3LLVA

The crystal structure of the nad(p)-binding domain of an exopolyphosphatase-related protein from archaeoglobus fulgidus to 1.7a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
133
structure length
133
Chain Sequence
RYEYIVIGSEAAGVGLVRELTAAGKKVLAVDKSKEKIELLEDEGFDAVIADPTDESFYRSLDLEGVSAVLITGSDDEFNLKILKALRSVSDVYAIVRVSSPKKKEEFEEAGANLVVLVADAVKQAFMDKIKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the NAD(P)-binding domain of an Exopolyphosphatase-related protein from Archaeoglobus fulgidus to 1.7A
rcsb
source organism Archaeoglobus fulgidus
molecule tags Nad(p) binding protein
molecule keywords Exopolyphosphatase-related protein
total genus 47
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3llvA00
3AM5A 4RPJA 4WK6A 4ROSA 2NVUA 1GTMA 2O48X 2ILTA 2X9GA 1OZAA 5G0VA 1ARZA 4X54A 3SC4A 1HETA 1E7WA 5JBIA 1Y8QB 5KTKA 3ZHZA 1UJMA 3TL3A 1OC2A 4ZRNA 3KYBA 4IIUA 3GFGA 1Z74A 4NJOA 4WLOA 5T67A 4EDFA 3SLKA 1Q7BA 4Q9NA 3K30A 4CLRA 1AHIA 2JD1A 1PU2A 3KYCA 1T2CA 4XWYA 3TF5A 2HMTA 5U4QA 1PL8A 3ZV5A 1Z7BA 1PQWA 2IDZA 3OJOA 3RC9A 2VT2A 3H9GA 5F5LA 3GG2A 2EKQA 4NK5A 1HDGO 2V6BA 3QY9A 1M76A 3I23A 3IC5A 3MJ4A 4M86A 1UXIA 3QHAA 1HF3A 3LVFO 4Q3AA 4WPGA 4JXKA 2C7VA 5THQA 1E1MA 2IE0A 1BHSA 1MXHA 3ON5A 3FF4A 3PWZA 2W2KB 1VE9A 3RUIA 3ROPA 4XEHA 4OQYA 4ID9A 4R54A 2VOJA 3K73O 3GAZA 3GDOA 3AUTA 1E3LA 3GUCA 3CUKA 1N2SA 2G1UA 5HA5A 4QQRA 4L9RA 1G0OA 4PRKA 1Y8RA 2AQIA 1YL5A 2TMGA 1JKIA 1NWHA 4E5MA 4DC1A 1FK8A 3E03A 3UCEA 2H6EA 1JKJA 3HSKA 3ZWBA 3F3SA 5ILOA 4B3JA 4EZBA 4HUJA 4M1QA 4CV3A 4BKRA 4KMSA 4N5MA 3E8XA 4GL4A 4R3WA 1VL6A 2CVQA 2HK8A 3WGZA 2QZZA 3CMMA 5H83A 4BO5A 1N8KA 4HFMA 2IODA 3LF1A 4OL9A 4IS2A 3OETA 3KRTA 5KIAA 2PKQO 1GCUA 1NM5A 1MLDA 4J1QA 1E5LA 3BMNB 4C4OA 2OORA 1NYTA 4U6QA 3RC1A 3VPFA 1T2AA 3MEQA 4IGEA 1ADCA 1ZK4A 1MX3A 5T8KA 2D59A 2PA3A 2YFQA 1P31A 3ZWXA 5L7WA 5HBRA 2R2GA 4ZGWA 4HV4A 4CLOB 2HDHA 2AQ8A 4L4XA 5HS6A 3WLEA 2DBQA 2LDBA 5BSEA 5JCJD 3Q0EA 4TSKA 1GZ6A 4GWGA 5T6BA 5A04A 2D0IA 1H6BA 1RM4A 1TB4A 3GMDA 5L7TA 5JDCC 3Q9NA 1ONPA 3AI3A 1DRWA 3DTYA 3HADA 1CRWG 1EZ4A 2E82A 4LISA 2GN9A 1E77A 5G0SA 2RHCA 1IHYA 3INRA 4GLLA 4L76A 1T25A 2DPHA 1I8TA 3DDNA 4I5DA 3VH1A 4FFRA 1XQ1A 2O3RA 3MCVA 3NTOA 3PHIA 1V0JA 4PLHA 4CQMD 1WW8A 4ND1A 4PZDA 4E13A 3CMCO 1FMCA 2WDZA 3JYQA 3H2SA 4NU6A 4PG4A 5DOZA 4BNKA 2Y1CA 4CMEC 4BNTA 1R12A 3VTZA 5A3VA 2VOEA 2ZB7A 1MG0A 2O50A 2BGLA 4CM3A 1LSUA 1NVTA 2VWPA 5IF3A 4J16A 1ZMOA 5KWEA 3VVBA 4BQRA 3H3FA 4IQ0A 1X7DA 2C5AA 2W4QA 1V3VA 2ZJ0A 3AOEC 3U4HA 4EJ6A 5FFFA 4YAKA 4XQ9A 4ALKA 2AG5A 4DQVA 3DBVO 1LSSA 4R9RA 5TX7A 4BO0A 1UP4A 2HSDA 3ZWNA 4W99A 4ZQEA 5F5NA 3WMXA 5B37A 4A03A 2FY8A 3ROKA 1UDBA 4HNHA 1NPTO 5IJZA 1GPJA 1NR1A 1Q1NA 4CJXA 1QYVA 2ZQYA 4XDYA 3C1TA 1LBEA 3WDSA 2Q4BA 1H9BA 2EG9A 4FFPA 1RYDA 4IJVA 1XELA 4AJ2A 4RDHA 1EK5A 3WFJA 2O3JA 3K6JA 5JS6A 1MG5A 4Q3CA 2B0JA 3DBRB 3I6IA 4XGNA 2X4GA 1OI7A 2GGSA 2I5PO 4W9NA 4IMRA 4FN4A 2J3HA 4WEOA 1R66A 1M75A 4BO2A 4FC6A 3S2GA 3C3XA 4WCDA 3JQ8A 2Y05A 1LX6A 4R1SA 2B4TO 3NEPX 3W6ZA 5LC1A 3KEQA 2HMWA 3ZCXA 2G76A 1O0SA 1B7GO 2BELA 1GEGA 4KTVE 3VDQA 4Q39A 1DIRA 1QKIA 4XRRA 3S55A 1A72A 1W6UA 2UV8A 3ANNA 4D3SA 2PNFA 5CG1A 3GUYA 2J5KA 4IY1A 3H65A 2JAHA 5AYVA 4BNMA 4RGBA 3KLPX 1QRRA 1F8GA 1NVGA 4OH1A 1YQXA 1KOLA 4LRTB 3GQVA 3L6EA 4J1SA 4LMRA 2Y0CA 5IXYA 1PWZA 1GZ3A 3GH3A 2AXQA 1U9JA 1O6ZA 3WR5A 1I24A 4WLUA 4OKIA 1DFGA 4CMKA 1HRDA 4JNKA 1DIAA 5TIIA 1PGQA 3WLFA 1XA0A 4J91A 1ZJYA 1HEUA 3FSRA 1DHRA 2VYVA 2Y1DA 4JJIA 1XEAA 3AUAA 3U09A 3E9MA 1YDEA 1HYHA 1B8PA 1YBMA 4R9SA 3TWOA 1I3LA 1PJLA 1QG6A 4ZQFA 4GGPA 3NT4A 3AU9A 1IULA 1X7HA 4KZPA 4ITUA 5CPFA 4F6CA 1YJQA 1VM6A 2DFVA 3JQCA 3KO8A 4FGSA 3H7AA 3PYMA 4TRRA 3KOUA 3GGPA 1LSOA 4XR4A 1PQUA 5FWNA 1C0LA 1WDMA 1X1EA 4RJTA 1DJNA 1LQUA 5IAAA 4YJHB 4NU5A 1A27A 2CDAA 2GERA 5L4SA 1BXZA 1LC0A 1BRMA 2JHGA 5DBFA 3UN1A 1I30A 3N7UA 1LJ8A 1PS8A 4E2ZA 1IPFA 1LUAA 1LDGA 1JU9A 5GY7A 1H5QA 4D44A 1I36A 1I3NA 3WGYA 5A4DA 5IN4A 5I9NA 4E5YA 4CMJA 2VT3A 3DBRA 5DBGA 3UKOA 5BSHA 1XDWA 1ZFNA 3KM0A 4RVSA 4P8RA 4W6ZA 3TZHA 4BV9A 1EEHA 1C1XA 3K2BA 2W90A 4P38A 3WICA 3F47A 4I1IA 4BKQA 1IOLA 4E31A 4BKUA 1IPEA 2G17A 5TJHA 3H5AA 3A14A 5TS3A 2UAGA 3GG9A 1AGNA 3GN1A 1ZMTA 2IYOA 4R1NA 5C5IA 1VRWA 3JQGA 1PJSA 3BYZA 3ZHXA 4YACA 2G82A 1V3UA 5G2OA 4YAGA 1Y9EA 2O3UA 4Q3BA 4NNJA 1ZK2A 3E6AA 2Y1OA 3RI3A 3NX4A 3WSWA 1F06A 2HU2A 5L3ZA 2DTDA 2E48A 3EVTA 1AUPA 1ISIA 1DJQA 4UUOA 3H6KA 1ONNA 4WCFC 1TEHA 3ABIA 3CINA 4PG7A 4NBVA 4BGIA 2O7SA 3S8MA 5JC8A 1V9LA 1Z73A 1QMGA 3ZWAA 1CQJA 3G0OA 2JCXA 3FHLA 1KETA 1PL6A 4AJIA 3LLVA 3PLNA 4DPKA 1KVQA 5JO9A 4O63O 2X0JA 3S2IA 2NTNA 3D1LA 2Q1TA 1K5HA 4BNWA 4KUEA 3U4CA 4MVJE 3VKVA 1D7OA 3BMOA 1NPDA 5I7EA 4YJHA 3GEDA 4ZQGA 3ZU2A 5KVCA 4O0LA 2A4KA 3QVXA 1DOHA 1WNTA 5I9MA 3DEYX 1T1RA 2J5QA 2DPGA 4TWRA 4YAIA 3O9ZA 4J0EA 4R68A 3BTVA 2V6GA 2D8AA 5EQFA 3F6YA 2NVBA 3WYBA 1V8BA 5K6AC 1I5RA 4RQTA 1NBOA 1JAXA 4AJPA 3TOXA 1IZ0A 3ZV6A 3WOHA 1XQ6A 2VQ3A 2BFAA 5A3JA 3EVNA 3U9LA 3KYDA 4J9UE 1DB3A 1E7SA 4LSMA 5HM8A 4J1NA 4Q3NA 4H15A 1CEQA 3DQPA 5FI5A 4YJGA 2P91A 4R69A 2BKAA 4RPGA 4BOYA 2PZLA 4IDEA 1D1TA 