQAD 4M86A 5T5QA 3GVIA 5I9LA 1R4NB 3WNVA 4R3WA 2EKPA 4IS3A 1QG6A 2EF1A 3RKUA 3JSAA 1MFZA 2P5YA 1E1KA 2JCXA 4NBTA 1J0XO 3JQGB 4E0BA 3WLFA 3E9MA 5ITWA 2AXQA 2GDZA 2VZ9A 4LCJA 3B20A 3KSUA 1GD1O 1MG5A 2O3SA 2AHRA 3FN4A 4XR4A 2VYVA 1BW9B 4O6VA 2C2XA 3MJCA 4KTTE 4R4JA 4M54A 3K8ZA 2GD1O 2YV1A 4OH1A 3VHRA 1ADFA 3GGGA 3ST7A 2HLPA 2FPGA 3JD4A 2EW2A 2DUWA 3INRA 3JD3A 1YBMA 1A5ZA 1DIGA 1MFPA 3PLRA 1M67A 1VSVA 2J3KA 2VZ0A 5CEJA 4O1MA 3GFGA 3W4IA 1ISIA 4AFNA 3ZW9A 2HCTA 1Y5MA 3VZRA 1DRVA 4B79A 1PS9A 4GMFA 4PLVA 2ZYGA 2B5VA 3QWIA 4NK5A 3WIEA 3L9XA 1N2SA 4GBJA 5TNXA 4OJNA 3LDHA 3Q1LA 4FJ2A 2C59A 4Y6SA 5I7VA 3LLVA 3OIDA 1ORRA 4NDNE 4CV0A 3VPHA 3W6UA 3WYEA 3ZGYA 1RJWA 1AN9A 4KOAA 1YXMA 3KUXA 4KUGA 4EEXA 1O5IA 1YVEI 3RWBA 4B4OA 3VZSA 3WICA 3KXDA 3GVPA 2Y93A 3P5SA 4DBVO 4L73A 5A5EA 1HYGA 4EGFA 4I9NA 2Q46A 4U5QA 4BGEA 4EI2A 2UYYA 4Z3KA 2X22A 1B7GO 3GMSA 2PD3A 1WMBA 3AI3A 2YHIA 1GQQA 1BXZA 2Z1NA 3U4HA 3RVDA 4YPOA 3D4NA 1N1GA 1H94A 4UUMA 4MJLA 3JQBA 4E2XA 1DB3A 1PJTA 4ZICA 1EUDA 1GCUA 4BNVA 4DQUA 1TEHA 4TMFA 1XEAA 4ILKA 1EK5A 1IYZA 3MWEB 4MP8A 4UEKA 1DO8A 1PJLA 1C0IA 1DIRA 1KOLA 1E3IA 3AOEC 2QRLA 4LSMA 1LLQA 5IFLA 5EN4A 4JLWA 4HFJA 3I52A 3WR5A 1L1FA 1P77A 4B3IA 5BSGA 5DBFA 2NM0A 4EUHA 4HY3A 2NVBA 2DBZA 4IBOA 5F1KA 3FBTA 2O23A 1MA0A 3FI9A 3H4VA 4NR0A 2YHIB 1ULUA 1PQPA 1F12A 3OA0A 1JAXA 2TMGA 3AUAA 3HADA 4A27A 4J4BA 4WNIA 3RUEA 3E9NA 4F6CA 1BGVA 2BRUA 2ET6A 3BHJA 3FPLA 5AVOA 5T64A 3DONA 2B69A 2Y68A 4BNNA 2X23A 3ZHZA 5C37A 4RORA 4LGVA 2NU9A 4UREA 4I5DA 1NNUA 4Q3BA 1LA2A 1T2CA 3EAGA 3B1JA 4Q9NA 2ZB3A 4IGEA 2GZ1A 4E4YA 3JTMA 3RAJA 5F1PA 1UH5A 1D7OA 2HMSA 1ZXBA 1DPGA 4AJLA 4Q3DA 3B1KA 1J5PA 3F3SA 2UAGA 4LVUA 4KQWA 3G0OA 5KVCA 3JQBC 4YTEA 5KVVA 3I9MA 1LLUA 4AJPA 1F8FA 3L4SO 1H9BA 3GA0A 2WEKA 4Q3EA 1VM6A 3GDOA 3WOHA 1TT5B 4CM9D 4JP2A 4DWVA 5KIAA 4BNJA 4WASA 1Q7BA 4FFPA 4U6SA 4HX5A 4NJMB 1RYDA 4FR5A 2CVZA 3CXRA 3F1KA 4IDGA 4OL9A 3RCBA 2EHDA 3LLSA 3EY4A 3NGXA 3CH6A 2RBEA 4FC7A 5ENVA 3WMWA 1V35A 1PU2A 4P4NA 4QSMA 4IM7A 3D5TA 1P0CA 2PR2A 3BAZA 4J0FA 4KQXA 2P68A 3WTCA 1Q2XA 2VNAA 1WNTA 1Z6ZA 4QT0A 4CV2A 1U8XX 3MWDB 1YDEA 1ZVMA 3JD0A 1JKFA 1C1XA 2O4UX 4BL5A 1YBAA 2NQ8A 4BO8A 2ZKLA 4ALMA 4OM8A 2O4CA 3UN1A 1HEUA 1I33A 3INGA 2UVDA 5DT9A 4W99A 4RJTA 4ZQBA 1B2LA 4ZQEA 4YR9A 2IYOA 4CLOA 4NFYA 4XYEA 4MO2A 1AXEA 1NQTA 4IIUA 2HAEA 1T4DA 4K6FA 2NWQA 2G5CA 4P22A 4WJZA 4BNXA 3LT0A 1HWYA 2Y0DA 3QLJA 5G4KA 1YQGA 3EZLA 1TA4A 1P31A 4BNZA 2O3JA 3RUHA 2SCUA 3IP3A 3WGZA 1I3LA 3GHYA 1E5LA 2GNAA 1OC4A 4FB5A 1UXJA 1IHYA 4DLBA 2FSSA 2W2LA 4W4TA 1LI4A 1Q0LA 1DLJA 1U2GA 1C1XB 2WMDA 1HDGO 2Z5LA 3OJ0A 4L4RA 4MVJD 4OXNA 2JFFA 3ZWVA 2WD7A 3IJPA 4FD3A 2ZTMA 3PJEA 4BNIA 3RUAA 1A9ZA 3HG7A 3NDIA 5CDSA 5GZ3A 4D0RA 3DZHA 4XJSA 5L51A 3FF4A 4CLOB 5HBRA 1HLPA 3ZCXA 4R16A 3FPCA 1L7EA 4D3FA 2BFOA 4E5PA 4YXFA 3GNQA 3VTFA 3EC7A 1BVRA 3PWKA 4R01A 5G4KB 1E7YA 2YJZA 2JCVA 4CM4A 1DFIA 3EVTA 3ETEA 2CY0A 2PNFA 1ZMOA 1C0KA 3NTOA 1VJTA 4NK4A 3E5MA 3WLEA 1Y9AA 2Y0EA 1FMCA 1HDOA 3PRJA 2OGUA 3M2PA 5L9AA 3IJRA 4DPLA 3A06A 1K5HA 2WD7B 3FSRA 3ON5A 4J7CA 4L74A 3W8FA 4LMRA 2BFMA 3S2FA 3QSGA 2X5JO 3TPCA 3V1UA 1QMGA 3CINA 4H3VA 4O63O 4CL8A 1DC4A 4Y6RA 3D7LA 2B4QA 1HL3A 2D2IA 4I9HA 1R0KA 1LDMA 2OBYA 5L3ZA 5A02A 5DN9A 3VAZA 3ZDFA 3I6QA 1M2WA 2JFHA 1UZMA 1UAGA 1B8PA 4HNHA 2VT3A 1K6XA 4EITA 2FPIA 3NTRA 4GKVA 3E8XA 1K3TA 1LDBA 4EUFA 2FZWA 2W4QA 3TZHA 3ANMA 1HDZA 5DBGA 1V3VA 2JAHA 3ZWMA 3EGOA 1PZGA 3OFSA 5DOVA 1YL7A 2B0JA 3IDSA 3ZNNA 5CAEA 4GX1A 1PWXA 3H9EO 4CM7A 3HSKA 4CQMA 3AY3A 2R00A 1ZK0A 