2X9GA

High resolution structure of tbptr1 in complex with pemetrexed
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structures of Trypanosoma Brucei Pteridine Reductase Ligand Complexes Inform on the Placement of New Molecular Entities in the Active Site of a Potential Drug Target
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 94
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x9gA00
2VZ9A 4IS3A 2WEKA 1K89A 2X5OA 3EYWA 3R3SA 3D4NA 4IDBA 1UAYA 3CZMA 4Y6RA 2QRKA 2ZTMA 4DIBA 3VC7A 1NFQA 2O3QA 3A9WA 3INRA 2GZ3A 1QV7A 3HSKA 4OM8A 5L95A 2UUOA 3LC7O 4N54A 2Y1GA 1RM3A 3DBLA 4CR8A 1O0SA 2OL4A 4YJHA 5G0UA 3OJEA 2F00A 3B70A 5KJEA 1DFHA 3KXDA 3V1TC 2B4QA 2WD8A 3BTVA 4GGOA 3O8QA 1ZBQA 4PZEA 5H81A 3VH2A 4BKPA 4ALJA 1NR1A 3WR5A 4CMEA 3C7AA 1Y7TA 4JXKA 4NI5A 1ENPA 4RF2A 5EJ2A 3PK0A 1ZKMA 2YHUA 3Q9UA 1VSVA 4P8RA 1X7HA 3ZV4A 3GGPA 1KVTA 4PVDA 3Q1LA 5L4LA 4HKTA 3L6OO 5TGDA 4J43A 3U4DA 4PLYA 1DAPA 3BHIA 1ISGA 4OKIA 4EEXA 2VTDA 2JCYA 2AEMA 4R1UA 5COAA 3OF2A 3OJOA 2YYYA 3TOXA 2PWZA 2AG8A 3GAZA 3KLPX 1V3TA 4E32A 3FD8A 2Q1WA 3PHJA 4YJFB 5DDIP 1IHXA 1H6AA 4G65A 2GZ1A 4CV0A 5JBIA 1P3DA 1PJBA 4DUPA 4A7PA 1LDNA 4DBZA 5TS3A 2DUUA 4J9UE 4DA9A 5CDTA 5JNLA 3DAFA 1GUFA 3RKUA 2ZCVA 3PQDA 4J0EA 3VPHA 2IZ0A 2O48X 3HN2A 3ZN2A 4DRYA 4YYZA 2QYTA 2BLLA 4WOJA 5C7LO 4KZPA 3WTBA 1QYDA 1P0CA 3AY7A 5COQA 1A4IA 2ZTLA 3O26A 3UVEA 5HTOA 2NADA 1H2BA 4XKJA 4UUOA 2YY7A 1PWZA 4IXWA 3G49A 1GEGA 3EVTA 4RDIA 1P74A 2A35A 4CLDA 2DT5A 1ISHA 1V3UA 4CM5A 1AN9A 3I6QA 5JY6A 5JMPA 4DIOA 1SOWA 4CM9A 4XQGA 1MC4A 3PJGA 4D79A 1ZXBA 4RPGA 1VPDA 1ZXLA 5EPOA 4D0RA 6ADHA 4XYMA 3TNLA 4IGEA 2WYWA 3FI9A 4BB6A 1I3NA 3EC7A 5BNIA 4O1MA 4NBTA 2I5PO 1SZJG 4DYDA 1OBFO 1E3SA 4XIYA 2PZJA 1R4MA 3F4LA 3AY3A 4BNGA 3PHGA 4KDEA 1UUFA 3IL2A 1E1NA 2HU2A 3FN4A 4IUYA 1DRVA 4KUEA 3IJPA 5FEUA 5JO0A 3ETGA 3GOHA 2BI8A 2A4KA 1F8FA 1BXGB 3HADA 5CDUA 3TF5A 1L7DA 4DLLA 4XYLA 3FNEA 3RQSA 4FJ2A 3D0OA 1VL0A 3NX4A 3HHPA 5FI3A 4DXHA 4PG6A 4XRGA 4J7XA 3EDMA 4RVGA 2OUIA 4K26A 4K9DA 2WWRA 3PFWO 4R51A 3L4BC 1E3IA 2CF6A 2PKQP 1YE3A 4BO0A 4OQYA 2Q45A 4JJFA 4Z9YA 2X0IA 4NDNE 3TFOA 5G0VA 4TRNA 1GYRA 1NYTA 4OHUA 5F5NA 1NASA 4LCJA 3VDRA 3DONA 3OETA 4XQEA 3D64A 3E82A 3JCZA 5LDHA 4NMHA 5L7YA 2JHFA 4Z9XA 3LLVA 2VYVA 2PLAA 3K6JA 1GR0A 1EVZA 2CMDA 4QO7A 3ZNNA 5C7OO 4U0KA 1GUZA 1R0KA 4PG8A 4PLHA 2I66A 4GX5A 1KVSA 3NTOA 5GY7A 4FFPA 3COSA 3AM4A 3NDRA 5CDGA 5IDWA 4RJTA 1KVQA 4U8GA 3ETDA 4CJXA 5C37A 1GFSA 4OXNA 2EGHA 3JQ6A 1PSDA 1YJQA 3Q2KA 3TJRA 3JSAA 4RVUA 2JAHA 3P2OA 2CD9A 2GN9A 3G1UA 3LT4A 5JC8A 2O2YA 2BFMA 4GQAA 3GH3A 3AM3A 3GY0A 1K3TA 3DBHB 1A5ZA 1T2EA 4QTZA 4EITA 1ULUA 3W8EA 4UVIA 4AFNA 4XEHA 3A4VA 3IP1A 3JQAB 3E5MA 3GEMA 4F6CA 3IKVA 4E31A 4Y98A 5HRUA 2ZTUA 2GGSA 4MJLA 2YDYA 3NDJA 4LRTB 5LC1A 2BD0A 5TQVA 4JGBA 5KVSA 2WD7A 1F12A 4QT0A 1EVYA 1EFLA 3RCBA 3LF1A 1A7AA 2PNFA 1NQOA 4AJ2A 3V1UA 1ZW1A 2FR8A 3VPGA 3VHRA 4J90A 1E77A 4R9SA 4YRBA 2OP0A 1XCBA 1HXHA 2CDBA 4TVOA 4XA8A 5CG2A 3HFSA 3N58A 4OH1A 4DVJA 4PLGA 1UAGA 1ISJA 3WJAA 1H6BA 1Q2XA 3GF4A 3ZWAA 4WLUA 2C5EA 3GVHA 3KYDA 4IJVA 5JYEA 1NM5A 3IMFA 1SNYA 2VQ3A 4INAA 4XR4A 4BNUA 1I3LA 3B6ZA 3Q11A 3MJVA 2I3AA 1E5QA 2GNAA 1F8GA 3HQ4O 3AK4A 3IJRA 1XG5A 2J6IA 2YFHA 2WSBA 3GFGA 3CZRA 5JDCC 3V1YA 4FGSA 3RUAA 4L0QA 1HDGO 5ER6A 1U7TA 1YWGO 5A9SB 4J1SA 4PVCA 2Q4BA 1ONOA 2GCGA 2PGJA 4GWGA 2X6TA 5MGBA 1Q7CA 2O3SA 4BOYA 2X86A 1M6HA 4E5NA 4XYBA 3DWFA 4XDZA 2GYYA 3ZU2A 3ZV6A 2OORA 1A4UA 4AJLA 1DRUA 1BW9A 5I7SA 3G0OA 4A03A 1J6UA 1LDGA 1QYVA 4ZHSA 3TZKA 2HMWA 1SB8A 2DBVO 3HNPA 3ZNPA 1BGVA 4TWRA 5K6AA 4MDHA 3FBGA 3QHAA 3WTCA 2Q4EA 4MPDA 2DC1A 1HWYA 4DYVA 1PJQA 4B8ZA 3LC1O 5IDYA 5KJ1A 5T5QA 2J3KA 1PZEA 4CM8A 4GMFA 1IE3A 3PGJA 1F17A 4JNKA 5HBRA 7MDHA 2PK3A 1A72A 4Z0TA 1Q0QA 2DBRA 2J3JA 2YHIB 4TZTA 4BV8A 2BH9A 5TC4A 1YRLA 3RFTA 4E4YA 1YB5A 1YL7A 1I2BA 1ISFA 4GKBA 4OXYA 3PDUA 4TRJA 2Z1NA 3W8FA 1HE4A 4PLCA 3IP3A 4TQGA 4XQCA 4MKRA 3OQ1A 1ONNA 4Q3BA 4I5EA 1BXKA 1ADBA 4DL9A 1LUAA 1JWBB 4BIIA 4W82A 4H15A 1VSUA 3H5RA 2FR1A 2AMFA 1D1SA 4PLZA 1I36A 2J5KA 3D7LA 1UDAA 3EW7A 3MTGA 3VAZA 3WB9A 2Y1OA 1F0YA 5LCXA 4BNVA 4DQXA 4IY1A 5C5IA 4YT4A 1U4OA 2IODA 4BL5A 1ZIDA 3AOEA 3L6EA 4KWIA 1KEVA 1BWSA 2Q46A 5JAZA 1I8TA 2O23A 5KJFA 1WAMA 2FOIA 2BI7A 3L07A 4J91A 1UZMA 3ZNQA 1U28A 4NPCA 2BGLA 4CUKA 2ZB7A 1XGKA 3DFUA 2E37A 2HK7A 3ZNOA 4E5MA 3UF0A 3NEPX 2J3IA 2BGKA 1VJ1A 1WXDA 1ZK0A 4J4TA 3JQ7A 4TKLA 4WASA 2YQ4A 1E5LA 1N1EA 3S2GA 2HRZA 5F3RA 3ROKA 4CUZA 3LF2A 3TZ6A 4BO7A 3AUAA 3ICPA 2DBZA 3ADPA 4I1IA 1PQWA 1TI7A 4D41A 2X9GA 3I9LA 3KRTA 4RPKA 4R41A 4AJ4A 3EZLA 1P1RA 1WMAA 2GN4A 3EMKA 4GH5A 1V9LA 4MVJP 3WGOA 4CLRA 1BHSA 2PH3A 1KYQA 4M54A 1UP6A 3RROA 4CM7A 4E2YA 2E48A 2RAFA 1TEHA 3WYBA 4FFMA 3W4IA 1RYDA 1PR3A 2IEDA 3GK3A 4C4OA 2Y05A 3T7EA 4CM8B 4BGEA 4NBUA 2E4AA 1N9GA 3PPIA 1CERA 5ER9A 2IRWA 5BSEA 1BRMA 2DFVA 4BNTA 3W6UA 3GA0A 1ENOA 4ALLA 3JQGA 4U6QA 3WIEA 3QRWA 4UVGA 4BO9A 2QZZA 5ENDA 4MVJI 3CIFA 3RUEA 5JSFA 4DQVA 4MIYA 4OKNA 4ND2A 4CM3A 4RLHA 1DJQA 1SAYA 1W8DA 2BFPA 3HB5X 4YTEA 3F46A 4MINA 1X1TA 3F3SA 1T1RA 