2ANCA

Crystal structure of unliganded form of oligomeric e.coli guanylate kinase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
205
structure length
205
Chain Sequence
AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 63
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2ancA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ancA01
3CLVA 1NG1A 2ECKA 3LV8A 4LV5B 3P4XA 5JI3E 3FHCB 5D3MA 2XOKD 2O5VA 3TAHA 4ZDIA 1RJ9A 3LXRA 2J9RA 1DO0A 2QAJA 4WXPA 1QHHB 1DVRA 1PVOA 1DAMA 1G6OA 1EX7A 3PVSA 4JYBA 3K9HA 1G7SA 2AWOA 2JAQA 1P61B 2BV3A 2JJ1D 3RRNA 1S0UA 1KK0A 4WA7A 1AQYA 4B32A 2QA5A 2RKOA 2ZM5A 2C77A 1OV4A 1NN0A 4N3NA 4Q7MB 2IUSA 3PEUA 3QVVA 1T3LA 4QGFA 2ATVA 3IEUA 3L0PA 4E07A 4BLQA 2JASA 1N5IA 1XCMA 1S4QA 3WMEA 4HYYA 3CNOA 2XZOA 4I81A 5L3VA 3THYB 2F43B 2QNRA 2RHDA 3HR8A 4JZKA 4EAQA 3TBKA 5JEDA 1VCOA 2I1VB 4P4UA 5JJLA 1R8SA 1YVDA 4EPTA 5E7JA 2FH5B 3TR0A 1KI4A 4OYHA 3U2QA 3I62A 2IX3A 2QGZA 4I99A 3GEIA 4CEHA 1TUEA 3WBKA 2FEMA 1NF3A 3MWLA 5BYKA 2E9SA 3EW9A 2QQ0A 2ASEA 4II7A 1UPTA 4MH0R 2N1BA 4UQOA 5CITA 1KAOA 1OXVA 4NONA 1RYFA 4OQMA 1L7VC 3ASYA 2J0UA 1Q21A 4Q4AA 2UZIR 1IHUA 4IFEA 3CO5A 1E96A 3QKUA 4V03A 5HKKD 4BZPA 3H0KA 1MR3F 2QE7D 2R62A 3CX8A 4M22A 4TQUS 1TAGA 1TQ6A 3HU3A 4GP7A 3EA0A 4DUGA 2GA8A 2HJGA 3B60A 1FQKA 1E9FA 2OILA 3JVUA 4F4CA 4A8JB 1G8FA 3VR4A 4EJSB 2ZRHA 4BE7B 1J8MF 3QSYA 1HH4A 5KNCA 1JEEA 3IIJA 4G3XA 2A2ZA 2YOFA 4LYFA 4UNQA 2VTKA 3BORA 1EFHA 5FL7D 3IIKA 2BIFA 4PAQA 4PR0A 2DPXA 1OFTA 4NYJQ 5GJWC 3K53A 2O8CA 1II0A 3GLIE 3W5IA 2WSSA 1L4YA 2R6GA 3IHLA 5CK5A 4CRWB 2XJ4A 1WQ1R 5GVSA 4RFVA 3QI2A 1ZMXA 2FZLA 4M1YA 1KI8A 3VNUA 4OHZA 2F3TA 4LJ7A 4F4JA 2PCLA 3UG7A 2FFAA 1EK0A 5E95A 3SU8A 1SQ5A 2EFGA 1MO6A 5FR1A 2MSEB 3A4NA 2RGAA 1PLLA 2W0MA 3O8CA 3THOA 3U61B 3ZD6A 4JJZA 1JJ7A 1TQ2A 3OAAA 4ZCIA 4EIWA 2FMXA 1S9HA 2WWHA 2WV9A 3HU1A 5HCNA 3VQTA 5LD2C 3FHOA 2FPKA 1E0SA 4KODA 2IUUA 1JR3E 1SVLA 3K9NA 4PANA 5LB2A 4EDHA 2IHYA 3T15A 5BN3A 1AA9A 3GLHE 1UF9A 2DB3A 3FMOB 4NZYA 5C4GB 1YE8A 3I4LA 4LBWA 2GXUA 1Q1EA 4B2PA 4MKHA 1CJMA 3N70A 3M4YA 1N6NA 1W4RA 4NYIQ 5AJYA 1SZPA 2Q21A 4R71A 3C15C 3U3JA 4GNKA 2JA1A 3O47A 1E9RA 1WBBA 3P1JA 1G64A 1O3YA 1Z0DA 4DVGA 4DC9A 2ODEA 4B2LA 4OJQA 4CT4B 4P4SB 5M04A 2ZSAA 4C0LA 1AS0A 1DAGA 2V1UA 1E2KA 1N0WA 4HUQA 3UMFA 3RNLA 4H1UA 2DWQA 1GL7A 2IYXA 2WWGA 3LY5A 3QY0A 3FYHA 4A0GA 1QZXA 4MYCA 3G0HA 3EG5A 2H17A 2PCJA 4EPYA 1NLZA 2IYSA 3W6NA 1GKIA 3FTQA 1WRBA 4K8OA 5F9FA 5FPSA 4M1KA 2WPDA 4HLDA 2H92A 4HAVA 1NN1A 1H8HD 4DJTA 2QAGB 2ZRPA 4LDJA 4PXAA 1YR9A 4NYJR 3ZQ6A 1FZQA 1N6OA 1IJFA 5EP3A 4ZKEA 5J5CA 4MDFA 2YWHA 2W2XA 2O8BA 4WZAE 1E4YA 2W6JA 3VHXA 5FUWA 1AGPA 3AVXA 5DSZA 4E22A 1NN5A 1OSNA 2Q6TA 2YKGA 3QE0A 2QMOA 3QKRB 2QY9A 4MKGA 1G21E 3U3OA 2YNMA 2QTVB 3TAUA 1AN0A 2OAQ1 3SR0A 4D0GA 4OI0A 1QF9A 2ZRDA 3B1YA 1LS6A 1N2CE 2G6BA 4GMDA 4F7WA 4A6PA 2NG1A 2IW3A 4EPRA 4HLCA 2PLFA 3IKJA 1D2MA 1E2QA 5CB8A 4HAZA 2FSGA 1YZKA 2H8KA 2VP5A 3LNCA 1JEDA 2EW1A 4QGGA 1F2UA 3VR3A 3W90A 4B47A 5EXPA 3Q72A 5EE1A 3ZYCA 4Z51A 4ZIRB 3X1XA 2GDJA 4Q1AA 1RC8A 2O8EB 4YMUA 4DKXA 5JJKA 721PA 4OJKA 1E9CA 1JAHA 1K5DA 2C9OA 3RYTC 4ARZA 2NO1A 5EXSA 4KBGA 1TX4B 3W34A 3ONWA 1XB2A 1XF9A 1Z83A 5JECA 1SGWA 2F7SA 2NPFA 1UFQA 2ZU0C 1E94E 4AKEA 1I2DA 4FMCB 4TLBA 2KSQA 5C46F 1E2NA 3Q7QA 1J8YF 3R9WA 4LBYA 2ZSFA 3PV0A 2IBMA 1A2BA 3EPKA 4RD1A 2E87A 3K1JA 3VFDA 3U44A 3B1ZA 1OFHA 2DCUA 1NIJA 3EZFA 3KJGA 3BJIC 3C7KA 4A9AA 1M7BA 2Y8EA 5JS8A 5LB4A 3TLXA 4DRZA 3BAFA 1SXJB 2J7PA 1G291 3IUYA 4QGAA 2GKSA 4PO1A 4DEYA 3W8NA 2AHOA 1Z08A 3SOPA 2ERXA 1W1WA 2IT1A 3SYLA 3NTUA 4HB2A 2F55A 4RZXA 5F98A 3X1DA 4PC6A 4DLSA 2WKRA 2ZEJA 2C96A 3EASA 4TL8A 4US0R 3REGA 3RS4A 2OFOA 4Z8YA 1P2SA 4FN5A 4X8MA 1ZM3A 4F93B 3GLFB 2VO1A 2ZR9A 1DAFA 1I4LD 1NL3A 4AIIA 3GLGB 3WYGA 1RVDA 3CH4B 1T6NA 3ASZA 3AVPA 3LW8A 4KSBA 3GPLA 2XEXA 3CF2A 2DFLA 2IC5A 3BE4A 4DLUA 2WWXA 1W7AA 4OQNA 4Q18A 3AKYA 2BJVA 2WJJA 3QKSB 1NBMA 3FKSD 3HPQA 3WRXC 2ODWA 2J87A 5GJBA 621PA 1ZNZA 2C95A 3CNLA 3GJ4A 3KB2A 2BMEA 2FE4A 2G1KA 1AQUA 4KITB 2IF2A 3D7MA 2WSMA 2WWFA 2IS2A 1E79D 2P6RA 1HV8A 3UWOA 5TMPA 3O8RA 1AIPA 3T1OA 2CCKA 4M4SA 2V1XA 4Q4JA 2CL7X 4HAWA 3L0OA 2OCPA 1Q1QA 4ESHA 3T5DA 4ZI3A 2QPOA 2ZS8A 1GOTA 2HT1A 1AJEA 1VMAA 2DFTA 1W0KD 2IWHA 3TGPA 1GNRA 2XGJA 2XXAB 1RZ3A 4D82A 3ADKA 3N5CA 4LHXA 2WIBA 2CVFA 4Q7LA 4HDOB 5DI3B 1R5NA 3E1SA 2ZI9A 1KSJA 2GF9A 2VSXA 2VP2A 4BWYA 3OESA 1CBUA 4US1R 5LPNA 1M6NA 1ZM9A 2ZI7A 2ZRNA 5CLLA 1HA3A 2CXXA 5KPDA 3I72A 5SZJA 2ZREA 1ZJ6A 3OEHD 1NKSA 4MGYR 1A5TA 4BFTA 2V6IA 4G01B 2FF7A 1EFRD 3NH6A 4PO9A 5DIFA 5G3ZA 3ADDA 1IOZA 1UKEA 4IOKA 1GP2A 4QHYA 3X1WA 2DWOA 1S3SA 1E2FA 3THWB 4B3XA 2JJ2A 5CDFA 2WKPA 4KLNA 1AZTA 1M7GA 2JDIA 2ZPTX 3PUZA 1FMJA 4NYMQ 4DXAA 5FL3A 3VTKA 3FB4A 3R7WB 4PSVA 1LTQA 2FPMA 3VAAA 2D2FA 3IQWA 5EP1A 3UG6A 4BFWA 5JSZA 1XXHB 3OFND 2IYUA 2QTFA 4QM7A 2EVWX 2EYUA 5E3HA 4NCHA 4UJ5A 1RRGA 4HLQB 4L8GA 3QBTA 4S35A 4PHTA 2G88A 1SKYB 3I61A 2V55B 4D0NA 2PLRA 3S1AB 1ELOA 1NLFA 3QF4B 4TLDA 2I4IA 3CX6A 4JLPA 2B8WA 2FA9A 1FNNA 2V54A 2ZYWX 3HU2A 2J0SA 3BB3A 3TKLA 