2ANCA

Crystal structure of unliganded form of oligomeric e.coli guanylate kinase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
205
structure length
205
Chain Sequence
AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Guanylate kinase
total genus 63
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2ancA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ancA01
2RHMA 1GAJA 3DMDA 4QGFA 3H2YA 5BXQC 4Q7MB 4G3XA 2BBTA 2ZSAA 4ZI2A 1A2KC 4NZYA 2ZRDA 5AJYA 4GNKA 1FL9A 1GKUB 2J1LA 2VSXA 1N6PA 2QU8A 3FMIA 5HKKA 4EFLA 3T12A 1S3SA 1LFDB 4LPKA 4A0GA 3QKRB 4Q01A 1A2BA 2ANCA 1RC8A 1OXXK 4N1AA 2UZ3A 3B82A 2YYZA 3QKUA 3TK1A 3VHLB 5JSZA 2AXPA 1ZMXA 4GP6A 4JLJA 4WXPA 4E03A 3DHWC 4Q1DA 4KLZA 1KI6B 2GJ8A 2X2EA 4Q18A 2WM9B 1E69A 4OHZA 1V43A 5IRCD 3T5GA 4KITB 2R6GA 1ZNWA 4QHYA 2RCNA 2EVWX 3CNLA 2A5DA 2A2ZA 3GLHE 4B47A 1U8ZA 2WHXA 4GI7A 3BJIC 3TNFA 5CB6A 4IJMA 3QXXA 3CPHA 4M9XA 3B1ZA 3I8SA 1R10A 3B7GA 3FHCB 1NN5A 1G3IA 3O47A 1AQUA 2J87A 3TSOA 2XITA 3ZH9B 1OFUX 4I4LA 1RRFA 1JNYA 4L5BA 3GLHA 2OLJA 4KBGA 4Z51A 2FDCA 1GILA 2QTVB 5FFMA 3RSOA 2JDID 4D26A 2F1JA 4NONA 3MG9A 5B58C 1GFIA 4MRSA 2OBLA 5L3QB 1WP9A 2PMDA 2W0SA 3AF0A 4RY2A 5CIWA 5JRZA 2ZE7A 1XD9A 3RWMB 2YINC 3NTUA 1MO4A 2CVHA 1WMSA 3K1JA 4OQXA 2V3CC 3N2EA 2P65A 1GSIA 4B73A 4RZXA 1D9XA 4ZIRA 2ZPTX 1B0UA 2IYVA 2O0HA 3CRW1 1KI7A 3ADCA 2J7PD 1QG2A 4B74A 4HSEA 5KDDA 1XZQA 3EZ6A 3W3AA 4IW3B 4DSOA 5FTKA 1F2UA 2WKRA 3EZ9A 3MAAC 2ZI7A 2IX3A 2HYIC 3UPUA 1NBMA 2VSFA 4PPQA 3TGPA 3A1SA 2W6JA 1CJVC 1KIMA 3WP1B 1OH7A 4R9UC 1S4QA 4O3MA 3VKGA 2J0UB 3CRMA 3QJYA 4P0TA 1OKKA 1P2VA 3IPXA 3S1AB 5J4LA 2IEZA 1WRBA 3I5YA 1DAFA 1MR3F 1O3YA 4OI4A 4TQ9A 1UBFA 1JXMA 1II8A 3AP1A 4M1SA 3OZXA 2ZYUX 4A9AA 1FOEB 3X1WA 5BN5A 2B6HA 1OSNA 2NPFA 2XXAB 1N5LA 4ZKEA 4MGZR 4OYHA 3LNCA 2WIAA 4TQUS 1KI1A 1LNZA 4FMCB 4Q00A 4Q4JA 5K8IA 4GZMA 2AR7A 2IYZA 2UVQA 4NHOA 1L2TA 3AVXA 4K8OA 3U6BA 4B32A 2G3YA 5KSZA 1Z22A 4I81A 4TLDA 4P33A 2EW1A 1EFHA 3KB2A 4UXHA 3EZ2A 4UNSA 2GXAA 3EZ7A 1E9AA 2MMCA 2ZVPX 3GLIE 2ZUDA 1TAGA 2JLWA 3NVAA 3NBFA 1JR3E 4JJKA 3GJ5A 1NY6A 2WSSD 3IUYA 2XB4A 3MGCA 4DCNA 2F9MA 2ASEA 2XX3A 4QGAA 4IDQA 5EXTA 1TQ6A 3U2QA 4NCHA 1COWA 2HXSA 5KSPA 3RVBA 1NF3A 1F3OA 4FD2A 5CITA 5D3MA 5FR1A 4NL4H 5DI3B 3SFZA 2A78A 2CK3A 4M9ZA 4OQFA 2ZITA 1ANKA 2OHFA 2W2TA 1T3LA 3AVPA 1DE0A 2F1HA 3KFVA 3KZ1E 3SU8A 3M6AA 3H0KA 1CTQA 4EAQA 2D3WA 4F38A 1ZAKA 1XJ0A 1DO0A 2GCOA 4EQ6B 3P4YA 3FPAA 2RGBA 3U44A 2IA5A 2ZRKA 2GKSA 2A9KA 2VL7A 3VR5A 4KCGA 4PHGA 1YZTA 4DEXA 4ZV4A 4QG7A 4D4MA 3QUSA 4F4IA 1A1VA 1XEWX 4CEIA 3DM9B 2GZAA 2VP6A 4PX9A 5EXSA 1I4TD 2BM1A 1OFIA 4M22A 2BBWA 3EARA 3FVQA 3L0PA 5TARA 1S9DA 2CL0X 2FF7A 2NOAA 3D31A 3MD0A 4HLQB 3RRYA 4Y0VA 2R9VA 3A1TA 4H1VA 4Q5IA 4TMVA 3OFNA 1WBBA 4M1YA 5JWHA 1D9ZA 3CBQA 3N70A 5KPJA 2NO1A 1IOZA 1JB1A 4GOJA 1KSHA 3IBYA 3C16C 3Q3JB 1SULA 5B2ZA 2OLKA 4NH0A 4OK5A 3SJBA 4Z1MD 2JLRA 1EESA 2OV2A 4EJSB 4QBFA 2HLDA 2O8DA 1GL6A 1JI0A 3EG5A 1W2HA 3U3JA 2IYUA 4UJ3A 3W8RA 4GSYA 4LZZA 4GDFA 1RJ9A 1E9BA 4Q7LA 2ZS9A 3L2OB 2B8TA 5FBLB 1Z6AA 2GJ9A 3T1OA 2EWVA 3FDIA 1ZIPA 1K6MA 1T9HA 5DNYB 4IRUB 4BE7B 4EFMA 3IIJA 3PXGA 4ZDIA 1IQPA 1RRGA 2AL7A 2DY1A 2V6JA 4QKQA 1CIPA 2PT5A 2AD5A 3EAQA 4Q4AA 5L3VA 3CO5A 2JJ1A 1NN0A 1ZUHA 2ZUBA 4W5HA 4OHXA 2IHBA 2G88A 4DHEA 1BKDR 4BFYA 3VQTA 3W3ZB 3AP3A 4TL9A 3UG7A 2YWGA 1W44A 1V5WA 4WVFA 3L43A 4P32A 1DAIA 2X8AA 4LDJA 5FUWA 5BW8A 1OIWA 1TPZA 3RHFA 4ASUD 2VF8A 2JLSA 2D06A 2FFQA 4D2IA 1JR6A 4X8MA 2IYQA 1EK0A 4AYXA 4WIAA 1BYUA 1W0KA 3U60B 4PSAA 2ZVQX 5E4FA 1Q44A 2FPMA 3LD9A 5C4GB 2C9OA 1GNQA 5KHOC 2PH1A 3U6KA 3PEYA 4WXRA 5DN6A 3EW9A 3MFYA 3OIVA 1Q0UA 2D62A 4M9SA 5HE8A 3WYGA 1XFAA 3U3MA 3ADDA 5J5CA 4UQOA 2GRJA 1Z2CA 1G4UR 1ODFA 2A5JA 2B92A 2XTZA 1U0LA 4EJSC 2WBLC 2PZFA 3VR3A 2REXB 1LS1A 2ZYVX 1XB2A 3EC1A 2V1XA 2ZRFA 2WIBA 2WJIA 3AEZA 2CLCX 2PEZA 2XTNA 4UNPA 3A1UA 4NYJQ 4QBIA 4WZAE 1LY1A 1JR3A 3FTQA 2PJRA 1IM2A 4LCBA 4B3BA 4TTQA 2ZS7A 3QVVA 2C8VA 2FGKA 3B1YA 3UWOA 1F2TB 1QHNA 3RWOA 4BUJA 3CZPA 2OFWA 3NKVA 2CHQA 4GZLA 1ZC3A 2B8WA 5B64A 2QSZA 4TWZA 3I72A 3MJHA 2YOGA 1IY1A 1DBSA 4NCNA 3CONA 2VP0A 2R65A 1XCGB 4BFVA 4DDVA 1E2MA 1R5BA 5CIQA 2HF8A 4NPHA 1KI6A 3KJGA 2XZOA 3O8CA 3QKSA 5BYKA 4LJ8A 4NYJR 1TU4A 3OIUA 5AJVB 3N2IA 1MRNA 4IDHA 2F1IA 1HT1E 2VA8A 1QF9A 2WVJA 4P4SA 1M74A 1EWRA 4Q9HA 621PA 3EPLA 1Q1QA 2Y8EA 3OAAA 2HEIA 1W36C 1XMIA 4TTRA 1U94A 4YDSA 2OFOA 4KODA 1ZCAA 5J4KA 2WPDD 1G3MA 4OHVA 3RRZA 2XJ9A 1G3UA 3BB3A 2RKOA 4N0EA 3BD9A 4OHWA 3BRWD 4NTZA 3Q5EA 3THXB 4IKEA 4QNRA 1F6BA 2XOKD 3GJXC 4FCTA 4US1R 4P4UA 3AVTA 2BC9A 2FZLA 2ZRCA 4BFSA 1Q22A 2IC5A 1Z0FA 1KDPA 4NCKA 2JLVA 2GF9A 4JVLA 4TL8A 1XXHB 4DUGD 2SHKA 3LA6A 3KTAA 4RJLA 2CE7A 3GLFB 1TEVA 4E09A 1P2SA 2YHSA 3CH5A 4CT5A 2QL6A 3LBHA 3RABA 2WWFA 3B6EA 2I1VB 1E0AA 5FTMA 2H92A 1AIPA 4NYIR 4YMSA 3W6NA 4DCSA 4UNRA 1RPZA 2IYSA 3THYB 4HLUA 1F48A 5DISB 1R6BX 1R7RA 2WOOA 4JLMA 3QQ5A 1H8HD 3UANA 4M53A 4HUTA 2CNWA 4Q4LA 5L3SA 2V7QA 2ZROA 2O8CA 1R0YA 2IYWA 2EQBA 2F9LA 3D7MA 5EE1A 5FL7A 1JQLB 1ZM3A 1NG1A 4K81B 4JLOA 4DKXA 3A4MA 2ZI5A 1E2JA 