2ANCA

Crystal structure of unliganded form of oligomeric e.coli guanylate kinase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
205
structure length
205
Chain Sequence
AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 63
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2ancA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ancA01
1KJZA 4EPWA 2PT5A 4W5JA 1CJMA 3RSOA 2OBLA 1U9IA 2CE7A 1N6RA 1ZRHA 3CW2A 4OI4A 4KHZA 5DO9A 5EE0A 4D81A 3ZLJA 4OQFA 1SVMA 2QRNA 4Q66C 4D4KA 4QG7A 2QE7A 3ADCA 4Q4HB 3WHLA 2ZRLA 2Z4SA 4MRSA 2ZQ5A 4NYJQ 2J41A 4UQOA 2WKQA 5D3MB 5LBIA 3KZ1E 2ZRFA 2JIZA 4Q4JA 3P20A 5EXSA 2IT1A 4BUJA 5KO2A 4JBXA 2W2TA 1P4SA 4BLOA 1FNNA 2ZE6A 1FQKA 3MUFA 4DUGD 1NKSA 5FR2A 3K09A 4XSGA 4YXWD 3IO3A 1UBCA 4HZUA 4V02A 1ZUHA 1E2PA 2OCBA 3ZD6A 4UXHA 4CZ2A 2JJ2D 2GETA 2R65A 3RC3A 2XNDD 2VP2A 3GLFA 4HB0A 1N0UA 3AVXA 4L9WA 4EPRA 1X1SA 5AR1A 1BOFA 1Z6YA 2JJ8A 2RGDA 1N0VC 4HAXA 3ZVLA 1JPJA 4MITA 4PC7A 5CB6A 2XTMA 4P4SB 4Z8XA 4JLNA 2A7QA 1Q22A 2HLDA 3U4QA 3BB4A 4Q9HA 1KSHA 4KODA 1OT3A 4L16A 1CBUA 2DYKA 1QDEA 2J0VA 3BB3A 5DI3B 2W2XA 2D4HA 5G3ZA 1S2MA 2EQBA 1IY1A 5EP1A 2X19A 2IX3A 2WWFA 1ZU5A 4B2LA 3EC1A 1ZM9A 1SVIA 1U8YA 3SFVA 3VKGA 2VF7A 2O8DB 1TAGA 1EG7A 1BIFA 4Q1DA 1IN6A 2OUKA 2ZJYA 3PUYA 1W4CA 4ZDIA 1XMVA 4GZMA 1S1CA 3GFPA 1RFLA 2IWHA 3PEVA 4TQ9A 1YQTA 1QHIA 2O0JA 3PEYA 3KQUA 1S96A 4IW3B 2EFHB 1KO8A 2PCLA 1NG1A 3B6EA 1OH6A 3GLIE 3QG1A 3ETLA 4B71A 2MSDB 1MH1A 5EE1A 4ZIRB 1PLKA 4KU4A 1MO6A 4RD2A 1EFUA 3TE6A 5EP4A 1JNYA 2YKGA 3B1VA 3GJXC 3AKCA 4V0MA 3T12A 1E2NA 1T9HA 2WJHA 4H1UA 2BMDA 4G5GA 4O0MA 2V55B 4KSCA 2GA8A 1AQYA 2HF9A 1E2QA 1FUUA 2BMEA 1DO0A 1HYQA 2BM0A 2FZLA 4NCJA 1E6CA 3QXXA 1M8PA 3D6TB 4LGMA 2J9RA 1F2TA 4LHXA 1MABA 2WPDD 5B57C 3GFTA 5FPHA 1IN4A 2QG6A 2RGBA 1FTNA 3L0PA 2IWRA 3RRMA 4YMVA 1E9FA 4MH0R 1OXXK 1P6XA 1QF9A 4RY2A 3B7GA 3R7WA 4NYMR 1SXJA 4JL8A 1NLFA 3MG9A 1XJ0A 1PZNA 1SHKA 1DTSA 2I1QA 2FEOA 3CX8A 4Q4LA 5AUOB 4DCTA 1N6OA 3L0IB 3AGQA 1XRJA 4OKSA 2BV3A 5AJXA 5FBQB 2ZXUA 5E4FA 4CF7A 4GRAA 2AKAB 2IXFA 5KNBA 1VCIA 2D06A 2OV2A 3MWKA 2W6IA 4OI1A 2E1RA 3LO5A 4FMCF 4V0OA 5GVRA 5CB8A 3GCGA 4BLTA 2XZPA 5DN6D 5F98A 2RGNC 3QKUA 1X8JA 2IYLD 3B1ZA 4U5XA 5SZIA 3PXGA 3NBFA 4EAQA 5BXQC 3ZH9B 5FTLA 2ZJ5A 4AK9A 2RH5A 3EPKA 3NDPA 4MYHA 3VFDA 1ZAKA 1R0XA 1DG3A 3Q85A 4CGZA 4G5OA 4QGHA 2GEUA 2ZJBA 3LRPA 1G18A 1I2DA 5J5CA 1KOFA 3U3OA 5GADl 4A15A 1B0UA 5E3HA 2A5YB 4JIMA 4AIIA 2JASA 4FMCB 1SVLA 2BKUA 1O3YA 1G8HA 1WF3A 1OIXA 2B7CA 2ZAMA 1WMSA 1UKYA 2AXNA 5CM8B 3QENA 1XBTA 1G16A 5GJCA 1FNMA 2FFHA 5LB2A 3WMEA 4ZO4A 4TYWA 1VYVA 4A4DA 1JAIA 3KUCA 5AK0A 2ZI5A 3KQLA 1EFCA 1NBMA 1Z0KA 1Q12A 1D2NA 2QENA 3F8TA 3QPWA 2UZ3A 3EA5A 3NHBA 4TQAA 3RS3A 4C0BA 3BC1A 3VTKA 3OIWA 1ZCBA 3FMIA 4ESHA 2EVWX 3QF7A 1BMFD 1T91A 3GLGE 5JSZB 4Q1AA 3H86A 5F2EA 3M0EA 4NDZA 1GTVA 4LBWA 5H70A 4S35A 2WOOA 1G7RA 1KY2A 3N2IA 4YMTA 1FPMA 4FIDA 5TB5A 3G0HA 1ZCAA 2RGEA 1CLUA 4C7OB 3IHWA 1JECA 1US8A 3BD9A 4TWZA 2GESA 2PEZA 3FTQA 4AKGA 2AD5A 3LLMA 5BYJA 1GSIA 4TYPA 3KJIA 4AYTA 4NZYA 4TZ0A 1K5DA 1R6BX 1T8UA 221PA 2CBZA 2VHCA 3PUXA 1ZINA 2R2AA 4GPTA 4LK2A 4JS0A 2E87A 3GJ8A 2J46A 5A0FA 3TSOA 3NKVA 2ZVQX 3UXMA 3ZJYA 1Q1EA 4YONB 2MMCA 4LJ9A 5JRZA 1G3QA 3U3JA 4X8MA 2XOKD 4P4TA 5JS7A 3LW7A 3FWYA 4JLMA 4AURA 2EFDB 4P0TA 2P5TB 2GILA 4TMZA 3T5GA 4LPKA 3FHTA 3QKSB 4XD7A 2ONJA 2W2VA 1KK3A 3FGNA 1RJ9A 3KDSE 2F9LA 4Q9LA 4V0NA 2ZU0C 3ZIAD 5LDDC 5IK2A 2EYQA 1CULC 4KO8A 2IS6A 1U90A 3I72A 4KBGA 1JR6A 1J99A 2LKCA 2V4ZA 4ERNA 2BJWA 2ZSFA 2OHFA 4HDCA 1QHGA 3MCAA 3U44B 2PLFA 4RD6A 1IXZA 3CX7A 3FDIA 4KYIB 3FMPB 3FKSA 2ZRCA 2VP5A 4UNRA 1QHHA 4M53A 2EWWA 5C18A 5EP3A 2PZFA 4Z8YA 2ECKA 4PQFA 4QM6A 2AK2A 2XGJA 3SYNA 5ELXA 2GCOB 1G1MA 3W3ZB 1OFUX 5HCIA 4TMKA 2J0SA 3EG5A 3VX4A 1OIWA 4QNRA 4TYQA 4WOPA 1ANKA 1ZW6A 3UMRA 4EPYA 2YWFA 3OFND 3HU2A 1KO1A 2B7BA 2IEZA 1YZNA 2OZEA 5G3YA 1R8QA 3TUJC 1XB2A 5BN5A 2CL0X 2C9CA 4Q9IA 1M7HA 3KKNA 4ZPXA 2BIFA 3I73A 2XXAA 4X8HA 5JZVA 4JZKA 1U94A 3LBNA 2IEYA 3X1YA 3PQCA 1L7VC 4XWAA 1LF0A 2VL7A 1ZP6A 2ZYWX 2ZSDA 3EZ6A 4PC2A 3W8RA 2YZ2A 2ZPTX 4YDSA 3IGFA 4KITB 2D62A 4LOAA 3AQ4A 3A36A 2ANBA 1G8FA 3NEJA 3NG1A 1TX4B 3FYHA 4PFSA 4Q1EA 5IT5A 5JEEA 3Q7PA 1AJEA 3TAHA 2ZITA 3T15A 1KO4A 1GRNA 2ZR7A 2AD1A 4A0GA 2GJ9A 3WNBA 3T1TA 1HUQA 1E9CA 2H8KA 3BWDD 1MO3A 4MDEA 2FDCA 4MRPA 3RRNA 5FTNA 4E22A 4URVR 4LUCA 4OJKA 3OE7A 4HB4A 4IVRA 1KDTA 4B48A 1RRCA 2QEQA 2VP9A 4U02A 1XMJA 4IDOA 2KBFA 2XITA 3K70D 1XEFA 3KB2A 3OHMA 3KKQA 5F3WB 3OAAD 1EX6A 2IYTA 1FOEB 3BORA 2DFTA 4LYAA 4XVRA 4M2LA 3VAAA 4YQFA 3DDCA 2JEOA 1S9HA 3C5HA 2FV8A 3BIFA 1KJYA 3DM9B 3IBGA 521PA 4DLRA 1LS1A 1CJKC 2JJ1D 2YC2C 4LCBA 4LRWA 4CEIA 3MJRA 1SKQA 4KLNA 1G7TA 1YZLA 4JLDA 1DG1G 4EPXA 2RGNA 4LBVA 4EUNA 1G19A 1V43A 1AQUA 4LC1A 1WE2A 1YR8A 2BMFA 3E1SA 5DISB 4OHVA 4PHFA 2V8OA 5KNDA 1GRRA 3O47A 4I4LA 4JLAA 2DFKB 5DI9A 1QG2A 1G7CA 1TTTA 4B2IA 1FMLA 4BLSA 4U00A 4DIDA 3PEWA 1IM2A 4G3XA 1W36B 1R0ZA 5HE9A 3REFA 2QNRA 1TUIA 2X77A 2ZRBA 4HDQB 3GLHB 1OYWA 1YZTA 4PSVA 5FL7A 3ZYCA 4A2QA 3H4MA 3P27A 2W6JA 2ZYTX 4HUQB 