1S2MA

Crystal structure of the dead box protein dhh1p
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
377
structure length
377
Chain Sequence
NTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVAEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Putative ATP-dependent RNA helicase DHH1
publication title Crystal structure and functional analysis of DEAD-box protein Dhh1p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 133
structure length 377
sequence length 377
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s2mA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s2mA02
1RRFA 4P4TA 2KI5A 4P33A 1G4UR 1KJYA 2J45A 4G01B 4YC7A 1AGRA 4B34A 3IGFA 4QRHA 2OUKA 5G41A 1K5GA 4GOJA 2NO6A 1E1QD 1T5LA 2OFOA 1ZD1A 3F0TA 4E03A 2R9VA 3L8ZA 1NN5A 5FBRB 1KNXA 3ZIAA 4D2IA 1XP8A 1E2NA 1FX0A 2CNWA 3PEUA 2FSIA 3FKQA 4FCWA 5AUQA 2HJGA 3SE0A 2BBTA 1FP7A 3RANA 3ASYA 3AP1A 3QQ5A 3LH5A 3U3KA 2QL6A 1BH2A 1R6BX 3ZVLA 3THWB 3NHBA 4DT1A 2PT5A 3TE6A 4HZIA 2NGRA 4B3FX 1G21E 2AHOA 4PHGA 4Q1BA 1Z6XA 3CIOA 4TLAA 1NMZA 3QKRA 5E7IA 4FIDA 3MWJA 2WBLC 3P26A 1XPRA 2F1IA 5EXSA 3I5YA 4W5HA 1YR8A 2FOLA 2QROA 4OBEA 4QGAA 5CIWA 2I1VB 4EAQA 3FMOB 4QGFA 1JQLB 1U90A 4LYHA 4QG7A 2QAGC 3R7WA 4JT2A 2PT7A 3K9NA 4QBHA 3KJGA 4LHWA 1G5RA 5AWFC 2YWGA 3AV0B 5GJWC 3TUZC 5KSOA 5CDFE 2J1LA 4OQXA 3B7GA 4XSHA 5IRCD 1XD2B 1XJ0A 5J4KA 2BMJA 3RS5A 2P5SA 4N1AA 4DVGA 1L7VC 1LFDB 4MDFA 2NO7A 2W2VA 2IHBA 2QAGB 1YZUA 2GRJA 1G1MA 4PHHA 4B2IA 5KSYA 2D7DA 1B23P 5FOWA 1SKYE 2A2ZA 4LYFA 3TIFA 1NN0A 3AF3A 1G3IA 4V02A 5FPTA 2ZJAA 2GJKA 4RJLA 1N0UA 4UNSA 3UANA 4B2LA 4E22A 4TYNA 4PAQA 2V6JA 4NP6A 2AR7A 4JLDA 4DB2A 3LW8A 2O8EA 3A37A 1S0UA 2DY1A 3IIMA 2OZEA 2VIIA 4PC1A 5IDVA 2GTPA 4GT1A 2A5FA 3OAAA 3EPHA 1KAGA 2WJJA 3EASA 3CWQA 2AD5A 3WHKA 1UJ2A 1EWQA 1KI2A 5DIFA 3WNCA 1T0JB 4B3XA 4UNNA 4ZCLA 2ZI4A 4F4IA 2ZRPA 3GJ3A 2GZAA 1I4TD 4ZV4A 4FMDB 3UG6A 1TF5A 1CJVC 1W46A 4JYCA 4LSGA 2H16A 5FI1B 4BUJA 2EFGA 2CCGA 4FCVA 1IOZA 1U8YA 4KVAA 1B0UA 2BEJA 4UNPA 5DYGA 3THYA 2J9RA 2F3RA 2BCJQ 1KSJA 2W6JD 1OXUA 2NMVA 3AKDA 3THXA 2PMKA 3D7MA 5AJYA 3CB4A 3FFAA 2I3BA 4NCIA 1ZJ6A 4Q21A 5EP3A 5JLJA 4PZLA 2ECKA 4D4LA 1UAAA 1U98A 4WIAA 1RYFA 3M0EA 2P3SA 4M2LA 3B8HA 2VP6A 2RGNA 3EC1A 3F8TA 1EXMA 3X1XA 3QF7A 2Q9BA 5LBIA 3BRWD 1RE0A 2BCGY 3K09C 3IO5A 4DLSA 4C2TA 1BO6A 4FI3C 1XXHA 1GP2A 1ZYUA 4RD4A 3T61A 5BN3A 3ZLJA 5FBWB 3VR5A 1S1MA 2G1JA 3QBTA 2BEKA 4AD8A 1CXZA 2CJWB 1IJFA 3RRNA 1CR2A 3JVVA 4OI0A 1CEEA 1MABA 2ZJ5A 5EE1A 2ZE6A 1K5DA 3KB2A 3EPKA 3OIVA 4RCYA 1KSGA 2AD1A 3T5GA 2QPTA 4TQUS 4PQRA 4HB2A 1Z83A 1Q57A 4HUQA 4TLBA 4DBLC 1TQ6A 3KX2A 2A5JA 3FWYA 4LGMA 5CM9C 1RFLA 1A7JA 4EJSA 5FH9A 3R9IA 3CRVA 2RGBA 1W36C 4WZBE 4B74A 3P20A 1US8B 4W5WA 3GJ4A 2WWHA 3TVTA 3TKLA 4CYMA 3UIEA 2DB3A 3TLXA 3NBFA 4C7OB 1MO5A 3BE4A 3K9LA 3CX6A 1P72A 2R6GA 1T6NA 3I62A 2KWIA 1FUUA 1TL7C 2O5VA 3CNOA 3ZIAD 3C8UA 3CZQA 1G17A 1R8SA 3Q3JB 4B43A 2E87A 4Q9HA 3I32A 2CNWD 1KZGB 1W36B 2OAQ1 4WXPA 1N5JA 5G3ZA 5KTYA 2F1HA 3P4XA 1E9SA 2QQ0A 2WKPA 2ZYUX 4D4JA 5FOUA 4O3MA 4DCNA 4TSFA 5KDLA 5KPDA 2DWQA 2Z6VA 2Z83A 2ZS8A 3QEJA 1ETUA 4WXRA 3RRMA 4MKHA 1NIJA 2HYDA 1XEWY 3WNDA 3OEHD 2V6IA 4ZDWA 2JLZA 2XXAB 1VIYA 2J7KA 4LHYA 2NPFA 1JEDA 3U7FB 1IONA 3LFUA 1XTQA 2WJIA 5J4HA 1KYIA 3CRMA 4JBWA 4ZKDA 4ZI3A 4KLNA 1TADA 4F4JA 2FA9A 5C2JB 2HT6A 1G8PA 4A15A 4RD0A 2QT0A 4NCNA 3BC1A 4N0DA 5FOTA 1G18A 4OHVA 1N25A 1IXRC 2RGXA 1J8YF 3U4QB 4CDGA 4B48A 5EJEA 2NOAA 3ICEA 1WRBA 2PBRA 4BWYA 3KB1A 5DGXA 3TK1A 4C0QC 1N5LA 1UKEA 2FH5B 2JJ2A 1G41A 2GBLC 2DR3A 3LBNA 4M1WA 4XSGA 1CR1A 1KI6B 1OFIA 4PHFA 4CEIA 4BEBA 3TSWA 1UPTA 2IL1A 3SHFA 1NIPA 4LV8B 1EFTA 1OFUX 3NBYC 2YOGA 1G3RA 2GCPA 2WWYA 1Z08A 3AF4A 4MRNA 5EP2A 4Q1CA 4KYUA 1OIVA 4O2RA 1U2RA 5TARA 1BYUA 1Q1ZA 1OIXA 1KOFA 1YQTA 3OAAD 4JLBA 2Q9AA 2QP4A 2KSQA 1TQ2A 1ZNYA 4CT5A 4MKFA 1LF0A 5K8TA 1Z2CA 2JLXA 1OB5A 1EFHA 5FOXA 4MYCA 2GEDA 3EIHA 1XXHE 4G5RA 1OIWA 3DZDA 1Q3HA 4EDHA 2JDIA 3KQLA 1G8FA 2RGCA 1E96A 5L3SB 2HXYA 1E3MA 4XVQA 2E1RA 4TMZA 3T06B 4AYTA 4JKYA 4S2EA 2CVFA 3LA6A 1E94E 1AS0A 3OHMA 1KY2A 3GEEA 1I4DD 4H9GA 4URXR 2IUUA 3PITA 3PEYA 4QBFA 3HU2A 4TTRA 3QBVA 3QIAA 2ERYA 5KUTA 3ADCA 1W47A 3BK7A 3NG1A 1R7RA 2MSCB 3P27A 2WOOA 2ZJYA 3LNCA 3VR2A 4BRWA 1T8UA 4DIEA 2F3TA 2QNRA 4Q7LA 1M1YE 2H7VA 4LZZA 5A5GA 1JPNA 1Q3TA 4A92A 4FINA 2RB4A 2NG1A 1SXJE 5JHGB 4HUTA 5ANRB 4A8JA 5JJKA 5FTJA 1Z28A 4MRSA 1BMFA 1TUEA 1JALA 2FPLA 1P3JA 3DPUA 1DAFA 2Z5FA 3BH0A 3CR8A 2GAAA 1G64A 1GOTA 1D9ZA 1SHZA 2QRZA 4G5QA 3GQBA 4MUAA 2CBZA 3THWA 1A82A 1NSFA 1LV7A 3U3RA 2EFEB 2GESA 5GVRA 2PJRA 4HLDA 3THOA 3SI7A 5JWOA 2KJQA 5KNDA 1D9XA 1W7AA 1OYWA 1VCNA 4TLCA 2GZDA 1ONBA 4U02A 2BMEA 4QJ3A 1X6VA 4NDZA 1YR6A 4J0QA 3D8BA 5H70A 1VIAA 3GEHA 1CRPA 4I1SA 4IEIA 4C0SA 4YMVA 3UATA 3HU1A 4DLRA 4IOMA 3D31A 3RWMB 4LJ6A 3AVYA 1SZPA 3EWSA 1U0LA 2J3EA 1UFQA 2G88A 1KMHB 5EUQB 5FBVB 2P6NA 1QHHB 2WWWA 1U0HC 1ZAKA 1XMSA 4JS0A 4TSFD 4ZCMA 5UKDA 3F3YA 1ZU4A 2GVDC 3TMKA 2BV3A 421PA 4HYYA 1G3MA 2QAGA 3KQUA 3GLGE 3D3QA 4FWTA 1WXQA 2R8RA 1L4UA 2B92A 5JZVA 3NHAA 1WE2A 5G3YA 5BYJA 1ZD9A 1X86B 