2X9GA

High resolution structure of tbptr1 in complex with pemetrexed
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structures of Trypanosoma Brucei Pteridine Reductase Ligand Complexes Inform on the Placement of New Molecular Entities in the Active Site of a Potential Drug Target
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 94
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x9gA00
5TJ9A 3SLGA 1CF2O 1Q7BA 4U8GA 3E9MA 2IYPA 3D3WB 2EGHA 1UR5A 3H2SA 1K6IA 2ZTMA 1PJQA 4AG3A 1U8XX 4QEDA 4BGVA 2PA3A 1HDGO 1QR6A 4A0SA 3T4EA 3R1IA 3WYEA 5TS3A 2PZKA 4TRNA 2Q4BA 4B7UA 3A28A 3VAZA 2HSDA 4J6FA 2QG4A 3F1KA 1ENPA 3H6KA 4D46A 1BSVA 1HL3A 1XGKA 4HWKA 3MWEB 4IDGA 4J49A 4NFHA 1HLDA 3MOIA 5JAIA 1LDNA 4K28A 3G79A 4IINA 3GY0A 3ORFA 4XX0A 3P19A 1NR1A 3INTA 1LSUA 2XXBA 3PHIA 4XA8A 3CSDA 4NDNE 3DBVO 3RFXA 3WMXA 3WYBA 4OH1A 4WKGA 1PIWA 2SCUA 1Q0LA 1V8BA 1R4MB 1X0XA 2I9PA 1LX6A 2NU8A 3WGYA 1E7SA 1R66A 1SB9A 3OHSX 4R9RA 5I7SA 1XEAA 2R00A 4K6CA 1EDOA 1CETA 2IEBA 1I3NA 2PNFA 3HUDA 2P5UA 3P7MA 4MKRA 5K0ZA 4N7RA 2O3JA 3N74A 1N1GA 2CVQA 3D1LA 4I5FA 3MOGA 4AJ2A 4BV9A 4YAJA 3AY3A 4PIVA 4BMSA 4CM8A 1Y8RA 9LDTA 1NHWA 3DEYX 5HRUA 3S8MA 2B35A 3A4VA 4UUMA 4UVHA 2WD7A 2D1YA 3PP8A 5G0WA 3ZZNA 4ZA2A 2B5WA 5DULA 4YPOA 2BFOA 2GLXA 2EKQA 3RUIA 5CDYA 1TB4A 4IGFA 2YHUA 3UCXA 5CEJA 3TL3A 1E7YA 3DONA 2O3SA 3JYLA 3MJVA 3W8FA 2UVDA 5F5NA 1LDMA 2IE0A 3MZ0A 3IKTA 2VZ9A 2NQTA 1B0AA 4NK4A 4E5MA 3K92A 1SO8A 1UXIA 1VM6A 3DBLA 5F1PA 5BR7A 1RWBA 3MTGA 5FWNA 1SCUA 3H3JA 2CSUA 2UDPA 2O2YA 3ABIA 4N5LA 1O5IA 4WLOA 4CV0A 1GZ4A 5ICSA 4PZEA 1DJNA 2OZPA 5AYVA 4CR8A 1R6DA 2X58A 4YJFA 1U4SA 1S7CA 2NADA 3JV7A 2WSBA 5DCUA 4CR6A 3QSGA 3ZN2A 4AJ1A 4WUVA 4D7AA 1H6CA 3DHEA 3I9OA 3Q2IA 3GN1A 4UEJA 4Y9DA 2FPGA 2NV6A 2IXAA 1JN0A 3AFMA 3PXXA 5A9SB 3ITKA 4OOFA 5IZCC 1BG6A 2VQ3A 2YQ5A 3DBRB 4OQZA 1FDSA 1Z75A 1W6UA 1XELA 2IODA 5G0UA 2J3IA 1YRLA 1HLPA 4IJWA 2DLDA 2Q46A 3QRWA 4LRSB 2VRCA 3JQFA 3MCVA 1H2BA 4RCVA 5IXYA 2ZK7A 1Q7GA 2B4QA 4ZQGA 3KYBA 1H93A 4UVIA 4R5MA 3GQVA 3T7EA 4J4BA 1E1MA 1H6AA 2ZKLA 4DQXA 3DMTA 3EC7A 4OXNA 4R4JA 3KHUA 1QYDA 3DAFA 1JKJA 4HKTA 4BNMA 3DAGA 1YWGO 1YVEI 4MVJH 4TVOA 4UVEA 3PEFA 3ZH2A 3H3FA 3ONEA 2QRLA 5ER9A 2B37A 1O6ZA 5GZ1A 4ZQHA 1Q1NA 1P1JA 2E37A 2CF6A 1OI7A 1E6EA 1NFQA 4PFJA 3VKUA 5BSGA 4R41A 4ZU3A 1Z7EA 3FWNA 3ZU4A 1NWCA 5JYEA 2JAPA 4P4NA 1K2WA 4PG7A 3CE6A 1P1RA 1T4BA 1X1TA 1F8GA 1HE4A 1EBUA 2EW8A 3LDHA 3U62A 4YT8A 3WSVA 3DOOA 3DHYA 3ZNQA 3VKVA 1DOHA 5J23A 3F4BA 3FBGA 5JMWA 2JHGA 3G1UA 3NGXA 2VRBA 2E48A 4L4SA 1X15A 2C20A 3WGHA 2JJYA 3IS3A 3H2ZA 1MFPA 1IHXA 4FD3A 4FBGA 4CM1A 1T1SA 1HT0A 4M54A 5KKCA 2GF2A 1WZEA 3W4JA 1Y8QB 2BGKA 4DUPA 5JLAA 3BTOA 1QORA 2FPPA 4CMGA 5KJ6A 1DO8A 4Z0PA 1A72A 1NVGA 4J2HA 3ITDA 5L3ZA 2X86A 4BGUA 3VPHA 4CMKA 3EVNA 1JQBA 1E6UA 1QKIA 2VRCD 3IUPA 4WLEA 2D0IA 1YH3A 3IP1A 5JNLA 4TROA 5JAMA 2CVOA 4FFMA 2I66A 2VWQA 1NNUA 3WX0A 4DGSA 1MV8A 1GV1A 1WMBA 4FS3A 2HCTA 3OA0A 1JAYA 1KY4A 1AXGA 4X54A 4ZJUA 4YAKA 1P1FA 1J6UA 4WCDA 1YQDA 5A9RA 5CEEA 3K6JA 4YRAA 2C07A 1ZCJA 1G6KA 5ILGA 1NHGA 3LU1A 5L7TA 3CUKA 1LSOA 4E6PA 1EBFA 4HFMA 1E7QA 3FNFA 4J43A 5JO9A 3NGLA 4BNFA 3JQAB 1WMAA 1XHLA 3I3OA 4IJKA 3LC2O 2VUUA 2ZYGA 3FNGA 2P68A 4FOSA 2HMSA 1C1XA 3E03A 5GZ6A 3FSRA 3NTOA 2OXIA 1U8FO 4Y8VA 1BVRA 1VPDA 4YAEA 3ZWVA 5TC4A 1B14A 1HYGA 5IF3A 4WCFB 1VL8A 1KYQA 4F46A 1TEHA 1Q7CA 2D8AA 3WJ7A 3ANNA 2NSDA 3V1TC 2FP4A 4JBHA 4Z9YA 1NVMB 2DC1A 3PVZA 3M2PA 4ZQEA 1PS0A 1WP4A 2DT5A 3IDSA 3VVCA 4ZQFA 3GGPA 4BGEA 2Y1GA 3TQHA 3RC1A 3U4CA 3TRIA 1P0FA 3IP3A 4PLFA 9LDBA 3BAZA 3OJLA 3HQ4O 1X13A 2X9NA 1RPNA 5DT9A 1DAOA 3BMNA 3PQFA 4AICA 3PYMA 1OZAA 1ZK4A 4RQTA 1RYDA 3L9WA 1EDZA 4LCEA 1HE3A 3LC1O 3HG7A 3QWHA 4UVDA 4LSMA 2HUNA 1SNYA 4IDEA 4W99A 1PX0A 3DOCA 5B4VA 2OFPA 2NLOA 4MP3A 5ER6A 1ULSA 4FGWA 2EGGA 3F1LA 4II2A 4RDIA 2O48X 3TOXA 2X5JO 4WNCA 2WYWA 5FI5A 4IBOA 5HM8A 4C7JA 4HNHA 3KTDA 3WTBA 3AWDA 5KIAA 1GZ6A 4E12A 2X0IA 4M1QA 1SB8A 3U3XA 4DIFA 4FSHA 4YWJA 2XXJA 5EJ2A 4TRRA 4J1NA 4PLCA 3TZ6A 3TPCA 4XIJA 4WCFA 1OC2A 2POQX 3GDFA 2GDZA 1GEGA 2P5YA 2NVWA 1V35A 2OO5A 4RORA 1QXSA 1B7GO 1YONA 1JDJA 5B12A 3RROA 2VCYA 4YYZA 3OBBA 4KWHA 5L95A 3GGOA 4M86A 1NYTA 4KDFA 4XDYA 1W4ZA 4TVBA 3WYCA 4CQLB 4YT4A 2YW9A 2J8ZA 1EUZA 1J4AA 1GPDG 4I5DA 3OP4A 3DBRA 5DBGA 4OMUA 3WGZA 2O3UA 1VSVA 2CD9A 5AXDA 1D7OA 1JU9A 2VTEA 2VTDA 3KO8A 4IQ0A 4A2CA 1PS8A 5JYDA 5H83A 1KC1A 5JCJA 4YXFA 1K5HA 3ZWMA 3IOYA 4PLHA 1MUUA 4XKJA 4PG5A 1LUAA 4FJ0A 2HU2A 2C7GA 5EPOA 1FDVA 2CF5A 3ANMA 3DHNA 1GUZA 4M89A 1AN9A 3C3XA 2HK8A 4L8VA 4IM7A 1FDTA 2PGJA 5F3RA 4WEOA 3ZHZA 2PKRA 3F5SA 3PQEA 1NVTA 1MX3A 3AFNA 4Q3BA 1LNQA 3VH2A 1HEUA 2Q2VA 3R6DA 3X2FA 4FFOA 1LRLA 4ZQBA 5TLSA 2J3KA 4E30A 5KJCA 2PLAA 5G0TA 1EMDA 4LVCA 1XU9A 2CFCA 3LT1A 1KVUA 1M75A 4QX6A 2AA3A 1YDEA 4J7XA 4RO0A 4B4UA 4JBGA 1PJTA 1I8TA 3I52A 2PH5A 4PLPA 2OMEA 4NBUA 1OMOA 4C7KA 2C7VA 3I9LA 2Q1WA 2X0JA 5I9MA 5A3JA 3BTUA 4EEZA 2PD4A 5CEFA 1UDCA 3JD2A 1KC3A 4CMHA 1X7DA 4FIZA 1ZZEA 3GRPA 5B4UA 1XQ6A 1YOVA 2GYYA 5AOVA 3HWRA 2Z95A 3Q1LA 2P9GA 1ID1A 2YJZA 3FCOA 