2X9GA

High resolution structure of tbptr1 in complex with pemetrexed
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
publication title High-Resolution Structures of Trypanosoma Brucei Pteridine Reductase Ligand Complexes Inform on the Placement of New Molecular Entities in the Active Site of a Potential Drug Target
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 94
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x9gA00
5JLAA 2O23A 4ND1A 3RKRA 4D42A 4GMFA 2FY8A 1Y8QB 3B1JA 4NPCA 8ADHA 4XZ3A 4MIOA 2B0JA 4DGSA 3U9LA 2VUTA 5IXYA 4FS3A 4MDHA 4ZHSA 1BMDA 4W9NA 2W2KA 3BMCA 5DOZA 3HDQA 1LSUA 4CM9D 1DJNA 4B3IA 5KNLA 2OL4A 1NTOA 1E3JA 2G0TA 2RHCA 2YHIB 2ZKLA 1P77A 4QX6A 4U6SA 3RUCA 3WMXA 1NP3A 4MKRA 1FDUA 3ZH2A 4EW6A 4ND2A 4Z3DA 4ZJUA 3T4XA 5CDGA 3ZWVA 3I9NA 4IJUA 4I5EA 2IZZA 3G17A 4RVGA 4RVDA 1PR9A 1OOEA 3JD0A 3MOGA 4M49A 2NM0A 4OXNA 1YONA 1DXYA 2C2XA 1YJ8A 3VTFA 1GCOA 2WMDA 3B1KA 3Q2IA 5AXCA 3WLEA 3ZWXA 4ESOA 1WDKA 5DP2A 4IDAA 3INTA 5MGBA 4XR9A 4L74A 2EWMA 4W82A 2PH3A 5IF3A 3HQ4O 2BRUA 1W4ZA 1ZK0A 4O6VA 4KZPA 1PGJA 5T57A 3WG9A 1VE9A 3TNLA 3NGXA 1PS8A 3DZJA 2X6TA 3ZV6A 4XIYA 2J5QA 3PEFA 3L07A 3P2OA 1QV6A 3IUSA 3NT5A 1I36A 1VI2A 3VTZA 1FMCA 1ONOA 1LQTA 4CMBA 2FRDA 5BSEA 1LDYA 2QHXA 3S2FA 3H9QA 3ZNOA 3U49A 2YFQA 4A73A 5L7YA 4GQAA 3GQVA 4WNIA 3RKUA 4YQZA 2GUGA 1WP4A 1U5AA 5TQVA 5IN4A 3JSAA 4EITA 5JXWA 3KB6A 1U5CA 3WGOA 4DQVA 4EEXA 2G1UA 1SEPA 1HETA 1VJTA 1XU7A 2FR0A 5KKAA 1U3WA 4PRLA 2F1KA 1YQDA 4CM8B 4YT8A 4FGWA 4DIOA 3H9JA 1GYPA 3GEDA 3KYCA 4XEHA 4CM9A 4Z9FA 4YT2A 2C82A 5L4SA 5F1OA 5HBRA 2VHYA 4HADA 2FN7A 4E6PA 5I7SA 4RZIA 4CLDA 3K8ZA 2VHWA 5TT0A 3DTYA 1E7QA 2Y68A 1C0KA 2NTVA 1XHLA 1GYRA 4OHUA 4UUNA 3HNPA 4LVUA 1DIBA 2E82A 3DL2A 3BTSA 2WYVA 3WX0A 2RH8A 2EIHA 1NWHA 4QO8A 5F1KA 4TROA 4U0KA 4GAEA 3C7CB 1D7OA 3U5TA 3M1AA 4RF2A 4NJMA 5ES3A 3RCBA 1KIFA 4YR9A 2GDZA 4PLPA 2Q99A 4L73A 1GDHA 1ORRA 2ZATA 3ZWOA 3JQ8A 1NWCA 4J16A 2W98A 1G0NA 2VT3A 1VJ0A 1JAYA 3FSRA 4RCVA 6LDHA 1P1FA 2UUOA 1HDRA 4YAKA 3ZU3A 2RBEA 1NHWA 3HDHA 5T64A 2OMEA 3BHIA 3N58A 1S6YA 3ZU5A 2PA3A 4D41A 1ID1A 3PYLA 2PGJA 2HK9A 3AFMA 4NBWA 4C4OA 1CYDA 1F8FA 3JQAA 2WE8A 5COBA 3CTMA 3QP9A 3PHLA 3PQDA 1DIRA 4BO7A 2QX7A 4LRSB 4NG5A 3RBXA 3ZN2A 1FDWA 1NXQA 3D3WB 3OIGA 2X9VA 3QHAA 4WLEA 1QXSA 4BGUA 1MG0A 1ZSVA 2QZ9A 4WLUA 1YB5A 4IMPA 5EJ2A 3F4LA 4KQWA 5A3VA 1B7GO 1E1NA 4E0BA 4JLWA 4NBRA 2SCUA 4WK6A 1BXKA 2GERA 4A7PA 3TL2A 4G2NA 5A1TA 4MKXA 1K3TA 2JD0A 3JQGA 3NJ8A 1AE1A 3P2YA 1V9LA 4GX2A 1A5ZA 4KTVE 2V6FA 3LDHA 1ZK4A 3GVHA 1PL7A 5KJ6A 2Y93A 1V3VA 2YUTA 1SPXA 3SC4A 4CMJA 2FR1A 5F1PA 3X2EA 2O7QA 3PHHA 5CDSA 1CRWG 1E3WB 3RSHA 3NDJA 1Q2XA 2VNAA 1V8BA 2YY7A 4O0LA 2OFPA 3E18A 3OH8A 2FHSA 3ZHYA 3QVXA 4WLNA 5H81A 4D0RA 4C7KA 1JN0A 4YXFA 1ZKMA 5A05A 1U4OA 5U9CA 4PLYA 1PZFA 4BS9A 1H6CA 1WVGA 4GVXA 1SO8A 4YAEA 4ND5A 4K6FA 3QIVA 3RQSA 4J1NA 1JTVA 1KEPA 1R12A 4RDIA 4A0SA 3WQQA 2VZ8A 5A5FA 1EZ4A 2WEKA 5L53A 2PR2A 3JYPA 5DCUA 3CZMA 1KETA 3ZWYA 2PH5A 3WYCA 4GSLA 1NVGA 1IB6A 2HMWA 3DHNA 4CLEA 1FDSA 4AFNA 2C7VA 2Q1UA 4RPLA 4CUJA 2GZ3A 2OHXA 3JQ7B 1FJHA 1T24A 1LDBA 2CF6A 2EW2A 3S8MA 2B35A 2NSDA 3R0IA 4J4BA 5A02A 3UF0A 2BGKA 1ZVMA 2VYVD 4N5NA 3RJ9A 3E82A 2CNBA 2Y1OA 4BMVA 2RH4A 4UVDA 2HMTA 1AHHA 3GG9A 1OFGA 4IS2A 1LUAA 3WBFA 3VPSA 3MJEA 3L9WA 1UP4A 4BNJA 1OZAA 3K30A 2W2LA 3NAQA 1HLPA 2EV9A 4XJTA 3M2PA 4PIVA 4DIBA 1P45A 4B79A 2R2GA 5EN4A 1XSEA 1HE5A 3ITKA 2NVWA 4RL6A 4XDYA 4AJHA 4RF5A 2C07A 3A06A 4YRAA 3F5QA 4MVJD 1UAYA 4M1QA 3ICCA 1WAMA 4XA8A 3H4VA 3KSUA 4WLOA 1ADGA 1M6WA 1NHGA 1QP8A 3JD3A 4IDEA 4HXYA 5JCJA 1VRWA 3TDKA 4MIYA 3WBBA 2NVUB 1UJMA 3WDSA 3MCVA 1LSJA 1E5LA 4NHEA 1LLDA 2R00A 3C7DB 4JBIA 1IUKA 4DQUA 1E3IA 1GQ2A 1DFGA 1KOLA 2AQKA 3BTUA 2NU6A 4XYEA 4FDAA 4E5YA 4YRBA 4BNKA 2NU9A 4UVIA 3GNQA 4ZQGA 1XA0A 1H6DA 3R3SA 2IYOA 1BW9A 2GD1O 1D1SA 1BXGA 4CLOB 2GSDA 3D7LA 3H3FA 3CH6A 3JD1A 1GTMA 5AOVA 2RAFA 4WOJA 3DDNA 4ZD6A 4MVJH 1ZBQA 4J2HA 1RM5A 2Y1DA 5AQ1A 3MJ4A 4ALLA 4L4SA 3V8BA 2VYVA 4WPGA 4AJPA 4OSOA 1O0SA 4RPJA 5DCWA 5JO9A 2DUUA 3ROKA 4CUKA 4EZBA 1LSSA 3TRIA 1G1AA 4WOKA 4BO4A 2HRBA 2QIOA 1B8UA 1KEVA 2X9GA 4OIMA 1HDOA 2EKPA 4NIMA 2O4CA 1YE3A 4E33A 3BMQA 2P5YA 3IUPA 5TSDA 3R3JA 3T4EA 3PIIA 3OECA 1QYWA 2B5WA 1LNQA 3ETDA 4OGWA 3DFZA 5LC1A 4YB8A 2JD2A 5JSFA 5G0SA 1V0JA 2BGMA 3H2SA 4J2OA 4CQMD 3F4BA 3D64A 2OZPA 1ZIDA 1LTHR 4QECA 1ZK1A 1IHYA 4NU5A 4Z0PA 4G5HA 2WD7A 1P1KA 3FPCA 4B4VA 1DO8A 2I6TA 3PP8A 1PJ2A 4MVJA 1EE9A 2I99A 5C3MA 2CDBA 4XCVA 3ROPA 2P68A 4WECA 3ABIA 4KUHA 3JQAB 2BMAA 2O48X 3ZI0A 1ISFA 3W6ZA 2DBQA 1IOLA 2WM3A 4I8XA 2LDXA 3IP3A 3UH1A 1Y8QA 4Y8VA 3RU9A 4R51A 4GWGA 5ILOA 1X1EA 1IY8A 1KVQA 5BNFA 4BV9A 4WJZA 1T1RA 1K5HA 1LI4A 2EF1A 4YWJA 1YXMA 4GMGA 1PL6A 4D7AA 5A06A 3E5MA 4HNHA 1R37A 3NTOA 1MV8A 2YHIA 4AJLA 1P1IA 3W6UA 3WSWA 3VVCA 1JVSA 1ENOA 1XCBA 1ZXBA 2H63A 4Q3DA 1BRMA 4EYEA 1U2DA 1Z6ZA 3QE3A 4XB2A 2CDCA 3KXDA 1HDXA 2YYYA 3ZWCA 3PLNA 1FDTA 1NFQA 3QVTA 2Y0CA 4XYGA 3K9QO 3LVFO 1N7HA 3GVXA 2EKLA 2W4QA 3O38A 4PG7A 5G0VA 3AUUA 4IDCA 3WNQA 1A9YA 4GVLA 4QUKA 5CAEA 4BL5A 4BUCA 