2X9GA

High resolution structure of tbptr1 in complex with pemetrexed
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
publication title High-Resolution Structures of Trypanosoma Brucei Pteridine Reductase Ligand Complexes Inform on the Placement of New Molecular Entities in the Active Site of a Potential Drug Target
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 94
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x9gA00
1DJQA 1S6YA 5KVQA 2OL4A 2B5WA 3U4IA 2FN7A 3TPCA 4ILKA 1R66A 3TL3A 4P38A 3KOUA 3IP3A 1ISGA 4YPOA 4WOKA 4GL4A 5L9AA 1Y8QB 3BAZA 4PGFA 2PY6A 3GN1A 4I8XA 1W6UA 4ALJA 5IDXA 3WNVA 2HMUA 2UYYA 1JKIA 1ZEJA 2YY7A 1QMGA 4UAGA 3ZWOA 2VT3A 1YO6A 2PD3A 1PWXA 5A9SB 1ZXLA 4J1QA 5IZCC 4BMVA 4YQYA 5BSGA 1B8UA 2EP5A 4L0QA 3K2EA 4LW8A 4NH4A 4RZHA 3AI2A 5L3ZA 2SCUA 3ZWAA 1E5QA 3C3XA 1JKFA 4N7RA 2P4HX 4YBZA 5EQDA 4GX2A 1U7TA 3ZN2A 2I65A 1CRWG 4GX1A 5KNLA 1GCUA 4DREA 1LSUA 3H4VA 4OJNA 4KDEA 3OSUA 4PFJA 4JK3A 1EDZA 3RFXA 3U4HA 2AQ8A 2HRZA 2PFGA 4YRAA 2VNAA 1YDEA 5BNFA 3CEAA 4CR8A 4BO3A 2NSDA 3KM0A 2O3SA 2AMFA 1Z7BA 1DC4A 4PVDA 4F46A 1H6DA 4BNUA 3WX0A 5JMWA 4BGEA 3P19A 4CR6A 5KKAA 4FFRA 4XIJA 4OKIA 4OHUA 4M8SA 2PH5A 4K1LA 3KYCA 3GA0A 5B4TA 4IDBA 2G76A 3GFBA 4J2HA 4NFHA 4K6CA 2Q2WA 3ZWMA 2JKVA 4CQLA 1X7HA 1ZNQO 4FFLA 1PQWA 3MJSA 4J7XA 4XB2A 4MVJE 4MIYA 3HNPA 2Q1TA 2C7GA 2J3IA 4XDYA 3JQ8A 1JA9A 1FDUA 3ENKA 4B3HA 3ZWVA 5H83A 3V1UA 1NM5A 3PFFA 2BF7A 4UEOA 4HUJA 3GQVA 4GLOA 4CM7A 2X8LA 2C29D 2WM3A 1PS8A 3DZFA 1BXGA 1ZJYA 2DPGA 5U4QA 2NQTA 3ZNPA 4BNIA 4JNKA 3ABIA 3MEQA 1MFPA 1TT5A 2A35A 1NASA 1VL6A 1KY5A 2G82A 2P5YA 2ZB7A 2ZYDA 2DBQA 3C1AA 4N18A 4R69A 5LDGA 4FOOA 3PJDA 1MXHA 3KRTA 1NAHA 3DTTA 2TMDA 2VHZA 1HKUA 1GY8A 3I83A 4YB8A 3TZKA 1G6KA 3WG9A 3DZHA 3LQFA 3FR8A 4RPJA 1O8CA 5HA5A 3RKUA 4Q3BA 4AJOA 1E7MA 5TJ9A 4WK6A 1HYEA 1WWKA 3L9XA 4BO6A 1PJ2A 1PWZA 2C59A 4CV3A 2P5UA 2DQ4A 3GPIA 1U2DA 4WCFC 4MINA 4RV9A 4OOEA 3KLMX 4UULA 3ZV6A 4KOAA 1PGPA 2O2SA 3WSVA 1B2LA 3ZU5A 1VKNA 4GSKA 3WYBA 1HSOA 1NVTA 4ND4A 3DZKA 3GGOA 1HLPA 1RM0A 2X4GA 5A9TA 1JWAB 1V0JA 1XU7A 2ZB8A 2X0IA 4RVDA 3JD4A 1I0ZA 3ST7A 3WQSB 3W1VA 5ADHA 1U4SA 1GUZA 3JYOA 2HO5A 1LDEA 4BGUA 1GYRA 1XWFA 1T4BA 4IJVA 1V3UA 1KEVA 4BKOA 3L4BC 1UP6A 2FP4A 2FPIA 1SB9A 4PG5A 2VN8A 5JE8A 3OA0A 1ISJA 3L9WA 1T2DA 3IS3A 4A7PA 5FYDA 1NPYA 4CMGA 4UUNA 2NVUA 1ZJZA 4HFMA 2EERA 1EQUA 3VH4A 4ZN6A 1PJLA 2FSSA 2AEFA 2PD4A 2NVWA 2IODA 3HSKA 4Q3NA 3LDHA 2CDCA 3AU9A 3GR6A 1XELA 4E6PA 5KIAA 1ENZA 4J9VA 1KVSA 3H2SA 1E3LA 4R4JA 5JPIA 3UKOA 3VZPA 3IL2A 4J3FA 3MJCA 4UVEA 3U3XA 3F47A 3TFQA 4D3SA 2BKAA 3WDSA 4P4GA 1LA2A 1WZIA 4JBIA 1A7AA 2PGDA 4RF4A 3VZRA 3W8DA 2W2LA 4MVJG 1AGNA 1LRJA 3E9QA 3D64A 1KOLA 1UXGA 4DPMA 4QEDA 1IYZA 3QV1A 2CFCA 4R1SA 4YRDA 3IJPA 5LDHA 4TZTA 3GOHA 3Q2IA 4CUJA 4ZICA 1Y9AA 4XQEA 5TNXA 2EKQA 3BMNA 4A5OA 3DZBA 4LSMA 2O23A 4PLYA 1Z74A 2VWPA 3K31A 4W4TA 1LSJA 5CFZA 2Y1CA 3INGA 4UVGA 1J0XO 5JAIA 4PG8A 4OQYA 4NZ9A 4BNHA 4LMRA 1W4ZA 3OBBA 3VPHA 3R3SA 4LMPA 3WSWA 3ASUA 1XKQA 1IOLA 3H9UA 2W90A 5A03A 3A4VA 3BYZA 3GZNA 3HDQA 5C7OO 3IP1A 2PGLA 1N5DA 3E1KA 3GVXA 2Z1MA 1L7DA 1QLJA 2OMEA 1UAYA 1M75A 2O3QA 3X2FA 1JWBB 1NR1A 1UR5A 1I01A 3PI7A 1K2WA 1DLJA 2FR8A 1IZ0A 1DIBA 4G2NA 2W2LD 2YDYA 4IZIA 4II2A 4QO7A 3VDQA 2AE1A 5DOZA 2ZTLA 3ONEA 4B4WA 4E5NA 5HBRA 1PQUA 2ZIZA 3OH8A 2ZK7A 4YAGA 5J23A 1BDMA 2O3RA 4AJJA 5FI3A 1O94A 3FNGA 1YONA 5I8ZA 1P33A 4QT0A 4Y9DA 4E33A 1Q0HA 3H9QA 4FPXA 4BS9A 3GN2A 3KEOA 4GKBA 2O3UA 1KBZA 3GHHA 3RC9A 1VRWA 3CIFA 4MO2A 1ZW1A 2FOIA 3UCXA 2DTXA 3JQ9A 1PZGA 2ILTA 3AM5A 3CH6A 1UXJA 5IDYA 2GDZA 3QRWA 4IY1A 3DFZA 2B36A 4PRKA 2HJRA 4EW6A 2J6IA 1YBMA 3FR7A 3M1AA 4HBGA 3NTRA 3I3OA 2QIOA 3OF2A 2EKLA 1F14A 2JAPA 3K73O 2EIHA 1DJNA 2HK8A 1NNUA 3LVFO 4H3VA 3PIIA 2B35A 4YCAA 1PQPA 1PL7A 1JVBA 4ND5A 3DHNA 4AJHA 4O59O 2E4AA 3VPFA 3BMOB 1SO8A 1RYEA 4WEQA 3LT0A 3INTA 2GERA 4YJHA 2V6FA 1HE4A 3OJLA 1I2CA 1EFKA 4E2YA 2PZJA 5U1PA 3GNQA 1EEHA 3LC1O 5ER9A 3MJ4A 1SOWA 3PPIA 4PLHA 1R4NB 1H0KA 1SEPA 5A05A 4CQMB 2GSDA 5L7TA 5BT9A 3BMCB 4TRJA 3LT4A 4URFA 5AXBA 1HSZA 4TQGA 2V6MA 5JW6A 3H3FA 3HQ4O 3BA1A 2BMAA 1BDBA 4YAKA 4I9NA 4ITUA 4PG4A 1MG0A 3SVTA 2FPPA 3I9LA 1N9GA 1DHRA 5KVVA 5I8WA 3ZV5A 4F45A 4QFCA 1VM6A 3ZU3A 3GK3A 3H7AA 1QXSA 4XYGA 3QE3A 4XGIA 1R0LA 3S2GA 1H6BA 2QZ9A 3JQAA 2HMWA 5JDCA 1ML3A 1NBOA 2IEBA 1U3UA 4A27A 5I9NA 2A92A 3LLVA 4K9DA 5G4LA 3R1IA 3JD0A 1RPNA 5JYEA 1HYGA 3VPGA 3Q9NA 4KUEA 3AFMA 4Q3AA 3F4BA 2WDZA 2PZLA 2NTVA 1BVUA 3SLGA 4QUKA 4MPDA 1EUCA 1LXCA 4CM3A 1Y5RA 1UDBA 3OQ1A 2GLXA 4TVOA 2EWMA 4ID9A 1XIVA 4GGOA 3GEGA 1K0UA 1F0YA 5EMHA 4BKQA 3DMTA 2VHWA 1CEQA 3D4NA 3JQBC 2Q4EA 3C24A 3V1YA 3PP8A 2GN4A 2Y1DA 4CMKA 3CINA 4WLVA 2GPTA 3G1TA 3AUAA 4IDEA 4ALIA 5T64A 4BO8A 3S2IA 4NG5A 1GU7A 2BFAA 3DC2A 1Z73A 3JSAA 4NPCA 5G4KA 4GGPA 1HDYA 3UFXA 3K92A 5ITVA 2WWRA 3WQRA 2D4AA 5KJ6A 1U1IA 4JGBA 2D5AA 8ADHA 4I1IA 2DC1A 2NWQA 3PWSA 4FW8A 4CV0A 5DP1A 3U62A 2ZTMA 3JQAD 1TB4A 1C1XA 2B4QA 4B8WA 5DCUA 2CD9A 4JBHA 1R16A 2Z5LA 3N74A 4WEOA 3OMLA 1U7HA 4Z0PA 4X54A 1DHTA 2GO1A 4L76A 4I9HA 4RZIA 4BNXA 