4TLCA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
234
structure length
227
Chain Sequence
b'HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPGFDLSALIERINYAIQKYRARRVSIDGVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kinase KaiC
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
total genus 79
structure length 227
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tlcA00
4RFSA 4CDGA 4EKDA 4B74A 4BFTA 3A4LA 3GJ0A 1ESNA 5D3MB 221PA 4CEJB 3TH5A 2GF9A 3U5ZB 3DL0A 2ZRAA 2IBMA 3GFPA 1SVSA 3KUDA 2JASA 2CK3D 2IT1A 3U6KA 3C16C 1E4VA 1N6PA 1OFIA 3BERA 4C0KA 2VRWA 2HF9A 1UDXA 4HLDA 5FR1A 4MYTA 1SVIA 2BV3A 1KNQA 4FMCF 1P9RA 1XZPA 2YOHA 4GT1A 3SS8A 3G0HA 1LB1B 2ZRHA 3ZJYA 4QL3A 3GJ8A 2CLCX 1KJYA 3HYTA 4A9AA 3QPUA 1ZRHA 1SVWA 3D31A 5DE3A 2ZE8A 1W36D 1P6XA 5LBIA 1ZM9A 4PSAA 3GJ5A 3P27A 2PEZA 3OIYA 3OZXA 4XSHA 4ZDJA 2XXAB 3MAAC 4LHYA 1LNZA 1IN7A 4LBVA 4LCBA 2J1LA 4KLNA 4IDNA 1UF9A 5HCNA 3GLFB 4QM7A 3CUEF 2EFHB 4F4CA 3OAAA 1FFHA 4B73A 5AR1A 1SHKA 1XJCA 3FFAA 4JLVA 5TDHA 3EAQA 4TQAA 1SXJC 5EE0A 3S1AA 4AI6A 5KSZA 3TR0A 2VHJA 4IXNA 5GVSA 4GMDA 3B78A 4OHXA 3K1JA 1F6BA 4KCGA 1XMJA 2ZU6A 4BRWA 2DFLA 2V1UA 4Q66C 3REFA 3BB4A 4MRSA 3BFKA 2RGDA 4EFMA 3EWAA 4PC3A 3GLHB 3PUVA 3TMKA 1CRPA 1RFLA 1NBMD 2F1RA 2J59A 3I32A 1N6IA 4OHYA 1W0JD 4KSBA 2YJTD 4AURA 1IJFA 2ZU0C 3BS4A 1JI0A 3PEUA 3RVBA 2ZJOA 4JLBA 4BEJA 2WM9B 1SVLA 1ZIOA 3R9WA 4DT1B 2FEOA 2MSEB 2JLSA 2V6JA 3R8CA 4KFTA 1SVOA 2GETA 1BIFA 3FMFA 4JJZA 4P4TA 1ZD9A 3SYKA 5BN4A 2WZQA 3IIKA 4EJSB 4GPTA 3U7HB 2WKQA 4RZXA 3CX8A 3DEFA 1ZP6A 3CWQA 4Q02A 5GADl 3MMPA 2HF8A 1X1RA 3RRYA 3BJIC 3O8DA 3QXXA 5DYIA 4KJZA 2ECKA 3BH7A 4GOKA 5B58C 4NL4H 3U3JA 3IO3A 1YZTA 2XOKA 3CX6A 2Y8EA 3T35A 4KVAA 1XFAA 3GQBA 4NKRA 4V03A 4TYWA 1TX4B 1W2HA 2ZSBA 4LBWA 1TQDA 1SKYE 1ELOA 4MKIA 1G8FA 3CR8A 2I1QA 5A5GA 5LB2A 4PO9A 2ZM5A 2PJRA 4L5BA 2QAGC 1CRQA 1E9BA 2CJWA 2VP0A 1S3SA 5FTLA 1JECA 4FCWA 2YVUA 1W47A 3EC2A 3D8BA 1XTIA 3CKLA 4PAQA 4PANA 4Q7KA 5E7JA 4LV8B 3AF3A 3SHWA 3GEEA 5JI2E 4RKFA 5FUYA 4TSFD 3EZ7A 1FNMA 3OIWA 1WP9A 2B8TA 2NO1A 4DDWA 1FW6A 3W3ZB 1P72A 3RAPR 2WWGA 5J47A 3AVUA 4HLUA 3B9PA 4J0QA 3HDTA 1EFRD 3MLEA 4NCNA 3QPVA 1IN4A 721PA 3FMIA 2GJ9A 1CXZA 1KKMA 1QHXA 1NSTA 3CH5A 2RGNA 3OE7A 4LHVA 3MJHA 2ERXA 3U3RA 4Y0VA 3RANA 4ITRC 3VAAA 2QGNA 2F1HA 1KKLA 3AM1A 4C2TA 2J0QA 2JJ8A 1X1SA 4A0GA 1CR0A 1G8YA 2IXEA 3VMFA 4AYXA 4ACAA 1UKZA 3BRWD 5LPNA 3IEUA 1E1QA 1O3YA 2G0TA 3U61B 1DADA 1RZ3A 1H8ED 1GL6A 1R4AA 3C14C 3QG5A 4NCJA 4PXAA 5B2ZA 3SYNA 2FZ4A 4Z51A 4LJ7A 5ELXA 1KI6A 4QHYA 1KO5A 2V3CC 1G3MA 2D7CA 1N6HA 1G8GA 3AVPA 5EUQB 4DSTA 1NJFA 1Q3HA 1BS1A 1G20E 1E2EA 3EZ6A 2FFHA 3IPXA 4NYJR 1AQYA 4YMSA 1XXHB 4DSNA 1HY3A 2GDJA 4R2IA 1CTQA 1NLZA 1SXJB 1KAOA 3PFIA 4P4UA 4YDHB 1PVOA 4HAWA 1UBGA 1EK0A 2D3WA 2F9LA 3CRQA 2PJZA 2HCJB 3VU9B 2KWIA 4M22A 3THXB 4TLBA 3T1TA 3AVQA 1PUJA 1T6NA 3KXLA 3HWSA 5JZVA 2RH5A 2YC4C 2CCKA 1W4CA 4MGKR 5AJWA 1II9A 5JHHB 1BH2A 4PSVA 1KAGA 2G1JA 3EIHA 1Z6XA 4Q1DA 3I8SA 1KJZA 1DOAA 3AUXA 1OHHA 1IY2A 1R0WA 4WXPA 4AKGA 4Q01A 5EP1A 5JI3E 2PBRA 4HAXA 5D3QA 2IL1A 2W6JD 5AUPB 1WA5A 4HZIA 3RNLA 3FGNA 2VSOA 1MRNA 1XP8A 2ZREA 1YQTA 4D25A 2AK2A 4DLZA 5FBRB 3BK7A 2D06A 1NY6A 4AKEA 1OH5A 3I62A 3TNFA 3FMPB 1CBUA 2G83A 4B48A 1M34E 1L2TA 4W9MC 1KI3A 1DO2A 2ZANA 2CK3A 4GSYA 5EJEA 2BC9A 4TL8A 1M7HA 5UKDA 3W8NA 4CRWB 2P65A 1YZKA 4RZUA 2DWOA 1J7KA 1E2KA 2ORWA 2BJWA 3MWLA 4JMPA 5FH9A 3THOA 1VTKA 2QAGB 5K8IA 5FOVA 3F0TA 1XU4A 2IYSA 1GL7A 2GESA 2GKSA 3H0KA 4TL9A 1IOZA 3UG7A 1UPTA 3EXAA 2YINC 2KI5A 2ZSAA 4AKHA 1IJEA 2H1LA 4GFDA 1Q20A 5GJVC 2JAQA 2F7SA 2N1BA 3RS7A 4M9SA 3SEAA 2C96A 1EG7A 1R2QA 2XNDD 3ADBA 1E0JA 1VG9B 4AG5A 2Q0HA 2FEMA 1KO1A 1NI3A 1QHNA 4JLAA 1NN5A 4B33A 2JJ2D 3KKMA 2OXRA 2J45A 5FL7A 4DCTA 1P2SA 5L8VA 2GJ8A 2FV8A 3MFYA 2WWYA 2O8FA 1N5JA 1JEEA 4WVFA 4BUJA 1CLUA 1NL3A 4B3FX 3LVQE 1XJQA 4V0KA 4YMTA 3GFTA 4HB4A 2Z4SA 3RWOA 2QBYB 3IBYA 4GI7A 2ZRNA 2WBLC 3AP2A 5KPDA 1Q57A 2CLSA 1DG1G 1DARA 2PMDA 4EUNA 1YJ5A 5EE1A 2ZUDA 1UKYA 1DAFA 1W2GA 1LF5A 2CVFA 4HZUA 4EDHA 1ZBDA 5B57C 1NBMA 5BW8A 4IVRA 2IYYA 1W0JA 1E79A 2QTFA 1QHHB 3NXSA 4MDFA 2C78A 3VR1A 5H1YA 2VIIA 3MSXA 2C95A 2IUUA 2UZIR 4MITA 4AY2A 3LX5A 4M8NE 4Q7LA 1MOZA 1P61B 2P5SA 2FSHA 1GFIA 3MG9A 3B1ZA 2YWFA 4QM6A 3B6EA 3D7MA 2IHBA 3VKWA 4PPFA 2WKPA 2A5YB 3AV0B 1OPXA 2ZRMA 1XF9A 2ZRFA 5CLLA 4URWR 3LA6A 1LTQA 3NEYA 4GOXA 2PL3A 4YC7A 4XOIA 3NHAA 4M4SA 1SQ5A 2ZSFA 4PAOA 1GP2A 1NG9A 5KNCA 5K8UA 1N25A 5TV2A 4RVCA 5JJKA 1XTSA 4HLQB 2EFCB 2XTZA 1I4DD 5CLQA 4G5GA 4G5SA 1DEKA 5ANRB 1CJKC 1R6BX 1Z6GA 2AWNA 3D3QA 1G5RA 1W49A 3W6OA 3RDPA 4PHTA 4M1WA 2IS2A 2CE2X 2Q3HA 5EXPA 1H65A 1KNXA 4KBFA 4LUCA 5AWFC 4OBEA 1N6RA 4TMWA 1Q22A 5KYKA 4B2LA 3AKDA 3ZZ0A 3KUCA 3SBDA 4XWAA 2OLKA 1M2OB 1LY1A 3MRSA 4NYJQ 2WJVA 3LX8A 1BMFD 1E2DA 3QKSA 3I1FA 4TSFA 1E32A 3GLHE 4URVR 1A2BA 2O8BB 2NQ2C 1UJ2A 3Q9LA 2Q6TA 4RZ3A 3DM9B 1DAEA 4WA7A 5KO2A 1NLYA 1RC8A 3U44A 2BEKA 1EFRA 1W1WA 1ZW6A 2BM0A 2OSBA 4C9BA 3CZPA 4U7DA 1JQJC 4X8LA 3ZS8A 1E2PA 5TARA 3NBXX 2OG2A 4PHGA 3T1QA 5B64A 3CWZA 2DCUA 