2ILTA 1PX0A 4WEOA 4OAQA 2B37A 3RC2A 2FR0A 2F00A 3RUIA 1EK6A 1VLLA 4NNJA 4IDFA 5CDTA 4R9SA 3NJ4A 5A3JA 4CMKA 1GUFA 1T1RA 1DJNA 3OIFA 3BTVA 4RGBA 1VI2A 4RL6A 4RPGA 4BQPA 1RYEA 2DTEA 5EL0A 3I3OA 3S55A 1LDNA 5DZSA 5CEEA 1IULA 2JCYA 3NDRA 4CM8A 1JW9B 5C3MA 1LQTA 1PS0A 1JQBA 1J6UA 4HKTA 5JAQA 1F0YA 2ZCUA 3M1LA 4J2HA 4O0LA 1Q1NA 4XGIA 1NFQA 3I4FA 3WXBA 1ZO8A 1LC0A 4ALJA 1Y1PA 1X7GA 4UVGA 5A9SA 3GN2A 1J49A 5F21A 3TNLA 4DA9A 4CQMB 3DZGA 4PRLA 4CODB 1CDOA 3DMTA 4KZPA 3ZN2A 1R4MA 4A03A 4DXHA 4W82A 2VUSA 3ANLA 1GADO 1ZCJA 4FFLA 1BMDA 1KVTA 4E32A 4NHEA 4IMPA 4D45A 1HDYA 4YT4A 2IEBA 1EBFA 3H7AA 3Q3CA 1SB9A 2OP0A 4BNLA 1YKFA 1HE4A 4BIIA 1V9LA 3KEQA 4MVJF 4J1NA 4ZGWA 3TSCA 3R6DA 4DLLA 1B14A 2BI7A 3HE3A 4LK3A 3C1TA 1OBFO 1SAYA 2OP1A 3TN7A 1IPFA 4TSKA 2VYNA 2Y1FA 2A4KA 2I67A 1VC2A 2ZB8A 1BHSA 2D5AA 2BGKA 5T8KC 7ADHA 2WWRA 1JWAB 5A9SB 3NT5A 4B3HA 4CJXA 1Y9EA 3BIOA 1R4MB 1YO6A 2DM6A 1Q0QA 3PFWO 4NMHA 1GFSA 4KUHA 3GVHA 4FFMA 3C1AA 4ROSA 1ZK1A 5JDCC 1IE3A 2I3AA 2Q49A 3G3EA 2WYUA 1LX6A 4CLHA 1JVBA 1ZKMA 2A9FA 3QV1A 4HWKA 9LDTA 3FR8A 1X7DA 3NDJA 3L07A 4CMEA 1UR5A 4QFDA 4D43A 3W4JA 1MB4A 1RKXA 3JYNA 3DMTC 1YB5A 4FGWA 2RCYA 1HYEA 4S3MA 3ROQA 4KWIA 1H5QA 4NFSA 3DFZA 4ZA2A 4BO9A 5L7TA 2AQ8A 2V6FA 4WUVA 3ENKA 1PGNA 4D44A 1PJSA 2VOJA 3EVNA 4BGUA 3TZKA 4R9RA 5B1YA 1P45A 1K6IA 3FWZA 3DEYX 4GQAA 5CDYA 5THQA 3H8VA 2NACA 4P38A 1PZHA 1PIWA 5BNFA 5CPFA 1WPQA 3DTYA 3GMDA 1NP3A 3IQDB 3MCVA 4M8SA 1R6DA 2IRWA 3FD8A 3S2EA 5ICMA 2V6GA 1X1EA 1U5CA 1E5QA 1HF3A 2I99A 1ONPA 3TQHA 5BQFA 3ZHXA 1ONNA 3UH1A 1HZZA 1YOVA 2VRBA 4CM3A 3AK4A 3DZKA 1GEGA 3JQEA 1SB8A 3DZIA 3AOGA 4IQ8A 2CDAA 2I66A 4XDYA 1ZXLA 5L4NA 5DCUA 1GYRA 1XCBA 4RVFA 2PZKA 3LSYA 3LVFO 2D59A 4QUKA 2VWHA 5A3VA 2VOEA 2Y1GA 4CMEC 5CDGA 5TC4A 2W98A 1N7HA 2BELA 1QYXA 3C3XA 1VL6A 1VJ0A 5JY1A 4BB6A 4FS3A 3N58A 1H6DA 3ZWYA 3PDJA 2A92A 1IHXA 2DFDA 4IUYA 3HNPA 5TT1A 2B83A 5CG1A 1NQOA 4WPGA 2O2YA 3PHLA 4LRTB 1SEVA 1YRLA 3RROA 5MGBA 5JYDA 3ITKA 3KOUA 1GCOA 3AUTA 3WSVA 3Q6IA 3I5MA 1N9GA 1EE9A 1KVRA 4IJUA 1LLDA 3UHAA 1R15A 1QORA 1X14A 3KLPX 4XYGA 4II2A 1KY5A 4U6QA 3KETA 1ML3A 4PLPA 4AJKA 3UFXA 3H9UA 3VZQA 1MXHA 2WDZA 4HFMA 3QA9A 3NT4A 2YV3A 4GSKA 4OSPA 1H6BA 4NZ9A 3AU9A 3RUCA 1NXQA 1Q7GA 4WECA 3SEFA 3GF4A 4DL9A 1XSEA 4BNTA 4S1VA 3KYDA 4H15A 3WGGA 4OSOA 2X58A 2AEFA 4G2NA 3A14A 1ZJYA 4RF4A 2PZLA 4HXYA 1N9GB 3PZBA 3KVOA 3NRCA 1UXIA 3RBVA 2Q2QA 4WCFC 2Q2WA 4JJFA 3C7AA 4MPDA 5U1PA 3T7CA 2AG8A 2IE0A 4GH5A 3RJ5A 1MLDA 3JQ9A 4E2ZA 3EDMA 3WMXA 1B8VA 1FDSA 3M6IA 3NGLA 3IC5A 2Q1UA 1DOHA 4KWHA 4MVJM 3P7MA 1JN0A 1QR6A 3OF2A 2PKRA 3JD1A 3KYDB 4PLFA 2JD1A 1NQAO 1DXYA 4YJFA 3QE3A 3QY9A 3GT0A 4OQYA 3BZUA 4CMIA 1A4IA 1YB4A 5CDUA 3OEYA 5FI3A 4RPLA 1IZ0A 1IB6A 4J9VA 5B12A 1QV6A 3GG2A 3C7DB 1X0XA 2GYYA 1F8GA 4ND1A 1R4NA 3BTOA 3WIDA 1BDMA 3D1LA 3ONEA 1BWSA 4FIZA 5FF9A 3FTNA 4K1LA 2NLOA 3K31A 4J2OA 3O38A 2EGGA 1YQXA 2FR8A 3KYCA 1H6CA 4RDIA 2PGJA 4PLYA 1I8TA 3LU1A 4OOFA 2V6BA 1KY4A 4L8VA 1LTHR 3ULKA 4AJEA 2GERA 4JK3A 4DC1A 5KWEA 4E6PA 3GN1A 3CUKA 1A7KA 4PG4A 5KJ6A 1NFRA 2DFVA 3TZQA 4BO4A 3WX0A 4XGNA 4YJFB 4B4WA 5U9CA 4RVDA 1UXGA 3FNEA 5L45A 1FDVA 4XR9A 4CMIB 2EWMA 3LT4A 3AI1A 4E33A 1PZFA 4IJVA 4CR8A 5JBIA 4CQLB 4J91A 3OH8A 3QHAA 4GI2A 3TDKA 4H7PA 1ADCA 2ZIZA 3U49A 2DPGA 1CQJA 5K6AA 3PFFA 1QYVA 1EUZA 3WFJA 1HT0A 3VPGA 3UICA 4AJJA 5JSFA 4C4OA 4YAGA 3JQ6A 4D41A 3KYCB 3WGTA 1A72A 2VQ3A 3BHIA 3E48A 5G0SA 1E7RA 5IDYA 1UP4A 3H6KA 3E1KA 1WWKA 4YAEA 1T2AA 1M6WA 1SOVA 3GVXA 3BMCB 5LDHA 3HFSA 4J4TA 4CLXA 3P19A 5I7FA 4B8ZA 1SEPA 4JJGA 