3LLVA

The crystal structure of the nad(p)-binding domain of an exopolyphosphatase-related protein from archaeoglobus fulgidus to 1.7a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
133
structure length
133
Chain Sequence
RYEYIVIGSEAAGVGLVRELTAAGKKVLAVDKSKEKIELLEDEGFDAVIADPTDESFYRSLDLEGVSAVLITGSDDEFNLKILKALRSVSDVYAIVRVSSPKKKEEFEEAGANLVVLVADAVKQAFMDKIKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the NAD(P)-binding domain of an Exopolyphosphatase-related protein from Archaeoglobus fulgidus to 1.7A
rcsb
source organism Archaeoglobus fulgidus
molecule tags Nad(p) binding protein
molecule keywords Exopolyphosphatase-related protein
total genus 47
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3llvA00
1U7TA 2G0TA 4J1TA 1GZ3A 5JDIA 3LYLA 1TEHA 4UEOA 3WIDA 4BO7A 3I4CA 1JN0A 4DXHA 3PI7A 3DB2A 1ZXLA 1OZAA 1E1MA 4B3IA 5CPFA 2FOIA 3H9EO 2AHRA 1O89A 4KP7A 3PZBA 5GZ3A 2GRAA 2D59A 2NTJA 2ZCUA 4DPKA 5KWEA 3IKTA 1VL6A 4I9NA 1I3MA 1H0KA 3GK3A 1DDOA 3P5SA 1EFLA 1I3LA 5FWNA 3GVIA 2NUAA 3RVDA 3DAGA 1LNQA 1P74A 2A9FA 3I6IA 4AJNA 4IUYA 4II3A 2IEDA 3WLFA 2DBZA 3TZCA 4FFPA 1Q7CA 3M6IA 5JS6A 1ZEMA 3Q2KA 1R37A 3NV9A 1PWXA 5KCZA 2HKIA 2DFDA 3PHLA 3UF0A 4FC7A 1E7WA 3FNGA 2X8LA 3H9QA 2NSDA 3HSKA 1B16A 3ICPA 4R9SA 4ZICA 4KUGA 4RPLA 2Q3EA 3FTPA 1BW9A 3S8MA 4JP2A 4HADA 4BNUA 1HDZA 4OYRA 4CLDA 4LRSB 3BTOA 5KKCA 4EBFA 1CRWG 2JCYA 5I7VA 3ULKA 1DIHA 3B70A 3GMDA 4XEHA 2RAFA 1QRRA 3FCOA 2Y93A 1HDCA 1DFHA 2P68A 2VHYA 1LDNA 3GLQA 4BIIA 4XQEA 2WMDA 4DPMA 1Y6JA 1DRWA 2ZTLA 3D4PA 5HS4A 7ADHA 3WQSB 1Z82A 2C0CA 3RUDA 4GPD1 3RFTA 4C4OA 1Z74A 4RPHA 1XQ6A 1YL7A 1I36A 2Z1NA 2NQTA 3K30A 3KYCB 3WOHA 2W2KB 1J0XO 1BHSA 5B4VA 1DEHA 1JAXA 3OQ1A 3NYWA 1MC5A 1RM3A 4WE3A 4YYZA 5BQFA 4BO3A 1YJ8A 3GOHA 1FDSA 1V35A 4K1LA 4ZQEA 4UUPA 1ZJYA 1HEUA 1I24A 4AJ2A 3MZ0A 4I8XA 5B4TA 3BMCA 3CE6A 4Y67A 1ARZA 1V6AA 2CDAA 3W6UA 4IXWA 1FJHA 1VI2A 1CQIA 1E6EA 3EZYA 4Y8VA 4XGIA 4IS2A 4AJHA 1IL0A 3BMOA 1T1RA 2P4HX 2GCGA 1RYDA 5CEFA 4GL4A 1R4MB 3D0OA 3PLNA 3WG9A 4ALMA 5G4LA 4E2ZA 2UUPA 3FNFA 5HTOA 3EVTA 3PGJA 3BMQB 2IDZA 4FGWA 5DF1A 2PZKA 3V1YA 4PLZA 3VH2A 2QHXA 3VPGA 2X5JO 3JQ7B 4E2XA 3OJEA 1QR6A 3JQGB 2PA3A 5AOVA 3L4SO 1K6JA 1OBFO 1V3VA 4KUHA 5HRUA 3U0BA 3JYPA 3GG9A 2X1HA 5ES3A 3SJ7A 1XCBA 2ZB4A 2QX7A 2WJPA 2PZLA 1U2DA 3DMTC 1LSOA 5A4DA 5I7EA 1B7GO 3WYCA 4JXKA 2X86A 1JVSA 3NT5A 5TX7A 4XIYA 1GZ4A 1CWUA 2WSBA 4A2CA 4N5NA 1R0KA 3ICCA 4AJPA 4MDHA 2AEFA 2EV9A 3OM9A 4R1UA 1RPNA 2PD3A 5EESA 3ANLA 3ZWXA 3PTZA 1HLDA 2C82A 4Z3DA 3RSHA 2FN7A 3TRIA 2BHLA 1DC3A 3MJVA 2C29D 4KUEA 3WGOA 1Q7GA 2Q2QA 1NASA 3FSRA 4JJGA 1ZW1A 5IDXA 4NJMB 4LMRA 2HAEA 3FBTA 4PRKA 3KTDA 3STHA 4E2YA 5CG2A 2BF7A 2BGMA 1OAAA 3RWBA 4A26A 3H8VA 4CM7A 1QORA 1YS4A 4CM8A 1F0YA 1RJWA 1NVGA 4TSKA 1OMOA 3HN7A 3SEFA 4BO2A 2O3SA 5G0SA 1XA0A 5BSEA 1NFQA 1L7EA 2RHRA 4BO9A 1XDWA 4FGSA 1YBMA 4GVLA 3DR3A 4FFMA 4U7WA 4J16A 1AN9A 3IAHA 4YT4A 4TRNA 1E7QA 3RBZA 3KHUA 1QKIA 3L6OO 4GMFA 1DSSG 2X0IA 3FRJA 2VZ8A 4BMVA 5TGDA 4F6LA 4BNIA 1FMCA 2OP0A 5I7FA 5AXBA 3HFGA 4CMJA 1CF2O 4OSPA 5F1PA 2X58A 4ALKA 3HADA 4DLAA 3DAFA 4NG5A 3QA9A 1GEEA 1XWFA 3WTBA 3QSGA 3TN7A 5F3RA 3RQSA 3D5QA 3WNVA 4F6CA 1MA0A 2Y0DA 5TJ9A 4RVHA 5DDIP 4CMIB 4DREA 2B36A 5JC1A 2GASA 1ENOA 2CD9A 2OMEA 3NX4A 4YTEA 3WDSA 1GL3A 4IMPA 4BMSA 3PFFA 4PVDA 2NNLD 4WASA 2HLPA 1WMBA 2NVWA 3DMTA 3H9UA 3LT1A 4IGFA 2VHXA 2QRLA 5FF9A 4CV3A 3OP4A 1YB5A 1NFFA 3EW7A 1ADFA 1E6UA 1VSUA 2ZJ0A 4HNHA 3KXDA 2JJYA 2GZ3A 4YXFA 5BNIA 3VDRA 3ADOA 1VJ0A 2Y99A 4EUFA 4GX5A 3DL2A 1JTVA 4MOWA 4H7PA 2OL4A 2GSDA 4XDZA 3FHLA 3FNEA 4FBGA 1LRLA 2AEJA 3KUXA 4YRBA 1N5DA 4WECA 3QP9A 4CR8A 1QXSA 3F47A 1DAPA 3Q0EA 1J49A 3DBHB 3RKUA 3UICA 4D0SA 3JQ6A 2WDZA 5ICSA 4ZN6A 3A4VA 1P3DA 1XELA 3GDGA 3OIGA 3NDRA 1GTMA 4BV9A 3OEWA 1WAMA 4RZHA 3I9JA 3ZW8A 3D64A 1A4UA 3DO5A 1EQUA 1A5ZA 1DHTA 1JWBB 3DOOA 4MP6A 4AJJA 4IIUA 4MKZA 2NU6A 2D0IA 1S6YA 4OXNA 4XYBA 4CMGA 4WLVA 2AXQA 2Z1MA 4OOEA 4MINA 1D4FA 1VSVA 2HMVA 4P38A 4BNMA 1XHLA 3LT2A 3L6EA 3V5NA 4CMKA 4TZTA 1KOLA 3W8EA 1FDWA 4NDNE 3RKRA 2JD2A 4WPGA 5IF3A 1V9LA 2PH5A 3R3JA 3AY6A 2VUSA 1JKJA 3Q2IA 1GV1A 1DC4A 3R6DA 4I9HA 5C7OO 2FR1A 1SEVA 2D1YA 4BO0A 3WTCA 2GO1A 3ZWWA 2IODA 1WZIA 4NFYA 3AM3A 5CP8A 1C1DB 4M54A 3PQDA 3QJ5A 2XXBA 3E6AA 3W4KA 2E4AA 3ORFA 1IPEA 1O9BA 4GAEA 3HDQA 5B4UA 1PJTA 1ID1A 4GSKA 2SCUA 3KSDO 1YVEI 5TSDA 3ZV4A 4QTZA 4B4UA 3ZWBA 3QWHA 3VH3A 3K96A 5I8WA 4LCEA 1Z75A 2BMAA 2YHIB 4Z9XA 5DOZA 3LLSA 4E31A 1T2EA 3O26A 1KBZA 4CM8B 2JAHA 1KC1A 2CZCA 3NJ4A 1VL8A 2GN8A 2E82A 5CDSA 1HZZA 1GQQA 3D3EA 1WDLA 1T2AA 2X6TA 4Z9FA 4W7IA 2VHZA 5F1KA 3GT0A 1UDAA 2HK8A 1U3VA 4HV4A 4RVGA 3A14A 1C1XB 2PGJA 3U62A 3KO8A 2WYUA 1E7RA 1LEHA 3IJRA 4OSOA 4CMHA 1Y8QB 2VRCA 3HNPA 1RKXA 3I23A 4NBTA 3C8MA 2EXXA 2Q45A 3GA0A 1RM5A 2DTDA 4RDIA 1SC6A 1PZHA 1ZK2A 3ITKA 3E48A 3PYXA 1BMDA 3EK2A 4O5OA 2Y66A 3F46A 3OICA 2EW2A 4Z3KA 2RCYA 3K8ZA 2DQ4A 2P2SA 1OC4A 1UZLA 3GC6A 1B26A 3GVCA 4XDYA 3A28A 1MG0A 3FD8A 1KIFA 1DC5A 2W98A 4RF2A 1K89A 2B69A 4BKRA 1VM6A 1L1FA 3HJAA 4N7RA 3BHIA 2PR2A 1GPJA 2GD1O 2QQ5A 4L74A 1EE2A 1B3BA 1PJCA 3MJSA 5L3ZA 2ZYDA 2J3KA 