3LLVA

The crystal structure of the nad(p)-binding domain of an exopolyphosphatase-related protein from archaeoglobus fulgidus to 1.7a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
133
structure length
133
Chain Sequence
RYEYIVIGSEAAGVGLVRELTAAGKKVLAVDKSKEKIELLEDEGFDAVIADPTDESFYRSLDLEGVSAVLITGSDDEFNLKILKALRSVSDVYAIVRVSSPKKKEEFEEAGANLVVLVADAVKQAFMDKIKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nad(p) binding protein
molecule keywords Exopolyphosphatase-related protein
publication title The Crystal Structure of the NAD(P)-binding domain of an Exopolyphosphatase-related protein from Archaeoglobus fulgidus to 1.7A
rcsb
source organism Archaeoglobus fulgidus
total genus 47
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3llvA00
1PZFA 1P45A 5C7IO 2V6BA 2DQ4A 3ADOA 1BDBA 4OKNA 2J5KA 4PLYA 5KJFA 3GFBA 2EP5A 5L4SA 2WM3A 3DAGA 4AJOA 2BRUA 1C0KA 4BNNA 5KVQA 2QZZA 1ISGA 1R15A 5CPBA 1XWFA 2HK7A 2POQX 3VTFA 4XIJA 1WZEA 1PU2A 1Q0LA 3JQ9A 1M75A 1ZSYA 3PYLA 4I5GA 4IS2A 4M55A 1P1IA 4A7PA 3PFWO 4CMIB 5TC4A 1C3VA 1KVRA 3ICPA 1GUFA 1O95A 2VNAA 4B7XA 3ONFA 3OM9A 4RPHA 1V8BA 4RLSA 5IZCC 4WASA 4LMPA 3COSA 3VH3A 3L4BC 5ITWA 2HAEA 1H6CA 1OZAA 3PDUA 4BO6A 1I3LA 3FI9A 4AJPA 4CR8A 4IBOA 2CVOA 4YQZA 1UDAA 1BXKA 2G82A 1NXQA 1WLYA 2C82A 2Y0EA 4LSMA 1T2FA 1XU9A 3S1LA 3UOGA 3QV1A 4BVAA 1DIBA 5CDUA 3IAHA 3PDJA 3PFFA 3MEQA 4J90A 1MC4A 1P44A 5ILGA 5JLAA 2VYVA 4ALNA 1GR0A 1ENOA 2I5PO 1YOVB 4Q3CA 3ETDA 1X15A 1PZEA 4CM4A 2H9IA 1EEHA 1H6BA 4DIBA 4ZQFA 2NWQA 1CERA 4EUFA 3B1JA 5LC1A 3F1KA 2Y05A 5IXYA 5KTKA 2H63A 1NHWA 3CSDA 3OJFA 1Q7BA 3QVOA 1PJLA 2DTXA 2VRCD 3GDOA 2VYVD 5U4QA 1NYTA 4BO1A 1QG6A 5AXCA 4DIFA 1KVTA 3C7CB 1ARZA 2W98A 5JY1A 1U7HA 3H5NA 4MOWA 2JL1A 2ZKLA 2Z1NA 4I9UA 3RU9A 4E2WA 4H7PA 3H3FA 1P1JA 5FF9A 4CMCA 3WBFA 1LSSA 2Q1UA 4TRRA 1FXSA 3S2IA 3TL2A 2HMUA 1HF3A 4E13A 2OP0A 4A0SA 2GO1A 2Q4BA 4JJIA 1DIAA 1EBUA 1VJTA 3PHGA 1PQPA 4XDYA 4BO8A 4E2ZA 4RPKA 2OFPA 1QMGA 1D1SA 2HQ1A 2QHXA 3Q9UA 3DZJA 4XR4A 3D0OA 3GRKA 2W2LA 4MVJF 4XB2A 1YQXA 4NFSA 4LVUA 2PNFA 4IDBA 4CM8B 3PZBA 4QO7A 4CM9A 1UP4A 4BKOA 1YE3A 1X0VA 3AM3A 4OQYA 3IDSA 4HV4A 1Q1NA 4IPTA 1V6AA 4A5OA 2VZ8A 4BNHA 5A9SA 1WWKA 3QP9A 3EAGA 1VJ1A 4KMSA 4MVJA 1KVSA 2B5VA 2FY8A 2WD7B 4N5MA 4YAGA 2PD4A 3NTQA 3RWBA 2QRKA 2I76A 4NJMA 1N2SA 4NPCA 4ZRMA 4CM9D 5TIIA 1MLDA 4WCFB 1C1DB 4ZU3A 5TLSA 3M2PA 4FCCA 1PSDA 3H9EO 5AXDA 4EJ6A 4MVJP 4OQZA 1V3TA 1PGNA 2B69A 1HDXA 2VUUA 3PZRA 4Q3AA 1LDNA 3LLVA 4FFRA 5DNAA 3ZHXA 5AXBA 1RM3A 1IL0A 3GGGA 1H9AA 2HLPA 3FPLA 5DBIA 3DZGA 3I5MA 3WOHA 3CPSA 3ZV4A 2Q3EA 4OH1A 4DL9A 4J3FA 2FZEA 1PZGA 4B4WA 2ZTVA 1GTMA 4J6FA 4K28A 1DAOA 1Y5MA 3RUIA 2DVMA 4K9DA 3VOSA 1KVQA 3NUGA 1SAYA 4GPD1 3T7CA 1WDMA 3TWOA 1GADO 1YGYA 2ZJ0A 8LDHA 1NBOA 3K8ZA 5IAAA 2CDAA 3WSVA 3NJ4A 3EUWA 2X9NA 3AWDA 1LA2A 3HHPA 2EJVA 4IDAA 4RF2A 5DULA 2O3JA 5TX7A 4D3DA 4GX0A 4U0JA 3GGOA 3HDYA 3PIDA 4UREA 1UZNA 2FR1A 1UXKA 3FNFA 3QY9A 4F45A 5JAIA 4KUHA 3C1OA 3CXRA 2PKRA 4Z9XA 3DZFA 1LSOA 3E9QA 1GZ6A 3NTRA 1B8PA 3ENNA 4MJLA 4TKLA 4E5MA 4FGWA 4NBRA 3EC7A 2Q2QA 2D3TA 5AOVA 5JDIC 1VLLA 3GNQA 1IY8A 4R69A 4CUZA 1B14A 1UZLA 3M1LA 5G4KB 2WE8A 4ZICA 2F1KA 3Q1LA 4U6QA 4GVXA 2C5EA 4DXHA 2VN8A 1H2HA 3CH6A 1LX6A 1XHLA 5HTOA 4WEOA 3JQAD 3H4VA 3DOOA 3K96A 4LRSB 1E7MA 2IYPA 4B3HA 5HBRA 1U2DA 4DLAA 1E7SA 4GWGA 2BF7A 2A92A 1HDRA 2BFOA 3GGPA 2AEMA 3QJ5A 1QYWA 1AE1A 3ZWCA 1WZIA 3Q3CA 4NBUA 3RIHA 1RM4A 4MKZA 1E6WA 3PGJA 4PLWA 4JBIA 1ZVMA 2VNSA 3D5QA 3IL2A 3JQ8A 3GFGA 3KXDA 2YDYA 5TGDA 4RO0A 4ROSA 3ULKA 1PL7A 1R4NB 4L75A 4P4GA 4KP7A 1LNQA 2EKQA 4KQXA 1Y8RB 1K2WA 4PG4A 4NBTA 1JQBA 4MIOA 5A04A 4XYMA 4WECA 1V3UA 1QP8A 2J6IA 1SO8A 3LF2A 3BXXA 5AXAA 2Q2WA 4J9VA 4D44A 4XKJA 1K6XA 5JS6A 1YB4A 4FJ0A 5CHEA 4A26A 1YONA 3CINA 4HUJA 1E7QA 2XOXA 3RKRA 2W2KB 4NJOA 1BGVA 3E82A 4RF5A 4AJKA 1E5LA 4E12A 3I23A 3WICA 3PJGA 4EW6A 3GVXA 4RDIA 4TROA 3WYEA 3QWHA 4DMLA 2HJSA 4IQGA 4YJGA 1E0DA 1UJMA 1ZK1A 3CTMA 4YQYA 1PS0A 2ZJ1A 3E03A 3AOEA 2E4AA 1YL5A 3PHLA 1F06A 1TEHA 2DAPA 3FSRA 3PK0A 4MVJH 4OHUA 4J7CA 3KETA 1BHSA 4Y8VA 2DU8A 2DFDA 4UUMA 2E82A 4UVHA 4CMHA 2FR0A 1PR9A 1GYQA 3T4XA 3WGGA 3JQ7A 4TWRA 4BO2A 3SJUA 2VRBA 2X0NA 3TFQA 3GUCA 3VZRA 4DBVO 1KVUA 3KEQA 2YZ7A 3JQCA 1XYGA 4K26A 4W7IA 5H83A 5IZCA 4OKIA 2IZ0A 1C1XA 4L4SA 3ZHBA 2Z1MA 1ZXLA 4XIYA 3WYBA 1DO8A 5KJ1A 1NQOA 2AQHA 3PI7A 3DB2A 4NQZA 5GZ6A 2X5KO 1R66A 1GZ3A 4EITA 4LK3A 3RKUA 5A5FA 3Q0EA 1C0IA 4LRTB 4BO3A 2WTBA 4IINA 1N5DA 2RHRA 3MTJA 4I1IA 4DQUA 4NU5A 2D2IA 3TRIA 4CMIA 2NU9A 4W9NC 1XU7A 3OJOA 1O0SA 5LDHA 4BKPA 1XR3A 2NV6A 2P9EA 3PIIA 5DBGA 4WLNA 1MX3A 3Q2IA 5AYVA 4OM8A 4OO3A 4CLEA 4Q3BA 1WXDA 4J16A 4EYEA 3GNTA 3DMTA 3S55A 5DDIP 2EEZA 3ROPA 3AUTA 3NDIA 4IDFA 1H6DA 4IM7A 1L1FA 1HYGA 2O50A 4RVSA 1Z7BA 1LBEA 4XJTA 3O03A 1VI2A 1Z73A 1EFLA 4LW8A 4MVJE 2C20A 4HFNA 4CJXA 3LT1A 1JU9A 1QYVA 1SMKA 3I9LA 3V8BA 1TLTA 1T2EA 3MTGA 3QLJA 1I3NA 1A72A 3R3JA 4BQPA 4BV8A 1FF9A 3KYBA 5JY6A 5U9CA 4ND1A 4CL8A 4P4NA 4EEXA 5JAZA 1Q2XA 5DT9A 4QO8A 5CPFA 1J4AA 2FN7A 1YOVA 4RL6A 1XGKA 3LU1A 2HMSA 1E1LA 1KEVA 3GEMA 6ADHA 5CG2A 1SB8A 2NQ8A 1ISJA 3DOCA 4R5MA 