1U7TA 4FSHA 1GUZA 3V2HA 3H5NA 1F17A 3T7EA 3RQSA 4XQCA 3G1UA 1I5RA 2DTDA 2EP7A 1GV1A 3E82A 3X2FA 4CLRA 1I2CA 5DP1A 3MJSA 5IG2A 5COQA 2AQKA 2B35A 3AOEA 2H6EA 3G79A 2XOXA 1MX3A 2C54A 3JQ8A 2PGDA 3WGHA 1Z82A 5IZCC 3D3EA 4D0SA 2DTXA 3V1TC 3CEAA 2HJRA 4RV9A 2OORA 3OIGA 5K6AC 3QP9A 5IN4A 4MVJP 2IXBA 6LDHA 1NVMB 3RC9A 2GF2A 5IXSA 1XHLA 5CP8A 3F1LA 4JGBA 1VJ1A 2DQ4A 2J8ZA 5H83A 2PV7A 1I32A 4N5LA 1WLYA 3H2SA 5KVQA 1HZJA 1V3UA 4ND4A 3KV3O 4CLRB 3ICCA 3IMFA 4JNKA 2XXBA 3WQSB 5TJ9A 5TSDA 4YRDA 1TLTA 3UVEA 2OMEA 3IAHA 3ZZNA 5IZ4A 4CM1A 1AE1A 5TT0A 3PYLA 4NIMA 3JQ8B 2PY6A 2QRKA 2VRCD 4RF2A 3FR7A 1S6YA 2WYWA 3OA2A 4TZKA 1YBVA 5FEUA 3EK2A 5TJHA 1DFGA 1LU9A 4PVCA 3A1NA 4RVGA 2GN4A 2V65A 2OOSA 1E3WA 3GPDG 2VYND 3DAFA 4E3ZA 3U62A 1WZEA 2FOIA 4IDEA 5EQFA 3EYWA 4GWGA 3FNFA 1LQUA 1P9LA 2BGLA 4ONEA 1MGOA 4MIOA 5ITVA 2EV9A 3KZVA 4G5HA 2YZ7A 4OGWA 4EYEA 3ZHBA 2F1KA 4XYBA 3SJ7A 2V7PA 1EVZA 2D3TA 2CFCA 5I8ZA 5EERA 3RASA 3AUUA 4XQGA 4GPD1 2HMVA 1CEQA 4J6FA 4DBZA 2E82A 4MKZA 1Y5RA 3R3SA 4QO8A 3GDFA 1LDEA 2PZJA 3KHUA 2UV8A 2A94A 5KCZA 1H0KA 1M66A 1T24A 4PLWA 4FFOA 1PR9A 4U8GA 1TT5A 3I9JA 4ZD6A 2FHSA 4WEQA 1DSSG 3F9IA 4L9RA 1LUAA 2Y66A 4ZJUA 1E3WB 2X0RA 4NJMA 1YH3A 5JC8A 2UDPA 2HKIA 5DCWA 3CE6A 1Z75A 2CZCA 1E1NA 4M49A 4L4XA 2HSDA 2Y05A 5IXYA 3ENNA 4AJ1A 1ENPA 3CMCO 4DRYA 3ORFA 1EMDA 5AQ1A 5IJZA 2O3RA 3I4CA 3NAQA 3L0DA 3R3JA 4CMCA 1OI7A 1HTBA 2YYYA 3SBOA 2I76A 2X1HA 4R1TA 1OAAA 2E49A 2VCYA 2FMUA 3RC7A 1H6AA 1T1SA 3ZV6A 1FK8A 2HK7A 2HRZA 4QFCA 1WP4A 1U3UA 5BR7A 3DDNA 4ZQFA 1PWZA 1JU9A 3T4XA 1PS8A 1W73A 2Q1SA 1R0LA 5ER9A 1D1SA 4QTZA 4R5MA 1ADGA 2EIHA 5DF1A 1ZEJA 2HDHA 3MJEA 4ND5A 4A73A 4BGIA 4FFNA 4R54A 5I7EA 3U4IA 3H5RA 4YAJA 3LZ6A 5TS3A 1YQDA 4L76A 3QVTA 2GSDA 2J3IA 2FP4A 4BO1A 1N7GA 3AM5A 1BDBA 1P1FA 1SBYA 3NV9A 3WSWA 1GAEO 1A9YA 3BTSA 1BXGA 3LK7A 2AQIA 4NU5A 3NYWA 4WKGA 1PTJA 3ZWPA 1RM0A 2IODA 3PLNA 4JJIA 3GUCA 2P9EA 8LDHA 2H63A 3HB4X 1M6HA 2RIRA
chains in the Genus database with same CATH superfamily
1IXKA 3G0CA 4YIHA 1A27A 3EIUA 3L01A 1DU4A 3BIFA 3H0CA 4JI2B 1U6JA 2GK6A 2GCOB 3MXOA 4DNFA 1PNQA 2YUIA 1Z6YA 2HU2A 2HU5A 4B3DA 3K70C 4H17A 4LVOA 2VLIA 4GE0A 4JT9A 2ALJA 4H08A 4JITA 5AIBA 1B8NA 1U28A 3E23A 4ND2A 2XUOA 5C7OO 5DLYA 1E5XA 1T5SA 3UW3A 4BE7B 4F71A 4D3ZA 4WN9B 3ZVLA 2Y9MB 3K1TA 4HJXA 3EXFA 2YCBA 3FJOA 2BTQA 1L4BA 3A3KA 4IRXA 1MC8A 1NATA 3A31A 3MOIA 2RHLA 3FYUB 4FOLA 1L5LA 4ZCRA 3S2GA 4EG4A 1CSEE 4LBZA 2DAPA 3K4PA 2C82A 3AF5A 4U7HA 4X8OA 3EFOB 4B0PA 1AMNA 3DKVA 4YUVA 3RREA 3Q3JB 2BP7B 1QNFA 1Y6JA 1ZZGA 3ZV7A 1MW8X 1MMFB 1DEXA 3KTOA 2HSWA 4OHVA 5JCJA 1E79A 2QV0A 3DAGA 5ISMA 2VSXA 821PA 3FAZA 3DVAA 1V7PC 3ZWNA 2I54A 3NJRA 3HY4A 3RARA 5IVPA 2DUJA 2IDKA 4R1MA 1LNQA 2P91A 3V7UA 2GVNA 2OXFA 4D7AA 5ILGA 2QENA 3HV0A 4QGAA 4Y7CA 4GC9A 3I2FA 1RCFA 1GV0A 1O87A 2CYBA 5AHOA 2QEQA 3E1GA 5CB4F 3RTCA 2OXIA 4JJ7A 5BUSA 5JZMA 5DGHA 3ZWOA 4RMNA 3EE6A 5BMVB 1D9ZA 5FOQA 3IEVA 1JNYA 3X1DA 3O82A 2I2XB 3AGPA 5JZSA 2ZB4A 3CN9A 2VAWA 4DMKA 4UTRA 2BGMA 1LSUA 1U2DC 2AMVA 3GZTB 3I45A 3QI2A 2HA6A 4OQMA 5HFJA 1V5GA 4ER3A 2IZOA 3V2UA 3OKFA 3U1BA 2RGGA 5ADHA 4CKWB 3BXEA 1T3LA 5FUXA 4WBNB 3BCRA 3ECCA 5BR1A 4EG7A 5FT9A 1G60A 1LJ8A 2ISSD 4NBLA 4RLHA 4BNFA 4BWVA 5C5IA 4OGFA 4G97A 5IKMA 2O2XA 2ZQYA 4NV0A 5LXTF 2A9JA 1XLUA 3EWAA 2WG2A 1B16A 1EXMA 3JQAA 4KK3A 3X2EA 1U9YA 3PNQA 1G8FA 1C3XA 1I3NA 1OJ7A 1NU6A 3WJAA 1TM2A 4QXOA 5AJWA 2WIFA 2XCQA 3A2NA 1WAMA 2BGUA 1LB1B 2DFLA 1NX9A 3MRSA 1KZ6A 4KAFA 4N3CA 4WESA 3ZWDA 4AG6A 5B7NA 5B57C 1DXQA 2J41A 3AHCA 5I7UA 