1S2MA

Crystal structure of the dead box protein dhh1p
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
377
structure length
377
Chain Sequence
NTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVAEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ATP-dependent RNA helicase DHH1
publication title Crystal structure and functional analysis of DEAD-box protein Dhh1p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 133
structure length 377
sequence length 377
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s2mA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s2mA02
1TQ2A 1G8YA 3C41J 3DZDA 4PHTA 4LYFA 2YC4C 1N5LA 2BDTA 4Q21A 3GLGB 1AK2A 2IL1A 3WYGA 1E0SA 2IYYA 2O8EB 1CR1A 3A58B 1GIAA 3GP8A 1ZBDA 2QRNA 2JJ8A 1FNMA 1IQPA 3FMFA 4CYMA 5E4FA 2ZPTX 2G6BA 4BZPA 1YRAA 2JLRA 4KFUA 4PHGA 2EU8A 2XTZA 4DSNA 1R2QA 2YWFA 3UPUA 3LBIA 2QQEA 2PBRA 5E3HA 4TL8A 1NJGA 3UKDA 1W0JD 1XMJA 2FEMA 2FV8A 1S9HA 1OB2A 4P4UA 4JVMA 2CHVA 3UXMA 4OI0A 3UWOA 1FTNA 5KHOC 5L3VA 3MJHA 1KZ7B 3GD7A 3RS2A 3CNOA 4NYIQ 2IUSA 3IILA 1HH4A 2GRJA 1C1YA 1LNZA 2J0UB 3BH6A 4W9MC 4LK2A 5F9FA 3FMIA 4PAQA 1P9WA 3PCRB 3U7EB 3L43A 3TQCA 2O8DB 1ONBA 2QE7A 1Z6AA 3EIEA 1KK0A 3UWKA 1N6IA 3AF4A 3AQ4A 1NMXA 4LPKA 4PQFA 2ZI4A 1CRPA 1E9CA 5BXQC 1YZUA 1H8EA 1Z0JA 1A4RA 3U60B 4WVFA 5HKKA 3BGWA 4UNQA 1U99A 5BN4A 2ZU0C 3KFVA 1Q1ZA 1KK1A 2LCFA 2Q21A 1ZUNB 3D3QA 4K46A 1YQTA 2WJIA 2G88A 2HCBA 1UF9A 4QHTA 3AVVA 2YOGA 2V1UA 1LB1B 1Q21A 5HCIA 1AIPA 3S1AB 4A15A 1KI6B 2ZQ5A 1XXHE 5EE9A 1DARA 4BEJA 4GZMA 4I99A 121PA 4J0QA 2VF7A 1WBBA 4URWR 3EPKA 1CR4A 5IDVA 1E3MA 3QY0A 3LRPA 1SXJA 1HURA 3RRZA 4A82A 3RSOA 3CF6R 1G8HA 3C5CA 3IIMA 3GEIA 3QXHA 1U98A 2UVQA 1QVRA 2HXSA 2CL6X 4KFTA 4N3NA 1VG8A 3PUVA 5JS7A 2R2AA 1RRGA 3D8BA 3LVQE 1KZGB 4NMMA 1XCMA 1NJFA 3I92A 1NNEA 5FL7A 2BJWA 4KI0A 3SJZA 4C0AC 2QGNA 3G82C 1VHTA 1FOEB 1MABB 3ICEA 3TUIC 3TLXA 1KYIA 5EUQB 4C9BA 3K0AA 4TYYA 3BK7A 2JASA 4H1VA 2ZXUA 5KDOA 3RNLA 1BH2A 1BO6A 1E98A 1KI9A 2NPIA 1C4OA 3B8HA 4Q4LA 4BUJA 3GJ7A 1IXSB 1VCOA 3EC1A 3FWYA 4CRWB 1E2GA 1EFRA 1Z6GA 2VP0A 3FTQA 1FUUA 1J2JA 3QG5A 3P4YA 4QGFA 2HT1A 2O8CA 1AS2A 2ZE7A 2ZYTX 4US1R 1K6MA 2QPOA 1EFUA 3C8UA 1OT3A 2NZJA 2Q9BA 4HZIA 3RRYA 1E2DA 1PUJA 4Q01A 4QOSA 4FWIB 2C2HA 4WA7A 3NBYC 1EESA 1KJZA 3VAAA 1NN5A 1L4YA 3MFYA 2ZSAA 2HUPA 3KKMA 1JQLB 3FFBA 3UK6A 4BFYA 2C96A 4IFEA 2O8BB 4NE2A 1FQKA 3SHFA 3T34A 2ZRHA 2BKEA 2WV9A 5SZIA 1X8LA 4ZI3A 4BLTA 1Q1EA 1W5SA 4PZZA 2ZJAA 1NI3A 4DCVA 2ZS8A 4P0TA 4EIWA 3KQNA 4ARZB 3P4XA 4ZIRB 2GXSA 2F55A 1HTWA 2WAYA 4CEIA 4BASA 1KI3A 2AXPA 4LJ4A 1HUQA 2WIBA 3EIHA 1J90A 1HE8B 5DI3A 1JXMA 3ZVLA 4B3BA 3ZZUA 3FKSD 2YC2C 4KLZA 3LX8A 3TVDA 4YONB 4C7OB 2WWHA 2JJ1D 4MA4A 2XOKD 2FU5C 1JI0A 3BJIC 2G9NA 3DHWC 3AVQA 1XTKA 1ESNA 3AVWA 1Y3AA 4OJQA 2ZI3A 2VHJA 4MKIA 3LY5A 2HCJB 2QA5A 3ZD7A 4ZI2A 3SBDA 2OG2A 1N0UA 3RC3A 3R9XA 2B6HA 1UBFA 3UATA 2FJUA 4D82A 1R0WA 4XVUA 1EXMA 3PEVA 4CZ2A 1MT0A 4P4SA 3I62A 4HUQA 1TADA 4DC9A 4G01B 4NCNA 3QVVA 3LV8A 3U3KA 3KX2A 1T0HB 3AEZA 2BHRA 3QKSB 3X1DA 4XD7D 2WWWA 1P60A 5KPDA 1VHLA 3WRYC 4Q1BA 3KKNA 4Q9JA 2UZIR 5BQ5A 1GSIA 2GJ8A 1LW7A 5AUOB 1EFHA 2REOA 3X1ZA 3TBKA 1OFHA 3MSXA 2F1RA 5JCZA 1A5TA 3RS4A 1U8YA 2W2XA 1KGDA 1AGPA 5DNYB 4YMTA 1D6JA 2YJTD 3M4YA 3WY9A 3C7KA 4DXAA 3K70D 4DSUA 1W4AA 1GL6A 4P32A 2HJGA 4TN1A 1MRSA 4PZLA 1TQ6A 1XMVA 2ZI5A 4LUCA 3RHFA 4NU0A 4GMDA 3CM0A 4Q9LA 3KTAB 4AKIA 2TMKA 3U3RA 4MDEA 2IYWA 2G0NA 4ZKDA 3Q7QA 3CX7A 4PC6A 3GJ0A 4D4LA 2VIIA 4CEHB 2PZEA 1YZKA 3BWDD 4JKYA 4HLQB 1M2OB 2ASEA 3W3ZB 4EFMA 2DPXA 1AZSC 3B1VA 2V54A 4GOJA 1F6BA 2WSSA 1TUIA 4WIAA 4D0NA 3TGPA 2ZUCA 1YU9A 1W2GA 1TX4B 2RGNA 3KKPA 3PEYA 1CR0A 1Z8FA 2RAPA 5EP4A 2DFNA 4LHWA 3X1WA 1KY3A 2IXGA 1HV8A 1P75A 3VNVA 4UNSA 2P6UA 3LQQA 5KUTA 3MWJA 4RCYA 3P27A 4RJLA 4D4MA 3O8BA 5EXTA 5KNCA 2BEKA 2O0JA 3T5DA 3KQUA 1UM8A 2R6CA 4PANA 4TL6A 3WMGA 4C0BA 1VMAA 1DG3A 2B21A 2A5DA 4CGZA 3QI2A 1W1WA 4FI3C 4Q9HA 5ELXA 4MKFA 3O47A 5DISB 1NMZA 4ZCMA 5GVRA 2FFHA 4HAVA 2IC5A 3W6OA 2FPLA 1XEXB 5JCPA 3TH5A 1UBCA 4BFVA 1IN5A 2F1HA 1GKIA 2WTUA 1NVWQ 2GCNA 3BB4A 3HR8A 1KDTA 4JSTA 4LJYA 4P33A 3B82A 1R0ZA 2DFLA 3BRWD 3M6AA 4HZUA 1ZP6A 4IJMA 4IOKA 4GP6A 2W6ID 3ETLA 3QXXA 5JBQA 3PENA 1LV7A 2FSGA 4OI4A 4PSVA 3DKPA 1F5NA 3L0SA 3GLIA 3TNFA 4BQSA 5HE9A 3CF0A 2N42A 4DLYA 2G0TA 2W6JD 4I4LA 1Q1BA 2A5FA 1WE2A 3GFTA 5H1YA 4JLKA 1OF1A 1ZINA 3LWNA 3R7WA 3LBNA 1NBME 2QSYA 1II8B 4JYCA 1UEIA 2FE4A 1G18A 3SZRA 4BFXA 3SN6A 1COWD 2A5JA 2IUUA 3ADBA 1QF9A 3MAAC 1KI4A 3WXMA 4OQLA 3UG6A 4XTRA 4TWZA 1QBKC 1MO6A 2QAGB 1GILA 3W8RA 1I4DD 3SU8A 2K5UA 2P6NA 4FD2A 1OFIA 2RKOA 1M34E 5CM8B 4NHOA 2BBTA 3KJIA 4LGMA 2QMEA 4LBVA 5D3MB 2BBWA 2G77B 4ZO4A 2ZRBA 3B6EA 3OIVA 2Q3HA 4MYCA 2QP4A 2BMDA 4KCGA 3QQ5A 3BH7A 3EA0A 4V0MA 3KJHA 5L3RA 1E4YA 1KO4A 1A2KC 5CIWA 2J7PA 4S35A 4K81B 3QVUA 2JLVA 2WBLC 2WJHA 1GZSA 4NCHA 2FWRA 1N2CE 1AKYA 3AP3A 3AVPA 2GDJA 4DUGA 2D2EA 1NN1A 4HAYA 3C16C 1FX0B 3VHLB 1H8HA 2YWGA 1VCNA 4OL0A 1KDPA 2CCJA 3IPXA 1ZD9A 1M8PA 2ECKA 5FBVB 1RIFA 1DELA 4JLJA 4EJSB 5KNBA 4JVLA 3W90A 1ETUA 5JS8A 2VQSA 2Z83A 1QHYA 