4TLCA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
234
structure length
227
Chain Sequence
HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPGFDLSALIERINYAIQKYRARRVSIDGVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
total genus 79
structure length 227
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tlcA00
1CJUC 1V43A 3PFIA 3GFPA 5DSZA 2JLUA 5C4MA 1RKBA 2E9SA 3P1JA 3NXSA 4D82A 1KGDA 1E2KA 4OHWA 4FD2A 4F91B 3BFXA 4BZPA 5FOVA 2BEJA 2WVJA 4IEEA 4PC1A 5K8LA 3EC1A 3KFXA 3I5YA 1OB5A 3UXMA 3ND9A 4LUCA 3GLIB 1N6NA 4QG7A 2ZRJA 4PC6A 2J59A 3SYNA 2IF2A 1II8B 4PPNA 1KNQA 3LX8A 1E2FA 1TEVA 3TQFA 2FF7A 4B2LA 1OHHD 3I1FA 4TSFA 3ADCA 1FX0B 3EZ2A 1EX7A 4PO9A 2C9YA 4MQBA 2QM8A 4NHOA 5EXTA 1Z3IX 4BFVA 4PQYA 4AG6A 5KUTA 1OYYA 2J0UA 4A15A 2CHQA 1GRNA 2IYLD 4BE7B 3T61A 4ZO4A 2QNRA 5FTJA 1MRNA 2EFCB 3EIHA 4L16A 3QPVA 1WP9A 4IDNA 2YWFA 1U8AA 4Q4HA 2AK2A 4LK2A 1XTIA 2GCOB 1UBEA 3QQ5A 4MRRA 3AP3A 3QKSA 4MYCA 3D31A 4AK9A 4GI7A 4LJ9A 3GJ4A 1XJQA 1EFRD 4OYHA 4YQFA 2IBMA 4DUGA 2QSYA 3KQLA 1J99A 2CVFA 3BB1A 2OSBA 2X2EA 1CP2A 2QT0A 1TADA 4JBWA 2BBWA 3BBPA 2N46A 4YMUA 2IK8A 4D4LA 2Z4SA 4OQXA 1VMAA 5JRJA 4IKEA 1JJ7A 3RVBA 5JRZA 5J40A 2FE4A 2YYZA 2O8EB 2JAQA 2GZHA 1E9EA 4Q1EA 2ZRDA 4LBYA 2QEQA 3I8SA 4JLNA 4IOKA 4M22A 2RKOA 4PQRA 4V0LA 1NLZA 2F3TA 2D2FA 2BJWA 3SR0A 4B35A 1VTKA 5HE9A 3X1ZA 5F9HA 2V6IA 4HSEA 1ANKA 3SQWA 3ADBA 3LWNA 5FI0B 5DHAA 1FL9A 1XTKA 1KKLA 1ELOA 3K70C 3REFA 5HZKA 4NYJR 5G53C 1GUAA 5K8UA 2EFGA 2NGRA 4OJQA 1UBFA 1JR3D 5CLQA 3RS4A 1RVDA 4R2IA 3BFKA 1P3JA 2CCKA 5L3SA 4Q1DA 5DYGA 3LY5A 4B33A 2OZEA 2X2FA 2PT7A 5DIFA 1IN6A 1N6OA 3RNLA 2ZI9A 2J45A 2WSSA 4A0RA 1U0JA 3SFZA 1M2OB 4JLKA 1N25A 3PXGA 2A5YB 3SJCA 2IS1A 3KKOA 3SS8A 3W6PA 4F38A 3EA0A 3VR3A 1U9IA 4IHQA 2PZFA 4C0JA 2BMDA 1GDDA 2ATXA 1JALA 1AIPA 3MGCA 2WOJA 3THOA 1GVNB 1YR7A 1XMSA 2ZSFA 1YZLA 1EFRA 1JI0A 1MO5A 3L0SA 1NVUQ 4IOJA 2WWXA 3W6NA 2QAJA 4LX0A 1VG0B 3VKGA 1IN5A 3CPJB 3K0FB 2RGNA 2C78A 2GVDC 4A8JA 2QY9A 3A4LA 4QBIA 1DO2A 1UF9A 2ZEJA 1VHLA 1YKSA 3IO5A 1HE1C 3EXAA 2IX3A 3GLFA 1OH8A 3V4RA 1NBMD 3SC3A 2AK3A 1KYIA 1NIPA 3BH0A 2Q9AA 3R9XA 2HDNB 1E1RA 1IXRC 3T5GA 3NVAA 1XCMA 5FTLA 1II8A 1P2UA 4AYTA 1Z0KA 3EZ6A 1C4OA 3MWLA 2ZVPX 4G5SA 5E7JA 4K81B 5KYKA 2C9CA 3JVUA 1XXHE 2A2ZA 1Q21A 4LJYA 4TTRA 2W00A 2VP5A 5J4YA 1YZNA 3IUYA 1TU3A 1JECA 3FHCB 4QC2A 5GADl 3Q3JB 1PV4A 1BOFA 4Q7MB 4KV9A 3NDBB 3U61B 1M34E 3QIAA 1MO6A 1TQ4A 3X2SA 2ZANA 2IXEA 1XTQA 1G3MA 3AP1A 3GD7A 2YOFA 5B57C 4BRUA 4E22A 1ZNWA 3WYAA 4TQUS 4C2UA 4PZYA 3PITA 1G9XA 1T3HA 1WA5A 2ZSEA 3O8DA 2DB3A 3LA6A 2ZAOA 2R6GA 1G41A 3F5FA 1Z07A 3EW9A 1OFHA 2H8KA 1L7VC 2YV5A 5AJWA 3BOSA 3D3QA 3SJZA 4ZKDA 1E9FA 2RGBA 5KU1A 3AVOA 3THYB 2GESA 3QXJA 3IBYA 5IHPA 4RD4A 2C9OA 1HV8A 4GOXA 2QZ4A 2F6RA 3B82A 2IW3A 1R2QA 4MUAA 5TV2A 3GLFB 1RRGA 2EWVA 2J3EA 2HXYA 5CJ2A 3GPLA 2A78A 4M1KA 5DH9A 2OXRA 3QEOA 4LHZA 1RFLA 3ZDQA 4DCUA 2FN4A 3CBQA 1S1MA 5LD2B 3J81k 3UATA 1SQ5A 2QTHA 1DAMA 4F4JA 1ZINA 3K0SA 4Q66C 5FBWB 1NY5A 1OFUX 4DT1B 2FFAA 3QXSA 3ZS9A 4DT1A 5GVSA 1IOZA 2VF8A 1TPZA 3TR0A 5FBVB 3C41J 5CLLA 1FUKA 4I1OA 4G1UC 5EXSA 4UXIA 1LNZA 1SVIA 5D3MB 3MJHA 5LDDC 1J2JA 4YXWA 5JZVA 1E0SA 2ZSAA 4IXMA 3VTKA 4DB2A 3WXMA 1KO1A 3EASA 2V54A 2RGGA 1EX6A 1S2MA 3LBIA 2CMKA 3QBVA 1K5DA 3NEJA 2PLFA 2ZYWX 1NN5A 1S8FA 4RCZA 1ZM7A 4M8NE 2ZR0A 3K0AA 2C03A 1CU1A 2H17A 2YKGA 1Z6YA 5FL7D 3M1IA 1J90A 4ZDIA 3EPLA 3WYFA 2WM9B 4MRVA 2V7QD 3BERA 1UKYA 4R7ZA 2QA5A 3FOZA 2BWJA 1W4AA 1GOTA 4NCNA 2ZI5A 1YU9A 5FTMA 4TYQA 3TLXA 4YMWA 4BQSA 4A1FA 2O8CB 2X1VA 4UNNA 3PVSA 1I4LD 1XF9A 5EE3A 4UJ3A 4CEJB 3Q7PA 2ZS7A 2XGJA 4XIGS 2Q21A 2ZS9A 1NRJB 4BUJA 2QAGA 1KTVA 4IEIA 1NVXQ 4Q03A 1IJEA 2HYDA 1E96A 3NG1A 1BIFA 5AJZA 3G82C 1WBBA 2OG2A 2REXB 3ZQJA 1U9IC 2WKQA 1Q1ZA 4MRSA 3EIQA 4N0EA 1HQYE 1KI4A 2QROA 3AQ4A 1M7BA 3EPKA 3W34A 2OXCA 3SHWA 3ZZ0A 2ZROA 2OCYC 4XVUA 2IYRA 1XZPA 3BORA 1SVWA 5CB6A 3KTAB 5C4GB 4AC9A 4EPVA 1L4YA 3E2IA 1TQ6A 5IT5A 2VTKA 1KOFA 4E09A 2XB2A 3Q9LA 4FINA 4G3XA 2RGNC 5FTKA 4XSGA 3T06B 2VHQA 3IPYA 4TMVA 1T8UA 2R8RA 4A82A 2BBOA 1TAGA 2GHIA 1FOEB 1E79A 3HDTA 3KKMA 1XMJA 4C0BA 2EFDB 1NP6A 3RSOA 1Z29A 2B8WA 2R9VA 1MABA 3LBHA 3OEEA 3VNVA 3NKVA 2IYZA 3OIVA 4B47A 4JLMA 1KDPA 2A30A 3ND8A 3CW2A 4PAOA 2W6JD 2QRNA 3VU9A 1E0KA 3B7GA 3TUIC 5AUQA 2JA1A 1P2TA 5FL7A 4B43A 2ZR7A 5CYOA 1F2UA 1F5NA 1VHTA 2GRJA 4EJSC 4RD1A 1NKTA 3I92A 3BH6A 3DKVA 5KHOC 1UJ2A 3OZXA 4UXJA 1W2GA 2G77B 3JZAA 2IYTA 4JKYA 3QEJA 4Q4LA 1VDZA 2ZJYA 4LYAA 5E95A 1Q1BA 1ZCAA 2ZTSA 2ZU0C 4MRNA 4FIDA 1S0UA 5L3QB 3R8FA 2F43A 3KQUA 3F8TA 1T6NA 3UPUA 4XTCS 3MCAA 4QM6A 3QJYA 3TUZC 4DBLC 2J7PD 1UKZA 1DELA 1T91A 1E99A 1YVDA 3IHLA 4Q9LA 3QI2A 4AURA 1GZSA 2QMUA 1R7RA 3CR8A 3N2IA 4GPTA 3ZS8A 5E7MA 3U44A 1KY3A 4HB4A 3WMFA 1ZM2A 4FMDB 4JVSB 4OJKA 2CBZA 2K5UA 1M8PA 2V6JA 4FN5A 2B7BA 4K8OA 3SYLA 3AVVA 2ZRLA 1C1YA 3SHFA 5H70A 2ZAMA 4DSOA 3K1JA 4MH0R 1G8PA 4UQOA 2YWGA 3JZMA 4R9UC 1DADA 3EG5A 2HEIA 1AKYA 2D4HA 2WJVA 2J0QA 3K0CA 1U81A 4B75A 2GCOA 3RS0A 2IHYA 4HDQB 2ZUBA 4B32A 3FMIA 2CE7A 2Z83A 1BYUA 4JS0A 1KI8A 