1XRRA 4DLWA 3I9OA 2B4KA 3KTDA 4WI1A 2CB0A 3A4MA 4DR4B 1R7RA 1NVKA 3PDCA 1XLTA 2ACVA 2FLWA 3RBZA 4ER6A 1V8FA 3G2HA 3Q3IA 1IUOA 4G0MA 3HCPA 3CUSA 4XDZA 1S2GA 1FFCA 1Q57A 1SKYE 1GA1A 4K6GA 4FGSA 5CJ2A 4WGFA 3DOEA 1ZZEA 3DKRA 4G1VA 4Q3LA 4U9HS 3U3KA 4NAHA 5HJ2A 5BPFA 4M55A 4QUBA 1Z38A 1URPA 1U6IA 3U3ZA 5BVGA 5L7WA 3SDZA 1Q91A 5JS2A 4X7BA 4KSBA 1JLSA 4EWLA 1JIXA 1U1DA 1ZFNA 1SWVA 4LCEA 2C58A 1ZGGA 4OKIA 1C41A 2JCSA 3H2ZA 1PZXA 3I2KA 2HQOA 4B5LA 4R9NA 1CUCA 4U1RA 2FXIA 3FCUB 4N54A 1QVRA 2IS1A 2YDYA 3CUWA 3B5EA 3OCZA 4Q4LA 3GOHA 4RWZA 2X2FA 5ELLA 4ZWNA 4A0RA 3MT0A 4KITB 5CFZA 2BTOA 1ZW1A 4NU0A 2EJTA 3CSDA 5CA1A 4Y8VA 5B58C 2H2FA 3AF6A 2WSSD 3N5KA 3DZCA 2BEUA 1LV8A 4N47A 1Z26A 1GNVA 1BH2A 3QBTA 1J2EA 3EGIA 5E1DA 1ABBA 1U94A 1BZYA 4WTOA 4KWTA 3UJHA 4DR7B 1WRBA 2J3HA 2H2IA 2FN7A 5TX7A 4HV4A 3R3WA 5D7NA 1KHTA 1E96A 2ZRIA 1CEYA 1E1MA 2HBQA 4BFWA 4C43A 4Z4GA 4R8MA 4IX1A 1R0CA 4XCXA 4UVIA 1VKNA 2JFOA 3F6EX 1JVNA 4JP1A 2ZE5A 4JBXA 1R9NA 2VTEA 1MCZA 3BWEA 2OXTA 1QSGA 2OBNA 2OFWA 5P8WA 2NZUG 1ONBA 2O14A 2PEZA 2ZJAA 3MMZA 1S3GA 2DCUA 4GT1A 2C99A 3BAFA 3E3AA 2BDUA 1FS4A 4XVQA 2RBKA 3VO1A 5AVSA 1EBBA 2X8JA 4IDNA 3T3PB 3WRVA 2G36A 2BFAA 4LZLA 3GUYA 1GVNB 3MTGA 4PONA 1RWWA 3WSTA 3EQ7A 5I5GA 2HU8A 4CMAA 5BSEA 4XIIA 3VJKA 1N5JA 1FQJA 4QPCA 2JZNA 4XLZA 4KR9A 1M2GA 2PK3A 4PX2A 3SC2B 4PAOA 4ZAVA 5BV0A 4CF5A 3U4MA 2JGRA 3TOXA 4EHNA 3QVLA 2F3TA 1GSIA 2AI2A 3EG5A 1YA4A 4RPHA 3UMBA 5CD9A 1HRDA 1Y5IA 3C85A 1C7IA 3Q41A 2J85A 1N4AA 2O7QA 4CQJA 1U7OA 3BQ9A 1SOMA 1U3GA 3CRZA 1TF7A 4NZZA 1P60A 4RS3A 1HFJA 3PX3A 1O8BA 4BFUA 2IHUA 5F12A 4XW2A 4W9NC 2H1CA 1PL7A 4KIUA 2ZWIA 1UOEA 1G1MA 2O7SA 3SEQA 1M2EA 3VOSA 1J33A 4R1UA 3TTWA 3MPOA 3SAJA 1EFPA 3NTQA 4JODA 3SSAA 3UNXA 1WXFA 2IXAA 2NU8B 1NRWA 3MJHA 4AZ0A 1L7BA 4F3NA 4HRVA 1KE2A 3DBIA 1T1IA 2QVXX 4N9QA 1XRPA 2GHRA 4BX3A 2UYGA 3BD9A 4XEHA 5A3SA 2ZYHA 1CQZA 3IQFA 3PQ3A 1Y34E 2B8WA 1V3QE 1XTRA 1GYQA 1X94A 5HOQA 1WQ3A 1WKCA 2D2XA 2ODTX 1H2FA 5TDHA 4FQ7A 2IYZA 1IEVA 1DQRA 3ZQUA 1B76A 3A8TA 3WG9A 2NZYA 5KDOA 2H4ZA 2LP4Y 4E51A 1P62B 4EKEA 4I5IA 3NRJA 1ZNQO 4AG3A 5GINE 1CZKA 2WHQA 3U0BA 2OMKA 4LV8B 4QU5A 3TLAA 5J23A 1DG9A 5K3FB 5DI3A 1E92A 2HSEA 2LRHA 3FPBA 3MLBA 1I3OA 1GZ6A 3EY9A 3N75A 4IIBA 2FLVA 4PVDA 2F7SA 3KB6A 4UUOA 4EG3A 2CW5A 3DO5A 1PJZA 5D01A 4BLQA 2AF3C 4CMBA 5A4JA 4KIJA 3O47A 4TKVA 1SD2A 2I2CA 3M4XA 3PNOA 1B15A 4M7WA 3SZRA 4LF4B 5JLJA 3QXGA 4NATA 5LIRA 2G9QA 3R5XA 1E1LA 1VLQA 2NZVG 3PYMA 4L15A 4L8FA 4JJ6A 3W90A 1QONA 3L6EA 2EW8A 3N28A 1UBEA 4PG8A 3GJQA 2IYFA 3FFXA 1Z4OA 5IJWA 4D9IA 1U0SY 3D6TB 4HN9A 1FJ2A 2JIPA 2Q3JA 3ASZA 1TI7A 2NXEA 5EWMB 3IHLA 2DHRA 4W5NA 4EUNA 4HNUA 1NW9B 1QRSA 4OB8A 4GPIB 1Y8QA 3VZPA 4HNRA 4K3VA 4RX1A 4QTXA 5K3SA 1I1HA 3ZOKA 1NJ5A 4Y9DA 3OZRA 2UVPA 4L4YA 3ZS9A 1BH6A 4WCFA 1SC9A 4L0DA 3AFNA 5KS2A 2XVMA 2X2EA 1NVWQ 5K3AA 5DWVA 3DEZA 2C0PA 4N12A 2QTAA 3W6ZA 1I6KA 4JC8A 4Q4CA 1AQUA 1KEVA 2ZDQA 2VVTA 2AR7A 4Q93A 3JAKA 3S28A 4NBUA 1P4RA 1V5FA 2EJUA 3C98A 4OKNA 1GR0A 1G5TA 1M0SA 2IYEA 2O2HA 4EBBA 1KC3A 2QBYB 1HTTA 2HC9A 2Q5JA 1Y63A 3GEDA 1J0DA 4PC3A 4UEQA 4R0VA 2IL1A 3MHTA 2FPPB 1O0CA 1AGPA 3B48A 4XYMA 5HSGA 1HFEL 3ETLA 3JATA 1XAHA 4GEKA 2FK8A 1Y9ZA 4V2IA 4TMWA 4X9XA 1U4SA 2XUDA 4YCBA 1AKQA 5F2EA 4XX0A 4YALA 3N8GA 1K7YA 2E85A 4HUQB 2PT7A 3ZU6A 4JOCA 2BMFA 1U8CB 2XADA 3ETDA 3ZYCA 2ZOSA 2XYHA 2JEZA 4WSOA 4RO0A 1GZ7A 3PUVA 3FUXA 3F4BA 2GA9A 2PSJA 2ACEA 4RPIA 3RSLA 3ZI4A 2JHAA 3OLWA 1X7XA 4RAOA 5DN6A 4B6OA 4PQGA 2PH1A 4UE3S 3HXOA 2PLFA 3V7NA 3UXMA 4B2IA 2IK8A 4BLPA 4MICA 