4W82A 3VKVA 5C7IO 3F6YA 3R1IA 3DHEA 1T4DA 2X22A 1U1IA 2JKVA 4KDFA 5IXSA 1A71A 1XU9A 1DJNA 5A1TA 4YJHB 5J23A 1I32A 3FTNA 3AWDA 3VHRA 5G0UA 5KTKA 1BVRA 1BXGB 3WMXA 1FDUA 5IDYA 1K0UA 4YACA 3PJGA 4R9RA 4GMGA 4NU5A 5ER9A 2ZYAA 1HE2A 1IZ0A 1HDGO 4AL4A 3LVFO 1BDBA 4OIMA 4J90A 3CEAA 4XYLA 2O2YA 3VOSA 1W0CA 2AQ8A 4FD3A 4RV9A 4K6CA 1M75A 2EWMA 5BSGA 4DIOA 2VUTA 2G1UA 3OJLA 4DIFA 4ALJA 4NZ9A 1YH3A 4LVCA 1AHIA 2PWZA 4N54A 5CPBA 3HN2A 1NM5A 3PHIA 3ZW9A 5JC8A 2QW8A 1U9JA 1AGNA 4WEQA 5C37A 1DJQA 4QFCA 1ZK4A 2CNBA 4FPXA 1D7OA 1LUAA 4XRGA 1P1KA 3RFXA 5JAMA 4NU6A 4PFJA 2EF1A 1NTOA 3KSUA 4R16A 4E5YA 3K31A 3D7LA 1XYGA 3HHPA 3P2YA 4IDDA 2B5WA 3ZNQA 1Z45A 3MWDB 3G1TA 5JNLA 3JQDA 2HDHA 4IDGA 5CAEA 1GQ2A 4MVJH 4XR9A 4W7HA 1NPDA 5JCXA 3I1JA 1KVSA 5EMHA 2R2GA 4P4NA 4AJEA 4M86A 4CLHA 5KJCA 5MDHA 4RF3A 2O48X 4YQYA 2I3GA 1ML3A 1QG6A 2DT5A 3ZWYA 4Q39A 3H65A 2HU2A 3ADPA 1M6WA 2YYYA 2RBEA 1TI7A 5JY6A 3DDNA 1DC6A 4F46A 1BXZA 3EDMA 1YJQA 4J9UE 2DBVO 4WCFA 4RZIA 1D8AA 4FJ0A 3F1KA 3RUIA 4UVHA 4BKOA 4MVJA 4GSLA 1QMGA 1BTOA 1E0DA 1SZJG 1X7DA 4FQ8A 1B2LA 4YJFA 5T57A 3JQGA 1A27A 3TOZA 4RPJA 3WS7A 2V6FA 4NK4A 4XB1A 4GX1A 4ZD6A 2HCTA 3EMKA 3WR5A 3H5NA 1H2BA 4Q3DA 3AI3A 4TRJA 3IL2A 3U4DA 2ZTVA 3QY9A 4DUPA 4WOJA 4K28A 1Q0HA 2DUUA 4O1MA 2GERA 3G0OA 4PLHA 3GHYA 2PD6A 4TRMA 5JLAA 3ENNA 4KDEA 5A02A 3U9LA 1PJ2A 4CODB 1J6UA 4BQPA 3JQAA 4MVJD 1KC3A 2X0RA 3H4VA 3UGKA 4ALLA 3V1UA 5ITWA 3RAJA 2AQIA 3AK4A 4JGBA 3AFMA 4XQCA 3AI1A 3MCVA 1JQBA 5L40A 1YB1A 4ZQHA 4MP8A 3V8BA 5U4QA 3ZN2A 4Y9DA 3PJDA 4CMEA 1UXIA 2WD7B 2R00C 2IXBA 3ZU5A 1DRVA 1UP7A 4W9NC 3VAZA 3W8DA 1QYDA 3PZRA 3L4BC 4RVFA 5DCUA 5L45A 1Y9EA 4M49A 2X5KO 4PZDA 4MVJF 1PZGA 2FHSA 2CDCA 1A4IA 2HK9A 4PG6A 4Q3NA 2W2LA 4Q9NA 1RWBA 2P91A 4QT0A 3UHAA 4XB2A 3T4EA 1F14A 4WEOA 4I08A 1T2CA 4BNXA 1XU7A 3GDOA 4QSMA 1WDMA 3GAZA 4KZPA 5THKA 2QRKA 1X1EA 3BIOA 3TQHA 1MFPA 4IPTA 3INTA 1J4AA 3CIFA 3JQBA 1LA2A 1GYPA 1NFRA 2GN6A 5IG2A 4QUKA 2JHGA 3GZNB 4DLBA 3D4NA 3MJEA 5H83A 3LSYA 4DL9A 1I2ZA 3I9NA 5FYDA 1OOEA 2JAPA 4IJUA 1KEVA 1V3UA 3O8QB 2YY7A 5DN9A 4CV2A 1VKOA 3D3WA 1NWHA 5K0ZA 3NDIA 3OHSX 5G4KB 4A0SA 3Q3CA 3BMNA 3PDJA 1SEPA 4WLNA 1UP4A 1ZK3A 2W2LD 2Q1WA 1QLHA 2DVMA 5I8ZA 2VHWA 3DAPA 4NBVA 4ZA2A 5T5QA 2IE0A 4EI2A 2OHXA 2P5UA 3JV7A 3KRTA 2R6JA 4BNZA 2Q1TA 5L51A 2E6UX 3I3OA 3KEQA 1AUPA 1YONA 1ISGA 3AI2A 5EJ2A 3IS3A 2Q4BA 1U5AA 3QVWA 3ROQA 3EAGA 4ITUA 1A72A 1KEPA 1PL7A 4CMBA 3LQFA 2BI8A 4RJTA 4CM6A 2X9GA 2YV2A 2DBRA 5HA5A 3Q6IA 1ONNA 2AEMA 1ISIA 3JYLA 4CM1A 2J8ZA 3PYMA 3DMYA 4YWJA 2NTVA 4RPGA 4XJTA 1UXJA 3GG2A 1D1TA 1GADO 1XSEA 2Q46A 3WGGA 4GQAA 1LSSA 4PLYA 2PLAA 1P0CA 2V6BA 1MXFA 3K92A 5L4LA 3UXYA 1ZIDA 3UFXA 4DYDA 4IXTA 2AQKA 2G5CA 4IJWA 3C3XA 1LLDA 2I66A 4JQCA 1QV7A 4GKBA 3K6JA 2YQ5A 4FOOA 2Z5LA 4MVJP 2Q1SA 2VYNA 1NNUA 4M87A 1H5QA 5DBGA 2I3AA 3ZV5A 1NWCA 3VPSA 3W6ZA 4UEJA 3NRCA 4OHUA 1Y9AA 1CYDA 1UDBA 4CR7A 4ALNA 1DIAA 3GVXA 5KVVA 1YB4A 2EGGA 2C5EA 4RF4A 4ND2A 3S2EA 4UAGA 5KJ1A 2UUOA 4BGUA 1MC4A 3U09A 5TRTA 4PRLA 2ZYGA 1O6ZA 1P1HA 1PJ4A 3GN2A 3I6QA 1PGPA 2HMWA 2YFHA 1T26A 4E5PA 1HYEA 3PDUA 4M89A 3E18A 1NQ5A 4NBWA 4NI5A 4C7KA 2CUKA 5I7SA 4MIEA 1MG5A 3H5AA 3JQFA 3AUUA 2D2IA 4R3NA 4WGGA 4BGVA 2IYOA 4OH1A 3ZWOA 4B7UA 1G1AA 1ISHA 1C1DA 3TPCA 1UP6A 3I9KA 4BVAA 3WXBA 2EKPA 2HQ1A 3H2SA 3ZCXA 4B4WA 1P45A 4CLOA 4YB8A 4R4JA 4YAJA 2QG4A 4CUJA 1BW9B 2P9EA 1DHRA 4G65A 4TVBA 3OMLA 1NYTA 4RQUA 2E49A 4YJGB 4ZQFA 3QVSA 3DZFA 3QWIA 2BI7A 3VTZA 2YFQA 4DQXA 3FBGA 3IUPA 4HFMA 5IZCA 1IUKA 2O3UA 5JYEA 4WLOA 5T8KC 2FY8A 3E82A 4NH4A 3OJ0A 1ULSA 5KNLA 5HWSA 1LDYA 5DP1A 4O6VA 5B12A 2EJVA 1E92A 4YAKA 1O0SA 1WVGA 3QWAA 1ONPA 3RASA 3IDSA 4DBVO 4U0JA 1Z6ZA 3KBOA 4FFNA 3AUTA 4R1NA 3WSWA 2OBNA 4P22A 4MVJM 3O03A 4TZKA 4L0QA 5JY1A 2Z95A 1C1XA 1BWSA 1ZSNA 3ROMA 1JKIA 3U49A 3AOEC 4XZ3A 1LQTA 6LDHA 1ZMOA 4I5GA 2YJZA 1JKFA 1VC2A 1LDEA 1EK5A 1ZCJA 1IE3A 2D4AA 1E1KA 2FSVA 1JAYA 1X1TA 2HMTA 2NACA 3IKVA 3PIDA 3ZZNA 1B8UA 3TNLA 3JQ7A 1IY8A 3JQCA 3JYNA 4J1QA 4DMLA 1PGNA 2AE2A 3EYWA 3S2IA 1DRUA 1TT5A 5TQVA 4PCVA 1NR1A 2FZWA 2TMGA 3ON5A 4IY1A 3EHEA 5EQDA 3GY0A 1LXCA 3ZWAA 4FJ1A 3GGPA 3AU9A 3DFZA 1HRDA 1ISFA 3SC6A 1B3RA 5A9SB 3SLKA 2B4RO 2P9GA 3W8FA 3OFSA 4HUJA 1EQ2A 2DC1A 3KYCA 4FFOA 1MUUA 2DKNA 4FIZA 1TB4A 2UV8A 1P33A 1ISMA 1RM4A 2Y67A 3ZGYA 4FSHA 5JSFA 2IZ0A 1Y81A 4Y6RA 1X15A 3VTFA 4GGPA 5EL0A 2Q1UA 4EEZA 1YQGA 3CINA 1UXHA 4IQGA 5JO0A 2W90A 4YAIA 5JAZA 1E6WA 2ZATA 3DEYX 4YCAA 4PGFA 3PEFA 2OXIA 2NVBA 3FPCA 5AVOA 2I6TA 4J9VA 1KY5A 2C2XA 1NVTA 4FS3A 2VWQA 3E9NA 1GDHA 5IZCC 2DAPA 2GGSA 1H9AA 4JCOA 4WNIA 4U8GA 4UEKA 2Y68A 3WBBA 3ZWMA 1EDOA 3TL2A 2ZK7A 1C3VA 1K5HA 4BV8A 4Z0PA 4BKPA 4LN1A 5DBFA 3TL3A 4UUMA 2VTDA 5IDWA 1EUDA 2VWGA 4INAA 4LSWA 3DZJA 3AOGA 4BMNA 2GN9A 1JWAB 3I9LA 4NBRA 1EFKA 4ND1A 3BYZA 4HFRA 1FDVA 3EZLA 4RL6A 3H9JA 3NGLA 3NTRA 3ZDFA 1YRLA 3VC7A 3JYQA 3QIVA 3AOEA 1HSOA 5DOVA 2JCXA 2FSSA 3ZHXA 1IYZA 2C07A 4Q3BA 4XA8A 3JD2A 4DRYA 1DLIA 1ZSYA 4BS9A 3AU8A 1W8DA 2VOEA 4H16A 3QVTA 3WX0A 3ONEA 4NPCA 1LQUA 1N1GA 1E1NA 1QYWA 3ZHBA 5K6AA 5IAAA 3GEGA 3JQ8A 4OKIA 1H6BA 2J5KA 3WGTA 2W4QA 4JLWA 1UAYA 2F1KA 2VT3A 9LDBA 