3OJFA 4FC6A 3PWSA 4UUPA 4BKQA 1P1HA 3BIOA 2DPGA 4WLOA 3KETA 1JU9A 1Q0HA 3PGXA 4PG5A 2NV6A 3ANNA 3ZU4A 1ADCA 3ZWYA 4CQLA 3KO8A 2WYVA 4BQPA 3HDQA 1ENYA 1QV6A 3KM0A 1MLDA 2QQ5A 1DDOA 1WZEA 1EVIA 3F4BA 3GR6A 3OIGA 3ZHBA 4WEOA 5K0ZA 1XYGA 2FR0A 5I7EA 1D4FA 1E7QA 9LDBA 4E2XA 3GPDG 4WLVA 3ANLA 2DFDA 4FR5A 1GQYA 3D3WB 3ZH2A 1SCUA 3DTYA 4YA6A 9LDTA 1EUDA 1OMOA 1HDXA 1RM5A 4F46A 1ZSNA 1Z45A 2C2XA 3UN1A 1SB9A 1ZUD1 5G0WA 2VWPA 2VRCA 3GGGA 3HN7A 1U9JA 3IC5A 3KYCA 1HE5A 3GVPA 3H9GA 4WEQA 5A03A 1KERA 3DBRA 3OP4A 4J2HA 3BYZA 4IJKA 1VRWA 4J1QA 4RPHA 4UREA 4D46A 3EVNA 4D42A 4E5YA 3LLSA 5L51A 2D5CA 2DQ4A 5A02A 3BMQB 4R9RA 1KEWA 2GN6A 3IAHA 4II2A 1CWUA 1PJ4A 3GVIA 5EESA 4YQYA 1WW8A 3D1LA 2CSUA 4EI2A 3FWZA 4GVLA 2ZYAA 4IMRA 1C1XB 2C7GA 3AFNA 3HE3A 2NLOA 2OFPA 2TMDA 3DB2A 4DMLA 1GADO 3RC2A 1NBOA 2AQIA 4F45A 4E3ZA 3W4JA 1Q7GA 2D0IA 3QWAA 2LDXA 4TKMA 1XHLA 4BO6A 1Y8RA 1GEEA 2ZB4A 2AXQA 2HSDA 2EKPA 4H3VA 1NPYA 2NWQA 5DBGA 1PWXA 2ZJ0A 3BMQA 3DBHA 4KOAA 3M2PA 4IXTA 1T1SA 2VHVA 2YZ7A 2ZTVA 3DZIA 1E6UA 3RC1A 3V2GA 2VCYA 1ADFA 1XELA 1H0KA 3NTQA 2IZ1A 3UCXA 1WNTA 3QWIA 4WCFC 5ITWA 5FYDA 2P9GA 2VOEA 3L6DA 3PDJA 1P44A 2VWQA 3F1LA 3FTNA 4GX2A 3NV9A 4KTTE 4LMPA 4R3NA 5HA5A 2A9FA 3LSYA 1R0SA 4GKVA 1J4AA 5KVQA 2IZZA 4M86A 1HYHA 3ZW8A 5I7FA 1U3WA 3OQ6A 3VPXA 4WE3A 1DC3A 1DIAA 1X14A 4MIEA 3GNSA 4YAGA 1IYZA 3WGZA 2NU8A 1DFIA 3HB4X 2YV1A 1LEHA 3PIIA 4R68A 2X9VA 1LDBA 1LRLA 2JD1A 1WPQA 2YV3A 3D5QA 3C7DB 4QEDA 2RH8A 4KTVE 3JQ9A 3KZVA 3O03A 5CEJA 3BA1A 4FSHA 4BNWA 1IZ9A 2R6JA 2G5CA 4J49A 4QO8A 2PKRA 3RI3A 1H2HA 1TT5A 4HBGA 3UKOA 2BFAA 4DQUA 2PR2A 4UVHA 1YJ8A 1PJSA 4W99A 1ZMOA 1G1AA 2HMVA 1UXJA 1DHRA 2QX7A 4U5QA 3B1KA 3K30A 5GMOA 1IULA 2NQ8A 3BHMA 1CQJA 1YQGA 4LSMA 2X5JO 4LISA 1ENZA 4J0FA 1GQQA 3JQDA 2I65A 4CQLB 3K96A 1T2FA 3UAGA 3HUDA 2OBNA 4CM1A 1EE9A 2UDPA 5DN9A 2YUTA 3PYXA 1P31A 3BTSA 4XGIA 5CEFA 1NHGA 2ZIZA 5L40A 3WQSB 3DMTA 3JD4A 1K0UA 1FJHA 5AXDA 4YBZA 5IF3A 4MP8A 1J5PA 1B26A 1V3VA 4IDCA 4R5HA 4ZD6A 3RFXA 4C7KA 4I08A 4NR0A 2V7PA 2F1KA 1C3VA 2WJPA 3DZKA 1E7YA 4GAEA 4YXFA 2Y1DA 4I5FA 5GZ3A 3WICA 3WQQA 2HDHA 1MA0A 3M1AA 1JDJA 1RWBA 1S7CA 1KVUA 1VKNA 2JHGA 3PZRA 2AEFA 4EUEA 5CEEA 2P2SA 4IDAA 3SX2A 3DDNA 4RVSA 1JA9A 3BMNB 3DBLB 1OFGA 4RZHA 5DULA 4AJHA 1ULSA 2C20A 4JP3A 5BNTA 1A71A 4CMJA 4B4VA 6LDHA 4ZQEA 4GI2A 3RUDA 3M1LA 4HP8A 3BXXA 1FDSA 2DUWA 4GLOA 4UULA 5ITVA 1PGQA 3G1TA 1B8PA 5BSGA 3PJFA 2E6UX 1LDEA 3PYLA 2D59A 1E7WA 2VRBA 3L0DA 4YQZA 4YT2A 1G6KA 1LRKA 1QP8A 3AUTA 4ZN6A 5THKA 4K6CA 1I10A 4WLEA 4MKXA 4Z3DA 4PLVA 1MXHA 1Y8RB 2BHLA 3UCFA 1SEPA 3FRJA 4OQZA 4RO0A 3RUHA 3T4XA 3ZWWA 3WFIA 2EP7A 4J7UA 1EBUA 3EAGA 2UUPA 3WGQA 3EGOA 3PLRA 1L7EA 3PQEA 3WYCA 3C8MA 5T64A 3DZBA 2UV8A 3EHEA 2R00C 2Y99A 4U7WA 4IZIA 1N7GA 4DMMA 4CLRB 2VZ0A 3TFQA 1LC0A 2GDZA 5FWNA 4L76A 4CPDA 4O59O 3QA9A 4PRKA 4Y67A 5B4UA 3R6DA 3GRKA 4YJFA 1JVBA 2PV7A 4QX6A 4CL8A 2DKNA 2G17A 1PJ2A 4OSOA 4J1NA 3S8MA 4GWKA 4P4LA 3KOUA 4CMCA 4OO3A 3KEQA 4JJGA 4CLOA 4BNIA 4J9VA 3IKTA 1BVUA 1FXSA 1B15A 1J0XO 4HFJA 1P1FA 1OOEA 2VHWA 4PLFA 4XYEA 2X1HA 4E13A 4IM7A 3RU7A 4FB5A 5IN4A 1NR7A 3CMCO 3PEFA 4I9UA 5KOIA 3RASA 3WYEA 3I4CA 3VVCA 4X54A 3E8XA 3E9MA 4BV9A 4QUKA 2AQHA 5C3MA 3L4BA 4EDFA 4LRSB 4ZQHA 3OEYA 1I3MA 3ZWCA 1LLUA 4ROSA 5DBIA 1LJ8A 4AJOA 3SC6A 3ZWVA 3R0IA 5KJCA 1W4ZA 3ZWXA 1UH5A 2CY0A 3QP9A 4HWKA 1HL3A 4IDEA 4D3FA 1ZCJA 4LVCA 1PL6A 2NACA 4BHTA 2WDZA 2VHYA 3OSUA 2X8LA 2J5RA 3PHIA 1PQPA 1DOHA 1O8CA 3OHSX 2HJRA 5KCZA 1GD1O 1R66A 4NIMA 1Z7EA 5TF4A 5KWEA 3BMOA 4YAKA 4EEZA 1DBVO 2EWMA 2IE0A 1IY8A 1Q0LA 3W1VA 4L74A 4D0SA 1UJMA 5A4DA 2UAGA 4PZDA 1B7GO 2Q99A 4RV9A 3FNFA 1GYPA 4EUFA 1YVEI 4I9HA 1VE9A 3WIDA 3DHYA 4FJ0A 1IHYA 1N7HA 1U3TA 2GR9A 3WOHA 4BO8A 3SJ7A 4ESOA 2HAEA 2EEZA 1ZH8A 5CHEA 3VKVA 1ZO8A 2IXBA 4NH4A 2PGDA 1ZK3A 3E1KA 1AHIA 4HUJA 5DCWA 1R0LA 4FS3A 2XF8A 1O5IA 2HMTA 1LSUA 2R00A 1KY5A 2D3TA 2Z95A 3QVOA 3X2FA 5JCJD 3ABIA 2O4UX 1EDOA 3HDHA 2XPCA 4ZRMA 1BW9B 3EZYA 4HV4A 4J2OA 2QYSA 5ENVA 3GAFA 4ILKA 4IDFA 4WECA 3INTA 4PN3A 1D1TA 1HSZA 4N5LA 1G0NA 1I33A 5KJ6A 5JS6A 3SC4A 1CDOA 5CG1A 1GL3A 2VWHA 3NYWA 2LDBA 3ZWNA 3CPSA 1V8BA 3TL3A 4LMRA 2GZ2A 1H93A 4BNMA 1DIHA 4BNXA 4AG3A 1GY8A 4XRRA 4HNHA 4PLTA 2PKQO 3PTZA 4Q3DA 5MDHA 1KOLA 3RC9A 2H6EA 1UDCA 4QFCA 1C0KA 3Q9NA 5B37A 4A0SA 4N5NA 3UHAA 4Q3AA 3ZWBA 1NFRA 3PI7A 3GEDA 2EP5A 5EERA 4UUMA 1V35A 3GMSA 1ZJYA 1LDMA 2Y0EA 2EJWA 3ORFA 4BKOA 1U5CA 3DHEA 1SMKA 3F5QA 3ADOA 4TMFA 1PZGA 4RF4A 3MEQA 4ND3A 4TVBA 1KY4A 4R54A 2H9IA 2JKVA 2D4AA 3W6ZA 2AEJA 1WVGA 1BTOA 1M75A 3F9IA 1OC2A 4B79A 1Q1NA 3GPIA 4JQCA 4EW6A 2AW5A 3W4KA 2VNAA 4TZKA 1YKFA 4IQ8A 2PFGA 3QW2A 1DAOA 4E30A 3STHA 3AW9A 2JFHA 3DOCA 2HJSA 3DAGA 3DR3A 3QVWA 5A9TA 4D7AA 4MVJF 1PS9A 1ISMA 1HDOA 4MVJD 3RBVA 1K6XA 2GERA 4ZA2A 3GZNB 3JYLA 2HO5A 4XIJA 3ZI0A 3I23A 4L4RA 4YRAA 1N92A 5GZ6A 2B36A 1XA0A 3DFZA 5JY1A 5F1KA 3PJDA 5LDGA 4FQ8A 1BDMA 4YAJA 4YEDA 2XAAA 1PQUA 2O3UA 1BMDA 3LK7A 1E7SA 1VM6A 2JJYA 4KUGA 2ET6A 4LW8A 3R3JA 3VPFA 5EIOA 3C85A 3CE6A 3DQPA 3ZU3A 3UOGA 1GDHA 4EJ6A 3FSRA 4TSKA 5I9LA 3GMDA 1EZ4A 1GCUA 1XLTA 