1LF5A 2CLSA 3TKLA 4D26A 4W7SA 1ZMXA 2YOFA 1LW7A 2F9MA 4M1WA 4NTZA 1TQ4A 4URYR 3AF1A 3NIBA 1Q0UA 2C78A 3RAPR 1T3LA 4JMPA 1UF9A 4AC9A 4M8NE 1S4QA 4LBZA 1Z47A 2IYSA 1AIPA 4A82A 3B1WA 4WVFA 4BZXA 1QHSA 3Q8XB 2IS1A 2CHQA 5D3QA 2H16A 4XOIA 2ZE5A 4B3FX 4GP6A 2G1KA 3QIAA 5FBVB 1OXTA 2GAOA 1N2CE 3EIQA 3B1XA 2Z83A 4M1OA 3G5UA 4DCNA 4OHWA 2VEDA 4EQ6A 2PH1A 2QGZA 2I3BA 3NHAA 1N3BA 2GWHA 2ZRJA 4EPVA 1GOTA 1YZKA 1BH2A 1G21E 3PENA 5GJBA 2GK6A 2WWGA 1RPZA 3SDZA 4E07A 2CK3D 3R9XA 4R2HA 5KSYA 4DJTA 3IQWA 3WHKA 3EIHA 4ITRC 4YXWA 2F3RA 3K9HA 2GVZC 1VPLA 1Q3TA 1Z28A 1I4TD 2WHXA 2IYXA 2XX3A 1XXHA 1HV8A 2ZETA 1JPNA 1OH7A 1Q1QA 1II8B 3SJBA 4F4CA 4JVSB 1M74A 2ORWA 1JBKA 1LS6A 2QRZA 3D31A 3CF6R 1OV4A 2KWIA 4NP6A 3HU1A 4QGAA 1G3MA 3SC3A 1KY3A 3AVPA 4HYYA 2YINC 4D4MA 1GFIA 1ZUIA 4FW9A 2J87A 3CR8A 3NTUA 2C77A 3L2OB 1OW3B 1JXMA 4W5HA 1DEKA 3AKEA 1HY3A 3IDQA 4JJZA 1WB9A 4FWIB 4JLVA 1EK0A 3ADKA 2ZRMA 1Z29A 5FOUA 2HV8A 2D7DA 1TF5A 2L0XA 3KFXA 3BERA 3CLVA 1TF7A 3AH8A 3CUEF 3QE0A 4Z1MA 5JHGB 3BS4A 2HYIC 2Z0MA 1U0LA 2H57A 4D25A 4UNSA 5CITA 5G53C 3D7MA 2BMJA 1B23P 2O8FA 3KTAA 3DOEA 1CRQA 421PA 5JFGA 2D74A 1OFIA 1DOAA 1S0UA 3GJ7A 2NIPA 1TMKA 1G5RA 5FUXA 1EFHA 4DLXA 4MRRA 2ZI7A 2WIAA 4X8LA 2V54A 3F0TA 2NPFA 2IUSA 3LY5A 1RE0A 3OEHA 1OH5A 2OESA 1F2UA 1A2KC 3VX3A 1ODFA 3BH7A 4TSFD 1W48A 2IS4A 1VG8A 1T5IA 3ICEA 5FUWA 2NTYC 4NKRA 2O8EA 5C4GB 2A5JA 3A1VA 5JHHB 4TT3D 1RYHA 3CRMA 3O8CA 1ZVQA 2FSIA 1XEWX 1E1RA 1XJCA 2F1JA 2OSBA 3TMKA 1KK1A 1H8ED 4AWXA 2FSHA 4ZCMA 4Q7KA 3REGA 5JMTA 4KSBA 4KCGA 3K0FA 2H18A 4M1SA 2HJVA 1KK2A 5L3VA 3A4MA 1E2JA 1OHHD 1ZM2A 2F43A 3F3YA 4LZZA 4C30A 4QJ3A 4ARZB 2O52A 1M34E 4PPNA 3X1ZA 3OZXA 2B92A 4PC6A 2WPDA 4HUTA 4B44A 2QPTA 3K53A 2QT1A 3P4YA 1C4OA 4JYBA 4AYXA 1S3SA 5FI0B 4PZZA 2YWHA 4Y0AA 3TVDA 3BXZA 4EKDA 4LHZA 3LH5A 4M9ZA 1Z8FA 4DLZA 4OK5A 1II9A 4BLPA 5LPNA 1VCNA 3CKLA 1XD2B 5JI3E 3I8SA 2A5DA 2ERYA 1KSJA 1MO5A 2VHUA 3QPUA 4RKEA 2ATVA 4TMXA 5B2ZA 3H1TA 4FWTA 1P2UA 3ZD7A 3CH5A 4MKGA 4XJXA 3RHFA 2AR7A 1QVAA 2C95A 1DAHA 1Q21A 2DHRA 5G41A 4N3NA 4QRHA 4ON9A 3THYA 5FPSA 4OI0A 3Q5DA 2FOLA 1XPRA 4KAXA 1OFHA 3T1QA 4IVQA 2CDNA 3SZRA 1SXJC 2ZI9A 5FOSA 3THXB 1KMHB 4N0EA 1OIVA 3IO5A 4HLQB 2Q6TA 1CIPA 2QORA 4RCYA 3TIFA 2OCAA 1CRPA 1W4BA 1RZ3A 4B6FA 1T4GA 2FH5B 4QGGA 3QKRB 4Q03A 5JWHA 2A30A 5HR5A 2VBCA 3RWMB 5BWMA 4D4JA 3RS0A 2ORVA 1NSFA 2HDNB 2ZU6A 3K0AB 3TNFA 2WWYA 1ZD9A 2CNWA 3SBEA 2XB2A 2C9YA 2WM9B 2GXUA 4CRWB 4B32A 2IUTA 5ANRB 2QP9X 1K8RA 3LBIA 1W4AA 1YE8A 2V1XA 4OI2A 5DYGA 1BYUA 2JCSA 4POAA 4HLCA 3UMSA 3CF2A 3A4LA 3GEEA 4HAWA 3T5DA 5A4JA 2B8WA 2JDID 4CEHA 1HE8B 4E03A 1RIFA 1BMFA 3HYTA 2W0MA 4IVPA 4W9MC 2IC5A 2R6CA 1ZIPA 4XWKA 1CR4A 1XTJA 1XTIA 2NPIA 2D3WA 4D4LA 3HU3A 5EJEA 2PZEA 3GQBA 4TTPA 2RGXA 5TV2A 2GEVA 1X6VA 1W0KD 4HZUB 3OIVA 4RD0A 2GCNA 1JAHA 2GJAA 1A4RA 2GEDA 3IQXA 2HXSA 2Y8EA 3THWB 3IPYA 4U7DA 1ETUA 5EUMA 4LX0A 1P3JA 5IHPA 2JLZA 5CM9C 2YOGA 3I5XA 5FPYA 2AFIE 3CH4B 5IF9A 4ILEA 3ZVNA 2QU8A 3ZZTA 1Y63A 4ASUA 4WIAA 3PUWA 2KSQA 2PT7A 3FOZA 2QN6A 1JR3D 1KDPA 2CCGA 1NY5A 4ABYA 1D2MA 1XD9A 2C98A 2XOKA 2AK3A 2ZE8A 4RKFA 3MWLA 4WA7A 2B6HA 4EFMA 1P2VA 2BBSA 4OL0A 4CIDA 2JLWA 1TUEA 1VHTA 4HAYA 4I81A 4BFZA 4IXMA 1M7BA 4NH0A 3A1TA 3T06B 3OEED 2JLXA 1E96A 4E09A 1RC8A 5HKKD 2BWJA 2AL7A 3OESA 2QMOA 4PHHA 3I92A 2V9PA 3U2QA 4K8OA 3QG5A 2RKOA 3QEOA 1GKYA 4LI0A 4TQUS 1W2HA 2Q0HA 1W5SA 1G9XA 1W36D 1XJQA 2N1BA 1Z5ZA 3SEAA 1CJUC 1EESA 3TH5A 4UXIA 1SVOA 3K70B 3WBJA 4ZI3A 4PPFA 3S1AB 4MYCA 3RSLA 3AF0A 3K1JA 5EUQB 1U81A 2PJZA 3QBVA 4MRNA 1XEXA 2ZRDA 5LB4A 1Q1BA 2J0UB 1RYFA 1G6HA 1KKLA 4B3CA 2WAXA 4ACAA 5K8IA 2GXQA 2XTNA 4GBMA 3U61B 1GL9B 2VHQA 4XVUA 4PZLA 3NH9A 5EE3A 1XPOA 2CVFA 2DFNA 4LY6A 5TARA 1LVGA 3FHCB 4HLDA 4OK3A 4BRUA 4KFSA 4OK6A 2KI5A 4M1YA 1R0WA 3B8HA 1RRFA 3V4RA 3L0OA 3AVWA 1MABB 2ZRPA 2RHDA 3ZQJA 4C0QC 1Z22A 1E2IA 2HF8A 1OXVA 1R10A 1H65A 2AFHE 4Q4HA 4S2EA 5KSPA 4F4JA 2OG2A 4NCNA 5D3MA 3CZPA 3QXSA 4BZQA 4JLOA 5KYKA 3HPQA 5JWOA 4NPHA 5KSOA 4CVNA 2PX0A 4IRUB 4M9XA 5J4HA 5HKKA 2ZI4A 2CJWB 4NONA 3BAFA 2O8CB 3SS8A 1E9BA 4RZUA 4XVQA 2XZLA 1SVWA 4URWR 4A8JB 1D2EA 3P32A 5FBRB 3VNUA 1G20E 4ZDKA 1NG9A 5JJKA 2AKYA 1U99A 3U60B 1J8MF 4O2RA 2GZAA 2IA5A 4RD1A 1NLYA 2ZE7A 3KX2A 3F5FA 3EPLA 2ZJOA 4KBFA 2IHYA 1U98A 4B73A 2XAUA 1TU3A 4JT4A 5FPKA 1W0JD 2WMNB 2ZRAA 1XU4A 3IUYA 5EXPA 1BKDR 3QY0A 2YHSA 3DKVA 5FTJA 1QHNA 2EU8A 1QRAA 2Q9CA 4D0LB 4GZLA 2V7QA 4LYFA 2CHVA 4RZ3A 4DVGA 3AGPA 3EPJA 2BM1A 5DI3A 4NYJR 2X1VA 2AWNA 2OO7A 1NI3A 5FOVA 3IILA 4C0LA 2O8DA 1ZD1A 1PLLA 1GIAA 2ATXA 3LQRA 4TMTA 4Q47A 4BFTA 1EWQA 2ODNA 4XH9B 3DKPA 4CW7A 3X1WA 4OHZA 5CYPA 3KQKA 3PV0A 1KI6B 1X1RA 1G64A 1JR3E 3AM1A 3PJRA 3DMNA 1XCPA 4C0KA 5L3QB 3Q72A 3B60A 3OIYA 2X2EA 1C9KA 2BCJQ 4IOJA 3LV8A 2OBMA 3O8DA 4TLAA 4DWJA 4CT5A 3JZMA 2QT0A 1KSFX 3A1UA 4ZIRA 2F7SA 5CYOA 4NCKA 3A6PC 2ZRHA 1QHYA 1OFTA 2G77B 1YKSA 2ORIA 2Z6VA 1XPUA 1NNEA 1VECA 5CLQA 2G3YA 2AXPA 5KPJA 5DSZA 1NIJA 2CXXA 4EDHA 1AS2A 4YMUA 5HZKA 2OCPA 4P3YA 5L8VA 2IL1A 3GLHE 3C41J 4MGIR 2FU5C 4DSNA 3U6BA 3MMPA 1XCGB 4TLCA 4A36A 