4DA9A 3V2HA 4RLSA 4F45A 8LDHA 1ZNQO 4I1IA 4YJGA 2CF6A 1T25A 2DBQA 3KM0A 4OAQA 1K3TA 3C24A 4NJMA 4S3MA 3UKOA 5COQA 2A92A 3WIEA 2BH9A 3G3EA 3LDHA 4E3ZA 1Q2XA 3ONDA 2E37A 1E77A 1G6KA 3HWRA 1GUFA 4R41A 3SLGA 1E1LA 4J7CA 4N18A 2ILTA 3P19A 1F8GA 3L9XA 4U0KA 1HSZA 4CQLB 4CV1A 3RI3A 5KJFA 2YQ4A 1DAOA 1CETA 1XGKA 3OQ6A 3OBBA 3RJ5A 3VH1A 2OZPA 4KWIA 4ZJUA 2NU8A 4WCDA 3VZPA 4J43A 3S2GA 4DIBA 5COAA 4B4OA 2Q4EA 2WM3A 3I4FA 2B83A 3AY7A 3KLPX 5CFZA 3DZHA 4D3DA 3C7DB 1U8XX 1JW9B 1P0FA 4HY3A 3RCBA 3RC1A 4XR4A 9LDTA 5IFLA 1YO6A 1VRWA 3TDKA 2BD0A 4MKXA 4GI2A 4GX2A 4BL5A 3PP8A 2WWRA 1VL0A 2AG5A 4R1TA 2QRJA 2VRBA 3KV3O 3GVPA 3JQ9A 4QFDA 3AJRA 4ND4A 4YJFB 1UJMA 3JD4A 3L0DA 2X0JA 3GGGA 3IOYA 3H3FA 3QLJA 5L4SA 2G76A 5IDQA 1HE5A 3ZI0A 5DCWA 1TT5B 4XWYA 1K6XA 1JU9A 3LT0A 3B20A 3ST7A 4BKQA 2PKRA 1NPTO 1Z7EA 4U6QA 2PK3A 4J0FA 4XRRA 2FR0A 1PR9A 1T2FA 3AW9A 4PLGA 4O63O 1QLJA 5A9SA 4TWRA 4B8ZA 4CLRB 3OQBA 1M2WA 5AXAA 1G0NA 4ND5A 3F5QA 2PKQP 3RROA 1CIVA 3FWNA 2BRUA 1KERA 1DFIA 2CMDA 3SXPA 4J1NA 4OQYA 5G2OA 4Y98A 1H9BA 4E33A 1KVTA 2FRDA 1Z7BA 5ITVA 1R0SA 2PKQO 3IUSA 3WQRA 2J3IA 1HYGA 2O4UX 4PLPA 5IN5A 2BGLA 1GZ6A 3QWBA 2X4GA 3RU7A 4BNTA 5L53A 1S7CA 4N5LA 1CJCA 2OOSA 1ENPA 5JPIA 3VVBA 4BNNA 2V7PA 2YHIA 4DWVA 4JN6B 3NT2A 1BG6A 3DBHA 1YGYA 4A10A 5FFFA 1Y8RA 5GZ6A 4NK5A 3LLVA 1YOVB 3GUYA 1UR5A 2WD8A 4IM7A 2P5YA 5EERA 1PIWA 4LCJA 1WNTA 4MKRA 2E48A 4HFJA 1DLJA 4MVJG 3JYOA 4TKLA 3OF2A 1A9YA 3DZBA 4XD2A 3MTGA 1QYVA 4CM3A 3L07A 3AM4A 4A27A 1R15A 3E9MA 4YT2A 3NGXA 2LDBA 4N5MA 1QYXA 1H93A 2VHVA 5AXDA 3ZHZA 3TFOA 4TQGA 4RCVA 1C0KA 2W2KA 1I0ZA 1NAIA 3E03A 4IBOA 5BR7A 4XKJA 4DTIA 4D42A 1EDZA 1GD1O 2EP7A 4G2NA 2WE7A 4EJMA 1DXYA 3C7AA 3TJRA 4CQLA 4TROA 2H63A 2VZ9A 4EGFA 3A06A 4NHEA 1KS9A 1YL5A 5AYVA 4OMUA 1X13A 3W4IA 4P4LA 4IMRA 2IEBA 2D5AA 3U4CA 4R01A 3DBVO 4AJLA 3OA0A 3Q1LA 1U3UA 2NWQA 1ZJZA 1C14A 5A03A 2RIRA 4ZU3A 3TZQA 3QVXA 1IHYA 1MLDA 2QZ9A 2HJSA 2Y1DA 5HM8A 5KIAA 4E0BA 2FMUA 1GAEO 2OORA 3MJCA 4J4HA 1HDRA 1U5CA 4KQWA 3K9QO 3EY4A 2Q2VA 4GLOA 3B6ZA 1E7MA 2I5PO 1XQ1A 1DOHA 4YBZA 4A5OA 4IZIA 3JSAA 4PLVA 4ID9A 2EW8A 1ADBA 3N74A 3UVEA 2V6GA 3TZHA 1HF3A 2JCVA 3GRKA 3RU9A 5HBRA 4TKMA 2PTGA 3ETGA 2DFVA 1FF9A 4RVUA 1G0OA 2A4KA 4EJ6A 1NX6A 4Z0TA 3ZNOA 2G17A 1E3WA 3DOJA 3IIEA 4ZQGA 2ZB7A 4CMEC 5KOIA 1LBEA 5I9NA 1Q7BA 3BMOB 3D5TA 4LW8A 1DO8A 1AHHA 1GQYA 2ZQZA 3GHHA 3INRA 4DQVA 4CLRA 3ZHYA 2Q2WA 5L4NA 2G82A 1ZH8A 1YKFA 3VH4A 3F1LA 4D45A 5BNFA 2IZZA 3DOCA 1ZSVA 2YW9A 4YJHA 1R4NB 3GN1A 1K6IA 5A04A 5BSFA 3H7AA 4ESOA 3ZWCA 3I83A 2BFMA 5MGBA 2V65A 4BNHA 2O3TA 4CL8A 1C0LA 3NEPX 1RYEA 2NVUA 1H6CA 3G49A 4FB5A 4IZHA 5CDGA 2YV1A 3ANNA 3GUCA 3GGOA 4EW6A 1EUZA 4CPDA 4OOFA 5IJZA 1T4BA 1GU7A 2RHCA 2YDYA 2PZMA 3RUCA 1PL6A 2C59A 3GF4A 3OA2A 3RFVA 3VVCA 5G0VA 4YA6A 3LU1A 3KYBA 1H6DA 1BVUA 1LC3A 1TA4A 4H3VA 2XF8A 4D41A 1EBUA 1P77A 3DZIA 1LSJA 3PVZA 1V3TA 4W9NA 4AFNA 3WLEA 5GMOA 5HS6A 3L4BA 3NJ8A 4R5MA 5CG1A 4UUOA 2VYVA 2NV6A 4XGKA 1KYQA 4IJVA 3OIFA 4D44A 3Q11A 4I5DA 1ZK1A 4CM9A 4DC1A 4IQ8A 3HDYA 3WYBA 1EVJA 1LDMA 4CM4A 4EZBA 5IXYA 4JBHA 3COSA 1MX3A 1ZXBA 2VZ0A 4R54A 4WCFB 1Y8RB 3F4BA 3HQ4O 3H3JA 1PQPA 1VJ1A 4IDCA 2C54A 1PEDA 3ABIA 3LC2O 3GMSA 3CZMA 4L4XA 3VDQA 2C5AA 3DHYA 4LVUA 1AXEA 3SBOA 5KJ6A 2WEKA 1XEAA 4AICA 3ZWNA 1NPYA 4JX8A 3B1KA 2Y05A 4RLHA 5A3VA 4E21A 4QO7A 1U3WA 4U5QA 4Z0HO 3WYEA 4DLLA 1JVBA 1V8BA 4CM9D 5JMPA 3T7CA 4NQZA 3RBVA 4K6FA 1EVYA 4K26A 2EJWA 2I9PA 4IJKA 4NBUA 1NXQA 4BOYA 3ZV6A 1ONOA 3E9QA 3PK0A 3PFWO 1KVUA 3GZ4A 3WGZA 3H6KA 3GPDG 2J6IA 1H6AA 3DHNA 4L4RA 1NVMB 3LK7A 3NTOA 5IN4A 1WWKA 3FN4A 3PIIA 4CM5A 3N7UA 4NFHA 2P4QA 1YDEA 4J91A 3WNQA 2I65A 1IHXA 1O5IA 2EIHA 2HK7A 1SAYA 1FXSA 1PS9A 2JFFA 2O7SA 1AE1A 4J4BA 4KWHA 4PG7A 4A7PA 3M2PA 4OKNA 1XKQA 5CDUA 4YR9A 3DONA 1F12A 1VLLA 5JO9A 3SVTA 2NTNA 3BXXA 1NQOA 4CQMA 4Q3AA 1B0AA 2JFGA 1P1JA 4UVEA 1JA9A 3WJAA 3ZU2A 1WPQA 5F5LA 2HRBA 4E5MA 1SNYA 3CTMA 1HKUA 5DT9A 1HTBA 2JL1A 1KVQA 2HMSA 1MV8A 2GR9A 2TMDA 1R66A 2O2SA 2X9VA 3RJ9A 1MP0A 1C0IA 3E8XA 3PRJA 3EC7A 3GNQA 1E5LA 3NT4A 1ZO8A 3NDJA 4ALIA 4QO8A 3DWFA 1PS0A 5JAQA 2NVUB 1R12A 1RM0A 5TNXA 4NFSA 4IDAA 1P1IA 4WNCA 2POQX 5JFOA 2Y1CA 3OSUA 3CKYA 3WGHA 4ZGWA 3LF1A 3MJ4A 4PVCA 2FWMX 3LC7O 3ETEA 2Q99A 4Q3CA 3S1LA 1E3EA 1CEQA 4ILKA 1BXKA 2F00A 3B1JA 5ILOA 3TFQA 1LLCA 3KYDA 4BKUA 1MXHA 4PN3A 3A9WA 3KETA 3I9MA 1SB9A 1P44A 1LJ8A 4GVXA 3UCEA 1HE4A 1JDJA 2XOXA 2CVZA 4PZEA 3F5SA 3FNHA 4GH5A 1EBFA 1WXDA 1BDMA 1WLYA 3PHJA 1PL8A 3MJTA 2UAGA 3F3SA 4HNGA 4P4GA 1ORRA 3SC4A 3V1TC 4DC0A 8ADHA 2NLOA 3BZUA 5A5EA 3DQPA 3LF2A 2V6MA 4E2WA 4YPOA 1CQJA 1N8KA 2HJRA 3A1NA 2VQ3A 5ADHA 1Y5MA 3W1VA 1YDWA 2Q50A 1H94A 3GAFA 1FDTA 4O0LA 1TVEA 4XCVA 2DUWA 1HXHA 4BO6A 2JFHA 2UYYA 4BNLA 5L7WA 5H82A 1I3KA 5F1OA 4HXYA 2VUUA 2J5QA 5BSHA 4WK6A 4UVDA 5H81A 4OM8A 1MGOA 4W6ZA 1I01A 3PGXA 4CUZA 4ZRMA 5ENVA 4L9RA 3WJ7A 4CM4B 1R4MA 5G0WA 5K9ZA 1OC2A 1W6UA 2IXAA 2BFAA 2H1SA 2I99A 5IZ4A 3TZ6A 3O8QA 4ND3A 4NNJA 5G4KA 4D79A 3ASUA 3I9OA 5KJEA 2BFPA 4L8VA 1PQWA 1UXGA 2GDZA 1I8TA 4BNGA 1UDCA 1KEUA 1N92A 2CSUA 3O38A 1NQTA 3DC2A 3C7CB 3D1LA 5DNAA 4J3FA 1F17A 1R6DA 4OO3A 4J49A 2Y0CA 