3C1TA 4DLBA 1P31A 1R0SA 1A4UA 4WJZA 4GI2A 1FDVA 2JHFA 1ZK2A 3D64A 4JJFA 3I9KA 2WYVA 3D7LA 4CV3A 3HDQA 3LDHA 3E5MA 2QX7A 2X86A 4XQCA 1G0OA 1HT0A 1Q0QA 5HA5A 3TZHA 4EGFA 2A4KA 5DP1A 3WGQA 3LT2A 5HS6A 5LDGA 2WDZA 3KSZO 2GZ2A 4QFCA 1ADCA 4BO4A 3I4CA 4UVGA 4Z6KA 4CM1A 3NV9A 4U8GA 3HADA 4MP6A 4KWIA 1MA0A 1MC5A 4MDHA 4BNYA 1PJSA 2UUPA 4QTZA 3TOXA 4BMSA 3UVEA 4Y9DA 4EBFA 2YQ4A 4NZ9A 4OSPA 3VPGA 3HDHA 2OBYA 3NKLA 1H6AA 9LDTA 2P5YA 2NU6A 4E4YA 3GDGA 4CMEC 5MDHA 1Y81A 2Y1CA 2WYWA 2X7HA 4HP8A 4MVJG 1GAEO 3H3JA 1I24A 3DONA 4L9RA 2P4QA 3KZVA 3NT5A 2ZYGA 1Z75A 2VHWA 1OC4A 3GHHA 3ZNPA 4WUVA 5TS3A 3G17A 2V6MA 3AY6A 1VE9A 4EDFA 2XF8A 4FPXA 2WD7A 4B4OA 4QECA 2VOEA 3KBOA 4GAEA 5F1OA 1ZZEA 4YRAA 4R5HA 4NU6A 4HFRA 1UDCA 1PJ4A 2I66A 4PLFA 3PQFA 3TPCA 3KM0A 5EMHA 1C1DA 3S2EA 3GG2A 4A03A 4B8ZA 4EUHA 4FC7A 1PL6A 3B70A 4BNIA 4GKVA 4AJJA 1PS9A 3UHAA 3W8FA 3B1FA 1UXIA 3PVZA 1YB5A 1LSJA 3OMLA 2NTNA 3I6IA 2ZK7A 3H6KA 3IP1A 3F5QA 2OL4A 4PVCA 4O5OA 1HTBA 1PZHA 1EBFA 1PJTA 2QW8A 2X22A 4K6FA 3ZDFA 1N8KA 4BKRA 2WD8A 4PVDA 4OGWA 3VKVA 3U4CA 5JDIA 4WCDA 1NNUA 4DWVA 4BO9A 1KEPA 5G0VA 3RJ5A 1ML3A 3UCXA 2Q50A 5FEUA 1LLDA 1P9LA 3ETEA 4E2YA 5K6AC 2YFHA 4UVDA 5JCJD 1HDOA 2W8ZA 1WVGA 3QIVA 1S6YA 3WFJA 1KYQA 3EYWA 1T24A 4CMBA 5IZ4A 1SB9A 4YT4A 4U5QA 3H2ZA 1DIGA 3ZWAA 3A06A 2Q4EA 3N7UA 3LQFA 2ZCVA 3U62A 3WWZA 4R4JA 2AQKA 3I9MA 3RBZA 3DHNA 4YAEA 2NU7A 4RV9A 2ZB8A 5G4LA 3O9ZA 4YRDA 2CSUA 5DZSA 2NACA 4EZBA 3PYXA 3V2HA 3C3XA 1Q7CA 1TXGA 4EEZA 2JFFA 2Q49A 3GMDA 3GNSA 4E3ZA 4QUKA 1I36A 4LGVA 3KV3O 3IC5A 4IUYA 5JMWA 4D42A 1HKUA 2Y0DA 1BMDA 3ROQA 1YB1A 1SOVA 3FBGA 3ASUA 2FSSA 3JTMA 3KSDO 4FOOA 4UEOA 3GQVA 5DCWA 3ZZNA 2VWQA 4ALLA 2AQIA 2B35A 4BMNA 1R0KA 1YS4A 1E7YA 4LSWA 5F3RA 3JQ8B 1Q7GA 1FDUA 1UAYA 4TSKA 1E3JA 2CMDA 4TKMA 3OHSX 1DRUA 4KZPA 2DUUA 1ONNA 2SCUA 3JSAA 4B3IA 3DBRB 4FJ2A 1N1GA 4BNKA 4EI2A 2EGGA 4XCVA 1RKXA 2NQTA 3QWAA 2B5WA 3JQGA 4CR6A 1U3UA 3AM5A 1QKIA 2HO5A 2I6TA 3ZNNA 3JYOA 3ZWVA 5A4DA 2AMFA 2BMAA 3ZWMA 5BSHA 4IIVA 1VL8A 3ROMA 5I7VA 3PWZA 1R4NA 3H7AA 4JBHA 1T2DA 1JDJA 2Y66A 1T1RA 4XRGA 2O4CA 1NX6A 4TQGA 2PZKA 1Y8RA 3UF0A 5DCYA 3PXXA 1A9ZA 5IDYA 3WJAA 1QSGA 3CMMA 3LYLA 4EUEA 4PG6A 4INAA 2BLLA 1A71A 2G17A 2VZ0A 1I2ZA 3L6DA 1D4FA 2BELA 1HRDA 2GSDA 4FGSA 2NM0A 3RCBA 1XSEA 4O0LA 4PGFA 4RLHA 3AY3A 2W2KA 4YT2A 2O4UX 3MWEB 1I5RA 4D0SA 1K5HA 4YAJA 3FBTA 2NVUB 4E30A 1GUZA 3A14A 4C4OA 3DZBA 1TVEA 2GN6A 3BTVA 1QV7A 1G6KA 3GZNB 2A94A 3ZWPA 4I5DA 1KEWA 4YJFB 5ER6A 2P5UA 3A1NA 4II2A 3ZV5A 3ABIA 1HL3A 2Y99A 1I01A 1PEDA 2E37A 1GFSA 5B4VA 2O7QA 1ZEJA 4RF3A 4ZJUA 2CY0A 2HMTA 5KJEA 2GNAA 3OEYA 3UUWA 4C7JA 1PJBA 4ZQBA 4CLRA 3EGOA 1XDWA 5G0UA 1PJQA 3GPIA 4R1NA 5CDSA 2FRDA 5GZ3A 1HYEA 5IJZA 4O63O 3KB6A 4KWHA 1XKQA 1CJCA 3VTZA 4D3FA 1GU7A 4W4TA 3DWFA 1A9YA 4AJHA 3OF2A 2VT3A 4IDEA 1SPXA 3GVPA 3IQDB 1NPDA 3VPSA 1NR7A 1PL8A 3HWRA 3RVDA 1PQWA 1E7WA 2Y1FA 3JCZA 2A35A 1QXSA 3UCEA 3UW3A 5JXWA 4XGKA 4XQEA 1E3WB 4WLOA 4R54A 1F12A 3ANNA 3QWIA 3LLSA 3K2EA 5B37A 1D8AA 3GT0A 3DEYX 3ITKA 3B1KA 1ID1A 4UUOA 1R37A 4KUEA 1K3TA 3TNLA 2GZ3A 4S1VA 3UFXA 1Y9AA 2QIOA 4NBWA 3UAGA 4BNUA 4GX1A 4H15A 5MGBA 5EN4A 3RFTA 3WG9A 1R16A 4C7KA 3IKTA 4JN6B 2Q1TA 4KTTE 2QQ5A 4KUGA 2EGHA 4ZQGA 1U4SA 4UVIA 3VH2A 3HNPA 3AU9A 3K31A 3BMOB 3PTZA 1BW9B 3D5TA 3DHEA 1HSZA 3ZHZA 3TQHA 3SEFA 4PG7A 1AXEA 3ZWYA 3IMFA 5CEFA 4RVGA 1I8TA 4JROA 1BTOA 1E5QA 4TMFA 1PJCA 1ZNQO 1MV8A 4R3WA 2G76A 2LDXA 3FF4A 3D3EA 1U2GA 2X0IA 3O4RA 4OSOA 2Q2VA 2BI7A 4HFMA 3RD5A 2X9GA 2IYOA 3L4SO 4CMEA 4E5KA 3ZV3A 3HZZA 2GF2A 3C7AA 4J1SA 5A5EA 4ALIA 4M49A 4BGEA 1FJHA 4Q9NA 4D43A 4RZHA 1F8FA 4D41A 3ON5A 4BGVA 1OAAA 1UXGA 3IS3A 3UH1A 1HDCA 4P4LA 3N74A 3WTCA 3QVXA 2O3RA 2YYYA 5DF1A 4CUKA 1KS9A 1UR5A 3ENKA 3TZQA 1IZ0A 5I9NA 5L51A 4R1UA 3WGZA 5BNTA 2D5CA 4NHEA 3DOJA 3F4LA 5I9MA 4KDEA 3AM4A 1TB4A 1YDEA 1RYEA 4OXKA 4CM7A 3AW9A 3MJCA 4MVJI 4MKRA 1A4IA 3NT2A 2BFMA 3OIDA 5BT9A 2C07A 4OL9A 3GN1A 2Q99A 4PCVA 1V3VA 1XG5A 1JA9A 4I8XA 2W2LD 4I5EA 2X5JO 3T7EA 4U6SA 2WWRA 1O9BA 4P38A 2PD6A 8ADHA 1P1KA 2JHGA 3P19A 4WE3A 5FI5A 1NPTO 3UXYA 1GYRA 1VL0A 1WMAA 3TN7A 3A28A 2O3SA 3SX2A 3AY7A 4BL5A 1VKNA 4BGUA 4MVJD 1JKIA 4II3A 1N7GA 4E6PA 1NASA 2EF1A 1D1TA 4R01A 5TRTA 5DBFA 3ZWWA 5K6AA 1TT5B 3QWBA 1HDGO 1Y7TA 2V6FA 2JCXA 2VHYA 1PQUA 2PKQO 3DC2A 5L7YA 5BSFA 4BNXA 3ANMA 1TA4A 1UP6A 2C59A 4GX5A 4CR7A 2FOIA 2WMDA 4CODB 2IEBA 3OA2A 2R6JA 3F1LA 4ITUA 4KOAA 3PHIA 2GPTA 3VHRA 1PJ2A 3DZKA 5T8KA 1T2CA 2PZJA 3KHUA 3S2GA 2PV7A 3RBXA 4ZHSA 3PQEA 2FHSA 3IIEA 4PG8A 5KIAA 1ADFA 1ISMA 1M67A 1HETA 4NMHA 2XXJA 3JQBC 1MUUA 1GDHA 3RAJA 4RJTA 4R16A 3NYWA 4IJKA 1ZIDA 2TMDA 3U0BA 4IS3A 4MIEA 1CRWG 4IZIA 5JBIA 3V1UA 1DB3A 2HMVA 4JK3A 4R51A 1A7AA 1EVYA 1OBFO 1GL3A 4IGFA 4Q3NA 3RFVA 5I7SA 4DVJA 1UUFA 3OQ1A 2VHXA 5ILOA 3FNEA 1JWAB 1YBVA 2VHZA 1E7RA 5CP8A 5T57A 5JE8A 4DC1A 2Z95A 3B6ZA 5EERA 5KOIA 5EIOA 2UYYA 3DXFA 1UZMA 5HS4A 1AGNA 1XEAA 3QVSA 2PTGA 1E3EA 3R1IA 3VPXA 1EDOA 1JWBB 1X1EA 1IYZA 3JD1A 4L0QA 5K9ZA 2DTDA 4DBZA 2E48A 1R6DA 2VUTA 1MGOA 3ZWOA 2GRAA 2GERA 2DUWA 5A9RA 4CLHA 1BXZA 2QRLA 4XR9A 2PFGA 4O1MA 3JQGB 5KWEA 4BB6A 3PRJA 3GR6A 4RZIA 4N54A 