4DYDA 2DLDA 1TT7A 1I3NA 3EY4A 3G49A 1B14A 4MVJP 5KJCA 3I6IA 4AJEA 4HFJA 1C1DB 1UP7A 2PGLA 1O6ZA 2AG5A 4PLWA 4PVCA 1CERA 4I9UA 4YACA 4DUPA 3RWBA 1HDCA 1JKFA 2OBYA 2DKNA 2C5AA 1LDNA 2E49A 2BFOA 4FC7A 4N5LA 3ZW8A 4R68A 1MC5A 3O8QB 4UUPA 3GGPA 5IJZA 3TQHA 1CIVA 2HLPA 3I6QA 4R54A 4J6FA 1DBVO 1C1XA 3I9OA 2IODA 2NADA 2VHVA 3D3EA 5JYEA 3GNSA 3LC1O 4LGVA 2IE0A 1N7GA 3N74A 4PZDA 2J5RA 3Q11A 5BNTA 3HB4X 2FSSA 1YH3A 1XKQA 1NQAO 4E2ZA 2VYNA 3MZ0A 1Q7BA 1T2DA 3A28A 1HL3A 3ITDA 1JW9B 4CM8A 4YJHB 1Y5MA 2WSBA 1UAGA 2IEBA 3L4BC 1KYQA 4CL3A 5JY1A 2Z5LA 2EW8A 1ZMOA 5FI5A 1MB4A 3NTRA 2DBRA 4IQGA 4CMCA 4QTZA 1CETA 4UULA 4BNNA 2JAHA 3EVNA 2PK3A 2W90A 3VH1A 5BR7A 3HDJA 3P19A 1BVRA 4YTEA 4GPD1 5HTOA 1PJSA 3MTGA 4UVGA 1LDEA 3E9MA 2BH9A 4QT0A 1Z45A 1N8KA 4X54A 2X5JO 4GX0A 4B4UA 3ZCXA 5H83A 3JQFC 1P9LA 1KY4A 3RI3A 3A9WA 1B3BA 4JGBA 2NVBA 3H6KA 1IPFA 2E48A 5DBIA 3NUGA 3DXFA 1RWBA 1D4FA 1LRKA 2AA3A 4EJMA 2HMUA 3GGOA 3C24A 5EPOA 1XG5A 3QVWA 4J43A 3W8EA 5A5EA 2Q2VA 4NFSA 3KVOA 1P1JA 3LSYA 3NT4A 4BNWA 2DM6A 4WASA 3DMTC 3OMLA 1EQ2A 1TEHA 3IC5A 4GGPA 1UH5A 2C5EA 2Q45A 2QYSA 2YQ4A 3O4RA 4CMGA 1JQBA 2X86A 4OL9A 3FBGA 3JQDA 4D3FA 3TFOA 1PIWA 3FPLA 4NBUA 2VZ0A 3JQ6A 5F21A 5BNIA 1HXHA 4CV0A 1EK5A 2EERA 3QWHA 4R5MA 3PZRA 1HE3A 5U4QA 1SB8A 4DLBA 1I2CA 4NJOA 4DPMA 2NU7A 3RC7A 5L3ZA 4L0QA 5F3RA 3GAFA 3Q6IA 4J49A 1DIHA 4OOFA 1PJ4A 5CDTA 3BYZA 5KJEA 5GZ3A 3MJVA 8LDHA 1RPNA 5EQDA 3JYNA 2CMDA 1E7YA 2B69A 1EVJA 1SOWA 1U3TA 4EJ6A 4XDZA 1DFIA 5GMOA 1VKOA 3GZNB 1W0CA 2JHGA 3U3XA 3D3WA 2IXAA 1GEEA 1Q0LA 1DLJA 1JKIA 3AI1A 3F46A 4AJ2A 4IXWA 3RUEA 4PZCA 2H9IA 3JCZA 1K0UA 4JXKA 3WYEA 1HSZA 4L4RA 3NDIA 3JD2A 4D3DA 1ENPA 3AFNA 4CR8A 2NWQA 2J5KA 4Z9YA 4R9SA 4MINA 2Y0EA 1B15A 1GV0A 4E5MA 4CMKA 1U7HA 5FF9A 2BD0A 4D3SA 1MUUA 4DWVA 2GLXA 4BNVA 1DRVA 3WB9A 2VOEA 1MC4A 3AY6A 1P33A 2DTEA 2CY0A 3ONEA 4WEOA 1E1MA 2GGSA 3DZIA 3COSA 3I1JA 4OQZA 1WXDA 3GPDG 3PDJA 1IYZA 1A7KA 1LQUA 2HJRA 5COAA 1E3WA 1N1EA 4IJWA 2Y99A 3S2EA 2Q4EA 3VOSA 3PTZA 4FD3A 3TOZA 4JNKA 1HLDA 2IYPA 3FNEA 1CJCA 1I33A 2EKQA 2P9GA 1P31A 1PJLA 3FN4A 4P22A 3AI3A 4Z0HO 5L51A 4B4OA 3PFWO 2NQTA 4EI2A 4CM4B 3TZKA 4YPOA 2DAPA 4IM7A 3DZGA 4CJXA 4OXYA 1AHIA 4HKTA 5CDUA 2O3UA 2QRJA 1M75A 1S7CA 1GL3A 3GG2A 4K9DA 1HT0A 1LC3A 1XDWA 3GN2A 4QSMA 3EZYA 1NAIA 2EGHA 3I5MA 4UEKA 1PQWA 5COQA 4FJ0A 5EMHA 1GY8A 4ZICA 4Z6KA 4TQGA 4XYLA 1VJ1A 4B7UA 2IZ1A 1UXJA 3VPFA 1Y9AA 2J3JA 4EUHA 3JQCA 2HJSA 3LLSA 1M66A 1OC2A 2B4RO 2GPTA 3JQ7A 3K2BA 1ISJA 3VPXA 3OM9A 1XU9A 3VZSA 5EL0A 5CG2A 1XELA 2I66A 2VHZA 5ITVA 2V6BA 1ISHA 4YBZA 4A2CA 3U09A 4RQUA 4W9NC 1TA4A 2PZJA 3WNVA 2Y66A 1QYCA 2JD1A 4FFNA 4O59O 3L77A 3O03A 1ONNA 3EGOA 2YHUA 2VRCD 3ETEA 3F6YA 4WNCA 3UCFA 3I9MA 4AJKA 2XAAA 3ZV3A 3OP4A 4LMRA 2Q2WA 4HV4A 1R16A 4CPDA 4BNYA 4MP3A 1FXSA 2X7HA 4XD2A 4HBGA 4BO6A 4BO2A 1L7EA 2HMVA 2BI8A 1A9ZA 4PG8A 4Y6RA 1P74A 4BNXA 3I3OA 1PJTA 4FGSA 4PLGA 2B37A 3IDSA 2DU8A 1J4AA 4R9RA 4ID9A 1U4SA 3RASA 3TJRA 3V1UA 4RPGA 4U0JA 4HY3A 4M54A 3TSCA 1C1XB 3KSZO 5B37A 2X8LA 3ZHXA 4UEOA 4ALMA 5KVCA 1BG6A 1OAAA 4Z3KA 2PNFA 4P8RA 3LU1A 5AYVA 4LN1A 1P1HA 1E7RA 5ITWA 2VQ3A 3FCOA 4W7HA 3PHGA 1EUZA 3JQAD 4N18A 1E7WA 5CEEA 4L9RA 4E5KA 1ZEMA 1UUFA 2H6EA 5MDHA 1R6DA 5C37A 2NVUA 1P44A 3GRKA 1O89A 1B26A 1ULUA 3FTPA 5BT9A 3ZWAA 3GHYA 2X5KO 3WGIA 3HN2A 5THKA 3WWYA 5KWEA 1VPDA 4MVJG 1B8PA 2Y1FA 3WSVA 4CM1A 2FZWA 5JAQA 5LCXA 4DVJA 4YT4A 3A4VA 4IGEA 2F00A 1BGVA 2WJPA 4MKZA 3IP1A 2E6UX 3KYDB 2B36A 4IQ8A 7MDHA 5I9LA 1D8AA 4R69A 4EDFA 1NQ5A 3RC1A 4BNUA 3OIFA 2P2SA 3EMKA 4GX1A 4ZQEA 3PPIA 3PHJA 2E4AA 5L40A 1TB4A 1F17A 1XEAA 3FNFA 4AJIA 4CLOA 4W4TA 4E32A 4J1TA 3AK4A 2IDZA 2I9PA 3FWZA 3UCEA 1PS0A 2DTDA 3AUSA 2AG8A 4P4GA 4XGNA 3UN1A 4R3WA 2PKRA 4BNMA 4BKPA 3OF2A 4WCFB 3VHRA 4BHTA 1LRLA 4CMIB 2VRCA 5L7WA 1EDZA 1ADCA 3W8FA 3WGHA 1YQXA 3VC7A 4ALNA 3H65A 2VNSA 3LF1A 2ZQYA 1BDBA 1PWZA 1EEHA 1M67A 4TZTA 4EUFA 5TIIA 5K6AA 4XR4A 4JROA 1PJCA 1E5QA 4WKGA 3PGXA 1PR3A 4BO9A 4YJDA 4J9UE 4DC1A 1I3MA 4PLHA 4RPHA 5L7TA 1PJQA 5L95A 4JP3A 3INGA 3AM4A 4KOAA 1A27A 1X0VA 1LLQA 1EK6A 4UVEA 4DPLA 2ZTLA 3LC7O 2O7SA 2ZB7A 3LZ6A 2CVOA 1GFSA 1UDCA 1DOHA 2XOXA 4B3HA 2GN4A 2WYWA 3WTCA 5KOIA 4LCEA 3LT0A 5IAAA 1Q0HA 5JBIA 3DZHA 3DHYA 4R4JA 1M76A 1PGOA 5JFOA 4F46A 3GMDA 3RUIA 2X23A 4A5OA 2G76A 4RGBA 2HUNA 2JHFA 1NQTA 3PWZA 4J90A 1HZJA 1GV1A 3KOUA 4N5MA 3M1LA 1LEHA 1QYDA 4NMHA 1R4MB 4CR6A 2OO5A 2ILTA 1DAPA 3OEYA 3ADOA 4WGGA 2Y1GA 3VH2A 1U8FO 2ZYDA 4ALKA 4DYVA 4CQLB 3PI7A 1JA9A 2W2LD 1GQQA 1UZNA 3H5AA 1LSOA 1GZ3A 2YJZA 3NV9A 4H15A 2C7GA 1A71A 2A4KA 2B4QA 1XQ1A 2QG4A 1NASA 3WS7A 3X2FA 4XQ9A 2AMFA 3UAGA 3RC9A 4KP7A 5JS6A 2E37A 3VDQA 4ROSA 1E3EA 2Y05A 3AU8A 3FNHA 1ZK2A 3C1OA 3QVSA 3R1IA 5I8WA 4U8GA 3C1AA 3AOGA 2BI7A 3E5RA 1XYGA 3ZNQA 3GT0A 3JYLA 4GWKA 3N7UA 4II3A 4NFYA 1J6UA 1DEHA 1I01A 2GZ1A 2X22A 3JQBA 5LDGA 5JCJD 4TMFA 3CZRA 3HFSA 1DHRA 2BHLA 4YQYA 2Q49A 1YOVB 3PYXA 4MO2A 1YS4A 3TZHA 3NRCA 4R41A 1Y81A 3ANMA 4CV1A 3OHSX 1IHXA 5EQFA 1ISMA 1C1DA 3DQPA 3EYWA 2ZQZA 1ZXLA 1E1KA 2CD9A 2X0RA 3F1LA 3GVCA 3PQFA 4FQ8A 2BELA 1VL0A 2VRBA 1EBFA 