4YA6A

Crystal structure of ligo-apo form from sphingobium sp. strain syk-6
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
295
structure length
270
Chain Sequence
MQDLEGKVAFVTGGGSGVALGQAKVLAEEAQMKVVIADIRQDHLDEAMGYFSQKNVAVHPVRLDLTDRAAYAAAVDEAEQVFGPVDLLCNTAGVSQFGPIEKATFDDWDWQMDVNVNGVINGVMTVMPRMIERGQGGHILITASMSAFVALPTTGIYCTTKYAVRGLAESLRVEMPKYNIGVSLLCPGGEAVFAGLKRVIEHGFDPVDLGRVVLDAVRNDRFWVLPYPEFAEGQKARDQEVIDAMMSYADHPDYARRMKIREQMKRDMPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords C alpha-dehydrogenase
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
source organism Sphingobium sp. syk-6
total genus 103
structure length 270
sequence length 295
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ya6A01
1DIRA 1EQUA 4HBGA 2CNBA 4MPDA 1HDOA 3HG7A 4MVJG 3WLFA 4OHUA 3S1LA 1GZ4A 3BMOB 1W4ZA 3EDMA 2VWQA 2EEZA 1E3SA 3KO8A 3GY0A 4H16A 4XJTA 4YPOA 1VJ0A 4PRKA 1BDMA 4PLCA 5EN4A 8LDHA 2IZZA 3INGA 4IXTA 1AUPA 4OXYA 3H9QA 3M6IA 5KVQA 5CFZA 3JYPA 2GN4A 1SC6A 1Q0LA 2D2IA 4IM7A 1E92A 3L6EA 5FWNA 3IKTA 3L4SO 2PKQP 3QW2A 4E3ZA 3I9MA 2Y0EA 3PHIA 3ZHBA 4XRRA 4D7AA 3TRIA 2GGSA 4CUJA 3FWZA 2DFDA 3AJRA 3FTPA 4UEOA 1HDXA 5JNLA 5AXAA 1OFGA 2NSDA 3S2FA 1EK6A 1DIBA 5DBGA 3GN2A 3E9MA 4P22A 3W4JA 4DLLA 5F21A 4PZCA 1N2SA 3NT5A 4I8XA 2WYVA 1NQAO 3BIOA 3VVCA 3C1AA 4DQVA 2EW8A 2CZCA 5L53A 4JIGA 1N7HA 1E7RA 4RVHA 1PGNA 2AW5A 3C1OA 4NJMA 4FDAA 3TOZA 1RJWA 3QA9A 4MKZA 2G5CA 3U4DA 2PZKA 3GK3A 3LQFA 4N5MA 3TF5A 1ISIA 4NZ9A 2RCYA 5HWSA 4YAJA 1JU9A 3JQGB 1WZEA 3DDNA 4RPHA 2WEKA 3I9KA 3RUAA 1UDCA 2VN8A 3I4FA 4XJSA 1HE2A 5IZCC 1R16A 2C2YA 2VYVD 5JMWA 1JWAB 1K2WA 3NGLA 2WM3A 3RWBA 4GSLA 4FB5A 2RH8A 1D3AA 3IIEA 1ZEMA 3GZNB 3TNLA 4BNIA 4AJ4A 1R12A 1SPXA 3WTCA 4E5MA 5EMHA 3PZRA 2BI8A 3H8VA 4BO5A 3GN1A 3L6DA 4AJEA 3JCZA 3GVHA 4CM9D 3MTJA 3HB4X 3DTTA 4DIBA 2EG9A 1LRLA 3MJSA 1GYQA 3GNSA 4NBRA 5CP8A 1D8AA 4CMGA 2B5WA 3D5TA 3SXPA 1P45A 4IJUA 4Y9DA 2CUKA 3NTQA 5TNXA 5GY7A 4OQYA 5TLSA 1QYWA 4U0JA 4A5OA 2IZ0A 2D1YA 1O94A 2A9FA 1C0PA 3D64A 2EWMA 2D59A 3GVCA 4Q3NA 4I9HA 1HDYA 3DAGA 5JAIA 4ZQBA 4Q3AA 2ZCUA 2J3HA 2JCXA 2JAHA 4DPKA 3GEDA 1QORA 3B70A 4PGFA 5G0WA 1SBYA 5I9NA 2JD2A 1GFSA 5A5FA 1UP7A 4ND3A 4FC7A 3SLKA 1B2LA 4CV1A 1DEHA 1DDOA 3O4RA 3D4NA 3GDOA 5HRUA 3QQPA 4QFCA 5CHEA 4B7XA 2QZZA 3GAFA 4DREA 1ZUD1 5F5NA 5LC1A 1PJBA 1ZCJA 3PXXA 5KKAA 3DFUA 4A0SA 3UUWA 3V5NA 2J5KA 2PD3A 1N9GA 2IODA 1N1EA 1GADO 2NQ8A 2PZJA 4RQUA 3JQBA 3OETA 4HX5A 1YONA 5EIOA 1PJTA 4BO9A 1UDBA 5IZ4A 1VLLA 1BMDA 1TT7A 3MTGA 3HDQA 1GYPA 1PEDA 4OM8A 4E5NA 3R1IA 2EGHA 2Q50A 1Y7TA 4YT5A 3W8FA 4DRYA 5KKCA 3DHNA 4UULA 3VKVA 3K31A 4YAGA 5AXDA 1P74A 1EQ2A 4IINA 3PP8A 3O8QB 3F4BA 5GMOA 1RM5A 2G17A 2V65A 1LNQA 3CMCO 5TRTA 3ASVA 3OSUA 4YTEA 3WNVA 4ZQHA 1B0AA 1WLYA 3HB5X 1I24A 5AXCA 3KBOA 2BFAA 1YDWA 4AJHA 1U8XX 3JQ8A 4RO0A 4U5QA 2RHRA 4CUZA 2C5AA 1R0SA 3CUKA 4L0QA 4Z0HO 3ZWVA 4BIIA 2GO1A 2VT3A 4G5HA 3VZQA 2HDHA 5F5LA 5G0UA 3VH1A 3RBZA 4DGSA 5U9CA 1E6WA 3Q11A 4DA9A 3G1UA 4WK6A 1QKIA 2QX7A 5DCWA 4ZVVA 3F1KA 3BTOA 2BGKA 3ZNOA 1UR5A 3A1NA 4JJGA 2DBVO 4MKRA 1XQ6A 1JAXA 3UKOA 3EW7A 2GPTA 1CEQA 2ZTLA 1JTVA 2JD0A 4CLHA 4BKRA 2NTJA 2UUOA 3B1KA 3ZWOA 9LDTA 1LSUA 4Y6PA 4AJJA 4J90A 3HHPA 1E5QA 2NVBA 3JV7A 4MIEA 4A27A 2Q46A 1A9ZA 2XAAA 2X58A 3JQ7A 4L9RA 4IQ8A 3QVXA 3RASA 1ULSA 1A7AA 3DBLB 4IQGA 5BSHA 2GZ3A 1LRKA 3LLSA 1EVZA 1ULUA 2EHDA 5U1PA 5G2OA 2HK8A 2YFQA 3AI3A 3MZ0A 3SC4A 4E32A 5JCJD 2JL1A 4YAIA 4KDFA 3AM3A 4D0SA 1U3VA 2B4QA 1CDOA 3ZGYA 4BOYA 3K30A 3DR3A 4BGUA 3OIDA 4WLNA 4JK3A 1ZBQA 1X7DA 1ZSYA 2O3RA 3FCOA 3INRA 3Q9UA 5HA5A 3RBVA 3RKUA 2Y67A 3M2PA 4MVJI 5T57A 5KVSA 2UAGA 2YYYA 5CDTA 1DJNA 1D7OA 5JYEA 4UEKA 1G0NA 4CLRA 3LT0A 5I9LA 1OZAA 3E5MA 3OICA 3NJ8A 1Q7BA 1T4DA 1XU7A 1E3LA 3WYBA 3BA1A 3L9WA 2VOJA 3BMQB 5AYVA 4FFLA 1IZ9A 1TT5B 4D3FA 1U4OA 4I5GA 5EERA 3WX0A 3JYQA 3MJCA 4UVHA 1T26A 4GVXA 2NQTA 4J0FA 3T4EA 2DTXA 3KUXA 3PI7A 5TC4A 4I5EA 3TDKA 4OXKA 3IJRA 3JQAB 3VAZA 4J7CA 1GU7A 2C0CA 2FR1A 3C3XA 3TWOA 1P3DA 4WLUA 3MWEB 9LDBA 2EIHA 3H6KA 4YCAA 4E4YA 4MIOA 2ILTA 3A9WA 4PLVA 2BFPA 1MX3A 2OGUA 4Z9FA 3ZWCA 5FYDA 4Z6KA 2G76A 2YHIA 1DXYA 5DOZA 3TZKA 2IYOA 2WJPA 4PG6A 2FPIA 1ZXBA 3WB9A 1PQUA 2FY8A 1H6DA 2J5RA 4RL6A 4LVUA 3V1YA 4Y67A 1QLJA 2X9VA 5I7VA 1WWKA 5MDHA 2B35A 1CYDA 4RDIA 2ZQYA 2DM6A 5T67A 4K6CA 1OAAA 2QW8A 5BQFA 1BRMA 4UREA 4TRMA 4N5LA 4YQZA 4HFJA 4OQZA 1T1RA 1QSGA 3RUHA 4PLHA 4YYZA 2ZJ1A 3BTSA 3N7UA 4AL4A 4CR8A 4K9DA 5HS6A 1B8UA 4WNIA 4AJNA 4MIYA 5A03A 3RROA 4EITA 2ZTVA 2NU9A 4MVJD 5K6AA 3OJEA 1MUUA 5G4LA 3DMTA 3ZWYA 3ROQA 1UXGA 3AFNA 4CMJA 3WSWA 1I30A 5A05A 2VZ8A 2QRLA 4I5FA 1LDYA 1HTBA 4BNUA 3RUEA 1YL5A 3JQ9A 1E1MA 4UEJA 1PJQA 4EI2A 2H6EA 5T6BA 2P9GA 2QYSA 5KCZA 2ZB4A 4IPTA 3PRJA 3L07A 1X13A 4RVDA 1DJQA 3L6OO 1MG5A 3U4CA 1I0ZA 2AQ8A 1FDWA 5A4DA 5K6AC 1EUCA 1KVQA 2WD7A 