1YR7A 1WXQA 3MUFA 1KMQA 1HA3A 2JAQA 5AJZA 3MWYW 1NVUQ 1U94A 1RJ9A 1W46A 1FFHA 5KDDA 3DOFA 1AGRA 2ZRFA 2BKUA 1F2TB 1CKEA 2DWQA 2GF0A 3OEED 3A8TA 2Q6TA 1NVXQ 4D26A 1VDZA 5EP3A 4Q47A 1IXRC 3J81k 3RRMA 2ZRMA 5G40A 3L0IB 1NG9A 2JDIA 3EW9A 1U8ZA 2HF9A 4QGAA 3O8CA 1AQUA 1JAIA 3R8FA 1TF5A 4A8JC 3DDCA 1XMSA 3GLFE 2XNSA 1U9IC 1GG2A 2O52A 3P20A 3CX8A 5E7MA 1OH6A 4QJ3A 3SOPA 1T5IA 1P6XA 1N5KA 4QL3A 5EXPA 4M0LA 1OYWA 4OK3A 1TL7C 2ZEJA 3D6TB 5DIFA 4MQBA 4A0GA 2IYUA 3IPYA 5KPJA 2YYZA 4PTLA 3IIKA 4MRVA 4M1TA 4RD0A 4F38A 1CEEA 1UKEA 3I1FA 4ZDKA 5L3QB 5AR1A 3NTUA 1IOZA 4B2IA 5FPYA 5BW8A 3MWKA 4L5BA 3WHKA 5JECA 1XPRA 1G8PA 3AV0B 3H86A 1HQYE 2GAOA 3ND8A 4P31A 4YXWA 4G5GA 3ZLJA 3IHLA 3ZGXA 1DTSA 2JJ2A 3NWJA 4QGGA 4TMKA 1KNXA 1DAHA 3ZVNA 4Q19A 1Z6XA 5KSYA 4EUNA 5KSZA 3L8ZA 3OEHD 5K8UA 4YMSA 2RGEA 1GNRA 3HP1A 5EZ5A 2V7QD 2WPDD 1G16A 1QHXA 2A2ZA 2H92A 4JBYA 1WF3A 2GBLC 1TUEA 1G9XA 1KMHA 1J8MF 4O3MA 4D2IA 5IHPA 3QG1A 1AKEA 1NVVR 3LNCA 5DSZA 2CXXA 5FI0B 1P5ZB 3L8YA 3AKDA 1JBKA 1S9DA 4A6PA 5B58C 1OSNA 3LDAA 3HPRA 2WM9B 4FXPA 5P21A 4CIDA 1KHTA 1G3IA 2PH1A 1BOFA 4NYMR 5EXXA 5F9HA 1K5DA 4BE7B 4PPGA 3SJAA 4CW7A 2ODNA 1JQJC 1U0JA 2IYRA 2Y8EA 1VIYA 1NY6A 2NIPA 2GCOA 2XGJA 1P3JA 3THWB 1KOFA 3NC1C 2IYSA 4JLMA 2RGBA 1DS6A 4MH0R 2EW1A 5FR1A 4AWXA 4DVGA 2HLDA 2QAJA 4MGYR 3AH8A 4RKFA 2PT7A 3AF2A 3NHAA 2GJSA 4BLQA 5FOVA 5FTKA 2D7CA 3QOFA 2YWHA 4V02A 1KI2A 3RSLA 3SNHA 2J41A 3K0FA 1YHNA 3T61A 4BFSA 3VU9B 4MKHA 2OILA 1OXXK 4S2EA 1SHZA 1G3QA 1RVDA 4RCZA 3ZDQA 2EYUA 2EFHB 1W44A 3KQLA 4OQMA 4JMPA 3W6PA 2VP2A 1KJWA 3SFVA 2WMNB 3GLGE 5A0FA 1MABA 1VPLA 5DGXA 3PVSA 5C4GB 4Q4JB 4F4IA 5HZHA 1MO3A 2ZRPA 3ASZA 5DN6A 3THXA 3MD0A 1SKQA 3FHCB 2XITA 4WW0A 1N6RA 1XCGB 2ZRCA 3Q3JB 4KYUA 1J70A 2ZR7A 4BFZA 3NVAA 3LW8A 5FTMA 3H84A 1XRJA 4O0MA 2NPFA 3AF3A 2CK3D 4JBWA 2XB4A 4LX0A 1GWNA 2QTVB 4OHVA 2OLJA 2GVDC 3IO5A 1L2TA 4L9WA 3RC8A 4PC2A 2FX3A 1S8FA 3TW8B 4D4JA 1R10A 4M4SA 3OFNA 2F1JA 4ZCLA 3U4QB 2NO0A 2CVHA 1S3GA 2JCSA 4A0HA 1WCV1 2HYDA 1VTKA 3KXKA 1XDBA 2Z4RA 2WJGA 2XX3A 2W0MA 1G3MA 3T1OA 1P9RA 1G3RA 3LLUA 2YNMA 5IK2A 3VR3A 2ZVQX 3LW7A 4OJKA 4EQ6B 3AP2A 4MRNA 3V4FA 4E22A 1DAEA 3PQCA 3ZZTA 1ZYUA 4XVRA 2GEDA 1ZU4A 1FP7A 5JRJA 5F98A 4ERNA 4KSBA 3TUZC 3THYA 4WOPA 1JJVA 2G1JA 4CEJB 3F5FA 2IUTA 3GEEA 3M1IA 5LD2B 2HT6A 4FWTA 2OFOA 4WZBE 4ZDWA 4F7WA 1UADA 1TQDA 3CNLA 3TVTA 3WYAA 4HB4A 4XTCS 4HI0E 2IEYA 2GTPA 3B9PA 5JSZA 4BZQA 1Z29A 3ECCA 5CM9C 4OQXA 1E9AA 4Z1MA 2V6IA 3U44B 4EPYA 1CS4C 4TT3D 3LXXA 3RS5A 1XXHA 2QPAA 4RSGA 4RFSA 5CLLA 4B33A 3EAQA 1NIJA 2RGGA 3TW4A 5JEDA 2CE2X 3PJRA 4IRUB 4XOIA 5FTLA 2VP5A 3QKRA 2GZHA 4OK5A 5JLJA 2ODWA 2CLCX 4Q00A 2BCJQ 4BRWA 3CZPA 1CR2A 2ZYVX 3SJCA 4WZAE 5KYKA 5EUMA 4PSAA 3SBEA 3AF1A 3HDTA 1SVSA 4KITB 2LKCA 4TTRA 3GJ6A 4KV9A 4LCBA 3A1TA 2Q3MA 5TVKA 3SC3A 1NL3A 2QNRA 2ZIAA 5GJVC 1KNQA 3HYRA 1Z08A 4M22A 2H8KA 3B13B 3K70C 2AKAB 4BECA 1YRBA 3REFA 4TYNA 4ILEA 4MDFA 3B1ZA 1NBMD 4QBHA 4XH9B 2B7BA 2VTKA 3HYTA 3N70A 1OIWA 1OKKA 1KKLA 1S0UA 2GETA 2P3SA 1E2EA 1P2VA 4IHQA 3FMPB 4EPRA 4DB2A 3AVOA 3OAAD 5FTNA 2PMKA 3SYKA 3VR4A 3K9LA 3NKVA 4HB0A 1X8JA 4FN5A 4BGDA 5L3SB 1KY2A 2VLIA 2ZRIA 2CEAA 4Q03A 3K9NA 5D3QA 1XCPA 3WBJA 3K70B 1G6OA 4DCSA 1JR3D 3CZQA 1XD2B 1BMFA 1XP8A 2X2EA 4HDQB 1OE0A 1VG9B 3U3OA 3ZIAA 1DBSA 4U02A 2CHGA 4ZCIA 2QU8A 4FMCB 4KBFA 4FW9A 2IT1A 1QG4A 2VHUA 2ZUBA 2P65A 1KI1A 4JLAA 4NYJQ 4DDTA 1M7BA 2OAQ1 1TMKA 3CIOA 4QBIA 5EE1A 1XZQA 4HYYA 4MRSA 4TL7A 3WBKA 4PXAA 4DT1B 4TTPA 3OIWA 1R5OA 2CMKA 3A4NA 5CB6A 4PO8A 4FINA 3TSOA 1YZNA 1CIPA 1G19A 1N5IA 3K09C 4LV5B 2ANBA 1DO2A 2MSEB 2B8TA 3KKOA 3VX3A 5H8WA 1FUKA 5B2ZA 1IAQA 1CP2A 1OW3B 2GKSA 1LS6A 3CRW1 3W9YA 1EFCA 2X19A 2GK7A 5CLQA 5IRCD 3AB3A 3O8DA 3Q9LA 3IIJA 1PV4A 2BBOA 2YOFA 1ZVQA 3SI7A 1IN6A 5SZJA 2ZREA 3T06B 3CNNA 4C30A 5JJLA 3VKHA 2GXUA 2IYTA 2PEZA 4DEXA 4W5WA 2WMOB 4MYHA 1M74A 2IXFA 1XEXA 1W5TA 2F43A 3AGPA 4TQ9A 3LXRA 1CJTC 2C78A 2ZRNA 4B44A 4CT4B 2CNWA 1K5GA 1DO0A 2GAAA 1GVNB 4HEJA 4M8NE 3QPUA 4DDWA 1WBDA 3ZD6A 2VH5R 3VR5A 1UPTA 1ZIPA 4I1OA 4TMTA 5J40A 3VMFA 4DDVA 2GJ9A 4LOAA 3WMEA 5HZKA 2O8FB 5CK5A 3RLFA 4AG5A 2FOLA 2H5EA 4B35A 4JYBA 5CIQA 1PUIA 4GNKA 1MO5A 3QBVA 5EE0A 1OIXA 3GFOA 4Q1AA 2ZS7A 4R7ZA 2ORIA 2R6DA 2XSZA 3OE7A 2VP6A 2HJVA 1CLUA 2D74A 1E1RA 1E79A 1Y63A 1YR9A 4OK6A 1G7SA 3RS0A 3I61A 1XJ0A 1OFUX 2XNDA 1E2HA 3Q85A 1NN0A 2ZRKA 1G64A 2I1QA 4Q5IA 2JLZA 2QBYB 2BM1A 4MRRA 2XB2A 4QM7A 1PLLA 2KWIA 3MMPA 4XIGS 3EWSA 3FFAA 2ZJ8A 1TAGA 3NC0C 2RHMA 4NCKA 5D3MA 4I1SA 3DL0A 3C5HA 3Q7PA 2YV5A 4IXMA 1Z06A 4GZLA 1BS1A 1EK0A 1RW4A 3FMOB 3NG1A 4RFVA 4ASUA 4D25A 1Z0FA 1KTVA 3PFIA 4M1OA 1W36D 4Q4AB 4PFSA 3I5XA 1XTSA 4TMVA 1MKYA 5K8IA 1OB5A 2BCGY 3PUZA 2HEIA 3GMTA 4D0GA 4OHXA 1E1QD 2I3BA 3CWZA 2VPPA 4CDGA 4DDUA 1FP6A 5C46F 1WA5A 4KBGA 2DB3A 2OZEA 221PA 4G1UC 3FHOA 3UMSA 1US8B 1E2FA 4BWYA 1YJ5A 4RKEA 1AN0A 3CO5A 2N46A 2EVWX 1E2IA 1M6NA 3IEUA 5AUPB 3K0CC 4UKDA 2QY9A 4LJ5A 1SVIA 1V5WA 1GKUB 1G7CA 4MGKR 3QPWA 4A0FA 1ZC4A 1Z63A 1G6HA 2A3RA 4TSFD 1FTSA 1E0JA 2WWGA 5JWRA 1B0UA 1MR3F 1GOTA 1R5NA 3A1VA 1EGAA 3A1WA 1JEDA 1W0KD 1YZQA 2GZAA 1E4VA 