1D3AA 3C1OA 3CE6A 3PI7A 2UUPA 3ZNOA 4TKMA 4BNNA 3UFXA 1DC5A 2FPIA 2B69A 2P5YA 3GY0A 3G1UA 3IS3A 4MVJF 4XYMA 1O89A 3RJ5A 5ENVA 3OIDA 3INGA 4ZJUA 2GO1A 3D5QA 2EP7A 3P7MA 4YRAA 2CDBA 3PJDA 3PWKA 3WBBA 3ZH2A 4FOSA 5CDUA 1Y5MA 1YJ8A 1MFPA 3EDMA 5JAMA 4RDIA 4NPCA 5IDYA 3NJ4A 1P1RA 1LDNA 1Q0LA 5L4LA 3WJAA 1VKOA 4ND5A 2OL4A 2VHVA 4HP8A 4XIYA 1U3UA 4OYRA 2JCVA 3I4CA 3ZHYA 3JQ7A 4XJTA 3WQRA 3F4LA 3EC7A 3KSUA 2ZCVA 3GGGA 3IMFA 4GBJA 1CF2O 1JWAB 2PR2A 2YZ7A 3DAGA 5DDIP 1VSVA 1NAHA 3C24A 1UZNA 2WYWA 5HRUA 2EJVA 1O95A 2VUSA 4XRGA 5CDYA 3L0DA 5L53A 4QT0A 1F17A 1I0ZA 4DLLA 3ZNQA 3GZ4A 1ISHA 1YBAA 2FSVA 4BB6A 3I83A 1IL0A 4Z3KA 4LVCA 3BAZA 4BNYA 5FI3A 4CMIA 4FB5A 3RC2A 3RVDA 1VC2A 1A5ZA 1KC1A 3PFFA 1JWBB 5LCXA 2DVMA 4YDRA 3ONEA 1KERA 3C1AA 1W73A 1QR6A 4LVUA 1GZ4A 3FNGA 1WDKA 1E5QA 4NBTA 3QWAA 3NDRA 2FR8A 2D5CA 5COQA 1SBYA 1HDOA 4NH4A 1Y1PA 4XQGA 3DHNA 4CMEA 4MVJI 2CD9A 1R0SA 3U3XA 3GMSA 4D3FA 3AY3A 3HDQA 3DBHB 5KJFA 1ENYA 1N1GA 3IJRA 1RYEA 1HTBA 4I9UA 4J2HA 2XXBA 3RBVA 4BNLA 3OSUA 5B4TA 4U0KA 1T1SA 1A4IA 4BUCA 3U62A 2NM0A 4IINA 1E1LA 1VI2A 3AFNA 1GQ2A 1GD1O 2VRBA 4MVJG 5KJ6A 3JCZA 5COAA 1FDUA 5ICMA 1R6DA 2VYND 4BGVA 3CZMA 3PJEA 5CEJA 5JPIA 5ITWA 5JY6A 2GRAA 3KB6A 1RM3A 5IFLA 2B4RO 1V3TA 1T2FA 3BMCB 3OJLA 1B0AA 3UOGA 1UP6A 3IJPA 5JAIA 1IB6A 3PGJA 4WNIA 1H93A 4E5PA 2YHUA 1P33A 5DOVA 4J7UA 4OKNA 2JFFA 2PGLA 2P2SA 4OGWA 4OSOA 1Q0QA 1JQBA 1GDHA 4BNIA 4BGUA 3RD5A 2PK3A 2C59A 1PIWA 4EITA 4H7PA 4NFSA 1U1IA 1Z75A 3BTSA 1PL7A 5A9SA 3LC7O 2YFHA 4E32A 5BR7A 2OBNA 1KVUA 4IJWA 1ULSA 1YONA 3IAHA 1HSOA 1DEHA 4NMHA 3FBTA 4TMFA 1HWYA 3FN4A 3OA0A 4NIMA 1NXQA 3JTMA 1DC4A 3AK4A 2YQ4A 3NJ8A 1U8FO 3OJFA 1TLTA 3PFWO 5A05A 4P4LA 4PVDA 2X23A 1LLUA 5DULA 2BGKA 2X7HA 1P77A 3Q9UA 4JIGA 1PR9A 3IL2A 1XYGA 2CSUA 3JQBA 3AY7A 4GGOA 2VYNA 3Q1LA 3MJCA 2X58A 1UUFA 1VL0A 2Q2WA 5F1OA 3EAGA 4HFNA 4XCVA 5DF1A 2HK7A 3OECA 3JQAB 1QYCA 4WLVA 2NNLD 1LXCA 3JQ8B 3DR3A 3VOSA 3W1VA 2VZ8A 5IZCC 3PHGA 1GYPA 5KKAA 1P45A 2NQTA 2AQHA 4E2XA 4MIOA 2JKVA 1E7MA 4A26A 3RKRA 3D64A 1YB5A 3ZGYA 1P0CA 3BMQB 3NKLA 5JY1A 4RPHA 5L7YA 1TXGA 4WNCA 4TVBA 1A9ZA 2POQX 1E3IA 2AQKA 4OO3A 3CTMA 3HE3A 4O5OA 1BSVA 1R0KA 2VHXA 1RM0A 2WJPA 4AJJA 3MJVA 4UUMA 4NQZA 4PZEA 3O38A 4GPD1 2NU8A 3DOOA 3D7LA 1KC3A 4PGFA 1ADFA 3RUEA 1PGOA 3PHHA 2J3IA 4DTIA 3VPSA 1DXYA 3GDFA 3LC2O 4MVJD 3RFTA 2EEZA 1LNQA 2EF1A 5FEUA 2FP4A 2BFOA 1UDAA 2YW9A 4AJLA 5EINA 2I99A 4ZQHA 3LT4A 1XU9A 3ULKA 4YPOA 2B35A 1H6CA 4A7PA 2H63A 5U9CA 2ZYGA 4N7RA 5ENDA 4XQEA 1N9GA 4Y8VA 5JXWA 3G49A 1XGKA 3JQBC 4YQYA 1P44A 4OSPA 3VTFA 1XWFA 2IYPA 4ESOA 4PLPA 2VNAA 2HO5A 3UVEA 2I3AA 4IXTA 3WX0A 2UYYA 2PY6A 3VH4A 4RVGA 3IDSA 1OAAA 2AA3A 2DFDA 1I2CA 2GZ2A 1AXEA 3F1KA 3ITDA 1P1JA 3DMYA 2J8ZA 4KTTE 1T2DA 2QIOA 3UCXA 3WS7A 2WYVA 1BTOA 3IKVA 3UGKA 5IZCA 1OBFO 5A06A 2VTEA 3GHYA 5I7FA 5CFZA 1E7RA 5EL0A 4A0SA 4FIZA 2GYYA 3WGGA 1Q0HA 4DLBA 4MOWA 1R15A 4IJKA 4FFMA 1B2LA 4FJ0A 1BXGA 4P4NA 4WLNA 4G5HA 2X9VA 5IG2A 2QRJA 5CDSA 3SJ7A 2OXIA 1UZMA 2G5CA 2IRWA 2O4CA 2PKQP 4GLOA 4YCAA 2NU6A 4GQAA 5DP1A 1VKNA 3EK2A 3IP1A 2ZYDA 3ST7A 3P19A 1W8DA 4E5KA 1H9AA 3ZHBA 2HJRA 3DBHA 3NT2A 2VTDA 1QSGA 4NJMA 4Y6RA 2GF2A 3I5MA 1ZZEA 2AMFA 4LCEA 4BNGA 5AQ1A 4KWIA 3ETEA 4YR9A 4MVJH 4ALIA 2DLDA 4FJ1A 4S1VA 2J3JA 3LZ6A 3FI9A 2PWZA 2EKLA 3ORFA 4BS9A 5G0UA 4D7AA 4BL5A 2X0NA 4B8WA 5KJEA 5IDWA 1XR3A 4ALLA 1ZSYA 4R1TA 1F12A 2JHFA 3DO5A 2FRDA 4EUFA 2IEDA 1H2HA 2HLPA 2AHRA 3JD0A 2QX7A 3ETGA 4JP2A 4G65A 3F1LA 5ER6A 5A02A 2E37A 4HY3A 3RASA 4YAEA 2PZJA 2Y67A 3NT5A 2PD4A 4OIMA 3ANLA 1AE1A 3RSHA 4EW6A 1PJ4A 2HRZA 1B8UA 1N9GB 5AXBA 3JYLA 1LI4A 3PZRA 2WTBA 3C7DB 1KEPA 2VCYA 2Y1FA 3JD1A 3OMLA 3B1FA 2Y0DA 1IHXA 4FBGA 3LT0A 3ONDA 3ADPA 3HWRA 4DQUA 3F46A 1JVBA 1ISFA 2YHIA 3B70A 3TFQA 1K6IA 1ZXLA 4IUYA 1RPNA 2O3SA 4R5MA 2RIRA 2C20A 5F1KA 4IDBA 4RF2A 4CM9A 1CDOA 1FJHA 1ZCJA 4WKGA 3PK0A 4BO1A 4B7UA 2VWHA 2B4QA 3EZYA 1T2EA 2YDYA 1J6UA 3EHEA 4YB8A 5JMPA 4BO8A 4CQLA 5F3RA 5C7LO 2V6MA 1YQGA 2H9IA 3EMKA 4J0FA 3GAFA 3EGOA 3H8VA 1BVRA 1U4OA 3NRCA 5BSFA 3R6DA 4EJMA 4H16A 4AJHA 4MINA 1CQIA 4BIIA 4YJDA 4CM6A 1MB4A 4MP8A 4U8GA 3PXXA 3IIEA 4H3VA 2VRCD 4FD3A 5TSDA 3VC7A 3DXFA 4J43A 5CAEA 3AI1A 3TL2A 5HWSA 1TT5A 1JAYA 3PHLA 4ALNA 2ET6A 4IS3A 1Q2XA 4MKXA 5JYDA 5EJ2A 4OXYA 1EVJA 4GKBA 4Y67A 3TDKA 1EE9A 9LDTA 4JGBA 5TT1A 4AICA 4CLOA 3DHYA 3GZNA 2X5JO 2FZEA 3AY6A 1HKUA 4I5GA 4L74A 1B8VA 2EW2A 4FS3A 1SB8A 4GX5A 1DHTA 1EBFA 1YWGO 4WCFB 4FR5A 4J2OA 3PTZA 4I9NA 1SOWA 2E4AA 2QHXA 2VNSA 1OFGA 2CDCA 4GKVA 4K9DA 3RWBA 2OMEA 1DPGA 1V6AA 2EW8A 1NQTA 3GC6A 2BRUA 2ZJ1A 1GV1A 2X0IA 4HFJA 4R41A 3UCFA 3U4IA 1H6AA 1GADO 1KEWA 2P9GA 3EYWA 2VN8A 4B79A 5MGBA 3A28A 1R4NA 4MKZA 4PVCA 1GY8A 1SZJG 2RCYA 5K6AA 3FNFA 1QORA 3BMCA 3HZZA 4PLWA 5CDTA 3QVOA 1UXGA 1XHLA 1G6KA 1W4ZA 1HE5A 1U8XX 1ZK3A 1GYQA 4RORA 1E92A 1M67A 5T64A 2AE1A 1J5PA 3HB5X 4MKRA 3OQ1A 4BO9A 2WSBA 4JJGA 5L95A 2EWMA 3K92A 4ZD6A 1KEVA 2X22A 5AXCA 4RVDA 5I9LA 2Y93A 5KNLA 1SOVA 3MWEB 3SLGA 3GEGA 4CUKA 1MV8A 1GUYA 1P3DA 3I9JA 4E33A 4ALJA 3FCOA 4XKJA 1VPDA 4HBGA 3V5NA 4D43A 1UXHA 5JCJA 4U7WA 3DOCA 2I67A 3I9MA 1T4BA 1X13A 1YQDA 2VHZA 