2WM3A 3K2EA 1QKIA 1Z6ZA 4QSMA 3ANMA 1K2WA 4FD3A 4OSPA 4B3HA 1E92A 3GHHA 3VZRA 4BGIA 5TRTA 1AUPA 1YH3A 3GDOA 3QV1A 4W7IA 4I9NA 2NM0A 2VHZA 2C59A 1EK6A 5DNAA 1CEQA 3JQAD 2X0RA 3JYNA 3ENKA 3GG2A 4DBVO 1I2ZA 3FPLA 4B4OA 3IDSA 3ZV3A 3U4CA 1NFFA 4ZQBA 5I9MA 3KYDB 1GZ6A 4GX0A 2X23A 3K92A 4ID9A 5L45A 3K5PA 2PZMA 3U3XA 2VUUA 4DPKA 2V6FA 4M49A 1PEDA 1W6UA 1EUZA 3GUYA 3GDFA 1I0ZA 2DTEA 5KTKA 1Y5MA 4CMIA 5I8WA 2XXJA 1ZMTA 1JLLA 1QG6A 4BS9A 1PJCA 2AQKA 2RHRA 3QIVA 3JQEA 2X7HA 3I9MA 1N5DA 3GDGA 4R4JA 4CL3A 3A1NA 5AXAA 1QORA 3L9WA 3AWDA 2I67A 3VH1A 5G4LA 1XR3A 5A1TA 4FCCA 3WJ7A 5EN4A 1Y9EA 4HFNA 4DPMA 1Y1PA 1ZK2A 3X2EA 5FI5A 3F6YA 4OL9A 4A2CA 1KVRA 2ZB3A 3H5AA 5ADHA 1LSSA 2J5QA 4LSWA 5JE8A 3PIDA 4RVDA 1WDMA 1RJWA 3GN2A 3L9XA 4YJDA 1PL8A 2Y66A 5J23A 1E3WB 4EBFA 3UXYA 4TRRA 2EERA 4PLPA 2FZWA 2Q1UA 4MP6A 1I32A 3INGA 1YB4A 2NVBA 3GLQA 5F5LA 5JPIA 3UH1A 1NX6A 4W7HA 4AL4A 3NKLA 4KQXA 4OMUA 1H5QA 2DAPA 3AUUA 2IXAA 3JD2A 3H8VA 1LQTA 1A9ZA 2GO1A 5G4KB 2HLPA 1YOVA 1RPNA 1DJNA 1W73A 4DLBA 3ROMA 4YRDA 4BQRA 2AG5A 1GPJA 1O94A 2X0JA 1K6JA 4O63O 4ZGWA 4KMSA 4PZCA 1SBYA 1V6AA 3WLFA 1AGNA 2GSDA 5DP2A 1WDKA 1MV8A 1LA2A 1YL6A 4FDAA 3VH3A 2B83A 3H9JA 3VZPA 3MJSA 1P1KA 2Q3EA 4RL6A 4D45A 1D3AA 1IZ0A 3I1JA 3ZW9A 4YT8A 3DAPA 5JDIC 1RYEA 3OH8A 1E7MA 3WLEA 3VDQA 2P5UA 2B37A 1JW9B 2PY6A 5ILOA 4NFYA 2YQ5A 1UXGA 5IZCA 3GNTA 1HZZA 4DC0A 3B1JA 3JQ8A 4WLFA 2W90A 4WNCA 3WXBA 4CQMD 2HCTA 1BXGA 3DBVO 5IJZA 1B0AA 1GV1A 1GZ3A 4KDFA 4ALNA 2ZCUA 3DZJA 4R1SA 3LQFA 4Z0PA 2EG9A 2ZYDA 4CMEC 3F5SA 1YDWA 1WWKA 1Y81A 4IGFA 1NVGA 1DXYA 4ZU3A 5JDIA 3WX0A 2P5YA 1A7KA 1F06A 4IIUA 5BNFA 3JQBA 1H9BA 1X13A 5DP1A 3BTUA 4BMSA 3TZCA 3ZDFA 1P1JA 1IPEA 3MOIA 5A9RA 1T2CA 3ITDA 4B7XA 5TX7A 5DCYA 3M2TA 1ID1A 1LBEA 1NWCA 3FNHA 3MOGA 2HRBA 3JYOA 4L4SA 4RCVA 2VOJA 3U4IA 4LVUA 3E03A 5ICMA 1TLTA 3E9NA 3OMLA 3AUSA 1HSOA 4NU5A 2OGUA 4QECA 1XQ1A 2H63A 3NJ4A 2AE1A 2CF5A 3EY4A 4NG5A 4W9NA 5A04A 4J4HA 2J3HA 3DXFA 1QR6A 4Q3NA 1C1DB 3C24A 1M2WA 4RF5A 1Y5RA 4AJNA 3CSDA 3MJTA 3I3OA 4BVAA 2W2LD 4FFRA 4XX0A 2D2IA 5IDXA 3TOZA 3DBRB 4FFNA 1E6EA 1RM0A 4MVJM 1JN0A 4U6SA 5U4QA 1YBMA 5BSHA 3OJLA 1IOLA 1NQ5A 2AQ8A 1XU9A 4L8VA 3DTTA 3ENNA 4RZIA 3FNGA 4FN4A 1KETA 4E12A 2P4QA 2Q2VA 3GG9A 1DC6A 3MCVA 5IG2A 1BVRA 1VC2A 2B4RO 2H1SA 4L9RA 2P91A 1T4BA 2FY8A 4UEKA 1B3BA 3RUIA 4PFJA 3H9UA 3C1AA 3H5NA 1LLDA 3TQHA 2SCUA 3OIFA 3PWKA 2CDCA 4MVJE 2P68A 5KVCA 1U8XX 4DPLA 4M55A 3I5MA 1PGPA 2ZKLA 1LDYA 2Y0DA 1HLPA 4JLWA 3B20A 3FR7A 4BNYA 2QW8A 1I01A 3GC6A 1Z82A 4HXYA 2AA3A 3QVTA 4W9NC 1LX6A 3N7UA 3P5SA 4YJGB 4EJ0A 2PA3A 4H7PA 4MP3A 2W8ZA 3NDIA 4O6VA 2O50A 2VUSA 4OJNA 3HDJA 5T8KA 3O9ZA 1VL8A 4B7CA 3K73O 2VUTA 2NNLD 2VT3A 1ZSYA 2Y93A 3GHYA 4TROA 2W98A 5B4VA 1I30A 3JD3A 1EFKA 3K2BA 1TVEA 3K8ZA 3JQ8B 5HS6A 4Z6KA 1IB6A 4PRLA 3AU9A 3NT2A 4JBIA 1MFZA 3ZV5A 5L9AA 2DBQA 5ICSA 2EW8A 3ULKA 2CZCA 4EGFA 4HFRA 1OAAA 2O7SA 3BMCB 4NJMA 4M87A 4YCAA 4L73A 2G1UA 2VZ8A 5TNXA 3TZHA 2VNSA 5JMWA 4W6ZA 3V8BA 1Z75A 3MJEA 5JAMA 4NFHA 2EW2A 5ES3A 2P4HX 2V65A 4S1VA 1FF9A 3PXXA 2CUKA 2X5KO 1KEUA 1SEVA 3WGGA 3WGTA 1CJCA 4E33A 1B2LA 5L3ZA 3VH4A 5K6AC 2NVUB 3JQBC 3E48A 3RJ5A 1MX3A 1HT0A 3NGLA 4LK3A 2Q1TA 1X15A 3UUWA 2VT2A 2YV2A 2JCXA 2FPIA 1WDLA 2RBEA 4BO2A 3I9OA 2WYUA 4J7CA 3UGKA 2B5WA 1EQ2A 5DCUA 3GGOA 3OECA 4PIVA 4OYRA 2HUNA 1NHWA 1ZFNA 3S55A 3T7CA 2FPPA 1OI7A 2V6BA 3WWYA 3H65A 3RUCA 3WSWA 4CM6A 4U0JA 4OOFA 4R69A 4XJTA 2JFFA 5A05A 3RKRA 1MP0A 3UICA 4YT5A 5AYVA 2TMGA 4XB1A 3Q2IA 4AJKA 1V0JA 1I3KA 4XDYA 4A73A 1QXSA 5B4TA 4GGPA 2A92A 3H7AA 5CDYA 1GCOA 3H4VA 3DO5A 5AOVA 5A3JA 3WGYA 2ZQYA 3ETEA 2WE7A 3P2YA 8ADHA 2X22A 4MKZA 5AXCA 4E21A 1HDYA 1J49A 1XSEA 3DOJA 4IZHA 1HRDA 1R4MB 2RCYA 4JK3A 3WGHA 2IYOA 1ZSVA 2ZQZA 4WK6A 5FFFA 4BNKA 4A5OA 4G81A 2YHIA 4Q9NA 3JQAA 1BXZA 1TB4A 3BMNA 5F1OA 3A14A 2BFOA 1VLLA 2PH5A 1T24A 1PZFA 2GLXA 1ARZA 3MZ0A 1ML3A 3KSDO 1O6ZA 3GNQA 1C0IA 1XU7A 4GVXA 3ZWPA 1WLYA 2ZJ1A 2EXXA 1M67A 4UUNA 5EL0A 4A27A 4AJEA 3IUSA 3DZGA 4S3MA 2IDZA 4K6FA 2V6MA 1TT7A 2EJVA 3S2FA 5IXYA 2GD1O 1JKFA 4UEJA 3U9LA 4ZVVA 1HYGA 2C0CA 3JYPA 3PZBA 3WFJA 4BB5A 4P38A 3OJ0A 5JYDA 4RPJA 2O3JA 4B7UA 3EUWA 4R5MA 3ZWMA 3DC2A 4OAQA 2HK8A 1IPFA 3NUGA 1YO6A 1X0VA 2Q2QA 4GSKA 1U5AA 2D1YA 3PLNA 2VYNA 5DOVA 2GPTA 2Q49A 4RVFA 2PD4A 4LN1A 2WE8A 3QSGA 1PGJA 1CETA 3ON5A 1NVTA 1ONPA 1YBVA 3RAJA 5B1YA 2EF1A 1UDBA 2PTGA 5TT1A 4HFMA 3KV3O 4BNZA 1DB3A 3WDSA 3LVFO 1UZLA 1KS9A 2EHDA 4NBRA 2YW9A 3C7CB 4JCOA 4BKUA 4CMIB 5T57A 4UAGA 2GRAA 2WTBA 3Q6IA 2B69A 2O3TA 5A3VA 1DHTA 1UXIA 3TL2A 1DRWA 3GVCA 3GZNA 1MB4A 3P7MA 4Z0HO 3GFBA 5TIIA 5THQA 4NNJA 2C29D 4YVFA 2X4GA 1LLCA 1JAYA 1PU2A 5L7WA 1EBFA 3OICA 4XGKA 3ZHYA 3CINA 3WWZA 2BF7A 4R1NA 3LC2O 3I6IA 3RUFA 1DO8A 8LDHA 3E9QA 2FWMX 3E5RA 1E3EA 4G5HA 1JKIA 1P1IA 3RBZA 3QVXA 4I5DA 3V2UA 5JAQA 1XIVA 2E82A 3WBBA 1QSGA 3KB6A 4NBWA 3D3WA 3VOSA 4CUJA 2QHXA 3IS3A 3ZHZA 2CNBA 4JP2A 1H94A 3KHUA 3U0BA 4DTIA 5EQDA 4NZ9A 4XGNA 3C1TA 3PHHA 4ZRNA 1CQIA 3G17A 4RVHA 3ZHXA 2NTNA 1LNQA 1VJTA 1P45A 2AE2A 2BMAA 2BGMA 3W8DA 1E3JA 5DOZA 1B14A 4P4NA 5B12A 1ZEMA 5IZCC 5KNLA 