3NBZC 4JLPA 1LY1A 4ZV4A 2ZROA 5BN5A 1Q20A 2VL7A 1P61B 3TK1A 1OHHA 2OHFA 3GLHB 3R20A 4JIMA 4AKEA 1E2QA 2MMGA 3OZXA 3WNCA 5EE3A 3EZ2A 4WXRA 4IEIA 5FH9A 5TY0A 2CLDX 4LHYA 1O3YA 4UXIA 3EASA 2EFEB 2DCUA 1A1VA 3U61B 1E0AA 2OM2A 3I8XA 4GL2A 4LV8B 1JEEA 4RD1A 4V03A 3B5JA 3VHXA 2GEUA 5E7JA 5AJVB 4A8JA 4D0LB 3TMKA 1T3LA 1U9IA 3ND9A 3ZYCA 4DLTA 4MRPA 2QENA 3WNDA 5HR5A 3SE0A 2HV8A 3ZH9B 4YMWA 1CF4A 2PLRA 1W0JA 3AVXA 1TF7A 1PJRA 2A78A 1P73A 2FF7A 1E9SA 2O0KA 4TLDA 4D81A 3EXAA 5C2JB 1I4TD 4B6EA 2ZE5A 5JEEA 3Q72A 2GVZC 4C0LA 1EWQA 3U6BA 3OIUA 3PITA 2J7KA 2DYKA 3CPHA 3HR7A 4JLBA 4PHFA 1D5CA 2J0VA 4TYWA 3GPLA 1J8YF 3CWQA 3EZFA 2ZRDA 3H1TA 4QG7A 4B3DA 4HLDA 1N5JA 3SEAA 2CJWA 2KBEA 2ZTSA 3IBGA 5DYGA 2FGKA 3AVTA 3VKGA 4HLCA 2XZPA 4LSGA 5K8TA 3T15A 1KAGA 1UAAA 1G20E 3T5GA 3B1XA 4IDQA 5FOTA 5J4YA 4EKDA 4CT5A 1G7TA 4D4KA 4EFNA 4XWKA 4C2UA 3ICQB 2FA9A 4GPTA 2FEOA 2REBA 2GWHA 1KSJA 2GBLA 4X8MA 4NH0A 5JJIA 4U7DA 1RPZA 4RZ3A 3RS3A 1E2KA 1SVKA 4QNRA 1ZM4A 3I4LA 1CULC 3VX4A 1AA9A 1E2MA 2ZJZA 3WP1B 5TV2A 1F2UA 2VSOA 1SKYB 4KYIB 2IF2A 2WWXA 3B2EA 4C2TA 3PEWA 1K8RA 2RCNA 4N1AA 5SZKB 4BFUA 1Z28A 2JLXA 4U00A 1PLKA 2GXQA 3A4LA 5JWHA 1DAGA 3RDPA 2J9RA 1XX6A 2XTNA 3VU9A 1S96A 4B71A 1ZCBA 1E99A 1OXTA 2NO6A 3DO6A 4FMCF 1SZPA 2YWEA 1XJCA 4EFLA 4KVGA 3T12A 2Q9CA 3CRMA 1KIMA 4GBMA 2EWWA 2ZR0A 4TMZA 2GILA 5FUYA 5JI2E 3GLFA 2XXAA 4A2QA 2ZU6A 1WP9A 3M0EA 5SZHB 1GTVA 1ZAKA 2QAGC 3VR6A 2QGZA 3B1YA 3BH0A 4HUTA 2JIZD 4KSCA 1SXJB 4UNNA 4URYR 1DOAA 1II9A 3G5UA 5TXGA 5CYPA 4F4CA 3PUWA 3VKWA 4JLNA 3PEUA 3JVUA 3RRNA 1QHHA 3DVLA 1P4SA 1U0HC 3QF4A 3PXGA 2WVJA 3FE2A 2Q0HA 4JKIA 1N6PA 1KSHA 4IKEA 2V8OA 2KBFA 3JZMA 4UJ5A 1HE1C 3IEVA 3U4QA 1E2JA 4AG6A 1IONA 2ORWA 1JR3E 3K0AB 4QM6A 1T3SA 2CBZA 2JLQA 721PA 4UXJA 2PEYA 4KFRA 2FSHA 1CJVC 3VNUA 2FMXA 2PJZA 4EJSC 2IEZA 1KKMA 4EPXA 5CYOA 1T3HA 2O8CB 1SGWA 3AM1A 1BYIA 1ZC3A 2W2VA 4AD8A 2KI5A 2QG6A 4BPBA 5H68A 4CEJA 1TEXA 3V00A 1HQCA 3ZJYA 1GNPA 5FI1B 4DLUA 1YZTA 5HE8A 2GCPA 2NG1A 2DY1A 4M1YA 2PJRA 2CDNA 4PAMA 1G4AE 1W4BA 2QTFA 3KXLA 2IWHA 3LO5A 2IW3A 3LFUA 4DIDA 1NSTA 2R65A 3CONA 2PL3A 1XBTA 5KSPA 3FKSA 2ZR9A 2IK8A 2WJJA 3SDZA 3GCGA 4HB3A 1Q44A 2QM7A 1B23P 2JJ1A 1G5RA 3TSZA 4ZDJA 4PC7A 1NRJB 2XOKA 3W3AA 1MV5A 4NDZA 3F0TA 4OHZA 4PPNA 1E9DA 1F60A 1OJLA 4GFDA 4L9SA 4CEIB 2P5SA 3KB1A 3SS8A 1XF9A 1YKSA 1NKSA 4IVPA 2OBMA 4FIDA 4C3ZA 1LTQA 1MO4A 2VYFA 2C9CA 2NZ8A 2WZQA 1S1MA 1OXSC 3GLGA 4JLOA 4PC1A 2O8EA 1E9EA 2KJQA 1W48A 3EX7C 2ZETA 2QROA 4HLUC 4XD7A 4RD2A 5UKDA 4NCJA 4D6PA 1YR6A 1CRQA 1SVOA 4GI7A 5EP2A 3THOA 4QJ4A 4PHHA 2JLSA 3CW2A 3LQRA 1GUAA 2OE2A 4NYIR 4Y0AA 4DEYA 2EYQA 3BB1A 4M2LA 2XJ4A 1N0WA 2BC9A 3ONWA 1RYHA 2DFKB 3N5CA 4PZYA 2J45A 2QEQA 4LC1A 1QZXA 2XAUA 3ZZ0A 4P4SB 1D2EA 2RMKA 1MOZA 1XZPA 2QT0A 2WAXA 4HUQB 4Q66C 4Q1DA 4Q7JB 2BM0A 2ZRLA 5EE5B 2W2TA 2WJVA 4JSYA 2ORVA 1KAOA 3SQXA 2IS6A 5FBWB 2PT5A 2EFDB 2J59A 1E32A 4Q9KA 1NLZA 1M7GA 2J0UA 1N6HA 2BJVA 3BXZA 4AYTA 3K0SA 1OH5A 3NDBB 3HJNA 3WYFA 3TIFA 4AI6A 2GESA 2FFQA 4XWOA 3VR2A 3BE4A 2O8DA 3VTKA 3KDSE 4DT1A 2A5YB 1SVWA 4WXPA 5F3WB 8OHMA 1X3SA 2RGXA 1ZIOA 3ZS8A 3IKJA 2I1VB 4EPVA 1Z0KA 2C03A 5GJBA 2PCLA 2R8RA 2OESA 2ZS9A 5DI9A 2IWRA 1G5PA 1SVMA 3MLEA 1CJKC 1UJ2A 3TKLA 1JAHA 3W8NA 3V4RA 2ZSEA 3ZVMA 4JLDA 2ODBA 2WKRA 4V0KA 1N6NA 5A5GA 2V1XA 4O2LA 3KFXA 3WMFA 4C0JA 2QE7D 1W4CA 1VYTA 4JJZA 2JLYA 4QRHA 3GQBA 4V0ME 4P3YA 2BOVA 2BIFA 3IHWA 5FPHA 3S1AA 3X2SA 1KI6A 1OH8A 4NBSA 1H8ED 5EJEA 2X8AA 5HKKD 4ZPXA 2H1LA 1G1MA 2OFWA 1FMLA 1I4LD 3K09A 4LHZA 3DZ8A 4O25A 2AWNA 3NHBA 3AKYA 1KJYA 4IDOA 2ODEA 5FBQB 4M1KA 2ERXA 2AK3A 5J4HA 2BV3A 3GEHA 3K9HA 5J4LA 3IQXA 3EWAA 2R9VA 4OQFA 3OHMA 3IDQA 1NIPA 2GHIA 3LA6A 2IBMA 3DMNA 1GRRA 3I72A 5FOXA 821PA 1YR8A 4C0QC 2PZFA 5DHFA 3PR1A 4WBSA 3GJXC 1AS3A 1VCMA 3I73A 4RY2A 4YC7A 2XEXA 621PA 3CLVA 3JZAA 3DEFA 2W6IA 1SXJD 2DBYA 4Q7MB 4BZXA 4AYXA 3MGCA 2C9OA 3EPLA 2VF8A 5KSOA 1QHIA 3KJGA 2W6JA 3QPVA 4AKHA 4G0NA 1SVLA 2RGAA 5J47A 3U6KA 2CNWD 1D9ZA 2E1RA 5E95A 1XD9A 5FL7D 4F91B 1BYUA 5ANRB 1Z0DA 2J5XA 2LWIA 4DWJA 1XPOA 3U2QA 4V0LA 1X86B 1COWA 1L7VC 4OHWA 3FYHA 3L82B 4HZUB 3RABA 3KB2A 2ERYA 5FOSA 2H7VA 1VIAA 2RGDA 2J0SA 4TLAA 4Z51A 2V4ZA 4URVR 3GLIB 3AP1A 3QNUA 2RB4A 2ZE8A 2ANCA 2EQBA 2XJ9A 5G53C 1QVAA 1W36C 1Q3HA 5A4JA 3R7WB 4LBYA 3TUJC 2GNOA 3T35A 3QXJA 5JJKA 1EFRD 3HU3A 5LD2C 4B32A 1E94E 5CDFE 3L0OA 2CHQA 2O8BA 1G5TA 1D2MA 2V55B 1YZLA 2YVUA 4LYJA 1R0YA 3EZ6A 5B64A 4JS0A 4TTQA 3TR0A 1S4QA 3BD9A 4IDNA 4ITRC 5TARA 2QSZA 1WQ1R 2GF9A 1KK3A 2XZOA 1W36B 4LBWA 4HAZA 4Q02A 4ARZA 4W5JA 3QUSA 1DPFA 1HEIA 4F93B 5IT5A 4ZIRA 2JGNA 1T91A 2AFHE 3LAWA 2EFGA 3LVRE 4LC0A 1XTJA 1VECA 2C98A 2VP9A 1HY3A 2ZUDA 4LWZA 2ZRJA 3E1SA 4UXHA 1DG1G 3QKUA 4B3CA 2AN9A 1T6NA 5AUNB 1G21E 4R9UC 1DAIA 1IM2A 1ZNWA 4C7OA 1JPJA 4RVCA 1DAKA 2YHSA 3KJEA 4QFMA 1N6OA 1NLYA 3ZQJA 1WDTA 2GJKA 1R0XA 5KTYA 4KO8A 2Q3FA 3DM5A 3T1TA 1ZW6A 2FSFA 4N0DA 1NKTA 1OXUA 3OEEA 1UBEA 3AKEA 3CX6A 3GJ4A 4FCVA 3GJ5A 1IBRA 4DBLC 4LPSA 1GKYA 1E9RA 1R5BA 2QN6A 2AX4A 3CH4B 4FCWA 4FMBB 4PSKA 1T8UA 3IO3A 3K0CA 4E09A 3QKSA 2CCGA 5JZVA 4LZZA 2Z43A 5DHAA 