3BXXA 5C3MA 5T5QA 3GLQA 5IDXA 1IYZA 3GVCA 2BD0A 4I08A 4CL3A 5BT9A 2O4UX 3ENNA 4JBIA 1SAYA 3G3EA 1ZIDA 1JA9A 2RAFA 1ADBA 4FQ8A 5ADHA 1YBVA 1SB9A 1AHHA 3WGTA 4LSWA 4A10A 1U3TA 3DZFA 2ZB8A 3ROQA 1PJCA 3MOGA 3PDUA 4Z9YA 2PTGA 1ZO8A 1U7HA 3AM3A 4CLEA 1GUZA 1KY5A 4AJ1A 4DMMA 3M1LA 3K8ZA 4YRDA 2YV3A 1PEDA 1DRUA 3I9KA 4CUJA 1ZKMA 3LLSA 3ZU5A 3GDGA 3RUCA 3W6UA 2Q46A 4YAJA 4DRYA 4AL4A 5BNTA 3DZKA 2IZ0A 1E6EA 1T26A 3N58A 2Z1NA 1TT7A 1JDJA 1JVSA 3TZ6A 4AJ4A 4ZICA 1SO8A 4IGFA 4N54A 4IZIA 3KLMX 4IPTA 1WVGA 3S2EA 4B3HA 2ZB3A 3HJAA 1L7EA 1J49A 3GA0A 3OICA 4YJGB 4CV2A 4FCCA 3EZLA 3MZ0A 3V1TC 1LLCA 2Z1MA 3GOHA 1MC5A 2PFGA 4I8XA 4B4VA 2P5UA 4Z0TA 2AEMA 4Y6SA 4ND3A 2P9CA 3AUSA 1Z82A 3NDIA 4PRLA 3GNSA 4UULA 3JV7A 2PZKA 2QYTA 2W2LD 5CHEA 4NG5A 3C85A 3LT1A 4Q3DA 1WMAA 5IZ4A 2IXAA 2X9NA 3ZWMA 2J6IA 3PGXA 5DN9A 3QSGA 1N7HA 1YL6A 1P0FA 3QVWA 5KKCA 4KDEA 1FDWA 4O59O 4ZRMA 2QRLA 3PPIA 3MWDB 3RC7A 2CZCA 4EUHA 1PZGA 3OFSA 4K26A 4CM5A 2GLXA 2JD0A 1ISMA 3SXPA 3WIEA 4CR6A 3KETA 4QXMA 4D3DA 1OOEA 4OXNA 5THKA 4R51A 3FD8A 3H9JA 3FWZA 4CMCA 3ASUA 3BHJA 1MA0A 2WMDA 1LEHA 3GNQA 3JYPA 1ZUD1 4ZQBA 3WBFA 5HS4A 2Y1EA 4BO4A 2VHWA 1UR5A 4EEZA 3VAZA 2D2IA 4LW8A 1LDBA 1NP3A 4F45A 4AJKA 1YS4A 1LSJA 4RCVA 2GN6A 2JCYA 5C7OO 3AOGA 1BXKA 1NWCA 3LSYA 4RVHA 1KY4A 2QYSA 3H5NA 3WJ7A 4PN3A 1NQAO 2Q45A 2Y68A 2PD3A 3OBBA 3ZN2A 2WEKA 3AU8A 4U0JA 5L9AA 1PZHA 1WXDA 1XIVA 2DTEA 7MDHA 5JNLA 2ZCUA 2VZ9A 1X15A 1ZJZA 3LK7A 2C54A 2HMSA 3DBLB 4A73A 3A9WA 4DA9A 4QO8A 1UDCA 4E6PA 1DFHA 3L4SO 3GVHA 3DAFA 2VWGA 1PZEA 3DB2A 4Q3EA 1NVMB 2HMUA 5A5FA 4BKOA 4JBGA 4WASA 5A5EA 2CFCA 1LQTA 5I8ZA 4RPLA 4D41A 2OO5A 4CM7A 4CMAA 4ZVVA 4DL9A 3JD2A 4RZIA 4E12A 4XYLA 3RKUA 3KEOA 1ENOA 1KYQA 2AW5A 3ZWPA 3PRJA 1FF9A 3L4BA 1HZZA 3NGXA 1EVIA 1RWBA 1Y5RA 1GR0A 2F00A 2GR9A 4J1TA 4AJNA 4XQCA 3WWZA 1E7YA 4R1UA 2VWQA 1TA4A 3WYCA 3HB4X 1KBZA 4WCFA 4E21A 1B14A 2EHDA 3HDHA 4F6LA 1EFKA 1XKQA 3DZGA 3B1JA 1ZSVA 2E6UX 3NGLA 4UUPA 1GL3A 2I3GA 3VH3A 3WQSB 1HL3A 2HMVA 2VYVD 1X0XA 3CSDA 3G17A 4TRJA 2QW8A 3KUXA 1ZW1A 4ILKA 4FDAA 3RBXA 2C2XA 2VUUA 4R4JA 4XGIA 4DIBA 2XPCA 4F3YA 2ZQZA 3WWYA 1XCBA 2Y0EA 2FZWA 3TZKA 1F0YA 3ETDA 1GV0A 2O23A 2QG4A 2HKIA 3JYNA 3M2PA 3JQ6A 4JQCA 1EVYA 4UAGA 2B5VA 2WM3A 4FOOA 1X14A 1N7GA 3K5PA 5AOVA 4O1MA 5KOIA 6LDHA 2Q2QA 3NYWA 1B26A 4K28A 4LK3A 2O7QA 1QP8A 4KQWA 3IUPA 2JL1A 1SNYA 4QFDA 1P1FA 2WE8A 3O03A 1YVEI 4B8ZA 3PIIA 2GSDA 3CH6A 3I9OA 5I7VA 4UREA 1PS9A 4CV0A 4GWKA 4P4GA 4IQGA 2R6JA 5ITVA 2EKPA 4ALMA 2B36A 3WNQA 1P74A 4IBOA 4Z6KA 3ZV3A 3PVZA 3OP4A 3OHSX 4AG3A 3D3WA 4CLDA 4D45A 5BQFA 1ISGA 3DAPA 2BLLA 4UVEA 5TC4A 5JE8A 2D5AA 4I5EA 2OFPA 2Q1SA 1HLPA 3NUGA 3O4RA 4YJFA 1VJ1A 2AEFA 3ZI0A 1NFFA 4NBWA 1J0XO 3DHEA 5JDCA 4E2YA 3C8MA 4IDDA 4U6SA 5IXSA 3TPCA 2Q50A 5GZ1A 2YV1A 3FRJA 1A9YA 5CEEA 1G0NA 2CY0A 3P2YA 5KVVA 1XU7A 4J4BA 1LLDA 3RUFA 4DC0A 1KVTA 3OEWA 4OOFA 3RROA 1K3TA 2D4AA 4ZA2A 2AEJA 2PZMA 3DOJA 2C0CA 3LC1O 4NBRA 3KZVA 4WLEA 1ZBQA 5F1PA 3S1LA 1M66A 1UP7A 1EK6A 5EIOA 1SC6A 3OQ6A 4DBVO 1PJQA 1XLTA 4YTEA 3GRKA 1ZH8A 4MDHA 1VJTA 2DUWA 4MO2A 4PLTA 5TGDA 4CMIB 1VSUA 3FWNA 3RUAA 4EI2A 3TN7A 4CR8A 3QWBA 3OF2A 1X0VA 2O2SA 5B4VA 3H4VA 2ZATA 4K1LA 3DMTC 2PGJA 4XYGA 5KJ1A 4NR0A 4BNVA 2UVDA 1IE3A 1JKFA 1Y7TA 5TJ9A 4DBZA 4D0SA 1QYXA 1YOVB 2XAAA 3QJ5A 3BTUA 1DSSG 1B3BA 1CIVA 3I6QA 4YRBA 1YOVA 4M8SA 1CJCA 4IDFA 3T7CA 3PLRA 3TFOA 2NTVA 3ZWOA 1UAYA 4PIVA 1DO8A 4GSLA 2FOIA 5H81A 4ND2A 3VKUA 4CM4B 4CQMA 2JD2A 4DGSA 4MP6A 3LF2A 1E3EA 4BV8A 5TNXA 4CL8A 2BMAA 4O6VA 2NU9A 5B12A 3OIFA 4BO6A 1LRLA 4F46A 4W9NC 4JJFA 4RQUA 1D4FA 4NZ9A 5EMHA 2X86A 2GZ3A 4YXFA 4JROA 1TI7A 5EESA 1PZFA 2SCUA 4NFYA 4DREA 3CPSA 3OQBA 4FJ2A 5K9ZA 2XOXA 2I6TA 1R4MB 4CODB 4E4YA 2E49A 4Z9XA 3ENKA 3R3JA 2NTJA 1D8AA 1K2WA 1LU9A 4PCVA 3UF0A 4EBFA 2OP1A 3ICCA 2G0TA 4MIEA 1WDLA 4FW8A 1I3MA 3GEMA 1K6XA 4BKPA 1W0CA 4IDGA 9LDBA 2C07A 1CERA 3KYDB 3M1AA 4MJLA 1ORRA 3ICPA 1N92A 4L75A 4PLGA 5L40A 1YH3A 1I01A 1PWXA 3PQEA 4UUNA 3DZHA 5TRTA 1NASA 3TRIA 2BI7A 2ZKLA 3L77A 5A9SB 4JN6B 1N5DA 3JQ9C 4IZHA 1AXGA 4TVOA 3A06A 3SEFA 1C0IA 2PLAA 1HXHA 2PV7A 3DONA 3PYXA 5JAQA 4XJSA 5I7SA 4J4TA 3TZCA 3V2HA 1SEPA 5CEFA 5ILGA 1LC3A 1HDCA 1M6HA 1UXKA 4L73A 3FPCA 3QIVA 1ZK1A 2HQ1A 1U3WA 3DFZA 1EQUA 1O5IA 5B4UA 3QWHA 1R37A 1C0PA 4DYDA 2P68A 3M2TA 2DTXA 3UW3A 2GCGA 4KOAA 4D42A 2EIHA 1C14A 5K0ZA 4UEOA 1I2BA 4UVDA 3E5RA 3GVXA 4KWHA 4GSKA 1XSEA 1WPQA 3DL2A 3DWFA 4BMSA 1YB4A 2OBYA 2VRCA 4R3NA 4BNFA 1GPDG 4BNHA 2Y66A 2VHYA 4DPMA 1JN0A 1ULUA 3V2UA 3W4IA 3H3JA 2R00C 1E3WB 4D79A 3UHAA 3Q2KA 4PLFA 1LDEA 3KBOA 3R0IA 3RUDA 5EQDA 3PP8A 4N5NA 4TRNA 2EERA 4N18A 3PZBA 4OXKA 4DMLA 2GN8A 4YJFB 5JSFA 2DC1A 1HDYA 1U2GA 1DLJA 4GX1A 2YY7A 5T8KC 3STHA 5HTOA 4B4OA 5G0TA 4J49A 3HFSA 1S6YA 1NQ5A 1HLDA 2BF7A 2EGGA 4ND4A 1LLQA 1I2ZA 4OQZA 1IZ9A 2RHRA 1HDZA 1PTJA 4ZU3A 1C1DB 1NR7A 4TZKA 1HSZA 2FSSA 3A1NA 2ZTVA 4YWJA 5KCZA 3IP3A 4XR9A 3HG7A 3DTTA 3DZBA 5L51A 3G79A 5A9RA 3FTNA 3HN2A 5L4NA 3JQ9A 3Q11A 3KV3O 4GMGA 1PX0A 3GHHA 4IJUA 3ZNNA 1R4MA 1C1XB 1DBVO 4I9HA 4PG6A 4PLZA 1S7CA 4P22A 2XXJA 3AI2A 1A71A 1Q7GA 3LDHA 2CVOA 3FTPA 5CPBA 1SCUA 2EP5A 1BDMA 1TVEA 