1GU7A 5JFOA 4CQMA 1KBZA 2OMEA 4BNNA 4BNHA 4BGVA 2NTJA 5C7IO 5H82A 3GVXA 1P0FA 2RIRA 5TJHA 2NVUA 5H83A 2Q1SA 4IMPA 4B3IA 4BKRA 2D8AA 4JBHA 5CPBA 2O3RA 3IQDB 4KQWA 5JAIA 5CDSA 2B4TO 1PL7A 3LZ6A 2BKAA 1Z73A 2NU9A 4MOWA 3S1LA 1AE1A 4AICA 4RPLA 4A10A 5KVVA 1P33A 4OOEA 2OO5A 1ZEJA 3ICCA 1P77A 3ZGYA 1SPXA 2FSSA 2ZYGA 3FCOA 1O95A 2GUGA 1YXMA 5IZ4A 1T2DA 5BR7A 4EUHA 5BSFA 5JXWA 3AOGA 2POQX 4BO1A 2Y1CA 1HDRA 3ST7A 4BMNA 1E6WA 4JIGA 1QLHA 4UVEA 5I8ZA 1MG5A 2NSDA 4NBVA 3N74A 3DL2A 3P19A 3GRPA 5IFLA 3LYLA 4WOKA 4NQZA 3QJ5A 3B1FA 4Y8VA 3GT0A 3MTJA 3LT2A 4P22A 3GN1A 1M6WA 1LTHR 2I99A 4ZICA 1I2CA 2VRCD 1T2AA 2EIHA 4N7RA 4YACA 7ADHA 4Y6PA 2W2LA 3CH6A 1VJ0A 1XWFA 1T26A 3LU1A 5L4NA 3KYCB 1B8VA 1DIRA 2NTVA 2ZK7A 4EJMA 4DGSA 3AI1A 4RF3A 1NWHA 5TLSA 3T4EA 1D7OA 4RDHA 1XKQA 4J6FA 3L77A 1X7DA 1EDZA 1MC5A 4XZ3A 3D3EA 2HQ1A 4IINA 1JAXA 5JW6A 5IDQA 4RQTA 4ND5A 5JC1A 5CP8A 5EQFA 3QY9A 4J4BA 1UXHA 1U1IA 4GL4A 1U2DA 3PHLA 3ROQA 5DF1A 5AVOA 1OZAA 1NAHA 2I9PA 5TJ9A 3H9EO 1E1KA 2FRDA 2QZ9A 3D5TA 4MVJA 1DC4A 2DPHA 3RWBA 1IUKA 3LT0A 3NT5A 3E18A 4CLXA 5BQFA 1ZK1A 5A9SA 3C1OA 1DIBA 3O8QB 4XD2A 1AHHA 2GF2A 5G0TA 3KVOA 4JN6B 1Z7BA 1EMDA 3H2ZA 1Q7BA 1T4DA 1YQDA 2GN8A 4LGVA 3KUXA 4YAEA 1VL6A 3OIDA 1M66A 1PS8A 3TZQA 3KBOA 3QQPA 4ALMA 4AJPA 4YWJA 4WKGA 4E2ZA 4PGFA 3A28A 2DVMA 4K1LA 1PZHA 1HTBA 3H9QA 4OGWA 3PQFA 4M8SA 3JQGB 3KSZO 4N18A 3WMWA 4IDGA 3U49A 2C54A 1UP4A 2CVQA 1RKXA 4ZJUA 4RORA 3BMOB 3TDKA 3RU9A 1HE2A 4WLNA 3ROPA 3RFVA 4IDDA 1U3VA 1PIWA 4NK5A 1I5RA 4GLLA 3AI3A 1CIVA 4ND4A 5CFZA 2QG4A 3LDHA 4JBGA 4R01A 4E5KA 2I6TA 4AVYA 3VZSA 2C7VA 4WUVA 3HG7A 3VPSA 1SO8A 4M89A 5I7VA 4IJUA 3V5NA 1DPGA 1A27A 4ONEA 3H3FA 1AXGA 4JX8A 4CODB 3O4RA 5ILGA 1FDVA 1JWAB 4ITUA 4Y6SA 1K5HA 3PP8A 4D3DA 3RVDA 3UFXA 1MG0A 3KYBA 1EUCA 3TRIA 2RH4A 3DZFA 4MO2A 4F3YA 1PGOA 1DLIA 2OHXA 3OQBA 2DM6A 5G0SA 1E7RA 3QE3A 2OOSA 3FHLA 4NU6A 4CV1A 1JVSA 4E2WA 3FBTA 4CLOB 4A26A 2EV9A 3PYMA 2X0NA 1X0XA 3Q3CA 2CDAA 1HF3A 2W4QA 2XOXA 3JYQA 4KUHA 4CV3A 4GX1A 1QYWA 5L7TA 3JD0A 2DTXA 3GEGA 2X9NA 2NQTA 4BNLA 4CLHA 2P9EA 1R4NA 1WMBA 1PTJA 1U2GA 3ONDA 3ONEA 5G4KA 4II3A 1KC3A 5DZSA 3WGIA 5HM8A 1XQ6A 1C0LA 2IYPA 2HMUA 2ZB8A 4NHEA 3DMYA 3WSVA 1LRJA 2OZPA 4FFLA 2Q2WA 4DREA 3ZCXA 1KC1A 5F21A 4XCVA 4MIOA 1EEHA 4JROA 4CMAA 5AXBA 1O89A 4R16A 3VVBA 2D5AA 2B0JA 4HX5A 1ISIA 3CUKA 2PZLA 3U62A 2OBYA 1DLJA 2DLDA 1E3WA 3SXPA 4AJ1A 1MUUA 4OXKA 1TA4A 3GQVA 3KSUA 3SLKA 4BO4A 4QQRA 1MXFA 1N1GA 1VKOA 1MGOA 3KLMX 4CR7A 4Q3EA 4E6PA 4G2NA 1E3LA 3JTMA 4EYEA 1E0DA 4BGUA 1R12A 2GASA 4CR6A 4HNGA 1FDWA 1WP4A 1GTMA 3E6AA 5DT9A 4IIVA 4N5MA 3RSHA 4IPTA 2XXBA 4PLWA 2PZKA 4NFSA 2PD6A 3HZZA 3SBOA 2YFQA 4RQUA 2C5AA 1Y9AA 3D4OA 3ONFA 2H5LA 5L4SA 4J3FA 1B3RA 1QLJA 3CEAA 3BZUA 3MWEB 4B3JA 3UCEA 4NJOA 1Z74A 1T25A 3QVSA 2FSVA 1LSJA 4CLEA 1C14A 2HMSA 1YOVB 1NVMB 1YDEA 2VYND 3VTFA 3AY6A 2JD2A 3OA2A 2C2YA 4Z9FA 1SC6A 1PJTA 2WD7B 2W2KB 2JFGA 5KKCA 4I5GA 2Y0CA 1CYDA 1YB1A 3DOOA 2JCVA 4BO3A 3IUPA 4B8WA 3U09A 3HJAA 2B35A 1HKUA 1GV0A 1H9AA 1L1FA 3WBFA 4LCEA 4C7JA 4CMHA 2HKIA 3WNQA 3DMTC 4FC7A 4CM4A 1CRWG 5F1PA 3AFMA 2I76A 1TT5B 4OIMA 2QRJA 4DC1A 3JQCA 3ASUA 1NP3A 1LLQA 4WJZA 2VHXA 2NU6A 3HWRA 1O9BA 3KTDA 2FHSA 3RBXA 2A94A 1LU9A 4XB2A 2DTDA 5EINA 2WMDA 4W4TA 1GZ4A 4XR9A 5T8KC 2FP4A 3WNVA 1EK5A 1HDCA 4WCFB 5COBA 3C3XA 1N8KA 4XWYA 3ZZNA 1D8AA 2EKQA 1C0PA 3PRJA 3FTPA 1FDTA 1M76A 2EGGA 1R37A 3BAZA 2O4CA 4L75A 1NXQA 1HZJA 4J16A 2CVZA 3HFGA 1A9YA 1LXCA 3JV7A 2DU8A 2Z1MA 4ZQGA 4GSLA 4BMVA 5TSDA 1LSOA 1DSSG 2J8ZA 1UP7A 4IBOA 2VWGA 3CKYA 3OA0A 2I3GA 5HS4A 3AM5A 1HEUA 5FF9A 5G2OA 1HDZA 2VN8A 3AU8A 5U9CA 4K28A 1R6DA 4CV2A 2YJZA 1SOVA 4WCFA 1LQUA 4FFOA 1UZNA 2AHRA 2V6GA 4Y9DA 3NGXA 4GMGA 4IQ0A 1IL0A 1VI2A 2Y1EA 1QYCA 1K6IA 1AXEA 1PGNA 1BG6A 4Q3CA 2OXIA 4O5OA 2G82A 4P4GA 1S6YA 3F1KA 3AJRA 1R4NB 4J1TA 3OBBA 3OEWA 1YL5A 1BSVA 3QWHA 1QYXA 4E0BA 5A5EA 3NRCA 1GAEO 1CF2O 1C1XA 2OP1A 3AI2A 4B4WA 5BT9A 2G0TA 5KKAA 5A06A 5L53A 4TRMA 4BNJA 1ZJZA 4UEOA 4FGWA 4PG4A 1EE2A 4YAIA 5U1PA 1NPTO 5TT0A 4EZBA 3QLJA 5T6BA 2JD0A 2HK9A 4NJMB 1QRRA 3I9KA 5IAAA 2Z5LA 1BDBA 1KEPA 3VKUA 3VTZA 3PVZA 3BTOA 5JLAA 1E1MA 2B5VA 2BELA 5DBFA 1HYEA 2ILTA 4CQMB 3TN7A 3Q0EA 4FOOA 4H16A 4ALIA 3MJCA 4R3WA 1PX0A 3DZHA 1Y8QA 2ZATA 4XYGA 3VZQA 3GUCA 3I52A 4JJIA 5EMHA 4YDRA 2C82A 4F6LA 1R15A 3H2SA 4KP7A 5JCJA 4IQGA 1H6DA 1NNUA 4O0LA 3QWBA 1Y6JA 3JQFC 4IS2A 3H6KA 1NPDA 1YBAA 2UVDA 4YJGA 1HLDA 1UR5A 2X58A 1W0CA 1PS0A 4DIFA 4MVJG 4BO5A 2FMUA 2FZEA 1FDUA 1U4SA 1U8FO 1N2SA 2C07A 3TPCA 4XJSA 2RHCA 3PJEA 2Y67A 1ZK4A 1OC4A 3DHNA 1DEHA 1JKJA 2G76A 3PWZA 3MWDB 1NQAO 3RC7A 3FF4A 4URFA 2W2KA 1U7HA 2QIOA 5AQ1A 1X7GA 2NUAA 2BRUA 1R16A 1B16A 2CFCA 1F14A 3IOYA 1YONA 3A06A 1KIFA 3H3JA 2EKLA 3S2EA 3WG9A 4L4XA 4B4UA 4R1TA 3LT1A 4ALKA 1ZVMA 3FPCA 4CM9D 1EQUA 3NTRA 5A5FA 1RM4A 3G79A 3NT4A 2NVWA 4BNFA 4FIZA 2YDXA 1I24A 3FWNA 5GZ1A 3U5TA 1DC5A 5JDCA 3GZ4A 5IXSA 3ZU5A 5JCXA 2QRLA 1PJLA 2PD3A 1MFPA 1HE3A 3UW3A 2VTEA 4D43A 3JQFA 3PFFA 3JQ7B 3JD1A 2UYYA 4GBJA 1E1LA 1NQTA 1P9LA 1LI4A 3D4PA 1X1EA 2E49A 4HADA 3BMCA 3U4HA 2JL1A 