3QG1A 1FOEB 4LSGA 1G8PA 1P5ZB 3SJAA 2ODBA 3K70C 4R2IA 1G17A 2QN6A 4MRPA 4G5SA 2QSYA 3EARA 4XD7A 1UDXA 3TE6A 4R98A 5J4LA 1T3HA 2WMOB 1X1SA 4Q21A 1G4UR 2QORA 1J7KA 2OBLA 3OF5A 4A36A 1AM4D 2QM8A 4BRUA 4Q1FA 1W2GA 1Z0IA 3IDQA 4MKFA 3KUCA 2CBZA 2X2FA 3PEWA 1KSFX 3B82A 2J59A 4OHYA 1XBTA 4IRUB 3RANA 3JZAA 4HAYA 1II8A 1IBRA 5HZKA 4XTRA 2QG6A 4IOLA 2CVHA 3WP0A 3I8SA 3U6BA 4QNMA 3CRQA 1XEXA 4FCTA 3C8UA 1E6CA 2OLJA 4Q4HB 2AK2A 1LF0A 1Q1ZA 2R8RA 3DKPA 4BLRA 1GITA 3CB4A 2GXQA 3QQ5A 1VECA 1DPFA 1GL9B 421PA 4DWJA 5K8LA 4Q1BA 3WNDA 4LRWA 2YHSA 2PEZA 1CR2A 2AXNA 4AC9A 1ZCAA 1PJRA 4LHVA 1COWD 4URWR 1Z22A 1ODFA 3R9IA 4QC2A 3I5XA 1FW6A 1Z06A 1GILA 2VEDA 3LVQE 3MG9A 4QKQA 3O8DA 3BGWA 4DIDA 4WZBE 4DB2A 2HUPA 1OLOA 2CE7A 3U3MA 5J4VA 4NDZA 1I4TD 1VYTA 2KWIA 4YONB 4ON9A 2QM7A 1IY1A 1I4DD 3BFVA 4I1UA 1U94A 1M1YE 2CNWA 1CRQA 4URZR 1V43A 2OO7A 3SJZA 2ZRKA 3CIOA 3VU9A 2IS4A 1XEWY 2A5JA 2ZQ5A 3FKQA 1ZC4A 5JS7A 4JLVA 4EPVA 5TARA 3CUEF 3FFBA 2GXSA 2HJVA 2GCOA 1C9KA 2ZYTX 4MGKR 3P26A 4B2IA 1KZ7B 3U6KA 5J4YA 1XPRA 1ZRHA 3KDSE 2WHXA 5FFMA 2ZJAA 3MCAA 1G18A 3CR8A 3PFIA 3UIEA 4URXR 4ZCMA 1VYUA 2BMFA 2AFIE 1KO4A 2EYQA 2QT1A 3RWMB 2OLKA 2O8DA 4JT4A 1NKTA 4IOMA 1JR3A 4KCGA 5JZVA 3VKHA 1PUJA 4NCNA 4BLTA 4MKIA 2OCBA 2OHFA 5TB5A 2ZJOA 2O8FA 4KHZA 3X1ZA 1W49A 4A0RA 2RGXA 3CONA 1RRCA 3FMIA 2QRNA 4W9MC 1RRFA 3HP1A 1OH5A 3IILA 1ZM2A 2P6NA 3MFYA 5EZ6B 3BB1A 3BK7A 4A15A 3ZS9A 3AGPA 5FTLA 3T1TA 5JJIA 1XTIA 4FW9A 4Q7JB 3KJEA 4RKEA 4C0HA 1Z3IX 4LY6A 2JLWA 2NQ2C 4KO8A 2N42A 3U7FB 1W44A 4PQRA 1UJ2A 4RJLA 2ZU6A 1KI9A 3KTAA 3CZQA 3RHFA 5CYPA 1XWIA 2Z4RA 5AUPB 3A6PC 2ZR0A 2D62A 2J0QA 1DAHA 3V4RA 2GHIA 1JNYA 2QT0A 2VA8A 3FDIA 4QOSA 4TMVA 2EU8A 5SZKB 4AK9A 4OK6A 3FOZA 3AVVA 3IBGA 2G3YA 5JHGB 1TU4A 5GADl 4BUJA 3THXB 4XWOA 1AK2A 1SVKA 1TPZA 3SDZA 3I73A 4LJ9A 4UXHA 4V0OA 1UBFA 2ZRGA 5CJ2A 3OHMA 3P4YA 3SFZA 1AKEA 4OL0A 2P3SA 3Q7PA 4AY2A 1T9HA 2WJIA 4IVQA 3VR5A 5F3WB 4PC1A 2QP9X 2D4HA 4M1OA 4BZXA 4A0FA 2CEAA 5B2ZA 3D6TB 2VPPA 3KB1A 5DYIA 1QRAA 2ZRBA 2VYFA 3LAWA 1XJ0A 2XNDA 1E9DA 3CRMA 4MGIR 4TZ0A 1QHSA 1U8AA 2WMNB 2BMDA 2YV5A 5E7IA 5HCIA 3GMTA 3A8TA 4OI1A 4U7DA 1KAGA 2J45A 2XTZA 4RFSA 4FCVA 1P9WA 2ZSBA 3AF3A 4KFSA 3RS3A 1E1RD 1R4AA 1NI3A 2AX4A 3IHWA 4TSFD 3BRWD 1E9AA 3U60B 4PPFA 2OEPA 2E1RA 2A5FA 3AF1A 5KHOC 2HF8A 4YDHB 3OZXA 3K0FB 1W4AA 2ZI4A 4JVLA 1TQDA 1XDBA 1FTSA 5B30A 4PPNA 3GJ0A 3OEEA 1SHKA 1E0JA 2ANBA 3T61A 1OIVA 2IXEA 4GI7A 2BDTA 2ZROA 1E3MA 4BGDA 3BC1A 4GPTA 2OBMA 4GDFA 4OI2A 5SZIA 4D6PA 1P3JA 1UM8A 3AB3A 4TQAA 5FOTA 1GL6A 2ODNA 1KTVA 4OBEA 5CLQA 5HZHA 3EAQA 2KB0A 4OK3A 5FTNA 5AWFC 1G7RA 4YMVA 1OPXA 2VP0A 4I1SA 4D2IA 4IDPA 1SVMA 1I2MA 2CK3A 4JLAA 2GNOA 1G5PA 5FUVA 4JL6A 2VBCA 2Q3HA 3NWJA 3CM0A 1FQJA 3RSOA 1SXJD 5G53C 3QXJA 1CF4A 3VX4A 3WXMA 5DN6D 1RW4A 2IYLD 4JVSB 1CS4C 2CMKA 3L0IB 4A2QA 1CULC 1KKMA 3AUXA 2ZRFA 4G5GA 4LUCA 5TXGA 2WJYA 1XD9A 3A1SA 4FMDF 1JI0A 1IY0A 3M6AA 4JLOA 5FOSA 2C99A 4N0EA 3NDBB 1XTQA 2BC9A 1NJGA 1R5OA 4LGMA 2SHKA 1FX0B 2GJKA 4CEHB 4B3FX 2B21A 4MRSA 4NP6A 1HYQA 4DLYA 1UBEA 3QG5A 5EJEA 4M2LA 4FWTA 1ZM7A 3BWDD 1E2MA 4HAUA 1EXMA 1ZU4A 2OAP1 1B23P 1W47A 2B92A 2IK8A 4V0LA 1P62B 3R8CA 1T5IA 5DISB 2F1HA 2HV8A 3AP1A 1QHXA 1N6PA 4QBFA 1KJYA 4NU0A 1NVVQ 1TF5A 2J0UB 1UEJA 2C8VA 2NZ8A 5B57C 1IXSB 3MRSA 5AK0A 1VIYA 3KFXA 2IF0A 2G0NA 2YOGA 1BMFD 2ZRAA 3AKCA 2MMCA 5FPYA 3LDAA 3QVUA 4HDQB 2BCGY 4RZ2A 3H2YA 4Q9JA 1KSHA 1XXHE 2IYWA 1JPJA 3L8YA 3U7EB 3P27A 3RVBA 1EESA 4ACAA 1QVRA 4C0KA 3F3YA 4LK2A 4CDGA 3CRRA 4O0MA 4A0HA 1QHHA 1KI6B 4Q00A 1E2PA 1CLUA 2XZPA 3O8BA 2X77A 2RGNC 3VR6A 3VX3A 4W5WA 4C0JA 4PQFA 1RPZA 3AGQA 2ONKA 2BEKA 1Q0UA 3DEFA 4O2RA 1W48A 5G41A 3B5JA 4QNRA 5DE3A 2QROA 4Q19A 3KXIA 2ZSEA 1OKKD 1X8KA 3GJ7A 3U3RA 3B13B 3D8BA 2R9VA 1OIWA 4HATA 4BFYA 4BLOA 4G1UC 1OHHD 1FTNA 2GZAA 4NMMA 4RD6A 3CWZA 4X8LA 3TSZA 3THYA 2F43A 4MQBA 4MDEA 1YRAA 4OQLA 2JLRA 4ASUD 5L3QB 3EC2A 1QDEA 1G3UA 3KKQA 4B34A 2GJAA 4JLBA 4PHHA 5IT5A 5FOUA 5EUQB 3ZZUA 2GETA 4YQFA 2V3CC 3KQHA 2XSZD 2NIPA 5G3YA 1YZUA 2ONJA 3UPUA 4YDSA 1E1QA 1E9BA 2I1QA 4X8HA 2JLUA 1GWNA 2GK6A 2XITA 3T35A 3GJ8A 3ZQJA 3VNVA 3EIEA 1OB2A 4KFTA 4E09A 2W0SA 4LHZA 1DADA 4ZV4A 2DFKB 2UZ3A 4DEXA 5FOXA 3K0CA 3T5GA 1Z8FA 4O3MA 2OCAA 4M9QA 3AP2A 2A7QA 2HLDA 4U5XA 4C7OB 3BH6A 2WOOA 1KNXA 2H1LA 3QXCA 2V6JA 5DLQC 1R8QA 4DSUA 2PEYA 4RVCA 4M1SA 4O2LA 1YZQA 4A8JA 2AXPA 4EJSA 2RGGA 1U81A 1IN7A 2BWJA 2GESA 1WF3A 4G5OA 5JWOA 2AKAB 2PJRA 3VHLB 4IEIA 1R0WA 4B76A 4C2TA 4GP6A 1RFLA 3EZ9A 4YMSA 2QPTA 4JSYA 2YJTD 3QENA 1KIMA 1M7HA 3KFVA 2BOVA 3ADBA 2BBOA 4PX9A 4XIGS 4FIDA 3WHKA 1GKYA 2YZ2A 5DNYB 1VHLA 3MMPA 5KPJA 1FP6A 4DHEA 4NPHA 2BM0A 4HB4A 3BFKA 4ZDWA 4CT5A 1GRRA 3H86A 2FSFA 4XH9B 1KHTA 2QL6A 1ZU5A 3H84A 2G83A 1CJUC 1NMZA 1Z0FA 4MUBA 3ZIAD 3L2OB 3LBNA 4U00A 3D31A 1XX6A 2ZE7A 1WB9A 4KU4A 2HXYA 2ZE6A 2JIZD 3ADCA 3I32A 3ZZTA 1MV5A 3GFPA 2IUTA 1E0KA 4LOAA 4CGZA 2G9NA 1PV4A 3CH5A 4A4DA 3KUDA 4DT1B 2HCBA 1Z0JA 4TL7A 4POAA 4B6FA 4TYQA 2OFXA 4IKEA 3W6OA 1F2UB 2GK7A 4U02A 1R0YA 2ZSDA 1RRPA 1H8ED 2YC2C 1Q3HA 1TL7C 3FGNA 5HE8A 1W0JD 