4TLCA

Crystal structure of n-terminal c1 domain of kaic
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
234
structure length
227
Chain Sequence
HQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPGFDLSALIERINYAIQKYRARRVSIDGVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kinase KaiC
publication title Atomic-scale origins of slowness in the cyanobacterial circadian clock
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transferase
total genus 79
structure length 227
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tlcA00
4Q66C 4Q48A 1NN5A 4KFTA 4PHFA 1G3MA 1NSTA 1S4QA 3VMFA 4B6EA 2VA8A 4O0MA 1N5IA 2JJ2A 4GPTA 3VU9B 2QGNA 4ZCLA 1JPNA 2AFHE 5K8IA 3BE4A 5FOVA 3GLGB 5EZ6B 1EK0A 3HU1A 4KFRA 1FOEB 2IF0A 4IXMA 1MR3F 4B48A 5D3MA 1DPFA 5JEEA 1NN3A 2VP5A 1IY2A 2ZI9A 3BRWD 3CZQA 3GJ5A 4PQRA 4NCIA 5BYJA 4UNPA 1U0HC 5A5GA 4Q4JA 1X8KA 1VMAA 1TX4B 4LJ8A 3ADKA 5DN6A 1GZSA 3BBPA 2JIZA 4FWTA 1PZNA 3WP0A 1OXSC 5FOTA 1OKKD 1Q12A 2O0KA 4CIDA 1JEEA 1FFHA 2Z0MA 3K1JA 5K8UA 3LRPA 1Z6GA 3TQCA 2O0HA 1D8TA 2OV2A 4JLMA 4A8JA 2V3CC 1CJVC 3UG7A 4JZKA 4CEJA 3WMGA 3CR8A 3JVVA 2ZRKA 1GSIA 3QG1A 1VCOA 1VYVA 4LZZA 2QP3A 3ZVLA 5C2JB 3PEVA 1E9AA 4TMZA 4MUBA 1GL6A 1S1CA 4QHYA 1IBRA 4M1SA 4XOIA 3KXKA 2QP4A 2JLZA 5DYIA 4AYTA 4MGKR 1TU4A 3CONA 4M1WA 4OQFA 2J7KA 2ZU6A 4PZZA 4CRWB 4W5HA 1E2DA 4OQLA 5KNDA 1IXSB 3B1VA 1YKSA 3N2EA 1KJWA 2BMEA 3SS8A 3LBIA 3R8FA 5FBRB 4RJLA 1BMFA 1NF3A 1E1RA 4KO8A 1X1RA 4Q9KA 2F6RA 4FMBB 1EFUA 4YLGA 2AFIE 3QKUA 1ODFA 3EX7C 3GPLA 2FV8A 2XJ9A 2Q3MA 4P4TA 5LD2B 1TF2A 4RZ3A 2ZUCA 4XVQA 4TLCA 4C0BA 1SKYE 2J41A 5KUTA 2HLDD 4HAWA 4QL3A 2QL6A 5AUNB 4CYMA 5KSYA 2KSQA 1JPJA 3A4MA 1MO5A 2QMUA 2NZ8A 1T3LA 2B6HA 2XNDD 4CT4B 2ZYWX 4M8NE 3HP1A 1NMXA 1G7SA 1Z83A 3O8CA 1KKLA 1PV4A 4YMUA 3CR7A 1B23P 1JJ7A 3OIWA 3VR4A 1O87A 3A4NA 2CXXA 4YDHB 4L5BA 3WRYC 1XPRA 2VF7A 2YINC 1EXMA 1OFHA 3OE7D 1VHLA 2O8FB 4ZDKA 1YZUA 4GOXA 1FTNA 1BH2A 5AJZA 3MWLA 1E9SA 5C18A 4ZDJA 2ZRAA 2ZRLA 4Q7KA 5HCNA 3W9YA 2XB2A 5F9HA 3I8SA 1E96A 2J7PA 1X86B 2GHIA 4Q02A 2CLCX 2V9PA 3EZ7A 4B71A 3W3ZB 4LHYA 4MGIR 2PX0A 2DY1A 1YZLA 1TTTA 1W0KD 2J87A 1T0JB 4DKXA 3AKYA 4RSGA 1NBMD 2WM9B 4OQXA 4M1YA 3PQCA 3MJHA 4ZDWA 4G1UC 3NXSA 5HR5A 5DHFA 4LJ4A 2QPAA 1IN8A 2MMGA 4AIIA 4C0HA 1M2OB 1YZNA 4PAQA 4TWZA 4C0QC 5E3HA 1XTQA 3OEED 5KPJA 1GWNA 2ZAOA 5C4MA 4CDGA 2WIAA 1P5ZB 3SFZA 4POAA 5K8LA 4JBYA 4RFSA 3TUZC 2BIFA 1AS0A 1Z28A 1KMQA 1CTQA 3I3SR 3O8BA 4XVRA 3TQFA 1XXHB 4URXR 3OIUA 4JL5A 4LBVA 5EE9A 2W6ID 4DDUA 4QBGB 4D0NA 2R6AA 2RGAA 2WJGA 5CIQA 1W7AA 2P5TB 3ZZTA 1P72A 5JHHB 2JLWA 3QF7A 1E2IA 3K53A 2GJKA 3EA0A 3L2OB 2A5DA 3EWSA 2GXAA 2OLJA 2OCBA 2G77B 4GZLA 5CYPA 1II8A 4Q4HB 3P1JA 4DT1A 4NTZA 5CM8B 1CLUA 4S2EA 3SDZA 3ZIAA 3KQUA 4BE7B 1RYHA 2EU8A 2G0NA 2UVQA 3IILA 4EPVA 1IOZA 1OH8A 3GMTA 4PC2A 4O2LA 1NP6A 2GCNA 1DARA 2YOFA 4QBHA 3GJ0A 4Q9LA 4NCHA 3ASYA 4JYBA 5JZVA 2OCYC 3IQWA 4P33A 4KITB 2TMKA 4HLQB 2VO1A 3BK7A 1QRAA 2RGCA 4IFBA 2IYXA 1G16A 1E2JA 2IX3A 3F3YA 3LAWA 3TIFA 1VCNA 4LYJA 4DUGA 4ZIRB 3BD9A 3X1XA 2DPXA 3RDPA 4E07A 4B6FA 5B2ZA 1SXJC 1SZPA 3I5YA 2GJAA 2V7QD 5H68A 2W6JD 1AZSC 3MJRA 4FN5A 2FSFA 1JALA 2G88A 3SJZA 2FZ4A 1GKIA 1G8FA 4LHWA 3H84A 3S1AB 2D2FA 3CRVA 1WCV1 1Q3HA 3AUYA 3TGPA 2ZROA 1KYIA 1R0YA 1AN0A 1AJEA 2GCOB 4PHTA 2WVJA 3THXA 2VH5R 3KL4A 2QE7D 3LA6A 4M53A 1II0A 1W2HA 1OPXA 3WP1B 2PZFA 3GFTA 3KXLA 2NO7A 4V0LA 1N6OA 4P4SA 4AI6A 2NO1A 2ZI4A 5L8VA 3KB1A 3QQ5A 1N0UA 1W5SA 4FMCB 3LWNA 2IUSA 1KI6A 4PPGA 2XZOA 1XEXB 4O3MA 1OXXK 1W5TA 3IPYA 5BYKA 2NGRA 1NL3A 4BRUA 4RD0A 1XJCA 1WQ1R 1SHZA 4K46A 5B58C 4HUTA 4NE2A 1IJFA 1ZVQA 5HTKA 4ZCMA 1WXQA 5GVRA 2OFXA 4ZDIA 3OFND 3PENA 1C1YA 3C14C 5L3SA 2ZAMA 1YRAA 4FWIB 1QZXA 2WMOB 5IDVA 4M21A 3AQ4A 1WBDA 2IA5A 1XB2A 2QROA 3B2EA 4TTRA 1S9DA 2D3WA 1RRFA 3SC3A 5KSOA 1JR3A 3JZAA 1JAIA 1AGPA 1KMHA 1JR3E 1K5DA 4FI3C 1PUIA 3Q8XB 1ZM3A 1IN5A 5FUWA 3RC3A 4AURA 2EQBA 3AGQA 2GJ8A 1KDPA 2P6RA 2OBLA 4M22A 3CW2A 4IDHA 3CIOA 4XTRA 1VIAA 1ZUIA 5DI3A 1Z0IA 2J45A 5AJVB 2V1XA 2QG6A 2I1QA 2NPIA 2D06A 1AKEA 1MRSA 2HYDA 5F9FA 4RVCA 4Q9IA 2V8OA 1I2MA 3LW8A 2GXQA 4B3DA 2F43A 4URWR 3LDAA 4TMKA 2LKDA 3GEEA 5J5CA 4DLXA 1XMSA 1M34E 4V03A 3R9XA 2FPLA 2Q6TA 1I4LD 3K9GA 1X8JA 1DEKA 4URUR 4B75A 4BZXA 1XCGB 2P65A 3EG5A 3TAUA 2BOVA 1WBBA 3BH0A 2WJHA 2WIBA 4AKHA 4TMVA 3UWKA 1O3YA 1OFTA 3K0AB 2VHUA 2VF8A 4FMDB 5SZKB 2PX3A 1IAQA 2WWHA 4RD6A 3T5DA 1E3MA 3PEYA 1AM4D 1ZU4A 2CL6X 4G0NA 2C9YA 2QMOA 4TMXA 1Q0UA 3BAFA 4LV5B 2QEQA 4O25A 2VP6A 2N42A 1DS6A 3G82C 2MSEB 4C0LA 1QHSA 3QEOA 2FGKA 1GNQA 2ZITA 5KNBA 2QAGB 3I73A 3T5GA 3AF0A 3FPAA 3NBZC 5AJWA 5DO9A 4DCNA 1EWQA 1DBSA 1EWRA 4A0HA 1X3SA 2GWHA 2F1HA 1HY3A 3ZVMA 1E4VA 2YWFA 2YZ2A 2FA9A 5E7IA 5FTMA 3B1WA 1F60A 2QRZA 1KGDA 1DAHA 4TYPA 2PBRA 2XZLA 1S2MA 1P9NA 3K70B 1S96A 1DAIA 4F91B 4JLKA 4QBIA 3C5HA 1GVNB 3BORA 5GJWC 2FMXA 1SVIA 2IHBA 1W1WA 3BOSA 4DLZA 4UJ3A 2Q9BA 3DZ8A 4Q1AA 2G3YA 1ZD9A 1ZINA 2R6DA 3N70A 2WOOA 3TMKA 2ZEJA 2PZGA 1G8HA 2IYLD 4W7SA 4MUAA 5LB4A 3ADBA 1XNJA 2R6CA 3LXRA 3RLFA 4ACBA 3CNOA 4TYNA 2P6UA 3P20A 1L4UA 3D7MA 3X1YA 5FOWA 