4DIDA 2O8FA 3I4LA 1YZGA 4JLDA 1Z0AA 3VAAA 2MSEB 4LRWA 4ZPXA 3QPUA 1KI3A 4LJ7A 1RRFA 3FMFA 3SBDA 1E32A 1AGRA 2DYKA 2F7SA 2ZJOA 4KI0A 2BHRA 3C8UA 3GLHB 3OESA 5JS7A 4WZ6A 3BD9A 4DIEA 1MT0A 2RHMA 1R8QA 5K8IA 3VR4A 3K8YA 4A36A 3DZDA 4GNKA 1B23P 2IHBA 1ZAKA 5JEEA 1IN4A 2ZITA 4PC2A 4OI0A 3KJHA 5KSZA 3TW8B 3OEHD 1R5OA 2J9RA 3ZGXA 3EIEA 3NIBA 1EFUA 1I4TD 4FCTA 4P3YA 5EXPA 4BASA 4KVAA 2UZ3A 5KOYA 3TRFA 4MDFA 4EKDA 3UWKA 3DPUA 1S1CA 1V5WA 1YZQA 4URWR 1YZKA 3TUJC 3CH5A 2OCAA 4BLRA 2VSXA 1OE0A 3DMNA 1XPRA 4NYJQ 1ODFA 4DDVA 2ZSDA 1HEIA 1ZC4A 3LXXA 4Q1CA 3VMFA 1H8EA 2XTNA 4TWZA 1HE8B 1W5SA 1X1RA 1OIVA 4CYMA 2OEPA 3BFVA 2YOGA 4JLAA 1CJTC 4L9WA 4QNRA 1Q3TA 3IO3A 3KL4A 3OIWA 4YC7A 4HZUA 1WE2A 3LD9A 2GWHA 4H1UA 1G5RA 2WWIA 2J87A 3AGQA 2JIZD 1R5NA 1XEWY 2MMGA 4MKGA 1TF7A 4PO1A 4V0KA 3VR1A 1ONBA 2ZRHA 1ZIOA 3K9HA 2W2VA 1EXMA 4M53A 3HYTA 4DHEA 5TY0A 3CB4A 4WVFA 1NVVQ 3AKDA 2WAXA 2WZQA 2VP0A 3ADKA 3FDIA 4NCIA 2BKUA 3K9NA 1OXUA 3U6BA 1IN8A 3CNLA 3BRWD 3THWB 3M6AA 1E3MA 3R8CA 2PLRA 1GILA 1EESA 5C1BA 1CIPA 1UKEA 4TYPA 4ZI3A 1R8SA 2P5SA 4P0TA 1VG8A 3V9PA 5JJIA 4BFTA 2FWRA 4GT1A 3QE0A 1DG1G 5F3WB 1XCPA 5LD2C 3IEUA 2VSFA 3W3AA 2GBLA 4YXWD 3PENA 1SVOA 1UKVY 3NBFA 5EP3A 3X1XA 1NG9A 3FWYA 3HJNA 1F2TA 1FMLA 1UDWA 4M1WA 4LJ6A 5B58C 4RFVA 4TT3D 1E9SA 2IYYA 2PL3A 3EC2A 2ZRNA 3MWJA 5D3QA 2JLXA 1N0UA 4URUR 4ZCIA 2GDJA 2YC4C 5GJCA 2WJYA 5IDVA 3ADDA 4EDHA 5KNBA 3UIEA 4HAZA 2FFQA 2WIAA 1PLLA 1PVOA 3RRYA 4TQ9A 4X8LA 1KMQA 3K09C 1R5BA 4UKDA 1UDXA 1IONA 2XB4A 4PR0A 4CT4B 5FOSA 2QP4A 2PJRA 2C95A 2DFTA 3Q85A 3O8RA 3LH5A 3ZD6A 4C7OB 4S2EA 1VG1A 4TL9A 1IY0A 1G7CA 1P73A 5KPDA 2ZPTX 1S3GA 2GVZC 4YMSA 1OLOA 1EK0A 2ORWA 2ZI4A 4JSTA 3TK1A 3IDQA 1G21E 4NMMA 1Z0JA 2OBMA 4NYIQ 2KJQA 4GMDA 4GZLA 4N1AA 3AEZA 3BB3A 4A0FA 5CK4A 4MUBA 3TNFA 1AM4D 3T35A 2BMEA 3K0CC 1LF5A 1OIXA 1Z47A 5BW8A 4CGZA 4DZZA 1XFAA 2PMDA 1CXZA 5EUQB 3R7WA 5E3HA 1TU4A 5KNDA 4WOPA 4CEJA 5DGXA 1GL9B 1VYUA 4D25A 1VKJA 4C0HA 3FYHA 4HLCA 1AS3A 1GNRA 1FP6A 1W5TA 2XEXA 4EPYA 3U5ZB 3HU3A 2ZQ5A 3UG6A 4TMZA 2DBYA 4NH0A 2O8EA 3U3JA 1N6HA 1II0A 1KDRA 3T15A 1YHNA 3LW8A 3QG5A 3WY9A 5CYPA 1GRRA 4QNMA 5GJWC 3RABA 1T4GA 5FUXA 3KFVA 5FPKA 3TIFA 3U60B 3GP8A 1WDTA 4HUQA 5BYJA 4PHFA 3M0EA 4FMCF 3KX2A 1E1RD 3ZD7A 1JEEA 1YE8A 3D7MA 2QRZA 3T1OA 2ZRMA 3K0FA 4TLBA 4A8JB 1NF3A 1Y3AA 3H1TA 3KUDA 1Z63A 2O8BA 4DKXA 2XITA 3CF2A 4G01B 3VU9B 3HPQA 2PMKA 5BN5A 4X8OA 3OHMA 1T5LA 4LZZA 3OFNA 3VHXA 1MABB 1X8JA 1Z0DA 3FVQA 4M1YA 2O5VA 2WMOB 3U3RA 1N6IA 4B3FX 1E0AA 4RFSB 2IYQA 4YMTA 3K9LA 3WMEA 2FNAA 1NI3A 3LBNA 4D4JA 4IDQA 2IUSA 1N5IA 1W49A 2FFHA 4BFUA 4LBWA 4LV6A 4MGYR 4GFDA 5ANRB 1GL7A 4HYYA 4ABYA 3PUVA 1Z08A 1HYQA 1JNYA 1VCIA 1XPOA 2HF8A 1QG2A 2LKCA 2D7DA 3THYA 2YC2C 1TNDA 4BLQA 3B2EA 4OBEA 3NH6A 3TSOA 2GZDA 3MJRA 2QSZA 3SN6A 2FGJA 1QVRA 3IIKA 1P6XA 4RSGA 5F2EA 1ZD8A 1KMHA 3GLIA 1KY2A 3A1SA 3KQHA 4RZ3A 5J4LA 3ZVLA 2W83A 1KK3A 4G5GA 2JJ1D 1E98A 2ZS8A 1KI2A 3THXB 2JATA 2ONJA 3F3YA 3IILA 1QDEA 3ASZA 4IRUB 2QM7A 3BB4A 3EZ7A 3HP1A 1VCNA 1Q12A 3CF0A 4MA4A 2JLYA 1Z0FA 1RRCA 2J41A 1YR6A 4C3ZA 1WF3A 3RDPA 2IEYA 3WHLA 2W58A 4I1UA 3LVQE 4TMXA 4R98A 3DOFA 2VRWA 2CJWA 3HU1A 2QBYA 2WWGA 4V0OA 1CULC 1NN3A 2XSZA 2FX3A 4Q4JA 3Q8XB 5TDHA 2OE2A 2QMEA 3QNUA 1IN7A 2PH1A 1KMHB 4A92A 4B74A 3ZQ6A 5AUOB 3G0HA 1RE0A 2ASEA 4LC0A 1EFCA 2CLSA 3Q5DA 3SFVA 1ZNXA 2A5DA 3KZ1E 4RD2A 4V0NA 4A2QA 3KQKA 1DO0A 2B21A 1G7RA 2AFIE 4M9QA 3P26A 3RRMA 2VP4A 2N1BA 1TUEA 3IHWA 4NCKA 4JMPA 3DO6A 4TSFD 5KPJA 1Z6AA 5DLQC 4LGMA 3QKRA 2I4IA 4CEHB 1NVWQ 2ECKA 1AQYA 2GXSA 2OBNA 4C0AC 3U3KA 1XMIA 2Z4RA 5EE9A 221PA 3UMRA 1MV5A 1ZBDA 1FNMA 2Q9CA 2WWFA 3GEHA 4N0DA 5KTYA 2GF0A 4I1VA 2VP9A 1OH6A 1NLFA 2DWQA 4G0NA 3K70D 1ZUHA 1KK1A 1DG3A 3KUCA 3RC3A 5EQTA 4BRWA 1PUJA 3FMPB 4LV5B 3HPRA 4PTLA 4Q21A 1JR3E 1SKYE 5E7IA 4NCJA 3SDZA 2JLQA 1FZQA 1FP7A 4A2PA 4Q1FA 2QMHA 2D7CA 3UMFA 4IDPA 4BPBA 4MKFA 4UJ5A 3P20A 2IWHA 1E9RA 1ZYUA 1AZSC 1OKKA 4C2TA 1N5JA 4PHHA 2JDID 1DAIA 4US2R 1NLYA 2C98A 3RRNA 2O0JA 1ZMXA 5JI2E 1HT1E 5DN6D 2WSSD 1IAQA 2VF7A 1SVSA 3PIRA 4NYIR 3TGPA 1RC8A 3AF4A 4E03A 2EYUA 3WNDA 4XD7A 1Q3HA 2O8DA 4Y0VA 2IA5A 3QXCA 1KKMA 4TTQA 5DISB 4KFUA 4JVNA 4TL7A 4TMWA 5JWOA 4I81A 4ZDWA 5KSOA 1KI9A 5CITA 2WKRA 3LLMA 3LQRA 4HB3A 1N3BA 1YRBA 2FV8A 3T12A 4G5RA 2BVNA 4RJLA 2GXUA 1MRSA 4E07A 3PEVA 2RGCA 1KJZA 5JFGA 3CRRA 2NO9A 4IOMA 1CR1A 1ZJ6A 1X3SA 4KCGA 3VR6A 3SE0A 3D8BA 3QF4A 4HLQB 3B9QA 2NO6A 2FZ4A 3A8TA 4EAQA 1T0JB 4NL4H 2FPMA 1N6RA 2PX0A 3B85A 4KU4A 5AWFC 1W0KA 3IKJA 5DI3B 5EZ5A 5J5CA 4TLCA 3VX3A 1W36C 4G5OA 2DPXA 2WIBA 3WYGA 3AF1A 3AUYA 2JASA 1U99A 3DMDA 2FEOA 2QN6A 1XPUA 4L15A 4TMTA 1RYHA 3CLVA 2GJKA 2Q0HA 2CLCX 1QBKC 1QG4A 2GNOA 1XNJA 2AXNA 1NSFA 4AI6A 1R0YA 1NNEA 2J0VA 3IQXA 1VYVA 4M1TA 1G20E 2P5TB 4FCVA 4QBHA 1R0XA 5CDFA 5CM8B 1XP8A 4Q4AB 4EQ6B 1DBSA 4W5WA 4A6XA 2KB0A 2NOAA 5IF9A 1FTNA 2A3RA 2XOKD 1F2TB 4Z8YA 3WNCA 1GFIA 2CNWA 1E9BA 3QENA 4LPKA 2E1RA 1XJCA 1YJ5A 3CKLA 4DLSA 3C16C 4Q48A 4GSYA 1FQJA 3B1VA 3F0TA 4B2PA 3QSYA 2VEDA 4A8JC 5JCPA 4Q00A 1LF0A 1VCMA 3PUZA 2NO1A 3CZPA 1HURA 