5HZHA 5L3RA 4QFMA 2CLCX 2VLIA 3TSWA 5J4YA 1WBBA 3SI7A 2WSSD 5H1YA 1ZM7A 3SYLA 3I3SR 2PZGA 2CK3A 4B3XA 1RJ9B 4HB3A 3GJ0A 1E3MA 2QMEA 4PPQA 3QSYA 2IYVA 3CX6A 5AUPB 2BVNA 5L3SB 3RRZA 2GNOA 1FZQA 3BH6A 3DO6A 1IN5A 1NJGA 2HYDA 4DSTA 1N6LA 4DLWA 4YMWA 3CNNA 3QVUA 4XTCS 2P3SA 1NKTA 5CIWA 3EARA 4BQSA 1G8PA 4OHYA 2FGJA 4FINA 3UMFA 2P0EA 1NF3A 3W5IA 4A1FA 1EGAA 1VYTA 1Z08A 3DHWC 1WRBA 2G1JA 2G0NA 5K8TA 1HT2E 3WRYC 2OAP1 2B8TA 2W0SA 3K0CA 2Z43A 2GZHA 3LA6A 1J7KA 1KDRA 1U0HC 4PSKA 4EJSB 4UNNA 2QMUA 4GI7A 2VP4A 4WXPA 4Q4AB 1RRGA 4FI3C 4MRVA 5B64A 4TLDA 1WXQA 2F3TA 1RVDA 2ZJ2A 3GJ6A 3AVYA 1Z2AA 2J1LA 3B1YA 2QQEA 1TEVA 2OLKA 3U3RA 4KJZA 3TQCA 4Q48A 1Z6GA 1ONBA 5JLJA 3SQWA 3GEIA 3RS2A 4QHYA 1EXMA 3WP0A 5FBWB 2HUPA 3EZ7A 4OQNA 3LX5A 1FX0B 2QE7D 4QBIA 3LVRE 5C4MA 1WP9A 2NG1A 3AP3A 4L9SA 3AVUA 2DR3A 2IXGA 2JIZD 3X1DA 3ZZ0A 4JBYA 5CK4A 3WY9A 3VR6A 2QZ4A 1YZGA 1R4AA 2GXSA 1AS0A 2RCNA 2ZIAA 4AD8A 3K9NA 4DT1A 1TU4A 5EZ5A 1Z6XA 5FOWA 4F91B 3PFIA 2BC9A 1R2QA 1CKEA 3FE2A 3CR7A 1GITA 3JVUA 3KKOA 4G5SA 4IJMA 4PTLA 1S9DA 2R6DA 4LBYA 2QP4A 5BN4A 4PX9A 2ZUDA 3LLUA 4G5RA 1G5TA 2BBOA 4LHWA 4BRWA 3V00A 4DLVA 2N42A 1IHUA 1SQ5A 1VG9B 3CF0A 1KZGB 1E99A 1SKYB 5TVKA 1G291 4NCIA 2QBYB 2ZYVX 2IUUA 4QXAA 4TZ6A 1I4LD 4PAOA 4A0RA 3U7FB 4BFVA 4KVGA 1H8HA 4A0FA 3LD9A 1N5LA 4IOKA 5DNYB 3GJ4A 1UBEA 1M1YE 2GBLC 3M6AA 2FFBA 3AF4A 2FFAA 3R9IA 1OF1A 1MT0A 4TTQA 5SZKB 3E5HA 4PQYA 3H84A 1MOZA 2GJ8A 2P6NA 2IK8A 1KI3A 3EC2A 1DPFA 2IXEA 1U0JA 3U44A 4XWOA 1JXOA 4JLJA 4PO8A 1O87A 3TAUA 3PUZA 5AJWA 3QPVA 4BEJA 4C0HA 4RFSB 3B9QA 4M9SA 3MLEA 3NBYC 1SHZA 4PZYA 3W90A 4M4SA 4B74A 4I1SA 4JJKA 3CBQA 4QBGB 4MQBA 3GLIA 5CJPA 2NMVA 5FOXA 1HQCA 3W6OA 4BLQA 5J40A 2RB4A 2FPMA 2QGNA 3Q7QA 3AF3A 4TL7A 4EPTA 2IF2A 4TYNA 5H8WA 1OYYA 3NC1C 2GRJA 4LJYA 5UKDA 2O0HA 3J81k 2ZS8A 2WBLC 1DAMA 2H17A 3NBZC 1GNPA 5J47A 2ZR9A 2IHBA 2FSFA 2YNMA 3PITA 1XMIA 2JDIA 2R8RA 2WSMA 2GDJA 3V9PA 2OE2A 1OB5A 1GNQA 4V0KA 3RRYA 1OKKA 2Q21A 5KSZA 2RHMA 5GJWC 1N5JA 4F38A 2PLRA 3CRVA 5HPYB 3LQQA 2VYFA 2Q9BA 4DDTA 4HAVA 5BW8A 8OHMA 5JWRA 5JCZA 1S1MA 3PG5A 1W0KA 4LJAA 2WJIA 3BOSA 3H2YA 4QNMA 5P21A 1D9ZA 1Q3HA 3KJGA 2NO0A 2UKDA 3ASYA 1COWD 3EXAA 4Z51A 3ND9A 4M1TA 2JGNA 2QM7A 2CCJA 4RCZA 2PEYA 3C15C 4Z54A 4II7A 1E9SA 3MD0A 2GHIA 4AKEA 3W6NA 1IN7A 4QOSA 2FA9A 1RRPA 3KXIA 1ZNZA 1CR1A 3QNUA 3SHWA 3QBTA 1N6HA 4TLEA 1PUJA 1KO7A 3FB4A 1CJTC 5H68A 4QGFA 2CL6X 4DDWA 2XB4A 3OEEA 4LV6A 2QM8A 2WJYA 3VHXA 1KNXA 4KI0A 3MRSA 2OXRA 1YZUA 2WMOB 3W5JA 1VHLA 4IXNA 3WMFA 4ZDJA 5CDFE 4GDFA 4DUGA 1NN0A 3V4FA 1HT1E 4NU0A 4JVNA 4MUAA 1E0KA 3VNVA 4US1R 5SZJA 3VHLB 2JLSA 2VRWA 2QUZA 4NYIQ 2R6FA 4I1OA 2JJ2A 4ZKDA 2PJRA 2CHGA 1NBMD 3LX8A 2IYZA 1UEJA 2XNDA 3WNDA 4NHOA 4IDQA 4DBLC 4ZI2A 2H92A 4Q01A 2DWOA 1KMQA 4LV5B 4MGYR 4QHSA 1T3SA 2J45A 5AJZA 4CEJA 4MA4A 4IEEA 3WNCA 4HUQA 1NRJB 3B9PA 4KV9A 3GLGA 4NL4H 3T35A 1TQ2A 5CK5A 2VHJA 2W83A 1R5OA 1R5NA 3OIUA 1QG4A 4RZXA 1ZM4A 2V6IA 2QTFA 1P5ZB 2K5UA 3MJHA 4TLBA 2WJGA 2YWGA 3B13B 4MYUA 1PUIA 4A6PA 4GSYA 2JATA 3SR0A 3BFKA 1MO4A 3LNCA 3AEZA 4TMWA 2WWHA 4GL2A 2O8BB 2VTKA 4RD4A 1ZJ6A 1Z0FA 1Z0JA 2Z4RA 3UANA 3I4LA 4F93B 2FN4A 4JT2A 2R62A 3ZGXA 3ZDQA 2A5GA 3BFVA 2JLVA 4DB2A 1YR9A 3AVVA 1KI8A 4IHQA 1FFHA 1G8YA 3K0SA 2OFWA 4EIWA 4C9BA 2UZIR 1AZTA 5TMPA 1JB1A 2DWPA 4MYTA 4AY2A 5A5GA 3CM0A 5LD2B 4JSTA 3QUSA 4DCVA 5KDDA 3NWJA 4XD7D 2CE2X 2C5LA 2OCYC 3AF2A 4ZCLA 3A37A 3AV0B 3CIOA 1KAOA 3KB1A 2ZYUX 3VR5A 3DOFA 5EE5B 4V0ME 2DBYA 2SHKA 2F55A 1LFDB 2VQSA 3VU9B 4LPSA 4D82A 3RC8A 3TW4A 4NCHA 3QEJA 2UVQA 2ZUBA 4WXRA 1Z3IX 2A78A 2WVJA 2GBLA 1KGDA 4RVCA 1CTQA 4DEXA 1IN8A 4RD3A 3FKSD 1NSTA 2IYUA 4M1KA 4R98A 3IBYA 5TXGA 121PA 2E9SA 2FPLA 4F7WA 2BBTA 3T34A 4ACBA 2G6BA 1ZD8A 3VKHA 4P31A 1R8SA 4Q1BA 1I4DD 4FXPA 1VIAA 1DARA 1P2TA 4NE2A 5J4LA 2J0QA 2CEAA 2MSCB 3IHLA 1E2MA 2I4IA 3BBPA 2RGCA 1HURA 2ZEJA 5HE8A 4IOLA 3AUXA 2BBWA 1WQ1R 2JA1A 2HJGA 2EFEB 1N25A 1G3UA 2ZS9A 3IIKA 4G5QA 4FCVA 4A92A 4PAQA 1A5TA 3A8TA 1ZC3A 3QJYA 3K70C 3ZS8A 2XZOA 1KNQA 4PXAA 2OBNA 3QF4B 1UDXA 5DGXA 1WCV1 3L8YA 4URZR 4GT1A 1XDBA 4Q7MB 1GAJA 5KNCA 4LHYA 3DZDA 1T0HB 1UM8A 2GCPA 2QQ0A 4AG6A 2QSZA 2NO6A 1L8QA 2ZR0A 1FW6A 2YC4C 5DN6A 3IPXA 3B85A 4HLUA 4M1MA 1CR2A 1UEIA 3T1OA 4UNQA 2QAGB 1KI4A 2D2EA 2C04A 2R6GA 1FUKA 1KI9A 1W4RA 1Z0DA 1KZ7B 3AKYA 1UAAA 2VP0A 2C03A 4DCUA 1MRSA 3K9GA 5KU1A 1XZQA 4GOKA 1ZUNB 2V3CC 3W34A 4TL9A 4GP7A 1ZBDA 2X2FA 1MKYA 4JL5A 4BFXA 3UWKA 2KE5A 3ADDA 1W2GA 1OSNA 1N6PA 2WWXA 3JZAA 3C16C 3MFYA 3MWJA 5DLQC 1GL7A 4IOMA 1UADA 2A9KA 4Q19A 3TLXA 2ZI6A 1F48A 2IYWA 1IOZA 1EFTA 2REBA 1NBME 3DPUA 3U7EB 2XSZD 1P61B 4OQXA 1IAQA 3I32A 1MR3F 5FI1B 2GAAA 4ARZA 1Q57A 1QBKC 1A7JA 1CXZA 4MGZR 4L15A 4RJLA 2OM2A 2WIBA 2RGGA 3HJNA 5GJVC 4QBFA 1F3OA 4BEBA 3KJHA 4Q4JB 2ZSBA 3TQFA 4DKXA 1K6MA 1ELOA 1E1QD 3LFUA 4UXJA 1XMSA 5C2JB 3BE4A 2O0KA 1LB1B 1NVVQ 1Q20A 1XD2A 1E0SA 4J0QA 3VKWA 4DDVA 3TRFA 5B58C 3U7GA 3EAQA 2R6AA 4HB2A 1P73A 1R0YA 2QY9A 3BJIC 3O8BA 4NMMA 1YZQA 2AN9A 3HR8A 3WYFA 2CCKA 1UFQA 4P4UA 1NN5A 3X2SA 2VA8A 4TL8A 1TNDA 1XTQA 3LXXA 4ZDWA 2VIIA 