2FR8A 3DMTC 4DMLA 3C24A 4JBIA 2VHVA 1LRJA 1XIVA 5JW6A 1E0DA 4J4BA 3H7AA 3PJFA 3OMLA 2F1KA 4JROA 3TZ6A 4CQMB 3KSDO 4IIVA 4J2HA 2AEJA 4WLEA 1QR6A 3KM0A 1Y1PA 2P5UA 3RFVA 4BB6A 1LC0A 2DBQA 3WFIA 5CEJA 1K3TA 2P4QA 1BVRA 3UXYA 4CV3A 1YQDA 4RPGA 3NV9A 4UAGA 3NKLA 3QY9A 2W98A 3P2YA 2C07A 4R1TA 4BGVA 4D46A 3PEFA 1FF9A 1XHLA 4MOWA 2OZPA 5DULA 2D0IA 1TA4A 4YT4A 3GPIA 3QHAA 1Q7GA 3P2OA 4FBGA 4DWVA 3IC5A 4FD3A 1KC3A 4UUPA 1IPFA 3FHLA 5C37A 3JQFA 4R4JA 3G49A 5ES3A 2EERA 2CDAA 4GLLA 4MP3A 1TEHA 4YJHA 4F3YA 2Q1SA 1XEAA 3HQ4O 3PFWO 1E3EA 1NYTA 2LDXA 4CV0A 2YV1A 1H2BA 3G3EA 1L1FA 3FWNA 2R00A 1XLTA 4HADA 4LW8A 2QIOA 4GI2A 1DSSG 1GY8A 2ZTUA 1KOLA 2C82A 3ZV3A 3IS3A 3ZWWA 1E7QA 1OC2A 4ROSA 5HTOA 4L74A 2TMDA 1LU9A 4BGEA 3JQFC 3D4OA 3VKUA 3M1AA 1JN0A 2DPGA 4GX0A 4GWGA 4JP2A 1EEHA 1NXQA 3H3JA 2W2LA 3GVPA 1A71A 4FSHA 1SB9A 1Q1NA 2JAPA 3KYCA 3QSGA 1GR0A 2D5AA 2YDYA 1AGNA 4JN6B 4DPLA 5IN5A 2VZ0A 2Y0DA 3CSDA 2X7HA 3KETA 3Q1LA 4ZGWA 1N92A 1IY8A 4QXMA 1JKJA 3TL2A 1DAOA 4CL8A 5F1KA 5JO9A 3WJAA 1ADCA 2WYUA 1N9GB 3W6UA 5THQA 2Y1FA 3I83A 4NBVA 1EMDA 4I1IA 4PFJA 4UVIA 4YEDA 4GAEA 3HZZA 4WPGA 1P9LA 3JD2A 3V1UA 4CPDA 1J49A 5IDYA 2PZLA 1E7WA 2PD6A 1DLJA 1QYCA 4II2A 1MP0A 2FZEA 3RAJA 4XQGA 1A7KA 3PVZA 4IUYA 4JJIA 4UVEA 1K89A 1QXSA 4E12A 1H2HA 2EGGA 4IGFA 5CPFA 2O3QA 3UH1A 4CJXA 1R4NB 4BGIA 3BMCB 2O2YA 1GQQA 4M87A 1VPDA 4HFRA 2PKQO 4HXYA 4LSMA 2HK9A 3T4XA 4BKOA 1EVJA 4TZKA 4YRBA 3BAZA 2CVOA 4XWYA 3ZCXA 1GD1O 2JFGA 1ZEJA 1Y5RA 3VTZA 2B0JA 3PDUA 3DXFA 3I6QA 1UAYA 2OFPA 4FS3A 4FN4A 4TROA 5JC1A 1EE9A 2OMEA 2YUTA 2A92A 4R69A 4QO7A 2PZMA 5ICMA 3WYCA 4BL5A 3E1KA 1EZ4A 1XSEA 4WLVA 1ISMA 4O1MA 4U8GA 4E2YA 3EVNA 1HDGO 1PGJA 2P2SA 1I2BA 2GDZA 5COAA 3H2ZA 3RBXA 3DTYA 4IDAA 4CV2A 3BMNA 2H1SA 1P77A 1U3TA 3NTOA 3PIDA 4WOJA 2GD1O 3KEQA 3CH6A 1PZEA 3NRCA 5C3MA 3KTDA 2CSUA 1U5CA 3PDJA 2DAPA 3OJOA 1V6AA 4UUNA 5KJEA 4R41A 1SNYA 1QLHA 4XIYA 3WGYA 4E2WA 1UXKA 4M55A 3L4BC 1ZK4A 3PTZA 5TIIA 5IXYA 5G4KA 4M86A 2X0NA 2BI7A 3LK7A 2GF2A 4QSMA 1YBMA 1SOVA 2JCVA 4OL9A 1ENPA 3VC7A 3TZCA 2JJYA 4CMEA 1R4MA 4YXFA 3K92A 1YBVA 3PPIA 1NHWA 4R1NA 4IQ0A 5BT9A 5DOVA 3C8MA 3HWRA 1EUZA 3FSRA 4XQ9A 2AEMA 1Q7CA 1FDUA 2Q4BA 2JKVA 1U3WA 1NR1A 1M6WA 2HO5A 1R0LA 3WGTA 3I9JA 4CQLB 2PY6A 4YJFB 3FBTA 3WWYA 3IDSA 1QMGA 4FFOA 4XGIA 3PYLA 5LCXA 1X7HA 5CG1A 4D0RA 1DRVA 3NX4A 3V2HA 4KOAA 4BO6A 3CIFA 4YDRA 1PS8A 1NWHA 1VJTA 3OP4A 1BTOA 2DTEA 1JA9A 1YQGA 1LUAA 2FMUA 1S7CA 4FC6A 1MFPA 3EZLA 1Z75A 2E37A 3E8XA 1EVIA 3Q3CA 4RVUA 5I7SA 6LDHA 1L7EA 2JCYA 3WGGA 1ZK0A 2YQ4A 4WCDA 1DFGA 4ND2A 3TZQA 4WE3A 1K6IA 2EV9A 4C4OA 4DVJA 2PWZA 1E7MA 1LSOA 2HRZA 4A10A 1KVUA 4OAQA 3ZWNA 5ICSA 2GYYA 4IY1A 4PG4A 3S2EA 3UVEA 1KETA 4JNKA 1B14A 4NJOA 2GZ2A 3WQRA 1NWCA 3ENNA 3DBHA 3GFBA 1H5QA 2IZ1A 4GL4A 1FXSA 1NBOA 2IEBA 3IOYA 4RVFA 1CQIA 1ML3A 4DYDA 3ZN2A 3A06A 3U9LA 2E82A 4FJ1A 3S2IA 3V1TC 2VUUA 2GNAA 5TX7A 1RM0A 1Y8RA 4R5MA 4W99A 5A9SA 2NU7A 3FI9A 5I7EA 3R6DA 2AQHA 1C1DA 4AVYA 1B26A 4R68A 3C7CB 2O48X 4Y98A 4XDZA 2O3SA 4YQYA 1ZW1A 4I9UA 3VTFA 2O3TA 5KIAA 4JXKA 4BB5A 1WXDA 2J8ZA 2X5JO 4J43A 1PZGA 4Q3DA 1B16A 5IFLA 1KBZA 3ON5A 3I5MA 4PLTA 1HE4A 4EJMA 1DC5A 2I67A 3ST7A 3JQ6A 1KVRA 2Z95A 3EAGA 4QUKA 1YJ8A 3X2EA 5FEUA 4ALKA 4K1LA 4J1SA 1T2DA 1I3MA 4MVJP 5THKA 1ZIDA 4Z9XA 5AOVA 2BF7A 3RKRA 3FPCA 4M1QA 4XKJA 4DC1A 4EJ6A 3AY6A 3GHYA 2X9NA 5DDIP 1IHXA 5C5IA 1XCBA 1X1TA 1GUFA 4IDEA 1C0IA 4O6VA 1HYHA 1PL7A 4RCVA 3E9QA 5TGDA 1JVSA 4E5YA 2VOEA 4YR9A 1H6CA 5DBFA 3PQFA 2C59A 2H5LA 5EPOA 3SVTA 2FR0A 2OORA 5JYDA 4YRDA 2UUPA 1B3RA 4N5NA 1PSDA 4NBUA 3HE3A 3WGOA 5A3JA 2W2LD 4FJ0A 4DL9A 4AFNA 2YY7A 1NASA 2A35A 3F5SA 4HP8A 3ZH2A 1P44A 3AOEA 5ER6A 3HDYA 5JY6A 4J4TA 1BXKA 2CVQA 2JD1A 1GL3A 5C7IO 4G2NA 3A28A 3IJPA 3D3WA 3H2SA 3D4PA 4PLWA 5JSFA 3DO5A 2J3KA 5ITWA 1UP4A 2NWQA 3MJEA 4QQRA 1ZSNA 1RYDA 1Y8QA 3FR7A 1U28A 3F4LA 4OKNA 1E3WB 3HFGA 4UUOA 1O95A 1XQ1A 3ADOA 1NFQA 1DO8A 4QECA 4YJGB 4RLHA 3QIVA 4J0EA 5DF1A 3PGJA 1IYZA 2ZB7A 3K5PA 3ZWPA 3ZV5A 3TZHA 2B4TO 2HMVA 2AQKA 4BO2A 5BR7A 3AOEC 1NFFA 1J5PA 3GC6A 3KLPX 5A06A 3RJ9A 5JY1A 5JO0A 4RQTA 3B20A 3ZWXA 1XA0A 1R0KA 3LVFO 3U09A 2W2KA 3I9NA 5A1TA 3DL2A 1X7GA 1ISFA 4NMHA 4M49A 1YB1A 3AM4A 3GGOA 1B3BA 3NT4A 2R6JA 1YS4A 4TKLA 1CQJA 4EUEA 1HDCA 4NIMA 2I99A 4ZD6A 1PQWA 3UF0A 1LXCA 1VI2A 2VT2A 3QP9A 2W90A 1M6HA 5HM8A 3HN2A 1X0XA 2VHZA 3GAZA 3ONDA 3CZMA 2B5VA 4YRAA 4B8WA 4C7JA 1DC4A 2BH9A 1YQXA 1H6BA 2PA3A 3UAGA 4CM8B 2AE1A 3WYEA 1U2DA 1F0YA 3G17A 5HS4A 4EW6A 4B3HA 4R1SA 4RPLA 2HJSA 1QV7A 3WWZA 5A04A 4TRRA 1KS9A 3QRWA 4LK3A 2B36A 2HCTA 2YV3A 3NDIA 1BXGB 4ZQEA 4TVBA 2VNAA 5U4QA 2BLLA 4YB8A 4J1NA 4W7IA 2HSDA 2NM0A 1KERA 3CINA 2UVDA 3HJAA 4PLZA 3VHRA 1PU2A 2Q1TA 3LT2A 4S1VA 4W82A 3GNTA 1SAYA 4M54A 3U62A 5JE8A 3AM5A 4Q3BA 3DONA 3PK0A 4NPCA 1JKIA 2NADA 3VH4A 3JQBC 3DZJA 4CR6A 4FGWA 4IIUA 4TMFA 3ZNQA 