2V8OA 3CRVA 2I3BA 1KI1A 1ZD1A 3AKCA 2F3RA 4ILEA 2ZUCA 4OI2A 5AK0A 2F9MA 3KDSE 3RS5A 3CH4B 4PSVA 2E87A 1QF9A 1JPJA 1WRBA 2IYSA 2HLDA 5LB2A 4IVRA 3FTQA 4PPQA 2Y8EA 3BGWA 1N2CE 4OI4A 1E9DA 1S96A 2D3WA 3CF6R 1DARA 3W8RA 4PANA 1T3SA 1X8LA 2IYWA 2IYUA 3CRMA 4WAUA 5DNYB 1KIMA 5JHGB 2HCBA 3U7EB 1Q44A 4NBSA 2DFKB 3JVVA 1HUQA 5FL3A 1MH1A 2XJ4A 2O8DB 4NYMR 2HJVA 1ZC3A 1HH4A 2GAAA 2JJ1A 3ETLA 4DC9A 2RMKA 2F1RA 3FFBA 2OLKA 4AG5A 1OF1A 1YQTA 2GK7A 1GNPA 3AVWA 5EXXA 4C7OA 2RGXA 3NHAA 5G41A 1FMJA 3VR2A 2IUTA 5EE1A 1CBUA 1PLJA 3IGFA 4NYMQ 3AVUA 4A4DA 2BDTA 1TQ2A 4LJ8A 1E1QA 1E2NA 2VHTA 3TMKA 1D9XA 2CL0X 4BLOA 3LNCA 3A1WA 2ZR9A 1A1VA 1NN1A 2G0TA 2EW1A 1L8QA 2XOKA 4NDZA 1I2MA 3D6TB 4DRZA 2C04A 2AXPA 1ESNA 1S4QA 5D3MA 1TMKA 1T5IA 4IFEA 4Q4AA 2PEZA 1XXHB 2P3SA 4LJ5A 3GLHA 4FCWA 3SNHA 4LYHA 5AJXA 3PG5A 3NC0C 2OM2A 1U2RA 1Z6XA 1JAIA 3OAAD 2ZRCA 3EPHA 2H1LA 4PQFA 3CNOA 3I32A 3MAAC 3U3MA 3TAUA 4DLVA 3GLGB 1Z2CA 1ZU5A 4MKIA 2HCJB 4UNSA 2DY1A 2FEMA 2ZRKA 5FBRB 4AYXA 4LHWA 2P6RA 3BAFA 2DR3A 4YONB 2ZM5A 1G6OA 3C14C 1DAKA 1SKQA 1HTWA 2CHVA 1A82A 2A9KA 2YZ2A 1P61B 3GJ3A 5LB4A 3BJIC 4RD0A 2F55A 4PX9A 1P7CA 5EP4A 2O0KA 3HYRA 3ZLJA 2PZGA 3DDCA 3DZ8A 2VYFA 4YDSA 5JBQA 3KQNA 5HPYB 1A7JA 1DS6A 4JT4A 1NN0A 2FA9A 1QHHB 1W1WA 2RHDA 2ANCA 3ZZUA 4ZI2A 3L2OB 4A0HA 3GJ8A 3N5CA 4HB2A 1O3YA 4MDEA 5KDLA 2L0XA 5SZJA 1D9ZA 4I4LA 4C0SA 2R44A 2REBA 2JJ8A 3SBEA 4MKHA 1WXQA 3DVLA 3M4YA 4KBGA 1QVAA 2CDNA 2C2HA 4NPHA 3U7GA 3QUSA 2ATVA 1VIAA 3GEEA 3THXA 4D26A 1QHXA 4TTPA 2WPDA 1G18A 3QPWA 3A58B 4XWOA 1E4VA 1H8HA 4KVGA 4QGGA 3G5UA 3KXKA 4TQAA 4DJTA 1LY1A 2BCGY 1N6PA 3B1ZA 2BEKA 3I8XA 1G3IA 2QTFA 1P9RA 4TLDA 4MGZR 1GITA 2Q9BA 1WCV1 3NDPA 4M1MA 3QOFA 4X8HA 3MD0A 4IVPA 3MFYA 2GTPA 3KJGA 1E79D 1ZUNB 3P4XA 1TEXA 1U8YA 2VA8A 5B30A 2GAOA 1G8FA 4NCHA 1JPNA 5DE3A 4D0LB 4HUTA 3AKYA 2CEAA 2Q3HA 2H5EA 1G17A 2AKAB 4XWAA 2D62A 4Q7LA 1KZGB 4Q9HA 5EUMA 4DDUA 3PV0A 5BWMA 4JJZA 1DTSA 4MITA 3ZVRA 2GCPA 2PCJA 5KO2A 1C9KA 2GETA 2VO1A 2XJ9A 4HLDA 4ZKEA 4JBYA 1CJKC 3OIUA 4M1SA 4D0GA 1IHUA 1MR3F 1KSHA 1KO5A 1VYTA 4R71A 4LOAA 2QMOA 2VPPA 1G6HA 1JAHA 1LV7A 5KSYA 4Q18A 4KFSA 1M74A 4OQFA 3RYTC 2VBCA 2CVHA 2IS4A 2IS6A 1Z83A 4KFTA 2J7PA 1YRAA 4BFWA 3PQCA 4BLTA 1RJ9A 3P32A 1TUIA 1VECA 4NONA 3V4FA 5EP2A 2IS2A 1B0UA 1ZIPA 2JJ2A 4ARZA 4TMKA 1PUIA 2FZLA 3H84A 2HF9A 2C8VA 5FUYA 2ZUDA 4KLNA 1HY3A 2FJUA 5AJVB 1ESMA 3GJ5A 4PSKA 3AF3A 3ZIAA 4CW7A 3C4JA 1JB1A 3ONWA 3BXZA 5JJKA 4OHZA 2JCSA 4TZ0A 4P4UA 3RWMB 2PCLA 4FMCB 2BKEA 4QJ5A 4JYCA 2WPDD 3AH8A 3KXIA 4JBXA 2UVQA 3IEVA 2HYIC 3BS4A 1H8HD 4EJSA 1G7SA 4TZ6A 2OAQ1 4B2IA 2B6HA 4YMVA 4JL6A 3PR1A 2GJSA 1DAEA 1W2HA 1KSFX 1CJVC 2XNSA 2WAYA 4MYHA 2HLDD 3MSXA 1OH7A 4PZZA 2DCUA 4H1VA 3KKPA 2BMFA 2FG5A 2WJGA 4NE2A 5KSPA 2V4ZA 1M6NA 1CRPA 2G6BA 1BH2A 1R0WA 2ODNA 4XTRA 4BGDA 1IXSB 3BE4A 1LW7A 4OHVA 5G3ZA 1W36D 1UBGA 4NP6A 2WSMA 4PPGA 3L0PA 4EFLA 2R6AA 4JIMA 3L82B 1OYWA 3FKSD 4RFSA 3KKNA 3ZJYA 1G8YA 1AS2A 2BM1A 1QRAA 4TL6A 1G1MA 1P60A 2HV8A 4JVMA 1X8KA 821PA 5C46F 3AKEA 3K70B 3OFND 4KJZA 4P31A 3LAWA 4AIIA 3C7KA 4TYYA 1G4AE 3TQCA 4US1R 4Z54A 2HXSA 2OLJA 3OE7A 1IQPA 1EWRA 2NQ2C 2X8AA 5DI3A 4YDHB 5GJBA 4JL5A 1F3OA 3T1VA 1CTQA 2P6UA 3VNUA 5EP1A 1Q22A 1XU4A 2J7KA 2XNDD 3GJXC 1EGAA 1NBMA 2VQSA 3A1VA 3FKQA 1CJMA 4U00A 2GEDA 3CO5A 5FPHA 5JHHB 3FKSA 1FW6A 3AUXA 5FOXA 3SEAA 3TSZA 4P4TA 4CEIA 2YWHA 4WXPA 4CVNA 5L8VA 1Z6TA 1NJFA 2A5JA 2EFHB 2BC9A 2ODBA 1XJ0A 2KSQA 2YNMA 2CJWB 3U7HB 4DLZA 2QBYB 4QHTA 4LCBA 3CRW1 4DCNA 1W0JD 4F4IA 4WZBE 4ACBA 2Q3MA 3T5DA 4DLYA 1AK2A 1KO7A 1RZ3A 2B92A 2G88A 2WJJA 3AVQA 3FB4A 3FHOA 4Z8XA 1W47A 5HKKA 3A4NA 6Q21A 3HU2A 1GSIA 4QGAA 3RS2A 1DVRA 2BCJQ 4IFBA 3KKQA 1K8RA 4AWXA 4PC7A 3VHLB 2W6ID 2RGDA 1TTTA 2G0NA 2ONKA 1RJ9B 3I73A 2OCBA 3BK7A 3H2YA 3KXLA 5HCIA 3TAHA 2IYVA 1Z6GA 4IW3B 3N2EA 5TVKA 1FPMA 3NWJA 1IM2A 1P9WA 4N3NA 4AY2A 4HAYA 3I72A 1MOZA 2D2EA 4IOLA 2FSHA 2EU8A 4WXRA 2QQEA 5H1YA 3CUEF 2CK3A 1DE0A 3FFAA 3X1DA 4BFXA 2OUKA 2FSIA 5AR1A 3GLHE 3W8NA 2QENA 5JI3E 4Q9KA 1Q1EA 1OIWA 5JWHA 4DSUA 3B78A 2XZPA 1KO4A 4M4SA 1E2JA 2GJ9A 4OHYA 4J0QA 3IQWA 3AVYA 2AD1A 1EG7A 1N5KA 4B3GA 1OFIA 1Q0UA 2GBLC 4TLEA 2WWHA 4QL3A 2MSDB 2FPLA 2YJTD 2OFOA 4JL8A 621PA 3P4YA 4C4PA 4E5UA 2AD5A 4O3MA 5JSZB 2ZJZA 3EPJA 1E2HA 3QXXA 2FU5C 4CDGA 1H65A 1NJGA 4PAMA 3ICQB 3KB2A 5J4VA 2ZJAA 1XD2A 4QOSA 5EE5B 3CIOA 4CF7A 4CRWB 4OK5A 2J1LA 3LX5A 3RANA 4RCYA 1E2PA 1XTSA 3PEWA 1ZP6A 2AWNA 4O0MA 3CZQA 2Q6TA 1QHGA 3W9YA 4MYUA 4CZ2A 4L4UA 3TKLA 2PZEA 3I5XA 2QAGC 4EJSB 2ZYTX 4LHVA 1MO4A 1XEWX 4W7SA 1E9AA 1J8YF 1S9DA 2BOVA 3CRQA 1Q20A 2DFLA 4ESHA 3MMPA 2A5FA 721PA 4LHYA 5JEDA 3EAQA 4HATA 2ZRAA 4NU0A 1SVLA 3GJ7A 2DHRA 4L8GA 2ZE8A 3VX4A 2ZSBA 3U44B 3OIYA 3EARA 1AA9A 1IY1A 5CK5A 5JLJA 2F1JA 5FUVA 4Q01A 2PT5A 4W9MC 4IJMA 3B13B 2GK6A 5FPTA 1ZRHA 4M21A 2HT6A 1A5TA 1RW4A 2ZREA 1DAGA 1M1YE 2QL6A 1HQCA 1R4AA 1ZM4A 1T8TA 3UWOA 1BYIA 2A5GA 3V00A 4D4KA 1N6KA 2GILA 1NIJA 1XD8A 1ZU4A 1N0VC 4FMBB 2Z43A 5JJLA 4F7WA 1CLUA 3I62A 2ZYVX 1QHYA 2B7CA 3CR7A 1E2DA 1OB2A 1XEXB 4LYFA 1FUUA 2C5LA 1GAJA 4D81A 4JLJA 2ZVQX 