4TLCA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
234
structure length
227
Chain Sequence
HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPGFDLSALIERINYAIQKYRARRVSIDGVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Circadian clock protein kinase KaiC
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
total genus 79
structure length 227
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tlcA00
3VU9A 4RKEA 4YC7A 2OFWA 1K6MA 4WZAE 3QXJA 1G4AE 2VSXA 4Z54A 2WWIA 4IDQA 4OBEA 4I1SA 3SHFA 4M21A 4C0BA 4C9BA 2ZQ5A 1O87A 1II9A 4WIAA 1NIJA 3J81k 5TDHA 3NH6A 3IHWA 3NXSA 1DG3A 3EXAA 4GOJA 4G5OA 1I4DD 3MD0A 5FL3A 221PA 4P4SB 2GILA 3FTQA 1MV5A 4FW9A 4MGIR 4B73A 4M0LA 4AKIA 3QXCA 3K8YA 2F3RA 4XIGS 4A4DA 1G1MA 3CO5A 1ZM4A 1G3IA 1YR9A 3IEUA 3TE6A 3RYTC 1R6BX 1JPNA 1US8A 2NQ2C 1Q1ZA 2QAJA 4A6XA 3ETLA 5LPNA 2RGGA 4L5BA 4P32A 2RGDA 3KJIA 3C15C 1VHTA 3VHLB 3CR8A 1T3SA 1DAGA 2P6NA 3FWYA 1CEEA 4TSFA 1X6VA 5IK2A 4Q1DA 3WMEA 2QEQA 3A1UA 2W83A 1BH2A 1Z07A 2PH1A 4QGGA 1IN4A 1NBME 2OILA 1XPOA 2GCOA 3MCAA 4ITRC 1KAGA 1G8FA 3DHWC 2ZJZA 3I4LA 2KE5A 3DOEA 3X1XA 5TXGA 1Q1BA 3AP2A 3AP1A 4QKQA 1KI4A 5FR1A 4OQNA 1EWRA 2DFKB 2ODBA 4KO8A 1GG2A 3WYGA 1YZTA 5EP4A 3GFPA 2YV5A 3L8YA 3P27A 3U5ZB 1QBKC 1Z06A 1E2KA 2WJIA 3B9PA 2IYSA 2O0KA 4MRSA 3TSWA 3BD9A 4LHWA 1S1MA 2EYUA 2P6UA 1MH1A 2EFDB 4KU4A 4IVQA 2GTPA 3REGA 2VA8A 2JA1A 3KTAA 4KLNA 1M74A 3PIRA 4HAZA 1ZP6A 4V0ME 4MH0R 4QBFA 1AJEA 1YRBA 4BWYA 2GNOA 3DKPA 4V0OA 1G5TA 1YU9A 4OYHA 2PX0A 3TGPA 1VTKA 1AN0A 1W4BA 3AF3A 3BGWA 1E0SA 3FMPB 2GJ8A 4EJSB 3KQUA 2GK7A 1E2HA 4D80A 1KO5A 3W34A 2ZYWX 1VIAA 2IEYA 4MDFA 4TSFD 3WNCA 1SXJC 2FN4A 5GVSA 5CDFA 3T12A 3EA5A 4LDJA 4OI2A 3SYLA 5IK2D 3AVQA 5SZHB 5CB8A 3W8RA 2RGCA 1N5KA 1Z0JA 3RSLA 2JLRA 1PZNA 1E9BA 2IXGA 4IW3B 4TN1A 3FPAA 5G3YA 2ZREA 1GRRA 2H5EA 4DWJA 1T3LA 4Q02A 3V9PA 2ZE6A 1P2TA 3QI2A 4QHTA 3W5IA 3SU8A 5FTLA 2J3EA 4DIEA 2W0SA 4PHGA 3BK7A 3SI7A 2OAQ1 2WIBA 5JSZB 1YQTA 4IDHA 4BFYA 1DAEA 1DE0A 1M7BA 3ND9A 5KSPA 3RANA 3X1ZA 1E4VA 1OJLA 4QHYA 4ESVA 4Q1FA 3MFYA 5IHPA 3AB3A 2J0QA 4G0NA 3KUCA 1P9RA 4TYQA 2XZPA 1ZMXA 1GL6A 1II0A 2WOOA 1RPZA 4NONA 1RVDA 2YWHA 3RAPR 3AVWA 4JL6A 2D06A 3AVTA 1EFRA 2SHKA 3CBQA 3D31A 5JI3E 5FOUA 2FPKA 3LX8A 5BN3A 1GWNA 4ZCLA 2QU8A 2X8AA 2QP3A 3GJ8A 1QHHB 2W6IA 5C4MA 4A2QA 2GVDC 4BLQA 2ZIAA 3L0OA 4KI0A 2CJWA 4XD7A 2YWGA 421PA 5DYIA 5AUQA 5KU1A 2ZPTX 2PZEA 3UWKA 2WZQA 3WMFA 1E9CA 3CX8A 3EZ2A 3QEJA 3T1OA 3V4FA 4OHVA 1OV4A 2Q9BA 3TRFA 2H1LA 4GOXA 4OHYA 3Q9LA 1U99A 1IN5A 1Q12A 3VMFA 2C78A 1HT1E 4C2UA 4PQYA 5AK0A 2P65A 2HXYA 2JJ2D 3M4YA 3IHLA 4Q00A 4TL9A 4M8NE 2J7KA 5JWRA 1AGRA 3GJ0A 2Q3HA 2ZS9A 3EX7C 2ZR7A 4Q1CA 1XEWX 4F38A 4MUBA 1EX7A 1T0HB 1E2QA 5JBQA 1NLZA 1JECA 3QQ5A 3ZD6A 1YRAA 3VU9B 1VDZA 2ZS8A 3Q3JB 1EFRD 2ONKA 1FZQA 3LFUA 1WB9A 4L9WA 3QOFA 3BH0A 4JVSB 1OIVA 4DEYA 1IY2A 3CW2A 2ZRIA 2ODNA 3GEIA 2W6ID 4DCNA 3Q85A 4KFRA 1K5GA 1KI6A 1YE8A 1TMKA 3CRW1 4LJAA 4XD7D 1A4RA 3OIUA 5LB4A 2GXAA 5E7JA 3CH5A 3EZFA 3WP1B 2DBYA 1W5TA 2IYLD 1R7RA 1N6LA 3FMFA 3K09A 4PXAA 4X8LA 2ODEA 3Q7QA 4DRZA 2RCNA 1LY1A 1E9FA 3QF7A 5D3MA 3KL4A 1SGWA 1G3MA 3VR3A 4JIMA 3N70A 5L3SB 3QKRB 3CH4B 4X8HA 3IBYA 5IDVA 3RNLA 3K09C 2IHBA 2G1KA 2ZR0A 4CT5A 4Z8XA 5B30A 1N6KA 4O25A 4M1MA 4FIDA 1VG0B 2I4IA 2OZEA 2ZI9A 4PPGA 4LBVA 4WBSA 4KVAA 2WMOB 3HU3A 4MA4A 2FA9A 1WXQA 2CL0X 5BWMA 5TY0A 1M34E 1NY5A 4GBMA 1RYFA 1FTSA 3SQXA 4YMVA 5L3VA 4B33A 1XMIA 3NHBA 5AJVB 1IJEA 1QVRA 4ACBA 5J4HA 2WHXA 3LRPA 2QPAA 3MG9A 4OL0A 4PO9A 3WHKA 3AP3A 1NJFA 2GCOB 5L3QA 4IJMA 4E07A 1FNNA 3E1SA 2I1QA 4KVGA 2IYUA 1NVUQ 4D4LA 2VL7A 3D7MA 4MKHA 3SNHA 4WZBE 1GIAA 3LXRA 1T9HA 5DI3A 4OJQA 4UJ3A 4XVRA 2QGZA 3NEYA 3DL0A 4PSAA 3A1SA 4N1AA 2NG1A 2A5YB 1GITA 2XNDA 3ECCA 2JEOA 3H0KA 2VHTA 3P4XA 4KFUA 3BFVA 3QVVA 2V55B 3KTAB 1CJKC 1H8HA 2VHUA 1NKTA 3CRMA 4F92B 4MRVA 1WBDA 3T5DA 1YR7A 5BQ5A 2ZI6A 4URUR 2Z83A 3LX5A 1KI8A 3OFNA 2V6IA 2ANBA 4JL8A 3U61B 3ADDA 3THOA 1SXJB 1JNYA 2Z6VA 2A5GA 3U3RA 2YNMA 1KHTA 1A5TA 2ZVQX 4ZDWA 4B2IA 4EAQA 4BECA 3SQWA 1AIPA 3K9LA 1AA9A 3TAUA 2JLSA 1W36C 3PJRA 4V02A 2IC5A 3W3AA 5FTKA 2NOAA 2YWFA 4HLUA 4Q18A 3WRYC 1ZNZA 4IDNA 1N6OA 1OFUX 4Q48A 2YHSA 3EPKA 1AQYA 2E9SA 4DCSA 2DHRA 2DFTA 4YXWA 5JHGB 4HLUC 5KPDA 1M1YE 4TLBA 1GAJA 1LS6A 1ZBDA 2B6HA 2XJ9A 4GT1A 2O8BA 1S0UA 1QRAA 4BRUA 1W5SA 2HJGA 4BFSA 3FE2A 3L0SA 4N0DA 1XCPA 1AS3A 1KK0A 2JLVA 1F2TB 1E79A 1ZU5A 1SHKA 2XNDD 3AVYA 1XDBA 4RFVA 4DKXA 4P4UA 3OEEA 1E4YA 2HUPA 3A36A 3FGNA 2R6CA 4U02A 1G8GA 1H8HD 2O52A 1MOZA 3ZJYA 3NHAA 3CRRA 5EZ5A 3AVPA 3GLGA 1WF3A 2NIPA 5P21A 1TPZA 4GP7A 3OFND 4M9QA 1WQ1R 1P73A 3EC1A 2QG6A 4FD2A 3AV0B 4HAVA 4Q4JB 1W36D 1A1VA 3ZQ6A 3VTKA 1M7HA 1KYIA 4LPKA 3ADKA 4EQ6A 1UBEA 1U81A 2DPXA 1KMHB 3B78A 1E6CA 4BFVA 4B3XA 4MYUA 3I61A 1NVXQ 3KFXA 1W48A 2ASEA 1YVDA 4LWZA 3CKLA 4P0TA 3W90A 5FH9A 3CWQA 3V4RA 3QKTA 5DHFA 2CJWB 1FUKA 5KDLA 1R0YA 2BM1A 121PA 5KNBA 2IX3A 1KK1A 3K0FA 3IQWA 3Q5EA 5GVRA 1C9KA 2MSDB 3GLHA 3C41J 4ZPXA 4YXWD 2HYIC 4BGDA 4JBWA 4BPBA 5F9HA 3KJEA 4V0KA 3EZ7A 2GDJA 3AF0A 4QG7A 1E69A 2G3YA 2XTMA 4G5RA 