1S2MA

Crystal structure of the dead box protein dhh1p
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
377
structure length
377
Chain Sequence
NTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVAEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ATP-dependent RNA helicase DHH1
publication title Crystal structure and functional analysis of DEAD-box protein Dhh1p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 133
structure length 377
sequence length 377
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s2mA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s2mA02
4WVFA 1EWRA 4XWOA 1QHHA 2DBYA 5FL7D 1VPLA 1R4AA 2WWWA 4CEHA 1D2EA 1SXJC 2I1QA 3O8BA 1P2TA 2W0MA 4CRWB 2FE4A 1KGDA 3RRMA 2AL7A 1A82A 2IC5A 2HT6A 5DLQC 1N25A 1W48A 3P26A 8OHMA 1R10A 1SVMA 1Z6XA 4IVQA 1DOAA 1LNZA 2C77A 2ZJOA 3HU3A 3KDSE 4NH0A 3CRRA 2XZPA 3VAAA 5LD2C 1GL9B 3AKYA 3QXSA 4JLVA 4NCJA 3SJBA 3OFND 1E2HA 2OLKA 1K5DA 3QY0A 3PUYA 1JQJC 4TZ6A 2O52A 3WHKA 3ADCA 1P73A 5B57C 5L3QA 2CBZA 1DAIA 1OW3B 3AVUA 1GVNB 4DSOA 4JYCA 4UNPA 4A2QA 2PJRA 1TQDA 5DHFA 1R5BA 5FBVB 4LHVA 2WPDD 4A15A 3V9PA 1KI3A 3TNFA 1TEXA 1PUIA 2ZUBA 4ZDWA 1Z6TA 1VIYA 4FMCF 1UKYA 2F43A 3DZ8A 4Q4JA 4A6XA 5FPSA 4Q1CA 1AQYA 2D74A 1F3OA 1IXRC 1GILA 3RRZA 4BFTA 1CJMA 1G7SA 3EXAA 3MWYW 1T9HA 3K0AA 1S9DA 2C9CA 2QSYA 3B82A 1G5RA 4MYCA 2OE2A 2VP2A 3A37A 3UG6A 2IF0A 4EFNA 1W36C 3K09C 3QNUA 1PVOA 1CP2A 4D25A 3LRPA 4LJ4A 4B75A 2F6RA 4JLKA 4IRUB 3WYGA 5TV2A 1KI6B 5UKDA 2OESA 2QEQA 1SHKA 1US8B 1Z0IA 2WIAA 4A0HA 3NHBA 2RGDA 2P65A 3SOPA 2FV8A 4GFDA 1Z2CA 3U61B 2QP4A 3I73A 2QMEA 3VTKA 1NP6A 1A1VA 1MH1A 3L82B 4HSEA 2DWOA 1G3MA 2KWIA 5HPYB 1O3YA 4A92A 4N0DA 3K70D 2Q9BA 4D4KA 1AKEA 3DPUA 5EQTA 4DLXA 5EUMA 1KI2A 3A4NA 3TAUA 5FUXA 4GMXA 4U7DA 1P9RA 2VHQA 5B64A 5GVRA 2VHJA 1QVAA 1SXJB 2ODBA 2VTKA 4A4DA 1PLLA 2GAOA 1OB5A 3GLHE 3GJ0A 1IY2A 2QNRA 1UADA 3B1XA 2IUSA 5BN4A 1U9IA 1UDWA 2VP4A 5GVSA 3LO5A 1KO1A 2ZI7A 3B78A 3LX5A 4ZPXA 2QROA 2YVUA 3HYTA 1JQLB 1T0JB 1OXSC 2BMFA 5LD2B 4RY2A 3WHLA 2J41A 3THYA 4QBGB 3BB1A 4LYAA 3B9PA 2C98A 2ZJ8A 2N46A 3QKSB 4G3XA 1SULA 4MYTA 2NG1A 2BWJA 5CJ2A 1KI9A 5LPNA 3FKQA 1R5OA 4KJZA 4AG5A 5JJKA 2RCNA 3CW2A 4KBGA 5C4GB 1E2LA 5FOTA 4QM6A 3TSWA 4LBZA 1XX6A 3I4LA 4KSCA 1KNXA 3JVVA 4RZXA 4ZCMA 4CIDA 2FFAA 3MSXA 1FP6A 4DLWA 3QVVA 4MRSA 1OIWA 1J2JA 2QM8A 2XTMA 2W0SA 3GLIA 1WBDA 1YVDA 3F5FA 4GOKA 1OF1A 5JSZA 4LJ7A 3ZS8A 5CITA 4BFUA 2O8EB 1GM5A 1NLYA 2JAQA 4JBYA 1QHNA 3KKOA 2W2XA 4LHZA 3SJAA 5CDFE 1E2PA 3K8YA 3KTAA 3CB4A 3CR7A 3U3JA 3W34A 2OCYC 3CNOA 2C9OA 1P2UA 3MG9A 2DYKA 2ZQ5A 2ZVPX 3DEFA 4QNMA 4TL8A 1W36B 4XTRA 4HAZA 2ZANA 5FPTA 1NBME 3FKSA 3SQWA 1R0XA 3RC8A 4KFTA 4RD0A 4DDTA 1FNNA 1XEWY 2OBLA 1XJQA 1AZTA 2AX4A 1ZU4A 1KDTA 2X2EA 1E32A 4KLNA 5KO2A 2QAGA 1E3MA 5A4JA 2J7KA 4C0AC 2V1XA 2V3CC 1TX4B 2K5UA 2FDCA 2I4IA 4ZIRB 5KTYA 2PH1A 2ZE8A 3UANA 4Q21A 4TL7A 2FX3A 1YE8A 3VR4A 4V03A 5AUQA 4ACBA 3TVTA 1E2NA 1L4YA 1GKUB 4C0KA 4P32A 2J3EA 5J47A 2V6IA 4N1AA 2XZLA 4Y0AA 2KI5A 4B3BA 5TB5A 2FSGA 4XJXA 4WBSA 4JS0A 4F91B 2QP9X 1MV5A 1GZSA 1ZVQA 3IKJA 2IWHA 3SR0A 1WF3A 4RKEA 1MOZA 1XTJA 2P0EA 4R2IA 3FMOB 4OI0A 2ECKA 1CF4A 5D3MA 2H18A 4WIAA 4D4MA 2RGNA 2HYIC 5JI3E 3U2QA 5FR1A 1N5LA 5JJIA 3E5HA 4OQMA 4HZIA 1F2TA 3LH5A 2O8CB 3BGWA 3I92A 3IPXA 4F4CA 5HZKA 1W0JD 2C95A 2GJ8A 3OAAA 4US2R 3HU1A 5CK4A 4DXAA 3GPLA 3VX3A 4MRPA 4XVQA 4XH9B 4OL0A 3AM1A 3PEYA 3U3OA 2ZR7A 3CPHA 1WBBA 3VKHA 2JIZD 3EPKA 2ZS9A 4MGZR 4D2IA 1HTWA 1Z0KA 3QIAA 4PZZA 1G8PA 3QUSA 4PQRA 3U3KA 1RC8A 2IXEA 5EE9A 3GLFB 2FGKA 2B6HA 2JLRA 4XD7D 4O3MA 4RZ2A 2WWGA 1DAHA 5FOWA 2PEYA 2GVDC 2ORWA 3LA6A 2C9YA 3B1YA 4G5GA 4LOAA 5KOYA 2D2EA 1L2TA 2W6JA 2CNWD 1ESNA 4PAMA 4KYIB 3OEHD 4EQ6B 5TARA 3OZXA 4DT1B 1PV4A 3U7GA 3TUIC 4KHZA 4ARZA 2G1KA 5L8VA 4M53A 2A5JA 3B60A 5CLQA 5FPHA 1F6BA 2CHVA 4BRUA 4YXWA 4M22A 5FBRB 2GNOA 3EZ9A 2VQSA 1WMSA 1J8MF 2QTFA 2Z43A 2ZI3A 1W36D 3LXXA 1MRSA 2XTNA 2O8BB 2F7SA 2FPLA 3C41J 4AY2A 1FQJA 2CEAA 4K46A 1DAGA 1COWD 3LBNA 3AVYA 3ZS9A 1G3QA 3EA0A 5KDOA 3ZGXA 1W4AA 4JLJA 3L0SA 3PR1A 3H0KA 3ADKA 3LDAA 4DDUA 5B30A 1E2JA 4Z54A 3KJHA 3UMSA 4A8JA 4MYUA 3NDPA 1RPZA 1CJUC 3CM0A 1M6NA 1RE0A 3EZFA 1SXJE 4GP6A 1RJ9B 5AUNB 4X8OA 4Q9JA 3VKWA 1WDTA 4UNQA 4A9AA 1XU4A 4OHYA 1QBKC 3P1JA 1YR9A 2OZEA 3THXA 1VKJA 4PO1A 3KJEA 4P4SA 3OE7D 2IS2A 3B9QA 4AURA 4LRWA 2NO7A 1OT3A 1TQ6A 4DDWA 4NZYA 3ZZUA 1CEEA 3C8UA 1CJTC 2JLVA 4B73A 3MWLA 2CK3D 2BCGY 2YOFA 1DAMA 2BMJA 4B3CA 5J4HA 3DZDA 2Z5FA 5F9HA 1JI0A 4AKIA 3U7HB 2OSBA 2ZJAA 4Q7MB 2ZS7A 3SDZA 2Y8EA 2IYQA 3N2IA 1OYWA 2GEVA 3BBPA 1E79D 2QPAA 1XD2A 2F3RA 2C8VA 2HJVA 3F8TA 4HAYA 4JT4A 5DI3A 3SC3A 4I81A 4CT4B 3GQBA 4QHTA 2C03A 2ZIAA 2ZRGA 2DY1A 2ZREA 2IK8A 4LGMA 3MFYA 2EFHB 3GEIA 3ZVLA 1NN0A 3UWKA 3EG5A 2BJVA 2D06A 2G3YA 2LKCA 1HA3A 1FTSA 1NVXQ 3RSLA 3EIEA 1RRCA 2Q21A 1OFIA 4WXPA 1XXHB 1TL7C 1NVUQ 4YC7A 3THWA 3VR2A 1L7VC 2RGEA 4A36A 2OXCA 4EPWA 2CLDX 5KPDA 1JBKA 2PT7A 4O2RA 3R20A 1S3SA 3AF1A 2CNWA 1RVDA 3CRVA 4PC2A 1RZ3A 4JBWA 1E2IA 5EXXA 4Q4AB 2VP0A 3EPHA 4OI1A 1FZQA 3I72A 3SS8A 4OQNA 5FOSA 3G0HA 3DDCA 2QRNA 