3PHLA 5CDGA 1N7GA 2VHXA 4NK4A 1H9AA 1V3UA 3DBRB 3ETDA 3C85A 3H5AA 1YXMA 3DWFA 5KJ1A 1ADBA 3GH3A 1NQ5A 3MEQA 3MJVA 4J9VA 1KYQA 5L4SA 5JBIA 3CZRA 3L9XA 1H9BA 3AW9A 1OI7A 2V6FA 3S2GA 1BVUA 1ONNA 1T4BA 4TWRA 3RJ5A 2NVUA 4NBWA 1YL6A 4YT2A 1T24A 1WW8A 3B1JA 5BNTA 3GFGA 5L4NA 4NR0A 1B8VA 1ZJZA 4BV9A 5L4LA 4FOSA 1E1LA 5L7WA 4J9UE 2I6TA 3RFXA 1YWGO 4EYEA 1DPGA 1E7SA 1F8FA 2QQ5A 4D43A 2RBEA 5I8ZA 2H63A 3OQBA 2POQX 2X0IA 1IOLA 4PLGA 3LT4A 1SO8A 2PK3A 3K2EA 2Q3EA 4IDFA 1N8KA 1YOVA 1L7DA 4MKXA 4B4OA 2E6UX 5KOIA 3LF2A 3JYOA 1JW9B 3KSUA 2EKQA 2VHWA 1V8BA 1BDBA 3GRKA 5JPIA 3UICA 4CLOA 1IULA 4CMHA 4RZIA 1B15A 4S3MA 1AE1A 3WGHA 5T5QA 1R4MB 4NG5A 3JYNA 1FDSA 1PJSA 3PWZA 2BGMA 2X5KO 3L0DA 2GCGA 5I7FA 2FHSA 1O6ZA 5KJ6A 1LLDA 5GZ6A 1UXHA 3KZVA 2DPHA 2A94A 2BELA 3CE6A 5CEEA 3VPSA 2BKAA 3AY3A 1ZMTA 3O9ZA 3GRPA 3OM9A 1K5HA 4ALIA 1I10A 2ZIZA 4WKGA 2I3GA 3MCVA 2CD9A 4L4SA 4CMIA 4AJOA 5CDYA 1EFLA 1UXIA 1O0SA 2X4GA 1FDTA 4FR5A 3DZKA 3PLRA 1FMCA 3H5RA 4GSKA 4IJKA 1YBAA 1LLUA 1Y9EA 2IE0A 2Q1UA 3SLGA 4B3IA 4CM4A 3C7AA 3PJGA 4ALNA 1PIWA 1QRRA 4TRJA 1LDBA 4IBOA 3HFSA 4BKUA 4YAKA 4ND1A 1HE3A 4L76A 3GGPA 4AJLA 6ADHA 3SJUA 4DIOA 4IXWA 4Z3DA 2XPCA 4MDHA 2B69A 5EQDA 2RIRA 2WE8A 1BW9B 5L45A 3BTVA 3KYDB 3VPHA 5JMPA 2RH4A 1VSVA 2B4RO 1GV0A 2WTBA 4CMAA 1Z73A 2XXJA 4J1TA 3ROPA 4MVJM 1WZIA 2CF5A 3ICCA 1UAGA 1I8TA 4IMPA 3RU9A 4JBGA 1UDAA 4PLPA 5KVVA 1KY4A 3CKYA 4WECA 1WMAA 1NX6A 3OEYA 2QRJA 1PZHA 3ZDFA 1E6UA 3DZGA 1PGPA 2FOIA 3RUIA 2YDXA 1G0OA 3DZFA 3CPSA 1NPTO 3RIHA 3UCEA 1ZFNA 3W4KA 4XGNA 2WWRA 3EGOA 5B4VA 2P68A 1HT0A 4OYRA 4XX0A 4DC0A 3QWFA 3ZHZA 4ZHSA 4BNKA 4BNTA 2AG5A 2DU8A 4HFNA 3EVTA 1U1IA 3FNGA 1VJ1A 2WYWA 3EK2A 4WOKA 3BMOA 3PJDA 2J6IA 2VHYA 4XQCA 1HLDA 2QHXA 2VCYA 1KEWA 1ENZA 2NNLD 4IDDA 4OSOA 1TLTA 2JHGA 2WMDA 4E30A 5J23A 1HF3A 4TVOA 1Y6JA 3EUWA 3WGQA 1P1KA 3WLEA 1EDZA 1E6EA 3AY7A 4WGGA 2W4QA 3I3OA 1R37A 1MG0A 2VZ9A 1Q0HA 1O5IA 4NHEA 2R2GA 4XR9A 1HLPA 1IPEA 3A4VA 3WICA 3RUDA 1PR3A 4YACA 4F6CA 5JDCA 4NJMB 3VZRA 4J7UA 2UYYA 4O63O 4R01A 3CTMA 4NH4A 2V7PA 5CG2A 3Q2KA 5L3ZA 2Q2QA 4MO2A 2PGJA 1YO6A 3H4VA 4ESOA 2Y1DA 4ALLA 4BQRA 5IG2A 3JQ9C 3FD8A 4JCOA 3U4HA 3FNHA 3D3EA 1P31A 3S8MA 4DUPA 3K9QO 5DBIA 4A03A 3JSAA 1A72A 1K6JA 3IP1A 4RZHA 4P4LA 5CDUA 4QX6A 2JFFA 1YGYA 4Z3KA 4HUJA 1HZZA 5JDCC 1IE3A 3GUCA 4P8RA 4BNNA 3ETEA 4X54A 2PKRA 1I36A 4M8SA 4XCVA 1BSVA 1J6UA 3WXBA 1UZNA 3JQGA 1BGVA 3I23A 2G82A 4EDFA 3RC7A 2HK7A 4KDEA 5A3VA 5B1YA 1HYEA 2A4KA 3GMDA 3MOGA 3KLMX 5IDQA 1GZ3A 1WPQA 4N7RA 1IB6A 1DHRA 3VPGA 1TI7A 5KTKA 1R66A 2YV2A 4PN3A 1LQUA 3ZWBA 5CDSA 3GZNA 4FFRA 3AI1A 5G0VA 4E21A 1Z82A 3RC2A 2IEDA 1ENYA 3O26A 2AA3A 2G1UA 4MVJH 1NNUA 3PYMA 4GX2A 1YVEI 1KIFA 4NFHA 2EF1A 4BO4A 1U8FO 3EHEA 4CLEA 3AUUA 1Z74A 2YJZA 5BNFA 3KRTA 1MA0A 1XKQA 4MVJE 3QJ5A 3ZNPA 3MWDB 4CL3A 3I1JA 2ET6A 3ZHYA 3WGZA 1SZJG 3PQEA 2R00C 5FI5A 1E7YA 2NACA 3WGIA 3P19A 2BFMA 3RFTA 4OKIA 2Q49A 3K8ZA 3JD1A 2GRAA 3ORFA 4E33A 3QVSA 1P33A 1SB8A 3GR6A 1DFIA 1YB5A 4P4NA 1WAMA 5DCYA 4ZN6A 3F6YA 4LMPA 2PH3A 5KJCA 4II3A 4E5PA 1DFHA 1LX6A 2ZK7A 3QWBA 1I2ZA 2I9PA 4LRTB 1CF2O 4BO8A 5CPBA 4DLBA 4KUHA 1PJ4A 4BO3A 3QLJA 3AFMA 3PHHA 4LMRA 5EJ2A 3GUYA 1Q2XA 3IAHA 2HKIA 3KXDA 1N1GA 4CM9A 2J3JA 2Y68A 1Z7BA 1C1XA 2NUAA 2SCUA 1U5AA 1T2EA 4HNHA 5IJZA 2PLAA 2Y99A 1VSUA 4J91A 1NM5A 1NFRA 1W73A 5DNAA 5GZ1A 1AHIA 1QG6A 3JQ8B 3OECA 3JQCA 4J1QA 1P1FA 5T8KA 2Q4EA 4E2XA 1F17A 3R3SA 3DMYA 3I4CA 4OH1A 4O59O 2DKNA 3R3JA 1LI4A 3O8QA 4IS2A 3PYXA 3GT0A 4AJ2A 5TSDA 1I01A 1VM6A 3GPDG 3I9OA 2J5QA 2OHXA 1WVGA 4PG5A 1ARZA 2YQ5A 3KB6A 1ZK2A 3DHYA 4B8ZA 1SOWA 3JD3A 5COBA 3RQSA 4MP6A 1MFZA 3ETGA 2O4UX 4EUFA 4MVJF 1W6UA 8ADHA 4O5OA 3EZYA 2QRKA 3NTRA 1ORRA 1KEPA 1GYRA 1PGOA 5T8KC 3D7LA 2Q45A 4GQAA 4RGBA 3COSA 3JQ7B 5AQ1A 3OA0A 4J49A 1NAHA 1WP4A 1LA2A 4ND4A 3S55A 4DQUA 4XYMA 1O8CA 5L40A 4DPMA 3WBFA 3PLNA 4N54A 1ONOA 3WDSA 1GCOA 4BNJA 4CM7A 3MJTA 4JBHA 3C7DB 4NU5A 3N74A 1VL0A 3IQDB 3PGXA 4J2OA 3FRJA 1JDJA 4RF4A 4ZRNA 3HUDA 2HAEA 3GDGA 4I08A 2X1HA 1SCUA 1ZJYA 3H3FA 2WE7A 5DN9A 1DB3A 1HSOA 1PX0A 4XB1A 3FF4A 1LLCA 3OJ0A 5A02A 3P7MA 2O3JA 2IYPA 4U6SA 1GUYA 1HETA 4AJIA 4EJ0A 3DBLA 3IUPA 1V0JA 3JQEA 4CLRB 4D41A 3I6IA 3VH2A 3ANLA 2HU2A 5DCUA 3OQ1A 4IMRA 3TOXA 4QO8A 1U7TA 2EJVA 4JQCA 3WQSB 1EBFA 2HMUA 2GSDA 4CM1A 2Y1OA 2O2SA 3WSVA 4IGEA 2AE2A 4KQXA 4CUKA 2DC1A 5TF4A 3QWIA 3D5QA 5ENDA 2NV6A 1I3LA 7ADHA 4CMEC 4H3VA 4AICA 2GLXA 4OO3A 1YJQA 2YFHA 4J4HA 4YA6A 3WR5A 1UH5A 1KC1A 3QE3A 2C29D 3B1FA 5KJFA 3LYLA 3JD4A 4JP3A 1YH3A 3DC2A 1JKFA 3GMSA 3EY4A 4MINA 4XYGA 2EP5A 2X9GA 3ULKA 4CMCA 5B12A 3DZIA 3BMQA 4FQ8A 2YHIB 4DYVA 1GQ2A 1TT5A 2C54A 1T2CA 1AHHA 1LDMA 3ONFA 1U7HA 2PD4A 4ALMA 4BKQA 1P1JA 2BFOA 3ROMA 3RVDA 2IRWA 2Y05A 3GOHA 4PRLA 3AOGA 3PHJA 4BNFA 2Y0CA 3NYWA 2BRUA 4YWJA 3JQAA 5TJHA 1NP3A 5TS3A 4PLFA 4BNZA 3ZW9A 4CLDA 2FWMX 3IL2A 