1XWIA 1IY2A 2N42A 3WRXC 3W3ZB 1GIAA 1XB2A 2RCNA 3OF5A 3W5IA 3CONA 3AP2A 4KODA 2QTVB 3QXHA 4KHZA 1XD9A 5F9FA 4DLTA 3E70C 1FX0A 4OI1A 1UAAA 4KBFA 2EVWX 1SXJA 2ZJ2A 2JJ2D 5CDFE 1LVGA 2JLSA 4ASUA 3MUFA 5DN6A 2OCPA 2ODEA 3FE2A 1AGPA 2QE7A 4AYWA 5CM9C 4EPWA 8OHMA 5LBIA 4JLVA 1Y63A 4ERNA 1G3UA 4LBVA 1N5LA 4HAUA 2V1XA 4DCSA 2KWIA 5M04A 1ZCBA 3ICEA 1D6JA 3KTAA 2MMCA 1GWNA 2WICA 1SZPA 3RAPR 1OXVA 2G9NA 4URXR 4BZXA 3OAAA 4DB4A 1JXOA 2JIZA 4PHTA 4RY2A 1ZD9A 1A2BA 1IBRA 4HZUB 1HT2E 2B8TA 2EYQA 2EWWA 3AF0A 5TMPA 2BBTA 3T1TA 1BKDR 2GCNA 2QU8A 2QAGB 4PXAA 1M7GA 5FH9A 1CR2A 3B8HA 1VIYA 2NIPA 1KJYA 1OXTA 2QE7D 3I3SR 2GJAA 521PA 2OT3B 2WWWA 1GTVA 3GFTA 2R6DA 3GMTA 4QHYA 4V03A 4M0LA 1YR8A 4EPXA 4PPFA 1OH5A 3DHWC 1FTSA 1RYFA 1W48A 2F43B 1P2SA 1OW3B 1UPTA 3TVTA 4QBGB 3WP0A 1EFTA 5KNCA 3U4QA 3QKSB 1X1SA 1W4BA 4OL0A 2GEUA 1QHNA 3EWSA 5FR2A 2JLZA 5JCZA 1XD2B 4K46A 4X8MA 1F2UB 2BBSA 3RC8A 1Z5ZA 2J5XA 1P62B 3EZFA 2YHSA 1R0ZA 5BYKA 1SXJB 2JLRA 3KB1A 1OT3A 4ASUD 4ZIRA 2P67A 4FI3C 2AFHE 4DDWA 1KDTA 3PUYA 4U7DA 3ZVNA 1E6CA 1SGWA 4NKRA 1G5PA 2R65A 1G19A 5LPNA 4B34A 3C5CA 3NC1C 1LFDB 2MSCB 4JJKA 4MRPA 3X1YA 3IIJA 3S1AA 3KJEA 1KDOA 4JT2A 3PUXA 3VFDA 1E2MA 2GKSA 4P4SB 4QGHA 2KBEA 1NMXA 3K9GA 4TN1A 4R2HA 3AVPA 5DI9A 2ZU6A 3RSLA 2D06A 4II7A 3W90A 4DCVA 3RS3A 1GKYA 3CX7A 4TYWA 2KBFA 2OBLA 5SZIA 2EQBA 1WQ1R 1KJWA 1R6BX 3AB3A 4GBMA 3FMOB 3CWQA 3ZIAD 3U7FB 2W6IA 3QF4B 1J7KA 2R2AA 3LO5A 5SZHB 3B5JA 4B3DA 3NBZC 1SXJC 2DFNA 2ZJ5A 1GKIA 1A2KC 1GRQA 3TSWA 1WB9A 3B1XA 5EZ6B 3KJIA 4UXHA 4ZCMA 3A6PC 1KAOA 2O52A 5HTKA 1Q57A 3AVTA 1II9A 2FFBA 1Z22A 1QZXA 2H92A 1EFHA 4M9ZA 1RPZA 5H8WA 1BMFA 5CIQA 2ZI6A 1D8TA 4KO8A 4PC3A 2ZJ8A 1W46A 1KI7A 2Z0MA 2XXAB 2G1KA 4G5QA 3L0OA 2DWOA 1S3SA 1T9HA 1US8A 1NMYA 5G40A 2FOLA 1U0HC 4LWZA 2FMXA 5J4KA 3K09A 3U2QA 1E2LA 1JQJC 1QHIA 5E4FA 4EUNA 5L3QA 2WJHA 1J8MF 3R20A 4I99A 2V7QA 1W0KD 2NO7A 4QGFA 3W5JA 3AV0B 3Q72A 2NZ8A 4NZYA 1GKUB 2QT1A 3BWDD 5J4HA 1LS6A 1G64A 1KAGA 4C0LA 1D2MA 3O47A 4LY6A 3ZVMA 1UADA 4URVR 3LV8A 4P32A 1P4SA 4PFSA 4OK3A 1XTRA 2NPIA 1NG1A 4IVQA 4WIAA 1E94E 1NBME 3ZYCA 1ZW6A 4MGKR 3E5HA 5JSZA 4FWIB 4JKIA 1OPXA 3GCGA 1W7AA 3TH5A 1TL7C 3EX7C 3TE6A 1KO8A 4BWYA 2W2XA 4ESVA 3LVRE 1OKKD 1IXZA 2AKYA 1PJRA 2QGZA 1G5TA 1XBTA 3DKPA 4EQ6A 1XRJA 5G3YA 1I4DD 5UKDA 1D5CA 2AN9A 1BO6A 2Q3FA 5CB8A 4IDHA 1OXXK 4XD7D 5FTNA 4XSHA 3L8ZA 3MWYW 1VPLA 3IBGA 4DLUA 2WTUA 5B64A 2IYXA 5TARA 4D6PA 3ZZTA 5JWRA 1BS1A 4JYBA 3HR7A 2O8BB 1X6VA 2GA8A 3DM5A 4DUGD 4AKHA 3I61A 1ZNZA 1COWD 3GLFE 4YLGA 1N6LA 3W6OA 1JXMA 3AM1A 2F1IA 4M2LA 1G16A 1NL3A 2IEZA 2V55B 3LRPA 4HUQB 1UEIA 4F4CA 5FUWA 5B2ZA 1UBCA 3LLUA 2WHXA 3CX8A 3SOPA 3B1YA 2RB4A 2C96A 4Q4JB 4A6PA 3L43A 2OO7A 2BMJA 4POAA 4H9GA 3TJZA 5BN3A 1LS1A 4C30A 3UG7A 1GG2A 2QGNA 2QP9X 3SI7A 4LJAA 4LV8B 1E0JA 5P21A 5HKKD 3C15C 3LXRA 5FI1B 3C5HA 2H57A 3MWKA 4QJ3A 2XTZA 5FPSA 2O8CA 1LB1B 4RKFA 1AN0A 5EJEA 2OAP1 1FQKA 1TQDA 5FBLB 2VL7A 2FPKA 4O2LA 1I2DA 4QHSA 4DLWA 5GVRA 2BV3A 5A4JA 2ORIA 4BFZA 1O87A 2ZI7A 5HZHA 2VHJA 4FXPA 4GZMA 1WBDA 2YWEA 3GJ0A 2CNWD 3K0AB 4XOIA 3QKTA 4LDJA 1F48A 2FGKA 2C99A 4OQNA 2GXAA 4KAXA 2ERXA 4KFRA 4DSNA 4AKGA 1KNXA 1L2TA 2EFEB 2QUZA 1D2EA 2G1JA 2ZRGA 1AQUA 4HB0A 1DEKA 5HE8A 2REOA 2GXQA 4KLZA 5FR1A 2PX3A 1N0WA 121PA 1T0HB 2Z5FA 1K5GA 3QBTA 4TYNA 3GQBA 4LI0A 3TR5A 1U98A 4KSBA 3NHBA 1S9HA 5DYIA 2QPOA 2FSGA 2ZIAA 4L9SA 1NSTA 2F9LA 4BLPA 3A1TA 3NBYC 2VP6A 2PBRA 4Q7JB 3WMGA 4MGIR 2X19A 2CHGA 4LC1A 1G4UR 5JECA 4HLUA 3QKRB 5TXGA 3TW4A 4Q19A 3N70A 2ZETA 1CR4A 4ZDKA 2AR7A 4ZDJA 4L5BA 4ACAA 1ZVQA 3TVDA 3T34A 2CK3D 4QM7A 2JDIA 4XH9B 3OE7D 1L4UA 5L3SB 2AL7A 1PLKA 4JVLA 1E1QD 1KK2A 2ZRPA 4RKEA 1P5ZB 4FW9A 3A4MA 4IXNA 3ASYA 4DVGA 4BLSA 2V9PA 2I1QA 1JEDA 5AJYA 4M9XA 3LFUA 3U3OA 4B48A 2TMKA 5FOTA 2J46A 3FHTA 4LBZA 3UKDA 1MO3A 3NBXX 4A2WA 4U5XA 4B76A 2BM0A 2XZLA 3PEYA 3B9PA 5C18A 1CR0A 1CRQA 1NMZA 4U02A 421PA 2OILA 2XTMA 3EZ9A 1KZ7B 2IWRA 4B3CA 2CL6X 1K6MA 4UNPA 3Q7QA 4P33A 5DO9A 4ZV4A 2HUPA 3RS7A 2XXAA 1DAHA 4QXAA 2GJ8A 1W0JA 3R7WB 2X77A 2XX3A 4FWTA 2YINC 5C2JB 1E9CA 3BC1A 2QI9C 4KYUA 5EE0A 1E2EA 1W44A 3FGNA 2F1HA 2IXGA 2NO0A 3H0KA 1QHHA 3GFOA 4S35A 3U6KA 1R10A 4GRAA 3P27A 1W36B 4CEIB 2LKDA 1FNNA 4WW0A 2AWOA 2WKPA 4BFYA 3QKUA 2G83A 1NVVR 4RZUA 2ZRFA 3WBKA 3QF7A 4Q47A 2A7QA 4LHXA 5IRCD 1ZM9A 3DM9B 4WA7A 3VKHA 3CWZA 4DCTA 1X86B 2VH5R 4DLRA 4RZ2A 1OV4A 2ZE6A 2AHOA 4ITRC 1E4YA 3MG9A 5GJVC 4Q4HB 2GZAA 4HEJA 3SJAA 4XVQA 2CLDX 2FSFA 1GP2A 5CJPA 4BECA 2ZRIA 3GLGA 3QVUA 2P2LA 1E2IA 1P2VA 4Q1AA 2G3YA 4JLOA 3S1AB 3L8YA 4LYJA 1UFQA 2XNDA 1OJLA 3SJBA 1YZUA 5HCNA 1SULA 4HAXA 4B3XA 3IPXA 2WV9A 2BIFA 4EPTA 2XSZD 4B71A 4NTZA 3A37A 4W5HA 4AD8A 2VP2A 1HA3A 2PEYA 5DHFA 2D74A 4OK6A 1OHHA 2ANBA 4HZIA 1MKYA 4OHXA 5ELXA 1KHTA 1P72A 4QRHA 4XVRA 4EFMA 4HI0E 3A1UA 1OFTA 1W4CA 3OEED 2W6JA 2NTYC 1AS0A 4C9BA 4LSGA 4PAQA 4QFMA 4BEBA 4DWJA 2IUUA 2VIIA 2HT1A 4D4MA 4B6EA 2CCJA 3SYKA 2CL7X 4F92B 4GOJA 2WBLC 4Q7KA 2PJZA 3O8BA 3VKWA 3LQQA 4EFNA 1E2GA 1NY6A 4JSYA 1SXJD 3R9IA 1OSNA 3PUWA 3A36A 1YZTA 1AKEA 3R9WA 4RVCA 2JLVA 2WMNB 