3DM5A 4HB3A 5KNCA 4Q4HB 3MRSA 3SQWA 3AP2A 4B3CA 1S9DA 4DT1B 2ZRKA 4NMMA 3X1DA 4Z54A 1M8PA 1BIFA 2ZR0A 3NBXX 2ZSAA 1ZM9A 4Q9LA 3AF0A 1MT0A 2IYYA 2WSSA 3R20A 3TAUA 1IM2A 1U8ZA 4YDHB 4JL6A 4ESVA 1TAGA 3Q5DA 2RHMA 2BDTA 4AKHA 1F3OA 3OIUA 2MSDB 4JLJA 2JJ2D 3CLVA 2V9PA 2F7SA 2V54A 4H1UA 3EG5A 3SYKA 2B21A 2IYRA 2YC2C 2XX3A 3A8TA 1KI9A 5LB4A 3WHLA 2GAOA 4LV6A 4M9SA 4MQBA 2AXNA 2A7QA 4UXJA 5F98A 4QHSA 5SZJA 4Q18A 5FPHA 3S1AB 3WYFA 3VAAA 1G5TA 4FXPA 2GKSA 5JECA 4W9MC 3VR1A 4BASA 4XTRA 4Q1DA 4LPSA 5FI0B 1Z6YA 4KCGA 3ZZ0A 2WJHA 1ZUIA 2A30A 2VP5A 2F55A 4BQSA 1W0KA 4F91B 2V4ZA 2HT1A 4KFUA 2FFBA 2ZU0C 1S8FA 4JYBA 2ZRMA 4Q19A 1L8QA 5EZ6B 2FNAA 4RKFA 4BFZA 2GDJA 2CJWA 3PV0A 1NG9A 4ZI2A 2RGDA 5H1YA 3ZQJA 1E0JA 2C8VA 4A6PA 2OM2A 3OZXA 4C0AC 1TQDA 1Z0JA 2ZRDA 4QC2A 4CW7A 1E2GA 1E9AA 2H8KA 3R9XA 1E2EA 3DMDA 3OESA 3QXHA 4B32A 2JLWA 5KO2A 2VH5R 2RGNC 4GBMA 1US8A 1NBMD 2AL7A 4G1UC 2B6HA 3N70A 1VKJA 3HJNA 5AUOB 2OXRA 2ZAMA 3AVUA 3IEUA 4C7OA 2ZRCA 3JZMA 5JSZB 4XVUA 3ADBA 2VHCA 4EQ6B 4D0NA 2OHFA 4U5XA 1ZP6A 3SN6A 1IN7A 1G7CA 4BFWA 1G7SA 1P6XA 4XWOA 4QM7A 3THXB 3K9HA 2D62A 2W0SA 4F38A 3A1SA 1W4CA 2G0NA 1N6NA 2OG2A 2QSZA 3SBDA 2ZETA 4IW3B 4BGDA 4ZKEA 3REGA 3AF2A 4EJSC 1VDZA 2ANCA 3K9GA 4FMBB 1DO2A 1E9CA 5EXTA 3I61A 4JBYA 2LKCA 1G16A 4M1TA 1S1CA 4A0RA 1XD9A 3B82A 4NCKA 2ZYVX 2UZ3A 4EPTA 3N2IA 1AS2A 2VSOA 5K8LA 2XXAA 1KO7A 4PR0A 2QAJA 2EWVA 2R44A 2VP9A 1SXJC 1CP2A 2QGZA 3SZRA 4HUQB 1Z3IX 2FZLA 2DBYA 4DSUA 4EJSB 3DKVA 1SVOA 2OSBA 4M9XA 1T91A 1XZQA 2QMUA 2CCKA 4A2WA 4AI6A 3B9QA 5KU1A 2EWWA 4FMDF 3WP0A 3VNVA 2GZHA 3RRYA 3W8NA 1J99A 4EFMA 3R9WA 3IO3A 1ZU5A 2VHJA 2B8TA 2XSZD 4ZIRB 2G6BA 4MKIA 2JLRA 1SXJB 4DWJA 3PUVA 4BFTA 3VFDA 3ADDA 5HZHA 3B1XA 2C95A 5EXXA 4R2HA 1VECA 1CR4A 4RZ3A 4BLOA 4JBXA 3JVUA 1Z5ZA 4JVNA 1X3SA 2W0MA 2A5GA 5JRZA 4W7SA 1NN1A 5GJVC 3DL0A 1EGAA 3E70C 2N46A 2KBFA 3FDIA 1DAHA 3R8FA 1T3HA 4IKEA 4IFEA 1ESMA 1N6PA 2REBA 1AKYA 2PCLA 5LB2A 2IT1A 4EPXA 3AVWA 2VO1A 3H84A 3SJCA 3O8DA 4JLPA 1MO4A 2BJVA 1L2TA 3QSYA 1RVDA 3VKGA 4DDUA 1NNEA 2IA5A 2WAYA 3QKUA 3ZVMA 4AG6A 4JLAA 2IYVA 1UKYA 1Y3AA 3SFZA 1FMLA 2CE7A 4K8OA 4YMTA 2EYUA 3WY9A 4FW9A 2ZJOA 4LBVA 1JB1A 4G5GA 5L3SA 1YR7A 1R0YA 1P9WA 1XWIA 1TTTA 3GJ0A 3TQCA 3PJRA 4KU4A 3GJ6A 4Q00A 3NBZC 2JJ8A 4E09A 3GLGB 3C41J 1ZNXA 4A1FA 721PA 2CLCX 3P1JA 4OHWA 3ZQ6A 1GILA 1OPXA 1F48A 2J41A 5IK2A 4YMUA 4ZDIA 1WBBA 4L8GA 1GWNA 2YJTD 3PUYA 2WKRA 5IF9A 1KJZA 5FTMA 2GILA 2JA1A 4OL0A 1Q1EA 1TMKA 1VPLA 5TV2A 5HZKA 4Q7KA 1E0KA 3MFYA 4LWZA 1E79A 1H8HD 1M2OB 3QI2A 3IBYA 3MG9A 3EPLA 2W00A 3AKCA 1E2IA 1OSNA 2OE2A 2QY9A 4XJXA 4A0FA 2X2FA 4TLEA 1P62B 4TQAA 1EFRA 3AVPA 2V55B 2J7PA 2IX3A 4PPNA 4Z51A 2PZGA 3RSLA 1JECA 1GFIA 4QKQA 4PZZA 3EA0A 2NO9A 4YXWA 2W58A 2AKAB 1G4AE 1NRJB 4B6EA 4UNQA 2J0QA 3CF0A 3O8CA 5JJLA 4B2PA 2EFCB 3KQKA 4LBZA 4RZXA 1DTSA 3VQTA 4A8JC 1K8RA 1SQ5A 3ZS8A 5DI9A 3QPWA 4S35A 4KLZA 1AK2A 4KV9A 2FMXA 1BKDR 3CO5A 3CWZA 5B58C 1N0VC 3LVRE 4C0BA 1W36D 4KSCA 2AK2A 2IEZA 5DISB 3BFXA 3ZZTA 2OBLA 5D3QA 4Q5IA 1AGPA 2IWRA 3BB4A 2XGJA 2QUZA 1KMHA 1QHHA 3TSZA 4C3ZA 4A8JB 3T1QA 1S2MA 2PZFA 1Z0KA 4LYAA 2YZ2A 1VYVA 1GG2A 4TT3A 4A9AA 1TQ4A 2C77A 4BFXA 3C7KA 3IPYA 1KK2A 4LJYA 2LKDA 4WOPA 1XU4A 3CPEA 2JIZA 4Q4HA 1GL9B 2O8DA 5AJXA 2BIFA 1LY1A 1W5SA 1QRAA 4LHVA 3NKVA 4FWIB 2HUPA 3U3OA 3DM9B 5JS7A 3HYRA 3ICQB 2XTZA 2B7CA 4I81A 4JZKA 4US1R 3WRXC 1IQPA 4HAUA 1N2CE 2ZI6A 3AVQA 3B1YA 3KUDA 3WMGA 1PVOA 1JI0A 4LJ4A 1XMIA 1PLJA 2ZRGA 4RVCA 1UEIA 5BW8A 2B8WA 3SYLA 2QMOA 2ATVA 5AJWA 1AS3A 3FVQA 1Z47A 4WW0A 4FMCF 5LD2C 2FF7A 3KJEA 3PEWA 3TR5A 4TYYA 2V7QA 2KB0A 1E2LA 1FMJA 2QP3A 4TYQA 5DN6A 2XOKA 2HJVA 2IYZA 2DYKA 2OV2A 2OBNA 1GRQA 2NQ2C 2G9NA 1CJTC 1FL9A 2ZM5A 1KO4A 3H2YA 1Q22A 2FGJA 3EARA 3S1AA 2HCJB 4GOXA 3BD9A 2WM9B 2ZSEA 2ZPTX 5DH9A 1WBDA 2VHTA 4C0HA 5LD2B 3UG7A 3MAAC 3G0HA 2ONKA 4Q4JB 4OJKA 1UKZA 3EXAA 2ORVA 1JXMA 4X8MA 2G3YA 4MGYR 5CLQA 4EFLA 2EU8A 2BM0A 3ZH9B 5EQTA 4C4PA 2WIAA 4MGKR 3LQQA 4BE7B 2GETA 1VYUA 3IBGA 2DPXA 2FZ4A 2WOJA 2DHRA 2D7CA 4ZPXA 3T34A 2EW1A 8OHMA 1GIAA 3QVVA 4LOAA 4LRWA 1VG9B 3UXMA 4ON9A 3LX5A 1VG0B 2OEPA 4TMTA 2XJ4A 3PFIA 3I72A 3J81k 2CL0X 2HXSA 4GI7A 1Z2AA 3EW9A 3QUSA 2XTNA 3LD9A 1R5OA 5FTNA 3KQNA 1J2JA 1KKMA 1NP6A 1TUIA 1LW7A 5C4GB 2IHYA 2F9MA 4GOKA 1CR0A 2GJSA 4PTLA 5K8IA 5ELXA 5JSZA 1VCMA 2PZEA 3TRFA 4EQ6A 2ASEA 2UVQA 3GPLA 2MMGA 1Z6TA 2C9OA 4OQMA 1FTNA 2QMEA 3KKNA 5HCIA 1E79D 3BERA 1U94A 3FMPB 3RHFA 1NKSA 2XB2A 2J87A 3FHOA 3Q72A 1W1WA 1O87A 4C30A 2VF7A 2AWOA 1LS6A 1N6KA 2BBOA 1XJCA 2VP2A 5TDHA 1E2JA 3GLFE 1EFRD 2YHSA 2BM1A 2WHXA 3LLUA 1Q12A 3B1ZA 2J7PD 1XPUA 3VHLB 4NYIR 4JJZA 1PZNA 3P32A 1OHHA 2ODWA 2ZRHA 4R7ZA 4RSGA 5DHAA 4BECA 1UKVY 1N6OA 4YXWD 1Z29A 2NIPA 2ZE7A 5HE9A 4TZ6A 3CNNA 3V4FA 2OCAA 1M7BA 3VR3A 3A4MA 1F60A 1E9FA 2WKQA 1XD8A 2R6CA 1KDPA 2QORA 4OK3A 2V8OA 2D74A 3WXMA 5L3VA 4L15A 4PQYA 1II8B 1I2MA 1H8EA 5D3MB 1ESNA 5KSPA 1AIPA 4XIGS 2P2LA 4AY2A 3RRZA 1R4AA 4A6XA 4ZIRA 1HE8B 2BBWA 1SXJA 5JWRA 1NMYA 3ECCA 3ETLA 4M4SA 1E2KA 4GNKA 2ZVQX 2VF8A 1G8GA 3VNUA 2W2XA 4LJ7A 3CF6R 1E2FA 3NWJA 4US0R 5TY0A 3TR0A 4KYIB 1QG2A 2FFAA 