5AMXA

Crystal structure of proteinase k processed with the crystaldirect automated mounting and cryo-cooling technology
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEINASE K
publication title Automated Harvesting and Processing of Protein Crystals Through Laser Photoablation.
pubmed doi rcsb
total genus 102
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5amxA00
1S2NA 2V8BA 1DBIA 1TO2E 4NMXB 2W2NA 1Y3BE 3DE1X 1TM4E 4OMDA 2PWAA 4AKTA 1GTG1 1P7WA 1WSDA 3EIFA 2DQKA 5JXHA 1SBHA 5SICE 1YU6A 3I34X 1Y33E 3HJRA 2Z58A 2Z2ZA 1AU9A 4LVNA 1NDUA 1AV7A 1SCAA 3DDZX 4OMCA 5JXGA 3OSZA 5B1DA 3ZXYA 1TM1E 3F7OA 3DE7X 2X8JA 1Y3FE 3Q5GA 2PYZA 5K7SA 3UNXA 1GCIA 1WMDA 1SVNA 3F7MA 3VSBA 2W2MA 4ZOQI 1GTL1 1T1EA 3VYVA 5FFNA 4B5LA 1NLUA 2Z2YA 3WQBA 2GKOA 5JMOA 2Z56A 1TM7E 3QFHA 5AMXA 3BPSA 2IY9A 5ARBA 3SICE 4WOCA 5ARCA 1TM5E 1AF4A 2X8JB 1YJBA 2WUWE 1EA7A 1T1GA 1YJCA 2PMWB 1GT91 3DE6X 3LXUX 1GA1A 3AFGA 2HD4A 1SBTA 1TK2A 1JEAA 1SIOA 1OYOA 1C9JA 3GCXA 4RYDA 3Q40A 1Y1KE 3EE6A 1ZVKA 1PTKA 3I37X 2W2OA 1IC6A 4NE9A 1AK9A 1KDYA 4Z2AA 3P5BA 3QTLA 5FAXA 5I9SA 1BE6A 4JP8A 1C9NA 1SELA 1MEEA 2PWBA 4H6VA 1P7VA 1GNSA 2TECE 1DUIA 1XF1A 3I30X 1SCBA 3DE2X 1KE1A 1GNVA 4BWGA 1BFUA 1AVTA 3BGOS 1EGQA 1SUAA 5JXIA 2Z2XA 3DE5X 5AVKA 3L1KA 2Z30A 1SH7A 1V5IA 1WMFA 1ZVJA 3CO0S 3DVQX 2PQ2A 1SCJA 1SUCA 3DE3X 4NE7A 1LW6E 5JXJA 1HT3A 1SCDA 1UBNA 1Y9ZA 2SECE 2QTWB 3A3NA 1Y3CE 1S01A 4CFYA 3BX1A 1PEKE 2P4EA 3PRKE 4H6WA 1SBIA 2B6NA 5ARDA 2WV7A 1THMA 4HX2A 3DVSX 2E1PA 2DUJA 2ZWOA 1SUDA 3T41A 1TECE 5AQEA 4C3VA 3LPCA 1SBCA 2SBTA 1C9MA 1PFGA 1CNMA 2WUVA 1SBNE 3WHIA 2W2QA 3D9QX 3DVRX 4H6XA 4DZTA 2ID8A 1Y3DE 1Q5PA 1SPBS 1SIUA 4OV6B 2SICE 5FBZA 1GA4A 3DW1X 1R0RE 3CNQS 2G4VA 5CW1A 1SCNE 4YN3A 1P8JA 3H42B 1PJ8A 4C3UA 4MZDA 3DW3X 3VV2A 1SIBE 1OYVA 3SQOA 2ID4A 1AQNA 2ZRQA 3GT3A 1R64A 3EDYA 1Y4AE 1WVMA 1SUBA 2WWTA 1GA6A 1BFKA 1V6CA 1MPTA 3TI9A 1VSBA 1A2QA 2Z57A 1KE2A 2DP4E 1KDVA 3DE4X 3LPDA 4DWWA 3I2YX 4AKSA 3A3PA 4WOBA 3VHQA 1SUEA 2PRKA 1WMEA 1Y4DE 2ST1A 4CFZA 3AJ8A 4LVOA 5B1EA 1BJRE 1Y34E 1ST3A 1C3LA 3VV3A 4KB5A 2XTJA 3GCWA 4I0WB 1S02A 4CG0A 4K8RB 1IAVA 1KDZA 1OT5A 1SN7A 4FONA 4KG7A 1TO1E 3TI7A 1ST2A 3DWEX 1BH6A 1NDQA 2XRMA 3QMPA 3WIVA 4GI3A 1GTJ1 4HVLA 1BE8A 3DYBA 1R6VA 4M1ZA 3GT4A 4ZARA 3WIUA 1TMGE 3DE0X 1Y48E 1YJAA 3VTAA 3PTLA 1AH2A 3D43A 1TM3E 2IXTA 1CSEE 1T1IA 4DJ5X 2SNIE 2PKCA 3LPAA 2W2PA 3F49S 4KPGA 3ZXXA 1SUPA 3A3OA 4J94A 3AJ9A 5AVJA 2ZWPA 2HPZA 3TECE
chains in the Genus database with same CATH superfamily
2OHHA 4B6OA 5IXJA 1HF3A 4JVNA 5HA5A 1PL6A 2HHJA 2V6MA 3TPZA 2O7RA 2PUTA 5TXGA 4HWGA 2XB2A 4IUBS 5CJJA 4MS4B 3N76A 4AFNA 1P17A 1XAGA 3KOOA 1XRLA 2XNHA 1Q0RA 4NNOA 5IDVA 5M04A 2CV1A 2NUTB 1P5ZB 2C54A 3PPVA 2Y1DA 1DJPA 1K3UB 1O97C 2UYHA 1GNLA 4ZEWA 4Z6KA 1QG0A 5DJ5A 3TMYA 2OT3B 2XUKA 3K2EA 4AMVA 3IKTA 2GTHA 3LNCA 4O2RA 3EEQA 1JJFA 4IO1A 6ADHA 1IE3A 1C2TA 3ONFA 4L0CA 1EA5A 1W2GA 1P62B 2DQKA 2JGDB 3DL0A 1HDEA 1VDZA 4PCLA 5JCJD 3EUFA 1WX1A 4XD7A 5AKLA 5SICE 4NBLA 1HDYA 2A3NA 3B3GA 4ETIA 1EE2A 4DR7B 1LQ2A 3EMKA 3QQ5A 3LWZA 2ZJ8A 4Y2RA 1CS4C 1FLVA 1V2HE 4Q4HA 2NVBA 4Y18A 1POXA 2OBYA 4MTLA 4FE7A 3X2SA 1I0IA 4CEJA 3GLSA 1EFUA 4LVNA 1XV5A 2H2WA 3KLOA 4N41A 5C8DA 3UEOA 1O4WA 1F48A 4UD6A 4RC9A 4R1LA 2I8CA 5J4YA 9ATCA 3G7NA 2IX3A 4H7IA 2D1QA 1UMCB 3ROKA 3HMKA 2FFJA 1L5SA 3L1IA 2RFLA 4OTZA 4RTLA 2X9NA 2HAEA 4DFDA 1Q7TA 3C6QA 4MQ6A 4EMBA 1YQ9A 4F56A 2CJWB 3GNTA 3UFBA 1E2GA 5JDIC 3GCDA 2VG8A 3PGKA 3EA0A 3KZOA 1K89A 1QO0A 4JKIA 1U3WA 4M0CA 1NW7A 2GX6A 2ZRJA 2IPNA 3GMSA 3O83A 2DMRA 3UATA 3FIUA 2QVBA 3L3BA 4B3BA 2VHZA 2CNOA 3DTNA 4CODB 5K6TA 3KZKA 1E5VA 1P9NA 2JJ8A 4K6GA 4MS3B 3UMRA 4F21A 1Y6GA 3OTIA 3G88A 1DIHA 2GAFA 3EARA 5FFNA 1SKBA 3MC1A 2EKPA 4REQA 4GGMX 3C3XA 4HWTA 4NABA 3CWQA 1X6VA 1YDEA 4KO1S 4BO8A 4F4DA 3TLZA 2DTDA 3GPBA 4D3FA 2FUG1 1Z0KA 5EG5A 3R3JA 1Z36A 2OGUA 1INLA 1UAYA 2IEYA 5LXTB 4YXWD 1QV9A 3OT5A 2X0JA 3D0QA 3QFTA 3IQZA 3G2KA 2IODA 2AOUA 2CDCA 3VR3A 3BMQB 1OWNA 1VQ1A 1ODIA 4PBSA 5DLPA 3ADPA 4E5UA 1QZUA 1Z0DA 3RRMA 1NNEA 1T5HX 2P27A 2WW8A 1AT1A 4PHCA 4R8KA 3GU3A 4BB5A 5IWCA 5LMNB 1KHHA 1HC7A 4F97A 3UGQA 2QAJA 1FFSA 2ZBUA 4KQCA 2YBDA 4DCVA 3OQIA 2E89A 3GCZA 3U2QA 1T8RA 2QUIA 1KFJB 4FS3A 5DEIA 1Q83A 4RY2A 2KS6A 4MR8B 3H04A 2WIFA 2BFFB 3I9OA 3ANXA 2CJPA 4A91A 1KY4A 5KHAA 3OOEA 1XJ5A 3DHNA 3K5PA 2CVPA 4LA4A 3PPWA 4D0RA 3IOEA 5LNK1 4Q9HA 3D5QA 3G8DA 3HV2A 5KDLA 3ZG6A 4DJDC 1PR0A 5LLSA 4UHCA 4YGYA 1FFXA 2HD4A 3AJAA 3OX1A 2HA5A 4J2OA 1JEAA 2B8EA 4DDTA 5BP7A 3ZQUA 4ND8B 4UXJA 1TYBE 4K9NA 1OYOA 2CUZA 3ZEIA 2WWHA 4PLCA 3DP7A 3ZHVA 4JLWA 4ZI2A 3I58A 5JPIA 1Z83A 3FB1A 3FMGA 4JGBA 3PGJA 3LBYA 4L07A 5MHTA 4CKEA 2IYAA 2XGGA 1S8AA 2Z08A 3C1UA 3B9RA 1VKOA 1IJKA 2W7TA 4TN1A 3X0DA 1G20A 1D09A 4Y30A 4B3GA 1A71A 3M4NA 2JJYA 1NW3A 1WOMA 2YY6A 1E79D 2HA0A 4OXQA 3S44A 2O3SA 4WZ6A 3L4BC 5CYGA 2P30A 1QGZA 2Q4TA 5AK4A 4A23A 3TXYA 1W6UA 2VF4X 2DSNA 3EDRA 1EFKA 3HRKA 4MQUA 4DEXA 4E5SA 1E3WA 3CJRA 1JBKA 4IUDS 2OLKA 2GXSA 4M9UA 3GI1A 1XVVA 1OJ7A 3QFRA 3T9AA 3ZEAA 3PNLA 5A05A 1XKLA 1JEQB 1DAHA 