1SOVA 2CDBA 2EGHA 4BB6A 2X22A 3BTVA 3EC7A 3MJEA 4R68A 2C0CA 1ZK4A 1HXHA 2CVOA 1ZSNA 1GTMA 1WXDA 3QSGA 1C14A 2YFHA 5EINA 3PEFA 1DXYA 5T6BA 3AUTA 3BIOA 3BMQA 1IZ9A 2RH4A 3SEFA 2OHXA 2D5CA 3C1OA 3B20A 2YHIA 3JD3A 4PG7A 1MG5A 1G0NA 4RLSA 4Y6PA 4IJKA 3RUHA 1D4FA 4AJIA 4D42A 2G0TA 4E21A 3D7LA 3TN7A 5IDQA 2YW9A 3HDYA 1IHXA 1DC6A 2G5CA 2DUWA 3D4PA 4DUPA 4HKTA 5GMOA 4K6FA 4LCEA 2WYWA 3H5AA 5DBIA 4GBJA 2J5QA 2OGUA 3K96A 1D8AA 2IZ1A 4WGGA 2BGKA 3F5QA 3GZ4A 3RBZA 4IGEA 3AOGA 2VRBA 2D8AA 4PZCA 1R15A 1OFGA 2O2YA 3U5TA 3K6JA 4XJSA 3V8BA 3I9KA 3PXXA 1PX0A 1PJ4A 1GDHA 3RUDA 3T4EA 1OZAA 4NBRA 1HDRA 2FMUA 1FDSA 1PTJA 4J0FA 4ESOA 4HFNA 4LRSB 4MKRA 4FJ1A 4KUGA 1KYQA 1LDMA 5C7LO 1A4IA 1A4UA 3Q11A 3T4XA 4W7HA 2P9EA 3OHSX 2PA3A 5L95A 1DFIA 3GMDA 1VI2A 3P5SA 1XR3A 4ALMA 4AL4A 4MIOA 1EVYA 1DSSG 5COAA 4MKZA 1H5QA 3A14A 2AG5A 4Y8VA 4J4TA 3RJ5A 2IXAA 3WMXA 1B3BA 3QWIA 4NK4A 3N58A 4TKMA 5A06A 5DT9A 5CDSA 4BO7A 3LF1A 3AW9A 4LCJA 3IUPA 2VUTA 3AWDA 5I9LA 2QRLA 3HUDA 5KCZA 5L53A 1EVJA 4KZPA 4EUHA 1I3NA 4OM8A 1P45A 2DAPA 4TWRA 4AJKA 1D1TA 1H93A 3JYNA 2H1SA 1R12A 3WGGA 5JAQA 3VC7A 1DDOA 4MP8A 4YR9A 2IEDA 1YVEI 2QW8A 3IIEA 4NJMB 1M76A 3RVDA 3AM4A 1BW9B 1C1DB 4YAEA 1HDZA 3ZH2A 3BZUA 3OICA 3K5PA 5JO0A 5DZSA 1KEWA 1HDXA 2Q1UA 1ULUA 5GZ3A 4CM8B 1E3EA 1D3AA 4TRRA 5G0UA 4MKXA 3VPSA 4L73A 5TT1A 2YQ5A 1I36A 3FTNA 4F6LA 1LLUA 8LDHA 1VKOA 3AM3A 1GYQA 1ZVMA 3SXPA 1ZBQA 3ZNQA 2AE2A 2X5JO 4P8RA 1ISIA 1IHYA 3PJEA 4D41A 2QQ5A 3L6EA 1DBVO 1YQGA 2HQ1A 4OAQA 1HE5A 5G2OA 3KETA 3PWZA 3RAJA 1ZMOA 4FR5A 2CF6A 2HCTA 1XEAA 3NDJA 5DULA 1LC0A 4IDAA 3NV9A 1PS9A 4MVJA 5AYVA 5TGDA 2PKQP 3PK0A 2CNBA 1MX3A 2JFFA 1AHHA 3WMWA 1FF9A 4CMCA 4G5HA 5ENDA 4BNMA 4YJGB 4DIFA 9LDBA 1QYDA 4J91A 1XCBA 4DYDA 4R9SA 3NDIA 3QVTA 2BELA 4HV4A 2EEZA 5JAMA 4UUMA 5ICMA 4J4HA 1XA0A 3AI1A 3HZZA 3AJRA 1XGKA 4J6FA 3B70A 1UAGA 5TF4A 3H5RA 3VZQA 4QTZA 2X0JA 4M54A 1EMDA 3PHIA 1RM4A 3JCZA 1JAXA 1PJSA 1UZNA 5CG2A 1BMDA 4EI2A 4FN4A 3PDUA 1I8TA 2W2KA 2E37A 4FGSA 2FZWA 4XRGA 1UDAA 5TQVA 2BI7A 2NVBA 4D43A 5A4DA 1SC6A 2X23A 3JQ9C 4MVJP 2ZJ0A 4J9UE 4S3MA 4UUPA 5TLSA 1P1FA 1YGYA 2Y05A 5LCXA 3SX2A 5CAEA 5CEEA 3W6ZA 2DBZA 1W73A 4KTVE 1E92A 4CM4B 3DBHB 5COBA 1QV6A 4MVJD 1GFSA 1LX6A 5JNLA 4KMSA 4WLFA 4FDAA 4JN6B 5BQFA 2XF8A 5B37A 4O1MA 3RSHA 1SBYA 4BO9A 1F17A 4YYZA 1F8FA 1ZK2A 1FDWA 4PCVA 1LDYA 1HETA 5FF9A 3M6IA 4GSLA 2O3JA 2WD7A 3FSRA 5DF1A 3AFNA 1EK6A 5IAAA 1XYGA 4DQXA 1NPTO 2DBVO 3RC7A 5I7VA 3EZYA 3ZZNA 4PRLA 1LBEA 1P1HA 4IDGA 5AOVA 4JP3A 2QYSA 5JBIA 3ZHBA 1KVRA 3I4FA 4CJXA 2OFPA 5JO9A 3WQQA 1N1GA 3HN2A 1YOVA 4WUVA 2ZQYA 1JDJA 4MIEA 4E31A 1J4AA 1U5AA 2GASA 1P3DA 1C0LA 4ND1A 3RBXA 3DOOA 1LTHR 4OO3A 3RU9A 4EUEA 1IB6A 1U4OA 1OI7A 3ASVA 2JCXA 2J5KA 4B4UA 1KY4A 4UEKA 1YL6A 3PTZA 2HJSA 4J16A 3DBLA 5KVSA 1JTVA 1P9LA 4D46A 3JQBA 1PSDA 2Z95A 2JD2A 3A1NA 3CZRA 1E1NA 4ZRMA 3VHRA 4Q3CA 5CEJA 1K6JA 4AJ1A 1O89A 2J5RA 1BVRA 1FDVA 1N92A 3GG9A 5JDCC 2VTEA 1N1EA 4DLBA 4J7UA 2VWHA 1UZLA 1Y8QA 4NI5A 5A5FA 4JROA 4UEJA 5JC1A 3NRCA 1G0OA 1YS4A 4AJEA 2BH9A 1B7GO 3AY7A 3UN1A 2LDXA 2JCVA 2ZYAA 1GYPA 4R1UA 3ZU4A 2Y67A 5A9SA 5U9CA 2GRAA 4B4OA 1IULA 3HDHA 4D3DA 1U3TA 4IPTA 4E4YA 1TT5B 2VUSA 1VJ0A 3DMTC 1CQIA 5A04A 1ADFA 5EESA 3PJFA 3TJRA 4UVIA 1WMAA 5IFLA 1J5PA 1E1MA 5KJEA 3P2OA 2X5OA 3O03A 3QHAA 4IZHA 3WS7A 4II3A 4R01A 5DNAA 4MVJI 4OXKA 2JHGA 3L6OO 1WVGA 1SNYA 4GH5A 2PZKA 4DLLA 4I08A 2NACA 2ZCUA 4OOFA 3RD5A 4R41A 2YZ7A 1ZK3A 3RU7A 1TVEA 5CEFA 1KETA 4KP7A 3GF4A 2DTEA 3GY0A 2FR0A 1JN0A 4OXNA 3WGHA 4D44A 5H81A 3PHJA 4BKUA 1I24A 4BNVA 2BD0A 1GZ3A 3ZWXA 1VLLA 1CJCA 4KUHA 5JY1A 4CMBA 1JW9B 5COQA 1DRUA 1E3SA 2EV9A 2VTDA 3PJGA 4BNZA 1Q0LA 5T8KA 5TJHA 4EUFA 2YJZA 1I2BA 3ZWPA 3V2UA 3UF0A 4D0RA 1WDLA 3CTMA 1MLDA 4IDFA 4LK3A 1H6CA 3JQGB 1HDGO 4KDFA 2BI8A 4J49A 5KJCA 3ZV3A 2XXBA 2HK7A 2Y1FA 3FWNA 5BSFA 1XHLA 1E6EA 2POQX 1YJ8A 1T24A 2AEJA 2E6UX 4TKLA 4ALLA 3I1JA 4MDHA 3MJVA 1T2CA 3KO8A 1RM3A 2W8ZA 2DM6A 3AOEA 1H2HA 4WNIA 1B16A 4WJZA 5I7EA 4JLWA 4O63O 3GVHA 2VUUA 4DMMA 4P4LA 4GWKA 4NFYA 2NNLD 3I5MA 4YAJA 2XAAA 2YHUA 4N54A 2X0RA 5IZ4A 3EGOA 1SAYA 1I10A 3WGTA 1E1KA 4XZ3A 1ZMTA 1C0KA 4I5DA 2O4CA 2PZMA 4EYEA 1GQ2A 2C07A 3KHUA 3LLSA 1WMBA 2EHDA 1JKJA 1H9AA 4FFMA 4ZD6A 2PTGA 1YWGO 1MC5A 4DRYA 4ZRNA 5EJ2A 4ALKA 2X7HA 3C7DB 4R1TA 4BNKA 4CMHA 4CLRB 4OXYA 4E2XA 4DWVA 4IQ8A 3GGGA 1QYCA 2X9NA 1UH5A 4U5QA 1A27A 3C7AA 3PFWO 5L45A 2JD1A 4FOSA 4A26A 4KQWA 1GR0A 1U8XX 2JL1A 2HUNA 2PNFA 1ZIDA 3COSA 4MVJM 4EJ0A 1AUPA 3C1TA 1I3LA 1I30A 5G0WA 4B3IA 3EW7A 3UUWA 4JQCA 3RC2A 4RDIA 1JLLA 3VTFA 3GGPA 3GT0A 2PGJA 1NPDA 3DOJA 3CUKA 3NKLA 4IJUA 5AQ1A 2Y0EA 3TF5A 2AHRA 4RPHA 1IY8A 4DPKA 1DIHA 3ADOA 4RGBA 5DP2A 1Y9EA 3CMCO 1NXQA 5ILOA 3AK4A 2RCYA 5IXSA 2D59A 5JMPA 1GV0A 2V7PA 3D3WB 4YTEA 1EBFA 3GAZA 3D0OA 3PRJA 3KLPX 5MDHA 3RKRA 1PEDA 1KC1A 1ZEMA 2NM0A 1XG5A 4IINA 2NTNA 4XYBA 1YDWA 2F1KA 4J0EA 4TRNA 5TSDA 3VVCA 2QZZA 3C8MA 3NGXA 4KTTE 3FPLA 1I5RA 4GMFA 2GYYA 3DBRB 4PLWA 1DIRA 2BFOA 3PDJA 1ADCA 3DEYX 4NDNE 4YAIA 1L1FA 5GZ6A 1EQ2A 3VAZA 2E48A 2HMVA 2PLAA 4YXFA 4OIMA 4ZHSA 3GDFA 4CM9A 4BNJA 