2VOJA 3O8QA 3IQDB 1XQ6A 4OO3A 3ROQA 1LDMA 4RF3A 1Z7BA 5HA5A 3MJCA 1QKIA 4EGFA 5BSGA 2CF5A 3H9GA 1W73A 1OBFO 3PJEA 2Q4BA 4E31A 1C3VA 4OKIA 3CUKA 4DC0A 4CLRA 4WLVA 1I2ZA 4WE3A 4IBOA 1DB3A 1WW8A 3VPGA 4EUEA 3RFXA 4BB6A 5ENVA 1JLLA 3AI2A 3OQBA 4R1UA 2OBNA 4DRYA 2ZTMA 3I9KA 2V65A 2VWGA 5DF1A 3RAJA 1T25A 2W8ZA 3BTVA 4H7PA 4RVUA 4YJHA 5ER9A 2UYYA 5IZ4A 5JC8A 4YEDA 1U3UA 4BNGA 1PTJA 3OJOA 2GCGA 2HK7A 3DBLB 5F5NA 4MIEA 2ZJ0A 3H5RA 3TPCA 2EG9A 2X4GA 1BVUA 3WGYA 3WXBA 5I7VA 5TNXA 5TGDA 4OOEA 4F6CA 3PLRA 2AEFA 1PEDA 2AEJA 1E0DA 3FNGA 4S3MA 5B1YA 3CXRA 3F3SA 3GDFA 3EVTA 2X0NA 2NV6A 1VKNA 1W6UA 1GYQA 3D5QA 4J4TA 2BF7A 2PY6A 3AW9A 4BQRA 2O3SA 5IN5A 3PYMA 1PGPA 4OYRA 3UW3A 1QYXA 4DTIA 1UR5A 4BB5A 4AJ4A 1UXGA 3BAZA 1J5PA 4ONEA 4MP8A 5TC4A 3WQRA 3AOEA 2YDYA 2LDBA 1E1LA 2FZEA 3ZU2A 4BKOA 5ADHA 1NR1A 3E48A 2C0CA 5B4TA 1IZ0A 2PZKA 3DB2A 1I32A 3RUHA 4DLAA 2VUSA 2Q3EA 5EINA 1Q7CA 1TVEA 5DBGA 4AVYA 1KC3A 3RU7A 3VVBA 4ALIA 5AXAA 5JCXA 4NH4A 5KCZA 3DAFA 4BVAA 3QY9A 3JTMA 1X7GA 3IIEA 3HZZA 3TFQA 4F6LA 1GZ4A 3IJRA 4Q39A 2D8AA 3IS3A 1R15A 2VTDA 5TX7A 5JO0A 4TZKA 4ND3A 4FN4A 4DL9A 1KERA 2TMDA 5CP8A 5C7IO 1RYEA 1PSDA 3OJEA 3TWOA 1NYTA 2Y0DA 3DZBA 4FIZA 4GSKA 4E3ZA 5CPBA 5DZSA 2J6IA 1E6WA 2R00C 3GZNA 4CLXA 1VM6A 2GR9A 3NT2A 4AJNA 3DO5A 4JBHA 4CM5A 1AXEA 5DDIP 1EQUA 1I0ZA 1LJ8A 2I3GA 1UXKA 4HFMA 1QRRA 2HK8A 1N5DA 4LRTB 1Z82A 1P1RA 4H16A 1ZZEA 1T2FA 2Z1NA 4KTTE 2Q2QA 4BKRA 1GCUA 4BMNA 4DA9A 1AUPA 3S55A 2OOSA 1V35A 1U9JA 5HWSA 1GD1O 2UUPA 3AWDA 4FFLA 2O50A 4R01A 3VAZA 4DREA 3I83A 3ROMA 4D46A 2FOIA 1GADO 1WPQA 2PZLA 3GF4A 1XR3A 3NEPX 4KMSA 2OXIA 3KZVA 3G1UA 4OJNA 3VKUA 4ZQHA 3RUAA 1HRDA 1VSVA 4DIFA 3C3XA 1ZO8A 3GK3A 4TRNA 2AQIA 4INAA 5CEJA 3E1KA 3U4CA 2WTBA 4E12A 5FEUA 4L8VA 3DONA 1H93A 5F5LA 3ON5A 4F3YA 4BNHA 3NKLA 1YB1A 3PWSA 4MVJE 1EBUA 3DZKA 4BO1A 4AICA 4FPXA 2HRZA 5FI3A 4FFRA 2VYND 5KJFA 1EFLA 3GH3A 3P7MA 4EBFA 5DULA 5IDYA 4CM4A 4E5NA 1UDAA 4CM3A 4I08A 2PD6A 4Y9DA 3FF4A 3DBHB 3AJRA 5I9MA 2YQ5A 3JQ9A 2VWHA 1LLCA 3U4HA 5KVVA 2GF2A 3ZV4A 3RVDA 3QSGA 4RDHA 1NPTO 3QLJA 5U1PA 3WJAA 2DQ4A 3ANLA 5I9NA 1KVTA 2FSVA 3WYBA 2EHDA 5JAMA 1K2WA 3ZHBA 2XF8A 3ZHZA 1N2SA 2D2IA 3ZU4A 5JW6A 2P9EA 3U4DA 5A9TA 3GDOA 3QWBA 4TWRA 3K96A 2FP4A 1TXGA 4NK4A 1Y9EA 1ARZA 4IQ0A 3EHEA 1M6HA 1UZLA 3KSDO 1PWXA 5C5IA 3PHIA 4R5HA 2ZTVA 4PG6A 5G0WA 3WMWA 3OETA 1A7AA 2UAGA 2DFDA 3WFIA 1RM4A 1JAXA 3PZBA 3GMSA 2DPGA 2D59A 3LC2O 1O94A 4YCAA 1R4NB 4GKBA 4BMSA 3IKVA 3Q1LA 1MFZA 4M87A 4WUVA 2X0IA 1X13A 3EK2A 2YFHA 3BXXA 5DT9A 2G5CA 3TZCA 3GVIA 3ZWPA 2WDZA 2QRKA 3D5TA 2FPIA 4XGIA 1BWSA 1ZSNA 3BMNB 2P5UA 3PJFA 4RF4A 4Q3AA 3RBVA 4CLRB 3EC7A 4PN3A 1ENZA 1WLYA 3TF5A 3PVZA 1SC6A 3DZFA 3GFGA 3FHLA 5A4DA 3QQPA 4Z9XA 2X0JA 2QZZA 2GO1A 4IDGA 3CE6A 3OICA 1E7MA 5AXDA 1E3LA 5JDCA 2Y1EA 1HE4A 3WIEA 4CMAA 1XIVA 3D4NA 3QWFA 3GLQA 4XWYA 3WLFA 1HWYA 1K6IA 4FJ2A 2UV8A 2DVMA 1ADBA 2ET6A 1TI7A 3L6EA 4IDFA 4J0FA 4FFPA 4LVCA 4I9NA 1M2WA 1QORA 4N7RA 3B70A 3BHJA 2AQ8A 1BSVA 3KYDA 4BNIA 4ZRMA 3G1TA 1NVTA 1RYDA 1ULSA 3FWNA 1FDVA 5FYDA 2BLLA 1NVMB 3ZGYA 4NDNE 2PKQO 3NGLA 2O3QA 4BGEA 1MLDA 2QYTA 1QSGA 3L0DA 4B8WA 1ISIA 4UUMA 1Y1PA 4R3NA 2X58A 2J3HA 4ZQBA 2PV7A 2C54A 4UREA 5JDCC 2JAPA 1SMKA 3L4SO 3LYLA 1ZCJA 4WCFA 4D0SA 4OSPA 3IL2A 1U28A 4YT5A 2DBZA 1YDEA 4CMIA 4OMUA 2JFFA 4FSHA 4QO7A 1HYGA 2GRAA 1WZIA 5CHEA 3S2IA 1MXHA 4AJ1A 3KUXA 4CR7A 2WE7A 4S1VA 1ZUD1 4JJIA 4E5PA 2Q46A 4IS3A 3OEWA 1F14A 1CDOA 2VUUA 1MG5A 4I5DA 1VL8A 2Q1TA 3IKTA 1DC4A 1Y6JA 2ZCVA 3CPSA 4RVHA 4HFNA 3DOJA 4R16A 3V2GA 3Q2KA 3BA1A 3DOCA 5GZ1A 4ZRNA 4BGIA 4KWIA 2D0IA 4MJLA 4CODB 1PJ3A 4NK5A 3SVTA 1NX6A 6ADHA 2RCYA 3MWDB 5CG1A 1IE3A 4TKMA 5TJ9A 4JBGA 1LX6A 4PFJA 2A92A 3HUDA 4WCFC 4KWHA 1N92A 2DTXA 1Z75A 1PZGA 4URFA 2JCYA 1YB4A 2HO5A 2NU8A 1GUYA 3OA0A 3QRWA 3I52A 3L9XA 4BO0A 4E2XA 5K9ZA 1I3LA 5T6BA 2ZYGA 1LRJA 3GRPA 4IIVA 4ITUA 4FJ1A 1X15A 2YDXA 4RLHA 3VKVA 3C85A 4W99A 4BIIA 1QR6A 1R4MA 3GC6A 4Y6SA 2CUKA 3UOGA 1EFKA 4PVDA 1SNYA 1WWKA 4FFMA 5DOVA 1O95A 3K6JA 4CQLA 4HNGA 4J7XA 4B8ZA 4A03A 3T7EA 2YZ7A 3I4FA 2G17A 4FR5A 1P0CA 4NZ9A 3RUFA 1DFHA 1T2EA 3KETA 1Q1NA 5DCYA 3K73O 3DOOA 3DR3A 3LF2A 3ZDFA 5C7LO 4GH5A 4IPTA 3M2TA 5H82A 2EP5A 1B16A 3WGTA 4LSMA 1R0KA 3FD8A 2VTEA 1PQUA 5I7EA 1FK8A 4ALJA 1VSUA 5FFFA 4IINA 1QV7A 1EDOA 1IL0A 2NUAA 1U8XX 4OXKA 1ZEJA 4HUJA 1E3SA 3S2GA 1PS9A 4PG4A 4D43A 5FWNA 4B4WA 4ND4A 1X7HA 1YOVA 3KEQA 2V6MA 3NDRA 1ZNQO 3JD4A 1RM3A 3CSDA 4J1QA 3OQ1A 2ZYAA 5A04A 3E03A 3PDUA 1GUZA 1SAYA 1KY5A 1NM5A 1HE2A 3SEFA 2WWRA 3PK0A 2B4TO 1ZH8A 4GX5A 2G82A 1U3VA 3GR6A 5GY7A 2GN6A 1NR7A 2C20A 3GFBA 4YJGB 3O26A 1MXFA 1SEVA 3WWZA 4Y67A 4E4YA 2C2YA 4QXMA 4BO8A 3JV7A 3RROA 3VDRA 1PU2A 1GAEO 4IMRA 1F12A 1PX0A 2HDHA 4PCVA 4YAJA 3QWIA 3PJGA 3BIOA 3BMOB 2O4UX 1NBOA 2AEMA 3QJ5A 1ONPA 3E9QA 1XWFA 3ORFA 5EESA 1MP0A 1MX3A 4XQCA 1K89A 2A9FA 1QLHA 1T4BA 1R0SA 4U6QA 1K6JA 4JP2A 1JU9A 3ZWMA 3G3EA 2PKQP 3L6DA 1EMDA 4Q3BA 4D45A 2UVDA 1YKFA 3DBRB 3DHEA 3DBLA 4AJJA 4EJ0A 3WTBA 2H1SA 1E6EA 5JNLA 3WR5A 3FRJA 4MPDA 2HMSA 1Y8RB 7ADHA 4LK3A 3IOYA 3NTQA 5IDXA 4CQMB 5G4KB 1JVBA 4ZGWA 