1R8SA 1Q0UA 2QGNA 1QHHB 1NIPA 1P2SA 1S8FA 4HZUA 3R7WA 1LS6A 4MYHA 3SFZA 4CEHB 2VSXA 3Q3JB 5EUQB 4DLSA 2R6FA 2C99A 2GJAA 5DE3A 4YONB 4A1FA 1GUAA 3NIBA 2QT1A 4KFRA 1FOEB 4OQXA 1U9IC 4OHXA 3A8TA 2BOVA 2P5TB 4G5SA 4H9GA 4EPXA 3IDQA 2PBRA 3AKEA 3FWYA 1HV8A 2O0JA 1R0YA 1T6NA 5AUOB 3FMFA 1CXZA 3A1TA 3A1SA 3U5ZB 2WWYA 1ZC4A 2X19A 3P20A 2AKYA 2GESA 3GFTA 3I8XA 4BEJA 1W7AA 3TMKA 4DZZA 4V0NA 4EFMA 2UKDA 2ZS8A 5F98A 1GOTA 1U99A 5HKKD 2ZRCA 2HXSA 4QGAA 3K9LA 2MSCB 4N3NA 2HT1A 2ZSEA 4ON9A 4G01B 2HLDA 2OCBA 5J40A 1IN4A 4DUGD 2CJWA 1XTKA 4ITRC 4TTQA 3IEUA 3P32A 4LSGA 3A58B 1Y3AA 1XPOA 5JECA 3GJ6A 4C30A 3OE7A 2ZRFA 3B7GA 4MRRA 1AQUA 4Q1AA 4Q4JB 3WBJA 4WOPA 4DCSA 2ODWA 1FPMA 3NH9A 1YR7A 2R62A 2AWOA 2ZRJA 4KAXA 2OUKA 1Z47A 3K0AB 5E3HA 2XSZD 3ZQ6A 1KSHA 2EFCB 2ONKA 1I2MA 5C4MA 3ECCA 4BZPA 3VR3A 2EFEB 2WKPA 3GLFE 2EU8A 3ZZTA 1E9FA 4B6EA 3QXCA 2C5LA 4AI6A 4PC6A 2CVFA 3OEED 3NC0C 4PC7A 1KJZA 2ZYWX 4LWZA 1QDEA 5IT5A 1NY5A 2QAGC 2ZPTX 2Q3FA 5JZVA 1XCGB 4P4UA 4S35A 2XJ9A 3D6TB 1F2UA 1DAFA 3BC1A 2KJQA 2Q9AA 1ODFA 4CVNA 1IJEA 1XTRA 1HQCA 1YR8A 4Q18A 2OG2A 3KKNA 4Q5IA 2JEOA 4U00A 5DYGA 5DH9A 4JZKA 1N6NA 3QF4A 4L16A 2ZRLA 4KXFB 4OBEA 2OEPA 4Z51A 1LVGA 1ZMXA 4GP7A 4YQFA 2ZU0C 4MGYR 5C1BA 5KSZA 1E98A 3LD9A 1NN5A 4L5BA 2W2TA 4A0FA 2RGNC 1IHUA 1KI1A 2CLSA 3SU8A 4KFUA 3K70C 1G7CA 1UBGA 2OV2A 1JAHA 1KK0A 4G1UC 2CCJA 3THYB 5AK0A 2D62A 4Q9KA 3EWAA 4B2PA 1KDPA 4I4LA 3DKVA 3O47A 4M8NE 3G5UA 1CU1A 3LX8A 4MRNA 3OIUA 3QKUA 3A4MA 4PC3A 2NZ8A 1E0AA 2BMEA 2VF7A 2WSSA 2WM9B 5LBIA 4MKHA 4A0GA 4RD1A 3UKDA 3X2SA 2YKGA 3LBHA 1UEJA 2GF0A 3IIMA 3IILA 5FL3A 4OQFA 3M0EA 5BW8A 4MA4A 5JSZB 3LWNA 1EG7A 4OHWA 2CVHA 1IBRA 3UXMA 2WJIA 2XXAB 3MLEA 4XOIA 1NJFA 1FX0A 3PFIA 2FSFA 3HWSA 4AG6A 3MAAC 2DFTA 3IO3A 4CDGA 2CLCX 1VIAA 1JXMA 4QNRA 4DUGA 1M7HA 3KTAB 2LKDA 4IOLA 1OHHA 4NYMQ 1J8YF 1P5ZB 2XAUA 4IDPA 3R8CA 3Q9LA 4A82A 4MDEA 4TLEA 3T1QA 4PSAA 2IBMA 4DB2A 2QSZA 5DGXA 3QBTA 1CTQA 2REBA 1U2RA 2WKQA 1DADA 2JLUA 4HLDA 3O8CA 2QAGB 1OFHA 3HPRA 3I3SR 4JLNA 1BKDR 2XNDD 1JR6A 4PZYA 5G40A 2WMNB 2ZRKA 1Q20A 4Q66C 4JVLA 1XXHE 2WV9A 4FI3C 4Q1BA 3RSOA 1GFIA 2O8FB 2C2HA 1MABB 1QG2A 2BKEA 5JEDA 1M74A 3NBZC 3I61A 4E5UA 1P72A 2QY9A 2XEXA 2YWGA 1NKTA 1SVWA 1F5NA 1R5NA 2OFXA 4LHXA 4WZBE 4B3XA 2QM7A 1AGPA 2E87A 1U81A 5D3MB 1Z6YA 2H8KA 4A8JC 1QVRA 4WZ6A 2ATVA 2ZVQX 3C15C 4NCNA 3K70B 3RYTC 4BFZA 4BECA 2G77B 5HE9A 1FP7A 4HB0A 1N3BA 4FWTA 1OH7A 3SEAA 3QKRA 3TRFA 3AGQA 4TYPA 1IY1A 3CO5A 3I5YA 1E9AA 4TL9A 3CWZA 1W1WA 3DKPA 2IWRA 1KNQA 4BFXA 1LB1B 1GTVA 2B7BA 2KBEA 4FXPA 3CZPA 3WMEA 2EFGA 1DBSA 2QRZA 2ZJBA 3BWDD 1JALA 2ZUCA 2WAYA 4GRAA 4TLBA 1V43A 4Q03A 3U7FB 3KJGA 4PR0A 2FSHA 1AIPA 3N2EA 3LW8A 1KMHA 1XJ0A 3Q5EA 3SI7A 4UNRA 3MJHA 5DISB 1N6KA 4YMVA 3BFVA 2GHIA 5J4YA 3KQLA 1N5JA 1WA5A 3BFKA 1P7CA 3PQCA 4C2UA 4OJQA 3RHFA 3WXMA 4IVRA 3PEWA 2GXAA 5FOVA 1ZM3A 1ZD1A 3GP8A 1NMYA 4BLQA 2ZI6A 1S9HA 4LYJA 5EP2A 2VSFA 1SGWA 2D4HA 4WXRA 1E9EA 2G83A 3QF7A 3TW4A 1S4QA 2F9MA 2FH5B 4IDOA 1OB2A 4P33A 4TMWA 1B23P 4LBWA 3HP1A 1Q12A 4IKEA 3CNLA 1ZAKA 1Q3HA 1Z6GA 4XWAA 1E2KA 2ERYA 2WSMA 4B3DA 1OH6A 4Q02A 2ZRHA 4D0NA 1VG9B 2QMOA 3HU2A 1E4YA 1GL7A 1Z06A 1EFCA 3M4YA 4QBFA 4C7OA 1M7BA 4B34A 2QPTA 1LF5A 5JHGB 2E9SA 2HYDA 3CIOA 3FGNA 4LC0A 3HDTA 1TADA 3RRYA 2W58A 5CK5A 4PAQA 2OLJA 2OBNA 4JLMA 1NLZA 3FKSD 4ILEA 3QOFA 2JATA 3BS4A 1KO7A 2V1UA 4TSFA 5BYKA 3K1JA 5KYKA 1LY1A 2E1RA 3JZMA 4RFSB 2VF8A 3PJRA 3HJNA 4E03A 2YNMA 4JKIA 3TIFA 2XNDA 3CRQA 3PUWA 3KQKA 1Z29A 2NZJA 4ESHA 3QJYA 5ANRB 4IEIA 4W5WA 1IAQA 1GKYA 4BLSA 4A8JB 4Q1FA 1FMJA 1G8GA 2ANBA 1MRNA 2ATXA 3CH4B 4DSTA 2OCPA 5JCZA 2GA8A 3EA5A 3QPVA 3H4MA 2A78A 1Z0AA 3I62A 3W3ZB 2WWHA 1W47A 1Z28A 4M2LA 4POAA 1OYYA 3S1AA 3THXB 4HUTA 5HCIA 2A5GA 2IYLD 1KZ7B 2NO0A 4P4SB 1Q1EA 5JCPA 2JGNA 5KSYA 3EZ6A 5GJVC 1G4UR 1VHTA 2IA5A 3OIYA 3X1YA 1DS6A 4Q7KA 1T0HB 2G0NA 2FSIA 3QPWA 1T3LA 3DO6A 3H86A 4NCHA 2W2VA 4M1WA 1R0WA 4RFVA 2BBWA 1BIFA 3ZZ0A 1G18A 3RANA 5KU1A 1J90A 3R9IA 4A6PA 2OXRA 4C0QC 3J81k 3MRSA 5FTMA 4MKGA 4NYMR 2MSEB 3OAAD 5FOUA 2GK6A 5DI3B 2IUTA 1SVOA 3B8HA 4F93B 1CLUA 4RJLA 1YZUA 3T15A 4QL3A 4UNSA 3VR1A 1UEIA 2WJJA 1OPXA 5AJWA 5JRJA 1KAOA 1AK2A 1ZIOA 1XMJA 3IPYA 2AN9A 4PHTA 2DR3A 1EFUA 3UK6A 1M34E 4NPHA 4M0LA 4MUBA 1G20E 1QF9A 1XD9A 1CR1A 3RABA 5J4LA 1ZYUA 2JJ2D 3C5HA 5ELXA 3QI2A 1BMFA 1OFUX 4M9XA 1LV7A 1XEXA 1YJ5A 4RVCA 3SYLA 3W8NA 4C0SA 3THWB 3QG1A 1ZNXA 3G82C 4V0MA 2W6JD 2H17A 4ERNA 4LJ8A 1OXVA 3SHFA 4XTCS 1CJVC 5KPJA 4ZI3A 3SBDA 1MR3F 4NHOA 4D81A 1FW6A 1GAJA 3Q72A 1NF3A 3V00A 5GJCA 2FU5C 1KOFA 3AVXA 4DCTA 3SYKA 4KSBA 5L3SA 1NKSA 4YXWD 2GZHA 2BJWA 3EIHA 4DC9A 2WWFA 1KO5A 2RHDA 4US1R 2YWHA 4HZUB 3R7WB 2JLSA 2VP6A 4Q9HA 5JWOA 4LPKA 4TMTA 4OI4A 3NWJA 4PX9A 4MGKR 4ASUA 3KQUA 3MWJA 1E1RD 1E96A 3QEJA 3WNCA 3CUEF 5FPYA 3EPJA 4F4JA 2J45A 2XITA 2IEYA 2EW1A 4LI0A 4CYMA 5F3WB 5BN5A 4FCTA 3NTUA 3SZRA 5BXQC 1DTSA 4URWR 2OM2A 1E0KA 4PZLA 4BPBA 1CR0A 1XEWX 2PT5A 4ZV4A 3T12A 2NGRA 1DARA 2EYQA 1I4LD 2VYFA 3L0IB 1W5TA 3W3AA 4JVNA 2QAJA 4CT5A 3UWOA 5SZKB 5E7MA 4EAQA 1HEIA 1TNDA 3FHTA 1EESA 3AQ4A 1OIXA 3GLGA 2CJWB 3FYHA 1BYUA 