4GFDA 3SYKA 2Q3FA 5C2JB 4JLNA 4A2PA 4JLPA 4EDHA 3CX8A 2KE5A 2YOFA 1H65A 4QBGB 2GESA 3IPYA 1N3BA 2JIZA 1N0VC 3SBDA 4PAOA 4DXAA 3GLIA 3F3YA 4R2IA 2EYUA 4L4UA 3FKSD 4W5WA 4JLVA 3WRXC 2HXYA 2FSIA 2H57A 2JATA 4BLSA 2HT6A 4DLVA 2IEYA 3CW2A 4ZKDA 5ANRB 5H1YA 3CF6R 4MYHA 2LCFA 5FTNA 5GVSA 1OYYA 5BN4A 5A5GA 1MO6A 4US0R 2D2FA 4QL3A 4UNNA 3PVSA 3KXLA 5AK0A 3FMOB 1OHHD 1X1RA 2ZREA 5TMPA 3LDAA 3LQRA 3WBJA 3T1TA 2BIFA 4D0NA 1OXUA 4DDWA 2ZRBA 3ZJYA 1O87A 3T15A 3KB1A 4ZIRB 3B1VA 3QBTA 4HB4A 1Z5ZA 3E70C 4F92B 2WTUA 1HA3A 1UEJA 3I1FA 3W6OA 3C14C 2EFEB 3L0IB 1E2KA 4DLXA 3EIEA 3FFAA 1PLLA 1AZSC 3AVQA 1E79A 4HB2A 3MJRA 2RGAA 2QSYA 1E4YA 2WICA 3A4NA 1E0SA 3PUXA 2DHRA 1RRPA 3FKQA 5BWMA 1W2GA 2QP9X 2VP5A 1R4AA 4JMPA 4AKIA 4RCZA 1AK2A 4OK3A 4M1MA 2EYQA 2VEDA 3Q72A 3GD7A 5EE9A 1OXSC 2DFKB 2CJWA 3TR5A 1IY2A 4LJ7A 3ZLJA 4TYWA 2Z4RA 4FN5A 4A8JC 4HB3A 4TMZA 4JKIA 1XEXA 2FN4A 4O0MA 2IBMA 4KV9A 2FFAA 1G3QA 1QHGA 3R9IA 3CRVA 1FPMA 4TMXA 2ZETA 3HPRA 3IHLA 4PPFA 1XZPA 4NU0A 2F43A 1G9XA 4Q4HA 5ELXA 1GTVA 4JS0A 5BN3A 1NIPA 2VP4A 5IHPA 2F3RA 2ZRHA 4U00A 3DM5A 2ZTSA 2O8BB 1BO6A 4ERNA 1FQJA 1D2EA 1E96A 1E9SA 1T5IA 1VG9B 4LBZA 4M9QA 1KSGA 4LX0A 1S96A 4O2RA 2EFCB 4EPYA 3G5UA 3NHAA 3TW8B 4IVRA 5HPYB 4IOMA 4JYCA 3B60A 3SZRA 1NLYA 2QZ4A 4TYNA 4XSHA 3P1JA 2G1KA 3KKOA 2CCJA 4WW0A 5M04A 3PUZA 2F6RA 5DGXA 2A5FA 2O8CB 2KB0A 3ZIAD 1G16A 1Z3IX 4C4PA 4KVGA 3GJ3A 1GRNA 3T35A 1NSTA 2ZAMA 1T0HB 3OHMA 4G5GA 1SVSA 2GEVA 3IDQA 4XWOA 4GBMA 5IDVA 2NZJA 1E94E 1XMSA 3UATA 2WKQA 1PZNA 4URZR 5AJWA 3EIHA 4KO8A 5EXXA 3EPKA 3NEJA 3CNNA 4LJAA 3QSYA 1F5NA 1YZNA 2G77B 4TLAA 1VECA 1RFLA 1UM8A 2IUTA 1OH5A 1HQYE 4AD8A 1NNEA 2FSFA 4IOJA 2RHDA 5FUVA 1G8HA 4TT3D 1CRPA 3IEUA 2VHJA 3EA0A 1VDZA 1QRAA 3ZQ6A 1XBTA 4C7OA 1X3SA 4C9BA 4CEJA 1VCMA 3U4QA 1NSFA 3KDSE 4OQMA 4RD2A 4Q9LA 4Q7JB 3CNOA 1Z6YA 1LS6A 3NHBA 5J40A 2QGZA 1ZINA 2JCSA 3GEEA 2FOLA 3QKSB 1SGWA 5C4MA 4HEJA 3CM0A 4TLCA 5HTKA 2GILA 3ASZA 3UG6A 1FQKA 1BS1A 5GJWC 2V55B 3KXKA 4XVRA 3T06B 4PXAA 2GXQA 4M1KA 4JT4A 2Z83A 4V0OA 3BXZA 3IIKA 2FX3A 2QA5A 2G1JA 3ICEA 3AF3A 5K8UA 1GNRA 1YVDA 4IDNA 3LVQE 4V02A 4PC7A 3FYHA 3OE7A 3QXSA 2PL3A 3VR2A 4CRWB 4C3ZA 4DBLC 2OCBA 4PAMA 1U9IC 1X6VA 3QEJA 1IN6A 3QNUA 3W5IA 4DT1B 1KAGA 1X1SA 5CYOA 3KUDA 4BZPA 2PLFA 2P6NA 1Z0AA 3IBGA 2ZJYA 5DSZA 3TLXA 1KJYA 4MRPA 4QM7A 2Z0MA 2ZJ2A 4Q1FA 2DR3A 2WZQA 3TUIC 3OEED 4IOKA 1UF9A 3GLGE 2VIIA 3TKLA 3IKJA 1N5IA 2P3SA 3VR1A 5JBQA 4GL2A 2J0UA 1S8FA 2IHYA 2QMUA 3RC3A 1IJFA 4PC6A 4URYR 1JPJA 1XDBA 1E2GA 3P27A 4L15A 1FP6A 3UMRA 1CP2A 2QG6A 3B1XA 1N5KA 1CEEA 3ND8A 4CZ2A 3CRRA 2EWWA 2VLIA 1DADA 2BOVA 4BASA 3SS8A 2YV5A 4DLSA 5CDFA 2QMOA 1YRAA 3HU3A 1G5TA 1P62B 1KDTA 1TMKA 2X1VA 2RB4A 1P75A 2N1BA 1KY3A 5LB4A 2XNSA 2QAJA 2VP9A 1DEKA 3F5FA 4Q21A 3Q5DA 1TQDA 4M4SA 2REBA 1W46A 2KBFA 2O8EB 1SVWA 3AUXA 2CMKA 3BH7A 4BZXA 5HR5A 3LV8A 3NC0C 2D2EA 4OI2A 1KK2A 1IHUA 3QPVA 2FG5A 3CZQA 5FUYA 2G0NA 1P4SA 2PZEA 3T5DA 4IEEA 1AS0A 4IDOA 3PIRA 4ZCLA 3RS4A 2OO7A 2GBLC 3C8UA 4B76A 4ESVA 2F1RA 1T3SA 3I73A 2W00A 5FBRB 1XD2B 1T4GA 3MMPA 3OE7D 1HH4A 4I1VA 2R8RA 5AUPB 2WMNB 2VP2A 1C1YA 2WWIA 4ON9A 3SR0A 3KQKA 3K70C 5DYGA 3C5CA 1ZCBA 1HURA 2J9RA 3FMFA 2AHOA 2GETA 1NRJB 3QPWA 3VAAA 4C30A 1CR4A 2GCPA 3KKMA 1SKYB 2ZXUA 2GJSA 3SHFA 3R9WA 3C4JA 4F7WA 2RGGA 1R0XA 3JZMA 3REGA 2AFIE 3DL0A 2YWEA 3B2EA 4AG6A 4Q1CA 4R98A 2CNWD 4JL8A 3L8YA 4KFSA 4R71A 4EPRA 4NYMQ 2QT1A 2PZGA 5TXGA 4P31A 1AS3A 3ETLA 4L8GA 3W34A 4KFTA 5KSYA 2A5YB 5EJEA 3JVVA 1P7CA 1RKBA 1N6NA 1XJQA 3LH5A 1GIAA 2J0QA 1KO7A 4IOLA 4URVR 4GOKA 4TLEA 5F2EA 4DLZA 4MGKR 5FBVB 2C9YA 3KKPA 1N6KA 1DAGA 2C2HA 2ZAOA 4PQYA 1SXJD 1P2TA 1SQ5A 1UBCA 3NDPA 4MQBA 4IVQA 1PLKA 1WXQA 2C78A 2TMKA 3I3SR 5LDDC 1KNXA 1E6CA 1UKEA 2PT7A 4LJ4A 4PAQA 4LK2A 2PLRA 2C9CA 2BKEA 1KGDA 3UIEA 3CPJB 1E9EA 3GLFE 5LD2B 4OHYA 8OHMA 3QE0A 4I1SA 4JLBA 4PO9A 3UMFA 3LBIA 1R0ZA 2W6ID 2IWRA 1U98A 3ZIAA 4D6PA 1RE0A 1VHLA 2PX3A 5FTJA 3TIFA 2OCAA 2BMDA 2RGCA 3PQCA 3SOPA 3TMKA 1L4UA 3VHXA 1IJEA 2REOA 2YJTD 4OQLA 2NO9A 3OIYA 1KO4A 2ATXA 2HT1A 3U3KA 5JCPA 5FOWA 2KWIA 3TQFA 4OJQA 1JECA 1DPFA 1KTVA 2VSOA 2XTMA 3CR8A 2VF7A 3KQLA 4MITA 2IS6A 1IBRA 2OSBA 2Q3MA 1YZQA 2NO0A 5JECA 4B71A 1PLJA 4JL5A 3FHOA 221PA 4PR0A 3TJZA 1R5NA 2NO6A 3U4QB 2ZS8A 1UAAA 4CEHB 3DOEA 3LW8A 1KJWA 2JA1A 2WSMA 1ESMA 1TF2A 2PCJA 2QQ0A 1RIFA 2OBMA 3PR1A 1R8SA 5L8VA 3CR7A 1UFQA 5G3ZA 2FWRA 4B43A 1NMZA 5FBQB 1Y63A 1VIYA 4D0GA 2YWFA 2JLQA 2QAGA 4RSGA 1KOFA 3K9HA 3B78A 2B7BA 3TAUA 4FW9A 5KUTA 2EU8A 3MWYW 3PUWA 3T1VA 1EFCA 2C96A 5JMTA 3KQNA 1W4RA 1KNQA 4ZDWA 3LO5A 3KJHA 1HEIA 4AYTA 4TYPA 1KI2A 1LW7A 3MWLA 4JBYA 4LYHA 2DFLA 1KMHB 1DTSA 3QVUA 3CH4B 3K0AB 2J59A 1QHXA 3K0CC 1AA9A 4WA7A 1RW4A 2X2FA 5DI3A 4AY2A 3EX7C 2W6IA 2ZSFA 5K8TA 1KMHA 2GK7A 4DCVA 4GPTA 4E22A 3AKYA 1Z2AA 1E9RA 2EFDB 4LJYA 1CBUA 3DOFA 5CM9C 4MGIR 3ZVLA 1ZUIA 1G7TA 2CHVA 3O8RA 1YR8A 3F8TA 3IO5A 4FCWA 1S9HA 1X8JA 1E32A 3AVUA 1JAIA 1HE1C 2CDNA 2B7CA 1NIJA 2H18A 3IGFA 3ND9A 5KNCA 1SXJA 4DLWA 1IN8A 1E98A 4G1UC 4ZI3A 2QQEA 3IO3A 1MT0A 4OL0A 2ONKA 1W36B 1G1MA 4BPBA 1N6HA 