3L0IB 3LW7A 4Q9IA 4Y0AA 4B6FA 4JLPA 4QBFA 1DOAA 4B73A 2KE5A 2NG1A 3WHKA 2ORVA 2QG6A 4M1OA 3HWSA 4AKEA 2P0EA 1U8ZA 3GLIE 3IIMA 3NH9A 4LJ4A 1G8HA 3CPHA 4BEJA 2JGNA 2VLIA 4ARZB 3AGPA 1CS4C 3GEIA 3Q5EA 1P75A 5FOWA 5IK2A 1UEJA 2W0SA 2VHUA 2ZE7A 1ETUA 4UNRA 4HLUC 2ZXUA 1ZUIA 4FMDF 5CIWA 5JS8A 2H18A 2WOOA 2IL1A 1RIFA 1W4RA 3X1WA 1SVMA 5L3VA 1Z0IA 4DEYA 3BH7A 2XAUA 2RAPA 3EA5A 1CF4A 4C0QC 3MRSA 4Q9JA 2R6FA 3RHFA 3UANA 5H68A 2OFWA 2ZRBA 5BQ5A 4UNQA 1SVKA 2CE2X 1JJVA 5FOUA 3SZRA 2P6NA 4KITB 2QORA 5TB5A 3O8CA 3K53A 1WMSA 3B6EA 2J0UB 1CKEA 1G8GA 4Q02A 1AZTA 4WBSA 1XXHA 2ZJBA 2BJVA 3DOEA 4XJXA 3TBKA 4RZXA 3NEYA 4Z1MD 4F93B 5K8TA 3QVVA 4GP7A 3CNNA 1XEXA 4DLXA 1YR9A 4A0GA 1H8ED 2CCGA 1U90A 3RLFA 4CIDA 3T1QA 2V1UA 4ZCLA 3GLGE 1QHSA 4JZKA 2UKDA 3PEUA 4B3BA 5FFMA 3THWA 2UZIR 2ZE5A 3CX6A 4B44A 5KDDA 4M9SA 4I1SA 5SZKB 2YOHA 4HAVA 1G7TA 2GEVA 1XEFA 4W5JA 2R62A 3OEHA 5BXQC 1JR6A 1US8B 3UMSA 1KSGA 1FFHA 2OFXA 3PCRB 1G291 4JLBA 4RD6A 2JEOA 1SHZA 4TL8A 3UK6A 5F98A 2RGEA 1OXSC 1ZNYA 3RWOA 4EPRA 4D80A 2ERYA 4A9AA 1JR3A 3SU8A 1Z2AA 2KI5A 4AKIA 3H86A 1LTQA 4V0MA 4GDFA 3ECCA 2RGAA 4URYR 3MLEA 2W0MA 1XTJA 2C77A 5AUNB 2AX4A 2Z6VA 1KI6B 3AVXA 2IXFA 1Q1QA 1D2NA 1P9NA 2NPFA 1G3RA 4ON9A 3BIFA 4WZAE 1T3LA 5L3RA 2IT1A 4OQLA 3WP1B 4OQMA 1VG9B 4D0NA 4O25A 1CEEA 2GF9A 3EWAA 4DDTA 3CM0A 4QKQA 4PZLA 2QPAA 4TT3A 1TF2A 4US0R 1U94A 3SQXA 2DWPA 3DL0A 4CT5A 1SXJE 2IF0A 1XCGB 1Z8FA 3VQTA 1IJFA 1NKSA 3B1WA 2NZJA 2XZOA 1M7HA 1XDBA 4MYTA 4IDOA 2OESA 2QP3A 5FPYA 4HDCA 4P4SA 4LPSA 1F6BA 1G3QA 2ZI3A 3CPEA 1RRPA 4V02A 2FH5B 2SHKA 2WJIA 4BZQA 4PHGA 1E2QA 1SHKA 1XMVA 1DPFA 1KK0A 2VHCA 2RH5A 2JLWA 4DXAA 3QG1A 5J47A 1J70A 1KSJA 4GOKA 5A5GA 4KYIB 2FDCA 2J0SA 1PZNA 2P65A 3FPAA 4DSTA 1TX4B 3K0EA 4RD3A 2QPTA 3VR5A 4ZIRB 2H16A 2OHFA 1ZM3A 1XZQA 3QY0A 5HR5A 4V0ME 5FBQB 1VCOA 1GNQA 5IK2D 4URZR 5A0FA 5AUPB 4CEHA 2O8FB 1BMFD 2CXXA 2OV2A 1Z28A 2V3CC 2R6CA 3E1SA 4KXFB 1GM5A 4Z1MA 4HDOB 3WBJA 1A4RA 3GJ6A 2YVUA 2NMVA 4O2RA 1UM8A 2IC5A 3U4QB 3PJRA 4PSAA 1JBKA 4PO8A 2HJGA 1AJEA 3H4MA 4BFSA 4OKSA 4GP6A 4DEXA 2VSOA 1E69A 4Q5IA 4EIWA 3B60A 3AF2A 3HR8A 1EWQA 3ZH9B 1XX6A 1F60A 4HAWA 3WNBA 5JMTA 5KDOA 2W2TA 1KI6A 1TF5A 2LCFA 1GL6A 1U0LA 4GL2A 2I1VB 3LDAA 4GMXA 1Z06A 2LWIA 4TLAA 3DEFA 5BN4A 3RRZA 3NTUA 1DAFA 4XWKA 3WRYC 1SKYB 4QJ4A 4Q1BA 4Z51A 3REGA 2QQ0A 2WWYA 1COWA 2ZYUX 4C0KA 2H7VA 4D2IA 2ODWA 1JQLB 4KSCA 2O0HA
chains in the Genus database with same CATH superfamily
3KPYA 1CJUC 1N57A 1H2FA 2RG7A 3VR4D 2O05A 4BPRA 5DSZA 5A4DA 2JLUA 2QRLA 2L17A 3QLVC 2E9SA 4D82A 2OXIA 3IH5A 1KGDA 3ZW9A 5JU6A 2C92A 4OHWA 2GD6A 3RBXA 4R3UC 4EG8A 4F91B 3BFXA 3FLMA 5FOVA 2B30A 3CLRC 4IEEA 3SEZA 1D3AA 3EC1A 4H7EA 4PIPA 2YIDA 1EXVA 5JNVA 3SDSA 3WIBA 3GLIB 3P5BA 4PC6A 2QTTA 1SIWA 2JIBA 3SYNA 5IBQA 1ENYA 5CXSA 3E3NA 4ID9A 1WZIA 3ROPA 1R0SA 3IKMB 1HKUA 2DE0X 4U0KA 1M72A 3DAHA 2FF7A 1KRXA 2W4MA 1XOIA 2NVWA 4AUNA 3B89A 1HETA 1S8OA 3EDCA 4FC7A 3R3JA 4ZANA 2E48A 2BSQA 1PIWA 3SLKA 3SC2A 2ACVA 1EAMA 3EZ2A 3NIDB 4G5HA 4MQBA 4A6EA 2QM8A 4YRGA 1EUQA 1CZKA 1ULHA 1W9MA 1SC1A 3GG9A 4CJXA 1D0SA 3AERA 4A26A 2QYOA 5DBHX 1FDUA 1KPGA 2XE4A 1LRJA 1NNI1 3GF4A 3T61A 2HSEA 1LPMA 3T7DA 3R0IA 4ZO4A 1Y1QA 1T35A 2QNRA 1U3VA 3W1EA 3UB3A 4RK1A 4MWTA 1DCTA 4WKPA 2VPZA 4W1RA 1WP9A 1QQTA 2IV3A 4Q9AA 5BVHA 5L6MB 3KB8A 3WL4A 4BQPA 4AMBA 2XCRB 3GFFA 2GCOB 4QUGA 3QQ5A 4MRRA 4MYCA 1FVHA 3T9FA 1ZIXA 3W9SA 1KZYC 3WZMA 4AK9A 5EJ5A 2X4DA 2IELA 4GI7A 1KS2A 4C7XA 4DJEC 1XJQA 4EM6A 4ZHSA 2ZWMA 5B37A 1EFRD 4AJKA 5CEJA 5KIAA 4W5TA 4AJPA 1OLSB 2X2EA 1U2PA 1TADA 1RQXA 3DQPA 3LHIA 2IK8A 4R5MA 3V7WA 2G9ZA 1L6IA 3LDFA 3RVBA 5JRZA 3E7DA 5DMXA 5IASA 3U9SA 1BDMA 3RUAA 3WRWA 3W7AA 3X43A 1GN9A 3BZWA 5IN5A 1T2FA 3ELDA 1K5PA 3CNEA 2BHTA 2PWYA 3UJAA 3PFNA 5IZCC 4KGVA 1YMQA 4JI1B 4YIHA 3A05A 2ADFA 5I7RA 1RJEA 3FYUA 5LA6A 3TSCA 5HKAA 1L9XA 3B3JA 4IOKA 5BMVB 2O5CA 2OAEA 4M22A 4PQRA 4ZO8A 1O0SA 2WJ4A 3DUFA 4IIJB 4XB2A 5BR4A 4B35A 4NJMA 5HHTA 4RDIA 1RKXA 2RJ3A 5DSXA 5EZYB 2V6IA 5IXJA 5F9HA 4R9VA 5C7LO 3LC1O 3HXQA 4HSEA 3VO9A 2YFKA 3N7AA 3LBFA 1NPTO 4QARA 4F9TA 5LLTA 2P3QA 1S5PA 3LWNA 5FI0B 3ADBA 1AO3A 3JD4A 2FF5A 1HQKA 2QL9A 1U5BB 3HZRA 1PT7A 3ESAA 3RQSA 4CBVA 3EVGA 3SXPA 5HZKA 1GUAA 2EQ5A 2A0XA 2GFHA 3FPGA 4G07A 1GV0A 5GGYA 5T5QA 3LVFO 4ME6A 1JR3D 3HLKA 5ER9A 4BYGA 1W6UA 3E82A 3GRVA 5L3SA 6AT1A 1NR7A 4X97A 4J29A 3GA0A 3FPCA 1IN6A 1QYCA 1R64A 2I03A 4IHJA 1ACJA 2O2SA 3WL3A 2TRSB 2ZI9A 4G97A 2WSSA 5KX5A 1TECE 1U0JA 1M2OB 2BSAA 2YYAA 2SKDA 1YQDA 2NZYA 3M5DA 4KKVA 3VOSA 1QB7A 3MOIA 3SJCA 5JY6A 1V8OA 1U8UA 3KE8A 2JCBA 4UVIA 2CSXA 4P1ZA 1FZTA 4EWLA 3FSGA 4IHQA 4JJAA 3V3TA 3QITA 1IULA 2ATXA 5EFZA 4UE3S 4W6QA 3KJFA 3AEUA 4U2DA 3THOA 1Z8HA 3OBBA 1Q0PA 2Q1YA 2Y2VA 4J6FA 1EM6A 4RPGA 1TYEB 2PGAA 4ZC8A 4WLOA 4R83A 2UDPA 2OCGA 3TLCA 1EFRA 1JI0A 1MO5A 3L0SA 3TZKA 4X5OA 5EIXA 4OV6B 3BE6A 3CRNA 2ATEA 2P91A 4N7BA 5REQB 1LX7A 2A67A 3ZE1B 4D9HA 2BFCB 3BGOS 3LQ2A 1VQ1A 4I19A 3EMVA 4A8JA 3WB2A 1Y5RA 1QCCA 2GVDC 1NYLA 2RGNA 3FWZA 3D3WA 2I4NA 3CZ4A 1S3FA 1UF9A 3JQ8A 3NAQA 4NSNA 3EXAA 4DPMA 