1PLJA 2ZI5A 2ASEA 4F38A 5IK2D 3DMNA 3W6PA 4HDOB 1A7JA 2P6NA 4HUQA 4AYTA 4IHQA 1N6RA 2SHKA 2P6RA 1NVVQ 4OK6A 5LDDC 2TMKA 2VLIA 3DOEA 2CL0X 4X8HA 4PPFA 1TEVA 1XPUA 3ASYA 4HDCA 3IGFA 1XNJA 2CE7A 1HY3A 1NBMA 2J1LA 4FINA 3FHOA 3FPAA 3TAHA 1GRQA 4B3FX 4JLAA 1OLOA 4QOSA 3IEVA 5J5CA 1AZSC 3ASZA 1GP2A 1S96A 4JBXA 2WWIA 4IJMA 2BHRA 1NMXA 1TTTA 4H1VA 3WMFA 1UBEA 5JRZA 3ZYCA 2QTVB 2D7DA 1XMVA 3F3YA 4Q48A 4A0RA 1M2OB 4B33A 4Q9LA 3A4LA 3GFPA 3L8ZA 4O2LA 4I1VA 5FUVA 3L0PA 3CZQA 1XZQA 4V0LA 1UM8A 4IDQA 4ZO4A 3QSYA 3VMFA 1RRFA 1F2UB 2ZR9A 3RC3A 2Q0HA 3X1XA 2ZETA 2B21A 1E4VA 3FMPB 2JJ2A 3HR7A 3OESA 4P31A 4B2IA 3CF0A 4DDVA 3Q85A 1ZUIA 2CHGA 3VU9A 2P2LA 4PPGA 4D4LA 5BN3A 4EPTA 1ZM7A 1GKIA 4DCUA 1MO4A 4KVGA 2C96A 2WMOB 4ZDKA 2IYXA 2IW3A 3KQNA 1ETUA 3KB2A 5EP1A 5EXTA 2JLQA 2O5VA 3EIQA 3WP0A 4MITA 1E1QA 1KTVA 4MKIA 2GBLA 1HT1E 4BQSA 4D26A 1KDOA 5B2ZA 5HZHA 1TAGA 1IN6A 4RZ3A 2GZAA 1G64A 2R6AA 4Q1EA 5K8UA 4BEBA 3LV8A 2A5YB 3AVTA 4M1MA 2ORIA 1U8AA 3BH6A 3CR8A 1KHTA 3WRYC 3ZVRA 4NDZA 1BO6A 4AWXA 1N0WA 4RD6A 4C0JA 1E1RA 2IYTA 2PLFA 2RKOA 4ABYA 4Y0VA 4NU0A 1DEKA 4KLZA 2ZRBA 4EPYA 1JEEA 1HE1C 3BE4A 5FUYA 2HCBA 3REFA 1XTQA 3U7EB 2DFLA 1JPJA 2Q9CA 4NONA 2HJGA 1IOZA 4YDHB 1S2MA 2O0HA 1EX7A 3CNNA 3RNLA 4QG7A 3E70C 3CF2A 1N2CE 3CWQA 2HLDD 3FB4A 4DLRA 4TYNA 1T3SA 1IY0A 4RD2A 3GCGA 2ZRMA 5IK2A 3ZDQA 2F1JA 5DO9A 3IBYA 3TKLA 1NMZA 3GJXC 1RRPA 1NSFA 2QTHA 1Y63A 1U90A 3Q5DA 5AJZA 1IN8A 2N1BA 2RMKA 4B6FA 2FZLA 2J7PA 1FTNA 1UBCA 2QE7D 4MUAA 2GCOB 3VQTA 1GG2A 4Q00A 2DFNA 1KI6A 4R98A 821PA 1FUUA 3UMFA 4X8MA 3IHWA 4RD4A 2P3SA 4EPRA 2ZE7A 1G3UA 1ZNZA 4DIDA 3W6NA 3WNDA 5K8IA 4NCKA 3PXGA 4XSGA 2NO9A 4B76A 2GEUA 4C0BA 3U44A 2Z4RA 5FR2A 1UJ2A 3GJ8A 4C0LA 1Q1ZA 1ZCBA 4CW7A 3EAQA 4JLOA 3B1ZA 4W5JA 4XWKA 1Z07A 421PA 2WJVA 1TF2A 4JSYA 4TTRA 1UAAA 4LPSA 2I1VB 3VHLB 2F1IA 2XJ4A 1SXJA 2PCLA 2B7CA 2WICA 4QXAA 3SYNA 1IJFA 2FOLA 5EJEA 2JLYA 4H1UA 3FMIA 4WZAE 1NY6A 1Z6AA 1ZM9A 2ZYVX 4MQBA 1E2QA 1G6HA 2G1JA 4C4PA 4M4SA 1GDDA 1KY3A 2V6JA 3HPQA 4IW3B 1P9WA 1KSFX 3GD7A 3DM5A 3QKRB 4DSUA 3K9GA 5LB4A 3QG5A 1GNPA 2P67A 3EPLA 3ND9A 3QPUA 1JR3A 4CF7A 3TGPA 1VG1A 3BH7A 3QKSA 4FMDF 4PO8A 2MSDB 3UG7A 2IYVA 1NVVR 1T3HA 2FFHA 1KIMA 2DFKB 1OE0A 1T8TA 1U8YA 2ZUDA 3NHAA 3H2YA 3LXRA 3OF5A 1D2NA 4MGIR 4QJ3A 5JWHA 5DIFA 3KZ1E 2VBCA 1G19A 2GKSA 4M9QA 4OHVA 2GJ9A 4OK5A 3BFXA 4XVRA 5KSPA 2BBSA 1H8HD 1Z83A 1VTKA 4IOMA 3KFXA 4D82A 4AD8A 2WSSD 3OIVA 2FFQA 4QJ5A 1I2DA 1NN1A 1TUEA 3RLFA 3NEYA 1JJVA 3CX6A 5EE0A 4GSYA 5FI0B 1FNMA 3LNCA 3PG5A 4XIGS 2KSQA 3TQFA 3EASA 4IXMA 3R9XA 4PC1A 4B2LA 1AJEA 2PMKA 2GXUA 3C14C 3X1ZA 2VRWA 5CB8A 3K09A 4LC1A 5L3QB 5FBWB 1HYQA 1R2QA 1Z3IX 4HATA 1CIPA 1EXMA 3BIFA 3FFAA 3RS2A 1OHHD 1W0KA 2VP5A 1K5GA 1GSIA 2J0VA 3PUZA 1X1RA 2Q6TA 4Q4HA 2ZYTX 1CR2A 1E2MA 4CGZA 2WJHA 2ZRAA 1P6XA 4HAVA 2V7QA 1WCV1 5E7IA 2GTPA 4FIDA 2A5DA 2F43B 5AJVB 5BYJA 2HCJB 2J87A 2QE7A 4L9SA 1D9ZA 1VG8A 2EVWX 3OHMA 4IOKA 2IXGA 3TVDA 4HB4A 1E9RA 3B6EA 3MCAA 4BLTA 1D6JA 4AYXA 2GZDA 2P6UA 1W2HA 2YZ2A 1E9DA 2AWNA 1E99A 1ZUNB 5DN6A 2BEKA 2NPIA 2V9PA 1U98A 1MT0A 4QJ4A 2Z83A 3T35A 1L4UA 3MJRA 4Q9IA 3SJCA 4Z8XA 3TR0A 1UDXA 4GT1A 1H65A 3GJ4A 1NL3A 3BAFA 1UKVY 3NC1C 1D5CA 2JCSA 1VHLA 5EXSA 1GITA 1KKLA 1II8A 1G5TA 3LY5A 5HR5A 3EZ2A 1ZM2A 3GMTA 2OAQ1 2R2AA 2VHTA 3AF4A 4ZCLA 1X8LA 2ODEA 3FVQA 1EFHA 5JEEA 3CRW1 3IIKA 1W4BA 3QENA 4B44A 3L2OB 1WP9A 3VKGA 1ZW6A 4PQFA 4G0NA 2B8WA 1TUIA 2XZOA 5EP4A 2ZSFA 1NLFA 1TF7A 2YV5A 2BEJA 4GOJA 5AJXA 1E94E 1A5TA 1W4RA 2OBMA 2QA5A 4HB2A 4LHWA 1KI4A 4Q7JB 5K8LA 1RYFA 2DB3A 2LCFA 2V54A 3AVQA 3CRMA 3GLFA 4TQUS 3D7MA 1W44A 3AF2A 2VHUA 4PHHA 5JS7A 4PHFA 3DVLA 4YLGA 1CBUA 3UMRA 4K8OA 4OJKA 3AV0B 2XB4A 1YZKA 1Z2AA 4UXHA 4OKSA 2OILA 1Q1QA 3DL0A 4HLUA 3KXKA 3AP3A 2W6IA 1H8HA 2ZXUA 3ZVNA 4HB3A 4II7A 4LZZA 1KI8A 5IF9A 1XEXB 2WZQA 2B8TA 3WY9A 1E69A 2IXFA 2RH5A 4FW9A 1L8QA 1W49A 3GLIB 3MWKA 2GF9A 2QORA 1TF5A 1XD8A 4QFMA 1P2VA 3IHLA 5DHAA 2ZJZA 2FEOA 4F7WA 2O8BA 2GEDA 3FHCB 3NVAA 2ZU6A 4DB4A 4B35A 2YYZA 2LWIA 4P3YA 1Q21A 1ZJ6A 3LAWA 4JL5A 4WAUA 1D9XA 1XF9A 5AJYA 3X1WA 1BOFA 3D3QA 4LYFA 4C9BA 3SNHA 2L0XA 3A6PC 3E1SA 1E2GA 4FCWA 2XX3A 4M1YA 1BYIA 3V4RA 3PCRB 1IXZA 1RFLA 1VCOA 3TSZA 1XMIA 4I99A 1G7TA 1X8KA 4TSFD 1XPRA 2X1VA 2CDNA 2QENA 3U6KA 3AUXA 2ERXA 4RCZA 1SVKA 2GBLC 4PXAA 5IRCD 4LYHA 5F9FA 3LQRA 2QMHA 1IM2A 4Z8YA 2HF8A 5CM9C 3PITA 4K81B 4B47A 1QRAA 3BRWD 5A5GA 5TMPA 3TR5A 5G3ZA 3JVUA 1VDZA 1G7RA 1DG3A 2FZ4A 5L3RA 4HLCA 4XSHA 3ZJYA 3KUCA 1GRNA 2W00A 1HE8B 2A3RA 3DMDA 3SE0A 4J0QA 4URVR 3GLGB 4RCYA 1C4OA 1N0VC 2J46A 4TTPA 4BZQA 4PO9A 4F92B 4DBLC 2XOKA 4JKYA 1PJRA 5FBLB 1SZPA 3AP1A 3NXSA 4HUQB 3CONA 1ZCAA 1W2GA 5JLJA 3UATA 2VHCA 1PZNA 3VNVA 1VYVA 1JB1A 5TDHA 4DCVA 3L8YA 5H70A 4F4IA 5SZJA 3I8SA 2IYUA 5AR1A 3REGA 2WHXA 1M7GA 3CBQA 5E7JA 1XWIA 2NQ2C 5P21A 4LJAA 2WTUA 1F2TB 4FMBB 3TSOA 3BOSA 1CRPA 2Z0MA 1OKKD 1EFTA 1K8RA 2RGXA 1XTSA 4V02A 4PTLA 4B48A 4YMSA 3KUDA 4NYJQ 3RAPR 4BFYA 2ZRNA 1YZTA 2REXB 5D3QA 2FPKA 3H84A 2J59A 4AIIA 3ZD7A 1QHYA 1UFQA 4X8LA 3RS5A 1N5IA 2C78A 2GWHA 3UIEA 1Q44A 4GDFA 5M04A 5JHHB 2R6DA 3BORA 2ZAMA 