3TJRA 3KEOA 4YT8A 2RAFA 1GDHA 2DT5A 3QVOA 5H81A 2DTDA 3V2GA 3DOCA 4DIFA 4D3DA 2VTDA 3WOHA 2IXBA 3IP3A 4OXNA 4PZEA 3ZZNA 5L9AA 1BG6A 2FZWA 4J16A 1EK5A 3F9IA 2VWPA 3ZU4A 2X0RA 2PGDA 2X6TA 4I5DA 1I3NA 1VE9A 4JX8A 4WUVA 1A9YA 4CM5A 1P0FA 3DFZA 4RV9A 3L77A 4OOEA 1KVSA 3OIFA 4KUEA 3U0BA 3U3XA 2D8AA 3E18A 2TMGA 5JAQA 1ZH8A 3X2FA 5ADHA 3OJLA 1PR9A 3OIGA 1K6XA 3F46A 2EKPA 2NU6A 3ZV4A 4EEXA 4K6FA 2O23A 4RDHA 1KEVA 4RPJA 4GMGA 1GV1A 2F00A 3IKVA 5I9MA 3GQVA 1I32A 1WDLA 4QFDA 2AG8A 1G6KA 2ZB3A 4BQPA 3AUTA 4ILKA 2C7VA 3ITDA 3AU9A 4BNVA 1SMKA 3VZPA 3QVWA 1NHGA 4TZTA 4B4VA 1ADGA 4L4RA 1T1SA 5H82A 1GPDG 1ONPA 3D0OA 2AXQA 2GN9A 1ZK3A 3AUAA 5G0SA 2AMFA 3AWDA 2WD7B 4IDBA 4IS3A 2FRDA 2V6GA 3OBBA 3U49A 1GQYA 1HDZA 1I33A 4GX5A 1DAPA 1DLIA 3GF4A 4A2CA 4FFMA 2AQIA 2GZ1A 3EC7A 3ZV6A 4EUHA 2O4CA 3K73O 4GVLA 4L4XA 4LN1A 3JTMA 4PG7A 1VC2A 2X23A 4URFA 4D44A 1EVYA 5JAZA 2HQ1A 1HDRA 1ISHA 1EBUA 4L8VA 3LU1A 1Z45A 5FFFA 4ONEA 3RUFA 1LSSA 5IZCA 1AXGA 1QV6A 3QWHA 4B7UA 4AJPA 2Z5LA 3NUGA 4FCCA 3RC1A 5G0TA 3ICPA 1DC6A 1OMOA 1DIGA 4WEQA 4OSPA 1PZFA 1UP6A 3HN7A 4GWKA 1UZMA 1NAIA 4Y6SA 4CQMA 4DXHA 1PL6A 2VRCA 1W0CA 4CODB 5JXWA 4NFYA 3ITKA 4ID9A 4YJHB 4OGWA 3I9LA 1M76A 5MGBA 2Y1EA 4PG8A 2HMSA 4YJDA 3WIEA 1YL7A 4DBVO 1OC4A 2FSVA 2OL4A 4MVJA 3VH3A 3DAFA 3I52A 1WMBA 4XGKA 5JCXA 3VZSA 3RD5A 3QVTA 4E31A 2EW2A 4TKMA 2O3UA 4A7PA 4RVGA 4UVGA 2ZYDA 5JLAA 3P5SA 1E3IA 4FFNA 4B4WA 3DHEA 3F3SA 4NU6A 2O50A 4IZIA 4BO7A 4DBZA 1S6YA 2HLPA 1JQBA 3TFOA 4RF5A 1UUFA 1ZKMA 4HNGA 4RLSA 4CMBA 4Q9NA 4D79A 3LT1A 3VDRA 4ALJA 3RU7A 3W8EA 1HRDA 3W8DA 3WG9A 4NBTA 3UCFA 3KYCB 3RI3A 1C14A 4QEDA 3E48A 1RM3A 2VYNA 5B37A 1EUDA 1IUKA 4E13A 1E1NA 2BMAA 3TN7A 2I3AA 2FN7A 3AK4A 2LDBA 4YBZA 4XDYA 4U6QA 4HWKA 3KYBA 3O03A 1Y9AA 1XR3A 2VRBA 5FF9A 2GN6A 1RKXA 3OA2A 3VPXA 1D1SA 3WTBA 4KWHA 2X22A 4XYBA 3WMWA 3ADPA 1NPYA 1PWXA 1UJMA 3M1LA 4Q3EA 1H0KA 1O9BA 4GX1A 4RORA 3A14A 1RWBA 4IJVA 5KWEA 5EINA 1ZZEA 1EE2A 5KVCA 5IDXA 1ENOA 4GMFA 3H9JA 5IDWA 1AN9A 1FK8A 4OIMA 3GG9A 4QTZA 4AG3A 4BMSA 2X86A 3AU8A 3SC6A 1QYXA 4INAA 3PQDA 1F8GA 4R16A 4BNYA 1C1XB 4BNHA 1XWFA 1U2GA 1YB4A 3G1TA 1VKNA 4BKPA 4R9SA 1HZJA 3AI2A 4GBJA 4W7HA 1O89A 3Q9NA 4XIJA 2PTGA 3K96A 4C7KA 1M67A 1Q0QA 4CLXA 4HKTA 1E1KA 4IZHA 2WD8A 1R4NA 2B83A 2ZYGA 3BMCA 3STHA 3VDQA 2VNSA 5T64A 3WNQA 1IL0A 2Q2VA 2DBRA 4E2ZA 2CFCA 2DUUA 3BMNB 3NGXA 2OO5A 1X0VA 1YE3A 2P5YA 3GA0A 2FP4A 5JAMA 3F47A 4ITUA 1SEVA 1Y5MA 1ISGA 2ZCVA 1K0UA 1YDEA 4R3WA 1LEHA 2ZKLA 2PH5A 4CM3A 1NVTA 2W8ZA 2OUIA 2Y66A 3ROKA 1V3VA 1HL3A 3OQ6A 3DZHA 2RHCA 3F5QA 1D1TA 3MJ4A 4GKBA 5DZSA 4EBFA 5DT9A 3UHAA 1MB4A 1F14A 4NFSA 2P91A 4E6PA 5COQA 2GUGA 3UOGA 2C20A 1I5RA 4XR4A 5G4KB 3PHGA 3M2TA 4W9NA 1CRWG 4J7XA 4LCEA 2ZB8A 4LSWA 4W6ZA 5KNLA 2Q1WA 1HSZA 5A9TA 3LC2O 1H6AA 5C7OO 1P1IA 1SEPA 2YHUA 3HDJA 2P9EA 2Z1NA 1VL6A 2ZYAA 1LC3A 3JQAD 3NDJA 3OHSX 3OJFA 5AVOA 5L51A 2ZQZA 2ZJ0A 2DQ4A 4YVFA 3K2BA 4PZDA 1PJLA 4CM6A 4OMUA 4UVDA 3SX2A 1V3TA 2PR2A 2CF6A 4W9NC 4EZBA 4HFMA 5L95A 1DHTA 3FPLA 1KEUA 2CMDA 2UDPA 1I2CA 3PZBA 3ENKA 5BSGA 5L7YA 4E5KA 4RVSA 1NVGA 4B4UA 1LQTA 1M2WA 1PS0A 3G79A 2G0TA 3LC1O 4WCFA 4FIZA 3WFJA 3Q2IA 4B7CA 3LF1A 1MXFA 1F12A 2HJRA 3GVXA 2X8LA 4WEOA 4CQLA 4YJFA 1MV8A 4AJKA 2Y1CA 1U9JA 4ZQGA 4BV8A 1PWZA 2GR9A 3B6ZA 3DBVO 2NVWA 5TQVA 2OBNA 2QZ9A 3INTA 4BO1A 1GEEA 1HEUA 2JFHA 4BUCA 1TXGA 1FDVA 2D5CA 3DBHB 1H93A 1Y81A 2EJWA 2EP7A 4GKVA 1LTHR 4OOFA 5B4UA 1LDEA 4Q3CA 2I66A 1T2AA 1MGOA 4JLWA 3DOOA 3TQHA 2NLOA 4ZU3A 4R3NA 4CR7A 3E6AA 5HBRA 4WCFC 3JQDA 3VVBA 5AXBA 1Y8RB 4KWIA 5K0ZA 1T25A 3O38A 4LGVA 3T7CA 5K9ZA 5LDHA 4XD2A 4LRSB 5A9SB 5DP2A 3WBBA 2PV7A 3NAQA 3ANMA 1C1DB 3GHHA 4FFPA 2IXAA 1CWUA 3GGGA 3VOSA 3KHUA 1JAYA 3RUCA 5IN4A 1PJ3A 1R15A 1EFKA 2HMTA 2FSSA 3Q0EA 1BWSA 3BTUA 4BMNA 3QWAA 4TSKA 3RCBA 3FNEA 4KMSA 3CMMA 1P0CA 1ZXLA 3CEAA 4BVAA 2HRBA 4J3FA 4FPXA 3ZU3A 2D3TA 3Q6IA 1MC5A 4NQZA 2BGLA 1A4UA 2VTEA 4CQMD 1EDOA 3WQQA 1X15A 2VRCD 4KTTE 1PGQA 2Y1GA 3KVOA 4WLFA 3FR8A 2BD0A 3SJ7A 3ZI0A 4Z0PA 1DOHA 1VKOA 4B79A 2V6BA 2XXBA 2DFVA 4B3JA 1GPJA 3LC7O 4MJLA 3RSHA 4A73A 1KY5A 4XA8A 4U7WA 4RPKA 2Z1MA 2J3IA 2CDCA 5JDIA 4Y8VA 2X0JA 3ONEA 1LBEA 1U4SA 4R1UA 3SBOA 2GASA 4F45A 3E5RA 3TPCA 2DBZA 1YRLA 3R0IA 1T2FA 4BHTA 2PFGA 5TT0A 4UUMA 5GZ3A 5L7TA 3DZBA 3SEFA 1DC3A 1AXEA 5ILGA 5ENVA 3OEWA 4Z9YA 4GPD1 4EGFA 1M75A 3PIIA 4BNWA 3HDHA 4O0LA 3W4IA 3G0OA 3ZWMA 4W4TA 5BSFA 1UXJA 3BYZA 1R6DA 7MDHA 3BHMA 4DQXA 1CERA 1XYGA 2VYND 4DLAA 3ASUA 4MP8A 4U0KA 5JDIC 1B8PA 5F1PA 3H9GA 3WS7A 1QYDA 3FTNA 3T7EA 3D3WB 3FBGA 1H94A 3H9EO 3V2UA 1ID1A 4L75A 5DP1A 1A5ZA 2DVMA 1Y8QB 4TQGA 1VRWA 1HE5A 1LJ8A 3NT2A 5ITVA 5TJ9A 3WIDA 4LVCA 1NQTA 5LDGA 1BXZA 1ZMOA 2FPGA 4KQWA 5F3RA 1LDGA 4NNJA 1I3KA 1RPNA 3TL3A 4BS9A 1QP8A 3GG2A 4PVDA 2NTVA 2EXXA 3WJ7A 2ZTMA 2CVZA 4HY3A 1TVEA 1WDMA 4ZJUA 1GCUA 1YKFA 1CETA 1V35A 2VQ3A 