1Q2XA 2PUWA 1D4OA 1Z56C 3OTWA 1T0UA 4NMHA 1OC4A 4Y6QA 5CJ2A 3HWWA 4JSRA 4X3PA 2VXCA 3F1KA 4Q47A 3EQZA 3ZLUA 5GGYA 1N78A 3PVZA 4UDNA 3NIBA 4DT1B 3PDCA 2PGLA 2QLJA 1J0AA 3DEKA 2FPPB 1GLNA 2C2OA 4PNHA 1H2BA 2G1JA 1CQJA 4FS8A 1UKEA 3LUHA 1HEYA 2GN9A 1YB1A 3OIVA 3HQ4O 3N8HA 1DPFA 2I3GA 2X1LA 2HCTA 1J7KA 2XQJA 1G18A 4WV3A 3U3XA 3DXZA 2RAPA 2FN3A 1XLTC 1X0VA 1NN0A 1OREA 1JR3E 3D2AA 3L05A 2P91A 3RLFA 1NVGA 3MJFA 4FYKA 1EFLA 5CCEA 3TIVA 1BDMA 4CRWB 3PLRA 4OHMA 3QKTA 2IHJA 2RDMA 1SUAA 2Y77A 2PBRA 1ZW1A 4RPGA 1M8JA 4QFCA 1D6JA 5IULC 1QU2A 2HK6A 4Z9FA 3LHKA 3DJFA 5H81A 1Y1SA 2ECQA 4L9RA 3UK2A 1ZJWA 3VGPA 1L4LA 1WETA 4G81A 4NCXA 2EX4A 4QQNA 3E9DA 3P20A 4HNSA 4EPRA 5C1DA 1BCSA 2BW0A 1OBOA 4DHWA 821PA 2AFHE 2D1FA 2WQZA 1JFFA 2DVMA 3PXEA 5JAQA 2FMXA 3VR5A 3DE3X 1W581 2BFDB 3MF4A 3A6HA 3SC2A 2DT5A 2CHFA 3HJAA 5GOZA 3R4VA 5G3YA 2FPGA 5IUNC 3MJDA 3WK8A 4ZQGA 1U31A 2CDNA 3RROA 2HLDA 3FDZB 1XCMA 2PSDA 5HCUA 4EPWA 4F8YA 1PJ4A 4HQ0A 4RCVA 4IIVA 1OFIA 4CN9A 4KN5A 1IVSA 2CB0A 2ZSDA 5H70A 2F90A 2WE7A 5E3HA 1E6WA 3KAJA 4JC4A 4WBXC 2F8MA 1AKYA 1LVUA 5F77A 1N4AA 5B7NA 5GZ3A 2ZWVA 5ECDA 3UMCA 2D4HA 3CR3C 3A6PC 3EMDA 3AVQA 1AOXA 4INZA 5BORA 4BXOB 1JPUA 4B48A 4EHHA 5F7XA 1GEEA 4DF3A 4PN3A 5HMMA 3BX1A 1Z5PA 3E7XA 4FHZA 4ZVTA 5HIJA 4CDMA 4D3SA 1H6DA 1XZKA 2IUTA 1LPSA 3A1NA 4IF4A 4RZSA 1UM9B 4KPEC 3GLIA 1WXDA 1M5UA 1N2BA 2O48X 4GOLD 2FNAA 2YXNA 3K30A 4CLOB 1RJDA 2FU5C 1MB3A 2I71A 3DLIA 3OPYB 2YS6A 2C78A 4TLCA 2IBMA 2ZIAA 4HEQA 3KALA 4KYIB 4CKYA 5I5EA 3AINA 1QE5A 1DJQA 3DMPA 4V2UA 2WUFA 3C41J 4HZUA 5BXYA 3TTTA 1JIXA 1Z39A 3HNPA 4WCVA 1QBGA 4CF4A 4FGJA 1XZJA 3MBKA 1JBQA 3DZFA 3CKYA 3KQYA 4PRZA 4C08A 3PI7A 5CRIA 1QRUA 3PNVA 3RVBA 3GRRA 1P5FA 1K86A 4X6LA 2D62A 3GDGA 2BEJA 3Q6MA 4LGVA 3TB4A 3W1EA 5KC9A 4LXHA 4D25A 1A4XA 3DV0B 3JXEA 1GPKA 3C14C 1SZJG 1HV8A 5FA6A 3WLSA 4CM7A 4X45A 2R7AA 2PUJA 3ET4A 1V5GA 3O9MA 4NAHA 3ENVA 2C4TA 2PX5A 3BULA 3KEQA 1U3UA 3RABA 3SIPA 4GM0A 2JAHA 2ZJ0A 1I32A 1T3LA 1JG3A 1CR0A 2NPOA 1QTNA 3HR4A 4IIDA 2MYPA 2WKSA 2LTAA 3WICA 1V39A 3MSXA 1ULZA 2BEWB 2FYTA 1GYPA 2J31A 2ZTSA 3LT2A 1NUPA 4Y2VA 5DK4A 1FYFA 4DLXA 1XA3A 5DXFA 4ZZIA 3OFKA 1WLSA 4I4TB 2VJBA 4LJ5A 4Y2TA 5AKZA 4UNNA 4L5YA 4OL9A 1JR2A 2PH5A 4MV4A 4QYIB 3U4GA 3T9DA 1ESMA 1QIEA 4OHUA 3ESCA 4NECA 4WA7A 5CW1A 5FTJA 5JS2A 4ZEXA 4GI2A 4R41A 4CLRB 5DCWA 2ONJA 2ZB4A 4YT4A 4EZBA 2W4IA 1UJMA 4C3UA 1Z6ZA 2OVFA 2WINI 4DIKA 5A4KA 3R3HA 1RT9A 1F5NA 2B4QA 1NRWA 2ATVA 2AT1A 2P6MA 3IIJA 4N5MA 3WRWA 3WYFA 5KSYA 1TZ2A 1E98A 3ZU4A 1NE7A 1OX4B 4ZCIA 5FH9A 5FNZA 1WXQA 3L7DA 4I5GA 4FYIA 2BFNA 1T3SA 2POCA 3WDMA 4B09A 3QFCA 4DUPA 2O57A 4MLZA 4XYMA 5DM2A 2PUAA 1UWVA 5JCOA 1U7UA 4CTKA 3LD9A 3GIDA 2UZ3A 4LRXA 1V5EA 2C58A 5J2UB 4JA2A 4JOQA 2HIAA 5ALTA 4BZQA 2W00A 1F38A 1H5NA 4RS4A 2A1TS 5JCZA 2DWPA 4A0GA 1XX6A 5AJYA 1EBUA 2O2SA 1JN0A 4OHRA 1J90A 4GC9A 1UWLA 1Z0FA 3GJ7A 2VDMB 5EL0A 3KCQA 5F2KA 3WX0A 3AVVA 2FP3A 2V7QD 4O2AA 4U7GA 2BFCA 3TR5A 3I5XA 3LRTA 3QVGA 2AXEA 4NDAA 4PY2A 3AHEA 2GHRA 1H2AS 3HUDA 1JIIA 4ZZ2A 5K3FA 1LW7A 1ZGHA 1RQPA 1VE3A 3EF3A 3JQ7B 1C4XA 1DEHA 2NTNA 4YTEA 5HYVA 1QP7A 3IP5A 3AJEA 4IFTA 4DLNA 1ZL2A 1LWOA 3NH9A 3JD4A 4H4CA 4IGEA 4NBTA 1NV8A 1O2DA 2AUMA 3UTDA 5ALUA 2BE7A 4X6UA 4E07A 4C0SA 2VH1A 1IK6A 5FBHA 4JP1A 1TM2A 3WGUA 3WFZA 1PZGA 4EYEA 5KTYA 4C04A 1WJGA 4P54A 5DYTA 2GPTA 3HXMA 5JAIA 5FL7A 4HNHA 2XT9A 3LUKA 1YHYA 3KQLA 3WVNA 1EHIA 5JH7A 1U0HC 3DMFA 5JC8A 1N6HA 3HGMA 3JD1A 1JIJA 2C7VA 1F0NA 4NTZA 4JDPA 3AP3A 4EW2A 1UC4B 2P2NA 5HKLA 4JN6B 3WWYA 2ZI6A 3AP1A 4KMSA 1OH7A 3D3WB 5DHPA 4BMOB 2RI6A 1GL6A 1QRRA 4M9QA 4ZV9A 3M2TA 4NICA 4WJKB 4UW9A 1T2CA 4AZ0B 1T2AA 4CVNA 2G0AA 1XYYA 2P2ZA 4G97A 1U81A 4HR7A 3DF9A 3DMNA 3I04M 5B1YA 3FCXA 4R8LA 3MYRA 1T6ZA 4U1RA 2PS0A 1LBTA 3NTVA 5IBCA 5JD5A 2BJWA 4V0ME 4CXMA 1XEFA 1JMVA 1O6BA 2VSFA 2X6QA 3OZAA 5G0TA 4MDYA 1VE9A 3DNFA 5K8UA 4B6RA 5CBKA 2NYUA 3C6KA 2AC4A 3PJDA 4JCOA 3RU7A 1H69A 4IIJF 1LSJA 1PRYA 3ZWPA 1GPYA 4MRRA 1KWGA 2FHSA 4FN4A 2PZEA 4RAQA 3B6MA 3G2IA 5BN5B 4FK8A 5C8YF 3UQZA 2BMJA 4J0DA 1RHKA 2VPIA 4BC1A 3H9QA 3O73A 3V9PA 2WKWA 1E1MA 1MABA 1MLDA 4O4LB 2O0JA 4Q00A 4FILA 4HWRA 3WIUA 5DX0A 5EYPB 2PXAA 4XCVA 3RG8A 4ARSA 5B3JC 1FVFA 4A8PA 3AU8A 4FHGA 3TR0A 2CCGA 1JQLB 2VAVA 1PAUA 1R74A 1RWBA 1GSOA 1X19A 2LRHA 3V6LA 1L4EA 2AB0A 1NIPA 3O1LA 4ZO9A 1T1JA 1SFRA 3ZU3A 2QUZA 4E3WA 4TZ6A 1UDBA 3IQFA 4G9BA 4UVIA 4DUGA 1SC6A 5IK2D 4BO3A 3CJTA 2HMYB 1XEWY 1GV1A 4U7DA 2GJ8A 3RU2A 4BV9A 1GZ3A 1SA0B 2J33A 4F2PA 4UBNA 3GLUA 2C2ZA 3IKJA 1RLIA 4PAGA 1FRZA 1NLZA 4BPBA 1FXUA 3ONNA 3RKUA 3BXEA 3NBYC 1GGVA 3BD8A 3FBTA 3O0TA 4YMWA 1UXGA 2FWIA 2PKCA 4BO4A 1H8EA 2PBFA 3TQOA 3ICEA 2UZ4A 3M1LA 1ZY2A 1W29A 5HFJA 1G3UA 1HYBA 2FEOA 4KQ9A 3A1UA 2XEDA 4AULA 2WMNB 2I22A 5CD9A 2NNLD 3DUWA 3WGZA 3WLAA 2GHIA 1P1RA 3FFBA 5BSVA 8LDHA 3G5MA 3GJ6A 4XAQA 3U56A 4NJEA 4NOKA 1LPOA 2JEOA 4TLEA 2FCAA 1C29B 4ER5A 2YQZA 3C48A 3OIFA 2R751 2VZ8A 3HADA 3KVVA 4W4TA 1G21B 1IHXA 3D4NA 3WA7A 5KJ6A 3QVOA 2B20A 1DMSA 4QTUB 5CLFA 3KE8A 4HUJA 5EUBA 3HJFA 4K2AA 2J9RA 4LYEA 4C7MA 2V4MA 3ZPXA 3DZIA 3NGMA 