2JIZD 4EUNA 2R6AA 1YHNA 5DSZA 5CITA 4D81A 5J4YA 3FHTA 3WP1B 3HP1A 3B60A 4DKXA 2AFHE 4QBIA 4BLTA 1KI7A 5J4VA 2J0SA 1HURA 3W3AA 4LBWA 1P2VA 3ZVRA 3HYTA 4IOJA 2G0TA 2O0JA 3EC2A 5P21A 1C9KA 1KJWA 3CPJB 3WMEA 2V1XA 2ZE5A 3RS0A 1GRNA 1QHGA 1OV4A 5SZKB 3I5XA 2DFTA 4KAXA 1N6IA 3ZD6A 4AG5A 1J70A 2IUTA 2PH1A 5DE3A 5FL3A 1E99A 5KHOC 821PA 2V7QD 3FMIA 3U5ZB 5DN6D 1R2QA 1RRPA 4EIWA 4OK6A 4PSKA 3F5FA 1GNRA 3OE7A 1D2EA 4V0NA 3W6NA 3GJ5A 3EPJA 3QE0A 3GLGA 2ZJZA 3KKMA 3AP3A 4L4UA 5FTLA 2D4HA 621PA 2AWNA 4BFSA 2F9LA 2ZRNA 3QVUA 2NZ8A 3GCGA 2ERXA 1E0SA 3QKTA 1E69A 1ZUHA 4LI0A 5BWMA 3UWKA 1G7RA 3M4YA 1ZW6A 3IPXA 3O8BA 1II9A 6Q21A 1XNJA 1ZBDA 1W48A 2ZYWX 1U8AA 4R98A 1NMXA 3SHWA 4GP6A 1N3BA 3K0AB 3CF2A 1W4BA 2ZREA 2WVJA 1GNPA 4NZYA 2WZQA 2L0XA 1V43A 1ZVQA 4GMXA 1PJRA 4LYJA 1DG3A 1OH6A 4LUCA 2BHRA 1MO3A 4GSYA 5FUYA 1YZKA 3BIFA 3TNFA 4I1VA 3EZ6A 3TW8B 4Q9IA 4Q9JA 2CXXA 2FU5C 4DEYA 1NLYA 4P4SB 4R71A 5F9FA 4IVQA 3U2QA 4QHYA 1XCPA 2H17A 3KFVA 2QA5A 2RH5A 4IHQA 1JAHA 3GFTA 1O3YA 4OK5A 4FMCB 3EX7C 3V00A 4C2UA 1D5CA 1F2UB 2FFHA 4PSVA 4BZXA 1HT2E 3B1VA 3U3MA 1T8TA 2REOA 2ZTSA 3BFKA 1EESA 4TMKA 4HZUB 2OCPA 3GLHA 1R5NA 5FR1A 3L43A 5HKKA 2Q9CA 4W5JA 1WB9A 1NY6A 1LF5A 1HEIA 1ZM3A 4FD2A 4DCSA 4DLTA 2GJ8A 4PAOA 3U44A 1G3QA 3NVAA 1Q44A 4Z8YA 2YC4C 4Q66C 1XTRA 2H57A 2O8FA 4NONA 1P2UA 4Q02A 1Z07A 1W2HA 1OH8A 3PR1A 1OXTA 3IUYA 2GXQA 1I2DA 5EE3A 3DOFA 1H8ED 1GUAA 3DKPA 2QI9C 3BAFA 3SJBA 1DBSA 2O52A 3A36A 4DCUA 3CRW1 4HI0E 1JNYA 4IRUB 3GMTA 4ARZA 1GL6A 3CH4B 3A6PC 1OJLA 4GP7A 2QGNA 1SXJD 1QZXA 1MR3F 3IIJA 3CZPA 4KHZA 4TMVA 4II7A 2BKUA 2CMKA 1FW6A 4PSAA 5FUVA 4U7DA 2IUSA 2P6RA 3DOEA 1EG7A 3GLFB 5FL7A 1M34E 3Q7QA 4I1UA 4RD1A 3ZD7A 5TMPA 2XB4A 1W49A 4DLXA 2ZSFA 3I8SA 1RZ3A 4MGIR 5M04A 2DFLA 5J5CA 1FQKA 3VU9B 2VBCA 2RHDA 4HLUA 1T0HB 4UJ5A 1AA9A 3L0IB 5KOYA 4TWZA 4PHTA 2ONJA 2JCSA 2WWXA 2R65A 2ANBA 2IXGA 1ZINA 2F43B 5BYKA 1R0WA 4DIDA 2O8DB 2Z0MA 3FFBA 1Q21A 2VL7A 4KO8A 5GADl 4Q4JA 1R0ZA 3KXLA 4DDWA 3SEAA 3AF1A 3K70C 3L8YA 1E1RA 2FG5A 3ND8A 1SVMA 5CLLA 2W83A 2QE7A 4IEEA 2WIBA 3A1VA 4XH9B 5SZHB 4PO8A 1ZM4A 4M1OA 1N6HA 3MCAA 3OEEA 1IBRA 3A4LA 1A2BA 2DFKB 5F9HA 3OE7D 1GZSA 3DO6A 2HV8A 2XZLA 1G19A 2ATXA 3KTAB 2PL3A 3QY0A 4PX9A 1AZSC 2E9SA 2RKOA 3K70B 1TNDA 1KNQA 1ZMXA 2NO1A 4LJ5A 1E9DA 1P4SA 1RJ9A 1MRNA 2OXCA 3PIRA 4DRZA 1L4YA 4CT4B 3CUEF 4CZ2A 3MGCA 1Z0FA 1PLKA 2QQEA 5CJPA 2C99A 1COWA 2Q3HA 3LRPA 3Q8XB 1HYQA 1RIFA 4OI4A 4TMXA 1W5TA 3MJRA 4DLUA 5EP4A 1FNNA 2BJWA 1DO0A 1IY2A 4V03A 4MDEA 1E2MA 3U7EB 4D0GA 5KSZA 3UK6A 1JAIA 2IYLD 3LQRA 3HR8A 4QBGB 4OJQA 4YONB 5DHFA 3HWSA 3B9PA 1KKLA 3FKSA 4GMDA 3FGNA 3TSOA 4B3GA 2ZR7A 3GLHE 3B2EA 4BZPA 4TYWA 1FOEB 3U6BA 1UBEA 2JDID 1FFHA 1E2HA 3BXZA 1XTKA 5EUMA 4A2QA 3A1TA 3WMFA 2C9YA 3WRYC 4QGHA 3P4YA 2KE5A 5DO9A 1E2PA 2REXB 1GSIA 2SHKA 2VP4A 4Z1MA 2FSGA 4M22A 3T5DA 1XZPA 3ZJYA 1EWRA 1V5WA 4DLWA 4M21A 1II8A 1R0XA 3EZ7A 4M53A 3ND9A 5D3MA 3RVBA 1CF4A 4OQLA 2V3CC 2WJYA 221PA 2GJ9A 1XMVA 3VKHA 2GK6A 1P75A 1KGDA 4QM6A 2D3WA 3FPAA 5HKKD 4L9WA 2CLSA 3CH5A 3VX4A 3PENA 1BMFD 2HDNB 3OIWA 3NTUA 4YQFA 5B30A 4L5BA 3HR7A 2IXEA 4BLPA 4BLQA 5KPJA 4JSYA 3H0KA 1F5NA 3A58B 2WWGA 4UXIA 3SR0A 4B47A 1LS1A 4M1KA 4BFVA 2YV5A 2OLKA 1GM5A 1K6MA 3SBEA 1JEEA 2ZRIA 4DXAA 3U60B 1P9NA 2DWOA 4JLMA 1AZTA 4WA7A 2PJZA 3KKOA 4HB4A 1NL3A 2HF9A 3AH8A 1YZGA 5FPKA 1FUKA 3LV8A 4NYIQ 2VPPA 2CDNA 4JL5A 3QXXA 1W4RA 1VCIA 1RC8A 2YINC 4LJAA 3I3SR 4JIMA 4CIDA 1XTIA 2ZS7A 1E4YA 1LTQA 4AKIA 3B13B 1YVDA 1N6LA 2RAPA 4TL8A 3L0OA 2ZI9A 2XTMA 4HB0A 3MD0A 4Q1EA 3C16C 4IXNA 4QHTA 4DLVA 2ZIAA 1T3SA 4LK2A 2QTVB 3TQFA 5JS8A 3RNLA 1SKQA 4LJ8A 5H68A 2PMDA 4JJKA 3PXGA 4RCZA 3SQXA 1E1QA 3N2EA 2B7BA 3OFNA 3MLEA 1IXZA 3PUZA 4YLGA 5CYPA 2QU8A 5FL7D 5LDDC 4ASUA 3C5HA 3W6OA 2NO0A 2QN6A 3FE2A 1E2QA 4PC7A 4TLDA 2FEOA 4JVMA 4TZ0A 1UADA 3DZ8A 4M1MA 5FBLB 2C5LA 2RGGA 1QVAA 2FN4A 1NVXQ 4JLOA 1R8QA 3LO5A 3PG5A 3B85A 1TEXA 1QBKC 4DSNA 1PLLA 4NL4H 1KZ7B 1SULA 1DAIA 1VG1A 1UF9A 2OCYC 2IF2A 3O47A 1XF9A 5TVKA 2CHQA 2QRNA 2CVHA 5JBQA 1W4AA 5L3QB 4A82A 4YDSA 3CBQA 1HQYE 1XEFA 4Q4LA 4DZZA 2ZRBA 2QE7D 3RSOA 4A36A 1D6JA 2WSSD 3X2SA 2OLJA 1IN5A 521PA 4XWKA 1KSHA 1HT1E 2PLRA 1A2KC 1HE1C 3OEED 4D80A 3UWOA 3DHWC 4TL6A 2J0UA 3K0SA 3W9YA 3SDZA 2WSMA 3K0AA 3LWNA 4ITRC 4MA4A 1IN8A 2IF0A 4LHXA 3SNHA 2BMFA 2TMKA 2QPAA 4Q48A 2QP9X 4EPYA 1NVVQ 3QXJA 3NDBB 2IS4A 1T4GA 1CU1A 2O8BB 1NVUQ 4Z8XA 1IN4A 2WJGA 2YWEA 4URUR 2ZUBA 1N5IA 5DYIA 2IWHA 3SC3A 1J90A 2D2EA 5AUPB 4RFVA 1COWD 2P65A 3EA5A 2GEVA 2ZUDA 2N1BA 1E9RA 2PX3A 2FX3A 2I1QA 2WICA 1FTSA 3KKPA 4P4SA 3HU3A 1IHUA 2EFHB 5B2ZA 1G5PA 2ODBA 4DCTA 1KAOA 4RD6A 2GEUA 3QG1A 4OHZA 2ZI5A 4RKEA 2QM8A 1ODFA 1P2SA 2GK7A 1F2UA 4G3XA 3G5UA 3K53A 4AKGA 3FKSD 4TL7A 1NG1A 4ESHA 4XOIA 1W0KD 3I8XA 2VHQA 2A9KA 4HZUA 3IHLA 4OHXA 2ZXUA 1Z0IA 5JMTA 5E7MA 1CJUC 4P32A 5JEEA 4Q7JB 5KYKA 1LB1B 3H1TA 1P73A 1E4VA 1FZQA 4MRRA 4X8HA 1AQYA 1NF3A 1W2GA 4EKDA 2QTHA 4UQOA 4TN1A 4IVPA 4BLSA 4DLZA 2G77B 2QENA 2HLDA 4PPGA 1RW4A 3C5CA 5C18A 4XD7A 5AK0A 3IEVA 2WPDA 4A4DA 1SVSA 4PPQA 2P6UA 1UEJA 2OO7A 1P60A 5FTKA 5IT5A 4LBYA 1GTVA 2RCNA 