4MRNA 1T8TA 3BXZA 2KBFA 2QM7A 3FVQA 4RZXA 2HCJB 3V00A 1E79D 4RZUA 1FMJA 2ORVA 4W5WA 2ZI4A 3OEED 4LHYA 2CHVA 1HE1C 2FGKA 2WSMA 3GJ4A 4O3MA 3U7FB 4Q9HA 2ZE7A 1KK3A 1GL7A 3T34A 2WKRA 4QGFA 3GLFA 1MRSA 3RABA 5DE3A 2FJUA 2WM9B 4MKGA 2WJVA 1DAKA 1RE0A 4IOKA 4D0GA 1MKYA 1OXXK 2BEKA 2PEZA 2DFLA 2FX3A 3QKSB 4DB2A 1Q57A 3RS3A 5C46F 3QBTA 5HZKA 1TU4A 4KV9A 2BCGY 3PCRB 4MKIA 1F2UB 1QHIA 3W3ZB 4BFWA 1LB1B 2OLKA 2OV2A 3THYB 4D25A 4A2WA 2FPMA 1T5IA 1E9RA 3CB4A 1W0KD 3CRVA 1G7SA 1C1YA 3EC2A 1KI7A 2FH5B 4LX0A 4B6FA 2WAXA 3HP1A 3GP8A 2ZRFA 4M2LA 3RS4A 1A82A 5D3MB 3WBKA 3WNDA 4ESHA 1NN1A 2JAQA 3E2IA 4UXHA 4DSTA 1Y3AA 4AK9A 3P4YA 2QSYA 621PA 4LCBA 2P5TB 1N6RA 2ZSFA 2WWFA 2Z0MA 4ASUA 2OFXA 2WJYA 3T1TA 1XMSA 3O47A 1IAQA 4UNNA 4DCVA 2VP4A 521PA 4MGYR 1JR3A 1DAIA 1FX0B 1EG7A 3Q72A 1AQUA 1KTVA 5B58C 1X8LA 1HURA 4B76A 3RRMA 1BMFA 1RZ3A 2QY9A 5FBVB 2WIAA 3OHMA 3VFDA 1DEKA 3FKSA 4C0AC 3K9GA 3VR2A 2BMJA 4IKEA 1MO6A 4DLRA 3GLIE 2X77A 3FKQA 1XXHE 5L3QB 3KB2A 2ZRAA 1QHNA 1Q1QA 2R44A 3GJ5A 1Z6AA 2D3WA 2WKPA 2BDTA 4M1WA 1IHUA 3U3MA 4M1TA 1Q1EA 4URXR 2A78A 4B44A 4KCGA 5DI3B 4JLOA 1R5OA 4CEIB 3ZS8A 1BO6A 3C16C 4IVPA 4FMDB 1KAOA 5FUWA 4KFSA 4A15A 4US2R 1OH6A 1HE8B 1L4UA 2HF8A 3GCGA 4EJSA 4UKDA 3W6OA 2NO1A 4CGZA 2V1XA 1HH4A 4D82A 4ASUD 3PEUA 3CWZA 4XOIA 1ZC3A 1M8PA 4C2TA 3B8HA 4AYXA 1JR3D 721PA 1D8TA 1R0XA 2QNRA 3KZ1E 4GRAA 4JT4A 2ZUBA 1UADA 2CMKA 1E99A 1W36B 5C18A 1G291 1HUQA 2W2VA 4MKFA 1BMFD 3GQBA 2FNAA 2ZRNA 4CDGA 1Y63A 1XTKA 5FUYA 2OXRA 1P3JA 3EA0A 1FMLA 3FKSD 2VP5A 3IKJA 1IN8A 3HPQA 4WXPA 5JSZA 2J0UA 1OKKA 2F7SA 3B9QA 2J5XA 5KHOC 1VG8A 2P6RA 3KFVA 3KXIA 1KY3A 1X8JA 3PITA 4HZUB 4Q21A 1Z63A 4Q9IA 2O8BB 3PEYA 1WE2A 1FP6A 2ZRBA 4AG5A 3QSYA 1UKZA 5EE9A 1TQDA 2BOVA 3IGFA 4MGZR 3SDZA 2B21A 2PZGA 4IVRA 4JKYA 1IY0A 3L0PA 3NBZC 4QJ5A 4ZCIA 5AUPB 2J59A 4F91B 3CF0A 2ZR9A 5K8LA 3WRXC 2YKGA 2CNWA 5JI2E 2QN6A 3BFXA 1XRJA 3DZ8A 3GLGB 1P61B 4RCYA 3CRQA 3TH5A 1QDEA 1TQ4A 1Z8FA 2WKQA 4AIIA 1BOFA 1QHHA 3RS5A 4JKIA 4KYUA 1YZLA 4DJTA 1JXMA 4EQ6B 1FOEB 2IXFA 2OUKA 3QJYA 3BC1A 2ORWA 4M1YA 1Z6YA 4JLMA 1OFHA 1L8QA 4ILEA 1R5BA 1EXMA 2ERYA 1JJVA 2B8WA 2PMKA 4M53A 1VPLA 3MWLA 2E87A 1R8QA 4B47A 4G3XA 2CK3A 1OKKD 3S1AB 2ODWA 1W2HA 5DO9A 1IBRA 3MWKA 3GLHB 4AKEA 1KOFA 1I2MA 1KI2A 4DCTA 5GJWC 2QAGC 1TNDA 4IDOA 4LZZA 1EFUA 1NIPA 1SKYB 2JCSA 4PTLA 4DLXA 4QJ3A 1F60A 4A82A 4A9AA 2QENA 5JZVA 1G64A 3PUWA 4CIDA 4TTQA 1CRPA 3FFBA 1UKEA 5AJXA 2CXXA 5KTYA 2H16A 4QRHA 2EWVA 4YMSA 1OIXA 2Z4SA 2CNWD 2HLDA 2FOLA 4M9XA 4HSEA 4PC1A 1EFCA 1U8AA 2GCNA 2XB4A 4Q9JA 1NSFA 2J1LA 1G4UR 5E4FA 4YONB 3SYKA 4EPVA 4BZQA 2D2FA 3M0EA 5HKKA 5CLQA 2IUUA 5SZJA 3GLFB 3W5JA 1ZM7A 4NCHA 2O0HA 1N6PA 3SC3A 1Q3HA 3QEOA 4XWOA 2J0SA 1VYTA 3EG5A 3F8TA 4MGKR 3L0IB 4HUTA 1S4QA 3THWA 4HATA 2C9OA 5CYOA 2NPIA 2GF0A 3CUEF 1KSGA 4DB4A 5G53C 4OI0A 4IHQA 4EDHA 5J40A 3VNUA 5GJBA 1NG1A 3N5CA 4JT2A 3CF2A 4PR0A 3RWOA 1SVLA 2FMXA 4UNSA 5BYKA 4UNQA 2CK3D 4FCWA 5EXXA 2J7PA 1IONA 1NLYA 3NTUA 3QKRA 4I1VA 5L3SA 1GKIA 1Z6GA 3BOSA 1KNQA 3GPLA 3EW9A 4BE7B 3R9IA 2J0VA 4MYCA 4MUAA 2J87A 2IWHA 4BQSA 2ZITA 5LD2C 2GXQA 2AD5A 3T1QA 2V54A 4KAXA 2FFHA 2O8EB 3B6EA 1G16A 4BEJA 3OEHD 3ONWA 1RRFA 4R7ZA 5L3RA 4AI6A 3AVXA 2HLDD 3KKOA 2IF0A 1X3SA 3QXXA 2PEYA 2V6JA 2BM0A 4RD2A 5SZIA 3ADBA 2N46A 5FPTA 1Z28A 3UIEA 2QI9C 5HKKD 1FQKA 2Q3MA 3T5GA 4K81B 2QE7D 3MJRA 4FMCF 4RFSB 3VX3A 2YYZA 4J0QA 1D2MA 4PSVA 4ARZA 1EGAA 4B6EA 2HCBA 1TUIA 4PHHA 2GZHA 2ATXA 2XNSA 3NEJA 2EYQA 1Q20A 2AWOA 3OF5A 3VR6A 1MRNA 2Z4RA 2B7BA 2YWEA 2XOKA 1D9XA 4F93B 1DBSA 4NBSA 4QXAA 2CBZA 2YOGA 5CLLA 2X2FA 2REXB 5DLQC 4M1SA 2F43B 4C3ZA 2B7CA 3IO3A 4IXMA 5UKDA 2J7PD 5LB2A 4DLYA 4DDWA 1U8YA 4DXAA 2VTKA 1HQCA 1U2RA 3I62A 1G6HA 1QG2A 3KKNA 2OCYC 4HAXA 1G8PA 4A1FA 4NMMA 2QORA 2ZETA 4W5HA 4GP6A 2ZJAA 4QC2A 2C99A 2XEXA 1XCMA 2H92A 1SXJA 3BBPA 3QIAA 4QJ4A 5FOWA 3CNNA 4B3DA 2RMKA 2BV3A 2P0EA 3LW7A 4NYMQ 3KX2A 3VKWA 4TYWA 3SZRA 2V4ZA 1KMQA 1DO2A 3IQXA 5TB5A 3I8XA 2FU5C 2OCBA 1P6XA 2X19A 2ZUCA 3EIEA 3PFIA 1E1RA 4JLDA 4BASA 1PVOA 2FEOA 2CHGA 2GEVA 3KQKA 4YMUA 1OFIA 1G41A 1DAMA 1HYQA 3AKDA 3GFTA 1G8HA 1Z0AA 1PLLA 2C95A 3CZQA 5B2ZA 2XGJA 1XTRA 3AVUA 2J0UB 2MSCB 2HV8A 2XOKD 2DFNA 1UKYA 1F2TA 4KBGA 1OHHA 2VF8A 5FBLB 2JJ2A 3NH9A 1XB2A 1KJZA 5FTNA 1MO3A 1ZC4A 1X1RA 3KB1A 2I3BA 3PV0A 4R9UC 5SZKB 2P3SA 4PQFA 4G5SA 3RSOA 1NNEA 1ZAKA 1S2MA 2ZYVX 3NBYC 1TF2A 2JJ1A 1NP6A 2JLZA 1SXJD 2QQ0A 2QPTA 3EZ6A 1P4SA 3M1IA 3QPWA 1CXZA 1KDTA 4Q4JA 1U90A 5H1YA 3UMFA 4TLCA 1U0HC 2JASA 4IOJA 1N2CE 4OQFA 1GRQA 5DN6A 3AM1A 2XSZA 1IJFA 1KMHA 2C5LA 2CLCX 4JLAA 4PZZA 4LYHA 1YR6A 2GVZC 1KZ7B 1DPFA 2OE2A 4XH9B 1VMAA 4A8JA 3QE0A 1T3HA 1AK2A 3U6BA 2HT6A 1OB5A 1E1RD 1JEEA 4ZIRA 3G82C 4Q4LA 5FTJA 5KNDA 3QY0A 1XD9A 4A8JC 4MRRA 1CIPA 4Q4AB 1CJUC 2PT5A 2H8KA 1TU3A 1UBGA 2BMEA 3LY5A 4F4JA 2WICA 1E9DA 3OIVA 4H1VA 2HJVA 2IHYA 1Q44A 2A5JA 4GOKA 4MDEA 2WTUA 2D74A 2G0TA 4NKRA 1DELA 2QAGB 2IYYA 3CM0A 1TQ6A 2O8FA 1Z47A 4LYJA 1OHHD 1S3GA 2QPOA 1U0JA 1SVWA 2JATA 1VG1A 1ZM3A 1QHYA 4URYR 2FE4A 3B82A 2NMVA 1D6JA 1SHZA 5LBIA 4B3BA 4GPTA 3B1VA 3VKHA 2OAP1 