3WRYC 5C2JB 3A37A 3DHWC 3LRPA 1ANKA 4EQ6A 4D26A 1XD2A 5FOWA 4RSGA 1PLJA 2DWPA 1P7CA 4LJ8A 5AUQA 4B75A 4DDUA 4GOXA 4P4SA 2J41A 2C5LA 3Q5EA 1XTSA 2D3WA 4LYJA 2OE2A 1NY5A 2OUKA 5JFGA 3LVRE 1LY1A 5BXQC 3CWQA 4B74A 4NCIA 1MRNA 1P9NA 3MLEA 4LPKA 5TVKA 2H18A 1RKBA 3RABA 5BWMA 1CKEA 3U44B 4D4KA 2PBRA 5L3SA 4AKIA 2QEQA 1L8QA 1ZBDA 4HDCA 3SC3A 4IDOA 2O0JA 4YMWA 3HDTA 1TMKA 1Q12A 3PITA 5AUOB 3W3AA 2CL6X 4KV9A 1F60A 1XRJA 1Z29A 4ILEA 3U4QA 4IXMA 2ZYUX 4NYIR 2QENA 5IK2A 3SEAA 2J0VA 4RCZA 4HEJA 4Z1MA 3AM1A 4YXWD 4Q03A 3UWKA 4BPBA 1VG0B 4RD2A 2YWGA 2R6AA 4MYTA 1CIPA 1G5RA 2AD5A 2FDCA 3TVTA 4CYMA 3DDCA 1XMSA 4PAMA 1AKYA 1GRNA 1D5CA 4TQ9A 3X2SA 3QKRA 5JCPA 1G4AE 1KDOA 4ZDKA 2BBTA 1VCIA 1P6XA 1DEKA 3LD9A 2F1JA 2VHJA 8OHMA 3KKMA 3SJBA 4L9SA 3NBYC 2FGKA 2VRWA 3K0AA 1WDTA 3G82C 4M1TA 2JLYA 4IDNA 5KSPA 2C04A 1R10A 2EFCB 3NEJA 2G1JA 3VR2A 1LS1A 3ND8A 1OXSC 3GJ5A 4B48A 1WA5A 3F5FA 1GZSA 4JYCA 4TWZA 1D6JA 2PZGA 4GT1A 2O8EA 4L15A 3OE7A 5HE9A 2GZDA 2W6ID 2H7VA 1KDPA 2YVUA 4WXRA 3ZZ0A 4AKGA 4TT3A 2JJ8A 3SHFA 1W36C 1NMXA 1YZLA 221PA 2B8TA 1ZC3A 3KQUA 3ZGXA 5EE9A 1WE2A 3ND9A 3CW2A 4QG7A 4D80A 4QJ3A 1ESMA 1U2RA 4QHTA 4WAUA 2BBWA 1T8TA 1V5WA 1DE0A 2BVNA 2J1LA 5DH9A 3ZDQA 4CF7A 3FHTA 4M9SA 4LCBA 2Q9CA 4XSGA 3RS5A 1LNZA 3NC1C 3IO5A 3NHBA 2R44A 4UXJA 1JECA 4LV8B 1A7JA 1WCV1 4F4IA 3HWSA 2A30A 2IS1A 5DHFA 3B6EA 1PLKA 2VHCA 4TMTA 2V7QD 1IY2A 3TJZA 1P2VA 1N6HA 4F91B 1Q3TA 1E98A 2XOKA 1ZNXA 5H1YA 3SBDA 4BFZA 3I3SR 1DOAA 4QJ4A 4PAOA 2NOAA 1E99A 1KO1A 2ZE5A 3T12A 1KDTA 4KVAA 3LQQA 4KI0A 4E03A 2RH5A 4EFMA 1XJQA 3EX7C 2GEVA 4TYYA 3RRYA 3D3QA 4LBZA 3CRVA 2JJ1A 3MWYW 3V4FA 3GLFA 3BB4A 1ZNWA 2QI9C 2QMUA 3Q85A 5F9HA 4NCKA 3HYRA 3GLGA 2R2AA 3A4MA 2GILA 3Q9LA 1US8B 2Q3FA 2P67A 1GUAA 5IRCD 4AG6A 1GSIA 3K9GA 4GRAA 1NSTA 1U0JA 4G5QA 4LV6A 1T8UA 2D7DA 2XB4A 4LX0A 3K0SA 3BH7A 3QEOA 3QKSA 3HJNA 2PX3A 1OW3B 3M0EA 3GCGA 1GG2A 1ZUHA 3EIQA 4M0LA 2NO6A 1P73A 5ELXA 3TUZC 2JLXA 2GAOA 2OXCA 1NP6A 2F9LA 2QTHA 3MWJA 3QEJA 1HE1C 3SNHA 4C4PA 1JQJC 1WBDA 2JLZA 4B33A 2WWIA 4F92B 5JRJA 4CVNA 4R9UC 5JEEA 2PX0A 5DGXA 1OB5A 3H4MA 3MD0A 1K8RA 2AD1A 3CR7A 1VG8A 5EZ5A 3C16C 3K0CC 1P60A 2XXAA 1FPMA 1KNQA 2QP4A 5B64A 5DI3A 1XPUA 1U0HC 2KE5A 4NBSA 4JS0A 5HKKA 3DOEA 1IN6A 4FMBB 2GCNA 2QE7A 4G0NA 4HZUB 4A8JC 4EJSC 1H65A 2QRZA 4P33A 4ZI2A 3QPWA 3ZH9B 2ZIAA 1N6KA 3BFXA 4Q9KA 3EZ6A 2FWRA 3AEZA 3FMFA 1SVSA 4IXNA 4NCJA 2YOHA 2YWEA 3A58B 1DAEA 5GJVC 3V9PA 4IDQA 1GNPA 1G7TA 5KDLA 2HXSA 5K8UA 3NH9A 5KSZA 2OXRA 4BASA 2A9KA 4DUGD 3GJXC 2VP6A 5FL7A 3LBHA 4LC0A 3SN6A 2QBYA 4F38A 1OFUX 2P0EA 2VSOA 3R7WA 2HDNB 1BS1A 1JBKA 1VCNA 2IEYA 2W58A 4NL4H 4QBGB 5GVRA 1D2EA 1MABB 1XXHA 3W6PA 4P0TA 1ZD9A 3JZMA 3SBEA 3EZ2A 4PC2A 2GRJA 4KJZA 1YJ5A 3ETLA 3AVUA 2CLSA 4OKSA 1R0ZA 2BEJA 2RGNA 1MH1A 2WSSD 4UXIA 1C1YA 3RLFA 4KFUA 1NNEA 2DR3A 3S1AA 2CHVA 3QF4A 4C30A 1VG9B 2OCYC 2GAAA 1D2NA 3GLIB 3P32A 2WIAA 4V0KA 4AYWA 4D81A 4RD3A 4EKDA 4NYMR 2EFDB 4JLNA 2WAXA 3QF7A 5AR1A 1S3GA 3OAAD 2FOLA 2MSDB 1KZGB 2F3RA 3LFUA 1L4UA 1OF1A 3WHLA 3DOFA 1TF7A 2ZJ2A 4Y0AA 4M53A 1AS3A 1S8FA 2CLDX 3ZVNA 4X8OA 1DAKA 1ZAKA 4DIEA 3RWOA 4WOPA 4CEIB 4P32A 4K46A 4W5JA 5LD2B 2ZS7A 1S96A 3E70C 2O8DB 1ZD1A 2O0KA 3EA5A 2IYTA 4BFUA 1ZM4A 3H1TA 4NTZA 2JLSA 3GLHB 2GVZC 3U3KA 1KOFA 3PUVA 1UKYA 2X8AA 4FWIB 4L9WA 4EPWA 2O0HA 3LLMA 1XJCA 2WKQA 2P2LA 1XMVA 4B3DA 1ESNA 4P31A 1CJKC 1OYYA 2JLQA 4Q4HA 3AV0B 1G1MA 2QAGC 3PQCA 4QL3A 4C0QC 5IF9A 3E2IA 2RMKA 2ZRIA 2REOA 5J4HA 1EX6A 2RGDA 1Z0AA 2FNAA 1H8HA 4FXPA 1Q44A 1IONA 3B1XA 4IOJA 1JPNA 3SZRA 5C1BA 1OYWA 4JJKA 2LKDA 2WPDD 3DZ8A 1GNQA 2HEIA 4V0NA 3ZJYA 3TQCA 5KDDA 4CIDA 1AS2A 1G3IA 3HYTA 4TYPA 5D3QA 4UJ3A 3B9PA 5FUXA 2WOJA 1JXOA 1DO2A 3AVTA 4N1AA 1SULA 5KU1A 1W5SA 3LH5A 4FI3C 1LF5A 4ZCLA 2REBA 3CNNA 2W6JD 4M8NE 4RKFA 2NPIA 4ZO4A 1UADA 4DCNA 4GOJA 1VYVA 4Q1EA 4JKYA 4NKRA 3UK6A 1G7CA 2EWWA 4JLDA 4BZQA 4DLZA 2P6UA 3DVLA 4B3BA 2IYYA 3AH8A 1HT1E 1UDWA 3CF0A 1TU3A 2Z4SA 5UKDA 4Q48A 1FNMA 4CW7A 3QXXA 2ZRMA 3GD7A 1Z2AA 2AWNA 2LWIA 4PFSA 3J81k 3FMPB 4HI0E 3CX7A 3T1VA 1N6RA 3OIUA 5IHPA 1HQCA 3NG1A 3WMGA 4DLTA 5EE5B 1E2EA 5H70A 2PL3A 2B7CA 5HR5A 2AFHE 2ZYVX 4C0BA 4EPXA 5KOYA 1NRJB 5HTKA 3PENA 2A5GA 1QG2A 1SXJE 3VKGA 1SXJC 2FJUA 1BH2A 121PA 1KK1A 4LI0A 4M1WA 4JVNA 4AYXA 3ICEA 1LV7A 2WJHA 4JL5A 1NLYA 2FSIA 2WWWA 3NDPA 4PZLA 4JIMA 3PXGA 4FMCF 5FH9A 1R6BX 2ZVQX 1X86B 6Q21A 3C4JA 3AQ4A 2MMGA 1AZSC 1OXXK 2J7KA 3BS4A 3DZDA 4KAXA 4ERNA 2BBSA 2CJWB 5FBQB 1KMQA 4JVMA 3GLFE 5FI0B 3PIRA 2J7PD 3UKDA 4GL2A 3GLGE 4BLSA 4QJ5A 1T91A 3QNUA 5D3MB 4QRHA 1XP8A 3THXA 2KJQA 1ZP6A 1RJ9B 2BKUA 2EQBA 2VP4A 4OI4A 1XTRA 5FPKA 2OSBA 1YKSA 3NBXX 1G16A 3GFOA 3TH5A 2PH1A 3I5YA 2WM9B 1Q1BA 4D4MA 2D06A 1HT2E 1KMHA 1G8GA 1QVAA 2A3RA 2IYRA 2Z0MA 1TNDA 1ZIPA 1C4OA 4PPQA 3FKSA 1SVWA 4UNNA 4GOKA 1OJLA 4JBYA 2QP3A 2ANCA 1HY3A 3FVQA 4NHOA 3TUJC 1KSGA 4B35A 1E79A 1N5LA 4CEJA 3OIYA 2LCFA 3PCRB 3PUYA 3TQFA 2VF7A 4R2HA 2EFEB 1NBMD 3LQRA 4AURA 5JRZA 2WVJA 1SHZA 4Q1CA 4I1VA 4URYR 2FFBA 4W7SA 1NVWQ 3RDPA 4HLUA 1S1CA 2JLVA 1F2TA 2GEUA 1HQYE 3K0FA 1ZUIA 3DPUA 3QPUA 