2X9GA

High resolution structure of tbptr1 in complex with pemetrexed
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structures of Trypanosoma Brucei Pteridine Reductase Ligand Complexes Inform on the Placement of New Molecular Entities in the Active Site of a Potential Drug Target
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 94
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x9gA00
2HAEA 2A35A 3BHIA 3PZRA 3L0DA 2EJVA 1AHHA 1SCUA 2CMDA 1QG6A 3BZUA 4G5HA 4ESOA 1A72A 4XCVA 4XA8A 1ZO8A 1N2SA 1OZAA 1DFHA 3GQVA 4BKUA 5A06A 2JFHA 4KUHA 4QQRA 3SC6A 1R0LA 4YT2A 1CJCA 1EFLA 1H9BA 4HNHA 4MKXA 4WE3A 1GPJA 3ZWNA 1K89A 4TRNA 4WPGA 1X0XA 3JQ9A 3IDSA 1I33A 1WAMA 2EXXA 2NQTA 2Q1SA 1UR5A 2IYPA 4LW8A 3GY0A 3WSWA 3K9QO 1BVUA 2X58A 3MJSA 4R54A 4F46A 3KSZO 4MIOA 3P19A 3LF2A 3NV9A 1PS9A 2VCYA 3WGQA 5JAZA 4NI5A 1U3VA 3G79A 3ROMA 3GEDA 4CM6A 4XYGA 4Z6KA 1KVSA 3HDHA 2RAFA 1DFIA 2BMAA 5H82A 4WECA 4GVLA 5CDYA 4K6FA 3SXPA 1VRWA 1N92A 1SNYA 2FSVA 3BTUA 1EQ2A 5BNTA 3GEGA 1UP6A 4UEOA 3PWSA 3NTOA 2CVQA 3AOEA 4J3FA 2P5UA 3FNHA 2Y67A 4NBUA 4WNIA 1DIHA 3O38A 2VYVD 1OC4A 3QJ5A 1C3VA 1C0PA 1E3WB 1SO8A 4BMSA 1D4FA 2OBYA 4LRSB 2WTBA 6ADHA 3WB9A 1H2HA 5DCWA 3SBOA 1PJQA 4AJOA 1KY5A 1YOVB 2FN7A 4LRTB 3A14A 1BXKA 5THKA 2PV7A 4S3MA 4ZVVA 3NRCA 1K2WA 3E03A 3M1AA 1C1XB 5IDWA 4D3FA 4YEDA 4CMGA 3C7CB 1LEHA 1A27A 4Y67A 1F8GA 1LC3A 5DP2A 2WD8A 3ANMA 2BGKA 3MWEB 5L7YA 1FF9A 2OGUA 2X9NA 2GPTA 2W2KB 3GK3A 1ENPA 4DRYA 3JD0A 1ZNQO 3LLVA 3OF2A 3UGKA 1D7OA 1KY4A 3U62A 5BSHA 5GY7A 3W8DA 4RLSA 4CV0A 3QY9A 1GY8A 3AI1A 1YE3A 2XAAA 3EHEA 1Y5RA 3TZCA 5EJ2A 3NYWA 1N8KA 1IULA 1W0CA 4FSHA 1BTOA 3V2GA 5AXAA 2NADA 3RFVA 1P1KA 2AG8A 4WKGA 5KIAA 2HMSA 2NVUB 4ZRMA 4YAJA 4Z9YA 3SLKA 4FFMA 4D0RA 2FWMX 4DGSA 3OEYA 1PWZA 1ZK3A 4MVJE 5ER9A 4NJMA 1FJHA 2X4GA 3QP9A 1EDZA 3EDMA 1UXIA 2PGDA 1JAXA 2IZ0A 2X1HA 3FSRA 3DZGA 2CUKA 4XQCA 4FN4A 4UUNA 4E4YA 3FPLA 1JKFA 3IKVA 3L07A 1UUFA 3QWHA 2JAPA 4XB2A 5CG1A 1AXEA 4CM5A 3DZKA 5F5NA 3RAJA 4D7AA 2QHXA 3W8EA 1K6XA 4RVDA 2RH8A 1YQDA 3WX0A 4FC7A 5C7IO 1LA2A 1ZK2A 3Q0EA 1MV8A 5KVCA 2CZCA 3BHMA 2JJYA 1E3WA 4BNNA 1PJTA 1KEPA 2X0NA 2YV2A 2JCXA 5JY1A 2DAPA 4L75A 1E92A 1YOVA 2UVDA 5FI5A 1XCBA 5EESA 3WBFA 4EDFA 2Y99A 4J2OA 1NAIA 4Q3CA 5I9NA 4R4JA 3RUIA 3VHRA 2V65A 3NEPX 1QYXA 3ZU5A 4DWVA 1I30A 2J5RA 1CIVA 4TZKA 1F0YA 1R4NA 1XLTA 3QA9A 2GR9A 1KEUA 3RASA 2D0IA 4RQUA 2IEBA 3AI2A 1KYQA 5F1KA 2WJPA 3NTRA 2I9PA 1HEUA 2YY7A 1SB8A 1RWBA 4TRRA 3JQAD 4Z3KA 3ITKA 4DXHA 2OFPA 4FGSA 2GYYA 3FNGA 3VDQA 4ZJUA 3X2FA 1G0NA 1ORRA 4L4RA 3VDRA 1ZUD1 2UDPA 1E3IA 3RWBA 4RJTA 3D3WB 1M2WA 4O6VA 2HMUA 2EHDA 4XWYA 2VTDA 4MVJF 1ADCA 1UXKA 4XYBA 4MINA 1UJMA 3MOIA 3WICA 3ZWCA 1BW9B 2JFFA 5IDYA 5LDHA 4JROA 4CV3A 2YHIA 3UH1A 3VPFA 2G0TA 3D4OA 4BHTA 2NM0A 4CUJA 5C7OO 1R4MA 3ZV6A 2JFGA 3PLRA 3JQAB 1OC2A 3AUTA 1LTHR 3PPIA 3ICCA 5ICSA 2OXIA 5JC8A 2BGMA 1ZSYA 4ZN6A 4OQZA 1IB6A 2FY8A 4NH4A 1I10A 3T7EA 4CQMB 1KBZA 3LZ6A 5BR7A 1P77A 3R1IA 5CPBA 3DZHA 3UCXA 3SX2A 4BKRA 5COAA 3GLQA 4I9HA 4CLXA 2D3TA 4GSKA 3DAPA 4NFYA 2BHLA 3LQFA 3VH4A 1HE4A 4IBOA 2FMUA 2HRZA 3FNFA 1C1XA 1RM3A 1VJ1A 4XQEA 2BLLA 2C0CA 1K0UA 4RV9A 4YT5A 4R9SA 3F4LA 1YB1A 3X2EA 4BNMA 4DA9A 4PG7A 3K30A 3ITDA 4RPJA 4UREA 5L7TA 2FR8A 5EPOA 2P91A 5CHEA 1GUFA 2EWMA 4BO1A 3TFOA 2AG5A 3GFBA 4CQMD 1W4ZA 4IZIA 4R1UA 3WGHA 3P5SA 4TSKA 1Y8QB 1U4OA 1I01A 3ONFA 4ALJA 2J3KA 5I7VA 1U3UA 3W1VA 2X0JA 4KWIA 3GVHA 4OIMA 2O3QA 1Z6ZA 4UAGA 3NT5A 4M86A 1DIGA 4UULA 2WD7A 1GPDG 3TOZA 5JCXA 3A4VA 2GN4A 1T2DA 4OJNA 5A3JA 2NV6A 1PS0A 3QW2A 5KJCA 4D44A 3UAGA 5A1TA 1LBEA 1EMDA 1LQUA 1ZXLA 4FOOA 4GGOA 4GX1A 3KYCA 3ENKA 4HXYA 3QVTA 1YL7A 3IJPA 3GGGA 1XR3A 4BIIA 3VVBA 5U9CA 1LDMA 1X15A 2YDYA 4WCFA 4OKIA 3VVCA 2QYSA 5F21A 1UP7A 2GLXA 1JN0A 1QV7A 1BXGB 1NPTO 2Y1CA 5G0WA 3OEWA 4R69A 4RF4A 4L76A 3D5TA 4J91A 1LUAA 1X0VA 3SEFA 1VSUA 1SZJG 4YRBA 3T4EA 4IGFA 1QXSA 1Z82A 3RUCA 2YV1A 1R66A 1ENYA 2O3TA 1ISGA 2ZKLA 1I3LA 3K73O 4H15A 3JQCA 5B12A 1YH3A 4M8SA 4JGBA 4UVGA 4BNXA 4GL4A 3U4DA 1SMKA 3ASVA 2EIHA 2W2LD 3FWNA 4J4BA 2CSUA 3GA0A 4N18A 5TQVA 4NU5A 3I4FA 4N54A 2NVBA 1PIWA 1YXMA 3OETA 3PFWO 3FCOA 1O9BA 3DFUA 3VTZA 4KTTE 1Q7CA 1UXJA 5AXBA 3DOJA 5G2OA 3WJ7A 5IXSA 1BG6A 3I9OA 1QKIA 4RZIA 3LYLA 1H94A 5HWSA 4JX8A 5JY6A 1SOWA 5EIOA 4MIEA 1PGNA 1O95A 2RIRA 4UVIA 4ONEA 4TRJA 5IJZA 2Y93A 2GASA 1DIBA 4L8VA 4ROSA 3I1JA 3OJLA 3D3EA 1EUZA 5K9ZA 4YB8A 5T64A 4E5MA 4E2XA 1T2FA 3DBRA 4ILKA 1MXHA 2BFAA 3NGXA 5TT0A 1I8TA 3BAZA 2CDCA 3H5NA 3VC7A 4A7PA 4R1SA 1HKUA 4BNJA 1DDOA 1EE2A 1MX3A 1X1EA 3VZQA 3EVTA 2XXBA 3PIDA 4AJIA 2F1KA 3ICPA 1I3KA 2H63A 4WLVA 1FDUA 3COSA 2EEZA 4W9NA 3IQDB 5TX7A 4RF5A 8LDHA 4NHEA 4AFNA 1O94A 4D79A 1GFSA 1Z75A 1HYHA 4BKOA 1I0ZA 4FIZA 3MJEA 3FD8A 4YJDA 2I65A 1ZIDA 3JYPA 1HXHA 2AEJA 4H7PA 3O9ZA 5AQ1A 4IXTA 4QUKA 4M89A 4RZHA 1H5QA 2O3UA 1R12A 2VHZA 3H65A 3FNEA 1WMBA 4DBZA 4J4HA 3WFJA 5G4KA 4PLZA 1HSZA 4CLOA 4DQUA 1PTJA 4PG8A 3KRTA 3AM3A 1E6WA 4K9DA 3I6IA 4PLYA 5TIIA 3ASUA 3GR6A 5CPFA 4NR0A 5HM8A 3EMKA 4RO0A 4NK4A 3GNSA 3V2UA 5KVSA 4Z0PA 5T8KA 2ZB7A 4PLVA 