3KSZO 1E3IA 1W73A 5L9AA 4D7AA 3QRWA 1GR0A 1YWGO 2AQHA 2D3TA 4QXMA 4NJOA 3FR8A 3R3SA 4D0RA 2B5VA 1EEHA 5T6BA 1KEWA 4MIOA 1QSGA 2DTXA 4J6FA 2O4CA 2X0NA 1YL6A 2X9NA 4XJSA 4R68A 5A06A 4IIVA 2OBYA 3S55A 1X0VA 3LZ6A 2DU8A 1T24A 4TVOA 2A35A 2VNSA 3F4LA 3OJFA 3ZU4A 2A94A 5DULA 1SPXA 3UUWA 5AQ1A 5TC4A 3MOIA 1WMAA 1B15A 3TZKA 5JDIC 5JE8A 4R51A 5FEUA 4CQMB 4UREA 3TF5A 1E7YA 5L95A 3I5MA 3U4HA 3ASVA 5CEEA 2ZTUA 3DTTA 1PJLA 2PV7A 3BHMA 3BMQA 2Q49A 1NR7A 1O95A 3DZGA 5KVCA 3ZNNA 2YUTA 4OL9A 4WJZA 5U9CA 4MO2A 4GBJA 1B8VA 4CLOB 2ZTMA 3JD3A 3N58A 1SBYA 3GR6A 1DPGA 4XQGA 4AG3A 3CMCO 5K6AC 1PS8A 4J7XA 4FC6A 1UH5A 4B8WA 1XR3A 3NTQA 1HWYA 1GFSA 2ZCVA 3WGYA 4EJ0A 3PQEA 4WCFC 3ENKA 4IS3A 2ZQYA 4B4VA 3ANMA 3NKLA 3E1KA 4G81A 4HX5A 3LC1O 3OETA 4WLFA 1EUCA 4JJFA 4B7CA 1ISJA 3PWZA 5B37A 1SB8A 1T2DA 2QYTA 1BSVA 3ZV3A 3AUSA 3G1UA 4HBGA 4AJIA 1KETA 1LRJA 4J2OA 3DXFA 3G17A 5EPOA 4BHTA 4EUEA 4JNKA 1UXKA 3UH1A 1I5RA 3FPLA 1DFGA 1TT7A 2D5CA 3PLRA 4Y6PA 1ZK0A 4CR6A 4BUCA 3ZWVA 1ZBQA 4IGEA 2CY0A 3U5TA 4X54A 2AE1A 1X0XA 1DIRA 2Y1GA 1KY4A 3VPXA 4EDFA 3EVNA 2FR8A 1N9GB 3VZRA 3L77A 5EIOA 1WZEA 3CXRA 2RH4A 4URFA 2D8AA 1PGJA 2CDBA 3ROPA 3TOXA 4BO1A 4CV0A 2AW5A 3RBXA 5ENDA 4W4TA 2HUNA 3UN1A 5GZ1A 3KOUA 5U1PA 3HG7A 1PWZA 2B4QA 4YRDA 5TF4A 3W4JA 5ER6A 1XLTA 3OIDA 3QVOA 3DTYA 4XGNA 2B0JA 1I33A 1A9ZA 2ET6A 2OO5A 5A9RA 3AFNA 2JHFA 3X2EA 2YHUA 3ETDA 4AJ4A 4B79A 4RORA 4JROA 5CDTA 2H5LA 3AY3A 4Z6KA 5I9MA 1PZFA 2XPCA 3DBLB 2CF5A 3WFJA 5C5IA 1P1RA 3PWKA 1P9LA 3CSDA 2UVDA 4E4YA 4ZVVA 2XAAA 1L7DA 3WMWA 4OXKA 3K5PA 1PJBA 3KZVA 5GY7A 1LLQA 1GUZA 3QWFA 1UZNA 4DPLA 5T64A 5LCXA 2DLDA 1ZVMA 2WYVA 1X7GA 1IPFA 2VOJA 4RDHA 3JQBC 4FFRA 2Y0EA 1QYCA 1QP8A 2P9CA 2O3RA 4K9DA 1MFZA 2UDPA 3E5RA 4LGVA 3OJOA 1E3WB 4E30A 4E5KA 2DPHA 1P1FA 2XXJA 6ADHA 1Q1NA 1PU2A 3KB6A 4E5NA 1DIBA 4XYGA 4FDAA 1SOVA 2I76A 3RUAA 2OFPA 2VNAA 3JQAB 5A9TA 2GZ2A 5A05A 3DBRB 1JLLA 4KQXA 1R16A 2O3QA 1GY8A 2C7GA 3C1TA 1SOWA 1M66A 2HRZA 4XYMA 1IOLA 3RUFA 3MWEB 2EP5A 3CUKA 4MVJE 3EGOA 5LC1A 2QZZA 3HB5X 4J0EA 1B14A 2W8ZA 2Y1FA 3QE3A 2C20A 3ROKA 2AA3A 3HDJA 4GWKA 5COBA 1Y7TA 1HT0A 5JCJA 4IQ0A 3RUHA 3ZWPA 3MTJA 3KEOA 2GPTA 4IDFA 1HDYA 3OH8A 1I30A 4GX0A 3GFGA 3SJUA 1WW8A 1R0LA 3D4OA 3QHAA 3HB4X 5DP2A 5JCJD 3F9IA 3K2EA 3ONFA 4NIMA 2X5OA 5L7YA 4EUHA 2I67A 4MJLA 2NM0A 4E12A 4B3JA 2VRCD 3M2TA 2FPIA 2GUGA 3Q9UA 1NBOA 5C7LO 4KTVE 1NQAO 3VZSA 1HDXA 1U28A 3DFUA 4AJOA 2OGUA 3PXXA 4EEXA 4PLWA 1UZMA 3QW2A 5JAIA 4I5FA 4LRTB 2B35A 3O4RA 4LSMA 2EG9A 2FPGA 5ICMA 2ZKLA 4ONEA 5JYDA 3T7EA 1F8FA 4KTTE 3U3XA 5BT9A 3D3WB 3OEYA 4M55A 4UVIA 3WGIA 3UW3A 5BNTA 3Q9NA 3BMNB 3IP1A 4OQZA 5EN4A 5JBIA 5THQA 1LTHR 4GGOA 4M1QA 3WBFA 4U6SA 5TLSA 2EEZA 1D3AA 2VWHA 1HYHA 3JQ8B 1UAGA 1PTJA 1ADCA 3AUAA 3BTSA 3PWSA 4GKVA 4L73A 4I9UA 3L9WA 1M67A 3I52A 1OFGA 4L4SA 2VCYA 3FI9A 3GNTA 4QQRA 4EYEA 3K2BA 2H9IA 2JD0A 1E5QA 4Z9YA 1KVRA 1ENZA 4PLFA 3IJPA 4LMPA 1U4OA 2NU7A 1H2HA 2Y1EA 5KVSA 5KVQA 1E7SA 5DBIA 3JQEA 4B3HA 4FOSA 1GV0A 1QV6A 3CH6A 3FWZA 1P31A 3HDHA 1Q0QA 4S1VA 4AJKA 3MOGA 4FW8A 2B4TO 1LRKA 4D3FA 1ZUD1 2WYWA 1CDOA 1TXGA 3UOGA 2IRWA 4A03A 4WKGA 1Z73A 4E13A 1WP4A 1BXGA 4BNVA 3V2GA 1EK6A 4ROSA 1LI4A 1U3TA 3ZNPA 2BLLA 1IZ9A 4TMFA 5TS3A 3WQQA 2RH8A 5CDYA 1VKNA 3CMMA 2BFOA 3BA1A 1I10A 5CEJA 4JK3A 4QX6A 1YOVA 2YDXA 3NAQA 1EVZA 1F06A 2NU9A 3HUDA 1CERA 1GCUA 5G0TA 4QEDA 1GYRA 3G79A 3DBLA 3RC9A 4D3SA 2BGKA 5FI3A 4D43A 2CFCA 2QIOA 5A3JA 4XYEA 1LDGA 4HWKA 2C7VA 3IMFA 4YJDA 1SMKA 3KYDB 5T67A 3PJEA 1ZEJA 1HL3A 4JIGA 5AXCA 1HETA 1N1EA 2FZEA 5F21A 1LU9A 3WICA 4CQMD 4KOAA 4BB6A 3ZH2A 4DMMA 1A7KA 2EKQA 5JDCA 5TT1A 1I2BA 4E32A 1U2GA 1DIGA 1M76A 4CLXA 4JBGA 3C1AA 1X7HA 2O50A 2C2YA 2X7HA 4HKTA 3T4XA 2GNAA 4JP3A 3BTVA 3GPIA 3QV1A 3IQDB 4YRAA 4PG5A 1LDBA 1OI7A 3BAZA 3LT4A 3RC7A 4UVGA 4YT8A 1ZFNA 2QYSA 4BGEA 3PJFA 4AVYA 3DBRA 4FR5A 3BTUA 1PJ3A 4YAGA 4Q3EA 1BRMA 3AM5A 4IINA 4Y6SA 1EZ4A 1M6HA 3WB9A 1ZKMA 3GQVA 1NHWA 5F5NA 4DVJA 5ILGA 2GLXA 4NMHA 4QECA 1N7HA 1U4SA 4BQRA 4L75A 1Y1PA 5I9LA 4FCCA 3V2UA 1DB3A 4PLTA 1PJSA 4II2A 4M8SA 3JQAD 4PZCA 1TLTA 1E3SA 1LC0A 2PZJA 4A73A 3QQPA 3GH3A 1I3NA 1XG5A 3GNSA 1N2SA 3ZU3A 3NUGA 3JQFC 5A5FA 3O9ZA 3HZZA 4O59O 2LDXA 1C0PA 3VPHA 7MDHA 2VWPA 2ZJ1A 2O23A 4RQTA 2ZIZA 2YZ7A 1YBAA 2PFGA 4DGSA 5LDGA 1BGVA 3GEMA 4CJXA 3P2OA 1YBVA 1MB4A 2WE8A 3JD0A 3FR7A 2IYPA 2O7QA 4OJNA 3B1FA 3RD5A 4RGBA 5C3MA 1O8CA 3CZRA 2O3JA 1NHGA 4R1SA 3OECA 1X14A 3INGA 3EUWA 1E3JA 3PPIA 2GF2A 5T8KA 1XIVA 1V0JA 3JCZA 1PGQA 1U8FO 2VN8A 3R0IA 3IP3A 4JJIA 4KMSA 4BO8A 1DBVO 2JD1A 1LSUA 3IC5A 2WD7A 4YEDA 2PNFA 1W4ZA 4UUNA 4CMIA 1VPDA 3TWOA 1ULUA 4BNJA 2PH3A 4PLCA 3HFSA 5JDCC 3X2FA 3WWYA 4I5EA 5JW6A 1Q0LA 1PR3A 2HSDA 4FN4A 1FK8A 1J5PA 2BKAA 2NADA 4HP8A 2NQ8A 4MPDA 4MVJI 5CHEA 2HMUA 1VE9A 2PD4A 3M1AA 3WSVA 1YQXA 3TSCA 4HFNA 1SO8A 3VZQA 2DTEA 4IDBA 1HLPA 2DPGA 2FP4A 3H2ZA 4BNWA 4ZHSA 4XX0A 4MIYA 4RO0A 2H6EA 4IDEA 2EHDA 5JMWA 1E3LA 4J7UA 5DCYA 1GEGA 1HDOA 1HE3A 2EGHA 4YT5A 4YAEA 4BNKA 2FPPA 1YQDA 3GDFA 2ZB8A 4FJ2A 5LDHA 4BNFA 4RPKA 1PQUA 1HZJA 4J2HA 1ZZEA 3K73O 4PG4A 3RIHA 3GEDA 3VKUA 1PGOA 1K2WA 1N7GA 2AMFA 4R3WA 3MEQA 4CMCA 2VT2A 