2B4TO 4NJOA 1RWBA 4OL9A 3TFOA 3ULKA 3NT5A 1K6XA 3WGQA 2C82A 4NR0A 3WTCA 2OBYA 4BNTA 4L4SA 4WLUA 3M2PA 4CUZA 9LDTA 4NFSA 1QORA 3EMKA 3PLRA 4YT8A 4GX5A 3HJAA 4AICA 4RVHA 1MC4A 2X9VA 2YYYA 4DGSA 3ITDA 1E7YA 4NU5A 5CDGA 4KWIA 1YRLA 3INRA 3NT4A 1WZEA 3Q6IA 3EHEA 3NGLA 2D3TA 4J43A 2NADA 3ON5A 3VDRA 3A9WA 4CL8A 3FF4A 4YJFB 1DB3A 5L40A 1PR9A 4NBUA 3HDJA 3UVEA 5CDUA 2RHCA 3KYDB 3UXYA 5IF3A 1P44A 1O0SA 3I23A 2VRCD 1EE2A 3DR3A 1YKFA 3JQEA 3UCFA 4BO0A 3TL2A 4CM9D 2XXJA 3KXDA 4DPLA 5AXCA 4XRRA 1P0FA 2AXQA 1V3VA 2GUGA 4J1NA 4PLCA 3ETGA 3VPXA 3E6AA 3AUUA 4BNFA 1QG6A 1SCUA 4FD3A 3IKVA 4ZQBA 4Z9XA 1ZO8A 1B3RA 4OMUA 1Y5MA 4XWYA 5B4VA 1U3WA 4CMEA 1P74A 3OJ0A 3QVXA 2VYNA 2VOEA 2PKRA 3GPDG 3ZV4A 1ONPA 4U6SA 3H9JA 3KV3O 1LJ8A 3ZWYA 3TOZA 3LF2A 4D3FA 4P4NA 4O0LA 4CLOB 3GRKA 4IDCA 4D79A 3ITKA 3TZQA 1Q1NA 4DXHA 3MWDB 1YE3A 3QLJA 1LRKA 5F5LA 1V9LA 2CSUA 2DTDA 4FC7A 3OEYA 4Q9NA 1A7KA 3Q9UA 4RF3A 3LZ6A 5A02A 1Z7EA 4HWKA 4INAA 4E30A 3BMOA 4IS2A 3QQPA 2O7SA 4YJDA 3G1UA 3GEDA 4JX8A 2IZ0A 2DBRA 2Y93A 5JCJA 2D1YA 3B1KA 2IYPA 1BXZA 4NBTA 4W6ZA 1YJQA 3FBGA 2UV8A 1PZEA 3QWBA 1Y1PA 4RPLA 3DAFA 4RJTA 1R4NA 1K5HA 4YEDA 4CQMA 3JV7A 5K6AC 2ET6A 1BHSA 5I7SA 4MVJH 3NT2A 4AJPA 2OORA 2VWQA 4BOYA 5BSEA 5EQFA 2VYND 2C2XA 3L77A 2Q2VA 3H6KA 1PGJA 5TC4A 3ROPA 3ZGYA 3CKYA 4PLTA 4Y6RA 2XOXA 5A3VA 1W0CA 4EJ6A 2NU9A 1I2ZA 3B1JA 3VTZA 1Y81A 3NYWA 3MOGA 2QX7A 3PWKA 4PIVA 1GQQA 2OOSA 1LDNA 5B4UA 5ITWA 4PLZA 3NTOA 2UAGA 3NAQA 3E03A 1CDOA 3F46A 4M89A 4F6CA 1NHGA 3FCOA 2B0JA 5THKA 1X0XA 3U0BA 4M55A 3EY4A 5L4NA 3M2TA 4WLEA 1B15A 1Y6JA 2VZ9A 4WCFB 3E9NA 2ZYGA 5JCJD 4Z9YA 3WJ7A 1EVZA 1X7DA 4D0SA 3T7EA 3JQ6A 3WTBA 4CQMD 5ES3A 1VC2A 3SBOA 1R4MB 1E5LA 2HKIA 3KSDO 2FRDA 5TX7A 4PZEA 2LDBA 4N5LA 1PZHA 2E49A 2QRJA 2C7VA 2Q4BA 5CPFA 1U28A 5IXYA 2Q49A 5A9RA 3GEMA 2IE0A 4XYLA 1LNQA 4DMLA 4QX6A 3I6IA 3ENNA 5BSHA 3TDKA 1OBFO 1YQDA 3GVIA 3I6QA 3RASA 3ZCXA 4XKJA 3UCEA 4U0KA 3RIHA 3W4JA 1QKIA 2JHFA 5JS6A 1RKXA 3TZCA 2Q50A 2NQ8A 1HF3A 1B0AA 4W99A 3VH2A 3F5SA 1YQXA 1TLTA 3I9MA 4LN1A 2O50A 4BGIA 4O5OA 3PZRA 4J7CA 1M6WA 1QSGA 5I9MA 4RQTA 3UHAA 2W4QA 4XDZA 5JSFA 5EIOA 5T8KC 5CDYA 1NVGA 3SC6A 3EAGA 4BO5A 1WDMA 1ZSVA 3HFGA 3TZHA 4XIYA 5GZ1A 1OOEA 1Q7CA 3ZWWA 3Q2KA 2YFQA 4DC0A 1E3IA 3RFTA 3BHIA 2A9FA 3O26A 1Q7BA 1WW8A 3KB6A 3Q3CA 2Q1WA 3OM9A 4Y67A 5L4SA 4RF5A 4GMGA 3U4DA 4QQRA 3MTGA 1MA0A 3LC2O 1Y7TA 3WIDA 3JYQA 2TMGA 1C3VA 4B7XA 2ZB3A 5LC1A 3MJTA 3AOEC 1DRWA 1P0CA 1M67A 3CXRA 1DOHA 1B8PA 4MJLA 4BV8A 1DC3A 1F12A 1HWYA 1PR3A 2AG8A 3U4CA 4L4RA 3TWOA 4IBOA 1EK5A 1NFRA 1UXIA 2B4RO 2P91A 1HZJA 4W9NA 2Q3EA 3GG2A 4ROSA 4DQUA 4PG6A 4ALNA 1CF2O 4AFNA 3OETA 1UZMA 3OIGA 2RBEA 4PZDA 2AW5A 4NNJA 3WBFA 4IMPA 4WCDA 1VJTA 5DBFA 3VH3A 4FQ8A 2NUAA 3WXBA 3ETEA 1NQAO 1Y8RB 4PLVA 2X1HA 4TMFA 1UDCA 4F3YA 2PK3A 1PGOA 2JAHA 1A5ZA 2H63A 2C5AA 3ANNA 3DQPA 4ND3A 4Z9FA 3HWRA 2C2YA 5JXWA 3N7UA 1NP3A 1WLYA 4DTIA 3DAPA 3VZSA 1O9BA 4M1QA 3O8QB 3WJAA 3X2EA 6ADHA 4U6QA 5K9ZA 3I52A 2E82A 2Q46A 3CZMA 4I5GA 1NQOA 1ZXBA 4HNGA 3C7CB 4XGNA 3UH1A 1ADBA 3AY6A 2HU2A 3HFSA 2NU6A 3B6ZA 2HAEA 4ZVVA 2BLLA 1K3TA 4FJ2A 4RLHA 1CIVA 3WWYA 4LISA 4GVLA 4XQCA 4Z3KA 1C0PA 3JYLA 4XX0A 4H15A 3S2EA 4BKRA 4PVCA 3WFJA 1PU2A 4D7AA 2NLOA 2PD6A 1BGVA 3BHJA 1MUUA 2I5PO 4H7PA 4U8GA 4XA8A 3UGKA 3SLKA 3RUIA 3WGYA 3JYPA 3ZWCA 3ZWNA 1PJBA 2Y0CA 1PGNA 3WIEA 1T2EA 4DL9A 4DQVA 3TOXA 1LU9A 4E12A 2X0NA 4C7JA 1Q7GA 4M87A 2NU8A 3OECA 2I66A 2J8ZA 2I67A 3GC6A 4NJMA 2EXXA 1GZ4A 1ISMA 4BB5A 4FBGA 1BW9A 1C1DA 1E3WB 5KJ1A 4EJMA 4HX5A 3B1FA 4B4VA 4IXTA 4D45A 5KTKA 2YV3A 3HADA 3SC4A 3NUGA 3CSDA 4OGWA 3ORFA 1GV1A 4Q3EA 3QW2A 4CM8A 3RJ9A 5DBGA 1JQBA 4BMNA 3EVTA 4U0JA 5EL0A 4E5KA 1Z6ZA 4CMIB 4YQZA 3JQ7B 3KVOA 1DO8A 1JAYA 5DDIP 4B7UA 2BGMA 1EFLA 1P1RA 4DIBA 3PYXA 4GWGA 1Z75A 4HADA 1UP7A 4Y98A 4E13A 2RH8A 1P77A 5EN4A 3OIFA 4E2WA 5BNTA 3FPCA 4B8ZA 5JDIA 4NHEA 2A94A 2Z1NA 1GAEO 1NX6A 4QXMA 1LLQA 3F1LA 3TNLA 3RQSA 5IDWA 4BGVA 4R1NA 1KVQA 4EEXA 2BHLA 3LC7O 3MTJA 4ZA2A 3CE6A 1K6IA 1LI4A 2DFDA 2WE7A 3GDGA 3H5NA 3NTQA 2GGSA 5DCYA 1TEHA 1JVSA 2GD1O 2CDAA 1DRVA 3FWZA 1DFHA 4GPD1 3UAGA 1EVIA 2Y99A 4OSPA 1KEUA 3G79A 4YJGA 4BNYA 2EG9A 5JC8A 3QA9A 3E8XA 5CG1A 1YB4A 5F1OA 3LU1A 5KVCA 1IE3A 4BNNA 2VT2A 3WYEA 4CMJA 1QYVA 3GFGA 3OA2A 1PZFA 3G3EA 2O48X 1HT0A 1M6HA 2VHYA 5H82A 3OJOA 2CY0A 2CVQA 4FSHA 5T5QA 4E0BA 3WGIA 5A1TA 2VCYA 5HRUA 4GI2A 4NBVA 2JJYA 4R54A 2QYTA 2P2SA 3PHGA 4CMEC 4JP2A 4OYRA 2IZZA 1CERA 3HE3A 1KIFA 1HE2A 2A4KA 5KKCA 5EERA 3UOGA 3GHYA 3UICA 2D2IA 2ZTVA 4L75A 3IQDB 4PLFA 4R5MA 2HDHA 4CLHA 1EUZA 1EBUA 3HB5X 4XGKA 3FTPA 1V3TA 5K6AA 3RFVA 4CM4A 5T67A 1XQ6A 4CL3A 3DBHA 3KYCB 5K0ZA 1NTOA 2FY8A 1GPDG 3ONFA 1H9BA 3DAGA 3EVNA 1OMOA 1IUKA 4YACA 4TZKA 4CQLB 2D0IA 1TA4A 1F8GA 4DBVO 4XR9A 1ONNA 2YV2A 1UUFA 1DC5A 4CM5A 1OAAA 3H2ZA 4G65A 1RYDA 4DIOA 2J3JA 1CWUA 4BO2A 1ENYA 1SEVA 3KSUA 1YXMA 3JQ8B 4BO1A 4I5FA 3MOIA 3OEWA 4XD2A 2PV7A 4CM1A 4A10A 1I3KA 4OSOA 4RPGA 4R3WA 2ZB4A 3DWFA 1BXGB 4MOWA 2HRBA 5JFOA 1ZH8A 3WLEA 1QP8A 1QYXA 3GMSA 5HS6A 2H5LA 4U7WA 5L7WA 2BFPA 3D4OA 4RORA 3WLFA 4C7KA 1PJQA 3F6YA 1LDBA 