4M1KA 4DLVA 1TMKA 3KL4A 4WA7A 4CEIA 3AB3A 1W5SA 4KU4A 2O0KA 4BLRA 4DCNA 4C0HA 4NE2A 1T4GA 4AKEA 1N6OA 1Q22A 4PPNA 4TWZA 5KNBA 4GL2A 1OH5A 1WB9A 121PA 4LK2A 5KDLA 1WXQA 1BMFD 1U0LA 1FL9A 2PEZA 2QGZA 2QU8A 1KDRA 5C2JB 2PX3A 3QXXA 4NKRA 3EC2A 4ZDIA 3VR5A 3AVWA 3ICQB 1UF9A 3ZLJA 1ZUHA 2PZGA 2HXYA 2B92A 3AEZA 3VU9B 2IL1A 3BJIC 2ZRIA 2PL3A 4L4UA 3TQCA 1ZIPA 3K9NA 3MD0A 4DLTA 1X86B 3L43A 2W83A 4KVAA 4QHSA 4D6PA 5KNCA 1DELA 1XP8A 4ARZB 2H1LA 4Q19A 2KBFA 5HCNA 1VYTA 5E95A 4QC2A 4KO8A 1WE2A 2CL7X 3NDBB 2ZEJA 1KK2A 1KMQA 2WAXA 3AF3A 2J0SA 5FH9A 3T1OA 3R9WA 3K53A 3U3MA 4KI0A 4ASUD 3B85A 2QP3A 1MO5A 1QHGA 3AUYA 2IYWA 4DEYA 6Q21A 4JMPA 2JASA 3T34A 3FFBA 1I4TD 1SKYB 1ZC3A 2QZ4A 1IN7A 1FMLA 3QE0A 2P5SA 1EFRA 4I1OA 3NEJA 1BS1A 2A2ZA 1CULC 1BH2A 1G3IA 1SVIA 2FG5A 4US0R 1RYHA 1LTQA 2EWWA 3GJ7A 4FWIB 5L3VA 5J4VA 3GEEA 4PAOA 3C7KA 1KO8A 5FUWA 2RHMA 1XB2A 1VECA 2PCJA 2NMVA 1DO2A 4CEJA 2YWEA 3W8RA 4NL4H 3W9YA 2F1HA 1X1SA 2GJKA 1JJ7A 3CPJB 1N6PA 1RKBA 2DWPA 1PLKA 4TMZA 5DYIA 3CH5A 1HT2E 4FD2A 4LJYA 1G41A 1I4DD 1U8ZA 3UPUA 2RB4A 1VCNA 2DPXA 5BWMA 3O8RA 1NVWQ 4IOJA 2WIBA 2AKAB 1YU9A 4MKFA 2REOA 1XJCA 4IEEA 2OO7A 4R71A 1NBMD 5SZIA 3M6AA 4N0EA 4PPQA 4EJSA 3ADDA 1F60A 1NNEA 4PSVA 2BMDA 3ETLA 1HH4A 4EUNA 1OKKA 3MUFA 5FPKA 2JDID 3AF0A 1KAGA 4DLYA 5CYOA 4YMTA 1FFHA 4FN5A 1OJLA 1E0JA 1XD2B 2X8AA 1T5LA 3U44B 5FFMA 3ZQJA 1C9KA 2FJUA 4V0ME 4B3GA 3GLIE 2X77A 2XTZA 4GBMA 4JVMA 3B2EA 3CF6R 2J0UA 4HAXA 4TYQA 4B43A 2ZJ2A 3NBFA 3PUXA 5CB6A 2DCUA 3ZH9B 1AN0A 4LUCA 5TY0A 4LV8B 3SN6A 3B1VA 5AWFC 1VG0B 4QM7A 3TUJC 5A0FA 1SQ5A 3ZIAA 3LQQA 2JJ1A 3E2IA 4Q1DA 2F1RA 2G0TA 3IBGA 5IHPA 2FF7A 4AK9A 2ZITA 2ZR0A 4PANA 3K0CA 1KI7A 2QN6A 2NO6A 2BKUA 2YHSA 3CKLA 3X1DA 4JLBA 4MRVA 2CXXA 5FL7A 1R6BX 4ZDJA 1E9CA 5H68A 1TU4A 3AKDA 3FE2A 5SZHB 2F3TA 2QL6A 4TLCA 1E1QD 4FMDB 2ZI9A 2WOOA 5E4FA 2C04A 1N6IA 3PIRA 4TLDA 4G5OA 3GLHA 1XRJA 3K0SA 2AD1A 1JPNA 5EP3A 2JLXA 2KB0A 2VA8A 4NYIR 2H57A 3H1TA 2D2FA 4RZUA 1P3JA 3EWSA 1XEFA 4DLUA 2IYZA 4BFSA 2YC2C 3OFNA 5EXPA 3K0FA 2PZEA 1A2BA 2VO1A 3GLGE 2GVZC 1CS4C 2XXAA 5C18A 1G6OA 4NYJR 2A7QA 2O8DA 4NP6A 2AFHE 1KY2A 4UKDA 4AKHA 4RSGA 4BLPA 4M9ZA 2HEIA 3O8DA 4RD3A 2QI9C 3K0EA 2ZYUX 5JBQA 4Q01A 2PX0A 3D8BA 1S3GA 2WOJA 2ZSBA 1F48A 2WPDA 2G88A 5HE8A 2IF2A 3LFUA 4LV5B 2OT3B 2FA9A 4DKXA 3THOA 2WKRA 4HLUC 4IFEA 4LJ5A 4TMVA 5KHOC 1Z0JA 4L8GA 4GI7A 1JXOA 1KK1A 2HUPA 2RGGA 3T5DA 1NJGA 4LJ9A 2HF9A 4M1OA 1Z63A 3RRNA 1KSGA 2OFOA 1EK0A 621PA 2JLZA 1E2EA 1S0UA 4Q4HB 2WVJA 2H5EA 4B32A 1E9SA 2GCNA 2AFIE 2ZI4A 5CDFA 4MDFA 4Q47A 2PZFA 3NBXX 3R8FA 1Q3TA 3LW7A 5TXGA 5LB2A 3U4QA 2V8OA 2J7PD 4UXJA 4HAWA 2IT1A 4JJZA 2O8FA 1MABA 1P60A 2FNAA 4PSKA 2BC9A 2H16A 3Q7QA 4QHYA 3F0TA 4R9UC 3EC1A 2FN4A 3RWMB 1AGRA 1VYUA 4QRHA 4LX0A 1NG9A 2JDIA 2HV8A 3ONWA 4FCVA 2GETA 2ZROA 1ZD8A 2OCAA 1E2FA 221PA 4KFSA 3HYRA 4DEXA 1NRJB 2FEMA 3MMPA 4TQAA 2IS6A 4GMDA 1P62B 4EDHA 1N6HA 1DAKA 1RRGA 1VMAA 2ORVA 2QUZA 2AK2A 1GNQA 1SXJD 4OYHA 3A1UA 2VSOA 4U02A 2IHYA 1G16A 1II8B 5KDDA 1IXSB 2OFWA 1H8ED 5JS8A 5CJPA 3QVUA 2EQBA 3A1WA 3RS3A 4G5QA 2QBYA 2YINC 1OIVA 3T1VA 1X6VA 3BH0A 3QF4B 4DVGA 4JLDA 1AKYA 1HURA 1JR3D 1SKYE 3W5JA 2QMUA 5JI2E 4NMMA 1NIJA 1AS2A 1UBFA 4JJKA 3QBVA 3SFVA 2IUUA 3TH5A 4URZR 5FTJA 5BQ5A 3PEUA 1YRBA 3CX8A 4ZKEA 1G8HA 4E07A 5EZ5A 3RVBA 4I1UA 4TQ9A 2EYUA 1XZPA 4KYUA 3KQHA 3QKTA 3WP1B 1LFDB 3NG1A 4DRZA 3Q8XB 4A2PA 4TZ0A 2AXPA 1CJKC 1G9XA 4S2EA 4URYR 1OXTA 3U60B 2I3BA 1TU3A 1HQYE 1OV4A 4IFBA 1UKEA 1R8QA 1DAEA 1G4AE 1JAIA 1SHZA 1ZP6A 2QG6A 4ZCIA 4R2HA 2GXSA 2MMCA 2Z4SA 1YHNA 4URUR 2CCGA 2N42A 3SQXA 1G1MA 5CM8B 2BDTA 1Z22A 1G17A 4D0LB 3M1IA 3SBEA 4HYYA 1FX0B 4LJ6A 3P4YA 1QHSA 1W0KD 3BERA 3IUYA 1E6CA 1UKZA 4RFSA 2ZRDA 2ZSDA 4A2WA 3TJZA 1JEDA 2F55A 4TMXA 3AVVA 4QKQA 4YMWA 3TE6A 2IHBA 2V7QD 1AS3A 1GRRA 2J9RA 1QHXA 1KJYA 2NO1A 4AC9A 4ACAA 3VX4A 3ADBA 1CR4A 1KKMA 4O25A 1NSTA 3PV0A 1U0JA 1US8A 1NN3A 1Q1BA 4JL6A 1DG1G 3PENA 1XBTA 3KKQA 1U0HC 2WWXA 2IS4A 4LDJA 4JL8A 2NIPA 5KSOA 2IS1A 5DN6D 5K8TA 1OFTA 3P27A 2QQEA 1C1YA 3PEVA 1Z0DA 4OHZA 1MO3A 2VH5R 3VR6A 1SKQA 3D31A 3A1VA 4IXNA 1G8YA 1HUQA 4P0TA 1JR3E 2YJTD 1M8PA 3LBIA 1J70A 1YZLA 2A9KA 4QGFA 3KXLA 4V0KA 3C4JA 4PHGA 1SVLA 2EWVA 1ESMA 4UJ3A 5IDVA 3VHXA 2WJYA 1WRBA 2RGCA 1ZD9A 4EFLA 2UVQA 3OIWA 1H8EA 2JA1A 1EX6A 1Z08A 1W0JA 2XB2A 1QG4A 2IX3A 1Z0FA 4UJ5A 5C46F 1KO4A 3PUVA 4C2TA 2BBOA 3CPEA 4GZMA 2BM1A 2BV3A 2Q3HA 3ZVMA 2FPMA 3IQXA 3QEOA 1YRAA 1YR6A 3B1WA 2D3WA 3DM9B 2JIZA 3LVQE 4LBYA 4TT3D 4L9WA 3V4FA 4D4JA 3ICEA 2AHOA 5CIQA 5DI9A 3W90A 1GNRA 2ZSAA 4EPVA 5JJLA 1PUJA 3NKVA 1IN5A 4TN1A 4IDNA 4QBHA 4W9MC 5CIWA 2AXNA 1M1YE 2GK7A 5FOXA 4XVUA 3TUZC 4XD7A 4CEIB 1KMHB 4D80A 4EJSC 1G291 1II0A 1J7KA 2GCPA 2R9VA 3KJIA 2H92A 2QPOA 5G41A 5GJWC 4TYYA 2WBLC 3EW9A 2W6ID 2VL7A 4TYWA 1LW7A 2YOGA 5EZ6B 3OEHA 2BBTA 4KCGA 1OH8A 4P4TA 2O8EA 2ZAOA 1KK3A 1MKYA 4L15A 1CRQA 1KZGB 3IIJA 4OI2A 4UQOA 3GJ3A 3KFVA 1J99A 2R6CA 3T06B 2CHQA 2BIFA 3GEHA 4LHYA 5J4KA 3KX2A 3BK7A 1AA9A 1E0SA 2GILA 1Z8FA 3LLMA 5FTNA 3P4XA 1MO6A 4BUJA 4C7OB 1RW4A 1ZRHA 4AKGA 3T1TA 1B0UA 2G6BA 3CLVA 1COWA 1E9BA 1ZM4A 