3WA6A 4BMDA 1M83A 3QY9A 4PG7A 1ZIOA 3N53A 2BFAA 2EZ8A 4TRNA 3TLGA 4I6EA 2AR7A 4JXKA 4UOQA 3ZDCA 2M32A 2ATIA 3T5AA 2PM8A 2H1RA 4WXMA 5DYWA 3IUYA 2FRDA 1JQEA 3BGWA 1Z5NA 2CV0A 4X44A 1NJ6A 2VTEA 4CLEA 3O82A 4YAWA 3WKCA 1Y3IA 4RHFA 1QFJA 1YBVA 5LLTA 2C9CA 3AUXA 1O6FA 1EWTA 1F4PA 5HX7A 4DIFA 4ZT7A 2ZVJA 3MCWA 3ECSA 5SZHB 3TE6A 1X8XA 1C0PA 3RM3A 4CKWA 3A6ZA 3KQQA 5K20A 4YROA 5HEKA 2QBYB 3HN7A 2VIIA 1DXHA 2R6GA 3IOCA 4U2FA 1UZMA 1VSVA 3I9V1 4LZNA 4WKPA 5DIZA 4BX9A 3S2EA 3FE2A 3TWOA 4GI5A 3UCXA 1YK1A 4O08A 5BSKA 4MV9A 5AOCA 4EYSA 3FF1A 3H9JA 3OWXA 5GAJA 3WG9A 2RAVA 4K6FA 3PQ6A 3L8DA 4LDNA 4UNIA 2OHVA 1SQGA 1YRHA 2VP2A 2P6PA 2WWIA 4HB2A 4AJNA 1YRBA 1I4TD 4LNHA 4F2WA 4EGQA 5IJ9B 3S4YA 2JHCA 1DKOA 3IS3A 5KSZA 3FZYA 3BE5A 4DXHA 4EHJA 3IAM6 3ZOZA 1N3IA 4IIUA 2XODA 1E2DA 5E2BA 1ZNWA 1BXRB 4XJSA 3RODA 3W8FA 4PZUA 2GAAA 5I9IA 3O8QB 3E4CA 2WVGA 5FPSA 1NW4A 5DW3A 1IBRA 2ZIFA 2B69A 2HPHA 1HO3A 1L0BA 1E8NA 4TQ9A 3U3MA 5CLGA 3NBMA 3AO0B 4LDRA 1UC8A 4FGLA 4IIFA 4KQKA 3GRYA 1A77A 1NQVA 2PL9A 3P32A 2HU8A 3NHKA 3HNRA 1I0LA 2VWGA 1YS1X 3VPBA 2FGKA 2IYWA 3DV2A 3H9BA 1KFCB 4GX5A 1HE4A 2V6IA 3ZJYA 4ZRDA 5JS7A 4P3PA 4Z4QA 3K35A 1Q92A 4ZVKA 3GRCA 4IO0A 4KUEA 4MP8A 4RXUA 2VP5A 2PCLA 2C82A 3PE3A 2ZKIA 3ESXA 3FNBA 5ARCA 1L3BA 4EF4A 3AFNA 5AM2A 2WVHA 2NUAB 1YJBA 1LS6A 4MPDA 3WB9A 1QHNA 2JLUA 4MHSA 3GJQA 1W4CA 4RM3A 3Q7EA 2VJCA 3T9CA 4AN4A 2WFAA 1PDOA 1KDOA 1YFKA 2VRCA 4OATA 4QA9A 4UMFA 1TA0A 4YWJA 1D07A 4E30A 1IOWA 3IR6A 5D51S 1JPNA 4HGQA 2V55B 2XV1A 3NT2A 3AVYA 4KVZA 4KHZA 2NV2B 1KL7A 3DTTA 4EGAA 4R1TA 4JBXA 5M34A 3C24A 1MIOB 1GZ7A 4KYUA 3W4KA 4GMFA 4RVDA 1GNRA 3CPJB 3UWKA 3K09A 4OMUA 3EISA 5ELXA 1A5TA 2NVWA 2AMLA 3AFIA 4K1LA 2G17A 1ADCA 3HDVA 5AICA 2NX2A 5CTJA 3GFFA 5TJHA 2PPLA 1ECGA 4IEEA 3EZFA 1VHWA 2R1ZA 5E7JA 1EQAA 3DDWA 2C2GA 3AHIA 1W4AA 2CCJA 3Q87B 4E3ZA 3N58A 4MR7A 3L7IA 3RC3A 3PNKA 4AMYA 5ICSA 3G7SA 1B8VA 3HDJA 4K6CA 1U6JA 2H92A 4M0PA 4N49A 3K0CA 5CM2Z 3UMGA 2JFWA 4ROTA 4KX3A 5IVIA 4O5OA 3F47A 1KDYA 5HJEA 2W6ZA 2OM6A 3RYIA 4EP1A 2N42A 2GD0A 4F71A 3FOFC 3CB4A 4P34A 1KZ4A 3PYXA 2X6RA 2Y0CA 4YX9A 2PUHA 1CFJA 1AUQA 4M0EA 2PZMA 2MSLA 1TAUA 1X1DA 4FD3A 3AWIA 1EDZA 5CVCA 1NWCA 3IMFA 1I94B 4E13A 3A9UA 5DM0A 3C39A 5D3QA 4ZJYA 1T8TA 4KX5A 1SELA 1MEEA 2JFFA 4DJTA 3A2KA 3VJKA 4BQPA 2ZJZA 3BBLA 4G4IA 4IIXA 1JA9A 1JHAA 4GMXA 4HVTA 2FZVA 3LC2O 4LZLA 4IWNA 4Y6LA 4EX6A 5B2EA 2TECE 3IV9A 3WWCA 4OHVA 2XBLA 2EBWA 2FMTA 3GIWA 3BH0A 1Z5VA 1G1AA 3PUKA 3PQCA 1PGNA 4MRSA 4CQLB 3DT9A 1JDPA 1T4GA 3FZEA 1R8SA 1X94A 1F6DA 2XNSA 2DE0X 3MGAA 1VECA 3NHBA 1AKUA 4LF8B 3FDJA 5BR8B 2Z2XA 4LRUA 3IP7A 4KN9S 5JDCC 1P2TA 1M6VA 3B1JA 1Q17A 4CF6A 2B4AA 2HHLA 1RMYA 3LJKA 4K26A 5FBRB 3HJCA 2VHCA 1E6LA 3H7AA 4G1EB 1M7GA 1HETA 1I6LA 3A27A 4F4CA 4XIIA 1WDLA 1K4MA 3G0OA 1BVYF 3F5FA 2ZPTX 4ONEA 3K9CA 1G7RA 4LF9B 4A92A 5IEJA 1XDZA 3N9IA 2B9VA 5IC5A 3COYA 4N3CA 1G5PA 4LY3A 3RE1A 4PIPA 4B4KA 3MS7A 4HUQB 1HT3A 4UHEA 2OGZA 3A4LA 2O7QA 4N76A 1UZLA 5CCDA 2X8BA 3BDAA 2ZCJA 4PONA 3QF7A 5KAPA 1GPUA 2O3RA 4NZNA 1T6NA 2OBNA 1T2UA 4EY7A 3TQSA 3GUCA 2AKAB 2LNDA 3BGVA 3HLKA 1Y9DA 4W9NA 3W9BA 1OWOA 4YRZA 1ELOA 1C50A 1I6KA 2DPMA 4FZRA 3RF7A 1CUJA 4LBWA 3RTBA 3WMEA 1ORTA 3KQOA 2IZOA 4UJ3A 2QAIA 1H2RS 3BK2A 4ITVA 4ENRA 1PUJA 3A0UA 4W6ZA 2AE2A 2BMAA 1YSCA 2D59A 2TRSB 2WMDA 5JWOA 1Z4NA 1KRHA 3M3PA 4XX1A 2C5EA 1PEKE 5FOUA 4RYLA 4ZCRA 1GR1A 1X80A 4QULA 4YI5A 4HNRA 4H6WA 3NC0C 4COKA 2QQ0A 3QPDA 3BCUA 1QHGA 2MSCB 3PQ7A 4PYQA 1ZXXA 2BMEA 4JGGA 4ZI7F 3C6MA 4K5QA 4R1NA 3UN1A 5KZMB 4IXTA 3KYIB 5JQGF 3D6UA 6ABPA 1NJGA 2VRNA 2XF8A 1JA0A 1YRQA 3OC0A 1IBCA 2JEYA 4TRJA 2AN5A 3C8ZA 4EOGA 4ZCLA 1UPTA 1TAQA 1V48A 3FNQA 2HMWA 4FGWA 4KO4S 3D6NB 4D92A 2C8LA 2IYEA 3DVSX 2A4KA 2P69A 3GUUA 4NCIA 4H15A 2JLSA 4TMKA 2CBGA 5E4FA 4XIYA 3TQIA 4EVSA 1X3LA 3D7RA 3BWVA 4U3JB 1UBEA 1CT9A 2JDIA 3HA7A 4LI3X 5D6OA 5EWMB 4XVHA 5A0FA 1M2OB 1KSGA 2VHVA 4ECAA 1COWD 4BV2A 5JSFA 1C0IA 3IV7A 2V0NA 5AQEA 3LPCA 4B35A 5K09A 1HZJA 4Y6GB 3AYZB 1WF3A 3DEAA 3QLJA 1BWRA 2CYBA 1C9MA 4XQGA 3PFHA 4B87A 1I9GA 1RXCA 4HDRB 5IFKA 3CNHA 4Q01A 4AUMA 1XDBA 4D3DA 4DLTA 2MYNA 1A9OA 1QHXA 1KO8A 2WHPB 4Z9YA 3V7NA 5JEDA 1M2GA 3SYMA 3M6UA 3AONB 3ZGNA 5ITVA 1IEVA 2QUJA 3LQKA 1DKRA 3DGEC 1SG9A 5KNCA 1N5DA 1ETUA 1YOVB 1V26A 4QQKA 2QL6A 1A97A 4LAFA 5AI8A 1FSGA 3EPLA 1Q5PA 3H16A 3HGQA 1BMDA 3RK0A 3L41A 4PYJA 1SPBS 5U4QA 2PWPA 3ZJVA 1R0WA 2IXEA 4OV6B 4B74A 2NO7A 3N6XA 4EA9A 2YXDA 3UT6A 5CM8B 3P9SA 4HAVA 2FSVC 3LZ6A 1OYWA 3RAJA 4AY4A 1H93A 1U8CB 3HWSA 1I4OA 3AOEC 2QN6A 2Z5LA 3F3YA 4QOEA 2R4UA 1WD5A 2A9OA 3O38A 3BOSA 4Z0NA 5KNBD 1KRXA 4RD2A 2JCBA 2QVXX 3NI2A 1J1IA 2FW7A 2XDQA 3L9WA 4PAQA 2GZMA 3AUYA 4D0SA 4Y9TA 2ENWA 3L8EA 1KFKB 3UCFA 4EPYA 1IWPB 4MLDA 1Z6TA 2RIRA 3OT4A 3UK7A 5G1OA 4D9NA 1RWKA 3SQNA 1XDDA 2IYXA 3HBJA 1MV8A 3PEVA 2NO4A 1H05A 1WAMA 3I4CA 2R00A 1GILA 3A9TA 5L4NA 1J70A 2ZRQA 3L6OO 2PVPA 4EAQA 1SC1A 4LJ8A 5ITZB 3GZJA 3LCRA 1RQRA 1TNDA 1RKBA 1T8WA 1DS6A 3G2PA 3Q3JB 1OV6A 4IIGA 3WBKA 1R64A 4DBZA 4ZT6A 1QXSA 1J2EA 1LLCA 1PTJA 1PT7A 1UODA 2D2IA 2LCIA 1Z37A 2OBBA 4PFKA 