5JSZB 3D6TB 4NZYA 2GK6A 1SVWA 1CIPA 2QM7A 2XTMA 2NO6A 4BZPA 3QVVA 1TUIA 1GDDA 3LH5A 4MDFA 4G5RA 3FMOB 4ESVA 2J46A 5D3MB 3GLFA 2WJIA 2CCJA 5BN3A 4Q4JB 3GLFE 3AH8A 1Z29A 3HU3A 1G9XA 1DG1G 1E9DA 1AGRA 2GETA 2A7QA 2BMDA 5FTLA 2H57A 2XJ4A 4Q03A 3PUWA 3IUYA 1P62B 2FE4A 1E2NA 4A2WA 4TL7A 1G41A 3Q5DA 2WHXA 5B64A 4ILEA 4OBEA 1R6BX 4LJ6A 1VIYA 4CEJB 4D0LB 3CRRA 2AKYA 4A2QA 5H8WA 2JLRA 4NYIR 1W48A 2WSMA 4D4KA 1V43A 4G3XA 3SU8A 4I81A 3L0OA 3I4LA 4X8HA 2ZR0A 4LJAA 2PMKA 5DI9A 2WJYA 3ADCA 5FI0B 2ATXA 2G1JA 4CVNA 1XEWX 3E70C 3IKJA 1ETUA 1W36B 3C4JA 3WNDA 3CPEA 3BJIC 1QVRA 1KI2A 2J0UB 2UKDA 1CULC 5FR2A 2ZXUA 2J0SA 2EW1A 3THOA 1OE0A 3PCRB 1JQLB 4PZLA 4DLYA 4GMXA 1W4CA 4LHVA 2ZJZA 1R4AA 4RKFA 4IVRA 1OIVA 3KQNA 1N5KA 1GP2A 1H8EA 1E9EA 3CBQA 4GRAA 3CPHA 1XTJA 1KSJA 2IXEA 4PAOA 1T8TA 2JDIA 1GUAA 1SXJA 4DSUA 3PFIA 1NJGA 1SXJE 3NBYC 3TE6A 1CF4A 1QBKC 3AP1A 4OHVA 3W5JA 1J8YF 2VQSA 1U90A 2HXYA 1M74A 4D2IA 3BWDD 3U3KA 2J5XA 2ZYVX 4B3GA 3CB4A 1FX0A 1L2TA 4M1TA 1G4AE 2EFHB 4ZI2A 4OHYA 4Q4AB 4BLTA 3ZDQA 4MRVA 1II9A 1DG3A 2VBCA 3MRSA 4MKFA 4NH0A 3SOPA 4PO1A 4NDZA 1UKYA 1Z6TA 4IFEA 2GF9A 1GTVA 2VPPA 4JLOA 4PQFA 5KPDA 1MT0A 2DHRA 5FL7A 4CEHA 2E1RA 1ZM7A 4R9UC 3ZQ6A 1TNDA 4H9GA 3VX3A 1DAFA 5J4YA 1Z2AA 1V5WA 2HV8A 1BO6A 5DIFA 3RSLA 2YVUA 1U99A 2P2LA 3K9LA 1ONBA 4A6PA 4KODA 4YMTA 1DTSA 1FMJA 2ASEA 2WSSA 2NTYC 1MABA 5CK5A 3UMRA 2XZPA 2I1VB 2ONKA 3NKVA 2BBTA 3HR8A 3FMFA 1KHTA 1CRQA 1G3UA 4W9MC 1R2QA 4LJ7A 1TAGA 3NIBA 1RRCA 1FPMA 3LX8A 4IDNA 4MYUA 1EFRD 3RS2A 1OH6A 5FR1A 2XNSA 3QKRA 4TMWA 5G3ZA 3AF1A 3C8UA 3F5FA 4LYHA 4C4PA 3G0HA 4B74A 4CGZA 2FNAA 4L8GA 1FZQA 4PAMA 3U4QA 4MH0R 4RFSB 1KK3A 3VKGA 3LLUA 2OCAA 3B7GA 4K81B 4NU0A 4YXWD 1IM2A 4JIMA 1DAEA 3TRFA 4AKEA 4W5WA 1US8A 4KJZA 3ZD6A 2C8VA 1Z07A 3CF2A 3FB4A 2J1LA 4V0MA 3A8TA 3ND8A 4V0ME 3ICEA 4PQYA 2Z4SA 4BLSA 2IS2A 3QE0A 1R0WA 5GJVC 4TN1A 5BN4A 3KQKA 1M1YE 2W2VA 1OXTA 2ANCA 4G5GA 1CBUA 5H1YA 3H4MA 4JL8A 4F38A 1KKMA 1OJLA 1P4SA 2F3TA 2VHQA 3OEHD 5KTYA 2C96A 2WTUA 1G19A 2QP9X 4DLWA 4D25A 4PO8A 3SE0A 4I99A 4IOLA 4D4JA 3FDIA 3J81k 5JRZA 4IJMA 1K5GA 2GEUA 1N5JA 2F1RA 4Q1EA 1XJ0A 3D3QA 1YE8A 4GMDA 1E4YA 2PL3A 5CB8A 4JLDA 5GJCA 2VTKA 4IOKA 3DL0A 5JWOA 3WNCA 1KNXA 2NG1A 4LV6A 3VR5A 4LV8B 1R5BA 1NKSA 3CM0A 4OI2A 1RRPA 3X1DA 2IYQA 1Z0DA 1UJ2A 2JLXA 3FYHA 4D6PA 1Z2CA 4HZUA 1RFLA 4PZYA 3MCAA 1T91A 3ZS8A 1N6HA 1RZ3A 4UQOA 1GRRA 4MGZR 4Q5IA 2QI9C 1DAKA 2AN9A 2GEDA 4RZUA 2PT7A 1VTKA 3B6EA 3RANA 4B43A 4DDVA 4H1VA 2WKRA 2EYUA 4OJKA 4WZAE 5SZIA 3M4YA 4ZI3A 3THXB 4IOMA 3R7WA 3RRZA 4JBWA 4ZPXA 1JJVA 1X1SA 1E79D 4GFDA 4A36A 4UNSA 1PLKA 3R8CA 2IYTA 1Q1EA 2ZR9A 3B5JA 1XMVA 3B9QA 5G40A 1XMJA 4P4SB 3BB1A 2NQ2C 4IW3B 1OKKA 1ZNZA 4WA7A 1QVAA 2KWIA 1UBFA 3PEWA 2ZETA 1T5LA 4JKYA 4HUQA 1RJ9B 3SBEA 2IYVA 5KOYA 3SYLA 2AXPA 3THYA 3KZ1E 4EPTA 4C2UA 2GVDC 2MSCB 2XSZD 4BFZA 3TVTA 2OFWA 2QU8A 1YR9A 4QOSA 5CIWA 2PLRA 4MYHA 221PA 4I4LA 4DLRA 1J7KA 2HEIA 4QNRA 3WRXC 1IN4A 1CR1A 4B76A 3QENA 1PLLA 4CT5A 3NDBB 2HT1A 2H7VA 4NKRA 2FGJA 2KJQA 3VFDA 5L3SB 2DFTA 4IVQA 1MOZA 4LBWA 4WVFA 4IRUB 4Z1MD 2A5GA 4ABYA 3BIFA 3FKSD 2GBLC 1NNEA 4LC1A 2LKCA 1U94A 1QHYA 4HAUA 4DCSA 2QSZA 2CK3D 3W6PA 1KMHB 2Z6VA 4Q19A 4S35A 3AKDA 4KFUA 3D31A 3MUFA 4OK3A 1NLZA 4QXAA 2JASA 1KAOA 1WF3A 5TY0A 5CDFA 1HQCA 1E9CA 4OK6A 1UBCA 3BS4A 1UADA 1XWIA 1YZTA 1QHXA 5DI3B 5CDFE 2GRJA 2HLDA 4E03A 3UIEA 1A2BA 1Q22A 2Z5FA 1N0WA 1CU1A 4DC9A 2V6IA 2YC4C 1XD2A 1FL9A 4HAXA 4FW9A 2O52A 3AP3A 4HB2A 5FUYA 2XNDA 2FG5A 2IYRA 5BQ5A 1P2UA 2ZJ5A 1AQUA 2Q9AA 2V1UA 4DJTA 5FOSA 3GLHA 3GLHE 3MD0A 3HDTA 1YR7A 2G9NA 1OB2A 5L3QB 1KDRA 3ZZUA 3QUSA 3TW4A 1NY5A 4NYIQ 3OE7A 2CCGA 1VDZA 2AWOA 1F2TB 2X19A 4RY2A 4YMSA 4EFMA 3WYGA 2GJ9A 4UXIA 1RW4A 1OFUX 5FPKA 2A5JA 1ZM4A 2GILA 4GOKA 1LY1A 4WAUA 4US1R 1J90A 3IPXA 3Q72A 1ZCBA 4R2HA 4OJQA 3PITA 4W5JA 5AUQA 5LD2C 1G5PA 3AVQA 1AIPA 4UNRA 4G5QA 3HYRA 1G5RA 4QHSA 3NWJA 3B13B 5CJ2A 4CW7A 3U44A 2G1KA 1W0KA 2QTVB 3DM5A 3PUXA 5E4FA 3RHFA 1G3IA 3THWA 4KSBA 1LB1B 1NBMA 1SVMA 1NBME 1LS6A 3QXHA 2GTPA 2BMFA 2IEYA 3OHMA 4EQ6A 1W36D 4I1SA 3OEEA 4NYMQ 3TSZA 3BXZA 1A2KC 4HLUC 2P5SA 4OI4A 3VR2A 2XOKD 2O8BA 1HQYE 3FKQA 4A4DA 1LV7A 3WNBA 4EPYA 4QFMA 2ZJYA 3W6OA 3NTUA 3DOFA 2W6IA 2V6JA 1ZNYA 5EXSA 2OBNA 2EYQA 4Y0AA 1SVOA 4N0EA 5ELXA 4NCJA 4XSGA 2J59A 3NEJA 4ARZA 1Z6YA 4MRPA 1AZTA 4TL6A 2QUZA 2AKAB 2GAOA 5EE0A 3W3AA 1M7HA 2QMHA 4PPNA 4TSFD 1SKQA 5JWRA 4MYCA 2DFNA 3TK1A 1F6BA 2R6GA 4BEJA 4XTCS 4FD2A 2DYKA 3CWQA 3HWSA 3QXCA 2CVFA 4AYWA 4C7OA 1J70A 2OT3B 3LLMA 1AS2A 3QXSA 4LUCA 1ZM2A 3FHCB 3QVUA 4QJ4A 4E22A 2OHFA 4A82A 3GLFB 1W4AA 1KI1A 3OAAD 1CKEA 5TDHA 2ZR7A 2GESA 2GXSA 3ONWA 4FCVA 1VHTA 2GAAA 3ZS9A 2AD1A 3GJ8A 4BFXA 1X6VA 2AX4A 4BWYA 4IDOA 2WBLC 1P7CA 3GQBA 1E2EA 1DAGA 4BLRA 1NVWQ 2H8KA 1R0XA 3LX5A 2VP4A 5JCPA 1NIPA 4IEEA 4BFSA 3A37A 3U2QA 1G17A 2V7QA 2Z4RA 2W6JA 3N5CA 1I4DD 2NMVA 3VKHA 4HSEA 2EFGA 2QA5A 3QXJA 1E2QA 1OXUA 3UPUA 4LSGA 4LHZA 4EJSC 3TJZA 4Q1DA 1W2GA 1KJYA 2ERYA 3V4FA 2CE7A 4Q4LA 2GK7A 3UMSA 5BW8A 3NC0C 1JXOA 3D8BA 4LK2A 1E98A 3LO5A 1J99A 2QE7A 3K0CC 3QF4A 5AJXA 4LJ5A 4V0OA 3R9WA 5B30A 