3FOZA 1ZCAA 4B76A 1RJ9B 4OI2A 4C0HA 1CXZA 2Z4SA 1VYUA 3TRFA 2QM8A 4TMXA 1Z5ZA 5HCNA 3VR1A 1CBUA 2D3WA 1DE0A 4N0EA 1C9KA 2P0EA 5F2EA 1GAJA 3RVBA 3TE6A 1ZUHA 4JZKA 1VG1A 2OBLA 5LB4A 3PIRA 1W47A 2P5TB 4O2RA 4EPTA 3X1XA 1IXZA 1OHHD 1OV4A 1YZGA 2AHOA 3T1QA 4GDFA 3V9PA 3RWMB 5JRZA 1LS1A 1RZ3A 1XTRA 2CE7A 2P67A 3C15C 4NPHA 4IOLA 2P2LA 1T4GA 3A1UA 1GRNA 3KTAA 3W5IA 4JLVA 2OCAA 4XWAA 1UKZA 3CUEF 3BFVA 4TL9A 3KKQA 5AJYA 1IHUA 1XPUA 3OEHA 4CEHA 2AFIE 3R8CA 2V7QA 2WPDA 3B1WA 4LV6A 5GADl 4ESHA 3AVUA 4B3GA 2KE5A 5JI3E 2GK6A 4PQYA 2BMEA 4Z8YA 5EZ6B 3LLMA 3K53A 2W83A 4Z8XA 2OLKA 1D2NA 4Z54A 1NLFA 2IS2A 1Q12A 1R4AA 2ZJ5A 2DR3A 2VRWA 5CJ2A 1LF0A 4RZ2A 4B43A 1CTQA 2P6RA 1X6VA 1ELOA 1DAFA 5GJCA 1S1CA 2NQ2C 4E5UA 2ZAOA 1IY1A 2MSCB 3TAHA 4QC2A 4B6FA 2IF0A 1KMHB 1X1SA 4KJZA 4LDJA 2AD5A 4PO9A 1XTQA 1IN8A 2IYQA 2O5VA 2WSSD 5J4KA 2JLWA 5CK4A 3RAPR 1U81A 2CL0X 3KUDA 4A0RA 5FUVA 4AYWA 5EXSA 1IN7A 4KXFB 4PC3A 1ZJ6A 4GOXA 4Q4HB 4JL6A 4YDSA 2Z0MA 3L0PA 1E2LA 3EG5A 2ZITA 1I2DA 1Z6TA 2X1VA 6Q21A 1GNQA 1NY5A 3L2OB 2YKGA 2GCOB 1NVVQ 3TAUA 5LPNA 2ZVPX 3IGFA 3QEOA 1D8TA 5JHGB 2C95A 4NONA 2AWOA 4LYAA 2RHDA 3GLHE 1KO5A 2G83A 4KLNA 4RZXA 1JB1A 2ONJA 1G41A 3OIYA 2LKDA 4NYMQ 4W7SA 4A36A 1R8SA 4NKRA 5DYIA 3UMFA 2OXCA 5LBIA 3SYLA 3CB4A 1I2MA 1SULA 2FH5B 2A7QA 3K0FB 2WOJA 4X8HA 4V0OA 1F48A 4ACBA 1II8A 4HSEA 3ADCA 5KDLA 3CRQA 3AUXA 2OXRA 3TJZA 4YQFA 2QP3A 4XVQA 1E2NA 4KU4A 4Q7KA 3E5HA 3FHTA 2CK3A 1Z47A 1KO1A 2IS4A 4AY2A 4BLSA 3RYTC 4DJTA 4IVQA 2QAGA 1AQYA 3A6PC 4UNRA 2H18A 5GVSA 1MH1A 1TPZA 2ATXA 3THXB 2W0SA 4URUR 4Q18A 2OT3B 2BMFA 1PZNA 4KAXA 2IYXA 3WP0A 2IS1A 2G1KA 1TQ4A 2OUKA 4OQNA 3CF2A 4PO1A 2N1BA 2BEJA 4C4PA 1FMJA 1JNYA 2EFCB 2DFTA 2PMDA 1CJMA 3KUCA 5FFMA 4BRUA 1YE8A 1G291 1OIVA 2FPKA 4A6XA 1G17A 2ZJBA 1Q22A 1QHGA 2QRZA 3K9GA 2ZI7A 4M9SA 5CB8A 4NP6A 4QJ5A 2F1IA 3AKCA 3OF5A 1XJQA 4LY6A 3N2EA 1GM5A 1TF2A 1ZRHA 3BOSA 5DLQC 1FX0A 3UANA 3K0EA 2ZSDA 1TU4A 3FGNA 1GFIA 4MYTA 4XSHA 4DZZA 1X8KA 2OEPA 3EIQA 2OCBA 3A4MA 2F3RA 3H0KA 1XNJA 4G5OA 1EX6A 2UZ3A 4EJSA 4DCTA 5G3YA 1SKYE 5CITA 4IOMA 4M53A 4JL8A 3PUYA 3EPJA 2MMCA 1DADA 2J7PD 4H1UA 3B9QA 4QHYA 4UJ3A 4DLRA 3EPHA 2CVFA 2IYZA 2OCYC 2RH5A 2FG5A 3SFZA 4DUGD 4QXAA 3BBPA 1GDDA 2F7SA 1F2TA 2PX0A 1H8HD 4TT3A 3QXCA 2FZ4A 3ZQ6A 3AGQA 3THYB 1Z2CA 4TQUS 2UKDA 4V0NA 4IDHA 4LBZA 3BORA 1G3UA 2ZJYA 4NCIA 4FMDB 1PLJA 4HAXA 1L4UA 4GMXA 4US2R 1N6KA 3NIBA 5TMPA 1NP6A 4LJ9A 4ACAA 5JSZB 2VO1A 3IQWA 4RD3A 2QMHA 3W34A 1KI8A 2DWOA 3SJBA 3AF0A 3B85A 3GFPA 5G41A 4MGIR 1SXJE 4I1VA 2H57A 3PG5A 1XXHB 2WSMA 1KDRA 4W5HA 4RFSB 5AJWA 4B73A 1MRNA 3O8RA 3CRVA 4HDOB 2JATA 2B7CA 4EDHA 2JDID 3PV0A 4I1UA 4LJ8A 3QKRB 4R2IA 5L3QA 1NBMA 1SQ5A 2I4IA 1W49A 2ZJOA 2QMUA 4IFBA 4Q1CA 1TTTA 4UNPA 5JWOA 1T8TA 2AR7A 3FKQA 4BLPA 3ZVRA 2E9SA 4HATA 2ONKA 1JR6A 3OAAA 1GRQA 2ZJ2A 4UQOA 5FUWA 4JVNA 2V9PA 3DKVA 1OFTA 4HLUA 5LB2A 1ZD8A 1RE0A 1Z07A 2QQ0A 4B3XA 3EARA 2F9MA 2QUZA 4IEEA 3U7GA 4MITA 1ZNXA 2OV2A 2NGRA 4OHYA 4EAQA 1UDWA 4HAWA 4DLSA 3KL4A 1FQJA 2F6RA 2VA8A 1J7KA 1JR3A 4ESVA 4BFWA 1EX7A 2C04A 3R9WA 2NOAA 1F3OA 421PA 2OCPA 4MKGA 5AJXA 4B75A 4YXWD 1UDXA 2O0HA 2QP9X 1GL9B 2GJAA 2JJ2D 2VHQA 2AK2A 2J1LA 2D06A 3P32A 4Q7LA 2C9YA 1UKYA 2FFAA 4E07A 2OAP1 1TEVA 3UIEA 3VFDA 1J99A 1AZTA 1W7AA 2WKPA 2Z5FA 3X1YA 3THWA 521PA 2WWYA 3CR7A 4M9QA 1IN4A 2A30A 1Z83A 4DLXA 4G5SA 1P9NA 4PAOA 4BEBA 4DIEA 4A1FA 3KQKA 1KDOA 2DWPA 1E9BA 1U0LA 4OI1A 1T0JB 4TZ6A 5FPKA 1IY0A 4G3XA 1E9FA 3K1JA 3I5YA 2HXYA 2FPMA 3REGA 2KSQA 5L8VA 4IW3B 1VKJA 4X8LA 4JT4A 2ZI6A 3BAFA 3P26A 1FZQA 1Z0AA 1ZUIA 2D4HA 1FL9A 2YINC 5CJPA 4GT1A 3ZS9A 1TU3A 1R8QA 3QSYA 1SXJC 1Z6YA 4M1WA 2WHXA 1IJFA 2HLDD 5AK0A 1EWRA 5IF9A 1OLOA 1XWIA 5DH9A 4A92A 1CJUC 4LHVA 1LFDB 1FNNA 4LYHA 2IA5A 5C4MA 4L8GA 3N2IA 4Q4JA 4YDHB 1XEWX 2SHKA 4TYQA 5BYJA 3NH9A 1E96A 1EFTA 3A37A 1ZM2A 1N25A 4M21A 2B8WA 4NTZA 2IYLD 2WWIA 3AVYA 4OKSA 1RRCA 4BLOA 1N3BA 3BB3A 2BMJA 4X8OA 4JBXA 4DKXA 1OYYA 2F43B 2XTMA 1UEJA 3QE0A 4IOJA 2QORA 5H70A 3OESA 4AIIA 4QHSA 1II0A 3LH5A 4HDCA 4KFSA 5DN6D 1O87A 2FN4A 1VCIA 2B92A 1XEWY 1ZMXA 5FOWA 1ODFA 2E87A 3U5ZB 4LI0A 1XTIA 1Z0IA 4WAUA 4B48A 3R9IA 4AURA 4R2HA 1RRPA 2WICA 5KO2A 4R71A 1AJEA 1ANKA 3QF7A 4AKGA 1P2SA 3UMRA 1G8FA 1LVGA 4B74A 1YVDA 1R6BX 2X77A 5KNDA 1KI7A 5J5CA 5E7IA 3B7GA 1E2PA 4GP7A 4EQ6A 3D7MA 1SHKA 3OFND 2GZDA 4JL5A 2OFXA 5FBRB 1Z2AA 3WHLA 2X2FA 3EC2A 4JVSB 4YMUA 3E2IA 4XSGA 2VP4A 1A2BA 1KK2A 2J46A 2ATVA 1W4RA 3HU1A 4TQAA 2F3TA 1Q3TA 3CBQA 1E1QA 2CLSA 3H2YA 3DPUA 1KSGA 2CL7X 3WNBA 1NSFA 1FPMA 4IXNA 4FCTA 4DRZA 1S3SA 4POAA 5IK2D 2V6JA 3QIAA 3KQHA 4MUBA 2BBSA 2H16A 5G3ZA 2J87A 2WIAA 2OSBA 1ZNYA 5K8LA 2WOOA 5C18A 4AK9A 3U44A 4NZYA 4OBEA 3BFXA 1W2HA 5KU1A 5J4VA 4LJAA 4DSTA 4D80A 4P4TA 4U5XA 2WWFA 1KO8A 4LJ6A 3TR5A 4G5RA 3MJRA 3BS4A 3MWLA 4Y0VA 4TSFA 4YLGA 3MG9A 2ZSBA 3IUYA 4ZKEA 1XU4A 4DHEA 3FDIA 5C1BA 3ASYA 4Q48A 2GXAA 3QJYA 5DI3B 3BERA 1QHSA 1IY2A 1W0KA 3UG7A 4Z1MD 4HB2A 1L8QA 2PX3A 4M9ZA 1RC8A 2ZE6A 4G5QA 2WKQA 4MUAA 2W58A 1RKBA 2NO9A 4TZ0A 2ZYWX 1Q57A 1WMSA 1Q0UA 3B60A 3BIFA 4GSYA 4TLEA 1CU1A 1P2TA 3KZ1E 4M1MA 1QHNA 2QT1A 