4NJMA 2CZCA 4F6LA 1DIHA 1PJLA 3JQ6A 2AXQA 3B1FA 3LT4A 3RFVA 1NR7A 3EVTA 4ND2A 4HADA 1HYHA 3OM9A 5C5IA 3ETEA 1NQAO 2CMDA 2VOJA 2Q1SA 2OOSA 1YJQA 2B5VA 1BXGB 1PQUA 4CLHA 1JKIA 1X1EA 3D5TA 1U3WA 3S2GA 4Z3KA 1YBMA 2P91A 2YDYA 3QW2A 4RGBA 4K1LA 1B8UA 4MIEA 1F17A 3DMYA 3GVXA 4XCVA 1DIBA 1V0JA 2FZWA 4B3IA 2DFVA 3QWBA 1T4DA 4FPXA 3ZHYA 1KS9A 3HN7A 3L4BA 1GV0A 4RPLA 3LQFA 3PHLA 3ZHBA 3ZWOA 2C59A 4FN4A 1LDGA 4S1VA 3E6AA 4YRBA 4BQPA 3U4HA 1T26A 3HN2A 5KOIA 3G3EA 2HLPA 3AUUA 4YVFA 4D42A 4N54A 4BMVA 4W82A 5EESA 4Z0TA 4URFA 4CLEA 3P2OA 2FZEA 2EWMA 1DIGA 5JC1A 3TFOA 1HWYA 3RC7A 2B4RO 3IIEA 5EMHA 1HZZA 3AI3A 3FR8A 4BNJA 4XZ3A 1F12A 2A35A 3JD3A 3PDUA 4BKUA 1PJCA 1I24A 3GAZA 4BNKA 5A06A 5EQFA 4CM6A 3H9EO 2ZATA 2X8LA 3ROQA 5C7OO 1PWZA 1ZXBA 1VJ1A 4CLRB 4R1UA 1B2LA 4RZIA 1NFFA 4Y98A 1DRWA 1AE1A 3F46A 5AXCA 3VC7A 2GR9A 1L7EA 1OBFO 4NPCA 1DXYA 2EHDA 4MKXA 5JO0A 2GN8A 4DPLA 3NDRA 3GDOA 1ZKMA 1MA0A 2EKPA 4BO9A 2UAGA 3VTFA 5CG1A 1CIVA 1WLYA 3UICA 4WK6A 1ZEJA 2XOXA 4LCJA 1ZUD1 2BLLA 3H9JA 3GVPA 5KWEA 4IDBA 2Q2QA 3GRKA 1MB4A 2BD0A 4FFLA 2ZB3A 2W2LA 4NH4A 1Y9EA 1ZBQA 3W4IA 3RJ5A 1TVEA 3UFXA 3A1NA 3RFTA 2PY6A 2AEFA 1QYVA 4H3VA 4I9HA 2BRUA 1DJQA 5TX7A 2FR1A 4CL3A 4DLBA 3F6YA 4NJMB 3GDGA 4IJUA 4DQVA 3K2BA 1R15A 1HTBA 3JQGA 2V6MA 3O8QB 3QIVA 1A5ZA 3JYNA 3ENKA 1C0PA 1KVSA 1K89A 1E7WA 1ML3A 5EN4A 4BO0A 2FR0A 2PWZA 3OFSA 1UAYA 2Q99A 5G4KA 1PZEA 1LRJA 3NUGA 3MTJA 4GWGA 4AVYA 3JQ7B 1D1SA 1A27A 3GFGA 1YGYA 3WTCA 4YDRA 3KB6A 4MIOA 2E6UX 1NXQA 5HS4A 4YT5A 1UXKA 2PH3A 1MP0A 5DZSA 4GPD1 2GN9A 1C1DA 4BIIA 1DFHA 2J5KA 2CDCA 1ZXLA 3GFBA 4GL4A 3Q3CA 4I5GA 3ZNPA 4BVAA 3NEPX 3FNEA 3E9QA 1OFGA 4PLYA 4BUCA 3CXRA 4YT2A 4JBIA 2YFHA 1QLHA 4EJ0A 2Y0EA 3FPCA 3W8DA 4BNLA 2PFGA 3DZFA 4QTZA 5TNXA 4FQ8A 1N9GB 3RI3A 4XDZA 3PHHA 3ZWWA 1ZEMA 4J90A 1JWBB 4TKMA 3SVTA 1SPXA 3ONDA 1R12A 3PGXA 1V3TA 2FY8A 3M6IA 2W2LD 3OJ0A 3PYXA 3UXYA 1WXDA 1A9ZA 3PLNA 2X5OA 1T25A 3FD8A 2OBYA 5CP8A 4RPHA 1WDMA 3GNSA 4B8ZA 4B4OA 1PSDA 4PVDA 1PJBA 4CM5A 2Y93A 2VYNA 3DFZA 4WASA 5TGDA 4P22A 1NP3A 3PWKA 4CJXA 5KNLA 4BO8A 3F9IA 3PHGA 2I65A 4CUKA 4HXYA 1CQJA 4XYGA 1Y5MA 1ZJZA 3FTNA 5L40A 2AMFA 3H65A 3S2IA 4M8SA 4O5OA 1CWUA 1QYCA 4OHUA 1I3LA 4R3WA 4CV1A 1YB5A 4JLWA 4RVGA 2VNSA 2YV2A 1KERA 2FPIA 5A5FA 4E5NA 4PG6A 3F47A 1B3BA 1DFGA 2EJVA 4QFCA 4TZTA 3WIEA 2BELA 4E4YA 4IIUA 4EUHA 3W6ZA 1W0CA 3VTZA 3ZV6A 3PDJA 3GA0A 5I7VA 3L4BC 3ANLA 5DP2A 4BNNA 4U5QA 5JY1A 3ZU5A 4Q3DA 3UN1A 2PD6A 1JVSA 2JFHA 3H7AA 4IIVA 2VOEA 4CLDA 3CMMA 3V5NA 1U28A 5ITWA 4D3FA 1E3LA 2VHZA 2VHVA 3I5MA 4D0SA 2CDBA 4BNHA 4MVJP 2FSVA 1NPDA 1E3EA 3KOUA 4BNUA 1KVQA 3GEDA 2O3QA 4XR4A 1VLLA 2DM6A 2AE1A 3GVHA 3IAHA 4JIGA 5KJFA 2XPCA 2EW2A 3EUWA 2B0JA 1M66A 3K9QO 2B4TO 4DIBA 8LDHA 1GFSA 2CNBA 1KEVA 2X23A 2IYOA 1DC3A 1MXHA 5IDQA 2IZZA 3WQSB 1B15A 2X22A 2Y1OA 3FRJA 3OQ6A 4FC7A 4E2WA 5G4KB 1FDUA 3UVEA 4LN1A 3O38A 4B79A 1YXMA 2A92A 5ES3A 1ZJYA 5FYDA 2RH8A 3D0OA 1NWHA 3WBBA 3AK4A 1MC4A 4ALIA 3G17A 4AJNA 3W8EA 4MKZA 1KVTA 2Y05A 5LDHA 2HMVA 4H15A 4ZRMA 4I8XA 2DQ4A 1YQGA 2OP0A 5B1YA 1DHRA 4DVJA 2YYYA 4CM3A 2D5CA 1O8CA 3O9ZA 4TSKA 1HSOA 2DPHA 3HB5X 2GZ1A 5MDHA 2DBZA 3NTQA 3IJPA 4BB6A 1MG5A 4OIMA 1PR3A 1M6WA 2NU7A 4ID9A 4AJLA 2JAHA 3H9GA 4U0JA 5A4DA 4D44A 1WW8A 1PWXA 3KYDB 1RM4A 3AUAA 3TOZA 4UULA 1Y8QA 2BMAA 2G76A 3DAPA 3OIGA 1N7GA 4QO7A 3VPFA 3I9JA 3B6ZA 3GUCA 1PQPA 4PVCA 3RVDA 5BSEA 3Q2KA 4RPGA 2JKVA 3TZCA 5EQDA 5JBIA 4B8WA 4W7HA 2Z1MA 4L4XA 3ZV3A 1SMKA 4E5PA 1XDWA 3KSUA 1GU7A 3RQSA 4BQRA 3AUTA 3K30A 2JCYA 1GUFA 3EW7A 2VUTA 4E2YA 3PWSA 3D4PA 4IS3A 1RJWA 4IDDA 4K6FA 3WWYA 4JJGA 4AJIA 3WFIA 1ULUA 3LT2A 3RUHA 1DFIA 2Y0CA 3ULKA 5A03A 4D0RA 4IZIA 2YV1A 2W90A 3WB9A 1BW9A 3OF2A 2DU8A 3DZGA 2NTJA 4XB1A 3RUAA 4IXTA 3D3WA 4BL5A 2ZYDA 1I36A 4TKLA 3Q9NA 1J0XO 4E21A 2DBVO 2EJWA 1SOWA 4RPJA 4XWYA 3DO5A 2UYYA 3BYZA 6ADHA 1QYWA 2VZ0A 3L9XA 4J0FA 3ZNOA 1XWFA 4MP6A 4BKPA 1KEUA 1TXGA 3ZWCA 4CMIB 4JGBA 1EEHA 4QXMA 3IC5A 3H9UA 5COAA 1CYDA 4IY1A 5T8KC 1QLJA 4NIMA 5A05A 2DTDA 2WJPA 2DBQA 2FHSA 1YB1A 3RASA 2J5QA 4C4OA 1PJ3A 3JQAA 3NX4A 4OXKA 1I33A 4K9DA 2YUTA 5TIIA 1DC6A 2C5EA 5I9NA 5MGBA 2HAEA 2VUSA 3BZUA 2PZJA 2X4GA 1XG5A 3HSKA 2WE8A 1GD1O 1UXGA 4EBFA 5A9TA 2BHLA 4CM9D 3GEGA 4MJLA 4BO7A 3BHJA 1T2DA 5AXAA 5ITVA 1ADGA 4DREA 4BO4A 3RUCA 3P5SA 2R00C 3NT4A 1I32A 2BI7A 2FN7A 2G82A 4NFSA 3OMLA 3H8VA 2BI8A 3RD5A 3VDRA 5DCYA 3RSHA 4MVJD 3LF2A 4DBZA 1H6BA 2JD1A 3RCBA 4DC1A 1SEVA 3TZHA 4Q39A 3DL2A 4IDCA 2OL4A 3FWZA 3NRCA 1HRDA 4K26A 1GAEO 4XYEA 1MGOA 4IMPA 5A3VA 1UZNA 3NDIA 4OSOA 4KUHA 2EV9A 1UDAA 1UP7A 3I23A 1C0KA 2X1HA 4I5EA 2O3TA 4E0BA 2D3TA 2JCXA 3QWFA 4G2NA 2PV7A 4GAEA 2W4QA 2Y1CA 4QSMA 4A10A 3WQRA 1LI4A 2O7SA 3VZSA 3IJRA 2Q1UA 2GCGA 1T2EA 3DBHA 4MOWA 4XEHA 2QHXA 1NX6A 3M1AA 1DBVO 4Y6SA 4I08A 2CVZA 3RWBA 5G2OA 1Z6ZA 3R3JA 2I3GA 2D4AA 1JWAB 1UDBA 2BFMA 4FJ1A 4AJKA 1JW9B 4XYLA 1VJTA 4YB8A 4EYEA 4JNKA 1P44A 2EP7A 2NVUA 3OEYA 1GR0A 4HFJA 4O0LA 1I30A 1EZ4A 1NASA 2C54A 1UP4A 4P8RA 1A7KA 2GPTA 5DBFA 3ZW9A 4PG8A 1PL7A 1HE5A 4BO2A 4RLSA 4EI2A 3RBXA 2Z5LA 1LBEA 2WMDA 3SEFA 2PTGA 4JP3A 2OP1A 