3IKJA 1TEXA 3EIEA 2LKDA 3FPAA 3GLFB 1HEIA 2R9VA 5HTKA 1Z0IA 1T6NA 2PMKA 2QAJA 3SYKA 1E79D 1AKYA 3THXA 1P75A 3UG7A 4O25A 2J7PD 2Q9AA 1EFRD 1AZSC 1UDWA 1UKZA 2VF8A 1P9RA 4HAUA 4I99A 4PSAA 3SNHA 3U4QB 1KDOA 2ZM5A 2RMKA 3QKRA 2DPXA 2P65A 1TQ6A 2YOHA 1IONA 2HCJB 2CL7X 2D2FA 2ZJAA 3BRWD 3L8ZA 1IXRC 2C9OA 1T5LA 4FCWA 4C2TA 4JLKA 4IEIA 4Q00A 4DLTA 4URUR 4B3BA 3ZIAA 1G4UR 3DEFA 4IFEA 1UKVY 5B30A 1G3RA 1V5WA 1M6NA 1GILA 2JLQA 1IQPA 4R2IA 4Q18A 1AGPA 1P2SA 2WTUA 4WZBE 3H0KA 4XIGS 5EXTA 1Z2CA 4GMDA 1DBSA 3B78A 3PEUA 3K0CC 1L4UA 2MSEB 1XNJA 4NYMQ 4B34A 4B6EA 1CP2A 1KI2A 1P62B 2Q3HA 2ZRNA 3DMDA 2XNSA 4TN1A 1FTSA 4BASA 1N5KA 4LJ4A 1P9NA 1EX7A 1GUAA 1NMZA 1Q1ZA 1VG0B 1XTKA 4PAMA 5CDFA 1BYIA 3OFNA 3VR1A 2EYUA 1DAIA 5AWFC 5FFMA 4ZV4A 3THWA 2A5FA 3NVAA 4OQLA 3P1JA 4PPGA 2OFOA 2FZ4A 2OLJA 5CJ2A 2VSFA 4DSOA 5JBQA 1E69A 4BFWA 2D7CA 2FE4A 5AUNB 5KDLA 2AHOA 1JALA 1SVSA 1F2TB 1R5BA 3CONA 2JLRA 3SJAA 3I62A 4UKDA 4QJ5A 4PC3A 2WKPA 3FKQA 1OXUA 3R7WB 1E9RA 5CIQA 1W5TA 1SXJB 2QA5A 1KSGA 3AVTA 3I8XA 3ASZA 1A1VA 1XZPA 2YV5A 1RW4A 1IY2A 3IIMA 3T1VA 1OXSC 4Z1MD 3TUZC 1VKJA 1LY1A 3Q3JB 3QI2A 4PO1A 1NVVR 1Q44A 4WZ6A 4N0DA 5FR1A 4OYHA 1TPZA 2V6JA 1N6NA 4OJQA 4CDGA 3SQXA 2GXAA 2JAQA 3TUIC 4GOJA 4EJSC 4BFSA 1XP8A 4L4UA 1SKYE 3OAAA 3S1AA 2GK7A 4DRZA 2NQ2C 2F1HA 3VQTA 1Z6TA 1E9AA 2JLUA 1BO6A 1Z63A 2CVHA 2B21A 3M4YA 3UIEA 2OT3B 3OEHD 3RS7A 2AWOA 3UATA 2FF7A 2JJ1A 3CRQA 4I1VA 1X8LA 4P4SA 3U7HB 4PQRA 2W58A 2J0UA 3KJEA 3TJZA 2Q3MA 4DIEA 3KKMA 3MSXA 5J4KA 4WW0A 3RVBA 4O3MA 1BS1A 3UWOA 3LVQE 4LSGA 1R7RA 3BGWA 4WZAE 1E1RD 1SVKA 1VDZA 3ECCA 2HXYA 4Q1FA 4D2IA 3D3QA 4B75A 4UJ3A 4WBSA 1G8GA 3WMGA 1S8FA 1QVRA 1PJRA 5DYIA 3TGPA 4CEJB 1OLOA 2FG5A 1KKMA 1G5PA 1E2LA 4MUBA 1G6OA 3IIJA 4LWZA 1WDTA 1NVUQ 3VMFA 1U8AA 3R8CA 1E0AA 4MKFA 3T61A 2ZRKA 1G3IA 2WAYA 2H1LA 3BFXA 1XWIA 1VCOA 4DSUA 2I1VB 1U2RA 1YVDA 3LDAA 4A6XA 2VO1A 2VH5R 3NH6A 2C96A 1US8B 2CJWA 3EA0A 3NXSA 2O8CA 3HWSA 3N2EA 4LJ8A 4IFBA 1NL3A 3GFOA 1KJWA 2IS2A 1COWA 4A8JA 1DE0A 4LYJA 3Q5EA 3K9LA 2QMHA 1JI0A 3GPLA 1AN0A 4ZKEA 1CEEA 4L8GA 1AS3A 2VP6A 3W8NA 5JRJA 4B76A 4BFYA 2EFCB 2CMKA 3RNLA 1F5NA 4TTRA 4JKIA 4JYCA 2DB3A 3SJZA 4K81B 5SZHB 2QP3A 2G83A 2ONKA 3ZZUA 1Z07A 3A1WA 3AVQA 1ZYUA 1VYUA 4P32A 4LHVA 4D0GA 4YMSA 5BQ5A 3CWZA 5TY0A 4Q7LA 3RANA 4ZCIA 1Z83A 3DZ8A 2CNWD 3W6PA 3W3AA 1DS6A 2A3RA 621PA 2ODWA 1XXHE 2QSYA 1CJVC 3QXCA 4Q21A 4I1UA 1FQJA 2BEKA 4DHEA 4G0NA 1UPTA 4N1AA 3ADBA 2PCJA 3BK7A 4AI6A 3CPJB 1TADA 1XTSA 1E0JA 4M9QA 3EZFA 1T3HA 2VPPA 3UK6A 3AUYA 1TL7C 4WAUA 4D6PA 4YC7A 4KFTA 2DY1A 1E2EA 2FMXA 1YR7A 1E2HA 4DLYA 1KI6A 2NO9A 3L43A 1TQDA 4K46A 1QHHB 1NN3A 3IEUA 2RGAA 5L3QA 3CNLA 2H7VA 1HQYE 2IBMA 4IDPA 4BZPA 4QBHA 4DT1B 4HDOB 1G4AE 4UJ5A 3HYRA 4D0NA 3I61A 4C0SA 1KI7A 3C7KA 5K8UA 2P2LA 1VG1A 4JLPA 5KDOA 1W36C 2ZAOA 3BB1A 1E2KA 3KL4A 1UBFA 4LDJA 1J90A 2F6RA 2MMGA 1E2GA 3FFAA 5FUVA 1L4YA 1P9WA 3DL0A 2BCGY 2XXAB 3C4JA 5FUYA 1NY6A 1UKEA 1Z0AA 1C1YA 4ASUD 1T8TA 3FMOB 2ZANA 4XSHA 1E32A 4IDNA 2J7KA 2HCBA 3E2IA 5DHAA 1SULA 2BOVA 3QXHA 3VR3A 2NO7A 1U8ZA 5FL3A 5JJLA 3K8YA 3GD7A 4RFVA 4LJ6A 2R44A 4RZ2A 1II0A 2HT1A 5E7JA 5JSZA 2Q3FA 5E7IA 2WZQA 2JLYA 4C4PA 1W49A 3EWAA 3TK1A 3ONWA 4Q1CA 2X8AA 2BJVA 4TSFA 5L3SA 3UPUA 2VSOA 4HEJA 2ZTSA 1GP2A 4C7OA 3GJ3A 3TSZA 3SN6A 3CNOA 2GJSA 1XX6A 1YRAA 3GJ5A 4TT3A 1XF9A 1A2BA 3L0SA 1WBDA 2GJKA 3MAAC 1H8EA 2YYZA 2RAPA 2REOA 1XTRA 4MKIA 821PA 5FOTA 1CU1A 5EP2A 1OHHA 2KB0A 3C8UA 1GZSA 4XTRA 3WRXC 4A2PA 4Y0VA 2G88A 2BKEA 2QPAA 1MV5A 5TDHA 2REXB 2YJTD 1I2MA 5EXXA 3GLIB 1FP7A 2P6RA 2FJUA 4CEIB 2G0TA 1E4YA 3U5ZB 5F9FA 2HLDD 4KFUA 4LJ7A 3NEYA 4EJSA 4C3ZA 2KBEA 4Q4AA 3MWYW 4FMDF 2CLDX 3QKSA 3R20A 4Q9JA 3EW9A 2IYRA 4FD2A 2QI9C 4PANA 3RS5A 1KHTA 3R8FA 4HATA 5EZ6B 4R9UC 1JEEA 1QZXA 1IBRA 2GKSA 3AP1A 3CZQA 4QM7A 2DFLA 1VCMA 4JKYA 1WA5A 1IY0A 1DAEA 3HDTA 3JVVA 3U3MA 3WYGA 3DVLA 3WXMA 5JCPA 5EE9A 1FX0A 4CT4B 3PCRB 4M0LA 1N5IA 4FMDB 2NO1A 3SU8A 2XJ4A 3AP2A 3B2EA 2QPOA 2QL6A 2PL3A 2XEXA 3C5CA 4BECA 1Y3AA 4BGDA 1JEDA 1JJ7A 1JJVA 1FL9A 1F60A 1FMJA 2J5XA 2GCOA 4H1VA 1ZC4A 1AM4D 1ZNWA 1NIPA 5BN3A 5J4VA 2ZSEA 1GKIA 3B82A 3EASA 4PC1A 3ICQB 4F92B 3TW8B 4HLUC 1NMYA 5K8LA 1ZIOA 3U3KA 3LW8A 1FP6A 1CR0A 2XSZA 4P33A 1E98A 3TBKA 4A2WA 2LCFA 5LD2C 2WKRA 4QHTA 4FN5A 4KFRA 4Q02A 3VR4A 2FEMA 2FWRA 1KIMA 2FPKA 4DXAA 4BPBA 2IW3A 4YDHB 4C2UA 2QBYA 4FCTA 2ZJ8A 3UG6A 4DCSA 4EQ6B 3GP8A 2WJJA 1GM5A 4OBEA 3MGCA 1CS4C 1XD8A 1E1QA 2V7QD 3WBKA 1ZM3A 3A1SA 1NN1A 1Z06A 1SXJD 5KTYA 1OH8A 1J70A 1AA9A 5FPTA 4B33A 4C0JA 4L5BA 1G41A 1NP6A 4DLUA 3O8RA 3D8BA 1XXHB 3B5JA 1CF4A 3SJCA 4X8OA 3KKPA 1EWRA 2W6ID 4NBSA 2OILA 5G40A 2ZRGA 3ZVRA 4BWYA 3GEHA 3EZ2A 4R7ZA 1E79A 1JQLB 4RFSA 3AB3A 5KOYA 3RDPA 3DM5A 5AUQA 1JR3A 3GLGB 2J7PA 4BE7B 1EFRA 1TF2A 2NZ8A 4R71A 3GMTA 4DC9A 1DVRA 1Z6AA 4G01B 3QOFA 1X86B 4JVMA 1X8KA 5KUTA 4JVLA 1E2DA 1LV7A 2GTPA 4KLZA 2ZVPX 4OQMA 2HEIA 3G82C 3A58B 1L2TA 1LTQA 4RSGA 2ZJZA 2QAGC 2TMKA 1P72A 1VMAA 2O8FB 3KTAB 5EQTA 4GMXA 3L82B 1D6JA 2KJQA 3GLFE 3KQHA 4HI0E 1GG2A 2ANCA 2FNAA 3NBXX 1E4VA 3LXRA 2N46A 3RYTC 3U6KA 