5DN9A 5FLXA 4KYTA 2OCKA 3SC3A 3LS2A 4YWJA 3CYFA 1KYIA 1YIDA 2CHEA 2Q9AA 2Z2YA 1VHDA 3LK7A 3WGJA 3WYEA 3R9XA 3PJEA 4B87A 3T5GA 3NVAA 2AJBA 2E82A 2CVZA 5HS4A 1II8A 2V5UA 1N9ZA 2C7PA 3EZ6A 3U4AA 3IVXA 1JILA 4C43A 4BTEA 3A9UA 1M8FA 2AG0A 1DEXA 4BKPA 4FGZA 5KYKA 1QFMA 2A92A 3HGTA 1B3RA 3SEFA 1V9LA 4FNAA 4X9XA 2A84A 4Y6LA 4IJ5A 3EFHA 2WP0A 5J4YA 2F8MA 5G0VA 2HK9A 3M49A 1TU3A 3FHCB 1AHHA 3G5AA 3U1TA 6LDHA 3HB7A 3IHKA 4LVOA 5KVVA 1RRKA 1GPUA 3Q3JB 3FOFC 4TXMA 3NDBB 3BHIA 5AVQA 1M34E 3TQIA 2YYSA 3JWIA 4I5GA 3UJ6A 7MDHA 4NCAA 2ZANA 4PS1A 5IH3A 5DB4A 4MP6A 4XGRA 3RHTA 3O03A 2MSNA 4ZVMA 4E22A 4LZPA 5JS2A 4TQUS 1DX9A 3LTNC 3BEDA 5SYMA 2WYWA 3HVUA 2GLXA 3O8DA 2RH9B 2DB3A 3LA6A 4R1PA 1NMEA 1SIBE 3CUSA 1G41A 4KVZA 4BNMA 2AT1A 1U3UA 3F5FA 4R1SA 3EW9A 4S04A 1E18A 3SJZA 1AKTA 3BOSA 1Z38A 1RYBA 3AVOA 2AOUA 3T5AA 2GESA 3ZHRA 1ECFA 1UPFA 1PR3A 1V8DA 3IBYA 4H7DA 1AG9A 3EEFA 4NBWA 3JQ8B 2B82A 2ODPA 2NVUA 4GOLD 3USES 2HXYA 4E6PA 2PLWA 3JQEA 3M6UA 4M1KA 1Q7GA 2XTJA 5DH9A 1RFLA 3ZXSA 4DCUA 3GVIA 5JNSA 2FR0A 1U2SA 3HB5X 1Z0UA 5H5JA 4HMPA 1G21B 3BRSA 3Q1KA 4G0WA 5FBWB 3RYCA 1N32B 3V6MA 2R00C 3LP8A 3OOHA 2FFAA 3QXSA 1W5FA 3AZOA 3M7IA 4OH7A 3JR7A 4LY9A 3NETA 4F2HA 4MAMA 3EGOA 2HA7A 4OUDB 1MFZA 3TB4A 2F48A 1I3KA 3DZIA 1JQEA 1O96A 2I66A 3SEQA 1SFRA 4YFVA 4NOKA 4RGQA 4EENA 2IEDA 1D7OA 2A33A 2BI8A 2D1SA 2R5NA 3KV3O 4G1UC 5EXSA 3MJHA 4CCYB 1LDGA 1YJQA 1WY7A 3CB2A 5JZVA 3W8EA 3AR8A 2ZSAA 4IXMA 1GYRA 1KA9H 1V35A 4TVOA 5CAEB 4ALMA 4EEXA 4DB2A 4IZIA 3CQ9A 4V3CA 3GG2A 3JQFC 4H7HA 2HX1A 2ONZA 5BVGB 2GPWA 3NEJA 2PLFA 3U4IA 4WZAA 4OXKA 1P80A 1NN5A 2NTNA 3N0WA 4RCZA 5TEWA 3BXHA 4DMCA 1L4KA 1JTVA 1IOVA 2YZMA 4QTUB 4ZDIA 2EF0A 2WM9B 3BMQB 4JHXA 2HM7A 3CCCA 1ECCA 1XQXA 5E7QA 2GKOA 2WM3A 1SRQA 1U1FA 1M1YB 3WSTA 3ZCVA 4HP8A 4YMWA 4DQXA 3CF4A 2O8CB 5ILGA 2CFTA 4O8ZA 5BUSA 1XF9A 2X2PA 4CEJB 2QWXA 2VH2A 2ZS7A 3WC4A 2Q21A 1NRJB 3O94A 1JJBA 3OIFA 1KTVA 1IJEA 2HYDA 1WZEA 1R12A 1YZVA 3OI7A 4X24A 2OGWA 3H7IA 4CL2A 2PANA 2REXB 2JAXA 2XDQA 3SVTA 2CLOB 1RM5A 4KH1A 1NSYA 4B3IA 2G08A 5IKMA 4NK4A 4EVRA 5LQUA 1A9TA 1KI4A 4ALJA 4QPPA 1IZ0A 1C9YA 3W34A 5JXJA 3ZZ0A 1W59A 1M5TA 4G9BA 3DDSA 2ZROA 2OCYC 4KNYA 2IYRA 3FPEA 1DC6A 3NC4A 2P6PA 3ELUA 5CDYA 1ONOA 4AC9A 2P79A 2Q5OA 2PL1A 3DAOA 1P18A 2X9GA 5IT5A 4LZJA 2XB2A 4FINA 1IQRA 1YCFA 1NR5A 2V7GA 3GYGA 1AKQA 1J2TA 1RHKA 2QRQA 3IPYA 4HH1A 1T8UA 2P8JA 4L0DA 1LJLA 4KDEA 1JNXX 1O9GA 1G2PA 2FRDA 3K8QA 5ALKA 1T0IA 3OX1A 5ECDA 1WX1A 3HDTA 1XMJA 3M82A 1L5VA 3RSOA 4MVJG 2R9VA 5IUNC 2JFWA 2HRBA 3OEEA 1HKHA 1ZGJA 2XUFA 5GM1A 5U4QA 3OIVA 4ED9A 1OBFO 1NOKA 1JG4A 4QULA 3ND8A 3G85A 2QLTA 4PU0A 2W6JD 2QRNA 2GEFA 3WGTA 3X2EA 5C51B 4O8CA 1CDOA 1MIOA 3B7GA 1PG0A 3MTIA 2H9YA 1IEQA 2AG5A 4NL4H 3SSAA 1TYZA 1UK8A 2Q2VA 3OHPA 3VMMA 1JVBA 2IH2A 2AE1A 4K86A 3BH6A 3GBSA 3GUHA 4Z3DA 3OT1A 1AV6A 1VE7A 3OZXA 1W2GA 3BWVA 3JZAA 1SRRA 4P36A 4JKYA 2EW2A 1NP7A 1AUXA 5K3AA 2R5WA 4JEIA 4YJFB 1TIKA 1BVUA 3L79A 2ECQA 3ZX4A 4EI8A 2XZLA 4EG0A 4ZCTA 4FIDA 3AEKA 3A11A 1S0UA 2PRSA 3QE9Y 3R8FA 3V33A 2F43A 3PEYA 1T6NA 5EZYA 1IVSA 1O1YA 4XTCS 3T4EA 2RGRA 4YQEA 3E7PA 5CU7A 3TUZC 3TXXA 3W3AD 3ET4A 4DBLC 4M0FA 1UKZA 1DELA 1Z4PX 1DIOB 1M1ZA 1ZJZA 1E99A 3KKKA 5BMVA 2VK1A 1BS9A 1ULAA 3CR8A 2XUIA 1IAVA 1WCYA 4MVJI 1XV5A 3F6PA 1RWMA 3OFJA 3FWHA 3ZJUA 1KU0A 5DHQA 3UF0A 1UPCA 5F1KA 3VU0A 4LFBB 4F56A 3HJCA 2I87A 2J33A 1GVHA 2XDAA 4FN5A 5EIAA 5K7SA 1O54A 1BSVA 2RG1A 3BWCA 3KWJA 4J0KA 3QMPA 1QMPA 3PYLA 1RYDA 3ZNPA 4DSOA 4FE7A 3AI1A 4F96A 1J0DA 2C8LA 2JIQA 2UXBB 1HK7A 2H1RA 3JZMA 1UBHS 4OFWA 4DADA 1SBYA 3RFTA 2Q2WA 5K6RA 4HDMA 2D4HA 3MAGA 4NC9A 2GYYA 2UVDA 1Z18A 1MB3A 1IOLA 2WJVA 3HB0A 2KS6A 1CDDA 3AY7A 3KK0A 4KNWA 4Z2YA 3OJFA 3KSRA 3ILSA 3RS0A 4BBPA 1Y3IA 2IHYA 4EI9A 2JAOA 4L8LA 3F7NA 3IUPA 5DM1A 4IVNA 3RT1A 1M6EX 1AMOA 4OXXA 1BYUA 4DIDA 5K2MA 2OG1A 2H5LA 3I4LA 4MJ3A 5ADWA 4JLDA 3VAAA 5HVNA 1NF9A 1E8MA 2MSEB 4ZPXA 2GX6A 3FMFA 4R1MA 5IJZA 3PRYA 2F7SA 3CLKA 5KQSA 3I2KA 1FFCA 5LDGA 4OMCA 4JASB 2DETA 5IS2A 1FUIA 1M0EA 3KAPA 5JG7A 1ZWKA 1IVNA 3OESA 4WZ6A 3BD9A 1YVUA 1DCKA 1LH0A 3FUVA 4AQ7A 1IL0A 2BLLA 2XR1A 5DTJA 4GNKA 4XLZA 1L5HA 2W6PA 1PG5A 3OPXA 1THTA 3ZWCA 4NPAA 5TGDA 3GH3A 3BHNA 4U1RA 4YBRA 2JLCA 2BFAA 2HRRA 4P3OA 1KDVA 3ZGXA 2YXNA 1EFUA 3NIBA 4FCTA 3GZJA 2UZ3A 5CPBA 2X6RA 3MBOA 1MX3A 1AXGA 2J5BA 2YMQA 3F5DA 4K3VA 3TRFA 2CSUA 1I3CA 2B0JA 1KR2A 1V5WA 1CUXA 3LY9A 4KL8S 1USVA 4U7TB 3LUBA 1YZKA 4MPTA 2AQ8A 3CH5A 4K28A 2Y99A 4MWSA 1BN7A 5AXBA 4G09A 4Z4FA 3E7FA 1OE0A 3JQGB 4BQNA 1A2QA 2G40A 2C61A 4NYJQ 4PX5A 5IH7A 3M34A 3T5TA 4K9QA 5IZ4A 4KTVE 2QMZA 4MV0A 1QRSA 1KFBB 4HQOA 4OLHA 5F35A 2XTNA 3HKBB 3GB9A 1WVMA 4MVYA 5DOZA 4BUZA 4DA9A 4D9IA 4GXNA 5BYAA 4G5YA 1W5SA 1X1RA 2FP4A 1OIVA 2HRCA 3EUWA 4XCQA 4AMYA 3IP6A 4WTOA 3BFVA 3QYPA 4JLAA 3ZKAA 2DPLA 4LKOA 1G8KA 1TGYA 4RSMA 3JU3A 4L9WA 4LRTB 3IO3A 4K9NA 1DBWA 2WJPA 2XCQA 4ZMBA 5JAZA 4HZUA 3ZCTA 2V97A 3LD9A 5ALXA 1RAFA 4E31A 1M9NA 1ZOOA 3WWOA 5BUCA 2WWIA 1ISRA 2JIZD 3PUKA 1R5NA 2C2OA 1XEWY 2IOQA 2J3JA 2MMGA 3KHTA 1LLFA 2ES4A 3IFSA 1ONBA 3FVVA 