3K0CC 4GPTA 2ZJ5A 3HR8A 1OSNA 2J5XA 4BRWA 4HAUA 1ZINA 4TMKA 4ZIRA 2NOAA 4JYBA 2UZIR 4KV9A 5FTKA 1CKEA 3KB1A 5FI1B 3RDPA 1EGAA 2V55B 2ZE5A 3BD9A 1Q57A 3DOFA 4M9SA 3T5GA 4R7ZA 1ANKA 4JSTA 2BVNA 4OK3A 4GOXA 2PJZA 3A36A 2J0QA 3C16C 3KXIA 1QZXA 3LLUA 4BFWA 3WYAA 4Z1MD 3W5IA 2XGJA 4O0MA 1YQTA 2VP9A 5CLLA 4CEJB 3BB4A 4JIMA 5KUTA 2Z6VA 1YZQA 4DSNA 4M21A 3BB3A 4FMCB 2CE2X 3AVOA 4RKFA 4DJTA 1TPZA 2IYYA 3TW8B 3WRXC 2GRJA 2IYRA 2XOKD 2CK3A 4TLAA 3S1AB 1UPTA 3WMGA 5H8WA 1LS1A 1G5PA 5AUPB 721PA 2HDNB 1XFAA 2AK3A 2UZ3A 3RS4A 2R8RA 4UXIA 3I5XA 1YKSA 5JMTA 4LV6A 4NBSA 3LVRE 1G8FA 2JLWA 4BASA 1G21E 2A5FA 3RWOA 1E79A 1XDBA 1KJWA 2ZM5A 2ANCA 3WYFA 2A30A 4YDSA 4LBVA 2VEDA 1EWQA 4EJSB 2AD5A 2VPPA 4QBIA 1R7RA 4GNKA 3RS7A 4UNNA 2R65A 2OHFA 1TQ2A 4TT3A 1U94A 1WQ1R 4LCBA 3Q7PA 3TLXA 4Q4LA 4ZKDA 3WBKA 4E09A 1ZNYA 3N70A 4KITB 1S1CA 1XTIA 2RGAA 2GDJA 4KBFA 3N5CA 3C5CA 3I32A 2J0UB 4W7SA 4HLQB 5JWRA 4BLOA 1ZU5A 3QXHA 1YZNA 3I1FA 4M1SA 2BM0A 2R6GA 4CZ2A 4BGDA 2AR7A 2FGJA 4TL6A 4B74A 4EQ6A 4BFVA 4IVPA 1XCPA 1FUKA 3SJZA 4DT1A 1ZBDA 1KSJA 521PA 2D7CA 1DE0A 1P9NA 1X8JA 3FTQA 4DLZA 1AM4D 3VFDA 1VCMA 3FOZA 4YMUA 1XMSA 2ZJYA 1KYIA 1ZNWA 2GXQA 2R44A 1NG1A 5CYPA 2JJ8A 1Z5ZA 3NH6A 4GZLA 2NPFA 3QQ5A 5EE1A 5EE5B 4AYWA 1FQKA 3NBYC 2OAP1 1P75A 2DWQA 4BWYA 5L3SB 2ODNA 4NTZA 2CL6X 3AVPA 3GLHB 2GJSA 1N0UA 5G3YA 1ELOA 1N6LA 2GAAA 4BZXA 1P4SA 3AGPA 3W6OA 3VNUA 3GFOA 2X2FA 1LF0A 4JT2A 3AKCA 1TQ4A 3U6BA 2H7VA 3K0FB 3SHWA 5HKKA 3EARA 4D0GA 4ESVA 4LY6A 1EFRD 1K6MA 4KODA 4I1SA 5FTLA 2O8DB 1DO0A 1RJ9A 1D8TA 2PMDA 4IDHA 4QGGA 3QXJA 3K9HA 2IEZA 1RIFA 2FMXA 4JVSB 3L0OA 4OQLA 4URXR 3AP2A 5JFGA 4G5RA 1T91A 5G53C 4B71A 2VIIA 3JZAA 1S1MA 2Q3MA 2YC4C 2YOHA 4Z1MA 5GJBA 3EX7C 1A4RA 1DVRA 4MH0R 1VCIA 4Q7LA 2QT0A 2RAPA 2ONJA 2RGBA 1GL6A 4BE7B 1GWNA 4PFSA 1NI3A 2V4ZA 2WJGA 4ZI2A 4M1TA 3KKPA 2ZRPA 2GCOA 2ZE6A 5KNDA 1AS0A 3ZD6A 1OXXK 4EKDA 4V0OA 2YWFA 5F2EA 5H1YA 4HDQB 3DHWC 2FFBA 2DHRA 4JLPA 1OXUA 1G3RA 3T61A 2XSZA 3B13B 2NTYC 2F9LA 5FBQB 1N5KA 3U4QB 3MGCA 2QQ0A 2BCJQ 1II9A 4NYIQ 4C3ZA 1W46A 1JNYA 4HI0E 3IO5A 1SVSA 4HEJA 4PQYA 4QGHA 1P61B 5HTKA 3OEEA 3TK1A 4NCIA 4DWJA 2O8CA 1IONA 3CX7A 3RS0A 2PLRA 4DIEA 2XNSA 1XCMA 2IYSA 4WW0A 3IQWA 2G9NA 1YZGA 1A2KC 3ND8A 1T5IA 2FWRA 4DHEA 1W4CA 3BXZA 2KE5A 5DSZA 3TBKA 1XXHA 3GJ5A 2ZTSA 4W5HA 1T8UA 2MMGA 1V5WA 1D2MA 1O87A 1X3SA 5TVKA 4EIWA 3PVSA 1IQPA 1DPFA 2CMKA 3U3RA 3AH8A 1JECA 3ZIAD 3WNBA 2JJ1D 5EE3A 4E22A 5B58C 4Q4AA 4U5XA 3FDIA 3KKMA 1GIAA 5GADl 1R0ZA 2CCKA 5DNYB 1E2DA 3EZ7A 2EFDB 1QHIA 3B5JA 2QBYB 1ONBA
chains in the Genus database with same CATH superfamily
4FHCA 1DEXA 1TUBA 3QITA 3ZCUA 1WY7A 3MTJA 1B8PA 5BOVA 2Q07A 1VPLA 2WWWA 4KIGA 1UFOA 4NZ9A 4MR9B 4RTJA 4AZ0A 4CEHA 4ZVKA 1ZJ5A 4Z2AA 3EVEA 3RRMA 4GZ5A 1W48A 1YWGO 2IXBA 3CSSA 4LZAA 3U4DA 5BSRA 2BFCA 2PXCA 3VC2A 1Z6XA 1DOAA 1LA2A 1C1DB 1KETA 2BGTA 2YMQA 1SOMA 3D1VA 4KQCA 3EQ9A 2BI7A 1O54A 2FFRA 1DKOA 3AKYA 1W9HA 1CNFA 3QXSA 1JT2A 4NCJA 4QDOA 5KKAA 2P2ZA 3OFND 2OLKA 5TQVA 3PSAA 5TQ0B 2OV4A 5BSTA 5TT1A 2WHPB 2ZAYA 1YS7A 4LKOA 3KJFA 2C5GA 3WHKA 3ABQB 2VF4X 3ZN2A 1RHQA 3BMNB 5AXCA 4ZJYA 1WMBA 5B57C 1NYQA 2VDKB 5TEWA 3ZI0A 1Z8DA 3Q9UA 5JFGA 5IM4F 3DBHA 1QYWA 2VHWA 1Q7CA 2FK8A 2X8WA 4QIHA 3FOBA 5C5CA 1I7NA 5CDTA 4RV4A 3GJSA 3L7DA 1K7XB 1VB3A 2W6OA 4BX2A 5M3BA 3MTEA 4A73A 1KI3A 1UWLA 1B74A 4AJJA 2IZOA 2J85A 4MJXA 2ZWOA 9LDBA 2AMFA 4JJ8A 1Z6TA 4ZDWA 3L7IA 3OQIB 4QD3A 3ESZA 3D1LA 4L8LA 4Q4JA 4LGVA 4CWAA 1PNVA 4FDVA 1PBNA 2VJMA 1ISHA 4B84A 1ZISA 4IXDA 4DA9A 5CDUA 1F3OA 1OJ7A 3PDIB 3T1YB 1Y6GA 2P9ZA 4GOOD 4UMEA 4YI5A 5SY6A 3K0AA 3B82A 1EDOA 3RFUA 2PN1A 2VP2A 1B42A 2YXBA 3UG6A 4EFNA 1T35A 3L4BA 1B93A 5L6LB 3P2MA 4FFSA 1PVOA 3U19A 1CP2A 2KPOA 3SEQA 2BH9A 1M9NA 4LJ4A 1KE1A 1T4DA 3N0TA 1YJXA 5EIOA 2MSNA 2QEQA 3FGPA 2A1IA 3CLKA 1Z0IA 4KWIA 2P65A 2R8YA 5J2TA 1CZRA 2LP4Y 2OENG 3BL6A 3F98A 4CMKA 4DL9A 1IQUA 1VCHA 2GYUA 3Q6IA 1NP6A 4JC5A 1MH1A 1QANA 3D6VA 3OZFA 1O57A 2KWIA 4YVFA 2TMDA 3ELWA 3OMLA 4WLEA 1CHDA 4AQDA 2HLNA 3K70D 1AKEA 5DP2A 5EQTA 4B3HA 3C4VA 3HP4A 4IYJA 4PW0A 5IT0A 1C7EA 1O6FA 1TAHA 1SIWA 2JK0A 4BATA 1I7SB 5FUXA 4GMXA 2JEZA 3RF7A 1PR4A 2A7XA 1DQRA 1TVEA 5COAA 2VT7A 3FWHA 4A4DA 4X1IB 1ZNQO 1M1NB 3UWMA 1OB5A 3MB5A 3QE4A 5ARCA 3RJZA 2ALJA 1NZDA 2QNRA 3CUUA 1HDGO 3PX7A 3OJLA 1BN7A 4UUBA 5LP6C 3TZBA 2VP4A 4ZV7A 2YXDA 3LO5A 3T4UA 3PD0A 5KYXB 2E48A 4M98A 1ZK2A 3B78A 2MJLA 3I76A 4ZPXA 4RQUA 1ZSNA 4E13A 1JQLB 3OKAA 4GBJA 4F1WA 3WGYA 3UT6A 4PYIA 4LCJA 2DTEA 3CWCA 3ZK8A 4OXIA 4RY2A 4CG3A 2O8NA 5CGQB 5C7YA 5KZMB 1WVMA 5HW0A 4PTYA 2Z3WA 2VDNB 4IIEA 1VM6A 3RSZA 3ABOB 1SQGA 4G3XA 4B3RB 5HKOA 3SFTA 2CUKA 3SF8B 4XZ3A 3IPAA 2BWJA 5CJ2A 2WTXA 1LK0A 2XCSB 2PMBA 1L7QA 2XEDA 4F2GA 4KR3A 2C5AA 3VRHA 3TBHA 5ICSA 1I2CA 3TSWA 3I4LA 2A0UA 1TZBA 3JVVA 4NEQA 5MHTA 3C6KA 1FP6A 5DEIA 4ZC1A 4JC0A 4MRSA 4EEKA 1TVMA 2QM8A 2YUTA 3GLIA 1WBDA 1FFBA 1YVDA 3N86A 5MF6A 4Q9NA 1PP4A 2R4UA 4BFUA 1X9HA 3GIWA 2JAQA 1RE1A 1GM5A 3VZQA 2FHPA 3KU1A 1QHNA 2W2XA 2IGBA 2RJNA 4I1IA 3K8YA 1QK5A 2AJTA 3ABSB 1H85A 3CB4A 3CR7A 3R5XA 1RBZA 4RE6A 1KQOA 3QTLA 4ER0A 1XU9A 