1SZJG 1O8CA 1YBMA 3BHMA 4BB5A 4PN3A 1GPDG 3NDJA 4HNGA 4XYBA 3DBRA 4FDAA 3PP8A 4FW8A 1X7DA 4DQVA 2CVQA 5IDXA 1J6UA 5A03A 3PYMA 4MP3A 1A5ZA 2RCYA 1N92A 3GMSA 3JV7A 3PLNA 4JCOA 4K1LA 1CWUA 4LMRA 4ALJA 3FR8A 2B4TO 1EK6A 1P1RA 4G65A 5JNLA 1U5AA 4N5NA 1M76A 1I2CA 1X14A 5AQ1A 1HLDA 1NWCA 4PLHA 1R4MB 5FWNA 1BVRA 4RGBA 1PGPA 2FPGA 2GGSA 3LK7A 5JO0A 1XLTA 5JDCA 3H9UA 2X58A 3JYNA 2GD1O 2J5RA 4L4RA 1UXHA 3RFXA 3S8MA 1DSSG 4B79A 1T25A 2Y0CA 4XDZA 5COBA 1VL6A 5IDWA 4JIGA 4BNMA 4BNGA 3JYLA 3NX4A 2X1HA 4GQAA 3HUDA 4GLLA 4HKTA 4TZKA 4BNWA 5CDTA 1YRLA 1LUAA 3RBVA 3C8MA 2NVUA 4BNLA 3LC7O 1OI7A 3SBOA 2QYSA 3D4OA 5K0ZA 2QRJA 1H0KA 3GZNA 3EZYA 4CLRB 1C0LA 3GC6A 3SXPA 2W90A 3VPHA 4A10A 2J3JA 1YQGA 4HX5A 1U3TA 1U9JA 3L9WA 4YJFA 3ZNOA 1GPJA 2HCTA 4G81A 2Q46A 3L4BA 3DBHB 3KLMX 3QA9A 1NP3A 3MJ4A 4R9RA 3WB9A 4CUJA 1V0JA 3G0OA 1AN9A 2A9FA 3IKVA 3RJ9A 1VPDA 4WLEA 3H8VA 1ZUD1 1AUPA 2DLDA 1L7EA 3PJEA 5EJ2A 3GLQA 4IDGA 4GWKA 3W8DA 1NFFA 1ENZA 2OBNA 1JW9B 3AJRA 3ZI0A 4AJ1A 4XGIA 3TOZA 2PWZA 3E5RA 3JQEA 4ND3A 4YWJA 3NJ8A 2QYTA 5IDQA 1LU9A 3ZV6A 1HE4A 1BVUA 2YV1A 2VWHA 4QSMA 1HWYA 3HJAA 3OEWA 4G5HA 4A2CA 1JKFA 3H9JA 1UXJA 1NVGA 2QZ9A 4HXYA 4U7WA 1E3WA 4J9UE 1P0FA 3Q6IA 2Y1EA 3DZHA 2CF5A 1EFKA 1YO6A 4CLOB 4YT8A 3P2OA 1QR6A 1JVBA 4XX0A 1TT7A 3CZRA 4E5NA 3KO8A 5IF3A 4IJVA 4J2OA 2H1SA 1EE2A 4Y98A 4NK4A 1X1TA 2VOJA 2WSBA 3V2UA 2P2SA 5FI3A 2VHVA 4DYDA 2OOSA 4F46A 5B12A 1LLQA 3WSWA 2XAAA 5EQDA 5JO9A 1E77A 1ULSA 4IQ8A 5JW6A 5JAMA 2Y93A 4E21A 3BMOA 1DOHA 4PIVA 4ZRNA 4B4UA 1BW9A 4UAGA 2NNLD 1DFIA 2CVZA 5CEJA 3OJEA 4RVDA 1U3WA 4R9SA 3GPDG 4BO7A 5B4TA 3DO5A 4ND5A 1X7HA 4HBGA 4FSHA 3KYCB 4B7UA 3GA0A 3EVTA 4FC6A 3OQ6A 1ISHA 1XELA 1DIHA 2ZB3A 4HY3A 4M87A 4UEKA 5JMPA 3WWYA 2X0JA 4YVFA 1Y8QB 2OO5A 4L73A 3RUAA 3CZMA 2FPIA 3IOYA 1UDBA 4DUPA 4RPJA 4JGBA 5KJCA 1MFZA 1DHTA 1IULA 1MXHA 1J49A 4I9HA 4BGIA 5L4LA 1RPNA 1DXYA 4DPMA 1NAIA 4HADA 3AU8A 2C29D 3LSYA 5L7TA 4LVCA 4FD3A 1HEUA 3KYDB 2BI8A 1EK5A 5T5QA 1GV0A 5EL0A 3KUXA 3K30A 2D4AA 2H6EA 4JX8A 1Z82A 1DC3A 5HM8A 2B4RO 3BTSA 3WLFA 1XA0A 1QYCA 2TMGA 1IUKA 1PGOA 3OFSA 3HN2A 3L6OO 2O23A 1I30A 3RUEA 4W99A 5B1YA 5THKA 2EV9A 1BG6A 4CM5A 5JC1A 4PRLA 5JCXA 1M6WA 4RORA 1OFGA 1X0XA 1RWBA 3C1AA 3PWKA 4XJSA 3DBVO 3F4BA 5T6BA 1X13A 1FDWA 3WIDA 2Q45A 5B4UA 2NADA 2EP7A 2XPCA 1GV1A 2E6UX 4YDRA 5CDGA 1RM0A 1H94A 3DDNA 2P9CA 3AI2A 4UVEA 4WLVA 3N58A 2CD9A 2P91A 1P1HA 5GZ1A 3H5AA 1WDKA 3MJSA 1LDGA 2ZB4A 4KDFA 4RQTA 4JQCA 4B3JA 4EJ0A 5TSDA 1IHXA 1WDLA 4HFJA 1VKOA 3ZW9A 1FDTA 2DPGA 2VYNA 4YAIA 3KLPX 5H82A 3BYZA 4RDHA 5GMOA 3TFOA 2DBQA 1TT5A 5AVOA 4BKUA 3DAPA 3DL2A 1B15A 1O6ZA 3A4VA 4CLXA 3K6JA 3INRA 4OXNA 4WPGA 1B26A 3AFNA 4B4VA 4JNKA 2DFVA 2BGMA 4Z0HO 2X6TA 4H3VA 3E8XA 5G0SA 2JAHA 5A06A 5CG1A 2FR8A 4WNIA 1B16A 4BIIA 2DBVO 1W73A 2GLXA 2I99A 4ZQHA 5TJ9A 4DA9A 2PGJA 4Z9YA 1GY8A 1ISFA 3WBBA 2ZQZA 3G1UA 1KIFA 5BNIA 2EKPA 4N5LA 4YA6A 5DOZA 1DJNA 4F3YA 3AUSA 2C7GA 1RJWA 2UUOA 4DPLA 3RC9A 3HN7A 2G1UA 3JQAB 3KSUA 3BHIA 3FR7A 3FD8A 4OJNA 4OYRA 2O3QA 1ZBQA 3KOUA 1CQJA 1N9GB 5EQFA 3WIEA 3VDQA 1O5IA 2RH4A 3U3XA 3AI3A 4J7UA 1XIVA 1YJQA 1DC5A 4E32A 2JAPA 3QVWA 2FMUA 2CUKA 1RM5A 3ZU2A 7MDHA 2YHIB 3GY0A 1KC1A 4GGOA 1CYDA 4GKBA 4AJLA 3U4DA 3PQDA 4R1SA 4QT0A 2BGKA 1HZZA 1KOLA 3LT0A 3OQBA 1BXGB 1GD1O 4IMPA 2C7VA 4OAQA 5GY7A 5KKAA 1MB4A 5ENVA 3OETA 3C85A 5DP2A 1UAGA 3O26A 4CQLB 3EK2A 1U8XX 3HB4X 5KNLA 5THQA 4IXTA 1GUYA 1EQUA 3KTDA 3M1AA 3VZPA 2EERA 3GOHA 5I7FA 2NTJA 5H81A 4BQRA 4J0FA 2BHLA 3F5SA 3VPFA 1ZW1A 1RYDA 5TT1A 2X8LA 1KY5A 4MINA 2RIRA 1TI7A 4GSKA 3ZGYA 4TVBA 2AA3A 5IG2A 4J4HA 1EUZA 4J1TA 3OJ0A 3Q9NA 3FN4A 5IXSA 3VZSA 2ZB7A 4IXWA 1B7GO 3WGHA 2QG4A 3DFUA 2PH5A 1M66A 1AHHA 1ADBA 4IDDA 4Z0PA 1CETA 2D0IA 3I1JA 5C7OO 4YXFA 3MOIA 1GEGA 4LCJA 3X2FA 3ETGA 5G0WA 4YAKA 3NEPX 2EKLA 1F14A 1R4MA 1QYDA 2EHDA 1G1AA 3F6YA 3OSUA 3BTUA 3E48A 1HE5A 2HMWA 1LC0A 4X54A 2VWPA 4GL4A 1E1KA 2OXIA 4E33A 4QQRA 1EE9A 1QLHA 1LEHA 5LCXA 3V2GA 2BGLA 4FIZA 4L76A 1EZ4A 3FNHA 2AHRA 3MJTA 1NFQA 3OIGA 1LXCA 4NI5A 4DTIA 3A9WA 2I65A 4I5FA 1BSVA 2ZYAA 3GAZA 2NTVA 4IQ0A 2Y1DA 4P8RA 2JKVA 2PZLA 3GZ4A 4W9NA 4XEHA 5F21A 2D5AA 1WP4A 3JYPA 4FOSA 4CMKA 5IFLA 4XA8A 2OUIA 4I08A 2EXXA 1NVTA 5BSEA 3G79A 4KTVE 3BMNB 4H16A 3O8QB 3DBHA 3DZIA 4FN4A 4XYEA 2DM6A 3V5NA 2O3TA 3KRTA 4PLVA 3AK4A 4YYZA 2J3IA 4YCAA 4BV9A 2O2SA 3L9XA 3WGTA 1LLCA 3H65A 4D7AA 2NLOA 3BMQB 3ZU4A 4RVFA 3VC7A 4ZA2A 4D3SA 3AOEC 5HWSA 2GCGA 2EIHA 4FFMA 4QXMA 4XGNA 2P9GA 4FQ8A 3NAQA 3ONDA 2V65A 2B83A 2J5QA 1EUDA 1ISIA 2FPPA 3FRJA 3NGLA 1JLLA 1U8FO 9LDBA 1Y1PA 4ILKA 3PHJA 4WLUA 3FHLA 1GCOA 3S2FA 2GN8A 2ZTMA 4M89A 1HXHA 1I2BA 1MG5A 4NBVA 1WMBA 1M2WA 4CM3A 4FR5A 2CDCA 3U4HA 5IN5A 4CLOA 2OP1A 2HRBA 3I9NA 4DMMA 2PZMA 3WQRA 3H9QA 3FTNA 4J2HA 1QLJA 2I3AA 1Q0HA 4AG3A 5JSFA 2BFAA 2W4QA 1LDBA 4PRKA 2HDHA 1A27A 2NSDA 1IPEA 3ADPA 2WE7A 4CQMB 4W82A 3HG7A 3T4EA 3KEOA 1LDYA 3ZH2A 5TJHA 1I0ZA 3MOGA 1B8VA 1VC2A 4OMUA 2DT5A 1HE3A 1I3KA 4NFYA 2IE0A 3ICCA 4Z9FA 2J8ZA 1U28A 4A73A 4YJDA 1PJ3A 3DBLB 3EY4A 4UULA 2ZIZA 1LTHR 3GVIA 2VRCA 3L07A 2IDZA 1ZO8A 2HU2A 1NTOA 2WYUA 1NR1A 1O94A 3K92A 4DQXA 4JP3A 5C37A 1W0CA 