3GLHA 4MDFA 3ND8A 1F6BA 1RKBA 2OAQ1 3KFVA 1E9DA 3SOPA 3X1XA 1F2UB 4EFNA 5FTMA 721PA 1NMXA 4US0R 3AVOA 3ZQ6A 2NGRA 4UNPA 4YLGA 1NVXQ 1W44A 1U9IC 2O8EB 3FMFA 1DO2A 2LWIA 2WV9A 2XTZA 3UKDA 1G17A 2ZI3A 1G7SA 1MRNA 1N6IA 2VHTA 5E7MA 4DB4A 2P5SA 4PO9A 4CYMA 4DLSA 1ESMA 5JECA 4JBWA 3C14C 3K0FB 2C2HA 5DHFA 4KXFB 2F43B 1GNRA 2WOJA 3QXJA 1OJLA 4M21A 1QHXA 4M22A 4LC0A 1OPXA 2ZRIA 4BFUA 5GVSA 1DAGA 4B3GA 3K09C 4BLRA 5FBLB 1XCMA 4B43A 4TL6A 3K0EA 2G9NA 3NC0C 3KUDA 1AKEA 3KXLA 4GNKA 3PVSA 2WWWA 3RABA 4A9AA 5AJYA 1LNZA 1JQJC 2OXCA 4FMBB 3RLFA 4DZZA 2V1UA 5F9HA 3CWQA 2NZJA 2O5VA 4LJ5A 1KK0A 2Z5FA 3WYAA 2ODEA 4MGKR 1OE0A 4EFLA 5IK2D 1W46A 1KO5A 3SFZA 1T0JB 2ZROA 3CO5A 3NDBB 2C99A 2XJ9A 4A0HA 1II8A 1GKUB 1VIYA 5DE3A 3THYB 1PVOA 4Q7JB 4B2PA 4QL3A 3N70A 1E9EA 3CPEA 3KXKA 3N5CA 2PMDA 2EFGA 1NLZA 3P4XA 4MKHA 4V03A 3CB4A 5DH9A 1HTWA 3CRW1 1W0JA 2ZREA 3QQ5A 5FH9A 3SE0A 1KI1A 4HSEA 3TR5A 2P67A 5BYKA 1YR6A 2PX3A 1SXJE 1KTVA 1OB2A 4JSYA 4W5WA 1XFAA 3A4NA 3SBDA 1YHNA 1PLJA 1P60A 2A2ZA 2O8BA 4KYUA 1D8TA 1HA3A 2HT6A 4O2LA 3CPHA 3OF5A 3E70C 2WICA 4AG5A 4Q9KA 3CRRA 3I1FA 3LAWA 1IJFA 4C0AC 4AKIA 2W00A 1K5GA 4B3DA 1D5CA 1DAKA 4QC2A 1KAGA 5AJVB 1ESNA 4QKQA 3PR1A 4CEHB 4US2R 4NYIR 2IYQA 3RS4A 4DDUA 3HPRA 3EPHA 2P6UA 4IKEA 2BHRA 3WP1B 1J2JA 2AX4A 2QTVB 1X3SA 1PV4A 1H8HD 4IDHA 2F1IA 3IEVA 2WWIA 1P7CA 1YJ5A 1UJ2A 2ERXA 2ZSAA 4DEYA 4E5UA 2ODBA 2EW1A 3ZS9A 3AKDA 3PIRA 3PUVA 2GF0A 5KPDA 3TR0A 1KYIA 2J59A 4B47A 5IRCD 1GRQA 1YRBA 2YVUA 3VU9A 1N0WA 1NJFA 3EX7C 4HAZA 3EZ9A 3OE7D 5C46F 3BH0A 1D9XA 2ZUCA 1HE1C 2BDTA 4QJ4A 3KQNA 5IDVA 1ZU4A 4TYYA 2DCUA 3I5YA 6Q21A 3QVVA 3EWSA 1VTKA 4AKHA 2YWEA 4JLBA 4G1UC 4LV8B 2QTHA 1NVWQ 2WSSA 3TVTA 2ASEA 2FFQA 5HCNA 4A8JC 5C1BA 1N6KA 5JJIA 4ESVA 2DWQA 3LWNA 4TMVA 3HP1A 2WJVA 1DELA 3RWOA 1GL6A 4F4IA 5JEDA 3W9YA 4OHXA 3R9WA 2ZS7A 1E2FA 1SZPA 3VR2A 1UBGA 1AK2A 1YU9A 2F1RA 1IJEA 2H5EA 3QF4A 2FGKA 2QROA 4AYWA 2GZDA 2NOAA 1W1WA 4HZIA 3FHOA 1M7GA 5M04A 3Q9LA 4URXR 4B35A 1A82A 4D80A 2OFXA 4GOXA 1GVNB 1OKKD 4GFDA 2FSGA 3HR7A 1DADA 4PHGA 1AGRA 1HH4A 2EWVA 2QAGA 5FL7D 3P26A 4JL6A 2FX3A 3THOA 1GDDA 4LYHA 3LBHA 2W6JD 4V0LA 2BEJA 1KMHA 1XEXB 2GVDC 3QKTA 1SGWA 5CLLA 2IF0A 3M1IA 5JI2E 2PBRA 4H9GA 5JS8A 3FVQA 1GWNA 1W7AA 1J8YF 4PHTA 2J3EA 2VSXA 3FFBA 1ZNXA 2IYYA 3ZVMA 4Q5IA 1IXSB 1ZNYA 5DIFA 4KVAA 1S3GA 1DAFA 1M2OB 5E95A 2C8VA 3K0AA 5FTKA 3SHFA 1E94E 4PR0A 5KHOC 1XEWY 2GF9A 1W47A 2OEPA
chains in the Genus database with same CATH superfamily
4E5NA 3IEKA 1ID1A 2XUKA 3RSOA 5LYJF 4U8GA 5ILQA 4DNOA 2CE7A 1N6RA 4QIHA 4UC0A 1Z7EA 3HSYA 2HRBA 1J7JA 3O4VA 4Q66C 2OHOA 4QG7A 5TMBA 3FNHA 4D4KA 2QRLA 5L7TA 3ADCA 1IQRA 4Q4HB 4LY9A 2X8LA 2RAUA 5BNIA 4Z9YA 4UQOA 4ESEA 1EP1B 3DAGA 5LMZA 3KZ1E 3QE9Y 5EXSA 5MDHA 3H11B 2W4QA 4BIIA 2IT1A 3U16A 4BUJA 3LPCA 5ICFA 3IOYA 3AIKA 4U2KA 3TTWA 3E1GA 3HYNA 4ZN6A 4BLOA 2REQB 1FNNA 3IQDB 1FQKA 2JVIA 3NS7A 3ZV3A 1WDLA 2JKVA 4XSGA 1VYHA 4CQJA 2EERA 4L85A 2DH6A 4V02A 5CFZA 3UBMA 5SY4A 4HDRB 2PRJA 4EGSA 3KQMA 3IEIA 4PYJA 2FF5A 3IP8A 3R5FA 2C0CA 4YROA 3L93A 4OCZA 3UJHA 3PGLA 1SELA 1XN4A 3KB6A 1GQYA 1IEWA 4HDNB 1XAHA 5AK3A 4HB0A 5CLGA 2GGSA 4EW2A 1AUQA 4G0MA 1GFZA 2LGJA 3OP4A 5AR1A 2RGDA 1DJPA 2W4IA 4A0QA 1JPJA 4ZOCA 1IXYA 2WYHA 5A03A 3G79A 1XMOB 2XTMA 3OLZA 3NV9A 2Q6KA 4BPRA 2VUIB 3JCZA 1G9TA 3FBGA 1YOBA 3RVDA 2P79A 3I9MA 1JFRA 4CIVA 3HKDA 1L5MA 4YUWA 5I9LA 2EQAA 2GN0A 2Y0BA 3NQ41 4OP2A 4QOGA 1QDEA 4M98A 1K9SA 3UK1A 3NTQA 1EUQA 5CCEA 1A9XA 4CV0A 2D4HA 3N76A 3R5HA 5JBIA 1A72A 2X19A 3DXZA 5H4GA 5K3BA 1ZU5A 3AQIA 1M2NA 4INZA 1ZM9A 4LRSB 1N92A 1U8YA 4YRPA 3MPOA 5TQJA 1NM5A 5E1BA 4QQKA 4DJDC 2O8DB 3BTSA 2P9TA 1U3GA 2MIIA 3BJMA 3Q2OA 3WLKX 1BIFA 1UPXA 3WLQA 3K5IA 4Q24A 1R64A 1Y1RA 1IN6A 5ERXA 2ZJYA 1W34A 1LTHR 3O8LA 4ZDIA 2YZGA 4D3ZA 3PEVA 1M34B 4TQ9A 1QKIA 1YQTA 3AFGA 3R4CA 1Z4IA 4TUYB 1SVNA 3PJDA 4E14A 1ZNQO 4KQMA 3YASA 3E0XA 3VSEA 3MFQA 2JANA 4FHZA 5KBYA 5F1KA 1SIUA 3ZGOA 4BVBA 1NG1A 2VPZA 1OH6A 1SBZA 3DA8A 3WB0A 2H07A 2Y6VA 4KWHA 3C6YA 2PMFA 4X45A 3EB9A 3LSYA 5L51A 3GLIE 2IELA 4BAZA 5IULC 5KVAA 1MH1A 2QD1A 3K8OE 1UDCA 3K6KA 1QC5A 1NSYA 1YUMA 1U6JA 1PLKA 3AT1A 3DO8A 4LNAA 1C30B 1HZZA 3LCRA 3VR5D 4AMUA 3TE6A 1JNYA 5A4AA 1BEEA 2Z8YM 3F6EX 2YKGA 1A7UA 1UANA 3B1VA 4HMOA 3DCNA 3JV7A 1NUHA 1U1IA 1P4JA 1AQ6A 4H1UA 4EHLA 4B6RA 5H0IA 1FFEA 1NJ2A 4KX3A 1QANA 2BEWA 2VNAA 4YV2A 1E2QA 1SB9A 1DO0A 4U2GA 3RTBA 4HD8A 4O1IA 3RTEA 1E6CA 4CFSA 1TI7A 4J4BA 5IMBA 1E5LA 1E8MA 2J9RA 3P4UA 4JP5A 5BV1A 3NO4A 4FEGA 1ZAYA 4IIBA 3HNOA 5IZCC 2DUJA 3AR3A 1IN4A 2SECE 2DSTA 2AYYA 4UM8B 5CFNA 1WD5A 2WAOA 3HXTA 1FTNA 4BKRA 1NDUA 1E9FA 4RY2A 1OXXK 4F72A 3OLVA 4U9UA 4WGFA 2NSDA 3VMMA 5LQRA 3MG9A 1TQ8A 1SHKA 1DTSA 4C4AA 1Z68A 2PMCA 4JMLA 4F6LA 4UHDA 1PGQA 3ZHTA 4ZCTA 3N1UA 4OKSA 3AFHA 3FZQA 1KARA 4GOOD 5AJXA 4NC9A 3IDAA 4FFPA 3AU8A 5HIIA 5TF0A 2ZJ3A 1A04A 2IXFA 5KNCD 3DG9A 4UUPA 2OV2A 3MWKA 3FWHA 4XJVA 2GM5A 1EIWA 3JW8A 2BKVA 4QJIA 3N05A 1YIAA 4BLTA 3M6FA 4UCWA 4ZTBA 5DN6D 3K6SB 1IG0A 1BRMA 1X8JA 3QKUA 2Q2NA 3PXGA 3B3FA 2NZXA 4I9UA 4PGFA 3GNLA 3M4XA 4TXNA 