1V26A 5C5DA 5T3UA 4QNMA 4BIMA 3BWXA 4OLJA 1EZ4A 3D2AA 3L79A 2YFHA 3EEOA 4ENUA 4HAZA 1I9GA 3DAGA 1UCFA 2ZANA 1X1EA 3FKSA 3SQWA 2PUWA 3IQIX 3JQFC 1FNNA 1ZGHA 2D8MA 1WSDA 1AZTA 1ZU4A 2XQFA 1Y82A 1AK1A 3AX6A 5KO2A 5JO9A 4IYRA 1HORA 2J7KA 2PKWA 3ICCA 3LY7A 3K71B 2V3CC 2K5UA 1TYAE 2QRUA 4RORA 3DE5X 3QFHA 3I2IA 4LXXA 3GYBA 4X92A 3UANA 3GLTA 2FX3A 5ERGB 3AZPA 5AUQA 1DRWA 1Y80A 4YRJA 3TVTA 4ACBA 4EX7A 4AVYA 1GKUB 1U2DA 1BSVA 4P32A 2J3EA 2YWJA 5D3ZA 1Y7HA 2V6IA 3R6TA 3SX2A 3T7CA 4CIXA 3LWZA 1FNCA 4GMGA 1DFHA 2PO5A 4WBSA 4JS0A 3PICA 2NUAA 3A6GA 2HK6A 2IWHA 3OJXA 1TO2E 1XTJA 4AJIA 4BB6A 4EOGA 1P4AA 3FMOB 1MAUA 2GERA 2ECKA 4RQTA 1AF7A 4C2BA 5TIIA 5IBPA 1NBAA 1PF7E 1UODA 3P19A 2J3DA 3EZLA 4K87A 4PYMA 1SPBS 4QYMA 5LP6B 4D4MA 4IDBA 3HDVA 4L5JA 3OCCA 2HYIC 5JI3E 2FR8A 2CVZA 3VR6D 5AKZA 1KDZA 5JUWA 2AT1A 5JJIA 3DP7A 3E5HA 1QIIA 2BR5A 1W30A 4OQMA 3D3NA 2XKBA 3DVRX 3K15A 4BGIA 2Y1EA 4R0MA 5ELMA 1VLQA 2DUJA 4BV8A 1TCCA 3BGWA 3UB3A 4CKBA 4LZPA 2TS1A 4M54A 3KVNA 3V2HA 1H6BA 2O2GA 2OZVA 2ZUSA 2QJTA 1L5QA 1A04A 2FWNA 3OUUA 4ZCPA 3UC5A 3W4KA 4F56A 2CWWA 5FYQA 1WUYA 3BWYA 3Q8WA 2GD0A 4MRPA 1EQUA 4DW8A 4E5DA 4OL0A 3AM1A 1MF7A 2PKQP 4BC1A 1L4KA 2GWRA 3VKHA 2X6RA 3WAKA 4CLOB 1NVDA 5AVXA 4FZVA 5L4NA 5L45A 1K4YA 1O97D 2EIXA 2H7YA 2XDQA 3CH6A 3IVAA 3KSRA 3NAMA 3PNSA 3JPYA 3Q2OA 2WDZA 4B46A 4LCEA 3VZPA 4U2GA 4EF4A 4DG5A 4BZWA 3PQ2A 3I12A 3H19A 3O2SB 3K32A 4XDHA 1WG8A 5C52B 2FGKA 4O3MA 2BONA 3QKWA 5FOWA 2PEYA 2GVDC 3B1YA 1B7GO 4LHEA 4DMRA 3HWWA 3Q3GE 4J0KA 1O0BA 2CNWD 2YYAA 2YJ3A 3M3DA 1K9VF 1NVFA 1PFWA 4KYIB 1QGUB 4NZZA 3T3MB 4PLCA 3G85A 3HVIA 2RK3A 4JUIA 5C80A 3U7GA 2BY4A 2WAMA 3TUIC 4RTNA 1EU1A 1REQA 5FPHA 2Q3CA 3VR5D 5LQRA 3HXOA 1F6BA 3FW1A 3L6RA 4YXWA 4BRUA 5LIPA 4FJ2A 4M22A 1VE9A 1XIVA 2GNOA 5FBRB 3EZ9A 1ACJA 1U8FO 2CZGA 3UJDA 4ZHQB 5DF1A 1J8DA 3AY3A 3BDIA 4LE0A 3LCVB 4FFNA 3ROFA 1VJ0A 1BA3A 3N2KB 5HRUA 5K0NA 3L9XA 3AETB 2CEAA 3PNKA 1G98A 4J4HA 5DHUA 1DAGA 2BMAA 4U2BA 1T4MA 1Z5NA 3F4KA 3AVYA 1CUFA 3PQ5A 3FIJA 3PD1A 3UBTA 1DX9A 1GPUA 1F4LA 1P18A 1RLJA 4J16A 3ZGXA 4D5EA 1W4AA 2FMKA 4GMHA 1ST3A 2Q1TA 1JW9B 2NV2B 3L0SA 2PXHA 3H0KA 4H7FA 4JLJA 2OR3A 3TDMA 4Z54A 1KC1A 4IQ0A 1KMCA 3UJ3X 1DT5A 5KTSA 3NDPA 2AI2A 1DKQA 1RPZA 3Q12A 2QDXA 3CM0A 4UDOA 5IANA 1M6NA 7MDHA 3B1KA 2J07A 1SXJE 2GN8A 4G0MA 4HBZA 1XTTA 1NM5A 4MQUA 4X8OA 3VR0A 4P84A 4NJEB 5BSUA 4OHYA 3P1JA 4DIKA 5C8YB 2OZEA 3THXA 1VI2A 4KQHA 2AN3A 1RXSA 3ITKA 1T9BA 1SG9A 1T1IA 2OD7A 3GDFA 3B9QA 1CY2A 2BFWA 4P4LA 3CLUD 3PVCA 1OT3A 2H4XA 3NUQA 4DY4A 2VXCA 1W88A 3MWDB 4NZYA 2QL7A 3ZZUA 1ORDA 1I6MA 2JGDA 1HLGA 4HLNA 3VU8A 5DP1A 1V1RB 5CD1A 5DU2A 2CK3D 2BCGY 1PL0A 2YOFA 3OEYA 4Q93A 1EQ2A 2BMJA 4B3CA 2GASA 1FDOA 2XRMA 3BJMA 4HWSA 4WSOA 2ZJ7A 3DYBA 5CLGA 1XAJA 5F9HA 1Y6JA 4TXLA 4D45A 2OSBA 5E6RB 2WFLB 5GGYA 2W4IA 3U7HB 1EE1A 1X9IA 3QTBA 4MAAA 3SDZA 5KQLA 2HU2A 2QM3A 3KV1A 1MVLA 2UZ1A 1XD2A 2XNCA 1FSSA 3F8WA 5DI3A 5DRTA 1MG5A 2E4YA 5B4UA 4A27A 4I81A 1FJHA 2IEGA 1KRXA 4E5VA 4QHTA 2ZRGA 2ZIAA 4XWYA 2ZREA 4EY8A 3S28A 1V11A 5ULLA 3M9LA 3MFYA 2IHVA 4L4RA 1SG6A 4U7GA 2VDWB 2EFHB 3K4QA 3EQ6A 3KHUA 3ZVLA 3DMFA 3B9RA 2BJVA 4Z0HO 2G3YA 3ZWQA 4W6ZA 1NVXQ 1RRCA 1AMUA 1OFIA 5EKSA 1KQFA 4ZOBA 3DLPX 5KYUA 4RHCA 3THWA 2BGIA 4DJFC 4JGBA 5FV7A 5IJ0A 1T5SA 3AUAA 4JU8A 2DRIA 1Q7EA 2CLDX 4NOJA 4YMIA 1JBKA 3OZAA 5KPDA 3L02A 1BOOA 3R20A 2C83A 2CNWA 2AC4A 4I9FA 2W6ZA 3I9MA 3CKKA 4PC2A 4JBWA 5THKA 2WZBA 2OO5C 1KVQA 4WZBB 1NV8A 5AM2A 3JQ7B 4NSNA 1PS9A 3UB2A 3KE9A 3SS8A 4DRXB 3RF6A 1PN3A 1ZD4A 3A0UA 4OB7A 1EFVB 3DCNA 2VBGA 4LRXA 3HCOA 2QGNA 4I4NA 1NIPA 1P2SA 1S8FA 3FRHA 3L40A 3WQBA 1D2CA 1L8AA 2W43A 1CS0B 3S70A 1DAOA 4FONA 1P91A 2Z2YA 3CPSA 4MYHA 3SFZA 4LWQA 1H5UA 2NSYA 4QREA 3KQVA 2C99A 2GZRA 3ICVA 3IDSA 5DE3A 5FI3A 3ZCTA 2H5LA 1GADO 4DQDA 1KJ9A 3NIBA 4PZCA 5GM1A 2QT1A 3FNRA 4KFRA 1F9EA 4X3PA 1WXIA 1YB7A 1R8YA 2GAJA 4OQXA 4CCSA 1IOWA 1J25A 7ADHA 1K1EA 1T9CA 4ND5A 2C5HA 3WFIA 3WWYA 4BMOB 5FWNA 5ITWA 4MVJA 5AUOB 2IZ0A 3BXEA 3BIXA 4CLOA 2XCTB 4X3OA 1CXZA 1PVVA 3GJQA 3DHYA 2DH6A 1QMPA 1Y3FE 1DIOB 1QSGA 3P20A 1VL6A 1IK4A 1USIA 2ZUUA 4FFVA 5AHWA 4ZT7A 4DZZA 3EVBA 4OO3A 3F2VA 1HFKA 1FSZA 5CG1A 5F98A 5HKKD 2WABA 4C1BA 2HXSA 2MSCB 4OD0A 2ZSEA 5GM2A 4BXOB 6GPBA 2HT1A 4XB2A 1RWBA 2JI6A 2HLDA 3E1GA 5AK6A 4DUGD 4N41A 3ZDDA 4PY2A 3P32A 1YKGA 3A58B 4QE3A 2X42A 3ISVA 3OZRA 1HR0B 4QUKA 3PHIA 1NVAA 5JECA 1QO0D 1VBKA 4GXRA 1JV2B 3MTBA 2PH7A 2E5FA 3GJ6A 1F4PA 4G89A 4XD2A 3ZHZA 2QLMA 4A23A 4Q6WA 4QLBA 5LP6F 5F5XA 1H23A 4ZZ1A 3B7GA 5IVPA 4HEA1 1QBGA 3BHMA 1EJ6A 1JHPA 3WBJA 3RIHA 1Z6QA 3BRSA 3W1VA 2NYUA 3BKWA 3KDPA 1E6UA 1FNBA 4UM5A 1FPMA 3KZMA 1KYTA 2DLNA 4D3XA 2R62A 4KAXA 4TV8A 1JFRA 1Z47A 2VPWA 2XADA 2K2WA 2YIJA 5BWBA 1KSHA 2XI4A 5JATA 2J33A 1JILA 5CMLA 3L0DA 3ECCA 3KPWA 2IYAA 2SNIE 4BLWA 4DLPA 2EFEB 4IQFA 1CUEA 3UC9A 3GLFE 3S1LA 3MZ0A 4ZEOA 5A4KA 1GZDA 4R1NA 3D4LA 1I6WA 4AI6A 4JJ4A 5F2OA 4K9SA 1RI3A 4OHCA 2Q1SA 3PWSA 1RMYA 4PC7A 1YQ9A 2JKVA 4LAFA 1PYOA 1Q0HA 5IT5A 1XCGB 1T4CB 2WU8A 1JFVA 3UJNA 4P4UA 3KVOA 1PNQA 5TS3A 4CM8A 5L9AA 2O54A 1KFKB 4YH1A 2ZIUB 3LXUX 5IMBA 