3DMTC 1GCUA 5T64A 5F5NA 1H93A 2C2XA 5A1TA 2I9PA 3WQQA 4CL3A 1YKFA 2YQ5A 3KYCA 4WEQA 2VWGA 4JXKA 1GQYA 2GN9A 3FWZA 5FYDA 2OHXA 3E9NA 1CEQA 4D46A 4Q3EA 3ZU3A 1Y8QA 3JQDA 1HZJA 4QFDA 2VUSA 1DPGA 3CIFA 5L3ZA 1YQDA 1IHYA 3HB5X 5JC8A 4PZCA 1O89A 3WJ7A 3W6ZA 3I6QA 4GSLA 3PGXA 4FFLA 5JAQA 3WMXA 5C3MA 5J23A 3PPIA 5A9TA 4YB8A 4IJWA 5JYEA 3ST7A 4NH4A 3HDJA 3X2EA 4E2XA 1IZ9A 3DMYA 4NIMA 1JVSA 2PR2A 3KYDA 4ESOA 2E49A 4M54A 2UDPA 1YDWA 2GYYA 1LQUA 1J0XO 2IXAA 3SVTA 1EVZA 1DEHA 1WNTA 2NVWA 4NDNE 3G3EA 1DIRA 2AEFA 2O2YA 4XD2A 5CAEA 7ADHA 5U1PA 4N7RA 4Y6RA 6LDHA 4YJHB 2JFHA 1ZJYA 5CFZA 5DOVA 3ZN2A 4PZEA 3QVTA 4YTEA 3NDRA 1QRRA 1OOEA 3U49A 1H2BA 1E6EA 4MO2A 5COAA 3RUFA 1ZK4A 1T4DA 4DPKA 3K5PA 1U7TA 4D79A 3RUCA 4J1NA 5I7EA 2C54A 2RH8A 3CEAA 1PGQA 2GUGA 3OBBA 4PLZA 3JQFC 2EW2A 2JD0A 3TJRA 4Z0TA 4XQGA 1EVIA 3LC1O 4JBGA 3UGKA 3WR5A 2Y67A 3O38A 1Z74A 1DLIA 1E3SA 3AOGA 4UUNA 3R6DA 4RPLA 1E6UA 1F8GA 3TZCA 3AUAA 1E92A 2V6GA 4I9NA 1YBAA 5KVSA 1PGJA 3WGOA 4GVLA 2FP4A 1YH3A 2VTEA 4ID9A 4UEJA 1JAYA 3E9MA 1SBYA 1DRWA 1Z7EA 3RQSA 3CKYA 4B8WA 2VQ3A 3PLRA 1P33A 3WMWA 4YRBA 3ANLA 4GLOA 5FFFA 2IODA 1U5CA 2X23A 3VH1A 3PWSA 2CNBA 2HUNA 4P22A 4DC0A 5TT0A 3WQSB 1DC6A 2VCYA 3HSKA 3QSGA 2ZTLA 4WCFC 1PWZA 2CF6A 5DN9A 3AFMA 3QW2A 3G49A 1I32A 2ZATA 3OECA 5DCUA 1KETA 1LQTA 3JD0A 1HDZA 1SOWA 1GQQA 3NT4A 1ADGA 2PK3A 5ENDA 2GR9A 1DFHA 4CV2A 2IXBA 3JQAA 3TSCA 2C5AA 3WYCA 1K89A 4TRJA 4TVOA 3Q2KA 4Q39A 1EQ2A 4MKXA 4IY1A 4WNCA 5KJ6A 3JYQA 3U9LA 4W6ZA 3FTPA 2DKNA 4RVUA 1MFPA 2PLAA 1I10A 4J7XA 1N9GA 1KY4A 5L4NA 1CF2O 1VM6A 2AXQA 3GUYA 4S3MA 4JLWA 4E31A 2AG8A 4NFHA 3TF5A 3CE6A 4E5PA 3GVCA 1NM5A 2YHIA 4ZQEA 2NU8A 4DRYA 4GMGA 3UN1A 4DLLA 3LZ6A 1BWSA 4Z3DA 1VRWA 1MG0A 2PKQP 5IN4A 3GDFA 3CUKA 4RPGA 1BXGA 5L9AA 5EINA 5L40A 1BDMA 2YW9A 1W4ZA 3ZCXA 1IB6A 2X5OA 4CQLA 1MXFA 1ZKMA 2VTDA 3LF1A 1K0UA 4AICA 1LDEA 4XB1A 3TL3A 1U1IA 3TDKA 2PY6A 4KQWA 3IJRA 2C0CA 3PJDA 4AJNA 1A7KA 3WDSA 2DTEA 4Z3KA 4FFPA 3NTOA 1IPFA 2YDXA 4M86A 3IP3A 4RQUA 4XYGA 1NQTA 1Z6ZA 4J4TA 1ENYA 3FWNA 4BMVA 4OOEA 1LLUA 1IOLA 1J5PA 4BNJA 3BMCB 2ZTUA 4ONEA 4TZTA 2JD2A 3STHA 3AI1A 4IIUA 1QORA 3D3WB 1LI4A 3JD4A 2B0JA 4RCVA 4CV0A 4GMFA 5BNFA 3U4IA 3MWDB 1I3MA 3GVHA 4B7CA 2OZPA 1KERA 1JKJA 4NNJA 4CMAA 5A3JA 2PGLA 3RASA 1ZSVA 2F00A 3OJLA 1PIWA 1SC6A 1GYPA 5KCZA 1WAMA 4LCEA 3I9JA 2JJYA 2DC1A 5A05A 3V1TC 1ZJZA 5ES3A 4E5YA 5ADHA 3FCOA 3GG9A 4AVYA 2NUAA 1PR3A 2FWMX 4YT5A 3G1TA 1N1EA 2PH3A 2YJZA 2IZ1A 1B3BA 2J3HA 4FBGA 4ZVVA 5T67A 3F47A 3W4KA 3R3SA 3VKUA 3EDMA 3EZLA 3RSHA 2AE2A 3RROA 1DC4A 1WW8A 5COQA 3DTTA 2LDBA 2X4GA 3GHYA 4BUCA 2EW8A 3F9IA 3Q11A 4URFA 2RBEA 3W8EA 2DBZA 3BMNA 1B2LA 3IUPA 3O8QA 2HRZA 1T26A 2P68A 3CMCO 4K6CA 4ND2A 4O6VA 3OH8A 2IEDA 4A27A 4CM6A 1EUCA 3V1YA 4LN1A 1K6JA 3BMQA 2DPHA 2YV2A 4QEDA 4ZGWA 4YR9A 2BKAA 2EWMA 1V35A 1NPYA 1Y5RA 3ZHYA 1KC3A 1SEVA 3U09A 1AXGA 4JJGA 1GZ4A 2R00C 4GGPA 4WK6A 4Y67A 4HWKA 4XZ3A 1OMOA 1ORRA 2I3GA 3IJPA 1B3RA 3ASVA 3B20A 3DQPA 1FK8A 1HDYA 4MIYA 4BNTA 1E1MA 2PD3A 3P5SA 5KVVA 3K73O 4WLFA 2R2GA 1ONOA 1NQ5A 1NVMB 1P77A 2X9VA 5BR7A 4GX2A 2CZCA 3JQ9C 2RAFA 1D3AA 3AUUA 4GH5A 3HQ4O 3W4JA 4HNHA 1SEPA 1V9LA 1C14A 1XCBA 4OXYA 4TRMA 2HK8A 3E6AA 4R68A 2ZCUA 2OGUA 3BZUA 3E18A 3RC7A 1AHIA 3VH4A 4BNZA 5L95A 3OICA 4CQMA 4TRNA 1ZMOA 1LSUA 3FNGA 3UICA 2CDBA 4CM4B 4AL4A 1NQAO 5BQFA 3OIFA 3H2SA 1U4OA 3ZNQA 2EJWA 1W6UA 4O59O 1DRVA 4J0EA 1XQ6A 5L53A 4YPOA 3GH3A 1F17A 2G0TA 3NRCA 4OOFA 2V7PA 1C0PA 1K6IA 1VSUA 3DBLA 4YEDA 3RU7A 2YV3A 1G0NA 3WGYA 3BAZA 3ZW8A 1HSOA 2IZZA 1DFGA 4IMRA 3F3SA 3K9QO 4IZHA 1Y9EA 1T4BA 2AE1A 1UH5A 1SNYA 4CQMD 5CDYA 4DREA 3DHYA 4RF4A 1CDOA 5F1KA 1U3VA 1LRLA 3BA1A 2C2YA 3DR3A 1B8UA 1CQIA 4NG5A 4FFNA 3SJ7A 4J49A 1UP7A 1QYXA 2YY7A 4AJ2A 1P1FA 2GZ1A 5G0TA 5L45A 3EHEA 3E1KA 4PFJA 4ND4A 2HSDA 4J4BA 4PLCA 4BO5A 3RI3A 5KVCA 5A02A 4R1TA 2J3KA 3DFZA 3ZU5A 5JFOA 1KBZA 5I9LA 3SC4A 5G2OA 3RUDA 4AJEA 3PJFA 1LRKA 4R41A 2OMEA 1JTVA 2Y1GA 4WOKA 1Z45A 1I33A 3K2BA 3MJVA 3PEFA 3RUHA 4IGEA 3ROKA 2YUTA 1PS8A 4FS3A 3BTOA 4QX6A 1NHGA 3MZ0A 3C24A 3OP4A 4CV1A 3JD2A 3JQFA 5A9SB 2OORA 3GF4A 3OA0A 1HE2A 4FB5A 4DYVA 1ZEMA 1N7HA 2D8AA 3ZWNA 3UKOA 3WXBA 3INTA 3WNVA 4CM8A 1ZCJA 1MP0A 4J1QA 4NJMB 2VT2A 2GN4A 4PLGA 1NAHA 2BD0A 1YVEI 1HYHA 4IDCA 4YJHA 4D0RA 3WS7A 3GEGA 3I9OA 4CMJA 5L7WA 3GAFA 4UUPA 2B36A 5F5LA 4BNVA 2B4QA 4PZDA 2ZQYA 5A3VA 2Q1SA 3JQBA 4W7HA 1EMDA 3GK3A 3L0DA 1XQ1A 2UAGA 3U5TA 4Y6SA 1Y6JA 3IUSA 4Q3DA 5EPOA 4D45A 4OIMA 5BSGA 2GASA 4WCFA 3HFSA 2FSVA 4BO0A 3GEDA 3P2YA 1B0AA 1D7OA 4XRRA 4XYLA 3KVOA 2VYND 5JCJA 1PTJA 1ZK0A 1CIVA 4CPDA 1WPQA 2DBRA 4AJ4A 1BRMA 4PLTA 3RC2A 2Y1OA 1FMCA 1DLJA 3GN2A 1H9BA 1PX0A 2AEJA 4G2NA 3GRPA 5JYDA 4YACA 3DTYA 1E3IA 3HE3A 3W1VA 5CEEA 2I67A 2EG9A 4BS9A 5TNXA 4ALMA 1E1NA 4MVJM 3R0IA 5I8WA 3WGIA 3ONEA 5C5IA 2HJRA 1DAPA 3H9GA 4ZD6A 3W6UA 1FDSA 5TQVA 1NWHA 2BFPA 2WJPA 3LVFO 1SCUA 1QV6A 1ONPA 1ULUA 4AJIA 2O7SA 1M6HA 2YHUA 4J43A 3M6IA 2AQ8A 2Z5LA 2H5LA 5ICMA 1ZXBA 4DIOA 3I4FA 3QHAA 4RVHA 3NGXA 4PLPA 4NK5A 5JPIA 2D59A 2G5CA 2HKIA 5F1PA 5T8KC 1P3DA 1OC2A 3ITDA 3TZ6A 4JP2A 3DAFA 1X7GA 3W4IA 3H5RA 3I83A 1GQ2A 4ZN6A 2O3UA 2AW5A 