4YXWD 5KOYA 4A15A 3ND8A 1E98A 3V9PA 2H92A 1XZQA 2ZR9A 4ACBA 1NIJA 1WQ1R 1XEXB 1DTSA 3TSOA 3U6BA 3FHTA 4NZYA 1L4UA 1K5DA 4JL6A 4JVLA 2WAYA 3IIMA 4IKEA 4LJ5A 1LFDB 1U2RA 3BH0A 1OYWA 1SHZA 2O8DA 4AYWA 2PZEA 1E2GA 5FBLB 1IHUA 1RRPA 4LHXA 4D4MA 1H8EA 1NY5A 1YR8A 5EP2A 4BEBA 3AQ4A 3WHLA 4NCIA 4DLRA 1AQUA 4A1FA 3SQXA 3KXKA 1RIFA 1ANKA 3DPUA 1Z08A 1FX0A 2JATA 1GNQA 1MO6A 2R8RA 3QF4A 3VX3A 3U4QB 2OCBA 2GXSA 4RD2A 4MRPA 3QKRB 521PA 3ZZTA 3QKUA 3IBGA 4V0NA 1TL7C 3BFXA 4TYYA 4U5XA 1CEEA 3WNBA 2FGKA 3B9QA 2O8CA 5DISB 1NVUQ 3QIAA 5IDVA 4MUAA 2EW1A 1Z28A 1LF0A 1R5NA 4L9SA 2EYUA 2NO7A 1II8B 2ONJA 4M9QA 4Q9IA 1FMLA 4LI0A 2RHMA 1EX6A 1JR3A 1T0JB 2SHKA 3C5CA 2R6DA 3RHFA 1CF4A 4C0LA 3QBTA 2IUSA 2QUZA 2PEYA 2ZJ8A 1ZU4A 2ZRGA 3NDPA 1VECA 3RSOA 4TTQA 4NDZA 2W6JA 2ZYTX 1T3LA 3AGQA 2ZJAA 2QTHA 2GAOA 3TAHA 1VYTA 2IYQA 3ZQ6A 3FYHA 4CEHB 3KTAB 4BZXA 1BOFA 3X1XA 1T5LA 3UPUA 1FOEB 2WIBA 3GD7A 3WYFA 5GVRA 1OXSC 2JA1A 2ZSEA 3QXHA 2L0XA 1OE0A 2P67A 2VHCA 3MUFA 1E94E 4C7OA 1U0JA 3R9IA 5EE5B 1VYVA 3DMDA 3QXSA 1S1MA 3U7FB 2CHVA 4RFSB 4HLUC 5F2EA 2H8KA 2LKDA 1Z07A 3CPEA 4LJ6A 2IEZA 1TQ4A 2FSGA 4TWZA 2XB2A 1KI8A 1K5GA 1WBDA 1AKEA 1XXHE 1EXMA 2RGNC 2ZS7A 3SNHA 4OL0A 1SXJE 4QHTA 3TW4A 4QRHA 4KFSA 4B2PA 1SKQA 3ETLA 2Q21A 3I5XA 5H68A 3JZAA 3GMTA 4W5JA 1KZ7B 5GJBA 2W58A 1N5IA 2YKGA 4TYQA 1VCIA 4DJTA 1N0WA 1P60A 1P4SA 2XNDA 1IY1A 2YOGA 3CM0A 5J40A 4AYTA 1ZNWA 3CBQA 1G8HA 4PFSA 1XJ0A 1G16A 4EFLA 4C0SA 2DFTA 3BFVA 1UAAA 2ZRCA 1F2UA 1OIXA 3TVDA 4B34A 4FI3C 4NU0A 2GRJA 3A37A 3BIFA 1KK0A 4DZZA 1GKYA 1OH7A 5EXTA 4QNRA 1JEDA 2ZJBA 1DAIA 2ZI3A 3S1AB 3HU2A 5DI3A 3I92A 4JYCA 1HTWA 4B2IA 2QP9X 4PO1A 3R7WA 1KO8A 3A1VA 1P73A 3LVRE 4MYHA 1F5NA 2QORA 2YHSA 1XD2A 4BLTA 4KFUA 1G4AE 1M6NA 2O5VA 3W3AA 1A4RA 1D2NA 1UBCA 4W7SA 3VR3A 1JAHA 4NBSA 4TTRA 2RGBA 2V9PA 1M8PA 1PV4A 1PLKA 2DHRA 4B44A 4X8OA 4D2IA 3I4LA 5DN6D 4JKYA 4TZ6A 4AKIA 1Z63A 4B3CA 1JR3E 4LC0A 5GJWC 1S96A 3QSYA 1II0A 1XCGB 3QXJA 2J5XA 4D80A 4OK5A 5CM9C 4BQSA 2GEUA 3H86A 1AZSC 2JIZD 2JEOA 3A4NA 2VHUA 2YNMA 1KSGA 4IFEA 4B3DA 2ANBA 4JL8A 3OEED 1X8LA 1NMZA 4L16A 3W6PA 4D82A 2GEDA 2IX3A 1GTVA 4HB2A 3CLVA 1AS0A 4FN5A 1AKYA 2FZLA 1TADA 5CM8B 1N6KA 3F3YA 4WBSA 1CJVC 2PLRA 2FSFA 2RGAA 2W2VA 3Q7QA 4CEIA 1BMFA 2CJWB 2EFDB 2FFAA 3BB1A 5FFMA 5EZ5A 2A5FA 2HT1A 1HYQA 1XDBA 2I4IA 2LKCA 1Q3TA 1W48A 2ODEA 3HR7A 2ATXA 2R9VA 4BLPA 5JCZA 4LRWA 4KLZA 1W36C 2QT0A 2FOLA 2JJ1D 2WKRA 3GCGA 4JLKA 4IVQA 1TUEA 1AS3A 2H18A 3NH6A 4QGHA 2E1RA 1KK2A 2OO7A 3KJGA 2WJJA 3LRPA 4H9GA 4G3XA 2QRZA 3CF0A 4NONA 2CL6X 4YXWA 5CK5A 1EFCA 4N3NA 2PT5A 3I5YA 4OI2A 1NG1A 3RYTC 1KMHA 1Q0UA 1PUIA 2D74A 3X2SA 4OI1A 1C9KA 1AK2A 3Q5EA 4HDOB 1E9EA 1QHIA 2XX3A 4G1UC 3MJRA 5SZIA 2B7CA 2R6CA 2NPFA 4IEIA 4DLTA 3AVOA 3RSLA 4IXMA 3JVVA 5FBWB 1YVDA 1XTJA 4FWTA 3ZD7A 2PZGA 2NO0A 1S9HA 1V43A 1E96A 1E9DA 3NVAA 2JCSA 3KQKA 4TL7A 1UM8A 4HAYA 2CXXA 3T5GA 1RYHA 2ASEA 1KI6B 5IK2D 4XVUA 2JLQA 4RJLA 4BZPA 2G1KA 3IGFA 5BYKA 4DVGA 2W0MA 1XTKA 1IN5A 2BKEA 3ASZA 3B5JA 1DAHA 1G19A 3K9HA 2CHGA 3ND9A 2A3RA 4LV6A 1KIMA 1ZD1A 2DWPA 2JLRA 4AK9A 1GM5A 2B21A 3LW7A 4OQFA 4XVRA 3ZLJA 2H17A 3EA5A 4MYCA 3KQUA 2J9RA 2R44A 3H84A 4MRRA 1DELA 1U8AA 1ODFA 2B7BA 1ZNZA 1NF3A 3QVUA 5E7IA 3V4FA 3GJ3A 2NPIA 4ZKDA 2WHXA 3EZ2A 5JS8A 3RABA 4Q4JA 1ZM3A 1JNYA 2FJUA 3BB3A 3WNCA 1NN3A 3M6AA 2O0KA 2VSXA 2HJVA 1F2TA 1ZIPA 3L2OB 1G3QA 4V0MA 3JVUA 4NCHA 4XD7D 1TQ6A 1VIYA 1V5WA 3ZYCA 4OQLA 2WSSD 4Q03A 1KHTA 1JXMA 4WIAA 3BBPA 1G9XA 3VTKA 4M1MA 3A1WA 3REGA 3U3KA 4DCSA 1YKSA 2ZJZA 4CIDA 4PR0A 4DWJA 3OHMA 3T61A 2NTYC 4PPGA 2WWXA 5G3ZA 4NYMR 1OXTA 2WV9A 2HJGA 4A4DA 1COWD 3FKQA 1Z0FA 4JVMA 2ODBA 2FPKA 1ONBA 1I4TD 3WXMA 1YR9A 3SBEA 3UXMA 1FPMA 4D4LA 1NLFA 5JEEA 1Z0DA 3HPQA 2A9KA 3EC1A 1W36B 5AJXA 3BOSA 2XSZD 4Q1AA 5JFGA 4R98A 4JBWA 1DO0A 3KFXA 2HUPA 4FINA 1MO5A 3L8ZA 2Q3FA 2QROA 1DAMA 5SZJA 1G6HA 2BCGY 2QM7A 3R8FA 5TVKA 4D0LB 2O8FB 2O0HA 2OCPA 4KXFB 5AJVB 3DM5A 1TF5A 3LLMA 4OQXA 1ZC4A 3KKPA 4EPXA 3QEJA 4ILEA 4JLMA 4TTPA 2J0UA 4Q19A 3L8YA 4EPWA 3P4XA 4JL5A 1IN8A 5AUOB 3TVTA 2K5UA 1BYUA 421PA 3UATA 3WYAA 2G6BA 4P32A 2QMOA 4HZUB 2ZYVX 3JZMA 3QG1A 3OIVA 1WE2A 3AVVA 3THYA 2GCPA 1XWIA 3RS5A 5CITA 3SJBA 1WRBA 2DYKA 2FE4A 5DN6A 3V00A 1CULC 4DSOA 5KSOA 4M1OA 3SJCA 4RSGA 1E0SA 5CIWA 2ZXUA 1H8HA 4Q1BA 1VG1A 5K8LA 5HKKA 1A2KC 1AGPA 2FF7A 3G5UA 3W6NA 3T12A 4R7ZA 2ATVA 4C0JA 1E2MA 2JIZA 2OAQ1 2XTNA 2CL7X 1D9XA 1P2VA 2CBZA 5JRZA 4HI0E 4V0OA 5KDOA 3NC0C 2RGGA 3OEEA 3ZD6A 4NYIQ 821PA 1NVVR 5FOWA 4KBGA 3X1WA 3FOZA 3KQNA 2AKAB 1QRAA 4ZO4A 2WPDD 3P1JA 4V0ME 1HUQA 1G3IA 2ZUCA 2H57A 5E4FA 1R8QA 1KOFA 5FOUA 2CNWD 2Z83A 4JVSB 1IXSB 4ERNA 4DCVA 3GLGA 3Q5DA 5JWOA 1QHYA 2AFIE 2GAAA 2ZI6A 2ZRIA 4DSUA 3N2EA 1MT0A 1XD8A 3LDAA 4JBYA 1J8YF 5JECA 2BIFA 5JWRA 4JLNA 1HQYE 1XEFA 4TL6A 2QSZA 1ZVQA 2F6RA 1HA3A 3K0AA 3LV8A 2JJ1A 2JDID 4JZKA 3UMFA 3QKSB 4B32A 2QG6A 2NO6A 4DHEA 1MABA 3FMOB 5L3QA 5EE9A 5DGXA 4MKGA 2FG5A 4FW9A 2ORVA 3B13B 3U44B 4FMCB 1D8TA 1UEIA 4EPTA 4YDSA 2ZRKA 3U7GA 1PLLA 4JIMA 4LYFA 4P4SA 1OB2A 3GJXC 2VP6A 1L7VC 5FTKA 3VFDA 2J7KA 1OKKD 3EWSA 2HEIA 