1V3UA 3DZHA 3I83A 5TQVA 3ST7A 4DBVO 4BO3A 5FI3A 4CM8B 5BSHA 4WOKA 3TL2A 3V1UA 4Z3DA 2J3HA 5DDIP 3EMKA 2BGLA 4DYDA 2PKQO 1R0KA 1EQ2A 1V6AA 4LSWA 4J7CA 2DFDA 4EUFA 2AQKA 1YE3A 4CQMD 4KTVE 2F1KA 3R0IA 4CMCA 1LDBA 4KWIA 1BRMA 1YL5A 5L9AA 1P77A 1DIAA 1T24A 2AQIA 3RKRA 5C7IO 3QP9A 3QVWA 1F06A 4UUOA 4LRTB 5CHEA 4MVJG 3GEMA 3MEQA 2ZQYA 2AE2A 3VZPA 3F5QA 4BHTA 5U9CA 4ZRNA 2EF1A 1U5AA 3AY7A 2HMWA 1O9BA 4WCFC 4EUEA 4Z9XA 1LQUA 2ZJ0A 3SBOA 4DQUA 5TRTA 5C37A 1DC4A 1KEPA 5ILOA 1KIFA 3JQDA 3UOGA 1N2SA 4WLFA 4YEDA 1M67A 4FC6A 3HB4X 5T5QA 1PZHA 4XYMA 3TDKA 3MJSA 3GMDA 3PJDA 4NBWA 5L7WA 3C1OA 3CKYA 1DRVA 2TMDA 4ND5A 1ISFA 1UXHA 4Q3AA 1DAPA 4M55A 3E8XA 1B8VA 3DMTC 4NJOA 1IULA 3FTPA 4YQZA 5TT1A 1SAYA 1U4OA 1GQ2A 3QVTA 4BO6A 1GYRA 3JQBA 4PGFA 3D3EA 1G0OA 2NU9A 4CMEA 5IXSA 3DZIA 2HK7A 2GNAA 5AXBA 4B3HA 2ET6A 1MC5A 2O23A 3PJGA 1CJCA 3P2YA 4WLNA 1LA2A 2YHIB 1K0UA 4NG5A 4QECA 2O3RA 5JDIA 4Z0HO 3E1KA 1Z74A 4PLZA 4TZKA 4BKQA 2A9FA 4ALJA 4F6CA 1ZK0A 3AM3A 5IZ4A 4RF3A 4FR5A 3KSDO 3ZGYA 1GYPA 1UH5A 3C7CB 3PWZA 4UEKA 1KBZA 2J6IA 1ZMTA 2EP5A 3KYDA 3ADPA 3QHAA 5F1OA 3JQAD 4R69A 2YFQA 4GGPA 1PR9A 3JYOA 5K6AC 4XQGA 4YAGA 3GOHA 1C3VA 3OECA 3VH1A 1NQ5A 2RHRA 2QW8A 1LRKA 2A4KA 3JQGB 3PLRA 5JY6A 3U09A 5DOZA 2AW5A 4QT0A 4BKOA 1ZK1A 1W73A 2FOIA 1NQOA 1NAHA 1SOVA 3PJEA 4DXHA 4E2ZA 3SX2A 3OH8A 1N5DA 4R54A 3GG9A 3RC9A 3ZU3A 4P38A 1NAIA 3AI1A 3Q0EA 4BKRA 1N9GA 2V7PA 3RAJA 5AVOA 2WM3A 2NVBA 1YDWA 4AJOA 1Z82A 5KVQA 4CLOB 5IZCA 5F21A 3D4NA 3IQDB 1W8DA 3O03A 2IEDA 3RJ9A 4AL4A 1I2ZA 3LT0A 2OHXA 1B16A 1DPGA 3OA2A 3JQ9C 2QYTA 1VRWA 3SC4A 3HDHA 3IKVA 4BO1A 2GRAA 3MJEA 3FN4A 4XD2A 3DQPA 2LDXA 2HMTA 3PFWO 1YBVA 3I6QA 4S3MA 5KVSA 3KETA 4CMJA 3RBVA 1N8KA 3QVOA 1E1LA 1XYGA 3JYQA 4G65A 1TI7A 3U0BA 3CH6A 4ROSA 4OJNA 4BNZA 1C0LA 1QSGA 4I9UA 3S2FA 5T57A 1E0DA 2YDXA 1GUYA 2Y1FA 4NHEA 4XJTA 1NFRA 1DSSG 3CZRA 4R3NA 1IZ0A 3L77A 1UAGA 1DDOA 4MINA 3O8QA 5LC1A 1LLQA 3JD0A 3JQ8A 2V65A 4OOEA 2GO1A 1NTOA 3WFJA 3NT2A 3KVOA 1CQIA 3H5NA 1GL3A 2XF8A 3M2TA 4W9NA 3E18A 4DC0A 1HE2A 1ZIDA 3RBZA 3AU9A 2WTBA 2EKLA 3F4LA 4ALLA 4P4LA 5ENVA 2PZLA 4MPDA 5L45A 1DLJA 1EE9A 1RYEA 3CEAA 3TWOA 1XIVA 4NI5A 3E9NA 5F1KA 3TZQA 4GVLA 1R4NB 1IUKA 1ARZA 2VWGA 4BNXA 5JDIC 1GPJA 5JS6A 4KDEA 1Y81A 2YY7A 3KBOA 3ZW8A 3DDNA 1C1XB 4HX5A 1ONPA 2AQ8A 3I9NA 3SC6A 3DZJA 4IS2A 3NKLA 2D2IA 1R4MA 2DUUA 3DXFA 3C8MA 2BKAA 1GY8A 1PZFA 4GSKA 2Z1NA 2G17A 3VH4A 1FJHA 3ZV4A 4OO3A 4XGIA 1IB6A 4HP8A 4LGVA 3UUWA 3FPLA 3RUFA 4RVHA 2WD7B 3KEOA 1BW9B 2VHWA 3FBTA 2O50A 1D4FA 2E49A 2Q49A 3JQ8B 3JD4A 3SJUA 1HDXA 3C1AA 1BDMA 1PL8A 3QVXA 4LK3A 4RV9A 2Y1EA 4DRYA 3CMCO 1OC4A 2H1SA 3A06A 3CZMA 3ZWYA 1WWKA 2HQ1A 4YJFB 4E3ZA 3O4RA 4MDHA 1FF9A 3B70A 3ADOA 3VH3A 1PEDA 4PRLA 2ZJ1A 1MLDA 4NQZA 1A7AA 2PD3A 3PRJA 2EERA 3WR5A 1C1DB 2VYVA 5DP1A 5HTOA 1RM5A 3AM4A 3NT5A 3AY6A 3VZRA 1VL6A 2GGSA 3V8BA 5HS6A 3VDQA 4BNYA 3CPSA 2FSSA 3K8ZA 4J1TA 4RF5A 5EERA 3ROKA 3PI7A 5DF1A 3KYCB 1O89A 4GGOA 1PTJA 2GASA 4E33A 3HDYA 3MJ4A 4EITA 2I3AA 5CDGA 3KXDA 1DRUA 4JN6B 4WE3A 5CFZA 1ZFNA 4IMRA 5G0VA 1BXGA 2WYVA 3K5PA 3OIDA 3GF4A 4GWKA 3PJFA 3JSAA 4XYBA 1LDYA 3ENNA 2NWQA 4TQGA 2FWMX 1LQTA 2QZZA 3C85A 4RZHA 2RAFA 1Y6JA 3GHYA 2O2SA 4B7CA 1P1KA 5AQ1A 1YL6A 3AW9A 5T8KA 5L4SA 3KSZO 3I9MA 2GZ2A 4R51A 3GVCA 3BMQB 5DOVA 1CERA 3L0DA 4CR7A 4CUJA 1PS9A 2WEKA 1P33A 3LZ6A 3CINA 4R01A 1FK8A 1LLCA 1EVIA 2C5AA 2ZCVA 4H7PA 3DZBA 5JAZA 3I4FA 1E3JA 2DAPA 3LK7A 3RC2A 1D8AA 4CODB 4W7IA 1GEEA 4TRJA 4EZBA 5IAAA 3IUSA 1FMCA 3JCZA 4FGSA 1U3VA 4LMRA 1TT5B 5CPFA 1EE2A 4JP2A 1E7RA 4GLLA 1I0ZA 1A71A 5COQA 1BWSA 1P3DA 4R1SA 5TSDA 1HDYA 4YBZA 1P1HA 2O4CA 5BNFA 4KOAA 3WS7A 4CQMA 4RQUA 4BNGA 3OETA 5DBIA 4CLRA 1BMDA 3BMOA 1Q0HA 4YJHB 4KUGA 3D4OA 4N18A 1K6XA 4Y67A 2EG9A 1ZSVA 4DL9A 4BNTA 5ENDA 4EJMA 1ZSYA 3ONFA 4J2OA 1T2FA 1PL6A 3B1KA 2V6BA 3PGJA 3STHA 3BMNB 1VE9A 1JVBA 2Q2WA 4IXWA 3UAGA 1RM3A 1F8FA 4P4GA 1QP8A 2YZ7A 1KVRA 1H0KA 2DVMA 4R16A 1XLTA 2QIOA 1Y8RB 4ZD6A 5LCXA 1R0SA 3F3SA 2GUGA 1C14A 1ENYA 2ZTVA 3EYWA 1ZVMA 4HFRA 3UGKA 4HNGA 1GCOA 1SEPA 4CQLA 4NBVA 3BMCA 1ENZA 2NTNA 1E6WA 4FOOA 1LXCA 3WIDA 5C3MA 1H9AA 1X14A 2CDAA 2Q50A 2ZTLA 3FF4A 3D64A 3HE3A 5JE8A 5CDUA 2X9GA 3SXPA 4R1TA 4BV8A 1XSEA 4JX8A 4OGWA 1QV6A 3WG9A 4XQCA 1JAXA 1T2CA 1J5PA 4OQYA 4KP7A 3BXXA 4ONEA 2YV3A 3I9KA 1LTHR 2I5PO 1VSUA 3OQ1A 2NNLD 2PR2A 1CEQA 4MVJM 4AJHA 1PQWA 4JK3A 1SZJG 4E32A 3JD1A 5JSFA 1GQYA 5U4QA 1E7MA 3IL2A 1P0CA 1R37A 3GLQA 1M2WA 4DA9A 1XA0A 3E82A 1BVUA 3C7DB 5F5LA 1UJMA 4YJGA 4DTIA 4G81A 3GHHA 5I8ZA 4E13A 4YA6A 4JJFA 1IZ9A 1I01A 1JLLA 1E92A 2E82A 3UH1A 2H6EA 5JW6A 5B37A 2D59A 1U7TA 4XRRA 3ZI0A 2WD8A 2Y68A 2VYVD 4WNIA 1XQ1A 1YB4A 4E5YA 5K9ZA 4TWRA 7ADHA 4IQGA 3INGA 3WXBA 1J49A 3EK2A 2C2XA 3O26A 3Q11A 3GVIA 4YRDA 2IZ0A 4WECA 4NR0A 4QUKA 1ISGA 5A1TA 5GY7A 3LVFO 2J3JA 4XB2A 3TJRA 1OAAA 4NFYA 1ISIA 1B8PA 2QQ5A 4UUPA 2Y1DA 4XJSA 2VWHA 4J0EA 4DMLA 3DTTA 2JFFA 5THQA 1MFZA 3S1LA 1PGNA 1SC6A 3VHRA 1SBYA 3JQEA 1DIRA 3GR6A 5G4LA 3KV3O 1DB3A 2E4AA 3PK0A 4JCOA 2P9CA 1EK5A 4Z6KA 3COSA 5T64A 2P4QA 4L73A 2LDBA 1WNTA 3WDSA 4LVUA 3WGTA 4Q9NA 