1UADA 1ETUA 1DAHA 2AKAB 3QY0A 3HWSA 4A15A 4KI0A 4BLPA 2AK3A 1M7BA 4LBWA 1CRQA 4L9WA 4DSTA 5AUNB 1P3JA 1MRSA 4B6EA 1S0UA 3DKVA 3ZVMA 1GKYA 2VQSA 1KDRA 4RD0A 3ZD6A 3AKDA 1M34E 1NJGA 4V0LA 5JI3E 5CB8A 1CJTC 4YMVA 2QY9A 1OFTA 1VKJA 4TYYA 2QAGC 1DELA 5CLLA 1GL9B 2FNAA 1TTTA 3AGPA 1Z6XA 2ZRIA 5FL7D 4KLNA 3ZS9A 2VPPA 1T91A 1KZGB 3AB3A 3BK7A 2K5UA 3MRSA 2V7QD 2J0VA 3OFND 4C0HA 4GT1A 1AQYA 2N42A 3VU9B 3GFTA 1RYHA 1TUIA 1VG0B 5JZVA 2PEYA 4Q1EA 3F0TA 1WBDA 4Q4JB 4EFNA 3PEUA 4URUR 3GQBA 3WNBA 3EIQA 4LC0A 1E2QA 1P2UA 2BHRA 2G83A 2W0MA 5DI9A 1Z6GA 1J2JA 1N0WA 3A6PC 4UKDA 2BDTA 4R2HA 1KKLA 3V4FA 1XXHA 1ZJ6A 2HJGA 5TY0A 4OJKA 3NG1A 1QHHB 3FMPB 3DZ8A 3BFXA 1Q1BA 3Q7PA 1UKYA 4O25A 5SZIA 3RNLA 1ZNZA 1A5TA 4Q03A 1ELOA 3UWKA 4NDZA 4BFWA 3L8ZA 1E9FA 3KJEA 2P6UA 2XOKA 4ILEA 4JIMA 5TVKA 3DO6A 1U8YA 2ODWA 2FGJA 2QRZA 4LJ5A 3ADBA 2ZJ8A 1VTKA 1VG8A 4RFSB 1Z08A 2WPDA 2G9NA 2P2LA 1NLZA 1Z0DA 2IYXA 2ZR7A 4XVQA 2IYTA 1Z28A 2QROA 1G3RA 1FUUA 1T5LA 3P20A 4YDHB 1COWD 2FSGA 4TL6A 1DOAA 5CDFE 5CK5A 1OE0A 2ZSBA 3IEVA 4HAWA 1P6XA 4PTLA 4LHWA 4A92A 3K70B 3QI2A 1Q1ZA 4QNMA 2CJWB 2WV9A 2J41A 1G5RA 1UDXA 3T1QA 3OEEA 4XTRA 3LRPA 3MLEA 4PANA 1OHHA 4MRNA 1OYWA 5LB2A 1OH8A 1TADA 4HUQB 1BH2A 1G8FA 3TH5A 3N5CA 1YU9A 1K8RA 1BIFA 5CJPA 4BLTA 4XOIA 1P60A 1TQ4A 1TL7C 1X8KA 4NKRA 3PEWA 4DB2A 2IS1A 5JHHB 1QHHA 4MRVA 3FKSA 1SKYE 4M0LA 4K46A 4AKHA 5B57C 2VTKA 2WKPA 4A6PA 5LPNA 1W5TA 3NBZC 5F9HA 1ZM2A 2JIZD 3GLFA 3W5JA 2QPAA 2ZJZA 2IT1A 2MMGA 3VNUA 3NWJA 1XD8A 1WDTA 2ZYTX 1YJ5A 4AWXA 4AI6A 4C0JA 1QG4A 3B1WA 1OLOA 3HYTA 4QBHA 3AVWA 3AKCA 3X1DA 4A8JB 2ZI6A 3DZDA 2FPLA 3X2SA 1KO5A 3FE2A 2ORVA 3BGWA 2CBZA 1T0JB 5JI2E 4ASUA 1ZYUA 4KJZA 2FE4A 1ZUNB 3PV0A 2RGXA 2ZR0A 4HDOB 3AP2A 1ZD8A 2G6BA 3LVRE 3CF2A 1YZLA 5FPHA 3VTKA 3I32A 4F91B 4Q02A 4DDUA 2P6RA 1EWQA 2P5SA 4HB0A 4B2IA 3KL4A 2WMOB 3A58B 1Q3HA 4TT3A 4EUNA 1S2MA 3CX6A 4S35A 3BH6A 2GXUA 3O8BA 1XTSA 2E1RA 4D0LB 4DUGA 3SC3A 3E1SA 1OV4A 3KQHA 1YKSA 3THWA 3TSWA 2WWHA 4LJ9A 1E2DA 4LI0A 2H17A 2I1QA 2QORA 2LKDA 2GVZC 1EFUA 1NKTA 5JSZB 1SHKA 3WHKA 4FWTA 4LWZA 1VYUA 2BBOA 3GPLA 1GNPA 1NL3A 4YLGA 1HV8A 3AV0B 1GRRA 4AG5A 1WF3A 3BERA 3NBYC 4GOXA 2WJYA 4LYAA 2HLDD 3K9GA 2ZRNA 3NDBB 1YR7A 2BVNA 4MYCA 4Z1MA 3CUEF 4TMWA 3K70D 1VMAA 2G0TA 1G20E 1NMXA 4AKEA 3KJIA 2YOHA 5H70A 2AWOA 2Z43A 5EQTA 1ZD9A 2IXEA 2CCKA 2FH5B 3KXIA 5K8LA 2E87A 4URXR 5HKKD 1HE8B 2GZDA 4DCTA 5CK4A 4LGMA 4FMBB 5SZKB 4TYQA 3I62A 1TEXA 2CE2X 4JL6A 1KSJA 1JXOA 1U90A 3C15C 2O8FA 1Z29A 2GZHA 2OE2A 4UNQA 4C7OB 1WQ1R 4PZZA 5FR2A 1Q21A 3ZVNA 3A1VA 2ZIAA 4DSUA 1F2TA 1MV5A 2QT0A 1XF9A 2VHUA 5B30A 4ACAA 1X86B 1OIVA 1RVDA 2YC4C 3VNVA 2QPOA 2OM2A 1JJVA 3MCAA 2BCJQ 4ZPXA 3GEHA 5GADl 1NVUQ 5H68A 5IT5A 3WNCA 1DG3A 2GDJA 1NMYA 4JLDA 2FJUA 2R44A 2F43B 2BMFA 4QC2A 1KI4A 4NBSA 4TZ6A 3THYA 1SXJC 5FBWB 4G01B 1PUJA 4AC9A 4A4DA 4RD1A 2GNOA 2OEPA 2XZLA 1M1YE 5H8WA 4DLRA 5HCNA 4JVNA 4IHQA 4XVUA 1DAMA 1P72A 3A36A 1E79D 1XXHE 1W49A 2XJ4A 4W7SA 1DAEA 3R8FA 4FXPA 1P9RA 2V8OA 3THXA 4A0FA 1YZGA 4B6FA 5L3QA 2NO7A 5FPKA 3ONWA 3VFDA 3SHWA 4DC9A 1KYIA 1EX7A 2YWHA 3THOA 3HDTA 3IIMA 1ONBA 2QUZA 1EG7A 5KOYA 2ONJA 1II9A 1P9WA 1VCOA 4Q1BA 4FMCF 5KDOA 4E07A 3BC1A 2H5EA 4MGYR 2ZR9A 2IS2A 1YQTA 5JLJA 5G3YA 2YKGA 1FX0A 1QBKC 2NPIA 3B85A 4V0NA 5E7JA 1GRQA 1FNNA 4OQNA 4II7A 4QJ4A 2DB3A 1IY0A 3L0SA 4DT1A 4AK9A 1J99A 2ZSEA 4P4SB 3LFUA 2E9SA 2FFBA 5FOUA 3C41J 4Q9JA 4Q47A 4YMTA 5J4HA 3KKNA 1NVVR 1IONA 2ZI9A 3ZVRA 4ZCMA 4Z54A 1CU1A 5AJZA 5A4JA 3VMFA 4ZDKA 6Q21A 1J90A 4JBWA 5HZKA 2JLXA 3QKRA 5E7IA 3WRYC 4MA4A 1F2UB 5FPSA 1XPOA 4IFBA 5EP2A 2OG2A 5KTYA 1NN1A 5E7MA 4XWKA 3TUJC 3WBKA 3LWNA 1PVOA 1Z83A 3QXCA 3VKWA 2J7PA 3LBNA 3SYLA 3RC8A 4XWAA 2WJHA 3A8TA 2PCLA 2GAAA 4I1OA 1W4AA 3LY5A 2ERYA 3SQXA 4B2LA 1H8HA 2H1LA 3GJ6A 3R20A 2ZYWX 2DFTA 4PZLA 4H1UA 3QBVA 3AVVA 2DYKA 1E2PA 3LLMA 5FI1B 1UPTA 4B3FX 2JLUA 4V0MA 2XAUA 2J3EA 5L3SB 2VYFA 5KDLA 2BJWA 1ZM4A 1RRCA 4RD4A 3ECCA 1HUQA 1W47A 4P3YA 4WAUA 2R6DA 1NJFA 3HJNA 3PG5A 4IXMA 5FOSA 4G5OA 1U8AA 2JLZA 2DFNA 3V4RA 3CPEA 3SDZA 2GCOB 4D82A 1J70A 4CW7A 1FUKA 1SHZA 2NG1A 3AQ4A 4LV6A 2I4IA 4Q1AA 3I61A 1ZVQA 3J81k 5DO9A 4TSFA 2WOJA 1KMQA 3I4LA 1XMVA 2Q9AA 1G7CA 4HAUA 1Z0JA 1DG1G 2CK3D 4PPNA 1M6NA 1WCV1 4WZBE 3CKLA 4W9MC 1K5GA 1II8B 1Z06A 1RJ9B 4QRHA 4RKEA 1OB2A 3OAAD 3RS0A 1UJ2A 5C1BA 5JS8A 2A5GA 3GMTA 3TSZA 4PFSA 4CDGA 2NGRA 3HR8A 4QOSA 3LQQA 3Q85A 4B3DA 1W5SA 1P5ZB 1XTIA 3PITA 1IXZA 4NCJA 4B3XA 1W7AA 1ESNA 1OXVA 3K0FA 1GITA 4EQ6A 2NZ8A 1CF4A 1L7VC 1D2NA 5TV2A 5FPYA 4CVNA 1FFHA 3TQCA 4OKSA 5KSOA 3MSXA 2VO1A 3FGNA 1D5CA 1J8YF 2QP3A 5UKDA 4KYUA 1XD2A 1OJLA 5JS7A 2J7KA 1KAOA 1TUEA 1U9IA 3SJZA 2Q6TA 3P4XA 3ZZUA 2IS4A 2OILA 4PZYA 4JVSB 3UK6A 3ICQB 2ZSDA 3HYRA 1JR3D 3TVTA 3HU1A 2XGJA 2CEAA 2ZE8A 3FOZA 1R8QA 4PHTA 5SZHB 1KKMA 2ZE6A 3QXJA 2CHGA 1D6JA 4M8NE 3KKQA 5FPTA 2GK6A 2WAXA 4G0NA 1OKKD 1TX4B 2XNDD 421PA 1AGRA 3U61B 1ZC4A 3RDPA 3UMSA 3U7HB 2ORIA 3SBEA 3H86A 1JAHA 1CS4C 4NYMR 2IK8A 3M4YA 3QEOA 4X8OA 5DN6D 3E5HA 1XNJA 4ITRC 1G4AE 1PUIA 4CT4B 4EJSA 2WJVA 4EPTA 1W0KD 4QXAA 1XTJA 1L8QA 3ZQJA 