1Y1QA 3HSYA 121PA 3D3WB 3I30X 5AKLA 5FNVA 1EK0A 2G9RA 3DULA 2F1IA 1M34B 4QJBA 4U8HA 5J2UA 4L1KA 1H8ED 2X0KA 1VZ3A 1V2HE 1VQ1A 4Y0NA 1OUMA 1QH1B 2EZUA 3BSSA 4H31A 4F5WA 3TNYA 2JZCA 5DHRA 3DPSA 5A04A 1D2GA 4G4JA 3ENZA 1Q21A 3EMDA 4K46A 5KYUA 1JXQA 1I0IA 3I1FA 4BVKA 1GT91 1PQYA 1NMYA 2WV9A 3DB1A 1IHPA 3NNSA 1T9CA 3HZRA 3NUZA 5SICE 4ZOQI 4RIEA 4G8DA 3PXDA 4I55B 4NESA 3F0TA 1FP1D 2VHTA 5LCXA 1H2ZA 5T4EA 3V1YA 5KYXB 1C7ZA 1PL8A 4UHFA 3D2CA 4YFYA 1T5BA 3AHDA 4FW9A 4Q3KA 3GLHA 3R0IA 2WICA 3RI3A 4ZMBA 1YFZA 4LKRA 5D8DA 1HLFA 3RFFA 5EMJA 3O9VA 4RK6A 5CLQA 4O25A 1YL6A 3WAGA 1VFNA 4RSGA 3RIMA 3QJYA 3W4KA 3QQPA 2ZTSA 5IANA 2OZKA 3T12A 2JLSA 3Q11A 2C5EA 2OSBA 2HPHA 4QYMA 2J3JA 1LWOA 1PUIA 1QRDA 1WDLA 3C3AA 3K5HA 3LBNA 1COWA 3AFOA 3MJTA 2WOOA 3OLYA 3QY0A 4FDAA 4RQUA 1XMVA 2X0FA 4NE2A 5EG5A 3HDJA 2W93A 1NQ5A 4NVRA 1UKVY 5KQSA 3DBHB 3TPFA 5JJIA 3EHEA 4EX7A 3UAVA 1IIBA 1F9EA 4B6PA 4F45A 1BX3A 1IOWA 4GXNA 1AV6A 1XA3A 1KYTA 3KUUA 3BMQA 1X1TA 2IHBA 1NRIA 4ARIA 2ZQZA 1KZ7B 2MSCB 2UYQA 4AJIA 4DIUA 1NF2A 1SZPA 4F6LA 3M5WA 4J07A 4DWJA 1Y8RA 4FP9A 2B9EA 3PFBA 4GP9A 3AXSA 4JLKA 5LQRA 1Z8FA 2V59A 3AKYA 5DNDA 1N0IA 5CW1A 1ZOOA 3NB0A 4L5IA 1QKIA 1GQ2A 3QV2A 2XNJA 3BMCA 4RH3A 2WU4A 4A5OA 1T26A 3B1XA 2NU6A 1UPBA 3I6MA 1LVGA 3RVNA 5JAMA 3PYXA 1JFVA 3GLRA 1X1AA 3T0GA 2JCBA 4MNTA 2YJ5A 1XMOB 3G2LA 1KO7A 4AKGA 4D9JA 4IS2A 5AIAA 1L1QA 1B23P 1XRJA 2DQYA 2QMQA 1A9TA 2ZULA 3H2KA 1MH9A 1R9MA 1DEAA 2NYRA 3INTA 1GP2A 3X1MA 4OAOA 3I05A 2EOAA 4HZUB 5C8YB 2X3YA 3SKYA 2UZ1A 3PIIA 4HB4A 2Y0PA 1E66A 4KDEA 5EQDA 4AJHA 3WLHA 4Z4IA 1SU4A 4H27A 4MKRA 4YXWA 1BA2A 1N6LA 3CZMA 3Q7RA 1XMQB 1W44A 1CERA 3FF1A 1QAOA 3ILYA 2B7CA 4TWZA 1OBCA 2VP9A 1AC5A 4Q9HA 4YECA 3BD8A 5U4XA 1K6MA 3WGJA 1A8QA 4KV7A 4WKOA 5DXFA 4DIFA 1Y5NA 4Z9XA 1ZXXA 3VKUA 5H82A 4YHHB 3TXAA 1NXXA 4U7WA 4R81A 5EJMA 8ATCA 3A28A 2WMNB 3GH3A 2IVZA 4Q34A 3KZCA 2YNMC 4E30A 2ON6A 2HHAA 3E4CA 3RRBA 4R71A 2X1VA 1RYMA 3K0HA 1HE2A 5ADVA 3C5VA 3C1OA 2QG4A 2AHOA 2XLCA 4CZ2A 4V0RA 2P6OA 3RDPA 2IXTA 2IYQA 3SC4A 1BO6A 2H29A 3LKBA 3G9ZA 3TTXA 4Q6BA 3QVXA 5LQCA 4NBVA 4YP0A 4BASA 3JQFA 2EERA 3CF2A 2O1SA 3QVOA 4FQ8A 2R79A 2P6MA 4Q3NA 3MUOA 4O4HA 4GI3A 4RFSB 3UO8B 2JARA 1HMYA 3EVDA 3O7MA 5JVDF 3W5SA 3ZQ4A 2IV7A 3TUZC 2IC5A 3DO8A 5EZYF 1GO2A 5JAIA 2Z08A 2WD9A 2JAUA 4FN5A 4OHZA 3FZQA 3NC4A 5ILOA 3SJUA 3CX6A 1F0KA 4H16A 1OH6A 2F43B 1NWHA 5T6BA 2IU0A 4EZBA 5EIWA 3PQDA 2YUTA 3ETGA 1DIBA 3CR7A 4UM5A 2B3DA 5J43A 3QVWA 3HI6A 5COAA 1Z0JA 2M1XA 5ERYA 2XRFA 3THXB 1ZM7A 4C2BA 1XJQA 2YJNA 3IPYA 4EJSB 1D6NA 1X7ZA 4I4LA 3F67A 3HA5A 3W2HA 2PX0A 5IJ0B 3ABIA 4N5NA 3USZA 4F21A 2DQKA 3ZNOA 4F9GA 4HVAA 2AG1A 1U9CA 3U5TA 3ZE0B 4U0KA 4IIXA 1GNSA 2GVZC 3A3NA 1IXYA 3TGWA 1R0XA 3H75A 3CRQA 3H97A 1O94A 1GEEA 3JAWA 4YV0A 3T3EA 1T9KA 1ZSYA 3CHYA 3VGJA 1T2EA 1Q1BA 1IIRA 4RE6A 3GDGA 3KQMA 4IDOA 3TIFA 5IC4A 1JDTA 2OC4A 2PLRA 3DV0B 5LOVF 2VP3A 1LSSA 1BRMA 1W1IA 2X6TA 3W9YA 4BZWA 2J6CA 1E1RD 2ZJ2A 3L04A 2JJMA 5KNCA 1G8MA 1TQ2A 2JBAA 1NSFA 2IYUA 1CB7A 3IUSA 2MU1A 3R7NA 3WWZA 3RFVA 2FX5A 3EDYA 1MIOA 4G5FA 3PHHA 2JD0A 3E2MA 3QYAA 4MVJE 4DCCA 2QG6A 4IQ0A 1LPBB 2C7OA 1Z73A 3GRVA 4A92A 5REQB 1KBZA 3TRIA 1U0FA 2RGNC 3ILSA 5IARA 4HB2A 4F5ZA 3KRTA 4BHTA 3S68A 4TXHA 4INPA 3KDSE 4YUYA 1SH7A 1X0VA 1PJ2A 3K20A 4ZT2A 2QLTA 3SEZA 4CDRA 1DZIA 2OAGA 4RJJA 1M1YA 3QLTA 5TVKA 5EIEA 4XAQA 1M6YA 2BJHA 2EYUA 3VH2A 2IZZA 3D0KA 1LLFA 2BR4A 3FWNA 5FEMA 3FCSB 3SYNA 3T1YB 2P2SA 3AJDA 2PG3A 3AU8A 3O1IC 4YT5A 3AR3A 3S2SA 1ZBQA 2C9CA 3PR3A 4ZCIA 1QBKC 1YC5A 2XUAA 2HWXA 3HA3A 