4H1VA 4V0LA 2QSYA 3FWYA 4PPQA 1RRGA 1U81A 1U94A 4QBIA 4LX0A 4JYBA 4HAZA 3U60B 2BBWA 2IXFA 3VR2A 5BN3A 1Z06A 2ZAOA 1G17A 5JSZA 5L3SA 2DFKB 2VO1A 4WW0A 1VCOA 2GHIA 4IHQA 3SFVA 5IF9A 1P2TA 1Y3AA 2WJYA 2VP9A 3LBHA 2QPTA 4GP7A 5HCIA 1YZGA 3AKYA 5CYPA 2VHQA 2XTMA 3TQFA 2MMCA 2O8DB 3QE0A 1I2MA 2QNRA 3ZVRA 1KSHA 4JJKA 1P5ZB 1T5IA 2VYFA 4QNMA 1GVNB 2F43A 2F9MA 3NG1A 1YZNA 4XJXA 1VDZA 3AKEA 2PLFA 2QN6A 3KKOA 4Q9LA 2IYWA 1FX0B 4NYMQ 4HUQA 3QF4B 3IUYA 1U90A 2MSDB 3DZDA 4ZIRA 4F38A 3VQTA 5H70A 3IHWA 1NVWQ 3E5HA 3CRRA 3TW8B 4RZ2A 4F93B 4A8JA 1P3JA 3MWJA 3ZQJA 2ZR0A 5JEDA 2WJGA 1AN0A 1N5KA 2O8CB 3B8HA 3CIOA 4ON9A 4D4KA 2ZE5A 4QBHA 3FFBA 4GMXA 4DLSA 2B92A 1G6OA 3NKVA 4LK2A 1A82A 3NH9A 2D62A 1F60A 4BLQA 1JB1A 4AD8A 8OHMA 3AP1A 4B3XA 4EFNA 1OT3A 1E0AA 3C8UA 5DI9A 4GP6A 1T3SA 4BLSA 2IYRA 1OIWA 2R2AA 2YWGA 5E95A 3L0PA 1XEWY 1TNDA 2IS6A 1JXOA 4XD7A 4DKXA 2CLDX 3O8RA 4WOPA 4B35A 2HCBA 1KDRA 3GLIA 4Z1MD 2WSSA 5H8WA 1QF9A 1Q1EA 3ZH9B 4BPBA 5JRJA 2B8WA 3PVSA 4C7OB 3A58B 3SU8A 2GZAA 2O0JA 4HB0A 4RD4A 1ZCBA 4HDQB 3ZDQA 1ZM2A 2VBCA 4LY6A 2V1XA 1TU3A 4UXIA 1Z0IA 2HYDA 4N1AA 1DBSA 2IA5A 3AEZA 1OFHA 4IOLA 4W5HA 4S35A 4TLEA 4Q9HA 1FZQA 1WCV1 2ZRDA 1COWA 1R10A 4PHHA 5BQ5A 4TMZA 5FTMA 4OK6A 5F98A 5FUWA 1OXXK 1FQKA 1LV7A 4L15A 4LV5B 4S2EA 4L4UA 4F4JA 1KGDA 2XSZA 1U98A 2BVNA 1U8ZA 4KYUA 2WIAA 4DC9A 1J2JA 4Q1CA 2J0VA 3WMEA 1RKBA 5K8TA 4DLYA 3ZZUA 4OQMA 4R9UC 2QQEA 2ZJYA 3CF6R 1OV4A 4JT2A 5BWMA 2UVQA 4O2LA 1XPUA 1R0YA 1F2UB 2ZJ2A 1IAQA 2IF2A 4QJ5A 2FN4A 2UZ3A 4B75A 2BBTA 3LBNA 3UWKA 5A0FA 4O0MA 2RAPA 2F55A 3WY9A 4WZAE 4LJ4A 3T34A 4DIDA 1VPLA 4XH9B 4GDFA 1X8JA 1W0KD 5DI3B 4NH0A 2A2ZA 3BD9A 3R7WB 4TYPA 3UWOA 2AK3A 2AHOA 3THWA 1Z6AA 1XD2B 4CVNA 1T9HA 3P4YA 1L4YA 4TLCA 1GRNA 2ZRBA 1CS4C 3QXCA 2W6ID 1G8PA 3KL4A 2H7VA 2ZVPX 5JCPA 1OB5A 1U0HC 2IEYA 2ZS8A 4FMBB 5EZ6B 1RPZA 4KU4A 4M1YA 3R9XA 3ECCA 4B6FA 2V7QD 1XEWX 1XB2A 4IW3B 2RCNA 2C9OA 1MO3A 4YMWA 4G5OA 4Q4LA 1DS6A 1EWQA 4MH0R 1TU4A 4DB2A 1D6JA 3KDSE 1GRQA 1U9IA 2A7QA 3I3SR 1P75A 2N42A 2YC2C 3VHLB 1NN0A 4CW7A 3TUZC 2X77A 3C7KA 3IPYA 4JSYA 2TMKA 2WPDA 4OI4A 1RVDA 3C41J 2ANCA 1A1VA 2GBLA 1DAKA 5TXGA 3QEOA 4LPKA 1EFTA 4PC2A 3AB3A 4KVGA 2BDTA 1C1YA 2W83A 3K9LA 4C0HA 1A5TA 2ZJ5A 1T91A 3E1SA 1R8SA 1AIPA 2EWWA 4KFRA 1UBEA 5J4VA 4CEIB 2CE7A 2JDIA 2ORIA 1F3OA 2EVWX 4QC2A 5SZHB 5DO9A 2GZHA 1W5SA 1NBME 3OFND 1CIPA 1M7BA 2RMKA 4R71A 1RW4A 1Y63A 4OHVA 2BMDA 2DBYA 3TLXA 3UIEA 1DPFA 1D2EA 1IXRC 3DKPA 4I1UA 4DLVA 2C77A 1Q1QA 2NGRA 2RGCA 4R2HA 3TR5A 2EU8A 1T3HA 2QE7D 4MKHA 4PX9A 3K0CA 1IY0A 1ZMXA 1D9ZA 4IEEA 2VLIA 3BGWA 4M2LA 4LYAA 4NCKA 2ZIAA 1N2CE 3FKSD 5EP3A 4I1VA 4XVQA 1S8FA 3CNLA 2JLUA 4L9WA 2AR7A 2Q9CA 4HYYA 4ZI3A 5JS7A 3BORA 4KSCA 1KTVA 2OE2A 5DYGA 1KMHB 1GZSA 2X2EA 2XJ9A 2WJIA 3ADCA 1Z0KA 2AFHE 4G5RA 4E5UA 2WWIA 3FHOA 3FHCB 3E70C 2V8OA 3CX7A 4DDVA 4Q4AA 621PA 3FDIA 2X8AA 2GJAA 3B2EA 1OF1A 4LJ8A 2X2FA 1T0HB 1G5TA 2N46A 5C2JB 3LD9A 4RKEA 3CNOA 4LJYA 5AUQA 4AWXA 4URZR 2IS4A 1LS6A 1AZTA 5G3YA 3AKCA 3NHBA 3W9YA 1NVXQ 4PTLA 2QEQA 3K0FA 1QVRA 5B30A 2BWJA 4Q5IA 1AS2A 4HB3A 2OESA 3HYRA 3CF2A 1FTSA 3LW8A 4BASA 3A6PC 2BCJQ 2CDNA 1TQ2A 1VIAA 3RC8A 5EXXA 2QPAA 4BFWA 4UQOA 4UNRA 1OJLA 3PUXA 1N0UA 3WYGA 2ERYA 1KK1A 2H16A 1SZPA 2VEDA 1Q12A 1JJ7A 4ABYA 1XPOA 4URXR 4Q7JB 1J99A 2HDNB 4F7WA 5SZKB 2QP3A 4DLUA 2A30A 3BE4A 3TGPA 2HXSA 1OXUA 4ZPXA 3AVXA 4DCNA 2WTUA 3ICQB 2JJ2A 3KFVA 2C99A 3Q7PA 4ARZA 2ZTSA 5DNYB 1HT2E 3TSZA 4Q4JB 1WDTA 4PQYA 4PC1A 4IOMA 1VYUA 4Z1MA 2NIPA 2NO9A 2VHTA 4DXAA 1F2TB 3B60A 4O2RA 1NIPA 2V4ZA 2Z5FA 4PQFA 4RCYA 5FOSA 3ONWA 3B7GA 3AH8A 3PV0A 1RYFA 2WAXA 3UK6A 1XMVA 3K70D 2J3EA 3NEJA 1YRAA 2ZI5A 2ZE6A 3LNCA 1KDPA 2C03A 2VPPA 3T15A 4MA4A 2AKYA 3NWJA 3PITA 3F8TA 4PC7A 4UXHA 1XMSA 4BECA 4A82A 4Q00A 5CDFA 4EQ6A 2XGJA 4UJ3A 3IHLA 5JHGB 4G0NA 1OH8A 1BKDR 1D2MA 1Z0AA 3GJ4A 3KZ1E 1LVGA 1QG4A 2Z0MA 3QKTA 1Z6YA 5L3RA 1CR4A 3UG6A 5FTNA 2WWWA 2GCOA 2KBEA 2QRNA 3B1VA 1FP6A 3CH4B 2GCNA 1KY2A 4X8HA 2VH5R 2J87A 3TUJC 1OFTA 2AXNA 2W2TA 4JLDA 2C98A 1FP7A 1JAIA 3CB4A 5CB6A 1TAGA 1TPZA 3L0SA 1CR2A 2GZDA 2BM1A 3MWYW 5FR2A 3BAFA 1UBFA 3KB1A 3O8CA 2XNSA 1UEJA 3OEHD 3A1SA 2Q3MA 4IFBA 3SR0A 4C0QC 1XNJA 5J4KA 3PIRA 3RRNA 2OILA 2XZPA 1W0KA 2J0UB 1B23P 4A8JC 1DVRA 1VCNA 3AVYA 3IQXA 1O87A 1SVKA 2P6RA 1XX6A 3T1OA 2ZITA 2GVZC 2QTVB 3D6TB 2XEXA 4AG6A 5F9FA 2REXB 2W6IA 1HT1E 2A5GA 3RS2A 4Q18A 4MGIR 3THYB 5A4JA 1Z2CA 1E2IA 1FQJA 3W34A 4F91B 4B3GA 3CNNA 4XTRA 1E6CA 2JGNA 1NMYA 2V7QA 2ZUBA 3P26A 4NPHA 2IHYA 4URUR 2GVDC 4OHZA 4TMXA 4TT3D 3W5JA 1K8RA 3TKLA 2QENA 3TBKA 5TB5A 2O8EA 2GEVA 4ASUD 1IXZA 3UMSA 3H4MA 1U99A 1CU1A 2LWIA 2GXQA 4U00A 4KO8A 3GJ6A 4A6XA 4CF7A 4V02A 1W5TA 4LJAA 1TTTA 3NBFA 3AGPA 2OZEA 4DUGD 3Q8XB 4D4JA 1PJRA 3IO5A 5P21A 4DDTA 1VKJA 1VMAA 4BFXA 5KPJA 3RRMA 2JLYA 4BFVA 1WF3A 3EW9A 1Z6TA 2G0NA 2GK6A 5L3VA 2AL7A 2BOVA 3GLGB 2KE5A 1KI9A 1US8A 2VP4A 2ZYUX 4B3BA 2CCJA 2JLXA 1MV5A 1Z83A 3TJZA 4FMDB 3OFNA 1QVAA 3LH5A 2BBOA 1UDWA 3X1DA 3EA0A 2WJHA 3K0AB 5EP4A 4IVPA 5G41A 1RJ9A 1T8UA 2AN9A 3LLUA 3TUIC 3X1ZA 1MABB 5L3QB 1LW7A 1XD9A 2WSMA 2J46A 