1E1NA 1VL0A 1ZK2A 4RVSA 4HY3A 3ICCA 4GH5A 4M49A 4J9VA 1BXZA 3EZLA 5JCXA 5JDCA 3JQBC 4J4TA 1Z73A 5KVVA 4MVJF 3NV9A 4H16A 3DR3A 4J4HA 2IRWA 4RDHA 3VPSA 4CMAA 5GMOA 4R68A 3U5TA 4MVJE 3HZZA 1TLTA 1RM0A 4GKVA 3RUDA 2PGLA 2G5CA 3NTRA 3U4IA 1KOLA 2VT3A 4NMHA 3TFQA 3GNTA 2HJSA 6LDHA 1Z7BA 2C2YA 1Y1PA 3ICPA 3ZNNA 3KM0A 2CY0A 4R9SA 3AOGA 2PKQP 1BHSA 3AI2A 4L75A 4MO2A 1D3AA 1H94A 4IGEA 3WMWA 4BNWA 1QRRA 5HWSA 3SJ7A 4CV2A 3L6EA 4NU6A 4NBRA 2P2SA 2AG5A 5A9SA 4L76A 3H5RA 1IY8A 1AHIA 2C0CA 3AU8A 3VOSA 1D1TA 3WNQA 5L51A 4PZCA 2Y0DA 4RL6A 1U3UA 1GADO 5IDYA 4F45A 1E3IA 4DLLA 3T7CA 3AUSA 4XQEA 1EVYA 2W2KB 4EJ6A 3HDQA 4F3YA 1EK6A 5KCZA 4L0QA 3NDJA 5H81A 3BTSA 2F00A 4D79A 1O94A 1A4UA 1ADBA 3RIHA 1HF3A 5I9LA 1HSZA 5THKA 4CM7A 3DBLB 3GG2A 2VHYA 3EAGA 5KKAA 1AHHA 2RBEA 2RHCA 2D5AA 4R1NA 1IHYA 1C0IA 2OBNA 5EL0A 2ZB4A 4E5KA 1DEHA 1HKUA 4GX5A 3W6UA 1K6JA 3QE3A 4WEQA 1B26A 4UAGA 2J5RA 5A5EA 4DLAA 3PIIA 2Y66A 3MWDB 4EW6A 2XAAA 1LEHA 3FR7A 3QY9A 4BOYA 1G0NA 4GI2A 5B4TA 2AQHA 4MVJA 3ASVA 1LJ8A 3HFSA 3TNLA 1A4IA 1LSJA 2X0NA 2Q4EA 4U7WA 3PZBA 4XRGA 2H5LA 1H5QA 1TA4A 1EVJA 1I3MA 2HJRA 4LISA 3OICA 1UUFA 3MJCA 3BHIA 3ZWNA 1BXKA 5IG2A 2VYND 4GX0A 4AJJA 3IMFA 4R5HA 1NBOA 5ADHA 4U6SA 4G5HA 4GQAA 4ZN6A 2X5KO 3BIOA 3NJ8A 2NQ8A 3WQQA 4J7UA 1N1EA 1QV7A 3TN7A 1U5CA 2ZCUA 3PFFA 2GERA 4WGGA 1HDOA 1EVZA 3FNHA 5JDCC 1XKQA 1VJ0A 4XQ9A 3WNVA 4NK5A 1YO6A 2G1UA 4RVDA 5BT9A 3HDJA 1XU7A 1Q0QA 1XR3A 2GN6A 3G1TA 3S2EA 3ZWBA 2QRJA 4IDFA 4IJVA 2VHXA 4RVUA 2X0RA 5L4NA 1U9JA 5IFLA 3C7AA 4PLGA 2QRKA 4GKBA 4IDAA 4FFPA 3VPXA 3HADA 2P4HX 5DNAA 3UCFA 4PCVA 1GDHA 3VPGA 3VZQA 3ETGA 1Q2XA 3S55A 2GN4A 3WLEA 3NAQA 3L6DA 4YAIA 1XCBA 1Y9AA 1EFKA 3FI9A 5HA5A 2NM0A 2NTVA 3EZYA 4CV3A 1GZ3A 1B3RA 2VZ8A 4B3JA 4JXKA 5LDGA 4B7XA 3WLFA 3E5RA 3U9LA 4LW8A 3GN2A 1O0SA 3GC6A 4J1QA 4ZHSA 2Q45A 4ND1A 3U4DA 4ESOA 1AUPA 3RUEA 4ZGWA 1PJ2A 1P45A 1YL7A 3I1JA 3PPIA 3GZNB 5JCJD 1DLIA 5G0SA 4BO5A 4DMMA 1IYZA 3B1JA 3KRTA 3H9QA 1NQTA 4GVXA 1PU2A 3K2EA 4EDFA 4XIYA 1ADFA 1IOLA 1Y5RA 2H63A 1T2AA 4QFDA 4ITUA 5IDXA 3HJAA 4J9UE 1G1AA 1ONNA 1F0YA 3PZRA 4WLVA 2I6TA 2WE7A 3W4KA 1KEWA 4A73A 1FXSA 3QA9A 4Z9FA 2EXXA 1K3TA 3UW3A 3MJTA 3GPIA 4Y6RA 1S6YA 1E3WA 3ZWAA 3ASUA 2PGDA 3C1TA 4PZDA 5JFOA 1Z45A 1YKFA 4ILKA 3QQPA 4FB5A 1ENOA 4ND4A 3DB2A 3GGGA 1I3KA 1AXEA 3NYWA 2BGMA 1H9BA 1ZK3A 1PGOA 1WPQA 2AHRA 2HK9A 4FJ2A 1HXHA 4GSLA 3NJ4A 3WICA 2OUIA 3ROPA 2Q3EA 2PK3A 1ISHA 4Y6PA 3H4VA 3KYCA 4ND3A 1P1IA 4CMIA 4AJPA 3WGQA 4A7PA 3WSWA 4RJTA 2R2GA 3K96A 3JTMA 1EFLA 2JD2A 3AOEC 7MDHA 3BMCB 3LYLA 3JQ9A 3KUXA 1DC5A 1GCUA 3ZCXA 1U2DA 1HDCA 3ZWXA 1EQUA 1LU9A 3DFUA 4CM9A 1GYQA 3CTMA 4OXYA 4XGNA 5CAEA 5L53A 4DPMA 1LLUA 1H2HA 1OOEA 2BFAA 4Q3EA 1X7HA 3GT0A 4ALKA 2DBRA 2V6GA 5L4LA 2AG8A 1CRWG 3GPDG 3ZV5A 3WGGA 2AEMA 3HFGA 4YCAA 3I4CA 4BB5A 1GTMA 1RKXA 3U49A 3PTZA 4HBGA 4RVFA 4A03A 1I5RA 1PZGA 1L1FA 3B20A 5T67A 4EGFA 2HDHA 2P9EA 3UHAA 2HRBA 5IN4A 5JXWA 4QO8A 3OJOA 2ZQZA 4CQMB 5DN9A 3JQ7A 4KQWA 3DBHB 1ZO8A 2I99A 1NPTO 2CUKA 3TF5A 1UZLA 2JHFA 1VKOA 2TMGA 2UV8A 3I6IA 4NZ9A 3ROMA 4RF4A 3N7UA 5JC8A 2IDZA 2VT2A 4WLUA 4YJDA 1IL0A 3GK3A 3JQCA 4OSPA 4PG4A 3EY4A 4O6VA 1UP6A 1A9YA 3BA1A 4FW8A 2R6JA 2ZIZA 3RKUA 4GMFA 5CPBA 4L74A 1TT5A 3AOEA 4D43A 4PLTA 4B4WA 4Q3NA 1ZNQO 5EINA 4YTEA 3LC7O 4RF2A 4E31A 4I9NA 4NU5A 3FHLA 4CMBA 5TJHA 3G49A 4O59O 2BH9A 5GZ3A 4UUNA 5K6AA 3HNPA 3LLVA 5CDTA 2EIHA 4CM4B 3V1YA 3KZVA 1LSSA 1ADCA 3BHMA 1X0VA 3DTYA 2BFPA 2FR8A 5KJ1A 5IJZA 3WGIA 4J1SA 1PGPA 3EGOA 1Y7TA 3AJRA 2NUAA 3W1VA 5EIOA 4NBTA 4MP8A 2GSDA 2HRZA 3SLKA 1YS4A 1MG0A 1I2CA 4J91A 3H5AA 2WDZA 3ON5A 4RPKA 5U1PA 2FRDA 4OKNA 1E3WB 2JD0A 1QYXA 1E5QA 5KTKA 4A5OA 2QYSA 5JAQA 1YBAA 4GX2A 2I67A 3KEQA 2AEJA 3PYLA 2A94A 4BGIA 4PRKA 5T6BA 4A27A 2DPGA 4J16A 5H82A 4TMFA 1EUCA 2RH4A 3D5QA 3V2GA 2PZMA 3WOHA 4BNIA 3GZ4A 3ZDFA 1TT7A 4KQXA 3BTVA 3L6OO 3UKOA 3OEWA 5HBRA 1EUDA 3GUYA 4W6ZA 1U7HA 1HZJA 1R16A 3L4SO 1P74A 3T4XA 3QV1A 5BNTA 1U1IA 3QLJA 5FF9A 1ORRA 4HFNA 3RU9A 3TZKA 4AFNA 4IUYA 4FFNA 4CL8A 2W8ZA 1H6DA 1IPEA 1CDOA 1ZH8A 3EDMA 2YHIA 3A9WA 4UREA 3OSUA 3OJEA 2RCYA 4WPGA 2Y99A 2WWRA 1AGNA 4L4RA 4GBJA 4YJGB 3C24A 3ZWPA 1VI2A 4KMSA 1UXJA 2B36A 5DCWA 1BGVA 1KY5A 2JFGA 3PHJA 2YQ4A 4GLOA 4WJZA 4MVJI 5JMPA 4QQRA 5I7EA 1P31A 2DTEA 4U0KA 4DIOA 1LLDA 2UUPA 2ZYAA 2UUOA 1VKNA 2X9VA 3HHPA 4O1MA 4O63O 3BMOB 4WOJA 2QX7A 2V6FA 1BTOA 1R0LA 1YQXA 4FFRA 4L9RA 4PLVA 4BS9A 5COBA 4ALNA 4ZVVA 3N58A 2ZB8A 1VC2A 1E77A 2HMUA 3GH3A 3WJAA 2IZ1A 4UVGA 1HETA 3K73O 3LSYA 4GMGA 4LMPA 4AJ4A 4A26A 5IDWA 2GZ3A 3DWFA 1FDWA 3RU7A 4ZICA 5KVCA 1UZMA 4KUEA 3TSCA 3KLPX 5FEUA 5ICMA 4N5NA 1R4NA 2Y67A 1U2GA 5JPIA 2I76A 4N5MA 1PJ4A 1T1RA 3WGOA 4JROA 1I2BA 1QG6A 5A04A 5CDSA 1ISJA 1X7GA 5IN5A 2ZB7A 3ETDA 4XGKA 3K31A 2VNAA 4CLXA 4CM4A 4DYVA 5I8WA 3GZNA 4DWVA 3BMQA 3OQBA 4I1IA 3M1LA 2OORA 2DUWA 1ZW1A 2DKNA 4OKIA 2ILTA 2WYUA 4DPKA 2QZ9A 2C82A 1BDBA 2O7QA 3X2EA 3QWIA 1E5LA 1YOVB 3Q6IA 2NACA 1ISMA 4D3DA 1N92A 1PGQA 2FMUA 1IE3A 4FDAA 1F14A 2H9IA 4BMNA 4PN3A 3GMSA 3QVSA 5I7FA 2W98A 4YJHA 3GAFA 2NVUB 1M6HA 2ZTUA 4HV4A 5A02A 3VVBA 