3L7NA 4FGLA 5CA0A 4D3DA 2A57A 2YMPA 2ABWA 4FCTA 2JFVA 1MRZA 4IR7A 1NW7A 2QU8A 1AQ6A 2WSBA 4HQOA 4D74A 4DUPA 1Z5NA 4I8XA 1TK9A 1FRNA 4RDHA 4TKUA 3U17A 3HU1A 4ITUA 3CLVA 1YAJA 2HY7A 2RAFA 3EGWA 3FZYA 4TKZA 2PT9A 1VIYA 3YASA 4ALLA 5L3VA 1CULC 2WVHA 2BZ0A 3QW2A 1P75A 1IRXA 4M2LA 2RGUA 2X6RA 3MEQA 2FPRA 4ZQHA 5JYBA 2G08A 3B53X 4JLJA 3FOBA 2HT1A 4RABA 3EUWA 4HVLA 5KNBD 1J42A 4KQJA 1S89A 4B9EA 3VHQA 4DG8A 1CBUA 3C6BA 3SEAA 5BV8A 3E22A 4TTTS 2W6OA 2RGEA 2ENUA 2HJHA 2PX8A 2FPLA 2OHIA 4GU5A 4UOZA 3DL4A 3BTUA 4R2IA 5I7OA 3A9TA 4KUEA 3RKRA 1VXOA 3IVMA 4PBTA 5B3KA 3VA7A 3H2IA 2DERA 1YQUA 3VUFA 4DF3A 5DULA 2Q6IA 3FKQA 3WHLA 4O2BA 4DIOA 3LO8A 1USVA 1G7RA 3IUPA 5HE9A 3ETHA 2WUFA 4ACAA 2RFLA 1CFJA 1PNTA 1E6EA 5HVNA 5JCXA 5K09A 2IEDA 1G21A 1IN7A 4I0WB 5CM8B 2AD1A 2X5OA 1X1DA 1XYYA 3OY2A 5K8LA 4TMVA 1QK5A 2C31A 3ZPXA 3TX2A 5EWLB 1Z7BA 4MW7A 2XTNA 3Q2KA 1PEKE 2GCOA 1TADA 3CRVA 3KKLA 4NJEB 1V11A 3WKBA 4TRRA 2WUGA 3IR6A 3NHSA 1FX0B 2OXCA 3NAMA 3AFGA 3M9LA 4V2UA 3GC6A 4HGOA 3SM3A 4DBLC 3OQMA 1FTNA 1DXHA 3UC9A 3UMJA 1SXJC 1KVQA 2IYSA 3LGSA 3MTAA 3OJFA 4K88A 4GSLA 4E5YA 1NR7A 4X92A 1M0WA 2N42A 2X7XA 5D51S 5D7BA 1EFTA 2BCGY 1BX0A 4FDTA 1A8IA 2OFXA 1NY6A 1Y81A 3MS4A 3HL0A 2I62A 3HXLA 4PR0A 5AHWA 1H1DA 4R7TA 4R1QA 3HJHA 1I30A 4L3VA 2FRVA 1OFGA 4UTVA 1HC7A 2HIGA 3H5LA 3OCXA 1VXRA 2OV4A 3D1VA 4FE3A 5M3BA 1RAFA 3TFOA 3EFOA 4LX0A 1KI3A 3F98A 2R6GA 4DJFC 3D8TA 4PN3A 2W6ID 1W8DA 4OQPA 2G07A 2B3TA 4EH1A 3OZUA 2X13A 1ZA1A 3C3JA 4NQZA 2O8BB 1V96A 2QE7A 2UZ3A 1T3HA 3CA8A 3REQA 3R6LA 1GL3A 3O94A 3P9PA 2C57A 2EKDA 4KAAA 4K6OA 3ZNPA 3T3GA 3WWCA 4ENWA 4EY4A 1U2PA 2DBVO 3PD7A 3KS9A 2ZT5A 2JI9A 4S12A 3RB8A 4MMZB 4BNKA 1BD4A 3R7FA 2NUAB 3CS3A 1B8UA 5G1PA 3GNLA 1AXRA 2O2EA 4QWWA 4JVMA 3E2IA 3P0FA 1PVOA 5AI4A 5HKLA 4MDEA 1DQYA 2IF2A 3L0ZA 3KYJB 4K1XA 4TL6A 3L06A 4P84A 4OJMX 5ALYA 3SF8B 1FBTA 5CM9C 3FMFA 4YB8A 6PFKA 2K7FA 1T1EA 4GZ6A 4LXUA 2EJBA 3PGKA 4MVJH 4HXFB 4BTEA 2DG2A 1JLRA 5L6MB 2O50A 2YIJA 2C4NA 5PNTA 4CKWA 1JI0A 3U3XA 2LPMA 3E05A 2FKAA 1J0BA 4JT4A 5BY2A 4J1SA 2VT2A 3P9IA 1NM5A 4IVNA 1ZU4A 3T06B 3VSCA 5BR8B 2SKDA 2HWYA 2O2DA 1C30A 1F2UB 1SIUA 3MAJA 1P1CA 3FNQA 4IXTA 4JOBA 3LT1A 3OQ6A 3IOMA 4L8GA 4EO4A 3PLAE 4AS3A 5BYBA 5ALQA 4MWOA 3T7JA 4IH1A 3UMFA 4L6CA 3HA7A 5TV2A 5LR6A 5I9IA 3MTJA 3DMRA 1RNLA 2BBWA 1J8VA 4COKA 3S3TA 3OLZA 1GZUA 3M5DA 2V9CA 1OFUA 2IDMA 4Q7MB 1MB9A 4YRKA 2XA2A 2QI9C 2ZJ4A 3GZNA 4OL0A 1JE1A 4PFJA 5AVRA 3T54A 3L8CA 2O05A 1MR3F 2XNSA 4IDDA 5EP2A 5G41A 4EVRA 3L77A 1EXVA 1WMAA 4CLEA 4YJ2B 1MG0A 4GM0A 4BMVA 1POWA 4RZUA 4B7ZA 2WE7A 5EPUA 5A7GA 3HB5X 1S3FA 2N46A 1WDMA 2IWRA 2C7BA 3KJEA 3ZH9B 3BMOB 3FCCA 1IY9A 4GHWA 1DAHA 1NTOA 5JO9A 1KXJA 5J5CA 5AXAA 4GKBA 2JFGA 1U2QA 2EG9A 3HACA 4G4GA 2H7XA 4KO3S 3PKJA 4J7XA 4Q9KA 1Z4MA 3PC7A 5AW2A 1RLUA 4TVBA 1WBDA 1SXJE 1Y1RA 3CLRD 3OM9A 4FOPA 3VC1A 2GEJA 4B33A 4J7UA 1ZI9A 2GZ2A 2I03A 1U4NA 3KT8A 3ROTA 1V6SA 5ES3A 1EXWA 1A96A 1M5TA 4HMOA 1DCKA 1JIKA 1I4WA 5L4SA 3CONA 4L78A 4A10A 3T9BA 3SBDA 3MUFA 3SN6A 4MYHA 1C7QA 1W6UA 2Q50A 4URYR 4B43A 4CM4B 4DWOA 1SBTA 2R7MA 1VL0A 1BXRB 3TL3A 1Q5PA 4MIEA 5K8UA 1VKZA 2OUIA 3C3CA 1OTHA 1DG3A 2OT3B 2BFDB 3HDVA 3ABZA 3OT1B 1SOWA 4MLDA 2PUJA 1N5OX 3HKDB 3SSNA 2QRJA 2VIIA 4I5EA 4KGXA 5HS6A 4L0QA 3AM4A 2FCAA 2FZEA 4E6EA 1LBTA 1UQRA 4ME6A 4OEHA 4BX8A 4ZK6A 3GHHA 1WHTA 1XTJA 2Q27A 3RFCA 2WJIA 5H80A 3ROKA 1GGKA 2XQJA 4F5YA 1EU1A 3N0XA 2PA0A 3O8CA 5ALUA 1IC6A 4FFBA 4FYXA 2C5LA 2XRMA 4RJIA 3OMWA 1B2RA 5LDGA 4X41A 3TLGA 3BXOA 1P7CA 4ON9A 2WT9A 3GZJA 5CGQB 4NJOA 