4S24A 2Q21A 3L8YA 5DTEA 3J80A 4WT7A 3BT7A 4AWAA 4DV5B 1SVIA 3ND8A 1I10A 3L4EA 1YRWA 3Q0TA 3EDYA 4ZQFA 5H02A 2XSZA 1WVMA 5E9QA 5KJEA 3KAQA 2GUWA 2VJKA 4GP7A 3H4MA 1GZ5A 4Q4CA 1PEYA 3E4DA 2VT7A 3L7BA 2GEJA 1USIA 1G17A 4LV6A 3MOGA 3VGJA 1TCCA 1M2JA 1UBOS 1WHSB 2EW2A 2JAPA 1D5CA 2MWMA 2OBXA 2WIBA 4Z4CA 2ARKA 2C1XA 5T6BA 3PD0A 1QHHB 1OI4A 2XX3A 3GJZA 5BNIA 1A2QA 2F48A 5K5EA 1GL7A 1I9CA 3HCNA 1XVAA 3ITEA 3U0BA 1KKUA 1NRIA 2H5LA 3WNDA 2V4ZA 4PLGA 4B84A 3OP1A 4X6YA 3K0HA 1YULA 3V8EA 2YCLA 2P1RA 1Y63A 2PEZA 4QPJC 3WNCA 1FIUA 1XD9A 4NY1A 4BGVA 4WOBA 1NBIA 4KXLA 4D9EA 1T9KA 4HH0A 2Q2NA 4XWWA 3GLGE 2ZJAA 2EKDA 2OM2A 1VJRA 3CYFA 1FP4B 3E9ZA 3ND7A 4PC7A 1NRXA 5A6SA 3OY2A 3UY4A 3KD3A 4YRFA 3QYAA 4EJSB 2YHBA 2ST1A 3AVXA 1TU0A 4K9DA 2O5RA 3EIQA 1W8IA 4KDCA 3U3RA 4A16A 4D4HA 2NXEA 4DRXA 4MIKA 1RKVA 4BLVA 3EUWA 4F9GA 1ZOSA 3OTHA 2QGNA 3SVZA 4BFSA 3TLXA 2HSJA 2FZ4A 2Y05A 2ZB2A 4R16A 1YZNA 2PLNA 2P11A 1I3KA 2XVZA 3E3OA 1KI1A 2A33A 1E6MA 2I6UA 2K7ZA 1IDN1 2C5LA 2RJOA 2WILA 1S02A 4L95C 4I4IA 5AK6A 4RCZA 3GDWA 2FPWA 1LCIA 1KI7A 2NAFA 1AO0A 1JKXA 1CDEA 1K4YA 3ICVA 1YIDA 3B5IA 4OREX 4TS9A 5T67A 3SYRA 4GO1A 1SN7A 1P2BA 2VSQA 4S3MA 5AIAA 4ABYA 4D1YA 1U0NA 1VLJA 3GVIA 4YUAA 3C3EA 5K2OA 1KEPA 2OD7A 1DQNA 4HKTA 4L5JA 1JJBA 1VXOA 5EE5B 5DGXA 5C51B 3GEHA 2AK2A 4RESA 4TZTA 3AG6A 4K9KA 2IH2A 2XNDD 2PGJA 1DAPA 1H9BA 1RP1A 4OJQA 3QMPA 4HWKA 2CZCA 3QU4A 3BRSA 1WULS 3I2HA 4KWTA 1HH4A 2A5DA 3EIOA 4I1IA 1H0KA 4NU6A 4ZAXA 3RAPR 1GGFA 4XGKA 1J8MF 2ZB8A 3NBUA 2CVFA 1FQJA 1FRFS 2CLMB 4YNBA 4AS2A 3BGSA 1Z34A 1N6PA 4MGYR 3JTEA 4RGQA 5ERGB 5B3KA 1QOZA 4FD2A 3GLVA 1W19A 2D6FA 2C3UA 1TGYA 5F7OA 4H7DA 3JCZA 3CW8X 1NP3A 3ZV7A 3X3HA 1OAAA 2IYNA 1U3TA 1DV1A 1NI3A 4DV7B 3U61B 4PWZA 1E96A 3OZCA 1EX1A 1H6AA 4AROA 2A35A 3SXPA 1UMKA 5BV1A 1E4VA 1QO0D 1YNOA 2BCJQ 2GJKA 2HJVA 1SK9A 3NH6A 4NAVA 5K3DA 1E1QD 4BCDA 3G0CA 1GKKA 5ADHA 2P1ZA 4MV7A 3TQCA 4ARBA 1KARA 5K4HA 4W5JA 3L06A 1U1GA 3UYLA 2B3DA 2D0OB 3QJYA 3DOEA 1VHLA 4GG1A 2E85A 4IDAA 5A9RA 4LXYA 4MGKR 2YXEA 3EFOA 3H05A 4O29A 4YAIA 3V34A 3FUCA 2E5FA 3DHYA 2R8YA 3I53A 4XWYA 3PPIA 3RV4A 1GNQA 2XGSA 3OIYA 1J2TA 3V33A 4PCUA 1OXUA 1XTTA 4MPRA 1BDIA 2LDBA 4PCVA 1C9EA 1I7LA 3FETA 3E7WA 4O1HA 5EZ6B 3IHKA 4MVJF 3VKWA 3VR3D 3AF5A 2D2EA 1L7NA 3U4QA 4D9HA 4IDCA 3BZWA 3IJRA 4QAJA 1SCKA 5BW8A 2BSQA 1P91A 4G9GA 1O0SA 2B4KA 1G5HA 2OUKA 4WXHA 4KR9A 4N7RA 3SMVA 1H1LA 1LBHA 4M98A 1I3CA 4NJMA 5CPFA 4DDWA 2C88A 2A9FA 1SD5A 5BT8A 2RBGA 3HHEA 1TJYA 1D6SA 4NMXB 1MJ5A 2A30A 3ZK9A 3FAKA 3ZU2A 2RKWA 1GXSB 2DQSA 4D3YA 2F4NA 3LA8A 2IYSA 2CF6A 1P9OA 1D8TA 6REQB 3ORYA 4FZ3A 3TRJA 3QG1A 2EW1A 1J6UA 1WV1A 2ADFA 4MITA 1N8KA 2BGNA 3R9XB 3OFSA 3T3NA 1PZEA 4RH3A 1RR6A 2C2MA 1Y4ZA 3EG9A 2CXSA 4ND4A 4CPDA 3MILA 2BPOA 5KVAA 2Z0MA 5LMUB 1KZ7B 3CKLA 3FKJA 1DC3A 1QQBA 2GPWA 5JXHA 4IGKA 3H4VA 2MR5A 3CTMA 4P4GA 3E03A 2VUHB 1DUVG 3ICPA 3KT0A 4JK3A 2H16A 4CQMD 5HJ2A 2Z1NA 3M3HA 1XQXA 3ZE9A 4MUMA 4CHGA 3LVRE 3JW8A 3QKWA 3TFWA 5ALIA 4F5DA 3UJNA 5CYFA 1QVRA 3CZQA 2CZGA 2XH8A 3WOVA 1AKVA 1MX3A 1GAJA 4JUCA 4LK3A 1NMQA 1BMTA 1FDSA 1PZHA 3R6WA 2HDHA 2OWEA 2E49A 3AF0A 4KAFA 4QOJA 4PWYA 1ZMRA 4P32A 3HRIA 4UM9D 5FA5A 4EO7A 5J3JA 4BQNA 1E92A 1DAEA 2NOAA 4HMOA 3LA6A 3NHWA 1BW9A 2H2HA 4BFZA 3F5DA 3JAKB 2PKXA 3JZDA 9ABPA 1E62A 4COOA 4EL5A 2QQEA 1ZD9A 2J0UB 4EI7A 1EE9A 1EU1A 2QTVB 3K9HA 4XM1A 1ZK2A 5D2CA 1A5AB 1RHJA 1Z0IA 3KR0A 1DC5A 2O2GA 4EF5A 1T9GR 4RU1A 4OL0A 1JQJC 2AMVA 2J0EA 1KPIA 2C29D 2F9FA 2VWPA 3QLUC 4DLAA 3ZLBA 4Z3OA 2V74B 2ODPA 2C00A 2XBMA 3O4RA 3AHDA 1KC3A 3BMNB 4UCQA 3IOBA 1JDJA 2XB9A 3TB6A 5K0FA 3H87A 4BZZA 4KITB 3A6LA 3HPQA 1RLTA 2PYIA 2I1QA 2XLBA 2XYPA 1XPRA 2WD9A 2YV2A 3GNQA 4REMA 2Q3DA 4KIWA 4RHUA 3SLGA 4BBJA 4EMSA 2ZT7A 7REQA 3CZCA 2OQIA 5CA1F 2BTQA 4Q4JA 1QE3A 1ZCZA 3HU2A 1E18A 5C1PA 1SAYA 3COVA 1MOQA 1QV6A 3W4IA 3HYLA 4ENUA 4C0LA 4QTTB 1E3DA 1CDZA 5M7EA 4B85A 4B3HA 5C1OA 1O6CA 3T9FA 5IKXA 1AGNA 2CDAA 4XH9B 2YVQA 1QK5A 2WF7A 1NOIA 2WFMA 2FSHA 1SU6A 3HGTA 1GTRA 1WUHS 1F2TA 1CD5A 2PJDA 3BL8A 2Q3HA 3LX5A 4YRPA 1SUIA 4RIEA 4GP6A 4PHTA 3VDXA 1E2UA 1FQWA 4L51A 4OI2A 5CJPA 3HWRA 2C5SA 2QRGA 1UEXC 2WV9A 1MCZA 2R44A 2ZBDA 4HS4A 3MWJA 1Y1TA 5AXBA 4BC0A 2CL6X 3QBDA 1NYTA 2E55A 2X8JB 2E4UA 2QZJA 4ZT2A 3AETB 3SR4A 1Z5OA 3OEYA 1UJ5A 2F2TA 1D2HA 1E7QA 1E2HA 1AV6A 2JF0A 1J24A 1YZYA 1O5OA 3KKQA 4MQEA 3AL0C 5C18A 1W93A 2FW8A 3DE6X 2OCDA 3FN4A 3ZH9B 1I4LD 1PSZA 3FCYA 3FFXA 1ZK1A 3OLZA 4JT4A 3UWPA 4QUGA 3J81A 3ROQA 3JALA 1TJ3A 3B36A 4QGGA 5HVNA 4XWTA 4I46A 4JENA 1QTIA 2PGIA 2BR4A 4I66A 1EE1A 1EP2B 1OXSC 1UP6A 3C4JA 4XYEA 2R6DA 4HRXA 1TI7A 1EWQA 3DZKA 2Z8ZA 4FNMA 3HE3A 2P67A 2OXFA 3BE4A 4ALNA 3HJNA 3GARA 1QJ4A 4DA7A 3SHQA 1S7CA 3BMCA 3OFJA 3CEHA 1KI9A 2JCSA 3H17A 4DTIA 2F3TA 3PC3A 2MINA 1RRCA 3SX0A 4BQSA 1WY5A 4PG8A 3D2CA 2C2HA 3R3SA 1CJKC 2IWRA 3QKSB 2OHFA 3EWSA 4I55A 4O1IA 4DB2A 4DJEC 2VXYA 3CUKA 1P6XA 4CE6A 3KZNA 3O21A 5EJAA 3IMCA 5FPTA 1SD1A 5H3LA 3UOWA 2AC2A 3DOFA 4O4HB 3VMFA 3SZMA 5IHPA 1WPGA 4NE9A 3OO0A 4UUMA 1IOZA 1ECCA 1AK9A 4AUNA 1ZIXA 2Z2IA 3WJ2A 5TQ2A 3ZWYA 3AUSA 4YT2A 