2BGLA 1YQXA 3GVCA 1ZMTA 1PL8A 3DAFA 4NBRA 4NBWA 1PSDA 3L77A 1Y8QA 4CMKA 3WNVA 4GVXA 5JDCA 3ORFA 2O7QA 1DOHA 2Z1MA 3ONDA 2AA3A 3OSUA 5ADHA 4LVUA 3QVSA 4S1VA 4B3HA 4IDCA 1XQ6A 2V6MA 3WIEA 4L9RA 4R5MA 3H9EO 3LC7O 3KXDA 4RPGA 3B1KA 3LC2O 3OFSA 3QWBA 1LSSA 1DLJA 2Y1OA 3INTA 1ZK1A 3I9KA 4JN6B 3V8BA 4CMEC 4HFJA 2O23A 3WLEA 5JFOA 1E6UA 2DTEA 1WLYA 5TJHA 1O5IA 1P0FA 1Y5MA 3HB4X 4RPKA 5GZ1A 3AU8A 1DXYA 2Q46A 1M6HA 3GHYA 4BGVA 3UUWA 7MDHA 3LSYA 4R01A 1ADBA 1JKIA 4OQYA 1T24A 4CR8A 1KVTA 1TVEA 4OSOA 3CH6A 3OA0A 4DC1A 4D45A 4BNZA 2W8ZA 2X5JO 3FF4A 4P4GA 1NHGA 1K3TA 5IZCC 2LDXA 5ILOA 3FBTA 1O8CA 1ZVMA 2DVMA 4QECA 1E3LA 1W6UA 5F3RA 4BNUA 1MLDA 1QRRA 1XA0A 3VPGA 1P1FA 2TMDA 4HX5A 5A9TA 4YAIA 1QSGA 3WWYA 4CMAA 3HFSA 1NFRA 5IN4A 3L4SO 3I23A 4J7UA 4NG5A 1T1RA 2ZIZA 4U0KA 2W4QA 3F3SA 4B7XA 3OJOA 4BQRA 5JS6A 5JDIA 1ADFA 1PZFA 1XWFA 3H7AA 3BIOA 5L95A 3F1KA 5G0TA 3E1KA 4HUJA 1P1IA 3S1LA 4Q3BA 1Y9EA 3HJAA 1BMDA 2C2XA 1IHXA 2CF6A 4J7XA 4XYLA 2WYWA 4WNCA 3KZVA 2P9EA 4QO8A 2CDAA 5I8ZA 2YJZA 5TNXA 1P1HA 1W8DA 4HNGA 5T5QA 1E77A 3QQPA 4O0LA 2F00A 4Q3DA 1EVZA 2B5VA 3W6ZA 4WUVA 1J0XO 2P9CA 3E5MA 4N5MA 5EERA 5KJ6A 1W73A 1CETA 2X8LA 2HCTA 2OL4A 2R2GA 4D3DA 3PHGA 3JQ8B 2VYVA 1LLCA 1VC2A 1X14A 4UVEA 1VKOA 5KKAA 1ULUA 2GF2A 3D0OA 3NT4A 1YL6A 4FPXA 5CDUA 1XKQA 1YDEA 3INRA 4FJ2A 2FP4A 4C7KA 1B3RA 1B8UA 4FGWA 3BTVA 4FW8A 4XGNA 2DC1A 3CZMA 3AM4A 5GZ3A 1K6IA 3C3XA 1P0CA 3CIFA 3K6JA 5CEJA 1ZCJA 4YYZA 5KOIA 1U28A 2SCUA 4U8GA 1OFGA 8ADHA 4IXWA 2IXBA 2YQ5A 4I1IA 2I99A 3QRWA 2AQKA 2NSDA 2W90A 3ZZNA 5FYDA 5HBRA 5CP8A 4XR4A 4IUYA 1BRMA 2NTNA 3CINA 3ZU3A 3UW3A 3HE3A 3ST7A 3H9JA 1GYRA 4MOWA 3EW7A 4W7IA 2PH3A 5IXYA 1GD1O 5GMOA 1J6UA 5L7WA 3WGYA 2NUAA 4UUPA 1JU9A 4XR9A 4YPOA 2PZMA 1ZEJA 3KYDA 4J4TA 4EI2A 2I3GA 1DO8A 3GN2A 2GUGA 3AWDA 1GUYA 2ZATA 2CNBA 4KWHA 4CLEA 4EZBA 2QZ9A 2DBZA 3IIEA 5B37A 2C07A 2JD1A 3I52A 2YDXA 3NAQA 4R51A 1EK6A 2VZ0A 1Y81A 3FPCA 2YW9A 4W6ZA 5IG2A 2QX7A 2RHCA 2OORA 3BXXA 1XG5A 1C0LA 3DOOA 1VE9A 2UYYA 2B4RO 3VZPA 3LT1A 1QYCA 1PGPA 1XGKA 1GZ6A 2FZEA 2CVOA 3Q2KA 5EMHA 1T2EA 4R9RA 2B69A 4ITUA 2HQ1A 4HWKA 2Q2WA 3JYLA 4EITA 1TLTA 3DZBA 4J43A 4MVJG 4JCOA 2O50A 5CDSA 3ZWBA 3ONEA 4OKNA 5IN5A 5AYVA 3VPXA 2HO5A 1H6CA 5KKCA 2OBNA 5ENVA 1EZ4A 1F17A 5DCYA 3QV1A 3FTPA 5K6AA 4BNFA 4OYRA 3JQ6A 1NVTA 1XYGA 4BGIA 2GGSA 2D8AA 4JBHA 5L40A 3NUGA 3WGTA 3U49A 5JCJD 4BNHA 4DIBA 3CEAA 4UEJA 2X9VA 1G0OA 1HZJA 3RVDA 2WWRA 4MVJI 1VPDA 3CMMA 3GZNB 3K31A 1E1LA 1PQUA 3TPCA 4GI2A 3TZ6A 3UKOA 1E6EA 1XU9A 2DUUA 2ZTUA 3OHSX 2DBQA 2EKQA 3MJ4A 4E2ZA 3PEFA 4B3IA 1U9JA 1XU7A 3GVXA 5L3ZA 2PTGA 3EGOA 3O8QA 1DAPA 2PNFA 3WS7A 4CQMA 4DMMA 4YTEA 4BNTA 4BO6A 3H9UA 4NK5A 4XJSA 1Y9AA 2CFCA 4DIFA 1YRLA 3EZYA 1VL8A 3PFFA 3GH3A 4URFA 4IIUA 4M55A 4GBJA 4KP7A 3GDGA 1P1JA 4PLPA 3DZIA 3RUAA 5J23A 1NX6A 4TROA 2VHYA 4DLAA 1IL0A 2I6TA 1E1KA 2DBVO 4PCVA 3E6AA 3GG9A 4XGKA 1GADO 2EERA 1VL6A 1PJ3A 4E2YA 4XRRA 2X5OA 4ND3A 2HK8A 1PZGA 2JCVA 4E5KA 2V6BA 2Q45A 4C4OA 1DJQA 3UCEA 3HDQA 5TGDA 4AICA 3G1UA 2J5QA 4F3YA 1PQWA 4KUGA 1DIAA 1HT0A 3AM5A 4I8XA 2UV8A 1MG5A 2X7HA 4BV9A 5A03A 3D3WA 2O4CA 1E1MA 1H6BA 3BYZA 1DJNA 4M1QA 3H4VA 3GVPA 3TFQA 1QMGA 1IYZA 5H81A 4BNKA 4XYEA 2FPPA 5JPIA 2IDZA 2VOJA 1O0SA 4FR5A 3GOHA 2P2SA 1A7AA 2POQX 1LDNA 2Y1FA 2G5CA 3RCBA 5JDIC 3ZWVA 1E1NA 4LCEA 3NTQA 4IGEA 3LF1A 2G1UA 4IQ8A 1LRKA 3L4BC 1Z74A 2GZ1A 1SEPA 2H5LA 5K6AC 1HLPA 2OUIA 1H2BA 3HB5X 2O3SA 1WWKA 3GFGA 2X22A 1RM4A 5BT9A 4GX5A 5JMWA 3HNPA 1EDOA 5JO0A 1B3BA 2NTJA 1KERA 4BO4A 3H3FA 1C1DB 1K5HA 4AJLA 2UAGA 1G1AA 4CV2A 1E3JA 4GQAA 3F46A 1DSSG 1TI7A 1SC6A 2J3JA 2J6IA 2W98A 4G65A 1Y6JA 1B26A 2XOXA 1GDHA 4CM3A 4E0BA 1YS4A 2Y1GA 1N7GA 4PZCA 3M2TA 3K5PA 2DQ4A 4G81A 3ROKA 5F1OA 5K0ZA 4YA6A 3H2SA 1MGOA 3TNLA 4AJPA 5AXCA 3DMTA 3L9XA 4OO3A 4ZD6A 5LC1A 3NT2A 3V1UA 4F6CA 4TWRA 1HETA 5CAEA 3O03A 3DTTA 2HKIA 3JV7A 2PKRA 4J1TA 4WCFC 1LC0A 1KVRA 4DYDA 4AVYA 1YBVA 3I9LA 3KEQA 1KIFA 4HADA 4AJHA 2VHXA 5A05A 5HTOA 4P4LA 2VZ8A 2HMWA 4A2CA 2TMGA 4NJMB 1XQ1A 4PIVA 3HUDA 5AOVA 1PGJA 1E7MA 1QYVA 3H8VA 3M1LA 3U5TA 2GN9A 1A4IA 1DFGA 1YKFA 1TT5A 2EKPA 3JQGB 5L51A 4HFMA 1XSEA 3BMNB 3I83A 3PWZA 3GNTA 1JQBA 4A26A 3FTNA 4MP3A 2D5CA 3D4PA 1HZZA 1YL5A 4M54A 4GKVA 1ISHA 5A5EA 2VUTA 1V0JA 1WXDA 1ONPA 4R41A 1GEGA 1BSVA 3PLNA 1DPGA 1HDGO 1S7CA 2V6GA 4QSMA 3ZWWA 1LSOA 4BGUA 4RVSA 1U3WA 2AXQA 2DBRA 3Q6IA 3Q2IA 1PJLA 2EJWA 3DO5A 2DUWA 2QW8A 3KLPX 4FJ1A 5DCUA 3TOXA 4RL6A 1YB5A 3HFGA 1E7QA 1UXGA 3W4IA 3QVWA 5IDXA 4UVHA 4ID9A 4NNJA 1YB4A 3F4BA 1DB3A 2JD2A 3DDNA 3OH8A 5ILGA 4JBGA 2DPGA 3S8MA 3F9IA 1ZW1A 1EVYA 4Y8VA 3W4KA 1DC3A 4YT8A 1ISMA 1ENOA 2GDZA 4BMVA 3DONA 2Q2QA 4GLLA 4L4XA 1N9GA 1Q2XA 1ZXBA 3EY4A 2IZ1A 3BA1A 4FBGA 4E32A 1GEEA 2EGHA 3FBGA 3G0OA 4ALKA 2OP1A 4A0SA 3DR3A 3KYDB 2B36A 2OP0A 3NJ8A 1WW8A 4BO9A 3RJ9A 1E0DA 4WJZA 1LSUA 2XPCA 5AVOA 4DLLA 5I8WA 2IE0A 1VLLA 2AQ8A 4MIYA 1SEVA 1Z45A 4YJGA 1GYQA 1DRWA 2GZ3A 3Q9NA 4IDEA 3DFZA 4ALMA 1EBFA 1TEHA 1QLJA 4ZHSA 2PKQO 5EQDA 3VKVA 6LDHA 1FDWA 3S2GA 4O1MA 3WJAA 4MDHA 5C5IA 2QRKA 1B2LA 1PR3A 2QQ5A 2NU6A 3ROQA 4R1NA 3HWRA 4CMIA 