1G64A 2WOOA 2WICA 2QE7A 1Q21A 2YV5A 1TEXA 5FL3A 2KBFA 1UADA 3QBVA 1G21E 1MR3F 4P4SB 2QMHA 5CIQA 4RD1A 3FKSA 1NN1A 1S3GA 4L8GA 5CYOA 1YRBA 1E1RD 1IM2A 2VF7A 1EESA 5HE9A 4GOJA 4JKIA 2G9NA 4M21A 4QBFA 1G291 3A36A 2F3RA 4TMTA 4O25A 4OK3A 1JALA 4IRUB 5JSZB 4QGAA 5L3SB 4LHZA 1FUUA 3GJ7A 3NBYC 3OF5A 2J0SA 4A36A 2KSQA 2PX0A 1T4GA 3GFOA 3B1YA 4QXAA 3CW2A 5JBQA 3WP0A 1ZUIA 1E4YA 1JPJA 4Q47A 4CT5A 5M04A 1G5PA 2I3BA 2QMUA 3BWDD 5CJ2A 4GZLA 2GF0A 2F43B 3EX7C 1EX7A 2J41A 1NP6A 2VL7A 4GZMA 3QI2A 3N2IA 1IBRA 1R0ZA 4HUQB 4UNQA 5J4YA 3J81k 4X8MA 4ZIRB 1GIAA 3DOEA 3GEHA 1U9IC 4XWOA 1E3MA 3IILA 4IOKA 3K0EA 5DIFA 4JLJA 4A8JB 5FL7D 3RS4A 1R5BA 2EYQA 4MGZR 4KITB 5DHFA 2HT6A 1E99A 3NBZC 1Q1ZA 4BLRA 4D0GA 1JR6A 1MKYA 3WBKA 2IW3A 4K46A 2X1VA 4URYR 4BRUA 2IF0A 4LZZA 2GBLC 4C0BA 4C0AC 1SVMA 1X8KA 3LY5A 3C15C 4N0EA 1RRFA 2RKOA 1IN6A 2DWQA 4UXJA 4A6PA 1M74A 2ZQ5A 3EASA 1NJGA 4MRNA 4N0DA 1XRJA 4B6EA 4EPYA 2JLWA 2J7PD 1P9WA 1QBKC 1VCMA 3WRYC 1UKEA 1Z3IX 1J8MF 4BWYA 1E79D 2ZAMA 1ZNXA 4POAA 1E2QA 5KU1A 4DB4A 5DH9A 3VR5A 3GLIB 2G3YA 3A1UA 2IXGA 5IRCD 2GJSA 2IK8A 4OHWA 5LDDC 2QA5A 1N6LA 4OI0A 2WWHA 4FD2A 2QP4A 4TQUS 2QY9A 6Q21A 4CGZA 4LJ9A 3QQ5A 3BH6A 4QHSA 1W7AA 3A8TA 3K0CC 4PZLA 3ZGXA 4MUBA 3O47A 4PQRA 3WMFA 2KJQA 4OKSA 1OH6A 2QT1A 2DPXA 2IS1A 3CRW1 2BMFA 1HE8B 4P3YA 3RS0A 1Z22A 3VX4A 3ZIAD 5J4LA 2QL6A 5KSYA 1CJUC 4EPVA 3QUSA 1GKUB 3PCRB 3TAUA 3LAWA 4KODA 5FTJA 2OBNA 3DKVA 3LQRA 1FUKA 3F5FA 2BEJA 4HEJA 2PCLA 1C4OA 2CMKA 4QFMA 2WMNB 3PR1A 4YONB 2VA8A 2IYTA 4PZYA 4AC9A 5J4HA 2HXYA 2EFGA 4XTCS 1KMQA 3X1YA 4KYIB 3AUYA 3QOFA 2AXPA 3MWKA 1P2UA 1Q1BA 2GA8A 3OEHA 4WZBE 4EAQA 4I81A 4NTZA 1KDOA 1JQLB 2VP5A 3HPRA 1ETUA 1HQCA 2QAJA 2IYLD 4OQNA 4PPNA 4U02A 1SXJD 2OEPA 2PH1A 2ONKA 3AP3A 3Q3JB 4ZV4A 2NG1A 2MSCB 4CZ2A 1XTRA 1OXVA 1SULA 3NC1C 3L82B 4OJKA 5JJLA 2BMJA 1OYYA 3W90A 1PLJA 3FB4A 1KSJA 2R65A 1M1YE 2YWEA 3THWB 5EUMA 4C30A 1GRRA 3SYLA 4TQ9A 3V4RA 4CT4B 1MO4A 2FU5C 3RWMB 2NMVA 3DDCA 4HDCA 4TT3A 2QMEA 1GNPA 3AVTA 2OM2A 1XCPA 4TMVA 1MH1A 3IIJA 2FGJA 4ASUA 4IDHA 3PXGA 3TSWA 1TMKA 1R7RA 1JJVA 4Q9JA 5D3MA 2BJVA 3QPWA 4CEJA 2NZJA 1G7RA 1B0UA 4Q21A 3U3OA 2ZYWX 1QDEA 4XSGA 4DUGA 1Z2AA 4KHZA 1OW3B 3HU3A 4Z54A 1EFUA 2ZR7A 1UFQA 4LDJA 4PSKA 2HV8A 1WB9A 1MRSA 4A2WA 3ASYA 4I99A 1VG0B 2PZFA 1WBBA 3KJHA 2KB0A 3OESA 3PUWA 3PEWA 3K09A 1F48A 4B76A 5FI1B 1ZAKA 4PZZA 3PG5A 5IK2A 5JWHA 1XPRA 5F3WB 1JR3D 2QPOA 1J70A 5CK4A 1JPNA 1G4UR 2QU8A 1U0LA 4E03A 2XXAA 3N5CA 2FMXA 1WMSA 2OBLA 5FPHA 1YR6A 4HLCA 2EQBA 3GLFA 3VHXA 4ESHA 1E1RA 4YMVA 4FCTA 2NOAA 4DDUA 4RD3A 2ZSDA 4M9XA 2WWFA 2AX4A 4QJ4A 4MGYR 5LB4A 3K9NA 4JLOA 1Q44A 4US0R 2GK7A 1CR1A 1KI2A 4M1TA 5HPYB 5KTYA 4US2R 3A1TA 3PEYA 3AF4A 4EPRA 1KSFX 1G7SA 2E87A 2NZ8A 4QBGB 3GLHA 4C3ZA 3IEVA 5AJYA 1X86B 2WVJA 2AD1A 4Q9KA 4Q4AB 4K8OA 2A78A 5E7MA 3SZRA 1N5LA 2PMKA 5FPYA 3DOFA 3QNUA 3B82A 2W00A 5FBVB 3UKDA 4DT1A 3TE6A 4BFYA 3GLGE 3VNUA 3VKGA 5G40A 4Q1EA 3ZVMA 2BKUA 1E2NA 5AK0A 2IYXA 5FUVA 3RRZA 1EFHA 1S9DA 4EJSA 4ZDIA 1S2MA 1E2HA 1GUAA 1TF2A 3K0FB 4HUTA 3SJZA 1FL9A 2FFBA 2IC5A 2R6AA 4YLGA 5F9HA 2DFNA 4P0TA 2GTPA 3I73A 1UKVY 4A0HA 4EIWA 5HZHA 4DBLC 2QQ0A 2H5EA 4KAXA 4D0NA 3O8BA 4DEYA 1G3RA 2ODNA 2VF8A 3U3MA 4G01B 1GDDA 2ZI4A 1N6NA 2RGXA 2F1IA 4D81A 1IONA 2FPLA 1P9NA 1KZGB 1N3BA 2EFEB 5CJPA 2I1VB 1VG8A 4UJ5A 4LYHA 4GL2A 3L43A 3EZFA 4LOAA 3ADDA 3NTUA 1ZCAA 1ZM7A 3DZ8A 2G88A 4K81B 5BXQC 1NSFA 2QM8A 1K6MA 2XITA 3NIBA 5DSZA 1KDTA 1Z8FA 4LHWA 1KI4A 1NVVQ 2J7PA 1KO4A 2O52A 3UMRA 2XZLA 2QGZA 3ICEA 4ZKEA 2F3TA 4ARZB 1GILA 1AM4D 5AUNB 4XIGS 2HYIC 2OCYC 1OIVA 4M0LA 2FSIA 2ZVQX 4BFSA 4M9ZA 1FTNA 3K0SA 1P62B 2ZE7A 3T1VA 3P32A 4Z8YA 5IHPA 4YQFA 3KXIA 2DY1A 4DRZA 2UKDA 1ESMA 1QG2A 4IDQA 4UNPA 3RC3A 1OFUX 4FWIB 3OIUA 4TYNA 2IYVA 2Z4RA 2LCFA 4NE2A 1G7TA 2GXAA 4JVNA 5FPTA 4B47A 4BZQA 4P31A 2ZETA 2Q9BA 3KJEA 4LBYA 3AVWA 3GPLA 1N6OA 1JBKA 4II7A 1YR7A 2QI9C 3CZQA 1ZNYA 3AF2A 3ZIAA 3AF1A 3B1WA 4EQ6B 3ZVLA 1QHSA 3I61A 5C4GB 3GLFE 1HE1C 1M7GA 5EXSA 3FE2A 1R5OA 2V55B 3TIFA 4IOJA 3HR8A 3SI7A 5G53C 3EZ9A 2YOFA 4JT4A 3TRFA 4M1KA 1ZYUA 1DAGA 1G18A 2CL0X 2GCOB 2VQSA 2AWOA 2ZI7A 4QJ3A 5DHAA 4I4LA 3WBJA 5LD2C 4DEXA 3K9GA 2DB3A 2A5JA 4PAMA 5EE3A 3WRXC 3H2YA 3SDZA 2OUKA 1E2LA 1I4LD 4PO8A 2QZ4A 2BBSA 1ZM4A 2OAP1 3DVLA 4Q1FA 3LQQA 2YZ2A 1L8QA 3GP8A 1XMIA 3ZVNA 3ADKA 4IDPA 2ZRJA 4HATA 4QKQA 5HE8A 1YZQA 1XXHA 1S4QA 1ZUNB 1KY3A 2D2EA 1SGWA 3GLIE 3PUYA 4WZ6A 2CNWA 1SXJA 2C5LA 3QVVA 4LPSA 3PJRA 1IQPA 4LYJA 2A5DA 2G77B 1VHTA 4BLOA 5E3HA 1NNEA 1BYIA 3KJIA 3VU9A 4BGDA 1AA9A 1RRCA 4YMUA 3THXA 2OCAA 2WOJA 3QY0A 3MGCA 3A4MA 1NRJB 2XJ4A 4A92A 3CRVA 4MDEA 2IYUA 1R0XA 4D6PA 4I1OA 2XAUA 1OLOA 4ESVA 3DMNA 2JLVA 3HP1A 3LO5A 2VTKA 121PA 3WHKA 4IJMA 2V54A 5BN5A 2OHFA 2WMOB 4DIEA 3Q85A 1EWRA 2GWHA 4ZI2A 3CONA 4JS0A 3M0EA 3QJYA 2OLJA 2P2LA 4RY2A 1E2FA 2REOA 4G5QA 3H1TA 4DCUA 1G7CA 4HSEA 3LBIA 5BYJA 2W2XA 1DE0A 1OKKA 2XZOA 3G82C 4UKDA 3M1IA 4RCZA 5JJIA 4OJQA 1ZJ6A 1CJTC 3PEVA 3K53A 2HLDD 1KI7A 3DO6A 2MMGA 5EQTA 2O8EB 4IDOA 3K70C 4BFUA 2OBMA 4KV9A 1Z29A 4H1UA 2PCJA 1X3SA 3HU1A 3PQCA 1W4BA 