4L4UA 1W0KA 2NGRA 3SJCA 4AKHA 1VPLA 3NBZC 5FTJA 1WMSA 1FP7A 3NBFA 4QFMA 1M8PA 1XTKA 1U8YA 1KJZA 2VL7A 4BEBA 1ZNYA 1K6MA 5FOVA 2ZRLA 2Q9AA 2X2EA 3G5UA 1IXZA 1XZQA 5SZHB 1R0XA 2OESA 3N2EA 1T3SA 1DAIA 1E32A 2D74A 4MRRA 1MO3A 3LX8A 2XZLA 4WBSA 3RC8A 3OEHA 2RCNA 4QGHA 5CM8B 3IBYA 1WP9A 2NO9A 4Q4AB 3NC0C 3C5CA 3RC3A 2BCJQ 2UKDA 1EFRA 1UKVY 1EFTA 1VTKA 2OM2A 3EPLA 5E7MA 2IA5A 3VR1A 2ZETA 2G0TA 3KXKA 4HZIA 4TTQA 3WMFA 4A82A 1KI2A 4D25A 1AGRA 1G20E 4BLPA 4ABYA 1D9ZA 521PA 4JLJA 1E2GA 1LFDB 1W4CA 2HT6A 1SKYE 3B78A 4V0ME 2JJ2D 2ERYA 1O87A 3IO3A 3AVOA 3OFNA 4DCUA 1X3SA 1D9XA 1SVIA 2DYKA 2JDID 4I1OA 4Q9LA 2ZJBA 4YC7A 5FPHA 4MUAA 2P5SA 3OIWA 4MA4A 3REFA 4DB4A 3ZD7A 2KBFA 3GJ3A 4UNRA 5F2EA 1FX0A 2O8CB 1T4GA 4WZ6A 2EFHB 4AD8A 3W5JA 4PSAA 4XOIA 1N3BA 2VF8A 4TMWA 1GKUB 4OHWA 4L5BA 5EXXA 4IVPA 1KO8A 5FBWB 4Q9HA 1UAAA 1G8YA 2F1RA 4UNPA 3KQLA 1Z28A 1QBKC 3X1YA 4LYHA 1CU1A 2WZQA 3CPJB 1NIPA 3CKLA 3EC1A 1HEIA 4BECA 4DDWA 4FINA 1XD8A 1CR1A 4HB0A 2ZXUA 2AR7A 4TMKA 2XX3A 3TW8B 2BKEA 4LPSA 1IM2A 1XZPA 1NVXQ 3B1WA 2YYZA 3TNFA 3NIBA 1Z5ZA 2WJGA 4KYUA 4A1FA 4XD7D 3K70B 5FUYA 2ORIA 3RAPR 4C0SA 4BEJA 3TSWA 1E2HA 4A2WA 1YZGA 1HUQA 3V00A 1K5GA 1KI6A 1P4SA 1IXRC 3PG5A 4JKIA 3FFAA 5AJVB 4Q7KA 4PZZA 2Z5FA 1J90A 3SFVA 1NVVR 1G41A 5B58C 5LDDC 2L0XA 2YINC 3KQNA 2GZHA 2V9PA 3AF0A 2P65A 3R20A 4HUTA 1S1MA 1W2HA 1EWQA 4IEEA 1YZNA 4Q4LA 1RIFA 4HUQB 3ZVRA 4LYAA 1CTQA 1ZCBA 2VHTA 2VH5R 2MSCB 1SKQA 4TMXA 1ONBA 4KSCA 2GEDA 3B85A 3BOSA 1OXUA 4J0QA 2YC4C 4M21A 5J4KA 5L3QA 3E5HA 3JVVA 1N5KA 3KJHA 2ZS9A 1Z0KA 1BIFA 1COWA 2IS6A 4JSTA 2WICA 1P9RA 1E4VA 1XMJA 2IWRA 3A36A 4B6EA 4IHQA 1JQLB 4JT2A 2RGBA 5EQTA 5BN4A 5FBRB 5A0FA 1OIXA 4RD0A 4PHGA 4JL8A 2O8BB 1YR6A 4D0LB 2VQSA 4GBMA 1XCPA 2CHGA 3SQWA 3B8HA 3KKOA 2G77B 4TLCA 4WVFA 1YR8A 1GM5A 1TTTA 4K81B 1QHNA 2REXB 2VHUA 3SHWA 2HCJB 4DBLC 3KL4A 5HPYB 3BERA 3SE0A 4EQ6B 1KJWA 1XD2B 2CNWD 4BFVA 2HYIC 2IXFA 3AUYA 1CJTC 1F48A 4YMTA 4C7OA 3MGCA 1M2OB 1ETUA 2QMEA 1DBSA 4MRNA 2FFQA 4PPGA 2Z6VA 2IXGA 1IN5A 1GFIA 4Y0VA 3AF4A 4DCTA 4QBIA 4US2R 4RCYA 1DG3A 5L3SB 2BJWA 1TUIA 5JHHB 4OHVA 4HB3A 3EIHA 1BYUA 1PZNA 5CIQA 4ARZB 1E2JA 3EPJA 1F3OA 1W46A 1E9EA 4FD2A 5GJCA 1JR3D 1F6BA 3I8XA 4WW0A 4QXAA 4EFNA 3KQKA 2ZRCA 3LLUA 5KNBA 3ZS8A 2GXAA 3QXHA 2CE2X 1A2KC 1KK3A 2IL1A 3AKDA 3HR7A 3K0EA 1WXQA 1IQPA 2VLIA 3KZ1E 3UMSA 2JCSA 1R5BA 3IEVA 1IN8A 4IDHA 3SQXA 1UEIA 3B1VA 4GSYA 1EGAA 1LW7A 2Z43A 4KFRA 3U5ZB 1E2DA 2FG5A 2ZI3A 4TL6A 3WBJA 1YQTA 1KDRA 2WBLC 3F0TA 1G6HA 4B73A 4CZ2A 2WWYA 5H68A 2KI5A 1Z6AA 4JLMA 2ZJ8A 4MYHA 4DT1A 2QAGA 4ZDJA 1KI3A 2ZTSA 4LZZA 3TW4A 3WYFA 1GIAA 4OQXA 1ZIOA 3K0AB 5FR2A 4H1VA 4TLAA 4OQFA 5L3RA 3CZPA 3OIVA 4AG5A 3B9QA 3BIFA 3TK1A 4BQSA 3KKPA 1CRPA 3BXZA 1RE0A 3SYNA 1U9IA 2OFWA 3UATA 3KJIA 1S9DA 1E2IA 5KUTA 4M9XA 4B44A 3TMKA 2J46A 4GZMA 4IVRA 1U99A 2YWFA 4Q1DA 2JGNA 3NHAA 1U8ZA 4BFXA 5AJXA 3EWSA 2GJ9A 5FTMA 1NG9A 3L8ZA 4MITA 3L43A 4HLUC 4IJMA 3GJ6A 2F6RA 4XVUA 2ZUBA 4KYIB 2DBYA 4JBXA 1E1RA 3MJHA 4C0AC 2ZR7A 4TSFA 1IN4A 2XNDD 4DZZA 4ITRC 2ORVA 5BYJA 3K09A 1T5LA 2GWHA 1IJEA 3K9LA 4N0DA 4Q47A 5CIWA 1U98A 5DHAA 1QHIA 2FZ4A 4ZIRA 2C9YA 3EWAA 2WAYA 1W4BA 1QG4A 3Q8XB 1E2LA 4GFDA 3A1VA 1E69A 1Z07A 2A78A 2OV2A 2ZRJA 3CRW1 3HPRA 3I92A 4Q4JB 4EFLA 4UKDA 2QGNA 5BQ5A 1XCGB 3BBPA 1VCMA 1N6IA 4XWAA 3C14C 1XPOA 1QHYA 3PEVA 3OEED 4B43A 2GBLA 1KGDA 1NJFA 4PHFA 5JLJA 1CEEA 1JR6A 2QZ4A 3DM5A 3B2EA 3U4QB 2V8OA 1E9SA 2NMVA 4HSEA 1CR0A 2X19A 2C78A 5C4MA 1U0LA 3AVQA 2B6HA 1SXJA 1JB1A 2LKCA 2ZJ5A 1Z6YA 5DI9A 3Q5DA 1UKZA 5DN6A 3B7GA 4TYNA 2IYVA 3NVAA 3EXAA 3ZLJA 4PQYA 821PA 4FMDB 2CK3D 4KXFB 2FGJA 4TMZA 3N2IA 3AVWA 1ZYUA 2K5UA 1B0UA 3CF6R 5CB6A 4S2EA 3RS0A 2C03A 2KBEA 2RGEA 5IDVA 1J2JA 2A5YB 5FBLB 3CBQA 5TY0A 3PEYA 1QHGA 3MUFA 1KYIA 1N0VC 5JSZB 3AF2A 2ZAOA 2CCJA 2F9MA 2DY1A 3FWYA 2ZVPX 2ORWA 4LWZA 3MWKA 4PC3A 2D7CA 5K8TA 2NO0A 1RYHA 4ZKDA 1Z63A 1XMIA 3PUWA 1MOZA 4DCSA 1X1RA 1M74A 3CPEA 2VP9A 3TSOA 1S2MA 1BMFA 1MO5A 3P20A 3FPAA 4E5UA 1J99A 3DMNA 4OHXA 5CK4A 4C2UA 3UMRA 3EPHA 4A6XA 1W36D 4DLWA 2PMKA 5JBQA 1TADA 4GMXA 3U7HB 5EUMA 3F8TA 4IFBA 1BO6A 3L82B 3WNCA 3WYAA 2PT5A 3MJRA 1Z2CA 3IIMA 2BHRA 5FTKA 3GEHA 1P72A 3ZVMA 1X6VA 4QM6A 1CR4A 3CPHA 4TTRA 2HYDA 1MRSA 1Q22A 2QBYB 2GCPA 2XTMA 5J40A 2FU5C 3RRMA 4V02A 1G9XA 1U90A 3SI7A 2BMJA 2GJ8A 2R6FA 1US8A 1OKKA 1II8B 4I4LA 2F1IA 4XTCS 4LHWA 5DYGA 4LJAA 1BOFA 3LXXA 2CCGA 5TDHA 1CJVC 2GVDC 2OBNA 1HE8B 1FFHA 1OHHA 4MYUA 4B3CA 5BN5A 2V4ZA 1L2TA 1XEXB 4JMPA 3QPVA 1OH8A 2QUZA 2W2TA 2RGCA 4KVGA 1TEVA 1A1VA 1T0JB 2FV8A 4LJ5A 4ASUA 3THWA 4TYWA 4OK5A 1E0AA 2VIIA 3WY9A 5J47A 2Q9BA 4KLZA 1LVGA 1SVOA 2AKYA 3T1QA 2IYZA 2P5TB 4Q5IA 2XSZA 4HAXA 2PZEA 2PMDA 3FE2A 4XJXA 4Z54A 1N5JA 2VHQA 4A2PA 4P4TA 1XU4A 2W83A 4XSHA 2QU8A 4W5HA 4V0MA 2PJZA 5JMTA 3LW7A 1E1QD 1DG1G 2FPLA 3LX5A 3ICQB 1YR7A 3KX2A 2GTPA 4MGZR 4LJ6A 4RZUA 4B3GA 3PUXA 3W3ZB 2IYQA 3GQBA 4D4JA 2FSHA 1JXMA 1UBGA 3W8RA 1NSFA 1T0HB 4HZUA 2XB2A 2HF9A 1HURA 1JJVA 4QBHA 1JAIA 3VU9B 2C9CA 1KY3A 2QSZA 3TIFA 4MRVA 3GEEA 1DELA 1XEFA 2H16A 2ZANA 1J70A 1KI1A 1N6LA 1VG1A 