3OJLA 1GPDG 1NQOA 1N9GB 4K26A 2A94A 4RORA 1YL5A 4M55A 3P5SA 3KYBA 5IDWA 4BQPA 3ANNA 3F5SA 4KUEA 4XGKA 1SZJG 2HQ1A 1D1TA 3JQEA 5A9SB 1AXGA 2ZB8A 4Q3CA 3UHAA 3SBOA 3CKYA 4I5GA 2J3KA 1ZMTA 3DMYA 4P4LA 1X1TA 3D4PA 3GUCA 5KIAA 3H8VA 4GBJA 4N54A 3G0OA 4YYZA 2I3AA 1EE2A 3JYOA 3GDGA 4IDDA 2QRLA 1YBMA 4J0EA 3WJ7A 4DBVO 4IGFA 2UDPA 3V2HA 1ZJYA 3NYWA 3KBOA 4G81A 3VH4A 3D4OA 2BFMA 4NI5A 4PLCA 2EP7A 3RD5A 4K28A 3MEQA 3V5NA 1VL6A 3K92A 5G4LA 4BO3A 3Q0EA 4O1MA 4E2YA 5ER6A 3LT4A 5DNAA 4FOSA 5LDHA 3OFSA 2IRWA 4L75A 2YW9A 1PGNA 3EUWA 1I2BA 1YDWA 2X1HA 2Y1CA 2YV3A 4PZEA 2DUWA 3SJUA 5A03A 1PGQA 3GUYA 1UXIA 4DQXA 5HS6A 1CQJA 3AU9A 5AXBA 5IFLA 2FPPA 4UVHA 4OKNA 1QMGA 3HDYA 1V3UA 4J3FA 4J4HA 3ASVA 2I65A 4E13A 1GR0A 2EJWA 1E7SA 1H2HA 1YGYA 3T7CA 4XKJA 2Z95A 1B0AA 5JE8A 1ZSYA 1SCUA 3UVEA 3CINA 4ZQFA 5T5QA 3PQEA 1GUFA 5EIOA 1V3TA 3QA9A 1P3DA 3GEMA 4OH1A 2ZCUA 5TJHA 1T26A 4FBGA 3UCXA 4J7CA 1TT5B 1GQYA 3PGJA 2Q1SA 4J9VA 4RO0A 3S1LA 4K6CA 2J3IA 2P4QA 1H9BA 3MTJA 2CFCA 2Q50A 1H2BA 1H6BA 1LC0A 5CPFA 1OMOA 2V7PA 4KUGA 5L45A 5L9AA 5CFZA 4NFHA 4E30A 5DBFA 4Q3EA 2QQ5A 3B6ZA 1DC6A 1DJQA 1DRUA 4LSWA 4LW8A 4PLTA 4IJVA 1LU9A 2Q1WA 1MA0A 4NR0A 3ZV5A 3UICA 5K6AC 1YBVA 2OUIA 1I24A 1LBEA 3FTNA 1RJWA 2IZ0A 5KVQA 1T2CA 5BQFA 3L6OO 4FB5A 4P4NA 2OGUA 4FW8A 4RZHA 1KS9A 3SLGA 4GLOA 5B4VA 3OJ0A 5JC1A 1MFPA 3DBHA 3CEAA 2A35A 4Y6PA 3HB5X 4NBTA 3ICPA 4M86A 4WEQA 4CM6A 4DLLA 2EEZA 1ISGA 3EAGA 4MVJI 3H2ZA 4UUOA 3UKOA 5A3JA 1WDLA 2D5AA 4RPKA 4CLHA 1DSSG 4D79A 3BHMA 3AY7A 1U2GA 3GNTA 1E6UA 1YJQA 3F47A 4O5OA 4GL4A 5EERA 4XYBA 4LMPA 5KVSA 3DWFA 1Z74A 1HKUA 4TSKA 4BKUA 4RVFA 5IG2A 9LDBA 1DLIA 2HU2A 2TMGA 3H9UA 1KVSA 2AXQA 4HWKA 1NNUA 4Q3NA 1MGOA 3F9IA 2NQ8A 2XXBA 3KRTA 2D5CA 3FR7A 4XJSA 4YRDA 2BKAA 2V6GA 2ZK7A 1JKJA 5CDYA 1R4NA 4TKLA 3AUAA 1Z7EA 2X5OA 1SBYA 1DC3A 4BGVA 4JX8A 2I67A 4KDEA 4JJFA 1A4IA 2VN8A 3GAZA 3ZNPA 2P4HX 1T2AA 3ST7A 1BHSA 1DHTA 3WQSB 4CUZA 2VT2A 2W2KB 2PLAA 3BMCB 3R6DA 4M89A 4PGFA 2AE2A 5BSHA 2YV2A 4XQGA 1JDJA 1KEUA 3BMNA 4XX0A 3IAHA 1HZZA 1YO6A 1DAOA 4QQRA 2D1YA 3JQBC 3KLPX 3W4KA 1UZMA 1B3RA 3HG7A 4YVFA 2GZ2A 2OP0A 3GA0A 3U62A 1PQPA 4IZHA 3ZZNA 2XXJA 1J49A 1YQGA 3MJSA 4Y98A 3QVOA 4XRRA 1F8GA 1N1GA 2JJYA 4M8SA 1H0KA 1HDYA 1NPDA 3W4IA 2I5PO 3SX2A 5I7FA 3W1VA 1I5RA 2B5VA 1GEGA 2JFHA 1UP6A 4BO5A 2ZB4A 4GLLA 1WMBA 3IJPA 4CV3A 3QW2A 1Y5RA 3ZW9A 2ZJ1A 5JY6A 5AVOA 4CM7A 3VPHA 3KM0A 3NX4A 3VH3A 3BTOA 3KTDA 1UDBA 1ENYA 2GN8A 1KVRA 1KEWA 3OJFA 2DC1A 4XYMA 2JCXA 3ULKA 3E9NA 5C7OO 3HSKA 5DN9A 3B20A 3K31A 3ETGA 1LDGA 2O3RA 4F45A 2NACA 1X7DA 4AG3A 2JKVA 4IY1A 3U0BA 1X0XA 4NNJA 2FR8A 1I8TA 5I8ZA 4BNLA 3GZ4A 3DAPA 5B12A 2IXBA 3EDMA 5HS4A 3DTTA 2ZB3A 2AE1A 4K1LA 3LLVA 3LK7A 4W6ZA 4L76A 4GKVA 2I76A 1DRWA 2Y67A 4GI2A 5JDIA 3AY3A 3GVPA 1SOVA 3H3JA 1AGNA 1C0PA 2J8ZA 3KYCB 1A72A 1QLJA 1VLLA 3FBTA 3GOHA 3OBBA 3MJTA 4PLZA 1AN9A 3DFUA 3PIDA 3TZ6A 3C7AA 4Q9NA 1NAHA 5T67A 2CZCA 1ADFA 3WGZA 5A9RA 5ICMA 4RLSA 2O2SA 2GASA 1L1FA 2DBVO 3STHA 3ONFA 4A10A 1I30A 1EVYA 3A14A 3RBZA 3EZLA 3O9ZA 3KEOA 1PZEA 4TRMA 3TL3A 2WD8A 3AUTA 1CEQA 5HM8A 1H5QA 3AOEC 1NFRA 3GGGA 4PG5A 1RM0A 3GN1A 3VZQA 3ONDA 4BV8A 1A4UA 1FF9A 1GPJA 1NPYA 3A1NA 5JDIC 2VHXA 2BGLA 4TVOA 1O5IA 3I23A 3HADA 2GNAA 1KC1A 1C14A 3CMCO 1X14A 4PLVA 5T8KA 5TLSA 4NJMB 4P38A 1CWUA 4NBVA 3OA2A 4OQYA 2O3JA 3SXPA 5KJ1A 2ZTUA 3JQ8B 1C0LA 2NTJA 1EUDA 3D1LA 3WFJA 3C8MA 3WIDA 4D44A 5DP1A 5CEFA 1B8VA 4I5FA 4AJOA 3VZRA 4BKQA 2C59A 3DAGA 4IXTA 1HYHA 3GHHA 3K5PA 4B7CA 1R66A 2P91A 3DEYX 2Z1MA 3LT2A 4HX5A 4J7UA 1F0YA 4PLFA 5KKCA 3AM3A 1ZJZA 3QV1A 4II2A 4YJFA 4BNFA 2FWMX 1HTBA 3PFFA 3ZWNA 2OORA 1YBAA 3GPIA 3WGQA 3HE3A 1YL7A 4ZN6A 1WNTA 4DPKA 2BFAA 2XPCA 1V6AA 5T8KC 3ENKA 4YAIA 3G79A 2FMUA 3FI9A 4ZA2A 1OC4A 2JL1A 3ADPA 2POQX 3DBVO 2CDAA 1ZK3A 4BNZA 1EUCA 1F06A 1LXCA 2HCTA 4JN6B 3HFGA 4QFDA 3WOHA 3GEGA 3ZWWA 1O9BA 3ENNA 3TOXA 3ZNNA 5G0UA 3PWKA 1VC2A 4XIJA 2PD4A 4TVBA 4FOOA 4FFOA 1H94A 3WICA 5IDQA 2HAEA 1RKXA 2DT5A 4JCOA 4YJGA 2EXXA 1E77A 3VZPA 1KBZA 3BZUA 5G2OA 3RFVA 3JQGB 1Z73A 3HWRA 3OSUA 4RVSA 5THQA 3I9JA 3UGKA 3PRJA 1CQIA 1XGKA 3JYQA 1QYVA 1I10A 5ENDA 4R1SA 4O63O 5TT1A 1SB9A 4NQZA 3BMOA 4CMEA 5K0ZA 1T1SA 1TLTA 4QEDA 1GU7A 1ML3A 1YRLA 3JQ9C 4A27A 3W8DA 3V2UA 3NJ4A 1CF2O 1P0FA 4IZIA 5L4NA 4I1IA 3IMFA 1ZFNA 1DPGA 1YL6A 3W4JA 4G65A 2WYUA 4U7WA 1IULA 4JK3A 3DBRA 2CVQA 2B83A 2PWZA 1HDGO 4RV9A 1K6XA 3H7AA 4NU6A 5JMPA 4KQXA 3RJ5A 3TZQA 4DMLA 1Y8RA 1O8CA 4J91A 1QG6A 4JQCA 4HFRA 3KO8A 3QWAA 4YA6A 4CQMA 5G4KA 2FPGA 3SJ7A 3EW7A 3L4BA 4XQEA 1N9GA 3FR8A 1BXZA 4B7XA 1Q7GA 4TRJA 2HSDA 4CMEC 2VCYA 5JMWA 1C0IA 1YVEI 5A9SA 1IPEA 3CMMA 3GY0A 2RHRA 4I9HA 5TS3A 4DBZA 2NTNA 2C29D 2O2YA 1G0OA 3C1TA 4MVJM 3ZWBA 5BSFA 1Y7TA 5KTKA 1PZHA 4IDBA 3I4CA 3U4IA 3JQFA 4ILKA 5B4UA 4UAGA 4IIUA 5TRTA 9LDTA 4C7JA 4XRGA 4ZU3A 4E2WA 2VZ9A 1G6KA 5J23A 2GYYA 5IZCA 1UXHA 1PJBA 1Q0QA 2HKIA 4BNTA 2CSUA 1PL8A 1WDMA 4BOYA 3Q9UA 2D3TA 1HF3A 4YDRA 1HSOA 3KLMX 4U5QA 1JWBB 4FC6A 3MWEB 3DMTA 3AM5A 4IJKA 4OM8A 5JYDA 2PFGA 1T4DA 2H5LA 3Q3CA 2JFGA 1DDOA 2PZMA 3TN7A 2PGDA 4RQTA 3DC2A 5JAIA 2P9CA 4ZVVA 