1C9YA 3ND6A 4G4JA 3NDPA 4CMIB 1HQKA 3H4TA 5DOVA 3Q85A 4RCVA 4QGHA 4CGZA 1I6LA 4P8RA 1O89A 1AKMA 3VU0A 2NYRA 1JMVA 2RK6A 5J5CA 5G1OA 1R15A 1JT9A 4YPOA 2X1LA 3VZQA 3D6NB 3FLEA 4JIMA 4AIIA 3Q6NA 4MS1A 4FMCB 4B7CA 1SVLA 2BKUA 2W2KB 2ZAMA 4P2BA 1OIXA 1U31A 3H8JA 4TXMA 4U7GA 4YFYA 4D9JA 1OYOA 2AXNA 5CM8B 3TLZA 4QTXA 2GPNA 1GA4A 2AOTA 1H3EA 3LY8A 2I8LA 1PKEA 1FNMA 2FFHA 4PAGA 5LB2A 3ZUPA 1VYVA 4DWWA 3LDUA 1N2XA 1LV8A 4IJVA 3KUCA 5AK0A 4XYLA 1X7GA 3KQLA 2F62A 2ZT6A 1OZ0A 1Y37A 2RHGB 4HWKA 3QPWA 1D2NA 2V7VA 3RQSA 1R9JA 4DV6B 3A11A 1O2DA 4M7WA 3KZXA 1VB5A 2AS0A 2H08A 2IE0A 4ESHA 1U4NA 4J91A 4KR9A 1IOWA 3GLGE 5HOEA 1NPTO 2O0LA 1J22A 4Z9FA 3HHEA 1GTVA 4AJNA 4PNZA 4JASB 1G7RA 1VSVA 4HX9A 1NQWA 3UWSA 1V8OA 4NH4A 3ZIDA 3O8OA 2GZMA 3N2IA 1JHZA 5EIOA 1RYZA 3SX2A 1W94A 1D1QA 1EFDN 2XGOA 1VRVA 4HPXB 4MQ6A 3ENQA 3IHWA 1F2VA 2BHLA 1US8A 3MIZA 3Q3HA 1BQ3A 4HAIA 3ELBA 3P9QA 4TWZA 3UOAB 2PEZA 3ESRA 3WWCA 3FTQA 2AD5A 1W9MA 3JVEA 4F04A 5BYJA 4DARA 3KJIA 3CH6A 4BO1A 4TZ0A 221PA 1T8UA 3A9UA 5C5DA 1A0OA 2VDMB 4B82A 2UDPA 2H9YA 5CIYA 1VJCA 3C3WA 5A0FA 3ZJYA 3Q8KA 3UXMA 3UK7A 1BJRE 3AM4A 3SK0A 2Z5GA 4INOA 1JHXA 4MV7A 5KNLA 1G3QA 2CDAA 4K2AA 3W3AH 1PT6A 1WUHS 1QIKA 4P4TA 1CD5A 4KHPB 4AURA 2EFDB 1GUBA 2P5TB 4YH1A 3W1EA 4D9NA 5I7SA 4XD7A 2ONJA 2W2VA 1KK3A 2V7GA 4I9NA 3DLHA 1GRVA 3HEBA 3J7AC 4D98A 1GU1A 5TQ0B 2JIRA 4V0NA 3HBAA 5D3KA 5DWVA 1QRSA 4L2IB 5IK2A 4MV3A 2M6RA 3MWDB 1KRWA 1CUIA 1ZVJA 2JAXA 2L82A 4NABA 3MXTA 5B37A 3RAGA 5CBKA 2LKCA 2V4ZA 4D3FA 1SC3A 2FPUA 3VJKA 3ZXYA 2BJWA 4RVOA 4ERNA 3W4JA 1QHGA 1MVOA 4RPHA 4A6DA 4RD6A 1IXZA 3EF3A 4OP1A 2G8NA 1YC5A 2VJPA 2XCOA 3FKSA 2DR0A 3JS5A 4NPAA 4AO6A 1AQJA 2VP5A 1Y98A 4M53A 4LGYA 4BQOA 5TQVA 1SU7A 2K87A 3MTQA 1NNI1 2R97A 3L7CA 5JAZA 3AY0A 1GLNA 4C4OA 3LA8A 2XT0A 2EKPA 2ZTHA 1KZYC 3RTCA 3WQSB 2C8JA 1T4CA 4DBZA 1DJMA 1G1MA 5BN3B 5HCIA 1C4WA 1P19A 1JVBA 1XDDA 3LK6A 4HNRA 1ANKA 4TYQA 4WOPA 2OD9A 4CV2A 3O2SB 3CVXA 3W4KA 3TWOA 3CVUA 2XQIA 1JG3A 1YTLA 4QEKA 1RAHA 1WCWA 2IEZA 4R5MA 4CM9D 1PR4A 3PEFA 3FWNA 3MJVA 4CU2A 1QONA 1R8QA 1SUBA 3MRTA 1XB2A 3ME5A 2CL0X 3V1YA 4EKEA 1Z4PX 2C9CA 4Q9IA 3NWEA 2JGRA 1V5FA 3KKNA 1XHFA 2I99A 3LZCA 5K0ZA 3I73A 4C01A 2FG6C 2Y68A 1TYEB 1OZFA 4GVPA 2X40A 3E05A 3W05A 4C5BA 4HNVA 2HC9A 3QEMB 1O5IA 1ZP6A 4H7JA 2ZYWX 4ND4A 4OUDB 4U9HS 3T1NA 4Q3LA 4RVDA 1H85A 3T9FA 2FEAA 3W8RA 2PZKA 3UCXA 3WWDA 2EBUA 4KITB 5JVDA 1T8WA 1BXRA 3AQ4A 4QWWA 1M1UA 3EF0A 4G5FA 2ANBA 1YKFA 2VUTA 1LBHA 2D5IA 4RLSA 4XDZA 4GM4A 4H4DA 4DOMA 2DSNA 1OT5A 2PS0A 3FYHA 3KSUA 4I5FA 3Q7PA 4Q1EA 5CW2A 4B80A 2R8XA 3VSCA 9MHTA 1KO4A 4DZTA 2AMJA 1HUQA 4FVTA 1CY7A 3BWDD 4ZT2A 3RRNA 3PNBA 3IVCA 2OPBA 1V1JA 3H6HA 4TT8A 3VGPA 4FGJA 4OJKA 1NQOA 1BEUB 1KDTA 4J16C 2OPHA 2QEQA 8ABPA 4U02A 1MBZA 4OXRA 4IDOA 3RIEA 2KBFA 3KDAA 3PTZA 4TV8A 4GW3A 5JSYA 1GA6A 4YFVA 3GN2A 3WIDA 3IP5A 3K70D 3QNMA 4GM1A 3MLBA 5BV8A 1KFBB 1VBMA 3G5TA 3OSZA 1QGYA 1LC3A 3L7OA 4ENPA 2NYVA 4XVRA 3IL2A 4L22A 4I9GA 4XJTA 5DYYA 1ZK1A 1UJCA 4CMHA 4I1PA 2F8MA 2DERA 4M0KA 3C5HA 2FV8A 5B1DA 1KJYA 3OSUA 4KR0A 2GKOA 1MIOA 3KSZO 4LCBA 5KJ6A 4KLNA 1LKZA 5KC9A 1TMOA 2GMWA 3UB3A 3I2YX 4DXHA 3DE4X 3E84A 3O83A 3AB8A 2A9JA 1T1EA 3H1GA 1Q50A 3TTVA 4QTYA 4ZHSA 1AQUA 4X3CA 2BH9A 4IMIB 1TM3E 1WE2A 2DPHA 1U2EA 1SU4A 4KQ6A 4LY3A 4OHMA 4BKOA 4OHVA 4PHFA 5LNK6 3AFIA 2BR3A 5KNDA 3DYBA 1KVSA 1K5PA 3N3BC 4I4LA 3HEMA 1MH9A 4QXOA 2Q7DA 5DI9A 1ORVA 1QG2A 3OZ7A 2WEKA 5FFNA 4GNRA 1FMLA 1XDWA 3H5WA 4KXUA 1IM2A 2XNHA 3EYWA 2GAFA 2Q3EA 1W36B 3QW4B 1NOJA 1O4WA 3REFA 1TUIA 1PSDA 4X20B 2FN9A 5T64A 3GLHB 2R6HA 2Z6QA 5EHQA 2D8AA 2YYYA 5FL7A 3OQVA 3LT0A 3WMWA 4ZK2A 5IJZA 5HX7A 5BVGA 5K0SA 2WNIA 2ZYTX 4O4JF 2CLSA 3W1VA 3PX7A 3TPFA 1N32B 3FSGA 2WD9A 2BSAA 4XLZA 5ALUA 3DMGA 1AGXA 4R4JA 4AZVA 1E3IA 1GNLA 4M1WA 4MKRA 3PRHA 4URYR 5IJAA 1BWRA 4DR7B 1YZHA 2EGGA 4B7ZA 2CKDA 4O4HF 3V4OA 3HCDA 4U2BA 3ZKWA 3ABZA 3OQ1A 2C78A 4IMPA 3RAPR 1T3LA 1TE2A 2VT2A 5LU9A 1X77A 4AC9A 3S40A 4LMAA 3SIPA 3O74A 2BCEA 4ZC1A 1XZJA 1ULTA 4ATNA 1THGA 1W4ZA 1YVRA 1WEKA 4H7IA 2QJRA 5CB4B 1OU0A 3NKFA 5COAA 5H7XA 1NTRA 3EIQA 3B53X 3RUAA 2QVYX 2F59A 4ZP1A 3H05A 4OHWA 2VVTA 4DLLA 2QGZA 2I3BA 2HF2A 3NHAA 3ZWCA 1N3BA 2H31A 3JD1A 2ZRJA 4ANFA 4EPVA 2QI9F 1BH2A 5C3UA 2GDZA 3ANSA 3OJ0A 4MVJG 5AVQA 2WWGA 1T34A 1B41A 2H1VA 4S1VA 4E07A 2V7BA 1QF7A 2O5RA 3R9XA 1QNFA 2IPNA 3BTOA 1IRIA 2VK2A 5KSYA 4DJTA 3IQWA 2BGLA 3W3AD 1WQ4A 4ITRC 4CIBA 2F3RA 2XXJA 3K9HA 3WRYA 4OMDA 1Z28A 4EUEA 3UENA 2ZWPA 1KU0A 2XX3A 4ND6A 3DDHA 2YICA 1JDZA 2DBQA 1R8YA 1Z37A 3BKXA 2ZYIA 5KWSA 1YRHA 4JVSB 1ISPA 1JBKA 3MQ2A 3R75A 4EGAA 3MS2A 2V7UA 3CF6R 5F23A 4XJSA 1OV4A 1R4NB 3I9KA 1C3JA 2VSQA 5DWDA 3AVPA 5TMDA 5BWLA 4ZYTA 2DQKA 4PRYA 1V1RA 4UULA 4D4MA 1GFIA 1ZUIA 5E2AA 3D7LA 5KSWB 5HEKA 1YRLA 1P9OA 2JHPA 3NHUA 4X6LA 2C77A 2QUKA 2VDQB 2LZ0A 1COZA 3X44A 4MR8A 4JSRA 5K03A 1G1AA 3AKEA 1E2BA 4U3JB 1GPDG 1M6EX 5IN4A 1HY3A 1WB9A 3RU9A 1NR5A 3MJTA 1K3TA 3K9WA 4JLVA 1EK0A 5U1PA 3PXBA 5EIFA 3BMCB 3FOFC 4GXQA 3F3SA 3HDHA 3I4CA 5FOUA 4M6WA 2C7GA 4ZYLA 4X1OA 4I50B 2L0XA 1Z2PX 3QE4A 