4RKEA 1ZAKA 3EPJA 2ODEA 1TADA 3W8NA 4DRZA 1G8GA 2EFDB 4L4UA 4DDWA 1ZYUA 5JI3E 1N25A 2ZSEA 1JEDA 2KE5A 5AK0A 4XVUA 1NIJA 5TVKA 1H8HD 1NVVR 3B78A 5IHPA 2BBWA 1SXJB 1T9HA 1Z0KA 4IEIA 1WE2A 1KI8A 3HU2A 4C0SA 1OV4A 1IN7A 2JJ8A 1XCMA 2BMJA 3FTQA 5FPYA 5JJKA 4XD7D 5JEDA 2QENA 4MRRA 1COWA 2YKGA 4QHTA 5P21A 1U8AA 3BB4A 4HB0A 1FX0B 5EE5B 3QBTA 2XB4A 3BFVA 3LVQE 2QQEA 3OFNA 3TW8B 4DSNA 4ESHA 1FW6A 1D2NA 2X77A 2YWGA 3UK6A 3EPHA 3BH6A 3JZMA 4ASUD 1IHUA 2V55B 4CEHB 1VYTA 2RGGA 4OI1A 2CVHA 2RHMA 3GJ7A 4R2IA 4FCTA 2OESA 2V4ZA 3WMFA 2BV3A 1P61B 2ZM5A 2BM0A 2ZSDA 2ERXA 3QXXA 2WAYA 5JHGB 2ODNA 3PJRA 3G5UA 3AUXA 3RYTC 4CEIA 4R71A 2EFEB 4JLAA 5JFGA 2CJWB 4DLVA 2ZSAA 4LYFA 3CRQA 1T3HA 1MABB 3VKWA 1QHHB 4Z8XA 1BS1A 3EZ9A 4X8MA 4N0DA 3E5HA 4M9ZA 2JLUA 4A9AA 1RE0A 2HCJB 3V00A 3U7FB 1UDWA 2OILA 3LY5A 4JBXA 1ZP6A 2W2XA 3EWAA 3WBJA 3B85A 2BC9A 2OAP1 3AM1A 1E1QD 3QKRB 2X1VA 2CL7X 3ETLA 1XEFA 1TMKA 1G5TA 4TLEA 1RIFA 5EXXA 3RWMB 2AL7A 1UFQA 2W2TA 1ZRHA 2DCUA 4JMPA 5FTNA 3GLGA 3BERA 3N2IA 3QKSB 3V9PA 3ZGXA 4Z51A 3GLGE 1ANKA 4OK5A 2HXSA 1XMIA 1N6KA 2GBLA 4XSHA 3UATA 4PO9A 3WY9A 4M4SA 2F3RA 4YQFA 2UZIR 1US8B 1ZIPA 1ZM9A 1D2EA 2KBEA 4UKDA 5JJIA 4NYJR 4KSCA 1CR2A 2FU5C 1XD8A 3T1QA 3U5ZB 1HA3A 3I92A 4TTPA 3T34A 3P26A 1E2FA 4LGMA 4C2TA 2ZI5A 1L4YA 1TEVA 4B3FX 2WWGA 5EJEA 1UPTA 1E32A 4TLDA 1NLFA 4P32A 2RHDA 2C03A 2LWIA 2VSFA 2GA8A 2GXUA 2BBSA 4BEBA 1OLOA 3FOZA 4OHWA 2DR3A 2B21A 3JVUA 3QPUA 1IJEA 1Z0JA 2IWHA 5JLJA 1P73A 2ZJOA 2NO9A 3KUDA 4ZO4A 4KU4A 4TZ0A 2BWJA 3W5IA 3PR1A 3SN6A 4H1UA 4FIDA 1CP2A 4G5OA 1D2MA 3VX4A 3BH7A 1VKJA 1NN1A 3F0TA 3O8DA 3QIAA 4DBLC 2R9VA 2IYZA 5FPHA 1N5LA 2XEXA 2HT6A 3U61B 2PLFA 1UKVY 4HDQB 3UXMA 5FOUA 3QKTA 2BKUA 2IYYA 4NPHA 1XP8A 1W4BA 1RC8A 3LFUA 1Q1BA 4DHEA 3NG1A 2IXGA 1KO5A 2VHJA 2QGZA 1KSFX 2DWQA 4G01B 2MSDB 4N3NA 5DE3A 4MKIA 4KHZA 2HJGA 1NN0A 4HDOB 4JSTA 4URYR 2OM2A 2Q3FA 1CS4C 4JLBA 1FNNA 4JJKA 4LI0A 2OAQ1 3A1UA 4QBFA 4XWOA 1ZUNB 2C9OA 3MGCA 4ZKDA 2PH1A 3CX6A 2MMCA 2YV5A 3R7WB 1HH4A 4NP6A 4NL4H 1GOTA 1Z3IX 2O8CB 4V0KA 4D26A 4AYXA 4UNQA 3BFKA 1EX6A 3X1ZA 4TQUS 4HLUA 2BCGY 1E6CA 2OZEA 4PXAA 2X8AA 3M6AA 3WHKA 4GT1A 4CZ2A 4N1AA 3ECCA 5A0FA 4AWXA 4TYWA 1G20E 5L3RA 3GEIA 2IBMA 4BECA 5LB2A 3T1VA 2JAQA 2F1JA 2J3EA 4RD4A 3O8RA 3ADDA 2FN4A 1N6RA 3C7KA 3THYB 2A5YB 3X2SA 1XZPA 721PA 2HF9A 2D7CA 1DAMA 1P9RA 2E87A 1KY2A 3LD9A 4EPXA 2VLIA 3MWJA 2PJRA 1QHNA 3FWYA 2C5LA 1LW7A 3FFAA 1ESNA 3VHXA 1T0HB 4FMCF 1F5NA 2CHQA 1G4UR 4MA4A 1L8QA 3GJ3A 4XH9B 1KK0A 3L8YA 2J9RA 3KKOA 3EC2A 4Q47A 4JLPA 3KTAA 1A5TA 1VPLA 1Z63A 3TR0A 5HPYB 5JS8A 4KAXA 3KKMA 3L43A 1ZCAA 4A8JB 2ZJ2A 3CNLA 2VHCA 1ZIOA 2ZRNA 3KUCA 4DZZA 4JS0A 4C0AC 4TT3D 2D2EA 3A6PC 1CXZA 2VP0A 1TEXA 1KK1A 1AK2A 1AKYA 1C9KA 4QC2A 4MDEA 1XXHA 3KJIA 4Q01A 1YZKA 3SBDA 3K09C 1XXHE 3E1SA 2JJ1A 3CZPA 4V02A 3BC1A 4EUNA 3DO6A 2LCFA 1R8SA 1U2RA 1HEIA 3GJ4A 5HKKD 1NG1A 2FF7A 2Q0HA 4TTQA 1Z0FA 5AUPB 2ZJAA 3CX8A 4U00A 1VG9B 2WKQA 5HE9A 1XD2B 3SYNA 2R8RA 1I4TD 1F3OA 3QEJA 1LFDB 2DWPA 4DSTA 1HYQA 3CRW1 2AR7A 4EJSA 1YJ5A 1QDEA 1TPZA 1GNRA 2ZS8A 3VNUA 2P0EA 1W36C 2RGNC 3GLHB 2X2FA 2EWWA 5J4KA 2BBOA 1FNMA 2YYZA 3FMIA 4P3YA 3P32A 1FUUA 2BJVA 2ZYUX 2QPOA 3PEUA 1U8YA 3EZFA 3K0CA 1G3QA 3VR3A 4GI7A 1SKYB 2GKSA 2IYUA 2VRWA 4HAVA 4NYMR 5DHAA 5HZKA 3U60B 5F98A 4FXPA 1GNPA 4Y0VA 4PC1A 4TQAA 5FBQB 4XIGS 2C77A 3NHBA 3CF0A 2ZANA 5E7MA 3FHTA 2PMDA 4EFNA 4I1OA 4ZKEA 1Q1ZA 3IDQA 2FPMA 4KYUA 3EXAA 5C46F 2CMKA 1S3GA 5C1BA 3ZD7A 4OYHA 4ZIRA 2IF2A 2ANBA 2PJZA 4URVR 4DXAA 3U3OA 1JB1A 2HF8A 3HYTA 3U44B 2ZS9A 3H2YA 2FH5B 1GM5A 2QT0A 5FFMA 2VYFA 1OB5A 3HPRA 2ODBA 3THWB 2F7SA 1KTVA 2QTHA 1KZ7B 4MQBA 5KU1A 5CJPA 4FMDF 3A4LA 3RRYA 1MO4A 1EFRA 4JJZA 2FSHA 3SQWA 1Z6XA 4RFVA 4NCKA 4M1MA 5KSPA 3S1AA 2J0QA 4TL9A 5FPSA 1G8YA 3ICQB 1R0ZA 3QBVA 1NVVQ 4HZIA 3GFPA 3ZYCA 5TXGA 2R2AA 3W34A 2PCLA 4HDCA 2IW3A 3C5CA 3LQQA 1FMLA 2D7DA 2JLSA 2ZREA 3B1XA 1E2MA 1SVKA 2IUTA 4YXWA 2WJVA 3RS3A 4ERNA 3IIKA 4YDSA 1OF1A 3DHWC 5KDDA 2YC2C 4M0LA 1W44A 2AXNA 5EQTA 3PXGA 2C9CA 4DCUA 2JLYA 2QY9A 4RCZA 5BXQC 1AS3A 3A36A 3L0SA 4ARZB 2OXRA 2ZRDA 1NMZA 3IBYA 3VNVA 3EARA 3U7EB 5KDLA 3T15A 1YU9A 2WPDD 4B3CA 2CLSA 1XEXA 1DOAA 1FQKA 2WMNB 4IDQA 2C78A 1VYUA 3KQHA 4TLAA 4R98A 5HZHA 4KI0A 3GLIA 1NG9A 1GFIA 1XTIA 3OEHA 3AVVA 3GLIE 1R5OA 1IY1A 4C7OB 1XD9A 1CRPA 3IQXA 3EIHA 4G5SA 1VCMA 5C4GB 1OIXA 4TL8A 4JVSB 5JRJA 4KLZA 3T1TA 1PLJA 2D74A 4XJXA 5UKDA 1OYYA 5JS7A 1VG1A 3DM9B 4BPBA 2ZE8A 5JECA 1YZQA 521PA 2C95A 4V0NA 5AUOB 4LYAA 5F3WB 2NIPA 3DVLA 1KJZA 2FEOA 4ITRC 2QQ0A 3C41J 2ZS7A 1OW3B 3W8RA 6Q21A 4A0GA 1Z8FA 421PA 5IK2D 4TMTA 2D4HA 2ZRGA 2FOLA 4OHXA 3U3JA 1IXZA 1W0JD 2IS1A 1II8B 4DT1B 1MO3A 1MRNA 4QJ5A 5E7JA 4B3XA 5GJBA 4PC3A 1F2UA 4MYTA 5BN5A 3UG6A 1OXVA 2X2EA 3T35A 3AB3A 2CL0X 4AKIA 1GL7A 2CNWD 4RZ2A 1ZJ6A 4EAQA 1BKDR 4Z8YA 2ZRMA 4PFSA 4X8OA 2IEZA 3QJYA 3KKQA 3SYKA 4EPWA 4ON9A 1QG4A 4F4IA 1N0VC 2V54A 2BCJQ 4HLDA 4KVGA 4NYJQ 1BYIA 2BEJA 1T5IA 3I8XA 2HCBA 4RD3A 4BQSA 4F93B 4JVNA 4D0GA 2WWFA 1GIAA 1W46A 2P6NA 3QF4B 4LJYA 5KYKA 1MKYA 1CJMA 1E69A 3KDSE 1ZD1A 1DELA 3R9IA 1G64A 1IQPA 1HE1C 1ZBDA 