1YAHA 1PJTA 4IVPA 1ZK3A 1SWWA 3SSMA 4CIWA 4YUYA 1FFEA 1OH6A 3P9YA 3TOZA 2D1YA 2JFGA 3NJ4A 1MOPA 3GRKA 5C8YA 2C3OA 2PSEA 4BYGA 1Z4LA 4GKBA 1I3OA 3FI9A 4DLYA 3KOUA 4BFUA 5JNTA 4PCAA 4IDHA 2Z2JA 1W85A 1HX7A 3R7DA 1W1WA 3I83A 4FMDF 4U9IS 4KACA 1PKEA 3NRBA 2LE0A 1JYEA 1PJ2A 2J3IA 2XUDA 2XQGA 2Q5HA 2NM0A 1GTZA 1OZHA 4MRMB 4GMDA 3V7WA 4QT0A 1Q1NA 1F5SA 2BKXA 2MSNA 4FVTA 1VMKA 3ABOB 4QXQA 5ISMA 3H8JA 3WJAA 2UUBB 3G8CA 3NYIA 4HDSB 4LUCA 3OEWA 3ENWA 3EQ8A 4MV5A 1SB8A 1Q57A 4PZ9A 2HQRA 1CIPA 1AGRA 1GM5A 3NEAA 4Q3EA 2WJPA 4IPTA 4BWGA 3ONEA 5DN6A 1O8BA 2J07A 2ZR9A 3K9LA 3T7DA 2JIRA 1PV1A 4QL3A 4UDOA 1SNYA 3KKMA 2O20A 3L0IB 3EPPA 3FYCA 1LSSA 2YZKA 1PJZA 1QQ6A 1VE1A 1ADJA 3U44A 1SXJD 1UOEA 1G21E 3MFQA 1Y6JA 1KYIA 4GSKA 2JARA 3C8MA 4MAMA 2OFWA 1ZGAA 3ZIAD 3O94A 4XARA 5EHZA 2HRDA 1ZD2P 4BPRA 3H83A 5HMLA 5IABA 1XJQA 1E9VA 1V0JA 3LSYA 2BFBA 3WLNA 4K0KB 1P0FA 2QDKA 5FLEX 5CG2A 1C1DA 3VPDA 2IS1A 1F06A 1SHUX 2IZ6A 3OUTA 3HACA 1L5HA 4DBLC 4M3NA 2AWNA 4QJ5A 4XR4A 3SBDA 4V0NA 1US8B 3E8MA 1EIWA 3ZWBA 4Z8YA 2X8WA 1J25A 5CMLA 3P0FA 5AM3A 4RTJA 1PVVA 1QFYA 2OMKA 4NE2A 1E3LA 4KOEC 2NO1A 1OFHA 2XLCA 4ZAYA 1CP3A 2NUPB 5G2OA 2DHQA 1DQRA 2DJIA 4QWWA 3AH8A 1NHGA 4BNDA 1RIFA 3PR1A 3PDHA 3RYCB 4EA6A 2J3EA 1S01A 1YUBA 2HTEA 4GXQA 2F3PA 4PHGA 4B76A 4BZWA 2F1KA 2YZ2A 4NENB 1SBIA 4UBIA 1TEZA 1R5BA 3MUNA 4MQBA 1FBTA 5THXA 3LCCA 1OLUA 1NVVR 4NONA 1II8B 2HX1A 4KIUA 1KKMA 1QYVA 1K8RA 4OSEA 4BJ6A 4X62B 2VF2A 1TD9A 4BIMA 2X9GA 1HT1E 3T5DA 4DJFC 4ISCA 1KRWA 2PZ8A 1R1DA 3U40A 2ZJ4A 3BRWA 1GNPA 3DMDA 3I52A 5HM6A 3D7NA 2LP4Y 5CB4B 2QRKA 2QB5A 3S99A 5K3EA 2O6HA 4JMLA 4I8XA 1UPBA 4KYTA 4C2BA 5J58A 3S81A 4C78A 3V2GA 1GY8A 5AXCA 1N2IA 4KH0A 1QB7A 3Q3EA 2G09A 3RTDA 2ECFA 4TGLA 3PNOA 1ENOA 3KSUA 3NP9A 4O4JB 1PFUA 4KPFC 3HM9A 4E5DA 1JR6A 1KDRA 2A9JA 5BSEA 1NBMD 4GE0A 2MSDB 3QWHA 4GOOD 3CVOA 4RTNA 1XTPA 2FEKA 1UDRA 3WE7A 2IBTA 3U1BA 2B4YA 4KUGA 4WAUA 3IKMB 3UMBA 4E5YA 4U2DA 1XYGA 3PC4A 3ZD9A 1VJ5A 5LSAA 1G8PA 2V45A 1O58A 1PHPA 3BBPA 3H5RA 4YQFA 2VDWB 5A3JA 5DT2A 3LX4A 4W5WA 3RIGA 3TLJA 5IYZF 2HBRA 3PFCA 4M99A 3JVVA 4TMFA 4BVGA 1IB6A 2RI0A 4R40A 3S1SA 3EIHA 1NUSA 1SBQA 4BECA 2R11A 5A4FS 1HKHA 3PJFA 4KE8A 5LOVA 3W5BA 2EL7A 1QCZA 3TW8B 1TAHA 1T0PA 1IY0A 2BCGY 3CNQS 3H6KA 1Q95A 4H27A 3KP1A 3U7RA 4BAUA 4V1CB 1WP9A 4TN5A 2Y71A 4KW7A 5BVGA 3EW9A 2RONA 2P79A 2P8JA 5BQOA 1IRXA 5ALXA 3R5TA 2D54A 3GYBA 4IVRA 1ND6A 3WL6A 4W7IA 4ZYUA 3UAWA 4LJRA 1QH0A 1GUBA 3NANA 1WS6A 2WYUA 3UKDA 4PZZA 2JGEA 3CR8A 5EIWA 1UBKS 3KVOA 3RRFA 5LZ4A 3HB4X 4CMEA 4EG1A 4B47A 1DE0A 5EMKA 2GBFA 4NDZA 1SHJA 2IUSA 1VIVA 1Z6PA 3LY8A 5HQTA 2F59A 3ESQA 3GLHE 4IQFA 3S68A 3CN9A 4OJNA 1P7ZA 3TDMA 4TROA 1Z68A 4HDOB 4GYYA 4QD3A 4RJLA 5AHXA 5J1TB 5K8TA 4DANA 3MJVA 2ZRMA 2CGEA 1KYXA 3ISVA 5CEEA 2POQX 5FHRA 2WSMA 2C42A 2A59A 3AR3A 1JYFA 2JBAB 3L0BA 3P9XA 2IV7A 3VMMA 1TF5A 4YDQA 3A3KA 5T4EA 1QBKC 4AY6A 3KT3A 1SUBA 2I8AA 2VN8A 3STYA 2BRUC 4O0LA 4TUYA 2O2IA 3C6BA 3F98A 3QWAA 5L8VA 3ZZ0A 1V6CA 2NXWA 2EFCB 2FQXA 2LIPA 4IJ6A 4KQWA 1N2HA 1CE8A 4GPZA 2C5HA 4ZVSA 3ZDQA 5JT1A 1EBFA 3C1OA 5LNK6 1IFXA 2PT9A 4JJKA 1KE2A 3C5CA 4DC0A 5IZCC 4HBGA 1DRJA 4CHTA 5BN1A 3NVDA 3WRYA 2JEZA 1TEXA 4FYMA 4KMOA 4ZZ1A 2ZFUA 3SX2A 4MEBA 1H8ED 2PKQO 4HDAA 4JI1B 5CYOA 5TMEA 3O95A 1ICEA 1U6IA 2H59A 2VJNA 3IRVA 3NV7A 4HFNA 1OI2A 5K0EA 3EXG2 3N2GA 3VNAA 5F9HA 5AJUA 3K0KA 3M6XA 1USGA 2PH7A 2Q6IA 1MBZA 4HH1A 3ORQA 1XAHA 1XJWA 2BZSA 2MMCA 2PAFA 3ZCUA 5A4MS 2BEUB 3MIZA 3UAGA 1NXXA 3LGSA 4DR3B 3JR7A 4C2UA 4RF5A 3OQPA 4H7EA 5F51A 3KXLA 2GAJA 4A6EA 5KTNA 3IBFA 1UDCA 1ZM3A 3CPSA 2FUNB 4YRCA 4DBVO 3JR3A 1Z0UA 4U2BA 1YZUA 2WD7A 4IM7A 4N6GA 1ODLA 2HV8A 3D0KA 1FZQA 5LIPA 2CFTA 4FI3F 2EXXA 3VV3A 5JNWA 1RCTE 3Q72A 3OE5A 4NOJA 1PR1A 2FEWB 2QPTA 4P7FA 3TNYA 2OV8A 3A1CA 2XTJA 5CT5A 2NSHA 4MUKA 1L7VC 2WAYA 1UJ2A 4OYYA 4KBYA 2AFIB 5D8DA 1W44A 3QLVA 3EVFA 4RF3A 3GBPA 1IAVA 2I2AA 4HDKA 5K3OA 4N39A 2NQTA 1TUBA 3TD2A 1JS1X 1OT5A 5CXSA 2BOVA 2VUTA 4LBVA 4E14A 3GEGA 4KJXA 2UVDA 2AW5A 2I1VB 2WB2A 4IEIA 4K3VA 3FYDA 4KG7A 3LHDA 2BH2A 4P0QB 3UB3A 4A3SA 2H85A 5HKBA 1Y9JA 5BWOA 3D3KA 3WB0A 4RK1A 4DCJA 5E38A 4UM7A 4LQDA 3ENNA 3UJ3X 2C1ZA 5EHIA 4BE7B 4F92B 4J9VA 4ZJZA 2J3KA 4S0XA 5AJZA 4D96A 3BAZA 3MCTA 3MT7A 3WIVA 3K5WA 1T4BA 5FXMA 4AS1A 1B14A 2Q4RA 2FSUA 1GTJ1 4TT3D 4UHJA 3PFNA 1N2CB 1T9GS 1MA0A 3BXFA 3DMRA 2QQ5A 1U90A 1A8HA 3JQCA 4CCYA 3NJRA 5T6MA 4DG5A 3VUEA 4ASUA 1NG1A 3I9NA 2R8EA 3K0EA 3OZFA 3OQVA 4HQLA 4MWGA 3USZA 4JD5A 4DLWA 5C5CA 1V96A 4R54A 3MGGA 3QWBA 4QECA 4Y9UA 1KJWA 5E1MA 2QHXA 5H83A 1KOLA 5DYYA 1ZVMA 1A96A 4WCDA 5FLKA 3VTAA 5G1PA 1N77A 4GUDA 5KKAA 4BMPB 3R0VA 4BVHA 1D7AA 1E2QA 4UDYX 1SKUA 1Z62A 1RI3A 4G01B 2EFJA 3R4CA 2Q9BA 4ZI7A 4PLWA 4W5TA 3QTBA 5L9AA 3WYGA 2B21A 3NJ8A 3LIPA 5JQGA 4HEHA 1NQWA 4J49A 3V8MA 3GEPA 4M55A 5AOAA 3VKUA 2ZETA 4JQYA 2IY7A 3JTMA 3NBQA 2XR1A 4HAZA 2JW5A 3VU0A 1RHMA 2QL5A 3FWPA 5HOEA 2OXIA 2FETA 2AH5A 2C5BA 3GD7A 2PRJA 1NPYA 5A4JA 3F78A 3KXIA 3SHTA 4RKWA 1GJRA 2QI9F 3LGXA 3C43A 4C0HA 1NKSA 2XTZA 5C7YA 4TL7A 1WLYA 4GM1A 2G1UA 3LPMA 5KYYA 3MINA 3DKIA 