4DYVA 4EITA 3M1LA 2GZ1A 3BHJA 4GLLA 1VJTA 1IB6A 2GN4A 1YE3A 1LLUA 4MP3A 2ZB3A 4YQZA 3S2FA 3SX2A 3WWZA 4RVDA 5TJHA 4WUVA 4CUKA 1EMDA 3H5RA 3JD1A 4OGWA 1ENYA 1YXMA 2VTEA 3CPSA 2PGLA 3GVHA 1R4NA 3L6DA 4YDRA 1ADGA 5JXWA 1EE9A 1O94A 1PX0A 3C1OA 4LK3A 5KKAA 1U7HA 4B7XA 5TIIA 4NR0A 2YV3A 4YVFA 3GRPA 5B1YA 4H15A 2B37A 2WTBA 1N9GA 1EVIA 4UULA 3JQ9C 1T1SA 3FF4A 1NAHA 2EKLA 4J4TA 4DBZA 2CVOA 4WLUA 5FI5A 2GYYA 5L7TA 4G5HA 4CLEA 2IZ1A 1IULA 5EQFA 3VPFA 4BO4A 4D46A 1UUFA 1ZMTA 4AJ1A 4BNYA 4R69A 3P7MA 4ZRNA 1PZEA 2OUIA 3PYLA 4L76A 1GYQA 3UCFA 3ITDA 4WOKA 4TRRA 4ZQBA 4CL3A 4BB5A 3UAGA 4W99A 1Y8QA 4E6PA 3GZNA 4PG8A 2HO5A 4LISA 2OP1A 3U4IA 1AXGA 4P8RA 1SCUA 2J3HA 1GPDG 4RF5A 2PGDA 2VYVD 3H9GA 5TT0A 4C7JA 1I2CA 2X23A 4JBIA 4FFLA 2Y1OA 3C85A 3KLMX 4XQ9A 4BGIA 4F3YA 4GWGA 1A7AA 1GCOA 3WGQA 1PJQA 2VYND 4DQUA 3PHHA 2BELA 3E5MA 4BO5A 1Y5RA 3HE3A 4XIJA 3BMCB 3PQFA 1WDKA 2AG8A 2J3JA 4J1SA 1NP3A 2EERA 3RUEA 4R5HA 1D1SA 3KVOA 3PHGA 2PY6A 2DM6A 3JTMA 4WLEA 4PIVA 2CVQA 4CMAA 3GFBA 4OXYA 2R00A 1B8PA 1PSDA 3WFIA 1GUYA 4RVSA 3RC2A 3UCXA 1LX6A 3DZKA 5EINA 5DZSA 2J5RA
chains in the Genus database with same CATH superfamily
1HG1A 1Z15A 2BUBA 2AYXA 4J1TA 4AMBA 3AKYA 2BJWA 2P11A 4BO7A 3PC8C 1G4UR 2O8DA 1GARA 3KOXA 5HUJA 3L06A 1OUMA 3JPWA 4NBSA 4EM6A 3I01A 3RVBA 3I04M 1V45E 3I9FA 2GRAA 5KWEA 2JKZA 3B3AA 2NP6A 3IKTA 2PVSA 1N6KA 3GD7A 3UAZA 2F3RA 1EIWA 1Q1ZA 4B3CA 3GK3A 4HTFB 2WU4A 1EFLA 1EINA 1UOPA 4PIMA 5EMKA 1RXSA 1CR4A 2IP2A 4G37A 1H1DA 1G7TA 1I3LA 3HC7A 1GZVA 1G3RA 2EJCA 3LL4A 1GHTA 3NU1A 4MHOA 4PS1A 4B5KA 1JSLA 3DAGA 1LNQA 1P74A 2YJ5A 3I6IA 1N0HA 1EKXA 3CA8A 2BDEA 3FPSA 4RW0A 5AOBA 1W1IA 1MO2A 1U7UA 1NE7A 3NV7A 3TFWA 3TZCA 3FROA 2ZRKA 4JEIA 5C1OA 5JNRA 4HDAA 2W2QA 1C41A 3SR0A 2LNDA 1Q7CA 1FY2A 3M6IA 1X1QA 3Q2KA 3AR4A 3PXEA 1IJKA 1QR2A 4EB8A 3NV9A 3AJDA 2HKIA 2QZ4A 3PHLA 4Q03A 5TVGA 3TLAA 4ER6A 4PSAA 1YZKA 3KDSE 1IXSB 2NSDA 3HSKA 4E1AA 5JIBA 2ZYUX 1JJBA 4IOMA 2J07A 2VBCA 4JXJA 4KXUA 3GIDA 3TW8A 5I48A 3K9FC 4RPLA 4TWZA 3TEMA 1H8ED 4HADA 3ICQB 3IIIA 1QHYA 3FY4A 4CLDA 1NSTA 1OX4A 4LRSB 5FOQA 2VJKA 2QEQA 2IUFA 4DV1B 4MQMA 2CJPA 3ZLJA 2JCYA 4G0VA 4B2PA 1S4QA 1WABA 2OVBA 2YN4A 4FHDA 3X1XA 3IE0A 1D2MA 2O8EA 1UFRA 2RAFA 1QRRA 1GO2A 3NBQA 4LYGA 2XVZA 3VPDA 2OGZA 3SQWA 4M9RA 2P68A 4KQ9A 4R8KA 1LDNA 1VJ5A 3OE7D 3OAAD 1BGWA 1AKVA 4B44A 5TPZD 4B8YA 2QX6A 1DKQA 1PT7A 2FUEA 3LGAA 3VKHA 4DPMA 2FN4A 4JUBA 4MJXA 1IB0A 3D6JA 2L2QA 1Z82A 1I2AA 3RUDA 4M0UA 4C4OA 2W6OA 3UKJA 1W48A 2W93A 3ZI7A 2Z1NA 5CCEA 1UF9A 2W2KB 2I34A 5B4VA 1CRZA 3RYHA 1Q14A 3O8OB 5J40A 1T8TA 2HA7A 4IMJB 1MC5A 4RZQA 4WE3A 1EQAA 4HRXA 4YYZA 5BQFA 2I80A 2BUAA 1YJ8A 3C1UA 3O1JC 3T1VA 1LWOA 1D0VA 4O2RA 1EWYA 1RMYA 4UFOA 1ZJYA 2C98A 1I24A 5AO9A 4BXOB 1THGA 4D26A 5LWHA 2YMLA 2VAXA 1QNFA 3BMCA 1ARZA 1V6AA 5DHQA 4Z5XA 1CXZA 5IWAB 3D2BA 3D7KA 3OE4A 4IXWA 1VI2A 2BFCA 1VE3A 4MYSA 5ERXA 5D3KA 3WHLA 4LOKA 2FGKA 4MICA 4XGIA 3FYHA 4IS2A 1G5FA 5IT0A 2DKFA 5LU8A 5LKRA 2MINA 1Y33E 3MB5A 1RYDA 2TSYB 2ZI9A 5FXMA 3S5UA 1Y7IA 5G4LA 2R4TA 3DMGA 3RQIA 1EK1A 4E09A 4E2ZA 3KLBA 5EIEA 3FNFA 3P52A 4C0XA 4CCSA 1ZR4A 4FGWA 2PZKA 4U2KA 1XDDA 4L2IA 3BF8A 3CJQA 1Q1QA 2QHXA 3CH5A 3JQ7B 4L27A 1RADA 3VH2A 3OPQA 4DCSA 3NATA 4G5GA 5BV2P 3JQGB 4DJDC 6GPBA 1U7DA 2PA3A 2PRJA 3L4SO 1K6JA 4HS9A 4ZPXA 1GM5A 1KHTA 1V8ZA 3O7WA 2RARA 4KRGA 1YI8A 1KORA 1GFZA 1KMIY 5G53C 3GG9A 2IHYA 5ES3A 3A9UA 5HIIA 4GE0A 1K5DA 4YP5A 4KBFA 1MVOA 2QX7A 2PZLA 2XMGA 3LVRE 4HWOA 1R6AA 1U2DA 2WSYB 2QORA 2YIJA 3D4BA 5LB4A 5A4DA 5K0BA 2FTKE 3WYCA 4NL4H 5DISB 3NT5A 3MVEA 4A2CA 4AZTA 4E51A 3TBKA 4N5NA 1R50A 3QXHA 4KODA 1C30B 2TYSB 4PAOA 5C4GB 2B0CA 2QP4A 5D6NA 4C4PA 3RAFC 4GI7A 4KR0A 2WG0A 4X8MA 2XE6A 4JKYA 1LS6A 3OM9A 4R1UA 4RA6A 1MHTA 1ESNA 2WHQA 1PR4A 1OYWA 3JQQA 4A8PA 1JQDA 3KQKA 1UMBB 1E4EB 5SV2A 1XEWY 2C82A 2CDRA 1G64A 2PBRA 5K5EA 4O4LA 3KR0A 2BHLA 1SG0A 5ESWA 4UPVA 4C0JA 3CRNA 3FG9A 1CVIA 2F67A 1VHQA 1OJLA 2PA0A 1ZM4A 1BS1A 1ZJ4A 3C98A 3QX7A 2BZSA 5DH9A 2O2GA 2WZDA 2W70A 1SQFA 4OBWA 1T9CA 4RAOA 5FTJA 2B8NA 2A33A 3AHIA 1OWPA 5IDXA 2AK3A 2HAEA 4ER0A 3KTDA 3RWBA 4BMZA 4WFQA 2V7EA 4RE6A 3H8VA 5IXJA 4QYWA 1XDGA 1AV7A 4H18A 1KYZA 4YXWA 3F98A 1I6LA 5FNVF 1SJ9A 1Z37A 2DPXA 4TSKA 2XLBA 3ESBA 3VBEA 1N8TA 1WPGA 4IZ6A 5F51A 3LPDA 4D0GA 1J2YA 3A8TA 4QBKA 1XA0A 3NXSA 3MYRA 4J2TA 3JATA 3OPMA 4U00A 3E22A 3UB4A 2IE8A 3V4PB 2Q5JA 4FGSA 1YBMA 3PVSA 2G04A 2JNWA 4HVLA 1E5XA 4ZZ2A 2RGYA 4TRNA 3W3ZB 3WNDA 1V7CA 3OURA 2DKOA 1X92A 2YJ4A 4CWAA 2DETA 1WUKS 4LF5B 3QU2A 4C0BA 5LQAA 2QTNA 1IJFA 3A6HA 1DSSG 2X0IA 1T43A 4UARA 4OUKX 2FQXA 4BNIA 4BTLA 4E07A 1WEKA 4F6LA 1KO5A 2XIQA 3PQ4A 1N2BA 3A1WA 4ZO9A 3IFSA 4ZK2A 5I7FA 2XGGA 3BB1A 1DIOB 1KYYA 2G0AA 3HFGA 3ZEIA 1WDWB 821PA 3A6JA 3K0BA 4CMJA 2ZM5A 4B34A 4ALKA 3MXTA 3NVAA 4B4KA 5NLLA 4FE4A 2X0FA 1E2KA 2BIFA 2HSZA 2EHJA 1F5SA 1GEEA 3SJCA 4JHLA 3DOUA 3KKZA 1MZVA 2QUIA 4Q7EA 3DC7A 3SQMA 3EZ9A 3WNVA 5CJ2A 1N75A 3WLRA 1QM5A 1BE8A 4BDSA 3FCXA 4DWOA 4F6CA 2OK7A 3QM1A 4GNKA 4NMWA 3BH7A 1RU3A 5TJ9A 2OLEA 3NLLA 4Z4IA 1CQIB 2QJTA 3P0RA 2VK1A 5JWRA 2GASA 2WABA 3A6GA 1BX0A 4OIFA 3WJ2A 4HDKB 4YJ2F 4F11A 