2WWIA 3UANA 4XWKA 1SVLA 3EAQA 3Q7PA 4KBFA 3TUJC 4QM6A 3NHAA 2YWHA 4AK9A 1XJQA 3KQLA 2XX3A 3GCGA 3LW7A 2NZJA 4LDJA 2XSZA 1KO1A 4QGAA 3KKPA 4Q1BA 2VHTA 5CLLA 3OIYA 2VEDA 4LPKA 1QHGA 4UJ5A 1LF5A 4WOPA 2QN6A 1OH7A 3RWOA 1DE0A 4U5XA 2OXCA 5DNYB 1WP9A 1UM8A 1QHIA 3RABA 3ZH9B 2REOA 1JI0A 2Z43A 1T3SA 5CK4A 4Z1MA 3SJBA 1A4RA 1EESA 1TQDA 2FFAA 2RGBA 4JLVA 3U7HB 2CLDX 2B7CA 3FKSA 1YZGA 4QRHA 2BDTA 2R62A 1KI6B 1R7RA 3CKLA 1Z22A 1EGAA 2CK3A 3RS0A 5DSZA 2C99A 5EE3A 4CEIB 1SHKA 1BIFA 4LWZA 1JXMA 4B47A 4GZMA 4DEYA 4MRSA 4WZBE 1ESMA 2ZRBA 2ZRFA 1T8UA 2O0JA 4HEJA 3TBKA 1PUJA 2OCPA 4YONB 4YMVA 1Y63A 5AR1A 1E2GA 4DIEA 3K0EA 2NO0A 1KSHA 5JSZA 2W83A 3TSOA 3VR6A 4DIDA 2QBYA 3DPUA 5IT5A 3DKVA 5G3YA 3SJAA 4FINA 4MKGA 4LX0A 3MG9A 2B8WA 3AVYA 3EZ2A 3GJXC 3K70D 2AK3A 2OO7A 5CLQA 5EUQB 3NH9A 5TB5A 4EFLA 1YRBA 1A82A 2W00A 4P31A 4MRNA 5AWFC 3RAPR 2W58A 3EZ6A 1GL9B 2EWVA 1GKYA 2O5VA 4A0RA 1RVDA 1IXRC 1GG2A 3TLXA 1OHHD 4LBZA 4F4CA 3NBXX 4TYYA 4R7ZA 5L3VA 5JWHA 5A4JA 1B0UA 4PSVA 4D81A 4A0FA 3QY0A 3K09A 1ZD8A 1P2SA 2IHYA 3FVQA 4QGHA 2JJ2D 2F43B 3A1TA 3OZXA 1UDXA 4YC7A 2BEKA 1XU4A 4TZ6A 4B3BA 1YQTA 1ZNXA 4M9QA 2XXAA 3I1FA 2ZRIA 2FFQA 3IIMA 2CEAA 2DFKB 3H86A 1R5NA 1G8PA 1R10A 2RGNA 4E09A 2QNRA 1S3SA 5DN6D 4HB3A 4B32A 2JIZD 2Q9CA 2J0UA 2H92A 1TQ2A 4MGYR 1U0JA 4LCBA 2XOKA 1YR8A 1KNQA 1OYWA 2VP2A 2AK2A 1XPOA 4JL6A 1NVUQ 5DLQC 4A1FA 1GILA 3W6NA 2VL7A 1IN6A 3QPWA 5EP2A 4EPRA 2VIIA 2ZSFA 4M1KA 4PPQA 4UXHA 1D5CA 2ZVQX 2Q3HA 1EX7A 4P0TA 3A1VA 2H16A 1CEEA 3P4YA 4K8OA 4KYIB 1S8FA 3TNFA 3GJ6A 1Z5ZA 2CCKA 4TSFA 3ZVNA 1ZW6A 3AF4A 1N6IA 3QG5A 4IOJA 1VG0B 4GOJA 3SI7A 3F8TA 2WJJA 1WRBA 3UMFA 4U02A 2B8TA 4KVAA 4C0JA 1NJFA 4IHQA 1HV8A 2ZTSA 2JEOA 2DBYA 1BMFD 5ANRB 3ZJYA 2ZRCA 4TLBA 4Q4AA 1E1RD 3B1ZA 4PC7A 2WWXA 3CLVA 3OAAA 2I4IA 2REBA 3IHWA 1XTRA 4BFTA 2W0SA 3NBFA 4C3ZA 4WBSA 4JVLA 5HE8A 2FX3A 4BLQA 2ZRPA 5FBWB 2RGDA 1KI3A 2GVZC 1L7VC 5J47A 2Q21A 5AJYA 3V4RA 2ORIA 3Q3JB 2WWYA 2DB3A 2OBMA 3PUZA 3K9HA 4PSAA 3AF3A 5FI1B 3A58B 3KXIA 1QG2A 4YMWA 1D9XA 3L8ZA 4B35A 4B2IA 1K8RA 1KO4A 4AG5A 2HJVA 2QMEA 3OESA 4DEXA 2XITA 2JLQA 1DADA 2BKEA 1M8PA 2FJUA 1VCIA 1NI3A 3CX7A 3L0PA 4A92A 4B73A 5CITA 1X8LA 4GP7A 1JECA 5JJLA 4BZQA 4KFSA 1LNZA 2J0VA 1G291 4RZXA 4ZCIA 3KTAB 1XX6A 1E0KA 2NOAA 2O8EA 1Q3TA 5FUXA 1FP7A 3LVRE 5J40A 3EW9A 1I2DA 1GKUB 4OKSA 3FGNA 2D62A 2QSYA 4BRWA 4B44A 2B7BA 2C04A 3U3MA 1G7RA 1DO0A 4LC0A 1KI9A 5DGXA 2FSIA 5DH9A 2ZSBA 3Q5EA 5H70A 4EKDA 2WV9A 1SULA 2J7PD 4TQ9A 4WXRA 3TR5A 2G0TA 4HYYA 4P4UA 3NVAA 5J4LA 1TQ6A 1H8HA 2ZI7A 3REGA 1NMYA 1Q20A 2F9LA 2CHVA 2IWRA 1RRGA 1EG7A 1HT2E 3SHWA 2HDNB 1NY6A 3B9PA 3BFXA 1TL7C 1E94E 2UZ3A 4Q1CA 1FQJA 3NDPA 4KV9A 4XD7A 3HJNA 2VSXA 1G6HA 4DLUA 3MFYA 4EJSB 3DOEA 3LBHA 3CUEF 1NSFA 2O8DA 2JATA 3UWOA 1A7JA 1S9HA 2A5FA 4DLSA 2GF0A 3LNCA 2ORWA 2CHGA 3TH5A 3RNLA 3CRMA 2DFLA 1C4OA 4ASUA 2JA1A 3MLEA 1OT3A 3AKCA 1Z6AA 1KO7A 3MWKA 2ONJA 4QKQA 3AF2A 3OIVA 4IKEA 4PSKA 1P3JA 4B2PA 5CYOA 1J8MF 5EP3A 2ZI3A 1TQ4A 2RB4A 1H65A 1E2KA 4M9SA 3GP8A 4BLOA 2GZDA 2WICA 1R8QA 4M9XA 1Z0AA 2ZPTX 4HI0E 3K0FA 2QM8A 2QZ4A 1WDTA 3ZIAD 1U9IC 3CNNA 4MKHA 1E9FA 4KBGA 1RYFA 3EIQA 2RAPA 1P6XA 1N6PA 4NCNA 3DZDA 1NKTA 3SJCA 4LOAA 2QRNA 1Z08A 4OL0A 3ZQJA 4KLNA 1DVRA 3SZRA 1E1QA 1HE8B 3TKLA 1AQYA 1CR0A 4HB4A 4RD1A 3RSOA 1W47A 1M6NA 3IEUA 1YHNA 2ZRHA 4UXJA 4DB4A 3VQTA 4BUJA 1ZNWA 3QPVA 2OSBA 2CBZA 1P2TA 3KB2A 1XTKA 3C15C 2H18A 1E9RA 2YNMA 3L0IB 4DUGD 2XTZA 5E95A 1ZMXA 2RH5A 3CWZA 4LY6A 2ODWA 2HUPA 5FOXA 1VECA 1Q21A 1RKBA 3EA5A 4GDFA 2QPTA 3IBGA 4Q21A 1LS1A 2IUUA 5G53C 5GVSA 4D82A 1RJ9A 3VR1A 1E0SA 1KI4A 2RGXA 4J0QA 1HURA 3VU9A 1S1MA 2OFOA 2VP9A 4XWAA 3GLIB 2WZQA 3IGFA 4L9WA 3DEFA 3KJEA 3U4QB 4LHXA 1COWD 3REFA 1QF9A 2A30A 1HT1E 1DO2A 3SQXA 2XGJA 5KHOC 2OG2A 4C0KA 1AA9A 3IEVA 2N1BA 4HATA 4WXPA 1OSNA 3AKEA 3VAAA 4DWJA 4U7DA 1JQJC 3K8YA 2GEVA 4BLPA 2P67A 2FSGA 4PX9A 2FPKA 2PCJA 1UBGA 1F2UB 1JAHA 3MSXA 4L9SA 1JBKA 2C98A 4HLCA 1SQ5A 1KAGA 2GZHA 4PHGA 5FUVA 2WOJA 4JLJA 4LBYA 5F2EA 3SR0A 2KB0A 3RS4A 2PT5A 3A1SA 4BASA 3CF6R 2JCSA 2XAUA 5TV2A 4DLTA 1XFAA 3I32A 3SNHA 1KZGB 1KO8A 1ZC4A 2P3SA 2GNOA 2PZEA 3IO5A 2YOGA 2WKPA 1JR3D 3TAHA 2KI5A 1SVSA 4DCVA 1GRNA 3K0SA 1S0UA 8OHMA 5L3QA 5EE1A 4AD8A 3U6KA 3AVUA 4HZUB 4DB2A 3PVSA 5FTKA 4EIWA 2CE2X 4PR0A 2YHSA 1F2TA 3OF5A 1XPUA 4MITA 1UBEA 4KXFB 4AC9A 1HUQA 1PJRA 1LVGA 3B1YA 2QAGC 3B82A 2ZUBA 4DSOA 5EZ5A 1MH1A 2RKOA 4B2LA 2W0MA 5JMTA 4Q9JA 1XBTA 2QT1A 2IS4A 3L82B 2ZE5A 1EFHA 2FFBA 5K8TA 2E9SA 2EFCB 1NVXQ 2F9MA 2FWRA 1HTWA 3SEAA 3I61A 2R65A 3K70C 4GL2A 1U98A 3WHLA 4FCWA 2ZYTX 2FEMA 2O8FA 3NC1C 4JT2A 5IRCD 1OH5A 5DISB 3CH4B 5J4HA 4HUQB 2H5EA 3VTKA 4QNMA 4JLNA 4TT3A 2HYIC 4II7A 1M7GA 1P2VA 4JT4A 5D3QA 1E2HA 4US0R 4ACAA 2GCPA 1KK2A 4QJ3A 2ATVA 5KNCA 1VG8A 3FMPB 3CO5A 5HKKA 3HR7A 3ZVRA 1MO6A 3T1OA 5FH9A 1Z06A 2XTNA 1CJUC 3TUIC 4X8LA 1XCPA 4IXNA 2DWOA 4F7WA 5JCZA 1G7CA 4Q1FA 4Q7LA 1BYUA 3AEZA 4WZ6A 3FHOA 2QBYB 1PVOA 3R20A 1CJKC 3KFXA 1G7TA 2JGNA 3RS7A 2K5UA 4BFUA 1KDTA 2IC5A 2G6BA 4PHHA 1CJTC 3DDCA 3LV8A 1M7BA 1XRJA 1KY3A 3AVWA 4QM7A 2YJTD 1FTSA 1G18A 1A1VA 1J2JA 5FBVB 