2ZRPA 1N6IA 2RGDA 4TN1A 3QG5A 1LVGA 1FNMA 4JJZA 2NTYC 1BMFA 1JJ7A 1RYFA 2J45A 3RYTC 4PC3A 3CX7A 4JLAA 1ZRHA 1PJRA 4KYIB 5KNBA 3C7KA 1M7GA 4GP7A 5JJIA 1HT2E 1WA5A 1XEFA 3VX4A 4BFXA 1KSFX 4HAXA 4R7ZA 2FMXA 1XRJA 2JJ1D 3A37A 2ZUCA 4B2PA 4RD6A 2JDIA 3K0EA 1IXSB 4AYWA 3LLUA 4LJ6A 3DEFA 2ZJ5A 2BV3A 2ZJOA 1ZIOA 1CJUC 2IWHA 2J5XA 2FU5C 3BBPA 5CYPA 4DZZA 5C46F 1XP8A 1Z0IA 2QNRA 1E0KA 1XJCA 4DIEA 2GVDC 1D2MA 4PQFA 3TAHA 5FOVA 4A2WA 4BLRA 4RZUA 4XTCS 4DSNA 3GP8A 4HLDA 3R9XA 4JZKA 1XPUA 2GEDA 4L16A 4B3GA 3GFOA 1XCMA 4US2R 4A1FA 4GRAA 5SZJA 1XU4A 4RFVA 2EFHB 3NC1C 1IAQA 2GTPA 4LUCA 3CWQA 3IILA 1OH6A 3ZS8A 3W8NA 3IQWA 1B23P 2V9PA 4BFZA 2Z6VA 2DPXA 1EGAA 4Z8XA 4C0BA 1SVOA 5P21A 3GEIA 3SE0A 1G18A 4DLUA 4DLYA 1JEDA 1VCNA 3BB4A 1JQJC 1Q1EA 4DVGA 2O0KA 2IYLD 2QMEA 2IL1A 2ODEA 5JFGA 4MYUA 1G7RA 1A4RA 4JKYA 4LYJA 1LV7A 1XTQA 3B9PA 1XWIA 4BFTA 2NMVA 1NLFA 4KXFB 3DDCA 1U2RA 5DHFA 2RGEA 3CIOA 5FOTA 4N3NA 2GJKA 3LXRA 3BFKA 1NN3A 3LX5A 3X1YA 3THWB 3K09A 4XIGS 2HDNB 3D3QA 3NH9A 4LV5B 1M8PA 3MUFA 5EE3A 2MSDB 5EZ5A 3U7GA 4LSGA 2JAQA 3BB1A 5LBIA 4DRZA 4LHYA 2AD1A 2R62A 3K0AA 4JVMA 4N0DA 3U7FB 2P0EA 3NBXX 4UJ5A 3ZZ0A 1VIAA 4WBSA 2VRWA 3X1XA 5FUXA 2ZEJA 2KJQA 1G19A 2ODNA 2QM7A 4D4KA 4IDPA 3H84A 4KHZA 2GWHA 2BMEA 3QENA 2R2AA 1IXRC 1E2LA 1SVIA 5DE3A 3AVOA 2C5LA 3NIBA 4O2LA 1DVRA 4XH9B 2IW3A 2WSSA 1E1QA 1W0JA 3BS4A 1T6NA 2GEUA 2IUUA 3M0EA 2N46A 1KK1A 4F4JA 1CJMA 2AXNA 3QG1A 2BMJA 1QDEA 4HDCA 1NI3A 2ZRLA 3EPJA 3KTAB 5KYKA 3C5HA 5F3WB 2P5TB 4GMDA 3TR0A 4QFMA 4Q7KA 5CLQA 4P4TA 3GLGA 1IN7A 2RGNC 2XB2A 2Z4SA 4LHXA 3RS3A 1CR0A 4DLTA 1CXZA 5G53C 3U5ZB 1G8YA 4PO8A 1Z8FA 1U81A 4LV8B 2YNMA 3TUZC 1EFRD 1OF1A 2F7SA 3WNDA 2Q3HA 2FFHA 1SVKA 1YHNA 3K0FB 4YMUA 2QMHA 2R6FA 2KBEA 2ZI3A 4JSYA 5C18A 4FI3C 2W6JD 1ZW6A 1NBMD 4DWJA 2FA9A 4U02A 4MDFA 3WYFA 1Q20A 3KX2A 4AKGA 1ZU4A 2MSEB 4FINA 4BZQA 1NBME 3LW7A 5JWRA 4D4JA 1E0JA 2HF9A 1KK3A 1YRBA 2GHIA 2IYRA 1VHTA 2BKUA 4QJ5A 3WMEA 4BLQA 2WJGA 4TL7A 4RD3A 3UKDA 1TNDA 2CL7X 2BEKA 1N2CE 2BCGY 1ZNYA 4HDQB 3MWKA 4EPWA 2ZI4A 1JEEA 1FTNA 1A82A 1HQCA 4CGZA 3V9PA 5FI0B 2AWNA 1S1CA 4DIDA 1T8TA 4RZ2A 2GAOA 1U0JA 3O8DA 4LY6A 4A6XA 1U0HC 3CRQA 3GJ7A 3R8CA 4IFEA 4LHZA 3PCRB 4LHVA 3GFPA 4AURA 2ANBA 2W83A 4Q48A 4X8LA 4Q4AB 1Z0KA 2QM8A 5JRJA 4M2LA 2ZU0C 4CEHA 2JJ2D 2GJAA 2ZRGA 4MH0R 2H8KA 5JHGB 2MSCB 4MUAA 3WYAA 1UKVY 1KHTA 4CEJB 3SJAA 2QN6A 4FMDF 4ACBA 4YC7A 2LKCA 5JEDA 3WMGA 4NE2A 1GVNB 5KNDA 4PC1A 1KI8A 4B44A 4XJXA 1QVRA 2Q21A 3S1AA 4QGGA 5AJXA 2Z5FA 4FCVA 5IK2A 3R7WA 1VPLA 2DBYA 2XZPA 3AKEA 3K9NA 4JBXA 4RCYA 2ZU6A 4LBYA 2FSHA 2OFXA 3VKHA 3VR6A 1W36D 2QE7D 2DWQA 2ZANA 3W9YA 1Z63A 1SZPA 3X1ZA 2DCUA 5EXPA 4J0QA 3JVUA 3SYNA 1NG9A 1NY5A 2ZRAA 4OK6A 2RH5A 2LWIA 3IQXA 2CLDX 4U7DA 1GKIA 3HPQA 1M2OB 4JT2A 4MRRA 1D8TA 2V4ZA 3K0SA 2OBNA 3PEVA 4G5RA 3OIWA 5AWFC 1E9CA 3U3OA 1W48A 4QHSA 3QF4A 1E1RA 2O52A 3L0OA 4RKFA 4Q9KA 5DIFA 1CR2A 5TB5A 3FFBA 5GJVC 3LAWA 5J4VA 1MO5A 1US8A 2QP4A 3G82C 3OESA 1OIXA 1J7KA 2WAYA 3CLVA 3QOFA 3U3RA 3PFIA 1GL7A 1G6HA 1M7HA 2QAGB 1N6OA 1NP6A 3B8HA 3QF4B 4HLUC 3CB4A 5D3MB 3SEAA 2AX4A 2EFGA 5LD2C 5HE9A 5FTLA 4A8JA 4A82A 5IF9A 2QEQA 1W4CA 2CXXA 1FMJA 3TRFA 2ZJBA 3GJ4A 5BYJA 2A30A 4KSCA 3RS7A 3QXHA 2OAQ1 1Z6TA 2O5VA 1Q3TA 1KY2A 2BJVA 2DWOA 4B48A 3EWSA 3MWJA 1CULC 1DAKA 3PENA 2YVUA 4BFUA 1FTSA 1G8PA 1QHSA 2VHCA 2Q9BA 2W58A 2ZQ5A 3P26A 5FL3A 1GDDA 4Y0AA 3VX3A 3EWAA 1GWNA 2R6AA 2WWXA 2D7DA 2C98A 3L82B 4LC1A 4PHFA 1QHIA 4XD7A 4IEIA 5L3RA 2BWJA 2QPTA 5EUQB 3Q7QA 2WWGA 1QHYA 5JCZA 2OXRA 5EZ6B 1C4OA 4PSKA 1AM4D 1TU3A 1TF7A 5DYIA 5BQ5A 3V00A 2HUPA 1R2QA 2YZ2A 2J0SA 1IN4A 1E1QD 3RS5A 821PA 3TE6A 2D7CA 2GBLA 2BEJA 3BFVA 4PPGA 5TDHA 2OESA 3A1WA 4TMTA 1J8MF 4XD7D 2JASA 5JJKA 4HZIA 4QHTA 1IN5A 2A3RA 3AH8A 4PC2A 5EE5B 5EUMA 1X8LA 3PUYA 1UKZA 1G7SA 3G0HA 1SKQA 1II0A 3BIFA 3BWDD 4BRUA 2L0XA 4PO1A 4B35A 4V0KA 4BEJA 2B21A 3I5XA 3E2IA 4MDEA 5F98A 3DPUA 1UBEA 4E5UA 1JALA 1HTWA 1EXMA 1Y3AA 2VHQA 4KBFA 3AGQA 3BE4A 1HYQA 4QM6A 4MYTA 5G40A 1S3GA 4G5QA 3H1TA 2D4HA 4M1WA 3RS2A 1KO1A 1XMJA 2JEOA 3DVLA 1Q57A 2V1UA 3TW4A 1G8GA 2X19A 4KAXA 4A0RA 5GJCA 4DEYA 2O8FB 1P9NA 1EFTA 4BQSA 3PUVA 3ZYCA 5EP4A 1YR9A 1SXJE 4UXIA 4IXNA 3T34A 3GLIB 5HZHA 3SI7A 1E2NA 3W6PA 4ARZB 4C2UA 2AK2A 1XEWY 2O0JA 5AUQA 4YQFA 2IXGA 4HZUB 1MKYA 521PA 1FMLA 4A2QA 3UXMA 3DKPA 3OEHD 3ADKA 4JYBA 3D8BA 3EXAA 2F55A 4POAA 1DS6A 4IVPA 2QE7A 2H16A 2Q9CA 1G291 1XTRA 4PHHA 1ZNXA 5JWOA 4U5XA 1UDWA 3NEYA 5J47A 1MO3A 2XSZA 1VYVA 4DDTA 1WE2A 1U99A 5IK2D 4DJTA 2V54A 4JSTA 5EE0A 1MH1A 1OXTA 3AF4A 4BRWA 2QBYB 2ZE5A 1R5OA 3CF0A 4B33A 4L9SA 2IYYA 4I1UA 1LF0A 1P61B 4S2EA 1CJKC 4ESHA 3REFA 2GXSA 1MABB 2C99A 3VR4A 2OXCA 4OI1A 4Q19A 2VH5R 2JJ2A 2IXFA 1H8ED 4HAYA 5CM8B 3WMFA 3FWYA 1GM5A 4TTPA 1KDOA 3WXMA 1F60A 5EP1A 1G17A 1OB5A 2I3BA 3EA5A 5GVRA 4D4LA 5A0FA 1I2MA 4HYYA 4HAZA 1W4BA 1VYTA 5D3QA 3GLGB 5JEEA 4M1TA 5GJBA 1XEXB 2UKDA 4LYFA 1Q12A 1BMFD 3AF1A 4BEBA 2Q0HA 2W2XA 3KFXA 4YXWD 1QZXA 5AUOB 1ZM7A 5AR1A 1GUAA 5DHAA 3BH0A 4C0QC 3K0CA 2ZM5A 1N5JA 5E3HA 3K9LA 3DMNA 4BECA 2O8DB 2JJ8A 4OI0A 1G64A 1SVMA 