1I3NA 1CQJA 3JQAA 4JNKA 3IAHA 2P68A 1DRVA 1EK5A 3PYLA 4B4UA 1QORA 4ALNA 4Q39A 4J7CA 1ULSA 1H93A 3M2PA 2ZB3A 4JJIA 1ZK4A 1L7EA 3H5AA 2A94A 1NFQA 3U0BA 3B1JA 4FB5A 4AJ1A 3IUPA 2Y0CA 3UICA 3HHPA 1HE3A 4PLFA 4CM4A 2I3AA 5KJEA 2GD1O 4YRAA 5A02A 5MGBA 3ZU2A 4PLGA 1V3UA 1AXGA 2C29D 3GGPA 1GR0A 5DBIA 4D41A 2WYUA 4O5OA 1GYPA 3TN7A 1JAYA 3WTCA 2OHXA 2LDBA 3NJ4A 5CDGA 2PFGA 1H6AA 1GCUA 4PVCA 4JJGA 4PLHA 3C85A 1K6JA 1SBYA 4AJ4A 5BSEA 1NR7A 3AI3A 3RBVA 1NBOA 3F47A 1YJ8A 2JHFA 3RBXA 4OL9A 4BNWA 1QYDA 4N5NA 4XDZA 4WLNA 1E7SA 4CMBA 1CERA 3BMQB 4F45A 2I67A 1Y8RB 3V1YA 1I5RA 1PX0A 3WIDA 2VHWA 3VZSA 3UXYA 3S2FA 4DPLA 1UZNA 3UCFA 2CVZA 2ZYDA 1X7GA 4Q9NA 3RQSA 3TQHA 4NBVA 3RKUA 5JDCC 3DB2A 2FPGA 2UUOA 5G0SA 4OXYA 3GPIA 1I2BA 3LC1O 2NVWA 2EW8A 3OM9A 3LDHA 2OO5A 4BUCA 4CODB 4MVJA 3DBLA 3LT4A 3Q1LA 5FI3A 2DPHA 2VQ3A 2VYND 3WLFA 1E7WA 5JAIA 1NQTA 4CM8A 5C7LO 4JK3A 1MFPA 3NGLA 4OAQA 4ZQGA 3IP1A 1ZJYA 3PK0A 4MKZA 1PJSA 1IPEA 3FR7A 5A9SA 5I7SA 1MUUA 3GRKA 2HRBA 4DQXA 2GRAA 1U2DA 2Q2VA 4WLOA 4HFRA 2ZJ1A 4FS3A 1BVRA 1U5CA 1LI4A 4MKRA 4XJTA 4W4TA 3KSUA 3P2YA 4PZDA 4Z0TA 3AUSA 1UDCA 4E6PA 1U4SA 4J16A 2BFPA 3KEOA 5B4TA 3FWZA 1FK8A 2VYNA 2Y66A 4M49A 4FQ8A 4CQLB 2R6JA 1IPFA 3R6DA 3JYQA 4PFJA 4CLDA 3AW9A 3FRJA 3WFIA 1ZJZA 2AW5A 1GU7A 1R15A 2O3RA 1NQOA 2DTDA 4CR6A 4RDIA 4LN1A 3TRIA 4EUFA 2VUUA 3QLJA 3RC9A 2Q3EA 3SLGA 4RORA 3WXBA 2HJRA 1U8FO 3PVZA 4IDBA 1VSVA 4YJFB 4MP8A 4B4VA 3C1TA 5F1PA 3BMCA 5BSFA 3GF4A 2Q4BA 1RPNA 2C7GA 1JW9B 3KUXA 2AMFA 4BNYA 3ZNOA 5FFFA 3PJGA 1T2CA 2JCYA 1CRWG 4IINA 1Q7GA 3RUEA 3KSDO 3STHA 4INAA 3DTYA 2RBEA 3A28A 3U4CA 2X0RA 1LDEA 1LU9A 3VH1A 4YXFA 4DL9A 2PWZA 3WYBA 3DAGA 3I9JA 3GMDA 5CEFA 4WOJA 5DN9A 3L4BA 1B16A 3WSVA 1E7YA 3MEQA 1GZ4A 1HRDA 3JSAA 1JTVA 2HK7A 2PZJA 4NJOA 1EQUA 4OOEA 2PR2A 2HUNA 1B8PA 3KV3O 4PG4A 3ADOA 3RC2A 5B4VA 4ALIA 4GLOA 2QRJA 4BOYA 2C5AA 2EP7A 1ONOA 1P33A 2NU9A 2O48X 2WE7A 3E48A 3VPSA 1NHWA 1NYTA 1HDYA 2AEFA 4X54A 1LLUA 2UUPA 3OQBA 1EVIA 2Q1UA 3RROA 2PD3A 1YVEI 4E2WA 5KJFA 1NFFA 5EINA 1A9ZA 2VWHA 1KVQA 3A9WA 4IS3A 3AY7A 4I9UA 1RYEA 4MPDA 3W4JA 2YFQA 2Y1EA 1P3DA 3VH3A 4OM8A 3C1AA 3CKYA 4YQYA 3O4RA 5L4NA 2O7SA 4Y6RA 2ZTLA 4R3WA 5KWEA 4KMSA 1ML3A 1TT5B 4R16A 2VUSA 3JQGA 1R16A 4XRGA 2YFHA 3JD1A 3RKRA 1QR6A 3PHHA 1NASA 4B8WA 2D59A 2X6TA 1MG0A 1AE1A 5I9LA 1HDZA 1IE3A 3N58A 1A7KA 4RPHA 4NMHA 4YCAA 2X5KO 4E30A 3VPHA 5JSFA 4RGBA 1F12A 5TRTA 4CV1A 2BI8A 5L45A 4XX0A 4EGFA 3IJRA 4IMPA 3G17A 4EJ6A 1HSOA 1GZ3A 1I24A 2VNAA 1U8XX 3RUFA 4FJ0A 3HDYA 4LVCA 4FCCA 4FOSA 3DL2A 3PI7A 5JC1A 3S2IA 4YWJA 4ND2A 4AJKA 2BI7A 3DBHB 1C0IA 3GAFA 4JLWA 1IY8A 3OICA 1NVMB 2B37A 2I76A 1LLQA 2E48A 3P7MA 3UN1A 4BB6A 2B4QA 2W2KA 3B70A 2AQHA 2NWQA 4MVJP 4NDNE 4NIMA 4NU6A 3VKUA 2PY6A 2AE1A 1D8AA 5HS4A 1T2AA 2VRCA 1U3TA 4P4NA 4OH1A 1RKXA 4WCDA 5F5LA 3L6EA 3MOGA 5H83A 5G4LA 3PZBA 1V6AA 3DMTC 3ETDA 3WNQA 1IOLA 3WR5A 5IDQA 1HYEA 1D3AA 3JYOA 1HE5A 2WMDA 4OMUA 3ZHYA 1PJBA 4CL3A 3INGA 4K6CA 1J5PA 4WLEA 5DOZA 4R68A 3WQRA 1EUDA 3OMLA 4GMGA 3GMSA 3K2BA 1ZFNA 1PZEA 4CMJA 4JXKA 1J4AA 1R37A 4R1TA 1H6DA 2GERA 3ENNA 4FD3A 4UVDA 5KCZA 3ZNPA 3KVOA 5L9AA 2XXJA 4I5FA 3ZNNA 4CMIB 5C37A 3AOGA 1U1IA 2VHVA 4ZQEA 4IDGA 4Z3DA 1ISIA 3NDJA 2NQ8A 5DBFA 1PR9A 4CL8A 1ZSVA 3GT0A 3PJEA 1PWXA 2O2SA 5COQA 2IRWA 3IP3A 4HKTA 3CMCO 4J1NA 1NNUA 1E5LA 3ZH2A 2HLPA 1R0KA 1KOLA 2HSDA 1MA0A 5L4LA 1JWBB 1BWSA 4LSWA 1AN9A 4BKPA 3QWIA 4BL5A 5A5FA 2C82A 5G4KB 5JO9A 3KTDA 3TJRA 3C24A 3N74A 4RDHA 2WEKA 1PJ2A 1JWAB 3RIHA 4J1SA 4A5OA 1VL0A 4QFDA 2EGGA 2P4HX 4PLTA 2VWGA 4ZQBA 4Z0HO 4WEQA 1T1SA 5JAQA 5L4SA 3QHAA 4DQVA 2A4KA 2C7VA 3OBBA 3ZWYA 4OXNA 1H0KA 3RC7A 2E82A 1PL7A 4PGFA 4YT4A 4DTIA 4DC0A 4ALLA 2AQIA 1EBUA 2PK3A 1I36A 4FFNA 1LLDA 3E8XA 1RJWA 5G0UA 4LGVA 2C20A 2J3IA 5LDGA 4UUOA 4XZ3A 1BDMA 2ZCVA 4Q3AA 3T4XA 1CWUA 2CD9A 3Q11A 1SOVA 2DU8A 3PQFA 2AE2A 2PD4A 3C8MA 3WBBA 4KQWA 2PZLA 1EUCA 4HP8A 4E12A 2J8ZA 3WMWA 1BW9A 1D1SA 1X7DA 1BDBA 1EFKA 2Q1WA 2YHIB 3NDRA 1P45A 3PGXA 4W82A 4TKMA 3QWAA 4K28A 4QEDA 1NWCA 2EV9A 4PLCA 3DHEA 3N7UA 5JBIA 2D5AA 2ZTVA 5L53A 3LT2A 4YJHB 2FR1A 1S6YA 1CDOA 4LSMA 1NP3A 1C1DA 3QIVA 3L6DA 1SAYA 4MVJD 4QO7A 4D46A 3DXFA 1JVSA 3AY3A 4ND5A 1FDSA 1N7HA 1B8VA 4P38A 3ZU4A 2YV3A 4TVOA 1MB4A 3K96A 3H6KA 3ZWMA 3HADA 1XEAA 4EW6A 5U1PA 1D1TA 3O26A 4WASA 1B7GO 2J5KA 4FFPA 4PVDA 3ROPA 2X86A 1DEHA 3EK2A 4I5GA 1HDRA 3GDFA 3LVFO 4W9NC 4A10A 1A71A 4R3NA 5KTKA 3DHNA 1JA9A 4IJKA 1QV6A 2C2YA 4RVGA 4J49A 1UDBA 4HV4A 3C7AA 3IS3A 3PIIA 1F8FA 2PD6A 2Q4EA 1DC5A 2VRCD 3RI3A 4JP2A 2Q99A 4B7UA 5IZCA 1M75A 2J3HA 4IDDA 1WPQA 5DF1A 2DKNA 1JLLA 3D1LA 3AOEC 4II2A 1ZBQA 1T26A 1TXGA 1LNQA 5T6BA 4GWKA 2Z1NA 2DTXA 4J9VA 4WOKA 1WP4A 2JHGA 4IDAA 2B4TO 1WVGA 2EKLA 2BH9A 4L73A 2ZB4A 1VJ0A 5MDHA 3KYCB 4YR9A 2AHRA 3GG2A 3BMNA 1PJ4A 4ZQHA 5DBGA 1DAOA 4FDAA 4AJ2A 2C54A 5CEEA 2GNAA 1HLDA 1LDBA 4MVJH 3T7CA 1ISFA 3GZNA 1OAAA 3K92A 4BO3A 4TVBA 4OSPA 3WG9A 1NWHA 2ZK7A 4XIJA 5DULA 1I3MA 3MTGA 4AJNA 3GGOA 3PXXA 3D64A 1V8BA 3I9NA 1ENZA 2NVUA 1HF3A 4D42A 1U2GA 3AY6A 2VT2A 3F5SA 3OA2A 2HU2A 4KOAA 2EP5A 1ZMOA 3V5NA 2ZYGA 4ZRNA 