2YV1A 2GN9A 4CV2A 4FCCA 1BTOA 1IZ9A 1ZW1A 3ASUA 3MOIA 5G0TA 3UXYA 1L7DA 4L4XA 3F1KA 4B3JA 5IZCC 1I3KA 2ZIZA 2CVZA 4MOWA 4H3VA 4CL8A 2X9NA 1HEUA 3V1YA 4CMHA 1WZEA 4XB1A 1XLTA 1WMAA 3RUDA 3HN7A 2AQHA 2JCVA 3LQFA 4AL4A 1TT5A 4TRRA 1E92A 1HYEA 5JAZA 4GGOA 3B1FA 3KHUA 1DC5A 1OI7A 5ICSA 1BW9B 1H9AA 1GZ6A 1DIGA 1U7TA 1BXGB 1DIAA 2DPHA 4A26A 5GZ6A 4OAQA 3M6IA 3UUWA 2QW8A 4MP6A 2PTGA 2VWQA 1KVUA 2R6JA 4UEJA 3OIDA 3HHPA 1JWAB 2IEDA 3RFTA 4DXHA 1B2LA 1EVZA 2AW5A 3HJAA 3RC2A 3I9LA 4LCJA 5HRUA 3CIFA 4Z0TA 4PRKA 4RJTA 4WCDA 4MVJF 2O3TA 1U1IA 4R1TA 2AHRA 2DFVA 3LT1A 3BMQB 1H6AA 5JPIA 4IUYA 3Q9NA 4LISA 1NFFA 1J0XO 4KDFA 3INRA 4QFCA 4R1NA 3RIHA 3SLKA 5IXSA 4JIGA 5TF4A 3H9EO 4DMMA 3V1TC 5L4LA 2OP1A 3E8XA 2BFPA 3PJDA 5ILGA 4HP8A 1R0LA 3E6AA 4YJFB 3K2EA 3UFXA 4EEZA 2NLOA 1YWGO 4W7IA 1D3AA 2WD7B 3D0OA 3H5NA 2D4AA 3WGGA 3OQ6A 1W8DA 1LLUA 2NNLD 3KV3O 2RIRA 4E21A 3PXXA 4YAGA 1HDZA 2PD3A 1BDMA 2EGGA 1LA2A 4WLFA 2EJVA 4J1SA 4JJGA 1EVIA 3SC6A 2VWPA
chains in the Genus database with same CATH superfamily
4RA6A 4AY3A 1BX3A 2O23A 4PV7A 5AW4A 3RKRA 4PIPA 5BQXA 1Y8QB 2AFVA 4IEIA 4JP8A 4NPCA 2FX5A 3OPQA 4QBIA 2O1XA 4LBVA 2B0JA 2YS7A 3Q3GE 5H1YA 1A9TA 3FVRA 1G3UA 3NC4A 4ZHSA 4DIDA 2W2KA 4FKZA 3BMCA 3TGPA 3N0RA 2D7DA 1H85A 4B3IA 5KNLA 1CJUC 4H0NA 2H1CA 3QF4B 1NTOA 2ODAA 2BFBA 3A4NA 3RUCA 2PEZA 4Q6WA 2ODWA 1Z5NA 4PAMA 4KYIB 3TSYA 3VX3A 2P67A 1FDUA 1Z5ZA 4EYKA 1FFWA 2W6IA 3ZD7A 2Z3ZA 2OYCA 4CYMA 3SF8A 5AW5A 3R3YA 2GM5A 4Z3DA 3T4XA 1JIXA 1KL7A 2QUZA 5CDGA 1FTSA 3NV7A 5FTWA 2XBMA 4P4TA 1GN8A 2IZZA 1OTXA 2A33A 3O4FA 4QVKA 1FDIA 2XHEA 2WPNA 4YP5A 4QXQA 3UMSA 5T7BA 4A3SA 1TMKA 1JDSA 1DXYA 4KX5A 5CT8A 3FOFC 3FYUC 4TV8B 5HCUA 1QM5A 2H2HA 4EG3A 4JX9A 5CAEB 4L51A 3R0JA 4JEUA 2WMDA 5LIRA 4ESOA 1UMDA 2IYUA 2YQZA 2D0PB 2P8JA 1MPXA 4DIMA 4IDAA 1JXQA 4XR9A 4A8JC 3SXUB 2PH3A 3KQHA 2C4UA 4H3KB 4ILEA 5T57A 1W4ZA 3WG9A 4KZPA 1FXUA 3TNLA 1QQTA 3A9RA 4EW2A 3UGJA 2Q4TA 2COEA 3DZJA 3RW9A 1UKBA 3P2MA 4XIYA 3PEFA 2PQ0A 4ESHA 5KSWB 3P2OA 4FILA 3IUSA 3CC8A 1T5HX 2H4HA 1NYLA 4DLZA 1FMCA 5HGXA 1UBUS 5G40A 3ZCQA 1FFYA 2FRDA 5CIYA 4S1TA 1M1ZA 1JFVA 3P9NA 1ZGAA 2FDRA 2GEFA 3BF7A 2VAXA 3ZKWA 3WYGA 3EIEA 1OBOA 3GQVA 4WNIA 4RKFA 4EITA 1F7UA 4P35A 1ZONA 3K6SB 2V54A 1ST3A 1U5CA 3ILXA 2O54A 3WLTA 1KAQA 1Y1LA 5AVJA 1WUKS 1SEPA 1E79A 3TH5A 2C2WA 2VNJA 5JUWA 1YU9A 4QDOA 1PO7A 1KYVA 3URKA 1NULA 1AQUA 3AHFA 3L41A 3AL2A 3T7DA 2BRUC 1MB9A 4FGKA 3KP1A 4I4TA 5HQJA 4Z9FA 3EXG2 3PTLA 4O25A 3KCQA 4I1UA 2CXTA 4ZZ0A 1SOMA 3BWYA 3ZEIA 2VHYA 2XUJA 4PPGA 1A8PA 3OJXA 2QQ0A 1OB5A 4MDFA 1AB6A 2FN7A 1MMFB 3V8NA 1BFDA 1MB2A 5EMJA 2B4KA 3TB6A 2BDUA 4U9UA 4KYTA 2IF0A 2VHWA 3A6KA 2L18A 3FTQA 3KJEA 5CLLA 1G5PA 4Z99A 1E7QA 2VKQA 1UDRA 2W8BB 1G9TA 3NOXA 1H3NA 4OHUA 4HG2A 2VPZA 2OLKA 4HOYA 2XQVA 1Z16A 2PZBA 5IRCD 2QRVA 4UMDA 6REQB 1UKEA 3GUVA 3WX0A 3U4AA 2RH8A 1B8NA 3L8YA 4YAFA 2ATVA 5IW8A 4QUAA 3WK8A 1FP2A 2PUFA 5KCMA 4GAEA 3LOUA 2IE8A 3N6RA 1P6QA 3T1HB 4I3HA 5EIAA 2C03A 5C8YB 1SXPA 3CZ4A 4DLUA 1SBCA 2IHJA 3PFKA 4NEHB 5ES3A 1TD9A 2OGSA 3RCBA 3CLUC 3K0AA 4XGQA 5CFRA 3I62A 4PLPA 5HFNA 3T0IA 2ZATA 1F20A 3L2OB 2H08A 1NWCA 2CLIB 2NOAA 3M6VA 1OKKD 2H1FA 2W98A 2O2XA 3LX6A 1Q95A 3IUEA 4BMPB 5BSUA 5JH7F 1QOPB 2HGZA 2RHLA 1OB2A 1KAGA 4C87A 3CTPA 1OGIA 2J9FB 2QI9F 1IY1A 4Q4LA 5DI9A 3ZWQA 5B6PA 3FSRA 4HQ0A 5A3RA 4XCXA 4BP3A 3JAMA 3EQ8A 5K0SA 1A8QA 1P9RA 2NXNA 4QEZA 4QUHA 3ELWA 4M6WB 2CXXA 5AKIA 4ZYTA 3W2FA 5I7RA 2W43A 5H8WA 1YE8A 5IT5A 3N58A 1GTZA 1S6YA 2F43B 2SHKA 4C7BA 1IIRA 1MO2A 1E3DA 1QHEA 1ID1A 3PYLA 1KMHA 2PGJA 4FHDA 1N2CB 3BCHA 1WBBA 5JLJA 1JPNA 2UXDB 5D8DA 2QTLA 4Q05A 4HEA6 2PU5A 3PHLA 1COZA 3PQDA 2H2FA 3ITNA 1DIRA 4LRSB 1TJ3A 5DMHA 5J9FA 3ZN2A 2J07A 5BQ3A 2YXDA 3D3WB 3VDMA 2X9VA 1QC5A 1F48A 1LJUA 4RTPA 1JI0A 4ARUA 3I76A 3NGMA 4LY9A 2XQFA 1K27A 4LJ9A 4FCWA 5EJ2A 1HY3A 1Y48E 3R8XA 3C3MA 1C3JA 1DBSA 2C42A 1J20A 4Z4IA 2IOFA 4O4LF 2WHRA 3RBAA 4KBFA 1E1NA 5JOQA 5KQPA 5DN6A 1IN6A 4FD2A 5TS2A 3B38A 4NBRA 5HMLA 5C4MA 1NUTA 5ULLA 5K6RA 3LIIA 4A7PA 4FWTA 2ECKA 4OAPA 3WKEA 5A1TA 3NWJA 3ZD8A 3HHEA 3QPDA 1K3TA 4ZREA 1XN1A 1T3SA 3JQGA 3NJ8A 1AE1A 2VPYA 4JLVA 2B98A 2FK8A 4KXMA 4GX2A 5EKTA 1UPUA 3V1MA 4PX5A 4KTVE 3A1FA 3ZC3A 4PYQA 2WIJA 3B6IA 3KZXA 1MTOA 3GVHA 1XL0A 3LDHA 2BMVA 1QOQB 4JLSA 5GV8A 5KYXB 1I9GA 1QG4A 1AQIA 4X1IA 3HBAA 2CHEA 1Z0FA 2IWRA 4FGJA 4Q4DA 4AS1A 4CQNA 2FR1A 3X2EA 4C6TB 4AECA 1AKEA 4XWTA 2FZLA 2O7QA 3AR7A 1RPJA 4O2AB 3PQ2A 3NDJA 4C4ZA 5SV2A 1W30A 4PQFA 1MOSA 1SUEA 1U81A 1F0PA 1UFRA 2J87A 2XQGA 2YY7A 3AC0A 4M1MA 1U2GC 3H2BA 2FHSA 2XRFA 1G16A 5BR4A 1HNNA 1TCUA 3OLCX 3FUTA 3VPDA 4HB3A 3A3PA 1YTUA 2ZBEA 5HOQA 4YXFA 4OHYA 2GKGA 2F62A 3CRW1 4Q4JA 5A05A 3STWA 2WYOA 4PLYA 1PZFA 4EG8A 5IANA 1UBEA 4HDNB 4K46A 1H6CA 1L7BA 1YRBA 4JB0A 5JVDF 4UNRA 1KYXA 3UAXA 2H1IA 1PFUA 3D4LA 1GM5A 1X92A 1IH8A 1LI5A 4YAEA 3WB0A 4D4GA 2ERXA 1V5EA 1YD7A 1X9GA 4K3VA 2NUTA 2GYVA 5AUOB 3EX7C 2YWJA 1KEPA 2YJTD 4MQ4A 5BYAA 3OY7A 4FQ7A 1OWOA 1OBCA 3JYPA 1F8UA 1SHZA 4F2DA 3OCWA 2CJPA 1Z6GA 3IRUA 3ZWYA 4B6FA 2QUKA 1JXAA 2PKWA 1NVGA 4FMCF 2H1OA 2PMDA 