1FP7A 4YMWA 3ZZTA 1BOFA 2OUKA 3PJRA 4PSVA 1KJZA 4NCIA 3EPHA 4Q9IA 1PV4A 2ORWA 2PJZA 3AM1A 2KI5A 1G6OA 3QIAA 4ZO4A 4RFSA 4KSBA 2NIPA 2O8EA 1FZQA 3QF7A 1EFRA 2HYDA 4JLKA 2JGNA 3U7EB 1HY3A 2V6IA 1N0UA 4D81A 1LTQA 4HUQA 3EASA 1QVAA 3SNHA 1YZUA 3ZDQA 1E4VA 2IUSA 4MKIA 2R6CA 4A0HA 4NP6A 4NYIQ 4Z8YA 1ZBDA 4W5JA 1RZ3A 4UXJA 4YXWA 4CEIB 4A36A 3GJ0A 3ZGXA 2FV8A 4Q66C 4YONB 3D6TB 1W1WA 1AZTA 4B3CA 3KUCA 2FEMA 3HU2A 2O8BA 2ECKA 2VBCA 1S1MA 2HV8A 3ASYA 2FPKA 4ARZA 3NXSA 1JBKA 2PBRA 1ZP6A 2P67A 1GOTA 1I4LD 1P73A 1AN0A 1VCIA 3BOSA 3GJ8A 4KVAA 1W0JD 3T61A 1MOZA 4MKHA 2OCPA 2DWPA 4HATA 1E9DA 3CWZA 4DCUA 1H8EA 1E3MA 1G41A 3FHTA 2A7QA 3HP1A 1E99A 4LPSA 3RSLA 2H7VA 1E2IA 1E2HA 4TQAA 2BBSA 2RGNA 4HI0E 3B9QA 3H4MA 3R7WB 3WY9A 1DARA 2OZEA 3FB4A 4TSFD 1I4DD 1ZU5A 3OF5A 1AS2A 3U44B 4M1OA 3SQWA 2NQ2C 2ERXA 2WWWA 1NVXQ 3M1IA 4WZ6A 3WHLA 1GG2A 2RMKA 1CR1A 3BAFA 4D80A 1XCPA 2XSZD 4C2TA 2GA8A 4C0KA 3Q9LA 4EPVA 3A4LA 4TMKA 1OT3A 2C95A 4F4CA 1AKEA 3BORA 2XXAA 1UBGA 2ATVA 4FIDA 1A7JA 1TQ2A 4V0ME 4CF7A 4C0AC 3SJCA 4CYMA 1R0WA 2FEOA 4MUBA 2F3TA 3HR7A 3SFVA 3OEHA 2WJJA 4KU4A 3VU9A 1SVLA 5HCIA 1G21E 121PA 4EPXA 5KPDA 3EZFA 1GZSA 2QENA 4F93B 2HCJB 5DH9A 1Z07A 2IF0A 2XEXA 1US8B 3NH6A 1L4YA 1N6RA 3ZD7A 2OCYC 4QGHA 4CIDA 2AN9A 3AF2A 2UZIR 2ODBA 1OW3B 2C04A 2QI9C 4MKFA 721PA 1EX6A 4I99A 5EP3A 3Q8XB 1AJEA 4LRWA 3RRMA 5FH9A 5KU1A 4EKDA 2HCBA 2GCNA 3K8YA 1BYIA 1ZD1A 1LB1B 2QTFA 3QPUA 3P32A 1AGPA 3TVDA 2CLSA 3B5JA 2OT3B 4GMXA 1I2DA 4RVCA 1GP2A 3RANA 5KO2A 2CL6X 1ZM9A 5DLQC 4C0LA 2BM0A 4C0SA 4PQRA 1KZ7B 2HJVA 2OAP1 2GF0A 2PX0A 1KI3A 3AVYA 1WB9A 1OFHA 3WP0A 4BGDA 1SXJB 1NVVQ 1TF5A 3JZAA 1T8UA 3GLHB 4WOPA 4KFUA 4EIWA 1Z47A 1UEIA 4URWR 1YR6A 2C03A 4M21A 4ABYA 5CJ2A 1VG1A 3AUYA 2CVFA 2QGNA 4V03A 3W90A 4BLOA 2VHTA 3GCGA 1JPNA 2AKYA 1E2FA 1C9KA 1KK0A 2QTHA 2RAPA 1YE8A 5E95A 4KFRA 4G5SA 2PMKA 1CKEA 4Q4HB 5G41A 4B34A 2J46A 4LOAA 4HAVA 1NKSA 1OPXA 1XPRA 4H9GA 1FX0B 4HZUA 3K53A 4FWIB 3IHWA 1K5DA 1NVWQ 2QBYA 4NMMA 3K09C 4X8HA 2X77A 4XSGA 5J4YA 1KO8A 1AKYA 2WWYA 4D25A 1T3HA 3B13B 2QRNA 2YC2C 3LXXA 2KSQA 3RLFA 3TBKA 4RZ3A 3KQUA 1FW6A 2IF2A 1XX6A 1DO2A 2AFHE 2ZJAA 3QKTA 2W2VA 2D74A 2ZRMA 5F9FA 1YZKA 5JJLA 3EC2A 1LF5A 4OBEA 4LBVA 3I8XA 4QJ3A 2JLYA 4AIIA 2XNDA 2ZRJA 3SN6A 2FZ4A 1CLUA 2C77A 1N6LA 1G5PA 4TLBA 1MABA 3I92A 3LX8A 4ZCIA 5FOXA 4DB4A 3RRNA 2CCGA 4TZ0A 1KI9A 4ZDJA 1N25A 4MKGA 4FMDB 4BWYA 4B75A 4HLCA 3RAPR 1E1RD 1XTKA 1E2EA
chains in the Genus database with same CATH superfamily
2A9FA 4XM2A 1VFPA 5ERYA 1CEQA 1H1LB 3H2YA 1EU1A 5H3LA 2B82A 1A2KC 1Z5PA 4IO0A 2ZRDA 5AJYA 1GKUB 1E2BA 4F9TA 3KDPA 1JXAA 2V45A 4DN6A 1SMKA 5HVNA 3UJPA 4A0GA 4E5MA 3C6QA 3BA1A 3PC7A 4N1AA 4D8VA 3IBSA 3FKJA 1EE2A 1GPJA 2XLBA 4LNUA 4P84A 3OLQA 1GYPA 2E5FA 2AXPA 2AQHA 2IDMA 3FPFA 4J3JA 4OXYA 5A03A 5FKJA 1AXGA 3JQPA 1KI6B 4QFCA 2R8YA 1N8NA 2FWPA 1YS9A 5IRCD 1N0IA 4YRBA 4JXXA 2R6GA 4L8FA 3OMWA 2W2PA 3MRXA 2YXLA 4NBUA 4TXNA 1S8AA 3GLHE 3A9SA 3NPAA 4WZBA 2ZPUA 5H83A 4B47A 2I65A 2WHXA 1Y42X 1EFLA 2H0AA 3WV5A 3L7KA 1XA3A 1J8VA 3PS9A 4MVJF 5DULA 5IT9A 2PN1A 4O1IA 1SXPA 3CPHA 2GMWA 3CEJA 4HQNA 3GR6A 2C4KA 1U8XX 3URKA 2XITA 4GWKA 1FVFA 4KFCA 1RRFA 4X3PA 5CHYA 3ZV5A 3A6DA 3UV6A 5CEJA 2FDCA 2VF2A 1OBOA 4LZOA 3PB3A 1XIVA 1Y5NA 3IPRA 1XC7A 1T0BA 2OC4A 3D4PA 4NONA 3MG9A 4QNNA 1OI2A 4NS4A 4R5HA 3ANSA 4TM8A 5G0UA 3TEJA 3V3KA 4M6WB 1E7SA 3M4JA 3ZQUA 4NR0A 2W0SA 5CIWA 1M5TA 3OVMA 3RWMB 5JCOA 1JQ5A 4UBMA 3NTUA 2B20A 1JA9A 1MO4A 1ND6A 2VUUA 1DEAA 1ZRSA 2GPYA 3EUEA 1E92A 1L6IA 3KSRA 1PS9A 4ND4A 4KXNA 3A04A 2OR3A 4JJ6A 3UVEA 4MRMB 5ECYA 4GI1A 5TLSA 4DQDA 4QQKA 4CL8A 4B8WA 4UUBA 3Q8LA 1IZ8A 1DRVA 4WN9B 2BGJA 4HSEA 3JS5A 4JLSA 5FO0A 5JAMA 3EZ6A 5KDDA 3W3AA 1RXIA 4DSOA 2QXUA 2WKRA 1ZXLA 2ZI7A 5ENZA 1XZFA 3UPUA 2VSFA 1D0SA 5IDYA 1J25A 3WP1B 1CJVC 2E4WA 1SD2A 4LQCA 4NE9A 2PSHA 2WYOA 4EI9A 1BVHA 4L5YA 3GP3A 2GZ3A 3HDYA 4TQ9A 1HEYA 4P98A 1N2CB 3UMBA 1II8A 3D7LA 3AP1A 2ZTMA 4M1SA 4Q3CA 1BZYA 2VKTA 3VPDA 3ZKWB 4RVDA 4XDHA 3X1WA 3UFXA 5BN5A 2B6HA 1OSNA 2W8ZA 5EKSA 1N5LA 1ISSA 4MGZR 2I33A 4OYHA 3W0LB 3PP8A 1WZ2A 2QYHA 1LNZA 4REQB 1F3LA 5DF1A 5K8IA 1UK9A 3VYTB 1HE3A 1SUSA 2UVQA 5LQKA 4KE9A 4KYTA 1GPNA 4D74A 4DG5A 2ZZMA 4K8OA 2A33A 2EW8A 1Z22A 4IQ0A 4REQA 2D1RA 4TLDA 4E51A 5EKTA 3NKFA 2X3UA 3TTSA 1DKQA 3VYSB 1E9AA 1SA0B 2WY2D 2ZUDA 2QQFA 2ZIXA 3V97A 4XRRA 1CZLA 4EJ2A 1MEEA 3NBFA 4JJKA 3R9WA 4DCNA 4NZPA 2F9MA 4QGAA 3ME5A 4PYKA 5EPUA 3E61A 5B1YA 3L8EA 4ETNA 3ABQB 3CLHA 4XZ3A 2HXSA 2O2XA 4MQEB 4UBLA 3OKFA 3AJ9A 4YAOA 3W78A 4OKNA 1VA4A 3IEIA 3OWXA 1X9IA 3F97A 1WX1A 2OHFA 1PW7A 2W2TA 1AK9A 1K8XB 4B7AA 1X1DA 2QJRA 3QQPA 2BEUA 2F1HA 3H2HA 4MLZA 3KZ1E 2V6GA 4XIJA 3GVPA 1SHUX 2EJUA 1CTQA 3EW7A 5IBCA 4FFMA 2KX7A 1KL7A 3AR3A 1R4MB 2JI9A 2V7XA 4L0QA 2IYPA 3KQWA 1KP9A 5DYNA 4F38A 1DINA 4UTPA 4ZHQA 2RGBA 4RE6A 2ZRKA 1Y3BE 2VL7A 4B6OA 1UOQA 4J43A 4Z53A 2DLNA 4U9IS 2AN3A 1CY7A 1AUOA 1UBSB 3E3MA 3HB1A 3KK0A 1XP5A 1A1VA 3DM9B 4CEIA 2FAXA 2GZAA 2RDMA 2Q4RA 5BSGA 2AMJA 3GUVA 5EXSA 1NVBA 1WHTA 1I4TD 3V7UA 2BM1A 2H08A 3ZBTA 1A27A 2AOUB 1H0RA 