1C1DA 3MJ4A 1B8UA 1QMGA 4YB8A 1DIGA 2CVOA 4AJJA 1XEAA 4WNIA 4IJWA 1GUYA 1FMCA 3IIEA 3V2HA 3NAQA 1UXKA 5T67A 1PR9A 4CM4B 3WMXA 4YR9A 4YJHB 4KWHA 3OM9A 4Q39A 1YS4A 3G3EA 3OFSA 4QFDA 3NJ8A 3QWFA 4ND1A 3SEFA 4ZQFA 3WQRA 4DLAA 3RIHA 3JQ9C 4QXMA 4D3SA 4PCVA 1XDWA 1ZZEA 2FN7A 4NK4A 4WPGA 1U3UA 4CMGA 4AJIA 4PG7A 1PJ3A 1YGYA 3O38A 3DEYX 2FPGA 2Y68A 4DWVA 1G0OA 1ORRA 3KEOA 4FBGA 4HY3A 3F47A 4BUCA 3L4SO 2IEBA 1EVJA 5JO9A 2O7QA 4GPD1 3TWOA 3TSCA 3R1IA 4YPOA 3K9QO 1GPDG 3HDYA 5KIAA 4RGBA 1NTOA 2VYVD 3CTMA 3RJ9A 1GYQA 3AOEC 3I9JA 1N9GB 4FJ1A 4FW8A 1TXGA 4Z3KA 4WGGA 1LC3A 3FR8A 3SJUA 3RD5A 3K31A 4M1QA 1NAIA 5I9NA 4RLSA 4XQ9A 4D44A 1DFGA 1WZIA 3CMMA 3EK2A 4MVJH 5IN5A 3I4FA 1ZNQO 4CMBA 4I8XA 1HETA 1FK8A 1JQBA 4WCDA 4FPXA 5CAEA 2NU7A 2JAPA 3S2IA 1YQXA 3I9NA 3ITKA 4UVDA 2Y1FA 3SLGA 3SVTA 1GQ2A 1ADGA 1Y8QB 3I83A 4CMKA 3BHJA 3WS7A 2O2SA 3M6IA 2PGLA 1JTVA 2R2GA 4FOSA 1H6CA 5CPFA 2Q50A 3ZWOA 5HWSA 2P9CA 3CXRA 4E5PA 5K9ZA 3ASVA
chains in the Genus database with same CATH superfamily
3MAJA 4EHKA 4IS3A 2VBGA 3EYWA 3H13A 3AYZB 3R3SA 4DM4A 2IF0A 3RF6A 4IDBA 1UAYA 1LCIA 2ONKA 4PX5A 3WLRA 6PFKA 1RKVA 3INRA 2CFIA 5FUVA 5LBIA 3HSKA 3O6VA 2VC2B 1AGRA 5K2OA 4IR7A 2UUOA 5L95A 1TYZA 2IP4A 4YJHA 1HNWB 4YBRA 4CKEA 4G5FA 5DM2A 3R8XA 1UOPA 1E79D 4CCSA 4YS6A 1OWMA 1JUDA 4QG3A 1RPZA 4UBJA 3HDGA 1CUZA 1JG2A 1LPPA 1OGYA 2QYOA 4GGOA 5CLLA 3VH2A 1IN4A 3TW6A 4BKPA 1CVRA 2AT1A 4JWKA 2W6ZA 4WBSA 1Z37A 3BL8A 4FYWA 3A10A 1U80A 3AERA 1ENPA 3TLMA 2DFKB 3C6QA 1YZ3A 2CV1A 3NIBA 1KPGA 4MWGA 3BIFA 3HUTA 3ZV4A 1KVTA 1OLUB 2BZGA 2Q5OA 2VP2A 2VI5A 3Q1LA 4WLOA 2ID4A 2PUFA 5ARBA 1CQZA 3Q8LA 4OKIA 4EEXA 4NCBA 2VTDA 2AEMA 1Y82A 4R1UA 5LA6A 2ZREA 3TOXA 1I6MA 1UBHS 3PQ2A 5F77A 3STUA 3ZDQA 3X1MA 1E2FA 4OFXA 2XHEA 4YUVA 4RDXA 3KLPX 1EEXB 4HLUA 1O6BA 3QU4A 3OM0A 4MUNA 4E32A 3FD8A 2Q1WA 3MWDA 4UDXX 2I71A 4BBAA 1JWLA 5K8VA 1IHXA 5JBIA 4CV0A 2J4CA 2OZKA 4M1KA 4BVFA 3V7NA 4DUPA 4DR1B 1ZH2A 4A7PA 1ZUIA 2IUFA 4HXGA 5FUMA 1P2SA 3K0CA 1W5FA 2DUUA 1Y5NA 4QHYA 4LF6B 3R3WA 1UQRA 1NVVR 2QTHA 3EBPA 5DK6A 1G3MA 4HGOA 4UPEA 5FJJA 4KACA 1C7QA 1N2OA 3EIOA 2OBBA 4AULA 2P90A 3IP8A 1R4ZA 5HBGA 3ZN2A 4REQB 4YYZA 1VCIA 1KYXA 2H54A 1I7NA 4R84A 4RH3A 4Y2VA 1PV2A 4WOJA 2ZANA 4R1MA 1LB1B 4KLZA 4CKXA 3CUEF 2JI6A 3LVQE 3WTBA 3WSTA 5ITZA 2KPOA 3Q9SA 4MW7A 1KYTA 1IBMB 4XLTA 5GOZA 3E61A 3HVJA 1U63A 3UVEA 1SRQA 1TNDA 4Q6WA 2HHLA 1H2BA 1WUTA 3A6HA 3OOSA 3DR5A 1JDTA 1K7EB 1M6NA 4DY6A 2IZ6A 3A9TA 2RAUA 4XAQA 1XU4A 1OX4A 1OW3B 2AC4A 2Z2JA 3KT6A 2XA2A 2WILA 3H4TA 1Z6PA 4CLDA 1RRCA 1EIWA 4CM5A 3KIPA 4EFLA 4KQMA 3KV1A 3I6QA 3BL5A 3DVAA 5JMPA 2W83A 4M0KA 1DQYA 3PX2A 1XF9A 2P4SA 2ZYRA 4XJVA 4BYGA 4CM9A 4BAUA 5KYXB 3WAGA 1KMQA 1XNQB 2FEKA 3PJGA 1KI1A 1CZKA 1YS6A 2JRLA 3GX1A 3QYAA 3TMAA 3I4LA 3T1TA 3U31A 1VPDA 5EPOA 1O7JA 4X85A 1JU3A 6ADHA 2GPNA 4N5IX 3TNLA 2ACKA 4WA7A 5BXYA 2EFYA 2ZXFA 1IRIA 5A62A 1SKUA 1TZ2A 1WSDA 3AF1A 4BB6A 2B25A 3DULA 5SICE 5AVRA 2F8SA 1A5AB 2LIPA 3N9IA 2QTMA 4DA7A 4O4JA 3UWSA 2F55A 3SI7A 3NIGB 4DYDA 2XLBA 3M6LA 3KWMA 4HHEA 4WT7A 3QX3A 1D6SA 1UFQA 2PZJA 4WVLA 4KFCA 1BE1A 4EA8A 3EQ8A 1BOFA 1RXYA 4HDNA 4HYYA 3T5PA 5CVJA 1E1NA 3AF0A 3ESAA 4P1ZA 2FPPB 4HNUA 4IDNA 4IUYA 2ZBFA 4IMJB 1E62A 2FX5A 5ALGA 3IJPA 3PC8A 2PZ8A 5DLQC 3GOHA 2J9GA 3TF5A 3KT8A 4DLLA 2JARA 5A4IS 1VPLA 5BYAA 3TIFA 3D0OA 1VL0A 4KH0A 3HHPA 1QTQA 3MFYA 4XRGA 2ZIXA 2VTBB 3SXUA 4BQOA 4LV6A 1GXSB 1XRSB 2B7LA 1S2IA 1U0HC 2OUIA 3EDMA 3FKQA 4K3VA 2WWRA 1SZPA 4R51A 1H85A 3L4BC 1KI4A 4HG2A 3IAEA 3W5AA 4NV1A 5KNCH 1W0KD 4OQYA 1GSIA 4Y2YA 3IHKA 3ZKWA 3AFGA 3DDCA 2XDAA 2X0IA 5AHOA 3SD7A 3GYBA 5F5NA 1QPZA 1QK4A 1NASA 2O5VA 4LCJA 1R1DA 2SECE 2V74B 3D64A 1NXOA 2NAPA 3NAZA 4YROA 3DKVA 3QU9A 3JCZA 4FUQA 4NMHA 3HCOA 5L7YA 2JHFA 2GJKA 2ZT5A 1Y4ZA 2VYVA 3LLVA 5JSKA 1JU4A 1T1EA 4KQ6A 1FSSA 4G0XA 1OBOA 4BMDA 1H1LA 3LCUA 3KT3A 5ESWA 3JQPA 2JGEA 2RGUA 3NTOA 5AOBA 4RSRA 5DSZA 5GY7A 1XK7A 3IEIA 4B6SA 3E0QA 1J0AA 3I9FA 1XXHA 2WNHA 1XAJA 5JNUA 3ENZA 2JIOA 1WMFA 1XHEA 2FMHA 3D4IA 4HRVA 3ZX4A 5FADA 2YVKA 1A8UA 4Q1AA 1L1EA 3MCUA 1CUWA 4BZQA 3NANA 1ZICA 3C3EA 2D6FA 3FCXA 2AK3A 2IY9A 1DG3A 1LZKA 4KFRA 1T29A 4ZCMA 1PR6A 4YY3B 4P3YA 2ZZMA 3IX7A 5CJ2A 2O2YA 2BFMA 2F62A 1UKCA 1RBYA 2OCPA 4GQAA 4NV0A 5K0LA 4DARA 1KQGA 3MIIA 3SOZA 2CV2A 2YJ6A 3KEFA 1NC3A 1W94A 4AFNA 4EHLA 3VYSB 4URVR 2WPNA 2QTLA 3HPRA 3R7LA 1KU0A 2PXHA 2BH2A 2JIPA 4FFDA 5HRUA 2R7AA 2XUHA 4M9CA 2GGSA 1NW6A 2HH9A 3A0RB 3O4HA 4CEIA 4JB0A 4KDCA 2ZYSA 4YP7A 3H2IA 1RXIA 2LKDA 1N6OA 2WD7A 3FJ1A 3RTGA 1JI3A 1FFDA 1B43A 1RYBA 3LF1A 3CX6A 2AUTA 4XWTA 1SCKA 3R7NA 3C48A 4AJ2A 4YUXA 2A5YB 3VHRA 4OK3A 4NYJR 3ZDCA 1GN8A 2CDBA 4QVKA 2JFZA 1Y3HA 3O3MB 4G5OA 2AYYA 3HFSA 4TWZA 1BX0A 4PLGA 1UAGA 2ZVJA 1Q2XA 2HGZA 1E9RA 4P7GA 1TDJA 4L8FA 4WLUA 2GN0A 3KYDA 1C1HA 3L8HA 4LRXA 4IJVA 3ZGOA 1AK2A 4EHNA 5CDFE 2VT6A 1F51E 1NM5A 3IMFA 1FDIA 4WDQA 3C2QA 4D4IA 4INAA 4PYIA 4BNUA 4TQAA 1GZUA 3Q11A 1RI3A 3IE1A 1F8GA 2ZBRA 4X20B 2J9XB 1XG5A 2FP4B 4XM1A 2WSBA 5JDCC 5KX5F 2FSGA 3N2IA 4L0QA 1U7TA 2H5IA 2V7QD 4X1YA 1YWGO 2Z3ZA 1PEKE 1PFUA 4B46A 3RYCA 