1ZMTA 1LC3A 4XWYA 3WX0A 2BH9A 3L77A 5G4KA 3P7MA 1ZK3A 1JN0A 4YBZA 4U0KA 1HLPA 2UVDA 1DHRA 3FPCA 3LT4A 3HFGA 5TF4A 5HRUA 1YJ8A 2JFGA 4EJMA 4IJUA 2CFCA 2JCVA 1E3LA 4F6CA 3QE3A 3VDRA 3ZWBA 2B37A 2ZYDA 3SLGA 2VZ9A 1W8DA 3JD3A 3QWFA 4LISA 4N18A 3QQPA 3JQ6A 4MP8A 5ER9A 3ORFA 3ZWXA 1H5QA 1T2AA 1EVJA 4FFOA 1ZFNA 4J91A 2NVBA 3F46A 4BKQA 5ICSA 4M8SA 1YWGO 3I3OA 2Y68A 1L7DA 4ALKA 3C7DB 3SC6A 1VSVA 2YFQA 4L4XA 1ZH8A 4GBJA 1P74A 4Y6PA 3WNQA 2Q1WA 1S7CA 4BOYA 3TZKA 2X0RA 2PGDA 1YL6A 3EW7A 3INGA 2UV8A 1ZSNA 3BIOA 3BMCA 3LC2O 1R0LA 2XXBA 1DDOA 2PA3A 3EVNA 3MJEA 4FJ1A 3EMKA 4DGSA 3L6EA 3WLEA 3D3WA 2IRWA 4WOJA 2FZWA 3PHHA 1LRJA 3WTBA 1EDZA 4MPDA 5EESA 3D1LA 5ITVA 4L74A 1ENPA 3QRWA 3WFIA 4E0BA 2P4HX 4XQ9A 4YJGB 1DBVO 4CLDA 2WEKA 4BHTA 4F6LA 2JCYA 2O48X 5KKCA 3D4PA 5I8ZA 3M2TA 5C7LO 1GEEA 4PG5A 1YXMA 3I52A 4L8VA 3UCFA 1T1SA 3VVBA 2AG5A 2ILTA 2ET6A 1VJ0A 2GDZA 3VAZA 3D4NA 1KEUA 1R12A 2HK9A 3VVCA 4CMGA 1JAXA 1LJ8A 3JQ7B 4BNFA 1LDMA 2D1YA 1YL7A 2JD1A 4NR0A 1PWXA 2RHCA 3VZQA 1IE3A 3BHJA 1DJQA 3MCVA 3SLKA 4AFNA 1P0CA 4WKGA 3RC1A 1F0YA 1C1XB 4M1QA 2R00A 1NFRA 4R3NA 5JDCC 4WGGA
chains in the Genus database with same CATH superfamily
3Q7RA 3N59A 1Z5OA 2NV0A 4U3JA 4TXHA 2IBTA 2V6BA 2CDNA 1G8MA 5KJFA 2JLXA 4X8HA 3TRJA 3PI6A 3BGWA 1NJ6A 4NOKA 2QG9A 4FMBB 1NVFA 2IHUA 1ISGA 1R15A 3PC2A 4MS4A 4AROA 1NQXA 4BMDA 3VTFA 1AF4A 1WZEA 1Y1RA 4XSGA 1FP1D 1P1IA 4A7PA 1BWRA 1SZCA 2NU9B 1KIMA 2O1WA 2WD9A 3LC0A 4LF5B 2YXPX 4ANFA 1O95A 3LCMA 4BEBA 4CKCA 3C3YA 4Y2RA 2YVLA 2HF7A 1P7YA 2LCQA 4FZ5A 4CI9A 2V45A 1ACJA 1MZVA 1Z5VA 4RLSA 3D3KA 4DXAA 5IZCC 4A0QA 2D54A 4ZTBA 4K03A 5TQ2B 3EG9B 4AZ0A 4OHXA 2HAEA 4TTRA 7REQB 3K8QA 2K2QB 5I5EA 3CRW1 3PDUA 3QW4B 2AOUB 3BL6A 1I3LA 2FFAA 2XGGA 5DGTA 1BFKA 2QQEA 2Z8YM 3MK31 3SG0A 3WO1A 4PSVA 4QVIA 1GRNA 2PL5A 5M7EA 4GUDA 4DIEA 3N8DA 2R1TA 2SKEA 3I2HA 4HWOA 4LX8A 4D8UA 1YAJA 5IMSA 1UDAA 1BXKA 1WUYA 4GOKA 2ZUUA 4IFBA 2I2CA 1WU8A 4JVLA 4C0BA 1HG0A 4BBJA 1QO9A 3RSZA 4CKXA 1QX3A 1MX5A 2QM8A 1P19A 1T2FA 1I6WA 2W0SA 1YZKA 4WN9A 3UOGA 5C8ZA 1QS0A 1HT2E 4FGJA 4LZPA 1DIBA 2E5FA 10MHA 2JDIA 5AKKA 1YHNA 2P9BA 1YDMA 1MC4A 3GFQA 4PZUA 4YRLA 5EPUA 5JLAA 4ALNA 3N2GB 4UHCA 1GA6A 3REGA 1ZA2A 3ETDA 3DMFA 1TTPB 4MGYR 4CM4A 4K86A 2QPLA 2H9IA 2JASA 3LD9A 4LX0A 1EEHA 2EFGA 2LUOA 4DSOA 3VO9A 4Q93A 1CERA 3B5EA 3C6KA 1OE0A 2BKXA 2EBHX 2XUFA 2Y05A 4YUWA 1KGSA 1NHWA 2I7TA 3IMEA 1R88A 3N39C 4RENA 3W5HA 3GIDA 4FQ5A 1YS9A 4EABA 2DSNA 1E2KA 4E70A 4D82A 3GDOA 2C3PA 2QV0A 4B3XA 2VYVD 1DP4A 1XL0A 2EKZA 5EEGA 3AFIA 4RA9B 1NL3A 1RQLA 5C52B 2JL1A 2ZKLA 5CD9A 4QYSA 1P1BA 4FZ3A 3C87A 4J07A 3TSOA 4I9UA 1BCRB 1FVFA 2JF0A 3UPUA 1GZUA 4H7PA 3SNKA 4JLBA 4CMCA 1U4NA 5CBPA 1RLUA 2FW8A 3WBFA 2PS3A 2Q1UA 2PKYX 4AMZA 1NP7A 1D2GA 3W2EA 4AY2A 4C0XA 1DQSA 3OX1A 1SGWA 1XUOA 1YRBA 3MLEA 1OFIA 1TQ2A 1EBUA 3RB8A 3PHGA 1PQPA 3WDLA 2WF7A 5MHTA 2Q6LA 4RPKA 2QNBA 5KHLB 4EPVA 1ZGZA 2YUIA 1XVIA 1X9GA 2XYPA 1UBHS 2A9KA 1T8RA 3BXPA 3Q9UA 1QF7A 1DMSA 1JLMA 3IE0A 1X1QA 3DZJA 1KSGA 2VUHB 2ZW9A 1FX0B 2Q5FA 2Q0HA 3SX0A 1XZHA 5TEVA 5KOHA 2IYQA 3V32A 3GRKA 1YQXA 5EOVA 1HT1E 3GFVA 3FNBA 3PZBA 5ECDA 4CM9A 5JBNA 5MFZA 1QR2A 1D2CA 1MVLA 2OO5C 3PX3A 5A5GA 3L46A 4BKOA 1YE3A 3UOAB 4BMCA 3UMMA 5FORA 1MC8A 2A0WA 5EUCA 4ZVUA 2ODTX 1GTSA 1V6AA 3H1PA 3BGOS 3I9V6 1WWKA 3QP9A 3VR6D 3EAGA 2ZULA 3CZQA 4KMSA 4MVJA 1NNEA 4IX9A 4QASA 2WD7B 2HHAA 4R7ZA 1A5SB 1GTJ1 3NFRA 5EIAA 4YAGA 5EIHA 4PO9A 3RWBA 4LI3X 2BGUA 2FJUA 3ANSA 4NPCA 4FM9A 1NTRA 2PTHA 3FRHA 3IBGA 4R8RA 3ZQJA 2EZ9A 4U7TB 1M0WA 1MLDA 4AQDA 5F23A 2X8JA 2WVAA 2Y76A 2F9MA 3FGPA 3LOUA 2C2KA 4WKOA 5DI3A 1PGNA 4QYWA 5DX1A 5KYUA 4HNUA 5CYGA 5LDDC 4IJ6A 3PZRA 1T6YA 1FB5A 1LDNA 3M83A 2XGOA 4QUIA 4Y2UA 1SKMA 4I4LA 3COYA 1RLJA 3E3LA 3UJPA 1XDSA 3MT8A 1IBKB 4UPDA 1ZUIA 3T8YA 1CR6A 3DZGA 3I5MA 3CPSA 1L5YA 3P8ZA 4OH1A 4DUYB 1RZRD 4DL9A 4JAVC 3GB9A 5CNKA 2QDXA 4NV0A 5IUNC 2FZEA 4J6FA 1ZIOA 3M9XA 5KQGA 1E9VA 4HAXA 1S1MA 3RUIA 3X43A 5GIPE 3G7UA 1SAYA 1WDMA 2EDAA 2IC5A 3FUCA 4QNRA 2ONJA 1GADO 3TWOA 1TM3E 5KTRA 5JYBA 2OSVA 3EXAA 3STUA 3ZLBA 3HUUA 4NDZA 2JIRA 3K2QA 3THSA 2ZRMA 4AK9A 2WK1A 1ZD4A 1LZKA 1D4AA 2NSYA 3SX4A 2QN6A 2XNCA 5DULA 2E7ZA 2Z6VA 4Q6WA 5TX7A 4U0JA 4DCGA 2YHSA 4NCIA 1A5AB 3VKFA 1M2GA 1QTQA 2ORYA 3FOZA 5M04A 4EKGA 3VR4D 2IV3A 4F45A 5JAIA 2LE0A 2QX6A 3C1OA 3NUZA 4Z9XA 5TARA 3DZFA 1LSOA 3CN9A 4E88A 2NU7B 3WKAA 5EHXA 4I55B 1B8PA 3ENNA 2NO9A 3X1YA 1Q91A 2PX8A 3QUTA 3BE6A 3I09A 1P1CA 4B6FA 4FGWA 4TTJA 2XYVA 2WIJA 5JDIC 3GNQA 2QTZA 4KITB 4QVGA 4R69A 4RD0A 2D7JA 1EG7A 3EC2A 1Z2NX 3M1LA 4OVKA 3KWMA 3ROXA 2F1KA 4ZOAA 4AT1A 2Z3VA 3Q1LA 2OZEA 4I99A 3R7NA 3U17A 5FR1A 1O5TA 3PC3A 4K6OA 4AI6A 1V16A 1HQDA 2H1RA 3CH6A 4DILA 5B3LA 3FOFC 4L07A 4GBGA 3MD0A 2X0DA 2J9FB 2NN3C 3OFVA 3BGIA 1E7MA 4LRSB 5FV7A 4PZAA 2Q6TA 5I9TA 1F5NA 1GPMA 3THYA 1IOVA 5GMOA 4DLAA 3ZE9A 4E5UA 3V7NA 1ZINA 3P9ZA 2BFOA 1Q1BA 3AERA 3I45A 2AEMA 4AW9A 3NONA 5D51S 3RTBA 4ND6A 3NBMA 1WZIA 3ESBA 3Q3CA 4DY4A 5KYTA 1N3YA 3LXMA 4ZXPA 3O2NA 4TYYA 2PBLA 1RM4A 4I50A 1RXCA 1XTSA 4JBIA 1GRCA 3LY7A 1FU8A 5JWOA 5K8VA 1D6SA 2WFLB 3IV9A 2XSZA 1UF9A 2ERCA 4P83A 4BE4A 3IL2A 