5CM9C 3C16C 4EDHA 5KO2A 4A8JC 2CDNA 2RCNA 3GEHA 2ZJ8A 2WAXA 2ZU0C 1UAAA 2H1LA 2AHOA 3NEYA 5EUMA 1N3BA 2I3BA 3FFBA 4DCTA 4PPFA 2KBFA 4Q4HA 1W49A 1EFTA 3UKDA 3KJHA 5EXPA 2IYSA 3GD7A 3DMDA 1IY0A 4GNKA 4JKIA 2F1IA 2L0XA 3EIEA 4UNNA 4WW0A 3ASZA 2XXAB 1Q44A 2OLKA 2RGEA 4QGFA 2OUKA 4BFYA 3SHFA 1G21E 2G83A 3AVPA 3AGPA 5SZHB 5GADl 5EP1A 3Q9LA 2OE2A 1UKEA 5CB6A 5EXTA 1N6LA 2AD5A 4BFVA 4PTLA 1E99A 1NRJB 4Q00A 4D4LA 1MV5A 3ND9A 4WIAA 2PEYA 4CF7A 2IXFA 5FL3A 3CH5A 1KOFA 5FBLB 2BHRA 5HCIA 3H1TA 2BM1A 3O47A 4D80A 2FDCA 3ZLJA 1W4RA 621PA 4OQNA 3X1WA 2PEZA 4DDTA 2R6FA 1CR4A 5IF9A 2GZAA 4RCYA 1BOFA 2B92A 2JJ1D 2Y8EA 2BVNA 2WPDA 2R44A 2Z83A 3LXXA 5FPTA 4A6XA 1U9IA 4I1UA 4EQ6B 3BGWA 4A2PA 3B8HA 2YWEA 3RS5A 1ZUHA 3MAAC 4QG7A 1XF9A 1U81A 3EPLA 2GCOA 4LPSA 2O8BB 4JVMA 1XDBA 1XEWY 3HPQA 4A15A 3AP2A 1UEIA 1Y3AA 5JI2E 3EASA 121PA 1Z47A 2QTFA 1H8ED 4NHOA 2IT1A 3H0KA 1G3RA 1Q57A 4KCGA 1UEJA 4OHZA 4NBSA 2JDID 3LBNA 2VSOA 4DVGA 1FUKA 5TMPA 3RC8A 4QGGA 5IK2A 3ZZ0A 4BGDA 1IONA 1SXJD 1ZU5A 2GJSA 4IDPA 1D9ZA 1KSGA 3Q85A 1KIMA 2ZRJA 3QSYA 1W0JA 1U8ZA 1GRQA 2ZJBA 3RRMA 2A78A 1E2PA 1GITA 3PIRA 3IHLA 4ZV4A 2CJWA 1YR6A 4GSYA 4LRWA 3TSWA 3Q7QA 4RD2A 1QHHA 3MMPA 2QORA 2IS6A 4NONA 2CNWA 4AY2A 2A3RA 2IYWA 1N6NA 1ZC3A 1G6OA 1UKZA 3AV0B 4IVPA 3LQRA 1KDOA 1UF9A 4O2RA 4D4MA 3AVXA 4URZR 2N46A 2ZE6A 5EP4A 2O8EB 1YVDA 5FL7D 1WB9A 1SGWA 3P4XA 1Q1QA 5J4VA 3PV0A 4Q7JB 3PUVA 2ZIAA 3QKSA 3QNUA 4LJ9A 1K6MA 2REXB 1ELOA 3IIJA 4L16A 2H17A 3KFVA 2WSSD 4GBMA 1LTQA 4M2LA 5JBQA 3NH6A 3U6BA 4OI0A 4HAYA 3I62A 3KKNA 3RRNA 2RMKA 3T61A 3I72A 1T6NA 3I5XA 1NLYA 4B34A 2SHKA 4NMMA 1F48A 4HAZA 1TUEA 3VHLB 3P27A 2F55A 1N2CE 2AWNA 1E0AA 4TYQA 3IO3A 1OIWA 2ZVPX 3DMNA 1KI7A 4AKGA 1U0LA 3PUYA 4C30A 4JYCA 1P9WA 4L15A 2ZQ5A 4BFWA 1E2LA 4OQMA 821PA 1TF7A 5KSZA 3WBKA 4Q9HA 3WYFA 2O8DB 1E0JA 2A2ZA 4Q18A 1E79A 3T06B 3U7GA 3FE2A 3KX2A 3KJGA 2ZUDA 4AG6A 3WYAA 2ECKA 5LPNA 5DYGA 3BB3A 2BJWA 5KDOA 5TARA 1TU3A 3U3RA 2WWWA 1P60A 3B60A 1WMSA 3EPKA 3K0AA 3MWYW 1OFIA 2ZE7A 3A1WA 4Q7MB 1EFCA 3WMEA 5B57C 2JLVA 3M0EA 1P75A 1E9BA 1XZQA 4Z54A 1GAJA 5M04A 2A9KA 4F4JA 4B33A 2ZI6A 3K0FB 4GP6A 3M1IA 1T4GA 4M1OA 4PANA 4F92B 3QI2A 1D6JA 2QAGA 4US2R 2OEPA 1LF0A 3DKPA 2EVWX 3SFVA 1JNYA 3GFOA 3T12A 2IK8A 4I1VA 3RVBA 2QAJA 3AVOA 3AVTA 3K9NA 3QOFA 2YOHA 1WA5A 4E5UA 2FZLA 2GDJA 4PC6A 2ORVA 5BWMA 1TF5A 5G41A 3W90A 3TVDA 1JR6A 4JSYA 2NPFA 2O8CA 1FP6A 3E2IA 5LDDC 4C9BA 5FTJA 1G1MA 2C2HA 1RPZA 2FFHA 1XTSA 1OHHA 3PG5A 5SZJA 3EC1A 2IL1A 3CPJB 3WXMA 5LBIA
chains in the Genus database with same CATH superfamily
5COBA 5FNVB 4FHZA 2HF7A 3LT5A 2OO5C 5AVOA 4BQQA 2J67A 3FNIA 4EZEA 3M7IA 3IAHA 3C6ZA 3KALA 3VU9B 4EYEA 2AFHA 3AHEA 5H0IA 1RKUA 3EZXA 1JPNA 2E4ZA 3BGOS 3WWDA 2J09A 4DIMA 1G6Q1 1UBLS 4EB6A 3PFFA 4PFJA 3D4IA 1FOEB 1SXGA 4Z4FA 4B48A 3BD6A 4DQLA 4QUKA 1ZVVA 3BL8A 3E8XA 4NCIA 2HWYA 2C4UA 1A8PA 4HAIA 4Q4JA 5A5GA 1X8KA 5EESA 5FWYA 4QOIA 3L7KA 2I6FA 3WR5A 3DD1A 3I5MA 2ID8A 3FX2A 1PP4A 3L6OO 4U2GA 3W1VA 1OXSC 2DFDA 1RI5A 1SOWA 4J7XA 5F1PA 4NZPA 1T4CB 2I6SA 4G4SP 3LRPA 1Z6GA 1D8TA 2WNHA 5IUKC 1KDVA 1CJVC 3GCXA 4YAJA 3S27A 3WMGA 3HXMA 1GSIA 5SYAA 1CDDA 2OOSA 4LZZA 2QP3A 5C2JB 1E9AA 1NDHA 2UV8A 2HQBA 1XELA 3DE1X 3ILHA 3IMCA 3RF6A 2NUTA 1P45A 1T9GS 3AM5A 4MQFA 3OIFA 1CUZA 1IBRA 2GN2A 4QHYA 1QQBA 4M1SA 1UP4A 3KXKA 3LGXA 3GNQA 2AYXA 4AYTA 3ORFA 1CUFA 4AM8A 4HFNA 2YMQA 2B4YA 3CONA 2PH3A 3PSHA 2J7KA 2ZU6A 2B61A 3ZZMA 3HK2A 4LRUA 3U4CA 4OQLA 3NTQA 5FHQA 2POQX 4AAYA 4ZHQB 3PKJA 4A03A 1RAFA 4L5JA 3TPFA 1IHPA 1YKSA 1T6BY 2A88A 2BMEA 2EG9A 2MSKA 3LBIA 1N5RA 2VNAA 3BJEA 3HHEA 3QLUC 4RJLA 4WOCA 3K94A 4XJVA 5DSTA 2FAXA 5FBRB 2Q7DA 1E1RA 3AR6A 4CL0A 3O7MA 4KO8A 4ZWNA 2OGUA 1VLLA 2F6RA 4BVGA 4GXQA 3EX7C 1ODFA 4HXEB 2Q3MA 4Y67A 1BJKA 4AULA 5ICSA 5LD2B 3T7JA 1TF2A 5FHRA 2KW5A 2JAXA 1W9MA 4DR1B 4TLCA 1C2YA 4C0BA 3Q7EA 3OZRA 5AKXA 5JD6A 1IBKB 2AVDA 1R27A 4RABA 4F86A 3HBFA 1NF2A 2F3UA 2P4HX 3O4HA 1PW5A 1JQ5A 2KSQA 1K6IA 1MO5A 2W8BA 2Q4TA 3AB7A 2QMUA 4PEVA 1Z13A 2O3JA 4DYDA 1RPAA 4EYQA 4M8NE 5JBNA 3V9AA 2V97A 1P44A 3NR2A 4YMUA 3WGYA 1B23P 5LA6F 1JJ7A 3MGKA 1ISFA 3VR4A 1O87A 2NW6A 3UOGA 3A4NA 3KPWA 3WRYC 4QTYA 1XPRA 1ZGJA 2J3IA 3IV7A 2E2WA 1OFHA 1V39A 1OZAA 2DC1A 1XEAA 3OE7D 2OG1A 4GKBA 2XMDA 1Q1GA 4FJ1A 2I8LA 2XMQA 1E9SA 1BHJA 2WAAA 2YZMA 3DP9A 4U6SA 2XB9A 3UXYA 1I0LA 4MI3A 2DHQA 1ACJA 5HCNA 1Z33A 1KY4A 4XM0A 3W4JA 5F21A 1C1DB 2BE7A 3ZWBA 1MW9X 3I8SA 2ZSIA 4IIGA 4W8HA 4DA9A 1X86B 4I9HA 1P0PA 3HBNA 2HD4A 3OCUA 4ZOEA 3WV5A 4H0CA 4MVJG 1JW9B 1VJ0A 4B71A 4C21A 4MGIR 5EIWA 1YZLA 1T6ZA 3YASA 1RMYA 3EMKA 1NF8A 5BV0A 2R6JA 3NHRA 2I34A 3AKYA 4NULA 3ZXUB 1S3FA 4H0FA 4C7VA 3RVDA 3T3GA 2VRCA 1E4EB 3NXSA 2Y66A 4LJ4A 1C30B 1M5TA 1JJIA 1R0RE 4MQ5A 4P38A 4PAQA 4TTIA 4U7HA 3KIPA 3KHSA 4V39A 3HV2A 1GWNA 1CY8A 1W1UA 2YY6A 3NNSA 4G0UA 3DXYA 1PJ4A 3ST7A 4POAA 3E58A 3FRIA 1IDOA 5DGTA 2XODA 4JBYA 1LX7A 3H6GA 5KX5A 2GH1A 3I3SR 3ZTYA 3HN7A 2WI8A 2YWDA 3O8BA 4JMLA 4XVRA 5CIYA 1Q6YA 1U31A 2PWBA 2D6FA 2X0EA 1ZIXA 4CG3A 2CF6A 3OIUA 3EGVA 2GLTA 4AICA 4J0HA 2W6ID 1JQKA 4URXR 1WPRA 2P3QA 5DT2A 1HM5A 