3QA9A 2Y99A 1ONOA 3L6OO 1V35A 4CUZA 4E0BA 1WWKA 1Y8RB 3R3SA 2WD7A 3NV9A 4Y98A 3RFVA 3E5MA 4EEXA 4G81A 4UVGA 3BHMA 4C7JA 1LTHR 2GNAA 1F8FA 4NFHA 2YQ5A 3RIHA 2DUUA 2DBVO 3F9IA 1D1SA 4OM8A 5BNIA 3LU1A 2A9FA 3PIDA 5ES3A 3S2FA 3CEAA 3MJEA 3FBGA 4GX0A 3G1TA 1C1DA 5JYEA 5A9TA 2GUGA 3V8BA 3HUDA 5CP8A 1E6UA 2V7PA 2PGDA 3TNLA 3FR7A 4W7HA 4BHTA 4EUEA 3ZV4A 1PGPA 1WZEA 5A03A 3OH8A 2H1SA 4GAEA 1HYGA 1UZLA 2DBRA 2OZPA 2ZIZA 3JQ7B 5AXDA 3VZSA 3ZZNA 3NTQA 1E1NA 4BMVA 3IKTA 2JJYA 1YKFA 4J9VA 3RJ9A 3D3EA 3PQFA 4WECA 4CMHA 4ZHSA 3P5SA 3OJ0A 3ADOA 1Q7CA 1SMKA 5G4LA 1H0KA 2GPTA 1A4UA 5DNAA 4Z0HO 3VDRA 1E6WA 3H9UA 1E3JA 2CNBA 2EJWA 3L07A 4HX5A 4R16A 5JCXA 1HE4A 1I3KA 3DFUA 4WOKA 3OJEA 3HQ4O 3PYLA 2DBZA 1MGOA 4IXWA 4G2NA 1R4NB 4YEDA 2GDZA 3GPDG 3GK3A 3VZPA 3WXBA 1U7TA 1WLYA 4DUPA 4QECA 4QO7A 1EFLA 3T4EA 3JSAA 3W8EA 3WG9A 2X1HA 1GUFA 4OMUA 4TQGA 3RUHA 1BGVA 1DC3A 1EDOA 1K6JA 1PJBA 3OIGA 4Y6PA 2X5OA 1G1AA 3U49A 1EUDA 2V6FA 3AWDA 4GX2A 4CLHA 4W82A 2YV2A 3FPLA 3NDJA 3JQAD 5IDQA 1JTVA 4KP7A 4NBUA 4DVJA 2B83A 3AFMA 1A7AA 1IUKA 3EUWA 1DLIA 4M54A 4PFJA 2DKNA 3D4OA 1WAMA 3JQFC 4GMFA 3L6DA 1U5AA 5MDHA 4DPLA 3GGOA 4EGFA 2XF8A 2BH9A 2YDXA 2Z5LA 1ID1A 1OC4A 4MVJA 5A1TA 3QLJA 2HCTA 5TT0A 4QTZA 1HT0A 1P1KA 1U3VA 1UAGA 3MTGA 3K31A 1GAEO 4OAQA 1YRLA 4LGVA 5DBIA 1SEVA 3V1YA 3QE3A 4MPDA 1ADGA 3BMQA 1BMDA 2BI8A 3WGHA 1DDOA 4PG5A 4J7CA 3TQHA 4XYBA 3VPXA 2BFMA 3WNVA 2A35A 2PH3A 3AW9A 4YBZA 4RLSA 1AN9A 2RBEA 2O3QA 2DAPA 3E1KA 4Z0PA 3M6IA 4YT5A 3JD3A 4IDAA 3I9LA 4E3ZA 4AJEA 4L8VA 3RCBA 4C7KA 1L1FA 1XG5A 3VPGA 2F1KA 3ZU3A 2Z95A 3GPIA 3PHJA 4M55A 4UEJA 4CMGA 1BVUA 1R0LA 2H5LA 3QWFA 1LRKA 1EE2A 4CLXA 2B37A 5T57A 2Q1WA 5DCYA 3Q6IA 3KSDO 4CR7A 4PZCA 3CKYA 3HNPA 1PS0A 3VZQA 3KTDA 4NHEA 1ZEMA 3RBZA 1CYDA 4EYEA 3OM9A 4DXHA 5JDIC 4NK4A 1H6DA 3IUSA 2OOSA 2X5KO 5B1YA 2NU7A 3HN7A 3B20A 3AM4A 4WEQA 1CETA 3PJGA 1B3RA 5F21A 2TMDA 3LQFA 1B15A 2EV9A 4L4RA 1NAIA 2OGUA 1EDZA 1Z7EA 2UUOA 2IXBA 4RF3A 4W7IA 5EN4A 1U28A 5JC1A 1DAOA 5G0WA 4GVXA 1PJ3A 3RQSA 5LDGA 1MP0A 3I52A 1NHGA 4AFNA 3LT2A 1QYDA 3MTJA 1FDVA 3WGQA 3N74A 2GD1O 3D5TA 5CG2A 2NVWA 2ZB4A 5L45A 4LMPA 5CDGA 1ZEJA 1LA2A 4B4UA 2ZTLA 4J90A 3TZQA 3NAQA 2PH5A 1GU7A 2NV6A 2X8LA 5TF4A 3L4BC 2Q4EA 1HE2A 2NLOA 3QV1A 1Y9AA 1A7KA 1R16A 3ASVA 1H2BA 3WTCA 3ZWYA 1BG6A 1FDSA 4BQPA 2RH4A 1NX6A 4KUHA 2OP0A 2HRBA 1ZXBA 4J4HA 4XDZA 3T4XA 1KVSA 2CVZA 1PGJA 2NSDA 2X6TA 1ZNQO 1X7GA 2AG8A 4N5LA 3HDYA 3JQDA 1F14A 1ENPA 4J3FA 4NI5A 1VLLA 4YT2A 2X0RA 1RKXA 3I9NA 4QX6A 4B7XA 4MVJM 4CM1A 1BW9A 3OEYA 1T24A 1QYWA 4YT8A 1Y6JA 3W4JA 3ZDFA 5LDHA 3VVCA 1NTOA 2WD8A 2BGMA 3JYOA 4OOEA 2ZYAA 4W4TA 3HHPA 2NVUB 1I32A 2QRKA 1N1EA 1WMBA 3ZW9A 4A5OA 1GQQA 4HWKA 2UDPA 1DC6A 1DIBA 2D3TA 3X2EA 3RU7A 4E2WA 5C37A 3C7CB 3UXYA 4QUKA 4CV1A 2Q49A 3DZJA 3WSVA 2Q1UA 3R1IA 4FPXA 4WOJA 2IZ1A 4YA6A 2GN4A 4XYEA 2J3KA 4XZ3A 8LDHA 1GEEA 5GZ3A 5JW6A 1BDBA 4CM4A 4CQMB 3BMNA 3O26A 2LDXA 3RU9A 3H5RA 1U5CA 1K89A 3KVOA 4PLCA 4WUVA 1DAPA 4JK3A 5FYDA 5H82A 4AVYA 1PR3A 5U1PA 3PEFA 5DCWA 4J7XA 4OJNA 4ONEA 4FFOA 2O3TA 1HZJA 3WQQA 2I66A 3BHIA 1MUUA 1TT5B 3E9QA 1PJTA 2J5RA 2DM6A 1YO6A 1HE3A 2HAEA 3HDJA 3I3OA 3JQGB 3BMOB 1O9BA 5COBA 4II2A 3ZWCA 4JLWA 3CZRA 3U4DA 1CWUA 4IIVA 4K6CA 4UVHA 3CIFA 3EY4A 4WLFA 1PSDA 2OUIA 2ZTMA 3AUUA 4HADA 3WB9A 4PG8A 3WGIA 4PLVA 4GH5A 4BMNA 2FMUA 4LRSB 1M2WA 4WGGA 1ZK0A 2C5EA 2I65A 1RM5A 3E18A 1KIFA 4B7CA 4JCOA 3FR8A 2Q3EA 3L9WA 5G4KB 1NFRA 3I4FA 3WTBA 3KHUA 3UAGA 1E1KA 4K6FA 5ICSA 3E82A 2WE7A 3T7EA 4JP3A 4XX0A 3F5QA 1KS9A 4LCJA 4YVFA 3WYEA 5JDIA 2VZ0A 3W8FA 4DIFA 6ADHA 1DIGA 2FN7A 2CF6A 3NTRA 3QP9A 1I10A 3BZUA 2YHIB 3WIDA 4CM9D 4M89A 3P2OA 2GASA 3F5SA 1EQ2A 3U5TA 4RPKA 1C0KA 3W4KA 3ANMA 3KXDA 3SBOA 2O2YA 2IEBA 3D4PA 4HNGA 5EERA 2PKRA 2W98A 3AJRA 4RVFA 4R01A 4URFA 4TRMA 4E5NA 1YXMA 1ISJA 3QW2A 3ZW8A 4XGKA 3WMWA 5KVSA 3GN2A 3FNEA 4FGWA 4XIJA 4CM8B 5DT9A 1MFZA 4IMPA 4XB1A 3ZWVA 2C7GA 2AE2A 3JD4A 4BGEA 1YGYA 2W8ZA 4INAA 1LDYA 2HK9A 1KEUA 3ZU4A 1P1IA 3D3WB 4KUGA 3Q2IA 4BNXA 1QXSA 1QLHA 1E0DA 2DU8A 2ZK7A 4DWVA 2CUKA 3GVPA 4XB2A 4CMBA 4S3MA 4R5HA 2EXXA 3A4VA 5ER9A 4U5QA 1O94A 1P1HA 3ZWWA 3QVTA 4KDFA 4GI2A 1QV7A 4LN1A 3TOZA 3VPHA 1C3VA 4BO7A 4MIYA 4NDNE 3QQPA 1BW9B 1NFQA 3KSZO 2JFHA 3PJFA 1VJ0A 4EJ0A 2ZTUA 1U4SA 1T4DA 4GVLA 1J4AA 3K96A 1I33A 4BNJA 1MXFA 2VUTA 2I9PA 4FC7A 4YT4A 2PD6A 2W2LA 3DZIA 1MC4A 2YUTA 3DBLA 4DQXA 3B6ZA 3GZNB 3MOIA 3TSCA 5GMOA 4YYZA 1Z45A 4QFCA 3V2GA 4BNZA 2IZZA 3GFBA 4FFNA 1ZVMA 2C2YA 4MP3A 3H9QA 4A27A 4BVAA 4XD2A 2WYUA 3JQEA 4L0QA 4RZHA 4IQ8A 2FR1A 3INTA 3K9QO 4RF5A 5TQVA 3RFXA 4D0RA 1VL8A 3PQDA 1YL7A 4E30A 1LDMA 3BA1A 2FWMX 1ML3A 3FNHA 3MJTA 3RAJA 1PQPA 3GNTA 4CPDA 5DP2A 2FPGA 1EVZA 2A94A 3QWIA 3ROMA 3U0BA 1EMDA 2FPPA 4J6FA 1EBUA 3B1KA 3BIOA 3SC6A 4B3IA 4KQXA 1NPYA 4AJOA 4YQZA 1PGNA 3H9EO 2JFGA 3D0OA 1WP4A 1GCOA 7ADHA 3ITKA 1NQOA 5JO0A 3SJUA 1FDTA 4D46A 4CQLB 1DFIA 4Z3DA 2JAPA 3VHRA 3D4NA 4DLAA 1GQYA 1GYRA 4MVJP 3C7AA 4UVIA 5GZ6A 5DCUA 3BTOA 2EGHA 2GZ1A 1BWSA 3F4BA 3DC2A 2BFPA 1E3SA 4JX8A 3OA2A 3TJRA 1E7QA 1DIHA 3GRPA 4TROA 3K2EA 1YE3A 5IN5A 4CM8A 3GF4A 4A2CA 3JQAA 4M87A 3ZNPA 1NHWA 1HDXA 