2H57A 1FQJA 2C9YA 2EQBA 2AK2A 1JBKA 1R0ZA 1MO4A 4URVR 1G21E 1TX4B 1YZNA 1ZUNB 2B8TA 2GEUA 2JJ1D 2O8DA 4DDUA 2IS4A 1IQPA 3NIBA 5H8WA 2V3CC 3HYRA 3EPLA 4AYWA 4TTRA 1W47A 2GF9A 5DN6D 4ZI3A 5CB6A 2XSZD 3EWSA 3TVDA 3BB1A 3SFVA 4LC0A 1CR0A 3QKSA 4HAYA 2AFHE 4XWAA 5JJIA 1Z83A 3I73A 1GDDA 1F5NA 2F1HA 2QROA 4NE2A 2ZTSA 1SVSA 4JLKA 1F2UA 3RRYA 3FFAA 5HE8A 1ODFA 3THWB 5A4JA 1N0VC 3THYA 4RD3A 821PA 1E94E 2OLJA 3SFZA 5EE0A 2OSBA 2VRWA 2FWRA 4AWXA 1CJTC 2BEJA 4LY6A 5ANRB 1VHLA 1D5CA 2QRNA 1SZPA 4NL4H 1NVWQ 2N42A 2J9RA 3GMTA 2YZ2A 4DLWA 5K8UA 3AF4A 3IIKA 4II7A 2FF7A 4OQLA 1AM4D 5JMTA 5LD2B 1CR2A 1M2OB 2JJ8A 1OYYA 3SJAA 1WP9A 2WMNB 2PCJA 5E95A 4NCNA 4LV8B 4R71A 5IRCD 3TQCA 1BYIA 4HDCA 1FX0A 3QNUA 1OW3B 1Q22A 3BORA 3IIMA 4LPSA 3ZVNA 3H4MA 3ZQJA 4GZMA 5J4KA 1J90A 2VO1A 4NCIA 5JCPA 3B1XA 4IFEA 1LTQA 4HI0E 2XTZA 1CLUA 2ZI3A 1Z3IX 1BKDR 1KZGB 1XJ0A 3LO5A 4G01B 4W5JA 4XVQA 4C0QC 1B23P 4ON9A 3HWSA 4RVCA 1G7TA 2BMDA 4QFMA 4U5XA 4KODA 3HU1A 4PANA 3NG1A 4ARZB 1RIFA 1G19A 1G7RA 2GCPA 4QOSA 4D4JA 4TZ6A 3GD7A 5J4LA 1H8EA 5FBRB 2ZE8A 4CEIA 1NN5A 4DLTA 4LJ5A 2DY1A 2VHCA 1YHNA 3EIHA 3OIYA 2PL3A 1XF9A 4BLPA 2GA8A 1NI3A 4Q66C 2QTVB 1U8ZA 3WP0A 3AKCA 1IXZA 3MLEA 4PHTA 1N5IA 1QHGA 2H17A 1PUJA 5J5CA 1NMXA 3IPXA 3R7WA 2RGEA 4V0MA 5BN5A 3SR0A 4Q1AA 1VYUA 3FB4A 4JVMA 4Z1MA 1XD2A 3I92A 2IA5A 4PHFA 3HU2A 4YQFA 2FSHA 1R8SA 1W7AA 3X1DA 2NZJA 1NY6A 2W2XA 4RD0A 2ORIA 1XMJA 2NO6A 5EXTA 1QZXA 1SVIA 2CEAA 1E96A 2AWNA 4KSCA 4EPXA 3LQQA 2JIZA 4WAUA 2YC2C 2AD1A 2Q9AA 1NBMD 2VBCA 4H9GA 4ABYA 3PXGA 4HZUA 1OH8A 4BEBA 3A4NA 2ZUDA 5F3WB 2FFAA 4LI0A 1GOTA 3I5XA 1H8ED 1LF5A 2QL6A 4DLVA 4RJLA 1DAFA 3ZYCA 5FBQB 3LXXA 3TR0A 4MQBA 2W58A 1RYHA 2ECKA 1XEFA 1S9HA 4Q19A 3MSXA 2FG5A 2GEDA 3AVVA 1CP2A 1DS6A 5CITA 1ZCAA 3FHTA 1T91A 3LWNA 1ZD8A 4FXPA 2ZS7A 2H7VA 4M9ZA 4CEJB 5KOYA 1VCOA 2CVFA 3I32A 3IIJA 4K8OA 1SKQA 1VYVA 3THXB 4Z1MD 4A0FA 4C0HA 2QTHA 2A3RA 3DOFA 4DLUA 2BMFA 4B3CA 4JVLA 2GK6A 2FFBA 2ZM5A 3ZGXA 1UBCA 4PZLA 3HDTA 4N0EA 4QGAA 5AWFC 1W2GA 4A8JB 2PJZA 1W46A 4V03A 2ZSAA 4EPWA 4QBIA 2WWYA 4BLTA 2R65A 2CE2X 5FPSA 5CK5A 4ZIRB 2GHIA 3ICEA 4BRWA 1KO4A 2JIZD 3S1AA 1KI3A 2UZ3A 1T5LA 1E32A 5ELXA 1W0KA 3UK6A 3PEWA 3TUZC 1P62B 3D8BA 3DZDA 3PUZA 4GNKA 4RZ2A 2XXAB 3WYAA 2QSZA 4GMXA 3DMNA 4KBFA 2REOA 2VSOA 2Z43A 3CPJB 2O8FB 3U44A 4BLOA 2ZRLA 1DTSA 4CF7A 1IXSB 3ZDQA 1K5DA 2B92A 4C7OA 2ZRGA 4EUNA 2GRJA 2D4HA 1LVGA 4JMPA 3SOPA 3SS8A 2PCLA 4EFNA 1V5WA 1P72A 4OKSA 4Q4HA 2EU8A 1CR1A 3BE4A 4B75A 2O8DB 4Y0AA 4KFTA 4LUCA 3BB3A 4C0KA 2WAYA 1VKJA 5J4VA 5J47A 5FPKA 1JEDA 4NYMR 1XTIA 1EESA 2C96A 3C7KA 3TBKA 4POAA 1CULC 4A36A 2A5FA 2WSSA 3E5HA 4JS0A 4DIDA 5JS7A 1W4AA 2VIIA 2WJHA 4ZCMA 3U3OA 3UPUA 4H1UA 4HB4A 3ZIAA 1RFLA 1IXRC 4NDZA 2ATVA 2CL6X 2NTYC 4M22A 4RD4A 5E3HA 4JYCA 3B13B 3NBXX 3QPVA 1GM5A 2F1IA 1Z0DA 4DDVA 2XJ4A 3VR1A 1D2EA 1ZJ6A 4AC9A 3I3SR 4URZR 4JYBA 5JHHB 1KY2A 2YC4C 4OQXA 4D81A 2OCAA 3T61A 2ZROA 4IDPA 2GJKA 1KGDA 3ZH9B 2O8EA 3QBVA 4Q47A 4IEIA 3DPUA 1YJ5A 5DHAA 2BBSA 3DMDA 4L9SA 3NDPA 3A1TA 3LD9A 2QUZA 4D4MA 5TMPA 1CR4A 4LYFA 2QMOA 1XU4A 1M6NA 3H86A 3G5UA 4TWZA 3I72A 2IUTA 4V0NA 4RFSA 4G5GA 3KDSE 4EIWA 3U2QA 5JJKA 1VCIA 3DKVA 6Q21A 3UG7A 1NL3A 3W9YA 1N5JA 2ZXUA 2WSSD 1T6NA 3Q5DA 2Q9CA 3WMGA 4TL6A 2HF9A 4LJ7A 4XVUA 4TYPA 3ZIAD 3TUIC 2F43A 3K9NA 2EFGA 3WBJA 4GDFA 3NVAA 1SVOA 2F1RA 1E2IA 3TKLA 1GZSA 2E1RA 2XTNA 2QMEA 3BERA 2GZAA 2LKDA 3GJ7A 3N2IA 2L0XA 2CLDX 1KKLA 2ZI5A 4ZKEA 1ZD9A 5CJ2A 4ZDIA 1XD8A 2EFHB 1G8YA 1P2UA 2ZU0C 2C04A 3CNLA 5JECA 1P9WA 3DO6A 1CF4A 2EWWA 1UDXA 2RB4A 2F1JA 4I81A 4DUGA 1GP2A 2GAOA 1XBTA 5G41A 1G17A 5CIWA 3R7WB 5TARA 2HYDA 4W9MC 1UKVY 2VHJA 4LV6A 5HPYB 4FMBB 4Y0VA 4MRPA 3O8DA 3T1VA 1MT0A 1O3YA 1XD2B 1OB2A 4PX9A 2WOJA 5EQTA 3FMOB 5CDFE 2AK3A 2PJRA 4HLDA 1J8YF 1CBUA 1XEWY 5EP1A 1S8FA 1R0WA 3FMIA 4TMZA 1QHSA 4NHOA 4MITA 4EFMA 3LDAA 4RKFA 1W4CA 1XX6A 4BFUA 2O8CA 1UEIA 2RAPA 1OXTA 3A37A 4TL8A 4Q7KA 2W0MA 3GJXC 1QHXA 5B64A 2A9KA 1L2TA 3IUYA 4I4LA 1E2DA 3G0HA 5EE1A 1Z6XA 2RH5A 3A1VA 3AH8A 4TLEA 2DYKA 1A2BA 4NYIQ 1E2EA 3IDQA 1Z08A 1G3RA 2QTFA 1G6OA 2ZRKA 1DO0A 3C5HA 5H70A 4AYTA 2BBOA 1GL9B 1GTVA 3JZAA 4D0NA 1BYUA 3VQTA 4DUGD 1ZRHA 2N1BA 5HCIA 3LBNA 2IYVA 2NO9A 2A7QA 2IK8A 2QMHA 1TEVA 4C30A 3JVUA 2WPDA 2QQEA 1NSTA 1G7CA 4FMCB 5DIFA 4S35A 1JB1A 3AKYA 3CONA 1GRNA 1HA3A 1SVKA 4XSHA 3SHWA 1GNPA 1KDRA 4LGMA 4PC7A 4NTZA 1AGPA 1U0LA 4IEEA 2D2EA 3PUXA 2W00A 2IUSA 3QPUA 4FWIB 4Q4AA 4OI1A 3SJCA 3UANA 5KNCA 3R8FA 3DVLA 1XFAA 5G3ZA 4PFSA 3VAAA 3TLXA 3CIOA 1KI9A 4TQUS 3K0CA 4D6PA 3CNOA 5FOSA 2QAGA 2ZRPA 2QT0A 3GFOA 2RHMA 1SQ5A 3RRZA 1TF7A 4CZ2A 1ZNXA 2BC9A 4PC3A 1KDPA 2ZANA 4BLRA 5GJVC 4DLZA 3K0CC 4NP6A 1XJCA 3N2EA 1X8KA 1Z0IA 1FPMA 2UVQA 5JLJA 4AD8A 2OCPA 4LJ4A 1N6HA 3UWOA 4UXIA 2NZ8A 2PX3A 1ZM9A 5AR1A 4PAOA 1KIMA 3RS0A 4N3NA 4DZZA 3U44B 1OYWA 3AQ4A 2R62A 3OEHA 4E03A 5L8VA 3EPJA 3HYTA 3P32A 4C7OB 4GFDA 3QXSA 1XMVA 3F5FA 5KSZA 3D6TB 1S9DA 1OXUA 2R9VA 1JQJC 1E2MA 1CS4C 2XB2A 4B2LA 2QE7A 4Q4HB 4D2IA 1JJ7A 3MJHA 1TL7C 1Z6TA 2CE7A 4QM6A 1GILA 4Z51A 5FOTA 2YJTD 4G5QA 2WPDD 4DCUA 1TTTA 3W8NA 