2JCYA 1O95A 2B69A 3KUXA 4TRMA 3STHA 4ONEA 1DPGA 1LLCA 3DOCA 1IPFA 2GF2A 4JIGA 3ZHXA 1MFZA 4NQZA 3S1LA 1I32A 3DXFA 2JFHA 3NX4A 1M66A 1GD1O 3M1LA 4WKGA 4IQGA 1VL8A 4LRTB 4E32A 2OO5A 4Z0TA 3DZJA 2CZCA 4HFRA 3W6UA 5L51A 1NAIA 3RBVA 2Q99A 4PLGA 1NYTA 4BUCA 2EGGA 3ZNNA 4WLOA 4LGVA 1NFQA 4YT5A 3K2BA 1NR7A 2WEKA 1U9JA 4A73A 3P2YA 5JCXA 1UJMA 4N5NA 1DAPA 5TS3A 3FNFA 1N7GA 3WB9A 4WNCA 3V1TC 2J3HA 3DZGA 5KJFA 2NV6A 4H16A 1ZCJA 4M86A 4WASA 3RUEA 2R6JA 2IXBA 4RO0A 3OIDA 1H6AA 2GN9A 4CV2A 4IIVA 1DAOA 2WJPA 3ROMA 2OXIA 2IDZA 5FWNA 2J3KA 1OC2A 1O6ZA 1TT7A 5THQA 1AHIA 1PS0A 4XJTA 2OP1A 3UW3A 4AG3A 4EBFA 2GZ1A 2DKNA 3FNHA 3DONA 5KOIA 2Q45A 1BXKA 2V65A 1R0SA 5AXAA 3DL2A 4C4OA 1Z82A 3BXXA 2IYOA 2NVUB 3ONDA 3IAHA 1ZK0A 4BNWA 3QWFA 5C37A 1B26A 5FEUA 3PGJA 4BMSA 2VHVA 5F21A 3JQCA 2DFVA 3MWEB 3DHYA 4JCOA 4E5PA 4RVFA 3DB2A 4BNGA 1LQTA 1T2FA 3PYLA 1E7QA 1Q0QA 5F3RA 3PQFA 1U8FO 3L6DA 4CLEA 4W7IA 1G1AA 4J2OA 1XLTA 1E77A 3ICCA 4G81A 4XQGA 1QRRA 1GPJA 4IXWA 4AJNA 3PLNA 1NQTA 1KEPA 3I9OA 2I6TA 1H94A 2FWMX 2HK9A 2VNSA 1QV7A 3JQGA 5IN5A 2ZTUA 3BMNB 3IMFA 3EK2A 4CPDA 4E5YA 3P7MA 4RCVA 3RCBA 3GAFA 1FDTA 3FBTA 5DOVA 3SJ7A 2PH3A 3A06A 3ROKA 3PGXA 1SB8A 1C0IA 4W9NC 2WYVA 3GZNB 3JD2A 1MV8A 3DTYA 4UUOA 4NU6A 3IUSA 5CHEA 4UREA 1LUAA 3L07A 2FZEA 4IS3A 4R5HA 4GKVA 2NTJA 3U49A 2B37A 1PJTA 2I99A 3L4SO 4FB5A 3JTMA 2I3AA 4MP6A 4DLAA 2Y1GA 1KC3A 3HB4X 1BWSA 3RUAA 4EZBA 3ANMA 3S8MA 3WWZA 2IRWA 1J6UA 2UUPA 4XYMA 3KYBA 1UXHA 2YUTA 5F5NA 4CLRA 1AXEA 2H9IA 2OZPA 3GRPA 1J49A 2Q1SA 3H9EO 5IG2A 1KERA 1LEHA 4NIMA 3RROA 2EJWA 2PWZA 1PGQA 1WPQA 2VRCA 3JD1A 2C54A 1OC4A 1GEEA 4HNHA 1CQJA 3VKUA 2GZ2A 3AUSA 2GR9A 1ZSYA 2AQKA 3MCVA 3HHPA 4AVYA 4WECA 2I9PA 2P4QA 4R16A 2G17A 5AVOA 1DIAA 4LSWA 4P22A 4OKNA 1X1EA 4CODB 4K28A 1E6WA 1T25A 3D3WA 4Z0HO 3V2HA 5JY6A 2EJVA 3JQFA 4LVCA 1YH3A 4GLLA 4EEZA 4Z6KA 1NWHA 3DFUA 1AXGA 1ID1A 2EP7A 3DO5A 4DA9A 4QSMA 5KWEA 5A3JA 4Q3DA 4TROA 3GDOA 4YJHB 5BR7A 2Y68A 1CYDA 4L74A 3ANLA 3DHEA 1N7HA 3DBRA 1FXSA 3K30A 2PKQO 4BVAA 3PZBA 2X5KO 4QECA 2YV1A 3F3SA 2FR1A 5IN4A 3BHMA 3CMMA 1WDKA 2V6GA 1BG6A 1T2AA 3DMYA 4EGFA 1P31A 2UVDA 2HMSA 1V35A 1V6AA 2ZCVA 4HY3A 4CLXA 3H65A 5B12A 4RL6A 2FPGA 1XDWA 1JU9A 1MGOA 3QVWA 2AA3A 1N9GB 1W8DA 5JDIC 3S2FA 2Y66A 3DZIA 4IMRA 4GQAA 2GCGA 4XCVA 4ZQHA 3GVPA 4A0SA 3MZ0A 1V8BA 1BSVA 1EZ4A 3FRJA 3H3JA 4DC1A 3VOSA 3ZW8A 1E1LA 3WOHA 3WNQA 2QHXA 3T7CA 2EF1A 3IOYA 3JQAB 4I5EA 2R00C 3F9IA 2NU7A 4IUYA 4NK5A 1UP4A 2BGLA 3QVSA 1X7GA 3PQDA 1YBVA 4L9RA 5G0TA 2BRUA 2I3GA 1XQ1A 4AJLA 3Q1LA 1GCOA 1WNTA 2C5EA 4FFNA 4E3ZA 1T1RA 5F1KA 2Y1EA 3RUFA 1MB4A 3BTOA 1LRLA 4YJFA 1VSVA 5B1YA 3KYDA 4FCCA 3ZHYA 5C3MA 1YL7A 1MP0A 1B14A 5HTOA 5A5EA 3DDNA 5IZCA 3QWHA 3LYLA 3W4KA 3JQDA 5DN9A 4JJGA 4GVXA 2X6TA 2Q2QA 1BRMA 1E0DA 1VPDA 3K9QO 4FFPA 3GUYA 2AQHA 4LVUA 2V6BA 3D5TA 3OQBA 1L7EA 2WYUA 1ENOA 1R37A 1FMCA 1KVTA 5G4KB 3VKVA 1Q2XA 4N5MA 4E2ZA 3FD8A 1RM5A 2CF5A 2ZQZA 5F1PA 3BMCA 3VH1A 1X0VA 1X13A 2P9GA 2Y1OA 5JYDA 3LT1A 2AEMA 3O9ZA 1C1XB 4XEHA 3R0IA 2BFMA 6LDHA 3R3JA 4JXKA 3F1KA 3OFSA 3IC5A 1ZK1A 2WSBA 2DUUA 4CLOA 4YDRA 3EZLA 3BTUA 3TSCA 3L0DA 1HTBA 3W8FA 1ARZA 5G0VA 4EDFA 1D7OA 3ZDFA 2O3TA 3C85A 1ZUD1 2GZ3A 2FSVA 2O7QA 4J90A 1T1SA 2X86A 2ZATA 3U9LA 1GL3A 1LSSA 2CMDA 2I76A 5I7FA 1U2GA 2OP0A 3GH3A 4IJWA 5TT0A 2VZ0A 1E7RA 4RVGA 4BL5A 3EYWA 3FHLA 3W8EA 1DIGA 1ENPA 5DCWA 4UVHA 1SZJG 4KWHA 4ZQEA 1LC3A 1QLHA 2DU8A 3BMQB 5L7YA 1NWCA 2B83A 3HN7A 4ZQFA 2HSDA 5JLAA 3AY3A 1QR6A 2YHIB 3QWAA 3PIDA 3GUCA 1HE3A 3OQ6A 3QP9A 4DVJA 2JFGA 1XSEA 3KZVA 2EKPA 4A2CA 4Y6SA 1HZZA 3D3EA 4FJ0A 5ILGA 1LLDA 3ZI0A 3E5RA 1VSUA 5BNIA 1NVMB 1VE9A 4RQUA 4XQ9A 5CP8A 4B7CA 3I9JA 3ZHZA 4BKPA 3NEPX 3A28A 5C7IO 2VOJA 2YDXA 4BO4A 1UXKA 2ZKLA 3OJFA 3TQHA 4AJ2A 1ONOA 3RWBA 1DFGA 4MP3A 1PIWA 1P1JA 1K89A 1NHWA 1X15A 4BQPA 3DBVO 4ZU3A 1HDOA 4JJIA 1YB1A 7ADHA 4FFOA 4AJ4A 1GUFA 4B3JA 4CV1A 2WE8A 3PHHA 4YT2A 1HRDA 3LK7A 1LQUA 3KBOA 5TRTA 1HYHA 1YB5A 4B79A 5HM8A 4NBWA 1AN9A 4WCFA 2OBNA 3AI3A 4OQZA 4CM6A 3U09A 3KSZO 1U5CA 1PJ3A 3D1LA 4HFJA 1ISHA 4YWJA 1N2SA 2R2GA 3I9NA 4J4BA 2VYVA 2VWGA 3PHLA 1ADGA 1VL0A 2HLPA 3H9GA 1R4MA 1ZZEA 2QG4A 1PL6A 4A03A 1TXGA 4ZJUA 1U3VA 4XB1A 4BV9A 5L4LA 2DVMA 3WFIA 3G49A 1KVUA 2B5VA 2PR2A 1LSOA 1H2BA 2VHXA 3QIVA 4WE3A 1KS9A 2AQIA 3OP4A 5HS4A 3L4BA 3ROQA 3ZNOA 4M49A 4BQRA 3F4LA 3RUCA 4YVFA 3S55A 3FNEA 1YBAA 1HLDA 2F00A 4DYVA 4E5MA 4XR4A 3R6DA 1BTOA 3BTSA 3Q0EA 1FK8A 4CUKA 3KEQA 2DLDA 1ULSA 1P1IA 1T26A 4FIZA 1I3MA 5C5IA 4L4XA 3PVZA 2G1UA 4J1SA 3KTDA 2FHSA 3GNSA 3QJ5A 1E7SA 1S7CA 3RC1A 4QO8A 1EDOA 1I33A 3E9MA 4GX0A 3HG7A 1A9YA 1GUYA 3WR5A 3WBBA 3ZWBA 2WMDA 2VYVD 2VZ8A 1A71A 1RJWA 4RVUA 4WPGA 2DPHA 4JJFA 1NFFA 2X58A 4HP8A 4O6VA 4YA6A 4CMAA 1A72A 2P9CA 2C20A 4K26A 5GY7A 3ETDA 4ZGWA 1PL8A 3V5NA 2DT5A 5HWSA 4BHTA 3SJUA 3E5MA 4Z3DA 4EITA 4HXYA 3E18A 4OH1A 2VQ3A 4XYEA 3G17A 4ND2A 4CR7A 1WAMA 2JD0A 1CETA 2O4UX 2YQ4A 1SMKA 2EW2A 3PYMA 1D1SA 4IM7A 4L8VA 1IPEA 4TVBA 1A9ZA 4BIIA 3WGZA 2RAFA 1X1TA 5EPOA 4NMHA 1DEHA 2EW8A 3ADPA 2CUKA 4ZQGA 2W98A 4J1TA 3PQEA 5G0SA 2WD8A 3QY9A 1WP4A 1T4DA 1YL5A 