2XVAA 5CIWA 1EEHA 3AUSA 5HF6A 1DJLA 3URKA 4C78A 2WB2A 2AA3A 5EESA 3PF8A 3RODA 5BV2P 5LP6F 3AI2A 3EVFA 5AVZA 5KPJA 3CNNA 4B3CA 3SC2A 3NR2A 1ZOLA 1E6WA 1BMTA 1M8GA 2PS3A 1QHNA 5HKBA 1QU3A 1JPJA 1Z36A 3FAKA 1RWVA 1ZPDA 2CCKA 5EHIA 3R24A 4Y6PA 1T3SA 5K3DA 4LQDA 1OLUB 4CHGA 1OZ0A 4Z4QA 3DXFA 1VL5A 3LBIA 3U13A 5FBVB 1T29A 3U9TA 1Y4SA 3GV0A 3ICQB 1ICIA 2P11A 3AIOA 3TRHA 1JZQA 1DO0A 1Z0KA 4CKCA 1NG9A 1J09A 4KV9A 1EQ2A 3BGOS 2CNWD 2QSZA 4NFHA 4NPAA 1DC6A 1ACMA 1P17A 1V1RA 2J9YB 1FTGA 1XCLA 4OQNA 3NM4A 2NPFA 1FUKA 4G5XA 3QRWA 3SC6A 5FV4A 1RADA 2ZREA 1JEQB 1RCTE 1M6EX 1OGIA 4H77A 4AF7A 2QGFA 3QKTA 2D2VA 2A0FA 1I13A 2QB5A 5I45A 1PFYA 2QX7A 1OOEA 4BN4A 3H3XA 3S44A 1N2GA 5B1EA 3V2IA 3FLEA 4TXJA 1ZCFA 3LT2A 3MWGA 4KO4S 1ECLA 4CM8B 1KJNA 1WUHS 3IAS6 4TUYF 3HYNA 4HSGA 2G0TA 4IFIA 5ITSA 5DRYA 1U3WA 4XQ9A 1QKJA 5K3FA 2R00C 2KMLA 4JLUA 3C39A 1KVUA 2GOYA 4E70A 4N8EA 2YFKA 2ADOA 5BSWA 5ILQA 3KAJA 2GX6A 3WL8A 3H05A 1YR7A 3OX3A 2BHLA 5HJ5A 1CUGA 5JISA 1R6TA 3HKBA 2D8AA 4HLUA 3RVSA 1XK6A 2I2WA 1K92A 3D7MA 2B2CA 4YCMA 1G98A 2CMKA 2A1TR 2M1ZA 1MJGA 3BWMA 521PA 3EDCA 3ZCUA 1ZI6A 3RHTA 2PO5A 4HLQB 1X80B 1YRQA 4Y1EA 4HEA1 4KRGA 5JANA 1TFRA 1HV8A 2GN9A 3H9JA 3H99A 3IDAA 4G9GA 5ERGB 3VVMA 1N5IA 5KNCD 1KP9A 3DCNA 3M6VA 4N3AA 1K8ZB 2O8NA 4Y2JA 3SFVA 5C80A 3DBLB 2X0NA 4QXMA 4V0KA 3HNOA 4DLSA 1C1DA 1CJCA 5DM60 1M8PA 4JU9A 1N3LA 3CF4G 1NBIA 3K1AA 2WTXA 2YWBA 4UNSA 4RTSA 1IJFA 1Q44A 4JAVC 3G8CA 1NBWB 1SG9A 2VAPA 2J32A 3FCAA 4FFWA 4JQCA 4RXMA 2FRDC 3TLYA 3FOFC 4MP3A 2J09A 1PQUA 4H7DA 3W9SA 2EJVA 3GLGA 2IYYA 4JN6B 4FB4A 2NO7A 4D5GA 3NC0C 3O2QB 1GHTA 3V8EA 3GPLA 5B7PA 3PNKA 4Q4HA 2YVUA 4X93A 1XXHE 1DAMA 4JT8A 3HCDA 3HCNA 1F4VA 3FYDA 4OFBA 4DQVA 2O8EA 3ZJ5A 4F04A 1XKLA 3L1VA 3QH4A 4P3XA 5HBGA 4M0FA 5AJXA 5B2EA 3LA8A 4RACA 2BKAA 4MGYR 5BWOA 2AOWA 3IPCA 3T9CA 5JEEA 3RS8A 2E4WA 5KVSA 1KFCB 1RI4A 4HP8A 1SHKA 3PGJA 2EYQA 2DPYA 3DMGA 1KMCA 1Q17A 3QMWA 1F6DA 1S2DA 2GXUA 3D64A 3H2JA 5CB4B 4DV5B 2LE0A 3LM8A 3KUDA 1E9VA 1QGZA 1VTKA 1U02A 4MWEA 4EECA 4ETIA 5BN5A 2B8JA 3M5CA 1ZICA 2C94A 3Q0IA 4NAVA 1DT5A 4LZNA 1K88A 3WIUA 1L5GB 4PHCA 3ER6A 5CG2A 4P7BA 5KSPA 3UA3A 3FTPA 3S81A 1NIPA 4DSAA 1XTKA 1G8GA 2DHEA 1LJLA 4ARUA 4RD2A 1MJFA 3P2YA 2XIJA 4AWAA 2YJGA 4KR0A 3GJ0A 4BDTA 2CLFB 5BUCA 1TO2E 2CJXA 4JC4A 2WLTA 4EM6A 5LNK6 3H7IA 2BHTA 1GU7A 1TDJA 2OD2A 4TQGA 2Q1WA 4JOQA 4DMFA 4EELA 4MXDA 2L42A 1JKJB 1QH1A 3STYA 5LXTB 4AMVA 5KYYB 3SS8A 5E4FA 1GGJA 2PLWA 3DFFA 2MJLA 4YJHB 5JI2E 3HEAA 2ORWA 2AG6A 4LE0A 3QLVC 4Q1BA 5LZ7A 2AGVA 2Q2OA 4M8KA 3EMBA 5ESDA 4AF8A 3N07A 3OQ1A 3PDIA 3W5AA 1DV2A 4JROA 1NUHA 2YJTD 3PIDA 5ELMA 4B80A 1SHZA 3AINA 3U1VA 3HEMA 5IKEA 2JK0A 5JSHA 1PGPA 4BVHA 1YVRA 4M1QA 4CV2A 4ZEMA 4JI6B 2FPOA 3O4RA 1N25A 1G66A 4RYDA 1L1EA 1HL7A 1Z7YA 4HWOA 2CJPA 2F3UA 2Y67A 2ZBGA 3NTLA 5H68A 4Z49A 4WNCA 1T9GR 4HDMB 3UJ3X 1YOVB 4GBMA 5HZGA 1ODLA 3FCOA 3PEUA 2E7ZA 1EXDA 3EVBA 1HRKA 2C1XA 4UUNA 3O2NA 3WWOA 3CVXA 4EB3A 4O02B 3SLKA 2OV2A 1TEZA 1ISSA 4E7OA 4JBHA 5C8XA 1NVTA 4YROA 4BGVA 2QYSA 2EX0A 5KJCA 3F6RA 4RLFA 2I1WA 4CMGA 3MLEA 1AA6A 2DPHA 1JNXX 3FWKA 5KWIA 2M6SA 3HWWA 2FI1A 3MCAA 4DMGA 1C1YA 3OO1A 2P6NA 1CG6A 4G1UC 5HTOA 2ZATA 1E9RA 1TD1A 3F4LA 3PQEA 4Y2SA 4TMZA 4ZVMA 3RVLA 1FRVA 4FYIA 4EJ2A 5D84A 3QEKA 4WLEA 1C3VA 1QQTA 1I7DA 4FMPA 5B30A 1SVKA 4WA8A 1ZY2A 5DI9A 4J0CA 4BQEA 3HWRA 3ICVA 3M1AA 1P1KA 3RF7A 1VLVA 4W8GA 2PJDA 3IEMA 2W2KB 3CX3A 2X8LA 2KBFA 3VVBA 2G67A 5GOZA 2YWJA 7MDHA 2O8DB 1X39A 2VDWA 3FXAA 2YW9A 4QOIA 2IXDA 4HRXA 1WPXA 4LQLA 4UDYX 2LD4A 4A36A 