3WGOA 1YB1A 2WWRA 3SVTA 2FR0A 1YDWA 2OHXA 3GT0A 3O8QA 4WE3A 5I8WA 4Y9DA 3QVSA 2NWQA 1EUZA 5BNFA 2Q2VA 2W2KA 1Z6ZA 5C7IO 2RH8A 2Y1GA 3O8QB 2HJSA 4NJMB 4PLYA 1RJWA 1LRJA 4B4WA 2NACA 1GFSA 1Y81A 2NUAA 2YJZA 4FFLA 3AOEA 4QSMA 3KYCB 3DMTA 3V1UA 4M49A 1HYEA 1L7DA 5FF9A 2P9EA 5J23A 2B5WA 5AVOA 4II3A 4I5FA 3GVIA 3LYLA 4DIOA 5JMWA 2C82A 3H2ZA 3L9XA 2YYYA 3QRWA 2WD7B 4XA8A 1NNUA 3UH1A 4BB5A 1K0UA 1M6WA 3CXRA 1SPXA 4HXYA 4UEKA 1UXJA 5KVQA 5JAZA 5G4KA 3COSA 1EUCA 3GR6A 4FSHA 1P9LA 2Q99A 4Z9FA 4RF4A 4ZN6A 3VH2A 1HDRA 3I1JA 4IM7A 4RO0A 1Y8QA 2DQ4A 1QLJA 2R00A 3W8DA 3UICA 3SX2A 3HFGA 3IQDB 4BNUA 1B16A 3WFIA 2NQ8A 1JLLA 2FHSA 4IDCA 2BHLA 8ADHA 1QV6A 2NADA 4RV9A 1DRVA 4L4SA 3IOYA 3ONFA 1ZSNA 4OHUA 1O8CA 4WJZA 1JW9B 3JQFA 3PWSA 3E48A 5JFOA 1WZIA 2C29D 5EPOA 5BSGA 1PJ2A 2I76A 4JBHA 1ENZA 2D1YA 3EW7A 4HKTA 5KJCA 1IY8A 1H94A 4RVUA 4DYVA 1KVRA 1UH5A 2DT5A 2CMDA 1BXGB 3MJSA 4TZTA 4TKLA 2HUNA 2P4HX 3Q3CA 2P4QA 4CLRB 5TLSA 4RLHA 2QZ9A 4HFRA 5JLAA 1E3WA 2A92A 4RL6A 4QEDA 5DZSA 1FXSA 2QQ5A 1X1TA 4BO3A 2V65A 2CF5A 3PDJA 3X2FA 3UUWA 5AXAA 3E9NA 1U2DA 3VZRA 1OMOA
chains in the Genus database with same CATH superfamily
3EOBI 2YW2A 4IILA 5JNRA 4ROSA 2ZQ5A 3FMOB 5CB4A 4DE5A 4ND7A 1OZAA 1J8FA 1IJKA 3AR4A 1JHDA 1E89A 5I3ZA 5AD1A 4N1AA 1U2SA 4HC4A 2B61A 4UASA 3OLWA 4NAUA 1DBWA 3U7JA 3MERA 2H16A 2N47A 1E8MA 1X7WA 2VSFA 4QVKA 5BQ5A 2HRDA 2W6JA 4YCLA 4RK5A 2EBWA 3KYBA 4WLOA 3IAXA 4OFBA 5FA8A 4X8HA 1RHUA 2OBFA 3SLKA 1I1QB 5HIAA 3R77A 2WKRA 2JD1A 1FEZA 1PU2A 2O0KA 2P1ZA 2QGFA 3E4DA 1PUJA 3ESRA 5DYTA 4EY4A 1J24A 2VHQA 3IV9A 1TEXA 1UEJA 2HMTA 3O4HA 4B5LA 2IYTA 2IDZA 5ECWA 1DU4A 2AF4C 1WPXA 2VT2A 2WJ3A 2IF2A 3KAQA 4N7BA 4Q4AA 1QX3A 1K27A 4MWOA 1KFCB 3FSGD 4EL0A 2V6BA 3PD7A 4ACAA 3OZAA 3QHAA 3A6HA 1HF3A 4FDMA 2XB6A 5THQA 1E1MA 1L7NA 2NGRA 2ZRGA 5F3WB 2C4WA 3AHDA 4QTUB 4RHUA 5LWHA 5K4GA 4PFSA 2W2KB 3DO6A 3NOXA 1E3DA 1G64A 1QJCA 1KK1A 1VE9A 2ZJYA 3EXHB 1SR8A 2LE0A 3ROPA 2QUJA 4F9GA 2RHWA 4OQYA 2GKGA 4QRDA 1M74A 3P20A 4X90A 2NUPB 3K73O 4C03A 1K63A 4K8RB 2MSKA 3CRVA 4HAWA 5K0NA 3CUKA 6NULA 1N2SA 2GZAA 1G8YA 2OLJA 4JI1B 1NBMD 2YVUA 2ODWA 5IJAA 4EPVA 4TZ0A 1CF4A 2FQYA 5I5GA 4PRKA 1XMQB 2AQIA 3MYRA 3MS2A 1U0LA 5JI3E 4AKHA 2MMGA 3E9DA 2JCSA 1NWHA 4KXMA 1OLSA 5CA0F 1SIWA 1M2HA 4LQ4A 1RLMA 4KRXA 4ARUA 1FK8A 1DBRA 3HSKA 3ZWBA 1UADA 3WWPA 2P8SA 1C9YA 4ML3A 4HUJA 5BUQA 1P29A 1R2QA 3QBDA 3DLBA 3EEOA 5G1PA 1E6MA 3A37A 2FUG6 2I29A 2XQJA 4HG2A 4GL4A 4OBWA 3T3EA 2ZEJA 4R3WA 4BN5A 4JV5B 2P2GA 4ED9A 3I53A 3RWOA 3CMMA 1QF7A 1SCBA 1OD6A 3E2IA 3HR4A 4FINA 4R81A 2XTMA 2WWYA 4M53A 1DS6A 3JWEA 4TGLA 1E4EA 1Z2DA 4JS0A 3H75A 1TK2A 3NHZA 3B48A 3P9PA 3UT6A 1FFHA 3WBJA 4Z7QB 5KIAA 5LQUA 2PWYA 2OORA 3ILHA 4MA5A 3LQ1A 2Z8YA 4OBBA 5E4JA 3P26A 2FMKA 1ZRNA 1FUYB 1ADCA 2PX0A 5H3CA 4P33A 1ZK4A 3K70C 4NZPA 5T8KA 2JJ1D 3U31A 2GBCA 1DBIA 3ZD9A 5CDHA 4Z86A 1E61A 5HBRA 3HN6A 5M3BA 3ROXA 4ZGWA 4CLOB 3V34A 1K7EB 1YRWA 3X1JA 3TRHA 1R0ZA 2VYQA 3ED1A 4ENQA 1TKBA 1Z68A 1YGPA 2LDBA 2IBMA 3QUCA 1IWBB 3OTQA 1GZ6A 4GWGA 4N3BA 1CDZA 4TTRA 2BEVB 4YMIA 4PAWA 4EYOA 4EGQA 1YFLA 1TB4A 3TS1A 2HPZA 4MYUA 4RXMA 1A4XA 3AEUA 3RW9A 2ZRAA 5C46F 2O9JA 2SICE 5G0SA 2YVLA 1TZKA 1E9VA 2RHCA 1PZXA 3INRA 5KHAA 1E2BA 1TYZA 2IYEA 3JQPA 4JLOA 3BJMA 2DPHA 4YV7A 5BMVB 3ME5A 3FPBA 4BC1A 3DDNA 5FBVB 4TS3A 1FYWA 1D0SA 1PFWA 4MKHA 4ZAYA 3SC2A 1QTIA 2HRCA 3ZCPA 2O3RA 1P7YA 2ZIWB 2IU6A 2JJQA 3U56A 2LBPA 1FXWA 4FEEA 1LWOA 5DXJA 1D6SA 1OXSC 5EP4A 4CQMD 1CUAA 2GM3A 2HSJA 3TRDA 4PZDA 3HU2A 4WZAB 5K8VA 5BYAA 3P4UA 3CMCO 1PJRA 1D2NA 3AF2A 4FT2A 4NU6A 4A0GA 1NKVA 3QEKA 1UKCA 2V4MA 3R0VA 5DWQA 3PLAE 4KHPB 3PC2A 5IJ0A 3DKRA 1IXSB 2UYCA 1OU4A 4H7IA 1YB7A 1L4BA 2BGLA 3PS9A 3HFRA 2QTNA 4D4KA 3L8EA 4V0MA 5EUCA 1MW8X 1OX6A 4UNQA 4AULA 3MA0A 3F90A 5HFNA 2W4QA 1IJFA 4RTQA 1Q50A 3CS3A 1KDOA 4M8LA 5K3FB 3RF6A 1ZRMA 4FT4A 1OXXK 1QH0A 1L8LA 2E55A 5DSZA 3RODA 4MZXA 4YAKA 4N0DA 4ALKA 2CNNA 1UBOS 3TD6A 1P4SA 1LSSA 1RKQA 4R9RA 5EUBA 5I3CA 2FPRA 3FNQA 3HP7A 1VP3A 4ZQEA 3WMXA 1XFAA 2F8LA 2G04A 3I30X 5B37A 4ARSA 2FY8A 1LVGA 1F3LA 3ROKA 4P7FA 1NVVQ 1D09A 1GPJA 3C48A 1XE3A 1NR1A 2NYAA 3OZUA 1QYVA 4W9RA 4BFVA 3FVRA 1QONA 2V4UA 1JXOA 3KNZA 4IZ6A 4EP1A 4Z7OB 4C7KA 3BH7A 1ZD5A 1H9BA 1T8TA 4NAHA 2EG9A 1JSRA 5ILQA 4ZFNA 1FFXB 4C6HA 3QVVA 5IM4A 2XHZA 1F0KA 1XELA 2M32A 3QH4A 4AJ2A 3LX5A 4DJ5X 2BFCA 4WOPA 4ARVA 4ESEA 1EUCB 2QN6A 2A0WA 4DWJA 2AUNA 4Q3CA 2XLCA 2B0JA 4MQBA 1ZNZA 3I6IA 4KLCA 4MPTA 5LB4A 2R3SA 2JW5A 2ODPA 4QOSA 1V5GA 4JR0A 1TTTA 5ADVA 4ENTA 3WLMA 2W42A 2J3HA 4AWBA 1R66A 1T8SA 3DE6X 3S2GA 5EJ6A 4J0KA 4L3OA 1I6MA 1P4AA 4B5KA 4JJ7A 3KPVA 3VR2A 3RTDA 4C0AC 3ABOB 1UIRA 3A1SA 2V58A 4UNPA 1LX6A 5KNBD 2YN2A 3K94A 3UJNA 5EFZA 4N5DA 1Q5PA 4S1WA 1B7GO 2BELA 3R5XA 1H1TA 4KTVE 5ANRB 4E14A 4XRRA 2D3WA 3JXEA 3U4GA 2CFTA 3TLBA 3EB9A 3FSEA 2W22A 4PU0A 4YI5A 4D3SA 5CG1A 1WUYA 3G2PA 3GUYA 1N6PA 3Q7IA 4IY1A 2LKDA 4XUEA 3TL6A 4JY7A 1FOEB 3NKFA 4IV0A 4RV5A 2XUPA 3LQQA 3JZMA 2CJWB 4IX9A 3VO1A 1J2EA 4DA4A 1FMTA 4NE9A 1OVGA 2BVNA 2WWGA 1P18A 2JJMA 1KOLA 4FX2A 3GQVA 4LYAA 1DC8A 4BP8A 5JZOA 2DGDA 3GEIA 2C8KA 4FMCB 4LJ5A 1GZ3A 3K53A 