4WK6A 4E33A 3VTFA 2O2YA 2BFMA 3FHLA 3JCZA 5C3MA 3ON5A 3WWZA 1GV0A 2ZJ0A 3PHIA 3ZV3A 3GN1A 3SVTA 5KVQA 1ARZA 3QVOA 3RSHA 4DIOA 1N9GB 4ND4A 4GH5A 4CLHA 1MXFA 1I32A 9LDBA 3LU1A 1WDMA 3Q3CA 3GNQA 4KTVE 3AJRA 4H3VA 2QRLA 4XKJA 1Q0QA 4NPCA 5G0VA 3V2HA 4BKQA 3LT0A 1PGOA 4A03A 3HN7A 4TKLA 1Y8RA 3E5RA 3ADPA 5I7FA 3TZKA 3LK7A 1PZHA 2RH4A 4LMRA 3S2EA 2WD7B 4XDYA 1QYWA 2YQ4A 1PU2A 2R00C 3CE6A 1G6KA 1E3EA 4IJVA 4YJGB 1AGNA 4L4SA 4C7JA 5DP1A 3DBRB 2DM6A 1YDWA 3ZNQA 2JKVA 1DBVO 4RVUA 2OZPA 3CUKA 4BV8A 2GN6A 4RPLA 2X23A 3AFNA 3DBLB 5JYEA 1QP8A 2H6EA 3I4CA 2Y0EA 3KLMX 3C7DB 3JQFC 3HQ4O 3Q9UA 1V35A 4PRKA 5JYDA 3JQDA 1HYGA 5B1YA 4WEOA 2YHUA 1B0AA 1R4NB 3CSDA 2P4QA 1V9LA 4OOFA 1NR1A 3PQDA 4Y6SA 2PKQP 3W6UA 4OXKA 3UF0A 2DFDA 5AXDA 5EQFA 4B79A 1UAYA 5TT1A 4CUKA 1XDWA 2B83A 3HSKA 3PP8A 1WZEA 1LQTA 2R00A 4CM4B 2NTVA 4U6SA 4L0QA 4LMPA 3DWFA 5JNLA 3G3EA 1NXQA 3E18A 4YBZA 3ZV5A 4E21A 3DHYA 3D7LA 3TWOA 2PLAA 3BMOB 1UZMA 2HDHA 1LSJA 4ZQFA 3CXRA 2WSBA 3A1NA 3PTZA 3B20A 5TJ9A 4HFNA 1PEDA 4CQLA 2FPIA 5EN4A 1R4MB 3JQFA 5BQFA 1LRLA 1UH5A 3ZWXA 3OIGA 3HZZA 3V1TC 3MTJA 4F6LA 4E13A 1LDYA 1TT7A 1MC5A 3NX4A 1Y1PA 3DOCA 2BELA 4IJUA 1JDJA 2G82A 3DZJA 4YVFA 1U7TA 4NQZA 4IY1A 4ZGWA 4U7WA 4CMHA 4GX0A 4J2HA 4A73A 5FWNA 1UP4A 5ES3A 1E7RA 3UOGA 5HA5A 1HWYA 1X7HA 5CFZA 3JQ7A 5DDIP 4D3SA 4B7CA 2BKAA 4B4WA 4TMFA 5CG2A 2Y1DA 3AU9A 5U4QA 3PHLA 4GMFA 4QFCA 1IZ9A 1NPYA 2IZZA 2NNLD 3WQSB 2VT3A 3OJ0A 3SC4A 4NFSA 3MZ0A 4XEHA 9LDTA 1ID1A 1KEVA 3E9MA 4EBFA 3ZWPA 5JMPA 2PGJA 5ITWA 5A9SB 3KYBA 1GCOA 4D0SA 3GHHA 3MJCA 4IJWA 4XYMA 3OJEA 4CJXA 3GC6A 4J6FA 3U4HA 1NAHA 1BXZA 3KM0A 1AUPA 1BHSA 3HG7A 4L74A 4PLWA 5DOVA 4BO2A 3RFXA 1X13A 3JTMA 2EF1A 4U6QA 1NPDA 1T4DA 3F1LA 3GRPA 3JQBC 4ZA2A 3EAGA 2ZYAA 3MJTA 2PA3A 3B6ZA 4LISA 4RLHA 4WLUA 5ENDA 2E4AA 1CEQA 2EW2A 4XB1A 1M76A 3L9WA 3VZRA 4XD2A 1EVJA 2C59A 3DC2A 3RBZA 4BO8A 4OGWA 3RU7A 3UFXA 3GUYA 3ZHZA 1UZLA 4EEZA 3PHJA 2OMEA 1V3TA 4YACA 1GQYA 3IUSA 4YJFA 4DPMA 1GQQA 1ADGA 2WE8A 4DMLA 1F14A 2E37A 1JKJA 1HE2A 3G49A 3OECA 4LCJA 2GZ2A 3BMCB 3KO8A 4BO7A 2ILTA 1CYDA 2FSSA 4CUZA 3K2EA 3GEMA 1U7HA 2VNSA 5ITVA 3BTOA 4GSLA 4RQTA 4BB5A 4O59O 2JD0A 1KC3A 2HMVA 3QWFA 2QYTA 4QXMA 3H5RA 1QLHA 4IQGA 1Q0HA 3TL2A 2H9IA 3KHUA 1PGQA 3FI9A 2NACA 4CPDA 2NU7A 1M6WA 4J1QA 1FXSA 4AJEA 5A4DA 4MJLA 4Q3EA 2E49A 3WGOA 2FRDA 4GWGA 2IYOA 1Z7EA 3OQ1A 1F06A 1R0SA 1Y7TA 2ZTMA 3R3SA 3ANLA 4JJFA 4BGEA 3I3OA 3MJVA 3DMYA 5TLSA 1IHYA 3VOSA 3QSGA 3WTBA 4PN3A 4R5HA 1OMOA 2YYYA 4IDFA 1C0KA 3SJ7A 4BO0A 5DT9A 4EJ0A 1YBAA 4M87A 2BD0A 1CF2O 2FR0A 1LX6A 4CLRA 5GZ6A 5IF3A 1UDAA 1IUKA 4ZICA 4U5QA 3PQEA 1ZK0A 3BMOA 4IS2A 5T57A 4E5YA 3ZWAA 4HBGA 1ZH8A 4CM9A 3AK4A 5BNFA 2QIOA 4I5DA 1PS8A 5A04A 3UHAA 2G76A 1OOEA 4GGPA 3C1OA 4BQPA 1FDVA 3FN4A 3I5MA 4I5EA 4LK3A 4TZTA 1B14A 1YJQA 1CQIA 3JQEA 3RC1A 2PGLA 1IZ0A 4DBVO 1LRJA 3HN2A 4BO5A 3GZ4A 2CY0A 5JAMA 3U4IA 2VTEA 4DVJA 1P74A 4EUHA 1LJ8A 1N5DA 4BNVA 1FMCA 3M6IA 4N7RA 3U09A 2NU8A 4PZEA 2O4UX 4MO2A 1P1RA 2Y68A 3OIFA 4JQCA 3WGIA 4RVHA 5JW6A 5CDTA 5DNAA 4CMCA 4PRLA 1EEHA 5I9MA 4XQGA 5DZSA 4KDEA 4IPTA 4Y6PA 2V6FA 1Q0LA 4CM8B 2D4AA 3LLSA 3PYXA 4JP3A 3VH2A 3EUWA 4YRDA 4DREA 3E9NA 3MCVA 2DT5A 3R0IA 3ZDFA 4YAGA 3H3JA 1P31A 4J0EA 4HY3A 2E6UX 4YDRA 2D1YA 3DBVO 2JL1A 1GL3A 2BRUA 3CTMA 2PH5A 3PGJA 1DHRA 5KVVA 1DHTA 3JD2A 5HS6A 1YONA 4N5LA 1UAGA 3EVNA 1VI2A 1HL3A 2OOSA 2YUTA 4Y98A 1E3SA 3ETGA 3L6OO 3RFTA 1HTBA 4EJMA 5LCXA 3EZLA 4BS9A 4EUEA 1P44A 3IOYA 3R3JA 3WYEA 2CDBA 4MP6A 1C14A 4WCFB 3IMFA 1KETA 3NKLA 5IFLA 1L7DA 1PQPA 3GUCA 2AEMA 3F5QA 4KQXA 4KUEA 1BXGA 4CR7A 4PG6A 1N1EA 3BHJA 4YQZA 2B35A 4DYVA 1HDXA 2O3JA 1P9LA 2Z5LA 5EL0A 1M67A 1NQAO 3MWDB 5JE8A 1Z7BA 2G17A 2Q1TA 5TC4A 1NQ5A 1ZZEA 2PZKA 3CZRA 4CM1A 2D2IA 3O8QB 1EE9A 1NVGA 1GQ2A 4IMRA 5TS3A 4TQGA 3TZHA 3ZWOA 4BVAA 2GCGA 3TL3A 2QG4A 2B0JA 5HRUA 3DEYX 4P8RA 4AJJA 1HDCA 2VRBA 2VWPA 5TF4A 1ZSNA 1V3VA 4JBIA 2Q50A 3WYCA 1B15A 3JD3A 4FC6A 2XF8A 2IXAA 2Q49A 1HDOA 1DLIA 4K26A 3WGZA 3EC7A 4CM7A 3ANNA 4II3A 3RJ5A 1NTOA 1E5QA 2DFVA 2ZQZA 3KB6A 2YZ7A 4RF2A 4XQ9A 3ZHBA 3PDJA 4NFHA 2V7PA 2VOEA 3PDUA 4Z9FA 4B4OA 3K8ZA 4GX2A 1RYDA 2RHRA 2X9GA 2HK9A 2GSDA 3PYMA 3ZW8A 1ZKMA 3OJFA 2RCYA 1DC4A 4IQ0A 3WDSA 4CLRB 3I9MA 1M66A 2P9GA 4GAEA 2CF5A 2Y05A 2GN8A 1L1FA 2WYVA 3BTSA 2BFOA 3JQ7B 3JQ9C 2I5PO 5JXWA 1YQGA 2NLOA 3U9LA 1GAEO 3ZGYA 3GVIA 3KBOA 1TA4A 4CMEA 2BF7A 5JCJA 4BNLA 3RUDA 5TSDA 1KVUA 4J9UE 3RU9A 4JIGA 4B8ZA 2WDZA 3JYNA 4IM7A 2FHSA 1LDGA 3TZQA 3JQ8A 4EEXA 5B4UA 2WM3A 3AUUA 3RUHA 4B3JA 4YJHA 2ZB8A 3WQQA 2I66A 3FR8A 3ZV4A 1KS9A 1H9AA 1J49A 7ADHA 4ND1A 4E3ZA 4FFLA 5A9RA 1RM0A 3KOUA 3DZFA 4UUMA 1ZEMA 3NDIA 1WZIA 1VM6A 3D4NA 4Y9DA 1PJCA 1A4UA 1XIVA 1X1TA 1XHLA 4A27A 1OI7A 1A5ZA 1ONNA 2Y0DA 1GTMA 2QZZA 2Z95A 1KC1A 3OQ6A 5THQA 4CLOB 4W7HA 4J90A 3ZCXA 3GAZA 1VKNA 2JAHA 5FEUA 3GDOA 5BNIA 4QX6A 5T8KC 1A9YA 1YGYA 3TSCA 1GV1A 3DBHA 3IL2A 3VAZA 1SB9A 3TF5A 1BGVA 3A06A 4J0FA 4H16A 3P2OA 4WLFA 3HDJA 3BMQA 3WOHA 4BMNA 1MC4A 3EYWA 1O89A 5I7EA 2DLDA 4OHUA 3ULKA 3D5QA 3F6YA 4E5NA 1AHIA 1OBFO 3JD4A 1DIRA 2B5WA 4UEKA 5JLAA 4DUPA 