1RPZA 5FOVA 4E5UA 4EPRA 4A0GA 1MKYA 3X1WA 3R8CA 5JEDA 4JSTA 3CR7A 3PQCA 5K8UA 1OH5A 2D2FA 1XCGB 3MWKA 4Q47A 3UPUA 1G9XA 4XTCS 3VHXA 1Z6AA 1CKEA 4QJ4A 1EX7A 2FPKA 4CF7A 2YVUA 1E2DA 5CJ2A 4HEJA 4C0KA 4F4CA 2VQSA 3GP8A 1IN6A 2VP0A 3U61B 1Z8FA 2ZJ8A 1Q1BA 3NIBA 1S3GA 4P3YA 5GVSA 5DLQC 3GLFA 1R10A 4AURA 2PEYA 4LCBA 3GLHB 2ZR9A 1XDBA 3E5HA 3K0FB 3VU9A 4N3NA 1YZNA 3U44B 3GLIB 2QPOA 1GVNB 2C2HA 2ZQ5A 1VG8A 4A0HA 2O8FB 2F43A 1SGWA 1W0JA 2X77A 5EE0A 2A3RA 4IJMA 2GXSA 2IW3A 2IBMA 2N42A 1YZTA 2ZSBA 4BFUA 5CB6A 3HPQA 4JMPA 2ZEJA 3OFND 1NJGA 4NKRA 1DEKA 2RMKA 1LNZA 2ZYTX 5E3HA 4ARZB 4ASUD 4V0ME 1GRRA 3SYNA 1Z63A 2JLQA 2QG6A 4HLUC 4OI2A 3O8RA 2FGKA 2P67A 4MYUA 3W8RA 1BYIA 2QBYB 4I99A 3K0CA 3QPVA 1KI3A 1WA5A 4PC6A 5AR1A 1UDXA 4NE2A 3VMFA 3CM0A 4C9BA 1D8TA 3KTAA 4ACAA 1XEWX 2ZI7A 2ZUCA 3K8YA 4B6FA 2ZU6A 4TL9A 1E98A 3BH7A 4IFBA 1DELA 5CK5A 1XPOA 3QJYA 4MH0R 3OEHA 1ZIPA 1YU9A 3I4LA 3ZVNA 4IDHA 3BB3A 2GXAA 1IAQA 3QENA 4V0LA 2H1LA 4MUBA 4DUGA 3PEVA 3SFVA 3RS7A 2O0HA 2GNOA 1JBKA 1Q20A 1UDWA 4MYHA 5J47A 1OT3A 2EQBA 1F2TB 4LDJA 4I1OA 4HSEA 5DI3B 4D82A 4LHZA 3TW4A 4US2R 2NTYC 1M6NA 2OBMA 1N0WA 1Z06A 1SVLA 3M6AA 1FNMA 4OQFA 1DADA 2YOHA 3VKWA 1TF2A 3TVDA 4LC1A 3GFPA 2OILA 1WCV1 1Z22A 1NY5A 3KQHA 1Q1QA 2CL6X 1IY1A 1TF7A 2HEIA 3PVSA 4HDCA 2VYFA 3BS4A 2ZE8A 5JJIA 1M7GA 5CYOA 3WBJA 3C14C 4M9ZA 4B71A 2ZJ2A 3W5IA 1FP6A 4Q4AA 5JCPA 1UBFA 3EIQA 3WBKA 2AXPA 3VTKA 4GDFA 2EVWX 3QPUA 3AUYA 3B78A 4B33A 4CEJB 4NPHA 1DVRA 3RC3A 1P9RA 1E9EA 5IK2D 1RJ9B 3UKDA 1DG1G 1HV8A 4IOKA 4LV5B 2XZPA 1KO8A 1Z0DA 2EYQA 3T12A 3U7HB 1KI1A 4NCHA 4DC9A 3WYGA 1E32A 4URWR 1OW3B 3T15A 4KBGA 2IYUA 1T5IA 4MRVA 3AVOA 1SVKA 2X8AA 4KFSA 4URVR 2YWHA 4B73A 3AKEA 4Q1AA 1CIPA 2K5UA 4DHEA 4R2IA 2WWIA 1MRSA 3NXSA 2IYXA 2GHIA 3C4JA 5FR2A 1MO6A 4RFSA 1IY0A 2HLDD 5TB5A 3RWOA 5IHPA 2YOFA 4UNRA 2IK8A 3N5CA 4L9SA 2AN9A 1NLFA 4XD7D 2WPDD 1EFCA 1DAGA 2PEZA 4F93B 1KMQA 2XAUA 1XEXB 2W2TA 2XZOA 3AGPA 4NYJR 3DMNA 1KO5A 1T3LA 4PANA 4YMSA 3IQWA 4M9QA 4DSTA 1CS4C 1UBCA 3TJZA 2WMNB 3SJZA 3T1VA 3U6KA 1G6HA 4JVLA 3L0SA 4K46A 3W6PA 2JASA 1OXVA 3LDAA 2Z4RA 4IDQA 2X19A 1YE8A 4AYXA 2AX4A 4RD2A 2QEQA 1JJ7A 2XNDA 2WV9A 3AB3A 1KDTA 3FB4A 2A5YB 5JI2E 4GPTA 3EAQA 2AFIE 3DVLA 2QT1A 4RZUA 5EP1A 1OH7A 5B57C 1X1RA 1DS6A 1GNQA 4QL3A 5C1BA 4FCTA 4TT3D 1PV4A 4YMWA 4KSBA 3UMFA 3T1OA 2IYTA 1A5TA 4D4KA 1UM8A 5EE5B 3VX3A 2ZI3A 1W0JD 4B76A 3E1SA 1KK1A 4HATA 1HY3A 2AKYA 3L82B 5FPSA 4O2LA 5G53C 4KBFA 4KITB 1QHSA 1VYTA 2AK3A 1AKEA 1X8JA 1CRQA 5L3QA 3A1UA 1DARA 3WNBA 3NEYA 3U3JA 1D2MA 1GDDA 2IYQA 2IYWA 1KI4A 1S4QA 4EPWA 1H65A 4DCVA 2BBSA 2GXUA 2F6RA 1MH1A 4HLQB 4JLKA 5AJZA 3AVVA 2CHVA 3DEFA 4WZ6A 4QOSA 4GL2A 2D06A 2GCOB 4XWAA 3IKJA 1NVVR 3I73A 5JHHB 3ZS9A 3RDPA 4P4UA 2BOVA 3B6EA 4EFNA 1A4RA 2CCJA 3V4RA 2IS2A 1N5KA 3L0PA 1KK0A 3K70D 2O8BA 1HTWA 4GZLA 5FUXA 3QKSB 2VHUA 1CJMA 2XOKD 3BGWA 4ZCIA 4M1SA 1MV5A 1AM4D 1OE0A 1CTQA 1VHTA 2OCBA 3MUFA 5L3RA 4DUGD 1I4LD 5JI3E 2Q3MA 4D4MA 4FN5A 2XITA 1QF9A 1U9IC 1JR3A 1DPFA 1JJVA 1RYHA 4RZ2A 2YKGA 4QGGA 1AN0A 2JEOA 1QHNA 3CRQA 3GJ7A 2VSFA 2GCNA 3IILA 4CEHB 4IDOA 1FQJA 1ZM7A 4Q9KA 3MWYW 3VR4A 3BOSA 5HPYB 4DB4A 4IVRA 4IDPA 3EIEA 1C1YA 1DE0A 1ANKA 1MOZA 1S9HA 1Z0AA 4DDTA 3REFA 3GD7A 4K81B 5F3WB 2LCFA 2J0UB 4A2PA 2Y8EA 3UMSA 1FPMA 2ZJBA 3IDQA 4GRAA 2C9CA 2F1JA 3C15C 2YNMA 1CULC 4AC9A 2X2EA 4HLCA 3SS8A 3B5JA 4JKIA 3TBKA 4QNRA 4ZDJA 3KUCA 4NHOA 5LPNA 3VR6A 3W5JA 2GF9A 2QTFA 2MSEB 3K1JA 1XTJA 1NI3A 5GJBA 1QHXA 1II0A 3QF4B 4C0JA 4DLYA 3FTQA 3AUXA 4IXMA 4JLNA 4BFYA 1EK0A 1J8MF 1XB2A 2WMOB 4PQFA 3NEJA 4NYMQ 4QXAA 4UXHA 4CRWB 1XTSA 2CL7X 4ILEA 2O8CB 2ZSDA 3SOPA 4R9UC 4G5OA 3GJ8A 3CNLA 5HE8A 3TGPA 1ELOA 4QFMA 1KY3A 4TQ9A 3GFOA 2GA8A 3B1WA 4Q7MB 3TH5A 2NPIA 5JRJA 4B3BA 2FFQA 3AVTA 1A1VA 3Q9LA 1DOAA 1OHHD 5G40A 2R2AA 1KO1A 2Q6TA 3K0FA 3ZYCA 3QXCA 3RYTC 3OIYA 4NH0A 2CK3A 5FPYA 3LVQE 3T35A 3X1YA 3GLIA 5F2EA 4D25A 5EXPA 1JQJC 4M1YA 3DDCA 1ZCAA 4LJ9A 1GAJA 2JJ1A 1NBMA 2BKEA 1OFTA 3KJIA 1YZQA 2BC9A 4Q1FA 3EZFA 4X8OA 4PAMA 1SKYB 1KDOA 2RGEA 3RABA 4BLRA 1DAKA 3RS2A 4RD3A 4ACBA 4LC0A 2OFWA 1G20E 1WQ1R 4MKGA 1GL7A 3JZAA 5HTKA 1RRGA 3ONWA 2Z4SA 2NZJA 2XNDD 3HDTA 5FOSA 4TTQA 4D6PA 1ZNZA 2QBYA 2IC5A 1X8KA 3BFVA 1AJEA 4DJTA 5TXGA 4C0LA 1XRJA 4M8NE 4URZR 4MITA 1ZIOA 4TTPA 4M0LA 3AGQA 1S3SA 4PFSA 3TUJC 2JGNA 2HF8A 1U99A 1R5BA 4HAVA 4MGZR 5BXQC 1S96A 4ZDKA 2CEAA 4PPFA 3ASZA 4OKSA 1HA3A 4D0LB 1JXOA 5BN5A 3LY5A 2FSFA 1JR3E 4KFRA 3X1ZA 5JFGA 4WZAE 5SZIA 1F2TA 1E0AA 5DI3A 5EE9A 2HYIC 2YWFA 1E9BA 3K0CC 4JT4A 1XFAA 1OXSC 4WAUA 4HDQB 1KI8A 4DEXA 2V1UA 2FPMA 2XSZA 2ODNA 1RKBA 4GFDA 4JLVA 4KFTA 3LXRA 3CRRA 4HAZA 4NU0A 4XVRA 1XD2A 2R6FA 1E6CA 4OQNA 4BRUA 3EZ9A 2ZS9A 4V0OA 1DAMA 1ZC4A 1ZRHA 1ZD8A 2UKDA 1OB2A 2YYZA 4Q03A 1FX0B 1ZCBA 4LPKA 1G8HA 5E7JA 1U81A 1OXXK 3MWLA 2FDCA 4D26A 3AM1A 2J5XA 2GF0A 1QHYA 5C46F 1C4OA 5CM8B 2J46A 3CW2A 3CX7A 4DSOA 1JR3D 1VHLA 2HCBA 4CEJA 2VSXA 1XMJA 1GITA 4B35A 2PLFA 5HR5A 4O0MA 2IS1A 2PCJA 2Q3FA 2FEMA 4HDOB 1RRCA 1KDRA 2ZRLA 3QKRB 2W6IA 4Y0AA 4NTZA 3GEIA 1OFHA 3PCRB 5EZ5A 3RC8A 4BZQA 1HQCA 1VCOA 2C78A 5JCZA 1JR6A 1U0JA 