1J70A 1JQLB 2F9MA 4NU0A 4Q9KA 1S3SA 1YZUA 4TMXA 3TQFA 2JGNA 4BFXA 3AVOA 4MYTA 1TEXA 3FHCB 1I4TD 5EXPA 1TUEA 1P7CA 2IEZA 4UNRA 3CF6R 3Q7PA 4A0GA 5FOXA 2VP2A 2IS2A 4ZKDA 5M04A 4KLZA 5HE9A 3KJHA 2C8VA 1FW6A 3TUJC 5CK4A 2GESA 5FL7A 4R2HA 1T4GA 5DYGA 5H68A 3U6KA 1XTSA 2VPPA 3LH5A 4TQAA 3C8UA 4FCVA 1UJ2A 4Z8YA 5TV2A 1J99A 3DM9B 3EAQA 4LOAA 2QBYB 4PPQA 5F2EA 3SYNA 3TIFA 2KJQA 4HLQB 2NPFA 4RY2A 3ZZUA 3SN6A 4G1UC 5AJZA 2ZI7A 1AKYA 1GVNB 1FUUA 4D26A 1X1SA 3RC3A 1KO7A 4NPHA 3AKEA 1ZUHA 2CCGA 2FSFA 3BFKA 2PBRA 1OPXA 2FDCA 4Q1EA 2GJAA 3A6PC 4Q7LA 5CM8B 3MGCA 4CT4B 3X2SA 1XP8A 4OK6A 2CL7X 2V7QA 3U3JA 2GJSA 4WXRA 2IXEA 2OM2A 3GLIA 1XXHA 1A7JA 2IS6A 1YZKA 4JSYA 1G9XA 3SJZA 1KJWA 2OG2A 3DM5A 1GSIA 2AL7A 3F3YA 4QNMA 1OXVA 5FL7D 2OFOA 4IOMA 4W7SA 3AF2A 1I2DA 1AS2A 1LFDB 1XZPA 2GBLA 2RGAA 3L82B 4HB2A 1KO1A 5JFGA 3CX7A 4V0LA 1Q3TA 2YVUA 1OIWA 4WW0A 3SEAA 4HYYA 2OHFA 2GBLC 3U3KA 4LSGA 3LA6A 3K1JA 3SE0A 1NG9A 1ANKA 4NZYA 4HDQB 2XITA 2VHQA 4ACAA 3OZXA 4LHVA 3IILA 4P4TA 4BFZA 3B5JA 1KI1A 1RJ9B 2Q3FA 4LV5B 1OF1A 1N5LA 4KSBA 4Q1BA 3CZPA 2IT1A 3BRWD 1RRCA 2VQSA 2OO7A 1LS1A 4X8OA 3R9XA 2PT7A 3NKVA 4OHWA 4LC1A 2V7QD 4WVFA 2BBTA 1XEXA 3K9HA 1KKMA 2ZJ8A 4OK5A 3P26A 2HT1A 4QGHA 3ZVLA 4RD1A 2WWWA 2O8CB 1OH5A 1X86B 4CVNA 2KB0A 3C5CA 2UKDA 3B85A 1U9IA 2Q21A 2GKSA 4U00A 3UXMA 4TYNA 4CEJA 3PEVA 1G18A 4QBGB 3MAAC 3NC1C 2CHQA 2PLRA 3MUFA 1MO5A 2C9CA 2WWGA 4WZ6A 5KUTA 4JJKA 4PQRA 3THXA 1U9IC 1E2PA 4HAUA 1PLJA 1Z2CA 4BLSA 3GEEA 3MWJA 1G20E 1DADA 3GLGE 4AKGA 2G6BA 4LBWA 4GMDA 1COWA 2DWQA 2ZSEA 1LNZA 4KXFB 4Q03A 2HXSA 2IYTA 1T0JB 2JLQA 1K8RA 5E7IA 3UATA 4FN5A 2VP9A 4OI4A 3REFA 2WJGA 2ZE5A 1RW4A 2KI5A 2ZAMA 3H2YA 3ZZ0A 5KSOA 5KYKA 4GL2A 3C14C 4DDTA 4D0LB 3K0AA 3PVSA 3RWMB 4I99A 4LJ6A 2XXAA 1DVRA 2ZAOA 1CJVC 3LAWA 4WA7A 1EFTA 4TQ9A 2BJWA 5FFMA 1Z29A 5JWOA 5KPJA 4FWTA 1E9EA 3CPEA 1ZNWA 2RGNA 4MYHA 3K53A 1ZNYA 2FZLA 3GLHE 2KWIA 4HDOB 4P31A 5G40A 4ZDKA 1IY1A 3FHOA 4TMVA 5AJYA 2JLXA 1EWQA 5DNYB 1SKYE 4IRUB 3MMPA 4P33A 2RGNC 3TSZA 2ZRCA 4HUQA 4B43A 1ZIOA 3VHXA 4B3FX 1NVVQ 5DI9A 2BHRA 4ERNA 2C03A 3A58B 1JR6A 3B1YA 1NJGA 1ZM2A 5EUQB 4CYMA 5HR5A 2IYZA 3VKGA 3U7HB 2PMDA 2V1UA 2EW1A 1VCMA 2IBMA 5JCZA 4GZLA 3B1ZA 2KBEA 3VR5A 5KDOA 3GLFE 2R6AA 4LRWA 1COWD 1G5PA 4F4IA 1LW7A 1TAGA 2WJJA 2VP0A 2ZJYA 4TLAA 1Z0KA 2BJVA 1W44A 1ELOA 1UM8A 2ZJOA 3IO5A 2GXUA 3TNFA 2GJ9A 4JBXA 3TR5A 4L8GA 3K0EA 3TJZA 1E0JA 4NYJQ 2WVJA 3X1WA 5KDDA 2PZFA 4UQOA 3UG6A 3U4QA 2W2TA 4JLBA 2XAUA 5JEDA 1AKEA 1E1QA 5HCNA 3RDPA 2BKUA 3FDIA 2D7DA 3QUSA 2IYWA 3ZVMA 3LW8A 3R8CA 5JEEA 2P2LA 4DHEA 1RKBA 5FI0B 3QVUA 2CLSA 3GJ3A 4E09A 2BIFA 1GNQA 1KSHA 2F55A 1I4LD 4QL3A 2J45A 3QF4A 1PV4A 3R9WA 2IYXA 3O8BA 1KJYA 1P9NA 1GKYA 3CPHA 2UZIR 5DH9A 1LF0A 2ZJBA 1W4RA 1E2JA 2ANCA 4NYIR 2AN9A 2W6JA 3KQLA 1AS0A 1N6IA 4B74A 2XZLA 3LNCA 1GFIA 5J4YA 4EKDA 1F3OA 1JR3E 4NCKA 3OIWA 4AG6A 1US8B 4B35A 1GNRA 1JALA 2Z5FA 4JJZA 1NBMA 2BBWA 3KKPA 2IW3A 4HAWA 4HEJA 4K46A 4M4SA 3W6NA 2QZ4A 3BIFA 2QM8A 1VCNA 4Q7JB 4IXNA 2G88A 3GLIB 1VIYA 2GZDA 3RS2A 1IN6A 1XXHB 1ONBA 1FTNA 1E1QD 2A30A 2VH5R 4LBYA 2G83A 4O2RA 1TADA 4OQMA 4CW7A 4L15A 4ZI2A 4C4PA 5CYPA 3ZVRA 4BZPA 4DEXA 3B60A 3QXHA 4A92A 1YZGA 3VX4A 1Q0UA 2G1JA 1RRPA 2IF2A 3LQRA 5FOVA 3U7EB 2QT1A 5EE3A 3D3QA 4C0LA 5DGXA 3BJIC 4US0R 3EZ9A 5FTMA 4QHSA 2MSEB 5KO2A 4TZ0A 3A8TA 1MR3F 5A5GA 1VECA 1U94A 1FFHA 1GUAA 2W6JD 3UMRA 2AKAB 1TF5A 1ZUIA 1HTWA 3IEVA 2YOHA 5FBWB 5HZHA 5GADl 3AGPA 3KXLA 5DISB 4WOPA 3GEHA 2Q6TA 3O8CA 1Q21A 2ZJ2A 2ERXA 4QBHA 5LDDC 2VF7A 5AUNB 2MMCA 1KSFX 1CJMA 2OT3B 3BH7A 4PAQA 4S2EA 1ZCBA 1ZW6A 1MABA 3PG5A 2OBLA 4FINA 4LJ8A 1HV8A 1P2SA 1XEXB 4YMWA 3BH6A 1D9ZA 1ETUA 1RC8A 4L16A 5TVKA 1CRQA 1XZQA 2BVNA 4RD6A 1QG4A 5FPHA 2AFIE 1YZQA 1CU1A 1NKSA 2ZYUX 1DARA 2NO7A 1II8A 1BIFA 1SULA 3HR7A 3O8RA 3DEFA 3VNVA 1KSJA 4L4UA 1W1WA 3SBDA 1FP7A 2X1VA 2ZSBA 4A2PA 3NWJA 5A0FA 5IT5A 1E0KA 2F9LA 2R6DA 4TMTA 4A0RA 1KDOA 1WDTA 3BWDD 4DC9A 8OHMA 2YOFA 3K70C 4AY2A 5F9FA 2ZYTX 4EPYA 3ASYA 4JLPA 3ZS9A 2AXPA 3LVRE 3EWAA 2BWJA 4B2PA 1N0WA 1JAIA 2VLIA 2DCUA 4DT1A 3E70C 2Q0HA 4TT3A 1U98A 3K0AB 1A2KC 4BFTA 3TMKA 2IYQA 3OESA 2R6GA 3OAAA 3IPYA 4JLVA 4XJXA 2FSGA 1Z5ZA 5CIQA 2R2AA 2H18A 2OESA 2BCJQ 3MWYW 3AGQA 3A4MA 4Q5IA 4IFBA 4KITB 1OH7A 4CEHA 3U60B 3AEZA 4PC6A 4TYYA 2DWOA 1J7KA 4HUQB 5KSYA 4LYAA 2VP6A 3KKMA 4Q9LA 3T15A 3WXMA 3PUYA 1IN7A 2FEMA 3B1WA 2J41A 2ZVPX 4JL5A 2O5VA 4LJ9A 4TMKA 3K70D 5JJLA 1Z2AA 1B0UA 3LVQE 4NCJA 1FL9A 3OE7A 4RZ3A 3RRNA 4B32A 4GI7A 4I1OA 2G9NA 3EARA 3NBFA 4XWKA 4PPFA 3NC0C 1R2QA 4DVGA 4F4CA 2RGBA 3PENA 2CVHA 2FGJA 1E0AA 1DAHA 1ZYUA 1JPJA 4B71A 2QGNA 4HLCA 3A4LA 3JVVA 5FUXA 3EIQA 4CRWB 3HJNA 2D7CA 4TT3D 3WYFA 4GSYA 2P5SA 3U4QB 4TTPA 4EFLA 1T8UA 2ZRJA 2IL1A 1QF9A 1N25A 1WCV1 1ZD1A 1PLKA 1ZU4A 3LV8A 3OAAD 2QBYA 1XPRA 1UF9A 2DWPA 1KK2A 3DDCA 2NO0A 1UFQA 4P4SA 3TK1A 2CCJA 4A0HA 1KI6B 3Q8XB 1P5ZB 2AX4A 2A2ZA 1AZSC 5GJCA 1W49A 4KYIB 3X1YA 1P75A 3ZZTA 3QF4B 3ASZA 1R4AA 1E2LA 3R20A 5FR2A 1EX6A 2GAAA 2JLWA 2J46A 1OT3A 3LLUA 5EE5B 4URWR 5EXSA 2WWHA 3I5YA 2LWIA 2P67A 4KHZA 3K0SA 4FI3C 1KNXA 1L7VC 