3HU2A 1GITA 1OH7A 3F8TA 3W6NA 4ABYA 2QZ4A 3P1JA 2D62A 1JECA 2L0XA 3A1SA 4NYJR 3E70C 5L3SA 4A9AA 1XFAA 2R6GA 3SR0A 3GLIE 2IXEA 3LBHA 4A2PA 5M04A 2ZAMA 5KOYA 2R6AA 4TYPA 3WRXC 3CPEA 1DEKA 2KB0A 1XD2A 1P72A 5FOUA 1OKKD 3NBFA 3TSWA 3KXIA 5LDDC 2V3CC 4FMDF 2R44A 1G4UR 2JA1A 4Q9IA 2FGJA 2IHBA 2NTYC 1UBGA 2F9LA 4ON9A 4PR0A 4A8JB 4LRWA 4B2LA 2AXNA 2CCKA 3TQFA 2IX3A 3F3YA 4JJKA 4ZDIA 1QRAA 5CDFA 2D2FA 3DM9B 5FPSA 1ZM7A 4WZ6A 4HAUA 2W00A 1LF5A 3BFKA 2FFBA 3HPQA 2QL6A 1BIFA 1BMFD 1M1YE 3ZIAD 4OYHA 1HYQA 3U7FB 2C8VA 5AWFC 1XB2A 3C4JA 2BVNA 1E69A 4AC9A 1E6CA 2BWJA 4GOKA 4Q1EA 4CF7A 3IBYA 1DAMA 2RGNC 5GJWC 2GEVA 3QEJA 2NMVA 4YMVA 5BWMA 2ZI9A 5TB5A 4BFTA 3Q8XB 3NEYA 1KO7A 3DOEA 5FBLB 4M9XA 2CJWB 4L4UA 1T9HA 1N6LA 4B47A 2OBNA 3K8YA 4PPFA 4B34A 1H65A 4F92B 3ADKA 1G7RA 1HT1E 2REXB 2QI9C 2H17A 3CRRA 5TDHA 3MCAA 4Q4HA 2VHCA 2MSDB 3JVVA 2PLFA 3NXSA 2QPTA 3Q5DA 4JT2A 1ZM9A 1IJEA 3CKLA 4H9GA 4MYUA 2A9KA 1OPXA 4K8OA 4URZR 2EWVA 4BLRA 5DO9A 1BKDR 2VSFA 1RYFA 2ZYUX 3VQTA 3QXSA 2OO7A 2Q9AA 4CVNA 3PUXA 3NBXX 2IYVA 2FDCA 2VHTA 5JMTA 1F2UB 1M7HA 2JLUA 1OXVA 1ZU5A 1FW6A 3GJ3A 4L15A 1VYVA 2O8FA 5FL3A 4B2PA 3U3MA 1ZM3A 4URXR 2NO1A 3CPJB 1JJ7A 3C14C 1AM4D 3SHWA 2J3EA 4L16A 1NN3A 3SYNA 2DHRA 1U90A 5BYKA 3A36A 3QBTA 2JIZA 2G3YA 3QKTA 1TNDA 1QDEA 3BC1A 3I3SR 3RANA 4A2WA 1KSFX 2HYIC 2QTHA 1QG2A 3NH6A 3QENA 1XMIA 2C5LA 5FUXA 4QKQA 3H4MA 2D7DA 1NF3A 3B78A 2PZGA 4C0SA 1RRFA 4DLWA 4QBFA 1GL7A 4PQRA 4TLBA 4E03A 5EQTA 4NL4H 3GLFB 2YZ2A 2QBYA 2XXAB 4XJXA 1T5LA 1GP2A 2Z6VA 3EZ9A 4QNMA 1UFQA 2XSZD 3OE7D 1E0KA 3DMDA 2VSXA 4PX9A 2FSIA 1WB9A 4LJ7A 2VBCA 3ADDA 4DSOA 1X1RA 3CH5A 3I8SA 1E1RD 3W5JA 1E79D 1QHHB 4M1SA 2RGCA 1V43A 3QF4B 2AL7A 2XNDD 3LX5A 4KODA 3RS7A 2ZSFA 3Q5EA 4Q4AA 4IDPA 1UKVY 1PVOA 3FPAA 2C99A 1U8AA 3U7HB 2XZLA 1N0VC 2VEDA 5EP1A 1ESMA 2ZRGA 1ZNZA 2FZLA 4GRAA 3NEJA 2HF8A 1JPNA 2AKYA 4Q1FA 4B3FX 5HPYB 1WRBA 3D31A 1D9XA 5JHHB 1US8A 4I81A 5FPTA 1P7CA 4ASUD 2AD1A 2R62A 2QMOA 4TMWA 3G0HA 4A4DA 5JFGA 2YOHA 5AUQA 1R7RA 1A82A 1NMYA 2IHYA 2R6FA 5FTJA 1EG7A 4QBGB 3FVQA 4R98A 4DLZA 1Z22A 2GA8A 4KHZA 4LHXA 4TLCA 3I32A 4II7A 4MGZR 4F4JA 3CR8A 3NDPA 1JALA 1S2MA 1G8GA 1XD8A 1Z3IX 1U2RA 2WJYA 2HDNB 3FB4A 3T1VA 5B57C 3U3JA 2J0QA 2NO7A 1NG1A 4DLVA 4RD4A 3EZ7A 5FR2A 3SQWA 1HT2E 2PCJA 2C77A 3GJ8A 4DB4A 1ZD1A 2A5GA 3EA5A 4DCUA 5B30A 2FNAA 3MRSA 3HWSA 4RD6A 3GLHA 2ZM5A 4EPWA 1P2UA 1VG0B 4RZUA 3LD9A 3AUYA 3RWOA 2ZANA 4US0R 1A7JA 4QGHA 4DCNA 1Q1QA 4C0KA 2JEOA 1JXOA 5DE3A 2ZRAA 5BN3A 1XEFA 4IVRA 1AS0A 4PPQA 1DVRA 1P62B 1RFLA 4KVAA 5HTKA
chains in the Genus database with same CATH superfamily
2FUKA 3MSCA 1MO2A 3SY8A 1L5SA 4R7TA 3PU6A 2YN0A 1KFEB 3DZDA 1JIJA 1MGPA 2YC4C 3GAMA 3KZVA 1QPBA 4HH3C 4PHTA 3ZDZB 1OPRA 5MHTA 1T2EA 3QVTA 2W37A 2O8EB 4DM3A 2ACWA 3A58B 4ZOQI 1GIAA 3GP8A 3KT0A 4RWZA 1CG6A 1U3WA 3DCNA 1EP1B 5E1OA 2HU8A 4IIHA 5CVEA 4PLFA 2ZB4A 1BHJA 4RDCA 3VI3B 3GFVA 2JLRA 3CX4A 4LIPD 1Q7TA 5IJAA 4PHGA 2XTZA 3JQAA 4DSNA 1N33B 3LBIA 4JYAB 1N1EA 3A70A 1NJGA 5ELLA 1LLDA 4HFMA 2DM6A 5EWMA 4A5OA 4CU2A 2FEMA 5K8VA 1S9HA 3CF4A 1K75A 2YH2A 1DU4A 3EQZA 4KMMA 3SQDA 2PVSA 2O50A 3R7BA 3KDPA 1FTNA 1J0BA 3RHTA 1BH6A 2CB0A 2XR1A 2CNLA 3GP3A 3MJHA 4GQBA 4NARA 4NYIQ 3AFHA 3RS2A 3LPLA 3BSSA 2EARA 2I80A 4CL0A 1XVVA 1XRSB 1LNZA 2J0UB 3F7OA 1N2HA 4MW2A 2WC1A 2H1VA 2IYAA 2Q1UA 2ZBPA 3FMIA 3LWZA 5F9FA 3FGZA 4LZNA 3EEYA 1MAVA 1NXTA 3KAJA 1OLUA 4YT2A 2O8DB 1Z6AA 4IXTA 1PSZA 1GNVA 3OE4A 3GMDA 1V41E 4OQDA 2ZZMA 1N32B 1YZUA 4YT4A 2PGOA 5KNDH 5B7GA 1D09A 2WILA 1ARZA 1U99A 4BE9A 1JIKA 1PFKA 5BN4A 1TM3E 3CLUD 1KK1A 4HDSB 1D5WA 2BTQB 4BQIA 1ZUNB 4K46A 3NNDA 4F21A 2G88A 1FYVA 1ZLYA 3CLHA 2HCBA 1ESZA 1UF9A 4ZPJA 2C8JA 3SWWA 2PX4A 3IAM1 2EBFX 4C3VA 3OMXA 4TKVA 5C0OE 4D8WA 4A15A 3GARA 1TW2A 2G7ZA 4XDYA 2RG1A 5HGJA 3QOXA 1DARA 4B8ZA 121PA 3M6LA 1LVUA 3M70A 3ORHA 4E30A 5AVWA 1IHPA 1ZGBA 4O4IF 1HYHA 1Y6GA 2HBYA 3LRPA 2HIHA 2A9VA 5HQ3B 1THZA 2B78A 1G8HA 3IIMA 1MOQA 1Y4DE 3GEIA 2UVQA 3QXHA 4J49A 4JJGA 4MQMA 1BWRA 3CGWA 4KFTA 4CDNA 1K6IA 3TJMA 3NHMA 3FTFA 1GPWB 1RRGA 3MM4A 2QN9A 1CF2O 1V11B 1TCCA 1ZN7A 4NMMA 3OP4A 4C0AC 2NV6A 3OICA 2QGNA 3G82C 3SPXA 4IS2A 1E1CA 1MABB 2PYIA 3IJEB 5AOAA 2EW2A 5E6SA 5EWLB 3CXRA 3TUIC 5KYWA 2WTBA 3EGEA 1YJAA 3FI9A 3K92A 4J4TA 1UPBA 3TLXA 3DG9A 5FWYB 1YVUA 5EUQB 4C9BA 4MUKA 3PQFA 4ROSA 5CW1A 5IC5A 3WKDA 4CM5A 5JD5A 1JIVA 1KC1A 4NBTA 1G6KA 3GJYA 2ZXUA 4WNAA 2OUIA 3UW1A 5BSWA 4HN9A 4BNDB 1L1RA 1F9AA 1BH2A 3ZGLA 1E98A 1C4OA 3CSUA 3O7WA 4BUJA 5ES4B 1IXSB 3FWYA 3HNOA 5AJTA 1BKSB 3AESB 2LTAA 1E2GA 1EFRA 1PZHA 2VP0A 4KPEC 3R75A 3C0KA 3NT5A 2AUMA 3SZOA 4I9UA 3AINA 3G02A 3ZI0A 1OREA 1ZQ9A 2ZE7A 1WXDA 1GUFA 1WDMA 2EW8A 2ZYTX 2YNMC 1XA0A 2QPOA 5HILA 3NDRA 1U0TA 4F72A 3MYYA 1OT3A 2WTXA 4Y1RA 1G20A 4B6QA 1UXHA 4WA7A 3NBYC 5ALQA 1KJZA 1KMIY 3HSKA 1N2SA 1W9MA 1T25A 2IHJA 4J94A 2WSBA 4QPJC 3G9XA 2XVMA 4GECA 1RD4A 4HQRA 3FUVA 4YP9A 2FX2A 4JY7A 1VB3A 3L07A 4N8SA 1Y6JA 5E8JA 2C96A 1VLMA 2CUTA 2R25B 1QCYA 3DL7A 2Y99A 3JQ9A 4L85A 3OQVA 4XQ9A 3S28A 2PUEA 3QKWA 2ZIXA 3T34A 3OTQA 1VE5A 2ZRHA 3EUWA 2BKEA 4MR9A 4YEDA 2UXCB 3QV2A 