1EE9A 4RVSA 1EUDA 1Y8RA 3NDRA 3FI9A 3IKTA 1R0KA 2W2KB 2UUOA 3GLQA 3O8QA 2HMTA 1M2WA 4TSKA 5T57A 3V2GA 4CLDA 3GVCA 3WGOA 3LSYA 5ER6A 4I9UA 1O5IA 3AU8A 3RI3A 3VVBA 1GADO 5ENVA 1HEUA 3ICPA 3QVOA 2GN8A 3TRIA 1AE1A 1HDCA 2GN6A 4RPKA 5FI5A 3LT2A 4UVDA 2P68A 4RDHA 1B8VA 1ORRA 3K8ZA 4Q39A 4IGFA 3TZ6A 5ICSA 3I4CA 3OJEA 1ISFA 1ZKMA 4MVJF 4R9RA 5IJZA 3JQFC 5CPBA 3FN4A 1N8KA 1R6DA 3IJRA 4BNLA 4WOJA 5MGBA 3W4IA 1X14A 1PJCA 3IDSA 4PLPA 4RF2A 1FJHA 1P1KA 1GQYA 1GEGA 1ZFNA 2WD7B 4FS3A 2ZJ1A 4YRBA 3E48A 4DBZA 3E82A 4R3NA 4R51A 5FFFA 3ZU2A 1F06A 2H6EA 3D5QA 4S1VA 2WTBA 3G0OA 2GNAA 2CVZA 4IIUA 3ZW9A 4JBGA 5TIIA 2R00A 4IQ0A 3CPSA 2RHRA 4WLNA 1E3JA 1TI7A 1NQ5A 3O38A 1E3WA 3EUWA 1SPXA 4QFDA 1YOVB 3NJ8A 1QYWA 2OUIA 3NJ4A 4W82A 1E6UA 4FGWA 4KQXA 3WYCA 1E7WA 1HL3A 3EDMA 5CDTA 2Y0DA 1Z45A 4FC6A 5JAZA 1IL0A 2X9GA 3GNTA 4IDDA 1MXFA 2XPCA 1VJ1A 4YT4A 1GZ6A 3H8VA 3WICA 1XU9A 4CMIA 4GAEA 4PN3A 3JQ7A 1DLIA 3DBLB 7MDHA 3O4RA 5AXDA 2QRKA 2RIRA 2UDPA 1LDGA
chains in the Genus database with same CATH superfamily
1W5EA 5CLGA 1S6YA 2QN9A 1C2TA 4B3CA 2VZEA 5E2AA 5FLKA 2PSFA 4UC0A 5FYQA 3RR2A 4CT5A 2WNHA 4CIBA 3T54A 3BFJA 2SHKA 2BOVA 4I5IA 3TL3A 1KMHA 3PXBA 3O4VA 3KOUA 4EG1A 1GZDA 3M9XA 2J46A 3SIWA 3U3DA 3BAZA 4PGFA 3LUGA 4KREA 1W6UA 4GBGA 3UAXA 1VCOA 3W90A 3B6JA 4X9XA 5IAEA 2LCQA 4DXDA 3PICA 2HMUA 2UYYA 2SKEA 2WA1A 1ZAKA 5FUMA 1QX3A 1QZZA 3ZWOA 1PJZA 4DR7B 2PD3A 4J1QA 3ZDBA 2CLIB 2HRQA 3OPNA 3AJDA 4YQYA 1AGRA 3IHTA 1I6LA 3KELA 3AI2A 1V8DA 2SCUA 5D1HA 5HSGA 4NP6A 1ILWA 4P08A 1N57A 4WN9A 4GX2A 2I65A 1CRWG 2R8RA 5C8XA 1A9QA 4RZ3A 4F5YA 1H2YA 1UPXA 3AT1A 2D54A 4HDSB 3WKDA 2VUHB 2YJ3A 4M1TA 1LSUA 4EFNA 3H4VA 3MAJA 2APJA 1Y98A 3OSUA 4KDEA 1T29A 2QDXA 1F0NA 3PQCA 4PFJA 4R8SA 4EPTA 5LJIA 1Q95A 1V7PC 1W76A 3EVGA 2AQ8A 4NV0A 4DRXA 3UYLA 3WQBA 5SYAA 4YNBA 4YRAA 1J0AA 1YDEA 3LA6A 5FBHA 4CR8A 1W29A 2H08A 2NSDA 5SYNA 3M5WA 1Q0PA 2AMFA 5DWVA 1NNI1 1H6DA 4LE2A 1EPUA 3ER6A 2CMGA 3WX0A 1KRWA 5JMWA 3R9IA 2CFOA 1SHUX 4OHUA 3HPRA 3GJ5A 4JB8A 4BX2A 3CCCA 5HUHA 1JU3A 3IO3A 4K1LA 2FEKA 2BVNA 3UTCA 1XJ0A 3K2QA 3SYNA 2PLWA 5FEMA 3TX2A 2I2FA 2Q2WA 4A6DA 3F7OA 5JD4A 1UQTA 3NHPA 3E3AA 4FFLA 4XB2A 1IQRA 2R47A 2PUEA 4JOQA 1UOPA 3R0VA 4MIYA 4KYTA 2CKDA 3HNPA 1VPWA 4IOLA 3RS9A 4M1EA 2C7GA 2HIHA 4CI0B 3OCYA 5FNVB 1ZDMA 1HFWA 4N8EA 5BQ3A 2XMGA 3UFBA 1JA9A 1FDUA 2ZRKA 3ENKA 4JUCA 3M6FA 4TLDA 5EC8A 1NMXA 1I5EA 1GLNA 1WV0A 2BMDA 3M6UA 3MS7A 4HUJA 5H02A 2OFFA 1TF5A 2CHFA 3NKVA 3R5FA 4A16A 1GDDA 2C29D 3QVKA 4ENTA 4YRNA 2VBGA 2XYRA 3DZFA 1N3BA 4YRKA 1HOXA 4BNIA 4JOSA 1KBQA 2J0QA 4ZAYA 4M36A 3HDTA 2WTXA 5C31A 1KAHA 1FSZA 5K0CA 5AJZA 3NIWA 5FB3A 1TT5A 3D0KA 3ROEA 3U80A 2JLXA 2WQ6A 4EMBA 1Z0FA 1VL6A 5EOVA 1Z6PA 3ABOB 2QTWB 2ZB7A 2ZYDA 3C1AA 2YN4A 4N18A 2DEUA 2ERCA 3FFAA 4RHCA 2AWOA 5GM1A 1JJBA 2Q07A 2XGOA 3H16A 3FYUA 2GXUA 2V7UA 3BRSA 4HDMA 1OYYA 2EFHB 2C2BA 2TMDA 3P0HA 2VHZA 1V16A 3G2NA 3U1BA 1GY8A 3I83A 5B2EA 1DDGA 3W5DA 3KQHA 2V03A 2IX3A 3EG5A 3FR8A 1JI3A 3BBPA 4KWEA 4B83A 2OPBA 3HRKA 1JKJB 2HWYA 3AEKA 3ELWA 1XWIA 1E7MA 4CKBA 5CK4A 1HYEA 3RYCA 1WWKA 3L9XA 2YCBA 3NEYA 2XUPA 2I71A 3DDUA 1JMYA 1ZGGA 2WF9A 3NRBA 3MT9A 1JEYB 1AZSC 1GM5A 2VDMB 2I2WA 4ZEMA 3PSHA 1MOPA 4OOEA 4G1UC 4DQLA 3ZV6A 3QKWA 4CGYA 4KN8A 1QGOA 3ZU5A 1VKNA 4D4MA 2XRZA 4Q1DA 3WYBA 1NVTA 2VK8A 2IDJA 3EOAI 1VIYA 3DZKA 3G8AA 3GGOA 1OYVA 2VSOA 3B9PA 1WIWA 2WJWA 2BMJA 1GL7A 3V8MA 4HDNA 3A2LA 2IUUA 4B75A 5CFPA 1XU7A 2B34A 1MDBA 2X0IA 4DCNA 4EHFA 2WLTA 1WTAA 2YMMA 4BFWA 4JLDA 1KNQA 2PRSA 3ZI4A 2HO5A 1CZLA 2CLCX 2Q8PA 2YC2C 4RKQA 4JVOA 4EYKA 3QYJA 3SS9X 2ZIGA 3EEFA 1FP2A 1GDTA 3F96A 4ZKDA 3TRFA 1V3UA 1KEVA 2OCXA 2ZJBA 1GPYA 3B9BA 4JLPA 2XWJI 5CIWA 3SSOA 1NW3A 3U7JA 4EZEA 1B43A 5KHLB 1OXUA 1TA9A 2Z30A 5LSAA 2W8BB 3KQKA 5JE8A 1T2DA 2QUIA 3IS3A 3SK0A 2RSLA 5D3QA 3OCJA 1I7LA 3HDGA 4QYXA 1IK4A 4CMGA 2RC5A 3RSSA 4RH1A 1SCAA 4HFMA 3IT1A 2MIIA 1E4OA 3VSDA 4DW8A 3N70A 2EERA 4MW7A 4ZN6A 5CCEA 1PJLA 5K2MA 1CSEE 3S8YA 4CEIA 3I2GA 2JK1A 4X95A 2CT8A 2IODA 5CIQA 3CNHA 3MTAA 3LDHA 1M8GA 1Z0ZA 2GVZC 1XELA 2HXGA 3AU9A 1N4AA 3RV4A 4ER6A 5KIAA 3IL2A 1OGYA 1JT2A 1QHGA 2YQZA 4PSKA 3CW9A 4IVPA 1E64A 2O0LA 2ZWAA 3U3XA 2GKOA 4GWLA 3TFQA 2O59A 4PANA 2PUFA 1RLMA 2YVKA 4JL8A 3E15A 4OHFA 2LW7A 1LA2A 2WG1A 5I4KA 5C52B 3UJ6A 3MMSA 6CHYA 2FMXA 4FX5A 3DUWA 4M1OA 4Q4AA 9GPBA 4MUKA 4AUKA 1OA1A 3D64A 2WICA 3G2QA 1VTKA 2HLDA 4YRRA 5LQJA 4BMZA 2DLCX 1W88B 1YRYE 3DOEA 4WZAB 1UPCA 2CFCA 4R1SA 5KOIA 3WGNA 4V0RA 3B1YA 3SCZA 2PLRA 4HQLA 1Y9AA 2G67A 4GLBA 2QRVB 4JJKA 3H1TA 1WO8A 3TR5A 4TXHA 5HVNA 5IJ0A 3W5CA 2P65A 2PUVA 3INGA 3SS8A 4PBTA 1U9ZA 5CNJA 4XIFA 4KX5A 4OQYA 4PG8A 4DC9A 4NZ9A 2AFVA 2JEOA 3VPHA 3N2KA 1CFZA 3EZ6A 3L3BA 2PE5A 3OJWA 3T3MB 3WSWA 3ASUA 1E5TA 1G5HA 1XKQA 1EU1A 3BORA 2XTZA 3H9UA 3QFFA 5A03A 4ZT5A 3FLMA 5C7OO 2PGLA 5BWNA 3WL7A 2Z1MA 4EI7A 1ZVQA 1SC4A 1QLJA 4KL8S 5FTLA 5DGIA 3HZHA 4UMFA 4AG5A 5DM70 2OPHA 1AIPA 4RKRA 3RAGA 4N48A 1HT1E 2YJ6A 3LUKA 3TQOA 2AR7A 2QQFA 4PHFA 5A0FA 4YPFA 3PEEA 4GXQA 4D8YA 4NENA 5I3ZA 4OFZA 2HADA 2MR6A 4IEIA 4II2A 4P4SB 3U3RA 3VDQA 1O9HA 