3LCUA 2Q6OA 4XE5A 1G6Q1 3CTPA 3MRXA 4X6XA 5TGDA 4RO0A 2HHJA 3G2QA 1VG0B 3TLJA 2GEKA 2QLLA 4INOA 4AKGA 2CFOA 5FV4A 5EJ7A 1Z0KA 4TOIA 5F12A 5FTLA 4KP7A 3KOWA 4OAPA 3FOCA 1TM1E 4FR2A 1P2VA 4I4TB 4JITA 1JQBA 4GS5A 2WU0A 3KUDA 4JDPA 3PX7A 3MYRA 2RHWA 4Y2HA 5FNVF 4CKZA 5CA1A 4G4IA 1SO8A 2YASA 4ENSA 1UBSB 2H2WA 1YIDA 4FJ0A 1PT5A 3UAVA 2ZROA 3CINA 4IZ6A 4QVKA 4ICIA 3SQXA 5B3AA 1JTEA 4NJOA 2HRCA 3UMJA 4AF7A 1NUAA 1VZ3A 4RF5A 1YQWA 1E5LA 4E6EA 4OLBA 2BYTA 2Q3JA 4WVFA 2D0OB 5FWYB 3I23A 1WLSA 4S1TA 1J8DA 1T0IA 3WICA 4EW6A 4A8PA 4RTSA 4TROA 3UFBA 3MMNA 3WNZA 3WYEA 4D4KA 4FHCA 4I36A 1LPBB 3OTGA 1QIKA 3CTMA 2VHCA 4J1TC 1C1YA 1JTFA 1TADA 4JUIA 4NF2A 3ERCA 3BAFA 5JNRA 1TEHA 1I94B 4A3SA 3EPPA 1DMRA 2DAPA 2QN2A 2V5UA 1SHUX 2N3ZA 3PFHA 4LBVA 3IOBA 3LA6A 1QIHA 2JI8A 4MV0A 1P62B 1C7EA 3IP5A 4GYWA 4UUMA 4UVHA 1OAKA 1GYQA 1PFUA 3GEBA 3G2HA 5DB4A 3T4XA 4BFXA 4GXTA 3WGGA 4BO2A 2DQZA 5B57C 4BLOA 3TFQA 1KP2A 1SBHA 1E96A 1T29A 3SK0A 1P72A 3SD7A 1ZVQA 3PS9A 4UBOA 4W7IA 5AR1A 3EIFA 4Z49A 2ZRIA 4L4SA 4DDTA 1SUFA 1V4BA 2O5VA 4DV7B 1CW2B 2X15A 1PK7A 3WYBA 1DO8A 2YR0A 5KJ1A 1NQOA 4JLJA 5ULLA 3TW6A 5EKSA 1RHRA 3FKJA 5EVJA 5B6PA 2E85A 2X5KO 3KHSA 1FFBA 1R66A 5DN6A 2ZDQA 1GZ3A 1FFAA 2QSJA 1FXWF 3LV8A 4J6EA 3FOWA 5DEOA 3TQTA 3NO4A 4KR3A 1K6MA 1TO1E 2XUDA 4BO3A 2OAP1 2WTBA 1VYHA 4IINA 1ODIA 2VH5R 3O7MA 4NU5A 2D2IA 3RTGA 1BX0A 2NU9A 3OPMA 1CZUA 1IXYA 2B8WA 3IQFA 1XR3A 2P9EA 3NC1C 4BKPA 2WSYB 3KOMA 3DE6X 1D2EA 4A15A 4X71A 2R7AA 2VJLA 3Q2IA 2EJBA 1R8SA 5DGXA 4H3KB 2BHTA 4OI4A 3UFXB 1WXDA 3L0SA 2RBGA 3EG9A 3Q3HA 5TQ2A 3F78A 4LTDA 3VSAA 7REQA 1YUNA 4UQLA 1SY7A 3JZFA 2WM8A 4ENTA 5KPDA 1H6DA 1Z38A 2AOUA 1C30B 5FR2A 1FUIA 5K0EA 2W6ZA 3KAPA 4I1RA 4WGFA 1YJXA 1F48A 4FT4A 2WT4A 1HYGA 2O50A 4LYFA 4PICA 1LWOA 1EAMA 1Z7BA 4ZT2A 1LBEA 1G8YA 2QT1A 1VI2A 2ZUTA 1EFLA 2NZXA 2CBXA 3U13A 5E0OA 4HF7A 2G7ZA 4HFNA 2JKYA 2PS1A 3LT1A 4CJXA 1Z6QA 3GT4A 1QDUA 1QYVA 3PQCA 3OKAA 5E3JA 5H59A 1RPJA 2WM2A 1TLTA 2HW8A 2O8DB 3MTGA 4BQPA 4DZRA 3PFIA 3GA7A 1PT8A 3HXKA 2QLBA 3ANXA 7AT1A 2NQ2C 1UINA 3VJKA 5HCUA 2VPWA 2CMKA 3TJZA 1JSRA 3KZKA 1EDBA 4RL6A 4RVCA 3CIOA 4QHSA 2OG1A 1LPAB 3PNMA 4KO1S 5U4XA 5HIAA 1N0WA 2FK7A 1KEVA 1Z6PA 3IEPA 4IRMA 4Q01A 3WK9A 3SBDA 5CG2A 3DO8A 1F7VA 2XUZA 2Q27A 4UARA 3T3IA 5B2EA 3UXHA 5L3QB 2DH5A 1FDVA 3ZLVA 4JJFA 2ECFA 2B4YA 3D7LA 1Z0AA 2OBLA 2VC2B 2ZJBA 1RS0A 3HDQA 3LDHA 5FPYA 3UEOA 4DN6A 5IVKA 4XQCA 5DGDA 4DMCA 1Q0QA 5HA5A 1VGRA 3VMMA 2CYBA 4LCBA 4V0RA 2OBFA 2ZBPA 4ZZ2A 2GETA 1K9SA 4KPGA 4O3MA 4RA9A 3KSZO 2GZ2A 2NUPB 2VDJA 5LXTF 5K6RA 4JY7A 5L3SB 3I4CA 1RWNA 4MYCA 1BCRA 4UVGA 2F8MA 1SKAA 2FEPA 4PAGA 3WYDA 3WGLA 1RT9A 2IYWA 1WXWA 4KWIA 1MA0A 4EG3A 4JSTA 3LZDA 3KJIA 3OAAD 4UMEA 1R0YA 2RHOA 3TOXA 4BMSA 1HA3A 2D2VA 2X5NA 2PX3A 1CJTC 4EBFA 1F6DA 4NZ9A 2FSGA 4GZ6A 2H59A 1YT5A 1H6AA 1TEXA 1RFLA 2P5YA 3E22B 2B4AA 1Y81A 2Y1CA 2RGBA 3O2SB 2WYWA 1FX0A 3LBYA 5BMVB 3IUQA 3ELUA 1WCWA 2EZTA 4G26A 4MVJG 4MI9A 3V8MA 1JEJA 1QE3A 4B45A 4X8OA 2B9VA 1XPOA 5JTTA 1VE1A 2PMBA 3DEJA 1ORHA 2YNMC 1WHSB 1Z4OA 3PBKA 3SZMA 1VLHA 2CUTA 5K2MA 3KZVA 2OTCA 3G8DA 5JNSA 3J80A 2Z8ZA 4RK1A 5HJ2A 2PMKA 4GUAA 1OC4A 3SIXA 1GCAA 4JQOA 4NEQA 1Z4QA 1NN5A 3GHHA 1FOEB 3A9VA 3V4PB 2JLCA 4M7RA 3RT9A 4BGDA 2XF8A 3I1IA 2WD7A 3AG5A 3BZBA 4UCWA 3W5VA 1M8PA 4URXR 3HXOA 1XL1A 3MGCA 1PLJA 1ZZEA 2DF8A 5F1OA 2AWNA 4G5SA 3ISTA 2FFRA 5CVTA 5JRZA 3OY2A 2PGNA 1NOKA 4PGHA 1OIVA 4JODA 4RFVA 1UDCA 1A2BA 4EKNB 3BRCA 3NHKA 5EMHA 2FLKA 3LA8A 2BM8A 4HI0E 3GG2A 3CO5A 4LDPA 4B8ZA 1G42A 5JJ5A 1MOSA 2HCRA 4R1OA 3TCNA 2Z9BA 4BNIA 3KL4A 3R9XB 4PQGA 1UXIA 1CUZA 1CB7A 1LSJA 3T3MB 2BM1A 3EVGA 3TCKA 4V0SA 2XUGA 3NEYA 4JP5A 4LVNA 4CL2A 4LWZA 2NTNA 1OBVA 2R4UA 3I6IA 3RK1A 4FUTA 5LA6F 2OL4A 1YJCA 4CG1A 1PJTA 3OG9A 3LX8A 4K6FA 4BKRA 1X7ZB 4PVDA 1RAIA 2XODA 4EWLA 1SQSA 3EISA 4EO7A 1NVAA 3HEBA 2IUEA 3E0QA 1L5LA 3CH5A 4HXGA 3RREA 1U9CA 2Q50A 3IAXA 3R5FA 1P9LA 1Z8DA 5BQ5A 1NLZA 3P9KA 1AS0A 2PLNA 4IFTA 4I0WB 3X1ZA 4DTCA 1UWCA 4U7DA 2W8ZA 1WVGA 3QIVA 1S6YA 2C2GA 4JR0A 3EYWA 1T24A 3H2HA 4CT4B 5H8WA 2OECA 3H2ZA 1R0ZA 3A06A 2CJPA 1QZXA 3KOOA 2K4MA 4HLQB 4OXRA 3PGLA 2ATCA 3ZHOA 4C3OB 2XNJA 1ZICA 3GFOA 4BRWA 1CUHA 1U94A 2VNKA 3BFXA 1FFSA 5HE8A 4R4JA 1W36B 3DHNA 1QZ3A 4JLDA 5IAEA 4JJEA 2NU7A 4B3CA 1YNOA 4I55A 5JROA 1WHTB 2CSUA 4EZBA 3PYXA 3V4LA 4II7A 5AW8A 3V2HA 4UZFA 1AS3A 2DR0A 2W5UA 5FTMA 4YUAA 2BFDB 4EEZA 4ZEOA 4DKJA 1FSSA 1E2DA 2ZIWB 3GNSA 2K2WA 4V0QA 1FSPA 3WLPA 3DUFB 2L2QA 5LQNA 5HZHA 1ISPA 2DFKB 5LYYA 2B8JA 1T8SA 3IC5A 4IUYA 4TKUB 2JIDA 2VQEB 2IH5A 1A9OA 1XN1A 4BKMA 2J0SA 1FMJA 4R8VA 4EZIA 2C94A 3FBGA 5IJ0A 2FSSA 3KSDO 1T5HX 3JRXA 4UEOA 2O19A 5CLIA 1S96A 1YE5A 1W8IA 2J9FA 2WUGA 1RIIA 3KELA 1YS4A 1E7YA 2GK3A 3F2IA 5A3QA 1J8FA 2H52A 2X3FA 3G82C 3HCOA 3DCJA 2J85A 4HGNA 4KR7A 3OFKA 5IAGA 2AFIB 1BMTA 5ADWA 1J20A 1DJPA 2XX3A 3FVWA 3NC0C 4WZAB 1K68A 2GPYA 2CD7A 3KOYA 1N1GA 5HEKA 1F51E 4UDXX 1JIVA 2EGGA 1Y1QA 1RKXA 4MI3A 4XEUA 1P6UA 3IVCA 3EIHA 3H42B 3Q3IA 3QU2A 4TV8A 5BQOA 3AV3A 4ACAA 5D2CA 2MJLA 4B43A 1BDHA 2FEKA 3ZWMA 5F7ZA 2IDJA 4NZPA 4CEJB 1YR3A 2VDVE 3NVKI 1T2DA 1JDJA 1KJZA 2C7PA 1V4NA 3U6KA 