3OP4A 4AL4A 1Z73A 4K1LA 5COBA 3KETA 3PJFA 2EG9A 1T25A 2A92A 3PJDA 3QVXA 3S55A 5ICMA 3E9QA 4WGGA 2C5EA 2W2LA 4D43A 4KDFA 1YO6A 1RM5A 2HMTA 1O6ZA 1JVBA 3B1FA 3CPSA 1WNTA 4RF3A 2P5YA 1LXCA 3QE3A 4DLBA 3G1TA 4IZHA 1Q1NA 1U5AA 4QT0A 4XIYA 1MP0A 3SJUA 3E82A 4I9NA 1DRUA 3GPDG 4E5PA 4PG5A 1GUZA 1NM5A 3ZN2A 4Q3NA 4QTZA 4KZPA 2FOIA 2ET6A 5BSGA 3AUAA 4FFRA 2ZCUA 3PWKA 2FZWA 5IAAA 3W8FA 2IEDA 3U3XA 1TB4A 3WGGA 4AG3A 3UVEA 5ER6A 1I2ZA 3IC5A 2VN8A 4MVJM 4BNGA 4BNIA 3ZI0A 1WDKA 3H9GA 2IODA 1FDTA 1WMAA 4GPD1 4IIVA 5KJ1A 3PRJA 3H2ZA 4RCVA 1WDLA 4CM9D 3ZHXA 5A3VA 4DPKA 4E31A 2X0IA 3RD5A 2H1SA 3DQPA 3H9QA 3ZW9A 3AFMA 1PL6A 4XGIA 4GKBA 1R6DA 3I6QA 4P22A 4FFOA 4TRMA 1YWGO 3JQBA 4ZU3A 3ETEA 4YAEA 1I2CA 4YAKA 5KNLA 1T4BA 3WMXA 1XELA 3IKTA 3TDKA 1KEWA 1MFZA 1VJTA 1N1GA 3ABIA 2ZQYA 4G2NA 5IZ4A 2HJSA 4RVFA 4Z9XA 4NZ9A 4U0JA 4I08A 2GO1A 3OIDA 5T67A 4W99A 5FF9A 4EYEA 1UXHA 2VWQA 1YBMA 1ISJA 4O63O 1Q7BA 2VZ9A 2A9FA 1SPXA 4NBTA 1DC6A
chains in the Genus database with same CATH superfamily
2SKCA 2XNDD 1SOAA 3HJHA 2O07A 3NHYA 1GXSA 1Y4AE 2VPZA 1E69A 2WP8J 2YOHA 4EYGA 5E2IA 3K3PA 5IUKC 5KSYA 1ZO8A 3WL8A 4MW1A 3GFOA 2OAQ1 2LNDA 1ZA2A 3STYA 1OLSB 1NDHA 1MHTA 3CNLA 2CJYA 2UUCB 3P0HA 2JBWA 4RZQA 4KUHA 3FCSB 2QL6A 1E2KA 3MXOA 2HIHA 1RCTE 1PG5A 3PUJA 2J1LA 1PWHA 3PEUA 1GCGA 2XMPA 2V8BA 1IBMB 1U0HC 4MKXA 1KR5A 4TRNA 1L4KA 1PRYA 4JI7B 4H1HA 1I33A 4RK7A 1WAMA 2G06A 3T5GA 1UR5A 1Z37A 4LDAA 3UJBA 3R44A 4LW8A 3RGWS 2BFCA 1PLLA 2BM8A 1BVUA 2L0XA 1AKEA 1BHQ1 3GJ6A 4WBNA 1EIZA 2XTNA 5C51B 3DT6A 3ASZA 3KSZO 1YR2A 2RHHA 4QU0A 3WADA 4CETA 1K7EB 1Z2OX 1C8KA 3NV9A 4IV8A 4G23A 5A4FS 1TDJA 2Z08A 2E3JA 5G41A 4RKFA 3G79A 3ORYA 3ROMA 2WTXA 3CH4B 2W7TA 1JE0A 4YGYA 4X44A 1TD1A 3D59A 4GVLA 4XR9A 2HSWA 4IH9A 3SXPA 4GSYA 1VFPA 2YZGA 3OTWA 2FSVA 1GSIA 1EQ2A 4HGQA 3FKQA 2XYRA 3U39A 5K8CA 4HUQA 3QUCA 4DR1B 4ZVOA 4HDOB 5JOQA 3UMYA 2PMKA 3VR2D 4WNIA 3D6AA 1FP4B 3R3YA 4PYQA 3HKCB 2EFEB 1OC4A 3LQYA 3D8HA 3TOVA 4JI5B 1KGSA 5ABPA 1RJDA 4RA6A 3CR3C 2OFFA 2OBYA 5LOVF 1J70A 1W94A 3E35A 2QLTA 2YNMA 4G1MB 2DHRA 3WB9A 3SYRA 5BSWA 1K92A 5DCWA 5ARBA 1NJ5A 1G42A 2FN7A 3A14A 4HTAA 5D1NA 4YV2A 3U9SA 4S3MA 5LN1A 4AKHA 1K2WA 1T0UA 5K0CA 4D3FA 3OX3A 4UMDA 2NTYC 1C2YA 4Y67A 2C2WA 5DP2A 3R7LA 3ZK9A 3NAGA 3ANMA 3D7SA 1RS0A 4LZOA 2C94A 3F7NA 3N6VA 2D1RA 2VXCA 4KLCA 3LH5A 4JDUA 5CVDA 4EF5A 1AT1A 1QGDA 5F2KA 1ENPA 5IAOA 2F9FA 4DRYA 2FQXA 4FOLA 4DDMA 5KX5A 1D7OA 1KY4A 3KU4A 2J6BA 4P34A 5LD2C 1KH1A 1T9KA 1KYWA 1GKKA 1GY8A 2QIPA 4CV0A 5C32A 1YE3A 3CSUA 3GGSA 1DX9A 3L06A 4K0RA 2FFRA 2PRKA 5EJ2A 4LF7B 1IULA 1E8NA 3KFVA 1BTOA 3CRVA 5DBHX 4JU9A 1PFQA 4O4JF 1C81A 1TZMA 3IDQA 3TLGA 5DHRA 1U9YA 3NBAA 1RI3A 2WUDA 4NABA 4IKEA 4WKGA 2MSNA 3GJ4A 2Q3JA 4F5EA 1UPTA 4MB0A 4ZRMA 4ZK2A 3MGBA 5JU6A 2Z6UA 1ZX1A 1YJ5A 3DA8A 2DMRA 3QEMA 3TDNA 4DDHA 4F85A 1A2KC 4F86A 1VKRA 1K8YB 2FWMX 4D0RA 5E1BA 4DGSA 4DNFA 1HDIA 3QPCA 4OQLA 1G4HA 5CA0A 2R1TA 4GZ3A 3QP9A 4L6AA 3TRFA 3VUEA 1V1RA 2BWJA 4I6JA 3A58B 1G8MA 1M9NA 1XTRA 2CFSA 1IWPB 3GBVA 1ORDA 1JAXA 2IZ0A 1OLUB 2JC3A 1R8SA 2IOHA 2HDWA 3GJQA 1GQRA 3TEFA 3DZGA 3UUGA 3KQKA 3FPLA 4N3GA 2J9FB 3L07A 2AS0A 4CKWA 1OKKA 1T4CB 2NYVA 2JAPA 3ABSB 1GA6A 3IPLA 5DNEA 5CG1A 1W5TA 2I1VB 1P7YA 5F5NA 3Q7EA 2W22A 3SF8A 4DLZA 1NQWA 3LWNA 3GLHE 1B6RA 4RVDA 1VE1A 5CVVA 4FC7A 3UUEA 1JQKA 1LA2A 1ZK2A 1Z08A 2C2KA 4A15A 5I7OA 4K2AA 1PYDA 3RIGA 3RRBA 1PJTA 4BNNA 1GKYA 1AQYA 1C3EA 1KEPA 2YV2A 3LZCA 1DGQA 1NUTA 5EHQA 2OAEA 2PBLA 4PSCA 5JY1A 3U7FB 5AM1A 1GPLA 1SIWA 4L75A 3KB8A 1E92A 4P93A 3TCXB 1CUAA 2YHBA 3IOCA 1GUBA 4TLCA 5ALKA 1Y6QA 1E5DA 3DFFA 3BZBA 3WBFA 4JUCA 5FI0B 5JFTA 3A0RB 1NAIA 3H83A 1DCMA 1GSHA 1KXZA 4R4JA 3ROXA 4P7GA 1TEXA 3VHRA 5JD4A 4KLRA 5BWNA 4CT5A 3DEIA 1TUEA 1TTHA 5EJ9A 2QMZA 3HLYA 5LSAA 3W5DA 1KEUA 1TZCA 2BDUA 2GAIA 2IEBA 4P82A 1KYQA 2VF2A 4RQUA 2WJPA 3HUEA 4CCYA 5HUHA 5JSQA 4MUJA 1PCXA 4Z4GA 2F8TA 4TRRA 4M7OA 3DOUA 3BL5A 2H4HA 2FFJA 3KFLA 3HN6A 3Q3JB 2OFPA 2WC1A 1GTJ1 3FNGA 4HVCA 3VDQA 3SE7A 1P2SA 4ZJUA 3OIYA 2OXEA 1JLRA 2VH2A 2OCIA 3TM4A 1UIMA 1C7RA 1E3IA 4EEKA 3CU5A 3D3WB 3QFRA 2I7CA 5J2TF 1XMXA 2HMUA 3N0VA 3S2ZA 5JROA 3KHSA 1BQEA 3H9CA 4FN5A 4BLSA 3E22B 3MOIA 3OU7A 3MT0A 4NAUA 3O93A 1XOIA 3LP6A 3ZWCA 5JYBA 3L7JA 4AK9A 4JROA 2I71A 3UH1A 3AHIA 3VPFA 5AVVA 2A59A 1EVLA 3OEHD 4MRMB 3D4OA 1USVA 4BHTA 1C3LA 1RRFA 3EVZA 3W5SA 1U99A 3C39A 2QM8A 1KFEB 4HDCA 4KQMA 1CQJB 4CKZA 1NMQA 1OAOC 3JVDA 3LWBA 5IKOA 4WVLA 1QZXA 5CVTA 1VIDA 5JC8A 2LVBA 1ZSYA 1ZJWA 4KIJA 3JALA 1N6HA 1M34B 4R98A 4N9QA 4RQAA 2IYFA 1YQWA 5CCBA 2HUPA 1QU2A 2QTMA 1ZI9A 1VMDA 5BR7A 1P77A 3R1IA 3UCXA 5ADUS 3AJ8A 2IPNA 2R8ZA 3T06B 5LXTB 1R9GA 4DCVA 3U6KA 2D3TA 1AKQA 1T8PA 4GSKA 4NZZA 4B5LA 3LQFA 3R3HA 3OT1B 2NPFA 1JVNA 2IYRA 5BSVA 2HRZA 4C3ZA 3A2MA 1COWA 4GR4A 3VYTB 3BRWD 1RYZA 5EEHA 1Q3HA 4GICA 4JR0A 4RV9A 4YT5A 3IRUA 1RHKA 4R9SA 1MGPA 3TQRA 4CEJA 1SR8A 4PG7A 1V37A 3GWGA 3EVEA 3ITDA 4UREA 3T9AA 1E4EB 2QRHA 1V1JA 5CH3A 2GCEA 5F9FA 3TFOA 2F3UA 3PU6A 3FNQA 4ZZ0A 2HIMA 3ZZ0A 4QLOA 3OZWA 4QJBA 5AKIA 4ZZ1A 3GFBA 1TGYA 2EU8A 2RHOA 5DIZA 4U8HA 