2Y93A 3EMKA 5EQFA 1E3WA 3LSYA 4NI5A 2D4AA 1XGKA 2W2KB 1JWBB 1TB4A 1UZLA 1OOEA 4YJGA 4XYLA 4YAEA 4ZICA 2BHLA 4BO0A 1B7GO 3IMFA 3IUSA 1IHYA 1XELA 3GNQA 2XF8A 1KVTA 2OP0A 2VUSA 3DB2A 4WASA 4Z0TA 1CIVA 4JGBA 2GERA 4P38A 1M66A 4DTIA 1J4AA 2WSBA 3JYLA 4KZPA 2HUNA 3KSZO 3N58A 4H15A 4F46A 1NVMB 1DIAA 4GH5A 4GGOA 4XYEA 3QV1A 2E4AA 1X1EA 1DBVO 1NPDA 5BNIA 3F1LA 2GN8A 1PJ2A 3GLQA 1ZK1A 2QG4A 1E77A 4D3SA 2QYTA 1NR7A 1RM4A 1E5LA 1GEGA 3C1TA 3RC9A 1XG5A 4NK5A 5CAEA 1MXHA 4A26A 3CXRA 1A27A 3E9NA 3K6JA 3OH8A 3UGKA 1IZ0A 2VYVA 1C0LA 5JFOA 3UW3A 4ZRMA 4NDNE 4BMVA 3FN4A 1DIHA 3PFFA 3BXXA 4KUGA 3VPFA 3ABIA 4H7PA 2Q99A 2VWHA 3GDFA 3UN1A 4BNXA 1PJCA 3BHIA 3BZUA 3ZNNA 4R9RA 3ZU2A 3NDRA 2XOXA 4GGPA 4K26A 4R51A 4CM8A 2I76A 1PL8A 2DLDA 1BHSA 1JVBA 1OBFO 1GZ6A 2OOSA 1PTJA 2JHFA 4XZ3A 5ILOA 1DRWA 1ZNQO 4OJNA 1GAEO 3H65A 3MOIA 5F1OA 5A5EA 1P1HA 5A9RA 2OP1A 3EYWA 3ANNA 1ADFA 5I8WA 1HXHA 3U4IA 1BXGA 5B4TA 3DEYX 5JS6A 4L73A 3UCXA 1MC4A 3HADA 1XDWA 1C0KA 2C5EA 1N5DA 1WNTA 4J6FA 5EL0A 4RF2A 3BHJA 2PNFA 3NJ4A 2P9CA 1Z7EA 4PVCA 1U3UA 2I5PO 3GVIA 4CMKA 4WNCA 4G81A 4K28A 4FJ2A 1QYVA 1PQPA 3WMXA 2NVUB 3E82A 3W6ZA 4IDGA 3H5NA 1GUZA 4G65A 3DBRA 4WJZA 5ER9A 4E0BA 5JC8A 3KV3O 2Q2WA 2YW9A 1LDNA 3TSCA 1HKUA 4PLYA 1NQOA 2VUTA 3L4BA 2UV8A 4IJWA 4D42A 3OF2A 1DRUA 1MLDA 4PCVA 4XRGA 3HSKA 2AHRA 2FPPA 5TT1A 5IXSA 1YOVB 4M89A 2I65A 4ZQFA 4IDCA 5IF3A 1Z6ZA 1ZSVA 1J0XO 2VWGA 3ZWAA 4CLOB 4TRNA 1RYEA 4D45A 3PJEA 3LDHA 5CEFA 3V8BA 2DUWA 1GTMA 4RJTA 2OBYA 2E48A 2P4HX 2ZATA 1HWYA 4F6LA 4GLOA 4BNLA 3GEGA 4XQEA 3FNFA 3DAPA 3PWKA 3D1LA 1ZO8A 2V6MA 4EEZA 5EESA 1E3JA 4FGSA 4HV4A 4P4GA 5BSEA 1NTOA 1JLLA 2B37A 2NU8A 2YZ7A 4Y6RA 4ND5A 5C7LO 2HMWA 2E49A 2AEFA 4CMIB 1D4FA 3GZ4A 2CDBA 4BNGA 1LLQA 1ISJA 1F06A 2WDZA 3DQPA 3KOUA 2C7GA 3DOJA 3AUSA 1W8DA 3H9UA 4CM4B 5H83A 1WDKA 3LLVA 2OXIA 1G1AA 4WCFB 3LZ6A 4AJ1A 4BNMA 4RF3A 1HYGA 2CY0A 2O7SA 4KP7A 1FJHA 4FW8A 2O7QA 3UFXA 1PS9A 2X5OA 3JD0A 2EKLA 3U5TA 4LCJA 3W1VA 4QT0A 4Q39A 3NEPX 1A4IA 3ZW8A 4I9NA 1X14A 1C3VA 2C2XA 2PGLA 4R54A 1P1RA 4N18A 5IAAA 2H9IA 4PIVA 1XU9A 3TFQA 4ZA2A 3HNPA 4FOOA 3GEMA 3ZHXA 2IDZA 4KTVE 5FI3A 4R5HA 5JCJA 4WLOA 3ZU5A 3PWSA 1VL8A 4XEHA 1LSJA 1BW9A 1ZVMA 1V9LA 3KYDA 4JJFA 4DMMA 3E03A 3OFSA 4LISA 1CJCA 2NTNA 4XB2A
chains in the Genus database with same CATH superfamily
3HKCA 1QGDA 3LRTA 4MX8A 4W5WA 4AECA 1SCDA 4NYIQ 4MEBA 1TO1E 4MPDA 1PLJA 1NVKA 4X1KA 1HDOA 4E14A 1W0JD 5IARA 5A2GA 3EDMA 3GW8A 3WGVA 1OV6A 1CJKC 1GRCA 1NDHA 1T35A 3NHKA 4A0RA 1C9JA 3GRRA 1ZZGA 2Q1YA 5LQNA 2ZSBA 2I3ZA 2QMOA 2REXB 4G67A 4OHFA 3FXAA 1E2IA 1FVHA 4DG9A 1W46A 3G2NA 2BEVB 3OFJA 4OXYA 3H9QA 3COJA 3WGMA 3M6IA 1SHUX 1CW2B 4HBZA 1SC6A 2GOYA 1Q0LA 4QM6A 4QOGA 1SQFA 1ZOOA 2GBLA 3D3KA 3G2QA 3H1EA 3L4SO 4HB3A 2PKQP 3QW2A 4C43A 4E3ZA 3HSYA 5ALMA 4WOBA 3TTVA 2H9YA 4V24A 2FWJA 2NO0A 4L27A 5EKDA 3RANA 3UJDA 3GLIB 1X87A 1AA9A 3FWZA 2DFDA 2RHOA 5LXTA 4FEGA 3HXLA 5AXAA 1FNBA 1SG9A 4UD2A 3KQUA 3KWFA 3OCYA 1MTZA 3QPDA 4DRXA 3T0IA 1J9GA 5HIMA 3WQBA 5J4VA 1DIBA 1YZKA 4JNCA 1JR3E 1TUIA 4HDRB 4LXYA 4AF8A 3AKZA 4DLLA 1R9MA 4PZCA 1NDQA 1N2SA 3B2EA 4DT1A 2ZYTX 2HA6A 3BIOA 3VVCA 2DR0A 3KPVA 3C1AA 1AZWA 1H1LA 2EW8A 3NTUA 4KQ2A 4JIGA 2YWBA 1E7RA 3IQXA 3S2UA 3EGXA 3C1OA 2ZIEA 4DCPA 4E09A 2PS3A 4NJMA 1H66A 5EY5B 1KA9H 1G42A 4RTNA 3B52X 1BJRE 4J6EA 3TOZA 1UEXC 3TJMA 1C4KA 1ST2A 4MKZA 3EXAA 3U4DA 2GBIA 3LHIA 2PZKA 2B30A 4Q4JA 1Y9DA 5F3DA 4YRIA 3R9XA 4K2AA 4FMCF 1D2AA 3LVBA 4GXNA 2P6OA 4IDOA 4YCBA 3BDVA 3H6HA 3DDNA 2G9RA 1JEJA 4W8GA 3L4JA 2WEKA 1JHUA 1CY2A 3O4GA 3I4FA 3MRSA 5EWJB 4Z4FA 1HE2A 1ZMRA 2FX5A 3P96A 2JJ8A 5HE8A 3T9FA 4KRXA 4UM9B 1JWAB 3NGLA 4EG4A 5LZ4A 2LE0A 5HKKD 4GSLA 1L5WA 2RH8A 3AR5A 4CEHB 3V4ZA 2FOXA 4W8OA 3NWJA 1NI4A 1FFCA 2QTVB 5AMXA 1S4MA 3TNLA 1X94A 4BNIA 3AY0A 2PIDA 3A37A 1R12A 2UVPA 3CN7A 4H4EA 3EPHA 2C5BA 2ODBA 2UZ3A 3EGDA 3DLPX 3GVHA 1WM1A 3JCZA 3O84A 2I54A 4F9EA 4A8JB 1HYBA 4KYTA 4DIBA 2PPVA 3DTTA 1M2OA 2EG9A 3QX3A 2PUDA 1M2KA 2FG7C 4NBRA 4F1WA 5BSKA 3K9FC 1S3GA 3KJNA 2GYWA 1QPZA 4UMEA 5FUXA 2ONKA 2W9XA 5TLSA 5H3HA 2JJMA 3OVMA 1RXWA 4OHMA 3MRXA 3KWLA 5DHUA 4A5OA 1DXQA 1FFXB 3NM4A 1N1DA 1EDDA 1O94A 2D1YA 2PGNA 4ZZ2A 2GCEA 1OT3A 3D64A 1RPTA 2EWMA 3GVCA 2IUUA 4RV5A 3VC3A 1KRWA 1GG5A 1NBEA 4P84A 4BMCA 4ZQBA 1L8AA 1L5RA 2AYZA 2ZCUA 3W2FA 5FBQB 5AK6A 3FA2A 3O74A 3VKGA 2C5SA 3PD1A 5G0WA 5TARA 5IKXA 1IMOA 4FZRA 5B7QA 1D2NA 5ERXA 4BBJA 2P6PA 5AIBA 4AN4A 4ZDKA 2R79A 3EFEA 5AJTA 2OPBA 5HUQA 3VKHA 2OFWA 3L79A 5DEIA 2MYTA 5DKFA 1DEHA 1DDOA 1CIPA 1YCGA 2GAIA 3NAGA 2PX0A 3ZDRA 3AEKA 4HVLA 4XFKA 5HKBA 1ES9A 5HRUA 2NXCA 4EX7A 4U2GA 4Y2TA 3UV6A 3BIWA 1IBCA 5FB3A 4AM8A 5DYNA 3VGPA 3PXXA 4D96A 1MKYA 4HH3C 2YVLA 3A2MA 3VTKA 3EXFB 1VE1A 3ENWA 3V5NA 2FCRA 4UHHA 2JLAA 4LRUA 1N9GA 5HX7A 3GLTA 4AMBA 3U7GA 1WSDA 5BOSB 1PHRA 3K6RA 1LJUA 2WFZA 2VXBA 