2Z2XA 3N2YA 1UQUA 2RHOA 3USES 4WLFA 1IJEA 1XTRA 4KRGA 3EJWA 1F8YA 2JEOA 3JQDA 4U00A 5T6MA 3ZHTA 3E0QA 1VGRA 5H59A 4RVFA 4QTXA 5JO0A 1N6NA 1KVTA 4IIUA 3MGAA 2QF7A 2UYCA 4PHCA 5K45A 1LVGA 4GP7A 3UB4A 2FTKE 4ERXA 5HZMA 2ZU0C 2QY6A 5FORA 1BU8A 2W2TA 3G2QA 4A0FA 3L5KA 2RGNC 3GGCA 4YJ3A 1UAGA 1G7CA 2I3ZA 2IXTA 3KS9A 1SO8A 1UBGA 1RR6A 4S1PA 2ISCA 2PUVA 1UC4B 2XH8A 4B3IA 3GGPA 2O50A 5A6SB 1OVMA 1K8ZB 1PWHA 2PGIA 3HJGA 3LDUA 5EERA 2VK4A 3L0BA 3OSUA 4M89A 3RR2A 2YV2A 1YZVA 3L41A 2D62A 2XRZA 4Q4CA 4ZEXA 5KVAA 4FNOA 3CX3A 1TM1E 1ECJA 3O47A 4M8NE 3LX8A 1YFKA 5DNCA 4I2NA 5JY6A 4NIMA 3DBLA 3ZOKA 5LBIA 4MQ4A 4O4LB 3IULA 4WFJA 5JZOA 4RD1A 2B5VA 4PLZA 3UKDA 2YWXA 1MB2A 4W82A 2YKGA 3LBHA 2GF0A 3IILA 4Y6QA 2DHDA 4FUTA 5JD3A 1D6SA 2EG5A 2QXTA 2XCQA 3M0EA 1O08A 4NATA 3LYHA 5I9SA 3MWGA 3O8NA 3FCOA 1GGEA 2X0RA 2IOFK 5E1DA 5GY7A 4IJ6A 4RLQA 4BLUA 2FSFA 5JFTA 2JGAA 5DOVA 3FBGA 2CLCX 1VIAA 1JXMA 1O03A 2J9YB 2JNWA 4J2HA 4DUGA 2M9MA 3KTAB 3NRJA 2LKDA 3AEKB 5C8YF 3EULA 3IOMA 4NYMQ 4JOQA 2SKEA 1J8YF 1P5ZB 3M6XA 1N8KA 3SNKA 1V8FA 5CPFA 2GPBA 4QICA 3V2GA 1QO0A 3DUFA 2FMTA 2UZ4A 2QXUA 1K3UB 4LDZA 1F0YA 1YZHA 1KGSA 1ACLA 2OYCA 4A26A 1VPEA 3Q3IA 1CTQA 2REBA 1NDUA 2YWRA 4CV3A 3BL5A 1B73A 3VKVA 2WKQA 4BNDB 2NV0A 3UHPA 3O8CA 4BS9A 3LJKA 2BSXA 1WCIB 3ZHUA 3TD6A 1CYEA 1ATIA 1OFHA 2JGKA 1RWQA 3K8ZA 1T0UA 2R96A 2UVDA 3ZKAA 1Z39A 1MENA 4JVLA 1XXHE 3BE6A 5A62A 2WV9A 5SY4A 2BMWA 4DM3A 2I78A 5L7TA 2YQ5A 1G2QA 2X76A 1GGHA 4M99A 4Q1BA 3TZLA 1V6CA 3LUDA 3K6SA 1U7OA 1P0FA 3R7AA 3N0WA 2NV6A 2O8FB 1MABB 3QKIA 5JEDA 3NBZC 4MV0A 4G36A 3I61A 5CA0A 5DFAA 1RXIA 5AT1A 4YCCA 4LHXA 4GI3A 4B3XA 5FBZA 4WOCA 1YL5A 1KP2A 3JQGB 3M33A 1L8OA 1E66A 2QYHA 1FB5A 2LE0A 4LQ4A 3TIIA 3DYVA 4FYWA 2PKCA 4J0FA 2P4SA 2C4KA 4IH4A 2H8KA 1SOWA 4G1VA 1H1LA 2RHCA 4HAIA 4MW4A 4OB8A 4WZ6A 4ZC8A 1DDGA 2ATVA 4JI8B 1LBHA 1CY6A 4G07A 4H7DA 5L6MB 5H3LA 3QLTA 4RVUA 4QUHA 1NXVA 4JIGA 4EJ0A 1FP7A 3AY6A 5A3SA 1Z6PA 1N3BA 1BE8A 4H7IA 2AJLI 4GO1A 3QKRA 4RO0A 3PRYA 4JJ6A 4TYPA 1IY1A 3ZWMA 3CT6A 2GM5A 3TM5A 2NW6A 3ZBUA 4RY9A 3DKPA 3DOJA 3D7LA 3NQ41 3VU3A 4ZEWA 5AW2A 4W5RA 5I9LA 3OQBA 4J3FA 4L3WA 5JCJA 2CV0A 2OC9A 5D8DA 1H93A 4OQPA 5KOHA 1B6RA 3CZPA 1MRZA 4P2GA 5LLDA 1SQFA 1T6YA 2DKFA 4LJSA 1OWOA 2N1MA 3TKYA 4RXTA 1O95C 3BWDD 2ZUCA 3F71A 2WAYA 4TLBA 4DCGA 1V43A 4DV3B 4C4ZA 4PR0A 1AIPA 5FRDA 1Y6FA 2I9KA 4UUPA 1XJ0A 3Q5EA 1QGYA 2EBWA 5C5EA 4AMZA 2UXDB 3WB1A 2CB9A 1BFKA 1XKQA 2HIGA 1SA0A 3GFSA 5JMPA 1P7CA 4OJQA 2GXAA 1L4BA 2PTHA 2RCYA 3WXMA 4KQFA 1ZM3A 1I1OA 1SIUA 3CXUA 3L8FA 3PKIA 4Q3BA 1X7XB 2EF0A 4WPGA 1V8DA 2X40A 2D4HA 1FRZA 3WGQA 3QF7A 1S4QA 1ZMRA 2F9MA 2FH5B 2AI1A 2HFJA 5BWNA 4LISA 1TLLA 2EP5A 1UXJA 4L50A 4P33A 3S2FA 2C1ZA 1E7WA 1LBQA 3FKJA 1EVJA 3G1TA 3G0BA 2OV8A 1CUUA 4POOA 5A4IS 3OP4A 4YECA 5AI8A 3FD8A 1I3LA 3PGJA 1O5IA 3EXG1 1GPMA 3ZBTA 1OH6A 4LC9A 2ZRHA 1TCBA 2QMOA 3DMYA 4J0EA 1GL7A 5IKXA 1Z26A 1X0XA 3CG0A 3OFJA 1Y33E 2OB2A 3WLEA 1E64A 2PZMA 4B34A 1PR2A 2E9SA 4MWCA 1D0IA 4X0EA 1TCVA 3ZU5A 3CIOA 3NAQA 2XUFA 4HNAB 2FI1A 3EY4A 2JHFA 2YWDA 3F6SA 3IBCA 3OMXA 4LC0A 5BV0A 5JYEA 1C0IA 2B9EA 1XE3A 2EHJA 1F9AA 2W58A 2A0WA 4ZO7A 4ARUA 4JXZA 1XCBA 2VJBA 2OBNA 4JT8A 3KKEA 4EMTA 1E1CB 4XFDA 1DQZA 3HBAA 1KO7A 4Q34A 2V1UA 3W5CA 1RYMA 5BYBA 3K1JA 4JBIA 4N6NA 3TEMA 3AESB 2F3QA 2JIOA 2HQBA 3M1AA 5LA6A 1JLHA 3OQMA 1WHTB 2X7HA 4KMSA 1GRVA 3LT1A 3CUYA 5IJXA 5JNUA 3BRWA 1S01A 3G3EA 2NZJA 4II3A 3OJFA 1D1TA 3IP5A 3JQCA 3QJYA 4IEIA 5FAXA 4W5WA 1GKYA 3GEPA 4PLVA 4FEYA 4DR5B 1G8GA 2ANBA 2QVBA 3PNVA 1U63A 2GVNA 3GLUA 5I4BA 2POQX 2B8NA 4ALMA 3JYHA 2A58A 1RKUA 3K73O 2VWGA 2RH8A 1K8QA 3EMDA 1JEQB 2P35A 5FJJA 1W47A 1MTOA 3ZC3A 1G8MA 1L1QA 3ZCSA 4Z3DA 2C2WA 1OYYA 3ZWBA 1A8SA 3PU6A 4P4SB 2NO0A 3EXHA 2WWTA 1FS6A 3QUAA 4DR2B 5JCPA 3DT6A 3PA8A 1I1HA 1P17A 2PZ8A 1XRMA 1N4AA 2I80A 2X15A 4XCQA 4M1ZA 3DO6A 1N0HA 2JHPA 3H86A 5C8DA 4W5OA 5DLEA 1L4GA 3EOAI 1N2CB 1HSZA 2BBWA 2HO4A 3G89A 4GECA 4I19A 5A2GA 3CBGA 5AOBA 3R9IA 4PNHA 2H63A 2J3IA 4CJXA 1AO0A 3MRSA 2AC7A 4MP6A 4MKGA 3G2NA 3EYAA 1KXZA 3DH0A 3OAAD 4OTZA 3RUCA 1FIUA 4KQXA 2GK6A 4EW2A 4GD3Q 3IESA 1BHO1 1WUJS 5CAEA 3UJHA 5KB3A 3NUZA 4M0KA 4RM3A 2ZATA 5ENVA 1SMKA 3VR1A 4J2OA 2WEKA 2EKQA 4EA9A 4CN9A 1R27A 4F1JA 4MRMA 2NN3C 4G0YA 4RQBA 1EFUA 2R66A 4TN5A 1VE1A 3UK6A 2VNAA 2QX9A 2QD4A 3KYCA 1G20E 1QF9A 5KYWB 1ZGAA 1TB4A 3QMPA 2YFQA 1ZOPA 3C5HA 2VYND 3ZGOA 5EHNA 1MGOA 2I9PA 1LV7A 4RVCA 4RA9B 2F3SA 2PMWB 4REQA 5DASA 4B6OA 1PEDA 1I2BA 4C0SA 4F9GA 1XNQB 3ER8A 2QVLA 4MR8A 3UAWA 8ATCA 2W6JD 1QS0A 2H17A 4LJ8A 4UUNA 4NARA 5EYPA 1OXVA 3SHFA 4ZVOA 1FYDA 5AP9A 5TGDA 1A4UA 3REOA 4C7MA 3CE9A 2WK1A 3K31A 4QTTB 2XA2A 2GZ1A 3T4EA 2JFHA 2ASVA 4ETWA 5JVDA 4YN3A 3EN0A 4BN0A 1OU0A 3D59A 3F5QA 3GD5A 1NXOA 1WF6A 3PGKA 5FF9A 2OCLA 3WWPA 5E0OA 1NKSA 5L3SA 1BCSA 1CVIA 3KKLA 4V2IA 3EIHA 4WZAB 2GO1A 3GI1A 3JV7A 2YWHA 4HNUA 2J6BA 2WUGA 4P5DA 2VP6A 5JWOA 1BMDA 4QQFA 1TZ2A 4E88A 2OL4A 4FZRA 2EP8A 4FOTA 1U6IA 1CDDA 4F6LA 4YACA 2ZDGA 3ZNNA 2X86A 3DSRA 1ACMA 4ZI5A 5HZGA 3WKEA 3QEJA 1E96A 2ZZNA 3WNCA 4XM2A 2O48X 3CUEF 1J00A 2WTBA 3OU2A 1Y5RA 4G23A 4XIIA 