4TZ0A 4F92B 2ZRPA 1G41A 2IWRA 5GJCA 1YHNA 1XBTA 2AD5A 3KQLA 4LSGA 3LXXA 4TLDA 2QAGA 1GL9B 1GOTA 2E9SA 2R6GA 2C8VA 2OFXA 4JBXA 4Y0AA 3EIQA 3EPKA 1QHGA 5C18A 3VR6A 1GAJA 3CR7A 4KI0A 4LGMA 4Q4HB 3SN6A 4A0RA 1HV8A 3KKNA 4ZCIA 4PHFA 4B43A 1HURA 2OXCA 1US8B 3IDQA 4Z8XA 4DLWA 4RD0A 1W4AA 2ODWA 1GG2A 4C4PA 3C4JA 4ZCLA 4LC1A 4AIIA 1E9FA 2GJKA 1Z5ZA 3EPHA 1P7CA 3ZS9A 2FNAA 2ZI9A 4M53A 3SC3A 1G1MA 2Z43A 1Z47A 2RHDA 1RJ9B 2D4HA 3CPJB 1CKEA 3GEIA 3T06B 3FTQA 2GXUA 1GITA 3KB2A 1E9AA 1S0UA 2CHQA 3RS3A 4UNSA 2ZEJA 2EWVA 4LWZA 1E0KA 5FBQB 3B1XA 4LBZA 2D2FA 2QBYA 1SKYB 4MKFA 3Q72A 4MRVA 3VKHA 4O3MA 3OAAD 4JSTA 4TMKA 2P3SA 5C46F 2GNOA 2BHRA 4PC6A 2W0SA 5FPSA 5C4MA 3IQWA 1W4RA 2CEAA 4FMDF 5CB8A 2YWHA 2D7DA 3NDBB 5HR5A 2R62A 2ZS9A 3SQWA 1J90A 2P0EA 1QHHA 3QENA 3I72A 4A2QA 3VNVA 1NKTA 2REBA 1YU9A 3M4YA 5DLQC 2BMEA 2OT3B 5FOXA 2RB4A 5LD2B 4TLAA 3BC1A 1YZUA 4E07A 3CRMA 4JLPA 3WMGA 2ZPTX 3AF0A 1FNNA 3W8RA 1LS1A 3L0OA 5IT5A 4OYHA 5KUTA 1A7JA 2FPMA 4E22A 3LFUA 3EPJA 2ZRLA 1GWNA 2IUTA 2VP2A 2C9YA 3KX2A 1KK3A 2PT7A 3CPHA 2PX3A 2V6IA 1I2DA 4Q7MB 1ZD8A 1S1CA 4D26A 1RE0A 3I8XA 4FXPA 5JMTA 2JLZA 3HJNA 4F4IA 4QOSA 3SJAA 1E9CA 1FMJA 2XOKD 3EIEA 1AGRA 2C9CA 3FPAA 3TQCA 2FX3A 3WP1B 2OFOA 5KDDA 5TMPA 2IWHA 3SFZA 5J5CA 1HEIA 4RFVA 2Z6VA 3MCAA 3E2IA 1ZC3A 1YE8A 4GRAA 3KQHA 2CVHA 3K09C 2R6FA 4Q48A 3CO5A 4DLXA 4HAUA 2O8BA 3N70A 3PENA 5FPKA 1TUIA 5KHOC 1ZUHA 1XCMA 1KI1A 2FFQA 4QGGA 3MD0A 5AJZA 5KSPA 3EG5A 5C1BA 5HZKA 3EPLA 1G3UA 2XB4A 4GNKA 3SHFA 1GNRA 4W5WA 3K70B 3U2QA 1NKSA 1H8HD 1E69A 4RD6A 3DHWC 5HKKD 4GBMA 3QF7A 3P20A 1KO7A 4NP6A 5KDLA 1DG3A 4NHOA 1XTQA 1YZLA 2CCGA 1XEXA 3W5IA 3OE7D 4QG7A 3EARA 4QGFA 1D5CA 1X6VA 3IKJA 5FI0B 2FWRA 1AJEA 2GILA 1NMXA 2OFWA 2X19A 3U7EB 3B85A 3LWNA 3WNDA 1E2JA 2P5TB 2C2HA 4NMMA 2C04A 4MYUA 3SE0A 3KKQA 4WXRA 1KYIA 4I1SA 4ZDWA 1PZNA 5KNDA 1TF7A 3PUZA 2DR3A 1E1QD 3LXRA 1QZXA 5FOTA 2Q9AA 5HTKA 3U4QA 1HH4A 1ZINA 1CP2A 1W44A 5FUXA 4EJSC 3QKRA 3VR4A 1WXQA 2FA9A 2ZROA 1EGAA 1GSIA 2IYZA 3C5HA 1E9SA 1E9RA 5TY0A 3K8YA 4FCVA 1TEVA 1GKIA 1W46A 5JLJA 4UNNA 1KJWA 2P6UA 1II8A 4M1SA 5KNBA 4Q4HA 1CJMA 3FVQA 4A0FA 2F1JA 2OV2A 4MQBA 4WAUA 4B71A 4XWKA 2P6NA 3SOPA 2YYZA 2VSFA 4FIDA 4BFZA 3BXZA 4ZCMA 5CDFE 3R20A 3RLFA 1BO6A 4HAVA 3TK1A 4BE7B 4CYMA 4E09A 4ZDKA 4NYIR 1T8TA 3UANA 4A2PA 4CEHA 1OHHD 2FH5B 3KTAA 3L0IB 4P33A 1OSNA 4C2UA 2B6HA 3T5DA 1VHLA 2FDCA 1U8YA 1ZU5A 1N0VC 4US1R 1Z0JA 2HLDA 2RGEA 4TN1A
chains in the Genus database with same CATH superfamily
4CDGA 4EKDA 5U9CA 2WZDA 3RKUA 4O4LF 1H2XA 2PV7A 1CR6A 3DEKA 4HOYA 4E4TA 5A7GA 3ETJA 3ZWQA 1X7XA 4YFYA 5JU6A 5D3MB 9ABPA 1JW9B 3TH5A 2GF9A 3KIPA 3ZCUA 4GXTA 2F4NA 2ZRAA 3K1ZA 5AXAA 2JBAA 3D0QA 5JG7A 4QUDA 3SHVA 1XRQA 1N3IA 2MR5A 5A3VA 4CIWA 2I2DA 1P0QA 5K3SA 5TEWA 3I4CA 4C0KA 3KCNA 1Y4SA 3VTZA 3RYHA 1O03A 5GV8A 4X6XA 4HLDA 1UJ4A 4Y30A 3FCAA 3ER6A 3CIFA 4FMCF 4GT1A 2YOHA 1VBFA 3AF6A 3G0HA 3LCJA 1V6CA 4YB8A 1MBZA 4FR0A 1WBJB 1G8MA 2CLCX 2YX1A 3HYTA 4Z9YA 4A9AA 2ZATA 1ZRHA 4HNGA 3S6JA 3LZDA 4FMPA 4DMMA 2VPXA 5LBIA 4HDRA 4Y1FA 1O95C 4XSHA 4NAHA 4ZDJA 3LUGA 5DP1A 1HDOA 2WWRA 3SJ7A 4U7WA 1W76A 4LHYA 3N87A 4PQEA 5B1DA 4OQYA 2VJQA 5CYGA 4LBVA 2QZPA 2J1LA 4KLNA 1UZNA 5HCNA 2UUPA 1U3DA 5SICE 4BBPA 4LZOA 3GLFB 1U7XA 2XE6A 2DBQA 4GEKA 5D8DA 3DTVB 2BGMA 1EWKA 1KR2A 3DFKA 3LYLA 4BU1A 4AN4A 4TS9A 1SXJC 3AJRA 5DMHA 5EE0A 3H5TA 3VR6H 5KSZA 3QVLA 5GVSA 4OBBA 4RL4A 5HILA 2FCRA 3A0RB 4IZ6A 1W75A 2ZU6A 4H1TA 2H54A 4OJTA 4BRWA 2V1UA 4MW9A 2VJDA 2X22A 4W82A 4DDMA 3VBCA 4MRSA 2P4EA 1SUCA 4HN2A 4EFMA 3EWAA 4PLHA 2C9MA 3I32A 4MVJF 4LJLA 4M7WA 3R09A 3WOVA 4OHYA 1CRPA 2X41A 4AURA 1ZS9A 2GBIA 2YJTD 1J09A 1JI0A 4UU1A 4MLCA 5CT8A 5F52A 1SVLA 3KAJA 4BUZA 3LU1A 3D4OA 3A6KA 4I7EA 1PJZA 2FETA 4QYWA 4UM9D 3EC7A 1ZXXA 4KFTA 1BIFA 1UZLA 3WV4A 3FMFA 4X24A 1XJ5A 4B4KA 5J58A 4EJSB 1UT8A 4XRGA 1ZRSA 3LBYA 3BX1A 4RZXA 3U7HB 1RZRD 4PR3A 5GADl 1USKA 5E3JA 1X1RA 2GEKA 3QXXA 4MCIA 4J4BA 4KJZA 4JVOA 4CMEC 3WLEA 1Y89A 3SXUB 4IJWA 5B58C 3U3JA 1HPLA 1XLUA 2ON6A 2Z2ZA 1O97C 1O0SA 5C1DA 2Q3EA 4UBLA 5KNCD 4DRYA 3T35A 4KVAA 3UHPA 1JE1A 1I80A 2AH5A 1OAOA 2BKXA 1ZVVA 3GRPA 3QWHA 3HXQA 4Y6LA 1ELOA 1SD1A 2PH7A 4V38A 5BWCA 3CR8A 5A5GA 4ER0A 3ZCSA 1D1SA 1MJHA 1SNYA 2YZMA 3MJFA 1L5GB 5JQGB 2QAGC 3EBOA 1CRQA 2J9XB 3TOSA 1S3SA 4MWCA 5JXWA 3EZYA 5ER9A 3GBSA 4JAVC 1W47A 1QCDA 2QUIA 3D8BA 4RAQA 1UJBA 3FCYA 4PAQA 2WDPA 3ZLTA 2Q6OA 5T8KA 4D46A 2DFDA 4IDDA 4PONA 1I3MA 1YA8A 5T4HA 2I8AA 3UTCA 3GEEA 4WX2B 2BFFB 4ZA2A 4IWXA 5FUYA 4TSFD 3EZ7A 3QVGA 1FNMA 2HU7A 4OREX 4C03A 4E2ZA 1FVXA 3PRHA 3RAPR 3AVUA 5G0WA 3M1AA 4C4TA 4DIOA 4JBIA 5EMKA 5FYQA 3AW8A 3B9PA 4J0QA 4B82A 3IA2A 3ZHYA 1H4SA 1PS8A 4HPWA 3UJ7A 3G0OA 3D4NA 4QU0A 2AIRA 2CXTA 3DXZA 4JYZA 5KOHB 1T2VA 4XB2A 2Y92A 1DBQA 2VFAA 4FD3A 4ITRC 4XUDA 3VAAA 4UFPA 5KHLB 4EJFA 3DEYX 3E9ZA 3MAJA 5JPIA 4C2TA 5ECWA 3G2QA 1BGVA 1G2IA 3S7ZA 1Q7CA 4HGZA 2JJ8A 1XZIA 3B6IA 3SXPA 1CR0A 1CY6A 1QS0B 4KK3A 5CLFA 3W5BA 4AYXA 2YYSA 4QLAA 2UYHA 4JYAB 2QL7A 3GA0A 3W78A 5I9LA 3BRWD 4MX8A 3IEUA 3WIEA 2DX7A 5FNZA 1O3YA 4RVHA 1SPBS 3U61B 1RZ3A 