1EFCA 2ATXA 3W9YA 2GCOB 2OZEA 3IPXA 3K8YA 4M1MA 4AI6A 1ZD8A 1IAQA 2DFNA 2HLDD 2OT3B 4DLVA 3R8FA 4QHSA 1Y3AA 3RSLA 1W5TA 3QKTA 4JBWA 2ZI5A 3K70D 3NEYA 2PT7A 4UNSA 4DDTA 3NXSA 1MABA 2XNSA 5KYKA 1OH7A 5KO2A 1OH6A 2J3EA 5EP4A 1ZUNB 1EFUA 3AKEA 4ESVA 2O8FB 4AWXA 3AVYA 3ZIAA 2C98A 1TEXA 3VKWA 3PJRA 2AN9A 1D8TA 5AUNB 3AP3A 1M34E 4PO8A 1A4RA 4IW3B 1DS6A 3BD9A 1BKDR 5EXTA 2JIZA 3RRZA 4PTLA 4AYTA 5A4JA 1ZVQA 3T06B 1FL9A 1UBCA 5H8WA 1VIAA 1MO4A 3GLIA 4URUR 1G3MA 1FUKA 1NY6A 4DLXA 2R65A 4BFSA 2H5EA 2ZJZA 3DO6A 3KTAB 2B7BA 1U9IC 1KK2A 3WP1B 3DM9B 2FFHA 2XAUA 3A1WA 4B71A 5KDOA 1VKJA 3A1UA 4LHYA 1YZTA 2WTUA 2ZUCA 2CLCX 4JLKA 4WIAA 4Q9IA 1H8EA 1BYIA 2Q3MA 1Q57A 1Z6XA 4BRWA 3ZVLA 5DO9A 3DMDA 3QOFA 3TR5A 4CEIA 1JALA 1W0JA 5EP2A 1DTSA 1VHTA 3A1TA 4DSNA 1NN3A 1XNJA 4TTPA 1VDZA 4DLRA 5ANRB 3QJYA 2AL7A 4RZ3A 1Z6TA 1X8JA 2QMHA 3GLHA 3RS7A 2CDNA 5JWRA 2O52A 3K09C 2A5DA 2GJSA 4RD4A 2RHMA 2ZITA 1YHNA 1XFAA 5AJZA 4R7ZA 5CJPA 4P3YA 2X1VA 3Q3JB 4TZ6A 2N46A 2ZE8A 1P2TA 1HTWA 2Q0HA 5EE3A 1OFIA 1GRQA 3L0SA 4H9GA 4ACBA 2DHRA 3A4LA 4RFSB 4DCVA 4ZPXA 2ZUDA 3R9XA 3DKVA 5G40A 3I1FA 2NTYC 5A5GA 1G3QA 2GBLC 1F5NA 5EE0A 1CXZA 1P75A 4YXWA 4XVRA 5CM9C 1G5TA 1PUIA 2QPAA 3ECCA 1KI7A 3IQXA 3LO5A 3VMFA 1R2QA 4URVR 1ZW6A 2W2VA 4TL9A 4O25A 5BW8A 1X8LA 3C41J 5FBVB 2FX3A 5IK2D 3KKNA 4Q66C 1LB1B 4Z1MD 1MKYA 3LA6A 4XWKA 1Q20A 4Q01A 4A92A 1EG7A 2GF0A 1TQ4A 3RS2A 2WJVA 3SYKA 2C2HA 1NBME 1DARA 2W00A 4C9BA 5KTYA 2UVQA 1KY2A 3GFTA 4NE2A 2R6DA 2J5XA 2PZFA 5JWHA 1OT3A 3MSXA 4Z8XA 2ZAMA 5FI1B 3T34A 1MT0A 1KMHB 2H57A 4TLEA 1GTVA 4NH0A 3GP8A 5P21A 3IGFA 2NZJA 3QXSA 1GAJA 2ZJYA 4EUNA 4LJYA 4KBFA 5JCZA 2BM1A 1A82A 4C3ZA 1OXTA 2IHBA 1G3RA 4Q02A 4LJ4A 2VSFA 4CEJB 2FN4A 5C18A 2W6IA 1NVUQ 4TN1A 2XTNA 1Z47A 5AJWA 1OE0A 4M9ZA 5KNDA 1KO7A 4DSOA 2EWVA 5FPTA 3C5HA 1NMYA 1ZINA 3LWNA 1KO5A 1GDDA 5E4FA 5L8VA 1R7RA 2OG2A 4PSKA 4XVQA 3DL0A 3NKVA 3SS8A 3U7GA 2CHQA 3OE7D 1F2TB 4DDVA 2IEZA 3UANA 1YU9A 1GVNB 3IPYA 4LC1A 4TT3D 3QBVA 2Z83A 3WNBA 1XTJA 2CL0X 3PR1A 3M1IA 5TV2A 4GZLA 3LBIA 2D2EA 4FCWA 1Z6GA 2I3BA 1KKLA 5KSOA 3BH0A 2AK3A 1FMLA 2TMKA 4RY2A 1Y63A 4G5RA 3UXMA 2JATA 4PZYA 3TVDA 1TF2A 4D4LA 1W36B 1G8HA 5KSYA 4L16A 1P2UA 2V7QA 5CDFE 2JEOA 1II9A 5CYOA 3MAAC 1N25A 2RB4A 3KXLA 5LBIA 4DSTA 3TUIC 2ZI6A 4YLGA 3TRFA 1G19A 2FEOA 2QQEA 2CJWA 2XJ9A 4LBVA 2RAPA 5K8IA 4PC7A 1YRBA 2R6CA 1N0UA 3QUSA 3EZ7A 1FUUA 1CP2A 3QIAA 5JI2E 2NO7A 1EWRA 1XEWX
chains in the Genus database with same CATH superfamily
3U7RA 5LFAA 3WL7A 3WK4A 4R31A 5BUQA 2C84A 3SICE 1G38A 2GB4A 1NU8A 2J9RA 1KP9A 2C1XA 1QHHB 1QFXA 1UR5A 3FFTA 1DAMA 1SOWA 4F3RA 3EMDA 5FWYB 3R5TA 1EXDA 2GNAA 4XDHA 4HNUA 4E5PA 3U13A 2JAQA 1TO2E 2BV3A 4EW1A 2J9ZB 1QR6A 1U04A 2QQGA 4WA7A 1AQYA 2QA5A 2RKOA 5JD4A 1OV4A 1DCTA 2ZIEA 3DOJA 4N3NA 1C3JA 4Q7MB 1NVKA 1T3LA 1HE3A 3L0PA 4E07A 2NZXA 1U0OC 3C4QA 2ES4A 1XCMA 2LCQA 3E3AA 2ZTVA 3EGXA 4FLFA 4MI3A 2RHTA 5F3RA 3WMWA 4OG2A 4GKAA 3WMEA 5L3VA 3EZNA 3H42B 2F43B 2QNRA 2RHDA 3MHPA 2CLLB 4B85A 2Z5VA 2HEGA 4X9XA 1HM5A 5K9ZA 5I47A 3OZRA 1R8SA 5IKPA 1KYWA 5KS2A 3H2IA 2FH5B 5ENDA 4E30A 3U2QA 1XN1A 2FLWA 4LFAB 2QGZA 4I99A 4CEHA 1U4OA 1NF3A 3MWLA 5BYKA 2QVZX 4XGQA 2AH5A 3GA7A 1CNEA 2E9SA 2JZCA 1KEPA 3KSAC 3OG9A 3SHOA 2H2IA 1J0CA 1L8OA 2F3UA 3GFRA 1YIAA 1N2OA 2N1BA 2Q5HA 2X6RA 4NBNA 4P53A 4XWYA 4ZCSA 4DMMA 2FRDC 1LBEA 4NONA 1RM4A 2X4LA 1RRVA 1BKYA 4R81A 5DHTA 4ZU3A 5A6SB 1RADA 2FZVA 3AHJA 3OSZA 4UATA 2WINI 3CZRA 3A0RB 4HDKA 4L0CA 3CO5A 4V03A 1MBZA 4G5XA 4NG4A 4Y2UA 3CVUA 5IUNC 4M22A 1TAGA 5CVDA 4EA7A 4Q9NA 2O2GA 2XCLA 4GP7A 2YZ7A 2ZIWB 4UBOA 3MMZA 4ML3A 2Q8PA 5D5QA 3B60A 3G1UA 4J49A 1M2VA 1FQKA 1E9FA 2DHDA 1SRRA 2HOQA 4OHKA 3W8FA 3EIXA 1IK6A 4I8XA 3U9TA 3UWDA 3ZU3A 1V3QE 4UTRA 2W90A 1MC5A 2WFAA 2A1TR 4TLMB 5KNCA 2UYGA 4X20B 3RTGA 4WXYB 3IIJA 2XGOA 3FAKA 4GUAA 5FHRA 3SM9A 3D7LA 4V3BA 3H3FA 1PG0A 3W3AH 1ICEA 1J9EA 4UM9D 5J2TA 2BIFA 3NASA 4GICA 3PNKA 4PAQA 4EB6A 2FR8C 1VXRA 5DKFA 4JBHA 3SF8A 1II0A 1P1HA 2MSNA 2WSSA 2RKWA 2ORED 1O03A 2YFYA 3IHLA 1LZLA 3M9LA 5GVSA 1EVEA 4L27A 1ZBQA 5HWSA 1ZMXA 2XVZA 1X9HA 2LPMA 1KI8A 4A23A 5LP1A 4AY3A 2P7IA 3LZDA 4JC4A 1Z4PX 3PXBA 2PCLA 3GEMA 3G5MA 3KR1A 3VAZA 4ZEOA 3AI3A 1XKLA 2GHQA 4G37A 4IX1A 5E95A 3SU8A 1KJ9A 2EFGA 1MO6A 2E4UA 3P0RA 4IJUA 4QVGA 1XDDA 1PLLA 2W0MA 4ZO6A 5DT2A 3ZG6A 1EJ0A 4KIFA 3U61B 2AV6A 3ZD6A 4C7BA 2Q99A 2B1GA 3GVCA 3OAAA 4D02A 1O96A 1HFWA 3MTAA 4EIWA 3EC7A 2FMXA 4G8BA 4GI2A 1UINA 1MIHA 4LZJA 4QICA 1JA0A 3BCSA 1XHFA 5HCNA 2J09A 5C1PA 2QAIA 2G6TA 1SVLA 4PANA 1ORVA 3NRJA 1E8MA 5K3FB 3TZ6A 5CEJA 5BN3A 1KQFA 3IPRA 1AA9A 1N2EA 2L19A 1AVTA 3BD6A 5C5IA 4EO9A 5AESA 3LT5A 3LC2O 1J4AA 3FMOB 4NZYA 2DRIA 3HADA 5K8JB 5KYYB 4OM7A 2I2BA 2HMAA 3ZU5A 3EJ6A 1AO3A 3FNRA 5CX1B 3GOQA 4YJ3A 4HG2A 2G0AA 5CFLA 1XYYA 4B7XA 5AJYA 1VHJA 4KI7A 2C4UA 1XQYA 4GNKA 5F7ZA 5H3LA 4OGKA 3SPXA 1RKVA 3JZIA 1X9IA 1NI4A 1ZX1A 3HKDB 3VYUB 4POOA 1FFDA 4CT4B 4EL0A 4C0LA 5I5EA 3LOPA 1UJNA 1NOJA 3M9XA 5ERXA 2ZIGA 3ZOZA 4KGXA 5K51A 2FWPA 4HUQA 4Y18A 3UMFA 1QAQA 4H1UA 2IIBA 3NTQA 3VNBA 5IYZA 2ET6A 3LY5A 4R2JA 