2BVNA 1SHKA 3R7WB 1KK3A 3LBHA 5L8VA 3A1WA 3A4NA 3ZGXA 3K0EA 2WAXA 4KJZA 3WYAA 1P2TA 2R62A 2ZVPX 4KI0A 2A78A 5B64A 1WMSA 2OT3B 1XCMA 1YJ5A 1QG4A 4Q01A 2XEXA 3BWDD 1YRAA 1XEXA 3LX8A 3KKQA 4I4LA 3SU8A 4F7WA 3GLIE 2JLVA 3T1TA 4B75A 3RAPR 4HAYA 2QMHA 4Q4AB 1NBME 3LW7A 1G8YA 3HPRA 5DNYB 2OFXA 3L2OB 2JATA 5KDDA 1TU4A 1OKKA 1AQUA 1DAEA 5FFMA 2OAP1 4ERNA 3ADKA 3SJAA 1NJFA 2O8EB 1H8HA 2C98A 3Q5EA 3V9PA 1X8LA 3KZ1E 4ZO4A 4QJ5A 1X1SA 2QZ4A 3FYHA 3CKLA 2FSHA 2CK3D 4H1VA 2A5DA 1TPZA 2I4IA 3K09A 1EFUA 1KIMA 2VLIA 3UMRA 4DDVA 1Y63A 2MMCA 3QNUA 2JJ1D 2P0EA 1NLZA 4E07A 2XNSA 4RFSB 4JVSB 2GVZC 121PA 4LX0A 4KXFB 4KVGA 1NSTA 1M74A 1TU3A 4ABYA 4EPVA 3QG5A 2UZIR 3THYB 1GKUB 3BBPA 1KSFX 2CLDX 2EFDB 2C04A 1GKIA 3RS4A 1P7CA 2FE4A 3W34A 5KNBA 3KL4A 2JLSA 3AEZA 2C03A 4MYTA 3TUIC 5E4FA 4NYJQ 3U7GA 2DFNA 2ODEA 4L16A 1VMAA 1CJKC 1HUQA 2OESA 2GCOA 2XJ9A 4AKEA 1BOFA 1XXHB 4PO9A 2IS6A 1EX6A 1XBTA 2JLUA 3IQXA 3QKSA 2DWPA 4TYPA 1TX4B 1MABB 1YKSA 1P5ZB 1G7TA 2F1RA 2J59A 3QXSA 2WTUA 4OYHA 3QEOA 5C4MA 3KDSE 4UKDA 3OF5A 1WF3A 1WDTA 1D2NA 1YZLA 1KHTA 1T9HA 2WJVA 3KJHA 3MSXA 5BN4A 4CGZA 2WWFA 2BMDA 1G3UA 1XX6A 4CEHA 4HAWA 5A4JA 3U4QA 1ZM2A 1NN3A 4KODA 1G291 1N6RA 3RS3A 1E1RD 4P0TA 1SVWA 3PUWA 4AWXA 1ZC3A 3H4MA 3LXXA 4LY6A 3H86A 1U9IA 4BEJA 1CLUA 1OF1A 2VEDA 4V0MA 1NVWQ 1QDEA 1QHIA 1ZUNB 2C96A 5KDOA 5H8WA 2GWHA 1IXSB 1KI6A 1G6OA 5J40A 3KFXA 3W90A 2CHGA 1UBGA 3EZ2A 4MRPA 3EWAA 3FHCB 3M1IA 2CE2X 1OYYA 3IIKA 4PC2A 3AKYA 4U00A 1WP9A 3BJIC 1JPJA 2H92A 2LWIA 2IXFA 5J4LA 1PUJA 2GJAA 3LAWA 1VTKA 3ZDQA 3QF4A 4NYMR 2W6ID 2GBLA 4N0EA 2O0KA 1Z6GA 1W44A 3W3ZB 1Q0UA 3LBIA 5HCNA 2Q0HA 2O8CA 1P61B 2DCUA 2FWRA 2ORIA 3D6TB 5AJVB 4WBSA 3CX8A 4POAA 3TAHA 1CBUA 5CDFA 4AYWA 3AQ4A 2RGAA 2JLYA 2ZAOA 1J7KA 2IEYA 3NC1C 4B3DA 3KXKA 2VA8A 5JWHA 4AIIA 3GJXC 2ZITA 2ZRJA 1QVRA 2FV8A 3LLMA 5CK4A 2IYSA 4PXAA 5FBQB 1YR9A 3ZZUA 1OLOA 5E95A 1HH4A 2FJUA 4AK9A 3G82C 4UJ3A 3IHWA 3Q85A 4CVNA 2ZRAA 2Q21A 3FMFA 2ORWA 4CEIB 3CONA 2ZRFA 2QM7A 3I92A 5A0FA 4Z1MD 3BB1A 4G5SA 1OKKD 5CB8A 3MMPA 1XJQA 4P31A 3FOZA 4F92B 4RY2A 2W6JA 2BWJA 1ZNWA 3Q7PA 4NCJA 4O25A 4NBSA 2G83A 3BH6A 3I1FA 3PUXA 1F6BA 4G0NA 2ZANA 4URYR 1TEVA 2H18A 4PO1A 2JAQA 4Y0VA 4IOLA 5CIQA 4TMWA 1YRBA 2QSYA 2ZROA 3E2IA 4GZMA 3MJHA 5FUWA 4JL8A 4BPBA 4WVFA 3NH6A 2KBEA 2P5TB 2VTKA 1PUIA 3CPHA 3QOFA 2VRWA 1KTVA 5BQ5A 4OHYA 2Z43A 2G1KA 3RLFA 2J0VA 1LVGA 1NKTA 4PC3A 5GJCA 5AUNB 4B44A 2X1VA 3NDPA 3AVXA 2H5EA 4HAXA 4QNMA 3KXIA 3NC0C 4PZYA 4X8LA 2PX0A 1SVIA 3BORA 1BS1A 1GKYA 3NH9A 1IJEA 1M7HA 4IDNA 2R6DA 4OI1A 4V0KA
chains in the Genus database with same CATH superfamily
1RRFA 2B78A 4P4TA 2KI5A 4MARA 4P33A 3T9BA 1I7NA 2J45A 4YC7A 1EAYA 2WWRA 1WU7A 4B34A 2LTAA 3A32A 3GDGA 3HZHA 1BE0A 1L7BA 1ORWA 1RZVA 1UWVA 3AIOA 3FSEA 3IGFA 2OUKA 4NJEA 4X20A 1NQAO 1K5GA 4E5MA 1O5OA 2OFOA 3O2JA 4ZOLA 2J0SA 1RWNA 2R9VA 2VT3A 3C6YA 3FTPA 3IR6A 4XDHA 5F5NA 1E2NA 1GARA 2CNWA 3G9UA 3PEUA 4FCWA 4K2AA 2XY4A 4UVIA 5EWMB 1OLSB 4PLPA 4ZA2A 1GZ7A 1W29A 3TIGA 5G1PA 1GADO 3AP1A 3DDWA 3K9BA 1YCDA 1MF7A 4MTLA 3LH5A 4MW6A 4AU1A 3GQBB 1N2IA 4GQBA 2CVZA 4TV9F 3U31A 5ALQA 1MG0A 1EEXB 3WWEA 4FB4A 1OFVA 4DT1A 5K5EA 2VAVA 2GM5A 5C5EA 4JJAA 4K3UA 3TE6A 4HZIA 2NGRA 2Q6KA 4QQKA 2CXRA 1Z6XA 2HF7A 2X58A 5JCJD 4UUMA 2OYCA 3MILA 2EX0A 3R6LA 1M6HA 1NMZA 1JKIA 1NZFA 1SUEA 2P7IA 3MWJA 3P26A 2GO1A 4FIDA 4G36A 4YCDA 1XPRA 4KR3A 3UMBA 2QROA 3ONVA 4G4JA 3TRKA 2GD0A 1R0LA 4PLYA 2QAGC 1SO8A 4HH4A 4MI6A 1PGQA 4AAYA 1N3LA 4JT2A 4JGIA 1EWYA 1CSEE 4QBHA 4M7WA 3BMCA 4U7GA 2XT9A 4EHDA 4LHWA 2ZOSA 4M49A 4I6GA 5GJWC 4C2AA 3TUZC 2F3SA 4J7XA 1V5GA 2FHSA 5LLSA 4OQXA 5CDFE 3UQYS 3FZNA 1B74A 2ABWA 2VDQB 1E2BA 1IUKA 3E18A 3FTCA 4L72A 4F0JA 1TB4A 3SKYA 2P5SA 3P94A 3O8QB 4N1AA 4BB6A 1UXOA 5F1KA 1W8IA 4DVGA 2ZUEA 4GKAA 1QV9A 2IOYA 5C9ZA 2UYHA 1DDIA 3KTFA 4DQXA 4F85A 2PGAA 1OY1A 2AVDA 4XGRA 5LZ7A 1Q6ZA 4K9KA 4JLUA 2AYZA 1YZUA 1G1MA 1JTFA 2XNHA 4B2IA 5KSYA 3I64A 2D7DA 1B23P 1QOZA 1FLVA 1NVBA 5I7HA 1QDUA 1T1GA 5CT4A 2W6ZA 5AJUA 2OZKA 3VI4B 1LBTA 5FPTA 4DBZA 4RJLA 4X3PA 4L22A 3VO2A 4TYNA 1F9EA 2QXTA 4MS1A 3QZUA 4NP6A 4U7PB 1L7OA 2BFEB 3IC5A 4JLDA 1X7WA 2QRGA 3H2GA 3A37A 2DY1A 1SUFA 4DL9A 2OZEA 2HGZA 2GERA 2SNIE 3KT8A 3G5TA 5IDVA 2F1OA 1P6UA 1D0VA 1EFDN 2ADFA 2WJJA 2GN2A 2H08A 2X6QA 3OBBA 1YAHA 3HXTA 3LWZA 2A0FA 3CWQA 1GGNA 2GYYA 2B99A 1P33A 3WNCA 1A9TA 5LQRA 2BONA 1T0JB 2H06A 5K0BA 1LKZA 3HNPA 3IJEB 4ZJZA 4LJKA 1RAIA 2YJGA 3G2QA 1DO8A 1JTEA 4ZV4A 5D7BA 5DLDA 4FMDB 3EEIA 4RJJA 1TF5A 2QUIA 3ACCA 2GHTA 4FIZA 4I9HA 4BUJA 4L4RA 4D9EA 2CCGA 3LYLA 1CY8A 1QJCA 4FCVA 5B53A 1U8YA 4U63A 4AJ1A 1B0UA 4JUIA 2DAPA 2XNCA 5KOJA 1VSUA 1OAAA 1OXUA 3HBNA 4GRIA 2PMKA 3P19A 5JLJA 3FFAA 4Q21A 1JQ3A 4NCIA 1UJ6A 4BNIA 3RUPA 1S3FA 1JA9A 4WIAA 4FBMA 4CMBA 2G8LA 3EZNA 4TLMB 1EUCB 3B8HA 3MTBA 3DAGA 3HB7A 3X1XA 10MHA 3QF7A 2Q9BA 1EDZA 1SQFA 1BCSA 2CV1A 3WGLA 1VJTA 4JOQA 3QYPA 3FTEA 4HP8A 3IEPA 4D98A 3N2ZB 2FQQA 2WF5A 5BN3A 1NJ8A 1S1MA 1VLQA 4R40A 4XVCA 3LTNC 1MQ9A 3E03A 3T5BA 4AD8A 4CCAA 1IJFA 1KARA 3JVVA 4OI0A 3W05A 2ZJ5A 3H4TA 3QH4A 3IKMB 5BY2A 1QIEA 4HUQA 1Q57A 4I5FA 3G5MA 