5ILQA 5BYBA 4X7RA 3P5SA 4TSKA 4CKBB 3PXGA 3CLRC 2EFCB 2VDLB 1U4OA 2ZE7A 4E09A 5AVYA 4WFQA 5ALUA 3HH8A 5K8JB 1BEZA 5HUQA 5CX1B 1GDDA 2FPGB 3ERCA 1XCMA 1MO4A 1YMUA 3TOZA 2ODNA 3A4VA 2QS9A 2XB6A 2E1PA 2GN4A 5A3JA 3QW2A 5D2CA 3OO1A 4W9RA 1RU3A 3COYA 1EMDA 2HTEA 2NO4A 5JUWA 4GGOA 2VPYA 4G41A 1G5IA 1PR6A 1PT7A 1OILA 4HXYA 4MDFA 4H59A 1Y6RA 3QVTA 3SZRA 5JAUA 3W77A 2F59A 3V8VA 2B2CA 1GN8A 2JIZD 3TJMA 4X60A 4BIIA 2AZTA 1LDMA 2PH1A 5JNWA 5U9CA 4YP0A 2GLXA 3DV0B 1WVIA 2RGUA 4W1RA 4HDAA 5FOXA 3OEWA 4QU5A 4L76A 3IP8A 2V7QA 1WABA 2D1FA 2QORA 1X0VA 2A57A 5B7GA 3L7OA 3K4QA 1D2RA 2GCOA 5IT5A 1SQ6A 3Q1KA 5ESWA 1YASA 4LHEA 2B1GA 5LYJF 4TZ0A 3KFXA 5KB3A 5BSUA 1U2ZA 4QOGA 1XAJA 2QU8A 3PDCA 5J47A 4Z53A 3RTGA 3K73O 1KAOA 2QTLA 4H15A 2VJNA 1WSBA 3E9ZA 2PX0A 1G4UR 4LAFA 4GL4A 1SMKA 1EG7A 3ASVA 3R9XA 3LHIA 5C0OE 3VTKA 5L3VA 2CSUA 2NUTA 3GA0A 4TUYB 4NF2A 4KPFC 4AUMA 2P4SA 2XE7A 5FBVB 5BMOA 2XUDA 4N8EA 1D2CA 1ZM4A 5BNZA 5DTJA 1PIWA 3SHFA 2X0DA 5B53A 4M1OA 2NO9A 4WADA 4KYVA 3FCOA 3VTZA 3N0RA 4YMUA 2RHGB 3IKMB 4RD3A 1Q7CA 2OILA 4IIXA 4XAQA 5AXBA 1MOSA 2R9VA 4C7OB 4JJKA 5EIHA 3WJ7A 1BG6A 3I9OA 3I0NA 4HNAA 4Q93A 5IT4A 3GLGB 4NKRA 1YKGA 4KIGA 2C96A 5IJ9A 3A3NA 3ZDCA 1SUFA 4CG2A 1A9RA 1Y1QA 5EIEA 1L8AA 3ZE6A 2QXUA 4ZOLB 2BVNA 2WHPB 4U7JA 3ZGZA 3ETCA 3N39C 1JQDA 1MOQA 3A2NA 4UVIA 4TRJA 1IK4A 1M1ZA 5IJZA 1VG0B 3H4TA 1UPUA 4L8VA 4JU8A 5DGIA 4YCLA 4AY3A 4X7BA 3BS4A 3IILA 1C29B 3UTDA 1G7RA 3W8RA 2V5VA 4E5MA 1KO7A 3DGEC 3EDYA 3I0ZA 3SDBA 2XDQB 1EK0A 4BN0A 1C1YA 1M0SA 5FTWA 1J7JA 1T2FA 2A9VA 2CHQA 2ILVA 3DBRA 3HP1A 3NALA 4RW0A 4X45A 5GPBA 5TT0A 2WF5A 1XZCA 2IEZA 2IUTA 3BAZA 4DLSA 4FBLA 5EXEA 3HKDB 2WF7A 1XMPA 1XF1A 1NRWA 2BHSA 1ORIA 1SKUA 3IBCA 4BNJA 2VJMB 4HWPA 1MX3A 4GPZA 4C22A 2OQ2A 1UKAA 3EVTA 1KPGA 3SZLA 5EE1A 1Y33E 3DT9A 3NIWA 4AJIA 2F1KA 4DHEA 1I3KA 2H63A 2YWDA 1JFVA 2BHNA 3MCWA 2G1JA 5FOQA 5JVDF 3A2KA 3BCSA 2XUGA 4WKNA 3FDZB 3DV2A 8LDHA 5A6VA 4AFNA 4L3WA 4D79A 1GFSA 3U7JA 4J3JA 4Z7JA 1XTIA 2YMQA 2LKCA 4ARUA 1M1NA 5A5DA 2ODAA 4BVBA 1F1BA 4YJDA 1DJLA 3JYPA 1HXHA 4H7PA 4IXTA 4QDUA 4C0XA 4M89A 5MF6A 2PQMA 2QL5A 3EEOA 2DQZA 2VHZA 2X2EA 3H65A 1H2AS 1QAOA 3DTVD 4EB0A 4DBZA 2ZBRA 2OV4A 3WFJA 3W6NA 5G4KA 4DMUB 5EVCA 2A30A 1EYZA 1NRIA 1GUDA 4FUQA 5ALXA 4C4PA 2XI4A 3N2GA 2LGJA 3GLRA 4RXUA 4TKUA 3BRWA 4MS3A 4X71A 2IOQA 1N3BA 3LKDA 3KRTA 4X1KB 1QX4A 3NHZA 4HDMA 3VMFA 3I6IA 4PG8A 3WWCA 3VR5H 1JEJA 1YIOA 1T3TA 4J1TC 2C04A 4CL2A 2WT4A 2JAUA 3EMKA 1YVRA 2YWXA 1T5SA 1W19A 3AETB 2CK3D 3HYCA 4Z0PA 1B8OA 5D7NA 4MWTA 2YXNA 4DLRA 4PLVA 3X1JA 1OR8A 4C5AA 5FX2A 1ZMTA 2QY6A 2CD7A 2CNOA 2LCIA 4MB6A 4GVXA 3VQTA 1KAQA 1F4PA 2BGJA 1NF3A 3IX7A 1A2BA 2HR1A 4CYMA 3OSUA 4MQFB 2ID7A 1R5NA 4ETMA 1XMOB 3UJCA 4LVUA 5AHKA 1NBWB 2ATCA 4MQ6A 3L7CA 3OQMA 3I2YX 1QC5B 1QIFA 1TJ3A 1V26A 3SJBA 2V6MA 3LBIA 4DA4A 2ZUDA 1Z5NA 4R5MA 5EPEA 2AFIB 1E9VA 1E1YA 1Y3FE 2C88A 2QTHA 1Z5PA 3WJ2A 2P9YA 3LP8A 3LXXA 3DLPX 3B1KA 5EUCA 5EZYF 3A4NA 1AMOA 2RAVA 4TV9B 1B6GA 3W06A 3CRQA 3NHFA 4AT1A 3HABA 3OFSA 5FNVA 4RD6A 4D99A 1PW7A 2GEKA 5JJIA 1E1DA 1YZHA 1DLJA 2PGAA 3OEED 3INTA 3HP7A 3KUCA 3R7FA 4DXDA 4OX9Y 2Q9BA 2G83A 3QX8A 3I8OA 3I9KA 4JN6B 4HX9A 3THYB 2BP7A 1LX7A 1AKMA 2WLTA 4KNYA 2GCOB 1WLYA 1CUUA 2FCAA 3G2IA 1NVAA 3B1YA 1O54A 3A10A 1MQAA 3AU8A 4MW4A 4LYHA 2E4YA 3BICA 1N2ZA 1NW4A 1PEYA 3R0JA 5HILA 4XIFA 1M6HA 2PLFA 2IS1A 4AM8A 2QE6A 4Z4EA 4R01A 1GR1A 1JKIA 3QENA 3U4GA 4FEEA 2R62A 3AV3A 3H2IA 3TMAA 2VDWA 4BX2A 5KNDD 4D45A 5LYJA 2J08A 4CTKA 2ZITA 3RVNA 3B13B 2CC2A 4HAZA 4P4GA 1K3TA 1NHGA 4GHWA 4E07A 3FOBA 4F3RA 2IIBA 3FBTA 5M3BA 1ZVMA 1EFDN 3R5TA 1E3LA 1W6UA 3SM3A 1MLDA 1XA0A 3L8ZA 4K40A 4C21A 4A36A 4HX5A 5E6SB 2XE8A 2CLFB 3HYNA 1UK6A 1X8LA 2AEEA 1QSGA 2X7XA 4BWFB 1QQ5A 1NUSA 1Z8HA 1NFRA 1JLSA 1TCAA 4NEHB 1SXHA 1HG1A 4AKIA 4XCXA 1GITA 2ERXA 2Q3BA 4BGDA 5JDIA 4LJ6A 3ZJTA 2IX3A 2QVCA 3AP3A 4BO2A 1XI2A 3BKXA 3F1KA 4I46A 1HFKA 2PLNA 2IW1A 2WU0A 4KXUA 4RC9A 5DGCA 1P1IA 1JPNA 5KU7A 1CUHA 4Q3BA 2AN4A 1WQ3A 4G0NA 2C2XA 2GJKA 2VS1A 4P31A 4QUDA 1MZPA 5KTTA 2PKEA 4XYLA 1W87A 4TTSA 4OHXA 2F43A 2P9EA 1QTIA 2CDAA 2EHJA 1JHVA 4H2DA 5TNXA 5AJXA 1GNVA 2VAWA 2WK1A 5HSGA 3GD5A 4O0LA 2JARA 2W2VA 3I2GA 2FVXA 1XNHA 2PCJA 2F00A 5EYPB 1YT5A 5FHQA 3U4AA 2C77A 4WUVA 4V0LA 1PUIA 1YD7A 3T1VA 2WHQA 4MWOA 3ZDRA 2YWJA 3D6FA 1IJKA 2J85A 2X8LA 2OL4A 4Q9DA 3WMFA 1XLWA 2ZIGA 1P5FA 2DHEA 3NVAA 4DB2A 4PBRA 2K7FA 2C5FA 4UVEA 2GEJA 1ULUA 2GEFA 1OBHA 3D0OA 4MLDA 4X6UA 4C29A 5FKJA 5CDUA 5KQSA 3PR3A 4C4SA 4FJ2A 4V03A 3R40A 3LW8A 3MMZA 4IF4A 3H9BA 2VQ6A 1EFCA 3BTVA 1E98A 4FW8A 2OENG 2BMWA 2Q6LA 2DC1A 2X1MA 3CZMA 4X1YA 4M9XA 4BP3A 3C3XA 4KGZA 2HA6A 3TH5A 4E1BA 3ESRA 4ZAZA 4U8GA 1EFRD 1JU4A 1O9GA 1RKVA 2ZUBA 4IXWA 2IXBA 4B3CA 3D5EA 3G6KA 1KEEB 2PS1A 4KQJA 4NESA 3HV2A 3QRWA 1DV1A 4NPHA 4WQMA 1S0UA 5FFMA 2NSDA 3U3MA 3QVMA 1CUBA 4EFLA 3U16A 5CLLA 5HBRA 5CP8A 2RH9B 4XR4A 2VUHB 4A0GA 2NTNA 3TCKA 2ZI5A 4ARZB 1TPZA 1ZUIA 2RGAA 1EG2A 3NBFA 2ZETA 3KV1A 4FILA 1CTQA 4FGJA 4NNOA 4NEGA 1P4JA 4CEIB 4GZLA 1XE3A 2YHSA 4IXMA 2HM7A 1ZD2P 2P3OA 2V7UA 5F3WB 2NZ2A 