1WDLA 2BF7A 2B69A 1JKFA 2OGUA 1ONOA 8ADHA 3OJFA 1PGJA 3QJ5A 4KTTE 1JTVA 5BNIA 3E48A 4IZHA 4W4TA 1LDEA 2HKIA 3ZHXA 4CPDA 5C7LO 2JCVA 1HDZA 1WZIA 3AM5A 4IQ8A 4TRMA 3CIFA 5KJEA 3WWZA 5BSFA 3LLSA 3EHEA 1I10A 4KZPA 1V9LA 3G0OA 1PJSA 1NPYA 2JL1A 2HO5A 4CLOA 1MXFA 2O4UX 4OAQA 4YR9A 1V3VA 2W2KA 4FCCA 2NU6A 3UF0A 4AJEA 1YJ8A 4XR9A 3JQFC 1E1KA 3V2UA 1LC0A 3V2HA 1IPFA 2IXBA 1E3SA 3ZU2A 3INRA 2C29D 1GQQA 1DHTA 2B83A 4D41A 4RLHA 2G0TA 5TT0A 3R3SA 1N7HA 1HDRA 2EEZA 4JQCA 4B4VA 4OL9A 4D45A 1QMGA 4D3SA 4UEOA 1KETA 5FFFA 3DOJA 2Q1TA 1WAMA 5BQFA 4E2XA 3OIFA 4II3A 4OM8A 4ALMA 4BNVA 4IPTA 4NNJA 4W9NC 1LC3A 4HUJA 1WVGA 1O95A 3JYPA 5L7YA 1M76A 2X6TA 4J3FA 4U6QA 3WBFA 4MIYA 5CG2A 1P9LA 4OYRA 4Q3CA 1ZSNA 1WDKA 2DTXA 3GNQA 5TF4A 4M87A 1HYEA 1JA9A 3E5MA 4INAA 3A14A 3DZKA 1U3TA 3Q9UA 4PLWA 1NM5A 3L07A 2VN8A 3QWAA 1L7DA 4GX1A 2GD1O 2RIRA 4JJIA 4YACA 2VWPA 4YQYA 3DC2A 3LF1A 3D7LA 4CMEC 4CUZA 4EEXA 3KLMX 2X7HA 3UCEA 3PIDA 3PQDA 1ZMOA
chains in the Genus database with same CATH superfamily
2I8AA 1CT9A 5F7JA 1CK4A 3UYLA 3RVMA 2CCGA 4OQXA 1RYFA 2QMOA 4U8GA 2W2MA 3E9MA 1QP0A 3H6GA 1W1IA 1XPJA 3D3WB 4UU8A 2LKCA 3H2SA 4B7ZA 5J2UF 3OPMA 5ALKA 2F2TA 2WIBA 1VG8A 3KJQA 7GPBA 4LBZA 2ZTMA 1M2VA 3UOAB 2QM7A 3RABA 1XZBA 4AG3A 3IB3A 5JSFA 4DR2B 1HY3A 2CJWB 2XUFA 2YWJA 3DVRX 2BKUA 2DPLA 2PA3A 1STOA 3IQXA 3PGLA 4HXEB 5KAPA 4RDCA 1XMOB 3WYAA 1WBDA 1EVKA 3LKBA 2PZKA 2OHIA 2Q4BA 1M5RA 1JZQA 1DBQA 1E8NA 5KKNB 1D5WA 2ODTX 2E9SA 5JAOA 3H6KA 4RK6A 2WWHA 5IXJA 1BSVA 2ZI7A 1Q3HA 2Z83A 4EQZA 1HL3A 1XGKA 3KWJA 4IDGA 4D96A 1EJ0A 4URUR 1IOWA 4JT2A 3G79A 4NV3A 3ZGZA 1IVYA 4IINA 3KQKA 3LMKA 4GF5A 5EIHA 4XWAA 3R7AA 4LC9A 4QDZA 1G5RA 4XX0A 3HXOA 3WJ2A 1NR1A 3INTA 3TDNA 1LSUA 3UWKA 3SOZA 4PSVA 3OFKA 3IUQA 3RFXA 2EZUA 3WMXA 3L46A 4OH1A 1QFJA 1VJGA 2SCUA 1VGQA 4DY6A 5AW1A 1VI6A 4OQNA 1E59A 4GUDA 1X1QA 1GNSA 3AESB 3CLSC 5IUNC 1PV1A 1Z5VA 3AVQA 4I66A 3WGYA 4J75A 7REQB 1QF9A 1EUQA 4FE7A 3MJRA 1U99A 4K6CA 4KB5A 1LWNA 3DDCA 1AMOA 5JSHA 2IEBA 4CI9A 1DCFA 2PS0A 1JHYA 3P7MA 4WN9B 2QJOA 3E3MA 4QZVA 5K0ZA 4MS3B 1VCOA 6YASA 2O3JA 1L7RA 2VXOA 1XDDA 1CJBA 1I2MA 4MHSA 8OHMA 1FYFA 2CVQA 1ZGBA 3A4LA 3D1LA 4I5FA 4QASA 3WKAA 3WLLA 4F3RA 3QX3A 3MOGA 1LPBB 1BFUA 3RS5A 3MRTA 4PIVA 4BMSA 3IPYA 4HSEA 1Y8RA 4BUJA 1QYIA 2VR1A 2NV0A 2W6JD 4XPIB 3Q7PA 1XNHA 4O4IA 3NM5A 4RKEA 1NN1A 2WPDA 3DPIA 5J9FA 4B1FA 3WBKA 1UWVA 3DE2X 2AHOA 2IWHA 4KMMA 5CXXA 1VPWA 4IGFA 4QJ5A 4NYMR 3UCXA 4X1YB 4YUZA 3CLTC 2ZM6B 4L6CA 1VIVA 2DWOA 3Q0TA 3BFXA 3MJVA 2C78A 1GGFA 1N5JA 2GAFA 5EIWA 3W8FA 1Y8ZA 1F5SA 5F5NA 1QVWA 1LDMA 2IE0A 4WW0A 1YE5A 2C5GA 3WRYC 5LWQA 4MWOA 2YJGA 4H59A 1W0KA 2IL1A 4N8EA 4E5MA 1QRAA 4EF5A 3D0RA 3K92A 1UXIA 5GV7A 1WA5A 3E0XA 4G0PA 5F1PA 3FNQA 2EBUA 3HV0A 3U7RA 1U7ZA 3ILVA 4QPCA 5FWNA 5HP4A 1SCUA 3W7VA 4EY5A 2O2YA 2ZE8A 3K4QA 2ZYIA 2Q5EA 3ABIA 1O5IA 4WLOA 4R8RA 4CIXA 1IY9A 2C4KA 1NUAA 4PZEA 4Q05A 2C57A 1V8FA 4ZP1A 1E6MA 5E4YA 4E3WA 4HYYA 3WB0A 5AYVA 4CR8A 4BFZA 1W4BA 1FPQA 2AIRA 3U31A 2YZNA 3H13A 4CWAA 5DCUA 2I2DA 3K53A 2WKWA 3BWEA 3SDSA 3THWA 4I1VA 1COZA 3QEOA 4JI1B 1QIGA 4IF6A 1CHNA 2X6RA 4WUVA 4D7AA 3NDBB 2O8NA 4ZYZA 4ZT6A 1Z33A 5EP4A 3EQZA 4IIEA 4L7QA 1QIHA 3GGDA 4TN1A 2NV6A 5IJ9B 3PXXA 1Q44A 2Q8PA 3C3EA 4CHGA 4DJJA 3L8CA 3I5AA 3A6KA 3H2BA 5IZCC 1JT2A 1TA9A 3EEBA 2V5VA 2YQ5A 2WVHA 4OQZA 2QGFA 3BFVA 4RABA 1Z75A 1DADA 4LYGA 5EFZA 2IODA 1FP4A 2JI8A 3EFOA 3QEKA 3TOCA 4IDPA 4A23A 4BMOB 4IJWA 1NUPA 1FFHA 2BEUA 2DLDA 1N6PA 2Q46A 3LVQE 3URKA 1H2BA 4RCVA 5AOBA 4ENQA 4JB8A 5IXYA 4BRUA 1T5HX 3G1WA 1P9RA 2O1WA 3KYBA 4EVRA 1KJ9A 5FA5A 4ZTUB 2CEAA 2J0VA 2UZAA 5HNKA 1KYZA 3FH0A 2ERYA 3VX4A 3B9RA 3T7EA 2QA5A 2I4MA 2C2WA 4Q34A 1WXHA 4J4BA 1E1MA 1H6AA 2FG7C 4DQXA 1WXGA 2ZJ2A 3ZHCA 3PXBA 2BM8A 1RBZA 2LNDA 4OXNA 4QOFA 4RXTA 3TIIA 1GTG1 4X5OA 3BCHA 1ODCA 1NV8A 4ERNA 1B41A 5ABPA 4ZVLA 1YWGO 3GROA 4OHBA 1L1QA 4TVOA 1XD2A 4UVEA 5DTQA 2RGDA 2B5OA 4GMHA 5FNVA 3ONEA 2XCSB 5ER9A 3WJ1A 4BMDA 5IT9A 3ZE1B 5GADl 1IZYA 1O6ZA 4M83A 2HLNA 1O57A 1EXMA 3DEFA 4ZQHA 2CC2A 3AR3A 4LZJA 2PWAA 4E5VA 4FB4A 1PG2A 5BSGA 2JGFA 4PFJA 4LXUA 1KH1A 1TU0A 1IK4A 1J9GA 1XJ5A 1Z7EA 2ZP1A 3FWNA 3HJCA 2A3NA 4MQ4A 1C81A 2RHBA 2Z2IA 2Q0QA 1AK9A 2JAPA 3BWYA 3NW9A 2RC6A 4N49A 4U7TB 1URPA 3AG5A 2JDIA 4PG7A 2GCEA 3T3NA 5GWXA 1VYTA 3H84A 4EA9A 1Y5IA 1CRPA 4RTPA 2CFTA 3SSNA 3L2OB 1YBHA 3MTQA 4JUDX 3HYSA 2CLMB 4ZGGA 2HJGA 4EFKA 4QBGB 3DFMA 2YJ5A 1VBKA 3FBGA 2JLAA 2COEA 1V8OA 2JHGA 4DWWA 4ER3A 3PXCX 4GM1A 1I5EA 1MJFA 4ZJPA 5I51A 5B58C 2FOXA 4OCZA 2R66A 3BH7A 3SS8A 4G4SP 1FNNA 2WNSA 3A1EA 3IUBA 4FYXA 4N5DA 4Y9SA 2FDCA 1I0IA 2CK3A 2Q5FA 5BUCA 1W4RA 1WVIA 3BXFA 3IDZA 2R1TA 4CM1A 1T1SA 4BX8A 2JVKA 2UYQA 4Z9BA 3ZKWA 1OPXA 2GF2A 2GVDC 4BQSA 3BRQA 4C2TA 4KNVA 1SD1A 4UNIA 2QD3A 1HMPA 3BRSA 3REOA 5JLAA 1CX9B 4C7OB 3CW8X 3B1XA 1CUHA 4J2HA 4FGJA 3ELYA 4ERXA 1N2BA 4H3HB 1T5BA 4PGMA 2D1FA 3Q8LA 2YIMA 4JVNA 3BVPA 3U7GA 1EG2A 4H0NA 4C2BA 3V48A 1E58A 5HVNA 2VIIA 4HVLA 1E20A 2PLNA 3OFJA 4E07A 3P2IA 2RCNA 2CVOA 5TEVA 2I66A 4G89A 2IOFK 3T4UA 1DKOA 3LKDA 1JV2B 1RFGE 2C83A 1E9BA 5CBKA 5A7GA 