4IS2A 4Q1VA 4X1IB 3I28A 3WWCA 1T9GS 4EJSA 3DXFA 1QE0A 3DJFA 3R9IA 1HNZB 3KJNA 1VIMA 4JVOA 1JHDA 3HY6A 4LMAA 1PT9A 4PS0A 4CYMA 5AO9A 4RIFA 5CNKA 4KPYA 3L01A 3NBFA 2ZIUB 1M3SA 3EAFA 3EHDA 4C7OB 1C9MA 1BAPA 1GPDG 1HBJA 2W2NA 2GN4A 4CKBB 2D00A 3GGGA 4P36A 4FZRA 3VUFA 2PXHA 4DQUA 2O5VA 5ALPA 2JD0A 3ZIAD 5CCEA 2AMLA 3CZQA 2DX7A 3RC9A 5JAZA 1UOQA 4YRFA 1QGED 5ARDA 1C9JA 4Y6PA 1N5JA 3E8SA 3OURA 1VMEA 4AMYA 3WLAA 2QQ0A 1A9XA 4ZD6A 3WLPA 4O3MA 3A9TA 4CU2A 4TSFA 4DCNA 3RRMA 1Y5NA 2I3DA 4UOZA 3ISVA 5B12A 2RCYA 5BSHA 4MKHA 2HYDA 1XEWY 3WNDA 3L5KA 4D8XA 1ISPA 4ZDWA 2JLZA 3BAZA 2XXAB 3V6MA 1VIYA 2JK0A 3JZDA 3Q9NA 1EJBA 1JEDA 1JXAA 3A1FA 3N7UA 1Q91A 2ZUSA 1DRUA 3KS9A 4DNOA 8GPBA 5J4HA 1V35A 3R7NA 4MWEA 5DNWA 5HKBA 4ZMSA 1NNUA 2R97A 2VNHA 5FTWA 1W59A 3UMMA 4DJFC 1I2AA 1CX9B 5B6JA 4GI5A 2Z2ZA 3KV3O 1K6IA 1QOPB 3AUSA 3JRNA 3BC1A 4N7MA 4OHVA 4Y1RB 1CDDA 5CBKA 2RGXA 1E6WA 1J8YF 4AJPA 1RT9A 2ZYSA 4GLJA 1H23A 3LZCA 3SICE 4CKWB 4DIKA 2NOAA 5KYWA 4B3TB 2EKPA 4HDKA 5EKDA 2PTHA 5DGXA 3TK1A 4MUJA 4YDRA 1N5LA 3LU1A 2FH5B 1YIAA 1K27A 2GBLC 4M1WA 2ISQA 3PICA 5JW6A 3W7VA 4HX5A 4HRXA 3QLVC 4NZOA 1KI6B 1DFIA 1V45E 4NOMA 5LR6A 2AUNA 4MV0A 4CEIA 3TSWA 1UPTA 4RPCA 3SHFA 1C80A 5FDFA 1E1CB 4EY4A 1SIWA 4O4HF 1DBVO 3ROEA 4NXNB 1TEHA 4A0QA 5A62A 1Y37A 4RPIA 5IJWA 1GEEA 1UDCA 3OCJA 4PZUA 1JQAA 4IO1A 4I3HA 1U2RA 5TARA 1DOZA 2BFBB 4CG1A 1KOFA 4NESA 4HG2A 1H1DA 2KSQA 2YQZA 1R16A 4CT5A 3DMHA 5K8TA 3IP9A 5BOSB 3IVMA 2AOVA 2ZLBA 1MHTA 1JL3A 4TV9B 1CF9A 2XUOA 3C6BA 2V03A 5B1IA 3TE7A 3WG9A 1BW9B 3DBHA 3Q98A 3KJFA 4G5RA 4GX5A 2R6ZA 2CZQA 1CR6A 1IATA 2FFJA 2B2CA 3IAXA 4MAMA 4N5NA 3KQLA 1E96A 1TXGA 4NULA 3WO0A 2QMZA 2CLLB 4PFQA 5GV7A 1RS0A 1VBFA 2AQ8A 1L4HA 4PYKA 4HB4A 1Y1QA 4XVQA 4B84A 4TXMA 3T06B 3BYZA 4KYVA 2J8ZA 3T5CA 2HPZA 1C4WA 2CVFA 1MAVA 4FU0A 4YQEA 1KY2A 3PEYA 2OGSA 3K1AA 2INGX 3PITA 1DIBA 1T9BA 1V2GA 2FPGB 2LR0A 2NUTB 3UV7A 1UPUA 1ZD3A 5LZ5A 4LF6B 3QNWA 1P0QA 3ADCA 2VWQA 1DBPA 1SD2A 1W47A 5E6SB 1W9HA 3RUCA 3ZXIA 4DW8A 1Y6GA 4NCXA 2ZJYA 1GD1O 3DO5A 3LNCA 4BRWA 4DIEA 2F3TA 4JXKA 1YKFA 2XF2A 4QU9A 1YF3A 3K5HA 3DLAA 3O7MA 1E3IA 3AI7A 4TSKA 1M83A 1U3VA 2WDPA 3WYBA 5A9RA 4NJMA 5JHGB 4AF7A 2HMVA 3RUFA 5ANRB 4JV5B 2P1RA 2YXPX 4U8HA 5FTJA 3T0GA 1J5XA 1BMFA 3BTVA 3E0XA 4DMLA 1JALA 2QR2A 4D9MA 4HH0A 1NYQA 2FPLA 3DPUA 2VOEA 1R5JA 4FP9A 1SG6A 4G09A 4RVGA 4CF4A 3BTOA 1W5EA 5HZGA 2Y0PA 2GAAA 4YAOA 3TLMA 1EWKA 4XJTA 1D9ZA 4UM8B 1YZ3A 3BSFA 3GQBA 3IVXA 4GIBA 4MUAA 4E11A 4JB0A 3NGXA 2HWKA 3VYUB 1O95D 1NSFA 4LA4A 1RJFA 1VBNA 3MZ0A 2P0AA 4W99A 1IHXA 2EFEB 4QO7A 4ALIA 3JWGA 1YS7A 2FG6C 2GPSA 3THOA 3WSWA 4JQOA 1GAEO 3GCWA 5KNDA 5D6OA 4QT4A 1UL1X 3PFWO 3TL6A 4XLLA 5JXWA 1YHZA 4KIFA 4Y2PA 4PGMA 1X6VA 4YMLA 1QNFA 1PWEA 4IZ6A 3JQ6A 2GGSA 3GEHA 4L8VA 2ZJFA 4I1SA 1KJQA 4IEIA 4NG5A 3KL2A 4YMVA 8MHTA 5B3KA 2WMYA 2DERA 4IOMA 2HLNA 4MVJG 1U3TA 4QVKA 3RWMB 1TYZA 3GI1A 3UZUA 4DIBA 3WA7A 4TKMA 3EWSA 4MCAA 3VAZA 2P41A 4B83A 3K96A 4E1VA 4QLBA 2J3EA 4TS3A 3FPBA 1UFQA 2G88A 1ECPA 1QHHB 1RFGE 2FJPA 4OCZA 4A6DA 1U0HC 4N39A 4UCFA 3O8QA 2ECFA 4WLVA 1NOJA 3EBLA 3F3YA 2WJAA 5IUJC 2Q8NA 3H11B 3RBAA 1MAWA 1G3MA 3KQUA 3UJCA 4TLLB 1Q19A 3GPIA 3D3QA 3GLGE 2FQXA 4HQ0A 4IHKA 2WYIA 3HO8A 1L4UA 1Z5NA 3K5WA 4FN4A 5JFTA 1WE2A 2ID7A 2WJ4A 1OWOA 1ZD9A 1FTQA 1X86B 2ZBFA 3DM5A 5BYJA 3STUA 3MRSA 1U11A 1K97A 4EKIA 1JG6A 2PU7A 5H02A 2B1GA 4Z54A 4MEBA 4Q37A 4O2BA 1BIFA 2ZR0A 3NBXX 3RK0A 3V2HA 4H7HA 4Q9LA 2QYTA 1UKBA 2VNKA 2QYSA 3DTNA 3GLTA 1HDRA 2WSSA 3OEWA 5K3BA 4J7CA 4YAFA 1U8ZA 4LS3A 3WGOA 4ESVA 1HMPA 1TAGA 3WKDA 2FEWB 2BGNA 2K4MA 2QW1A 2ZB3A 4JU9A 1MNAA 1O0SA 3UO8B 4MQFB 1XTVA 3OIUA 4X1YB 2MSDB 2A57A 3CLRD 3G8DA 4KAAA 3T3IA 5IG2A 3EG5A 3SYKA 2VT6A 4P92A 3ZZMA 2XVXA 3UJ3X 3KR1A 1Z5PA 4QUHA 3A1DA 1FU8A 1KI9A 1LTHR 3JD0A 5K6RA 5FA8A 2GAOA 2ODPA 2C7BA 3E7PA 4MQBA 5JSHA 4F1JA 2AXNA 2NSYA 5LIRA 4G84A 2HU5A 5K0TA 2O48X 2J85A 4QHSA 1SIOA 5SZJA 5KWVA 1U6IA 1VBKA 1XTBA 1Y4DE 2EXXA 2R8YA 5ECGC 2J3KA 2JH3A 3QP9A 4FXPA 4R54A 3VAAA 3D02A 1L5WA 2JRLA 2XT0A 5KVQA 2PUHA 1NW9B 3WB9A 3S2EA 1BKSB 3WR5A 1EUCA 3ZNNA 4AL4A 2OV6A 5T64A 2EBHX 2XH8A 3D8RA 1EFLA 2QRJA 3PPVA 1RWVA 4YX9A 2VP5A 3DONA 3GELA 4NI5A 2F55A 2X8BA 2NZVG 3F9CA 3PX7A 4HDSB 1I0IA 2D5BA 2Q2WA 3ROTA 1ZS9A 1PJQA 1GLVA 1S2DA 1S8FA 1YDFA 3L06A 1L8QA 4JYBA 3UV6A 5A06A 1ZGJA 2R84A 3NBMA 1LVUA 5T5QA 3SZGA 4RKFA 4YUVA 4BFZA 3F74A 5IJ0B 2UYCA 4GPZA 2Z04A 1NG9A 1OVGA 5H1YA 3ETGA 1YC2A 4ZI2A 1E0JA 2C8VA 3OO0A 3OOJA 3ISTA 3IODA 3ZHYA 5JCOC 3ZNPA 4BGIA 4A6PA 1YFLA 2M1XA 3TBFA 4QC2A 1Z0JA 2ZRDA 4Z4GA 1E2GA 4NXMB 5GY7A 3JR7A 3RIMA 1E2EA 1XLVA 3KTDA 1NVMB 1JIVA 5C53B 3W9BA 1P17A 1NBMD 2AL7A 2B0JA 2I6FA 4GSLA 3N70A 2H07A 3VR2D 4FKBA 3GQVA 4IXTA 2OXRA 2RHTA 3GA5A 4MVJI 3W3AH 3AVUA 2PMBA 4C7OA 2ZRCA 4L95C 2VHCA 2FZEA 4EGFA 3HCPA 3SN6A 4U5XA 5EGSA 3DD5A 2FSSA 1IHDA 4G0QA 4ZK2A 3ZDFA 2F90A 5AI6A 5FFNA 5HGXA 5LQDA 1PYOA 1LLUA 2W0SA 1G9TA 4J75A 4OAQA 5F3DA 3CNEA 2JBAB 2GUWA 1FS4A 2OG2A 3B9BA 4YHHB 4FDTA 2PUGA 1MQSA 4BGDA 5A0TA 2F8MA 1VDZA 1FVFA 1HEYA 1DO2A 4FMBB 1P74A 5EXTA 5FA6A 4JBYA 3TINA 1QTRA 2LKCA 1G16A 