1AMOA 3EPJA 4EMBA 5DLPA 2NM0A 2QLFA 1YV9A 4CYMA 3TECE 2YN2A 2G72A 5COBA 5B12A 4RGYA 2OWEA 5BN5A 4EEXA 5J2UF 3ZV5A 2DUUA 3NTUA 4IX9A 3SZRA 3UHJA 4F9EA 5BXQC 1E0KA 5E4JA 3KLOA 3NAZA 2Q0XA 1XEWX 1JN0A 1LPSA 1P29A 2PQ2A 2EGUA 4ZV4A 3T12A 3EGXB 2NGRA 1DARA 2EYQA 1J0EA 2VYFA 1RM3A 4LDRA 4RSMA 4ER6A 1OZFA 3SEZA 3H9CA 4L02A 3VV2A 4CT5A 4M36A 2AOWA 2KLBA 1HEIA 1IUOA 4Y2JA 4ZARA 4FGUA 1ZN2A 4EL5A 1OIXA 4HH4A 3R0VA 5A71A 1XTZA 4NWIA 2ZI5A 5EVJA 3H7IA 2IGTA 4F38A 3DMNA 5BVHA 5F7ZA 4ZOEA 1A7JA 2AFHA 4JLSA 1IZYA 3AEUA 1VZ3A 5DBFA 4IHQA 4AYTA 1N6RA 5JAZA 4UBJA 1NVVQ 2HU8A 4FBMA 3WWCA 2ZOSA 4ARBA 2NU7B 4DY6A 1MC5A 1EHYA 3DOEA 1XTBA 3LQFA 4C3VA 2NUPB 4C6TB 1G1AA 2NZ2A 1AGYA 1TEVA 4ALLA 3ASYA 4IIJB 3IGFA 3GK3A 3OICA 5KHAA 5EIAA 1G2IA 4NRDA 4F6RB 3I5AA 5TPWA 4IPTA 4C0XA 3I5MA 4B3FX 3WIEA 4QOSA 1NFQA 1WW3A 5EQDA 3BILA 1S96A 2E5WA 2NSLA 4JBXA 2A1TR 2BHRA 3UVEA 5K1ZA 1A8IA 3E9RA 3NWOA 3M49A 1E5XA 4U0KA 3WMFA 2VYVD 1NI4A 2D7DA 3QV1A 1XMVA 3F3YA 4RXMA 5BO5A 3V97A 2L17A 2O1SA 4B83A 4EGCB 2WYVA 3DXYA 4W5QA 3O8QA 4Y2XA 1IIBA 3A4LA 3GFPA 3OZ7A 4B33A 4I1VA 5AHXA 1AQIA 5BQOA 1XZQA 4G0QA 4Y1RA 2G04A 1UM8A 2O3RA 4ZO4A 3QSYA 1F0NA 4GLJA 2HBQA 1F2UB 1GUZA 2VTBB 1YK0A 1ZVJA 2FN9A 2P6PA 1NOJA 1BZYA 2RGWA 1GCOA 3CEAA 2ZETA 3X1XA 2B21A 3FMPB 4FZ3A 4JGGA 2QM0A 4F2PA 4P31A 1LRKA 1YVUA 2GSDA 3CTPA 4DDVA 4LZNA 2J5QA 3WLOA 1KOJA 1LVHA 4ND2A 2GD2A 2WD9A 1UBMS 1HE2A 1V2GA 3HCRA 1AXEA 4KTTE 1JTVA 4WY8A 4L0DA 5E3IA 1ZI6A 2ERCA 3CLSD 4BJ1A 1XUOA 4LW8A 4NZPA 5LWQA 2P9HA 2QZSA 1MO4A 1RMQA 4DCUA 4ARIA 2WMOB 1EVZA 2IW3A 1THGA 5DX8A 2FQXA 5EP1A 5I9IA 5EXTA 1OC2A 1U6JA 1NYRA 4GEKA 1SVUA 3RTDA 1BNCA 3V8RA 1E1QA 4QXRA 1K7FB 1KTVA 3TYXA 5CFLA 2GBLA 1VKZA 3WLNA 4BQSA 2B4TO 4YCDA 3C1UA 4EYKA 4JUFA 3WIUA 1C1DA 3IUNA 3OA2A 4RE5A 4NOKA 4ECAA 4EG6A 2QE6A 1FCJA 1OBOA 1G64A 2FWAA 1OTHA 1EJBA 5JD5A 4HSGA 2ORIA 3BH6A 5ECDA 2GPNA 1AUXA 3F49S 4H3KB 3WRYC 2D3TA 3RYCA 4B4UA 4NDNE 4RD6A 1FVHA 4GP9A 3ET5A 1EWKA 2IYTA 3EQ7A 2PLFA 3L7AA 4NU6A 2HSWA 4Y0VA 5HF9A 5DYTA 2HRZA 2VLBA 2CWDA 1BMQA 1R3DA 4RY0A 3N6RA 2R4TA 1WCYA 1XDWA 2HCBA 4JCCA 1VHDA 2IHNA 3PFWO 2Q9CA 4L75A 1M2FA 2CNOA 2OWDA 1S2MA 3BHNA 5AHKA 2X4IA 3RNLA 3L8GA 4QG7A 4J94A 4QUAA 3V4SA 2FVYA 2Y4OA 3HEBA 4KTVE 4TYNA 3HM9A 3WJAA 3VJRA 4Q15A 4AJLA 3ZE0B 2YMLA 1X7GA 2PO7A 5KNCH 3R3XA 2A4KA 4EWLA 1L4EA 1NF9A 3F97A 4QEKA 3BULA 4BQQA 3PDIA 4RA6B 3FUCA 3T5TA 2X5JO 5F21A 5DO9A 3TKLA 2C4MA 4D97A 2FMIA 1EP1B 2XAAA 1RRPA 1NSFA 5C3MA 5J59A 3Q5DA 2EKDA 5JD4A 4Y9UA 1E7SA 2KW5A 4LZWA 4YT2A 1XWWA 2N1BA 2RMKA 2YJNA 2ZT8A 3BXPA 2J7PA 1IRIA 3M4XA 4I55B 2B25A 1UBCA 4LQLA 4MUAA 4OGKA 5FP0A 2OQVA 5G1PA 1GG2A 1T1GA 3UMFA 4X8MA 3THRA 3BEDA 3D3WA 4D99A 5FOQA 3JWGA 1G3UA 3FHLA 1BE0A 3H1EA 3LQ2A 4HJXA 1MJ5A 4K2AA 4PR3A 5DHQA 4FB4A 1XKTA 4KR2A 1ZNZA 1K8XB 2FWJA 3L9WA 3PXGA 4XSGA 4B76A 1DKLA 4ZRMA 3BPSA 2XMGA 5FR2A 1W4ZA 3LCCA 2XVMA 3PDUA 3Q2KA 3FPFA 3NYIA 4BVAA 4DMKA 3LBYA 3CURA 3KOXA 1NXSA 4M0UA 3RBZA 3GUUA 4OUDB 2JHCA 3GCDA 4RZIA 3QHQA 2F1IA 3C7AA 1HYBA 3ZGNA 1XNHA 3EA4A 3KSDO 3UKOA 2B7CA 1M1NA 2J9XB 3EHEA 3H3JA 4QXAA 4YLEA 3W04A 1BG6A 4HFJA 2GHQA 1U1EA 1FU8A 1YCHA 3TOZA 4IQ8A 1TU0A 5EIBC 3A06A 1E2QA 3EGCA 4P08A 4EUSA 1JIUA 3TD9A 2WF8A 5IARA 1KY3A 4IW3B 4OXXA 4S24A 3R6WA 1W87A 3UAGA 2JKZA 2AQIA 3N3BC 1ID8A 1J56A 2L18A 1CPYA 3IEPA 3ORSA 3QBEA 1GNPA 1ULTA 2OD9A 3V33A 3QPUA 1GGJA 1JR3A 4CF7A 3BH7A 4OFWA 1JVBA 3IP3A 4FMDF 1Q0RA 4MVJE 4NE7A 2IP1A 4ENTA 2JAXA 2HHCA 2OHIA 2IYVA 1B00A 2QRQA 5K8JB 1K2WA 3CF4A 3VBEA 1KIMA 4DRYA 4Z3OA 3QEKA 4K8RB 1U8YA 5IT4A 1Q95A 3LXRA 4UARA 4YCLA 1G5QA 1QH9A 3FCYA 3UMMA 1Q1GA 2C3OA 3PX2A 1K7SN 4WN3A 3IMCA 3PWZA 4M9QA 1OYOA 4MI6A 5I4CA 3BFPA 3BFXA 5KSPA 1BFUA 2BBSA 1GQQA 2QT9A 3WBFA 1H8HD 3A4YA 3H2KA 4IOMA 3G2KA 4BBZA 2OPBA 5EWJA 3N8HA 4AD8A 4DMHA 1U3UA 1W1UA 4ND8A 3OIVA 4QJ5A 4CF4A 4YLYA 1NN1A 3DEZA 4FE3A 4E11A 2J6CA 3RLFA 3AIMA 1JJVA 3SP1A 4NESA 1G2OA 3UV7A 1NXWA 1UC5B 3PXBA 4JVSB 4XIGS 5JE8A 2PRIA 4NXMB 2A9RA 2GXUA 4YJ2B 5GZ6A 1CJBA 1M1YA 4HT3B 2K7ZA 1XRLA 2ZW9A 4MVJP 3ZU2A 2A9FA 4FX5A 4LXHA 5LYJA 3U40A 2HGZA 5L3QB 1QCDA 1XLTA 2VJDA 4HATA 3TLAA 2F1KA 4PV7A 4D02A 1CIPA 1R18A 4PLHA 5AKYA 2X58A 2VPQA 3IPCA 4QDJA 1BQEA 1W0KA 4G0ZA 1WUIS 4M0FA 1L7OA 2J0VA 5E1MA 2H1WA 2WMDA 2LBPA 3HN2A 2XKAA 3OLXA 1E2MA 1FFAA 4FE7A 2XKKA 2HIMA 4ND4A 2WJHA 2ZRAA 3UAYA 3HRHA 1V8OA 1WPXA 3BTOA 5TVGA 1ZG3A 1QLJA 2GTPA 4FIDA 3WB9A 1XZNA 4IIJF 3U7JA 4C4TA 1U02A 3M34A 5T7BA 2J87A 3SS7X 5HJ7A 1C30A 5KU7A 4S05A 5HIAA 3LI2A 4XLLA 2DR0A 2P7HA 5KYYA 2PMEA 5THXA 2WUWE 3EEFA 3JWIA 3K9WA 3OHMA 1NP3A 4IOKA 4MB2A 5CTJA 1W52X 3NO4A 4YJHB 1Z56C 1E5DA 3COZA 4R05A 4UEOA 2GZDA 1LRJA 1W2HA 1JWAB 3SMVA 1LLFA 5KMGB 3NR2A 3ZWOA 4MR7A 3NV9A 2TMYA 3EAGA 3T9AA 4UPVA 4FFDA 3OCUA 1OOEA 4ZT4A 2C4UA 4LZJA 1L4UA 3SJCA 1I4OA 4Z8XA 4BZZA 1XO1A 4XGQA 3HCAA 4CXMA 4LJLA 3H5LA 3GJ4A 3LHKA 1CQJB 2VT2A 4NFHA 5CURA 3JQAB 4BCCA 4HVLA 1RHMA 5GMOA 5KI6A 2CLKB 5EXSA 3BSFA 4G09A 1KKLA 3VHRA 1SUPA 1G5TA 4QZVA 3HC7A 4ETIA 4F11A 5HR5A 3EZ2A 1ZM2A 2MINB 4OY3A 3IP8A 3E3OA 2A57A 2H7XA 2OAQ1 3AF4A 4ZCLA 3T3NA 4MUHA 1EUCB