3P4UA 1S9DA 4R31A 2FF7A 4C7XA 2VZLA 3D31A 4HLQB 5DCWA 4B0PA 1NQTA 1SG0A 3A6KA 3HDQA 4K9SA 3RRYA 5GM2A 3V32A 1M8GA 4IZIA 4Q5IA 1YT5A 1OMOA 4PX3A 1QYCA 4TMVA 2Y1GA 5JWHA 3VNAA 5H7XA 3VZCA 4E1BA 2NO1A 5FF9A 2V97A 2ZTUA 2GM5A 3DDWA 2DSNA 4GF5A 3HZOA 4GOJA 2GX6A 4OBXA 3ISTA 4CR6A 4DLBA 1JHDA 4F12A 1MA0A 1V37A 3HBAA 3IBYA 3Q3JB 2QMQA 4JN6B 4YT4A 4NH0A 5ICEA 3NGMA 2WF8A 3EYAA 3JASA 5ARDA 3D6FA 2W7TA 3L7YA 3LWDA 1AF4A 2E1PA 3NHWA 4QBFA 2HLDA 4YQZA 3H65A 5JDIC 1JI0A 3O3OB 4DPLA 5LQAA 3EG5A 1W2HA 1T34A 4ZHQF 2IYUA 2XA1A 1I4EB 2RHGB 3HHEA 3CGWA 2YUTA 2H4FA 2AJLI 4UJ3A 2BPOA 4LZZA 2WNSA 4ZVSA 3TPFA 2NYVA 4P58A 4ZXPA 3C1AA 1RMYA 4F9FA 4YPFA 3WRYA 1ECLA 4R2XA 5HSGA 2ZS9A 2B8TA 5FBLB 4NATA 1XHFA 3JVEA 3VHXB 2EWVA 2AEEA 3L40A 1KETA 2OD7A 3AEUA 1GARA 1L3BA 3CV3A 3HVKA 1NZDA 2A59A 3LGAA 3O1JC 3QOXA 2H11A 2WG0A 4IRUB 4EFMA 4YT8A 1R27A 3IIJA 4G1EB 3ANLA 3T3EA 5EJ7A 1IQPA 3NP7A 4GYJA 4O4LF 2DY1A 2V6JA 3K1ZA 2A92A 1KVQA 2IYFA 4LXGA 5K0SA 4Q4AA 4W63A 2BMAA 3TTWA 3UICA 3FNFA 5CB4F 2I91A 4MV4A 1ADFA 3HYNA 5ALNA 1NN0A 4BVKA 4DE5A 3TI7A 4PLPA 1BKDR 3R74A 4QDZA 1BDIA 4BFYA 3W3ZB 1KR2A 1V8FA 1SC1A 3BULA 4Q6WA 3UG7A 3CSUA 4ES6A 3KVVA 3PGVA 3OX1A 1OFVA 3OU2A 5A5DA 3HBJA 4NV0A 5D6NA 4CBVA 4HCJA 1V3TA 1E1YA 2D2VA 3RHFA 2D06A 2R5FA 1HT3A 3F3SA 4RTNA 4HBGA 1B2LA 1AG9A 3U60B 3K73O 4MB6A 4PSAA 1C29B 1Q44A 4PNPA 1WCWA 3M5CA 5KHOC 2YHIB 1XVLA 2PH1A 2QN3A 3KXDA 3U6KA 4WXRA 5CX1B 4BNDB 3OCXA 5JZBA 4XCVA 2RBEA 1RCUA 3BMNB 3CYFA 3U3MA 3ADDA 5IM4F 4LQ4A 4YCDA 1JH8A 2QVLA 5DHUA 1HF3A 3EXIB 3WFIA 1ODFA 2XTZA 2VNAA 3O8LA 3L7NA 2WBLC 5B7NA 2BGTA 4YH1A 1VKOA 3IULA 2H2FA 1DBWA 2ZYVX 3KBBA 5LP1A 4X7MA 1YC5A 3EBOA 4P4GA 2XTNA 2ZT8A 3DCJA 4RULA 2V8BA 1LY1A 1JR3A 2QRJA 3A4VA 3FTQA 3WQBA 5EHIA 4B1FA 2WU1A 4RGVA 1IM2A 3I5AA 5JMPA 5GINE 4G09A 1QCYA 4ZYUA 5AIBA 1RSZA 6ADHA 2R7KA 1Y5LA 2QYTA 1JDSA 2ZJ4A 3FHJA 5AVTA 1NV9A 3VAYA 3CZPA 3FRJA 2ZDHA 4X1YB 1ZSNA 5B64A 3I72A 2KM1A 2O7QA 1QO0A 1SQGA 3DBLB 5PNTA 2XMDA 1AB6A 4Y1EA 2DERA 2NVUA 3PHIA 1APBA 5B37A 5FWXB 1EINA 1SOVA 3EGEA 5DGIA 2I8LA 3V33A 3OZAA 5IDXA 4BFVA 1R5BA 4UCQA 5CIQA 4UM9D 5JRDS 1BMQA 4FLEA 2XZOA 3O8CA 3QKSA 4TXLA 3F7NA 3MWEB 4NEHB 1RHUA 5I7HA 3RU2A 4AQDA 4J07A 3EPLA 4QT0A 3NYQA 2JIBA 4OF4A 1XMIA 1XU7A 2PUTA 4TTRA 1EAMA 1UBUS 1AUVA 4KODA 5B6JA 4C3VA 4X3CA 1RWNA 3DL4A 3NETA 4RCVA 4WFIA 4Y2JA 1GN8A 3A28A 1G3MA 3RRZA 3TO5A 1G3UA 2DT5A 3QU4A 2NZYA 3UAGA 4BVBA 3SK0A 1JG3A 3BD9A 3THXB 5E7QA 2PDAA 1O95C 2XOKD 4US1R 1N2ZA 2EW2A 2MU1A 3ZXXA 4FSHA 1VJDA 2N3ZA 3SC2B 1MT3A 5JASA 3NHUA 4JJ4A 4OXKA 2ZJ6A 3QBEA 1FJGB 4YCAA 2MCFA 5EJ8A 4DV7B 1FZTA 1LBTA 1I14A 4BNUA 4I1RA 3F6EX 5D1HA 2YWJA 5JAUA 2IQIA 4QTTB 3TIVA 1H3EA 3RE1A 5D87A 1P45A 4KO2S 3W8FA 4ADSG 2WWFA 4IDBA 2R84A 2I1VB 3TSCA 5IU6A 4B6SA 1HZZA 1XNHA 3IDFA 3L7JA 4R81A 1TIPA 5U1PA 4F11A 1KFCB 5HKOA 1FU8A 1OUMA 2CFOA 2BHNA 5IDQA 3F73A 1DTWB 3GZNB 1L9KA 5BVHB 1R7RA 4WXYB 3QQ5A 3A1CA 3MWDB 4JB0A 1HDEA 1VE7A 3ODGA 2WWRA 3AKZA 1U8CB 3WKAA 1USGA 3VH4A 1AO3A 2O5RA 4I5EA 2K87A 3ZCQA 3OPVA 2O8CA 4EMBA 3D7MA 3TXAA 3KB8A 2AZMA 3L6EA 1GN9A 5HCUA 5EXEA 1NG1A 2GJ4A 4HJXA 3UHJA 1AV7A 3BDVA 3WK5A 1I80A 3OJOA 1KJ9A 4G26A 1K68A 2OZVA 2VG8A 1BEEA 1V8DA 2BMVA 1S2OA 2CVPA 4KZPA 4G9GA 1WWKA 1ONNA 4Q7QA 2GPBA 1JKIA 1OR8A 2JD0A 2GUWA 2YOFA 4MPDA 5A04A 1KEUA 2GESA 2I2DA 1PV2A 3UENA 5B3KA 5LR6A 4JXJA 4PAOA 4DXAA 5KREA 4R1UA 3OQ6A 3P71T 5CRIA 5ARBA 4JLVA 2H57A 2JATA 4BLSA 2HT6A 2FP4A 1WXDA 2DHDA 1DJPA 2BHLA 1XQ1A 2BSAA 4QO7A 2NTNA 5LFAA 5AK6A 4N6NA 5DMHA 1YJAA 4B85A 4U0KA 3RBZA 3HJRA 3BYZA 4CF6A 3MQ4A 3FMOB 4D3YA 1U0BB 2ZREA 2ZT5A 3ZKAA 3LDAA 1VLVA 4NNPA 3D8HA 1H85A 3LQRA 1Q7GA 4PZAA 3GPDG 3K15A 5DDIP 1OXUA 3P9NA 4B17A 4GWLA 2XVXA 4EARA 3OIDA 4FHCA 1T9GS 3UK1A 4HB4A 4OHFA 4ZI7A 2WTUA 3GJRA 1RM0A 3A3YA 4OOFA 2EFEB 3JWEA 3L9XA 3L0IB 5EKUA 2PL9A 5AW0A 3F6RA 3LCCA 1IWBB 4QX6A 3AVQA 5AMXA 4ZI7B 5JOQA 2O14A 4HDNB 3SSAA 5JW6A 2C82A 5JJBA 2HM7A 3CLTC 4F8EA 2BR3A 1E0SA 3KO8A 3OT4A 3PDIA 3QM1A 4QU5A 3THRA 3O7WA 3CPSA 5JXIA 5BOSB 1BN6A 3ANMA 4GXQA 2HFJA 4AKIA 4OK3A 4M1MA 5ALEA 4UQLA 2VEDA 3VISA 3KVOA 3LC2O 3D0RA 1WETA 2C5SA 2V5VA 4TYWA 3BE6A 3BKXA 3R4CA 4FN5A 4A8JC 4YJ2F 4HB3A 3BQNB 3AT1A 1SHLA 3BT7A 1FSSA 4E88A 1A9QA 2FN4A 1PJ3A 2VWQA 3IAUA 1XDSA 4UBOA 1H2WA 1E6WA 1M2JA 4RANA 4TV9A 5FWYA 1FPMA 4QBKA 4TMXA 4RDXA 3DXZA 2VJOA 3HPRA 4KZKA 4PPFA 1T1JA 1XZPA 3IP9A 4BX8A 5IT0A 1G2IA 5ELXA 4Q9DA 5ERGB 4PYOA 4W9NA 5IHPA 3EGWA 2D0IA 1ZN7A 2FOXA 1EP9A 1V9LA 2ZTSA 3D81A 3H9GA 1E9SA 1T5IA 1VG9B 3O2JA 4CKEB 1AKNA 1BHO1 4Z7NB 3TL2A 5AHKA 3VDMA 2EFCB 2YJNA 3C1TA 1J8FA 3G5UA 3NHAA 3TW8B 5HPYB 3WLEA 1ODTC 2QZ4A 4Y2TA 3KR0A 4ZOEA 4DA7A 5IFKA 3VSEA 2WTNA 1PJ8A 4YWHA 3BMQA 4YP1A 2JEZA 3QVLA 1N2JA 2SICE 5DGXA 2A5FA 4LI3X 3WGQA 2NX2A 4CT0A 3WR5A 5EJ4A 1G16A 3U80A 5DK4A 4PHCA 3PQDA 2JGJA 3QOWA 5IMBA 3SDBA 4Z5XA 2WJAA 3G6WA 4KQKA 3LOPA 3HKCB 3OHMA 4UEJA 3KAQA 4R41A 3IDQA 4XPIB 2RAFA 3P2IA 4U2EA 4EW1A 2X1MA 1VLQA 3BICA 2XCRB 1X1TA 1ST3A 5AHWA 4JV5B 3FPKA 4RK4A 4DLPA 3UATA 2WKQA 1PZNA 2PMBA 4RUKA 5A6SA 5AJWA 4MVJE 3H0EA 4KO8A 