3WQQA 5TQ2A 4M53A 1EXMA 1YZ3A 3LQ1A 3H0CA 3HYTA 1B74A 3CB4A 4GKKB 1NVVQ 1A9YA 4A7PA 3FDIA 1BXKA 4S2UA 3AEKB 1NWCA 1O5OA 1OBHA 2AG1A 1Z7YA 4QRIA 4F9EA 1NX9A 3U6BA 5GONF 3M6AA 1V25A 3G1TA 1GU7A 2VJNA 2RJOA 1GILA 4K3UA 3UB2A 4TS3A 1F0KA 5KYVA 1UKEA 2I8LA 4TYPA 3TRJA 4P0TA 1KQ3A 3UAYA 5HQ3A 4GT1A 3LDHA 1DG1G 4XVHA 5A3JA 1N2OA 1UMBA 3DTYA 3H3JA 2G4LA 3FYSA 3QX8A 1QPGA 1AK9A 2VSFA 3BHJA 5F3WB 4YXWD 3PENA 1SVOA 3DXZA 2FX5A 5KVQA 2EP8A 4CLRA 2Y9PB 3LBYA 5JARA 3JQQA 1QF6A 3FWYA 5K5EA 1XRQA 4IIEA 3GWGA 3ZLVA 4RFVA 2AJLI 4FEAA 4TT3D 1XZNA 1Y1RA 5LR6A 2GYVA 4CG2A 4MI9A 4Z4HA 5DYTA 5LXTB 1T5DX 3DE7X 4ZCIA 4YK7A 2GDJA 2YC4C 4MPRA 4JLSA 1VE1A 3QX9A 5IDVA 3SZGA 4D1YA 3RUEA 4EDHA 2Q6OA 5B6JA 3VGJA 2FFQA 4C21A 3K71B 2F3SA 1ISJA 5AKGA 3X3HA 2DEUA 1PVOA 4JI6B 3D54D 1RJWA 1YJCA 1KMQA 3K09C 1IONA 4K1XA 4PR0A 1PR2A 2PR7A 3OTQA 2CYBA 1DJMA 5J1SB 3MF4A 1NT2A 3Q2IA 1C1DB 2H3EA 4TL9A 5KPDA 2CV1A 5G0SA 1WV1A 1C2TA 2Q6IA 4GYJA 1WOYA 2G9VA 4GMKA 4MUJA 4YIKA 2ORWA 1N8TA 1R3DA 4JSTA 5I4KA 3F4LA 1ARZA 4RMIA 4U7JA 4M1EA 1J0BA 1Z0JA 3LT4A 4DVGA 2E5FA 4NYIQ 2F17A 4TTTS 4GZLA 5AW4A 3AEZA 2OZKA 3VZDA 2VC2B 5DWQA 2LR0A 3FI0A 3T35A 1PEYA 3A1DA 1FDWA 1GDHA 3DGFC 2ORED 1IPHA 1UMDA 3L18A 4G67A 3WAGA 3Q87B 4DZZA 2X0RA 5LZ9A 3I3OA 1Y5IA 1BFUA 1R15A 1NPDA 3EAFA 3GWZA 3M6MD 2J9GA 3L1UA 4X60A 4YCDA 4L50A 4BGVA 2FQ1A 4O0LA 4CEJA 1SB9A 1NTRA 4UPVA 4WOPA 5DGXA 1UDBA 5DZSA 4LOIA 3TD2A 1GL9B 3NM4A 1CE8B 3Q3VA 5J3JA 2FVYA 3NTQA 1VKJA 1SQSA 4EARA 3FYHA 3E7XA 1W5TA 2OGSA 3O4FA 2DPGA 2XZDA 3OKCA 2A0UA 2H1IA 5BWOA 4N7JA 4UE2A 5JQGF 2WB2A 4NH0A 2O8EA 5SICE 2A3NA 3PTLA 2OHJA 3VSBA 3UOGA 3ORFA 3QU5A 4PZ0A 3LW8A 2DY0A 1L5QA 1G0OA 3RABA 4L22A 1E60A 5DM0A 3UUFA 2VCEA 3JQCA 2EEPA 2Z04A 3ECAA 3IPLA 4GH5A 3PR3A 4HUQA 5FPKA 3FOWA 5BYJA 3WIDA 2C5FA 5IVDA 3GP8A 3V8RA 1B2LA 1J2EA 3SIPA 4YAGA 4EF4A 3WG9A 1UC8A 1YE8A 3D7MA 1JG2A 5FJIA 3SPXA 3STWA 1UP7A 1NF3A 1Q7RA 3H1TA 3KUDA 4NV3A 4AT1A 2O8BA 4P4LA 3CF2A 1K6XA 4KOEC 1PN3A 2FRVA 3HPQA 1XR3A 1VMDA 3ZV7A 1GPKA 1H93A 1X3LA 3NJ4A 5JCOC 4X8OA 4EYGA 3OHMA 4LZZA 4RSHA 3I23A 3L1VA 3OFNA 4MVJF 1CZOA 1Z0DA 5G53C 4QOEA 1TRHA 2AFHB 1GZHB 2O6LA 3BGDA 3NAZA 4M1YA 5D01A 2TYSB 5E38A 3U3RA 1E8NA 4KN6A 3C7CB 4L7QA 2VF5X 5FNZA 1DSSG 1E0AA 3TN7A 1N1MA 4P3XA 3K9LA 1JEJA 1A9XB 2GDZA 1I01A 5KOJA 4D9BA 5AQ1A 2FMFA 4JXZA 1W49A 4BFUA 4YMGA 2R1ZA 2X9LA 4LBWA 4MOWA 4LV6A 3E53A 4R8KA 4U0JA 1GL7A 4PNHA 5L7YA 3D81A 3PUVA 1JNYA 2YVLA 1AY0A 4CIXA 2HI0A 2Z1NA 2EBUA 3ABSB 1CNMA 2LKCA 1MA3A 1EUDB 1LNSA 2B1GA 2AVDA 3VDRA 3ZD9A 3BE8A 4RA6B 3N39C 4LNUA 1DWQA 4YUWA 3MJRA 4U5QA 1DPGA 3SN6A 1DKNA 1QVRA 2OVBA 3G8AA 3PGJA 2HD4A 4RSGA 1ZD8A 1KDYA 4UVGA 5HUHA 2X1HA 3EC7A 4UC0A 5U1PA 3G1WA 4RH3A 2B9VA 3ZVLA 4LYYA 3UV3A 1Y3HA 3ZWXA 1L4GA 1HYGA 4G5GA 2JJ1D 3UT0A 3GCDA 4DXDA 1E98A 5KU7A 3NXKA 1TJ4A 1KI2A 2ONYA 4FNGA 1XP5A 5IBCA 1X1EA 5JOQA 4R8MA 4TKUB 3QXGA 1W9HA 2QM7A 1CE8A 1R4ZA 3JYOA 1CUHA 3P0EA 5C3MA 1NRIA 3OOEA 3W9UA 2XLCA 3I1JA 4ZU1X 3ZI0A 3EY4A 2J41A 2IH5A 1Q7EA 2H5IA 5FV7A 2IEYA 1CNFA 4K87A 1UXHA 3PXUA 1L4NA 2X3UA 4I1UA 4IXWA 1D2GA 3PR2B 4KGDA 3IXMA 3DOFA 2FEKA 1Z2EA 2VRWA 3HU1A 1YDFA 2WHPB 2WWGA 3K4PA 3LT0A 4MW7A 4CT0A 2CW5A 4HFMA 5FO1A 2JK1A 2XSZA 2FX3A 2C5BA 3AFHA 3K6RA 3LL4A 3QUAA 4KQHA 1FVFA 4DQ0A 5KINB 3ISJA 3ONDA 4JQYA 2C7GA 4U7HA 1KMHB 4JHLA 2AUTA 4A92A 4DA0A 3C7AA 5KYUA 4TUYB 1HYHA 2FQWA 3MD9A 2ASEA 5K0CA 1EFCA 2QN8A 3Q5DA 4DV6B 1FXWF 5LQCA 1ZNXA 3KQKA 4V0NA 3T41A 4A2QA 4ETNA 1DO0A 3B6IA 2B21A 1R0BA 4MB2A 5FUQA 3WV5A 4DYHA 2HMUA 1SG0A 5I9BA 3QLVA 2TSYB 3P26A 4DRXB 4HAOA 3O4GA 1VL8A 1Y5LA 4NCKA 2I2FA 3DO6A 4TSFD 3UUWA 1Z6AA 5I7HA 1ZD2P 3LGXA 5HJ7A 1M2FA 1IZYA 2FWIA 3C8HA 4LGMA 1QV7A 4PW0A 1NVWQ 2ECKA 3MWGA 5IDWA 3CSSA 3HDYA 4C0AC 1KEZA 2Z4RA 3UMRA 5B3JA 2FI1A 1CS0B 1QYXA 2RB5A 2CD7A 1ZBDA 4P3KA 1FNMA 4CKBA 3GEHA 2J9FA 3T1HB 4W5NA 2GF0A 2XUPA 2GZ1A 4YACA 4CL0A 3VHXB 4UUBA 5JADA 4R9RA 1NLFA 4G0NA 1J00A 4UFPA 3K70D 2Z8XA 2NZWA 1PJBA 3O8OB 2ZG6A 4YJ3A 4RE6A 5IKXA 1DG9A 1FCJA 5K0ZA 3E48A 2PUEA 3KSMA 3GRUA 3HPRA 1Y7HA 5ED4A 2COEA 2ZCJA 4FBMA 5KI6A 2JLQA 2XHZA 2ZFUA 1YK1A 1QK5A 4MUYA 4Q1FA 4CM6A 2D7CA 1VPVA 3UMFA 5HQ3B 3ZZ1A 3GUYA 3NHJA 4MKFA 4AX4A 1PT5A 3H2IA 3NU1A 3N6VA 4GOMD 2IWHA 2OPBA 5KTNA 5J2TF 1N8NA 1XNGA 5KJ1A 1AZSC 1N5JA 4LVUA 3PX2A 4US2R 1NLYA 4WPGA 4D4HA 2NSDA 2QV7A 3X0DA 1HT1E 1T2DA 3LKVA 1XQWA 1F4LA 2WSSD 2ZP1A 2ZTMA 4P81A 1DMSA 4NYIR 3AV3A 4JOBA 1YDWA 2CL5A 4H7JA 1ZRMA 2DKOA 2EYUA 3PNLA 1SUIA 1UDRA 3IOMA 1W93A 3PD7A 3W2TA 5DSTA 3UUGA 2B35A 4Y0VA 2IA5A 2XBLA 1VL6A 1V7QA 3BCUA 1YBVA 2K7ZA 3ZE7A 2LZ0A 3ZU6A 4I81A 3WLIA 5KSOA 5CITA 3OX2A 1E3SA 5AVWA 2FPGB 4Y6OA 1WB4A 1ABBA 1Z0SA 1PJCA 3DXXA 5ALUA 4I4TA 3EXEB 3M9WA 4D45A 1A88A 2PUGA 4YP1A 4UAVA 2AN1A 4QOGA 4IOMA 1X3SA 4KCGA 4IDCA 1YB2A 5CXUA 2Z1DA 4Y2PA 4HLQB 5JVDB 2E37A 4HFNA 2FK8A 2FZ4A 1L4HA 1D6NA 1TU0A 2FJPA 2C3UA 2J08A 3AIIA 1N6RA 3PGVA 4KMSA 1TT5A 2PYIA 3B85A 4L4XA 4U63A 2AJDA 3IKJA 5AWFC 5DI3B 5J5CA 2XMQA 2G9UA 1UOQA 1W36C 4LSMA 4G5OA 3TLMA 1A8SA 2YZGA 3DHYA 1ENOA 1SWVA 4F2DA 2XUQA 3AF1A 1Q92A 1GUFA 