3G7NA 4GWGA 3VNBA 2X6TA 2YWRA 5MGBA 4K6OA 3R6LA 4TKZA 5LSAA 1M6HA 2V8BA 4E5NA 1NLYA 1QTNA 1FVOA 2BDTA 2ISCA 2WM8A 2YJ3A 2GYYA 2YWXA 3P9ZA 4TTQA 4KQ2A 5KSYA 3FOWA 3V4FA 2WWHA 2QTGA 1PSZA 1Z5PA 5IKOA 2IDKA 5E2BA 4DV6B 2B20A 2ZR7A 3D8HA 3AF4A 3I0MA 3JASA 3T1VA 4A03A 4D81A 5HXAA 1LDGA 1QYVA 1YDFA 2IKSA 3L6UA 2XWPA 5IXJA 4RK7A 5LOVB 5HUJA 4HGZA 4H18A 1P18A 5K6AA 3KYIB 3OZGA 3PFNA 1ATIA 1FY2A 2Q4EA 1H65A 3TJZA 4DKJA 4DV1B 1W7AA 1HWYA 4FZ3A 5AUQA 4DYVA 4KE7A 3WYGA 2QSJA 2ZPUA 4FT4A 2G8NA 5IDYA 1U0OC 2VDLB 4F7WA 1UK6A 1IE3A 3PGJA 1F17A 3DOHA 1CP2A 3MBKA 1A72A 4JNKA 4Z0TA 2DBRA 2BPOA 2DHRA 2J3JA 2NGRA 2VXOA 4TZTA 4UM7A 4BFCA 2AZ4A 5F35A 4BAGA 2R8RA 4BV8A 4TKVA 5J2UA 2GBPA 2BFCB 1QVZA 3K5IA 5KNBH 1YB5A 4X62B 2JJMA 4KYIB 1ISFA 4OXYA 3PDUA 2PEYA 1XDZA 3IV6A 4TRJA 4H3HB 4REOA 3MMSA 5HG0A 4XQCA 4MKRA 4EKEA 3OQ1A 4MPTA 1VLHA 3B89A 3PFHA 3RT9A 3UK6A 3N8HA 3CF2A 4B5LA 2QY6A 3FYUB 2X9LA 2ATVA 2RGRA 1ADBA 3KXIA 2IHKA 2H1VA 4KSYA 5KYVA 3SZUA 1S2MA 2PZAA 1TYCA 5K6TA 5ALNA 4I9FA 3WYAA 4W82A 3MS2A 4JELA 2FR1A 1STOA 4OHCA 3RQIA 4D4JA 3DKIA 4BNVA 3TSWA 3FTDA 4L8YA 1HL7A 3G2MA 2QW0X 3BWMA 3WLKX 4G1CA 4BL5A 5AKEA 4JS0A 1NUSA 2P0AA 1N0WA 3NETA 3AOEA 3EXHC 5E8JA 3NHJA 5JAZA 2WUEA 1XDUA 2FOIA 2B7CA 3K5WA 3NHMA 4QULA 1GM5A 1RFGE 2AI1A 2P9FA 4CUKA 3D1JA 3WBKA 2JGNA 1XGKA 4CYMA 2XVXA 4BU1A 5C1BA 4TXNA 4L50A 1NONA 3E7PA 2JZCA 3BIWA 3DFUA 2MSWA 3DWIA 3MPOA 1X7WA 4NICA 4AZTA 4Z7QB 3SQXA 2ECKA 1VJ1A 2AZMA 1ZK0A 1DG1G 1SUBA 2XITA 3AHEA 2HA4A 4J4TA 1G9XA 4MYUA 2A0FA 2ZRJA 3OIUA 1RQXA 3KVNA 4MI6A 4WASA 1E5LA 4WBNF 1V11A 2JA1A 3DF9A 1N7IA 1SVSA 1K3UB 4ENWA 1SH7A 2DBZA 4GXNA 1JEYA 2X9GA 3I9LA 3KRTA 4AJ4A 2V0GA 1B4DA 3U7IA 5K09A 2A9RA 4C3OB 5JXHA 3ZJTA 5EP4A 4GH5A 4QQKA 4CLRA 3VA7A 1L5WA 3OPYA 2CGEA 2PH3A 3URKA 1U0SY 3NHZA 3OLYA 1W5SA 4CM7A 4E2YA 1Q3HA 4ENQA 3CNBA 3KWLA 2GM5A 3WYBA 3W4IA 4H3KB 5LWHA 1PKXA 4R8VA 1UBEA 5FNVF 3V2UA 5KKNB 3CUYA 2VS1A 4BGEA 4BRSA 3M3PA 4JCCA 1CERA 3AKEA 5B3KA 4ZU1X 1ENOA 1M8JA 2SHKA 3JQGA 4MS3B 4BO9A 4KXMA 3ZY3A 2Z57A 4U1RA 1BQ3A 3VNAA 1U7WA 3THWB 1AD2A 3KR1A 1L8QA 4BEJA 5JSFA 1RADA 2VTVA 5J1SB 1GPH1 4RLHA 4GOKA 4LZPA 5FAKA 1FP2A 3NHFA 4MINA 3VU3A 2PU5A 1Q21A 1QVRA 1M2VB 1OXUA 2J3EA 3BIOA 3LX5A 3KETA 1JHQA 1XDBA 1JU9A 4QDUA 4LYJA 1X1CA 1Q19A 5DISB 4PG5A 2ZJ4A 1VL5A 3ANNA 1JEQB 4RD1A 3ZU4A 2WWGA 3KO8A 1UOQA 1S2LA 2F9LA 3PUJA 3UM9A 1UBFA 4YCLA 3LQRA 1VLVA 4TVKA 1ENYA 1JT9A 2HWXA 2I4NA 4IDOA 4F21A 1W2WB 1GTVA 3IILA 3KM0A 4NEGA 1E2NA 4K05A 2GAAA 1WZEA 2F1RA 1EVIA 4JOCA 2L69A 2VAVA 4M99A 3LPDA 4Q34A 2OCXA 3C3PA 1GTZA 3RC8A 5CURA 5IC5A 3RYFB 5JWRA 4WLVA 4M0MA 4J0QA 3ANLA 4QWMA 2HUPA 3GFTA 2DFDA 5CW2A 5IT5A 1GQYA 3D3WB 1X9GA 3OOHA 3MAAC 1M1YE 1OMOA 5ULLA 3PSHA 1YB2A 4F46A 3I1IA 4DMKA 4AI6A 3MOSA 1HT1E 1T5TA 1CK4A 3IIIA 1NNSA 1I1OA 4PYRA 1ZUD1 4I4CA 4QXPA 2VWPA 2QTZA 2VAWA 1IAQA 2YWBA 4N8SA 4B3TB 3M9XA 3S99A 3KYCA 2VBCA 5EJ5A 2PZEA 5A03A 1CTQA 5AVJA 4AKGA 4RIHA 3DBRA 3WK7A 1I13A 3BYZA 2QMHA 1G17A 4BFSA 2DWCA 4J1QA 1DCFA 3ORRA 4Z49A 4YO8A 3TOCA 3ND9A 1HFEL 1JDPA 1D9XA 2IU3A 2VXYA 3LLSA 3ETLA 2D5CA 3D7SA 2DQ4A 1NMXA 5A02A 3BD6A 2II6A 4R9RA 1UPTA 1KEWA 4TLAA 3T06B 2QPTA 3GVIA 1OIWA 2QP9X 4YQYA 1ADYA 1AQIA 4A82A 1LQ2A 3CNHA 3D1LA 2CSUA 1PNTA 4BFXA 3NTXA 3W77A 4EI2A 5AJWA 4D9KA 4EYQA 4K1XA 1YRYE 1EA5A 1Q3KA 1WHTA 5J43A 1C1XB 2C7GA 3EE6A 2VNKA 4HEA1 1B74A 1WV0A 5DHRA 5EXSA 1Q7TA 3RV4A 1KE2A 5KNLA 1JJIA 1GADO 3FNBA 1WO8A 3SZRA 3QTLA 2WVGA 1DRJA 1V26A 2HC9A 4X93A 2VH5R 1EP3B 1ECGA 2ZOSA 5JSQA 3ES9A 5CYGA 5C51B 4GZMA 4TKMA 2E89A 4TMKA 3ZDXB 4EPXA 1GEEA 2CYBA 2FQ1A 5EIEA 4J8PA 2AXQA 2HSDA 1N5MA 4GVPA 4TZ6A 4H3VA 5DBGA 2GA8A 3HGQA 3M3HA 3HXLA 1Y6ZA 2F43B 1PQYA 2CMKA 1W36B 3G9TA 4IXTA 2Y9MB 2ZE8A 1T1SA 4Z1MD 3SHOA 2RHLA 1R0ZA 3AX6A 4LOKA 4ERXA 1R6VA 4DMFA 4F4UA 1XELA 4PZ0A 1O5TA 3PF8A 4MGIR 4KR6A 2P9GA 2BVNA 3G9XA 1P44A 2P5SA 3PRYA 4LMPA 2C4NA 3NV9A 5HA5A 4IIHA 4NL4H 4R3NA 3GPLA 1FRQA 1SC3A 1R0SA 2XNDD 3O8BA 5T41A 5KVQA 4M86A 4CT0A 1EUDB 1SBZA 5EJIA 3OG9A 4LJKA 2H4ZA 1VPVA 2R6FA 3GFSA 5I7FA 1U3WA 2B21A 4UBIA 4WE3A 1DC3A 3HLTA 3JR7A 3NBQA 5IM5A 4HLNA 3V7FA 2BHNA 3R5TA 2DHCA 2NU8A 1WUKS 4EM6A 1GSHA 2GA9A 1QMPA 3FPKA 4PXAA 4ZOQI 2H1RA 2W0MA 5CBPB 1WXIA 2IA5A 3U19A 4OB6A 3O03A 1YVRA 5E2AA 1J7KA 3BA1A 4O2BA 4Q16A 2HSWA 4FSHA 1L4FA 4CF7A 3LY7A 3NXSA 2G5CA 1BROA 4QTXA 5EE9A 1QS0A 1QTRA 5EZYF 3RI3A 3SKVA 1JIXA 5KTMA 2OKCA 4HTFA 4Q0MA 3J81k 2I9KA 4HBGA 2PUAA 2BFAA 2Z9BA 4F1KA 3EXIB 1K63A 2P6NA 5SZIA 1TGYA 1V71A 2QLTA 1HNZB 2CJWA 5HCUA 4GPTA 4A8JC 1ZMOA 1G1AA 2A33A 3V8QA 2HMVA 3EMDA 1UXJA 2HREA 3HYCA 3PGA1 1BS1A 1YULA 1J8MF 4PPGA 5T3UA 2WZBA 2DWOA 1IULA 1VGVA 5IUJC 4PR0A 2X5JO 2J59A 2QVGA 4BJ1A 1WZUA 3ZYZA 4GQBA 1Y33E 1AZLA 3TE6A 1GQQA 4Z99A 3HSSA 1OGIA 5BQOA 3I1YA 2JH3A 4RHYA 3W5DA 2XQFA 4LDNA 2XB4A 3RARA 5LD2C 3R9WA 2JLRA 2E85A 3HY3A 4FR2A 3W04A 2GNPA 1C8BA 2B0CA 4EMUA 1C0EA 1YR8A 4GUAA 1JS1X 1EE9A 4UCXA 1JNXX 4ABTA 4BLVA 4C0AC 1TW3A 5CEFA 1GTJ1 2JDIA 3DYIA 2XCTB 4MDYA 4UE6A 3V3KA 2YN0A 1SUWA 3P9SA 4PZPA 1K0UA 5DIFA 1E1RA 2OQIA 3OZSA 4JLUA 3JRWA 