4QNRA 2BKEA 2C2HA 3BB4A 5K8IA 4BUJA 4JBYA 2F6RA 2XX3A 2RHDA 4R98A 2JDIA 2ZU6A 4M1KA 4DLSA 1DG1G 3QG1A 4ZDJA 3OE7D 4US1R 3A1WA 5CM9C 2V8OA 3ADCA 1ESMA 1R10A 1WMSA 3ZLJA 4UJ5A 1H65A 3FOZA 2R6FA 4U7DA 1DOAA 2ZRDA 1N3BA 4TLDA 3RHFA 2IWRA 1E2NA 3B2EA 5F98A 4M1OA 3FYHA 3LBIA 2AR7A 2QRZA 5EZ6B 3WHLA 5BW8A 2GETA 5DSZA 4PPNA 1XCGB 3I1FA 1EFHA 3WY9A 2RKOA 4LJYA 4UNPA 1IM2A 2A5DA 4KJZA 1G3UA 5AUOB 4B48A 2VEDA 1HEIA 1XTJA 2IYRA 1YKSA 1J2JA 3KXKA 4JZKA 2K5UA 4LHXA 2C77A 2ZRMA 5C2JB 2WBLC 1J8MF 5C4GB 4JSTA 3BS4A 3F0TA 1NN0A 1AZTA 1HY3A 3L2OB 2NGRA 1UEJA 2OBNA 4PO8A 5EJEA 2ONJA 1E2GA 1W0JA 1E9AA 1Z0FA 2EVWX 1SXJE 3SJBA 2YINC 1LV7A 4YDHB 2TMKA 5BN4A 4QM7A 1NVVR 5AJWA 3HR8A 1RJ9A 2MMGA 4JLJA 3LBHA 1XPUA 1PJRA 2REBA 3KQNA 3T06B 1XJQA 3SBEA 4YMTA 1F6BA 4ZV4A 5CJPA 3U7GA 2JDID 4OHZA 1E2FA 1QVAA 3M6AA 3TVTA 5C1BA 2QMUA 3UKDA 1E3MA 3L8ZA 4RCZA 1WBBA 3CLVA 1ZVQA 1NF3A 4EJSC 4YDSA 4E5UA 3RC8A 3ZD7A 1XTQA 1JI0A 2ZEJA 4ZO4A 4FCTA 1TQ2A 2EFCB 3QG5A 1KO8A 3CR7A 4HB3A 4HZIA 4M9SA 2CDNA 4P3YA 1JAHA 3B7GA 2X2EA 2DR3A 1MABB 4B3GA 1OE0A 4NYJR 2PLFA 1ZIPA 3L43A 4A6PA 4XTRA 2Y8EA 2G0NA 4HB0A 1GKUB 3TW8B 1UDWA 4PZYA 1ESNA 1NMYA 4PAMA 3PQCA 5K8TA 5HTKA 5JWHA 4DBLC 1UBFA 4LHZA 3C4JA 3TW4A 3VR4A 1NRJB 1NMZA 2KSQA 1L4YA 1CKEA 5FI1B 4DSUA 5JRZA 2HEIA 1CTQA 3H1TA 4TMWA 3AUYA 4D4KA 5EP3A 3RS7A 1N0UA 4PO1A 1II8B 2GWHA 1N6NA 2ZSDA 2QP4A 4C0JA 1YR8A 3ICQB 2G77B 2IS1A 4O2LA 1W0JD 4IOLA 2WV9A 3QKUA 2O0JA 4XSGA 2I1VB 2LKCA 3K70B 4EPRA 1FNMA 1EK0A 1PUIA 4LK2A 4BZXA 1NLFA 4DSNA 3KJGA 5FUVA 5E7MA 1HQYE 3AF1A 1WRBA 1OFTA 2AKYA 2VSFA 3PR1A 1Z22A 4JLNA 4OHXA 1OXSC 4EPTA 1S96A 3AUXA 2ZRHA 4AKHA 2ZJ5A 3JZMA 5BXQC 2GXSA 5EUMA 3GJ6A 3IBGA 1OSNA 1RRGA 2CCKA 3NDBB 1VG9B 2FZ4A 1M7GA 4XTCS 1IOZA 3HPRA 4DT1B 1D2NA 2XZOA 3RLFA 1C4OA 1ZINA 1P2VA 4DSOA 2RGXA 3PUVA 3MRSA 3CX6A 1BS1A 4LBZA 1S1CA 3T35A 3TAHA 4Q7MB 4F7WA 1WA5A 1G5RA 2VYFA 2D62A 4X8MA 2F3TA 1F48A 1UAAA 4YLGA 1OLOA 4RSGA 4CEHB 2HDNB 3I8SA 4Q01A 1P60A 2OEPA 2AXNA 3K0FB 1NN3A 1XNJA 3H84A 4OK3A 3RVBA 3W6PA 4UXJA 4E22A 4I1UA 2OXCA 2AHOA 3BAFA 1E98A 1G3QA 4NH0A 1R5NA 4FMDF 2C98A 4O0MA 5JS8A 3LLMA 4OJKA 2FPLA 2FSIA 3KKQA 1XWIA 2LCFA 3WNBA 2FV8A 3UMSA 5JRJA 2R8RA 1JXOA 3QENA 4B34A 3EPHA 2V9PA 1V43A 3ND8A 2FFQA 2QA5A 4TL7A 3TSOA 1HT2E 3KUDA 3KQHA 4PC2A 2JLUA 3P1JA 4PSKA 2DB3A 2JLYA 4R2IA 3P20A 4AURA 2WWXA 5BYJA 1E9SA 5IF9A 2EFEB 4JVNA 4C0SA 5B57C 5EP2A 5D3QA 2OBMA 2QP9X 3EASA 5FPYA 1UPTA 1SVMA
chains in the Genus database with same CATH superfamily
4U1RA 2QN3A 4JVOA 1WUHS 1B41A 1YQUA 3QXJA 2VSXA 2JAPA 4H7HA 2WWIA 4IDQA 2DF8A 3PZBA 1O87A 3NDRA 1II9A 4NEQA 2JNWA 3S1LA 4DKJA 1KYZA 1NIJA 4MW5A 4NICA 5DTEA 3UUGA 3H75A 3NXSA 3I4CA 5I45A 3F9RA 1DG3A 3IUPA 4NOLA 3HHEA 2EERA 3W7BA 3D0KA 3LHDA 2WFLB 4G5OA 3RYHA 3SCZA 4P4SB 3N0WA 1K06A 1PDVA 4DV6B 4G63A 4LEIA 2P1RA 2VDJA 1DEHA 4M0LA 4B73A 2F3RA 4XIGS 1G1MA 5F1YA 4ZD6A 3OQBA 5SICE 1E59A 1G3IA 2H4XA 2A9RA 4L57A 3GMDA 1PGNA 3COZA 3IEUA 5AD1A 1VBNA 3FUXA 1R6BX 2I8LA 2I87A 4PZUA 3V1MA 3ZKAA 1FP1D 5LPNA 2ZJ1A 1ZDMA 4DLKA 1P0QA 3UJCA 5HBRA 2XH8A 5IDWA 2ZZNA 3C15C 4G0WA 1A9QA 3CLRC 4IICA 2LBPA 2WVAA 5C8VA 3BJRA 4MUFA 4AZ3B 3GC6A 1B15A 2N1MA 5IK2A 5TQ2B 3U7RA 4OLJA 4DV3B 1RI3A 2GYUA 1Z07A 4YWHA 1RWQA 3NHUA 2IZ0A 5KHAA 1OASA 3GFSA 3H4VA 4PV7A 4CCSA 4EHLA 3A3YA 5HILA 4BVEA 1JU3A 3EF3A 5F21A 3DEHA 4Z4IA 3R9WA 3MCAA 4J16A 3EVTA 1KAGA 1G8FA 2CDCA 4JA2A 2QAIA 1WB4A 4M7WA 2ONZA 3AK4A 3QBJA 3L7JA 5BRJA 3ZUGA 1ZXLA 3I6QA 4BWVA 4ZVMA 5TXGA 4COOA 1Q1BA 1MN6A 2FMHA 3AP2A 1DIBA 3LC1O 1BS9A 1CYDA 2V3VA 4WUTA 1KDYA 2W6PA 1FU4A 1KEPA 1V7PC 3VPXA 4ZYZA 1VGQA 2ZCVA 3S2EA 4RSMA 5J2TF 2GBIA 2O2YA 3AINA 3EXIA 1C30A 5HMMA 4ZWNA 1QBKC 1Z06A 1E2KA 3A2KA 1KZ4A 2O0KA 4FLEA 1SQSA 4MRSA 1H0HA 1VP3A 3PRHA 3UFXB 4LZWA 4L6IA 1YDFA 4M46A 3RT7A 5A4IS 4HFJA 1VJGA 2ISQA 1ZGBA 2PLNA 4HQLA 2VA8A 3KTAA 4KLNA 3H8SA 1KRWA 1JKJB 5J5VA 3CLHA 3L79A 4LDZA 4MH0R 3TLBA 1K6XA 4QBFA 5ADUS 1YRBA 3AZQA 2AN5A 1MTOA 2GNOA 5DTQA 3A6HA 3TWOA 3CLRD 1YU9A 3TRJA 3VPBA 3C48A 3KAPA 5CPBA 4C3VA 3TLYA 1W581 3TRKA 4ER5A 1XMXA 2C9DA 16PKA 2GJ8A 2HZBA 1HYEA 1C7EA 1E2HA 2GK7A 1WSDA 2QRHA 4N5NA 5EKUA 3S2ZA 3ENVA 3JYPA 1IZ0A 1VIAA 2IHKA 2YQ4A 3L46A 4NBVA 5L4NA 4WKBA 1NFRA 2VQ3A 3Q8KA 2DERA 5GVSA 2FN4A 2QUAA 4OI2A 1RHUA 1LX6A 3AVQA 1L8XA 3AOEA 3D0OA 4IGEA 2JH8A 3O6VA 4HYQA 4CUZA 3HFSA 1RPAA 5A5EA 1QG6A 1R66A 1IUOA 1PR9A 2Q4BA 2DRIA 2CEKA 1PZNA 3OU6A 1E9BA 1UP6A 1ZMRA 4TN1A 4ZC8A 3FMVA 4LOKA 5BVHB 2EIHA 5EJ2A 2YBDA 3N28A 5JQGB 3R7FA 4JI1B 4CKXA 1ZITA 1CEYA 4DIEA 1HLPA 4BZWA 2P40A 4JEMA 3BK7A 4KIJA 3IE0A 2WIBA 4FYMA 1E3WB 2QTBA 1OT5A 4IDHA 4R1MA 2H48A 1DAEA 3U9LA 1RQLA 5KSPA 1M2GA 1E3JA 3ELYA 3IAXA 3OWXA 3QE9Y 5ITSA 1RQPA 3QI7A 2ZLBA 1KQOA 4HGYA 1SUAA 3GT7A 3NYIA 2C97A 3IUSA 4Q1FA 5JJBA 4FYWA 3EVCA 4I55A 2JB9A 4G0NA 4LY0A 4M7OA 4DIUA 1C29B 3NASA 3QVJA 4Z9BA 1C0LA 2BZSA 2XZPA 4B9AA 4PLWA 3RVRA 4PNPA 3ACDA 1E66A 1LBIA 3BK2A 3ETGA 4XQGA 5KYGA 2YDYA 1CUAA 2VZ9A 1QKIA 3SFTA 3ZD9A 4DXDA 2BR5A 2WKWA 2YWHA 3AVWA 3FHJA 3SXPA 3ZU6A 3ZCVA 4H35A 3U3DA 3AVTA 2O2EA 3AY0A 1GVHA 