4MQUA 1UWLA 1KFJB 4BLTA 1W5SA 2YTZA 4PZZA 2ZJAA 2KLBA 1J9ZA 1BRTA 1NI3A 4IFTA 2ORED 4XOUA 3WGUA 1GAQA 4PHCA 3WLQA 5J1SB 2XA1A 4EIWA 1OI4A 2VQ3A 1D1QA 4RLSA 4WDRA 1JG4A 5JXJA 1DKNA 1UC5B 2GXSA 3T3GA 4GKJB 2WAYA 1ZMBA 4JP5A 4CEIA 5AOBA 1F7VA 2YW9A 3ZWBA 3BL8A 2PBLA 3EIHA 1J90A 1CUXA 1HOXA 5CT8A 4E08A 2E6KA 3FPFA 1TVKA 2HUNA 4IG4A 4KLZA 4X54A 1I6KA 4C7OB 2WWHA 3TG2A 1W76A 3EISA 1FVHA 2GRAA 2XOKD 2CY0A 5AVOA 3DHWC 3HI4A 4TVKA 4V2IA 2PKEA 2G9NA 4F8EA 4G0WA 1T3ZA 4BHTA 4AJLA 1DT3A 4MIOA 2HNKA 4LNUA 1AGNA 3STHA 1C4XA 1N0UA 4KDCA 1GV0A 2B6HA 1M2EA 4G0ZA 2GI4A 2FJUA 4TM7A 4GI1A 5IG2A 1EXMA 3V7YA 1ZJZA 1RNLA 2RGYA 2C97A 3MWGA 3I62A 2VQDA 4RVDA 3IKVA 1TADA 2UUPA 2LBPA 4NCNA 3LV8A 3QVMA 1B0PA 3QFRA 1R1DA 2VYVA 3BXPA 1JKXA 3AEZA 2YV4A 3M9WA 1D07A 5DCWA 5G2OA 3U48A 5KOHB 1GR1A 1WUYA 3I4CA 1VHLA 3WRYC 4WT7A 1QTNA 5DX1A 5FEMA 1T2NA 3F98A 3AK4A 1RI1A 5DU2A 5BNZA 5C5EA 4KSYA 3TL6A 3NHWA 2C7OA 2P2SA 3BGIA 1GSIA 3IUMA 2Z1MA 4UBOA 5G0UA 3GWZA 3BEOA 2FEAA 1YXMA 1GGKA 1OTXA 2MT9A 4IHJA 3SC2B 3W5VA 3AEYA 3MSXA 4D02A 5C53B 3KAQA 1A5TA 3E18A 3M81A 4PYQA 1H4SA 2VDMB 3AEXA 3HN7A 4BO8A 5JNRA 3NETA 3K70D 4DYVA 1W4AA 1ZLXA 4I3FA 7REQA 1GL6A 2BF7A 2HJGA 1FJGB 4I5FA 4V1CA 1VIVA 1WKCA 2Y66A 1MRSA 1JKJB 4E5YA 2ZI5A 1TA0A 2JGMA 3JQFC 2P9BA 4B71A 2GN2A 4ZRDA 5H16A 3T7DA 2YVLA 4YV2A 1YZVA 2CW5A 5L4SA 2XBUA 3U3RA 2AQ8A 2FMIA 4MDEA 5F52A 4PS1A 3EEQA 4OBWA 2NTVA 4F45A 3NV7A 1XU7A 1EXWA 2A3NA 3CX7A 4PC6A 1U7ZA 5D84A 5CGZA 5F78A 4LN1A 4QATA 4ZZ2A 4D4LA 2BFAA 3OM8A 4JKYA 3QITA 1U2EA 1M2OB 2H65A 2O8NA 3I2HA 3E4CA 5ENVA 3HLTA 3O9MA 3G6KA 2H08A 3TSCA 1JYSA 3V7WA 3AUFA 5HF8A 4CQNA 2DCMA 4GOJA 2G40A 3UJDA 4HZGA 1F6BA 2WSSA 4DR7B 1KJJA 4F2DA 3U0VA 1MVLA 2XVYA 4BQRA 3C1UA 4DC1A 5KWEA 1W2GA 4UFNA 3SF8B 5J1TB 2A4MA 3V8VA 4HLNA 1HI9A 1Z6PA 1ZZEA 3UGQA 2C61A 4XLLA 4B5KA 4EITA 2BF4A 5CYGA 2N0SA 5I4IA 3P9YA 3V1YA 1KY3A 1QQTA 2IXGA 4L8VA 3WGYA 3WO0A 4C7VA 3VJLA 3OJLA 1P75A 2ZDGA 4UNSA 5JYDA 2P6UA 4CQMA 1XALA 2FMUA 3FSRA 3MWJA 4RULA 1U3TA 2RJOA 3P27A 1D0IA 4MQFB 4QXMA 3ZE7A 4B3FX 5EXTA 2EL7A 2BEKA 2HGSA 2O0JA 2OYCA 4KQFA 5CHEA 4JYMA 2REQA 5A7HA 5C8YF 1KTIA 2C5AA 3U7QB 4AUEA 4L5JA 1GCUA 4FS8A 4P2BA 3WMGA 3OLCX 2GYUA 4JWTA 4C0BA 1VMAA 2A5DA 3PLNA 4D8UA 4J0IA 4CE6A 5AUOB 1VBFA 3WK7A 3O47A 4ZJZA 3DUWA 4IQ8A 3TTUA 2FFHA 2EX0A 4G5FA 4OXIA 1AKQA 4LMBA 4ADSG 2IC5A 3Q8KA 2BGLA 2W2LD 3IR5A 4HOYA 1XEXB 1QK3A 3JQGB 1YNSA 4X41A 2ZAYA 4RTPA 2WTUA 1GKIA 4ND5A 1NVWQ 3ICVA 1NFFA 4RENA 4LJYA 3AJDA 5D3ZA 1WNTA 2GD2A 3AZPA 3ECSA 3F47A 4LDZA 4IOKA 3NHYA 3V3KA 2P6MA 4GP6A 2F4VB 1P5RA 3BF8A 1AC5A 3ETLA 3OEWA 1H1LB 3QXXA 1MQSA 1NQAO 3EZLA 4FR0A 4OI4A 4PSVA 4YJHA 5TF0A 3RB8A 3SG0A 1HWYA 3D6JA 3FR8A 2P7HA 1TO2E 3LHDA 5HE9A 3UWPA 5I7UA 4GGMX 3UT5A 1Q1BA 3F6SA 3DNMA 2LVBA 3G9TA 5BN1A 4N6GA 1EIWA 4QQNA 2XCLA 3EY4A 2H7XA 4KGZA 1ZGGA 4WN3A 1TZMA 4FNGA 1GPLA 4HC4A 4HTFA 3C5WP 5B1DA 4CM9D 3I9OA 3UK7A 3OFSA 4HQ0A 3SN6A 3RJTA 3PCTA 7MDHA 1YO6A 4CPDA 1L1QA 3BICA 1QF9A 5LP6C 3MT9A 4NBNA 1I24A 4RF3A 2OXTA 5KYGA 2V7VA 5BVHB 5LA6F 1WL8A 1YWGO 2PGJA 3CMMA 2YCBA 4CKBB 3WDLA 5K51A 3F73A 4EW2A 4J0GA 2A9QA 2QUKA 3DZCA 3OQBA 2K5UA 3LUBA 3WBFA 3R3XA 4KPGA 3NHFA 1GQSA 4ANFA 4P34A 5DT9A 4NHOA 4U8HA 4LGMA 1JEJA 2QMEA 1LLFA 4D4GA 3RFCA 2WU0A 4JQYA 3V9AA 4ZO4A 2ZRBA 4BGUA 3DLTA 5DX8A 5BNWA 1C50A 3B6EA 2B4YA 4FR5A 2JAWA 4EF6A 3LC1O 1JIIA 3D5QA 3QQ5A 4HNSA 3LZCA 1AQIA 5L3RA 2RJ3A 4X71A 4K81B 3IRVA 1MUUA 1OLXA 3QVUA 2JLVA 3WNQA 1C0KA 1G2IA 4NCHA 1Z12A 3SHVA 1PNTA 1CQPA 3TBFA 4CTOA 4LXUA 2GDJA 4ENSA 5FO1A 2D2EA 2YZGA 1QCDA 2ONZA 1X15A 3C16C 3VHRA 2JFZA 4WY8A 2BH9A 1KAQA 2Q9UA 3JZIA 2YWGA 3N3AC 4YAUA 1ML3A 2CCJA 1RXIA 3K9WA 2VK1A 4JLJA 1DELA 2BGIA 2M9MA 4FQ7A 3VNAA 2OGZA 2R6ZA 5LMZA 1YR7A 3OHSX 4QDTA 1SC6A 3AONB 4BP3A 1K08A 2ZYRA 3SZUA 3QHPA 3EJWA 1W6UA 1B3RA 3WFJA 2VOEA 4LZJA 3ZQKA 5I3ZA 2HHHB 5K0LA 2PUVA 2HSJA 3ADPA 5ILOA 2W11A 2X0IA 2FZEA 3DOFA 1NWHA 1UOEA 3PYMA 4AWAA 1AGRA 2ZRFA 3SF0A 2W8BA 4BB0A 4XVCA 3MRXA 1F2TB 5A5DA 1CKEA 4UBMA 2QE6A 1WXIA 2AS0A 4RK1A 3MT7A 2Q6TA 1PU2A 3LUFA 4XR4A 4D6XA 1VDZA 1JU3A 2BL4A 2P1ZA 3E27A 4HQNA 1IXRC 1NQXA 3ZWYA 4BTEA 2WIJA 2ZRMA 2ZSIA 2HZ7A 1D2RA 2GSWA 3KNZA 4DMCA 3GA0A 2JDIA 3GDOA 3EW9A 2HF9A 3KPWA 4M49A 4QGAA 4C5BA 1OI2A 1A69A 5B36A 4ZT5A 4JI5B 4A8JC 3DDCA 2X9NA 3RD5A 2BFMA 3JAWB 2XNSA 2LW7A 1GG2A 1KY4A 1H0RA 4OA5A 5KVCA 1OH6A 1Z35A 4V38A 1G1AA 1H1TA 2VNSA 2VWPA 4OK3A 3UJPA 3IV7A 3RT7A 1ZI8A 3IEXA 1BDHA 1R6UA 1BX1A 1OGYA 1U5AA 2P40A 2YYZA 2ZULA 3QGMA 2X7HA 3CIFA 4MRVA 4F38A 1V2HE 2YXEA 1C9DB 4ZJPA 1DXOA 4QU5A 4ZDKA 4AN1A 3EVCA 1IOZA 1VXRA 4F4HA 3FTNA 2XE8A 1ZK1A 1JX6A 3WHKA 1HG1A 1K7EB 1G8PA 4E70A 1TO6A 2GAOA 1CJBA 4GBGA 4UBJA 1HDYA 3O7MA 4YXWA 3GRYA 1BZYA 1SHLA 5IAGA 5LXTF 2FZGA 4AB1A 4MV1A 3GY0A 4C5AA 4YK7A 1QB7A 4JT8A 4M87A 1Y80A 1I32A 1NQTA 2BDUA 3L7MA 3VSDA 4FDUA 4BY9E 5KSZA 3L8ZA 3BWMA 4F97A 7GPBA 2YVAA 5DXJA 3UM9A 3HP1A 5EZ5A 2V7QD 3DC7A 3W2FA 2KQUA 3LP8A 2A2ZA 3E82A 5DSXA 5JAIA 4JBYA 1U80A 1WF3A 2GBLC 3C3MA 1KMHA 2AFHA 3OQMA 1J8MF 4O3MA 2VXBA 2O4UX 4WOJA 4D2IA 2CXXA 1B7GO 1ULTA 1T6XA 2CDCA 3TM4A 