2BGWA 1PEYA 5BSFA 3H99A 4A0GA 1QZXA 1TUBA 3HCAA 2XMSA 3EG5A 4DY6A 2X1LA 1A7KA 1NLZA 2FW1A 3IXLA 3BWEA 1WRBA 2C5BA 4EH1A 3OTGA 2JD2A 1SHLA 2FLKA 2AI3A 5TNXA 5KOJA 5F9FA 3AG6A 3REOA 1TDJA 1QF7A 2Z5LA 4M1KA 2WPDA 2ZTUA 3GNSA 4XFKA 5JNTA 2H92A 5KOHA 1AC5A 3QXGA 3H3XA 3A28A 2QAGB 3G0CA 4G67A 2KX7A 4PXAA 2HADA 1ZIYA 4TRNA 4C7VA 5ICFA 3G88A 3R5JA 1PWXA 3U49A 2Y1LA 2GAFA 4KGVA 4NESA 1DB3A 4MDFA 3AT1A 2YWHA 4UM8B 3D6MA 5HUJA 2O8BA 1G63A 2EBHX 2IPNA 3IR5A 5J3JA 5FUWA 1IOVA 3C3MA 1UKCA 4MP6A 1AK9A 3DAYA 3QE0A 4GHWA 5DGCA 4BN0A 5DLYA 5LMZA 1Q7EA 5H81A 4FM9A 4MKGA 5LQRA 2FF5A 3MCTA 4MAMA 2YYSA 1N9KA 3WNQA 3U3OA 1EFVB 1F2VA 3TAUA 4DG9A 1AN0A 3NIGB 2OAQ1 5D84A 1QP0A 3NYWA 3O31A 3SR0A 4G63A 4D0GA 5KVAA 1XSEA 4OI0A 1AQNA 1LVHA 3B1YA 4GMDA 2IW3A 2BFFB 1QGUA 1D2MA 1ORWA 1PNOA 3OECA 5HJ7A 3FSJX 3PPXA 1YQ9A 3L7IA 3FW1A 3IE1A 3QEMA 2FSGA 1KXJA 2H8KA 4QGGA 4UTZA 2EW1A 1F2UA 5CBKA 5A9SA 3COPA 4HNVA 2A9OA 2QLBA 1J06A 4KMOA 1ZONA 2GDJA 1PJ4A 1Z2PX 2VRCA 3D02A 1TK3A 4HVLA 4J16A 1LX7A 4WFJA 1U3CA 2B4RO 3F3MA 1PG5A 4ZOCA 2FY8A 1SFRA 1V4VA 3RFUA 1JAHA 2J9FA 3VI3B 1HT3A 5B37A 5EXSA 1JU9A 4Q6BA 4IGKA 5ALZA 3CB2A 1VB3A 1PFGA 1XF9A 1JE0A 2PVCA 1DWPA 2F7SA 1UFQA 2ZU0C 4NE9A 5JR3A 1E94E 2G4LA 1I2DA 4MAAA 1FDIA 2ZXEA 3CUUA 3DMPA 4FMCB 1VJ0A 4GR9A 2KSQA 3QELA 4XDGA 2D2VA 2ZWOA 4MUIA 2O2XA 3WVNA 4YWJA 4WBNB 1K5PA 4JI0B 1ZHOA 1P4RA 2NU8B 1E1NA 1W8IA 2Y1FA 3T3OA 3R9WA 3NT5A 4Y9UA 2O7NA 3NC4A 2YZKA 4QOGA 5EMKA 1QIFA 1YJBA 5C1IA 3VFDA 2OQ2A 4TS9A 2EP5A 1NIJA 1V1MB 3EZFA 3KJGA 4PV7A 5AM1A 3O8QB 3SDSA 4YT2A 3BJIC 3C7KA 4YRMA 2COKA 4QXOA 5JS8A 5KVCA 4R1TA 5J2UA 3TLXA 3S7ZA 5A3RA 1G291 1TA9A 2H2WA 3EMVA 1E6WA 3A6FA 4QGAA 4JP3A 3ANYB 5F52A 4DEYA 2JKZA 2HIAA 4HQLA 1WJGA 2OGZA 4U0KA 3IODA 3SOPA 4B7AA 1YVPA 1MC1A 2IT1A 2Q5LA 3KD2A 3SYLA 1AK1A 3NTUA 3D6AA 4LZWA 4YX9A 2Z4TA 5F98A 2FPIA 5KC9A 1WV1A 1YI0A 4UDYX 4BRZA 4PC6A 4DLSA 3RT1A 2ZEJA 2C96A 3EASA 3VMMA 1EUCB 3REGA 3RS4A 1I30A 2WF5A 4FN5A 2CXHA 2FOIA 4U2KA 1OXKB 1ZM3A 3DFKA 2GPTA 3GLFB 3WTCA 4JB3A 1BRTA 4Q3CA 3ZLVA 3HXOA 1DAFA 1I4LD 2WM2A 3G2OA 1ADCA 1UKAA 3FZGA 4HDMA 2W2LD 2V3WA 5J1SB 3KQVA 1F38A 3ASZA 1J42A 1WXEA 2G4VA 2Q2VA 3E8SA 2W48A 1TA0A 4JT9A 3UXEA 4BB9A 3VJKA 4RY9A 1Z12A 2J31A 3CF2A 5DM4A 3NW9A 3LU1A 1L7PA 3BE4A 2WWXA 3L1JA 2R8OA 2WK1A 4RHYA 5C53B 3ETDA 4AS1A 4MINA 1FSZA 2WJJA 3H5AA 4TOIA 4UZEA 4BMXA 4II2A 3NHRA 3V48A 3Q11A 4CKCA 4HJRA 5AFSA 4MLPA 5JYEA 3L0ZA 4IQGA 4KITB 1AQUA 1ISPA 1OA1A 4ETMA 3OPXA 4D1YA 3ACBA 2VEOA 3VV2A 3NV7A 2VDUE 2VDWA 1M5UA 4R01A 3DHYA 4HGYA 4C21A 3NVDA 1NA5A 1AIPA 1T9ZA 3DCJA 5J23A 1BXRA 3WL4A 3NOVA 1NDUA 3IAS6 4MV9A 4DRXA 5LXTA 3CUYA 3IC5A 4IJVA 2O7RA 4ESHA 1CIVA 2ENWA 4FFVA 3WOHA 4NS4A 2OBXA 1RLOA 3L18A 1OLXB 4UMDA 1Q95A 3JAWB 1RZ3A 5F64A 5FKJA 4RJTA 1RBMA 1YZFA 3HKCA 3QMVA 4EHBA 1XDSA 4MVJI 3DNFA 1RP1A 2VHZA 4HDOB 5DI3B 1CZLA 1NUQA 1XVIA 1YA8A 4V3CA 2JAPA 3E1SA 4C89A 3JALB 1YQDA 1HI9A 2VQ3A 4N40A 4N82A 5DCLA 3M5CA 3SF0A 1HA3A 1OBOA 2AA3A 2EBUA 2X7JA 3GCXA 1GQSA 2ZREA 1MNAA 4F96A 1FJXA 3DMTA 1KKUA 2A5LA 4MO2A 1NKSA 2R87A 1LLDA 5EHQA 4X0EA 1QH1A 2KQUA 3HA7A 1YCGA 2O2EA 5DTQA 1P2BA 2FUNB 3BILA 3Q41A 3KQMA 1GNTA 3NH6A 4IM7A 5DIFA 5G3ZA 4R2XA 2WD9A 3H65A 1IOZA 1TB4A 2CJXA 2D5IA 3R7LA 3EVBA 3OA0A 4WUVA 4N3GA 4MZXA 3LHDA 5TF4A 1GUDA 2Y0DA 1ZVMA 3B7PA 2GDZA 2WJPA 2WIKA 3FPSA 4CN8A 3THWB 1DRVA 4HS9A 4B3XA 5CDFA 1H42A 1D6SA 2IYOA 5TPZA 3ZGVA 4EFDA 2H2GA 1JG6A 1Y7IA 2ZPTX 5DIZA 2PY6A 3PUZA 4NYMQ 2YY6A 4BC1A 5FL3A 3T6KA 2X4GA 2XKBA 3ESBA 3R7WB 5T4BA 1K63A 1LI7A 2FPMA 3LO8A 4RV4A 2R96A 1RIIA 1FFAA 4OF4A 1TEZA 2CV2A 1G20B 3OFND 3RW9A 4QM7A 1P2GA 2FXIA 4CDRA 3PJEA 5E3HA 4NCHA 4UJ5A 2H4YA 2ZYAA 4J6EA 4RXMA 4ND7A 2SKEA 1X94A 4G6ZA 2FEWB 5FV4A 3K6JA 4HFMA 3CLUD 3TTTA 3GRPA 4WQMA 3Q8KA 3PD7A 2RK6A 4GU5A 4W8OA 3D0OA 5EWMA 3ZKWB 4D0NA 2P9BA 3F5QA 5HEKA 1ELOA 1LBQA 3S1AB 4CG0A 1M6YA 2I4IA 2R3SA 1NNI1 3Q87B 4OHOA 2Q8QA 4JLPA 3ZHRA 3HU2A 3KDAA 4RU1A 2J0SA 4M0PA 2Z08A 3QG1A 3TR6A 2IPLA 2F4NA 2ZWPA 4BQQA 5JMWA 4L0MA 5DF1A 3SJAA 4DAEA 2C94A 2GZ1A 4QUBA 1G17A 2X8WA 1S89A 4HXFB 1L9KA 2QN6A 4MRPA 3GBPA 4E7PA 4HOYA 4NK4A 2F48A 3E23A 3BL8A 1UDXA 3PDJA 3LIPA 1YH3A 3GG9A 1USUA 4RL6A 1T3HA 5J4LA 2BAGA 1G5HA 2QORA 5NULA 4TVBA 2OBLA 3OF5A 5F7JA 2QM8A 3A9RA 4O2BF 3IDQA 2JGEA 3GDWA 3NIDB 4MV3A 5DCUA 3NAZA 1SY7A 3KUCA 3AJEA 2CBZA 1D0VA 1XR3A 2XPCA 1J9ZA 1QG0A 3CLKA 3I2GA 2QYHA 3K35A 3L77A 4YCNA 4ER5A 3DQQA 4YAFA 5FD8A 3RANA 2CSXA 3OVMA 4HAYA 4TVOA 4YEDA 5HIKA 2LIVA 1CE8A 1NWHA 3DXZA 1WSWA 2ZYRA 1UP6A 4EOGA 4K86A 3PGLA 1ABBA 3DOIA 4KQFA 2OLJA 1G98A 2VDMB 2AK2A 4MUEA 1LF0A 1Q1ZA 4BMOB 5JAIA 1CY8A 2JGDB 4ZEVA 2YCLA 1CDOA 4MWDA 1DIAA 3IOYA 3JQEA 3HKEB 421PA 3K9FC 4H6XA 5FORA 4Z0TA 4NU6A 5IASA 5BRAA 2YXNA 2PEZA 3PHJA 4AC9A 4RGVA 1CHNA 3MS4A 1ZCAA 1PJRA 4JT8A 4NJEA 4URWR 1Z22A 1XG5A 1XELA 5T4EA 1P29A 3R9IA 1FW6A 2FEPA 2PD6A 2FMKA 3EEOA 2WM8A 2YNMC 4XYLA 4JHLA 5IW8A 1GSHA 3L6OO 4UHKA 3STWA 4DB2A 1CQWA 3BWYA 3S7TA 3RYCB 3WB1A 1DV2A 4ZXPA 1SEPA 4JAVC 2P77A 2F8MA 3U3MA 5FNVA 3G59A 1VYTA 4WXHA 2Y0PA 4ON9A 2VOEA 