3OETA 4HX5A 4LQDA 1FLNA 1MAUA 4OXIA 4UM5A 4YLEA 5DGDA 3V8PA 1ODCA 3DZCA 1Y63A 4TXMA 2QW1A 3RF7A 4N7JA 1BMDA 3FYHA 2R4UA 4HJXA 4HYQA 2P5SA 5K3AA 4E5NA 5JMTA 3IV6A 1N77A 2EGHA 2A0FA 1C7QA 2G4CA 2Q50A 4XFJA 3E8SA 3ZE0B 4FZJA 2P90A 4EB3A 2QX6A 4M1KA 3O31A 1A2OA 2B2CA 2HJGA 4YAGA 1QGOA 3C1UA 2FE1A 3NYRA 5JCPA 3HMKA 4LG1A 2ADMA 5C35A 3DL7A 4UXHA 4JJKA 5EQTA 3F4BA 2XOEA 5GMOA 2BVNA 2FW9A 2QTLA 4IYRA 1DOZA 1LNQA 1TZCA 3ASVA 4B44A 4ZQHA 3NBFA 2HK6A 3OQHA 1WLYA 3MWYW 4FDVA 2HWWA 1Z0IA 4DJ5X 5EJ7A 4DA8A 2VSXA 5TMBA 2RGYA 1KI2A 4ZMSA 1EH5A 3PUJA 4IEFB 5BV1A 5F3WB 1R0CA 2B2NA 3KVVA 4GPAA 4L0QA 4NSNA 2GO1A 2OD7A 2VT3A 1MAHA 4G5HA 3AVQA 2OCDA 4ZKEA 3UTDA 2DQZA 2R4TA 2WF5A 5F5LA 5G0UA 5BUSA 3VH1A 4DGSA 3CPEA 1E6WA 1T3GA 5U9CA 5C1DA 1P61B 3G89A 1Y0BA 3R0JA 2GZDA 1GKYA 3L0ZA 1VIAA 3Q6NA 3FPBA 1JFLA 2BGKA 3GRYA 4XH9B 4H1WA 3N53A 5AOAA 3BRWA 3K0SA 3A1NA 4JJGA 1P5HA 5ICGA 5DGXA 3IOMA 2DETA 2ZS9A 3CZ9A 3UKOA 2ZTLA 3NP7A 1NW9B 1XI2A 3EQ9A 4BTVA 1YZGA 4MA5A 1QZ3A 1U0HC 3HEAA 1JE1A 1WV0A 2HIGA 4UMDA 2PL1A 4IIJA 5EHIA 4BKRA 3OZDA 1LSUA 5GJWC 4I55A 4BQSA 5JNUA 5HJ5A 1RMYA 2JLUA 1OWLA 3WLJA 3MK31 4O2AF 1F2TA 1AX9A 1TTPB 3C39A 3PQ5A 4MIEA 1T34A 4ESEA 4ZJPA 1U2QA 3G7NA 3JQ7A 4X84A 4EHNA 3C14C 2OK8A 4H7JA 4S04A 3M1IA 4JDPA 1NVXQ 1A7AA 3A3NA 5J9FA 3LPNA 5B1HA 4ZC8A 4FGLA 5EMJA 3JAMA 2QAGC 1TD9A 5CFMA 2CMFA 3L05A 3G0CA 2XD9A 3MZ0A 4EKNB 1U80A 5BW8A 4CF3A 4P83A 4AKIA 1Y9ZA 3SX4A 3JATA 1P39A 2X9QA 3ZGYA 5JOQA 2Q6IA 1XL1A 4CWAA 4KNWA 4ACAA 1IFXA 1D09A 4RD0A 4S05A 4IF6A 1I13A 1ZSYA 4JYMA 2O3RA 5HA5A 3Q9UA 4EF4A 2NZJA 2QY9A 2JIZA 2VDLB 3O3NB 2VDPB 3I3SR 4G09A 2YYYA 5FQNA 4DEVA 1U3GA 2BEUB 2WFAA 5CDTA 3ZHOA 2RGRA 4AY5A 1KSHA 1AOXA 1Y3CE 3PITA 3QFFA 3UKJA 4AUEA 1G9TA 1G0NA 2BE7A 3LT0A 4EJSC 4QICA 4C0QC 3JAWB 1OZAA 1XEXA 4B3SB 1A8PA 4UBJA 1YDHA 4AO7A 4YCMA 3BD9A 2IZ5A 5GAJA 3TM4A 1E3LA 1P75A 3BA1A 3BX1A 1B74A 1WUHS 3PWTA 1JDNA 4GOND 3OPYA 2WF6A 5AYVA 1XPOA 1MO6A 1ZQ9A 3H42B 3WGNA 3PTAA 1GAWA 2Z6UA 4I5GA 2AOTA 3FH0A 3FOBA 5BQ3A 3NM6B 1VL1A 3JYQA 4UVHA 1OTHA 1ZG3A 2I55A 1XAJA 2QVBA 2RJOA 3PXBA 2DTXA 3KUXA 1YFZA 3PI7A 4KVZA 2W42A 6REQB 3JQAB 1YMUA 1QH8A 3A6LA 1T3ZA 3C3XA 3L82B 3LS2A 2QV0A 3N0WA 3VZDA 2IU4A 1Q11A 5FOSA 1GVNB 1U7OA 2EIHA 4YCAA 5TPZD 1NE7A 1YJAA 1E1QA 3CLTD 2ILTA 3DZDA 3ESDA 3KKPA 4PLVA 1MX3A 4XJVA 1KI6B 2IQIA 3KKNA 4Z9FA 2G76A 5IVIA 1XQWA 3FYSA 1O96B 2Q0QA 3KHSA 1U98A 1EK1A 2FPMA 1X2BA 4KU4A 2R8PA 3U17A 2FPIA 1JIIA 2RGCA 3SN6A 3AUJB 1ZXBA 3RVJA 5DHQA 1PQUA 2FY8A 3GARA 1IY0A 2J5RA 4MUGA 4Y2XA 4YRZA 3N07A 4J76A 3CB2A 1EFCA 4Q4HB 5CR9A 1QLJA 3V1YA 2XMSA 4ZO7A 3MINB 3O3MB 2IDMA 4OU4A 3LW7A 4PHTA 4BX3A 1DAGA 2ZWPA 2LUOA 3V4LA 4C7VA 4CKCB 3LBAA 5I7VA 3IEKA 2QVXX 3LXUX 2CXQA 2Q21A 4OHXA 1OAAA 2V03A 4L7QA 3QUSA 3BWCA 3KAPA 1A8IA 2W58A 1OHHD 4TRMA 3H11A 4UREA 1YS7A 1FTNA 1ULHA 4HFJA 2AH5A 3E7XA 3VOAA 1BCSB 4KDCA 4PLHA 3WL5A 2OBLA 2CLDX 4WA7A 2F1OA 5HEKA 2V7BA 3OESA 3BTSA 3N7UA 3PQ4A 4AL4A 4CR8A 5B36A 1APBA 3IEMA 4F9TA 2D0OB 2F3UA 1B8UA 2VFAA 4WNIA 4EO7A 1YKGA 1QGUA 5A03A 4D4LA 2PPLA 3OLCX 3DCIA 2C7PA 3FUVA 3HGMA 3UOWA 4ZCRA 4MVJD 4H6VA 4QG7A 5C3UA 1TQ4A 1SCAA 3G6WA 3DMTA 1HG0A 4EVSA 3Q5DA 4XSHA 1IN4A 4CMJA 2QJOA 4YAFA 3HO8A 1I30A 5H16A 5K3EA 3MTEA 3PDWA 1Y6RA 4NYJR 3FSJX 5K4AA 4I5FA 1LDYA 4NOMA 4UJ3A 3MWKA 4U02A 1VG0B 4IMIB 1ATIA 3G2KA 1XFAA 3JQ9A 3QF7A 4UEJA 3ZLJA 2F1RA 3BBPA 1XT6A 1K4KA 2HIMA 1U3CA 2HMAA 4KAJA 5T6BA 3SY8A 1MB2A 1J39A 1W0KA 4MPRA 3DV0A 3K5IA 4GLFA 1FMLA 3VPCA 2ZB4A 1R1DA 5KCZA 4IPTA 3PRJA 2JFWA 3FPGA 1XZCA 2YRFA 3C48A 3IHTA 4GXQA 3TZEA 4GPTA 4KZKA 4N8SA 3U4CA 4S1TA 1FDWA 3KKOA 3IOCA 5FBHA 5A4DA 4C3ZA 2FR8A 2JFQA 1XAHA 3I09A 4LYYA 2X2EA 3U4AA 1V8PA 3CVOA 5DVZA 5BN5B 4BLRA 1E0DA 3PA8A 1CJVC 5LLTA 1DP4A 3N9IA 2UZIR 3ND6A 1DJOA 2P75A 2ZRNA 1GNLA 3TZ6A 2Q4TA 4TL9A 3KUKA 2A9PA 1ECGA 2WWFA 1Y1PA 1KP2A 2JVKA 5JCOC 5LP1A 1JIUA 3ZDQA 3IR6A 2EVWX 1QH0A 1PO7A 4PTZA 4CV3A 3I2FA 4P7BA 1YFJA 1ODKA 4UAGA 1WS6A 3N7AA 3NKLA 1GA6A 1Z7WA 2C07A 2C92A 3HZOA 3P2YA 4D46A 1FF9A 1TJ3A 1SVNA 1XHLA 3GP5A 2G0AA 4BVFA 3FOFC 2X5NA 4EY6A 3QU5A 3U7JA 1D0VA 2GB4A 4TSRA 1Q7GA 3NV7A 4DWVA 4FD3A 1EGMB 3FHLA 3JQFA 4H6PA 1P4HA 4NOLA 3G49A 3HCCA 1EK0A 4FHEA 2CDAA 2JI7A 4HJRA 3NNSA 1ZD8A 4ETMA 1TEHA 3FHTA 4EHJA 3S1AA 2OM6A 1XEAA 1MDBA 2H11A 1D1QA 4QXOA 4RZXA 2A67A 2LDXA 2NZUG 3AONB 3GNLA 4EA8A 1X6VA 2VDOB 1ICEA 2P69A 3L46A 2OXRA 3MGGA 3PNYA 5AJVB 1MIHA 3CX3A 2RC5A 3FWNA 4F5ZA 1XLTA 2Q3LA 1Z2NX 1EUDB 4HADA 4GI2A 3KZOA 1W48A 3OZGA 5KMGB 1KOLA 1P7VA 5BN4B 3VHXA 2I2CA 3QLTA 2OZLA 4HOYA 2VBCA 3EG9B 3LX6A 4P82A 1H8HD 2FAXA 3AB8A 4YFYA 3PC8C 4EHDA 5HTOA 3ZHSA 2TMDA 3LGSA 1T6ZA 2XJ4A 1ZAKA 3R4CA 4BGEA 4BCCA 3HXQA 4AAYA 4B3CA 3WLHA 3VKUA 4YLYA 3LY9A 2DPGA 2NP7A 2H0QA 3UWDA 1J21A 1T0BA 2AFIE 3B8EA 4GWGA 1EEHA 3H3JA 4JP2A 5AJXA 4ZT6A 5J58A 4FSHA 2PO7A 1PZNA 