2AXQA 2PSSA 1SQSA 3TTYA 3VR3A 1XN4A 1BCSA 1B4DA 4R8KA 2X2PA 3TTXA 3WR5A 2VJQA 3UBMA 3RRFA 4YYEA 10MHA 1FW6A 5TMDA 2PUGA 2D1TA 2DFPA 4NESA 1L4EA 4WCVA 2REOA 4WLUA 4JI6B 1U7ZA 4Y1RB 4CMKA 1QGUA 3BBPA 4JNKA 3GIWA 4AY6A 5TIIA 3VR5A 3ZEIA 2QORA 1XA0A 3AJDA 4JU8A 1ZJYA 3VR0A 3WO1A 4KR6A 3OOEA 1VJGA 3CUWA 1XQYA 1AS2A 1U81A 3WZ2A 1E2GA 4IUBS 1TVMA 3IOBA 1HYHA 1YBMA 4R9SA 2HHAA 4QPDA 3TWOA 1CX9B 3MTIA 2Q6VA 4IIBA 3K9WA 5FHQA 1PWEA 2D2VA 2C3UA 2NUBA 3AXTA 3ABZA 3ID6C 2X76A 3NT4A 4Y2QA 3M33A 5LXTF 4EPYA 3B82A 2ZI5A 4BMXA 3SY8A 3ISVA 4KZPA 4ITUA 1E62A 2FWNA 2H17A 2IC5A 1YJQA 2DHEA 2DFVA 3KO8A 4WACA 4ERNA 4F6CA 1T9AA 3EJ6A 3PC7A 4FGSA 4K9MA 1TCBA 5IK2D 1ND5A 2GAJA 3LG2A 3W06A 3CVWA 3OCWA 1DO0A 1DV2A 2I2AA 2OGZA 4RH3A 4WBSA 3GGPA 4DHEA 2JH8A 4EK9A 1PQUA 1E2MA 3CO5A 2YVKA 4R1QA 5JEEA 3SMVA 2IHZA 1DJNA 3FAKA 3R7DA 5AKEA 3RTBA 1EHCA 4K9QA 4P0PB 1A27A 2CGEA 2GERA 4YWHA 4NCKA 1BXZA 4M83A 1BRMA 5EUQB 1GTZA 1LW7A 2JHGA 3QFRA 1DMRA 1XMOB 3ETNA 2BOVA 1LJ8A 1PS8A 5DV9A 2W2PA 1GQRA 3B6IA 5EJMA 3V7FA 1LDGA 5A7FA 2C9CA 3U40A 2XYVA 2GCNA 3WLQA 4G67A 1M1NA 2D1SA 5BV0A 5A1JA 4ZPJA 1C3OB 3DMDA 1T0HB 4PBRA 4E5YA 2CYCA 3PICA 2ZLBA 4XVUA 2RKBA 3RRYA 5DBGA 1V43A 5HJ2A 3TUIC 5JSZA 1GFZA 4ZYYA 4JA2A 4FLFA 1ZFNA 4Z1MD 1FU7A 1D4ZA 2VS1A 1VXRA 2PKXA 4W6ZA 4S0ZA 3FZEA 3WRVA 4Z4CA 2XA9A 1J2TA 4CCWA 6GPBA 4GMXA 3WISA 2I8CA 3F47A 3PKIA 4M36A 4ZT2A 4MI3A 1DAMA 3AR2A 1L5VA 1PP4A 2C2HA 2WHPA 3TR0A 1ZGAA 2G5GX 3ZHTA 2XODA 3J7AC 1I2AA 2C7RA 5A5GA 2AZXA 1OGIA 4J0CA 3A14A 3MCZA 5FOWA 3SYNA 2UAGA 4HZIA 2E3JA 3L46A 1OJ7A 1QHYA 3H0CA 4GZ3A 4BU1A 3GN1A 1AN0A 4JEHA 3EXHA 4ZJYA 1KI4A 5HMLA 4ZYXA 2IYOA 1Y6ZA 1JDTA 2BGJA 4JXJA 2HX1A 3ZHVA 3VR6A 4DV7B 2G82A 3EOAI 4NFLA 4YAWA 2XQVA 5G2OA 4HLCA 4UJ5A 4YAGA 1KQOA 1VDMA 1Y9EA 5EKXA 5HEKA 1KZYC 4NNJA 4EW1A 3E6AA 3GD5A 2I71A 1XTJA 2WZBA 3FTDA 3HU3A 2P3LA 2OHGA 3RI3A 4KAFA 3S27A 4MHSA 2DTDA 2JIQA 1MH1A 1MPXA 3BRWD 4YPVA 1ISIA 3W5HA 1F2VA 4RAOA 3RHZA 1TM2A 3CF0A 3W3AA 4WCFC 3ABIA 1NONA 4EYQA 2O7SA 3G89A 4LRYA 1HOTA 1WPRA 1JEOA 1RD4A 1V9LA 3OD5A 3G2MA 1QMGA 1XZBA 4IOMA 2VXCA 3C7KA 3CG0A 3QXGA 1L1RA 1JHAA 2IZ5A 2P9FA 2FPWA 4P54A 3T4UA 2R1TB 3TXXA 4QBFA 5G3ZA 4ZIRA 2HY7A 3CZPA 4Q4JB 5JO9A 1BXRA 4LWPA 3E1GA 5KDDA 5GADl 3OKFA 3UV6A 2PYDA 1TO2E 3B1ZA 4OEHA 5JS8A 1KJQA 3JW8A 2HJVA 4KUEA 5LKRA 3F6CA 2NMVA 3L7KA 1I3OA 1YDFA 2DWCA 4O2AF 2DHQA 121PA 4IG4A 1MN6A 2C83A 5I7EA 1G2IA 5JISA 5KWIA 1KI8A 2XE4A 4O0LA 1U31A 4QQ8A 5DJ5A 3HL0A 1Z5NA 3AVTA 1EG2A 2V7XA 5I9MA 2BUAA 1ZONA 2XD9A 2OO7A 2C5LA 2J5QA 3MD0A 2DPGA 4MI1A 3E5NA 3WV4A 1GKIA 1TUIA 5CLHA 4L57A 1KGDA 5K6AC 1P72A 5CFLA 2IH5A 4RQTA 1NBOA 3AHEA 1R9MA 3ECCA 3OEHD 2VHCA 2CBGA 2ZYTX 5JSYA 1ODKA 1F6DA 3IBCA 4CDGA 1COZA 4ZVNA 1TZCA 4RTJA 4BMYA 3M6WA 2B2NA 5A3JA 2CXQA 2Z43A 1QC5B 3U9LA 3KYDA 4J9UE 1DB3A 1QOQB 2WP0A 3G9TA 3TXYA 4J1NA 1G7RA 4C20A 5KS2A 1EM8B 2NUTA 1QK5A 2RHBA 1CEQA 4Q3NA 2H7CA 1CD5A 2P91A 4R69A 4RPGA 2XMBA 2PZLA 1QH9A 2ARKA 4C7XA 4TV9A 1KS2A 3RSCA 5INTA 5E3JA 2UUPA 3V4FA 5LU8A 2HJ9A 4TKMA 1BOFA 1G8PA 2A84A 2P5YA 4BNNA 4YASA 3HDVA 3G1UA 3SHOA 1PQ4A 4B46A 1N25A 1RE0A 2ATVA 1O89A 3H5TA 4P5EA 4URUR 4Y6PA 4XCQA 1BCSB 2VAVA 3D6MA 1G21B 3AFOA 1A5BB 3EUFA 3N2KB 3D5QA 4X7RA 3T5DA 4ZJUA 4MHTA 4NEHB 2JJ2D 5EPEA 3P7MA 1X87A 2DUMA 5SZIA 3N7AA 3CH4B 4YMHA 2LCFA 2YQZA 1TADA 1L5MA 2G9NA 3H4IA 1SRQA 2B6NA 3M49A 3CRW1 4IIJB 1Z0SA 1FJ2A 4WESA 3GLHA 3QE4A 3ZH2A 1Y5MA 1L5GB 3WHIA 4J0DA 1LPSA 5JAMA 5GVSA 2GS9A 2CD7A 4KXXA 3NJ4A 4MW0A 4RKEA 4WFIA 1P1RA 2QSUA 2ZSIA 5L4LA 3T1OA 3WYAA 2OL4A 2VHVA 1JQKA 4HP8A 3L3BA 4XIYA 1WQ4A 1S0UA 4YN3A 2XOKD 5HSGA 2OXCA 2JCVA 1IZYA 2GLTA 1KL7A 2HT6A 3F74A 4OH7A 5DK6A 3V6MA 3JQ7A 3FDFA 3IH5A 4OA8A 1X1RA 4B6FA 1UJNA 4JMPA 3RG8A 3QEAZ 4FE3A 1LPMA 1XMJA 3KSUA 4EYKA 5J4VA 2AYXA 3W5CA 3H9CA 1ODFA 1WBJB 1E2QA 4C0WA 1TAHA 5CFQA 3DAGA 5LB2A 4NEQA 5DGXA 1LK5A 1T35A 3C3MA 2IHNA 3L8HA 1NE7A 4TMKA 4WL0A 3WGNA 1NAHA 2CC2A 2AWNA 1OLXB 3ORYA 5HRUA 4J2TA 5ALHA 5JYCA 1YR6A 4ZZIA 5L3QB 2BLNA 2VUSA 4XRGA 5CDYA 4E22A 1JVNA 4RETA 2SBTA 1N0HA 5FULA 1I0ZA 4CKWB 2VDWB 4FLEA 4AY3A 4ZOBA 3I83A 4Z3KA 3NNNA 1CUJA 4HQFA 1X8XA 2EC5A 4BNYA 5FI3A 4K6KA 1J42A 1NZFA 1WXQA 3AF3A 2VQ6A 3DVQX 3KZKA 2O8FA 4ZCSA 3QKUA 3A58B 4NOMA 2PUBA 1A9QA 1UT8A 2ZI6A 5LCXA 4D9FA 3RARA 1PV2A 2CXPA 5DRYA 2OPHA 3QFFA 1BDHA 4ZXPA 4MW2A 1W73A 1QR6A 1G20A 1Z2NX 2JI8A 2UZ4A 5F12A 3C97A 3DE1X 1G5IA 2NO9A 5HGXA 5EMNA 5JJ5A 4L4UA 1YMQA 4HF7A 2FR8A 3LVRE 3GFVA 4AC9A 7AT1A 1JXMA 3C2QA 4JC8A 5JQWA 1KDTA 1U0BB 1Y1PA 4DCVA 2YIMA 4P3OA 2FPMA 4ZEOA 5IVHA 3AL3A 4MVJI 3FFTA 5TPWB 3WI7A 4ENUA 3HPRA 5EE0A 4HPXB 1R0SA 1JYSA 1MVNA 3MJFA 4I6JA 4J94A 3G7SA 4D3FA 1T4MA 5F2KA 2FW7A 4L3WA 2JFQA 4E15A 5KJFA 3OZXA 1ENYA 4OUDA 2IY9A 1M1YE 3ZLTA 1B8NA 4UTNA 2XITA 3THXA 5JVDF 4LZNA 3M89A 5D8DA 4U0KA 2BY4A 2JAOA 4PHTA 4RCZA 5GJCA 3RE1A 2BP7A 3UJPA 4HGYA 5I51A 1XPRA 4BUCA 5DIFA 5F1YA 2H52A 1JQEA 4WZAA 4BE9A 1JLKA 2YH2A 1W4CA 5B7QA 2ECPA 3DF7A 5GP1A 4OLBA 1RXCA 2ZITA 2QM0A 1R6DA 1XCOA 1YZ3A 1TMOA 1T34A 2GM9A 1AUQA 3B2EA 1BH6A 2G1JA 3NASA 5EYPB 3A4LA 4BGVA 4ZU6X 5JPIA 1BE8A 4DR2B 4EKYA 3HJFA 1D2GA 1RM3A 