2GPJA 2VJLA 3OPYA 3EDCA 5EHQA 1DCKA 2V3WA 3LX8A 3X0DA 2NVWA 2QU8A 3COVA 3T7JA 4G8CA 3FNIA 1H4SA 3IOCA 1LPNA 1Z4MA 4Q15A 2W6IA 3CYFA 2X0DA 2GVDC 3SZGA 4KI0A 4A26A 2CJWA 1DRKA 2YWGA 3CN9A 4L07A 2NT4A 1YA6A 2VDWA 1J09A 3WDKA 5DYIA 4L02A 3EEOA 3C8HA 3N07A 4Q4CA 2B4RO 2C9BA 3UM9A 5KU1A 5CDYA 1PFGA 3LKDA 2GFQA 1E9CA 4FNOA 4F3TA 3KJFA 3QEJA 1T5BA 5HW0A 3WGYA 1YFLA 1PKXA 2RH9B 2Q50A 1DC4A 1Q12A 3TOXA 4J8PA 5FLXA 4G97A 1N92A 3JAKA 3ZK8A 2P65A 2HXYA 2ILTA 2JJ2D 1MTZA 4EHIA 4R2JA 1GCAA 5I3ZA 4LTDA 4A16A 3M9LA 5EMMA 2ID9A 1RP1A 2ZR7A 3U56A 3Q6MA 2DQYA 2Y1LA 1H6BA 1T0HB 3B3GA 2FN8A 4NFHA 3I9V6 3QQ5A 1K4MA 3JU3A 1EQUA 4BMYA 1GTL1 4TXMA 3KKKA 1S2NA 3TZLA 5K99A 3BHMA 4MVJI 5EHZA 2IFTA 1SUDA 2J3JA 4RJ2A 1EFRD 1N1GA 1SCIA 1SMKA 1WB9A 2ZYSA 2FXIA 3FF1A 4MUMA 5DZSA 3BH0A 1UK6A 1Z4QA 1WP4A 1IBLB 2AZDA 4CKBB 2Z2JA 2A1IA 3OZUA 4BYMA 2ZRIA 2ODNA 4DCNA 2DY0A 4P83A 4QUGA 1TMKA 4Z9YA 4KKVA 1A4RA 3OIUA 5CVEA 5LB4A 3N0TA 3PIDA 4A6DA 4B46A 1X7GA 5J3JA 1TDJA 4XB1A 4KC0A 1FEZA 2DT8A 4F1JA 1S2LA 2HHLA 4PXAA 3O03A 4XUEA 2ODEA 3Q7QA 1KVRA 1E9FA 2R1ZA 2XLBA 3QUTA 4G25A 5AKGA 3BDIA 1YL7A 4D8XA 4NBNA 1WHTB 4JIMA 3VR3A 1D6MA 4Q6WA 3QKRB 4FFOA 5B3KA 4EG0A 1QAOA 4X8HA 1A9SA 3IBYA 5I47A 3K09C 4DCJA 4BNDA 2ZR0A 1I36A 5FWAA 2IYOA 4FIDA 2XMDA 3GGSA 4FZ3A 2ZI9A 5BT9A 4YMGA 2WMOB 3HU3A 4MA4A 5M29A 1A7AA 2GPBA 4AZWA 2JIOA 4FZRA 5BWMA 3ACBA 1JDZA 1F9EA 1EGMB 4ZQEA 3SSNA 3CNBA 4BWFB 3S5JA 2ZJ0A 5G1OA 4U2EA 5IAAA 4YMVA 5L3VA 3PLRA 4D42A 4R5HA 2AMYA 2ZQZA 3BGOS 1IFXA 4MPJA 4OP2A 5AJVB 4B7XA 4B6PA 5JNSA 2JAOA 3MGAA 3LRPA 3MG9A 4PO9A 4AJHA 2AN1A 1BHQ1 1UP7A 4K2HA 3R7BA 2GCOB 3RBVA 4UOEA 2JIDA 3EXG2 3V80A 3TDKA 2XUOA 3GY0A 3SHVA 3TNJA 4M55A 1O97C 2IY8A 1PNOA 1ECBA 4KVGA 2QRKA 4CPDA 4K0RA 3TTSA 2HD4A 3LSYA 4KO2S 5BW5A 4D4LA 4PG7A 5ABPA 4MS4B 4KRYA 1F0PA 5KYVA 5LDHA 1T9HA 4HQOA 3F4KA 3KPJA 2HF2A 4C76A 1E58A 1J8VA 2MSLA 3UXYA 1J39A 1RAGA 4IX9A 4IIVA 3A1SA 2H4FA 4QVGA 4TKUB 2QDKA 2XNDA 2Y2VA 2ZYAA 3H0KA 4N0MA 5ALYA 1JT2A 3P4XA 5A4AA 4KFUA 3BX1A 2I7CA 5LZ7A 3V7NA 1JAXA 1H8HA 3U81A 1NKTA 3I5AA 2V0GA 4MRVA 1EJ0A 1CF2O 2AMFA 3R44A 2W70A 2H5JA 2AXQA 2I6QA 1SA0A 4IWYA 5EVJA 3OETA 4RK6A 3LGAA 3U61B 5I9MA 1E5XA 4K88A 2ADFA 2X4LA 3NDJA 5IKEA 3DYIA 1JNYA 4B3MB 4ZTUB 3BWVA 1R9NA 4Y9DA 3PRJA 4BXOB 1MVOA 2YNMA 4IJUA 3HZOA 4YVFA 4DARA 1A5TA 5K4HA 1IBMB 1RI4A 3NVMB 4JR0A 5AK6A 4ZDWA 1LUAA 3ZHXA 2Y0PA 2DFVA 1UQTA 5SYAA 3G2QA 1B74A 3K4HA 3GNTA 3LIIA 5M7EA 5BMVB 2J9FB 3I23A 1JT9A 1O97D 4V02A 3NDIA 2WWRA 2IC5A 3DLHA 3E0QA 2NX2A 3L6DA 1OWNA 5CA1A 2VJYA 4CV2A 4IDNA 2VFAA 2QLLA 3A3OA 4P1ZA 1UMDA 2YHSA 3INYA 3EGEA 1E77A 2KMLA 4IWXA 4LJSA 4IXTA 2DHRA 2JAUA 3TI7A 3ZWQA 4RVFA 5JHGB 2I80A 5KPDA 2WMYA 3WMWA 1EFVB 4P53A 4RO0A 2O8BA 1Z2EA 1S0UA 1QRAA 2JIPA 2Q49A 2HJGA 3H9GA 3HJFA 1DJNA 1GTRA 3FE2A 3L0SA 4H60A 3RM3A 2I6XA 1VLJA 1YO6A 1PV1A 2DTEA 2GYVA 1F2TB 1E79A 2VNJA 4ATNA 2XMQA 4DKXA 1GG5A 3IUQA 5JO9A 1IATA 1VE9A 2E6KA 2IZ1A 3A36A 1TK3A 3NBAA 1N7HA 3RASA 2R6CA 3DBLA 1Q83A 1A88A 4MUNA 4BP8A 5THXA 1FMTA 2YHBA 1MOZA 3BHNA 4XIYA 3ZWVA 3KOWA 2EIXA 3AVPA 1YOBA 1AQJA 1TPZA 4GP7A 3OFND 1F2VA 3PUKA 1WQ1R 4G4IA 4M9QA 2AW3A 2LGJA 2Y76A 4R83A 3AV0B 1NUUA 4GX0A 4H7DA 4Q4JB 1MHTA 1OZFA 4OREX 3ZZNA 1M7HA 2EX1A 3AX6A 2DPXA 3H4TA 4Z49A 4O4IB 4EY5A 4NXNB 3T3OA 4X65B 3I61A 1XTVA 2ACVA 1U2SA 1W48A 3L1JA 3T1HB 2ASEA 5GAJA 4P0TA 1NUPA 2NLOA 3WLQA 1P77A 3A9SA 1HSZA 4FFWA 2BZGA 2P9GA 2GX6A 4TTTS 4JGBA 2G28A 3G13A 1QZUA 3N39C 4X97A 3RVKA 3UWMA 4X1KB 3GRYA 4ENRA 1FUKA 2WJZB 5D6OA 5KDLA 4HUJA 3RTEA 121PA 3NM6B 6GPBA 2IX3A 1KR2A 2I7DA 2WI8A 4MUJA 1K9SA 3EODA 1FJHA 4FGZA 4ND2A 3V4PB 4U7JA 2WV7A 5E6SA 1FU8A 1LVUA 1QE0A 2QJTA 3SLRA 4YJDA 3L0ZA 1CK4A 4V24A 5JPIA 3WGNA 4QG7A 1TZCA 1E7SA 4CODB 1E69A 2G3YA 2IDKA 4G5RA 2P3QA 4MRNA 4ZGGA 1YCFA 3B36A 2HW8A 4GUAA 5DBHX 3PX7A 1FLNA 1QF6A 1RIIA 5HUJA 1MA3A 2A1TR 4JB0A 2OFFA 4P58A 4PLPA 5T64A 4TV8A 1ZG3A 4P0QB 1IYZA 2K2QB 1UOQA 1C8BA 1JHXA 3GLKA 3PC6A 1LLQA 2RSLA 3NNDA 4RGVA 2I34A 2PK3A 1YNSA 1FP4A 1TO2E 1FCJA 3AM5A 3BM5A 3R0VA 4FX5A 1V45E 4QGFA 3WYDA 2WILA 1FFDA 1LRLA 3HYLA 3NHFA 4FHZA 4GLBA 4JSRA 2C7GA 2FJUA 3COYA 4P5EA 4OM7A 5IANA 3NNNA 4FHFA 2LNDA 2BGUA 5GP1A 1RQ2A 1PL6A 3VI3B 2DFLA 2EL7A 4HEHA 2PD3A 3DL2A 4DB2A 5ER9A 4IUCS 2VXBA 3QBTA 5EZSA 3N53A 3R6GA 3WKEA 2CKDA 3RREA 1C80A 2ABWA 1WUIS 5KTRA 3W3ZB 4BFWA 4O4LF 1LB1B 1NI5A 2XEDA 2OV2A 3W5UA 3GR6A 1GFZA 1YA4A 4G5HA 4A2WA 2X8BA 4L4YA 5HJ5A 2FPMA 5JIBA 5FIUA 3IEMA 4YJ3B 1JX6A 2IUYA 3PNMA 4Z3KA 2RK6A 4KPYA 2C84A 3MUNA 1K4YA 2LUOA 1ZMBA 4LX0A 5C52B 3OP1A 5KTTA 3GP8A 2ZRFA 1K0FA 4M2LA 4ESHA 1A82A 1AUXA 1EM8A 5HQ3A 2H6EA 5KINB 2CJFA 3OOSA 4FFNA 4X91A 3ESYA 4YBRA 4AK9A 1TZBA 3KS9A 1BXGA 1H69A 5BT8A 3T1TA 5CXUA 1F2DA 3W3AH 1XMSA 1BCRA 1HRKA 1IAQA 1K63A 1PZFA 3M89A 3PQ4A 4WY2A 5IM4F 3AJRA 1U8XX 5JYDA 3NBQA 1EDDA 2H51A 1EG7A 3R3SA 3KYIB 3M5DA 4Q9NA 1YRHA 4LXTA 1Y5NA 1AQUA 4L0DA 4OJYA 4Q93A 5JSFA 4FILA 1AY0A 2FZKA 4R41A 2BFWA 1MW8X 2R5FA 1DZIA 3WWCA 1MO2A 1RZ3A 2QY9A 3UJ9A 2WIAA 1FVFA 4QO7A 4QLOA 1QK5A 2BCEA 1ZKDA 2UV8A 1ZHHA 3H9QA 3O82A 4QVKA 