3D8NA 5I9BA 4EBFA 3NEJA 1CUAA 1OX4A 4GX2A 1TTHA 1KQGA 4AKTA 2R2GA 1J5XA 3D7KA 1M0TA 3D6UA 3VJKA 4Z3KA 7AT1A 4KWEA 1RFLA 1UM8A 1W6RA 1HQYE 4MVJM 4AD8A 1DKOA 1UQTA 2IEBA 3I6IA 4HEA1 5FUVA 1G8HA 3WLPA 4CM1A 2C07A 2RJNA 4Q3EA 3FZYA 3MMZA 1JTFA 5AKKA 1M54A 1WMFA 1R5JA 3G79A 3UQZA 3GX1A 3DE7X 1BSVA 4ZGBA 4IKPA 3ZQ6A 2Y93A 4IP0A 5A3SA 4YLYA 3NDJA 2QD3A 3IUSA 2HPAA 2H2DA 4HG2A 1VCMA 2EP8A 3R0VA 4RD2A 1EFKA 4WUVA 4DW8A 2NSLA 3B36A 3HXPA 2BRUA 1PV1A 3IA2A 3FUCA 4IZHA 3W2GA 1ZD3A 3PQ2A 5J40A 1K0FA 4CKZA 2JCSA 2VDRB 1RNLA 3QKSB 1XQXA 2CJPA 3C48A 3ICCA 1Z12A 1RI3A 3P7MA 2ACKA 1JG7A 1UBRS 5IJAA 2VK4A 2NTJA 3Q3IA 4QD3A 1W96A 2ADFA 2GILA 4MQFA 4DBVO 4S1VA 2MOKA 1BS1A 1QU2A 5AI4A 5JSUA 2V55B 3KXKA 3OCVA 4NJOA 1M67A 4PXAA 1JF8A 1PCXA 5JYBA 5ER9A 1NQOA 3IEXA 4BV3A 2QXTA 4JT4A 2FX3A 1BWPA 2AYXA 4F4DA 1MA3A 2IY7A 4C6TA 1QIMA 3BTOA 3AF3A 3RG8A 3C3CA 3BL8A 4HNSA 1N8KA 5D00A 1J9EA 4G9BA 2FPPA 3IR7A 3LVQE 2P5YA 1UXOA 3VR2A 4CRWB 1WB6A 1V5FA 2XYVA 3KPVA 2O3TA 2IV7A 1YZFA 3W9UA 4DBLC 1U9IC 2ROQA 3QNUA 4RZSA 3W5IA 4U2BA 2W2KA 1QF7A 1AKTA 3UH0A 5CYOA 3RCBA 4E2WA 2Z1NA 5CTJA 4RAQA 4DOMA 2WJPA 5BMOA 3IBGA 1NJSA 2GEBA 2ZJYA 4IMRA 5DSZA 3WSWA 3ZX5A 5GONF 3S7TA 5BR7A 2Z0MA 3UBMA 3UJCA 2D1SA 3TUIC 1ISJA 2WZQA 2FQWA 3GI1A 3P8ZA 4MIEA 4AO7A 4LDPA 5T3YA 1Z5WA 3KDAA 5A6VA 4FT4A 3NASA 2J0UA 1ODCA 4KOEC 2H06A 3PGJA 3RC3A 4GL2A 1VBFA 2Z3ZA 2V3WA 4URYR 4CM8B 1JPJA 1XDBA 4IR7A 5EZYB 4AJKA 1RC1A 3P27A 1TJ5A 1WUTA 4LG1A 4IDEA 3SQOA 3W1VA 5KNLA 1ISRA 1GKLA 1K0UA 1RQPA 3TF5A 1C81A 1CEEA 1JDTA 4IUCS 4NF2A 4IZOA 5H3CA 3TPCA 1H05A 1HO3A 1XDWA 3CRRA 6REQB 1JIIA 1H2AS 2HO4A 3P19A 4GI5A 4Q05A 4EY3A 1PWHA 2P2ZA 4DABA 1P62B 2VP3A 5F35A 4CMGA 3L7IA 3F5FA 4Q21A 3KBOA 1T4CB 2KBFA 2REBA 3NWEA 4FEGA 4EX6A 3AUXA 1M0SA 1EA5A 5AHXA 5EMJA 5GP1A 5C3UA 1ZA1A 5JS6A 4ZOLA 2AG1A 4OI2A 3GGJA 5DX8A 4BMSA 5A62A 1PDOA 2IOFK 1G8KA 1O96A 1IHUA 3DWGA 3MJCA 3CZQA 3AIKA 5FUYA 1G21A 3D3KA 4ZAVA 2IEDA 4QXMA 1N3LA 3FA2A 1RI1A 2DFPA 4B76A 4WLOA 1QU3A 1BGXT 3C8UA 5JCXA 4ESVA 4EG0A 2F1RA 2XTAA 4QYIB 4R3UC 5JAPA 3FCAA 3W8DA 1DMSA 1K9SA 4M9RA 2R8RA 5AUPB 1K4YA 2WMNB 1LI4A 1KYVA 2WWIA 2WYHA 3SR0A 1BD4A 4F04A 2AG8A 4XQEA 4ED9A 4X85A 3SAJA 3NT2A 3QVOA 4EP1A 5DYGA 4RGYA 3SZMA 4FNMA 1C3OB 3BVPA 2E4XA 3R3UA 3WIBA 2C9ZA 4ER0A 2GETA 2HD4A 1NRJB 2WUFA 3VAAA 4C30A 1UZUA 2YJGA 3UCEA 3KKMA 2R00A 1PBNA 1SKYB 4RKRA 4NECA 5C8ZA 5T41A 2ISQA 2Y1OA 5IT4A 2ZZKA 2QV0A 4IIJF 3REGA 2O19A 2C8LA 1WUHS 3ZJTA 4WEQA 5GIOE 4NV3A 3K20A 4IO1A 4OUDB 2BFAA 3C5EA 3IQHX 4AG6A 4TLMB 4DV5B 2C0CA 2CNWD 1TJPB 1P0MA 2ID9A 4UM9B 2OO3A 3M33A 5TXGA 1CVLA 5A2GA 5IJ0B 1AS3A 3ETLA 1N36B 3PL5A 2Q5IA 3SM3A 3UXEA 3BMCA 3G0BA 5KSYA 4QFDA 2IPLA 4HWTA 4O4JF 3JVVA 4JU8A 3GO4A 1RKBA 1N6NA 2FUG1 1GIAA 5KHLB 5JNVA 2J0QA 1KO7A 2CJYA 2QLTA 3RU7A 5I3ZA 1DDIA 1QJCA 4IOLA 4BNGA 1LBEA 4URVR 2Z09A 4TLEA 2FQYA 4PLFA 3V8MA 1J0BA 2YASA 3REOA 5FBVB 1X1QA 1UKBA 2NYRA 1N6KA 3T5BA 3WDKA 1SXJD 2DXIA 4V1CA 1TYBE 4Z4FA 4CCSA 3JZIA 3NDPA 5IEJA 1QM5A 3PNOA 1RXYA 2IP2A 4GX5A 2C78A 2EG9A 2JAWA 2I4NA 4IQ8A 3ROFA 3OLVA 2PT6A 4UDYX 1UKEA 4LJ4A 3OQHA 4J29A 4PAQA 5EUCA 4LK2A 5ALSA 1TD9A 2CWDA 4R9RA 1NQ5A 2C9CA 3E23A 1KGDA 3EAFA 1Q0ZA 2ZKIA 3CPJB 4YBZA 1P2BA 1GQFA 1CUVA 3AHJA 4YP0A 2EP7A 1E1DA 3TSYA 3WLJA 2XRZA 1UJ6A 2IITA 3WLQA 3VSAA 3UMFA 4FFVA 1X74A 1ZEMA 3HO6A 3LBIA 3PQ6A 1WIWA 4IJUA 3UC5A 3WGGA 4AP6A 4UTVA 5FV4A 1GUZA 2EJTA 4CLEA 4DLAA 1KH3A 3ZIAA 1FVOA 4HQ0A 1VHLA 4FE4A 1KIFA 3V8EA 2RGCA 3PQCA 3TMKA 3WHPA 1L4UA 1QCCA 1P8AA 3JAKA 1TU0A 2WM8A 1Y3HA 4WY2A 2X5XA 4N5MA 1KO4A 5FTWA 1CZKA 1VI6A 3BZBA 4ILKA 3ANYB 3DV2A 4EL5A 2B78A 5JCPA 2HT1A 4QVGA 2G9RA 1JECA 3DDHA 2YV3A 3V2GA 1KTVA 2VSOA 2GUGA 4IUYA 1U7HA 5HJ2A 1QO0D 3VH3A 3WSVA 4BQEA 5CA0A 5BSVA 1IBRA 3NOVA 5I7WA 5JECA 5LLTA 4HGZA 4EEXA 4JYPA 1B6SA 5PGMA 4JL5A 3HNOA 3D1VA 3NTVA 4JEMA 1TB4A 4PR0A 1ZA2A 1AMUA 5C1OA 1UAAA 3RS8A 3KSMA 4C04A 2PWAA 5A0TA 1Z56C 3UYLA 4CQLB 3OZBA 3QUCA 4DANA 3GUUA 3Q2IA 4X1YA 1ZMTA 1KS9A 3DD5A 3KZNA 4MK4A 3TRHA 1UFQA 3TZKA 4BQNA 2A67A 4ENVA 4JI0B 4C03A 1MORA 3DOJA 4XYBA 3TTXA 5FWNA 1K6XA 3GEPA 3MS7A 4GM4A 5DXAA 5G0WA 5KX5A 1OYOA 2B7BA 4ZVQA 4FW9A 4L22A 2G7ZA 5KUTA 5J5VA 3N2ZB 3PUWA 4B4UA 1RHQA 1EFCA 1D2AA 2UDPA 2X3FA 1UOOA 2HTEA 3LO5A 2Z2XA 3FW1A 3KJHA 3KKKA 3M34A 3PKJA 4TV8F 1M76A 4LYHA 4AVYA 1Q91A 4AYTA 2XV1A 2FZGA 4KHPB 3K0AB 2J59A 1BKSB 4G97A 4LOLA 3DZBA 2IHKA 2ZWIA 2X2FA 1QGAA 3K32A 3O3CA 2QN8A 1R12A 5BQFA 3GU3A 3ROKA 1EKXA 2GK7A 2QLFA 4J75A 1C9MA 3AKYA 1OV6A 1E9RA 1Z2AA 2EFDB 2HA7A 3FVWA 4HRAA 3ESZA 2W6QA 1YDHA 1QUEA 1VJGA 3NRJA 2H1FA 3ZVLA 1T9DA 1JZTA 2HK9A 5CNJA 3I5MA 3L7DA 3U3ZA 3O4RA 1WU8A 4DPMA 4WBNB 3IVAA 1I0LA 3HVRA 4RA9A 3HB4X 1XMPA 4IHJB 1YDFA 5E3JA 1HE1C 1K9VF 4C6HA 2QYOA 4R7TA 4Y2HA 3IGFA 1NGSA 5HDQA 4YMIA 1SXJA 1NW9B 3UT6A 4WBNA 1V16A 3FZGA 4G1UC 1SIUA 3I2IA 2X4DA 1SXHA 4FYKA 2QQEA 1UM9A 3TLYA 1MT0A 1IPHA 4GW3A 2C4HA 2FUEA 3C98A 1HRKA 5KNDH 5BN3B 4TS9A 2A5LA 1K1EA 1PWZA 3BX1A 3Q2KA 4EH1A 1ETUA 1DAHA 2AKAB 1KY4A 1JYSA 5FUQA 3E22A 3LY9A 4LBWA 1PGPA 4WPGA 3RJZA 4YCJA 4YROA 4L9WA 