2ZR8A 2BCEA 1T2FA 3OJLA 2ZRQA 2H1HA 2E7ZA 1EGHA 3GP5A 4UU0A 2PLRA 1T6YA 2ZT8A 3IJPA 1RWMA 3Q7TA 3HKBA 4UC0A 4XLZA 3U7RA 2EL7A 3D8BA 2ONKA 3LHSA 4YP6A 4D9IA 2G5TA 2MOKA 1L5KA 1ZM3A 4TLMB 3A3YA 3ETJA 3SDZA 4YMGA 3FUWA 5CFPA 5AK3A 4BUZA 4EI9A 3O21A 4NENB 5IJXA 2FOXA 1GXSB 2Q62A 4BNIA 2IU3A 5CNKA 3BS4A 1RP1A 2QD2A 5IKMA 1R0RE 1V5IA 1PIWA 4LXHA 5EC8A 1PO7A 1AC5A 1OI2A 3BTSA 4YX9A 1JSCA 2OZKA 1Z2OX 2F8MA 2UZ3A 1ESNA 1TK9A 1EGQA 3I2YX 2OBNA 3IV7A 3KKQA 4HWSA 2YOFA 4FE4A 1NVFA 1YONA 4GYYA 5DISB 3I62A 4EKDA 4KE6A 1W87A 2RC6A 3VSAA 5K51A 1HWYA 2E85A 3R5KA 5HDBB 1NXQA 5D1NA 1JWLA 5DI3A 4BZWA 4MW6A 1B2RA 1U0FA 4QPNA 4D4GA 1JV2B 5DVZA 4ZT7A 3B6JA 4Z51A 3NVKI 1Y7LA 4B4KA 2X23A 3JS5A 2O1SA 1WP9A 2X7HA 5DRTA 1P77A 4P3PA 4MVYA 1TW2A 5JMOA 1XKTA 4YUVA 2ZVQX 1WV0A 2JGDA 2VJPA 3LK6A 4GGOA 3Q1LA 1CZOA 3W5IA 1UUFA 1VL0A 2Q2WA 3BFPA 3COVA 3DDWA 4HFNA 4U8HA 2YWGA 4R9NA 3OZWA 4X3OA 4DIMA 2J9ZB 2Q5EA 3LRXA 3OECA 4QATA 4WLVA 4H4EA 5IAGA 2MCFA 3SOZA 3JQ8B 4GRAA 1SUIA 1QU2A 3C6BA 3W9SA 2IXFA 3DR3A 5C1OA 3KOZA 1N3IA 2VZ8A 1D2AA 3KV1A 3PHGA 1FVXA 2C3OA 2JANA 1P45A 2X2OA 4MAMA 5C8ZA 3WNBA 2ISQA 2QLJA 3LCJA 3LUGA 3N2ZB 4WIAA 5D5PA 1D6MA 1L7XA 3ZI7A 4E2XA 4G9BA 2D54A 1E7MA 1GQOA 1ZM7A 4QUIA 5LZ7A 1G5HA 2J0UB 3V80A 3HCEA 4OAPA 3KQWA 4RPHA 3I09A 4GPEA 4L7VA 4GKAA 2CL6X 3CTMA 1JQ3A 4EHAA 1C8KA 1SUEA 1ATIA 2VHXA 2P5SA 3I05A 1SXJE 3ASZA 3U4QA 1SZDA 1R8YA 1BA2A 4OF4A 3TQQA 4A2QA 2Y71A 1ADFA 3PHHA 2AOWA 4Y9TA 4G8JA 5J4LA 2FP4B 1DXYA 5DSTA 1W2HA 1YZVA 3G8DA 4D3XA 2BKEA 3RFTA 4HWTA 2KW5A 1RQPA 5FEUA 2FP4A 2PZEA 5IPFA 1U9YA 1CS0A 2ZAYA 2H5EA 2I99A 3B9QA 4L4YA 5EINA 3LT4A 3S2YA 2YL2A 4YPOA 4B83A 1KYIA 1H4QA 2QD5A 3BEDA 4FXPA 1UMDB 4A7PA 5U9CA 1RBYA 5TVKA 5JR3A 4OGKA 1YHZA 4NQRA 1UK7A 1GPWB 1GT6A 2ZREA 3BAFA 4Y8VA 4YQYA 5K3CA 1P44A 1XCJA 2H1WA 1XWFA 3NHAA 3UVEA 2I3AA 1EFDN 4IXTA 4XTCS 2PY6A 3VH4A 3BSWA 4MGHA 4RHXA 1OASA 2HGZA 2ZETA 1ESZA 3IDAA 5JECA 1AXEA 1EH5A 1UJ6A 2WWHA 3F1KA 2OV4A 3FCXA 1P1JA 3DMYA 3TCNA 2J8ZA 1TPYA 4EHFA 2QEQA 4PS1A 3G9ZA 1BTOA 3OPMA 3IKVA 2PL3A 4PNEA 1SK8A 4IEIA 2WOJA 3QMMA 4M0KA 3UGKA 3SFZA 2AR7A 2QRNA 2X2FA 1RWOA 2W6PA 2ZXFA 5H8WA 1U04A 3ZJVA 4Y2GA 1E7RA 1E9CA 2AOTB 1NP7A 4TOIA 4A0SA 6YASA 4CDNA 3T9FA 5CCBA 1IN5A 4QOFA 1QHHA 2ZIEA 4PSUA 3WIOA 3LCVB 1EK0A 4EKGA 4KITB 1O0CA 2HA4A 3B78A 3WGGA 4IDQA 2X1LA 3AHFA 2R60A 1RQRA 2XYPA 4HRVA 4IMJB 4MOWA 4FFMA 3EYAA 4P82A 1U1DA 3THYB 4FJ0A 5AJUA 4CCYB 2VPPA 5AW0A 4GZLA 2X9VA 2AMYA 1XUOA 3ADDA 1YK0A 3QQ5A 2ZWVA 3KE8A 3S3TA 3CF4A 5AM4A 5CDSA 3T5CA 1R0WA 2PKQP 3WGKA 5KYXB 3QVGB 4M0UA 3W78A 2JKZA 1VKNA 3GFPA 3SC3A 3EK2A 2H65A 3WL8A 3IP1A 3UWDA 1LGYA 1OX5A 3REOA 1ZOLA 2QB5A 2Q0SA 1O1YA 3ZHBA 2C58A 2HJRA 3RVJA 4F93B 1QDEA 3LKBA 4Y6RA 3OOYA 4ETIA 4DR1B 3GH1A 3G8AA 3ET4A 3PC4A 5LQKA 2AMFA 4CIWA 2H92A 4EQZA 3WLTA 4BNGA 1EWVA 1S7GA 1PDWA 2J9RA 4MVJH 5DYWA 4ID3A 5G3YA 5HTKA 4EB6A 3Q15C 2CHUA 2ZUDA 5C4GB 5HCNA 3GBVA 1OPRA 3OLVA 1FDOA 4J3JA 1BJKA 1XRRA 3O0DA 3OZVA 1PFYA 1UFQA 5GIOE 2PEZA 4D7AA 5G0UA 3ZE9A 1SXJA 2XZDA 2VG8A 3TEJA 1XR3A 4J0GA 1T9CA 5IDWA 3DFMA 1ZSYA 1WOMA 1YD7A 3VYVA 2FRDA 3VRHA 5C0OE 3SSOA 2AHRA 1WUKS 3EMDA 1XQ9A 4TYMA 2GJSA 3PHCA 1BMTA 3LUJA 5F7XA 3OI7A 3EC1A 2XUDA 4MUAA 3AP2A 1XZEA 3BWCA 3F1LA 3FLEA 4KU4A 2E4ZA 4L6AA 3SGLA 2E37A 4DLVA 4YHBA 2VAMA 1DWQA 2H7XA 4HEQA 4W63A 2R8PA 2FFAA 1QKKA 3T3DA 3DHWC 2RIPA 1KZ9A 3LHKA 1SQ5A 2OD7A 3VHQA 3ZKWA 3O91A 4P3NA 5AH0A 1WB4A 4WOBA 2GBFA 3ZXUB 4AROA 5J1SB 3P96A 1QFMA 2O20A 1XZIA 2Y0DA 3RIEA 3V00A 4QM7A 3ROZA 1MOSA 1ZCAA 1SHUX 3NAZA 3UWOA 4P4UA 3BL6A 1ISFA 1DKMA 2YHIA 4FOPA 3JZFA 5DHRA 1TCAA 2NO6A 1U0HC 3EC2A 2C42A 4JBNA 5F1KA 2JATA 1HC7A 1CDOA 1FJHA 1ZCJA 3DWEX 3U37A 4Q9DA 4R40A 3W5VA 4BO1A 1KHTA 3CN9A 1VHDA 2VWHA 3LRTA 5IJ0B 2VAXA 1H4TA 3CRQA 3SPXA 3LPNA 3E2PA 2ZI7A 2A0KA 3H0EA 2HM7A 1GJRA 4QVGA 4Q9AA 2ANCA 5M29A 3EHEA 4YB8A 4BO8A 2QBYB 4E46A 3DPIA 4A8JA 1JG1A 2CYAA 5F3RA 3CJQA 3H99A 4IH4A 2ZAOA 3GAFA 3GFRA 3PT5A 4PQRA 1YBHA 1U4OA 5KEIA 3WHPA 5CTJA 4EJMA 1USUA 2IZ7A 3T6KA 2OQ2A 1YA6A 4AJHA 2FWJA 1QNLA 5JMTA 1EP1B 4MKGA 3VC3A 4YJDA 5SICE 3E8MA 4CM6A 4BTLA 5FOVA 1V16A 1KPGA 3PXXA 4U7FA 4NE2A 4FD3A 3CX7A 2B7LA 1DJPA 2VDOB 5BN1A 1LH0A 1H1DA 4XTRA 2PUWA 2WNHA 2YWDA 1L8XA 4YDHB 5JTTA 1GLVA 1LPPA 1JAYA 1U8EA 2QDKA 4LDNA 1ILEA 3CEJA 3F5FA 4KO4S 4MKXA 1UWVA 3DEJA 2CFIA 4I55F 4PQFA 5EJ2A 4EB6B 4OXYA 1S2MA 4JUFA 4V1CI 2AI3A 4Y67A 1G5TA 4HHEA 3OC6A 4CLOA 3AZQA 1ORWA 1UM9A 4AICA 1L3BA 5JBNA 1KI6B 5C1DA 2X5JO 4HTFA 4KQGA 3TE7A 2FZEA 4L74A 4Q4HA 4BWFB 4BX9A 2W6QA 2W9XA 3FW1A 1SB8A 4GX5A 1DHTA 4S2EA 1G7SA 4WCFB 2P1DA 4F8YA 1EUDB 1R1DA 1V47A 3N2NA 3PTZA 2B4YA 3QVJA 1UQTA 2WDPA 1SOWA 2VNSA 2UKDA 1P1CA 1OFGA 2WABA 4M1ZA 4B40A 4K9DA 1FQWA 4LZLA 1Z28A 5HVNA 3SYRA 2PUTA 2VXYA 3BKXA 3GLHB 1RMQA 1NQTA 3QLTA 2LXNA 2BRUA 4NX2A 4P08A 2ERCA 2X0IA 4R41A 3UCFA 5KSZA 3U4IA 2BMEA 1DAFA 2H29A 2IA5A 1O9HA 3EVEA 3K20A 2ZZNA 3EYWA 3A6GA 5MGBA 3A28A 3IUJA 4TXNA 4O29A 1UJ4A 4WFQA 1SZJG 1YR3A 2RCYA 3FNFA 1QORA 3PDIA 2BFWA 3OPYA 2WZCA 4UU8A 3HH8A 1QZZA 2F3PA 3IURA 3QE0A 2XD4A 1UXGA 1XHLA 5FBZA 3PNBA 3TTSA 3G9XA 4BWGA 1W4ZA 2Y1LA 