2RB5A 3S29A 1JIQA 1N8NA 2OCLA 4F97A 1J5PA 3VU8A 1JIIA 1V3VA 2MMGA 3ETHA 4F11A 4MDEA 3ANTA 4FOPA 4DC9A 4NR0A 4CDNA 1VKHA 4WSOA 1UBUS 1KJWA 4JEHA 2J3MA 2XQVA 2GPBA 4R81A 1J25A 1Y37A 2LE0A 3DW1X 2P6MA 5CLJA 5IUNC 1FZTA 2R97A 1BMQA 4A8JB 4AF7A 4I5FA 4I50F 3KPVA 4IFTA 4PYQA 3WICA 2LUOA 4D82A 5F7OA 5K3CA 1MA0A 1I6WA 2ZJYA 3IP9A 1I1HA 3R20A 4B75A 2GJ9A 3M1AA 4Q18A 1A50B 4YR7A 4C2UA 2I6FA 4JZKA 1GL6A 2P2SA 3KWJA 3F49S 3BFVA 3FOEC 3DDNA 121PA 1JA9A 2V7EA 4RY8A 5DULA 3R0ZA 4AJHA 1TYEB 3OE4A 1QO7A 1YZVA 1IJEA 1A71A 2AG1A 2MU1A 3MT7A 4JP3A 1PJ8A 2O1XA 1E59A 4R0VA 4ZQEA 3PXGA 4OQLA 2POCA 4BZPA 1IM5A 3HUEA 1YQUA 2FW7A 1V1JA 1GSAA 2VYCA 4KRGA 4PNPA 1AS3A 3BBPA 5JNSA 3LPNA 4ZREA 1PGQA 2F48A 3FCAA 4W5WA 1DO2A 1ZCZA 3BB4A 1CRPA 2BGGA 2E6UX 5ERXA 4IHAA 3KX2A 4IX9A 1K66A 5JSUA 4FYVA 2VRBA 4U39A 1K75A 1Q7RA 1R4AA 3M4NA 4JITA 5EE0A 4YT2A 1G6KA 1M7BA 1QP8A 2O1WA 2OCKA 3BCUA 4EJSB 3DVQX 4WV3A 3CWCA 4A1FA 3S1SA 2KYRA 3KXPA 1DQRA 4K6CA 5AM0A 2OK7A 5EVCA 1U2ZA 5BN5B 3V8EA 4D6YA 3C3DA 3OTGA 1XC7A 5JEEA 3H5TA 4PLVA 4QBKA 3FAKA 4JMLA 4ESVA 1E2EA 3FRJA 4OQZA 3T4XA 3RUHA 3LE8A 3O95A 3GT4A 3WFIA 1F8YA 1KXZA 4MLDA 2EP7A 5JWOA 4WQMA 1KO7A 1BS9A 1UC4B 2BEUB 4IXDA 3MD9A 1E4EB 2O07A 5LU8A 2UUPA 4DLZA 3PR2B 3P26A 1C9MA 1UKVY 5ESDA 2PX0A 1YHZA 3QF7A 3PQEA 1L7EA 721PA 3C16C 5AJVB 3INYA 4IIJF 4FHFA 3Q7IA 1Q1GA 3MMPA 3AF6A 2CDRA 3KKPA 4FDLA 3ZLUA 4IZIA 3UHPA 1M2VA 1J0DA 1V7CA 2O7NA 4LHEA 4OD0A 5H16A 4Z2YA 4CLRB 1MT3A 2OLKA 1L1RA 1SKAA 1T2NA 3RFCA 3CLSC 3QKRB 4L76A 5JR3A 4Y67A 1G9SA 1P9RA 3QITA 4XD7A 2FE4A 2ANBA 2BR5A 3R6DA 4MKHA 6ABPA 1Y1RA 2G71A 4N03A 1EUQA 1HH4A 1WE2A 2PV7A 1G5HA 4NU0A 2DKNA 2H4FA 1E5TA 2BSAA 2G17A 4QLOA 2NU9B 5JYCA 4R40A 1Z2DA 4P4LA 4PW0A 4HZUA 5IBPA 3KOUA 4BP9A 5D87A 1DDIA 1S4QA 2PS3A 4BNIA 4NDAA 1L7MA 5BW5A 3IKTA 5THXA 3E22B 2DLCX 2CD7A 4B47A 1XEXA 1P1FA 3CH4B 4Z4FA 3UAYA 2VHWA 4X45A 3WL8A 3PUIA 5IN4A 2XZPA 3ECAA 1GHTA 3EEYA 4FGZA 5DTRA 3ZCUA 1DJPA 3K09C 4QBTA 2CYCA 4KOEC 4I9UA 3UFXB 5KOIA 1EH5A 1VA5A 3F67A 4HJRA 3I4CA 1N2JA 4W5HA 1P0MA 1Y3IA 2FUCA 2X40A 1Z0IA 1OBVA 2ODEA 3E8XA 3GWZA 3EEOA 2AQHA 4FQ5A 3UV6A 4DMCA 1KZ7B 3OEYA 4Q24A 1I3MA 3NONA 2ETXA 4IILA 5FCDA 2Z9DA 1XZHA 3DE4X 4ROSA 5DBIA 2WLSA 3SC6A 5IFKA 2I0FA 3P96A 2ZB2A 5LU9A 3K1TA 3ZWXA 2W6NA 4EG5A 1HL3A 2C4TA 5BVHA 5ETJA 4GNKA 4LVCA 1UPFA 5L6MB 1SUEA 1T4CA 2HEIA 4BIMA 3OZRA 3A6GA 3G8BA 3IDZA 5ICCA 5LQKA 2CXNA 3PCTA 2HJRA 4Y2SA 4Z4QA 2RHDA 1GD1O 3RTAA 4B35A 3PT9A 2O14A 4WAUA 3NFYA 4Z7NB 3L6BA 3HLYA 2O2DA 2CXXA 2VJKA 4Q4LA 3R5KA 5TF4A 1N3IA 1N2GA 4QFMA 3KKLA 1U3DA 2YVAA 1Z25A 3WZ2A 2EWMA 1FJXA 2IE0A 1N6KA 2B9VA 2D13A 2D1QA 4HN4B 1OT3A 4D0SA 4P33A 4NPHA 4RHUA 2Y1XA 4B2PA 5FAXA 1FS5A 3GGJA 3X44A 4GDFA 3I32A 4RV9A 2FN8A 1J0EA 2VIIA 3FNFA 3P9QA 4EHBA 4EUFA 4KODA 4I9HA 3L0SA 2XGOA 3DHYA 2FNAA 3IULA 2UYGA 4C3UA 4Q3OA 1N5LA 2ID8A 2QZSA 5HFNA 2YWFA 1L5MA 4C07A 4ESOA 2HAEA 2B8WA 1TM7E 2EEZA 4PGHA 1ZH8A 1M1UA 4RZSA 3BCRA 4UFOA 3KTOA 4OP1A 1ZO8A 3QM1A 2VJLA 4BRWA 2EW1A 1OTYA 5EP3A 1FFXB 1VHLA 2N42A 3PKJA 3SCZA 1AHIA 2VHUA 1QC5B 3U3KA 1R0LA 2GRUA 2ZI4A 3IR6A 1KY5A 4D8TA 1EFVA 5JCJD 1X1QA 3E7XA 3S5JA 1QK5A 3C7TA 2ZIWB 2EBUA 2YNMD 3WLHA 3IAXA 3MT8A 2BFFB 5AESA 2CXTA 1TCBA 3GAFA 2CNOA 3INTA 3OZEA 1A95A 4NPAA 4OP3A 1HSZA 4IWYA 1RQ2A 5KEIA 1I33A 1L5ZA 2HIGA 3G0IA 4RKQA 2XGMA 5GVSA 3CF4G 3GJXC 5KDLA 4OGKA 2HQSA 1OU4A 1UOEA 3NYWA 4WESA 3ZWNA 1V8BA 4LMRA 2L42A 2HEGA 4EVQA 4XRRA 1ABEA 5AMXA 1Z8NA 4QEZA 1F3LA 3V7YA 3T52A 2D2XA 2WMNB 3HI4A 2BR4A 2Y76A 2MYTA 3H75A 1M8FA 1ZW6A 3QQ5A 4WBXC 5JZMA 1ZCFA 4MS4B 4EW2A 1S8FA 1MBZA 1C0KA 3PC4A 5IM4F 5BXQC 1NL3A 3UHAA 3K0CC 3QMWA 4Q3AA 1JB1A 4QBGB 1KQOA 1LBTA 3A3NA 4XIFA 4C03A 1ZR4A 1JPVA 4FGLA 4UUMA 1F9AA 3STTA 4H2DA 3T0FA 1CB0A 4UMVA 1V35A 4BKOA 1ZD9A 1X80A 3M6FA 1G8FA 1IG0A 1QR2A 4GMXA 1QOPB 1R9GA 1SMKA 1SVIA 2OR3A 1KTVA 1GT91 2GTIA 4DJFC 5FI1B 4RF4A 3PPVA 4HXFB 2I7XA 4ND3A 3D59A 3F3YA 4V38A 4X20A 4DV2B 1J07A 3HR4A 2O54A 2AEJA 4FYYA 2DETA 3E1GA 5J2UF 3L6CA 4JQCA 1ES9A 3KKMA 1HV8A 2FX3A 1Y89A 3P9CA 1YKFA 4ZCIA 3K70C 3EA0A 3MGGA 4DDHA 3C3BA 2JFHA 5CX1A 4V02A 2GX6A 4E5VA 4MVJF 3ZHOA 2ERXA 3BC1A 4I19A 3KE8A 1DAHA 4RH0A 3QXJA 4JC4A 4BATA 5LQMA 2H7CA 3U6BA 1NW4A 5JJBA 3CX7A 5G4LA 4XIJA 3ZXIA 2W2XA 3ZI0A 1UBMS 3CZ4A 4L4RA 1BN7A 4LDZA 4C7XA 1XJ0A 1VGQA 4YRAA 2QWXA 3QFSA 4W5OA 1N92A 5AJTA 5ECDA 1HBJA 3L7JA 4C0WA 1KMNA 2JLQA 2PNJA 3E2PA 2IYTA 2QJWA 2FLVA 3CH5A 3O75A 1MKYA 3F4KA 2I4LA 3CV3A 5DFAA 2AFIB 1XI2A 2EGUA 3C3AA 2CE2X 2GEFA 4B34A 2W42A 4KUGA 4M8LA 4LW8A 3R3JA 4RD4A 2BWJA 3L1JA 4F84A 1RHRA 3UOGA 2IXDA 3EGXA 3BKWA 1GDHA 2C2GA 5DYWA 3IXMA 2B1JA 4NZYA 1LI7A 3OFNA 1N34B 5LD2B 3UA3A 3AR8A 3K2EA 4QFBA 3T61A 1ICIA 1BEZA 2QLLA 1K2WA 3HH8A 4WL0A 2XRMA 4Q01A 4LY6A 4B3HA 1E92A 5FLXA 2AX4A 1I7LA 4C76A 5BMVA 1YMQA 1AUPA 1YH3A 1S2GA 3QV1A 4W7IA 3C3JA 3UHFA 4I9NA 2VT7A 1WMDA 3LGSA 3OT4A 1JJVA 3H2YA 3JQAD 3PKIA 1N3LA 1OBCA 3JYNA 4R1PA 1ZIXA 3GG2A 3ISVA 3A9VA 1V1MA 1TA0A 3ZE1B 3ZV3A 1L9XA 5BOSB 5I9MA 1K86A 4RTMA 2ZIUB 3L82B 4PSDA 1XZQA 3NBXX 4HVAA 3DTVA 4QPZA 1KDRA 2NT3A 5EOVA 