2XUFA 4CUZA 1Y1RA 3O4IA 4YJ2F 4NCJA 4RFLA 1UDBA 4OSEA 4IIBA 2UZ0A 4QHYA 2NX2A 4EHNA 2X0FA 5BNIA 2HK8A 1N6HA 1G8GA 5D5PA 4CQLB 1GY8A 4XYEA 1CYEA 3IS3A 1NJFA 3EZ6A 4NYJR 1E2EA 2FFHA 4O02B 2V58A 3TLZA 1XXHB 2ZUTA 1HY3A 1CTQA 1LPPA 3AMVA 4F97A 1J39A 1T2FA 4DIKA 3G7SA 3UHJA 3MUNA 3ND5A 5EHIA 3P0HA 3MLAA 1UBGA 5AJTA 1EK0A 1QF7A 2D3WA 3BL5A 3CRQA 2PJZA 4C06A 4FNOA 3BF8A 4FLMA 4XPIB 4DV3B 4M22A 3VKFA 1QRSA 2EJBA 4V24A 5FQOA 3T1TA 2EHJA 1FB5A 3L8CA 5H81A 4PYRA 2RH5A 1Z2PX 2YC4C 4LTDA 4ZI7F 1JU4A 2Q29A 1Z38A 2RH8A 7GPBA 3KD2A 3QELA 4NVRA 3JQDA 4PSVA 4PWYA 1KAGA 2X4DA 3DV2A 2M9MA 3CCCA 3IAM6 4PN3A 3EIHA 2OV1A 2R84A 3FGOA 3I8SA 3GRFA 3AUXA 4OMDA 3IMFA 4WXPA 4BBAA 5HK8A 3I28A 3LKVA 5C4IA 4Q01A 5EP1A 1CRZA 1LCIA 2PBRA 1L7DA 2I5PO 5DTRA 4D4GA 5LKRA 5AUPB 2VLBA 4KX5A 5DHQA 2WDZA 1H22A 4GOND 1OZFA 2VXCA 3I34X 2ZT7A 4I8DA 3FGNA 3UF0A 1IM5A 1YQTA 1HQDA 1PWEA 4DBVO 4MIKA 2FUG6 2Y1XA 4DLZA 2FSVC 2FVXA 2NSDA 3PXDA 2R85A 1SBZA 3CH7A 3ROFA 3N0VA 1ECBA 5KNBH 1CBUA 4DLLA 1UMCB 1THMA 3JYPA 1WUYA 3AL3A 1M34E 4FCCA 4R3UC 2XQJA 4W9MC 1O5TA 2WFLA 3GLSA 2ZANA 4JB3A 1YFKA 2ZDQA 2OO5A 4GSYA 4YIKA 2Y0DA 1CCWA 5UKDA 1OLUA 4CM7A 1W94A 3W8NA 1IG3A 1YZKA 1DV2A 1BGWA 2NAPA 3BSYA 5JLAA 2BJWA 4L4RA 2QX7A 3OH8A 1JXAA 2QL5A 1YONA 3EBPA 2BHSA 5K8IA 2VDKB 1E5VA 3Q4GA 1OB2A 3F0TA 1L7NA 2GQ0A 2XF8A 1TYEB 4BO8A 4EB3A 4L1KA 1VLLA 1SRRA 1IOZA 3C3JA 4TL9A 4ZOLA 1GPKA 9ATCA 2ZSAA 1G6KA 2ALJA 2EBFX 2JAQA 4RANA 1FRZA 5KWSA 2C96A 5JJCA 1R2QA 4LRXA 1E0JA 3RIHA 1BEUB 4AG5A 1QHNA 1NI3A 3GDOA 4JLAA 4ZEMA 3LUCA 3UK2A 1XTPA 2JJ2D 1KRHA 3CJRA 4F2DA 1TMGE 3HJFA 4DCTA 1BH6A 5L8VA 2R66A 3FI0A 2WWYA 5C8ZA 2YVQA 2WTXA 3NDJA 1JEEA 5EMHA 4FHDA 1PT6A 4WVFA 4N9QA 3KE8A 5EINA 1L6IA 1XJQA 3WWDA 1JVNA 4F11A 2VC2B 3PJEA 5DYTA 2IOFK 4KH0A 3IURA 4HQFA 3AP2A 4FONA 1AQNA 2PE5A 1DG1G 1M2KA 4HH1A 5DM1A 5EE1A 1UKYA 1DAFA 1UANA 1W2GA 1LF5A 5ENVA 3K7EA 4GIBA 1Z6ZA 2RHJA 4FOLA 3KEGA 1ZBDA 2XQGA 1BXKA 1PZEA 3RKRA 4EDHA 5B57C 4QVIA 2PRJA 2WE8A 2QX8A 1E79A 1H4TA 2FFJA 1T9BA 3C4VA 3KDAA 3KSDO 2C78A 3CNHA 6CHYA 4MDFA 4TYYA 1M72A 2C95A 3HGMA 4QAJA 5G1OA 2BELA 1DXYA 3DDWA 4CNQA 4YUAA 1TC1A 3LX5A 4P98A 5CXXA 5JXGA 1MOZA 1P61B 3DULA 2FSHA 4U7FA 1EWYA 3DYVA 4LDNA 3MG9A 5A1JA 3L9WA 3H6HA 1KQ3A 1UZMA 4GGPA 3D7MA 4R9NA 3TBHA 4YV7A 4ZYYA 1EGHA 1BMQA 4PPFA 2O7NA 2PAFA 1R27A 1XF9A 1XR3A 3I6IA 4PVDA 5CM2Z 5CLLA 1DKOA 2A1UB 3TIXB 2PZAA 2WF6A 3IBFA 4BV8A 1LTQA 1Y3CE 5GONA 1JDUA 3NEYA 2TMDA 2IYEA 2PL3A 4YC7A 3UT5A 1QR6A 1NOJA 1PVVA 5CX4A 3O95A 1SQ5A 2MYPA 2A1IA 2HSDA 1R6VA 3E03A 3TIGA 2O59A 1A8IA 5CXSA 5CLQA 4G5GA 4G5SA 1V3VA 1XIVA 3QW2A 3LC7O 2AWNA 4JJFA 5KOJB 2XUKA 3IDAA 4RA9B 2IPMA 2RJ3A 1P74A 2ZT6A 3MYYA 1XRNA 1PQWA 4M1WA 1EZ1A 1QNLA 2IS2A 1FDWA 2Q3HA 3L7DA 1MC1A 2A9QA 2QJFA 1FF9A 4KBFA 4OHFA 4OBEA 3MBKA 4B2LA 3FPFA 3PUIA 4Q39A 3ZZ0A 5DB4A 2GKGA 4NV0A 5L4SA 3HXKA 4NYJQ 3K6RA 5JNVA 2GUWA 4IGKA 5JD4A 5KQSA 1DKNA 3OFSA 4URVR 4TS1A 3AJAA 1YAHA 2JJMA 2NQ2C 1FSSA 2ZYGA 1EXVA 5K4GA 3AUTA 3UGJA 1DAEA 2I3ZA 4DCGA 1NLYA 4R01A 2X8LA 1RQXA 1W1WA 1ZW6A 4HYEA 3CZ4A 2BM0A 3TFQA 3CZPA 4BATA 4DAEA 5TARA 1W25A 2QM0A 4KQXA 3G68A 4NNOA 4V0SA 5FQNA 5AQ1A 4WPGA 1GCAA 2AI2A 3ZDRA 5GZ1A 2LCQA 1QQ7A 3MHPA 4Y2RA 1W0CA 2H4JA 1U7PA 2OHIA 3ND8A 1EGVB 4OYRA 1OI7A 5FF9A 3UWMA 3V9PA 2H92A 2OYCA 4HGPA 2JLCA 4RPGA 4ACBA 1WQ1R 2VHVA 3ZQ4A 3W0LB 1NVAA 2B2XA 2F90A 2PVSA 1K5DA 5THQA 4LCEA 4JL6A 1ACMA 1DU4A 4MQFA 1AA6A 4BGIA 1XN1A 1HE4A 3W5HA 1T5BA 1IOWA 2NTVA 3CGWA 4L74A 5FWXA 3OQNA 4A23A 2CDRA 4AO7A 5LL6P 4KE8A 2HMUA 4H6PA 1RRPA 1H8EA 4D9JA 1RT9A 4ADSG 2C84A 3IQZA 2VUSA 3IEXA 3AEKB 4RW0A 2FR8A 5EP2A 5U4XA 4BEBA 4NCIA 1WETA 1RIFA 1VPEA 4QEKA 2VYCA 3H18A 1Z08A 1UBUS 3QF4A 3U4QB 1MC4A 4PLCA 3KJZA 1B6SA 5U4QA 3UCFA 4MRPA 4TS3A 4MULA 2JGRA 4V0NA 4PICA 4UAJA 1TJYA 1LW6E 4CLXA 1TM1E 2O8CA 5DISB 4JXXA 2I54A 1GRVA 4HC4A 5JADA 4RHEA 2H11A 1R5NA 3P2KA 4N5IX 2HU5A 1YVPA 1RYBA 4WDQA 3B7PA 5IARA 1QP0A 4Q9IA 3T7KA 1FMLA 2R4TA 4ZOAA 1MFPA 2RHMA 4ND8B 3C5CA 1LC3A 1OAOC 1VSTA 2SHKA 5JSYA 3MWGA 5A2GA 4GU5A 3QBTA 2IUSA 2NXWA 2O7SA 1MC5A 1IZ0A 1ZU4A 2F3PA 5JNSA 3NDPA 3ADOA 3MOIA 3CE6A 4M6WB 4YJDA 3OQHA 1C2YA 2HF7A 4J75A 1L7PA 2C2GA 2W6JA 1T3LA 3AGQA 5BSTA 2ZJAA 2QTHA 1QO9A 3U4IA 4Y1GA 3E9DA 4K9PA 4MMXB 4YLEA 3ZQ6A 1R6DA 3L6UA 4XGRA 4D79A 3H19A 5KQGA 1HE2A 1T5LA 5T8KC 3IUEA 3SMQA 2CJFA 3IP7A 5GVRA 1TIBA 3QXHA 1HLFA 3HDYA 1E4EA 4FYWA 1IUKA 3FCCA 4J2HA 4MUKA 2TSYB 4QUJA 4ZWNA 1N4AA 5IXSA 2CHVA 1W581 4TWAA 4D96A 3ZGLA 4M0PA 2IPNA 1TQ4A 3CMMA 4EVRA 3W2EA 2WJAA 2ODQA 2PKRA 1PHPA 1XXHE 2HA3A 3H2HA 4O4HA 1X9GA 4XM2A 3VZRA 3GGCA 2BYTA 4BQQA 3CVXA 2GPJA 4QHTA 1OFVA 1RHUA 1N7IA 2DPGA 2LD4A 3SFTA 1UFKA 1EVQA 3PXBA 3Q87B 2Q21A 4XM1A 3RSFA 3JZAA 4W5JA 1MAHA 1YCFA 3UMBA 3DEZA 2SNIE 3TDMA 2FAXA 1PW5A 1N5IA 3BWYA 4FYKA 3JD0A 1D6NA 4TYQA 1VCIA 4BQEA 2XXJA 5ICSA 2D7JA 3KP1A 1VDMA 3TECE 2X9QA 4XGNA 4DZTA 3JZFA 3SMVA 3CM0A 3E27A 3H1PA 5EEGA 5F5NA 3CBQA 3EF3A 3GYGA 2OHXA 1O94A 3T3OA 4IUDS 4PFSA 1XRLA 5AM5A 4IX1A 2RARA 4ESEA 4GE3A 4NX2A 2V03A 2H0AA 2IHJA 2DFTA 3BFVA 3BIJA 2QRKA 1NPTO 