4QBGB 4B4UA 3OMWA 5AM3A 2WJGA 1Q7TA 3W2HA 1B42A 1LDBA 5JECA 1EWYA 2INGX 2JFBA 2PXCA 1E2IA 1F5SA 3RTAA 4PYJA 3EA0A 3L2OB 3HCWA 5K6RA 3WLFA 3B7WA 3NNNA 3SKXA 1SUIA 5FYQA 2G77B 4ZOAA 1XXLA 4D9HA 4Q4HB 3P1JA 4NTZA 2J3KA 1CLUA 4J3FA 5CM8B 4ZC8A 3SDZA 4CKCA 1I5RA 1SOAA 1U3DA 3TM4A 1VL8A 4DR5B 1IOZA 5JDCA 2R47A 3WLQA 4LF8B 3GMTA 1U0TA 4MQEA 3L0YA 1PGJA 3C6MA 3HUEA 4JDUA 1DUSA 1U3TA 3EQZA 5E1BA 3GJ0A 2ZSKA 1GDTA 1CUHA 1WUJS 2QMQA 2YFHA 4AZ3A 5K3AA 2OCYC 3GR6A 3SEZA 4P33A 1NWHA 1NVDA 3GMSA 4RPJA 3LRXA 2W8ZA 3ILSA 3KKEA 4M0DA 1TK3A 2P1RA 2O05A 2J6HA 2YXNA 3F3YA 3LAWA 3TIFA 2X0FA 3VZDA 5KQGA 4R9NA 3BD9A 3LHIA 3TG2A 3F3SA 4G4JA 2F90A 1GGVA 4Y7CA 1SZPA 1MOQA 3HO6A 4V2IA 4JUCA 2GJAA 4F4FA 3IAS6 5H68A 2G70A 1AZSC 2Z9BA 3DV0A 3RFVA 1ITZA 6REQB 1JALA 1FFDA 2QZJA 1C3VA 2IHZA 2XUHA 2YHIB 1XYYA 1IK6A 2FZ4A 2HI0A 5FWXA 4LTMA 1XRPA 3GVHA 4YRJA 2CDRA 3NJRA 4BKRA 2Z5LA 3QOWA 1JLHA 1WG8A 1ZH4A 3AUYA 4DMFA 3AM4A 1MU0A 2ZROA 4L4SA 4C6TA 2FMFA 1B00A 2FEPA 1K7YA 1AN0A 1EDBA 4MAMA 4R0VA 4DRXB 2GCOB 1AJEA 3EXEA 5F23A 4MB0A 3PT5A 2X13A 5K03A 2D1SA 3FTDA 4TWBA 1L4BA 1W2HA 4L4RA 3NRJA 5IAEA 1UIMA 2V4MA 3H8JA 3KAQA 2A84A 4WLFA 2D5CA 3GFTA 1DTWA 3R5KA 4WVLA 7MDHA 3NP9A 4P4SA 3ZY3A 4AI6A 1K8ZB 1T35A 3NBAA 1PWEA 2RG1A 5F77A 4D99A 1L4NA 2FSVC 2ZBGA 1W59A 2DU8A 2VYQA 2IUSA 1KI6A 1XEXB 4DE5A 2J5RA 3Q8KA 4LGVA 10MHA 2GO1A 3BCSA 2GCGA 2C2MA 2NGRA 2NZUG 3FGPA 2VT7A 4DCPA 3S8YA 3NHJA 1GCGA 4CEHA 2F2TA 4Y9RA 1XJCA 1EVKA 1M0WA 2GX6A 3ZJ5A 3EFOB 1YIOA 5JARA 3AF6A 4ZCMA 1B3RA 4ZDIA 1JZTA 5GVRA 3OPYI 1H2FA 2OFXA 5IVDA 3BSWA 3I4CA 1P31A 1YRAA 2JHCA 1QZXA 5DBHX 4XLTA 4EVQA 2CLFB 3ZI7A 4ECEA 5CH8A 1H42A 2B5VA 2WF8A 1JHVA 3PDUA 1WBDA 2CMHA 3HUTA 5ECWA 2I87A 1XB2A 3B2EA 4TTRA 3GRCA 1S9DA 1WMFA 1XP5A 2XT0A 1PFVA 3MILA 1JAIA 3OUUA 1E7WA 4FXOA 5FIUA 3TFQA 1KMHA 4K6FA 3CTPA 3RB8A 4FI3C 4CG0A 1P0FA 1UOPA 2BZ0A 1ZM3A 2BPOA 2HTEA 3AQIA 5I8PA 2BZ1A 1C3XA 5K7SA 3ZKWA 1T15A 2EQBA 3MQ4A 5T64A 2PKXA 3SDBA 4DXHA 2GPWA 1QH1B 3OJEA 3NBMA 4QRDA 3M89A 3HJHA 4UZSA 1YE3A 4EHIA 4YBRA 2YXDA 2P4QA 4TZTA 2Z30A 5GONB 5D1HA 3LGSA 2V1XA 2OV3A 2I1QA 2D3TA 4R0MA 3KOOA 4WD3A 1CUUA 3JYPA 4B81A 3LP8A 4P22A 3ZTWA 4AMBA 2RGWA 4Z2AA 5C1DA 3GJQA 4IO1A 2Y9MB 2O3RA 5K8JB 2RI6A 4DV0B 1CYEA 3LDAA 1W5AA 3R0XA 4V0QA 1V3UA 1M34A 4KK4A 1GZDA 5LYJA 3P2EA 1J0XO 5AW6A 5D7BA 1LWNA 4V03A 1PQYA 3JASB 1UZAA 2FPLA 2Q6TA 5CJJA 5IDQA 2X3FA 2J6BA 2IRWA 3K9GA 5CNKA 5ARCA 1X8JA 2PANA 2WU0A 1DEKA 2ZJ1A 4B75A 3Q7SA 4BZXA 1RLUA 1UMBA 2HU2A 1YZVA 3DAOA 1WBBA 2BOVA 2WZCA 4YAOA 3TSCA 1JFFB 5B2FA 1O3YA 1RI2A 3AESB 1CE8B 4YJ3F 2WWHA 3F8SA 3PEYA 3G1WA 4PW0A 2CL6X 2GKGA 3PKZA 2RIPA 3T6KA 5LWQA 4ZV7A 1Q0UA 3FA2A 1RC1A 3B3FA 4LV5B 3FYUB 3JWEA 4O25A 4IILA 1LDMA 1DS6A 2A33A 2N42A 3D5TA 3OZ7A 2MSEB 4ND8B 3F3KA 3ZDZB 2B3DA 3INTA 2FGKA 3RR2A 4M0FA 5KNBA 3AJDA 3Q9SA 4QYTA 4CFSA 3AF0A 5BUSA 3FPAA 1ZOPA 1YC2A 4MQ4A 2I54A 2PA0A 1BROA 2Z1MA 2ZIVB 1OX4B 1DBSA 4R1LA 5AJWA 5DO9A 3LRTA 4A1OA 3I12A 2WB4A 4F56A 2GWHA 3LQ2A 3ODGA 2F1HA 5GZ6A 1P77A 3DULA 3OQOA 2OVBA 4QJIA 3LGAA 1PFKA 1WCIB 2J5QA 2YWFA 5FT9A 4ALMA 2ONYA 2P11A 5AIAA 5FTMA 4BX9A 1KGDA 1MJGA 3EJ6A 4TUYF 3RYCA 3K70B 5KTRA 2A9JA 4NPAA 3C5HA 1W5EA 2X22A 1R4MB 2YCBA 3RYHB 1PT8A 1TUBA 5IX8A 1L0BA 3E27A 2FMXA 3WWYA 5CA0F 5HJEA 1DUVG 3DJFA 1W1WA 3H17A 4DPKA 3TDMA 4RIEA 5FLKA 4DLZA 1RYBA 3AIMA 4O5AA 5J59A 4OB6A 4YCCA 1HRKA 1ZD9A 1ZINA 3ZXXA 3FOEC 3N70A 4S1NA 2WOOA 4CG1A 2ZEJA 2PZGA 3C24A 1V6CA 3PNPA 5ALVA 2OFPA 3EVBA 3PGA1 5FAKA 3RLFA 4C6RA 1JWBB 5C51B 3EQ2A 3GVXA 1NP7A 4IRMA 9ATCA 2CF5A 3X1YA 2K4MA 1OLXB 1IQ0A 5JSZB 3MJSA 2P75A 2P3OA 5KYXA 2C7RA 3DBIA 2DH6A 5JYDA 1E8DA 1JH9A 1EWQA 3E9MA 3A28A 1SFRA 1TM4E 3QVVA 4FR5A 5EWLB 3DTVA 3LH5A 4YA6A 3U4AA 4DNFA 2QR5A 1Q7GA 3L1HA 3FMOB 3DFFA 2J46A 1PJQA 3M2TA 5KOHA 3J7AC 1THGA 2O8CB 4K28A 3GEBA 2CCJA 3DE5X 3HU3A 1G9XA 1NBWB 1ORIA 1DG1G 1XA4A 2E3JA 2IDMA 3BIOA 2QRVA 3SMVA 4GRIA 2PZJA 4I1RA 2QSJA 3DR5A 3KYJB 1CEYA 5FTLA 4CM7A 3M9XA 2OB2A 4MPJA 4Q03A 3PUWA 3VYWA 1LU9A 4OLHA 1G41A 1V1RB 4CM9A 2WHXA 1M0SA 1WDKA 3T7KA 1AKNA 2XBLA 1GQOA 5LWHA 3VJRA 4M8LA 1R6BX 1Y6ZA 1ZEJA 3KSBC 1A9SA 4BNTA 1FC0A 3GDGA 1U3GA 4FONA 3CRRA 2AKYA 5E6UA 5H8WA 4CM4A 2MYPA 4HMOA 2CZGA 3L0OA 5DI9A 4EVIA 3DC7A 2VZ8A 2G9UA 5AM0A 4ZT2A 2XR1A 1KZ4A 2G1JA 3JQ7B 1XEWX 3ERCA 1Y42X 5TPWB 3C4JA 2ON6A 4EI9A 3QQPA 5BSVA 4RULA 2VRNA 4M1QA 1VL6A 3OQPA 4LQLA 2QVLA 4EUHA 2A35A 3BRSA 5FR2A 5A5DA 5C32A 3DVQX 2J0SA 2EW1A 1YJBA 3PCRB 5K51A 4Y6GB 4D02A 1W4CA 2VTBB 5JD4A 1MAWA 4L78A 1AQLA 3NV7A 2YMLA 3TRIA 2O5RA 4LDAA 2R68A 3GUZA 2PVSA 2BGKA 1OGYA 4ZXPA 1GP2A 4I9UA 2VJNA 4DNXA 1HYEA 4RF2A 4XXHA 2O3QA 4O63O 3WGKA 4AJJA 1EE9A 4HO1X 3B7PA 4KGZA 3CW8X 1CZLA 4L5IA 2FW0A 1Y6GA 1SXJA 2HBYA 1JKXA 3WGMA 3PFIA 4QAJA 2CNKA 3L7DA 3ZE8A 4Q16A 1Q1NA 4OHVA 4E7OA 4NU8X 4MQ6A 5DX8A 2WG1A 4M86A 1L5HB 1M74A 5DV9A 4D2IA 4UTRA 3BWDD 2XQJA 2QJOA 1Z8DA 4JXKA 2Z1NA 3U3KA 5BYAA 3SXPA 4EFKA 1L2TA 4LISA 1QGUB 5SYMA 3PLNA 2EFHB 3MINA 4ZI2A 1NE2A 1WHSB 1AKUA 3ZNPA 2DT8A 2I6UA 1FSSA 1WVMA 1Q15A 4I55F 1PAUA 2VHYA 4MKFA 4NH0A 1QDUA 2VZLA 4R81A 3W9BA 4PO1A 