2NPIA 2QDXA 3NBFA 4TYPA 3X1JA 4MULA 4YRIA 5KQMA 2H16A 1N5LA 4OHOA 1LDBA 1FMTA 2OXRA 3CNOA 3IVRA 4PC6A 1OVMA 3P0FA 1J1ZA 2B35A 2NSDA 4J4BA 4M1ZA 1H65A 1FFXB 5H59A 2VYVD 1BGXT 4IZ6A 4JHLA 3QU4A 3RC8A 4BMVA 4FDMA 2AKEA 3VU9B 3TW4A 5IEJA 1JDPA 2QR2A 4M38A 3QPVA 3R23A 3D9QX 2HU5A 1QP0A 3L5KA 3VPSA 4HEA1 4OJYA 1NRXA 1YZTA 3BSWA 1FSFA 5CD9A 1I0LA 2G4LA 3KDAA 2P6OA 2W2LA 3GRZA 1G21A 3NAQA 4I4TF 1DAMA 1ZD1A 2Z57A 1P45A 4JEMA 4B79A 4D96A 5IT9A 4Z5XA 1WKVA 3MWEA 5EN4A 3A9TA 3HFJA 3SXJA 5TR9A 2BMJA 1ZRNA 4DSOA 4YRJA 2C58A 2WTXA 4MKHA 5E1OA 4NZOA 2IIBA 3RRMA 4YR7A 2EIXA 2GBPA 3S7ZA 5F7XA 2OHIA 2C07A 3LXMA 2XW6A 4HEQA 3DVRX 4I4CA 3V97A 5AW2A 1SH7A 1BU8A 2Z4RA 4M1QA 1T9GS 3ICCA 1VQ1A 2C84A 3KSUA 3T38A 4ZCRA 1M6WA 1QP8A 5EP2A 2XMDA 4HXYA 1L5WA 5CH8A 1ZWLA 5B36A 2NVUB 1LY1A 1G9XA 1C9EA 2AN1A 3IVAA 1UJMA 3HA2A 3RSZA 3WDSA 3SQWA 3MCVA 4BZPA 4DCSA 4GKAA 3VHQA 4DR3B 1R3UA 3GLFA 3UH0A 4JBIA 4TSRA 1GKIA 1RYBA 4BUJA 4J0DA 1RJDA 2AQKA 2P3LA 3OPYA 5ALUA 3OZTA 2FFQA 4Y2VA 1KRXA 4NZPA 2V7BA 3R5SA 5DTRA 4BNKA 3QIAA 1QHIA 2ECFA 3AR2A 2QN1A 4DA7A 4L9SA 4DCJA 1XLWA 2HLNA 1EVKA 3KQSA 3DT8A 2LVBA 2HEIA 5FWDA 1MIOB 3UPUA 1NUQA 4RIEA 3GT3A 4B31A 2GD2A 2BW0A 4EX7A 4L95C 3ZY3A 5ETJA 2WIGA 1GTMA 4H7HA 4WOJA 5CVJA 2QXUA 1PCXA 5WRFA 1ZBQA 4J2HA 1FUIA 1RM5A 4BCCA 3MJ4A 3L7LA 1L1QA 4I66A 1NN3A 2V0NA 1J7KA 4RS3A 4AZTA 4NOJA 4R40A 1JHYA 4WN3A 3CKLA 5DCWA 5JO9A 5I7WA 2FGKA 1LSSA 2HRBA 3DBOB 2W71A 4EF4A 1KQOA 4P2BA 1F3OA 3OE4A 2O4CA 1U0HC 1A9PA 2O57A 3QI7A 4E33A 4MUIA 4RH3A 4QYSA 1X39A 1PHPA 4B6QA 3IUPA 5T4BA 5K2OA 2FSFA 4C07A 5BOSB 1NVVR 1OLSA 3L1HA 4OPMA 2F9FA 1ZI6A 4MHOA 1IY2A 1ULBA 2GZDA 4D4JA 3A6LA 2B5WA 1LNQA 3N28A 3ETDA 4DSZA 4LDZA 4HL6A 1GLNA 3HJCA 1M73E 1MBZA 1PP4A 4HWPA 2HX1A 4CVNA 1S3FA 1YZHA 1KORA 1BWPA 2BGMA 4CQMD 3F4BA 4KL8S 2Y1KA 2G9NA 1ZNYA 2OZPA 2R8EA 3DO6A 2Y4OA 3AV3A 3DE6X 3Q8KA 1VPWA 3WYAA 1IHYA 4ZRDA 4NU5A 1ISSA 2X4DA 2PGOA 4QYWA 4Z0PA 4DNXA 5EC8A 4XVCA 5HZGA 2F48A 2I6TA 2I99A 2SICE 4V1CA 2CDBA 4WECA 3UEOA 3ABIA 4V3BA 3FCCA 3MB8A 2BN4A 1XZFA 3JQAB 1V9CA 1MOQA 3CPJB 1N2GA 2CNWD 4JVMA 5DISB 1KP2A 1FP7A 3TNJA 1ISFA 3WV5A 5JADA 1EM8A 1RIIA 2XVAA 4ZZ3A 2R4UA 1IOLA 5E4YA 1KZGB 1KI8A 1XTIA 4N49A 4P0QB 4I8XA 3LW7A 1Z8FA 1OROA 3V4PB 5HQ3A 2EARA 2HHLA 1WCYA 5ICFA 3IP3A 3UH1A 5IAJA 3RU9A 4OAOA 4IXDA 1X1EA 1IY8A 3NPMA 1B43A 1TGYA 2HI0A 5BNFA 2LNDA 1T1RA 4US2R 1UC5B 2HQSA 5FHRA 3TW8B 1FJGB 1KO7A 1U02A 2JARA 1DS6A 2X15A 3OLWA 4D7AA 2JAWA 4X8OA 1Z2CA 3IPRA 3WNCA 4X20B 1YNOA 5IKMA 2ILVA 2IYRA 3CEJA 4HNHA 3SYRA 3NP7A 4D8XA 4DWOA 1T1IA 1L7VC 1R37A 4QU5A 1C0EA 4FSXA 5BRNA 2OKGA 1L9KA 2PUTA 2HWYA 2WWFA 1P1IA 2YHIA 3AHIA 1T0PA 3DJFA 1WV1A 4M53A 2LGJA 4N5DA 3W6UA 2JI6A 2XWBF 4ZT5A 5CA0F 1JVSA 1ENOA 1Q92A 1DDIA 1K7EB 3BHNA 3FFXA 1JQJC 1UINA 5BVGA 2CDCA 5KPDA 2I4TA 1G8PA 3VR2A 1RZRA 3UB3A 1C3OA 2QLMA 3U4MA 4EB0A 2MYPA 3GD7A 5HUQA 1REQA 3ZY6A 3OJWA 3IUQA 1N7HA 5DLDA 3MLAA 2KB0A 1KDVA 5B64A 5EEHA 2OECA 4AY6A 1V4VA 1X80A 2W4QA 3D2BA 3O38A 1Y3HA 5G0VA 3NPAA 1RAFA 2XQJA 4ZI3A 1IXRC 2AMJA 2J7KA 2GM3A 5DB4A 5EZ5A 2WIDA 1SN7A 3JPWA 2F8SA 2BCJQ 1ODIA 3NCHA 1I3NA 3B6MA 3O73A 1DOZA 2D13A 1VIVA 4MVJP 5HF6A 3QV2A 5FBHA 4AJEA 3BRWD 3CJQA 1C1DB 2GI4A 2PGLA 1O6ZA 4P3OA 5JDIC 4DUPA 3IXLA 3ZY4A 4AJHA 1N32B 3WGVA 4EFNA 1QDEA 1KI7A 3F0TA 3LKBA 3FOWA 1ZS9A 3IE2A 2BDEA 1GNQA 4INZA 4W1QA 2DR0A 3I0ZA 1JLHA 4W1SA 4QJIA 5K3FB 4AIIA 2B1IA 4I14A 4QGHA 2TMKA 3GV0A 5IX8A 4HB2A 5K45A 2R8XA 2XCTB 1AV6A 4PX9A 3NG1A 3ADDA 2F1RA 4L15A 5IJZA 2GHTA 4GW3A 2XUOA 2VEOA 1MQSA 4PYMA 1Y7PA 2CBXA 2C2KA 2RGBA 3FB4A 2HLPA 4LI0A 2WU3A 3QKRA 3KL2A 2ESRA 5AJTA 3OM8A 2IODA 2NADA 5J5VA 2IHUA 4S04A 3M33A 1S01A 3FYDA 2XKJE 3LC1O 3L7JA 3MSXA 3NHMA 2IE0A 4LGVA 5D3MB 1YS6A 3ET4A 3GU3A 4RTMA 2NUPB 4KE9A 3SZ3A 2ZSFA 4AUNA 3X1ZA 2FSSA 1JZSA 2XYPA 1NQAO 3QFFA 2VYNA 2XCOA 5ALWA 2QR3A 3A28A 5AESA 5BWCA 3I1YA 4YJHB 3ZJ5A 3VPCA 3A1VA 1B1AA 4PXAA 4CL3A 5JY1A 2P9ZA 2Z5LA 2M6LA 1SG9A 4PPYA 1MB4A 3NTRA 4CMCA 2SBTA 4PCAA 4MR9B 4B6OA 1V8FA 4BNNA 5HXAA 2JAHA 3VH1A 2EZ4A 1KNXA 2PK3A 2W90A 1SR8A 1YZUA 3HDJA 3L0OA 3LX5A 4F4IA 4LF7B 3MTEA 4YTEA 1KDOA 4G5OA 3ICOA 1PJSA 2FVXA 4JC8A 1LDEA 4MARA 3E9MA 1RTTA 5T4FA 4D81A 3A2KA 4V38A 5IULC 1N8KA 1RWPA 1Y63A 2QA5A 4GX0A 4NCHA 1D4AA 2MSWA 4YUZA 1WXEA 2VK1A 3HPQA 3G5TA 4XJVA 4HAZA 3TTVA 1QRTA 1I2MA 4P98A 5CCBA 1RBMA 4WOBA 1FX0A 5AW8A 3JATB 4KPEC 3DVSX 3LZDA 4MKIA 3RU2A 1EFCA 5JANA 2Z4TA 2A14A 1Y4DE 2AZDA 2NVBA 3EBOA 1NVBA 3OTGA 3H6KA 3PR3A 3LNTA 4V0SA 2ZU0C 4YNBA 4C1NA 3R6GA 4F2PA 2C98A 3NUGA 1UK7A 1RWBA 5LOVB 1BROA 4TZ0A 1NG9A 1D4FA 1LRKA 1U1EA 2AHOA 1O5OA 3JZMA 1KYZA 4M1SA 4EJMA 2DB3A 1LFDB 2PPLA 2CW5A 1XG5A 3QVWA 2WKRA 1V96A 2Q2VA 4HMPA 4BNWA 2DM6A 3ZE6A 2CD7A 7REQA 4LQDA 2O0HA 2WM9B 2Q45A 2QYSA 2YQ4A 2ZS8A 3EXIA 3FNRA 3O4RA 4DV1B 4LZZA 1JQBA 2X86A 4NABA 4KPUB 3JQDA 4YMHA 1PIWA 4DLSA 4MYHA 3IQFA 3RWMB 3JQ6A 4S1OA 3TXAA 4YRMA 1HXHA 3OX1A 1QTQA 2W6QA 4MAAA 2EERA 3NYRA 2P6PA 4GOMD 3B85A 4BLUA 1C8BA 3ZDDA 2G36A 5FORA 4NJOA 4C0KA 4QBFA 2NU7A 4OM7A 4X1YB 5DBEX 5F3RA 3Q6IA 3NJRA 4J49A 1PJ4A 2AUNA 5CDTA 