1E1LA 5SY9A 3WI7A 4EIWA 3E5HA 1S2NA 2G8NA 1OD6A 2F8TA 2ZTHA 1NHWA 3IAFA 2GLXA 3LQQA 2R6CA 1F7VA 2VP4A 5F3RA 4YAFA 1DBIA 1EUZA 1ZJ6A 2ZXEA 3ZDEA 4DSAA 1FVHA 1KQNA 2H07A 3IDFA 2BAGA 4YRNA 1JEJA 3P19A 3FHCB 4EHLA 2GBLA 3W5DA 5TS3A 3MUFA 3VR4D 2PWAA 1PL8A 1U7TA 1VMAA 1Z8FA 4JFRA 2Q99A 3C6YA 2XKJE 4K7JA 5D01A 4Q4AB 4EGJA 4MV0A 3UPTA 1KZ9A 3GFPA 5EZYB 5A0TA 3NM5A 5KKCA 3ICCA 3CH5A 5IMSA 2FR1A 1UXKA 3KHUA 3BRQA 1HDOA 1Z4QA 3RVPA 5HIKA 2YNMD 1LSOA 3O93A 5AUPB 4Z9AA 1QIMA 1XHFA 3D1JA 3H2SA 3SHWA 3UXYA 3WIDA 4ETMA 2C03A 4FW9A 3GAMA 3RV3A 2P1DA 3G17A 4A15A 3M5DA 3R7FA 2P9GA 3EUEA 1XWWA 1PL7A 4JB3A 3QOXA 3VR2A 5DCUA 2F3SA 1R4MA 2WYIA 4GZLA 1ZXBA 2HF2A 2IHNA 5KDOA 1PK7A 2HKIA 3L7OA 4MGEA 1U98A 1FMTA 1WCIA 2CVQA 3U1TA 5JUWA 3WBJA 4E4TA 3OFNA 1T36B 3DPIA 4GW3A 2MYTA 1SM4A 3GP8A 2DULA 4NOLA 1FY2A 4E5NA 4FHFA 1I1QB 1N6LA 2DH6A 5BWLA 1UZAA 1KYQA 2E4VA 3IBGA 3KQTA 2AZMA 2IS2A 2QRVA 5JY6A 4H3SA 1TIBA 1QO7A 3Q1LA 2WYHA 4M0LA 4GVLA 3OLCX 3B3QA 4U39A 4KKXB 2PGAA 1YGPA 4UE3S 2DWQA 1GTL1 2VK1A 4GUAA 2MSKA 2QU7A 4PLZA 5JPDA 1Z7WA 4P1ZA 3L43A 4KFCA 2ZIEA 1IMJA 2YWFA 1NA5A 2C0QA 1BKSB 1V9CA 3JYOA 3PC7A 4HJXA 2PGDA 2GA9A 2OO7A 1AQLA 3FCUB 3I4LA 4WERA 5KOYA 2CYCA 1W2WB 5BNWA 1VG9B 1DVRA 5AMXA 2SCUA 2PQ6A 4F96A 5B57C 3G7UA 5C4GB 4ML3A 2WTBA 2HXGA 2QSYA 2FX3A 3LSTA 1F2UB 1SPXA 1Y3HA 4MVJP 2QG6A 2DEUA 3EMBA 5H0IA 2BVNA 5F9FA 4R7TA 1S2GA 3SEFA 3WXBA 2RGBA 3RK4A 1R7RA 2O7NA 3EUAA 1XC7A 5MN5A 1NTOA 1J1UA 2GD2A 2R5FA 1KEUA 4JZKA 3ZIDA 1C4WA 1H66A 3DXYA 3M5WA 4I9UA 1ACLA 1ZH8A 1ACJA 3P0HA 4OYLA 4EBBA 2BY4A 3W7BA 2X0FA 1JIUA 3AJDA 3K0FB 2O8NA 3VPXA 4Z9XA 5LYJB 1VL0A 3VU9A 2JFOA 1SZDA 3Q7RA 2AZ4A 2X5OA 4OHPA 2HJ9A 3X1XA 3AHHA 2BCEA 3GYGA 5KYWB 4ZGWA 5DNAA 1OZFA 3QW2A 1ZC3A 2HV9A 5GQSA 3LYLA 3MWDA 3NW9A 1ZH6A 4TMYA 5TPZA 3K71B 3AB3A 4UTZA 3ROFA 3A28A 1J21A 4NBVA 2XT0A 4CFSA 2CL7X 3R7LA 4BAGA 3S7ZA 3BG5A 3SKVA 3DSRA 3LUPA 2WJWA 2R85A 3ZDZB 3P2OA 1N5RA 1YMVA 1A27A 1NXTA 3G5TA 2R8BA 4P08A 2ATEA 5HQJA 2Y1KA 4H7JA 4Y2XA 4E5MA 3QEMB 4P5PA 3X1YA 1QO9A 4HYYA 2GRUA 5DSZA 3VC3A 2IE0A 1RZ3A 3P0JA 1IWOA 5JBNA 1OHHA 4DILA 2OLEA 2IHKA 1FFBA 1N0IA 1ESCA 2G28A 5JAMA 4MV6A 4INAA 1G2QA 2FF5A 4NVRA 4G0QA 1VBKA 1LH0A 4RNDB 5JWHA 5CP8A 3VUFA 4J16A 4Y1GA 2YFKA 5F21A 1EGMB 4Q3LA 4ENPA 1L1RA 1TKBA 2Z6QA 3KOZA 1EFPA 3LUBA 2TS1A 2V9PA 2WJHA 3TG8A 1E2IA 1NMSA 1DV2A 4IYRA 4MYDA 3PFKA 4G5QA 3TLAA 4BFCA 5HR5A 5EKDA 1CJUC 2AR9A 2CK3D 2I29A 1YT5A 2LZ0A 3OP4A 1K7XB 1BD4A 1V37A 2FZKA 4C4XA 3GP3A 1GGJA 1MDBA 2AW3A 5JSYA 4O1MA 4TV8F 1R27A 3PUYA 4HZGA 4TV9B 3PUZA 4B45A 4OBEA 3KTOA 3LUAA 1G6HA 4LXGA 4EM6A 1SG0A 3DT6A 1E2MA 3GT0A 1J0EA 2FLKA 3PT5A 3U9SA 1JFRA 3LECA 1AIPA 1QPBA 1BA3A 4AO7A 1XQVA 1N6IA 4LXTA 5KQPA 3GJYA 4BEJA 4CIAA 4QFBA 3WAGA 4YJGA 3I6QA 1S9HA 2A88A 2GETA 3DBIA 4V3CA 3ZIUA 2FK8A 4E7OA 4OFBA 3TLBA 3X43A 1WB9A 2BV3A 1IUOA 1D3AA 1YI8A 1GCUA 2QQGA 3HDQA 4FHDA 4HAYA 4QHSA 3WGJA 4AJ2A 5E4JA 4MYCA 4BNMA 3Q0IA 3D31A 2CLFB 1VSTA 2X15A 4MK4A 1RAFA 1W52X 2H1SA 1DEAA 2CUTA 1T4DA 1E4OA 2PLWA 1RSZA 3B89A 4MVJA 1JXAA 1Y9AA 1Y42X 3MOIA 4A8HA 2CLKB 1FMCA 4AQYB 3ER6A 4ZT3A 5T4HA 4BVJA 8ADHA 1F8YA 4RPLA 1RM4A 1ZKDA 2FXVA 1MO3A 3FYHA 3T54A 3WSTA 2ZRNA 3LT5A 3L7YA 1U94A 2G72A 2RB4A 4PTYA 1GPWB 2JIZA 3N0WA 4ZMRA 2FSGA 4G0ZA 3PNMA 1BMFA 4OKSA 4L6IA 5EHGA 4LY9A 4M9XA 3I01A 3MWEA 1N1EA 4NCKA 4GPIB 1Y9ZA 4X65B 2F3RA 1H3NA 1WEHA 4HLDA 4L22A 4GLFA 1FTGA 3CZRA 5L6LB 2P3QA 3FZQA 3GZNB 2VBCA 4JLOA 4B17A 4CN8A 2GARA 4HQRA 4W1PA 1T2FA 2H4XA 3IH5A 3ES9A 4JC5A 4JJIA 4NNJA 1K8XB 1A8PA 4Q7EA 2OY0A 3TAXA 1P4JA 4AVYA 4NYJQ 3A3NA 3ASUA 2ZYHA 2DB3A 1EX6A 1HE2A 1Z5GA 5T5QA 2IQ5A 1Z0SA 2I62A 1COZA 1YZQA 5AJXA 5B2ZA 2VJAA 4M1EA 2XRFA 5GV7A 3IMGA 4REOA 4BNNA 4CF7A 1FNMA 2QMUA 3H0KA 3N2ZB 3PNYA 4HAXA 4ODIA 4P58A 5C37A 2D4AA 1K92A 1L7DA 5LQRA 2PJUA 1FVXA 2CY0A 3BHNA 3AOGA 2L18A 2YYSA 1QLWA 2FH5B 4KNWA 4ZGGA 1S2IA 1MQAA 1DQZA 5JIBA 1KI4A 2J6IA 2ZVQX 4W9RA 5D3KA 1VIYA 4IV5A 5AR1A 1GEGA 3QG5A 4R31A 2DUJA 3P2YA 5E1OA 4S05A 4J75A 2RHRA 2PR7A 4ND7A 3MZ0A 2ZSFA 4S12A 2HO4A 3S5JA 1XTIA 1ISHA 1W0JD 1EFCA 2ZSIA 3IQXA 4BX2A 2O59A 3T12A 2AYXA 1KVSA 2Z5GA 4J90A 5HIIA 1X7YB 4EB3A 1E7SA 2IHZA 4XCQA 5KTPA 3BDIA 4UBOA 1EUCA 1C1XB 2R1TB 4QBGB 4R8MA 1NYQA 4CL0A 2OORC 3M6VA 1XK6A 3QOYA 4IX1A 1HFKA 3D0OA 2HRBA 3L0DA 4JB8A 4WPGA 3STVA 4A1FA 5BSHA 2FMFA 5CA1A 3GFVA 3NM4A 1SWVA 3Q2OA 5CGQB 5C4MA 1F4LA 5TSDA 3C8DA 2H29A 2JFHA 1TD1A 4OFZA 3BWYA 1VCNA 5IAAA 2YW2A 3GNLA 3HG7A 1QRAA 1U0EA 1YE3A 3CU5A 4BBAA 1HQKA 3BIOA 2VJQA 3IOMA 3OZIA 1IOVA 1E4EA 5KNBH 4PG6A 4X94A 2A0WA 4MJLA 5FWDA 1EJ2A 1A4RA 3WB1A 4QVKA 2ZAIA 4D5EA 1NVWQ 5L45A 4MHTA 2BP7A 1NLYA 2VZLA 3RDPA 2W6NA 3D3NA 2BZGA 3DEJA 2H11A 4MDHA 5FBZA 1GA4A 4NFHA 5H68A 3SEAA 1ZH0A 5G0VA 4E22A 5LXTF 1X1CA 2FPIB 4JQCA 3D4BA 3OZRA 1U2QA 5U9CA 5EI5A 3ZR4B 1QOPB 2HLHA 1VSUA 3TZCA 2XJ4A 1VA5A 3KQSA 5E9WA 1TRKA 1Q19A 3E9YA 1PFWA 1P80A 2E37A 3WZLA 4JV5B 3MOSA 1UKCA 3H42B 3T7JA 4CM4A 5JYDA 2F8SA 3E9NA 5E7QA 1DDIA 1IH8A 3QMVA 5EEHA 5C46F 3THYA 2QNRA 3DWIA 2WICA 1BS1A 3AZOA 1Z4IA 3BD7A 3G0BA 3NIGB 4JHLA 3SBOA 