1FTWA 1F2UA 2XUJA 4B34A 4FI3C 2JGEA 2GRJA 4RK4A 3BIFA 1UOPA 4ZGGA 4PG5A 4H08A 3FOWA 2XEDA 1Y0BA 2OZPA 4G9EA 1X1EA 4QNRA 2BZGA 2HSGA 2JHCA 2HX1A 4I08A 1DAIA 4LMPA 3NEPX 1HLDA 2AFIB 2YDYA 3LT5A 5DI3A 3S1AB 2CB9A 1I0ZA 4B2IA 4EW1A 4I19A 2PAAA 3R7WA 2AE2A 5E6RB 2AMVA 3A1VA 2QNIA 3LVRE 4MYHA 3ZDXB 3B38A 1I13A 1PEAA 1IIRA 5JNLA 2OMEA 3W3AA 2GARA 4OHRA 1D2NA 3VR3A 2DQKA 5E4TA 2XWSA 1M8JA 4R8SA 3ESRA 1YDHA 2RGBA 3UMJA 3U17A 4YRZA 2NU6A 2OB1A 1PV4A 3STWA 1N9ZA 2WTMA 3I4LA 3UOAB 5DN6D 5HRCA 4EB6A 4JKYA 5KKCA 4KGVA 1TYDE 5BVGB 2PS1A 1G21A 4AKIA 3C70A 3QSYA 1Q1GA 1QANA 2AG1A 1XCLA 4LC0A 3GZNB 3TLBA 5KVSA 5A5VA 1SXPA 3BULA 1URPA 4IIFA 1XCGB 2J5XA 3O3MB 4OK5A 4QD3A 2QE6A 5H3HA 4X5OA 4PLGA 3V9AA 2DLNA 2W2PA 4U7JA 4IFEA 2V6BA 2XCOA 5CU7A 4PLVA 1ZUD1 1QV6A 1VA4A 1XU9A 1DJPA 3PB3A 1PR4A 4HH4A 1X8LA 4WUVA 1GRCA 1NMZA 3JPYA 1OZ0A 3W6PA 2VZ8A 1J0AA 1WHTA 2A1TS 4WY8A 2OO5C 1GTVA 1P4GA 3EPPA 2E18A 3ZY5A 1IDOA 3M2TA 1TADA 3ICPA 5JYEA 3KJXA 3CZMA 3ZU3A 1A95A 1CJVC 4H6XA 4Q3OA 4ZO8A 1A7AA 2CJWB 3BB1A 3MPOA 3JZDA 3OJEA 4LNUB 5FFMA 2PR7A 3HCWA 4CG1A 3NKFA 5EJMA 1XDBA 2I4IA 3RBXA 1MW9X 4KAJA 4A5SA 2BY4A 2DY0A 3D81A 3FGZA 3KOWA 3HACA 3KZXA 2OGWA 4YEDA 1CDZA 4QPNA 2FOLA 1QKIA 2ZKLA 3DZJA 4PNPA 1VLJA 3GCGA 3KQQA 3GLGA 3IBTA 3QVWA 1TUEA 1Y8ZA 5F76A 1VPVA 1AS3A 1K5HA 3NH6A 3JYLA 1HNZB 1SCAA 1KK2A 2OCLA 2YDXA 2WJJA 2EL9A 1C3VA 1O96A 3LRPA 3OKFA 4WXHA 2QRZA 3T7RA 2I99A 3BMCA 4NONA 3ZBPA 5IVHA 3R0VA 3K4QA 4N82A 4JFAA 3ZXIA 4P7KA 5JS2A 2PS3A 1WCIB 4IHKA 4M54A 3T4XA 2GHTA 5B3LA 1C30A 4JP8A 5DWQA 3I5YA 1EK6A 5I7EA 2ADOA 1NYTA 2ZGVA 5LP6C 4CM4A 1KMHA 4EX7A 3X1KA 4CMAA 1V3TA 2D74A 4OI1A 1AK2A 1Q0HA 1X7GA 3Q5EA 4ZQIA 1EQAA 1A9PA 2IOHA 1DCMA 1E9EA 1E58A 1ZY2A 2HK7A 2WHRA 2XD9A 3NETA 2HHHB 3EEQA 5JC8A 1J23A 3MJRA 1VFPA 2B7CA 1T6ZA 3NORA 4JSRA 1H6CA 2PGXA 3RSLA 1O6ZA 2X15A 3ANXA 3O93A 1U8XX 3JVVA 4FU0A 4P93A 4WN3A 1ODJA 1YVDA 2HV9A 4WV3A 1WB6A 3ZD7A 2R1UA 5AKJA 1CY0A 5B7QA 2HRQA 1JJIA 3EXIB 1BVHA 5HG0A 3KHTA 4OQPA 1JILA 1JRLA 1ZICA 3TTYA 4AP6A 4WMLA 1QO0A 5DM60 4BMPB 4ZYWA 3WWEA 3IAXA 1JHPA 3JAKB 1APBA 4AF6A 4MO2A 1TUBB 2JLQA 1KFCB 1U3VA 2WVAA 5BYKA 4UMVA 4ALNA 3LRXA 1XTKA 2YFQA 3B6ZA 4A8HA 1UZUA 1RAGA 1IN5A 2RHRA 4C07A 3ASZA 1Z7BA 4BV2A 3EFOA 1K7XB 4PU0A 1G19A 5MF6A 2P2NA 1KIMA 4JJIA 1PCXA 4AY4A 2JVKA 1IHOA 4B3IA 1HNWB 2OGZA 5AVOA 5CDGA 5IDXA 4D99A 3SHTA 3MFQA 3WQRA 1M6HA 2PQ6A 2Z5LA 5CB6A 2VCYA 1DELA 1J8QA 1JHMA 2XODA 1U3FA 3SK0A 1NQAO 2KX7A 1ODFA 4YCNA 1XNRB 2QN7A 1VKOA 2QXTA 2WIDA 3MMSA 3ITKA 4E0BA 4ZKDA 2OV8A 3BMNB 3EZ2A 3BICA 3RABA 4L27A 1M2WA 4OHPA 1IYZA 1ZM3A 2ILTA 2ZBUA 3SR4A 3UXYA 1B76A 4UZFA 4LKOA 4X0EA 4AXXA 4EY4A 3LTEA 3HCEA 3G0DA 3ZHUA 3H16A 3CZ5A 1P44A 1ZIPA 2FPIB 1G3QA 5AH0A 3JVUA 2G63A 3HXPA 4H0FA 3QTLA 4XD7D 1VJ5A 3N58A 4I3FA 1V5WA 1DQRA 1NJ8A 1CQJA 4OQLA 3KTOA 4Q03A 3TZHA 3KTDA 4G5HA 2I55A 2BE7A 3DXXA 1NTOA 2DBRA 1SOMA 3IHKA 3VTKA 3TG2A 4M1MA 1RLIA 1ZH0A 2WI8A 5D3KA 3REGA 2QTRA 2QUHA 2WHEA 4B8WA 5JNWA 5CT5A 4I5EA 4DBZA 2ZJZA 4PR0A 1C8VB 1F8GA 4CIVA 2PYDA 1KARA 4R16A 5HFNA 3N59A 4MR7A 3R75A 2WWXA 4ZVTA 1PR3A 2WV9A 3IVCA 4RYLA 1YRWA 2D2VA 4CF5A 3B3QA 2EJUA 2VP3A 2BONA 3KXDA 5JH7B 2FF5A 1U0BB 4FJ0A 2HPZA 3ZZMA 1V16A 3IT1A 4G0QA 4EEZA 4OUDB 4MW2A 3FKQA 4K05A 3LWZA 3MMNA 1IPHA 5C8YB 2VF2A 3SBEA 4OX9B 1IUOA 3IB6A 4PRKA 1Z0DA 3HPQA 3RBZA 2A9KA 1W36B 4C3OB 1O8CA 1ZIXA 4OG2A 4JBWA 1DO0A 4RH3A 1FBTA 1QGYA 4B0PA 3NMUF 5CTAA 3UWPA 3BGOS 1TM3E 2G25A 3EF1A 4K6OA 5IJ0A 2FR8C 5ALZA 4Q37A 1LVUA 1RTKA 3EWNA 3PNLA 4M8LA 3GY0A 4X71A 2OQVA 1IBKB 4YYZA 4NU6A 3R8FA 5EGNA 5TVKA 2QUAA 4XE5A 5A05A 3U26A 3QVSA 4OQXA 2G4CA 5E1BA 3KKPA 1GCIA 1ILWA 4ILEA 4Q19A 3L8YA 3IT3A 4EPWA 4LRTB 2XWPA 2VJCA 1C3EA 3EVGA 3P4XA 4Q4CA 1P81A 5JBNA 5JS6A 3DB2A 2Z8ZA 5DULA 2IEIA 2K5UA 3Q5GA 3UATA 3WYAA 1I1OA 4R8VA 4FNMA 3DVAB 3EZLA 3IALA 4HWOA 3WYCA 3HMQA 4UNIA 5I5EA 2ZYVX 4XX1A 2J5KA 2MOKA 4MV3A 4EHHA 1KMMA 3TNDA 4UTVA 4C2AA 4P92A 3THYA 2G1PA 3SF8B 3OICA 5IF3A 1XWIA 3UY4A 1BA2A 3RBVA 4D44A 2V0CA 3NT2A 3LQ2A 1WRBA 1YQ9A 1CULC 3WHPA 1NOIA 4QAQA 3WFJA 4HCJA 4BNGA 3D0RA 5E1MA 1OU0A 4L07A 4MI6A 3OX4A 1U2SA 2EDAA 1B3BA 4C01A 2YN0A 5DCYA 1Z4NA 3M6MD 5CNMA 3EIFA 1TGVA 1K6EA 3H5WA 3JD2A 4MGHA 4GPD1 3RTGA 1CS0A 5T41A 2B30A 2AFVA 2GZ1A 2CBZA 1HWYA 3B9BA 4XA8A 5EN4A 4KWTA 5DW3A 4V0OA 3QTTA 3OEEA 3CB2A 3N7TA 3QLJA 1YTLA 3HUEA 5DASA 5ESWA 2Y1EA 3C43A 1QRAA 4B7ZA 3G2HA 2AFHB 1CLEA 2WPDD 1KF0A 1V4NA 3OFVA 3M83A 1VL1A 1WXXA 4RXUA 5E4FA 3SR3A 2IIBA 5FOUA 3INNA 4QYSA 1CNEA 1Z13A 1R1DA 1HX7A 1IXSB 2CDCA 3RG2A 4BCBA 5EJ6A 3G59A 1PHRA 3FUUA 2Q8NA 3DWGA 1QHYA 1T43A 2AFIE 2GAAA 2JIMA 2ZI6A 3IUQA 1LA2A 4GBED 2RG1A 4O4LB 4FYMA 2BGKA 1MT0A 3TTXA 2QYSA 4HXEB 3HH8A 2OKCA 3B9RA 3ZOZA 1MVOA 1EVEA 1NI5A 3LDFA 5JECA 5DTIA 1JFLA 3PNBA 2B82A 1A77A 1DEXA 2RK4A 4TL6A 4PYQA 2ZIUB 1CUFA 2OK7A 2NO6A 4QGSA 3QFCA 5L3QA 2PU7A 4F3NA 1JHDA 5TVGA 3GLRA 1EZ4A 2G7ZA 2NNWB 3TX2A 2ORVA 3FSEA 4H4EA 3TM4A 1YSCA 1O94C 3OOSA 4FMCB 3HJCA 2JFFA 1NDUA 1Z4IA 2Q3JA 3PGJA 4BNNA 5L3ZA 2VP6A 1L7VC 1D07A 1PBTA 5FTKA 4ITVA 1PGJA 5LU9A 1XKQA 4H1VA 