3AQ4A 1DOAA 1GV1A 5E6UA 2J3EA 5K8TA 2ZJBA 1DAEA 1KY4A 2FEPA 2PX8A 2EEPA 4NZOA 2ROQA 4WCDA 4RCZA 5A9RA 1PFUA 2RHDA 3LW7A 2GJ9A 2QRMA 1KO1A 1Z4JA 2FWBA 2H4WA 1O5OA 2HTFA 5JNTA 1G3IA 2R4TA 5L7TA 3CUKA 2HSEA 4RH1A 1EBFA 2YFYA 1XU4A 1E7QA 4HFMA 4RZSA 4WNAA 2XZLA 1BN6A 5JO9A 3SBDA 3E05A 3QEBZ 4JEHA 2TMKA 2K7ZA 2OA0A 4YR7A 5HYVA 1H2YA 4BMXA 1FQKA 3LGAA 3L7BA 1Q7EA 1VA5A 2IITA 2ZYGA 3F71A 4JMPA 4Q1CA 4RZ3A 4EG3A 1Q17A 5FBQB 2VDWA 2UZ0A 1L1RA 3BRWA 1B14A 4B31A 5IF3A 4REQB 1TJYA 4ZHQF 4B3RB 1C7EA 1KYQA 1TF2A 3HJUA 4JA2A 1EAMA 1Z4MA 5JQGA 3FYCA 2FW6A 2PAAA 4MITA 1GZUA 1NUUA 3D8TA 3TTUA 2PGIA 3ANNA 3IMEA 3WLRA 1XK7A 3ZG6A 2VDUE 5LXTB 4PNHA 4Q02A 3EPHA 1H9CA 1NE2A 5KOHA 5BYKA 2AYXA 1DG9A 3GAMA 2CJWA 3UHOA 3VVCA 3F0TA 4PANA 2HEIA 4BGEA 4EMSA 4QTYA 2IP4A 2H7CA 3OQVA 4NCNA 3KFVA 3PNLA 4HWSA 1LPOA 1XP8A 2C96A 1C2YA 1ZJ5A 1P0FA 2FSVC 2EJTA 4PLFA 1Q12A 3TRIA 2IXFA 3OJLA 5A2QA 2H7XA 1RPNA 4K9NA 1TYBE 4D3XA 1R64A 2N0SA 3UWDA 1RZ3A 4NESA 1USVA 3N05A 1OZAA 5DPMA 3UAVA 4BATA 3L9WA 4LCEA 4PYMA 4RU1A 2VFAA 5IULC 1C2TA 2PMDA 1K5DA 3ZDCA 4LSMA 5C3UA 3DOCA 5LQUA 4ZCQA 2OFPA 2XA1A 3VR3D 4EHIA 1I4DD 2EGGA 2HWYA 4RDIA 1XZAA 1EGMB 2XMPA 2Z1DA 5NULA 2OZEA 1LY1A 4HC4A 2O0JA 2GZSA 3TQIA 3WTBA 3HXMA 4WY2A 3AWDA 1EXNA 4G4IA 4AU1A 4M1QA 3C8DA 3U3XA 4PBRA 1T8UA 1FNMA 3B5JA 5E6SA 5I7HA 1YASA 4KQKA 3T8YA 1IMOA 1BFDA 4PLCA 5IM4F 3F6RA 4B2LA 3AVOA 3TPCA 3U40A 4R31A 2X9LA 2OR3A 4JI6B 2CLSA 4RGVA 4TV8A 3NTVA 5HCUA 5K3AA 3FLEA 4KO8A 4MKHA 1I7SB 1KY3A 1V35A 4KRGA 4RTNA 2WB2A 2UZ1B 3U7QA 4RHUA 4RORA 2FJ0A 3VHXA 1QIKA 2EWVA 1JDJA 1QHXA 5DJ5A 3RROA 2VCYA 3WDMA 4B3XA 3ORSA 2W5UA 4JYBA 3T7DA 2WA1A 1CZOA 1G17A 5DGCA 1NYTA 4XDYA 1NMSA 3FCSB 5FHRA 4CCSA 3B5EA 1PRYA 3EVGA 2WT8A 2G63A 3NEYA 2F3TA 2ENWA 5KNBA 3L05A 4YAWA 1L4UA 2J8ZA 5FA6A 1GPDG 4I5DA 3VZDA 1MDBA 1OVMA 2GN2A 5E4FA 5CVJA 1Z5GA 3MQ4A 4GR9A 5DBGA 2CMGA 2LGJA 3IT2A 5DM4A 4YIKA 4Q7KA 4Z8YA 4H6XA 1PK8A 5AXDA 3CUVA 4U7DA 2GZMA 1D7OA 1G21E 4RQBA 1BGXT 4IQ0A 3TMAA 4A2CA 2RGWA 4PX2A 5JYDA 4HN9A 1LCIA 1KC1A 5JCJA 1DMRA 2YHBA 3ZWMA 5AWFC 5TGDA 3LWDA 5CGZA 2BBOA 5F7XA 1JIKA 1LUAA 4HQ0A 4MDEA 2HU2A 2P7IA 4D80A 1R0YA 1UDWA 1NZDA 1M0SA 1JFRA 1PD1A 1SOMA 1VFPA 1G4HA 1XLUA 3G0GA 5AKXA 1EDDA 3F98A 1NXPA 2WK1A 1EB8A 5JAHA 4MMXB 4QQKA 3WLSA 3K0CC 1GG9A 2C4VA 1KTVA 4ZCRA 1G2IA 5F3RA 5BVGA 3CWZA 2PKRA 3OLCX 3F5SA 4Q3BA 4UHFA 1TIPA 1WSWA 3AFNA 4GM0A 1CD5A 4QOEA 5B36A 2Q2VA 4W5HA 5C8DA 2DERA 2XJ9A 2AF3C 3TAXA 2C8JA 5TLSA 3PFGA 2OD9A 3H4IA 1F3LA 3ENVA 4ZI5A 3WHKA 4E30A 2IP2A 4EJSB 3SIRA 3BK2A 4RNCA 3T3IA 1EMDA 1XU9A 1EVLA 1S2IA 3JSXA 3FCAA 1YDEA 4KHPB 4Q3LA 3OZCA 2EFGA 4V2IA 2PDAA 1Y8AA 3I01A 2JAWA 1I8TA 2IKSA 3BD9A 2I4TA 2A86A 1VFNA 4LJ6A 3RS4A 3V1KA 4DLUA 4P80A 4PLPA 5A7FA 2UYOA 1R8SA 3I9LA 1QFZA 1D4AA 1G9SA 2X0JA 3BC1A 5A3JA 5K01A 5H8WA 2P6PA 4NE7A 3RBAA 3U26A 3T1TA 5ICCA 4HQRA 4KSCA 1ES9A 2W22A 4CMHA 1T1JA 1X7DA 3KL2A 4P0PB 2F43A 5J2UB 5AOVA 3KZCA 4CF5A 4L5AA 2P9GA 1NJ6A 3O3OB 4EHLA 3ISTA 4WK4B 5K3FB 5DX1A 1UPAA 3CZ9A 3FHCB 3M4JA 5KU1A 2B61A 2CZCA 2FZVA 3IAAA 3THSA 2PQ2A 3LT4A 1O95C 1OKKD 3RVBA 1NR7A 2Z0MA 4W9RA 2O2DA 4PXSA 4GMDA 1OAOA 5EQTA 3P26A 3KOWA 4GMKA 1H4QA 2H1VA 1XNRB 4ZI7B 1NQAO 3A1DA 4QPZA 2CFRA 3CVWA 3OC6A 3K7EA 2OOSA 1OJ7A 1YJQA 2ZPUA 4RMJA 4R7GA 1RP1A 2Y76A 3EODA 4CLHA 3HY3A 1X1EA 3EG5A 2O8BA 1RYBA 5FBRB 1GTVA 3OU2A 4EVSA 1YBMA 4JS0A 4M76B 3D7RA 4MIEA 4N3GA 2D0OB 2IY7A 3KOMA 4F93B 1DIBA 1M2JA 1KZ9A 1FOEB 1SZPA 1WHTA 2B9EA 2W58A 1T4DA 1MH9A 3ZHYA 1FX0A 1EWTA 4I8IA 2AZMA 4RPLA 5AW9A 2TS1A 3ZHBA 3P9SA 2C59A 4FFDA 2D5LA 4FN4A 1C30B 2D7JA 3E6AA 4YRBA 2JCBA 4B43A 3BD7A 4MYSA 1T26A 2ODEA 4BQPA 3G3EA 2C9OA 3BE8A 4WHMA 4D9MA 3G8AA 4G0ZA 3IHKA 1LPSA 1QRSA 1EFCA 1TW3A 4W82A 5KINB 2J09A 1MQ9A 5ECGC 3IUNA 3GLKA 4JC0A 4Z0TA 2ALJA 4URFA 4CLEA 2NSHA 1CUGA 3BSWA 1PYDA 1XD8A 3IIMA 5HGJA 4B82A 4HRYA 1IM5A 2PT9A 4C5BA 6ADHA 4XVQA 4Q03A 1OB2A 4J0IA 2OCKA 5F4BA 3RC7A 3LUHA 4DT1A 2ZROA 3S81A 2JFWA 3DM5A 4N8DA 2B4RO 3X3HA 1S1CA 4BNJA 3FR8A 5IC5A 2HNKA 3RUPA 2A35A 3JD3A 3R5KA 1Z2DA 1W4CA 5K0FA 4P3XA 3S29A 4MUIA 4XUEA 3AXTA 2C9ZA 2JBHA 2QAIA 4BNKA 5A06A 3PFHA 2ZUTA 5BYJA 3ZLTA 3D59A 2IPXA 3ENWA 3ZIAA 2PVPA 4XD7A 1T8TA 1JNXX 3UJBA 3W1EA 4YRZA 1SH7A 1VJ1A 1YT5A 4MAAA 3W34A 3VC7A 4KO2S 2J0SA 1VP9A 3R7SA 5C51B 2UVQA 2LRHA 5LXTA 3I0ZA 4M0FA 5LYYA 3AETA 4MKXA 4NATA 3UT5B 1TZBA 1DNPA 5K0SA 4V24A 3LPMA 5CHYA 3QPAA 3U6KA 1GL7A 1JTEA 3GDOA 5JVDB 4M9UA 5KPJA 1WO8A 2UAGA 1E1DA 1K8QA 1ZISA 1YHZA 3CZPA 3VTFA 2QTTA 1ZEJA 3ZQJA 3A3NA 4Z3OA 2XOXA 3HKEB 2GPYA 4LCJA 4AZ0A 4EO9A 4KGDA 4TV8B 3GVPA 3N6VA 1EX9A 2I9KA 1JL3A 1R8XA 5DI9A 3N6XA 2G8NA 3L6BA 4FHEA 4HNRA 4ZT5A 3GRKA 5GJVC 1YZVA 2YXBA 1U0GA 3HU5A 4NH4A 1AB6A 1Y9EA 2YCLA 2O5CA 1MJHA 4MVCA 4UDYX 1XXHA 1RADA 3UFXA 5B6IA 3A1NA 3WGLA 4BXOB 4KFSA 3OPYB 2P1DA 4QLBA 1YRAA 1C9NA 1US8A 1VIMA 2FR8C 2NXEA 2C7OA 4QBHA 4ZTBA 4PYIA 4H3VA 1NUHA 4XSHA 5LJLA 4I9HA 2HRRA 2YMPA 3HKCA 1H1TA 4K03A 1TPZA 1RZRA 3F6YA 4NJMB 2DQYA 1D1QA 4IJUA 1NBAA 1W5EA 2HA5A 1KXZA 4EHBA 3B9BA 5BN5A 3U2QA 3K70C 1R15A 4KHZA 1P4AA 2ZZKA 