1TF7A 3QE0A 4DJJA 1I3OA 1HE3A 2X23A 5GM1A 1QLHA 2Z56A 2XMSA 2KHZA 2FR8C 1G5HA 2Q45A 3GGPA 2HBZA 1J2RA 2BMJA 4JJ7A 5EJAA 1B23P 2O8FA 4PF1A 2EEPA 5IC6A 1CRQA 1QGED 3HM2A 2JBWA 2D74A 5IXSA 1W1UA 2GASA 1O94D 3EVAA 4U9IS 4X71A 4CL0A 1S0UA 1SUIA 4V39A 5IDYA 5IKEA 1YCFA 4IIVA 4OGWA 4CLRA 4Z3KA 1G5RA 4KNVA 2CBXA 3G13A 4DLXA 2ONYA 1GADO 2XUIA 5KYXB 2IH5A 1UXIA 4BQNA 5F5XA 1JDVA 1L5VA 5FA8A 1YU6A 1N75A 2WU4A 3SX4A 5JIBA 3M83A 1W48A 4TSFD 2IS4A 1T5IA 2FOXA 4HWRA 1UT5A 4WNAB 5FUWA 1CNEA 3A9CA 4B4OA 1HNWB 3A04A 3H1PA 4ZRNA 2A5JA 3OFJA 4TT3D 5H59A 2PS1A 5SY9A 4ZK6A 1PDVA 4R1LA 1J97A 2G5CA 2VS1A 2C97A 5C5CA 3TINA 2FSHA 3REGA 4JDPA 4PIPA 3NCTA 5IZ4A 1N9GB 3K0FA 4OV6B 5AXDA 3NGMA 4MCHA 2FPGB 3P9NA 4QJ3A 5EESA 2QWXA 3M8KA 2O52A 1M34E 2PPVA 4PPNA 4L73A 3X1ZA 1HFWA 4L6IA 3DYIA 4B44A 3HUUA 2I66A 1HZZC 1YUNA 4AYXA 2FDXA 1S3SA 3GG9A 3KUUA 1UDRA 1MQ9A 5CFOA 4Y0AA 3V7YA 1E66A 2QLFA 4M9ZA 5IHXA 1ZLXA 1W96A 1FFXA 1GTJ1 4BLPA 3A7DA 3AUAA 1X1CA 1VCNA 2PKQO 1P5JA 5JI3E 1MO5A 2IZ1A 3DMTA 1LPOA 2ATVA 4RKEA 4FWTA 2G40A 1P2UA 3CF4A 2OQ2A 4UU0A 4TGLA 4OXIA 5EZSA 2AV6A 2Q5HA 3CH5A 5DX8A 3WLPA 5KQSA 3MM4A 3N8KA 1ZH4A 4A7PA 4AZ3A 1Q21A 3FZYA 2BLNA 5FWNA 2JKYA 3RVMA 2Q5FA 2QPLA 3THYA 3G8BA 3ITDA 4UAUA 2J4FA 3PSHA 4P35A 3WLLA 4LF8B 2WFZA 3L9WA 5FOSA 3RYIB 3TB4A 1KMHB 1Z7GA 2CDRA 2JHFA 5FLXA 2BFDA 2EV9A 1CUSA 2PO7A 3H7AA 4RCYA 4YI3A 4I2VA 4GH5A 3TIFA 1CY6A 4ECEA 1T4GA 3NANA 2FH5B 2XA1A 4QGGA 3R3VA 4Q03A 4D99A 5GZ1A 3W8FA 5LOVF 2Q4DA 4X9XA 1E9VA 1VKOA 2F2TA 4NZPA 3HXPA 4GAEA 4UEWA 4KR6A 1F0NA 2WWYA 3VRHA 1HNNA 4N7JA 3EOBI 3JPWA 5DT2A 1JPUA 2PL1A 2WM9B 4YS6A 3E22B 4CRWB 2BGWA 1Z4JA 2IUTA 1OWPA 4V3BA 1RYNA 2ERCA 3DE1X 3MOSA 4B9AA 3S1SA 2V1XA 5ECDA 1CY1A 3H2SA 4WN3A 4BDTA 2DHDA 3VAZA 4I9HA 3UMSA 5DF1A 4Y6LA 3BL5A 3GEEA 2UVDA 3T5DA 1T0BA 4D42A 4POOA 1B14A 1C9NA 4JP8A 4BP3A 1NXPA 5B4UA 5JH7A 3WAJA 1L9XA 2DUWA 1B1CA 1ECCA 1H1LA 2WAAA 3PL1A 3SZOA 5FEMA 2AVDA 4LYEA 5FQNA 3U40A 4YAUA 1EXDA 4H7HA 4CKEB 2IC5A 2R6CA 2VG8A 5CGZA 2JAHA 2P5UA 3A26A 4FYJA 4UM5A 5LCXA 4C5CA 1JQAA 1AKQA 1V71A 2CY0A 2RB5A 3AR5A 5AKLA 2PZEA 3PIIA 3GQBA 4ZJUA 1HSZA 2XV1A 2GEVA 2XD9A 1X6VA 1OGIA 1W0KD 2Q28A 4I1RA 1X3LA 3OEWA 1OBCA 1JAHA 1RHUA 3DUWA 1N1GA 1XDUA 2ST1A 3N5KA 4YRRA 2Y8EA 4W9NC 4P38A 4KRFA 3GT4A 3IJPA 3PNOA 4MTCA 2BDUA 4FDUA 5FDFA 1V7ZA 1VSBA 1ETUA 9LDTA 4MJ7A 1P3JA 2MSLA 4YJHA 3JQBA 3UCFA 5EJFA 2RIPA 1C0KA 3A0RB 1NGSA 2YOGA 3V1LA 3QH4A 4ILEA 3GGJA 2W2QA 4I55B 4OMFG 2GPTA 1JR2A 4E4TA 2XRFA 4WIAA 3SWWA 2KSQA 1HKHA 1M3SA 4GOND 4KO1S 1XR3A 3G9TA 5AKZA 5LDHA 2H00A 1D2MA 3X1JA 4YJ2A 3ZD9A 1AUVA 1FXWA 2AK3A 1QH0A 3MWLA 4GVLA 4RKFA 4ZT4A 4YWJA 4WA7A 4YAGA 2B6HA 4PEVA 3P52A 3NHWA 1X2BA 5EL0A 2QD3A 4P9NA 4TXHA 4HXGA 1VHTA 3GXOA 4H27A 4QGBA 5HOQA 1TCCA 1RZRA 4G23A 1E96A 2BW0A 1D7OA 2I76A 2AL7A 2VZEA 3G0IA 4IJQA 1L5SA 1RU3A 2V9PA 5D5HA 3U2QA 1P0MA 3OF3A 2LTAA 3KYJB 3UB4A 5MN4A 4U7WA 4G1EB 3UT5B 3WIOA 2J9FB 3BWYA 3OWXA 4Z3OA 2AMFA 5J2UA 2B1JA 2JCYA 4G8BA 2QK4A 2ZZMA 1ESEA 4UBIA 3HABA 2ECPA 3ETDA 3O6VA 2GHTA 5EJ8A 1W36D 1Z5ZA 4RIIA 1VJ5A 4UXIA 1TO6A 5EWJB 3I52A 3VM6A 4O8CA 1VQ1A 2BP7A 1EGMB 3BK1A 4PPFA 1BDBA 2UUCB 2Q5CA 4DLBA 1KWKA 4OQQA 1FLVA 2RCYA 4FK8A 3DPSA 4MP6A 5JTTA 1VFNA 5ES3A 3UZUA 1DJQA 2VPWA 2DKFA 5E8JA 3RI3A 4ZEMA 1G21A 2Q27A 1EXNA 2IITA 3E5MA 1FFWA 2LR0A 4ED9A 1REQA 5J43A 3K9CA 3LY9A 3PHGA 4I1IA 1OTXA 4JROA 4PCUA 1DUSA 4ACAA 4Z1OA 4Z4CA 4DKJA 2FN7A 3B3QA 2VK4A 4DAEA 3RBXA 3ASVA 1VA4A 2XDQB 5HG0A 2V9CA 4HFRA 4BMYA 1EVLA 3DCIA 4XCVA 1TW3A 3NH9A 3GXBA 3DE7X 3V1UA 3W9UA 2DFNA 4RA6A 4LY6A 5TARA 3ED1A 4HLDA 2VDJA 3QWAA 4RKWA 4EX6A 1K68A 2OP1A 1OGJA 4KFSA 1ZLYA 2CL5A 2RDMA 3NYIA 3B8HA 2O2HA 3RSZA 4F7DA 2XIQA 1MABB 2RHDA 3BXFA 4BL5A 4RDHA 1E2IA 1NZDA 4HAOA 4PNHA 3HJUA 1H65A 2XQFA 3TTYA 3WHIA 3MWEB 4V2UA 3UFXB 4NCNA 1Z5UA 3MHPA 1AXRA 1W8DA 2DPMA 4JLOA 5KYKA 3MINB 5I7FA 4Z4EA 4Y1GA 3OP1A 4L75A 2ICAA 3H2GA 4CG3A 4CVNA 5KSOA 3K0HA 4IRUB 3DBHB 5J4HA 3BD7A 4O6VA 1N36B 4JU8A 2NACA 2ZI4A 3L7AA 3BAFA 5IANA 2Y3IA 2O8CB 1E9BA 1GGNA 4ZMBA 2OECA 1I6KA 2G4LA 2V4UA 1B8VA 5K0EA 4JAVC 4FM9A 1A69A 4EYKA 2W2OA 1TPYA 3DS8A 4KDFA 2GD1O 4UBNA 3ZV5A 3IR7A 4W63A 1NG9A 3F97A 4X7MA 3TI7A 4ZOBA 3CX4A 4RD1A 3RYCB 3HBLA 4R2JA 4HADA 4DXDA 5DTIA 1JI3A 2VTBB 2GLTA 1NJ8A 3REQB 1TU3A 2P2YA 4JT4A 5JV5A 3KO8A 3PEEA 3UOGA 3K2EA 2Q4TA 1JKIA 3K9FC 2HRQA 1XU4A 5EYPA 1BKDR 1SO8A 2WWTA 4L07A 4UHKA 5DX0A 4F21A 5LKRA 4HHEA 5E1DA 4R2MA 1QHNA 2EU8A 4Y2SA 3WB9A 2P9JA 4BWVA 2CZCA 2V7QA 3OPMA 4RZ3A 3ZWXA 3HJBA 4N3BA 1YHYA 3AGPA 2AN5A 2BM1A 3AU9A 1R74A 4N7RA 5J59A 4MO2A 5CA1A 2X1VA 3KYCB 3HBMA 5DNEA 3RVKA 3ZU3A 2XMPA 1NI3A 2DTEA 1QR6A 2K6GA 3IILA 1HX7A 1JKMA 1ZD1A 1YL7A 4QM6A 3G2HA 1E62A 4LF5B 1TVKB 3WYNA 4WBNF 4XH9B 2BRUC 3DKPA 4K6CA 4NJEA 2W42A 1S8NA 1X13A 2A57A 3TD2A 3KQKA 4CUZA 3R6DA 4YACA 1KI6B 3LG2A 2VQ3A 4RHXA 5H3CA 2RHHA 3OZEA 4YK7A 5ALZA 3PJRA 3INNA 4AS3A 5EHXA 4NNOA 3B60A 4AZ0B 2PKEA 4NV1A 4FU0A 5ERYA 3BUSA 1WUTA 1RMQA 2BCJQ 3LF1A 4PFQA 1ZGZA 5JZOA 2VDRB 2G67A 1JIUA 1RLMA 4Z53A 4NCKA 5EJGA 2WDPA 3RUEA 1OFTA 4E5MA 3A6PC 