4N0PA 3TTUA 1DQYA 4G5FA 4PE5B 5FL7A 1ZM7A 4FSDA 5HSGA 4CL3A 1L7EA 5AKEA 1TNDA 2FW1A 4R1NA 1Z2AA 1GTSA 4EG3A 3EQ6A 3N74A 1BO6A 3R7DA 2QLTA 3NJ8A 1MJ5A 4J4BA 3DVAA 1YR2A 3GY0A 3HNRA 2YVUA 1TLLA 1MAVA 1MJFA 2P2LA 3QU7A 3W7BA 1ONBA 4A6PA 1RXEA 1DTSA 1H6BA 1P8AA 1Z56C 2LIPA 2NTYC 2ZTVA 4XDYA 4UFPA 3NKFA 5CK5A 1E60A 4FFOA 3DFKA 3UMRA 1O8BA 3S4YA 3BZWA 2C7GA 5DOZA 3NKVA 4AY5A 2OCDA 3DKIA 1IVNA 5IAGA 4CNBA 1G3UA 4OXQA 1R2QA 4R6XA 1ST3A 2NSHA 2H3HA 3NIBA 4UEKA 4Y7DA 1N8KA 3P2IA 4IDNA 2JBHA 2JFOA 3FYCA 4BWFB 3EUAA 4HAOA 1N57A 1OH6A 2QE6A 2P2YA 2RC6A 2GD0A 1LLQA 3G6KA 3JALB 2AJBA 4OSOA 4TMWA 5ECYA 5HWSA 4LYHA 1S2OA 3G0HA 5D5QA 4EMUA 1MB9A 2LCIA 3FG9A 1XR3A 1XNHA 1DDGA 1Y3BE 2Q6VA 1KK3A 3GPIA 4QQ8A 2PR2A 3VKGA 1T0BA 5DTRA 2NV0A 1JXAA 4YXWD 5B7NA 5IFKA 1DJQA 4B6SA 5C8DA 4RXTA 4DMUB 3IAAA 3FWZA 5CPBA 2IYEA 5FP0A 2QD2A 1I5EA 2Q5IA 3TZEA 4GAEA 1BW9B 1US8A 4NECA 3FNGA 4KJZA 2B36A 1UKBA 2QHXA 4UZFA 4BEVA 1E20A 1KJQA 3ZD6A 1EUZA 3FB4A 4C78A 1Q1AA 1TCBA 4O1IA 5AK6A 2CW5A 2Z4SA 2RHRA 3I58A 1RJFA 1CSEE 2Q3EA 4KX5A 3M5CA 4PQYA 2E89A 2YUIA 4YQEA 1M1YE 1U2QA 2PXAA 3CG4A 1W5BA 1V1MA 1Z8HA 3W06A 1HTBA 1KKMA 2F3TA 3BYZA 4FFPA 1PJ2A 3TXAA 1YL7A 2IP4A 4HYTA 1DCKA 3JWGA 3IOYA 2WYIA 1VSUA 4JQOA 4MVJI 3MJEA 3SE0A 1NW8A 5GTDA 1LLDA 1QQTA 4I99A 1HG1A 1XVAA 4IOLA 4Z99A 3MJVA 2GEUA 3SD7A 3WLMA 2C2BA 2NP7A 2F1RA 1RAGA 3HGMA 4UCQA 1QE0A 3WQBA 3DSRA 4ER3A 1PFQA 4JLDA 4KQFA 3U39A 3JQCA 4IDCA 3IAFA 1B73A 1KNXA 3K72B 2PYIA 1F0YA 2HQSA 2XVMA 3QPDA 4KKXB 4NSNA 1IHOA 3EIUA 3FTEA 3EXIB 4KO2S 3EG9A 2FMIA 3GG9A 1KVTA 3MK31 1H9AA 1GPUA 3KRTA 4K05A 3JAWA 3A2NA 3LNTA 1I7DA 1RFLA 4Q9DA 3WGOA 4FLFA 3MCAA 4QQKA 3ZS8A 1N6HA 1R1DA 2VYND 1RZ3A 4CKXA 1PT7A 4MGZR 4Q5IA 5A05A 3R09A 1PQWA 2FJ0A 1NOJA 4A0QA 1V26A 4U9IS 1TZBA 2GEDA 4RZUA 1OMOA 1VB5A 1M2GA 2OP0A 2UXDB 2PT7A 4AX4A 5F64A 4AN0A 1E7SA 3SC2A 2R79A 4WOJA 1ZX1A 3B6EA 3HZZA 3LCVB 4OU5A 4DDVA 4OJKA 2EYUA 2LBPA 1YNSA 4UW9A 5SZIA 3THXB 3ABQB 4HNRA 4EJ0A 1EDDA 4PHCA 1GTL1 4AJPA 1MZPA 3IL2A 4QE3A 5IH3A 2IKSA 1XKLA 1X70A 4GWKA 1Z4IA 2BHTA 4EHLA 3B5JA 1XMVA 3JSXA 2FSUA 4GNRA 5HDBB 4AUKA 4BO6A 3BB1A 3FLEA 3OLVA 2Y0EA 2XNKA 3QWHA 1U1DA 3E4DA 4HLNA 4LA4A 4M6WB 1QVAA 4F3TA 2R2GA 1JWAB 1YS7A 2MOKA 3DXZA 4JKYA 1RJ9B 2J85A 3FIJA 3L6UA 2WU1A 3IA2A 4RNDB 4W8OA 5KOYA 5LD2C 4ZVOA 3THYA 3DAYA 5CT6A 3RO7A 1QFXA 1BX1A 3JWHA 4YJFB 4Y2JA 4BFZA 4C5CA 1DEXA 1ZXLA 2XKJE 4QOSA 1J0CA 2JI6A 1REQA 1K89A 3GELA 3ML1A 1J7KA 2C0CA 3WRXC 3DLTA 5DBEX 5BSTA 3QENA 1I2AA 1PLLA 1F1BA 1LPMA 2H7VA 1PDOA 2FGJA 1R18A 5G0SA 3NZEA 2DUWA 3PXXA 5DTMA 4IRUB 4Z1MD 2P9YA 1UJCA 4O5OA 1PSZA 2GBLC 5DASA 4TGLA 4LC1A 1U94A 3VYSB 5B6JA 5CCBA 2J5BA 1H05A 4IPTA 2R8ZA 1CUDA 1PVDA 2WHEA 2Z6VA 4RA9B 5FTWA 4WKCA 3T7SA 3V4SA 3DNPA 4KFUA 5IZCA 4W5RA 2IZZA 3UT5A 1OZHA 4P7GA 1ZJJA 4RPLA 1S7CA 1FUYB 1WAMA 2OV6A 5B7QA 5TY0A 1WF3A 2J3QA 1DBVO 1HQCA 3M5WA 4IS3A 4J1QA 4OIMA 3D6FA 3GDHA 1QAQA 5TE9A 1QHXA 5DI3B 3IUMA 2H29A 4GC5A 4U63A 4U1RA 4RSHA 3UIEA 4CF6A 1W6RA 1XZAA 1Q22A 2EEZA 1NDUA 4KXLA 4X71A 4D9FA 1G5IA 4ZK2A 5C52B 3KR1A 1WB6A 3W9YA 1XD2A 4HB2A 3U4MA 2RIRA 2I4TA 4NE7A 1P2UA 1A9XB 4WNAA 4DJTA 3NMUF 3F47A 3FRJA 5FOSA 3GLHA 4CCSA 2HIGA 4N0QA 3O91A 5DP1A 2R97A 3MD0A 4L76A 3ETNA 3HDTA 4R9VA 4WFKA 3UBTA 4RKYA 4CTOA 5L3QB 3Q15C 3VH1A 3S81A 1CIVA 2LP4Y 1XF1A 2BD0A 2P40A 2QY6A 3FVTA 1JZQA 5IAKA 4ODIA 3GK3A 2HIMA 4ND3A 1OFUX 1U7DA 4G1FA 2UUBB 1WHTA 1R0BA 1ZM4A 3HKCA 1ULHA 2V6GA 5AOCA 4QECA 1X7WB 2C20A 3AYXB 3RVSA 1JHUA 3IPXA 4OJQA 3IP3A 3ODPA 2X0NA 2ZUSA 4UNRA 1JUDA 4ER0A 2VH2A 2Z56A 5GGXA 1X7DA 4RL4A 5DXAA 2N1MA 3QELB 5DP2A 4N3CA 2G1KA 1W0KA 1L1RA 2Q7XA 2X6QA 3DM5A 4Z0HO 4LNUA 2NUPA 5CXXA 3T0IA 1MPTA 3T4EA 3MBOA 4BKOA 1SVMA 3EXHB 3UJ6A 4ZU3A 4RUKA 3W5HA 2IEYA 3OHMA 2VNKA 3OPVA 1RXIA 5EG5A 3UCXA 1V41E 1W36D 3TDNA 2QIPA 3OEEA 4NYMQ 1L4FA 4IP0A 3G8AA 1YOVB 2MTBA 5THQA 3TSZA 4WKPA 1A2KC 4BYGA 1WLSA 4E1AA 1PJZA 4B3TB 1YU6A 2JHFA 3NVDA 5LU8A 1HKUA 3FKQA 5AKHA 4A4DA 4WDQA 3HXOA 2VT6A 2IV3A 1YZYA 1CX9B 5BT8A 3DOFA 2NSLA 1D7AA 1AU9A 4DARA 1XCLA 5IU6A 1SVOA 4CQLA 3O9VA 4XSGA 3N2GA 3M81A 1J24A 1NUUA 3OOSA 1HFWA 4MRPA 2WABA 1X9HA 4J6FA 4TL6A 2A0KA 2GAOA 1M7HA 3EDRA 1Y1PA 3B5EA 5GAJA 3K6SA 5JWRA 1QR2A 5SY6A 3KYBA 1X9GA 1BE0A 1DOHA 3E6AA 3G2QA 1F6BA 3PXCX 3OKCA 4G25A 3WL3A 2OVFA 4FD2A 4HC4A 2CVFA 4BVLA 1ZXXA 2C42A 4C7OA 1KETA 5ES3A 2WYVA 2ZFUA 3TLGA 4E22A 4OXKA 3K8QA 4A82A 3QPAA 4GU5A 2O9JA 2D1RA 3OAAD 1CKEA 3IDOA 1N1DA 3TRKA 2ZR7A 1J06A 2GD6A 2FWJA 1CW2B 4P3PA 2CYBA 4OYLA 3VDQA 4J16C 2AX4A 3W4KA 4GEGA 5ILOA 2P9QA 4ZFNA 1E77A 1Y4DE 3BSSA 4XPZA 1P7CA 4Y2UA 1JHOA 5SICE 2OD7A 5KC9A 3IPAA 3UAOA 4AS1A 3G5AA 3TNYA 2W7TA 1DJLA 3D3JA 1ISPA 3LX5A 2VP4A 4KDFA 3RC9A 3PXAA 4IEEA 3EXFB 4KE6A 4X61A 2BY4A 3WLRA 5JCPA 4YCDA 2BSAA 5C0OE 3GLTA 3NYQA 3U2QA 5J5AA 4BNZA 1G17A 2AN5A 2Z4RA 2W6JA 2HHAA 5G02A 5LL6P 1NMSA 3GH3A 2NMVA 3IUBA 2PNFA 4YK7A 3ASVA 3SSOA 3H6HA 1ZI8A 3OIDA 4F85A 1DT5A 1BG6A 1GGHA 1U28A 1ZHFA 3I34X 3KWFA 4R2JA 5CLJA 4LSGA 6YASA 2XCSB 4LHZA 1L4KA 1UM9A 4RELA 1S01A 4ZQFA 1ECFA 4UREA 5K0SA 3TJZA 2ERYA 2CE7A 1SZJG 4GYYA 4QOJA 