4AZTA 1OWNA 1F51E 1ZK3A 1D0VA 3C87A 3K4HA 3N9IA 4OHMA 3MWGA 1E92A 3IQHX 1EFPA 4U7JA 4MKRA 2W2QA 3F9RA 4BO9A 1IHUA 4ZZ2A 1L7VC 2YC2C 1XCMA 2EWMA 3BH6A 2O1WA 3M5PA 5T4FA 4BCCA 5L95A 2C2KA 1OFVA 2MDTA 2XF2A 2X22A 1FYDA 1SBCA 3CLUD 3ESDA 4D99A 3NHWA 2E0IA 1BQEA 2Y93A 1DAGA 4RJLA 2R48A 1SOVA 3EUEA 3MWEB 1ZAKA 2DOKA 3GEGA 1MV8A 4UMFA 1K4MA 1XZDA 5A6SA 3BX1A 4HBGA 3IX7A 2JFOA 3ZXYA 1E3MA 2VDRB 5JCJA 4U7WA 2I80A 4LJYA 5TQ0B 2CWDA 3I9MA 4F06A 1T4BA 3BJZA 3BXXA 2OXIA 2WM8A 3CW9A 2J3EA 2ZIAA 1KK3A 1MOQA 1W30A 3PEVA 4JZKA 5T5QA 5IDXA 5F77A 1I7LA 4CL3A 4KFSA 2A58A 3LQYA 4P53A 1G3MA 2JARA 2IGBA 4FTWA 4JBIA 3DDUA 4KXUA 4FQ8A 5KSYA 5HKOA 4E5SA 5IVPA 1Z25A 4BZZA 4LSWA 1P60A 3HACA 4Q47A 2I6UA 3RSFA 2QTWB 4L8GA 4QYMA 1SD2A 1W6RA 3PDUA 1TYEB 4XPZA 3K0FB 4Z9YA 3BFVA 2PTGA 1ZO8A 2QRZA 2XT0A 2C7BA 1U3CA 1OFUA 1E2NA 1F5SA 2W4IA 3QOWA 3H04A 4K5QA 4XFKA 2QNBA 5HZKA 1N3LA 1ULHA 1X8KA 2LKCA 1AGYA 3F67A 1U6KA 4AJ1A 1MHTA 1QHSA 3M1LA 2YV3A 3FYUA 4QU5A 5CYPA 1AO3A 2WIBA 3AVYA 4IIDA 3O2JA 1DRUA 2RHGB 3G2JA 1E3QA 3I9KA 1JDUA 5HP4A 1ZKMA 3EF1A 4EYSA 3VGJA 4OHVA 1PFQA 2AS0A 3GDGA 2F17A 3HO6A 1E2LA 2NT3A 3W6UA 5KNDH 5AJZA 1CJSA 4URYR 2IZ0A 1E6EA 3DT6A 1T26A 2Q6KA 1STOA 3FCSB 2WAMA 1B6TA 3SR3A 1JDJA 3K7EA 4F3RA 4AJ4A 4ZICA 2OILA 2GBLA 3LX6A 1MJGA 3S28A 3THWB 1E1QA 3KLMX 4S2UA 3S2EA 1XNGA 5HKKD 3UMCA 1L7EA 1J49A 3GA0A 3OPVA 4HSGA 4KQ9A 5BRNA 1KEKA 5BYKA 3VNSA 2C61A 2R7NA 4IUCS 4N39A 1EJ6A 4AM8A 2Z1MA 2WM9B 1YNSA 1G291 1R5BA 1MC5A 1N6NA 3I6MA 3M6FA 3NC4A 1JF8A 3P1JA 2HT1A 2LPMA 5FTKA 3SE7A 1XOIA 4Y6SA 4BC0A 2P9CA 2EFGA 5ES4B 1CPYA 1G8KA 5KYWB 1EHYA 1Z82A 3FWHA 1DBPA 4WXHA 1TE2A 3GNSA 3PQ5A 1U2TA 2OXTA 1FFEA 4OFWA 2W2LD 5CHEA 3VPAA 3RVNA 4Q3DA 1FXUA 5IZ4A 3O7MA 2IXAA 2X9NA 2ZUFA 1NW4A 4KKVA 4X3CA 3D1JA 4DEYA 4YP7A 1CXZA 4EY3A 1YL6A 4WBNB 1R74A 1CCWA 2P5TB 4NG4A 4KDEA 2XVAA 4O59O 2D6FA 3NXKA 4DSTA 2XNSA 4ZJPA 2AZ4A 2QM3A 4IKPA 5EXXA 3R9WA 2FE4A 2YTZA 3TINA 3F73A 1RZUA 2CHFA 3SXPA 5TR9A 1ISMA 4CR6A 3CNHA 4F9EA 5J2UF 4XWAA 1GL7A 2CLLB 3WLIA 4OXNA 1EHIA 2QRUA 3DEIA 5E4YA 2RD2A 1SCJA 1P61B 3D7SA 3D3JA 4B7ZA 2FSGA 3H9JA 4CNQA 1ABFA 4CMCA 5BXQC 1MA0A 3AKYA 2WMDA 2BDUA 5CFRA 1LEHA 2GH1A 1TYBE 1ZUD1 1JPJA 3WBFA 3LCRA 1YIOA 4DRZA 4BO4A 2WSIA 4Y0VA 2JFPA 1UR5A 1ZD8A 3PE3A 1N6LA 5EE3A 4AYWA 5H4GA 2HCBA 4PY2A 2ZAGA 5CLGA 4CW7A 1O96A 4YP9A 3BBLA 3IA7A 1ZD4A 3G8CA 1YS4A 4JB0A 4NATA 4AJKA 4AZVA 2QMUA 1PFUA 4KWTA 2I78A 2GN2A 4MDYA 4RCVA 2GN6A 4RMJA 3RFCA 1HQDA 3CHYA 5C7OO 2F1JA 1DI0A 1T15A 3KQMA 3LSYA 3QVMA 4RVHA 1SELA 1KY4A 2MSNA 1VJRA 3H5NA 4F2WA 4PN3A 5GONB 3UANA 2AN9A 2PTHA 3W0LB 2GB4A 1FLDA 1RBMA 4KR9A 1E63A 1WXGA 2WEKA 3DSRA 4U0JA 5B7PA 1QZTA 5K0SA 2UUBB 4LDZA 4LHWA 2VZ9A 1EVLA 1X15A 2J0EA 3KJIA 3LK7A 1Z6GA 2VF7A 3TECE 2BP7B 5J9FA 2XUHA 3DBLB 1EX6A 4A73A 2G67A 4G09A 3V1MA 4DLPA 1R0CA 2JC3A 2QGZA 4QO8A 3TSOA 1YZHA 4E6PA 3DAFA 3DHVA 1ZVJA 3P4YA 5AWFC 1U5BB 1NGSA 1V6SA 4C5BA 4URVR 4OQEA 5EIFA 3QE2A 1W76A 1WHSB 1X74A 1ZA1A 3CLRC 3I8OA 5ESXA 2H59A 2QZPA 2X4DA 3PXBA 1FUIA 4K2AA 1Q0TA 1P1BA 4G86A 4HB0A 4ZDIA 2Z2KA 1LVUA 4D4MA 2NZVG 4HB4A 1KYYA 1NSTA 2WT8A 3RRXA 4DL9A 2OO5A 4CM7A 1H85A 1F48A 1IBRA 3R75A 4E12A 1K8XB 3HJCA 3TD2A 3CGGA 2H1OA 2ASVA 3RKUA 1JHMA 3KEOA 1KSGA 3EXIA 2HA2A 3ZWPA 1G20B 4IRUB 3WVNA 4GPAA 3ZD7A 1N6IA 2QE7D 4PGHA 1O08A 5JD4A 4C88A 1Y5RA 2XNHA 1GR0A 3EHDA 5FQNA 3UMGA 3QYAA 5AVXA 3EPKA 5B58T 5ENZA 4XQCA 3WWZA 3A1TA 1E7YA 1CDEA 4MLPA 3M6LA 2VWQA 4R1UA 1R0BA 2G40A 4G0XA 3OAAA 5ALLA 3STWA 3GLTA 3WYCA 3QBVA 4WCFA 3TYXA 4E21A 2EHDA 4ZT6A 1J7JA 3HDHA 4DLKA 4F6LA 1XKQA 2Q28A 4LJ8A 3RUPA 4IQFA 3GEBA 3LYAA 4LYGA 3HYSA 5JQGB 1HL3A 4IHJA 4KI0A 2WAXA 3NEAA 1X0XA 3UT0A 1SZPA 2GYUA 4KSYA 1Z6XA 3IO3A 3NC0C 1NQWA 1L7MA 2A5JA 4TRJA 3KUXA 3L04A 3B5JA 4D96A 2C2XA 3LVQE 2VUUA 3PXUA 1DT5A 3RIXA 4V3CA 4ZK6A 3A9CA 1FCJA 4OP2A 3G82C 3FVVA 5SZJA 3ZDZB 1EX1A 1BX1A 1OIVA 1F9AA 1W4RA 2XPCA 3AEKB 3BD7A 3H13A 1DKRA 4G4IA 4R6XA 4F3YA 5I45A 2ZQZA 1IONA 1LZKA 1XT6A 5GONA 3WWYA 3TDMA 2Y0EA 2JLVA 1F0YA 3ETDA 1YB2A 1JEQB 1Z8DA 3OF3A 5JSQA 1KQPA 4U7GA 1CJTC 3L49A 3IQEA 5KYTA 1WSWA 2WM3A 1CY8A 5H68A 1X14A 1N7GA 3K5PA 5AOVA 2Q7DA 2RCNA 1KO5A 4YHHB 2Q2QA 3NYWA 1HG1A 1ZYUA 2ACKA 3OZTA 5J43A 1PI3A 3OTWA 4UUBA 3UXHA 4BXOA 1NRIA 2XNKA 2RKOA 4QJ4A 1EFHA 1P1FA 2WE8A 1OWMA 1YVEI 2GTPA 3C16C 1KMIY 5EJEA 4GI3A 3N6XA 3K0AB 2CN1A 2YVQA 4DLYA 3WGJA 4B82A 1E58A 1VBKA 5EZ6B 4IQGA 1M72A 2XECA 3FF1A 3RNOA 2B8JA 3SLGA 3LA8A 3RYHB 3VU1A 4MV3A 4ABTA 1TZBA 3ZV3A 5BOSA 2P9ZA 3OHSX 1LD3A 3D3WA 4UATA 4D5GA 2PO7A 3VQTA 2YWXA 1ZZGA 5TC4A 4L5AA 2QENA 3FOAA 3ZZ1A 1A8HA 3H18A 5J2UA 4DDKA 2IZ6A 4RIGA 2QP4A 1HM5A 3PUHA 1RJDA 2AEFA 4A4DA 3TQFA 1LKZA 5F7ZA 3STVA 4NBWA 1J0XO 1K8ZB 2FRVA 5JDCA 3N59A 2A5FA 2NTEA 2WUWE 4U6SA 2FEOA 4G25A 3AIOA 2VBGA 2IYQA 2Q50A 3DVLA 4I14A 3V48A 2YV1A 2I2CA 2EEPA 4MB6A 2XDWA 4Q9KA 3ZOKA 4D6PA 1QH8A 2PX2A 2VCEA 4J4BA 3TMKA 1A1SA 1PR0A 4M1YA 3RUFA 4OOFA 5HRCA 1C4WA 3H11A 2DWOA 3EWNA 4G1UC 5CAEB 3I2GA 3CFYA 1DCKA 1Q1AA 5MFZA 1M34A 1J7KA 1MMFB 4KGDA 2HU8A 5KX5A 2C0CA 5DYIA 1M1UA 3C4VA 1DPFA 1K8QA 1AQYA 3LC1O 3OE4A 4FMCF 3R7LA 3KZVA 5F1PA 1OLUB