1KOGA 3KYCA 4DDTA 1IXYA 2IC5A 4IL5A 1GR0A 5B2ZA 3HJNA 3AG6A 3MRTA 1Z6GA 3PT9A 2FZ5A 2ZLBA 1AKVA 1U8CB 3PFCA 4N49A 4DPLA 4B3TB 1PLKA 3GJQA 4NENB 2X7HA 1N92A 1GG9A 1X1BA 1QO0A 2JZCA 2Z3VA 5ILQA 4CCSA 5CA1A 3DNMA 5JO9A 1RCUA 5A5GA 4XWKA 2BSAA 2IP1A 1ZUNA 5BSMA 2D2VA 1E4OA 4C0JA 3LK6A 3ZTYA 2Y1FA 4YEDA 1N5IA 2KE5A 4WBNF 2XSZA 2C2OA 4QJIA 3Q10A 4CG0A 3W5DA 4AZ0A 2CJWA 2A9JA 2OAQ1 1E7WA 1I5OA 4Y9UA 1J07A 2ZROA 3RTCA 4MJ7A 4XQGA 1D5WA 5EE1A 5J1SB 1Q50A 1MJNA 2M9MA 2LWIA 1T36A 5REQB 4Q9KA 3PRYA 4QQNA 2UYOA 4Y18A 5K3BA 4HRXA 3UH1A 4CJXA 4QRHA 4MI1A 3WKBA 5JJCA 2D4HA 1WMFA 4JL8A 2WTNA 1BHQ1 3LXMA 3ZQ4A 4M87A 4MR7B 1S8AA 4LSMA 1R6BX 1V26A 2HK9A 3T4XA 1EFPB 1EVJA 1P0PA 4BKOA 5GJBA 2EYQA 2CVOA 3BAZA 3ZCXA 3AFIA 5KYXA 3MSCA 2JFGA 1RKUA 1DWQA 2B0JA 4PBSA 3WRXA 3B9RA 4BVBA 2YICA 1ZGCA 4L9SA 4J0GA 3DXFA 5H0IA 4AKGA 1UAYA 3LAWA 4TYWA 1K4YA 3WLOA 4PC7A 1CUBA 4JUDX 4FN4A 3N8IA 1W4CA 4PV7A 4TROA 5ICEA 2P41A 2A92A 4R69A 1HFWA 4G5OA 4OPMA 2WT8A 1DTWA 2G9VA 2IELA 2SKCA 4Y2YA 3OLWA 1XJCA 2DPMA 4Q7KA 1I80A 2M6KA 1FP1D 1XEWY 4ZOBA 1T2NA 1OLXB 1ZH4A 4CTOA 1MOSA 1XSEA 2CEAA 1QIDA 2XOKA 3OPXA 4U8GA 2P7HA 1YA4A 1ZW6A 2EL9A 2P2SA 2GDZA 1WZ2A 2P62A 4O4LF 2HSWA 3H2ZA 3RBXA 3DTYA 3OTWA 4CV2A 1RFLA 3G23A 3VR5H 2PJZA 3GRVA 4HDMB 2O9JA 2W6IA 4LJ7A 3G8BA 1P77A 1U3TA 2M6RA 4Y1GA 5F1YA 4BP1A 3M34A 4ZGBA 4MPJA 1Z0KA 1V96A 3QF4B 3TSOA 2YL2A 1E2JA 2GNPA 3LDAA 4RZQA 4YRNA 5M5BA 2OWEA 4R2JA 1Y4ZA 5B6PA 2WLSA 3Q8KA 5JI2E 2E89A 3KE9A 1Z2PX 3KS9A 4IH4A 1EFTA 5JWHA 1L7NA 1WPGA 3SX0A 3HBFA 1T8PA 1SNYA 1RXCA 3Q8MA 1QLHA 3Q0TA 1ZXXA 2GN1A 4F8EA 2ST1A 2ZCJA 5DI3B 5CLGA 1DBPA 5KQGA 2WDPA 3LHKA 2I3BA 4N0MA 4WERA 2WJYA 2OCGA 5FTJA 3REQA 2NO9A 1BEEA 1WR8A 5G4KA 2G5GX 3MGBA 4AXXA 1TFUA 1M8FA 3KR2A 5IXYA 4CBVA 3WY9A 3EXEB 2WR8A 2BI7A 2XUPA 2GF2A 2JB9A 4ZAWA 3NAMA 5EZQA 2ZU6A 4JEMA 4II7A 4Z99A 2O0KA 2OXEA 2BMDA 1UEIA 3JWIA 3QMMA 5DWDA 1V48A 2EG5A 1XNJA 5TE9A 4MUMA 1YBVA 2WZCA 3FAZA 5LB2A 4URWR 1ZD3A 3CWZA 3PXEA 1XZQA 2JFNA 1JL3A 3OD5A 4N03A 3HWRA 4NQRA 5DT2A 3FSRA 1CDZA 2AEMA 3PVCA 1EKXA 2VNJA 5EXTA 2FZGA 2JKVA 2ISSD 3QLUA 3UATA 5KX5B 3R3ZA 1Q15A 2GCPA 3T99A 3M6AA 5B1DA 1XKTA 1PT5A 5K0TA 1G8JA 5FO0A 3R9KA 3I9JA 3TGWA 5FWXB 5C4MA 2M98A 3EC2A 2KPOA 4YJFB 4JLDA 1NW3A 1QMGA 4XGIA 5AJYA 3EIOA 3PIRA 3QLVC 4XJXA 5LCXA 1X7HA 4EHIA 4EB8A 2VEOA 5F64A 3SM9A 2PZ8A 2G5PA 5G1OA 4N48A 4AYWA 4XCQA 3ZKWA 4BO6A 3CIFA 2P30A 4QQFA 1B6GA 2GBFA 4FWTA 4B81A 4J0KA 1VMKA 4TLDA 1YQGA 2KYRA 3DEAA 2CMGA 3D6FA 3EZLA 1MDFA 3CUWA 5C51B 3E3LA 4RLQA 3C3DA 4GUAA 3B38A 3OO0A 3R3UA 5ARDA 1A5AB 5B30A 1L7EA 1MD9A 4H1VA 4G0UA 4AI6A 4ECAA 1ZHOA 2UUCB 2XUGA 1VI6A 3PTLA 1DFGA 4WE3A 1K6IA 1B6SA 1S3IA 2R86A 1BHO1 1E7MA 5BPHA 1X7YA 4N7BA 3H8WA 1RBYA 4FIDA 3DPUA 2C5HA 5ICSA 4OQDA 4PG4A 4WINA 2Q6TA 2BFNA 2GFQA 1IVYA 1KETA 4PAQA 3SEAA 3TTUA 3UVEA 3ZTWA 4JP1A 1TZJA 2PQ6A 4BEBA 4I9FA 2XCOA 3GFBA 5JTTA 1CY0A 4C20A 2IZ1A 1P1CA 1C3LA 4MR8B 2PDAA 4GPBA 1JPVA 4NU8X 4HNTA 5G3YA 3PPXA 2JJQA 3ZDEA 4IO0A 2RGGA 4EVIA 3IOYA 4RVFA 1ML3A 3H4MA 4E3WA 3A06A 2X14A 5HOQA 1HEYA 3PF9A 2ZE5A 2R4QA 3U7RA 2ZRPA 5EHNA 4BWFB 4W99A 4L7VA 3U56A 4NBNA 2Z9DA 1G3IA 4X93A 5KEIA 1PX2A 1TVCA 2NU7A 2ZAYA 3CNOA 2C3PA 3FI9A 2AQHA 3R6DA 1QHFA 3CKKA 2GSWA 1IM2A 1I7NA 2Y6VA 3LGAA 4XOIA 3A26A 1TA9A 3BF8A 2FB9A 5EGNA 7YASA 4Y98A 2WUDA 4YR7A 1CB0A 3RS2A 4WRRA 4NCAA 1BWPA 1WQ4A 5IH7A 1I14A 3P4XA 2UXBB 4MNTA 4F2HA 4QPZA 5A0VA 1OTYA 1TIKA 4X41A 4JXKA 1FRZA 4BB5A 3QMPA 4GHWA 4J43A 2COEA 2WB2A 1QOZA 3KTAB 4IUDS 5KNBD 1J8FA 2Z2ZA 4PLTA 1DBIA 5LMUB 4E46A 3H97A 1CHNA 1Y1RA 1VHQA 3ST7A 4UBNA 4C2TA 1KVRA 1BFUA 2C2WA 3EAGA 4QUKA 4AYTA 1QE3A 4XQ0A 1U7WA 4B73A 5FEUA 3BA6A 1N33B 9GPBA 3C6KA 1F7UA 4BAGA 1YAHA 4HMQA 4W5OA 4ZCQA 4K5QA 4JL6A 2XKAA 4EJ6A 2Q27A 3FPCA 2JBWA 4M1QA 4DC1A 4EAAA 1SKBA 5AI6A 1RRPA 5EIWA 5LBUA 3GHYA 3M9LA 3X1KA 1SR8A 5DDIP 1K7FB 1W94A 3ZGOA 4CGYA 3G0HA 2JGRA 1IHXA 1AQYA 1XCBA 1GUFA 1ONSA 4IDEA 4QEKA 1QC5B 4FILA 3IUYA 1UQRA 1PL7A 2R1VA 1GXSB 2I29A 5TGDA 1GG8A 1MGPA 5KQPA 1AUQA 1NBAA 1U0TA 3CVYA 1PV4A 4YR9A 2PT9A 1H6CA 5DBFA 1UOOA 4WKBA 3VOBA 2FR0A 1EGHA 4NXNB 1QJCA 1O5OA 1OUMA 2HC9A 4YRDA 2O2CA 1WG8A 1CJSA 4FCTA 5AIAA 3SK0A 2XVAA 1ZESA 3UWOA 1S01A 4LJKA 2YZNA 3O4VA 4FJ0A 4E5UA 1Q1EA 3PEWA 3WNBA 1XCGB 4G1MB 4L85A 4LXGA 3ZHQA 3H0EA 2FPGB 2IF0A 4AFNA 1MW8X 5JRDS 5DMHA 1PD1A 3FNBA 3ZH2A 1YFKA 1SKQA 5C0OE 4EGSA 2JLZA 1B23P 2BEJA 5ER6A 4G5GA 5GGXA 2BTQB 1BXKA 4J4TA 3E8MA 1RQNA 4LNAA 4WSOA 5EIBD 2C4VA 2W7TA 2XMBA 1X2EA 5EZYB 3WKDA 4DNFA 2C9CA 3A28A 3IJPA 3D3WA 3PE6A 3NHAA 4MS4B 1UP4A 3AQIA 3HBMA 4WXYB 1WE2A 1ZSNA 1GKKA 3FR7A 3BXGA 3HZRA 1U28A 3C7TA 3F4LA 3V32A 1E3WB 2IF2A 3L40A 2DSNA 2TSYB 2IUFA 1O95A 1XQ1A 2GI4A 3A4TA 4UUBA 4UUOA 4QECA 4DA7A 3IQWA 2R2AA 3COYA 2Z1DA 4RLHA 2VBIA 4MEAA 1G4UR 3DV2A 5DF1A 5LA6B 1Q7EA 4MUKA 3CNNA 3K5PA 3RTAA 