4NBKA 1UIRA 3TL3A 3T3PB 1GLVA 4KN5A 3P2YA 2ORIA 4RH1A 4R16A 3TKYA 3OTWA 4JC0A 1BGXT 1SHUX 3H5AA 1VECA 5CLQA 1ORRA 3PF9A 4OQEA 5DLPA 4D3YA 4G8CA 5BSWA 5AHXA 1KIFA 4LQDA 3OZIA 3R76A 2B36A 4Y9DA 1UMBB 1AS2A 4YMUA 5HZKA 1NFFA 1YNSA 1YIOA 3GLHE 4MGIR 4QUIA 3WG9A 1EI9A 4EFKA 1UBNA 4WFIA 5BOSA 4DSNA 5BUSA 1RQXA 5ICMA 2JD2A 4TLCA 4A36A 2CLCX 4HNAB 1K88A 4XR9A 5CTAA 3I2FA 2TMYA 3SI7A 1T8PA 3TSWA 4YAIA 1WBBA 2WSSD 3FRHA 3SYLA 1RPJA 1YFKA 2EJTA 3QPDA 2FW0A 1GZVA 5KNBH 1F2DA 3LX4A 4B3XA 2BL4A 4UZSA 4PPQA 2ZBRA 3CX6A 3H4IA 1E1DA 3KVYA 4ZVMA 5AUPB 3D3WA 1A9QA 1IHOA 2IV2X 1JB9A 2OGTA 3VR2D 3MS7A 1LDYA 5FLKA 3BH6A 3ZV4A 5GINE 4GPD1 1JBQA 3CVYA 3VVCA 1C5KA 2W4MA 2AOXA 2Y05A 3GELA 3BIXA 2QTLA 3ICWA 1UT6A 1C1HA 3HB9A 4CMEC 1YB2A 4F5EA 2QS9A 2VH1A 4R1PA 2DBZA 3QVUA 3EODA 4QYSA 1P7WA 2P3SA 3SEZA 1Y7HA 1NKTA 3K35A 4QYWA 5EY5B 2Z6UA 2PJUA 2GNAA 1M6VB 3EGXA 1VJDA 1Z17A 2IYOA 4OKIA 3P2IA 4YQEA 2PA3A 2VC2B 1I2CA 3W5IA 4G4SP 4KXWA 4IHJF 4IS3A 3ST7A 1A71A 3AJRA 2WT8A 1FW8A 3DO5A 4ZOQI 1QH1A 5E1OA 1IJBA 5JROA 2R1VA 4TRJA 5K8TA 2HX1A 1NW8A 3A70A 2A0KA 4M8KA 3WRYC 4RSMA 5MGBA 4UQLA 2O3JA 1KQGA 2C1XA 2Z43A 2GZHA 2WDZA 1J7KA 1RWQA 3LA6A 3UJAA 4PSKA 2C9BA 2N0SA 5CP8A 1M2JA 2QMUA 2VP4A 4WXPA 5BSUA 4P4LA 1RRGA 4FI3C 4MRVA 2RKBA 4JK3A 2IX9A 1YBFA 3GAMA 3JD3A 2WJPA 4TLDA 4F8JA 1Z5GA 1XA4A 2UUPA 3P0HA 4ETIA 4F3CA 2NQ8A 3CEMA 1NBEA 3IBSA 3F8WA 5EKTA 5KJCA 3HH8A 4B5KA 3AVYA 3S68A 2TMGA 2QQEA 2OLKA 2X22A 3PPIA 2LUOA 3U3RA 3H2KA 3KLNA 2P4UA 4C1BA 3WGJA 4DCPA 2AFIA 3SKXA 3U39A 3NLLA 2HI0A 8MHTA 2PRIA 2P4SA 4BJ5A 1W19A 4O5AA 1ACLA 3THSA 1ITZA 1QIFA 1TD1A 3UPDA 3IOMA 4HQKA 5HKBA 1ACMA 1WU8A 2R86A 2IFTA 1N5RA 4Y2TA 3W04A 2J3HA 3PHIA 5C4MA 5TRTA 3AVUA 1F38A 1MG0A 2JIOA 2IXGA 1DEHA 4ETMA 4YRMA 5KYUB 5J3JA 4JBYA 3WY9A 2WIGA 5CFQA 2GXSA 2RCNA 5EQFA 1WJGA 4F3YA 1G2PA 3STHA 4FBMA 4OGGA 3QXGA 4YMLA 4ENRA 1Z4LA 1CKEA 2K7FA 3IUMA 2IKQA 1GITA 4N9QA 3HZRA 1RE1A 4RANA 4FNOA 2R6DA 2ZCJA 3ERCA 3AHJA 2PRZA 1ZMOA 4ZVKA 1S8OA 1Q1GA 2IE8A 1JDBB 4UE2A 2IUYA 5DTEA 2BBOA 4WPGA 4JXZA 3V00A 1UQTA 3WADA 1VGVA 4JB2A 2N42A 3K2QA 1VG9B 1N7JA 2VXYA 1SKYB 2ZJ0A 4PPYA 2C7VA 5EHGA 2P1RA 1G291 3FWKA 1CV2A 4RSHA 3WK5A 5IFLA 5MF6A 2ZYVX 1OROA 3F4BA 4QXAA 3E5RA 3Q0EA 3V8QA 2BEVB 5TPZD 5DBOA 2ACEA 5KTMA 4FYIA 1B6RA 4BFVA 2W2PA 1H8HA 1RHKA 4IJ5A 4A0FA 1YGYA 3R3XA 1N5LA 4YAOA 2XLCA 1CETA 4DLPA 2O1EA 2EAUA 5ELMA 1Y3FE 4FHDA 2FFAA 1OF1A 4TTQA 1BQEA 1DKRA 3E5HA 4FT4A 4XGRA 4UVHA 2GJ8A 4RH0A 2W48A 4UUQA 2P6NA 3MAGA 4N0PA 5G0WA 4WSOA 4OHOA 1UOQA 2DRIA 3IALA 3OJLA 3G0OA 2IXEA 3CB2A 1GDHA 2G9UA 3LXMA 4G36A 1G2OA 3CLKA 2B69A 3DT6A 4DUZB 5KAPA 2WILA 1T3ZA 3CLSD 1JXOA 2ZB3A 2I80A 4OMUA 3TAUA 2MYPA 2UYOA 3QPVA 2HMUA 4C0HA 1VI2A 5DMHA 1AB6A 2NTEA 3DP9A 1RXEA 3B9QA 2J33A 3NDIA 1UMDA 1AKNA 2O8NA 3MLEA 4JD5A 2YR0A 4L4ZA 5FULA 4CTJA 4PZYA 3W90A 1X1AA 3JQGA 2B98A 1MXHA 1GQFA 4NATA 4ZJPA 5AVVA 1TK3A 4XAQA 4DEVA 2E4AA 3CBQA 1NYLA 4QBGB 3DL2A 3GLIA 2NMVA 2TS1A 5K9ZA 2EX4A 2C83A 3I9JA 2PGNA 5J40A 4BLQA 2HKIA 3PICA 2RB4A 1ZH6A 5MHTA 2O57A 2YVQA 4ES6A 1AHIA 4O2AB 5BMOA 4ZQEA 5FLEX 4E88A 3ZCRA 5B4VA 1L5LA 3D7RA 1R27A 4R9VA 4JOBA 4WDQA 4MWOA 3RIXA 4DQLA 5J47A 4FLFA 4AJ4A 4XWGA 1U3WA 2Z5LA 3WGQA 2YNMA 2JDIA 2WSMA 4AG3A 3R3SA 2GDJA 3IUSA 4M9RA 3T7TA 4AB1A 3I6YA 1PFYA 2Q21A 2NU9A 3LX6A 2RHMA 4F4UA 5HPYB 4LFCB 3DBRA 1RWKA 1HLDA 1UT8A 1L5OA 1DFGA 3TG8A 2DTXA 1QYDA 1S1MA 2PZLA 3TOXA 3PG5A 2D1FA 1DT5A 1WPRA 4HDMB 2XH8A 4LJAA 4CKCB 2W71A 4MSUA 1LW6E 1U11A 2WJIA 1L1QA 1QGUA 1Q3HA 3H19A 3K1AA 5KNBD 3PCTA 2NO0A 1XZEA 3C3XA 4UARA 3SIRA 4QG3A 3GFGA 3ASYA 3I23A 3VPCA 3EXAA 3KHKA 4P7KA 4Z51A 1UJBA 1QPBA 3IIEA 3PRKE 1YBVA 3E35A 4M1TA 4RK1A 1PS9A 5KYVA 3TLEA 2O6LA 3HM9A 2CCJA 4Z54A 3C15C 2NZYA 1CG6A 2GHIA 2H2IA 3L84A 4PFJA 4C4TA 2IHTA 1GXSA 1UMCA 4QOSA 3PNVA 4I2NA 1GCGA 2FA9A 1RRPA 2RK3A 1UMKA 3FPSA 1ZNZA 1TYDE 2V7PA 4HK4A 5AJHA 1CR1A 1R3DA 2P6OA 2YFQA 4XIFA 3QY9A 2NXEA 1PUJA 4D0RA 3CEPB 5TEVA 5H68A 5BYAA 2XA9A 1ZIXA 1O5OA 5HVNA 2JLAA 4AUNA 1SA0B 3HACA 3P2KA 2XB4A 3RVNA 3L4EA 5K0LA 1BSVA 1OJ7A 4RF3A 2XUDA 1Y82A 2BZ0A 4MARA 3S6JA 2OXRA 3AOGA 2WMOB 2ZJ6A 3W5JA 1VHLA 4ZDJA 1L7PA 4R9RA 3RIHA 2W6PA 4LF7B 2IV7A 2CXSA 4G65A 2O07A 4C76A 4NU0A 3C2QA 4YT2A 4R8SA 4MEAA 1FDOA 4CMGA 1QGOA 5SZJA 5IJWA 3P19A 2GN9A 3K7EA 3OQ6A 2QUZA 4I4TB 4KWTA 2G71A 1CEYA 4I1OA 4GZ3A 1SPXA 4IHAA 4FYPA 3ZBPA 2HWUA 3LX8A 1MA3A 3NHSA 1UEJA 1U0EA 4JYPA 4TSRA 4WWHA 1RCFA 3R3ZA 3WNDA 3ZWBA 2INGX 3WLOA 4LKRA 4LV5B 1B6GA 1SVUA 3KALA 4QHSA 1T3SA 3HXKA 4LXQA 4MA4A 3WNCA 3P9XA 1NRJB 2YVAA 3B9PA 3R3WA 3GLGA 4NL4H 2B4RO 3T35A 1DGQA 3DEIA 1TQ2A 4IMJB 3SVTA 2VHJA 1ZK4A 2NN3C 2I8AA 4AJIA 2ZBQA 2IZ6A 4NJOA 1W73A 1C3VA 1EDOA 1ZM4A 4RWZA 5CYFA 2I71A 2V6IA 2QTFA 5CXXA 3MJHA 1SCQA 2XYRA 5FWDA 2WJGA 3NONA 3B13B 4QZVA 4GSYA 2JATA 3NP7A 4MHSA 1SUSA 2W8BA 5GONF 3BFKA 5M7EA 2WWHA 2ZJ1A 2VTKA 3ORHA 4RD4A 4TV9A 2WHRA 4AF7A 1ZJ6A 1Z0JA 5TF4A 3WX0A 4QPCA 4K86A 1PTKA 3UANA 5FV4A 3GMDA 3I4LA 4F93B 1DC5A 3UPTA 3ZDQA 1V16B 2QW1A 5DHSA 1XRRA 3GPCA 1CF9A 1KI8A 3KZNA 1BC5A 3AR4A 4HXYA 1KR5A