3FFWA 1Q5PA 5DOZA 5LA6A 2P1RA 4KIWA 2XOEA 4TWJA 5FORA 3Q7RA 2PL3A 4KPUB 1NRXA 2O3RA 1NVVQ 2WHEA 2NZ2A 3M33A 2RONA 1YONA 1S3IA 4QT0A 2KBFA 4L8YA 5FHQA 4Y2UA 4Y9DA 4E33A 3B7WA 5DIZA 2A14A 3EXG2 3QYAA 2O3UA 4GKBA 2WBLC 1UEXC 4ENWA 2MSDB 2B98A 3GHHA 1N2JA 2B1RA 2C42A 4HN4B 2V8BA 3RFCA 1NONA 2XH8A 1JQDA 2OYSA 3NFRA 5LU8A 4P3KA 1UXJA 4YC7A 3EQ8A 4MYRA 3QRWA 2B36A 4CKWB 1OBHA 2C7BA 2IDMA 2HR1A 3M1AA 2P9YA 3BWMA 3NTRA 2GPBA 3REFA 2C61A 1RKUA 2EYUA 2ONKA 3HJCA 1RZUA 1F14A 1H8ED 3CZ5A 2JAPA 2BFDA 2RH9B 5ERGB 3WHLA 3UG7A 5CLHA 5KDDA 4OUKX 3R3XA 2Z6VA 3RVPA 1V9CA 1UMCB 4Y18A 4KQ1A 3I32A 4TLBA 3FHTA 4H7IA 2HK8A 3Q8XB 3KIPA 3LGAA 4IYRA 4WTOA 4ACAA 1JALA 2B35A 3PIIA 5BYAA 2CMFA 1PL7A 4TQAA 1JVBA 2CL7X 4AJHA 1U0BB 4P2BA 3O31A 4O59O 3IEKA 2E4AA 2A5DA 3PNPA 3BMOB 4MJ3A 1PFYA 1P5FA 1RYEA 4I3FA 3DNFA 4DA7A 3E7PA 5KSPA 3ZBTA 1VA5A 3OG9A 1QO9A 4TN5A 4Z49A 2VH5R 2FU5C 1GU1A 2V6FA 1HE4A 1FNSA 3V4SA 4IHAA 4RJ2A 3I58A 1C9JA 1ULAA 4E2YA 3KKOA 2W2VA 1RT9A 1ZUHA 4IGIA 5CM8B 3SJZA 3PPIA 1HURA 3VR5D 4JVSB 1KI6A 2PQ6A 5D1NA 3L04A 1P0PA 4CQMB 5A2QA 3QEBZ 1VBFA 5L7TA 3BMCB 3EZXA 5CFOA 3HR8A 3H11A 1OYWA 1T5LA 1L4MA 2C97A 3IP8A 3P9PA 4KR9A 3FSGA 2G9UA 1E8NA 4RTOA 3D2AA 3DDOA 4ANFA 5JNWA 1V5IA 2B7LA 1JQJC 4V0NA 4ITUA 1U7ZA 3QPVA 2CK3D 2HSGA 4LY3A 1FNNA 2NU9B 2A9QA 3ZLTA 3RHZA 5D86A 3VTAA 2SECE 4RESA 4DLPA 2UVPA 1SQFA 1F6WA 1Y82A 3GK3A 2IIQA 3L0ZA 2ZW9A 4DMKA 3K0AA 3HZRA 4L28A 2CLEB 4L72A 1A8PA 4ZEXA 1MGPA 3D6VA 1TQ6A 2QZ9A 2BUBA 2WW8A 4JLSA 3JQAA 2HMWA 5LWHA 1UBGA 2JBAA 4YMLA 2C2MA 1CUAA 1J1IA 4EPVA 1RXEA 1VI5A 2ALJA 2NTEA 3ZIAD 3RYTC 4TTJA 2E85A 2DE0X 3Q9NA 4KUEA 3VPGA 3NMUF 4C0HA 1N2XA 3IMEA 4ZVNA 4UDOA 4HTFB 2WDZA 2PZLA 4XSGA 3JQRA 3BQMB 2Q3BA 3C5HA 4QUKA 4F91B 4KNYA 3HLYA 1Y5RA 4TGLA 2GLXA 1IJEA 3D3KA 4ID9A 1A5BB 3AHHA 3NV7A 1H0HA 2ZSKA 1D2EA 5ALZA 3CVYA 1CQWA 1Y1SA 1GG8A 1QBKC 2D5BA 2WJHA 2XB4A 5E6SB 2XQIA 1EFAA 2HA7A 2DCUA 4LHWA 4WINA 4RM2A 1GRQA 4IYJA 1PHPA 2NZ8A 5JMOA 2CUTA 2HH9A 2I33A 4BO8A 5KOYA 3O0TA 3RVOA 1GU7A 1O1YA 2BFAA 5K3FB 4TMWA 4NPCA 5C18A 3V9AA 4ESVA 1GAQA 1K66A 3K92A 3WQRA 1LCIA 4G23A 2D4AA 4HNUA 2BSQA 1U1IA 3AZQA 3CXUA 4D4HA 1KP3A 1TF7A 1Y37A 3LCMA 4I1IA 3DVSX 4WZAE 3RLFA 4FW8A 4CHGA 1M34A 1Z36A 1MO5A 4K9MA 4XPZA 3U62A 1L9KA 1TB4A 2B4QA 3JZFA 2H4ZA 5DCUA 5LXTF 2QXYA 4AO8A 4GMHA 1YC5A 1PFVA 4X60A 5A6SA 1JIUA 3EH2A 1WU7A 4MYSA 2GO1A 4EHLA 5JNTA 4RNDB 3RTCA 3VR4D 1CBUA 2FZ4A 4NCBA 4YCCA 1DCKA 3N07A 4RXMA 2ZPUA 1SOVA 4P3NA 1SHJA 3UT6A 5B6IA 2X22A 3NTUA 5B5SA 3WKCA 4R68A 4D8TA 5I01A 4PO8A 2YZGA 1ZSNA 3DLCA 2P9BA 3B6IA 4QFMA 1M5TA 3CBGA 3DPSA 3ZIDA 4DDWA 1T9HA 4PQFA 5LBTA 1BAPA 4QQNA 4BN0A 5C35A 3HCCA 5IASA 4EM6A 2D5CA 3B20A 4OA8A 1MG5A 1PEAA 4E21A 1WD5A 1D4FA 1LBQA 3HCRA 4WUTA 3UMJA 1RZVA 1TD1A 4JI4B 3GA7A 2AFRA 5IWCA 1NMYA 3TMKA 4PICA 5JCPA 2WUEA 1N6RA 3HCOA 4GRDA 4K6FA 4R3UC 3T7DA 4KJXA 5DBIA 5E4YA 3UJ9A 5CT4A 2WSLA 5BUQA 4OXIA 2GZHA 1EKXA 1OWMA 3AG5A 1Q1QA 3K96A 2R1ZA 2OGTA 1GXSB 1I1OA 2BGKA 3GZ4A 3V33A 3CONA 2REQA 2VRBA 2D8AA 4X3OA 1R15A 3ELDA 3V7YA 1OFGA 2YC4C 4HRXA 4XPIA 3T5DA 3V8BA 1B93A 5HFNA 2K2QB 5B1DA 1PR6A 5BQOA 1M7GA 2AZMA 3FW1A 3M5CA 1UPUA 1OZAA 3GRYA 4NBRA 1FDSA 1HDRA 4ESOA 5ALIA 4J0FA 5JEEA 5KQMA 2UXDB 3A3NA 4GR5A 2PRJA 1ULHA 4CNQA 1KZ4A 3CG0A 4K1XA 1LDMA 2GAJA 3DE7X 3NBZC 2QLJA 1M1NA 1Z2CA 3Q11A 4GI3A 3MAGA 2GQ0A 2P9EA 2PA3A 2YOFA 3OHSX 4W7HA 5L95A 5F7JA 1VI2A 3AR5A 2R2AA 3P5SA 1L5NA 1XR3A 4ALMA 2FSIA 5FLEX 1OQAA 4MIOA 2QTBA 5AKIA 1W59A 3UAZA 3EZ2A 4XE5A 1NIPA 1KJ8A 2BR4A 3O2SB 5DEIA 5FOWA 2AG5A 4MRMB 2JPDA 4Y8VA 1TZKA 4GRAA 3R5SA 1VHWA 3LWNA 2XT9A 3SX4A 1GVHA 3NYRA 2HHJA 4C87A 3PFHA 5DRTA 4WH0A 3I2HA 2FDCA 1EFUA 1SY7A 3N87A 2N42A 4QL3A 4TKMA 4GOMD 3DDSA 2HLNA 3GJXC 5A06A 3HNOA 4EARA 4BLQA 5LVAA 5JCOA 3M1YA 2OECA 4URXR 1WDTA 2VAMA 2BN4A 4LCJA 3KQTA 1XEFA 3SC2B 1EM8B 2JS7A 2R7NA 5L53A 1R0WA 2H0RA 1OAOA 2DQKA 5AFSA 1P45A 1XZNA 3LP5A 4GF5A 4TWRA 1R12A 5CDUA 5ALYA 2I55A 1DBWA 3KOZA 2X7JA 4LMBA 1DDOA 4MP8A 3BGIA 1YVEI 3IIEA 3L7OA 3LDFA 1M76A 3KT0A 3HN6A 4KLRA 1C1DB 1MQAA 4AZ3B 2PUTA 2YFYA 4JC5A 4WFKA 4EI8A 2ROQA 3COPA 4KO2S 1H69A 5G3ZA 3KYIB 2WF6A 1RD4A 1AQ6A 4IG4A 1HDXA 2W6MA 3C6ZA 4P7GA 3G88A 5HE9A 2VQ6A 2PSEA 2IPLA 5GZ3A 1UBSB 4WBSA 2F67A 3IQXA 3O4HA 4YMGA 2NPIA 2QMEA 1XAIA 3CY6A 3KPJA 2FF5A 3CLUC 4L73A 3L0PA 1QGED 1X77A 4X84A 5TT1A 2WVAA 2YQ5A 2XGSA 4KK4A 2RK6A 5HJEA 2IZ6A 5AUQA 3UBTA 4AKGA 3HM9A 1FUIA 4ASUD 1B23P 2W2NA 2QTHA 4FMDB 1KSJA 3C3AA 3SXPA 3UK6A 2AE2A 1P75A 4I1PA 1UBKS 4RY2A 4BP8A 4E1AA 3I8SA 4TV8A 3PJEA 1USUA 3BOSA 4RC9A 1DBVO 4C0JA 1OXVA 4NAVA 3UXMA 5JRDS 3H1FA 3LUFA 2EJBA 4AF8A 4ENRA 4TV8F 1C80A 2JIOA 4I2VA 3KYJB 2OC4A 2AFIB 3FCAA 1XRQA 4HEQA 4YP9A 2QOEA 2H1HA 2RCNA 3NDJA 3W6NA 5DULA 2YWXA 4Y0AA 3A4TA 2AHOA 4J0DA 4MW6A 4HN9A 2HF7A 4JBWA 1A82A 5TQ0B 1XDBA 3PPWA 2GZDA 2H5IA 1A50B 5AYVA 5TGDA 3TOCA 3WK6A 3VNVA 5DNYB 1A8HA 3TYXA 1AHHA 1A7UA 5D3MB 4CMCA 2Y1XA 3THYB 1VBKA 3ESAA 3F9CA 3U7EB 5E9JA 1GKKA 4NBLA 1C3XA 1SCIA 4RTRA 2VTBB 1KOJA 2FE1A 1LI5A 2FR8C 2ODQA 2Q8NA 4L51A 4DYDA 3V32A 3LHDA 1XVVA 3D3JA 1X1DA 3MW8A 