1OSNA 2G07A 4N65A 1VLHA 3HBJA 4FJ0A 4CN8A 1YDHA 4H77A 3EK2A 3F3KA 5FF9A 4DMMA 3KS9A 2QV7A 1G8JA 1SCBA 3EXG2 1QHFA 1Y3IA 3JD2A 1NQOA 4UOEA 2ODNA 4F3TA 1U0JA 2Y8EA 4HDSA 2WG1A 5JMOA 1SXQA 1ECJA 1R12A 1ZUNA 3STUA 2XGJA 3V34A 3ASUA 4CLHA 2CDBA 2RGBA 1CQIB 2ZVJA 3ICOA 1VP3A 4MH0R 3CISA 2FCAA 2G5TA 3B3AA 3LG2A 1WP4A 4RMIA 4CQLB 4OHOA 2Q8QA 5FR1A 5H5JA 1A88A 1Y1SA 2JFUA 4P3NA 2OORC 2X0RA 3ANMA 4RKFA 2ZWAA 4EY7A 4RYDA 4BLQA 4H2DA 3OZAA 4U3JA 3GXOA 4X61A 2V7PA 5AXAA 3QOFA 3S2FA 2ZSUA 3FMVA 3ZDEA 1MXHA 2J3MA 5BSHA 1N2ZA 2EQAA 3KIPA 2HBZA 3HFGA 2YFKA 3EVEA 1PQPA 3MTAA 2IHTA 4K6CA 2OPBA 4PW0A 3RT9A 4C76A 4EATA 5K4HA 7MHTA 1EA5A 3FSGA 1HKHA 1F3LA 1JG2A 4ONEA 2OILA 4NU8X 3RBXA 3UPTA 1CNEA 1A77A 3V1NA 1U8TA 1NBOA 1G3QA 3IPAA 3GDFA 1YTLA 5JMWA 3GFSA 2EXXA 4UHBA 2EYUA 1W44A 2BFWA 4O4HB 5I51A 2J3JA 2YHUA 1KJWA 3N7TA 1P7PA 4B3HA 2X4DA 2ETXA 1PDOA 1MABA 1VPLA 5A0FA 3TEJA 1ECPA 3GN2A 5IKXA 4MQLA 5H9WA 5LQCA 3Q41A 3GOHA 1MO3A 2ZRPA 1Q0SA 5FLEX 2GNPA 1GCGA 3ASZA 2FHSA 5C7LO 2I65A 3MD0A 2H48A 2AUNA 1OROA 1QK5A 1SXGA 2D1QA 2ZIGA 3ZC3A 2H9YA 1ZXXA 3H4TA 2YXBA 1QRSA 1NW9B 3HCEA 2VBFA 4EMBA 3LW8A 4JI3B 4L5CA 2PZBA 1OBFO 4BJHB 1R88A 3UAZA 4EO7A 4RGYA 4CMHA 2VJLA 3AESA 4GBJA 2ZYDA 4JBWA 4Q93A 4GM1A 4LX0A 3JD0A 2RE8A 2GN8A 4L9WA 4E5DA 3P0HA 2FQ1A 2D5LA 4J7UA 4PC2A 5CDHA 1R10A 5L9AA 4M4SA 3MB5A 5DBOA 7ABPA 3SS9X 2F1JA 2FSVA 4DPKA 2R8EA 4ND8B 2NO0A 4EUFA 3LTNC 2CVHA 4L57A 4UOQA 3Q3GE 2A7XA 3LMKA 1IWPB 2NZ2A 4E11A 4ZTZB 4PGMA 5IZ4A 1QGED 3PDIB 1OILA 3D81A 1DWOA 3JSXA 2PU5A 1T4DA 2EEPA 4JJFA 1XDBA 1OT5A 2Z4RA 4E21A 1DKRA 2XX3A 3DMYA 4OU4A 2DC1A 1Z2PX 1R3DA 4OFBA 3STYA 3HY3A 3SM3A 3GJRA 1S89A 5EZYF 1O6FA 3I2GA 4B8WA 1PR9A 4OJKA 2C9BA 3JWEA 3VDXA 4PLPA 4O02B 4KZKA 3IAUA 3PZRA 3RVPA 4E22A 4EGQA 3CZAA 4ZVVA 3ROZA 1LWOA 5JRJA 4ERNA 1LRJA 3TUZC 2GM9A 3HUEA 3USCS 3I45A 2IP4A 4HMOA 3F5FA 2HK6A 1DL5A 2ID4A 3M1IA 3NYQA 4YJGB 1TJYA 5LD2B 5JQGA 4FGZA 1UADA 5F21A 1YA8A 3WGLA 5KOJB 5GONF 4YAJA 4KIWA 5JSHA 4DMGA 4FGUA 1I1HA 1P19A 1GHTA 4CKYA 4OFWA 1M66A 1Z29A 3ECCA 5CM9C 4OQXA 3ZCVA 2C2MA 5KX5B 2BDEA 2F3UA 1XZNA 2V6IA 4ZO8A 5AIAA 2NXJA 1CS4C 4GLOA 2A0YA 4G2NA 2NU8A 1BVUA 1L4FA 3EOBI 4B9EA 2Z9DA 1O9BA 3MQFA 4FFBA 4C21A 3F5QA 4CCSA 3OPNA 5INTA 4MHTA 4O63O 3H4IA 2IZ0A 1Q91A 3PJRA 3KKLA 4IRUB 4XOIA 1TDJA 3UENA 2PWZA 4MI6A 5FTLA 4OK5A 5LP1A 5JLJA 4NF2A 5KWSA 3TOVA 2COKA 5A4MS 5KYKA 1ZSNA 1E3IA 4PSAA 1CQZA 3ZHCA 1SVSA 3DEKA 5LZ4A 5LMNB 4REMA 3C3EA 4GXTA 4PG7A 2FJPA 5KQGA 3S2GA 3GJ6A 1RDFA 5HHTA 5GZ6A 4O2BB 1EEXB 2UZAA 5DBIA 5FYDA 5KOHA 1SD1A 4J9UE 1K4YA 4MS1B 3ESYA 4PR3A 4PZ0A 5GJVC 1RBYA 4HXFB 5FX2A 1DBQA 3NIWA 1RM4A 2VI5A 4ZMRA 3HUDA 1ZJ4A 5KNCH 1QFXA 1BEUB 3TO5A 3DHVA 2H29A 1CZNA 2W2PA 4S24A 3OZRA 1PCXA 4V39A 2QWXA 2X3YA 3SC2A 3QA3E 1WHTB 1CZUA 3G23A 1HDGO 1IVNA 2XH8A 1Z2NX 2P3SA 1I3NA 3TIGA 1Y98A 2DOKA 4YR7A 3ZXYA 1E89A 2PMKA 2JZCA 3NKVA 1Y1QA 4EYKA 3SIWA 4LQLA 4YCBA 4CETA 1X8JA 1GAEO 2VYNA 2YUIA 3O92A 1KY2A 2ZRIA 1AVTA 1XQXA 5D3QA 3WLLA 2IHVA 5KWVA 1JEAA 2DLNA 3JVIA 3LXUX 2P2GA 1MDBA 4WNYA 2XQJA 2PR7A 2ZCVA 1G6OA 4TS4A 2OK8A 1UT6A 3IH5A 4MW7A 4QTXA 4DCSA 4CIXA 1E5TA 1JR3D 1XP8A 3CYFA 1GKKA 1VG9B 3MAJA 3KQSA 4ZCIA 1LNQA 2AVDA 1ODJA 1HORA 2QU8A 3DCIA 1OGIA 3EUFA 1BXKA 2FZKA 4H7JA 4NE9A 1QG4A 2VHUA 1M2OA 1UPXA 2AC7A 2G67A 2H1CA 3NM4A 4JLAA 4TTIA 1M6WA 1M7BA 4U2KA 2QX7A 4UHEA 5DHQA 4DA0A 3GDGA 1NW8A 1XZQA 4HJRA 4IXDA 4MRSA 1O94C 3WBKA 1RPAA 2HRCA 1ZWKA 4GXQA 4PXAA 4UAUA 1XHLA 5FRDA 3WMXA 4AULA 4TTPA 1IYZA 2HJWA 3A4NA 5B4UA 2OL4A 1PEKE 2XUJA 3A11A 2QPLA 3ZZMA 3FPHA 4KW7A 1G19A 1Z16A 1WS6A 4GRIA 5P8WA 3UEOA 4IZOA 4MWOA 1ZI6A 2L2QA 3U4CA 5J3JA 2V5AA 4BVLA 1RKVA 3F4KA 3EGDB 2H54A 3IL2A 1FUKA 1POXA 2I87A 2IRWA 5B3JA 3IP7A 3H1GA 4FYJA 2AJTA 3CRW1 3W9YA 4MQFA 1JP7A 3FCEA 4XR9A 4KXUA 4HWKA 5AXBA 3QWIA 1CHNA 4S3MA 1BU8A 2BBOA 2YOFA 3KTOA 3WKEA 3ZJTA 3SKVA 5CVDA 2PD3A 1GD1O 1S2DA 1PFYA 3AR3A 1HZZC 1A9OA 4DEXA 2IY9A 3FPSA 3EHEA 1WKVA 1IBSA 3CLTD 5A4KA 2CFIA 4MYHA 1V4BA 3KEFA 4ZI5A 5CA0A 3VGPA 4A27A 4BBZA 2V8BA 4RIHA 4F5WA 4V3CA 1EU1A 1XKQA 3W2GA 1Q11A 1W5TA 1XEXA 2F43A 1NJSA 1JFTA 5C81A 2HA7A 1B8UA 3I6BA 4B44A 3U9TA 3X3HA 4PAWA 5DBEX 4KOEC 3ONFA 4CT4B 4E1VA 1ABFA 1SCQA 4M8NE 2E4ZA 4KPUB 4C7MA 3UGJA 3ZD6A 1NVAA 2A58A 1WW2A 3G9ZA 4NK4A 3ZEAA 4I1OA 4C78A 2QTBA 2OV8A 5J40A 2GJ9A 3WMEA 4CKWB 1JHOA 4DDVA 5GZ3A 1QANA 3KK0A 3VYTB 3UFXB 5I45A 4E2XA 1MC4A 4AG5A 2FOLA 4HY3A 4EHIA 4B35A 5CIQA 4EZEA 4XWTA 4YVFA 1W1UA 4ZK6A 5CA1F 1LWNA 5K7SA 4K8RB 1CUIA 1V6AA 4Q9NA 2FW7A 1MMFB 5IAAA 4C22A 2RI0A 2Q4BA 2J6IA 2VP6A 1H4TA 3T9CA 4KL8S 3JYOA 2NLOA 3G2KA 1RMYA 1QAMA 3A0RB 4L22A 4Z4CA 1CLUA 2D74A 2PV0A 2OCGA 5BVHA 4Z86A 4HUJA 3RS0A 1XJ0A 4CFYA 3I61A 3IAFA 4DADA 2XNDA 3FUCA 1NN0A 4Q5IA 3ROEA 5A06A 3LQKA 3LC7O 4HNAA 4OJYA 5BW5A 5JCOC 4FOTA 2XB2A 4QM7A 3MMPA 4XIGS 1W5EA 1JQKA 2C88A 4NCKA 2RHMA 3LUPA 3GUVA 1E8NA 3H9GA 4RKYA 5F33A 1B6GA 4I1SA 1TM5E 4RZSA 1ZGHA 2XT6A 3T7EA 3VDQA 3N2LA 4FMPA 3OVMA 3T1HB 1A95A 3C5HA 3DL0A 5F2NA 5HS4A 2X7JA 1CC1S 1Z06A 4OYYA 4YV1A 4DM4A 4RFVA 3NG1A 3K71B 2CGEA 5H59A 2AYXA 3NPAA 4P08A 5JD3A 1W36D 