3HVHA 4LGMA 3OLYA 3QIVA 3QVVA 3KE9A 4HQOA 5CT5A 3WYFA 2YS6A 1OBCA 2P3LA 4FEEA 3U19A 1FIUA 1KVSA 5DLYA 1EBBA 3PV0A 3SEZA 4DG5A 1EXVA 2CW5A 5IAGA 1QIMA 5BSWA 5HQJA 4BO0A 3NRJA 1X1BA 2WWVD 3RFUA 1XZKA 1FTSA 1R0CA 5G4KA 1UAYA 4LXGA 2V7QD 2DG2A 3ZK8A 1LRJA 1DQSA 3CZCA 4GWGA 4AVYA 3M7IA 4Z4HA 4NE9A 1BMFA 1H1LB 3WNZA 3KJIA 1YGYA 5AW6A 1P72A 3L82B 2E6UX 1AKUA 3OU7A 1NW4A 4AWXA 4EFDA 1NXQA 4WJKB 1BEEA 3KQPA 4ZVMA 3ZIAD 2W48A 2VSFA 3O4VA 4KO4S 4TV9B 1C1DA 2QUJA 3V8QA 2O8FB 4RTOA 1C4OA 3G0DA 3EG9B 5CM2Z 1A1VA 4I5GA 2CDCA 3ZNPA 4BVAA 3Q3CA 2GKGA 1U0BB 3D6JA 3FNEA 4JEUA 2ZZMA 3RODA 3SHWA 2I8CA 1ZD4A 2NUPA 4AMYA 4HEJA 4B74A 4YP6A 4YT2A 4EJ0A 3EMVA 3G2KA 3P32A 3W8DA 5LZ9A 5LXTF 4ETMA 1A7UA 3ZW7A 4LE1A 5CLQA 4QTZA 2N47A 3KT8A 1XBTA 1FRVA 3RI3A 3SK0A 2BT4A 1QOZA 1YZLA 3U1TA 1JWBB 2A5FA 4M0UA 1VIYA 4TKMA 4Y0NA 5K2MA 2ZQ5A 1VL1A 4BNDA 1SPXA 4AQ7A 1CFJA 2OLKA 3AINA 3ONDA 4HPXB 1V3TA 1X9HA 1PDWA 3OJ0A 3QG5A 4M9CA 3WGMA 5IDWA 2R8EA 4Z53A 1A9ZA 3NJRA 2E21A 3PLNA 4O3FA 3SC3A 1T25A 4IVQA 4M88A 1ABBA 1RLMA 2XZPA 1NSTA 2J0EA 2CLLB 4B8ZA 5AVJA 3M3DA 4B4OA 2WHRA 2FOLA 3HXQA 1PJBA 3DO8A 4DWJA 4G97A 3R9WA 1SKYB 3M6XA 1W36D 3DFZA 1OFVA 3PD7A 3U3MA 10MHA 5DTRA 3VYUB 3NONA 1CZRA 5EXPA 2WT4A 3I1FA 2YZ2A 1FCJA 5LLDA 5KNLA 1F0NA 4GHWA 2HJVA 3F9IA 3FW1A 3ICOA 4BO8A 4DDWA 3HLTA 4XYGA 1ZJZA 2MINB 4NBKA 4RJ2A 2AMFA 4AZ0B 3S2IA 4N3AA 4O5OA 1CWUA 3RSCA 4BLOA 2MSKA 3S2SA 4R3WA 2B94A 3QLTA 1CF4A 5DMXA 4AMVA 3G5UA 1QO0D 4Q4HA 2Q2OA 5I6DA 5HSGA 4D99A 1XQWA 2FPIA 2PRYA 3WA7A 2NO7A 3UOWA 2IHNA 1B3BA 4ILEA 2BELA 5HJ2A 3LGSA 1SC1A 4CKWA 3UZUA 3GLGA 3UJNA 2H29A 1GL6A 3GA0A 4R8LA 3IJEB 1QG2A 5I7VA 1V4NA 3L4BC 3LX8A 1FUUA 3C1UA 3TSZA 3UKJA 4INJA 4MI1A 1Y8CA 4Q3DA 5TMPA 1JVSA 2YZMA 5K0NA 4XM1A 4H7JA 1T8YA 1T0UA 4L4UA 5HDQA 3H7AA 2P9JA 2X2PA 3ZHTA 2RGRA 4FLEA 1WW2A 1YS7A 2ZVDA 5HM6A 4M21A 3LUFA 3EDCA 3TVYA 3O94A 3V5NA 5ITWA 5JJIA 2AK2A 3ZJ4A 3ROTA 4FMBB 1TAUA 4L7VA 3LE8A 2Q3MA 2FSVA 1KMCA 3I6ZA 4LKRA 1E3EA 4V39A 3UG7A 1JAIA 5DXFA 3WXMA 3GEDA 3PUJA 3ZD6A 5F2NA 4FEAA 2O3QA 1U2EA 2OV2A 2IS6A 4XR4A 1VLLA 4KXLA 1OWLA 3L8MA 2AYZA 2HBZA 5KJFA 3ZLUA 2EW2A 3E7DA 2A9QA 4R8MA 2ATEA 1YA4A 3K9HA 2H2GA 4PO9A 2B4TO 2GZRA 2PFSA 1OWPA 1N6LA 1GRNA 1KEVA 4XEUA 4V2UA 5ELMA 4QRIA 1DC3A 5IDQA 3OT4A 3WQSB 5ALSA 4TYYA 2X22A 3V1LA 4Y9RA 3FRJA 1ECBA 1FDUA 5CCBA 3WWCA 3WY9A 2LBPA 1OLSA 3G0IA 1XZEA 5ESDA 4QL3A 4PYKA 4NONA 4JLUA 1QQTA 3DYVA 3E61A 1Z5ZA 3PUVA 4FZ5A 1IEWA 1HNWB 4ALIA 1IUOA 2NN3C 1N78A 1L5WA 2PRSA 4D56A 3T9FA 5AK5A 5E7JA 5JWHA 3W8EA 3N8NA 2P2YA 2A7QA 2C00A 3CUSA 4HNAA 4F9GA 4ZRMA 4MQFA 1HLFA 3PQ2A 4I8XA 1OZGA 1Q77A 2OP0A 1K06A 5CBPA 2ZWIA 1DHRA 1U0JA 3W8NA 3DYBA 2H51A 4K8OA 5FULA 2DPHA 2EBWA 3EBOA 3M6WA 2IXDA 3A1UA 3AILA 1TIKA 3COZA 1V1RA 5B55A 5FOUA 3TINA 3A4IA 1ACJA 1U7DA 3EGIA 1JQ5A 3NHSA 4J16C 1PR3A 2V3WA 1M6WA 1IPHA 2WWTA 3IBYA 4FTWA 2X5NA 2PLFA 5SY9A 3UMVA 1R9GA 4AJLA 4QUHA 4C6RA 4LJKA 4U0JA 5A4DA 3R74A 2HPHA 4BTEA 2O8DA 1TD1A 1MB0A 1WPGA 2GBGA 4UULA 3SQXA 1SXJA 1Y8QA 3CYFA 3VMMA 1EGQA 1SCUB 3DAPA 4QO7A 4WRRA 2J4FA 4IGAA 4FUTA 1NNEA 2H48A 5CLIA 1PQPA 4A0QA 4JUAA 2M32A 1ZINA 3Q2KA 4RPGA 1G4UR 4QOJA 1QHYA 5JBIA 4X94A 5FTKA 1WXFA 1SBHA 2ZSFA 2PHZA 4L15A 4L4XA 1NVUQ 2XYQA 1B73A 3KSUA 5CFOA 1U0LA 3FHJA 2A0UA 3STVA 4B71A 1WM1A 2V55B 3TLKA 1P62B 3E9YA 5AKHA 1M8GA 3PWSA 1ZVKA 3D4PA 5EIAA 3K70D 4JLSA 5DMHA 2Y4NA 2ZVPX 3HJRA 3PDHA 1LFDB 1OLOA 2DWPA 4JJGA 4JT4A 3FMPB 4UM8B 4KC0A 5ENZA 1VCMA 2OBMA 1WDWB 4FMCF 3RUHA 2XUQA 3R5FA 2Y0CA 3TNYA 5A03A 3GJQA 2XOEA 4OQ4A 2BGIA 4Y7DA 3WLKX 2IUEA 1X80A 1OXBB 3R09A 1U8UA 4R7TA 1MOZA 1XNQB 3S2YA 2XCQA 2WDPA 3QJGA 3CC8A 3PE3A 3UXEA 2DU8A 1OA1A 4C0LA 4BCBA 1Y3BE 4FDMA 5BWMA 3CB4A 3HJTA 4BL5A 3AVXA 1I36A 4TKLA 4E21A 2EJWA 3QFCA 2B2CA 1VYHA 4U1RA 3H2IA 4UXIA 5HCIA 3VSAA 3YASA 3DO5A 3FSGD 2UYYA 1E6KA 3BYZA 3FUCA 1QYWA 1JIIA 1XMXA 1G5QA 1RWNA 2A5DA 2BFCA 3L0OA 4BAGA 4DEXA 2FX5A 1QQBA 1TXGA 1ZESA 1H5UA 3FMGA 4ZC1A 4ZYYA 4JGBA 1EEHA 4RIIA 1SD5A 1YF3A 3O4FA 5F77A 4IY1A 2VBFA 4NIMA 1P4JA 5A05A 2WJPA 1ZM4A 1G6OA 1PR1A 2FHSA 5K2OA 1RPZA 1JFLA 1N0UA 4ID3A 3JQAA 4C4OA 3HB9A 4ZZIA 1C8VB 1U1FA 1EFTA 2I4RA 3NHYA 1GU1A 4Y2VA 5MGBA 1Q83A 5EZYA 3BZUA 2ZR8A 2PZJA 4Q3KA 4S1OA 2TECE 1XG5A 2YZKA 3HSKA 1MPTA 2WE8A 1GD1O 4HTFA 1A5TA 4MLCA 4YJ2B 4ZCSA 5D00A 4ARZA 4M0EA 2W83A 2BHLA 4CM9D 1GAJA 3GU3A 2ACVA 3GX1A 1TLLA 4HDKB 1NF8A 1R6XA 1N6KA 2QJRA 4US1R 5AICA 5AXAA 5BN5B 2OHHA 3OT1A 2ZULA 3ZUPA 5AVUA 3TOSA 1V6CA 3E7WA 4BO4A 3LH5A 3RUCA 4GYJA 2R00C 1I32A 1QG4A 1X80B 2FN7A 4NFSA 3PXGA 3H8VA 4RQAA 5CJ2A 3GJ4A 3TJZA 5C1PA 2C7QA 1NMYA 5JZMA 5AH0A 3ETNA 4OEHA 1H6BA 2JD1A 3KQMA 1HFWA 1PR4A 2FLKA 2H92A 2II6A 3A7DA 4DC1A 1OXUA 2WM8A 3GLRA 2JIOA 2QUBA 1GP2A 3E2IA 3H11A 3HRHA 2HFKA 2AFRA 4PFKA 1OU0A 1L8OA 1LKZA 2G4LA 2OVBA 2ZJ8A 2Y8EA 3QW4B 2FW9A 1OFHA 4TKZA 1S3IA 3UA4A 5IHPA 1QMPA 3NDIA 4OSOA 2QL5A 4BP8A 4G85A 5ALWA 1RW4A 4LZZA 2FG6C 1TM7E 3N6RA 4JOQA 3G2NA 1C0KA 4PNEA 1ECCA 1ZWLA 1DC8A 4E0BA 4PWZA 1WG8A 2JCXA 4R83A 3QWFA 3P9KA 5LBUA 3UK7A 3V7WA 2PV7A 4GAEA 2W4QA 2Y1CA 2F64A 3NQ41 5CM8B 