4C0AC 1N77A 2Z6AA 3VR2A 4IKEA 5AKYA 5F35A 1M72A 5H4HA 3FKQA 1WUKS 4M87A 4NR0A 1H6CA 3E81A 2RKBA 1WQ3A 4DYDA 4UTVA 3IP6A 1QHNA 2R44A 3GJ5A 2IODA 4KNYA 1JFRA 1U9CA 2BJHA 2D3WA 4M1WA 4NFSA 5KQSA 5JS1A 4YUVA 3O91A 2QE6A 4UM8B 3E9DA 2RE8A 1IHUA 1JHUA 1SBIA 1Q1EA 4ROSA 2K2WA 4URXR 3DZIA 5FQNA 3GV0A 5BN1A 5DI3B 1R5OA 3DFKA 2VCYA 3ZS8A 1O6GA 3PD7A 1ZOOA 3DQPA 4C4ZA 3DHEA 4J0HA 4A15A 4LNUA 5GOTA 2C07A 1Q7TA 1N8TA 4F3CA 4V0RA 3BG5A 1YJQA 4B5LA 3BGDA 1G42A 1GRCA 3GCGA 5DCYA 4YRCA 5DM60 4UKDA 2R7AA 1ISPA 1X1AA 2XECA 4MWBA 2NO1A 3RKUA 2V1XA 1HH4A 2YWBA 3V8QA 4CIXA 4F84A 3AETB 3FZQA 2DSNA 2IV2X 3M9XA 4YJFB 2B0JA 2CLKB 3PEUA 1TB4A 2AW5A 3BMNB 3LUDA 2SECE 1QYDA 1ZC3A 3FWPA 4WWHA 3T5BA 2WD8A 1EUQA 3B8HA 1JR3D 2B37A 2QNRA 3AIMA 1V47A 1VL5A 4JT4A 3IQZA 2Z6QA 2DSTA 5C18A 1G291 5KNBH 2BFNA 2JLBA 3D3EA 5DHRA 2C7RA 1HUQA 2HNBA 4ZAZA 2QUHA 2W2VA 3G3EA 1MD9A 3PQ6A 3BMOA 1RWVA 4CDGA 4LGYA 4RGQA 5I7FA 6ADHA 4AP6A 1BD4A 1JHDA 1P3JA 1FMLA 3RHZA 3VDRA 3W6UA 4YAUA 2VP5A 3RAGA 1M3SA 3IAS6 5BSTA 2HWKA 3IQHX 4WXPA 2FEAA 2EKBA 1KY4A 3PHIA 2FW8A 5AW7A 3T6KA 3ROTA 3T3GA 4BNVA 4L2IA 5EQDA 3MBOA 1RLIA 2JZOA 1QGOA 3FXAA 5KHOC 3ON5A 4D9NA 2BFEA 4KAAA 1KY3A 3P9XA 1JU9A 3FUTA 2YCBA 4PCUA 4E46A 1GUZA 4Q9IA 4E2YA 1YDWA 3HM2A 2AFIA 4FGKA 1HO3A 2NXNA 1FXUA 1PAUA 2ZRBA 4Y9UA 1RBYA 1SUFA 3JV7A 1L4MA 4XYEA 1FNCA 1UKZA 5AW3A 3QSYA 3JQAA 3IGFA 1XPOA 4S2UA 1Z38A 3EFOA 3SDZA 3IRUA 3B9RA 5FWXB 4P7JA 1RRMA 1AKRA 4IVRA 3WB0A 1JDVA 3JQCA 2NO4A 3NBZC 3DV0B 2XZTA 4HWPA 4QJ5A 1XRNA 2ZR9A 3MCTA 3LPAA 1NW3A 1J1ZA 3OJWA 4N0PA 4OHOA 4QXRA 2ZIXB 1I2BA 1CVIA 1K86A 3MZ0A 3ZWNA 3L4BC 4B4VA 4BKMA 2Q3BA 4N7BA 1R00A 2WIKA 5CFRA 1LI7A 4J0DA 4MW6A 1UINA 4UAVA 1P61B 3NYWA 4B4KA 4C4SA 1EVLA 1JEYA 3TH5A 5CLFA 1TQ4A 1E61A 1Z8FA 2WKQA 2A8YA 2ZIUB 2XXJA 1DIAA 1GPMA 3L1VA 3NJRA 2EBFX 4JKIA 4AIIA 1IJBA 1YZLA 1Y4AE 2WNHA 3OZTA 5DEOA 4J2TA 1ADJA 4GOMD 4H77A 3QJYA 1CZNA 1CQJA 2ZYIA 4J0EA 1XL1A 2Z56A 1AGXA 4ILEA 4BJHB 1XIVA 1U11A 2JAXA 4MO2A 1O6ZA 2ERYA 1JJVA 3GUVA 3E9CA 3ESQA 3HUFA 1UOEA 1GJRA 3BRQA 4IFTA 2V03A 3K0KA 4AVYA 4Q24A 4R68A 1R8QA 1OILA 2WTMA 3D1VA 2CK3A 2M2IA 1OKKD 4ZTZB 2ZYHA 5KQPA 2QTRA 4QQ8A 4JOSA 3DFMA 3GZTB 2KX7A 3BCHA 2J6CA 4AKEA 1KOFA 2ZB2A 1I2MA 4ZZ1A 3K71B 2C0QA 5TMEA 4DCTA 1C2TA 3MHPA 1TNDA 3H6KA 2JCSA 1VYHA 2KM1A 3EQZA 2H85A 1B2LA 1Y5MA 4A9AA 4Z4CA 1HE4A 3I53A 3H11B 4WI1A 3PUWA 3P0JA 1FYVA 3DDOA 2BHSA 4KE8A 5AJXA 2CXXA 5KTYA 3LZDA 3QWBA 1ZD2P 1NF2A 3RCBA 5HS4A 5DP1A 4PC1A 2CNWD 4RNDB 3VU9A 5AW6A 2GN1A 4I5IA 2GCNA 4QQFA 1I1HA 1IDN1 3SMVA 1ONOA 1CUBA 1G4UR 1V6SA 1JHMA 5IJ0A 3S2GA 2D2FA 3M0EA 3RH0A 4UBMA 5DF1A 1P33A 3OM1A 2W9XA 3VU1A 3SC3A 1N6PA 4NZ9A 2I78A 1DINA 4KQKA 4DMKA 4I36A 2BT4A 5CA0A 2UU9B 4QWMA 1E6MA 4QU5A 1DC7A 1UZAA 1X7ZB 5CYOA 2ZIGA 1Y48E 3T1YB 4KH1A 3Q7IA 4HH1A 4J6EA 1U5BB 2VT7A 2WHPB 3PKZA 5G53C 1QDUA 1SKBA 4YJ2B 1KSGA 3TQOA 4B9EA 4DB4A 3P2KA 4EYKA 5I7RA 1VSBA 1NG1A 3REOA 3RWOA 4H2DA 4Y1GA 3RE1A 1HF3A 3WK9A 3VYTB 2E4VA 4B7UA 3MJFA 4MW1A 2PBFA 3LP6A 4UNQA 3ZK9A 1C9NA 5GTDA 2WNIA 4MA5A 5LYJA 2ZZKA 1TT7A 4QEDA 3KSAC 3R3VA 4EGAA 5TPZA 5KOHB 1JQEA 1KNQA 1ZGZA 4BE7B 4EY6A 2JHAA 3OTOB 2PS0A 1YVEI 10MHA 2IWHA 4ZI7A 2J08A 1LI4A 4JYAB 2C8LA 2IEDA 3BF7A 3KCNA 1S2DA 2V54A 4DR4B 3K6JA 4GIBA 2A92A 2FFHA 2AOUA 1I2AA 2ZBQA 4MQMA 3CEHA 2O5EA 1L7PA 1U8EA 2HLDD 1QFXA 3KKOA 4II2A 2CXNA 2XQJA 3I6BA 3QXXA 3KQMA 5F33A 1KEVA 2HMUA 2QI9C 2QTCA 1NULA 2BP7A 2DX7A 4W8HA 3PIIA 4TS3A 2ZAGA 3DAFA 3GOQA 4FMCF 1BMQA 2NUAB 2WSYB 3LUCA 1DEAA 2YYZA 1K2WA 2OTCA 4ARZA 3M3DA 2HCBA 3BWYA 4JITA 1JTEA 4YRLA 2WEKA 4ERXA 5BSHA 4Y0NA 4ARIA 4F3YA 2OKCA 1QF7A 2GZRA 2XCRB 2W6QA 4L9AA 4ZHSA 3OF5A 3AI7A 2Z4RA 3VPSA 1OA0A 4EJSB 3JD3A 2V59A 2JGLA 4KP7A 3GGDA 4II3A 3EXFB 4C6RA 3JQDA 2HWYA 5CTAA 4M1SA 4O2BB 3GXBA 2F43B 2B7CA 3IO3A 5UKDA 1OWOA 4DDWA 3H2IA 2D13A 3WMXA 3BWCA 1G6HA 3IKMB 1QG2A 2XGOA 4PYKA 5IEBA 3I62A 3KKNA 4JC0A 3D6JA 4ME6A 1V2HE 2QK4A 3ZV6A 2ZETA 3N8KA 3COPA 3D64A 4YQZA 2NAFA 4C7VA 2AE2A 3ICPA 4MWEA 1VL6A 4AMBA 2YFHA 4GE3A 2EP8A 1O95C 1L5KA 2BV3A 3LW7A 1HKUA 4NYMQ 3RFTA 4MWTA 2IOQA 3T4XA 2NZUG 2VNIA 5AW2A 1W4ZA 2XVMA 2Q4RA 3A14A 3AHDA 3ILYA 2DGDA 2XDAA 3TB4A 4IGAA 2VPYA 1QRTA 1S7GA 2P30A 3T3EA 4RK5A 3A4YA 5H5JA 3U17A 3VA7A 3ZY6A 1LSOA 1VE3A 1PG2A 2FEOA 4PS0A 2GEVA 4PX5A 4YPFA 4YMUA 4EI9A 1SIBE 5CDUA 2PZJA 7MHTA 1G41A 1HYQA 2QW0X 3LC7O 5FF9A 1Z0AA 1Z5OA 1RPNA 5H0IA 3RIMA 2QW8A 3TECE 1OFGA 4UVGA 1YDEA 2AJDA 3VR6D 3U7JA 3ZBTA 3TTXA 3AVUA 4RTLA 2HV8A 4MV1A 4PNZA 1WXEA 3WL7A 3IESA 1AMUA 5KVCA 4HY3A 3K7EA 2P27A 2NU7A 2FLVA 2O23A 3MWDA 1J5XA 3VPGA 2GR9A 5CT5A 1U7PA 1UM9A 4G89A 2H7YA 4MLCA 2OO5A 4R2MA 5TT0A 2O5CA 2ETXA 4JGIA 1ZC4A 1Q2UA 1QC5A 2A1TS 2APJA 3PV0A 4R9UC 4U6QA 2P3SA 4PQFA 5SZKB 1WMFA 1YDGA 2WG2A 1ZAKA 1ZK4A 4EENA 3PX2A 2YYSA 2F62A 3FYCA 3G1UA 1ZVVA 2O07A 2JHPA 3R7DA 4AJ9A 3M1IA 4CTKA 1DRJA 1HWYA 2H29A 3DUFB 4EMBA 4EG4A 5H1YA 5I01A 3PEEA 1AO0A 3KYDB 5HUHA 1N2CE 3AM1A 1L7BA 2O3JA 3TSAA 4OP3A 1E3LA 2C5LA 2D0DA 2ZTLA 4I66A 4MP6A 1GUDA 1XGKA 2OENG 3LHFA 1ETHA 4DMHA 2WG1A 4PZZA 3DYBA 4LYHA 4D79A 1O9HA 4DQVA 