3GVPA 1G1AA 1IZ7A 3UHFA 3N2IA 4HMPA 1NU6A 1IOLA 1UZAA 1X1BA 1MAAA 3F6EX 1I01A 4JUFA 4N8DA 5HRUA 1KO7A 4TTIA 3A3OA 4S0XA 2XXAA 1ZQ1A 2EWVA 4L8LA 3HY4A 1S01A 4AJKA 1SXJC 3L49A 5K0SA 4OFXA 4C7JA 2FXIA 3FUXA 3NRJA 3LNTA 4FCCA 3I2HA 5A5VA 4DPLA 1Z3IX 1KY5A 1WX1A 2FZLA 3GT0A 3HDYA 3HWRA 2PS0A 3I52A 3KU4A 4B4UA 2DPHA 1XZQA 1EM8A 2V7PA 3SZLA 1GCOA 1L5RA 5KU1A 2EWWA 1PD0A 4GX1A 3WP0A 1MD9A 1UAYA 1MTZA 2E4WA 3DLIA 4Y1RA 1Z3CA 2C5FA 3RRYA 5A9SA 4N5HX 1TT7A 3QMVA 3B5IA 3N74A 3U1BA 2VHJA 2B8TA 2XSZD 3HCFA 4PF1A 4D9BA 3G2LA 4ZIRB 1QYXA 2G6BA 3FWNA 3ZK8A 1N9GB 1VLJA 3DXZA 3L9XA 5HZHA 4IQFA 2QG4A 1OI7A 3LCRA 5FD8A 3K2IA 3ABIA 5EXXA 3J81A 2BUBA 4RZ3A 3IPRA 1C1XB 3JASB 1QU3A 3JX9A 1V4VA 3A9VA 2P69A 1R0KA 4X7MA 3C2QA 2P4EA 4ESEA 4UZFA 1E7QA 1MC8A 5C5CA 4GE0A 1NN1A 2C8KA 4DMRA 2Q5CA 4I4CA 5K0EA 1KZHA 2VTBB 1MUUA 4YXFA 3E82A 2N46A 1JN0A 1T0IA 2JAHA 4F5EA 4ZYYA 4EYKA 5AVXA 3LX4A 1BGXT 3PRHA 1T3HA 4IFEA 4YP5A 2CV0A 1I6KA 4W9NC 1N6PA 4UASA 1YQWA 2BFBA 4J94A 3R3WA 4R8SA 4UE6A 3H84A 2EKLA 1A7UA 3SJCA 1H9CA 5E38A 4KPGA 1L2TA 3L6RA 1KS9A 3QSYA 2HK7A 2V9ZA 4Z9FA 2HA5A 3O6VA 3PNBA 4I36A 4TV9A 3OOHA 3VZQA 1NOIA 1XZBA 4AG6A 1HG1A 2QQGA 1BW9A 4YRZA 4JLAA 1UKYA 2B20A 4UPDA 1FMLA 2C00A 3PQEA 2ZJOA 1J42A 5JNWA 1DBIA 5HUJA 2BHSA 1YR7A 5J3JA 1RBQA 2XQKA 3Q1KA 1P9WA 4LSWA 1U0EA 2AZDA 2EHJA 1MB2A 3HADA 3NPAA 5EEGA 4CM8B 5C7LO 4HXFB 5DFAA 5EJAA 3QFRA 4OBXA 2R86A 2JJ8A 4FKMA 3TOCA 1BXKA 1IXYA 1R9JA 4E09A 3M49A 2FPGA 2NUTA 3KLBA 3C41J 3GHYA 3AUAA 1A8PA 3E5NA 721PA 2JFWA 4GVXA 3E22B 1FFAA 1ZCZA 1GILA 4MAAA 5E6SA 1SC9A 4X61A 4FD2A 5SYAA 1VLLA 2V9CA 1WHSB 3NEPX 1ENPA 1LNSA 2CUTA 2XODA 1VJGA 2YJTD 2G06A 1Y5IA 5C8YF 2IFTA 1HL7A 1BJRE 3OLQA 4FR5A 5FQOA 2GILA 3WMXA 1Q1EA 1IZYA 1TMKA 2Q45A 2VYQA 3QU7A 5TV2A 2DKFA 4KRGA 4LWZA 4PINA 2VBGA 1NASA 3EGXB 4TX1A 1X15A 4GKBA 3VPBA 3EPLA 2HU2A 3AKCA 2FPOA 4DCMA 5MDHA 1OSNA 4XJXA 3RARA 1FLNA 4YGYA 2FW6A 4TLEA 3TPZA 4AO8A 4KK4A 2GCEA 1YVUA 4TQAA 1Z62A 3QEKA 3WLKX 4X65B 4GZ3A 2IX3A 4X9XA 1EINA 3LOPA 4PZZA 1NYRA 3N39C 4YXWA 2ZG6A 3ZR4B 1QQTA 4TS1A 4BBPA 5JC8A 4UUBA 2J0QA 1A97A 3CF0A 4CT0A 4R7TA 2Z57A 5JJLA 3KELA 4B2PA 5BYBA 3LSYA 3ZU3A 1J7JA 4TPKA 1IWPB 1GQQA 2QUAA 1V7QA 4RZXA 3CVYA 2JGAA 2PBZA 3L0ZA 1DX4A 1SQ5A 4CG2A 4EW1A 5KYXB 3LFTA 1YS1X 5F4BA 4EW3A 1GV0A 3NW9A 3QJGA 1ZJWA 3EFOB 1N0VC 3QOWA 2X9QA 4PONA 5FQNA 5I9NA 4L7VA 1W36D 4KV7A 2AK2A 2IEZA 5DISB 4FHFA 2A1IA 3X44A 4GR9A 4GQAA 4U7HA 5E1BA 5HRAA 2XGJA 2QUZA 2YBEA 5DTJA 3O75A 1L5LA 1QHHA 2HMWA 4C3ZA 2DTDA 4OXNA 3NIGB 4A8JB 5B7GA 5D2CA 3M3HA 4ZP1A 2XV1A 4HYQA 1VYVA 1Z45A 1XDDA 1Y3HA 4TT3A 1ZMBA 5FI3A 4YRBA 4CKZA 5EIXA 3ES9A 2C77A 2PRZA 1S2IA 2PTGA 2L17A 5IAAA 2FN7A 4CM4B 4ZEMA 5IWAB 4XFKA 4LJYA 2WPNA 4L5CA 2D2XA 2WWVD 4XDYA 3DT6A 1JP7A 5AJXA 4FFVA 3M2PA 1LY1A 1QRAA 4LHVA 4JQCA 2QLLA 1D7OA 4IICA 1MJHA 5JS7A 3RI3A 3NNSA 3CMMA 4LRSB 4EKGA 4I81A 3WRXC 4I1RA 4HMQA 4EHJA 2WT8A 5A03A 1IQPA 4HAUA 5JO9A 3SJUA 5KTSA 3AVQA 4E5KA 1WMDA 3DMTC 1JI0A 3STYA 2YMPA 5ESRA 4JP2A 1FYFA 3WLRA 2NNWB 2X0KA 2FDRA 5BW8A 5CDUA 2B8WA 1NBEA 3FRHA 4UATA 2NW6A 3SYLA 3VOAA 2XWJI 4MQFA 3DP9A 4G1FA 4TWAA 4X1YA 1D3AA 4H1TA 4URFA 2I99A 4PZAA 5LD2C 3KJEA 5AICA 1J09A 1YC5A 4TYYA 1SBZA 2PT9A 2V7QA 2XB6A 3JATB 2KB0A 1E2LA 2QP3A 3D6UA 3EZLA 2B1QA 2C29D 4HVLA 1VKOA 3KOYA 2BLLA 2BFOA 2DYKA 4IL5A 5FAKA 4EMBA 9LDBA 2AFHA 3KJZA 3SSNA 4CTKA 1Y1SA 4ZCPA 5TR9A 5C37A 2BPOA 2I2WA 2POQX 2HCJB 4GOXA 5DP2A 1AB5A 2GM3A 1M75A 2ZSEA 3KT3A 1NBOA 2XA2A 4FFNA 1GSHA 4CLOB 2YZGA 5E9AA 3UG7A 2XD4A 4BFLA 4Q4JB 1ZGBA 1DKMA 4G65A 1ECFA 1JXMA 4NU6A 4X8MA 2G3YA 2A9VA 4HDSA 4W5TA 2BM0A 2XQVA 4JOBA 3GLSA 3ZH9B 2WIAA 3ITEA 1HWYA 3N0XA 3TI9A 1UWCA 2Y1CA 4X5OA 5IJ0A 2WOJA 1DCTA 4ZEOA 3QE3A 1ZXBA 2HCFA 5I5GA 2ZTLA 4KR9A 2O8VA 4AJJA 1PL6A 4LRWA 1TJ3A 3VZCA 2A0XA 3ZE0B 5D1HA 3JTEA 4UBKA 4P3NA 1JDNA 3S8MA 2QUBA 3CZAA 2JFUA 3DNFA 3PFIA 2ZSHA 1QNLA 3D6HA 1T26A 4Y8VA 5B2EA 1JTVA 1NFFA 3F8SA 2XTNA 3LD9A 5ENZA 1R5OA 1MVOA 3KQNA 4FT2A 3ELDA 1J2JA 5KNBH 3QVJA 2Q4TA 4HPJB 3I04A 4R8KA 3HXMA 1T3TA 4NX2A 1WXGA 2IHYA 2F9MA 4GOKA 2YJ5A 3KNZA 5K8IA 2PRKA 1B42A 3BRCA 4X95A 3UHOA 2FG7C 3NANA 4MIOA 1DIOB 1JHYA 4WXEA 5AKZA 1P77A 1JEQB 1ZKMA 3R0JA 1FTNA 2GH1A 2QRPA 3BERA 4H7JA 2XB2A 1Q7RA 3FMPB 1NKSA 3IXLA 3FOAA 2J87A 2W6QA 3ZTYA 1X9IA 1WKCA 2JBAA 5AW6A 2I71A 1W1WA 4TXNA 2IYNA 5AVKA 3QJ5A 3PQFA 2BBOA 2VP2A 3QWAA 4EHLA 1AUOA 3ZGOA 1DCKA 2BM1A 3LLUA 3MS2A 4V1CB 1U63A 4NYIR 4HNAA 3I4CA 4JJZA 4YACA 2BR4A 1RNLA 2VJLA 1OHHA 2C4HA 2ODWA 3OP1A 1NONA 2RK4A 2DPYA 3P32A 4K6GA 4KX5A 2FTKE 4OYRA 3NTRA 4QFCA 3ZLUA 3EK2A 1V1JA 3RBXA 1IQRA 2R6JA 5E1OA 2POCA 3CNNA 3IMCA 3UB4A 1YVPA 4TZ6A 1KDZA 3NAQA 1M7BA 4AMZA 1H4SA 1BVYF 1QH8B 4D43A 1JMYA 1F60A 1O6ZA 2MWMA 5JMOA 4XVHA 1HNWB 1Z34A 1OZ0A 3AHCA 5FUMA 1OBVA 3QVGA 1PK8A 3IE1A 1XD8A 3NCHA 2WSLA 2ZPAA 3WXMA 1R0SA 3A6GA 4L15A 3VKVA 5L3VA 1H6CA 3RSZA 2NNLD 1H8EA 1BOOA 1M9NA 1AIPA 3E9ZA 1WZUA 2JIMA 2II6A 1PR4A 3MD9A 1TM3E 4AY2A 3RRZA 3WIBA 3N0RA 4A6XA 4IXDA 4ZIRA 1E6KA 5EMHA 1ZHOA 1N9GA 3F3KA 3ECCA 1CB0A 1E2KA 5BV2P 4HNGA 4K05A 1EX1A 5HKAA 2VF8A 2YWJA 3AK4A 