3U3XA 6GPBA 1BU8A 1VDZA 2HFJA 1NQVA 1GU1A 3EAFA 3M4YA 3RRJA 3TB6A 2E6KA 4D3ZA 5FLEX 1EUZA 4ML3A 2WI8A 3DV0A 3GUYA 5BVGA 1OWNA 3GDFA 3OLZA 1JLKA 1PDWA 4FZJA 4TYQA 5JISA 4BAZA 2MYPA 2GBCA 4GXTA 2CK3D 1Y5MA 2ICAA 4D4GA 2VPZA 4YCMA 1F6DA 1Y3BE 2RHRA 3ELDA 1KO4A 2C83A 1JQAA 2X7HA 2DKOA 1GKIA 1SU8A 3IEUA 4HDKA 1TTTA 4TTTS 4PZZA 3DOEA 3A1NA 4CL3A 1OLUA 3NIWA 4YAOA 1X8JA 3VH1A 1MV5A 2R60A 3DVAB 4HEJA 3VHXA 2BTQA 3B1YA 3WJ7A 1HEYA 3TYXA 1Y9EA 1V25A 4DPMA 4QNRA 1RC8A 1CR6A 4R9NA 1UDRA 4BYMA 2QTCA 3DTNA 4JH0A 3H5AA 4Q9LA 1T9HA 5ARCA 1LSSA 3ZJ5A 4YRMA 3V1NA 5DYNA 5ADHA 4CDGA 3J7AC 5JE8A 1WDMA 4EUSA 2A1IA 4UMDA 2ONZA 4OY3A 5JBQA 4JI0B 2E0IA 4B45A 2A9KA 5BVGB 2VF4X 4EBFA 3NHWA 1C80A 1W88A 2EERA 3O3CA 4L07A 2FZWA 1I32A 5F5LA 1BAPA 3VC2A 5CVCA 3ZGNA 4EKDA 1VZ3A 4H9GA 5CCBA 3VYTB 2ANCA 2QTRA 5IH7A 4OMUA 5JXGA 4W9MC 3AUUA 1ZJ5A 3MUFA 3H5OA 1G5QA 4ZK6A 4QJ4A 5DNVA 2HMAA 3MWGA 3R7BA 4ESHA 4CCYB 4HR7A 1RPNA 3TECE 3Q87B 5CDHA 4UE3S 1JHDA 4YLEA 2X0JA 4O63O 5FFMA 5KNDA 2JCGA 1KZ1A 1PN3A 2G80A 3ZDZB 3N8IA 3D2LA 4O4IA 4OLHA 4FEEA 5E6UB 2D4HA 2NV0A 2R9VA 3Q85A 4MQFB 4P81A 4GICA 4ZAFA 5HDQA 5I3ZA 1JDSA 5LXTA 4L08A 1CT9A 1WDKA 2W48A 3EQ9A 2CCKA 1F2DA 1GJRA 1LA2A 4NXNB 5BUCA 4OL0A 1R8XA 2FP3A 4Y7CA 2IXGA 3VZPA 1GRQA 3OX2A 1ATZA 4TYWA 2OHJA 2Q3EA 4RL6A 4A6EA 2O7RA 2QNRA 2J30A 4EGSA 3T3OA 5LKRA 2XMSA 3AEZA 3DAPA 3WL4A 1NI3A 4EG3A 5JDIC 3OH8A 5AM2A 3V80A 4H0NA 3W5JA 1CZHA 1NVWQ 4DABA 3D4LA 4PPYA 5EXPA 3BHNA 2YQ5A 1Y9DA 3GNTA 1CDEA 1LPNA 3B1JA 5I47A 4G1FA 2ZR9A 3M9LA 1RP1A 5LIPA 1GPNA 3ZCSA 4XDHA 4KU4A 5KMGB 4CMEC 4ER3A 5REQB 1YDWA 4LSGA 3GQBA 1Y81A 3QUTA 2OFXA 1YC2A 1VYUA 2OG2A 3FE2A 1DXYA 4PPFA 4RZQA 2H1HA 2IV3A 1M2EA 2HB6A 2H1FA 3NJRA 1LY1A 4C7VA 1K27A 5KMGA 4YCDA 2ZM5A 3F2VA 2DWQA 1F06A 4WVFA 5C5CA 3JQBA 2C7PA 4FDUA 4R05A 5AKIA 5BV8A 1H9BA 1JX6A 2DCUA 4HVCA 1X13A 4XSGA 1SCNE 1PBNA 3JAKA 3ZDFA 1G291 4EY3A 2M6RA 2C3OA 3CPJB 2AC7A 3ITDA 5EYPA 2FQWA 1OHHD 1TECE 3I04M 3M2TA 1FFXA 4QL3A 4EPRA 1CLEA 2ORYA 3H4IA 4E5DA 3QGMA 4JFAA 1IOZA 4KVGA 1PVDA 4HF7A 3UMBA 1KTIA 1DNPA 1XZAA 3NBZC 3U4IA 2PVCA 3OMLA 3E3AA 3QFHA 4LVUA 4NU5A 1MMFB 2OGUA 2VYFA 4WACA 1XQ1A 2H63A 2QKYA 3R3YA 3BUSA 4NG5A 3ER6A 4B3FX 1OR8A 4W9NA 1NDQA 1XTTA 3ZDEA 5A04A 3L8CA 4ZO9A 2J0UA 2WHYA 3W8NA 3IP5A 2NQ2C 3I9V6 4CF5A 1T4CB 4HYTA 4C9BA 1CVLA 2ZQ5A 3I3OA 4BVAA 1IM2A 2CL5A 4COKA 3BXFA 5IDXA 4YMUA 1UEJA 2BMEA 3DAHA 5TEVA 4BN4A 4M36A 5FBHA 1JN0A 4U6SA 5U4QA 3SS9X 4TV9A 5JZSA 5BSHA 5H9WA 3QXGA 5BYJA 3B9BA 1HI9A 4RU1A 5FBRB 4L8VA 4MB0A 4ZVTA 3VR3D 2JIRA 2XE4A 3DMHA 3QK7A 4S1TA 3VU1A 2EYUA 4JBXA 3ENNA 1ESEA 1AV7A 4KIFA 4HDMA 4Y6LA 2OQVA 1U02A 3CVWA 1FNDA 2BFBA 2QOEA 2C8LA 4P08A 1ZUNA 1FTGA 4KYTA 5EKTA 4MXDA 1SXIA 4E12A 2Q2VA 3UJAA 3MCVA 1DC6A 4Q1BA 3UAWA 2B4KA 3P71T 4DGQA 1VA4A 5DI3B 4L9RA 4CN9A 4XWOA 1MO6A 3RK4A 3DEIA 3T1QA 5HQJA 2HV9A 5JJIA 3FF1A 4BFVA 3RUIA 1UJ4A 2QLJA 5LKAA 3H9UA 3H5NA 3B1WA 3TQHA 4PS1A 1WD7A 2QRMA 2W4IA 2O8CB 2YMQA 1R0BA 3PWKA 5E9WA 1N78A 2IYNA 4AO6A 3OD5A 4V24A 4LFCB 3WK8A 2ST1A 1W5BA 3ILYA 3IMCA 2XXAA 1A5TA 1QHSA 1CU1A 3HCNA 1GL9B 4RUKA 3UC9A 4AZ3A 1PGPA 4CIVA 2Y0DA 5ALTA 5KQLA 1TUEA 3HCEA 3FR7A 4AP6A 5B7QA 1A1VA 3TR5A 2IYYA 5BRJA 1U9CA 1YUBA 4EUKA 1W46A 3VPBA 2WIDA 1QQBA 3B6KA 3QVTA 5J2TA 3P5SA 2G83A 4YJGB 1J97A 2H51A 3LS2A 4GKKB 4KWEA 3U2QA 4H7PA 1NBEA 2PKCA 3UMVA 1Q1QA 3NDIA 4O6VA 4OJNA 4Z5XA 4YUAA 5T8KA 1YZYA 3O9ZA 4Q4JB 1VL8A 4WXMA 4B81A 3K73O 4ZKEA 4B71A 3W9BA 3GHYA 5B4VA 5D01A 5KYUA 4AZVA 2MSKA 2W98A 2DERA 3ET4A 1EFKA 4RFSA 3K2BA 3K1AB 1V7PC 2CNWA 3AL2A 5HS6A 1GLGA 1NJ6A 3AV0B 4JL8A 2HWKA 2O2IA 5A7HA 1KYVA 4FZ5A 5D3MA 1CF9A 2C2BA 1GL7A 4PNZA 3T1NA 4D9HA 4KPFC 1LBIA 1KYWA 3LHKA 3I5YA 4IKOA 1MD9A 5IUKC 2IOFA 1K8XB 2R8YA 1TKBA 4YIHA 3KSAC 3U7GA 4HFRA 4DWOA 2OV8A 4INZA 1XLUA 2O7SA 1F0PA 1RMQA 2JIQA 5DWVA 3SQMA 2QM3A 3N8GA 2G0AA 4YP5A 3W5IA 2CXOA 2J0VA 4LKRA 1HG1A 3EJWA 3A6EA 1ZUWA 4GLBA 1KEZA 1ZOIA 2OQ2A 1IRXA 3K9BA 5SY6A 1YDHA 1II0A 4BPRA 4FMBB 2PPVA 4QPCA 4QODA 2PGIA 1NI4A 2IIBA 1C9KA 2V65A 1FF9A 3EVFA 3PXXA 4YWHA 4XX0B 3ZWQA 4BMPB 1CJCA 4AQDA 3LBNA 4HX9A 4D0NA 2IUTA 1KL7A 1RC1A 2NVUB 2GLUA 1GGMA 2QJRA 2GEUA 3A2LA 3NP9A 4DW8A 2AFIA 3UUWA 2JLYA 3DM5A 3GELA 2ATXA 4FE7A 2YV2A 2RHMA 4Y0NA 1RPTA 2HJ9A 4P34A 5KSOA 2WYUA 3F8SA 3GDHA 4J7CA 4E3WA 1UPAA 2RDMA 1LWOA 4JJAA 1FLAA 2I6GA 3C0KA 4G37A 3O4IA 3K9LA 3P4YA 2CLIB 3V4ZA 3MUNA 4ENUA 4LY9A 4L28A 3IUJA 1QIKA 3T7CA 1XQYA 2XMRA 4EMTA 1NZFA 1QDEA 1QOZA 1Y3AA 2V6BA 4KAJA 7AT1A 2ISQA 2FN9A 4G0ZA 3UMJA 3WSWA 3DOIA 2JFFA 2VF8A 3COPA 3WKCA 1X19A 4HEA6 1OXKB 2R85A 1V0JA 4YMHA 1I3KA 1FYWA 2BFCA 3MVEA 4ZYUA 1FBNA 1FX0A 2QLNA 3H7AA 1NMYA 5DGXA 3K71B 2DPYA 3ERCA 4H0CA 3BRWA 3WGVA 1KEEB 4RFLA 5LB4A 1B6GA 1OFHA 1E4EA 4K03A 3AVPA 3P2YA 2IV2X 5PGMA 4MRAA 5EJ4A 2AR9A 1WNFA 3E05A 3GOQA 2B1IA 1HDYA 4ZARA 3QYFA 1PFKA 1MCZA 1HRDA 1R4MB 5C5EA 5AVZA 1KEKA 5IRCD 3WGHA 2IYOA 3UATA 3R7WB 3F90A 1GQOA 4A5OA 1BCRA 2V3CC 1VMIA 3R0QA 1KQ3A 2QVZX 1G19A 2HA2A 4GEKA 1Z83A 3RUPA 1WKBA 5BN5A 5KDOA 3TGPA 3OZBA 3BMNA 3QW4B 4D0GA 2PQMA 3FSEA 1T24A 2V03A 3O7WA