1Z9BA 3QWAA 1YVPA 1O6BA 1U99A 1UXKA 1BNCA 4A1OA 4AXBA 2QX8A 1CY1A 1IMOA 3Q1LA 4L15A 1NI4B 4IJ6A 4TMTA 3CLVA 3FR8A 3P2IA 1G2QA 1QBKC 1A7KA 1XNJA 2Q3LA 2QN1A 4IS3A 5FR1A 3UGJA 1NNEA 3R24A 4ND6A 3U4HA 4CM3A 1VYVA 4WBNF 3MPUA 4ROSA 3B6ZA 2QRJA 2O14A 4QBHA 1FP4B 1R0XA 3CW9A 1YMUA 1Z39A 3GRCA 4Q4AB 1DBSA 4HK4A 4DF3A 4A6XA 2CXPA 4BP9A 2IU6A 2LCIA 1KWKA 1F20A 3SE7A 2W42A 5C4IA 2PQ0A 1J20A 2A3RA 2XOKD 4AJEA 3FUXA 2Z2ZA 4F85A 4FHGA 4F21A 2R8XA 3BJMA 4RY0A 4DLSA 3T3DA 5FAKA 5MGBA 2CKDA 3I04M 1D2AA 5JZOA 2GUGA 5KNBH 1NI4A 1RFGE 1W73A 4CDMA 3KZCA 3PFCA 5DHPA 4WDQA 5GWXA 2Z56A 3CF4G 3R0JA 5C1IA 4BNHA 4QOHA 4ZEMA 4OU5A 2XD9A 4TRJA 1M0WA 4JELA 1BE6A 5FBZA 3S7TA 1WZ2A 2V8OA 4QICA 1AXRA 3DDOA 2HWYA 2IPLA 1ULSA 5AK0A 4FLMA 1N1EA 3GJYA 3KDSE 4KO2S 1M1NB 4DYDA 1Z5WA 5CPFA 2IEAA 3CH4B 5KWVA 3E9ZA 3EVTA 2X5NA 3KWFA 3R09A 1JPJA 3TLEA 5JZMA 2B8JA 4EF6A 3QVLA 5LB2A 4ABTA 3BYZA 3FTQA 1AUQA 4PPQA 4KEAA 5IU6A 3OKAA 5K99A 4YNBA 3FVRA 1DC5A 1S96A 1Z5UA 3EEYA 2XDQB 5AD1A 3W8RA 2YWBA 1X8LA 4JC0A 1Y4UA 1AB5A 4JYZA 3G0GA 4NBSA 2DFKB 5MGNA 1RAIA 3LX4A 2YXPX 5D86A 5K4GA 5J23A 1NBAA 3JVVA 4YP5A 3E5RA 5EC8A 4WCDA 4ZVNA 5A3VA 1QP0A 5CUQA 1RXIA 3F4BA 2O8DB 1PBNA 3SQMA 5IDXA 1DV1A 3M4XA 1PEAA 5GQSA 1P1KA 1KBQA 3NIWA 3VJLA 2JJ1A 1HORA 1SCDA 5JSKA 1TPYA 2F1RA 2PWZA 4KAFA 3L6OO 3TL6A 2OLKA 4R1LA 1P0FA 3UAWA 1JBEA 1YQTA 1RAHA 3OPYA 3VNRA 4ZFNA 4C7OA 4KQ6A 2R8ZA 2RGXA 3NHAA 4IMIB 2PL9A 1QYVA 4ZMRA 1GCGA 4MR8B 5EE1A 4BO1A 4JODA 4DDMA 1YJAA 4XWAA 3AVUA 4GPEA 1EDZA 3OT1B 4A4DA 2HLPA 4LJ8A 1E1QA 4UBOA 3QU7A 3TDKA 4TV9F 3TMKA 2M6RA 4F46A 1A8QA 2CL0X 3M70A 1E3JA 5EIHA 2YDXA 4Y2RA 2AEJA 5TEVA 1NN1A 2I2AA 5EJ6A 1YC5A 2EW1A 4JENA 4ZCPA 4KO1S 2CYAA 2NQ8A 5E0KB 1KDZA 4J7XA 1RXCA 3GU3A 1ESNA 2X0EA 3O82A 2PLNA 1OY1A 5F21A 3ZDZB 4BNNA 1N3LA 1V3TA 5ARCA 3GFBA 4LZAA 4LHSA 5BV8A 3NRJA 3RM3A 5ITSA 1NWHA 1ZFNA 1QNLA 2XMRA 1EDEA 4MINA 4Z1OA 4OFZA 2XVXA 5CGQB 1BEEA 5CDGA 3EZNA 3K5PA 4NX2A 4OFXA 1JAIA 3WQHA 1G59A 3FF1A 3Q40A 4GR5A 2ZRCA 5DWVA 3I32A 1PJ2A 5C8DA 3DBLA 2P1RA 3MAAC 4ZK6A 3TAUA 4DLVA 3D0RA 2ZJ6A 3DV9A 2FEMA 2ZRKA 5FBRB 2C4KA 4W7IA 1J8DA 2GLUA 3U4DA 1DJLA 3T7SA 2NP6A 1OQAA 2DR3A 3BK2A 3K5HA 4LX8A 2F8LA 4MWDA 2DHCA 1UCFA 1NYRA 4X1YB 4IGEA 4MI6A 1BCSA 1QGDA 4M9RA 1A82A 2XGSA 3RS8A 3L1KA 1F6DA 1ZJ4A 2ZTHA 1UJNA 1UT6A 1L7DA 3GJ3A 3IRUA 3O0DA 2WDPA 2PSSA 3WS7A 4UTVA 4TUYA 2M2IA 3AL0C 5D51S 2X86A 1CUIA 4K8RB 3WFZA 2WWTA 3NYIA 2P8SA 1WIWA 4HWPA 1U2GC 2JHAA 4MWBA 1DXHA 2P3LA 4FWBA 4JBLA 4GEKA 3U7RA 3WTBA 4JT4A 1DS6A 4NHEA 4IH1A 3BE5A 3L5OA 2DR0A 4YHHB 4CIVA 5AT1A 1O8BA 4JN6B 4RPIA 4KX3A 4JJ4A 3VSDA 5H59A 5BQFA 3L2OB 1KEVA 1U6IA 1T3GA 3N5CA 5AMXA 1NJ5A 2WLTA 4O4HA 3ANLA 3Q8LA 1PDOA 5M5BA 2BFOA 2C4VA 1D9ZA 2Y0EA 2VBGA 2YJNA 1UXGA 2REBA 1CUYA 2JJ8A 4YRFA 3SBEA 3M81A 4MKHA 1C8KA 5LQDA 1ULTA 1LA2A 3DVLA 2H51A 3G2JA 3QGMA 1QVAA 3L02A 4KBGA 4XWGA 5I9LA 4X1YA 3UY4A 1QO0A 1ZD5A 2WIDA 3THXA 4JQCA 4D26A 2WPDA 2V7XA 3NGMA 3QPWA 2WG0A 4XWOA 1T9KA 3GLUA 3H13A 5KCMA 5A04A 3LUPA 3DWIA 4HF7A 4QGGA 4O4LA 1JQBA 2BCGY 2QLFA 2XCLA 2ZJ3A 2BEKA 3PPWA 1WUIS 2P0YA 1DIBA 3KKZA 3R3HA 4DGSA 5CB0A 2W6ZA 2A1UB 4MGZR 3ZGVA 4CKEA 2X0NA 1J5XA 4GSLA 4HQRA 5BSTA 1HFKA 4DTIA 3FJOA 3OSUA 3MD0A 2CVQA 1H2YA 3ID6C 1Q16A 1CY7A 2CWDA 4G1VA 5HS6A 4O02B 1CVIA 3P4XA 2ZDGA 1NW6A 2CZCA 3H7AA 3R9KA 4FQ7A 5B30A 1TJYA 2HRDA 4YP0A 5DE3A 5K3DA 1XVUA 2ZPAA 1Z2OX 3NDRA 5H3CA 1P77A 2CEAA 1Z7BA 2NADA 1ODCA 2Q3HA 4GI3A 3WGMA 1VL1A 1IB6A 1G17A 4AMGA 1MJFA 4BIMA 2ZSIA 3PV0A 4XM0A 3TTTA 1DTSA 1XFDA 1I94B 3BJRA 3LF1A 1ZIYA 3IUNA 4WFKA 5B7PA 1HZZA 1QO7A 4X7MA 4UU1A 3E9RA 3UAVA 5AM0A 4JBYA 5EHNA 1CJKC 3WGKA 3R5JA 4MPJA 4D0GA 2PYDA 3VC2A 2H59A 1EE9A 1TQHA 2PKQP 4YEDA 2WUWE 3V2UA 3GZTB 4ITVA 4HYTA 2E2WA 2QMOA 4QU9A 1G8AA 1IN1A 1JAHA 5KSYA 1UFRA 1YS1X 1W96A 1QZTA 3PHJA 4Q3OA 1M74A 3DSRA 1AGYA 2VBCA 2CVHA 3EJWA 3N8HA 2Q9UA 2IS6A 4IAOA 4I8IA 4KFTA 1PJLA 1YRAA 4MW4A 5BW6B 5T8KA 1RJ9A 5ALVA 3L4SO 2Z8YM 3P32A 5EP2A 2VNSA 4URFA 1YB4A 1PUIA 2FZLA 3MBKA 1SBNE 2ABWA 1EVLA 2VP3A 3M3PA 4FJ0A 2ZUVA 2Q7DA 3FHJA 1Y1SA 1USUA 1P5JA 3AF3A 1OXBB 2IPOA 3GIWA 3GOQA 4F6RA 5IWAB 1PWZA 4TZ0A 1KVRA 2JCSA 4WK6A 4LDPA 3H4IA 5DM2A 5IM4F 4OSOA 4JYCA 4HLNA 4U8HA 2GEKA 3AH8A 4I5FA 3IEVA 1NX6A 1T1RA 3KL2A 1MAHA 3BS4A 1ZJWA 5KKCA 1H8HD 4WZBB 1G7SA 4JL6A 2NX2A 3SZLA 3U40A 3HCNA 1KSFX 1CJVC 4Z7QB 1JDUA 1CUVA 3ENVA 1XKXA 3MSXA 1EDOA 4YJHA 2NSLA 4D3XA 2DCUA 4BYMA 3KKPA 2XMDA 4ZQIA 5K03A 1BDJA 4J0IA 4NE2A 3MJFA 5EWMA 4MI3A 2V4ZA 5JISA 1QHFA 1CRPA 1Y34E 3Q0TA 1NVTA 1QLHA 3H1FA 3UPDA 3SJUA 4JX8A 3QK7A 4D9KA 1W36D 3CTPA 1UBGA 3ST7A 3AU9A 2I7VA 1MNQA 4X20A 4NP6A 1FDVA 3EGVA 4ZICA 2WSMA 3VPAA 3ESXA 4J0FA 3L0PA 3P2JA 1Z45A 4HYQA 4OREX 2NTJA 5F64A 3DLTA 4F5EA 1QOPB 4YUXA 3L1JA 2CDAA 5IFLA 3ZJYA 1ZPDA 1U3CA 4BC1A 2KYRA 3C3DA 1QRAA 5IKPA 5JSUA 4CDNA 3BFPA 2A57A 2QJFA 3IEPA 1AHIA 2C2KA 3SVLA 1JKFA 3H8VA 3DTTA 1J9ZA 1O6CA 2J6IA 1FA9A 1PL8A 4GOOD 4GLFA 1S6YA 3COJA 3ON5A 3PGMA 4B80A 2VJKA 2DTEA 1FRZA 4EHDA 1JQ5A 1SCNE 4US1R 4WKGA 3OE7A 5IX8A 5KC9A 3TF5A 4JP8A 5DI3A 5G0UA 3V8QA <