3CEJA 4U9IS 1G6Q1 4MW9A 2YMQA 1PNVA 1I4DD 4HVAA 3RC9A 1U94A 4EITA 3ASVA 4CLXA 2CNWA 3AIOA 4URZR 4MIKA 5LQSA 2OO7A 2FMFA 2NADA 2ZRKA 3VPHA 3CWCA 2X76A 4UBLA 2BHNA 2V6FA 4FP9A 4Z9XA 3ILSA 1C9JA 4EPVA 5ICMA 2HQSA 3CN7A 5AW5A 1RXWA 3MTJA 4C88A 1C9KA 2FMHA 4YCCA 1Z4QA 1TKRA 1GZHB 3P26A 4QFDA 2Q4OA 1RR6A 3F5DA 1C30A 2BGUA 1HETA 1T5OA 1ULSA 2ZVJA 1QYRA 1EMDA 3SR3A 4BB6A 2ZSIA 4GXQA 1N92A 4N5LA 1QH0A 2NX2A 4URXR 1WY7A 4YRFA 3FGZA 4ZCMA 1UT6A 5CVJA 3RV3A 3TLKA 3VPFA 3WK9A 1JHUA 5JYBA 2EYQA 3P9ZA 3RWMB 4M7OA 3WLEA 5AKKA 4BVEA 4Z4GA 1XNGA 1F3LA 4KLAA 4Y3UA 4I2VA 1QOPB 2DFDA 4WTOA 4BNHA 4NECA 4F3KA 3UJNA 3LP6A 3MJCA 1V9CA 3RF7A 1M1ZA 2DQSA 7AT1A 3M6XA 3DOHA 3X1ZA 2O8FA 3BJMA 5B1HA 2QUHA 3CONA 2WVHA 3IBSA 4RGBA 3FMIA 1KQOA 3COYA 3D2AA 2ZXFA 3KSBC 1L5HA 1JL3A 2QQ5A 5IFLA 5CDSA 1R6XA 1N3LA 5IDQA 3IILA 4LSWA 3DWFA 5EZ6B 1XMQB 3FDZB 1O0SA 2VBFA 2CNBA 3AGPA 2JAWA 3OJ0A 4Q7JB 2IPOA 3KJEA 1Q7CA 4LY6A 1MNQA 1L5WA 4RK0A 1S7CA 4KO8A 2N42A 1Z26A 1UJ2A 2ZU6A 1KP2A 2VDVE 4KW7A 4L8LA 5AUPB 4GOOD 2Z4RA 3O74A 1S01A 1VJ1A 2QT0A 3FDIA 4TMVA 1WHTA 1KU0A 2B69A 3HMKA 4GQAA 5SZKB 4HTFB 4J1TA 4OK6A 1JMVA 3IERA 3UW3A 2V0NA 4F4UA 1GRVA 1S2IA 2JAOA 2ZJFA 5GADl 1LUAA 3AK4A 1SVKA 3I1IA 3HN2A 4CL8A 3HV2A 1DTWA 3A25A 4LJ9A 2MCFA 4YAJA 2D2XA 2L69A 2PUBA 3IP1A 2DBZA 2LW7A 2R6R1 3CNEA 1B6SA 1FDSA 2WNSA 3RFCA 4N6OA 4YUWA 2BGRA 3SFZA 3UEOA 1JFLA 4OXIA 3U17A 4AY2A 3DC7A 4OKIA 3FOWA 2WJIA 4IVQA 3VR5A 3FYUA 4F97A 2G71A 4RPCA 1Z8DA 3OOYA 3R3YA 1XLTA 4ZC8A 1ONNA 4RMJA 3R3SA 4WZAA 5I7EA 1YJXA 3D6TB 2W2KB 4V0QA 5DYIA 1QRAA 4P7BA 5BSTA 1YTUA 3DUFA 2BZSA 4KQWA 4U3JB 1ISMA 2XNDA 3CRMA 2GN0A 4MGIR 5HRUA 2PRKA 4C4ZA 1FP1D 1G21A 2WMNB 4ZHSA 5AOAA 4U7DA 3HA2A 4F11A 1KAGA 3UUGA 3ZE7A 5ADWA 4TXJA 4G0XA 2O3SA 1TPYA 4KFSA 1PZEA 5KWEA 1R4AA 3Q1KA 2AX4A 3MTDA 2I6TA 3KWJA 1M1UA 1SHUX 3QU2A 4LWOA 4CCSA 5KTKA 2NU7B 5KHOC 1M1XB 1SK9A 1U9YA 2XXJA 4YDHB 2X4IA 2I2XB 2ZBRA 1WKBA 4PAGA 5TQ0A 1RAIA 1SHKA 4DA7A 3PCXA 4EGSA 1FXUA 3D6VA 1DDIA 2PRJA 3OPMA 3T61A 2XODA 3OT1A 2ZROA 3VU8A 4C0WA 2DPYA 4FX2A 1T8RA 3N8IA 3TDNA 3BC1A 4ZT5A 1PG2A 3FX2A 1D4ZA 3D59A 5SZIA 4D6PA 1A9ZA 3AB3A 1FVOA 1DSSG 2FPPB 1GL6A 4G0WA 3EH2A 2QSJA 1DC6A 1JHMA 3UB4A 1MEOA 4DJFC 4YMVA 1OPXA 1SA0A 1X1DA 2VYND 4RM2A 2VJKA 4D2IA 2OENG 4AL4A 4ZP1A 1I7LA 1QANA 2WA2A 3KE9A 3GBVA 4I8DA 4HRYA 5B3JA 1ZOIA 2VBCA 2Q3HA 2XHZA 1X7YB 2AUMA 3E8MA 2A14A 5EOVA 2XIQA 1NQVA 2QW0X 3STHA 1CF4A 3MSCA 4ZQFA 3WXMA 2C9DA 5GWXA 3VZRA 1CS4C 4AROA 5BUZA 3OTHA 2CMKA 4O4HA 4PQGA 4HT3B 3DV9A 3S0JA 1UK7A 2CFCA 4A2QA 3C5VA 1KKMA 1CUZA 2F9FA 2XVMA 2ZRFA 3AUXA 4G5GA 4EMSA 1CUVA 1XD9A 3KNZA 4D8VA 3A1SA 4QEKA 2Z6UA 2EX1A 1QGOA 1JI0A 3MFQA 4LSMA 2NXWA 3UT5A 4R1QA 3NDBB 1R50A 2HMYB 4UU0A 5LWQA 1BFKA 4LGMA 3UY4A 4W9NC 2GJKA 2GD6A 3V4LA 1NVTA 3BN3A 4MRSA 4NP6A 3MYYA 4DARA 5KINB 3QG5A 5U4QA 4FWTA 3ELBA 1ZM7A 3RAJA 3MT0A 4ZO8A 1WZIA 3AI2A 1QTRA 4ZTBA 1EXMA 1ZU4A 2W6NA 3M3DA 2NYRA 1W47A 2ZBPA 4V0LA 1T5IA 3IXMA 1RHKA 5DISB 3ZE1B 2AI1A 1N6PA 3AX6A 3DVRX 1CQZA 1J2TA 1WR8A 2QTRA 3C3JA 4BVFA 2NZ8A 2C8VA 1K8ZB 3ZW9A 2QD1A 1IFXA 1QRRA 4BXOA 4MS4B 2G0NA 3AJDA 4RTNA 1BMFD 5JPDA 1Z74A 2PLAA 1LGYA 3GF4A 4MVCA 4O4JA 4ZAWA 3QVUA 3VKFA 4PBTA 5L6MB 2BCGY 3NWEA 1C8VB 2NXJA 3H2YA 3FYSA 3MTEA 2HFJA 1FDUA 4AUNA 4EHFA 4YRQA 1JPJA 1JHRA 3U7EB 3ZJTA 1FSFA 2A94A 3WGYA 1EESA 4C08A 3R3HA 3LSYA 1PQWA 1RJGA 4A1OA 2RAFA 3AEQB 4IH4A 4O0MA 4A0HA 5ICSA 2FMTA 3K20A 2O2CA 2P2DA 4Q00A 1E2PA 2FEKA 5ERYA 2BSQA 1NFFA 4EEZA 1AMOA 1L6IA 1W48A 2ZUWA 1UJBA 1IWBB 2YJ6A 2QTGA 1XMPA 3B5JA 5AK3A 5JAZA 2QTLA 3U48A 3WKBA 4JGIA 5DE3A 5KC8A 1EZZA 2HLPA 4Q19A 5F35A 3KXIA 1L4LA 4EL5A 1PR3A 2BGMA 1KPHA 1T4BA 4UFNA 5TR9A 3B13B 2ZK7A 2R9VA 1UJ4A 2VDQB 3AETA 4EP1A 4R6WA 3ISVA 3W5AA 3TSZA 5HVNA 3I2IA 5E6UA 4UE2A 3THYA 4Y2GA 2A9JA 3V7WA 1O4VA 3HZRA 2I6GA 1YRAA 1MOSA 2E2WA 3ED5A 4ASUD 3F2VA 5L3QB 5REQA 4BP1A 4Z7NB 3K71B 3KKQA 3DLIA 5ALEA 5EVCA 3HDGA 1C7RA 3T9AA 2BZ0A 4WFKA 5FOUA 1RU3A 2GGSA 5HUHA 1PK8A 1MJNA 1EK6A 1FJGB 4M89A 4O2BB 3DOCA 1ZGZA 3BWVA 4UNIA 4BB5A 1Z82A 3L9WA 5G3YA 1WUHS 4YDSA 3WLNA 3QX7A 1E1QA 1PQ4A 3OJXA 1U5CA 1QRSA 3DBLA 3S99A 4X8HA 3TXYA 2XITA 3T35A 2G9ZA 3I01A 3O9MA 3MERA 3DL2A 1L4GA 3KM0A 1OB2A 1Y8QA 4R2MA 5CBPB 3BDAA 3IEIA 3HSKA 1WCIA 2Z1NA 3LYUA 4OU5A 1PJZA 4KUGA 2IP1A 1PD1A 2UZ3A 3FOBA 3KV3O 3QUQA 3T1YB 1IM5A 1YS9A 4RKRA 1H2AS 4RIEA 1I80A 3PFGA 2AHRA 5CB4F 3HB5X 1KZHA 1KZ9A 1WQ3A 8GPBA 3DS8A 1NQAO 3AP2A 2A7QA 3F1LA 2XUQA 4RPGA 5KYUB 2BFDB 4WDRA 4C1BA 1CY6A 3CF4A 4M1SA 3LK6A 4O2LA 5BT9A 1GCAA 2CDBA 4OP1A 2HW8A 4GR5A 2IHZA 3K4QA 1WMEA 4LOJA 1ZH2A 1I7PA 3QVSA 4YAGA 4KN5A 2BWJA 4HEA1 1GJRA 4MS3A 5MN5A 5FTWA 8LDHA 1LC0A 2AEFA 2PYDA 4LCEA 2PJRA 3CUKA 1ND6A 1A9PA 4IEIA 4L2IA 5M34A 1AQJA 4C2TA 3UO8B 3H9QA 4BNWA 3ECSA 1P4HA 2QUKA 4QECA 1SNYA 1X7WB 2PSSA 3OH8A 1KIMA 1IAVA 4XIGS 3OZTA 2YZ2A 3RC2A 1DPGA 3G1WA 3ZIUA 3PYMA 1FQWA 3RS8A 2UZ1B 3ZJUA 3G9QA 3SX4A 2ZUUA 4CT5A 5FLYA 1CUAA 2FSFA 1KHTA 2QL6A 4DNOA 4HPWA 2G83A 1AH2A 4EI9A 1CJUC 3ZIAD 4COKA 3AEKB 2WU0A 2G5PA 1GPWB 3KJFA 4JUCA 1XX6A 3A2NA 1P8JA 5IAEA 