1SOAA 1O2DA 2VKTA 1ZU5A 4CRWB 4D9MA 1W0KD 4QOIA 3BIXA 4UHFA 5KX5B 8LDHA 3JYNA 2BLNA 3DEFA 1THTA 1E7YA 3KQQA 3RVBA 1EVQA 1GU0A 1SOWA 2VPIA 2G1KA 3OO0A 3V4OA 1R74A 1KGSA 2Y9PB 3AZPA 3GLHB 3GZNB 4O4IB 5LXTF 2BP7B 4EG4A 5IK2D 2NYVA 2D5IA 2YVQA 3HGTA 3P0HA 4ZKEA 1RHUA 3IP6A 3MG9A 1QIHA 4JOSA 4CG1A 1F2VA 2JFNA 3A7EA 3AI1A 3JCZA 4TL9A 3DLIA 4OQNA 1HSZA 3NDIA 3KKZA 4D3DA 3Q88A 3AFNA 3C43A 5G02A 5C8DA 1GZ7A 3M34A 5FTMA 4I9GA 1AK9A 4YRFA 4ZWNA 3TLBA 3TLMA 5KYYB 1ABBA 2V59A 3MCTA 4IVQA 1MUUA 1P8JA 3MM4A 4GECA 3RB8A 1YFLA 1S3GA 4B3TB 3M4NA 2OT3B 2IPAB 2OESA 3NHSA 4J8PA 4L8FA 2JHPA 4A36A 4FLEA 5EHXA 3ONEA 3TSZA 1WHTB 4QUDA 3FROA 3C3WA 4N9WA 1DTEA 3HCEA 5I7OA 5F9FA 2BKVA 2EZUA 1FL9A 3RS3A 1WHSB 2QI9C 1E3WA 3PKJA 1KI6A 2ZSEA 4O2BB 1JIIA 4LSZA 1WW2A 1J42A 2JDID 2ZR9A 4EMBA 2C8VA 1Q6YA 4JNKA 2NZVG 1QYIA 1I33A 2DG2A 2EKQA 3GGDA 2Z8ZA 3FN4A 4P22A 1RJ9A 4LVOA 3QKWA 5L51A 3PFWO 1CFZA 2WT8A 3NH9A 1TYEB 3QU5A 5KPJA 1OFHA 4HSGA 5EP1A 1S2LA 2GXSA 1E9VA 3DZGA 4GRDA 5EXSA 3EFOB 4J3NA 1H8HA 5A6SA 1RWKA 4RZUA 5CDUA 2O3UA 5E7JA 1M75A 2D2XA 1N3YA 2AJLI 3QQ5A 1FEZA 4GPAA 4K9DA 1RAAA 3H1GA 3VNSA 3ZEAA 3GN2A 4OX9Y 4RETA 4ZCTA 3I5MA 3OQIB 4UEKA 4WK0B 1PQWA 2IUUA 1JKMA 4ARCA 4LZNA 1W59A 1O97D 3ESRA 4TQGA 3QLTA 3GCZA 3IEKA 2ZI3A 5LD2B 4ZK6A 1CKEA 1JHVA 4L5IA 1ZCBA 3HDTA 1Y9AA 4GXTA 1X7XB 4Q34A 3STTA 1UOQA 3ZLBA 5K0BA 1ORWA 3TB4A 1G8JA 4V0ME 4WZ6A 1NZFA 1OC2A 2GPTA 2J6BA 3BGSA 3JQ7A 3K2BA 3WJ1A 4HWGA 2OZKA 3MOSA 1M2NA 5ITVA 4ZQCB 2YKGA 4YRGA 1VP3A 4Q3OA 4A2CA 3THYA 2GXQA 1EHIA 1DQNA 3BM5A 3L0BA 4CKCB 4HVTA 4PZ9A 5EZQA 2Y66A 4ZHQB 1QAMA 2C4HA 4W1RA 1E0SA 4PAWA 2A0XA 2JGDB 4LOIA 3F6YA 4WNCA 3UOWA 4D5EA 4C6SA 1ZITA 2VA9A 4RA9B 4AJKA 2FJ0A 2XAAA 3ZV3A 2VLIA 4P58A 1RKVA 2Q2WA 2HRDA 1XUOA 3ZDYB 2X5XA 4ON9A 4BNYA 1FXSA 3U3JA 4MVYA 4DR7B 3JVUA 4CGZA 1X94A 4PG8A 1P74A 1CUBA 1WCV1 1ZL2A 2JK1A 5IJ0A 1E1DA 4W5RA 4PLGA 2W6NA 4RVNA 2B37A 4R9RA 4FN5A 1U8EA 4XD7A 5AKLA 4ID9A 5EAIA 3RASA 1KE1A 3TJRA 3U1BA 2FPIB 4M54A 2GZRA 4FFSA 1QQ6A 1C1XB 2VNKA 2Z2YA 3MTAA 4FEEA 1WE2A 5B37A 3AL3A 3ZHXA 4ALMA 3NVAA 5KVCA 1BG6A 1E3QA 1OAAA 1CS0A 3FKQA 3KOOA 4U02A 1BQ3A 3OX2A 5AYVA 3K6RA 3F3KA 1G38A 2G9QA 1UKVY 1DKRA 2FWNA 4UW9A 4ZCSA 5I9TA 3PHGA 3ZGZA 4BE4A 2PS9A 1EUZA 4JZYA 4N18A 1E7WA 4B74A 4ER5A 3IIIA 4D9BA 1TZBA 4MUAA 3AR4A 3OT4A 2Y3IA 2H6EA 5MDHA 2B1RA 2V8OA 1VLZA 4P7KA 4IXNA 1EK1A 4GWLA 2CFOA 1Z5PA 2F4NA 3GRKA 1O89A 3W78A 1ULUA 4IHJA 1OZ0A 1EFUA 1Q1QA 1E1RD 2GCEA 2OBBA 3DKIA 3RLIA 2C88A 3NM6B 4JJAA 3TI7A 4DKXA 5KYUB 1Y4UA 4DG8A 4MVJG 1N34B 1JHDA 2H4WA 2OCKA 3NVDA 3QOFA 2FZWA 3AVYA 3T1OA 4DVJA 5CITA 2WJPA 4N3AA 3X3HA 3QZUA 4G4GA 1USIA 1D8AA 4NYJQ 4EDFA 1WEHA 5A0TA 2HFKA 3NHAA 4YMGA 5JATA 1GGNA 5BN1A 2FW8A 3PPIA 2NYAA 3CX4A 1TB4A 1IBCA 2IYSA 2ZYTX 1ULTA 1HOXA 1QHSA 1RZUA 1IN8A 2PVPA 3P2IA 3QEOA 2CK3D 3ZYZA 3IA7A 4E32A 2PIAA 1TJ5A 3QFCA 3AK4A 5LP1A 1D03A 2V3VA 1ZUHA 5J4KA 1NJGA 2DTDA 3HU3A 3GUUA 1Z8DA 2VLBA 3PNPA 3B9RA 3OZIA 2BSXA 2PKRA 2VQDA 4AMGA 4BNMA 3ANTA 1DWPA 4C04A 4HXFB 4MW5A 2GN2A 4PS1A 1ODFA 4BHTA 1JIUA 4CMIB 3K0BA 5JZOA 3UA3A 3C5HA 5LWQA 3ORHA 5JNTA 4JFAA 4LDPA 3KXLA 2QPOA 1ADCA 3UJBA 5KHOC 4XIGS 4I4IA 4YS6A 3DVQX 1KAEA 1QCYA 1O87A 2FB9A 1A77A 3HBLA 3JARB 3HL4A 4KVAA 4KPYA 4HAVA 3H05A 3LKVA 4Q0MA 3THXB 3I64A 1EU1A 1E5QA 3ZDRA 3PGXA 2ZUBA 4QD3A 3ZDAA 1XTTA 3WP1B 2R6AA 2BISA 1I3MA 1W6RA 2ZITA 4NF2A 4UMEA 1JS1X 1WL8A 3SHFA 4OLBA 5E6RB 3QKTA 4DCTA 3AM4A 1PBTA 1E8NA 2WVGA 4KOAA 2AX4A 2XKBA 4LX0A 3C3BA 1M6VB 3A0UA 4DPLA 2ZRPA 3T5BA 3U19A 2ZTLA 4NAHA 4AZ3A 1XCPA 4BRZA 2O7SA 4CN8A 1GFSA 3O0DA 5BN3B 3D54D 3D4IA 3LHIA 5DNWA 4N47A 4A23A 3O95A 5FNVF 2GN4A 4MV9A 1CEEA 3EGWA 5KOIA 2GFIA 3LT0A 1R6AA 1EIZA 3KKOA 5JBIA 4NDAA 3U16A 1U2EA 1M76A 4EABA 1G3IA 1CU1A 4F46A 3BBPA 4B9EA 2Z3WA 4NZMA 4A8TA 4JD5A 4LYYA 3V33A 3EIXA 4Q9AA 4K9RA 4YCSA 2E6KA 2HUNA 2YOGA 3DV0A 4AMYA 4B73A 3K70D 4QC2A 1NQTA 2G80A 4KAFA 1ZRHA 3AONB 4ZVKA 3S8YA 3KOUA 4YCBA 4YMVA 4H27A 3CYFA 1QYDA 1SVMA 3M1LA 4C5BA 4CR6A 1SD5A 2OO5A 3JX9A 4TTVA 2ILTA 5EJMA 1RQ7A 2EJBA 2G0NA 3ADOA 3U4GA 3TSWA 1URPA 2ZYDA 4LFCB 4ALKA 4DYVA 4O02B 1MEEA 1CBUA 1OYVA 3DDWA 2XX3A 3Q0TA 2XD4A 2I03A 1T1JA 3MERA 2BFWA 3HKEA 3VXKA 3MQ4A 1GZ3A 2R2AA 4COKA 2HHHB 4K05A 3ZVLA 4Y2UA 1BHO1 1D2CA 3LUDA 3PJRA 4F3TA 1CUGA 2NZUG 3GMTA 3EIFA 2XB4A 3WS7A 1XV5A 3UAGA 1MORA 5BSRA 2OVFA 2PLWA 2X8JA 3RC9A 1T0IA 1E1QD 2DQKA 4DNPA 3HB0A 1MX5A 4ZCQA 2E37A 1KJZA 1SU7A 4MPPA 3RRJA 2EQ5A 2REXB 1YZGA 4U8GA 1JSXA 3GRRA 4U39A 3E5RA 1XYGA 3MGBA 1Z2AA 3OT5A 4KQJA 4OUDB 2K7ZA 1RRKA 3GT0A 3JYLA 3Q3JB 1LVUA 3DOHA 2W58A 4GWKA 4QXPA 1DEHA 4D9IA 2QX8A 2X22A 3JQBA 5JCJD 1T4MA 3HNOA 4TMFA 4UMVA 1E2QA 1DHRA 2BHLA 3JVVA 4YQYA 1M5TA 3PYXA 1ONSA 2ECPA 2H59A 3G2NA 4XUGB 4YCLA 3NRCA 4NE2A 1YKGA 1HFWA 1PG5A 3ANMA 1CNMA 1IAVA 3OHSX 1IHXA 2GJ9A 2JVJA 3VKWA 3Q7IA 1SJ9A 2ZSKA 1ZUNA 3DQPA 3LDAA 4H7FA 4D25A 1EDEA 1IC6A 3E9EA 3L8GA 3P2JA 4AY4A 1B73A 5ITZB 2F2TA 3S8EA 1CP2A 4TWZA 2G67A 4FQ8A 3F1LA 3OF5A 3PQFA 1UDWA 4YUYA 1G19A 1VL0A 4QREA 4PQYA 1JHQA 1P4HA 5DEIA 5AW6A 3JZFA 3O8QA 3IQDB 5TQ0A 1ZGJA 