4EVRA 4KN8A 1XTSA 2F48A 1MKYA 3FPLA 1A5ZA 1GXSB 4KWIA 2O3RA 4BU0A 5IXJA 3ZU4A 3UAOA 2I3BA 4WK4B 1JILA 4JROA 3ELBA 2VPPA 2VTEA 2X0KA 5F2KA 3W5UA 4NAHA 2HCFA 1FP6A 3WRVA 4BVKA 4U2EA 4Y6LA 4BP8A 3TTXA 4EK9A 3FTEA 1WSBA 3P0EA 2HDWA 1GJRA 4PFKA 3TD6A 4F56A 1FX1A 4ARVA 5CDGA 1Z4IA 1YJ5A 3NUGA 3X2FA 3LDGA 1G2QA 1JSLA 5ULLA 1E2IA 2ICAA 1M6NA 1XAHA 1OYOA 1PYOA 3SFTA 2G8LA 3AERB 4AECA 2GZ2A 1ZUD1 3M7IA 1DEAA 2MR5A 5E1DA 3WOVA 3GA5A 1ZN2A 1J1IA 1D7OA 3N0TA 3C7AA 1GGVA 2GAIA 4A0FA 1Z63A 5JVDB 2FUG1 3O8QB 1BXGA 1FTSA 1E0JA 5CTAA 4ZALA 1TCAA 1GOTA 1C5KA 4PRYA 2NUBA 4IDCA 3TLEA 1YZQA 4QOFA 1TFRA 2RGUA 4R0NA 3QELB 1SQ6A 2PPVA 1XDDA 1BCSA 1JVNA 1Y3FE 2XQVA 4UFOA 3TB6A 4ZV4A 3SZLA 2PSEA 2WU8A 5JYBA 4AMYA 3TZQA 1RAAA 2MMGA 3MELA 1U63A 1TYAE 3EZ2A 4WXRA 4ZCPA 3O9VA 5D7NA 5TY0A 2CLDX 1L4NA 2EFEB 4KX3A 1Y4AE 4MYSA 1QKJA 1FC0A 3ESXA 3I8XA 3NASA 4HEA6 3BHNA 4PF1A 4GL2A 1L7AA 1QKKA 4RD1A 3S7ZA 4BAGA 5COAA 1MPXA 3B5JA 3PKJA 1YUNA 5A5FA 2GEUA 1M3SA 4YREA 3IURA 2Z04A 4DNXA 2Y6UA 2O3UA 4D0LB 2FQXA 1ORWA 2ZRQA 1E3WB 1E4OA 1J4AA 1RPJA 1HZJA 4Z4GA 4B4KA 1V96A 5SYMA 2X0FA 1P9LA 1ES9A 1UXGA 4RLHA 3ZCTA 3P2JA 4TXNA 3PIIA 4KE6A 3PGXA 4YMWA 3ODPA 3HXTA 4XKJA 3HSYA 4ID9A 1LVHA 1PJRA 3BCRA 1E9SA 4R1LA 4R8SA 2D1RA 2YBDA 3DVAB 3LHKA 2I66A 3EXAA 4D81A 3D4BA 1U4NA 5C2JB 4B7CA 1I4TD 2ZDHA 4H7FA 3Q72A 4L0DA 4TWIA 2GVZC 4Q4DA 4B82A 2J5RA 4C0LA 3PITA 4MW0A 4BNFA 3EH2A 1EWQA 1D5CA 2J0VA 1P0MA 3GPLA 3HRIA 3TG8A 4J0JA 2A4KA 2ZRDA 3ULKA 1XVLA 4XYMA 3RSSA 3ZWAA 4EY8A 1N92A 2HO4A 2AMFA 2KBEA 1NU6A 1EQUA 4AF6A 2F8TA 5EJ2A 5KTTA 4MR7A 3T15A 3OLQA 3B1XA 5AM1A 1KYYA 2C1XA 3WKCA 3R6LA 2QDXA 1G7TA 4H6WA 1QX3A 4XWKA 4C2UA 4KB5A 1U6JA 1F8GA 2FEOA 3BREA 1TB4A 3HDVA 5DM0A 2DPYA 1C7EA 5JJIA 1X14A 1GU0A 2QNBA 3C3BA 3OZWA 3INTA 4M1QA 4O4LB 1ST3A 2HRQA 2QRLA 3FDZB 4B7ZA 5EJ5A 5JAUA 3MMZA 1M8GA 1PTKA 2WSLA 1R50A 2X3FA 1E2MA 3VX4A 4F4DA 4CLRB 2COEA 1RYNA 1U7XA 2DKFA 1K3FA 3NORA 5L95A 1SKYB 1X80A 1K9VF 3QTLA 4PS0A 5EJFA 4FGJA 2VRBA 3PGKA 1K8RA 2BMVA 4IDBA 4C2TA 4HP8A 5SZKB 1TC1A 2CSUA 3GZNA 1NXOA 1PLKA 2AOUA 3IUNA 1UL1X 2RI1A 4MK4A 4ZVQA 5JWHA 1FFDA 4KAFA 3RDPA 1IM8A 4UTRA 4OO3A 1C0PA 1EBBA 1KYZA 3DWEX 3NYIA 1ZCBA 5DHUA 1CK4A 2QMZA 1JFSA 1DC8A 1UKAA 4QODA 1XKLA 10MHA 1DUVG 4D45A 1DQSA 2YWEA 4EFLA 2VR1A 2GD0A 2HMWA 3E9RA 3FHJA 2Q9CA 3DE4X 3CRMA 5CBPB 1UANA 1SB8A 3E5MA 4QSHA 4QG3A 2EWWA 3IAS6 4H7PA 4R2JA 2NT4A 1E3LA 2ZR0A 3HJUA 3MYRA 2GILA 4H16A 1B14A 1WM1A 4M54A 2JARA 4CTMA 9LDTA 2R60A 3OJXA 4PCVA 3FF1A 3IT2A 2WWRA 4MRMA 4X64B 4POOA 2BFBB 3HGTA 1XWWA 2W7TA 3DKIA 3DB1A 3EXEB 3FSGD 4X91A 5EESA 5EMMA 3TQIA 2MYUA 1RBMA 1T6BY 4V0RA 2JIZD 1SXJB 3C6KA 3OT4A 3G5UA 4XYBA 1EHCA 5CYPA 4YRZA 1DBPA 4I1RA 3VKWA 1WNFA 1YRYE 1J2YA 3FJOA 5K8LA 3WA7A 1IU9A 2HWXA 2VWHA 1H6BA 3D8TA 3E7XA 1AN9A 3PXGA 5T4EA 3RAFC 4ETNA 2Q0HA 3DUFB 4L75A 1VZ3A 1IDN1 4W9RA 2M6KA 4P1ZA 1EFVA 4U9IS 1CRLA 1O4WA 3H6GA 1DJNA 2ROQA 5AKLA 5HFJA 4GYYA 5AESA 4JKOA 4K7JA 3AOGA 4XX0B 4WXMA 4C1BA 2DEUA 1H1DA 5EZSA 1MU0A 5CCDA 3BPSA 4HGOA 3EUAA 3IJPA 4HXEB 1RQGA 2QLNA 1IONA 1D2CA 4EYSA 1SUWA 3V2IA 4LX8A 1OA1A 1JDJA 5YASA 3K0AB 4WD3A 3TOCA 2P9YA 1DTEA 4AROA 3WFZA 3U7QA 2PZKA 3W8EA 3ZWVA 5EHGA 4GM0A 1Z2EA 1FDIA 1I3OA 1ZL2A 2H1HA 1TCVA 2PEYA 3OJCA 4NABA 1RQLA 3HXMA 3VNUA 3RYFA 3R3ZA 2FMXA 4EJSC 1P0CA 5FUBA 5AKIA 2AOTB 2ECQA 3TEMA 4ARUA 1TJ4A 1SGWA 4WDQA 4OGGA 4FGSA 4PLYA 2HZBA 3CLKA 5JS6A 4ZO6A 3AM1A 4AD8A 1VMEA 3I6YA 5C8VA 1SB9A 4YMIA 2FOIA 4JI2B 2VAVA 4BPBA 5AKKA 3PQ6A 4DQKA 5H83A 4YCCA 3V00A 2FW6A 1HQCA 3FNHA 3HJCA 5AK3A 2OGSA 5T57A 1GNPA 4DLUA 3Q10A 2XVAA 4F2WA 5HE8A 1PJLA 4ZT3A 2NG1A 1RWPA 4M1YA 4M7OA 4ALJA 2CDNA 4ZXPA 1G4AE 1JG3A 3KB6A 3LT0A 4INPA 3LO5A 4R8RA 2QM0A 2XXBA 2YS6A 1NSTA 3HNPA 2R65A 4JJ8A 1NVBA 1GT6A 2PL3A 1A9ZA 1AKTA 1GTJ1 2APJA 2WJ3A 4JEHA 4YRPA 2L82A 4OXRA 3RO7A 3GF4A 3SDZA 3VTZA 4HB3A 5LLDA 4KR3A 4KQEA 4EP1A 5K6AA 3DOCA 1V1MB 1RBQA 4ZDJA 2PS9A 4PC7A 5DGTA 2QLJA 3HCCA 1FDUA 4EUEA 1E3TA 5DCYA 2HHAA 2W6CX 3U9LA 1E9DA 2G4VA 1F60A 2XLCA 1IK4A 1VJ1A 4DSZA 4GFDA 4L9SA 4WINA 4H1TA 1BCRA 4OHCA 2R1VB 3DMPA 3DDHA 3KB1A 1XF9A 2ECFA 3NTQA 1GTL1 3U31A 3QEAZ 3ZHVA 2CYCA 1MO4A 4O2BA 4IUCS 1V1RA 1FTYA 4M0EA 5BQPA 2NZ8A 1AOXA 5ICFA 3EVNA 4JLUA 1OXSC 4MS1A 1YR2A 1XN4A 5I9SA 3N7UA 1MJFA 1RZRD 1E9EA 2KJQA 1W59A 3PFNA 3EX7C 2ZETA 1RI2A 3A4TA 1NURA 1UBTS 5KKCA 4CT5A 1ENYA 3LUJA 5UKDA 4NCJA 5JD6A 1CRQA 1SVOA 3KPUA 1IUPA 1YDWA 3D8SA 3THOA 3DPSA 5CFZA 3R6TA 5JSQA 4MCAA 4PHHA 1H3EA 2JLSA 4BNIA 3WJ1A 4MICA 4YRQA 1HX7A 3W5AA 3KEMA 3MJFA 1OZAA 1N0WA 2HK7A 2XCUA 8ABPA 3E3AA 1L7BA 2H1RA 2J45A 5GY7A 5TE9A 2XAUA 3L0YA 4MTLA 4ND2A 4P4SB 3ZZ0A 4BMCA 3HVKA 4RE5A 1L5HA 1GPH1 2I34A 2AR9A 4H0FA 1VL0A 2IV2X 5REQB 4D9HA 2W2TA 4YPVA 2WJVA 3CB2A 2ORVA 1KAOA 2Y67A 2OP0A 3M4XA 4KIUA 2YBEA 3IYLW 4HDMB 4OSPA 5FBWB 1N9KA 2EFDB 4AX8A 2J59A 4B80A 1WHSB 4ZI7A 2O14A 3AUTA 3RSQA 1M7GA 5K0SA 5EMNA 3DL2A 2BJVA 1A4UA 1OH5A 4DR4B 2ZWMA 2GN6A 2EV9A 2O1EA 1PQYA 2P4UA 1ACLA 4QJIA 3TIFA 3EBPA 3UJ3X 1GDHA 5EYPA 1DZ3A 1E6WA 5K3FB 5BSRA 5BRNA 1EHYA 4FYPA 3AIMA 4YWHA 2A5YB 1SVWA 2BN4A 1Y1RA 5F3WB