4HYEA 5BVHB 2ZTUA 5JJKA 2PR7A 4BNDB 3WFIA 1BN6A 2CYCA 3GCDA 2QVCA 4L9WA 4I4TA 4CM6A 1EQAA 3FFWA 3JYPA 4F97A 1GIAA 1W49A 1SVNA 1TC1A 2ZBQA 4EHJA 1O54A 1VRWA 5ELXA 4RTNA 2VHXA 3N8NA 4RM2A 4QDTA 4BJ5A 5F5LA 4EJ0A 1XKQA 3OU2A 4BO5A 1PE0A 1XTPA 2FXVA 3IBTA 3A4VA 3PPVA 3ZLBA 3DMFA 1Y1TA 4O29A 3QVGA 5GJCA 3SP1A 1D2EA 1F2DA 3W8RA 5HUHA 3K0BA 1U63A 4HZUA 5C8YA 3RVBA 3TZLA 2JFNA 3FBWA 2NADA 3ZJTA 5IT9A 3ABRB 2JGFA 2JAPA 5AHKA 3UH0A 4FFVA 3T7IA 3BF8A 3OZIA 4HX9A 4OK3A 4X6UA 3O0TA 5P21A 4W1QA 4LBVA 2F9MA 1U9IA 4YQZA 4XH9B 2CFTA 2PXHA 2BGRA 1LSJA 1GTMA 2CE7A 2F3PA 3D0OA 1ZN9A 1W7AA 3TKLA 2VQDA 3BA1A 1ONOA 4J94A 1JDJA 1H2AS 1HDXA 3PKIA 3SX4A 2Z9DA 5FQNA 4MYUA 1NW4A 1WPGA 1ULHA 2WHXA 2NIPA 4CR6A 5D1HA 3KJZA 1E2LA 3PJDA 3RC1A 3ZS8A 3W6OA 2HFJA 4JMPA 5ER6A 4D9FA 4IKEA 3O8QB 4DABA 4N6OA 1JF8A 2I5PO 3HXQA 4P3OA 5AESA 3BCHA 2QNBA 3FZEA 3ECAA 3JQGA 3PQ6A 3OQJA 4NDAA 2GAFA 3O75A 4M1EA 1VHLA 4QEDA 4Q4AB 4O1HA 2J30A 1A8SA 3K0CC 2FY8A 2DKNA 4L4UA 3QUAA 1Z8DA 3WL5A 4JFRA 4MDHA 2CCJA 2QTVB 3O2JA 1ZJ4A 1YVDA 1ZD8A 3B82A 4JP3A 2ZUVA 1YS7A 3K2EA 2BGTA 4HMQA 4UZFA 2P0EA 3ZJ4A 4HT3B 1TRKA 1KYVA 1LTKA 1QE5A 2ICAA 2G5PA 2WWXA 1A9QA 4KIFA 1OFVA 4IZIA 4QBKA 3C7TA 3T9AA 3VR5A 1W8IA 2CHEA 4BJ1A 1DADA 2J67A 3MF4A 1AB6A 5E9AA 1QGUA 1E2IA 1Z12A 4R40A 5I9LA 2IZ5A 4GR9A 3V3KA 1NYLA 2HCBA 1CE8A 3R09A 1XLWA 2EKPA 3NHFA 4Y2PA 1U2SA 4LNUB 3DV2A 4JEUA 1J97A 4G5QA 3UW1A 4C05A 2KM1A 3LSTA 2P5YA 1E1KA 1ZH2A 1J0XO 1SXGA 1JJ7A 1P3JA 2R1VA 4QASA 2HI0A 1AKRA 2JLAA 1M9NA 2QMHA 4JEMA 1U0JA 2AXQA 2QUAA 4PHFA 5K4AA 3SD7A 4BIMA 3KSAC 1RVDA 2VXCA 2E1RA 3B20A 5AW1A 3LVQE 3IO3A 5CH3A 1EWQA 1PHRA 1BCRB 1MG5A 2O3SA 3LK6A 4PYNA 5FBRB 5SZJA 2YHAA 4KVAA 4TLDA 2C2XA 4B84A 4PNHA 3E84A 2CCGA 4DUYB 4XTRA 4EA7A 3K8ZA 1FVOA 3C5WP 1CJTC 1N0HA 1XF9A 5K8TA 5J3JA 4D26A 1MRNA 2EBHX 4WZAA 1ADFA 3GGGA 1NIJA 1ZN7A 4QXPA 2OILA 2QV7A 1FY2A 4D5EA 3EBPA 2XUIA 2FPGA 1RACA 2QMOA 2BSQA 1H1LA 2WKSA 2NYAA 3VHXB 1MPXA 1MFPA 2I7DA 3PLRA 2RK3A 4QYSA 2XMCA 4UC0A 3SG0A 2Y8EA 2VZ0A 4YV1A 3LECA 5I9TA 1D2NA 2N75A 4LFBB 4G84A 3GFGA 1SQ6A 4AFNA 1ISIA 2XBMA 2X9LA 3E53A 3E7FA 2QD5A 1UJNA 3VZRA 1DRVA 2R4TA 1TX4B 2ZP1A 3F90A 4GMFA 2B5VA 3WYGA 1N2SA 1VJRA 1EK1A 3CISA 3SYTA 3TTVA 1QIHA 4CL2A 2IPOA 4FJ2A 4V0LA 5F2OA 3OIDA 1R6UA 3AKDA 3IEXA 3W6UA 2JI6A 4DV1B 3HPQA 2ZPTX 4D3XA 1RJWA 4EF5A 3R9KA 1PD1A 1DDGA 4D4MA 5C4GB 2AOXA 5AM1A 1OREA 1CXZA 3CVJA 4KUGA 3WK8A 3UWDA 5AO9A 3SZ3A 5HX7A 4F2WA 2E0IA 4HOYA 3PICA 4MX8A 4PQEA 3WICA 1TGVA 3DEKA 3IELA 3C45A 4O4LA 3PA6A 1MB0A 4QYIB 4DBVO 2CMHA 2Y93A 4ZYZA 5H59A 4PYRA 3PC2A 4I9NA 1DWQA 1GCIA 1CDZA 1R64A 2IX3A 2A9PA 2Q5HA 1NN5A 1SCIA 4X95A 4FHCA 3AI3A 3NYIA 1C7JA 2HM7A 2YHIA 1AHNA 4EW3A 1X70A 2WILA 3TAXA 3U4HA 2I78A 2Z1NA 3R77A 5KX5F 2HYDA 3D4NA 4MYTA 4UUMA 1H94A 5E4YA 1G19A 1T5OA 4MJLA 4E2XA 1DB3A 1PJTA 1YR9A 1EUDA 2PJZA 2YOGA 1Y7IA 2YWEA 2ZIAA 2BFBA 3IO5A 4DQUA 2PMWB 1EYZA 3A36A 4IDQA 1REQA 1EK5A 1KA9H 2RHDA 4C2AA 3SF0A 1XDGA 3MWEB 1TW2A 2ZDGA 3BXFA 4GOXA 1TJ5A 3MMPA 5K7SA 1C0IA 4OA8A 1KOLA 3AOEC 2OYRA 2VNIA 3G0HA 2VG8A 5H16A 4JLWA 5YASA 2QRZA 4RS4A 1L1FA 1ORDA 4BVGA 4A1FA 4MLCA 4RENA 4B3IA 2PUDA 2NM0A 5DNYB 2HJGA 1J0AA 2ARKA 5EWLA 2Q41A 4ZAYA 5TQ2B 2NUBA 2HXGA 3I76A 1J2YA 4IBOA 1QIFA 2NZWA 3FBTA 2O23A 3PUHA 3AH8A 3M3PA 3STXA 4GEGA 1J06A 3OA0A 2W43A 1JAXA 3HADA 4P5DA 3W2FA 2VTBB 4Q24A 3T3DA 5BXYA 2YH2A 4WNIA 2UXBB 2ZJBA 3TRKA 4F6CA 3CNQS 2BRUA 2ET6A 3BHJA 3FPLA 3N3BC 3CZCA 3TTSA 3SSOA 1PR5A 3ZHZA 5TQ0B 2AYYA 4RORA 4GBED 1NJ6A 3A6HA 3IILA 2GDJA 4H3SA 4UREA 4R6XA