4A0FA 2WNSA 4PC7A 4QBHA 2CBZA 1JU9A 2HQBA 2AYYA 1ZEJA 2PZMA 1ZN2A 2QQFA 1V96A 2E5FA 4J4TA 1OU4A 1Z3CA 3VC1A 1CJUC 3DD1A 1DO8A 3GN2A 5LKRA 1SVWA 3SPXA 1DWQA 3K9HA 2I6QA 2YASA 1DC7A 4ND8A 4S1NA 4TS1A 3QPAA 4XX0B 4EZBA 1SBTA 2C9OA 2NMVA 4J6EA 3R8XA 2ZTHA 2RGRA 1BMFD 2YDXA 3LCJA 3SK0A 4R51A 3VDXA 4RD4A 3B7GA 3SCZA 3CF0A 1Y81A 4EB3A 1EDEA 5JNUA 1ZLYA 4QUAA 4ZVQA 4QOSA 2RHCA 1N6PA 6REQA 1XG5A 4UM5A 4FGLA 2OKGA 3M5PA 5C8YB 4NYIQ 4YXWA 1VE9A 2UYYA 3VZPA 5CJPA 1PGPA 3BSFA 4KPYA 1A5SB 1ATIA 2PWAA 4NEQA 1CDDA 1ZVQA 2CVOA 5DHQA 1Z2PX 3Q2KA 1JDVA 1IIBA 1A9SA 4R9RA 3VI4B 5CXUA 4TQ9A 2HQ1A 4TKZA 1Z4JA 4PWZA 4EITA 1BS2A 3C3CA 4J43A 3LVRE 5JASA 5EHGA 3E7FA 2GA8A 1TKBA 2GNPA 3IO3A 1L7NA 3LS2A 4BZZA 3ORQA 1N57A 3FMPB 5HW0A 1QQBA 1QIIA 4OKNA 1PSWA 4X8MA 2GRUA 4QAJA 3KIPA 2H1WA 3I9V1 4QA9A 3TAUA 2PGXA 2ZE6A 4ADSG 4BNFA 2AOTB 5HFNA 2X3UA 4ZJPA 2ZJ8A 2WPDD 1RTTA 1WOMA 1BA3A 1XYGA 2YWHA 1YA8A 4AZ0B 3SNHA 1KK0A 4QUHA 2AV6A 5L40A 3NUGA 2FLKA 4U9IS 1N2BA 1N2HA 4EK9A 2BFFA 5JCJD 2RHJA 4Z1MA 5KYWA 4NLLA 1CP2A 4BNHA 4DSZA 5A4AA 2JH9A 4PZUA 2J9GA 2YS6A 3BE6A 3PUVA 3TLMA 4DT1A 4WY5A 1HZJA 3RVDA 2ODQA 2QJTA 3OC0A 5JCPA 3S5JA 5TQ0B 3QM1A 2HX1A 3HUFA 3W9UA 4H31A 4BQIA 3R8FA 2ZTUA 3AVVA 2BFBA 1OXBB 4CI9A 1PEKE 4O5AA 2G80A 1U9JA 4OVKA 2G25A 4B46A 3L5OA 5F9MA 4BP1A 2PTGA 3ABQB 2J41A 4S0ZA 3OZSA 2CEAA 5J4HA 1N6NA 2OO5C 1GSOA 2C83A 2XYPA 2IOYA 5ICSA 2AMLA 2CNWA 4OL0A 4BNTA 4CT0A 3RG2A 1J1IA 3GLIB 3CSSA 3HCRA 1YRLA 1N5JA 3B3QA 4JKIA 1IUPA 1TM5E 2NG1A 3WB1A 5C9ZA 1J2JA 1N5LA 2RHWA 4P2GA 4M55A 5ELLA 4K6OA 3GDGA 4PLPA 2F17A 3PFIA 4DCUA 5ESXA 5C4GB 1NX6A 4TROA 4W8HA 2C3PA 3RVKA 4YJ2A 5HF8A 1XCJA 2B7LA 2LW7A 3TQCA 5EWLA 2P6UA 2VHCA 1IPHA 2DQYA 2AZMA 1G21A 5LZ2A 5ALHA 2C00A 1PJAA 2G36A 4DTCA 4N5IX 4M0MA 4INPA 1PZGA 1J2UA 3FSGD 4O1HA 1DQPA 2V6BA 5EP4A 2Q45A 2ZWIA 3VVMA 3PICA 1J90A 1DJQA 3DF7A 5TGDA 3U17A 4PO9A 3ESBA 3GUZA 4G1EB 2WAYA 1C9EA 2IL1A 4ZO8A 4BPRA 4F3YA 5LU8A 1JG3A 4I8XA 2BMFA 4YP6A 2X7HA 2H4XA 4A6PA 1YQQA 5A4JA 2O2DA 2O4CA 1YRWA 2IY8A 1CNEA 1DJNA 3A1VA 3BYZA 4M1QA 4TWZA 3AERB 3Q7IA 1XX6A 4I1YA 3TFQA 1QMGA 3BWEA 3TIVA 4BNKA 4LQCA 1C8VB 5JXJA 4UJ3A 3L8HA 4XYEA 4TT3D 1XP8A 3MCZA 2FPPA 3DOFA 2IDZA 5ALYA 3V6MA 1DT5A 5AJVB 2WTUA 1HI9A 1G8SA 1OFUA 3P2JA 4RIFA 1DKLA 2M6SA 1N3LA 4PEVA 1AS3A 4JJAA 3RCBA 3ZWVA 4DVGA 5JDIC 2O8EA 4LCEA 4F92B 1LW6E 4TTJA 5CU7A 1BCSB 3PA6A 1Z74A 2YXLA 2GZ1A 1B23P 2Z6VA 2DPMA 4Z4IA 4YUAA 2OUIA 4LGMA 3EQ9A 2FA9A 3HB5X 5LB4A 5AVTA 3BJMA 1H2YA 2D4HA 3U40A 1G3UA 3M49A 1P7WA 1KY2A 3OZCA 1BOFA 3BKWA 5IARA 1KSGA 1KERA 2RJOA 1KJJA 2YIVX 1TM4E 2B9VA 3A26A 4B6QA 4EB6B 3GAAA 3H19A 1DVRA 5CLIA 2H17A 4BNDB 3EA0A 4YRCA 2JDIA 1E3JA 1GFWA 1QH0A 1Y8AA 1DXQA 1J1ZA 3F46A 3Q10A 4Q6BA 3GLTA 1W36D 1SC6A 1G2OA 4NC9A 1OX5A 2J6IA 3NJRA 2WMNB 1EINA 3FWKA 4DA0A 1CX9B 1GCAA 2C2BA 2PBRA 4JJ7A 1NI4B 2Y2UA 4CM3A 4E0BA 1EHCA 3FVWA 1KMMA 1FUIA 1Z0UA 3R0QA 1RT9A 1C4XA 4DW8A 1R5BA 3H75A 2ZR7A 3KLOA 1A0OA 4G81A 5F1OA 4BVGA 3IV6A 5IHXA 5GM1A 5A4MS 4UPEA 4N48A 3TNLA 2NAPA 2CLCX 1CZNA 4RCYA 1D2NA 2WFMA 3TW8B 1UC4B 4GOXA 5KTNA 1CUWA 3HZHA 4TWRA 1NBMD 4MWBA 1XO1A 1VBMA 2FUG6 3A9SA 4S2UA 4FOTA 3TR5A 2ZSUA 3RF7A 2ZPUA 1P17A 3JV7A 1XTQA 3GBPA 4WCFC 2D13A 3OP1A 2A0YA 4ZOLF 4L9WA 3I9LA 2GBLC 4F9EA 3K6SB 5GGXA 4EZIA 4HADA 4AJHA 2F62A 4H6XA 4P4LA 5FT9A 3SEAA 3ZY3A 5CIWA 1J0EA 2TMGA 4YLGA 4KAJA 4NJMB 5T41A 1Y9ZA 1N8TA 2BFFB 4NOMA 5AOVA 3MERA 3H8VA 2Z3WA 1QTNA 3DL7A 2GN9A 1A4IA 3EXHB 4EHNA 2PX4A 2C7RA 2OD7A 2EKPA 3JQGB 2I7VA 2FE4A 1P0IA 2P1RA 4UTVA 1J9EA 4LWZA 3MGGA 2QSYA 2JG3A 3R3ZA 1KR2A 5HZHA 4II7A 4XUGB 4D4HA 5J4VA 4A26A 3FTNA 4MP3A 4UDXX 1K98A 1OIVA 4PWYA 2XCOA 3OQPA 4L07A 4MGEA 4ZFNA 2E18A 2WWGA 1JJVA 3IEUA 1GOTA 1V0JA 3VC2A 2XLBA 3EXG1 3SI7A 3O8LA 2EAUA 1HDGO 5AJUA 4F4CA 2QG9A 2V6GA 3ZWWA 4BGUA 4PM4A 3WHKA 5IFLA 1IOVA 1M54A 4L2IB 1DEAA 1U3WA 1TUGA 3DDHA 4RVSA 2AXQA 4H3HB 3UOAB 5CIYA 1JDUA 1PJLA 3ZI4A 1QCYA 2EJWA 3DO5A 2D54A 2UVPA 2Z8XA 1DBSA 2DUWA 3EA4A 3HGQA 2GJAA 1TO6A 4IWYA 3TOXA 4KBFA 3U4QA 3HFGA 3AFGA 3W4IA 1UXGA 5IDXA 4UVHA 4ID9A 4NNJA 3A9RA 3N76A 1VKHA 3ESQA 3H8WA 3IKJA 3VSEA 3S8MA 3K72B 4EECA 1U7XA 3DZCA 3F9IA 2FNAA 1M7BA 1MABB 2BKEA 4JP1A 2IZ6A 3AF4A 3R74A 1P4AA 3SE0A 3W4KA 4YUZA 5BOSB 4RTKA 1E9RA 1ENOA 2Z43A 3R4VA 1YS7A 4L6IA 4MYRA 2CNLA 1WHTA 3AIIA 4J0GA 4R6XA 3U80A 4LOAA 421PA 4BMXA 1XZAA 4JA0A 2ZE5A 4IQ4A 1LFAA 3CVUA 3EY4A 1U5BB 3EIEA 5FUXA 3DWIA 4ENSA 5C3UA 2P8SA 4LOIA 2NUAB 5TE9A 3DR3A 3AUKA 4A0SA 2D5IA 1SXJD 1EX1A 4TLEA 5EZQA 5F76A 2HA3A 3RJ9A 3URKA 1GGVA 4WJZA 7AT1A 2FJ0A 2XPCA 1UJ5A 3MBKA 1SHTX 1YJAA 1VLLA 4ZXFA 3BQMB 3F97A 2UKDA 4EA9A 4EX6A 1GA4A 1Z45A 2A0KA 1L4FA 3KOZA 5AQEA 3RFFA 4JNCA 3SSMA 4YRSA 4M22A 4IDEA 2YXDA 3DFZA 4ALMA 1TEHA 4KPUA 1XAIA 3ITNA 6LDHA 4JY7A 4Y2GA 1R9MA 4EFKA 3V8MA 3VBCA 3BFXA 3ADDA 3S2GA 4O1MA 3MUEA 3BC1A 4O4HF 1L3CA 1EP1B 2QRKA 4EMTA 5REQA 5LBUA 1B2LA 3L7DA 3S27A 1EHYA 4GGMX 1DS6A 4JSTA 1BCSA 3PI6A 4EOGA 1QGOA 2R3SA 3F4KA 3PNPA 3HMKA 4F2HA 4NYJQ 4C20A 4CMIA 1M8JA 3VOBA 3IAHA 2P68A 1E2LA 1EK5A 4IJQA 2XH8A 2MDTA 3T7AA 1X19A 4J7CA 