5LSAA 4LYHA 1AUQA 1PE0A 1JGTA 4IGFA 1DO2A 2FLVA 3EOBI 3H9UA 3V1LA 2GPSA 2VHXA 2GPNA 3EYAA 1DOAA 4LCBA 4YONB 4CV3A 1YB5A 1ADFA 1TIPA 1VSUA 2ANBA 2LUOA 1O2DA 3OPYB 3LO5A 1MOPA 3L4JA 1RLTA 2BEUA 3WLMA 2GZ3A 4KLZA 4R2MA 3DVAA 1UAAA 5AK0A 3PC7A 3VDRA 3JS5A 4QE3A 5K8TA 4QELA 3OE1A 4EG4A 2Q4RA 521PA 5IJ0A 3LFUA 4H7IA 1G5HA 1A1SA 1V1RA 4F2PA 3CZCA 4A8JC 1BROA 1KR2A 3MT0A 4Q3KA 4FZVA 2QZSA 2VIIA 2O19A 1ZOLA 2V0GA 3QP9A 4GYKA 4CR8A 4PHHA 2R4QA 2DQZA 4YDHB 2JK1A 1J49A 2XOEA 4Z2AA 1HDIA 1DXQA 2FFHA 2PX3A 3IKMB 4TKVB 3WMRA 4AF7A 1KH3A 1U65A 4ZN6A 1P3DA 3BK7A 3OIGA 3I2FA 3NDRA 1GTMA 2N42A 2VH2A 3UMRA 3OEWA 4RZHA 2IQIA 1JR4A 1QO0A 3I9JA 1H2WA 3C14C 3D64A 1A8HA 3ZW8A 5FJIA 1DHTA 2QWXA 1U7WA 2JGEA 4YFVA 1BE1A 3TRFA 4TLDA 4TTVA 1LPSA 3ZBUA 4YV2A 4U7JA 3Q5EA 5C1BA 4HCJA 2X2PA 1KSGA 3Q98A 1JV2B 1RLOA 1S6YA 1XZ8A 1SOAA 3NC4A 3CEMA 4FT2A 4W1QA 5EZYA 4BJHB 2PMWB 4CMGA 4DMHA 4QRDA 1PNQA 2GKOA 3ZU6A 1VSVA 3PA6A 3DGEC 1PG5A 4JDUA 5AW9A 5LXTA 4PR3A 4PNHA 3Q3VA 3V32A 4TZTA 3LLMA 4DLKA 3I92A 5FR1A 1B0UA 1J07A 3W8EA 1FDWA 1NJ2A 3RKRA 2JD2A 4WPGA 1KOFA 2YHSA 2PH5A 1BH2A 1EH5A 2WU0A 2R1VA 1AD2A 4KIJA 5BQ3A 1B6RA 4TS4A 3DDZX 4DAEA 4IG4A 1VLZA 3R6DA 1DMRA 5HCIA 3UPTA 1ZM3A 2F3QA 2DMRA 1UFQA 2XGMA 4XQ0A 4BO0A 1L7RA 1QF9A 1SXJD 3VO9A 3WTCA 5CK4A 1JE1A 1CPYA 4OYHA 3ZWWA 5AM2A 2FUKA 1QONA 4TV9B 3IPAA 1K08A 3K6KA 3TQCA 1SXJE 3C6KA 4R2IA 3WY9A 5J43A 2DLCX 2Q5QA 4MX8A 3CZ9A 4D4LA 2PLNA 4RSMA 1O9BA 2OCAA 1YI1A 1YKGA 1RRFA 3ZUPA 1PJTA 3PR1A 2HFJA 3ONWA 1EFAA 3TZLA 3FNRA 4QYIA 2VVTA 1PDVA 1THTA 5HIKA 4CXMA 3ZWBA 1T0PA 3QWHA 3TLBA 2GVDC 1NOIA 2P27A 4KX5A 1A69A 3T3DA 4BMYA 4AJ9A 2FMXA 4Z9XA 3K20A 3K5WA 4YC7A 3U3MA 5CRIA 3AILA 4CM8B 2PKCA 4BVFA 1Z08A 1Z8NA 2XZDA 1Z8FA 4ODIA 1KTIA 1YFLA 3NUQA 1VE6A 3GJ0A 1AHPA 1SXJA 2QTMA 3W9SA 3KVNA 1EX7A 3DWIA 2E1RA 2IYZA 4OA5A 1AKYA 5CDSA 1UBUS 2P40A 2UZ0A 4ZMRA 1T2AA 3FVWA 4W7IA 3CIOA 4RS4A 1FS4A 3E70C 1QHXA 4YLEA 5FUWA 1UM8A 3PNOA 2FAXA 2R9VA 4YCSA 4HV4A 4W9MC 4RVGA 4U9HS 4FVTA 3UGTA 1QAQA 2UVQA 3HJCA 4D6YA 5IC5A 1ONBA 1G2IA 1VKJA 4FHZA 1PUXA 4KPUB 1GU1A 4I1SA 2B8JA 3WFZA 1EHIA 2JAUA 3DO6A 1CY4A 1TEZA 2WSMA 4HDQB 2I2CA 1R6VA 1ZLYA 1RKXA 2ZT8A 4LYDA 3I23A 4NBTA 5IP5A 1NYLA 3C8MA 3ENZA 4Z8XA 2Q45A 2UZ1B 4H6VA 2GH1A 2AR9A 1SXIA 3NM4A 1OYVA 2EJTA 4H1TA 4PC3A 2P5TB 5AVYA 3V4LA 4RDIA 1B6GA 4LNHA 1VLHA 5GM1A 3QK7A 3VSEA 4YJ3F 4E3WA 3H8SA 3LM8A 2AX3A 2NZYA 3CEPB 2IV7A 2FJPA 4JI7B 2BTEA 5E1DA 3ENQA 3LV8A 1HMPA 4RZUA 2ZZNA 2FRDC 1B26A 4D98A 2WIJA 3KB1A 3OCXA 3EGWA 2ZAMA 3FD8A 4JR0A 5AOCA 5JS2A 1CDDA 3R5FA 3O91A 4RF2A 3MIZA 3VNAA 4N3CA 3IOMA 5A6SA 2B69A 3N8NA 4BKRA 4N3GA 3EF1A 1IM2A 3FFTA 1PFYA 4N7RA 4ZCQA 2XCUA 2PR2A 1GPJA 2GD1O 4NCBA 4LXUA 1XYYA 3EMBA 4Q1BA 4LX8A 5CU7A 1PJCA 3MJSA 3GI1A 2ZYDA 4WY8A 4W82A 5DIZA 5L3ZA 2ZYHA 5C7IO 4JI5B 3T52A 2HU8A 2X22A 2W00A 2GHRA 1LBHA 2VJBA 4UE6A 3VPCA 4DZZA 4CF7A 3D6TB 2XW6A 4CE6A 4QLAA 5EXXA 1JEDA 2WTUA 3AWDA 5CX4A 5G0UA 4MVYA 4ER3A 3M81A 1CRPA 1A88A 1AGRA 3BEOA 4BX2A 3KSAC 3ASZA 5ALIA 4L51A 1PBTA 3UGJA 2J0EA 1VRVA 1K9SA 2JBHA 1TQDA 3CNBA 4Q4AA 1CCWA 1XLVA 4ZAFA 1OPXA 3T3HA 3ZDEA 1IAQA 4QTTB 1QWOA 5ER9A 1YTUA 1HDGO 3I45A 5KYUB 1MRSA 3LVFO 1EVKA 1OFUA 3KZCA 4MEAA 4JLKA 4ZO6A 3RNOA 4D9FA 4AZSA 1SCAA 2VDMB 2XD9A 2GWHA 4JMPA 2AQ8A 1U2TA 4GZLA 3R44A 1DX6A 3EASA 4DIOA 3BGIA 1N2ZA 3OJLA 3CBGA 1SBCA 4HLCA 2BISA 5I01A 2P9JA 1YH3A 4FFDA 4M1ZA 3TZEA 4EHAA 1G98A 3AB3A 2PGIA 4EZEA 3G8AA 4XUDA 3HCAA 1U9JA 2EX4A 5C37A 2IUSA 1KQOA 2CNBA 4XRGA 4IJQA 3LSTA 2AI3A 4I81A 2CLFB 4UDOA 4PFJA 3BA6A 3KSUA 1WUYA 1KK2A 1WVMA 2EZ9A 2ZBVA 1Y9DA 4M8LA 3RJTA 2QX4A 3L4EA 4PC2A 3IQIX 4OBBA 4XXHA 3L7NA 2P9TA 3UJ7A 1WTCA 2QUBA 3EDCA 3LIIA 1N7IA 2FEXA 1UINA 1DQRA 3L5KA 1Y9ZA 721PA 2ZJYA 4QGSA 3I8XA 2O8FB 2CXTA 1M2EA 2P5SA 4QPCA 1IH8A 3F9RA 4IF4A 3K32A 2Q6IA 1JIIA 1NPDA 2ZR9A 4JLJA 3TVDA 4FMBB 5AQEA 4PZZA 4QC2A 5EMHA 2OCYC 4J07A 1VLJA 2R2GA 4U7GA 3MRVA 4W8OA 5TPWB 4RF3A 1QAMA 4UDYX 1GGVA 4AIRA 1V71A 3ADPA 2WJIA 2YYYA 1L4GA 4GECA 4TYYA 2ZSBA 1U81A 5JY6A 2QA5A 5E2AA 4OLBA 1XTPA 4IUCS 1LVUA 3INYA 3Q4GA 1Z5OA 5EHNA 1U8CB 5AVTA 5KNBD 1JHZA 1N2OA 4FJ0A 3RUIA 2K5UA 4UVHA 4ZJYA 4MVJA 5EP2A 2PS3A 4G8DA 2BOVA 1QMGA 4HH1A 1E0DA 1SZJG 1YDHA 4FQ8A 1G20B 4AY4A 1N0VC 3JQGA 1J24A 3QVUA 3D8BA 2A4MA 1XAHA 3TLEA 2P7HA 4RPJA 5KX5F 2V6FA 4XB1A 1YRWA 2K4MA 4ZD6A 1TCBA 4L3OA 4HUTA 3AF6A 4XSGA 4RHCA 3GEBA 4IQ4A 3ZTYA 3H5NA 1H2BA 3B1ZA 1OIVA 2FW9A 2F3UA 4Q3DA 4PY2A 3KVVA 2CNWD 5JZVA 4WOJA 1AT1A 1ECGA 1Q0HA 2DUUA 1NOJA 4O1MA 4MV0A 1U9ZA 3G0OA 3MCTA 4U1RA 2IVFA 3K1JA 3VPAA 2PD6A 3FGZA 4UOEA 1R0WA 1RNLA 4Q6BA 5AVVA 3KR9A 5A02A 3IMEA 1D04A 3LW7A 3VKWA 4DC9A 2RHWA 4MVJD 3QYPA 5K4GA 3H4VA 4I4NA 4RD3A 4CG3A 3V1UA 1E3QA 2AQIA 3AK4A 3AFMA 3F7NA 4B3BA 3VR2D 3MCVA 1ESEA 1M5TA 1NUTA 1THZA 1YZ3A 1GRQA 1YB1A 2HI0A 2ACWA 2QS9A 3NIGB 4KE8A 3M1YA 4MP8A 3V8BA 3ZN2A 4CMEA 4Y9DA 4EG6A 3GLFA 2EZTA 3D8SA 4Q4HB 2OXCA 2R00C 5AI8A 5FA8A 1DRVA 1X1DA 2V96A 4LTDA 3VAZA 3H87A 4UM8B 4D82A 2BSQA 2H06A 1T1JA 2ZYTX 1N33B 4N3NA 3ZD9A 2DGDA 4B6GA 1O08A 3P32A 1II8B 4D9BA 1QV9A 1ZD8A 1TKCA 5BV7A 3AV0B 2V0NA 1QHHB 2FHSA 1A4IA 5EC8A 4PG6A 