2R1TB 2GVZC 1DPFA 4QYIA 4XH9B 4A8JA 1VMAA 4M0UA 5KEIA 3G0CA 3H8JA 4CIAA 1OBVA 1OB5A 1EBUA 3RYFA 4ZIRA 4RNCA 4CKCA 2FVYA 4DY6A 3IMKA 1P7WA 4U7WA 2VOEA 4FYVA 4NEGA 1A50B 1M67A 3A2MA 4Q4AB 4D9EA 5JBIA 2PT5A 2H8KA 1K8ZB 1W87A 1YB2A 1Z3CA 3LY5A 3GQVA 1I1QB 2WFAA 3A4VA 2VOJA 1RWOA 5I7VA 4R3UC 3GLUA 2GHQA 3KHKA 4I50B 4EUFA 1NUAA 3GUCA 1JSRA 3E9QA 5E9WA 2IYYA 3CM0A 1Q1GA 4CLXA 1M8JA 1GAEO 4BVGA 3H9JA 4KQ2A 2FG6C 1OHHD 3L05A 1JMVA 4G9EA 2OUIA 1NVMB 1U0JA 2D1QA 3R5XA 5JCOA 2OYRA 4QFCA 1UT5A 3ZTTA 1H1LA 2NMVA 2XT0A 1U2DC 4BO9A 1D6JA 2LVBA 4MW0A 2ZJ7A 4JR2A 4DM4A 1QQTA 1SHZA 2PIDA 3VKHA 5L53A 1NAHA 4GX2A 2PFGA 4XGRA 1PVVA 1BHO1 1G21E 3K1YA 3WK6A 3SPXA 4MQLA 4O02B 4J76A 2IS4A 3ST7A 3HYRA 5G4KB 3EPLA 4TTRA 1QYWA 3GWGA 5DN6D 1S8AA 3O93A 2FWBA 3EWSA 3VDMA 1JFTA 1O6CA 4MVJD 4HAYA 3LJKA 1TT5B 3HH8A 4XWAA 1YR2A 5AOVA 1GDDA 1F5NA 2F1HA 4KIFA 2ZTSA 1SVSA 3VYRB 4I1YA 3KHTA 1YCHA 4NAHA 3RRYA 4JCCA 5LU9A 1HR0B 1WKVA 1ZI9A 3TOVA 1HEYA 2HGSA 4RSRA 4ZCRA 2V5VA 3OZVA 3KPVA 4PYMA 5G2OA 1NVBA 1E94E 2QLTA 3WYNA 1EAMA 4LY6A 3UC5A 2I54A 5CHEA 3T38A 1VHLA 1D5CA 2QRNA 3RTGA 4ZN6A 3VGPA 1ACJA 4JR1A 4NL4H 1KYVA 2DUWA 4BLWA 5C7LO 1JDTA 2J9RA 3GMTA 5AK5A 3AF4A 4M6WA 1NI4B 2UVDA 3TZBA 1AM4D 1K6EA 3P0IA 4YRRA 4YUAA 5J58A 1M2OB 4IO0A 5LD2B 4G56A 1OYYA 2PXHA 1N0IA 3IOEA 5AK4A 5LQCA 1NJ2A 2EQAA 2XIQA 4JJAA 5KYNA 4AUNA 1NVAA 2PMWB 3O7MA 1W5FA 3ZLVA 1P2FA 4RF4A 2HAEA 2P5UA 1TI7A 1AB5A 1GLGA 1ULUA 1BYIA 4HDCA 1FX0A 5IYZA 3QNUA 3MHTA 1OW3B 1GL3A 2IPOA 3DQZA 4IVNA 3ZVNA 1UBTS 1T2UA 2X2PA 1U0SY 1WW2A 3Q6NA 5MHTA 3RYCB 3OQHA 4LZNA 3JAMA 1KGSA 1J90A 4NCIA 5DNUA 5JCPA 4IFEA 4BO8A 2QRGA 3FGOA 1LTQA 4HI0E 1SY7A 2WW8A 2XTZA 3ASVA 2JGDB 1E6KA 3KAQA 3P8ZA 2BFBB 4O1HA 4ZT2A 1CF9A 4W5JA 4C0QC 3IMEA 3M82A 2C4TA 4RVCA 3C3JA 3E22A 1EFPB 1MU0A 2H0RA 2R48A 3HU1A 2DVMA 4HH4A 1W5EA 4K9MA 1RIFA 4LFAB 1SHJA 2GN9A 1G7RA 3D6VA 4RE6A 5JNRA 2C7PA 4QOSA 3H8VA 4P2BA 3GD7A 2HNKA 3ZV4A 4MHTA 5A02A 1JIJA 4CEIA 2MYTA 3HNOA 5DJ5A 1JWAB 2DY1A 4W7IA 1Z17A 3DTVB 3FMGA 3O4IA 1P8JA 5AI9A 5IC4A 3EIHA 2I66A 2P78A 1Y7TA 2BFFA 3G2OA 2PL3A 3HRHA 3JASA 3KVOA 1JIIA 3LKVA 3OIYA 4MS1B 4MROA 1GZ6A 2NP7A 2E5LB 1GGEA 1NDQA 4BYGA 3WP0A 3FCXA 3L4JA 3QVSA 1OWLA 3OCYA 4D8UA 1PUJA 1STOA 5J5CA 3FH0A 1Y33E 3N8HA 3SHQA 2RGEA 4U63A 1PGOA 1X13A 3KOOA 1QHEA 5AQEA 5IN5A 3JR7A 4J49A 4L6CA 3O3CA 4Z1MA 2R96A 1WZNA 3HDJA 3V2UA 4BMSA 2J67A 1KFKB 3WB9A 4PHFA 5K0SA 4J43A 4RV4A 1A4IA 3PFHA 3X1DA 3FI0A 3G85A 1NY6A 2B35A 5GPBA 4AO7A 4RD0A 4M0CA 2UUOA 2VYND 4GL4A 1XHLA 2QMYA 4R8RA 2XYVA 1BEEA 4M37A 4BQFA 1QZXA 1SVIA 4NZOA 1E96A 3KTOA 2PWZA 2AWNA 2QD4A 4QFBA 4KSCA 5CJJA 3ZHUA 4OKIA 3RQIA 3ZGYA 4XYLA 3LQQA 1UPCA 2VBCA 2Q9AA 2YC2C 4L85A 3OLWA 3NM4A 4H9GA 4J1TC 5F77A 2PNJA 3T3IA 2J5BA 2YJNA 3SVTA 1U28C 3IKLA 3DFIA 2PQMA 3SF8A 1S6YA 1L0BA 4YUXA 2GPAA 1NBWB 2FFAA 1POWA 3CCCA 1HC7A 1TYAE 3ZWBA 4RVOA 5AVQA 2QL6A 2FDXA 4RC9A 4RJLA 2R6ZA 4F96A 3JQ8A 3TR0A 3LXXA 2A9FA 2ISSD 3FTFA 5AKXA 2QW1A 1RYHA 1VE6A 4WXMA 4N18A 5B4TA 3DMPA 3Q2KA 1R8JA 2GZMA 1P81A 2NV0A 2P79A 4Q19A 3ZCRA 4QJIA 1FSGA 4LYDA 1CP2A 5LFAA 1DS6A 4RA6A 1WUYA 1GQOA 2GO1A 4ZT7A 4LTNA 4BVLA 3FX2A 2ZS7A 3LOQA 1O54A 3E4CA 1M6EX 1VIMA 4M9ZA 4MS3A 3B38A 1RJGA 1KE1A 1BFKA 5DCLA 1KQNA 2CVFA 3FNHA 3RFVA 2REQB 2JHFA 3PC8A 4H6PA 1V1MB 4WJKB 1SKQA 4XM0A 2Z2KA 1TZMA 1PEAA 5LNK1 2MCFA 3AL0C 2W8BA 3EUWA 3PC7A 4LSWA 4C0HA 4EO7A 2Z57A 3GEDA 4HTFA 2GK6A 2FFBA 4JVLA 5ALZA 1UBCA 1V3VA 1XZIA 3OSZA 5LDGA 1GUBA 4N0EA 5ELMA 1W2GA 2PRJA 3C3MA 1LLDA 3UBTA 2ZSAA 4B8ZA 4QBIA 3N9IA 3GRVA 1Z6QA 1LV8A 3PGA1 1XU9A 5BV7A 1VJRA 3QYAA 3I0NA 2JIZD 2O1SA 2XE4A 2YH2A 2UZ3A 5HM8A 2X5JO 4OLAA 1DBQA 3T1NA 1W0KA 3QYPA 4PYOA 3ODPA 4AUMA 1PI3A 1Z2NX 1HLGA 3G49A 4M7PA 2F1OA 3PF8A 3ZD8A 5A9SB 1J0EA 5ITWA 1VE1A 1GEGA 3KT8A 2OHVA 1GU0A 3DMNA 2REOA 3C1UA 3C3CA 4BE9A 3QFRA 2Q5EA 1SUIA 1R8XA 3KEGA 1QZ3A 2ZRLA 1E5QA 4OPMA 3ZDQA 4CF7A 3VC1A 1K5DA 2YMLA 2SCUB 3STTA 4ANFA 3ELUA 4NOMA 3MTJA 1B1CA 3U16A 3ZI0A 2D4HA 4EY4A 4JMPA 2C3OA 2NNLD 1R6AA 2XGGA 1ONPA 2D1SA 3GCWA 1UQRA 1X14A 3K92A 3WAKA 2CVQA 2W71A 1WEKA 1C8LA 4YRPA 1T34A 2FW0A 3SQMA 3WBBA 1LD3A 3DFZA 4Q3AA 4KFTA 3UAVA 1VP9A 3LLVA 4KQEA 5D51S 5J47A 2OZKA 5FPKA 4IIJF 2ORED 2WDZA 1L1EA 4NYMR 1JG3A 1W8DA 1XTIA 1RPJA 1MQ8B 2WAOA 4FFVA 2C96A 1OLUA 1EVJA 3C7KA 1PO7A 3JD0A 3NW9A 4ZANA 3ZGOA 1MC4A 3I01M 1R0SA 2Z1MA 2GPTA 4DIDA 5JS7A 1N9GB 4JP2A 1XALA 4A10A 2PA3A 4ZVKA 4ZCMA 3LK7A 4Q34A 3VV3A 4WNAB 3ZIAA 4DANA 3JY6A 1WXHA 1JYSA 3W5AA 4BY9E 1CY0A 3R9KA 1XLTC 2WF5A 5E3HA 2C1XA 3QPVA 1WZUA 4JODA 3M33A 4F6RA 2XE7A 3ZK7A 1PW5A 2MR6A 3DE3X 3ZV3A 4X41A 3ZDAA 1UJ6A 1JDUA 5I7SA 5HOEA 3CVXA 1WZIA 4O2AF 3WZLA 3QLEA 4PRKA 4CR8A 2FZWA 4TKVA 2OR3A 3L8DA 3PHLA 3PD0A 5E3IA 3MS2A 3T61A 3STXA 3UO8B 4F60A 4BNJA 2H1RA 1ZWLA 2YXEA 3QBVA 3K9WA 3DPUA 1YJ5A 2DU8A 2CB9A 4ZOLF 3DMDA 3GFVA 2FJ0A 3NDPA 2F2TA 2QMOA 3IDOA 5EKSA 5DTMA 4ZP1A 4TWZA 2KLBA 2IUTA 2NYAA 3O90A 1PFVA 4RFSA 1C9YA 1QX3A 1SNYA 1Z9BA 4R9NA 3RFXA 1OA1A 5FTWA 4XCXA 3MMNA 5K3FB 3LHKA 2AEFA 2PZ8A 1UT6A 4OG2A 2PSDA 1F38A 3B48A 3IPRA 1NL3A 3JQ7B 3ITEA