4OJTA 1ULSA 3DXXA 4RD1A 2YX1A 5DM4A 2ZB3A 1J2TA 1FNNA 1QNFA 4PTZA 3RT9A 4AJ1A 1PV2A 3HA5A 2Y0CA 5JNVA 4ER7A 1HE3A 7YASA 3KT6A 4MVCA 4CM4A 2P6PA 2FN3A 2V7XA 3DVRX 3H0KA 4LTMA 4PYNA 5TPWB 5FA6A 5MGBA 3A05A 5MHTA 1FLDA 1V3UA 4S1WA 4KSYA 1AXGA 2C29D 2OHJA 1GR0A 3O4IA 5C4IA 1SC3A 1XNQB 2WYUA 3TN7A 2G3YA 5C18A 1ZJ6A 2OHXA 2WKPA 1TQ2A 3D8RA 1RHUA 3EUAA 2NO7A 2JAWA 1KO8A 2R8OA 2FX3A 4PVCA 3CLHA 5HMMA 4AY2A 1SBYA 5BSEA 3DDOA 4BFLA 1NR7A 4PQEA 3K9CA 3ONWA 1CVIA 3RBVA 3F47A 1PDOA 2JHFA 3MA0A 3REQB 4OL9A 4YRGA 1QYDA 3PGVA 1QGUB 4N5NA 4WLNA 4OHMA 5LUBA 2JBAB 1E7SA 3V8QA 3BMQB 2ZZMA 2CLIB 3ZR4B 2I67A 1Y8RB 3FTCA 3SQWA 3ADKA 3MB5A 1RAHA 2A2ZA 1S1CA 3VZSA 2C78A 1C2TA 3UXYA 4DPLA 1SOUA 5C2JB 1UZNA 5CNIA 3UCFA 2QEQA 4JVLA 4Q9NA 2G6TA 3U4MA 5DGTA 2H3EA 3MTBA 3ZD7A 1D5CA 3G2NA 4ZOCA 5FNZA 2CVHA 3ZI7A 1E0JA 4BLTA 3UAOA 2Z58A 2EW8A 3PQ2A 2B4AA 3Q8WA 4B6PA 4BBAA 2TMKA 4MVJA 4UM7A 3LT4A 5FI3A 3SS9X 4WXPA 4HAWA 4N3AA 3VMMA 1VCIA 4FZJA 4OJQA 4WVFA 3W3AH 1JHYA 2DPHA 2GPNA 2VQ3A 2WJ6A 1N6RA 3AKCA 4R1QA 3AJAA 3KR0A 1NQTA 4MR8B 4QUIA 1ZIPA 1NXTA 4L8WB 2FFBA 3TIFA 4H1UA 1U65A 3B5IA 5DGDA 1D07A 2LCFA 1XVLA 2QN8A 4MKZA 4L16A 2PXAA 1VPTA 2Q4RA 3SYLA 4PZ9A 5A9SA 4K9KA 2OCDA 3LGXA 3O92A 2UZIR 1FTSA 3DAHA 2PZBA 1B74A 1L7PA 1EBBA 2DHQA 2R8BA 4HFRA 2ZJ1A 1BVRA 1NDQA 2QPLA 1JZTA 1LI4A 3MXTA 4WBSA 1W1WA 1C7IA 4PC2A 3DDCA 3OHPA 1IZZA 3BRSA 3D02A 4PHHA 1X7ZB 4Q18A 5FO0A 3AUSA 5BQ3A 1SK8A 2XCLA 3F8SA 4P7KA 1WQ1R 3PITA 1ES9A 2E5WA 4HB3A 1CQXA 2VYNA 2W6OA 4XFJA 1J25A 2R6JA 1UFKA 3EIUA 2CE2X 2OT3B 2RGBA 3N8NA 4HZUB 4MAMA 5I47A 2O3RA 3PXBA 1O87A 2PVPA 2XMDA 2WU4A 4LN1A 4EUFA 4UOZA 2ZDGA 3VZDA 1BX3A 1E18A 3H1EA 1USUA 1JR2A 4RORA 3RC9A 4LF9B 3WYNA 3F7MA 2H18A 1N2OA 1RMYA 1U8FO 1VSVA 2CGEA 4IDBA 4PX3A 1KNQA 4IEFB 4QVKA 3D9QX 2BR5A 1RBQA 2PVCA 4DCTA 5HM6A 1CY8A 4YJKA 3O83A 4YCNA 4Q21A 2MU1A 5BSFA 1J39A 3GF4A 4EHAA 1BYUA 2Q4BA 1RPNA 2C7GA 2F3TA 1E60A 1AKNA 1KEZA 2H59A 3GT3A 1XMJA 1FFGA 1PQ4A 1RI2A 3H2JA 2BRUC 3KUXA 2X0FA 4ED9A 3SYTA 1T2CA 2NTEA 2CNDA 5CYFA 1T1EA 1Q7GA 4FU0A 1XVAA 3KSDO 4UXIA 4BN5A 1NN5A 4AF8A 6NULA 3JASA 1CUVA 2DWUA 3DTYA 3GEPA 1XNGA 4L6CA 5JNSA 2WZQA 3T4PA 3P5BA 3VTAA 4D6XA 2UZ1B 1WCYA 4YXFA 4DL9A 4LZWA 1K7SN 5EE0A 2CJPA 4RCZA 4K9OA 1SVSA 3MPOA 4QG3A 5CBPB 5IUJC 1LNZA 4C1NA 4WOJA 2FQQA 4PPFA 4MUYA 5D6NA 1W4RA 2P6NA 3QELB 4OU5A 1ZGHA 2PUAA 4KI0A 3BL8A 5F51A 1EM8A 4AZVA 4E51A 4HB2A 1XCLA 1EQUA 4P80A 1TJNA 4ZCQA 5KYXB 1QDLB 2JIOA 4RVNA 4CCYB 1YNSA 2J7KA 5DTMA 3KOMA 3RRZA 2GF9A 2CCJA 2MWMA 3G9ZA 2GZRA 3PCRB 5LLSA 4ALIA 2FP3A 5KREA 3K0FB 3PKZA 4BB0A 3IPRA 1ORTA 1ADJA 2COUA 2VL7A 2NU9A 2EP7A 4ZDWA 4F8JA 4CHTA 5KYTA 5HXAA 3ELUA 5JI3E 1G3RA 2AEFA 4X54A 2ZANA 2MTBA 1WSDA 2PD3A 1YVEI 3ZKAA 3P4YA 4Y1EA 1PEAA 3IHWA 5EINA 3A9WA 1RI1A 1Z62A 1V47A 4I9UA 5A3SA 3ZUGA 1FJXA 5E0KB 1KE2A 1OI3A 1MQ9A 1P3DA 3C14C 2FG7C 3SYKA 3ETNA 3ETJA 2YRWA 2AOVA 4YONB 1SBQA 3DE7X 1FE8A 5NLLA 2Z9DA 1L4BA 1MT0A 4R3WA 2JRLA 1ML3A 2DE0X 2ISCA 2VUSA 4V1CA 1SA0A 2ZJ2A 4OB8A 1I0IA 2YN2A 3UK2A 4I2NA 3JD1A 1QB7A 3REQA 1QR6A 1VLZA 4IHJA 3HB0A 1NASA 5IK2A 1TF5A 1KQFA 2O8FB 1NXSA 2X6TA 5AVSA 3VNVA 4GO1A 4FYJA 1NONA 1IE3A 1Y3HA 1A7KA 4O4LA 2OC4A 2WOOA 4MPJA 3H1AA 3SQDA 5JD6A 4JELA 2B8TA 2J09A 1WCV1 1IXSB 3L1JA 1F12A 1I4LD 4UCQA 2BGIA 2BTEA 1KU0A 3IJRA 1DDGA 4EY7A 2H1OA 2CVFA 5KEIA 1HQDA 1UJ4A 1GKLA 1HSOA 1QHXA 2MMCA 2YJ6A 4G4IA 1W7AA 3RUFA 2VCHA 3E23A 2WHRA 4DRXB 3LHKA 3S8YA 1Y7LA 4MR9B 3L1KA 4FCCA 1ZOOA 4O4HB 1WD7A 1O5TA 3PI7A 4IJMA 4WK4B 5DH9A 1SCUB 3ZYZA 4ND2A 3AIKA 2BI7A 2ZP1A 2ZPTX 2PM8A 3DBHB 2Z30A 3H2BA 3IQGX 3GAFA 5BV1A 1IY8A 1QQ7A 2ZRJA 2B37A 3V1MA 4GFDA 4YPVA 2H9AA 3A9CA 3UN1A 4WY2A 1ZCAA 2GBLA 4MZXA 5DSTA 2W2KA 2NYAA 2R6ZA 2H0RA 3B70A 4H7EA 3UB4A 4YHBA 2WKQA 3V2IA 4NU6A 4QYTA 2V7VA 4F56A 1SD5A 1SCKA 4NCJA 3RG8A 5CLQA 1D8AA 4MMXB 1T9GS 5KTYA 5JXGA 4IKPA 2RFLA 4XLLA 2PMFA 4WMLA 4AWXA 3QE9Y 1VZ3A 4WCDA 1EX7A 3N0WA 3L6EA 2EDCA 1GTSA 5H83A 3WA6A 3NIDB 1GGHA 2ZRDA 1OBOA 3ETDA 2XOKD 3OCXA 4HLNA 2GM3A 5IDQA 4XTRA 3O82A 1YJBA 3ED5A 2ACWA 4P3PA 2WMDA 2QZSA 2WV7A 1J24A 1ZCZA 4OMUA 3GLFB 1V71A 1OLXB 1G7CA 2HF7A 4W5JA 4DJFC 1E3QA 4MCIA 3T38A 4H0NA 5DK4A 4DLPA 1RXVA 3LUGA 3FTDA 4M99A 1QH1A 1XP5A 1ZFNA 2PL5A 3FAZA 3O2SB 2HCBA 2IT1A 2R5NA 5GOZA 5EPUA 4RFLA 4IUBS 3ZIAA 2ZB2A 1VHDA 2JLQA 3H0CA 4X6XA 1XRQA 4UVDA 3N05A 5IW8A 1STOA 4DBLE 2XXJA 4I5FA 4RPIA 1U1IA 2P6RA 4IDGA 5HOEA 3NDJA 2NQ8A 5EI5A 4AP5A 4GXTA 1U1DA 3PTAA 2G8LA 3NC0C 3QEOA 2QTRA 4LDNA 4LJAA 4PSKA 4R84A 5COQA 5GWXA 3WZLA 3V3KA 4XDGA 3HCOA 2IRWA 1NNUA 4HDNB 1HYBA 5CB0A 4QYSA 3ZH2A 4G89A 3RHTA 4XPIB 1R0KA 2IGTA 3NHRA 5E4TA 3STUA 1BWSA 1E62A 1UM9A 3C3MA 5DIFA 3IQHX 3KKOA 1Z33A 3L2OB 5T3YA 2V97A 4QPPA 3UB3A 2EFDB 3C24A 5EMNA 3V8EA 2WEKA 3K5IA 1U0GA 3ZQ6A 1JWAB 1VPVA 1ZCFA 2FEOA 1UEJA 2GM4A 4J1SA 1LB1B 4NZPA 4JUBA 2G4LA 3QXHA 2J48A 2VQDA 4QFDA 2GH1A 3KZNA 2VWGA 3RWMB 1GARA 2PUFA 1NKSA 1WUJS 3OKCA 3CE9A 1KYTA 1EM8B 1RAAA 3FWHA 1WXWA 3OBBA 2C7VA 1AXRA 3RS0A 3LBHA 3NAZA 1KHHA 3F6BX 4AZWA 3KKLA 3JWGA 4Y18A 2E82A 5LQAA 3MT8A 5E3JA 1YMQA 4PGFA 4DC0A