1QV9A 1LDMA 1JDUA 1P8AA 2A7XA 3LWZA 4RF3A 4AZ0A 5I51A 1FBTA 2B2NA 3CF0A 1KFEB 2VBGA 4MB2A 2MSNA 2CF5A 5E6SA 5BSGA 2P78A 1KFKB 4B48A 4HDMA 3ZVRA 3F7TA 1ZNWA 1EB9A 1LB1B 2CLSA 3HCRA 5JISA 4LWOA 3OCVA 4WLVA 4DT1B 1E6CA 3V7WA 3UWMA 1IOZA 4DXDA 3AETA 4WE3A 5HVNA 1DB3A 1B0UA 1VECA 1WW8A 2PNJA 4EUEA 1HT2E 3CRNA 3IHTA 4G5SA 3TM4A 3TCXB 5K09A 4LV6A 3C1UA 3I9KA 2V65A 1SBHA 5AOBA 3Q3VA 3QJGA 1KJ9A 1L5KA 3RAJA 3TNYA 3KOMA 2QG9A 3PHBE 1YB7A 3IVGA 4GDMA 5IZ4A 1GVNB 4YJ3F 2WP8J 5LZ4A 4CU5A 1G8GA 1QF7A 1UBTS 4YEDA 2OA0A 4MJ7A 3OJOA 3VMMA 4C7OB 2HA5A 1VFNA 1MOPA 3PXEA 4NMMA 5F5NA 4IHJF 2D54A 1SQSA 4MIEA 1L5RA 3FNIA 2ZJ0A 1HQDA 3TPCA 4DBLC 4Z7JA 2ID8A 4YP6A 1BVUA 5FR1A 1UPXA 1FSPA 4JUCA 5TGDA 4OOEA 4TKUA 1T36B 4HUQA 1XVVA 4HTFB 4C7VA 1PEDA 2AEJA 1E0DA 3CEMA 3FNGA 4QIHA 4LOKA 3RO7A 4BRUA 5B1YA 4F4DA 1SBIA 3IUNA 4R1PA 5FCDA 3SDZA 1WO8A 3H16A 1QQAA 1V43A 4IH9A 1CG6A 1M1YE 2WUGA 3EVTA 3HO8A 1XZAA 5FI1B 3VSCA 4AM8A 3RYIB 4C14A 5HGJA 3GLTA 3NNNA 1E2DA 3PR1A 3F8TA 1M9NA 1CE8B 3TQFA 1XZNA 3SBDA 2WY2D 3FDIA 3N8DA 3PYMA 2RD2A 1VDZA 3IDZA 2GPNA 2GK6A 3UW3A 3DM9B 3M9XA 1S89A 1N4AA 1UR5A 4P5EA 3W1EA 4I1OA 4FHGA 1L9XA 4AYXA 1VKRA 4U7FA 1J5PA 5LWHA 3ORSA 3E58A 1SC9A 1E1LA 4KXFB 3VR3A 1HOTA 3EGXB 3PRYA 4ZIRA 1NR1A 4OFBA 2PZKA 2Q3EA 3H11B 1E2UA 3DKKA 1G5IA 4DN6A 3HEMA 1AMOA 4OK5A 5FR2A 3PGLA 4ALIA 2GEBA 4NH4A 1NBMA 1PYGA 1U90A 3EG5A 5F2NA 1YK0A 2B78A 3MRXA 4N40A 4F04A 2R8ZA 1ZA1A 1ZJ5A 2R4QA 1J0CA 3HCAA 4L7QA 1PW5A 5HCIA 1OH6A 2OILA 3AL0C 2D1SA 3IS3A 1R15A 5JO0A 3OESA 2RI1A 3RPEA 4WKCA 3KU4A 3A10A 4DL9A 3PVCA 3C4VA 2H85A 1A8SA 1RYEA 3KPVA 4MUMA 2Y0DA 3ORQA 4FIZA 4YMIA 3BE4A 4QXRA 2FPPB 1ZM7A 3VZBA 3IQWA 3RJTA 4CM8A 1VM6A 2GR9A 3NT2A 4HAUA 5FHQA 4AJNA 4CM5A 5DDIP 2JEZA 1WXFA 1DWUA 3KVRA 3VOAA 5EXPA 2I3GA 4GM4A 5CNJA 1W4RA 1CY8A 3S2ZA 3ZY2A 2D5BA 4EAQA 3T94A 1M5UA 1N5DA 1SBNE 3Q98A 1P1RA 2FOLA 1TCBA 2OK7A 1ZZEA 2QU8A 5KHAA 4GKJB 4M0CA 1JEOA 5EXTA 1THMA 4X65B 2QYOA 2VTBB 5EPUA 1GCUA 3U7QA 4DA9A 4V2IA 3HUEA 4DILA 1QH8A 2OOSA 1U9JA 1LS1A 1Z15A 1XJCA 2UUPA 2JLXA 2H4XA 4ZEOA 4DREA 1CD5A 1VHTA 1NC1A 2ZI4A 3RRNA 5E2IA 3A2MA 3QFRA 4ER3A 1D0VA 4II7A 3VNVA 3HYTA 4TYYA 1GADO 2PZLA 1FQWA 4KMSA 5I8PA 3D6AA 4WNAA 3KZVA 3G1UA 4KXQA 4OJNA 1NNSA 2IYNA 2QAIA 3RUAA 4KSBA 1ACMA 1VSVA 1HURA 3C3XA 4MPTA 1TUEA 2VVTA 1KGDA 2QG6A 1D2RA 4TRNA 3O8NA 3AJ9A 4FKBA 5CEJA 1JH9A 2WTBA 4E12A 1Y34E 5FEUA 4L8VA 3DONA 2DR3A 1EM6A 1QRUA 1H93A 1M2FA 3BD7A 1TUBA 3FSGD 4TXLA 2ORIA 4FTWA 5BUSA 3B5JA 3EDQA 3IP7A 3SIRA 4FPXA 2FPXA 1RE1A 5T4HA 4BU1A 4N82A 1EFLA 3ZBQA 4DCCA 1VCNA 1KZYC 4X24A 3WGKA 1QPGA 2A5DA 4HDQB 4C01A 2QD2A 2RHGB 2Y6VA 1WZNA 4Y9DA 2FFRA 3RVJA 3B82A 1J0EA 2VWHA 4A6XA 5KVVA 2I2AA 3ZV4A 4DEYA 2OXTA 3RVDA 4B33A 1I13A 2O0MA 3E3LA 1D4ZA 3BS4A 3P4YA 5U1PA 4P9NA 1L5NA 3WJAA 2FSVA 1DWOA 2VHEA 3PNLA 3A26A 4ID3A 4DV0B 2HH9A 4CQJA 2HV9A 4EOGA 1Q50A 3CHYA 1RVV1 3R20A 3WK5A 4I1PA 1BU5A 3DUWA 4CG3A 5I01A 5JW6A 3U4DA 4IX1A 2RI0A 4F85A 2HSJA 3AB8A 5JRDS 1OTYA 1L8XA 2FP4A 4HLCA 4C76A 2CV2A 3IULA 4H1VA 4NK4A 2HV8A 4GLFA 1ARZA 1RBZA 4IQ0A 2D2FA 4ZOLB 1G41A 1ZRMA 1AO0A 1UZLA 1VE3A 3PHIA 2IEZA 2ZJYA 3P9CA 1FP6A 3QEKA 3P52A 3ZXUB 1A7AA 1U8ZA 2PCLA 2UAGA 1EG2A 1DX4A 2DFDA 5IWCA 2QLTA 4IX9A 4FBLA 4XASA 3GFFA 4PN7A 4NESA 4EG6A 1YA8A 3JVEA 2P4EA 3SIPA 4OXQA 1RLMA 2A5YB 2D59A 4JLDA 1LS6A 1VIMA 2WYHA 4HN2A 4B3RB 4ZAWA 1RD4A 5IXJA 3IKVA 4XSGA 4ER7A 1MFZA 2H0RA 4DEXA 2ICAA 4Z3OA 2MYTA 4K9MA 1PR1A 5JRJA 1G5RA 3NHJA 2C7RA 2ZRFA 3FA2A 4L5JA 5EJFA 3CLRC 1KMIY 4BBZA 1QCZA 3GIDA 1DX6A 4DDKA 4NAUA 1UBNA 1L3IA 1CRZA 3KWLA 2HPAA 1HTWA 4FYMA 4KKVA 5FTLA 3CZ5A 2FQWA 1YU6A 2LW7A 2Q62A 1E6LA 1NBEA 4OI4A 4WZAB 4AYWA 1ZSNA 4X97A 1GTSA 1GR1A 3BMNB 2RHOA 3CPEA 4HK4A 2P5UA 4I4LA 1XEXA 1JR3D 3S27A 3ZLVA 4PN3A 10MHA 1J0DA 1XI2A 1G4HA 1WLYA 1SELA 4NAVA 3DTVB 1WETA 1N8NA 3K0CA 4QVGA 1TKRA 3ZQJA 3SDBA 3OT1B 5E6UA 5T41A 3OSZA 2VJOA 4RD2A 1NNI1 1P4GA 3CLTD 1C2TA 3OICA 4I1RA 3PXGA 5JDCA 3I6ZA 2HSGA 3M8KA 1RHKA 3SJZA 4QKQA 2E0IA 4HNTA 1XIVA 4FDTA 4M36A 5CT6A 5BYJA 2QL7A 1CUZA 1T5BA 3UAVA 1FBNA 4FJ2A 2YWXA 4MA5A 3UOAB 2DVMA 1CUCA 2C4MA 1TQDA 1EFRD 1TI7A 3NEAA 2AC4A 3R7FA 2IXEA 4BEJA 1HG1A 4HZIA 2QZ4A 2Z5FA 3R4VA 4JB3A 4BCBA 2GQ0A 3B3JA 3B70A 3BHJA 3U44B 3M1YA 1OASA 1WKBA 1NW9B 3KYDA 4XLZA 1LTKA 3OFJA 5IVPA 3U60B 1M1XB 1NVTA 1ORIA 1TM4E 1RFLA 4Y2TA 4RSHA 1DKUA 1EX9A 2PUJA 1A97A 2ECOA 4BKMA 4ZJZA 5BWNA 2FU5C 3EDYA 2FEMA 5IVDA 1DCTA 4G0ZA 2ES4A 2PU7A 4NDNE 2ZREA 1W19A 2A0YA 4INJA 3N1UA 4JQOA 5EP4A 1D9XA 4L85A 2HXGA 1N8TA 3ZJVA 1XPJA 2GBLC 1U8UA 3MUFA 1G9SA 3TR0A 1NBAA 4UUBA 1DRJA 3L4SO 3RS0A 1L3BA 2CEKA 2C3UA 3N05A 4Q3KA 2NMVA 1U28A 1YDEA 2ZIUB 1KF0A 1HYGA 2GRAA 3GDHA 3IX7A 4W5NA 3WWPA 4MV3A 6NULA 1UC8A 3FY4A 4P3XA 1NBIA 5EE3A 1YR7A 2WE7A 4S1VA 2X6RA 1ZUD1 4MYCA 4P3YA 3C98A 2Q46A 3DEHA 3T61A 3OEWA 2GEVA 2C2BA 1F14A 2QE7D 2AYXA 3I8SA 1KFJB 3JY6A 4I5DA 5A4AA 1I4TD 5C2JB 1Y6JA 2Q3LA 4TMYA 4HFNA 4EG7A 4H7IA 1XQVA 3THSA 3DOCA 3PKIA 5ALYA 4HNSA 4KWIA 2COUA 2ZDHA 1CF4A 3ND5A 2YCLA 1G8AA 4G8DA 4NK5A 4HVLA 3U56A 1VLMA 1U63A 3MWDB 4TKMA 4TS4A 4Q1BA