1FDRA 1N2GA 4P5DA 4XRGA 2O4CA 1QHEA 3LUPA 4TQGA 2B2CA 3JARB 3QIAA 4WXMA 5CIQA 1E2HA 3UQYS 4OEHA 4X93A 3CO0S 4HN4B 5DCYA 3PXXA 4I4TA 5E2AA 4BQEA 5IDYA 2TMKA 3GJZA 4C7VA 1QSGA 4EUEA 5KYNA 3I5UA 3LBFA 2BLLA 3L7LA 2CVHA 2FGKA 2FVXA 1TF5A 5E2IA 3WGUA 3ESZA 1B2RA 1JAIA 4GF5A 1HRDA 2GSDA 5CMLA 3ZR4B 5HK9A 1XZFA 1W5AA 2AMYA 2H31A 2PDAA 2MYPA 4RLHA 4UUQA 3ETNA 3HEAA 5ELMA 3VNRA 1JQJC 4YT2A 3BH7A 2Z1DA 4TXMA 1RXSA 3VJMA 5KEIA 2R5NA 3MWEB 5TDHA 1Q7EA 4D0SA 1O54A 2NV2B 1GPKA 5FWYA 5CFLA 2BIFA 3FBTA 1VJDA 4JJ8A 2V7TA 4LC0A 3NDBB 4H31A 2IYNA 3L7YA 1X39A 3IQHX 3T9EA 4C4OA 3G2PA 2F62A 2GN6A 3KXKA 3MT0A 1XQXA 2V7GA 4G63A 3GZNB 4KRFA 2WAOA 3A4YA 4I5DA 5AW9A 2VBIA 1KEWA 2REBA 5FH9A 5F73A 5AUQA 2QROA 4AS1A 1Y6RA 5ER6A 5M5BA 1PR5A 2HU7A 2ZAGA 1DKRA 1XLTC 2P5UA 2V5VA 1NW6A 2PX6A 2XBLA 1A4RA 3A1NA 3I05A 3N5CA 4II2A 5FBVB 4CIWA 2EWVA 4ER0A 1GFSA 1V4VA 1GDTA 4RF3A 3X1MA 5CK5A 3H3XA 5JFGA 1IZ8A 1FBNA 1X77A 1YMVA 2WHQA 5ALMA 2H5JA 1DKQA 3EGOA 3OMXA 1Q74A 1L7PA 1G9TA 3C8UA 3EDCA 3NIFB 1XEXB 2G83A 2OCAA 2WRZA 3LECA 5IJZA 4LXIA 4O63O 2O2HA 4V03A 1AG9A 2IHZA 1XKQA 3LWBA 2PBZA 1CJCA 2FKAA 2KE5A 3LY9A 1QH8B 2G5PA 4W4TA 2I22A 1MVOA 2PRZA 4BUZA 1M5UA 3BIWA 4U9UA 3VPSA 1PL8A 2ATIA 2W22A 2HUPA 1CJVC 5E7QA 3VKWA 1Y1SA 5BXQC 1PQWA 3JCZA 3T7TA 3EBPA 1VG1A 4NNOA 3UCEA 5CB4B 3WADA 1SVUA 5DX8A 1E3WB 4H2DA 3ANNA 2IH2A 4UDYX 16PKA 1MEEA 2HJHA 1T9GR 3AEUB 5D7NA 2R79A 3VX3A 1RVV1 2BOVA 4Y2YA 3GJ5A 4WN3A 1E9RA 2QJOA 2A4MA 2Q6IA 3NHJA 2F90A 3DVLA 4M0PA 5JRJA 1G21B 1SK8A 3T3DA 2ZYRA 4HS9A 1K3TA 1U98A 4NMLA 2JFPA 1GNQA 1O95D 3UFXA 1Y9AA 1IQRA 2FMIA 2PUJA 1B6GA 2W2MA 4GX1A 4PFSA 2JK1A 5EN4A 4QGSA 1K7FB 4JJKA 2EG5A 4LG1A 1EA5A 4I14A 4HB3A 3I61A 4YECA 1C30A 1TYEB 2GB4A 1QDEA 2Q1TA 2QQ5A 2LZ0A 3PNYA 4KUGA 4URHA 2Y1KA 2OQ2A 4ZQGA 4HLCA 4N0MA 2PKXA 2C95A 3FG9A 3A6EA 4YCDA 1I9CA 3LIPA 1O97C 4JP1A 4C29A 3ND7A 3E84A 4N3NA 1TMOA 1Z6TA 2W2PA 2OWEA 1V5IA 1EWRA 4HDKB 5BPFA 3A6LA 1T43A 2CHQA 3T9BA 3O8DA 2O8DA 1XMOB 1KI8A 3O93A 3RIYA 3S6JA 3ZWYA 3UAZA 4N7MA 4BVJA 1UM9B 4GI5A 1T4GA 1BTOA 1E5QA 4RZXA 5KQRA 3NASA 1ZNQO 1TVMA 4XGQA 4Q1CA 1ZGJA 1RC8A 4R3WA 2LDXA 3PGMA 3D3EA 3ZCSA 2P41A 4ERNA 1DT3A 1ORTA 2FPIB 4G0UA 3HXPA 4ER7A 1XXHE 2AZDA 5EHIA 2QJTA 4HQNA 1GNVA 2C1ZA 2X9GA 3R74A 4BV2A 2WU1A 4URYR 3DDSA 1HORA 1TYCA 5J9FA 4PZ0A 4CMEA 4E5KA 3BS4A 5KNBH 3HZZA 2HA5A 5BUQA 1R9GA 3QHQA 3C7AA 1QFZA 3PUJA 1EFUA 2O1SA 4J1SA 1FRVA 1K5DA 3NHYA 4ZAGA 5SZJA 4M49A 4N0PA 1FJHA 1M8JA 4CW7A 5FUQA 1W7AA 3QBTA 1A8SA 1MQAA 2GRJA 1BDJA 3GRUA 5I4CA 3T54A 4D80A 2V7BA 1O6BA 5L3SA 2RHTA 3D7RA 3RV4A 4BGVA 4I1PA 5FL7A 1HDCA 3W7AA 3LQ2A 3N74A 3B89A 1Q15A 2QY6A 3WTCA 2O3RA 1EFTA 1JPNA 4JLNA 2CJFA 5DF1A 5EWMB 3KE9A 1ZM3A 2XLBA 3CEMA 5ABPA 2AXEA 1YRHA 3KEGA 5SY4A 3UGQA 3IO5A 3CF2A 4OY3A 5I9NA 1YZNA 2CMFA 1DX4A 1UJ4A 5AMXA 3IVXA 2W2QA 5HOQA 3E22A 3SHTA 4OXKA 3SP1A 3AW9A 1OXSC 3ZU6A 2RGCA 1A98A 2D1RA 4IHJB 1V9CA 1Z22A 4M0DA 4PQFA 4YI5A 5BT9A 3UJ7A 4JI0B 4B1FA 1O57A 1C3OB 3GN1A 4PCVA 4YJKA 3LUDA 1WHSA 1BQ4A 4OHKA 4BJ1A 3ZE1B 3TVYA 2W6OA 1E1YA 2WWRA 2I8AA 2X2PA 3VR5H 4EG0A 1XPRA 1RQRA 2C4MA 8ADHA 3T3NA 1JFFB 2OCLA 4GT1A 4N6NA 4MUHA 3UKJA 3WP1B 2QTVB 1GYRA 2XGJA 1CTQA 3EQ8A 1G4AE 2O3SA 5FA5A 4D5GA 4ADSG 2FHPA 4R8MA 1VKNA 4U2BA 2JGFA 4MVJD 5B2FA 3HHEA 4II3A 4D92A 1N7GA 4INZA 1NASA 5CNIA 4E6PA 4YRIA 1KWKA 3VXKA 3QVVA 1GKLA 1PYOA 2ZYHA 3QWBA 4FNMA 1Q2UA 2G07A 2MINB 2JCXA 1XQYA 1LNSA 2ONZA 2V6FA 1M2HA 3DC2A 5BSFA 1KZ6A 4ZI2A 3FY4A 2C61A 4GX5A 4KFTA 3QFCA 4MAFA 4TMWA 1M5TA 2IEBA 5BW8A 3BBLA 3S3TA 4FHFA 2IUSA 3QYJA 3OA2A 5HG0A 1ODTC 3F1LA 1S1CA 3R9XA 2BEJA 2J9YB 3E7WA 1PJ2A 5E3HA 5IARA 1ZNXA 1JPUA 2VEOA 1NW5A 3BIFA 3DZKA 3ORHA 4O0MA 1P2DA 3GBVA 3OQIB 2OQIA 3KHUA 2PV7A 3RBXA 1X7ZA 3OTOB 4GKJB 1QGOA 1A77A 2ZJ5A 3PQEA 4A8JA 1M6EX 3GLSA 4Z7NB 1Y6FA 1ADYA 1ZCBA 4QLOA 4FHDA 1ADFA 1EJBA 4LSZA 4Q4JA 2XZPA 2JATA 2XXJA 3ROZA 3CW2A 5A5VA 1SCBA 3OURA 3RVMA 1GDHA 1ZN9A 3BGSA 1JXOA 2WJAA 1CXZA 2EJUA 1QTNA 2X3UA 1SVKA 2HJVA 4PYRA 4L6AA 3TINA 2Y3IA 1I7QB 2Q5JA 4TLAA 5FUXA 1W87A 4IS3A 4LNUA 3OC6A 2VK8A 3GJ3A 1RPTA 2AXNA 4BQQA 2XE4A 4JK3A 4YONB 4F21A 4IGFA 5KVAA 3U60B 5D8DA 3LPAA 1XNRB 2K5UA 4MGEA 1UUFA 1V1MB 4YDHB 4P2GA 4JCCA 1VI6A 1WHTA 1XD8A 2J1LA 1UZAA 4DC1A 1W34A 3DTVB 5F98A 1TZKA 2RKOA 4PV7A 4GWLA 1W88B 5EIOA 2BFDA 2GOYA 1N4DA 1AGNA 1XEAA 2AC4A 3QVSA 5HS4A 3DUFA 5ADVA 4GOXA 3AVTA 1JWBB 4JVNA 1VKZA 2A7XA 2OHIA 4TKUA 1SUPA 4L0QA 1FBTA 5K9ZA 1ZGCA 1U8UA 2DTDA 3W3ZB 2IGTA 2VUTA 4F12A 3D6HA 3CVJA 3AVYA 4JOBA 2OG2A 3ZIAA 4CLHA 4KE6A 3ICQB 5T3UA 4P84A 2ZLBA 1Y5LA 3BRWA 3PCRB 3M34A 1ND6A 3FUXA 2Y6UA 1B8NA 4NZYA 2NX2A 2QTMA 3WZLA 4N54A 2AFIA 3L8FA 4L95C 4CVNA 1YBMA 4YIKA 2OZVA 5AJVB 3ZJTA 4WZAA 5GQSA 4HNGA 1XWWA 4XYBA 2DULA 5FKJA 3WHPA 4DWOA 4MQ4A 3PP8A 3A0RB 4C7OA 4AS3A 1AKMA 2EHJA 3ELWA 3LO8A 3E9EA 3ECSA 3UHJA 1QP7A 1LK0A 4JQSA 1IHUA 4RY0A 4K7JA 3VPAA 3ZD7A 5A6SB 4J76A 1GAXA 4QRHA 4MP3A 4XSHA 2Y6VA 3HB7A 3GP8A 4PGGA 4LOAA 3GMSA 5FOQA 2JLUA 4JCOA 3I01M 4ZAYA 1DG1G 5JNLA 2HA4A 4G65A 1P1RA 1PLKA 2G88A 3VDXA 1DQYA 3JWPA 1TO6A 4IGKA 1HYQA 1NMQA 5GJCA 4CEJA 1WCV1 2YZGA 4WKNA 4FYHA 1PVDA 4B6PA 