4C7MA 4YAUA 2W2LA 1H2XA 3L8CA 4N6GA 4R8VA 1RWBA 4KVFA 1F14A 4WEOA 2C4NA 3EISA 1QS0B 4LRWA 1P0PA 2G80A 2HYIC 2EU8A 3GDOA 4B40A 1RZUA 1WDMA 4KZPA 3D59A 1PFQA 1X1EA 3TQHA 2BH2A 4F3TA 1RJDA 3INTA 2AT1A 5KO2A 3DD5A 1K4MA 2Q0SA 1SC4A 4I3HA 1LA2A 5F7XA 1NI4B 4QUKA 4ZOEA 3GZNB 4IXMA 4FZ5A 4OLHA 3GZJA 1JQ5A 3JR3A 3LSYA 4TXHA 1N0IA 8OHMA 2JAPA 4MQFA 3GJ8A 1FSZA 2UZIR 1EBBA 2ZZKA 2JJ1A 5DN9A 1YF3A 3P97A 1VKOA 2A9JA 1T5LA 1CQJB 1MGPA 4A0SA 2ODAA 3CF2A 5G4KB 3ZVMA 1W8IA 2J6HA 2PUJA 2NO9A 1UIMA 2QU8A 3BMNA 3PDJA 1SEPA 4LZJA 4DIKA 2W2LD 1RLJA 4M60A 3RANA 1S2MA 4WMLA 3WV5A 2BEWB 2DVMA 2VPTA 5T5QA 4EI2A 2OHXA 1SXGA 1A2KC 3JV7A 4QGBA 2R6JA 3U56A 1LTQA 2PHZA 2KM1A 5IX8A 3G5LA 3KEQA 4HAXA 4C30A 3KJFA 5E6RB 1JR3A 4KV9A 3HRHA 2Z04A 4B85A 2J33A 2MTBA 2B9EA 2C2BA 2PJRA 2HA3A 3ROQA 3K35A 2XMZA 4UPDA 4ITUA 1A72A 4CCYA 2R5WA 4DJEC 3LQFA 3RHZA 3AG6A 1ZH4A 1ZCZA 3AYXB 4TTPA 5AW3A 1JYFA 2X9GA 1PZMA 2D2FA 5BR8B 2DBRA 1E8NA 1XFDA 1J97A 1WXHA 2YXEA 3Q6IA 3WOVA 4TYWA 1R0RE 2CKDA 2AEMA 4EH1A 2OHVA 4DLSA 4YWJA 5IT4A 2X2OA 4WFKA 1GADO 4LRYA 4H9GA 2WQ7A 4GQAA 1ZC3A 1DBWA 1SOMA 4TTTS 4G5SA 1P0QA 1MXFA 3B1VA 2QN2A 3MWKA 1C8BA 1RQ7A 1T1IA 3UXYA 3VQTA 4KJXA 1RAIA 4IXTA 4PLZA 1M6VB 5ADVA 1AUXA 1GG2A 4E70A 2I66A 1C1YA 1JFRA 3GA5A 5ESDA 3ORRA 4GKBA 3UT0A 3JAMA 4UTZA 2ZJOA 4X41A 2I3DA 2XKBA 2YQ5A 5AD1A 4I55F 4FOOA 3ZDFA 2D6FA 2XCTB 4TLMB 4CKBA 4LZLA 3ZDRA 4BLVA 4WA7A 5CIWA 5PGMA 3W6ZA 2PUEA 5KS2A 4OHUA 1CYDA 2GD2A 1UDBA 1MQ8B 5EMMA 4CR7A 4YRIA 3NONA 5CLHA 1EDEA 1Q1BA 3RPEA 1DJMA 3R75A 2H4HA 4WBNB 1YB4A 4OHWA 1KNXA 3RHFA 2C5EA 3ISJA 5IJ0B 3W9YA 4YV1A 1MJNA 3GUUA 3EEYA 3G2IA 3D3NA 1XTVA 1W581 3ABZA 4JL8A 3C8ZA 4PBRA 1JHOA 3U3OA 1FX0A 5HCNA 2H1RA 2LCFA 4MS3B 1Q84A 5TRTA 3KPUA 1FDRA 2R7MA 3OM1A 1WW3A 2W0MA 1NXTA 2ZYGA 3JASB 3PL5A 1O6ZA 1P1HA 1M1YB 2CYBA 3VVLA 2PJDA 3AH8A 2JFBA 4M89A 1NQ5A 1RLMA 1IRIA 1JPUA 2VBIA 3PRHA 1Y3BE 2CUKA 4LQDA 4ZT4A 3H5AA 5HG0A 5J5AA 4JV5B 1PZNA 3SYKA 5EWMB 4MWZA 1K27A 3Q7PA 1A5BB 5FPKA 3IT0A 4J6EA 1UQRA 2IYOA 1DWQA 4O2BF 2AZTA 3N5KA 1BN7A 4LSZA 3ZD7A 4G1FA 1P5ZB 4CDRA 3K0HA 1C1DA 2CHQA 2O1XA 4N3BA 4UOQA 3A4IA 1GGEA 1UP6A 1G18A 4NZZA 4BVAA 1FRZA 4TSFD 3WXBA 1XPRA 3CEHA 1TAUA 1DQZA 2HQ1A 3OCYA 4JB8A 3ZCXA 1P45A 1S3GA 1KP9A 1FW8A 4QGHA 1N0WA 4YB8A 3TH5A 2GM5A 4CUJA 5BN3A 5AW6A 4V0MA 3FNIA 4K2AA 3TCNA 4FI3C 3MA0A 4ZQFA 2PT7A 1KJ9A 2H1IA 3QVSA 2QAGB 3EXHC 4U8HA 2YXBA 5CCDA 2YFQA 2JG3A 3MMNA 2QSYA 3PNLA 1EIZA 3W5HA 4DQXA 3S81A 3VR5H 3IA7A 1IMOA 3PDWA 4WLOA 1TDJA 3HJHA 3OJ0A 3GPLA 5HIAA 5KNLA 2VBFA 4GLJA 1RFGE 5DP1A 4O6VA 4F38A 1U0TA 1E92A 1VGQA 3REOA 1BAPA 1ONPA 1CQXA 3RASA 3GGDA 3WKEA 4C03A 2QG9A 4U0JA 1Z6ZA 1BDJA 1XALA 2IL1A 3WSWA 1ISPA 3GCDA 1D2RA 1G8FA 2XTNA 3ADDA 2VK8A 2Y9MB 2LBPA 2ALJA 4JQYA 2IS1A 2FMKA 5JY1A 3ILSA 2Z95A 3NYQA 1C1XA 2E4WA 5LA6F 4MW0A 5ALOA 5JNSA 1CUHA 1N6PA 3QMPA 1JBEA 2FHPA 4ARZB 5BOSB 5IC4A 2VDQB 5JASA 4G4SO 2D4HA 5KWJA 3CFYA 5LYJF 2FSVA 2D4AA 1PLJA 3IKVA 4DDVA 1E1KA 3LWBA 3T5DA 4OGFA 3RVSA 3WP1B 3PEEA 5BURA 3OQIB 4D99A 1GCIA 1VP9A 5LVAA 3MTQA 3JYNA 3EGIA 1NATA 1WB9A 5EEGA 1JHXA 2HXSA 4TN5A 5G3YA 1HPLA 3VUEA 4JNCA 4K8OA 1DEXA 3FMIA 2VHTA 3DCIA 3P4YA 2B8EA 2XJ4A 1AKMA 1DRUA 2G63A 4R9UC 4YRRA 1Z4JA 1JYSA 2X4DA 1Z0UA 2GD6A 3H8WA 3ROZA 3U19A 4N01A 3F67A 2JASA 2QY9A 3EHEA 3TBHA 1N5JA 5K45A 4LTMA 2UXDB 2WM8A 3ICWA 3TECE 4D02A 4RTRA 3SC6A 3OT5A 2LCQA 4ARCA 4UXHA 1NMYA 2CV2A 3MERA 1Y1TA 4B74A 3C6XA 3HJUA 3OFSA 2WIKA 4KFUA 4RPCA 2A1TR 5FBRB 3KYCA 4YUXA 5HJEA 4FFOA 5F2NA 4I4TB 3L01A 3O73A 2QQEA 1JIVA 3K8YA 2QTBA 4WWHA 1CJTC 4KVAA 1ISMA 1ES9A 2Z9CA 4IO0A 2PSHA 2Y67A 2WHRA 4O4JF 4FSHA 2FWBA 1GVNB 2EW1A 2B34A 1U8YA 3B8EA 4MPTA 5JSKA 1Y81A 2RC6A 1HYQA 2RK6A 4X24A 2IWRA 5GIPE 3VC2A 1JEQA 1X15A 3WI7A 3UTDA 3VTFA 3NASA 1TMGE 5EL0A 5C52B 1V16A 2WFLB 4GP7A 1YQGA 2HA2A 4L7VA 5GGYA 1YR3A 3W5IA 3CVVA 5F3WB 4QEZA 2W90A 1NMZA 1G17A 4YAIA 2P6RA 4YCAA 2HFKA 3F4KA 5BNWA 1XMPA 3PEFA 1HNNA 2NVBA 5AVOA 2QPTA 1TQHA 2HLDA 4ML3A 3A2NA 1E9RA 4UJ3A 2YR0A 1V95A 2DAPA 3W7AA 2GGSA 3P27A 3WB1A 1E8MA 5FWAA 3WBBA 4JUAA 3O90A 3TKAA 3TL2A 1C3VA 4IVQA 1K5HA 4N8EA 1NKSA 2HBYA 2RJ3A 3IVMA 4H3HB 1N5MA 1P0MA 2K7FA 2IGBA 1EUDA 4INAA 5EZYF 4LSWA 5H4GA 3TI9A 2WT9A 1RW4A 1JWAB 1EFKA 2PBLA 2CB9A 4ND1A 3BYZA 4L0DA 3VYVA 5JHGB 1XRRA 1A50B 1F8UA 5LFAA 2CFIA 1RE0A 1LZKA 2BGRA 1M33A 3ZW7A 4Z7JA 1SHUX 2FUG1 4QGGA 2E5LB 2JFOA 4AS2A 5FPPA 4NCKA 5BMVB 2ZBRA 4G97A 4IR7A 5GONF 4EKIA 4OJQA 1MX9A 4LKOA 5DOVA 5BRNA 2JCXA 5IJ9A 2FSSA 4L0CA 1IYZA 2C07A 2HMAA 3IEMA 4DLUA 4DB2A 4IIJF 4BS9A 3SNHA 4Z1OA 1PO7A 3VSCA 5IBQA 1R5BA 4F4HA 5J2TA 1MOQA 2OBLA 2VOEA 2HF7A 2J0UA 2OKGA 4XE5A 2ZSHA 4X61A 4ZVKA 4CTOA 5T7BA 1G9TA 1OD6A 1VIAA 3OIWA 2VQEB 4NS4A 3OFVA 1FNBA 3DF9A 1R5JA 3IQZA 4KQIA 1N1GA 1E1NA 2J87A 2O0MA 1WXWA 3AI7A 4A6DA 4EHFA 5BY2A 3ASYA 1PR1A 2P3SA 5K6AA 5GIOE 3GEGA 5LD2B 4DR6B 3ZGVA 2AOUB 2QRMA 7AT1A 3GRZA 2IWHA 1YZTA 2C7BA 1J23A 1O97D 2W4QA 3DULA 2E18A 1V2HE 1P6XA 3GU3A 3KNZA 4V02A 4M9CA 1P7WA 4IMIB 3EBLA 2VATA 4N12A 3A1SA 3SOPA 5BN3B 1ZYUA 8LDHA 1RFLA 5FUVA 2ODTX 3THYA 4I1PA 3ERCA 4I1IA 1E0SA 1T25A 2FZ5A 1K3TA 3SQLA 3UKOA 