2HMSA 3ORSA 3C70A 4BJ3A 4QREA 5JIBA 1YR3A 2PSDA 1WTAA 1JG1A 1R3UA 2ZE6A 3I32A 2X58A 4OXNA 2OHIA 3FUWA 5JAQA 3GFPA 3OX2A 4UHDA 1C8BA 2UVPA 5A04A 4DCMA 2NNLD 4A27A 1VGQA 2ZSUA 1DDOA 3BKXA 3IALA 4Z3KA 1PV4A 4CGZA 4DT1B 3KUDA 1BVHA 2HCBA 2OXIA 4AAYA 5LQJA 3KIPA 5I9TA 3O3CA 4KN6A 2H4ZA 4TL7A 1J0BA 2UU9B 5AI0A 1VLQA 2VRBA 3ONFA 1N7JA 4HTAA 3DVAA 4B6FA 4TYQA 2PA0A 1H23A 1X7ZA 3HBLA 1UXOA 2J0EA 1SXQA 1VI6A 5G0TA 2NU9A 2L2QA 2GK7A 4RF4A 3N8KA 1R0YA 4DBZA 3URKA 3MWDA 2HGZA 3TLGB 5CJJA 3LT2A 3CTPA 5BMVB 3ZHBA 4AMGA 4CI0B 1RNLA 1I2ZA 1C2YA 1JIUA 1P9OA 1HYHA 1TL7C 1XLUA 3FGNA 1PTJA 2AX3A 4P7JA 4RDCA 5HE8A 4DMKA 4IGEA 5C2JB 4MHTA 3QYAA 3DHWC 1ANKA 4D26A 3HRHA 4E5YA 4B3SB 1JWLA 4Q05A 4PG4A 4GOXA 4X91A 2IELA 2ILTA 4F4HA 1JDNA 3OF2A 2OE2A 4YRLA 5JFGA 3TJRA 2AUTA 4S1OA 1IMJA 1DKMA 3MBKA 1ODKA 4Q39A 3SKYA 4RSMA 2BGJA 2W6PA 1P9NA 1XZCA 3RSCA 1QPZA 2JCBA 3DE4X 4EUFA 3B7WA 1RKBA 1CKEA 1O95C 3LUFA 4HNSA 5C1OA 4CIWA 2QEQA 3A4IA 4IDOA 5ALOA 4LF9B 4BIMA 4FBMA 3DOOA 5TC4A 1R5JA 3OM0A 3W3AA 4RMHA 4DQLA 2R7KA 1RJWA 1ULHA 4XUEA 1TMGE 2QENA 4FYVA 2E4WA 3NM5A 1J0DA 2QRJA 4L0DA 4MIEA 5EA2A 4YXWD 3UWKA 1H2EA 1VG0B 5DTRA 2R6AA 3WBFA 3B9BA 2AFIA 3NNSA 1CIPA 1UMCB 4UHJA 1TYBE 3TRHA 5IABA 4MW5A 3ETNA 2I3ZA 5M29A 1FJHA 2AD5A 2VC2B 2VNKA 3TVTA 4CYMA 2FDCA 2W43A 4PYMA 4ZOLA 1QQ6A 5GPBA 5T67A 1D5CA 4TQ9A 2WKWA 3W9SA 1SQSA 1ZFNA 3OQIA 2RSLA 3KEMA 2AFHB 2OK7A 2Q4DA 4TZKA 1A04A 1K7XB 5CFZA 2Q2QA 3T3MB 2F1JA 1MXHA 1T13A 3W5UA 1N78A 1BSVA 2MR5A 3KKMA 3KU4A 2GD0A 3WMRA 2FGKA 3MF4A 4G5FA 5B55A 3HYNA 2VBGA 4J0CA 5DEIA 3ND5A 2EFCB 5C5DA 3MJEA 4B4VA 2XUZA 3DA8A 1OXSC 2QU7A 2C3PA 3ND8A 4FZJA 4LDPA 5FT9A 4DQVA 1SCUA 3F5FA 4F45A 5KYTA 4JYCA 1O6FA 2PZGA 4KLRA 1V26A 2XMCA 4NR0A 4DYVA 5IJWA 2C2YA 3V32A 1FRVA 4QXRA 4MTCA 3PXDA 2D5CA 1JGTA 2Q5QA 2A1TS 4WXRA 3WSTA 1GGMA 4MPTA 5EC8A 3WWDA 1MXFA 4GVXA 5TMEA 3E03A 1N2JA 1ZCFA 4YP0A 2B8TA 5EE9A 1WE2A 3CW2A 4WL0A 3BHIA 1ESMA 3JYPA 3P71T 3PA8A 4ME6A 2AN3A 3DBHA 5K20A 2L42A 1F4VA 1C4XA 3BMOA 3T3GA 1EDEA 2J1LA 1CUHA 1QB7A 2XYRA 2APJA 2XUAA 3ZDQA 4CF7A 2MTBA 2O6HA 5EVJA 3FHTA 1TJPB 1JE1A 1LNZA 1R0BA 2Q3DA 4KH1A 1E3WB 3IO5A 3NHBA 4UXJA 1WCV1 1RCUA 3ZGZA 1JHPA 4DR1B 3L8CA 3SEQA 4Y6OA 2NZVG 3JWPA 3NIWA 2GOYA 3ZWYA 1GADO 4O3FA 3URMA 4EHAA 2V7QD 1IY2A 4L73A 4MROA 3TSYA 1MFZA 1E98A 1GKLA 4U6QA 1ZNXA 4MQFA 3LSTA 3I3SR 4QXPA 5JZMA 2QJWA 3W1EA 4QJ4A 5A3JA 3CCBA 4PAOA 4CKEA 4EABA 5HKAA 3L6BA 4R1SA 5FO1A 3RRFA 3WQRA 4AZ3A 2QRQA 5DX0A 5E4TA 3QUTA 4KVAA 1UPFA 3LQQA 5AQ1A 1DQPA 3BE5A 3CBGA 3K8OE 3O82A 2HPAA 5BUCA 2JJ1A 3BEOA 4E94A 1ZNWA 1HNNA 5F9HA 3B12A 2A57A 2PBLA 1V8OA 3Q85A 7REQA 3A4MA 1LI5A 4CNBA 3MIIA 3FIUA 3D4OA 2ZPUA 2P67A 4YECA 4LECA 4U2CA 5E6SB 3OTWA 4AG6A 1RD4A 1GSIA 3HO8A 3VPAA 1MPXA 3K9GA 3QFFA 5AI5A 4PLTA 1NSTA 2YRXA 2VSYA 1I3LA 1DIRA 2BHSA 2HA3A 4V0SA 2Y99A 4RVUA 1U8CB 1A2QA 2XB4A 3HEBA 3QP9A 4M46A 3HJNA 3QYFA 1OW3B 4QT0A 1ZUHA 5IT4A 1Q11A 3GMSA 4BO2A 1X19A 1B3RA 5ELXA 1AD2A 1R66A 3AYXB 2E49A 2JLXA 1AZLA 5TGDA 4FUTA 2GAOA 3WLRA 1NP6A 3TZQA 4BJHB 1P1FA 3OPYA 1DZIA 1HDGO 1OX4B 2QTHA 3MWJA 1FW8A 1HE1C 3LC0A 4RESA 3EDMA 4C4PA 4DCCA 4DC0A 2HPHA 2WWIA 4NZ9A 4WY2A 1JU3A 5CVUA 1DKNA 5JRJA 5MN4A 4MW7A 5JEEA 3GLRA 4NWIA 2O7SA 3TLAA 2IBTA 4QUAA 2AD1A 1NXVA 1R18A 3E7WA 3L8GA 4CIYA 1N5MA 4JC8A 5LYJF 4WJLA 3LX6A 1BFDA 2AF3C 2XXAA 4IDCA 1WPXA 2R5FA 3UB2A 2Y1EA 1PIWA 2CKDA 1XA4A 2KE5A 3DDNA 3ZBQA 4IIBA 4OSOA 3ZDAA 1DWQA 5FQOA 4FMBB 1OOEA 1REQB 3JTEA 2CXUA 4G0NA 4A8JC 3EXG1 2HM7A 1WY5A 4P33A 4EMTA 2IVZA 3BWMA 5JTUA 4HDRA 5CB4A 3AJ8A 4QODA 2HNKA 3BFXA 4TXMA 2PK3A 4UCXA 3AZQA 2JFVA 3EDYA 2O05A 2H2AA 3AEZA 3ITNA 4UFPA 1BCSB 3HNRA 4Z49A 2GZSA 4G1BA 2B5OA 2YOHA 1SOUA 2VNSA 3T7EA 3V9PA 1VC2A 1GNPA 2M6KA 2M1ZA 1BQEA 3VZCA 4WXMA 1NXTA 3DFMA 3LS2A 1TUGA 4MEJA 5FAKA 1INLA 2A9KA 2I99A 3JQGB 2IU0A 5CHYA 1MX9A 5DHUA 5FL7A 4AJ1A 3H11A 2WF9A 3LLCA 1EQAA 5GP1A 2QBYA 3U4GA 1TK2A 4HPJB 4OP2A 4F38A 1SCKA 3BZUA 4MWGA 5AM4A 5E9JA 5H4HA 1RCTE 4KVZA 3ENQA 4BMPB 2B5VA 1MABB 4P0TA 4WXEA 3SXUA 1QVZA 3SBEA 4IV8A 3EXHA 3NONA 3O93A 3KCNA 4XRRA 2JRCA 3EZ2A 3GDFA 1T9KA 2GRJA 4F8JA 5KTOA 3IUJA 1YJ5A 1EXNA 4BE4A 1X2EA 3V7FA 4PYQA 5B1YA 3NX4A 1CC1S 1R0ZA 2RGNA 3R0ZA 5F4BA 1SBQA 1C1YA 1DQZA 1YDMA 2Z3VA 3EIOA 3A10A 3RIGA 2DR3A 2JI7A 4I36A 2C58A 1P7VA 2YN2A 4C0BA 1NNEA 3UTDA 1UFKA 4PAWA 1ODIA 4FC6A 1L3BA 3O4FA 5AW0A 1X7GA 1WXDA 4AJIA 5JROA 2B2XA 4R1UA 4IZOA 4NENA 4H4DA 3KCQA 3ZVKA 2QMZA 2EGUA 2ZGVA 3GA0A 4EKDA 4NYMR 2IEGA 2WAXA 2C83A 3GFQA 2MSDB 5H3HA 1KEEA 3MC1A 2HIGA 3VV3A 5BR1A 1Z35A 1WU7A 1OF1A 4TTSA 2CT8A 1MCZA 3OZGA 4QBTA 6REQB 2OV4A 3MMSA 1DAKA 2BFPA 2EZ8A 5K0GA 2UUBB 5KNDH 2BFEB 4WOPA 3ZGOA 3CT6A 2CUTA 1D0IA 1JKMA 1WMFA 2DLCX 4UAJA 1PJ3A 2ZS7A 5REQB 3PDIA 2XB6A 5C3UA 5TJ9A 2GEBA 3TB6A 1ID8A 4WLOA 4F60A 1MF7A 1NUUA 3H1TA 1UWLA 2F67A 1PFQA 3GVHA 3PUVA 1OMOA 4KQCA 1C0KA 2OV3A 4L9WA 4A0SA 1DQSA 2YVQA 3W1VA 2WKQA 1XMOB 2PRYA 1R0KA 1G8JA 4D8WA 3TLMA 1FQOA 2X3UA 3Q6NA 2PL9A 3IJ5A 4IIJA 1GO2A 2JLQA 2W93A 1WL8A 4KXUA 4RPIA 3HYLA 4ECEA 2Z3WA 1NF9A 4QL3A 1CR6A 4BFCA 3IE2A