2HF7A 5D7NA 3OX2A 1GZSA 2J9GA 2WUWE 1X7WA 4F4UA 3KUUA 4IL5A 2IKQA 1S89A 4MOWA 4XEHA 2DEUA 1QO0A 2G1AA 1BROA 3DLBA 1DBVO 1XA4A 1H8HD 1JHQA 4QARA 3RWBA 2V7BA 4A2WA 5G2OA 1Z6ZA 1E69A 2I3GA 2YZGA 4XJVA 2PX5A 2RGNC 2BFMA 5F2EA 3T52A 5SZJA 4XYLA 4HI0E 1VJTA 1ZM3A 2PM8A 4QUIA 4UEWA 3V2IA 2KWIA 1RP7A 2EP7A 1Z07A 2NVUA 2FMKA 4HFJA 5DBFA 2WUFA 2GPTA 4GR4A 3S2UA 1NN0A 2PGOA 1HE5A 4BO2A 2F7SA 3SZMA 1NTRA 3V8NA 4O08A 4ZI7F 1LBEA 4EGSA 3CX6A 1XRLA 4RIHA 2PTGA 4FYVA 5IJWA 2PJUA 1WXQA 4WADA 1P18A 4W8HA 1P75A 3BCSA 4WOKA 1RWQA 1QHSA 5LB2A 3TBHA 4LBYA 1L4EA 4GEKA 3H6HA 1AQ6A 2VQDA 4Z3DA 1SBQA 3HJGA 3S99A 3EMKA 5ELLA 1JBQA 4JLPA 3IPCA 3U48A 4LSWA 2P4EA 3CS3A 3I5UA 4J7CA 1L4MA 2DFDA 3RVKA 1PCXA 1YR7A 2AQKA 2R6R1 4ZDWA 5I5EA 2PJDA 2CL6X 1M34B 3AR9A 4M9QA 521PA 4OMCA 1FRZA 4P84A 4PAMA 2ERXA 2PUHA 2IS1A 1QC5A 2H0RA 1CUIA 3EAQA 5FNVF 1E99A 4KWTA 1AGRA 5M04A 4UTVA 2F67A 2R8RA 4BHTA 3KOZA 2EF1A 2E1PA 4LHEA 3QM1A 1NW8A 1U5AA 2NXNA 3K16A 4WKCA 1O9BA 4EUEA 3IOBA 2UXDB 2DB3A 2UXCB 2ZJ0A 2C7PA 1SGWA 4KSBA 1KEPA 2WAYA 4WNYA 3HB7A 1DC7A 5A6SA 1N2SA 2Q21A 4H77A 2JFZA 4FC6A 4L27A 4RZUA 4UU1A 1D07A 3IT0A 2G6TA 5KSOA 4H18A 2OD2A 4H7FA 4LZAA 4NBWA 4D9JA 1EIZA 3FYDA 3USZA 4F3NA 2QPAA 1E1QD 4N82A 1DWQA 1QDUA 2PIAA 2AZTA 4M55A 2I7XA 4NAVA 4BUCA 2V96A 4KPYA 3Q7EA 3FOBA 2ISQA 3DL0A 4GI1A 4NJOA 2X0DA 3FTPA 4TPKA 1JIVA 2HA2A 4UM9B 1SAYA 4WQMA 1GQ2A 3EZ2A 2PX3A 1LS1A 2X7XA 1XVAA 2ZGVA 5CT4A 5ALXA 5E2AA 5IP5A 2IPMA 4GOXA 4GYKA 4PGFA 2ACEA 1A2KC 1PF7E 4B75A 4MCJA 3EBLA 1O6BA 3DKKA 3HU2A 4BWYA 5IXSA 4DUYB 5EKXA 1SC3A 1NLYA 2GNAA 4B3HA 4N8SA 3UKDA 4ESEA 2VCEA 1CJCA 3P2YA 2AB0A 3BBPA 3R7WA 3FPKA 2ZJ6A 2O3RA 2R8XA 4TLDA 4HR7A 1WHSA 2HPAA 2B8TA 2JVIA 2VO1A 3LD9A 1YQWA 1ZK0A 5IZ4A 4OBWA 3RREA 2IYEA 4DNOA 1GYPA 4HWTA 3UUEA 3ZPXA 3PWZA 4A6PA 1Q22A 2C03A 3M6MD 5AHXA 2J6IA 3IQHX 4LOIA 1ZD9A 2EP5A 3MSCA 1F7UA 2J0QA 3GEBA 4M60A 2PKXA 1KJJA 1UFOA 1FXWA 4DSUA 3WL8A 4GGPA 4KCGA 2F8MA 4MV4A 1KWGA 3EISA 2G70A 4JH0A 1GPMA 4OLJA 1SRRA 2ZI4A 1XFDA 1C3VA 3MINB 1NR5A 1UBCA 4KZKA 4XQGA 4AY3A 2LIVA 1F60A 2Q8NA 3ZCVA 3JQGB 4NHOA 4RXMA 5DOZA 3H2KA 4AF7A 2WFLB 2AW5A 2FOIA 1W73A 2HWXA 3LCCA 4MQFB 1NAHA 1RXIA 2XIQA 3OQIA 4BLPA 2ONJA 1J07A 1L5SA 2D2VA 2W2PA 3CNHA 3D81A 2G28A 3DT8A 2XGSA 3RJZA 3SX2A 4D1YA 4KITB 4HDKA 3T3HA 2AUMA 4PC3A 1YIDA 4IJ6A 1AHPA 3IAXA 4QUEA 1RHRA 3QJYA 4MQ6A 2Z9CA 5ALMA 3RC9A 4P38A 1GAXA 1BCSB 3GH1A 1S8OA 2FEOA 2V4MA 2W2OA 1H69A 3AI1A 4BKRA 2GARA 2GBFA 5CVTA 4FKZA 5AVOA 1T9GR 1QGUB 4IVPA 1U0FA 2UZIR 4AJOA 1V11A 5AUNB 2AZDA 2EOAA 4YI5A 3UO8B 1JAZA 4LDQA 1K9SA 3OTIA 4REOA 1UMBA 1OTYA 2B1IA 2ZAGA 3NAZA 4GXQA 2GNOA 5AVVA 4N6NA 2QTFA 3FN4A 2PU7A 4ESHA 3BXEA 4B6SA 3G2QA 1TO2E 1LPNA 4UU0A 3WKEA 5KVSA 3KETA 1EH5A 2YNMC 2FP4B 3R3XA 3H17A 1N8KA 4CFZA 5CFNA 3UMBA 3R8FA 1EUYA 5IANA 2O1XA 4G65A 4LCBA 2Z57A 1KEKA 4PPGA 3G85A 3UFBA 4YRKA 4ROSA 3F4KA 1U8EA 2M98A 4I9UA 2OCIA 4IIJB 2F4VB 4PPQA 4UNQA 1E0DA 4XTCS 3DEKA 5IH7A 2B98A 4NHEA 5KHOC 1NFRA 3CEMA 2FFQA 4A6XA 3LSTA 1IZ0A 2QM3A 4R3NA 1YZGA 3D8HA 1GO2A 2NO0A 2DQSA 1DDOA 3DMRA 5EWMA 3H5VA 3B8HA 4IIFA 2HF8A 1UK8A 3O8QA 3R5SA 5AJZA 1K8XB 4OOEA 5BN1A 2AZXA 1NTOA 2B4KA 1CQIA 1V7CA 4JGGA 3CZ5A 4UTXA 3R75A 2FQQA 4X6YA 3KYIB 3M2TA 3E18A 5E6UB 5CX1B 1T29A 1R9NA 3GD7A 3PC8A 1W87A 2EKLA 3HJBA 4N3CA 1PHRA 3C6XA 4TGLA 3BILA 1C7ZA 1H2WA 1NQWA 1XVUA 3A9UA 3IMCA 3OC0A 4HK4A 4IJQA 5EIBC 2P4UA 4QJIA 1U1CA 3AJDA 1QIJA 4DADA 4ND8B 1ACLA 1XIVA 3CX8A 2FF5A 5F1KA 4EPXA 4GVLA 3HTXA 3Q88A 1ARZA 1WHTB 1CY4A 4HLUA 4KDEA 2RI6A 3DXXA 4UAVA 3AEQB 4HYTA 4AQYB 2O8DB 1X39A 3E23A 3SC6A 3TQCA 2FF7A 4LFBB 1LB1B 1ODSA 4LJYA 5K09A 5CU7A 3SE0A 2XMCA 1Q91A 1R4MA 2DUUA 5DTIA 5MN6A 2O2JA 3QXSA 2BOVA 2YVAA 3LKZA 1S5PA 4XB6B 2SCUB 3CN9A 2Z1NA 2G17A 1NC3A 4IVRA 1Q0RA 3AP2A 1YE8A 2WOOA 2QRGA 4JXXA 3R6WA 1IBCA 1LF5A 4LGVA 5K3DA 3A0UA 4GC9A 3BH0A 1Z13A 3PEUA 4GECA 1ZXXA 3PFKA 1X7YA 1KFKB 5AKYA 3OIVA 5JJKA 4PPYA 2VHWA 1RMQA 2G88A 5TV2A 1Z39A 5EP2A 1KJQA 1NDHA 1D4FA 2E49A 3JQ8B 1QGED 1JSLA 3JD4A 4I9FA 2W6OA 1H4VB 1T3TA 2YCBA 1QO9A 4ZAXA 5EVCA 4JODA 3ZWDA 3I2IA 3BXGA 3PCTA 1UK6A 3PUKA 4IJMA 4RV9A 3FKSD 1BVHA 5KTNA 1G5HA 1OFTA 3MB8A 3CMCO 4G5OA 2P4SA 3STWA 4R7ZA 3ZWYA 5BOSA 3E22A 1OVGA 2HQ1A 1KHTA 4JHXA 1N2OA 3HGMA 3H2YA 4MDHA 2AZ4A 1FF9A 4E3ZA 3ONVA 2FN8A 2BTEA 3ADOA 2XUOA 1FNCA 1KH3A 2ZYVX 2ZJ1A 1CJTC 2ETXA 2GXQA 1N5OX 1H22A 3H4MA 5JHGB 2F3PA 2PD3A 4NMXB 3WR5A 1C1DB 1T1IA 4AY4A 3NWBA 1CJUC 2H1WA 3AM4A 4KVFA 1RABA 3TRJA 4MVXA 1W76A 2R1VB 2XQFA 2RK6A 4MK4A 1LVUA 3VZRA 4MV6A 5JASA 2GGSA 3GUUA 3DTVD 1KXJA 3F2IA 3IYLW 2FSSA 4RF5A 4I6EA 4BNYA 3BX1A 5MHTA 4I36A 1KP3A 3D6UA 4L8FA 1O89A 1PR2A 1YRQA 2GASA 2JW5A 4IGIA 4EITA 1FTWA 2QP3A 1C80A 3KV1A 3KXDA 5ECDA 5CDGA 4TTJA 1YFZA 4UEQA 2IH5A 4PX9A 4WE3A 3G2LA 4GOJA 3W9SA 821PA 2JLYA 1M1UA 5BNWA 4Q9JA 3LXUX 1GFZA 1ZFNA 1T36B 2V8OA 4YPVA 3CEPB 2WYVA 5FADA 3H11B 1DWPA 1CULC 4A2PA 2GK3A 4LDJA 1VIAA 3C6BA 4HL6A 3WMFA 2BI4A 3ENNA 2VJCA 2RARA 3QEMA 1Z37A 4HPWA 3JQQA 3P9XA 3LQ2A 2DOKA 2J9YB 3FOFC 1LQTA 1EHCA 1Y6JA 1EX1A 2C1ZA 2WWWA 3LVRE 4HLCA 4B7CA