5JD5A 2BFNA 1S8NA 3GPBA 1M0WA 2DUJA 3B70A 1PZMA 2OSBA 5TF4A 2X0JA 4M54A 3GEEA 3PHIA 2ZAMA 2JNWA 1UZNA 4GBED 4M1YA 1KQNA 3TEMA 1W19A 1WW3A 4FN4A 3RS3A 3PDUA 1I1HA 5J4YA 4Q7KA 2E37A 4FGSA 2FZWA 1JHVA 3G23A 4XRGA 4MVXA 1JJFA 3DLBA 4RGVA 4HLDA 2QW1A 2X23A 3JQ9C 3LTEA 1AKVA 1ZXXA 1Q1BA 1M54A 4MGHA 2Y05A 2JJ1D 3A4LA 1ODKA 1EP3B 2B99A 2BKXA 4INJA 4H35A 5ALNA 6REQB 1YHZA 4KTVE 1E92A 3F2VA 3NEJA 1VG1A 3EWSA 4Q9KA 2B25A 1PZNA 1QV6A 2FPUA 2O8EA 4Q19A 5CGZA 4N6OA 4NVRA 4WBXC 2PUCA 3OWHA 3AVPA 2XF8A 4K0RA 3DVLA 1AV6A 4X1IB 1A3CA 2JFNA 4HGNA 1SBYA 2E5WA 4HNVA 4OQQA 1W34A 2QE6A 2I4IA 4P7BA 4K3UA 3TBKA 1FDWA 2IHJA 2PVCA 3M6IA 1KYXA 1W1UA 1QTNA 4OL0A 3USCS 3LL7A 3ODPA 1O96B 1EK6A 5DF1A 1TFRA 1O6CA 3GFFA 1QCCA 3QFRA 4DQXA 2V0GA 4F06A 3EDRA 2AYXA 4Q02A 1CUEA 1RCFA 3DLIA 1V11B 4JP3A 1ZMXA 1D9XA 2QYSA 3BGDA 4HNQA 5H0IA 1YF3A 3MYYA 4HDKA 2BEVB 4OLHA 3TLMA 1WMDA 2NO0A 1BROA 5AW1A 4LRUA 3IH5A 3ZDXB 5FFNA 5B7GA 2BGGA 3HN2A 3M3PA 4DJ5X 2AOXA 2PX0A 2ZQYA 3B2QA 3HFRA 4MIEA 4RVNA 4UAJA 4V39A 1WF6A 4X1OA 1U5AA 3WAKA 1C0LA 4ND1A 2WG0A 4OO3A 1LTHR 1TU4A 1S2LA 4OBWA 3RU9A 2FSFA 2DWPA 5I6DA 1VB3A 2HBYA 3L0BA 3O21A 5JXJA 4K6OA 2ZYWX 4ICIA 4K6KA 4NZYA 3EC2A 4I6EA 2HI0A 3SZLA 2ZREA 1Z4JA 1K8QA 2I0FA 1YVPA 2GILA 3FZGA 1D0VA 3RJMA 2ZUSA 3UPDA 1OLXB 3EIEA 1JTVA 2VJLA 4JA0A 5AVUA 1KEEB 3L0YA 3JQBA 1PSDA 3PLAE 4X1KB 1YDGA 2JD2A 2ZI3A 1E1NA 3SM9A 3WMFA 1KHHA 1I0IA 1Z83A 4AJ1A 1MW9X 2J5RA 1KDYA 1B0PA 3KSRA 3H9CA 2FI1A 5DNDA 3M81A 2VTEA 1WU8A 4EMSA 3STXA 1K6MA 2XZPA 3G7NA 4BE4A 3WIBA 2VWHA 1HKHA 1UZLA 5A5FA 1I3OA 3E27A 1X86B 2P4EA 5DYWA 4Y1GA 4ZU6X 5THXA 1YFJA 1MD9A 4KAAA 3KXIA 2VF2A 2IYSA 3VR5H 2PSSA 5DU2A 2QTRA 3WRYC 1B7GO 3AY7A 5KTRA 2JCVA 4C7OB 4QE3A 5U9CA 2GRAA 3EUAA 3WLAA 1RQPA 4B4OA 1IULA 4HNTA 1PEKE 4D3DA 1U3TA 1NG9A 3BEDA 2AL7A 3F3KA 2GH1A 2VUSA 1VJ0A 3DMTC 3GAAA 1KU0A 1M6NA 5FTJA 5BNZA 1ADFA 1IXRC 3F2IA 4M53A 1YRBA 4UQPA 4HDSA 1WQ1R 3BB4A 5CJPA 4JAVC 5HMLA 3RTGA 3IQIX 1JTFA 1WMAA 3T3EA 2X41A 5I7RA 2AMVA 2YNMD 4G85A 4LFBB 3D8SA 5DNAA 2FUKA 3OCUA 4OXKA 2AK2A 3L6OO 4GH5A 2AOTB 1RKQA 5K0GA 1SXIA 2XDWA 5EGNA 5AHXA 4C6HA 5CT6A 1QVZA 1JHAA 3BWDD 3D6FA 1MO2A 2F3UA 1Z6GA 1VLVA 4R41A 5TDHA 4GOND 1LK0A 1P5RA 1MX1A 2IYUA 4V24A 1EZZA 3DCYA 4ME6A 1ZA2A 3GBSA 1RXVA 3GJRA 3EXAA 2JGDB 3GY0A 3A2MA 4FHEA 2GDJA 4G4IA 2DJ5A 2QE7D 2YXNA 3TI9A 4PY2A 3W6OA 4OXNA 2QRPA 3AEXA 2BD0A 5DYGA 3LPDA 3ZWXA 3UWMA 5AW6A 4Z4GA 1QIJA 3JWEA 5JY1A 2J7KA 1NVFA 1XP8A 3PT5A 1JW9B 2FRDC 2E5LB 1X1RA 2VTDA 3BRCA 2R1VB 4BNZA 1GZ5A 4K6MA 5TJHA 4UZEA 1EVKA 3ZWPA 3RS8A 3V2UA 4D0RA 1OF1A 3UWKA 2NUPB 5FNVA 8OHMA 4LK3A 3VU8A 1YASA 1H6CA 2Y0PA 3FWYA 4D4KA 3KU1A 4KDFA 3EXG1 3FOFC 1MTZA 1C8LA 2EFEB 5F2EA 5KJCA 3UPUA 1T8PA 3PC4A 1ZG3A 2YXDA 3ZQ6A 4BEJA 2V4MA 3ZLJA 3HM2A 4X41A 1QDLB 1WD7A 2P9TA 4IJ5A 1E6EA 2WINI 1FA9A 3FYSA 4Y3UA 1VJDA 3AUKA 4QT4A 5GTDA 2AEJA 2E6UX 4TKLA 3WGUA 1NT4A 1MEEA 4G01B 1T3GA 5GADl 1P60A 5M3BA 1ECJA 3AIMA 3IE2A 3S6JA 1B4DA 1AB5A 1D5WA 1YAJA 2NUTB 4QLOA 5B3KA 3N8HA 4C05A 2LRHA 3RSFA 4JLWA 2AD5A 2C4VA 1OZGA 4LE1A 2EL7A 4KDCA 4P4LA 2XUFA 4RD4A 4U7PB 1EFDN 2M6SA 4P3OA 1KMQA 2XAAA 2YHUA 3NQ41 4N54A 3KB2A 5JMTA 3X1WA 5D00A 5EMJA 1JZQA 1ZMTA 3ILXA 4OBBA 4I5DA 2O4CA 3NGMA 4UDXX 2V7GA 5JVDB 3DL7A 4ZYZA 2PZMA 5LOVF 3NVKI 2C07A 1XK7A 2WILA 4GKAA 3ZXXA 4G89A 1HT3A 1VP9A 1JKJA 2GEVA 4DLRA 1H9AA 4ETWA 1QE0A 1J24A 4KQKA 3VSEA 2ZULA 1Z5WA 5A62A 5GVSA 3C7DB 4CMHA 3GJQA 4CLRB 4OXYA 1F3OA 5ESDA 1SXJD 4IQ8A 3K3PA 4GUAA 1JEYA 1FBTA 2XUQA 2IZ7A 4DQDA 2OCGA 2JD1A 1CUJA 1IH8A 1DE0A 4FOSA 4M60A 4A26A 1GR0A 2GTHA 4DV1B 2F64A 4QGAA 3VZDA 2VNIA 3BIJA 2AWNA 1H4VB 1VIAA 1PNRA 1AUPA 1DO2A 1I3LA 1CQJB 3HO6A 4L5CA 5DTMA 4B3IA 3HA5A 3JR3A 4YRIA 1ABBA 3VTFA 3UMMA 1NPDA 4NYJQ 1ZUWA 2C92A 4PNPA 3CUKA 3HKCB 1Y9JA 2DG2A 2FWIA 5B7PA 1TEXA 1AB6A 1IG0A 1NBEA 3OD1A 5DM4A 1DQYA 2P6NA 2ORIA 2VZLA 3K9GA 3LCCA 4RGBA 2I29A 3MS2A 5KO2A 1D6JA 1NXQA 1FVFA 4N0PA 3OZXA 2IBSA 3S0JA 2C5FA 4QELA 5JMPA 1L7NA 2DX7A 2V7PA 4YTEA 1N2ZA 2HCFA 2W8BA 3MWKA 1TPYA 4HGOA 4HH4A 2TECE 3BN3A 3KLPX 1XUOA 4PTZA 1W2HA 5MDHA 1GGJA 1PEDA 2AKAB 1XAHA 3KQSA 1XG5A 2ID7A 3PUIA 4LV5B 4IINA 1FW6A 2J0SA 3GCDA 1YDWA 2F1KA 3AKEA 2XE4A 4J0EA 5TSDA 3QE9Y 2QZZA 3H0CA 4KQCA 4EKYA 5FA6A 1U6JA 3FPLA 4HBZA 2BI4A 2IF0A 2PGIA 4C3ZA 5C8DA 1IQUA 2FSHA 3DBRB 4H08A 4JR2A 1XB2A 1ADCA 3BSSA 1A5TA 4ON9A 1L1FA 2ACKA 3GROA 3UG6A 2ZRMA 3O9VA 1C4WA 1N5MA 1GGFA 1EB9A 1UBOS 1BHJA 3TQCA 4IXNA 5U4XA 4UU7A 2AJTA 2D7JA 4JT2A 3P1JA 4U4AA 3PC6A 1RI4A 4MA0A 4R2XA 4F71A 3FTDA 4N3AA 5M7EA 3EZFA 3O9MA 1NUUA 2IPXA 2QD5A 4QXPA 3WGVA 1YZNA 2XT0A 1K4YA 2FPGB 1XL0A 3ULKA 1CZUA 2ZFUA 4FHZA 4LYAA 4OHWA 3IJ5A 4ZVMA 1HH4A 1W88A 2J33A 4BFTA 4WZAA 1X7ZB 4QXOA 3KDPA 4WLUA 5BV1A 4MYTA 1UQUA 2ATVA 9LDTA 4YUWA 4EQZA 1AQYA 5DNCA 2DYKA 1Y0BA 1C7EA 4OKSA 1QORA 5KEIA 3OZIA 2QRVA 2WUVA 4AROA 1DBSA 5BYBA 2J9XB 5IU6A 2PZ8A 4XFDA 4TLLB 1TK9A 3R7WB 4LHZA 4HEHA 4YHHB 2QX4A 3IAM1 3MNFA 4GX5A 4AICA 2YJ4A 4FYXA 2D6FA 1J21A 1NE7A 4RVHA 1JA0A 1MC4A 1Z39A 2X9VA 3ILSA 3OZCA 4BMOB 2BV3A 2Q3MA 2JARA 1T8UA 3ITDA 1CD5A 1E9SA 