4NJMA 3T34A 2FPGB 3O5AA 1II9A 1XMQB 1TJ4A 2EX0A 3PFCA 4WN9A 3RS8A 1XO1A 3R5TA 4E3ZA 1HGXA 1JILA 1UT5A 4PEVA 2BP7A 2PSDA 3M4JA 3AKCA 1ZIPA 5EWLA 3V46A 1BHO1 2JDIA 5LXTF 4AMGA 1C8LA 4LJ7A 4YCBA 2WBLC 1YS7A 4CV1A 3HXKA 2ATCA 1Q1GA 1XGKA 2HL6A 5EPUA 1XDUA 2XYRA 4B09A 1KI1A 4KWIA 5K3FB 3TG2A 1MAVA 3DJFA 3VZPA 3S2GA 4G0NA 1BE0A 1JNXX 5CYPA 3PEWA 4B4OA 1A2QA 5K0GA 3KXPA 3NHJA 4GXRA 1V4BA 1S96A 2C4VA 1ZJ5A 4GUDA 4UUQA 3ND9A 2P9HA 5FAXA 3S2SA 3UHFA 1N6IA 4NS1A 1CHDA 4NAUA 4E94A 2H4YA 1U8XX 3W8RA 2WMNB 5AP9A 3R7SA 9LDTA 3K8OE 1YO6A 3T9DA 2FEMA 1SHKA 4M46A 4MKXA 1YB6A 4X7PA 4GX2A 3RRNA 2FQ1A 3PP8A 3TK1A 2WWRA 3RVMA 1KEKA 1K75A 1SC9A 2ZE5A 1QHGA 4HR7A 3SZGA 2QRJA 3WL6A 2J48A 4YMIA 3GVPA 3F8TA 4NOKA 2QW1A 5I4BA 2ZAOA 3FPBA 4ND4A 3HJRA 4MK4A 1UJMA 2AD5A 3AIMA 3E05A 4O02B 4XD7A 5CVTA 2V8BA 3H3FA 2X77A 5L4SA 4LJAA 1GJRA 1M83A 1V5IA 3O94A 5IDQA 1QAOA 2BCJQ 2R8ZA 2V6IA 4EYQA 4GOKA 5HZKA 1UQTA 4PC1A 2GZAA 2ZTHA 1Y4UA 1XQVA 1K6XA 1JU9A 3HCBA 2W4IA 3LP5A 4XWYA 3ST7A 3R0ZA 2PKRA 1NPTO 1Z7EA 5AHRA 1T3SA 3FX2A 5ALQA 3PX7A 4J0FA 1QE3A 4R2WA 1KOJA 5AJTA 1M8FA 4XRRA 5HFAA 4KL8S 1K66A 2FR0A 2N1MA 2O52A 2PG3A 2YQZA 4IUBS 4PLGA 4EY3A 4O63O 1DC8A 1QLJA 1HYBA 4K3UA 3VZCA 3FCYA 1GL7A 2BGNA 3L0YA 4TWRA 1L7AA 3OFKA 5SYNA 4B8ZA 5IKMA 3KV1A 1QIFA 2LWIA 3C3EA 5AXAA 1G0NA 2BMJA 4BBPA 3ESZA 3KEMA 4OX9B 2YWEA 5C34B 3BGDA 4QU9A 3SXPA 4CKWA 3U80A 1RQXA 2OFXA 4LXIA 4G0MA 4E33A 3B7WA 1KI9A 3R3XA 5ITVA 1G9XA 4M22A 1VFPA 2J3IA 1XNJA 1YGPA 2M6KA 3A6LA 5EJ5A 2FGJA 1MV5A 1D5WA 1Y8CA 4PLPA 4AXBA 1AMNA 2HZ7A 1QPBA 2Y6VA 1KRHA 4MRAA 1CF9A 3L7LA 3QWBA 3HL0A 2X4GA 4L5AA 2WU8A 4Y7CA 4BNTA 3IODA 1G8KA 4GMXA 1CJCA 4N5LA 4N9WA 4F8JA 4LZWA 1OZGA 4OHOA 2V7PA 3VVBA 4DWVA 1YR9A 4A10A 3R9WA 1TYBE 1R4ZA 1YOVB 1NF9A 4N82A 1FX1A 1KZYC 2WTAA 2P5YA 1KDZA 1QHHA 1PIWA 3OX2A 4LCJA 2AYYA 4HFJA 2GJKA 1DLJA 5F73A 3EXG2 1TYAE 1TAHA 3JYOA 3RUPA 1U8UA 5TE9A 1RI1A 3D31A 2YL2A 3ABRB 3DZBA 4DG5A 3MTGA 1JDSA 4CM3A 3L07A 5FPSA 2RD2A 2C8LA 5TQ2A 4Z1MD 4CNQA 4URXR 3ZE8A 3AM4A 4O2AF 4TVKA 3E9MA 1CE8A 1ORHA 3P4XA 4ZWNA 2LDBA 5I7RA 1AQNA 5H8WA 2FUG6 4EPWA 3AGQA 2QVYX 2ZIUB 2ORVA 3AXSA 1TA9A 3A11A 4LDPA 1ZBDA 1H93A 1NQVA 5T4EA 4KIWA 4UTVA 4ZT5A 3ZHZA 1E3TA 4E13A 4YALA 4RCVA 4XM1A 1V7ZA 3DAYA 1I0ZA 3D3QA 3E7DA 4Q6WA 2EP7A 4G2NA 2O8VA 1GGKA 2E4UA 4EJMA 3RWOA 4LV6A 1XVAA 3HU1A 3MTBA 1ECPA 2H63A 1GGJA 1H65A 1I4DD 1V1MA 3A06A 1KS9A 5LM3A 4YV7A 1D2NA 1NDUA 2BBWA 2HRRA 2QIPA 2ZOSA 3BK1A 4LXHA 1KS2A 1JHPA 3EARA 4KE7A 3BRWA 4OQNA 2D2VA 5K3CA 2IEBA 5A7HA 3SSOA 4QDJA 2D5AA 4WINA 1VHTA 1XAGA 1XD2B 4EEKA 3DBVO 1U3UA 3RK1A 1GSHA 4DN6A 5HXAA 1DQSA 3ORHA 1PFKA 3E3OA 4QVKA 3TW4A 4CKEB 5FTWA 4ABYA 5A03A 1IHYA 1MLDA 2P3LA 2QZ9A 4N65A 2P78A 4NVRA 4UHJA 2OQVA 3TB6A 1U0SY 4E0BA 4N4AA 2OORA 4ZIRB 3FSGD 4XFJA 1HDRA 1U5CA 1ETUA 1F0NA 2VS1A 2YHBA 1G6Q1 1SK9A 3K9QO 2JLWA 2J9FB 3TXXA 4OI2A 4YBZA 4A5OA 1DOHA 4YP9A 2R6DA 2P7IA 2VXOA 3AVUA 1XKTA 3EQ7A 4WOPA 3WWOA 5K3EA 3UANA 1DKLA 1GXSA 3UVEA 1G8JA 3O1IC 4BP9A 1R8JA 3OD5A 3LAWA 4QWWA 3H0KA 1RCFA 4L16A 1E2LA 2C4MA 4OQPA 3TPZA 5AKJA 4ZT2A 1UKAA 4TKMA 4UHHA 1XROA 3WHPA 4ZP1A 1Z5UA 2VHUA 2WZCA 1PJZA 2J7PD 3GCXA 3RRYA 1JDZA 1CUAA 3VA7A 2G4LA 3AVQA 5A5GA 1XEFA 1ZMBA 2C04A 1Z0JA 2JGDB 3IIEA 4ZQGA 4XPIB 4YRBA 1Q7BA 3TE6A 3AHEA 2KBFA 1DO8A 2VJMB 1JECA 2ZQZA 4B80A 1GSAA 2JVIA 3DL7A 4Q4LA 4CLRA 3BULA 3KWLA 4EA6A 1UBMS 2Q9BA 3F73A 1T5DX 3CN7A 1USKA 2OQIA 5GVSA 5B7PA 5I5EA 1ZH8A 2BFBB 5K0TA 4HAIA 2ECQA 2ODNA 1P5HA 3HABA 1XX6A 3JWHA 3P0FA 4L8WB 4MWBA 4L78A 4U2CA 4BJ3A 1UPXA 5JQGF 1DJOA 2IZZA 3DOCA 3R3VA 4IWXA 2KBEA 2DHEA 1GP2A 5C8ZA 1KJYA 1K6IA 2NYVA 1JP7A 1B42A 4WXPA 2DQYA 3H7AA 5DEIA 3DE2X 4ESOA 5CA1B 4EPTA 3U2QA 3W5CA 3MUOA 4O2AB 5IEBA 5MGBA 1IUOA 4BNHA 7GPBA 1CY6A 1TGVA 4KPGA 2B25A 5E6SA 1C3XA 1H6CA 5HILA 4IZHA 3WSTA 5CDGA 2YV1A 3NHFA 4EW6A 1IWPB 5BPFA 1ZHFA 3E3AA 3OD1A 4MQBA 2Z3ZA 1E9AA 5KWVA 5TY0A 3KIPA 2EFHB 5DI3A 1QZUA 2C84A 3H4IA 1RAHA 1TA4A 3KTOA 2J0QA 2OD2A 3FOCA 3DM5A 1KXJA 1Z36A 2Z2KA 3EH1A 3OTOB 4OFXA 2WWYA 4BLPA 4KQ6A 3PVZA 3F0TA 2D7JA 3LI2A 5H1YA 4HNVA 4RETA 3NJ8A 4M9ZA 5CG1A 4EA7A 1I2DA 4FE7A 4LV5B 1FNCA 4QICA 4XGKA 4NKRA 3JPYA 3ZZUA 1L7OA 2WWWA 1S3SA 4TTAA 4CM9A 3HDYA 3PB3A 1LDMA 4S0XA 1VIVA 2PR7A 2HJ9A 3F7MA 4F4DA 4FR2A 1QC5B 4ZAVA 1U2DC 1SCUB 4NJEB 1EK0A 4JYPA 3WB0A 2NYAA 3AR9A 3VSBA 1Y8RB 3F4BA 4IDCA 4Z49A 2Z8YM 3TCKA 2C54A 3ABIA 4EGQA 1PDOA 5KX5B 1RQ2A 1KRWA 3DHYA 1G20A 1N6OA 4LZOA 3TS1A 5KJ6A 5LWQA 2IYQA 4PSDA 2N1BA 4ZYYA 5KKNB 5IT9A 2Z0MA 4ZALA 3ZE6A 2Z2IA 1LB1B 4N7JA 3D1VA 3MJHA 3G88A 1SBZA 2FEPA 3QX8A 3LHIA 3T9FA 1AQ6A 1ZUHA 1E9VA 2V7TA 3O9MA 2ZT7A 3SGLA 3HXLA 5A3VA 4ZI2A 4U5QA 5EIAA 4RIFA 1L5LA 1P2UA 5IS2A 1WF3A 1FFWA 4CM9D 4CPDA 4DRXA 1T6BY 3B85A 4NQZA 2JFPA 3RBVA 2ID7A 3T7CA 3R4VA 5IMSA 1NULA 4AS1A 2IYSA 1P9RA 4NBUA 2VXBA 4NABA 3M5CA 4EB3A 1MHPA 1MJFA 3PK0A 1KVUA 4V0OA 3TR6A 2OZLB 3X43A 2MR6A 4L5IA 1ZOPA 1H6AA 2J6IA 3DHNA 4KIFA 1GZDA 3GB9A 5ALUA 5IH3A 3ZWKA 1NVMB 3LK7A 3U13A 1WWKA 1IEVA 3Q8XB 5A3SA 1EM6A 5KOHA 3BFXA 1ODJA 3DF7A 3WNQA 4OHMA 4LNUB 1O6GA 1NXSA 2A9RA 3J80A 4DNOA 1LPOA 3LPNA 1FXSA 1PS9A 3LDUA 5LNK1