5D5HA 5J4LA 2LCFA 4RTKA 1VGVA 2YIMA 5EWLA 1PUIA 1E9SA 3H3FA 1HM5A 1R00A 1UBUS 3O4JA 3OE7A 4JHXA 3ZNPA 4F0JA 3FHTA 5LLDA 3DULA 4LJ6A 1AB5A 3GT3A 4IS3A 2AN4A 5C32A 3O8BA 2HCRA 4P7BA 5DB4A 1P75A 4KGXA 1C3JA 1C7IA 2ZI5A 3WGGA 1MEOA 3HUFA 1YS6A 4JT8A 2QZZA 4TSFD 1EG7A 2FFBA 2X1HA 3RIMA 1U80A 4RK4A 3KQPA 3R7WB 1O03A 2RHWA 4L4ZA 2ZBQA 4D5GA 4FYWA 1BX0A 1GA6A 1WSWA 2A1UB 3P4YA 3FJ1A 1V95A 2ZJOA 1A72A 1AQYA 2H08A 3JAWB 1KTIA 5EKTA 3BZBA 3ZBPA 5BN4B 3H1PA 3G2NA 1WE2A 2Y2VA 5K51A 4AF6A 8AT1A 3KOWA 5EIAA 4KXXA 2XOKA 3C6XA 1YDWA 1OQAA 3LWNA 5EFZA 3QFSA 2HJGA 1P19A 1RZUA 2G06A 5BVHA 2FGJA 4NBKA 1Y89A 2DP4E 3LBNA 4PICA 4KQEA 2XIJA 3NCTA 4LZZA 4R3WA 4GH5A 4XM2A 3BWXA 4V0RA 2GEBA 5H4HA 1R3UA 3BIFA 5K99A 1HR0B 1Y5MA 2XTMA 3QHAA 3TZKA 4MYHA 2RHLA 5TLSA 4TMZA 4C87A 2JC3A 4OX9Y 3JQGB 4LZOA 5TS2A 3P9IA 3R74A 3AEQB 2FRVA 4G63A 3T7CA 3WP1B 1NN3A 4BJ1A 1E7RA 2P9EA 1KR5A 4FP9A 2JD2A 5E9JA 1V11B 3OU7A 4HTAA 1M34B 3U4MA 4XGQA 2VP6A 3Q4GA 5EMLA 1TQ4A 4L9WA 2OV6A 5TARA 3FYUA 2EVWX 2EZ4A 3OZXA 3HO1A 4Z54A 3RYHB 2WEKA 5FBWB 4M1WA 5HHTA 3PPXA 5TIIA 1C3LA 1Q2UA 1I6MA 1Z29A 4G8JA 4IX9A 4UASA 4XTCS 5CHEA 5AH0A 1UFKA 2JANA 2Q1TA 5FNVB 1F60A 1G0OA 3CLUC 4JUFA 3D3QA 2WU1A 5BN3B 1WPQA 5C7IO 2DETA 3A8TA 3K9NA 2LDXA 4I0WB 4H1UA 4KWIA 1BYUA 5ERYA 4LSMA 3FPCA 4PZEA 1TU4A 3G6KA 2GJ4A 1VYTA 2HA4A 2P4UA 2Y0BA 4RD0A 4XX0A 4E5KA 8OHMA 1CZHA 1ORHA 2BFEA 1IXZA 1CUSA 1G7TA 3DFMA 2QZ4A 3LY7A 3VJMA 3T5TA 5EZSA 3OEEA 1XKTA 4IQ0A 1OV4A 2QTHA 5CLHA 3A1DA 4BO1A 4JU8A 5J4KA 1JR3A 4MRNA 4DRZA 1E59A 3ZKWA 3LLMA 4GKVA 4IRUB 2W4MA 3IBCA 2GK7A 3RC9A 4CR8A 2FFHA 1EVQA 3DWEX 3EGDB 3HKDB 4PX9A 2YJ3A 2FOXA 5A6VA 3HFSA 4FW8A 2IV2X 5HUJA 4OM8A 4GF5A 2WAXA 3UA3A 1T5DX 9LDTA 5JSZA 2YVKA 3ILYA 2GXQA 3R44A 2CKMA 2JCXA 2OCYC 5JLAA 4W5QA 2AG0A 1DIAA 4BWFB 1GDTA 3TJZA 4HVLA 4LWZA 4PLHA 1N0WA 4OSPA 4M0FA 3N8DA 5GONA 4YRIA 1ZITA 3NWEA 1W94A 2WTAA 2ZYIA 3K2IA 3G3EA 3L02A 1EP9A 4TXMA 4DREA 4LDZA 3KCNA 3I2IA 3VTKA 3KYCA 4AF8A 5LUAA 4N5DA 4OU4A 2HF7A 3BF8A 3JQBA 4MKIA 1OXKB 4Z0PA 4WN3A 1JDVA 3GQBA 1WZCA 4OHZA 3WAKA 2O8BB 3ZHTA 2FN8A 2RG7A 2Y1EA 3I3SR 3CS3A 3A6KA 2BGUA 4C5CA 4E4YA 3H5OA 1RKQA 2QU8A 5AVRA 1J7JA 2YIJA 1BU8A 1T8SA 1W36D 1N5JA 1GADO 3TZ6A 3UWDA 1B0UA 1RVV1 3F49S 4P83A 2WJJA 2OUIA 5CNKA 1JZTA 3KC2A 3GRAA 4QOSA 1RYBA 2LKCA 1HQYE 3NHRA 2QD3A 1P7CA 2KM1A 1H2EA 2BM9A 4UC0A 3HY6A 3CRNA 4J94A 4MWCA 1E3SA 3BYZA 4BMCA 5IJ0B 3ZCXA 1LJUA 3GG2A 4KAAA 4ALMA 4ZTZB 3ODPA 3C16C 4I1UA 1RFLA 1X9HA 2YWDA 3KZ1E 4JYBA 3MS4A 3W7AA 1VYVA 4AD8A 1JHDA 1JH8A 2H8KA 2VHYA 1K7FB 2XUHA 4MCJA 5L95A 2IIPA 3DEYX 3FUVA 4C14A 1N2JA 1L5WA 3R7SA 3AK4A 2DX7A 3DYVA 4S1WA 1E2NA 3BEOA 3NO4A 4IOMA 4X1IA 1VLHA 3NKFA 1RQNA 2W5UA 2B30A 5IX8A 2VYVD 1WXEA 5CEJA 2PZFA 2FLVA 3B70A 5I7OA 5DRYA 4F9TA 4ID9A 3DE1X 1UBFA 3N87A 1VCMA 4QO8A 3O2JA 4G0VA 5HCIA 1HOTA 3D8SA 1GZUA 3EOZA 3IXQA 4HDMA 4OA8A 3TZLA 4BFYA 3AEZA 2Q8QA 3G13A 3MQ2A 3C2QA 2XUOA 3EIFA 3IESA 1CVLA 1ISFA 5HSGA 3UZUA 4TXLA 3RTAA 3F5QA 5CNMA 1JLLA 2ASEA 2Z9DA 2WU0A 2UZ1A 2RCNA 1SJ9A 5FA8A 1DG3A 4L4UA 2Q5LA 4YP7A 3KQWA 2J6HA 4JLDA 4KIGA 3HY4A 2W8BB 1U2SA 1UK7A 1YB2A 1T34A 5AW7A 1AHPA 3B2QA 1EMDA 1WQ1R 2DG2A 4RZUA 3QMWA 3WYEA 4MEJA 1N3LA 1M76A 2O1WA 2QVYX 1DTEA 4I4TF 2FMUA 1KGSA 1CU1A 1FU4A 4L0MA 4O33A 1Z15A 2J4FA 4P5EA 3WJ1A 5K2MA 5J2TB 4J4TA 2ZUBA 3H0EA 3QEAZ 1U28A 2YQ5A 4XW2A 4QLBA 2NXCA 2WZCA 5C2JB 1T8UA 4JYZA 1KQPA 5ALPA 1P3JA 5EMNA 3WXMA 5MGNA 2FV8A 3YASA 5TC4A 2C2KA 1DOZA 5LKAA 3NV9A 2CE7A 3UNXA 5K0JA 2G5CA 1KMHB 1WMDA 5L3QB 4UNRA 1SVNA 3OCJA 3PDIB 2AJDA 2IP4A 3F7MA 2D2XA 1Z6QA 4QDOA 3FI0A 3THRA 4S2EA 4K2HA 4Q93A 3TOVA 1MG0A 2QN1A 3DUFA 3VO9A 1JE1A 1M1NA 2PPVA 2JHAA 2GCGA 1P81A 2NYRA 2DUUA 3KUCA 4ERXA 1OI3A 1TVCA 5BQXA 5IT0A 4C76A 1AE1A 2LD4A 1X1QA 2OESA 3KTAB 1RRMA 2R48A 4GICA 3HY3A 3U4DA 3LQ1A 2JHPA 2QX7A 5J2UF 4LYYA 3WQHA 3MRTA 3TFQA 4JYAB 2FG5A 3A1TA 3PQDA 2JK0A 2BT4A 1QX3A 3VYRB 2WBLC 3ZBTA 1DLJA 4GBGA 2VYNA 2EIHA 2J85A 4PPGA 4QGFA 5KVSA 5IT9A 3C45A 2VTBA 3GZ4A 5JJIA 1PT8A 4KRGA 4YCSA 4D4GA 4PQGA 1N1DA 2H7YA 3BTSA 2QD5A 3O2QB 5I9TA 4UUPA 3LL4A 4BN5A 1JU9A 2C4MA 4XWOA 5AVOA 1BWQA 1OYYA 3HABA 5CT9A 3QBEA 5CD1A 1YFLA 4Q18A 1H85A 1ONNA 3KM0A 1PGJA 3V32A 5IAKA 1YVRA 1H0RA 3GJXC 4OXYA 5CW2A 4EEKA 1YJCA 2GB4A 2XDWA 3L84A 4MVCA 4AL4A 4C21A 3JAMA 4HI0E 5AKGA 5DULA 4YHHB 3HCOA 3VNQA 2GZSA 4FFMA 3K6KA 3IODA 5AM5A 2QMEA 2ZT6A 3WYDA 5I8WA 4BMZA 4OHKA 3RHTA 1FYWA 2I76A 1DXOA 4YV2A 2O8FB 2FP4B 3QVXA 4Q7JB 3TVDA 3UK1A 1UQUA 2QVLA 4MP6A 4WBNF 3GR6A 1DFIA 4HLUA 4R1SA 5DXAA 3RS4A 2J9FB 3NWBA 3ZWKA 1HE5A 2AFIE 1ATZA 3N2KB 2UVPA 3EVGA 4HQOA 1EINA 2CMHA 3CIOA 4RDIA 1FX0B 1EJ6A 1G0NA 4DIMA 5FYQA 1U2RA 3L79A 3ZYZA 4OK6A 4B44A 1NYLA 5HRCA 3A7EA 1F17A 4NV3A 4QXOA 1XXHB 2AK3A 4LOLA 3LOPA 3F6PA 4PX5A 4Y6OA 4PPNA 4BIIA 6LDHA 4JNKA 1JHRA 1L4YA 4IEFB 4C43A 3A1FA 2QPLA 3N3BC 4GX2A 1LPPA 5C53B 3EGVA 5GOTA 4FXPA 1ODKA 3OQ1A 1PV2A 2JKZA 3M6LA 3ZY3A 2BEKA 4PEVA 5F1YA 4BFVA 2IEZA 2YICA 3VH3A 1ZR4A 1F2DA 1EEXB 3AXTA 5CXXA 1N2CE 3BN3A 4EJ0A 5BR1A 3CNLA 3U7QB 2JRCA 1ICIA 2PX3A 3ME5A 1BSVA 1ZD1A 4ZVPA 