1NP7A 3L84A 1WNTA 2OD9A 3COWA 2YY6A 3TL3A 4FVTA 2YHIB 1C1XA 4US0R 5GGXA 5TY0A 3HA2A 1G8JA 2R8ZA 3NOXA 3CF4A 4QBKA 1QG2A 1F1BA 2IELA 2FFAA 3FWPA 5REQB 2H4YA 3SXUB 1O5IA 3D3EA 4JA2A 3IDOA 1XWWA 4DCSA 3URMA 4AXBA 1U7DA 1LGYA 1YHNA 1KETA 4A26A 4D81A 5J4YA 3ELYA 5C8YB 3HP1A 3B60A 5FOQA 2WYVA 1Z9BA 4I9GA 2K6GA 4H7KA 5SICE 3MMZA 3B6IA 4LVCA 1WULS 2I3AA 1LC3A 5J4VA 2YV2A 3U5TA 1P2VA 1IHPA 5K2MA 3U4GA 4RVHA 1GPKA 2YVQA 2ZYGA 2O0JA 3DFIA 3GDFA 5IZCC 1C9KA 4M0FA 5F73A 1C9EA 2ZE5A 1QHGA 1C3XA 5FNVF 3TECE 5A5FA 1Z37A 3N2KB 4F86A 1J70A 2PH1A 2Z8XA 5FL3A 1E99A 1FYWA 4I6EA 3EMVA 1CNFA 3R7LA 1RXVA 3U5ZB 2O2YA 2GKGA 1RRPA 2G09A 1TLTA 2B8EA 4PSKA 4X6XA 4EIWA 3FOFC 2H8GA 1UPCA 2G7MC 4CM8A 1HSZA 1KRWA 3OE7A 1D2EA 1EE2A 1K5HA 1V7CA 4RV9A 2UV8A 3KR0A 5JH7F 4X93A 5KVVA 3GJ5A 5DCYA 3TM4A 1U04A 1KJNA 2WAMA 4BRSA 5K01A 1M8KA 3KKMA 1D4OA 4JI1B 1WS6A 3OUUA 2E6UX 4WE3A 1U1FA 4TM8A 1GN9A 3E22A 2O06A 2I8LA 3IMFA 3LP5A 3ZLBA 5FTLA 2KLHA 2F9LA 2AQKA 3PDIA 2QD2A 1TAHA 1WHSA 4RXTA 4JR2A 2X4DA 3BHIA 1ZJZA 3FF4A 2Q1WA 1GT91 1M2GA 1DPGA 2WF6A 4F4HA 4LI0A 3EOAI 5BWMA 3UWKA 5CGZA 3P2EA 1DEOA 3MOIA 3M4YA 4JZYA 3SC4A 3ORQA 4AUEA 5C32A 1AF4A 3W6UA 4HRVA 2WA2A 2JAPA 4G5XA 4KQXA 5LZ8A 1NX6A 2VDOB 2VK8A 2OUIA 3DBIA 1W48A 3F98A 1U8AA 4JY7A 1C41A 4AQ7A 4OIMA 1QFZA 4U7WA 4WFIA 5JAPA 1PWXA 1TYCA 1T1JA 4QYWA 5HZMA 1ZVQA 2PBLA 1DWOA 2PZBA 3DVSX 1NAIA 4MS4B 1B0AA 1PJRA 4YFYA 1DG3A 4ND8B 1OH6A 1GCAA 1PR3A 2Y67A 3MQ4A 1QIIA 1P6QA 1MO3A 4DVJA 1F3LA 3SSMA 1TQHA 3ZWVA 4BNDB 3O21A 3BM5A 1ZCFA 3OEYA 3ROMA 2AW5A 2O7VA 3TNFA 3VVMA 4RELA 2VQEB 1UR5A 1NQVA 2CXXA 1QKKA 2QZZA 2XMRA 3G49A 5KYXA 4YJ2F 2P8JA 4IVQA 3D3KA 3RFCA 3T5TA 3U2QA 2C2XA 4QHYA 1N33B 1BH6A 1OLUA 2RH5A 2RI1A 1DIAA 2I80A 3EX7C 1JFLA 2DBQA 1F2UB 4ARAA 1SXPA 4BKMA 4FOLA 4PYJA 1HT2E 1TLLA 3B1VA 4OXYA 2H1HA 4QYXA 2XCSB 1T8TA 1XL1A 1EESA 3QTTA 2JFYA 4ZVNA 1VA4A 2OCPA 5FR1A 5HKKA 3L43A 1IULA 3H42B 3U3DA 1LF5A 3TLAA 3WYNA 4FGJA 1B7GO 4M36A 5IANA 3GG9A 3PJFA 4EL5A 3KBOA 2GJ8A 2C3PA 3HLYA 2Q4EA 3PJEA 1PS9A 3NVAA 4Q15A 2OXIA 1U0BB 2HJHA 4CM4A 4RS3A 1Q83A 1XTRA 3Q4GA 4CNQA 4NONA 1Z07A 2V7XA 3WLSA 3G2MA 4GUAA 1OH8A 1VHDA 3CUSA 1T2VA 3IUYA 5HNKA 4E4RA 3ZIDA 4KIGA 1G42A 1J2YA 1F6WA 3BT7A 4JGBA 2NVOA 5EE3A 2Z6UA 1GUAA 2OO5A 2QI9C 1C30B 1JHPA 1PFYA 2R6HA 2XMZA 2M6KA 2QIPA 3ZUPA 3JQFC 3JCZA 3IT3A 4LVOA 3V4SA 2ETXA 3KWJA 4E6PA 1GL6A 4BNYA 1FY2A 2QGNA 5EJGA 2IKSA 4RJIA 2QN1A 1UBKS 4JB2A 4EI2A 3LQYA 4P3OA 3C4QA 2JD1A 3AI3A 1TIKA 1K63A 4XIIA 1V25A 1PP4A 2HV9A 3H87A 4FS8A 1E5QA 2OR3A 3CINA 6REQB 2IUSA 4YRNA 1B73A 7ADHA 1TA9A 5ITVA 3K6SA 1EG7A 4LDQA 3FVRA 5J1SB 2D5CA 1M34E 2HJSA 2HMTA 1EMDA 3BN3A 4KBYA 1JSRA 4DLXA 4NH4A 3LWBA 4MGIR 3DE5X 1T0PA 3I3OA 4RAOA 1OXKB 2VBCA 1BG6A 1DKNA 2DG2A 2RHDA 4UJ5A 1T0HB 3AHIA 3RHTA 4BN0A 2B36A 1UCFA 1MNQA 4KTVE 5I7OA 1H05A 1PGJA 4UD6A 3DZIA 2PBFA 1ODCA 2ANBA 2IXGA 4R9VA 2F43B 3K6JA 3RF6A 1I7DA 5ADHA 4CLOA 5ADVA 4IIFA 1Z2DA 3O9ZA 1R4NB 3FDFA 3FFBA 4KO8A 2CWWA 3BWYA 1JT9A 4M7PA 4Q4JA 4IGKA 4CTMA 5GADl 1YFKA 5GMOA 5DBIA 3SEAA 1XRRA 3AF1A 5TSDA 3L8YA 1E1RA 2IPXA 1RDFA 2XNKA 3ND8A 1O6GA 1SVMA 1ZXXA 1T6YA 2D5AA 1V9SA 2JCXA 2ZIVB 3LUJA 4XM0A 1ZM4A 4QD3A 1WF6A 3I1JA 4YRLA 1N6HA 3T95A 1X7XB 2FOXA 1E4OA 2OCDA 2DFKB 2KM1A 5ES3A 3ULKA 4AX8A 4EGAA 3CF4G 3NTQA 1IIRA 3MXOA 3DHYA 1U4OA 4I4IA 1E7MA 2XZLA 3W4JA 4AJ4A 4YIHA 4QUJA 3QY0A 1SPXA 2F17A 2ZJ3A 4QOGA 4DYHA 5KBYA 2CLEB 3R6TA 1RPNA 4J43A 4KGVA 3USCS 4EI9A 4F3RA 3V3TA 1IMJA 2RIPA 1ZGAA 2HY7A 2O2EA 2RBGA 1E9DA 3LF2A 4LDRA 5DSTA 2EFJA 4EGJA 3PIRA 4CT4B 3GCDA 1ZHHA 2Z2YA 4QPZA 1WCWA 3Q8XB 2Q3HA 1W87A 1CJBA 3PCTA 1D2RA 2HSWA 2OMKA 4JASB 5EJ8A 4Y2SA 1IG3A 1JR2A 2E7ZA 2I78A 2VUSA 4K28A 5F51A 4MVJH 3NXKA 1SCJA 5ALEA 1DO0A 2B34A 3CCBA 1Z4KA 1GFSA 4U1RA 2Z9DA 4X3OA 1E2MA 1V47A 5FBZA 5G1NA 4OX9Y 3RTAA 3B36A 2H4WA 4R1SA 3A3YA 5C51B 3A2KA 4CF5A 3B9PA 1CUSA 4IX1A 1KKLA 3P0FA 2C0CA 4B3GA 2H4JA 1Y1RA 5BRNA 2UXDB 3KYJB 2ZR7A 2UAGA 2C57A 1V71A 1RTKA 3U6BA 1UBEA 2IV3A 2FRDC 1RWBA 2JC3A 1FFHA 1QVWA 4A2QA 3EQ9A 4X64B 4E94A 3T0FA 3A1TA 5BNFA 3FCUB 4BE4A 2FSVA 5C8VA 3O1JC 1IVSA 1U31A 5T6BA 3GMDA 1FJGB 1QH8A 1NT4A 2ZYDA 1LD3A 2BKAA 1E2PA 1O1YA 2O1WA 1ABBA 3KLNA 2REXB 3TZ6A 2Z09A 2FSGA 4MJ3A 3PP8A 4H3SA 4JEMA 1ZLXA 1QRDA 3KZXA 5HSGA 1FDOA 3MIIA 4RIEA 3P0HA 4M53A 2B6NA 1QRTA 3Q6IA 1Q7EA 1OUMA 4OUKX 2CY0A 5FNVB 1XKXA 2H7YA 4LKOA 5JAIA 1W96A 5FWYA 2V3CC 1CF4A 2GZMA 1LRLA 1UC8A 2GVNA 3U4CA 2GJ9A 5CEJA 5AW9A 4Y2VA 1YDEA 1M5TA 3IQZA 3VH1A 4BQPA 4C6HA 3V7FA 1R15A 3KE8A 5DWQA 1UFOA 4J0GA 2GCIA 3VX4A 5JH7B 1BMFD 1LDBA 1CZKA 1YJXA 2N3ZA 3M4JA 3NTUA 3OIWA 4IDDA 4YQFA 1VHQA 5HKLA 5HF6A 4BLQA 4LGVA 4ND1A 3H0KA 1F5NA 4BFVA 4JFRA 5E1DA 4EI7A 1K6MA 1SCIA 3A4YA 5M3BA 3GU3A 5REQA 4B6SA 3NTVA 4P7JA 4JQSA 5EIWA 3UCFA 3ZCSA 4JLMA 1ML4A 3QBDA 4W1SA 3UWMA 1A8SA 1NJ5A 5LLDA 1FUKA 3LV8A 4NYIQ 2YRXA 4JL5A 4KRXA 2R8OA 2W98A 3SHQA 3SC2A 2YINC 1QXSA 2I2CA 2LRHA 4YH1A 2PGNA 1EKXA 4CIDA 4RMIA 3DC7A 3JD4A 2X15A 1R3UA 3OJEA 4YMHA 2HWXA 1I13A 1M1UA 2RAUA 2YN2A 3GEGA 2ZI9A 3L0OA 4LK3A 5DW0A 3WTCA 4BUZA 5I9IA 1XDWA 3C16C 4IXNA 1DLJA 4DLVA 3O8RA