1GPYA 4CM6A 2PUCA 2ONZA 2WC1A 4YRGA 1KS9A 2ZWVA 1FCJA 2AR9A 3NIGB 4FOPA 4LDRA 4R2KA 1J9EA 3ZCRA 1A9PA 3ACCA 1HBJA 4IHAA 5AW0A 3DH0A 2BJHA 2HXGA 3I28A 4JP5A 1ZAKA 3LM8A 4WK0B 2ODEA 3RVRA 3EPJA 2AYZA 2IZOA 2BFFB 3W8NA 2C7BA 4LYEA 1YQWA 2CLKB 4D42A 4E5VA 1G8GA 2EFDB 2WG2A 3C45A 4L4UA 1Z6QA 4HKTA 4OLFA 3S2EA 4DDWA 1ZYUA 2VEOA 5JI3E 5MN6A 1JEDA 5AK0A 1NIJA 1NVVR 3B78A 3T3IA 4FNMA 4YUYA 1WE2A 2VRBA 4NG4A 1OAOC 5THXA 8ATCA 2BH2A 5ITZB 3OE4A 5AQ1A 3H2KA 1PNTA 4B3SB 4I5GA 4CMIA 5AIBA 4N76A 2QWXA 3KD3A 1CYDA 3G88A 1COWA 1GADO 2JFUA 4PGHA 4QHTA 5JXIA 4KJXA 3M4ZA 3QBTA 3BMOA 3ZV6A 2WFLB 1IBSA 4HQOA 3QNMA 3LVQE 4D6XA 4HRVA 2FFRA 3OFNA 3TW8B 3W05A 3EH1A 4A91A 2ACWA 4DSNA 5KU7A 3U37A 2YWGA 1TEHA 3KR0A 4RIIA 4ASUD 2WD8A 1PQPA 2CVHA 2RHMA 1V7ZA 3PR2B 1QVZA 4PXSA 5HW0A 3WMFA 4E5DA 1ML3A 1QO0A 1P61B 1B8NA 1I2ZA 2C5BA 3CZ9A 2ZBRA 4MYSA 3RAJA 3SBXA 5CA1A 3QXXA 3ZX4A 1ZGBA 2G67A 2N47A 3FTCA 2PD3A 3NFYA 3ZHYA 3PJRA 3AUXA 4MVJD 2NLOA 1H9CA 3TSAA 2CLIB 4J3JA 2GEJA 1JTFA 3CRQA 1T3HA 1MABB 4DLVA 5AVZA 1LBHA 1W0CA 9ABPA 1QHHB 3HKEA 3QLEA 3GRPA 2GHRA 3PHHA 4NICA 5EKSA 4F9GA 4ZJPA 5JAPA 1W52X 4N0DA 4IXWA 2JD2A 2WA1A 1M1NB 1DCMA 1RE0A 2HCJB 3OLWA 1ZUWA 3IEIA 3OX4A 1L4MA 2A9VA 4QIHA 5LQNA 4EWLA 2XADA 2REQA 1FP2A 2DF8A 1T1JA 1Y80A 3EWAA 3N86A 1XMXA 4LXXA 2I78A 3KQSA 1E1QD 3QKRB 2X1VA 2P6PA 2PD4A 3Q0TA 4KQIA 4RHFA 4BKUA 5A9SB 2JEYA 2Q3DA 1XEFA 2FWAA 1TMKA 1WXWA 3KOYA 5JY6A 3GLGA 4XB6B 3QKWA 2DP4E 4D0RA 1GYRA 4MNTA 2HXSA 4H6VA 1O6CA 3BTSA 5I9LA 4R9RA 1N6KA 4HWSA 1XHEA 4XSHA 2BFDA 3LC0A 3LUGA 5CHYA 4YWHA 2VJDA 3UATA 3WY9A 2QUIA 2QTTA 4HUJA 4LG1A 3USES 2B98A 4DL9A 4LWQA 2FR8C 4W9NA 2VAMA 2TRSB 1ZIPA 4TV9F 4HWKA 4KSCA 3PL1A 1TZCA 1XVTA 1WP4A 2V7UA 1CR2A 1X7YB 1YB6A 3H05A 2HPZA 5IYZF 5EAIA 2C5SA 2EJBA 3WLOA 3U5ZB 5BN4B 3ENWA 1ZMBA 2DOKA 4B3FX 1NFRA 2WWGA 1UIRA 5FYDA 4JASB 2BELA 3BD8A 3IMFA 5FI5A 2G4VA 2VSFA 3NHMA 3TTXA 3UCFA 2J48A 2JARA 4BMOB 1XTVA 1B1CA 1JPVA 2QLNA 4LCEA 3JVUA 1CUJA 2C9BA 3QPUA 1IJEA 4MKRA 3K5IA 3WIUA 1P73A 3L8FA 2NO9A 4NWIA 1JU4A 2QUKA 4UUOA 3KQWA 5JVDF 3H4IA 3NV9A 4KU4A 2BWJA 1DTEA 1EVYA 2I3ZA 2PFSA 4CU5A 5DGHA 1T6YA 3KFLA 3JYQA 1IHXA 1X1QA 3PWTA 2YQ5A 4UATA 4IWNA 1AUXA 3BFPA 3SCZA 4BB0A 2YQZA 1UC9A 3WGIA 2QDXA 3VX4A 1D2MA 5JSHA 3BH7A 4GGMX 1Z68A 1NN1A 1NC1A 3O8DA 3ROPA 3BKXA 1F7UA 4LRQA 3IOCA 3PYMA 1N5LA 5FPHA 2XEXA 5ADHA 4W8GA 1ENPA 1UKVY 2WU8A 1JDSA 3UXMA 5CM2Z 4X1IA 4LZJA 1XLTA 3K20A 3BBLA 4MS4B 1IB6A 1XP8A 1RC8A 1T0IA 1IZYA 2JI8A 5BQPA 3PNLA 1C4WA 3EBPA 5M3BA 5JC1A 3NG1A 1I94B 2A94A 2VHJA 1HE4A 2DWQA 2MSDB 1SG0A 4ZI7B 2HJGA 2VPZA 3DC2A 4JSTA 1Z82A 4MWTA 5DBFA 5M34A 4JI7B 2OM2A 4JLBA 4QU5A 4IGAA 5D3ZA 3R24A 1QRUA 2AN4A 2PL5A 2Z09A 3UGTA 4GKKB 1O9BA 3OECA 3MGCA 4EX7A 2OQRA 1B6SA 3CX6A 2MMCA 4PG6A 4D26A 2QRQA 4OMDA 5IBRA 4EGQA 1YE5A 3U56A 1EX6A 3C48A 3D8TA 4TQUS 4HLUA 5I9MA 2BCGY 3X1ZA 5KNCH 5CW2A 3P4UA 3BL5A 1SU6A 5AW5A 3H5NA 4ZVQA 4P4LA 3B3GA 1E3JA 1I4OA 1V5FA 3WISA 2O2EA 3UWMA 4HK4A 4N1AA 1JEYB 4K6HA 4AWXA 4YUWA 1G20E 1GKLA 3GEIA 5L3RA 2B9VA 3DZHA 4BECA 3T1VA 3ONEA 3ADDA 1RVV1 3AFIA 2AFHB 4AQDA 2FWNA 2A5YB 2Y1EA 2MR5A 3DXFA 721PA 2D7CA 2AW5A 3K6JA 5COQA 1IG0A 3CGGA 5FJIA 2IV7A 4E6EA 2PX4A 3IHKA 4JC0A 4LQDA 1V37A 4MVYA 1R15A 4GKVA 4JGGA 3TLAA 3PPIA 4FQ5A 2PJRA 3BMQA 1L4HA 1LW7A 3FFAA 1T0HB 1AT1A 4FMCF 3ZBPA 2BL4A 3HBLA 4MA4A 1KK0A 3KKOA 3LUFA 4JLPA 4PRYA 4YT2A 1E3DA 1HDEA 1VPLA 1KOGA 2Q8QA 1OC2A 4JFAA 1YK1A 5EMJA 2Y2VA 5K99A 1LC0A 2GS9A 2XMGA 2B9EA 2NUBA 1OJ7A 1XVVA 1E7RA 2D1YA 3V6LA 1ZIOA 4XI9A 2HU8A 1FYXA 1T5BA 4JS0A 1ODTC 2D2EA 1EI9A 4EQZA 2VP0A 3A6PC 1LI4A 1TEXA 3UXEA 1Q84A 1C9KA 1ML4A 2Q2VA 3F74A 4QC2A 1AKQA 2ZWPA 5D2CA 2OZKA 4P7FA 4JI5B 3UZUA 4MQFB 3KJIA 4Q01A 4Z4CA 3K09C 1XXHE 2DZDA 4V02A 5KNCD 2CMGA 4BNDB 2OCKA 3KYDB 4V0SA 4AUEA 2O5CA 2LCFA 3CGWA 1S7GA 4UTOA 3PE3A 3O94A 1JHPA 1DWUA 5LKRA 2Q0HA 1KEVA 4MS3A 5GPBA 4U00A 1GG8A 2VWGA 3AIOA 4HEA1 3I6IA 2JS7A 3SYNA 4X64B 4GZ5A 2R8RA 1F3OA 2FW9A 2XHEA 3EZNA 3O1IC 4J1NA 4UVDA 1HYQA 3HTXA 1N2JA 1YS2X 4C0XA 4YCBA 1DI0A 2VAVA 3QXGA 4RVOA 1HOXA 3F5SA 1A5BB 2MT9A 3AHJA 4G0ZA 5B1EA 3NALA 1W36C 1BH6A 2RGNC 1H2EA 4F45A 4YVFA 3TRJA 2AFIB 4P3YA 3P32A 2RK6A 1FUUA 1J2RA 2PRZA 5B1SA 2D7JA 2BJVA 5E9AA 3OLZA 4HBGA 2FETA 3E3MA 2WE8A 2QPOA 2V58A 1U8YA 3MTQA 4O02B 1PYDA 3WMWA 1G3QA 1NMQA 3VR3A 1EU1A 1SKYB 4FDMA 4F4UA 2IZ5A 5BSFA 2XYPA 1M6HA 1J20A 1QZUA 5F98A 4FXPA 2ASVA 4B45A 4K9NA 1IRXA 1WDMA 3NHBA 5E7MA 1BQ3A 1HZZC 8GPBA 5DDIP 4NV1A 3VPSA 1UP6A 4V3BA 1RQNA 4KB5A 2BN4A 2W8BB 4KRGA 3ZWNA 4GX1A 4KYUA 1NM5A 1FDUA 3EXAA 4BJ3A 2O1EA 5AK4A 1MIHA 1X7XB 4NNPA 4DQXA 3ULKA 3STWA 3U3OA 1R00A 4WKGA 2H1FA 2HF8A 5T4HA 5FADA 4CR6A 1UZUA 1DXYA 4QUDA 3U44B 3G9ZA 4D96A 1OB5A 3THWB 2F7SA 3CVOA 1C50A 4ZRNA 1LVHA 1KZ7B 2Z8XA 5DJ5A 1ATIA 4FMDF 3A4LA 1G8SA 1EFRA 1C9EA 1M76A 4WY5A 3M9LA 2J6IA 3T99A 4JC8A 3S1AA 3UFXA 3GC6A 3U0BA 2I8CA 2LV8A 3IJEB 1RQXA 2QQFA 2VZEA 4YP9A 4ZYZA 1NVVQ 2HV9A 2JAWA 2J9YB 3H2ZA 3KQYA 2F8TA 4CQMB 5CDUA 3U49A 2QVCA 4BZWA 1EQUA 4DJDC 1R6VA 2WSYB 5CLFA 2QDKA 3A2KA 1E1DA 3LQQA 4I1IA 3DZCA 1FMLA 3DE7X 4WESA 3PTAA