3Q8KA 4KKXB 4UHKA 4NNPA 4ZVQA 1BKDR 3SU8A 2OCXA 1BVRA 1PAUA 2GTIA 2QTCA 2XUPA 3EFHA 3IPRA 3JARA 4KXXA 6REQA 3SE0A 4HH1A 3V97A 5MN5A 5D3ZA 5AK3A 5FJIA 5K99A 4IXMA 1YR8A 1OGYA 4KSBA 3UK1A 3GLIB 1IBMB 1L1RA 1NVDA 3QVKA 3NWPA 3S8YA 4WY8A 4LHZA 3VKHA 3CEPB 3ZE7A 3AJAA 1AMNA 5HMLA 1Y1TA 5AJUA 4O3FA 2J5RA 3CT4A 3MXOA 3RFXA 2FN9A 1OFUX 2XE8A 2ODBA 2ZAIA 4ABYA 1PR2A 4BTVA 4DIKA 4ER5A 2Y0CA 3HCNA 4KXYA 4XDZA 5COBA 1VL6A 1TGYA 5IDWA 3PDCA 1MAWA 2XZTA 4BNGA 3MWEA 4F2HA 2F2TA 2UZ1B 4FYKA 5JZSA 3VR2A 5KYWB 1L8QA 4HKTA 4TZKA 3OQOA 2H4WA 3EA4A 1YRLA 1LUAA 2RONA 4JA0A 3QXCA 2AR7A 3I0NA 1A76A 2RGUA 3FTDA 2SNIE 3HPQA 3R6TA 3BKXA 5DKFA 3I72A 3VHXB 5KZMB 4UATA 2GCNA 3GZNA 4J03A 5K4AA 4CLRB 3MGAA 2AR9A 3EH1A 1U3TA 4N4AA 4X00A 3VTKA 1PW5A 1Q95A 3A9UA 2NIPA 1Q0SA 1JEOA 3DAOA 4TL8A 3KUKA 3DBHB 4O08A 5J2UF 1Y3IA 4R9RA 3DMHA 1CUWA 4G0YA 3T7JA 2O7RA 2FZKA 3DP7A 4MA0A 4EMUA 3RIMA 2O8VA 4TM8A 1RHKA 3P9PA 3KJQA 4B4KA 2PUTA 3H8VA 4NYIQ 5C31A 1ZUD1 1AUPA 2DLDA 3OF5A 4RH3A 2VP3A 1NLYA 5BV0A 2ZJ8A 3U0VA 3GLQA 3ISVA 4HXFB 4G1VA 4ZOCA 1ENZA 2C78A 2OBNA 2FE1A 2KYRA 1RBMA 4KVGA 1XEXA 3B3AA 3E5RA 1CZRA 1OH7A 1VKHA 3SS9X 5IDQA 2C8JA 4ZKDA 1RPAA 2FPPB 1QH8A 2KMLA 5ANRB 4G6ZA 1BVUA 2QN7A 4MS1B 4U2FA 3W04A 4MLPA 2ZWMA 3K1JA 1OLOA 4X92A 1U3CA 4MRMB 4DDUA 2QRVA 1ESCA 1PKXA 3HJAA 4G5HA 5CJ2A 4U02A 5CB4A 3RSLA 1XZAA 4O4IB 1E3WA 2ONYA 3N8HA 4PXSA 1P0FA 3RHSA 3AEUA 1EFAA 1Y3FE 1JDBC 3Q6MA 4L4UA 4YT8A 4FYVA 1EIZA 4JOQA 1U0JA 2R60A 4MWSA 3ZBTA 3KO8A 2NPOA 2AI1A 5EMLA 5HJ7A 2IDMA 3NVAA 1W4RA 1MX9A 2HRRA 4HH0A 4HDSB 3PFNA 1EE2A 1G21A 1YCFA 4UE2A 2JGKA 4MDEA 3K3PA 2BRUC 3OZRA 3C6QA 4I1OA 4ZU1X 3WIBA 4UBJA 3CUEF 3DAHA 3V2UA 5FI3A 2PSDA 3PA8A 2Y1WA 2VHVA 4OBBA 5KNDH 1AS2A 2QUBA 2ZBEA 3NRBA 3QBEA 5JO9A 4Y2PA 2X8BA 3U7QB 4TGLA 4YAFA 3FYHA 3LLCA 3DVRX 1RVDA 1DAGA 2WJGA 3KD2A 4L22A 3BXHA 4FDMA 4XPIB 3DUWA 4E21A 4OQFA 5LQUA 4XD7A 3JS5A 2E4UA 5JASA 4PIVA 4MULA 2NNLD 1DFIA 4DLNA 1NLUA 4ZIRB 1IY2A 3QPAA 3CLUC 2IEAA 1XOIA 3M1YA 1U3WA 4HDKA 1RLMA 3RRNA 5BYKA 2VQFB 1JB1A 3QGMA 4BO7A 5DI9A 2X0EA 4HBGA 4FSHA 1JNXX 1X38A 2JH3A 3GCGA 3KQWA 5CITA 1NU8A 2YJ5A 3C4QA 3KYCB 1UM9A 4B7UA 4X24A 3R7LA 3EVTA 4C7XA 3O73A 4QJ5A 1PHRA 2ZB3A 4UEKA 4QQNA 1ONBA 2W6NA 1N2IA 3V4RA 2CHUA 2XVZA 1H8EA 3EARA 3T4UA 2GKGA 4HEHA 4XCQA 2PSSA 4ZYXA 3IJEB 2OO5A 1AA6A 2FPIA 3KCNA 5FPTA 2Z6QA 1P7WA 1KYZA 2QVGA 3MJDA 3Q85A 1SWVA 3EVBA 5K0NA 4BQSA 3AF6A 2IPMA 2WB4A 4YFYA 3EPLA 3T95A 3HYTA 4I9HA 1E99A 1JIXA 3MMSA 1H5NA 1XZQA 2LNDA 4MUNA 4TMKA 5L4LA 1XPUA 4CGYA 2R85A 1MKYA 3P9RA 4QPCA 5EAIA 4X85A 2YZ2A 1KJ9A 2QMOA 1O94C 1YBFA 3ZWKA 4MKGA 3NVDA 2BGNA 4LVCA 1UKZA 4FD3A 3KYDB 1L7NA 1Q6YA 3CT6A 4E5SA 5T5QA 1ZMXA 3KUXA 4AN0A 1X7WB 2IQ5A 3PXUA 4QHYA 1KWGA 2FG5A 4CDMA 4K8RB 2FZGA 3BTSA 2DUJA 3HCAA 3Q8XB 4BJ5A 1QYCA 2TMGA 3B5IA 1F0PA 3ZZUA 4BV3A 3HKEB 1COWA 4YP0A 3L05A 3NBXX 5THKA 2EV9A 3NYQA 2C00A 3OE5A 4BZQA 1J24A 4RKRA 5CAEB 2YIJA 4GYJA 2FFHA 3C1AA 1RJEA 2NAFA 5KWJA 2ZIFA 5LPNA 2GO7A 1X13A 3L40A 1QC5B 4F3RA 4M0UA 3W06A 3WJ1A 1G5TA 2EP7A 1Z0UA 4QIHA 1GV1A 4IHJA 2E6UX 4AYWA 3AFGA 1WSWA 1RRKA 2YWRA 3HVIA 4IDHA 4FWTA 1KI9A 8ABPA 2CD9A 3MCZA 5GZ1A 3FJ1A 4G5OA 5LZ4A 4RQTA 2Z98A 4B3JA 2JKZA 4BFTA 1IHXA 1WDLA 4B34A 1SZPA 4JC8A 4UXIA 5IVIA 2RMKA 3FDZB 4XVCA 5JNTA 2VA9A 3CU5A 1GILA 5K8UA 2I62A 3QKIA 2VYNA 4HWRA 4JKIA 4YAIA 2AOWA 3OM1A 1IIBA 1PEKE 4IH9A 1PZNA 1GGJA 4XLZA 3NHSA 1X92A 3GLVA 5AKYA 5JSKA 2DB3A 1C8KA 4CNQA 3GEIA 2CNKA 2MINA 2V96A 2GPBA 1B15A 4FYMA 4H6PA 1LK5A 1NSYA 4KN6A 5CUQA 5IM4A 1C9EA 2PZ8A 2YCBA 3INRA 3P9YA 3QFHA 3REQB 3U19A 2GPAA 1B26A 3IHTA 1IIRA 1ILWA 1GNPA 2Z2JA 4HUTA 3CRRA 2X6TA 1L5OA 3ADDA 4A0RA 1XRRA 1G1MA 1QZUA 2FR8A 5CG1A 5DSXA 4FZVA 2DBVO 2GLXA 1CR0A 2HTFA 2YIDA 4MTLA 2CXNA 3R7AA 4XWTA 4C0KA 2CVFA 1ZG3A 3QVMA 2NSLA 2OV2A 2QLTA 5F33A 4ZOQI 3R0QA 4FINA 4Q34A 5BSVA 5BNIA 1BAPA 2EKPA 2G63A 2O0KA 4AB1A 1T0PA 4P3OA 1H2XA 2P2NA 3KKOA 4ZI7F 1ZHHA 1W4AA 3R4VA 1E4OA 1R0XA 2C7GA 3IAUA 1F1JA 3A10A 2BMVA 2OKCA 1OV4A 2C58A 5JJCA 2YVAA 3JQAB 3KSUA 3KDAA 3CVYA 3WE7A 3IDOA 4E5VA 3PRKE 4ESVA 1TPZA 2A0KA 3LHKA 4OYRA 3C1UA 5ALRA 3V3TA 4DYHA 4QELA 1ONSA 3WLOA 3KOUA 3D8RA 5GV8A 4S12A 1O5IA 3F6BX 3QX9A 4J7UA 2ADMA 3DF9A 4NS4A 3KLNA 4P7FA 5CA0B 4MCJA 4XIFA 4E32A 3QVWA 4HATA 2F48A 5TQJA 2OA0A 5IWCA 5UKDA 1RM5A 3VYUB 3ZU2A 2YHIB 7MDHA 4RYDA 4R9NA 2RGNA 3NVMB 1KY2A 3G6WA 4GGOA 1WKVA 2EL9A 2OXRA 2PL9A 2ERXA 3DTVA 5D86A 1W0JA 3U4DA 3ORYA 1W88A 3DMNA 3UMFA 4G1FA 2W6QA 1KOLA 1PEAA 1BXGB 3OQBA 4IMPA 4B84A 1TCUA 1MB3A 1I2MA 5AJXA 5LLSA 3E0XA 5DP2A 3BFPA 3ND9A 3EK2A 4Z9AA 3Q5DA 4ZTZB 5KMGB 2A1UB 4PQEA 1Q7RA 3AETB 2X1MA 1T36B 2AYXA 2VPYA 3FMVA 3G7NA 1L4GA 4GOMD 3E7DA 1GL7A 3H1EA 3L84A 3RHFA 2YJGA 2NTYC 3GJSA 5E1MA 4WERA 1FW6A 3BREA 1SUBA 2J31A 1GQSA 1HDEA 5K0BA 4R2KA 5F76A 1NBMA 1R9JA 4BEVA 4QPPA 5JI3E 3PXEA 1KY5A 2PXCA 2ZETA 4S1WA 3SSOA 1TI7A 1DV1A 1NM5C 2R6GA 4G0NA 2AA3A 5CT8A 3KQLA 3TSAA 5IG2A 4DCCA 4J4HA 4J1TA 3OJ0A 1POXA 1HYBA 2QRGA 3FN4A 2FK8A 1SBNE 2GJ8A 3LQQA 2IIBA 2X0FA 5A6SA 1TF2A 5JATA 2ZB7A 5AUNB 2DHCA 4DDWA 5IJWA 2C4KA 2QG4A 5EE1A 2AR0A 1UT6A 1SKYE 1M66A 4R31A 3AEKB 4HPJB