3ZW7A 1E2LA 2ZUWA 4V0MA 3PPYA 2EP5A 5F5NA 4PW0A 3W5AA 1WZUA 2PLAA 5J47A 1GQQA 1JHUA 3F7TA 2D5CA 2XUJA 3ESDA 3HKEB 1XTRA 2ALJA 3GQVA 3BRWD 1Y6QA 4HPJB 2XCTB 5CLIA 2AD1A 2ODWA 1I0ZA 4G9EA 3DL4A 5REQB 1O77A 4WBSA 1ZUWA 5CTAA 2I91A 1GPLA 3IT3A 3G9XA 4DCNA 4O4LF 4PZLA 1G63A 1TQDA 2HUNA 3SQDA 1XF1A 3QEJA 2CBXA 1JAIA 1KJJA 4PZCA 3HA3A 3O2NA 4IDQA 2FPLA 4MS1A 3IQHX 3KFVA 4MW5A 2R7MA 1F8XA 2ANCA 4N8EA 3VR6D 1KYTA 4LFAB 2G9QA 4N3AA 4OBBA 4H16A 4XA8A 2V4UA 3C5VA 5JCOC 2LGJA 1YE8A 2DH5A 5A06A 5A2QA 4WNCA 2GPAA 1XF9A 2OD9A 3L07A 2E87A 1JVSA 1YWGO 3GJRA 4ZANA 1A04A 2WOJA 3PP8A 3LYUA 3FBGA 5TGTA 3ZNQA 2APJA 5CVEA 1E9DA 4B33A 4BYMA 5CDFE 4ZOLF 2C7QA 2DLNA 3ULKA 4JBHA 2RGRA 1YASA 3INYA 3GWGA 3F7NA 3MUEA 1UT8A 1IL0A 1DDGA 1SU8A 2X0IA 1MZVA 4UD2A 3KG2A 2TMDA 4ZT5A 4DDMA 4UCWA 1EM6A 4GZ6A 2BHLA 2M1ZA 3SGLA 3BFJA 3K0AA 1GQ2A 4OB8A 5HDQA 2O06A 4OK3A 3QVUA 1C3XA 1ZKMA 4PYMA 1ZS9A 3GAZA 4UPEA 4I4CA 5G4KA 3ZHSA 3ONVA 1RBQA 3TNJA 2YY5A 5DHRA 4M36A 4WKBA 5G3ZA 3RHZA 4PZDA 2QTWB 1OXXK 2RH8A 3X44A 2IXDA 3ZW8A 5KB3A 4U8HA 5F98A 1D6MA 2V3WA 4OA5A 2Z3ZA 1YI1A 3DV9A 2NXNA 1R6XA 3NEPX 4U5XA 3O8DA 1Z7EA 3FPKA 1F6WA 4CFYA 5KTRA 3RIXA 1O5TA 4KU4A 1N9KA 4JWTA 4P2GA 4NLLA 4HB3A 4CV2A 5DNYB 1NRJB 4JQOA 1CQXA 5MN4A 1S9DA 5ALFA 1CLUA 4XD2A 5C34B 1OPXA 1PKXA 3I4FA 3P5SA 2FB9A 2VPWA 5EESA 3I9LA 1Z38A 2BKUA 2ZUUA 4NATA 3FSGA 4UMVA 4ZT4A 4MAFA 2C5AA 1II0A 5IBQA 2J08A 4RACA 5HGJA 1FMJA 3DVAA 5KQMA 4BO0A 1HDXA 4JGIA 3TIFA 1DBVO 3W5HA 2GRJA 1PHRA 2HK9A 4L4SA 5DBHX 1A9XA 2ZWOA 2W2KA 2R8OA 5EXDA 1JFLA 1HURA 1BMQA 4H4EA 4N54A 4ARZA 5AIBA 2C4NA 2HIHA 3GLRA 4OHCA 4RGYA 4TXNA 1H4SA 1UT6A 3KB8A 4M0DA 4AW9A 3NALA 4EDHA 4OU5A 4XI9A 4AJHA 4WEQA 3SPXA 4P4NA 1U9CA 2SBTA 4K8OA 4RVUA 4IH4A 4G1CA 2JGJA 3EAQA 2O14A 4FJ1A 5LUBA 3G0DA 1RADA 1FDTA 1K8YB 2WTEA 3GRVA 2WWFA 3E3AA 4CEIA 2XZPA 3GMTA 4FDVA 3UENA 5CA0F 1CDOA 2C5GA 3A36A 5BNFA 1E5QA 3LBFA 3DTYA 2REXB 1P0IA 1AURA 2FVYA 3BFPA 1AZTA 1DRVA 1XEXA 4R4JA 4WL0A 3N7UA 5FBVB 4DBLE 5KTKA 2Y99A 3B7GA 5J9FA 2AC7A 4P53A 1PR6A 3M4ZA 3DS8A 1FXSA 1E7WA 1U0GA 3IP9A 4O3FA 4OIFA 4KQJA 4D8TA 2GYVA 5AUOB 3S8YA 3F73A 4NXNB 1ATIA 5ALDA 1ZD4A 1A82A 3I04A 4O5AA 10MHA 5FUWA 3ZZUA 3FVQA 5JALA 3TMAA 1RXSA 3JASB 5CFNA 1BVHA 3CX3A 3Q9UA 2PBZA 3NOVA 2QXYA 2WK1A 4R1OA 5AI9A 3ZBQA 2QD4A 4QELA 3ZUGA 5ES4B 5E8JA 2RGUA 2JFPA 2DKFA 4IHAA 4WKCA 1S0UA 5AUQA 1E1RA 1O7JA 3MB5A 1IM5A 5T64A 4EY4A 4ZI3A 1RYYA 2PEYA 4E6EA 5BWMA 5FPKA 3WO0A 2EKBA 2GHTA 2EF1A 2PJZA 5CURA 1Z0AA 1EGVB 1XNJA 5H3HA 3AIIA 3CRVA 3QENA 1HLFA 2Q2VA 1FFXB 1SRRA 3FG9A 4IQGA 3JZFA 4MMZB 4WH0A 2IP2A 3LF2A 1J9ZA 3B6JA 3PQEA 1U8TA 1YR9A 1J42A 1GG5A 2BGTA 5E6SB 3RVMA 3SQOA 3P9CA 1VDMA 3WLTA 2AHRA 3ABIA 3BSYA 3WMFA 2G07A 4CQMB 3KL2A 1L4KA 3CH7A 1EZZA 1JI0A 1U5BA 1ZQ1A 1RM3A 3OF3A 2GF2A 2Q9AA 2V6GA 4QJIA 1RRFA 1K66A 3E3MA 1ZIYA 2UZ0A 5GJWC 3G02A 2DU8A 1E1CB 1FPMA 3WGVA 1SVKA 4KWHA 4BMYA 1QS0B 2CSUA 1KYWA 1G20B 2C7GA 3IFSA 2GZAA 1TT5A 2JIDA 3BH6A 1N7IA 3PXCX 1XELA 4UM9B 5C4IA 5LMZA 3F3KA 1G8KA 4ZO8A 5F9MA 4XZ3A 5KNLA 2P68A 4O2BF 1U5AA 1RWPA 2W71A 2Z5VA 1S1CA 3A7DA 3TO5A 3ZI0A 1LEHA 1DIRA 1E3WB 2XOXA 3D7KA 1XKQA 3E35A 5KMGB 2NGRA 4W7HA 1XQ9A 4Y0AA 4B9AA 2FRDC 2AJTA 2DUMA 1GSIA 1F4VA 4G67A 1C3VA 1LPMA 2P5TB 3UOAB 3KYDB 3I23A 4FOTA 2ZREA 2NU7B 1B0AA 3PLAE 1OFTA 3TFOA 4KR0A 2W6ID 4YA6A 5SZIA 5IANA 3HO6A 2V7UA 4JJ7A 5E6UA 1GQOA 3OLXA 1X92A 2NQ8A 3ZWQA 2Q3EA 4X95A 4Z7QB 1GSHA 4J1TA 4TV8A 4XJVA 2QOEA 3FR8A 4RADA 4WRRA 4B8ZA 3U7GA 4WOPA 2RGEA 3T1QA 3AJ8A 3JVIA 1VA4A 2CNLA 3KVNA 4P86A 4RL4A 4XIFA 1KEEA 2F43A 2G25A 5K1ZA 4MIEA 4DNXA 2JGNA 3GLFB 4II3A 4K9PA 2YWBA 1LRLA 4YDHB 3CX7A 3H75A 4G0PA 1OBVA 1O97D 1YF3A 4CL3A 1E66A 3QJ5A 1XNRB 3NAZA 4Q1VA 3ILVA 3P94A 4DKXA 5IAOA 7MDHA 2X4IA 3MYYA 4IMRA 2XD9A 3ADKA 2V7GA 1TLTA 2ECOA 4GQIA 3W5SA 4A8TA 5HS4A 2EP7A 5JJKA 3KJGA 4YJ3B 2VEOA 4OI0A 1JEDA 4HP8A 4BL5A 4OCZA 3W4JA 2Y67A 1BCSB 3VYWA 1AGPA 1JDSA 4WW0A 2O8DB 3PICA 3IVGA 3HVIA 2A7XA 3WLOA 2P9QA 3KU1A 3NETA 4G0NA 3D6TB 3IAS1 3OLWA 1YJ5A 2QP3A 3IVMA 4O4IF 3C0KA 3OCUA 3FMFA 1SXPA 3A6DA 2AEEA 1WV0A 2Y1WA 3AY3A 1RXEA 4YB8A 1YDHA 1OCEA 1XFAA 4N8DA 3CUWA 4NYMR 4RHEA 5HQ3A 2WPDD 3FZNA 1V8BA 1L5YA 2YV3A 4C7XA 4JP2A 3OLVA 4MS4A 5KWJA 1L8AA 2D3TA 1XPJA 3B20A 3FPAA 4WNIA 2NUTA 1NL3A 1Z8DA 2VP9A 1NXSA 4J0GA 4FX5A 3IQEA 5FUYA 1HEIA 3GAAA 3HP7A 1UEIA 3ROXA 5J59A 5FUQA 4ZFNA 3VPAA 2YZNA 1EK1A 4CTMA 3MFYA 4E6PA 4AKHA 2ACKA 2H0RA 3HFRA 2B8WA 1M6NA 2ZIXB 3MA0A 3OECA 1B42A 5GVSA 2DUWA 4K9RA 2VR1A 5I48A 2P9CA 1UPCA 1MDFA 3NAQA 4BN4A 4ZTUB 1TYEB 1HRKA 1JXQA 2RHBA 3JYNA 3V7UA 4I19A 3SYTA 2W2PA 1N2XA 4IIHA 3GA0A 3K09C 4UM8B 2BBSA 5IAJA 1A9SA 1RACA 2VEDA 2YNMC 3BKXA 2G70A 1JT2A 3E3NA 4HZUB 4PR3A 3UJHA 3HJUA 4P4SA 5BYBA 2HBYA 1MRSA 1NUAA 5DHFA 2WU8A 1A4UA 1R15A 2YOFA 2QMZA 5AVJA 3T1TA 2EWVA 3U1VA 1NQOA 1UMCA 4DCSA 1BS2A 3KYBA 2C9ZA 4X60A 1X7DA 5DOZA 3VPCA 4YT8A 2DT8A 2JJQA 4GKJB 3OCVA 2FX5A 4XXHA 1THZA 3NRJA 3K8YA 3K0CC 4LOKA 4U7JA 4EB0A 1GCOA 3IEVA 4S2UA 1NW9B 4RABA 4RA6A 2CLIB 2CXOA 1CY7A 2CJWA 2VXOA 2NZYA 4PPFA 3DT8A 1EVZA 1EB8A 3E2IA 5JVDF