1WTCA 2P5SA 4DLTA 2CK3A 1WZEA 2C3UA 3KKKA 3R77A 4X1YB 1U3CA 2WP8J 3NGLA 2D3TA 5BUZA 5KUTA 3VDRA 3A9WA 4DANA 3MVEA 4YJFB 3T5AA 5L40A 4NBUA 121PA 4QGBA 3K0HA 3KSAC 3LNTA 4LXUA 3K71B 5A3RA 2RBKA 2HA0A 1VHTA 2PT6A 2VRCD 3M70A 1GRNA 1U7WA 1EE2A 3C6QA 3T12A 4F2PA 4MW9A 4XWGA 1YKFA 1NRJB 5HMMA 1G66A 1P2VA 4BBZA 4CM9D 2XB9A 1EM6A 4YDSA 2ZRJA 3B3GA 2JIZD 5AXCA 1DCFA 4P4SA 4XRRA 4ZYVA 1V3VA 3BSWA 1JDSA 1NQVA 1SQGA 2H65A 3D8BA 4L4YA 4CYMA 4ZJYA 4IQFA 4D3YA 3T7SA 1PX2A 2W2TA 4EPRA 4KPUA 2HEGA 4BNFA 1X8JA 1QG6A 4WOPA 1JG4A 4G56A 3QKTA 4ZQBA 4EY4A 3PFNA 1ZO8A 2A5LA 4YH1A 1FTYA 3KQMA 4RY8A 4A0GA 3K1ZA 1HLGA 2FJ0A 3NTLA 1RLUA 3WYGA 1JNXX 1Y5MA 5CR9A 5D3ZA 4MIKA 1U3WA 4J76A 4CMEA 5J63A 5J43A 2BKVA 2PSJA 1OH8A 4W1PA 2PKRA 4JYMA 1Z6XA 3KV3O 4UBKA 3O84A 2VP3A 3MWYW 4B0OA 4CKWA 5EPUA 4MEBA 4HPJB 4O0LA 4UM9D 3K8QA 5I7UA 2J7PD 1TGYA 3DV9A 3KQVA 4D4IA 1JIXA 6ABPA 1DUVG 5FUBA 1U1EA 2XCRB 5F1YA 1ZM4A 4M7PA 3TZQA 1Q1NA 3QKSB 1KBOA 3MWDB 3DQQA 4DXHA 3QLJA 4Q16A 1UMCA 3LPAA 3ZQKA 2Q3JA 4H3SA 1NSFA 1V9LA 2ETXA 4I9GA 2QJTA 1JFFB 1Q77A 2PRZA 1QO0A 4PF1A 4Q9NA 4YMIA 4DMHA 1Q74A 1QP0A 5D85A 3PX7A 2C31A 4HWKA 4EVSA 4MKHA 4RLFA 1RYZA 2IH5A 1ZU5A 3BMOA 4IS2A 1QC5B 1X6VA 3G1UA 3MPOA 4DUGD 5K01A 1FCJA 3QX8A 2F4NA 2Y93A 1VMDA 1W6RA 3BQ9A 3LH5A 1KORA 4GI5A 2WUWE 4TUYF 2P6OA 3DH0A 3TKLA 3C3BA 3CV3A 2XNSA 1L4NA 2LGJA 4LC9A 3VX3A 1Z0IA 3KJHA 4EY3A 4RJTA 1RC1A 2EZ9A 3ISTA 4CQMA 1E94E 4LBWA 1V4VA 2HM7A 4YV7A 2ET6A 4Q7EA 4R9NA 3RGWS 4AUNA 5I7SA 4P0TA 4HB3A 2O2CA 1MRZA 2C2XA 2D7CA 3L77A 2O2GA 2Z5GA 4D4LA 1RMQA 4G4SP 2RG1A 1QYIA 1PGJA 4JC8A 2ZJYA 3ZGYA 1JEQB 1Q57A 4Y6RA 4FDVA 2C2ZA 2Q5IA 1CRQA 5IAJA 1P91A 4NZOA 4R7ZA 5K2OA 2MYTA 1M2KA 3HI4A 2NU9A 1PYGA 3ZJVA 2F8MA 3ZX4A 2I6SA 1QWOA 4BRUA 3M4ZA 4KHZA 1LDNA 1U99A 2G70A 1RBZA 3P0FA 4X71A 3WJ1A 2R7MA 2UAGA 3IRUA 3NAQA 5LYYA 2PDAA 1LPOA 3A0RB 4M89A 4DVGA 1N6NA 4F6CA 1JR3A 2PUGA 5IKPA 2B0JA 1J70A 3OLZA 5THKA 4HAVA 3U0BA 2CCKA 3HVHA 1HT2E 4M55A 3ZVKA 3R23A 1C7IA 4K40A 1UMDB 3O6VA 4P3YA 5DGXA 4X44A 3E9NA 4MB0A 5I45A 4DS3A 1JEEA 2OGSA 3R0JA 2IEZA 1F4LA 2ZYSA 5JCJD 2ZJOA 3A6KA 3NZEA 1K92A 1EP9A 1M1XB 2B94A 3ADKA 2WDPA 4B4KA 1VZ2A 3PXDA 3NVAA 1X7DA 4HDAA 4HTFA 3SDSA 1S7GA 4TLCA 4F3CA 2VLBA 3WTBA 1KJ9A 1TIKA 1VC2A 1FLAA 1E5LA 4QHTA 2OYCA 4N41A 4Z8XA 1I14A 2VF5X 2H3HA 2BFFA 3KSDO 3NR2A 4GICA 1VBNA 2YOGA 2HU5A 1HNXB 1S5PA 4V0OA 2WZDA 2E49A 2OO5C 1J25A 2C7VA 2BWJA 5CPFA 4EFMA 3EMVA 5IXYA 4AQ7A 1DI0A 4GQIA 4Q4JB 2G8NA 4UHCA 5E6SA 1WDWB 1UIRA 3TLKA 3S1SA 4OP2A 2KB0A 4LKRA 2C7RA 1LNQA 2DQSA 5JANA 3OIVA 2XVAA 3I6IA 4F96A 3TDKA 5GIPE 1YQDA 3QNWA 4JI0B 2WJVA 3WDMA 5K3FA 2OZEA 3OEHA 1F20A 2H0QA 3PGKA 3W4JA 2QS9A 2Y76A 5JS6A 2LBPA 2P3OA 1P1BA 1DL5A 4FHCA 2HCRA 3O2QB 2NQ8A 4P92A 3GRAA 1ZHOA 3F5SA 1R00A 5EVCA 3WHIA 1YQXA 3WWEA 1K7SN 1PFUA 1EVQA 1PT5A 1TLTA 1YKGA 3FRHA 3LQ4A 1WG8A 5K4GA 2W00A 1J8YF 2IHVA 3PZRA 3QOWA 4PQEA 1M6WA 1QSGA 3EBOA 3PQ5A 1KR5A 1SQ6A 1TTHA 4X24A 1DADA 2Q5HA 4LDAA 2J09A 1ZR4A 5K0JA 2FQYA 1JXMA 3IYLW 1TCUA 1ZSVA 4M2LA 1NF8A 1YKSA 4XIYA 5J2UB 2Q41A 2QA5A 1JDBB 1E3IA 4EPYA 3Q5DA 2A9FA 3O26A 4DUZB 1BVHA 3KB6A 4IFTA 2DF8A 2Q1WA 3E61A 3OM9A 4UD2A 3QGMA 4RF5A 4S1PA 1Y9DA 4GMGA 3U4DA 3DNPA 4I1SA 2PH7A 2FWJA 3WIDA 1CUWA 3JYQA 4JB0A 4GQBA 4BN4A 4WT7A 2AN4A 3SZ3A 4E03A 4EJFA 3R5HA 1YK0A 5HK8A 5LC1A 3MJTA 3L0SA 3FDFA 4BASA 1BS2A 3OSZA 1DOHA 3FMIA 4AY3A 2FHPA 3T1NA 1ZGJA 1HWYA 2ZSFA 1DKMA 4K05A 4FBLA 3CYFA 4YECA 4PSDA 1EK5A 3GV0A 3KQUA 3KWFA 2FW7A 1MC8A 1UXIA 1Z0AA 1KQGA 4W9NA 4MKIA 2PUHA 1RAFA 1WHTB 2OT3B 4QYSA 4ROSA 1QQAA 2L18A 3B89A 3EMDA 3HMKA 3LOUA 4QOIA 5EJAA 5HIKA 1U4NA 4RKEA 1GXSA 1LPMA 1UQRA 4BLTA 5K0LA 3HU1A 4PZDA 2AW5A 1ZJWA 1U2EA 4KRXA 5EQTA 5HP4A 4H1VA 3WWDA 1VJGA 3B1WA 3VI3B 4OI2A 1BMFA 4RIIA 3EGXB 1S9DA 1ZOLA 5DBFA 4FQ8A 4RZQA 3LGXA 1EUDB 1L7RA 4PLVA 2ECFA 1UDCA 5D87A 5ELMA 1PGOA 2PK3A 4M0LA 1A5ZA 1LKZA 3DWEX 1DRJA 2KLBA 2C2YA 1WKBA 4KQFA 5JXWA 1SBZA 4JUIA 4NCHA 2O8DA 1O9BA 2QAJA 4M1QA 3HYNA 3SMQA 4X45A 5K9ZA 1YQTA 3I6ZA 2V7QA 3KALA 4Z4FA 5LP6C 4OPMA 5B58C 2QY9A 3RVSA 3OQIB 1N5OX 1WPGA 2YZNA 2DWCA 5D8DA 5F78A 5DH9A 4U02A 4CFSA 4DDHA 3BSYA 4MRMA 4CKCB 4OI1A 3M6WA 1L8AA 3B6ZA 1YSCA 4ZVVA 1GTJ1 1NNLA 5JWOA 2G4VA 1SUWA 4RLHA 4RLQA 2ZUBA 1CIVA 3QLUC 1ZCZA 3LHSA 4GVLA 4BJ1A 4EA9A 4EKIA 4TS1A 4U7TB 2JAWA 4L9WA 4M1WA 4ZO6A 4C0WA 2W43A 3BJIC 4D7AA 4QGHA 4Q4HB 2B1JA 1MUUA 2I5PO 3SC2A 1EM8A 2JJ1A 3ZXUB 4JWKA 3WGYA 3SZUA 3WIEA 2Z08A 1XT6A 1T2EA 3FVWA 1JAIA 3PQ2A 4C5AA 3TLYA 2NX2A 3R7NA 1KH2A 1ZD4A 1IUPA 1Q7GA 3DGEC 4EATA 1CX9B 3MSCA 2PWBA 1ZN9A 3GC6A 4GYYA 2FPSA 3IIMA 5JZOA 4AZ3A 1C1DA 2H51A 3SR4A 3HJHA 4UHBA 4BTVA 1RRPA 1TRHA 4G0OA 3MWJA 4YMHA 4OGWA 3C3DA 4L07A 3MRSA 1FFHA 5AJTA 1PQYA 5EFZA 4UNRA 4NCJA 2RDMA 3QELB 1TAHA 4BMNA 4AQYB 4E5KA 3CNEA 1PQ4A 1ZAYA 1Y34E 3DFFA 3OT4A 5D5QA 4BAGA 4I1UA 4XWOA 4Z1MA 2X19A 1SCKA 1DO8A 1V71A 3PF9A 4B7UA 1G7SA 2BGMA 2X40A 5KI6A 3PYXA 5GONF 4DIBA 1IXKA 4HADA 1XTPA 3HL4A 2RH8A 4URYR 1WCV1 1FC0A 3VUEA 4E7PA 4GNRA 1EBBA 2UYOA 2REOA 5I4BA 5EKDA 3Q72A 3BF8A 2OAGA 4IR7A 4HNAB 1QHXA 4BMPB 1VPEA 1VPVA