5AVXA 4MR9A 1BDBA 3ISJA 1XZGA 1Z2NX 1GCOA 4RAOA 5AKXA 1Y9ZA 3RTCA 1IPEA 1DRKA 1U94A 2PGLA 2OXTA 1MT3A 3VNRA 3R7AA 2HO5A 4HAZA 4HV4A 1KXZA 1MA0A 3KBBA 3WO0A 4W9RA 3D1VA 3TLJA 3V2GA 2PPVA 1G17A 1QWSA 3LDUA 2WILA 2NZUG 2C4TA 3SFVA 4D74A 1JEYB 1MNQA 3HA5A 3RC1A 1WPRA 2WJYA 4YWHA 4Z4EA 3RVSA 1AZLA 2W6ZA 3NZEA 1YZGA 5A6SA 1PJ2A 2YMQA 3TQFA 4UCXA 2MMCA 3R0IA 1A5ZA 1DMSA 5K3DA 2F3UA 3JU3A 5DTEA 4H3KB 2VYFA 1ZK4A 4U8GA 1L7XA 4MW6A 1YB5A 4UE6A 1KL7A 2CWWA 2FEKA 5IVKA 4FSHA 2O50A 4RVNA 4TV9F 4OOFA 3H65A 3TQHA 2OQRA 4Q9LA 1U8CB 5TGDA 2IYWA 5TPZA 4HUQA 1H3FA 3BQ9A 3U3DA 2IOFA 3ZHSA 1DQNA 2ACKA 4QVGA 4MB6A 2XRZA 1YQWA 3PSAA 1P18A 4BJ5A 3OKCA 2X5JO 2VOEA 1S2IA 3TW8B 3VPGA 1GLGA 1L4BA 1A88A 4ARAA 4F93B 3MB5A 2ZR0A 3OQIA 2WJGA 5JEDA 3H17A 2LUOA 3AL0C 3B8HA 3GVPA 4ON9A 4KPUB 4E2WA 1LLUA 4C6HA 3K5HA 4QBHA 2HWUA 5IH3A 2F4VB 2FSSA 1HKHA 3LWDA 1MIOB 3OTQA 1PEKE 1BWSA 1TB4A 2VK2A 1BX1A 1IL0A 4KI7A 5ITSA 2I67A 3RVJA 3C8UA 4KR0A 5DI9A 2WRZA 2AZDA 4GP6A 3BHNA 4FX2A 3WWCA 2O2SA 3VYRB 3FPEA 3TL3A 4YRBA 3DMYA 3R6GA 2ONYA 4L4SA 5CGZA 3ZZNA 3THYB 2Q5LA 1GTL1 1E6UA 5H3CA 1J9EA 2YVAA 4KQFA 5I3ZA 4B35A 1QPGA 2AEJA 2GK3A 3R6TA 1O0CA 2R5NA 1LD3A 5M3BA 4I4TF 3K9FC 3BGSA 2C4WA 1QF9A 1YDFA 3V3KA 3LHDA 1EVIA 1IDN1 1ZO8A 3ZH9B 5FFFA 1DX4A 1OX4B 2FE1A 3PVSA 1F20A 1S5PA 4GZ6A 2GZAA 4RD4A 5G0UA 1LPNA 4CM9A 2FXIA 3EXG2 1PF7E 1EMDA 4HQKA 2I29A 1TU3A 4UXIA 2C8JA 3IP1A 5DNWA 4G5FA 1DBSA 2IA5A 3WGIA 1FFXB 1PGQA 5ILQA 3VOTA 4IOLA 2FDRA 3QYJA 3M5WA 4Q9HA 1ZH2A 4JQCA 1PVDA 3FN4A 3H0CA 1JYEA 2CKDA 3PD7A 2FLVA 2F48A 4DYHA 1SXQA 3E5NA 1OXXK 1FQKA 1LV7A 1J1ZA 4L15A 4LV5B 4YR9A 3MTQA 4L4UA 5EWLA 4WCDA 1JIIA 4W5TA 1ZKDA 4FKBA 1RZRA 2Y0BA 4HH0A 2XSZA 3AY6A 1ONPA 2BVNA 3LYUA 2BZ1A 1A27A 1CUDA 4OX9Y 2RH4A 1KVQA 2V7GA 3OO0A 2FW1A 4ZQCB 5JFOA 2X0EA 2WIAA 3ORSA 5AKYA 4Q1CA 3SLRA 3LT2A 4G8BA 1RKBA 1JKJB 2ZTVA 4LFBB 1J0DA 2D0DA 3GPCA 3KKLA 3N2GA 4L8FA 1ONOA 1QVVA 4LEIA 4R9UC 1IPFA 3N0TA 4ZP1A 3OOYA 5EFOA 3MVEA 1KMNA 2H51A 3V1MA 1OV4A 5EJ2A 3E81A 5BWMA 5AVUA 4O2LA 1EXNA 1QGZA 1JB9A 3P97A 4J0HA 2IXDA 1GXSB 2BBTA 4P3PA 4R6WA 3LBNA 2CLFB 1RYNA 3HL0A 1R5JA 4YJFB 3DMPA 3T34A 4PNZA 2NQTA 1FYFA 1VPLA 4XH9B 4GDFA 1X8JA 5JVDF 2Q3DA 2V7UA 1DINA 4MMYB 3V97A 2JGIA 2R87A 1J8VA 2WSIA 4B5LA 5BPHA 2XF2A 1W0KD 5K09A 1DFIA 1QORA 1X92A 4FSDA 3FFWA 5A9RA 4RZIA 5E9AA 5FV4A 2VXOA 2IEBA 4MP6A 1EA5A 3HKDB 3U7QB 5EJ8A 3PC2A 4FIZA 5BVHB 1HETA 1EJ6A 1U0OC 4WBXC 4BX2A 1T9HA 4TLCA 1SD2A 3X44A 1LVHA 5JCPA 2H7VA 3LUJA 1OWMA 2IEYA 5CRIA 3LUDA 4TKUA 2ZS8A 5KVQA 3ZWPA 2HXGA 4B6QA 1QV7A 4FC7A 4RTKA 1G5IA 1RPZA 3R9XA 3ECCA 2GCIA 3FI9A 1XEWX 1QYCA 1XB2A 2HQSA 2C9OA 1QK5A 3E7PA 4G1EB 4ZOCA 3TCNA 2OGTA 1DS6A 4A91A 4ZI7B 4Q6WA 1ZOSA 1QM5A 4MH0R 4TX1A 3FNFA 1NBOA 1P75A 2O2EA 3FAZA 3HB9A 3LXMA 3WA7A 2H0QA 3H9BA 3DUFA 3C7KA 4U9IS 1T9GR 3IPYA 4GKKB 2GEBA 2TMKA 4GWKA 5F51A 2Q5QA 4YXFA 4ZCQA 1SC6A 2B94A 2R6R1 1XQWA 2BR3A 1P3DA 3NAGA 4DARA 1HNNA 3DJYA 3T7JA 1DTWA 3HZRA 2DTXA 4QUBA 1QAOA 2W83A 3G0IA 1ISFA 1R0LA 5BURA 3GGSA 3KBOA 2OCKA 3WGGA 1FP1D 4XD2A 3MWEB 2DU8A 3NYIA 4CKCA 4P3XA 1GA1A 2ZJ5A 1P1HA 1T91A 1R8SA 3ZCPA 3EDOA 1OA0A 1Q0QA 4HTAA 2CE7A 3ENKA 3HV2A 2ORIA 4YROA 1XA0A 4Y67A 2EVWX 3CCBA 4NS1A 4F71A 2GYUA 2Z56A 4GMGA 1XRPA 3L77A 1CIPA 4OGKA 1GPUA 2DPLA 2GNPA 3OLCX 4OH7A 4WBNA 1Y63A 2OYRA 1YA4A 2BMDA 2ZXEA 4YMGA 5CCEA 5EGSA 1DPFA 4RS4A 1D2EA 3FNHA 1IXRC 3IAHA 3N8IA 4MP8A 4DLVA 4MV4A 4X6LA 5LU8A 1SQFA 2I2XB 2PWZA 2RC5A 2NGRA 4NNJA 1YQEA 3UQZA 1XZ8A 4EMTA 4JR1A 1P2DA 2QE7D 1HSZA 2WUWE 3IJPA 3JQBA 1ZMXA 2AG0A 2BHLA 5ESDA 3G2NA 4IEEA 4LTNA 5NLLA 3TINA 3BGWA 4QARA 3D3JA 1XTBA 4NCKA 1WZEA 1N2CE 3FKSD 1UMDB 5BV0A 4S04A 3ZJVA 5KREA 2JLUA 2Z30A 3CNLA 3PQ3A 1G9TA 2AR7A 2Q9CA 4P5PA 4ZI3A 4TUYF 4KSCA 1E61A 2OE2A 3EMDA 3GFGA 1JWLA 1GZSA 5J1TB 1TA4A 2XJ9A 4RGYA 2WJIA 2YRFA 3TZQA 1T0PA 2AUMA 2AFHE 3H4TA 1EK1A 3VOSA 4E5UA 4BDTA 1E64A 1YKGA 1F9EA 3CX7A 3M8KA 3G5AA 4QUHA 4Q4AA 3R3XA 1J2YA 4UW9A 2GJAA 3B2EA 2VAWA 4LISA 4LJ8A 1GA6A 1XMXA 1T0HB 5JMPA 5AW3A 2A3NA 4F86A 3THRA 2VBFA 3LD9A 2FW6A 3CNOA 1JIKA 3EEFA 3H2GA 3O2JA 5AUQA 2C7GA 1NUUA 5BV7A 5AKGA 2BFEB 1W29A 1WVGA 1PQUA 4F45A 3W9YA 1ISGA 4PTLA 2EW2A 3AXTA 2DERA 5B30A 4BNDB 1OBVA 2C97A 2BWJA 2XUPA 1AS2A 1IQUA 1MX1A 4HB3A 2OESA 5FWDA 3ZV4A 3F46A 3KEFA 3LM8A 2YUIA 1FTSA 3CF2A 3KOOA 3WK5A 1UL1X 2CDNA 3NHJA 2C42A 1XO1A 4NENB 4BASA 4FB5A 5DBGA 2VQDA 1QCCA 3KVNA 3TO5A 1X13A 3K2BA 4OEHA 3KR1A 1N0UA 1S2GA 2WYWA 3HBMA 5CA0A 2ERYA 3PKIA 4HGRA 2HBYA 4MJXA 4U2KA 5JR3A 1CJCA 1KK1A 2C5HA 1A9QA 1L3IA 3QV1A 2ID9A 4IVNA 1XPOA 1WKBA 2IZ7A 4IV8A 4BO4A 4Q7JB 2HDNB 4WQMA 4Y2XA 5CB0A 1Z8DA 5SZKB 3VTFA 4U6NA 2QP3A 3A9RA 3T4EA 3LIPA 3N9IA 3S2YA 3PQ4A 3O8OA 1MGOA 2HXSA 1J0EA 2PBLA 4R1OA 4WDRA 3O8LA 5D2CA 4ZPXA 5TEVA 3A6ZA 3AVXA 2YXEA 2JJ2A 2YHIA 2Z58A 3Q7PA 4OM7A 1Z17A 2I33A 3STHA 5HNKA 3RV4A 1HT2E 1I7PA 4Q4JB 1YB2A 5B1SA 4ZJUA 1GQSA 4IOMA 4PC1A 3PE6A 1VYUA 4GQBA 3FCEA 2NIPA 3KVVA 2C4UA 1ZN7A 2JIPA 1LDMA 1SHTX 3ZY6A 1F2TB 1VJDA 2JHGA 1NIPA 2CBXA 2V4ZA 2ZAGA 3K73O 4G8CA 1RYYA 4O2RA 1U5AA 1VL0A 1U0NA 5FOSA 3RYFA