3TXXA 4QTXA 2OMEA 4N40A 1YQEA 2NZUG 1S0UA 3NFRA 3OZSA 2YHIA 3MZ0A 1IUNA 1CUUA 4JLUA 4GX1A 3Q4GA 3VC3A 2WMDA 3AKDA 3KG2A 1LBIA 1M34E 1BG6A 1F17A 3JWPA 4WDQA 3T99A 3ZCXA 5DTRA 1VKJA 5G1NA 2B5VA 3B6KA 5CLLA 3W9BA 5CLFA 2FNAA 1NA5A 4ZAYA 4LZPA 1XRNA 4WSOA 3Q9NA 4QU9A 5FL7D 1KZGB 1PG5A 1U5BB 4N0MA 3RVDA 3VPGA 2GCEA 1VJ1A 3VMMA 3ZE6A 5TE9A 5IXJA 4L08A 4GT1A 2N42A 2K2QB 1RYHA 3R0ZA 4J8PA 5C5DA 1O8BA 4MCHA 3LK7A 4R8SA 1GCOA 1NNSA 2GB4A 3JQ6A 1QQAA 3ESAA 5HP4A 2QVZX 3GUZA 3WL7A 2FB9A 3KOYA 2M32A 4OSPA 4EFNA 2OCXA 3WNBA 4LC0A 5AW9A 1P2UA 3PLNA 1W9MA 5DI9A 1PNOA 4P81A 2GI4A 5IAGA 4U6NA 4R2HA 5KTPA 1YBHA 2XGSA 3PX3A 2YMPA 1XXHA 4G4SP 1ZJ5A 1AKUA 3NG1A 5CMLA 2WG2A 4O25A 1UKYA 5SZIA 4GVLA 5KVVA 3OY2A 1SVUA 1Y9AA 2YR0A 2DUJA 3EC7A 4W1QA 5JVDA 3UWKA 3C8ZA 3N9IA 3LFHA 4RV9A 1HLGA 3KJEA 4HAIA 5KTOA 4ILEA 2XF2A 3C6MA 2JGDB 3MF4A 3BRWA 1QZUA 5JBNA 4MRAA 5JMOA 4DRXA 2H63A 4CFYA 1VBMA 1Z08A 2YW2A 1X7DA 5GZ3A 4CMAA 2G9NA 3CUYA 3R0JA 1PD0A 4TKUB 5KINB 2Y0CA 1AUPA 2BELA 4KE8A 2C2YA 1Z28A 2IYTA 3OOJA 2G5PA 1G3RA 3KL2A 4HH3C 2VJQA 3M6FA 2FSGA 2PKQO 4TL6A 1TM4E 1DOAA 2WJ3A 2DKFA 1Z0ZA 3MJDA 3OZRA 2ZSBA 4XX0B 1L7PA 1O6CA 4PRKA 4HAWA 4MHOA 3ZBPA 1X8XA 4OL9A 5JO0A 1Q1ZA 1I6WA 1M2VA 4ERXA 1XZBA 2JS7A 2J41A 2WV9A 2Q62A 2DEUA 4UATA 4L1KA 3T1QA 2ZJFA 3O4GA 2F90A 5E6SB 1RWXA 1P1IA 4W7HA 4UTZA 3V5NA 3TNDA 4PANA 4HT3B 3FETA 2DWCA 3MGKA 4YMHA 2ZSUA 3F7MA 1K08A 3EA4A 3VYUB 3ACCA 3GIWA 4HUQB 4ECAA 1BH2A 5DNUA 3TH5A 1KARA 2CBGA 2L2QA 3N5CA 2FW6A 1N9GA 1UXIA 4JX8A 5D5QA 1E6UA 1YU9A 4ZZIA 1BIFA 2UVDA 3Q9SA 4B5LA 1E3DA 2PRKA 1T2EA 3GEMA 4N12A 4BLTA 4XOIA 3VR2D 4L3WA 4NKRA 3S1SA 4DB2A 3PRJA 4LISA 4MZDA 1SKYE 4W8GA 1AUQA 2NW6A 4M0LA 4JODA 4ZYLA 4NZNA 3OPNA 2IOHA 3IOCA 4BO2A 4YRGA 3WXBA 4C4XA 1EFPB 2JIZD 2GSDA 2O8BA 3W5JA 1BWQA 1VE9A 1QGDA 4GLBA 2HHCA 3DLIA 3EQ9A 4A16A 3IB6A 1YQUA 3OLCX 3G9QA 1UR5A 3GRAA 1N4DA 1OLOA 1C3LA 1M8KA 4P7FA 1TMYA 2ZI6A 3CN7A 3RSZA 1X2EA 3FE2A 2DBZA 4B79A 4HDRB 2ORVA 1LJUA 1NM5C 2W43A 3DL2A 2V6MA 4GM0A 5E8RA 2LIPA 4WDRA 1S2NA 3OQJA 4YEDA 2IHZA 3QV1A 1OI3A 2ZBGA 3PV0A 4HDOB 4QYTA 3BCSA 4S1PA 1EJ6A 4XYMA 4YT2A 5KJ6A 5J2UF 2P41A 4C4AA 4HN9A 3QE3A 2EDCA 3JTMA 1YZLA 1E3JA 4L07A 4UMEA 3N59A 2BGKA 3NC4A 4L8WB 3FIJA 4P5EA 4Q02A 5F76A 5EFOA 2OXIA 4YNBA 2EBWA 4DDUA 5L3ZA 1NUPA 4CJXA 4J1TC 3UW1A 4HB0A 4HWRA 3TDNA 3AW9A 5BSHA 2UXBB 3TZEA 4LAFA 4F8JA 1S2MA 4WACA 4HTFA 2Q07A 2OAEA 4D98A 1GADO 3RM3A 2C7VA 4DUGA 2CMGA 2XNHA 3U40A 5K3DA 3SHVA 3KQHA 1SBHA 1L5RA 3I2FA 4NBVA 2G04A 2WWHA 1A9TA 4MV8A 3OA0A 2JA2A 1EFUA 2VHEA 3V80A 5JSZB 1SHKA 1CX9B 1YBAA 5JI3E 2V03A 3F49S 5ALPA 4EKYA 1EGHA 4EYGA 4MR9A 1T0PA 2R751 1DFGA 2C5GA 1IVNA 3TJMA 4GAEA 2CHFA 1WEHA 3PL1A 2YBDA 2GD6A 5EVJA 3MGAA 4B8YA 1QIHA 1EXDA 3RJ9A 3CUKA 1RP1A 2ZRNA 3S70A 2BGGA 1NONA 2FHPA 3I0MA 4MYCA 2BVNA 5CNKA 1GPAA 1SUFA 2DQKA 3K70D 3KZCA 2G0TA 1RQNA 3OC0A 3SX0A 1G20E 2QZZA 3QWIA 4LMPA 3RFUA 2HCTA 1BCSB 3VTZA 5LBTA 3S2SA 4YLEA 2IXEA 1CZRA 1MPTA 2FH5B 1X19A 1PD1A 4BJ1A 4YCSA 2E87A 3IVGA 5H4HA 2GZDA 4TX1A 1FMFA 1KR5A 1MJNA 5SZKB 1SC4A 1UBLS 4FFSA 4TYQA 4LFBB 2CE2X 1KSJA 2J6HA 1MO2A 3LC7O 2DAPA 2ORYA 5ICGA 4JA0A 3O4IA 1PGNA 4BEVA 4FFBB 2O8FA 1Z29A 2GZHA 4NBNA 4IMIB 2OE2A 1IBSA 5H16A 1ULTA 2OBYA 4PZZA 4JUIA 5L4NA 1MV5A 4HMOA 3E03A 3PCXA 1XF9A 1VJ0A 5HIIA 4NQZA 3OQPA 4J03A 2DLDA 3C3JA 3UMJA 2FRDA 4MGHA 1OIVA 2VPQA 4RELA 3L6UA 1PJTA 5FNVA 3T7TA 2QPOA 2FPGA 4RE5A 3MCAA 4Y2YA 4ZPXA 4BJHB 5GADl 2EZ4A 3WA7A 5H68A 1O1YA 2Q99A 1N2HA 1M34B 1KVSA 1PR9A 2A86A 2NU7B 3G68A 1CPYA 4RHYA 4AMBA 3G89A 1NMYA 1SBYA 4CVNA 1FDIA 2FJUA 2CSXA 2F43B 3FLAA 2BMFA 3DB1A 3HWRA 1BWRA 3FYUA 1KI4A 5KYNA 1EK2A 1RPAA 1KEZA 2BZGA 1Y8RA 3THYA 1SXJC 5FBWB 2F1OA 1PUJA 1P4GA 2B4RO 4RD1A 3R1IA 2GNOA 2XZLA 2C9DA 4RYDA 3QYPA 2YJ3A 2OFFA 4F06A 1EWTA 4BUZA 1AMNA 4FTWA 2Q1UA 4GECA 4GPIB 5ELMA 1XXHE 1FLVA 5ALGA 1DAEA 1Q83A 2V8OA 4A0FA 1YZGA 4ARUA 2CUTA 4B6FA 2Z30A 5SYMA 1I8TA 4E2XA 1VP3A 2Q29A 3QUTA 4MOWA 5BNIA 3VC2A 3LECA 4XGNA 2W4IA 3ZJUA 3UJ8A 1E64A 4Q4DA 5ALRA 5JZOA 4NNOA 5D86A 4ZAXA 1XVTA 3FWZA 3O8QB 4OQYA 3WTCA 1A2OA 5KOYA 1H1LA 1P9WA 3K6RA 2GTIA 1VCOA 2IYNA 4F9EA 1NC1A 3VPCA 3ZE2B 4E07A 4KUEA 2CXUA 3BC1A 1NULA 4D8WA 4CG0A 2IDKA 4K6FA 2C0QA 4EUSA 5A5FA 1CB7A 1PK8A 1YQTA 1I5OA 2ZBPA 1QBKC 9MHTA 1BE0A 1FNNA 1FW8A 2LBPA 1OZAA 2PMWB 2PZAA 2Z2KA 3EIOA 3KAPA 4QJ4A 4UBKA 4WKNA 2ZM6B 5KVSA 3AJDA 4DWWA 3LFUA 4MUYA 4INPA 1SKAA 4KLAA 1XQ6A 1N1EA 5J4HA 3KKNA 3QLEA 1NVVR 2C3MA 3MPOA 2Q7OE 1K8ZB 1PF7E 3SHTA 2Q4EA 3ZVRA 1BDJA 1X92A 3K8OE 4QWWA 3H1GA 1IB6A 1QLJA 1O54A 2ACEA 3OJXA 4JBWA 1T6BY 4KMOA 3VZPA 4BKPA 4HV4A 4BGUA 3FJ1A 2JLXA 1XTZA 5E7IA 1I0IA 4MVJD 3STWA 5K6RA 4CCWA 1NW5A 2VTDA 3UJ9A 2X4LA 2AC7A 1XSEA 1P6QA 4OLFA 1KZHA 1DCFA 3TUJC 1PVOA 1TO6A 2B3TA 2HH9A 2Y68A 3QXCA 3NQ41 3WKCA 3VKWA 2RJOA 3FI0A 2J7PA 3DO5A 3PQ8A 3DFMA 5EIHA 5K0EA 2WJHA 3A8TA 2PCLA 5I9TA 5IAEA 2GAAA 1XZCA 1RMTA 4I1OA 3U4AA 2J85A 4KWHA 5A3VA 2GLXA 2ERYA 3LY5A 1YTUA 3NKLA 4MMZB 4YRCA 3S6JA 4D92A 4ZPJA 4W8OA 3GJ6A 1JFLA 3R20A 1LQUA 1XCOA 1YJXA 4JOQA 4XFKA 3WLTA 2EKPA 4PZLA