1RHMA 3WIUA 3G88A 2B1JA 3ZWPA 4Z0NA 3G2PA 2HMVA 1E9RA 3MVEA 5BR7A 1O08A 3AOEC 5FUVA 4BP3A 1IN6A 1XXHB 1U63A 3W90A 2H9AA 3FDXA 3QIAA 5A4KA 2WK1A 4O4IA 3RPEA 4DCUA 1JEDA 2QSUA 2WHPB 1F2DA 2WIFA 3RJ9A 4JT8A 5JO0A 3MB5A 3DC7A 3B20A 1XQYA 3DKIA 1KDRA 2G77B 1HMYA 1ESEA 2GHQA 3EDCA 1Z88A 3LVFO 3OEHD 5A1TA 5AHWA 3GLHA 2PYDA 2XDQA 3NALA 3AM4A 3GGOA 4QRIA 4WTOA 3RNOA 2PLWA 3LQ2A 4QDZA 2JC3A 3L06A 5DHTA 1CQJA 3B2QA 1SBIA 3SIWA 2AYYA 3FHJA 2JANA 1L6IA 3K0EA 2I4OA 2VT2A 3EQ2A 3H8SA 2DR2A 2V0GA 3OZSA 4JJEA 4U7PB 4LXQA 2D1RA 5NLLA 3X3HA 2QUZA 2B5OA 4DFDA 2I91A 1J5XA 3OY2A 1AHPA 2EBWA 3CZMA 1Q0ZA 4HATA 3NANA 4R40A 1T9HA 1TK3A 4B8WA 4PZUA 5DNWA 2IY8A 2AOVA 4I6JA 1H6BA 2AR7A 3O73A 1U2DA 2XMQA 4MCJA 3WYEA 2JASA 1QAOA 1RT9A 2YXBA 5JWRA 1SPBS 3PNKA 4LDPA 1V4NA 4B35A 4F9FA 3IR5A 4QDXA 1QV7A 3WWZA 4URXR 2EJUA 2ONYA 5A04A 4XPZA 4JZYA 4F3NA 5IU6A 1YUNA 3D7SA 4WN3A 1BXGB 4X1IA 2BLLA 3PU6A 3KE8A 4BMPB 1PFQA 2CHFA 3DGFC 1Z0FA 4J1NA 2HSGA 2NM0A 3HJAA 1YHZA 3O2NA 4M0UA 1W5EA 2ALJA 4D4GA 4CXMA 2ZJAA 4C7OA 3LT2A 4TS3A 221PA 4TLLB 4L8GA 4F1JA 5CYGA 4KR0A 3CQ9A 5IEJA 3LWNA 1KJJA 1B41A 4RTRA 2VAVA 3DCYA 2FEPA 5JATA 4YS6A 1OAOA 4X8HA 3OQIA 3HB1A 3TRFA 3VH4A 3JQBC 1BC5A 1YUMA 1LKZA 3RNLA 1NT4A 4PGGA 2REBA 4QU8A 1N7GA 4RLFA 4BDTA 5CDGA 4NK4A 2WQ7A 1V3UA 1N3IA 2Z4SA 5K0BA 5G1PA 3DBRB 1GU0A 1P17A 2NZVG 1WB5A 3I8XA 3GJ5A 2F6RA 3DDCA 4HB0A 4IFTA 5M7EA 1RI2A 1NQ5A 2PQMA 3HXPA 1T6BY 1RHJA 5L4SA 2ZIXB 1L4FA 2VF4X 1W4AA 3UMMA 2QR2A 3OPNA 2ZI6A 3TNFA 3JVVA 3AHJA 1E1RD 3AW9A 2ZRKA 5IAGA 3S2GA 2C7RA 3ODPA 1CUSA 2QN2A 4UU8A 2VPIA 2NO1A 1BVUA 1T4BA 1O9GA 2GM3A 5JAUA 2NVUA 4NBWA 1TF7A 3IPXA 4RKEA 3B1JA 1Y8CA 5L4NA 3VHLB 4NR0A 1ZJZA 3GRAA 2ZAGA 5F7ZA 1OXTA 4AU1A 2I6TA 3JPYA 4OJKA 4RVCA 4EYEA 1RACA 1DPGA 2PGXA 1F8FA 4TUYB 1DV1A 4HLUC 5U4XA 3T1TA 4Q24A 1ORWA 3VR4H 2POQX 1VBFA 2X0IA 2O57A 1TYEB 3TCNA 1Y34E 4E7PA 4TTQA 3TSZA 1SO8A 4WFKA 3R6LA 3K2EA 1C4WA 2Q3EA 1WCYA 1VE7A 2NZXA 3KWMA 4Z4GA 2B21A 3VDMA 3HJGA 2C7BA 1CRQA 1QJ4A 1JLLB 2E6UX 4LXHA 5TV2A 3KSUA 1Y6QA 2PU5A 3FUWA 3W3ZB 1N0IA 5EJAA 2YOHA 5EMLA 3N2ZB 3GL9A 3VO2A 4ZIRA 2F55A 2H3HA 2YZ2A 1AE1A 2PX8A 3F5FA 1E9CA 2ZRFA 4S3MA 4Y9RA 2FRXA 4BC1A 4ZEVA 2IBTA 1AJEA 8ATCA 4I1RA 3LQKA 1F1JA 1PJSA 2BGMA 1WCV1 2X5KO 4RC9A 2PAFA 4C9BA 2O07A 1G1MA 1H4VB 2PWBA 5ALDA 1T10A 1ORIA 1QH1B 3UGQA 4DZTA 2BR4A 4ZDJA 1JYSA 4K3VA 3AJEA 2Q8PA 3SKVA 4CCYB 2A94A 3V48A 1CUFA 3K6KA 3GPLA 3CE6A 4FK8A 1KZGB 1C9NA 5DXJA 5KSPA 3AY3A 4I2VA 2IPNA 5TQ2A 3NVAA 3UXMA 4I3GA 4DLTA 1Q74A 4CIYA 3RHFA 2HN9A 2O05A 1A5TA 2WOJA 4JT2A 1NF9A 3AHDA 3O92A 1L7RA 1VKHA 3AEUB 4J7AA 5FPYA 1BHJA 4ZT2A 1KE2A 3COVA 1SQ0A 5CDYA 3Q7TA 3ZU6A 3ZXUB 2JARA 1KQGA 2X4GA 3T3EA 1H5NA 1FDTA 3CBQA 3LY7A 3WMFA 3DZKA 4YJ3B 3PLRA 1OYVA 3U1TA 2AYXA 3E7PA 3I28A 3PC3A 5ALXA 1DRKA 1KZ1A 1OJLA 2CXTA 3PPVA 1W36B 2RAPA 4FBLA 3H5RA 1DQZA 3MD9A 3U80A 2YWDA 4CM4A 1Y9EA 2IE0A 2Z4RA 3ESAA 4ALNA 1GZ7A 5FQOA 1I2AA 4DDUA 2VA8A 1QRRA 3B1VA 5LDDC 2BZGA 1LDBA 2G9ZA 4PSCA 5ESRA 1U5BB 5K0SA 1N34B 1HE3A 1E0SA 5E7MA 9MHTA 2JAXA 2AG0A 1RKQA 1XEWX 3RO7A 1XNHA 4LX0A 3T5CA 4MQBA 5HFJA 5C8VA 2YWHA 4KQGA 1CX9B 1RADA 4NKRA 4ACBA 1GTG1 1BW9B 4LTDA 1VG9B 2DKFA 2EBUA 4XWTA 4F5DA 5L45A 3WMXA 2RSLA 3HBJA 5DTMA 4WX2B 3AVPA 3GT4A 2V0NA 4K81B 4XW2A 2R6ZA 1HKHA 2C9MA 5A7GA 1FYVA 4LS3A 1EIZA 4OHVA 3CVVA 1NV9A 1WSWA 4N6NA 4RMHA 5KYWA 3A8TA 3M83A 2WSSA 1K98A 5T4FA 5AW1A 2HBRA 3IVRA 3O7MA 2IGBA 5KOJB 4EGQA 5I5EA 1Q57A 1R5BA 4XFDA 2EARA 3P0RA 4BLOA 3GU3A 3RLIA 3CKYA 4WECA 4MQEA 3OEYA 1E6UA 2EW1A 4JXXA 3LXRA 4Z53A 5JNSA 1U0JA 1PEKE 3HPQA 4DDVA 2BUCA 2YDXA 3DZFA 2R6HA 4BLVA 1IDOA 3RIHA 3WKCA 1ZFNA 3STYA 4XGNA 1MNQA 4IHJA 3LCCA 1UJCA 1NQWA 2WWRA 3EGOA 5C7YA 5B4VA 1BX0A 2B4AA 1WUTA 4AP9A 2IYAA 3ITEA 2HSZA 1X92A 4DLRA 4J1TC 4X45A 3Q0IA 3U6BA 2VL7A 3BAFA 1U1IA 3EVTA 3FNGA 3GGCA 4YJ2B 5IX8A 2GRJA 4OP2A 2F59A 121PA 1GSOA 3EAQA 4QA9A 3R3HA 2Z9BA 4XQCA 4YP7A 4F4FA 3BMXA 2QHXA 4L9WA 2CL5A 1NRWA 3GV0A 3ZGVA 2Y1KA 3SC2A 3A4IA 4I4TB 5EEGA 5J23A 3OZCA 2VTVA 2GD6A 1FQWA 1VA4A 1TCUA 3NJRA 3WGQA 1HQCA 5EWLB 3RRBA 5C18A 4Q1BA 3SXUB 4B3FX 4LX8A 3D6NB 3E2MA 1UJ6A 3DDHA 1P6UA 2W4QA 3DOIA 2VZ9A 1KSFX 5E9AA 4ZXPA 4NHEA 1XVIA 1MB0A 2GLUA 1EB9A 2YS7A 2QJRA 3CT6A 4UXJA 4DLPA 1EA7A 2Q3FA 3FETA 2AFRA 3A1EA 3RUDA 4BV3A 2O2DA 5JDCA 1DU4A 1FU7A 2VLBA 5JSZA 1YZYA 4I8IA 1IWBB 1USIA 4K9QA 1KAOA 2HWUA 3B5EA 4TM7A 5BWLA 3AR4A 5EG5A 4MO2A 1M8KA 3JW8A 4KV9A 5B7NA 2ZBEA 3BZBA 2WJGA 3H4VA 1NUAA 4G5XA 4ALLA 1BH2A 4ESOA 1ZR4A 4YUVA 2A8YA 3U31A 1AUVA 3CEHA 3ZE7A 2BKXA 1P7ZA 1I7DA 3FNHA 1MEJA 3T0FA 2JW5A 4UBOA 3ID6C 2HADA 5DBIA 1UANA 2BGUA 3KG2A 2CLCX 3TH5A 3V33A 4FNAA 3WV4A 2R11A 3DMFA 2WWVD 1WL8A 4JYBA 3UEOA 4HUJA 1HZZA 1ZCAA 4CDGA 1UJBA 5AM3A 2QF7A 4X54A 1QCZA 2H59A 3MWLA 2W11A 4DIDA 2EZ4A 1U7DA 1BSVA 1Q0PA 3NORA 4E5SA 1K7EB 1J6UA 1TM5E 5K0CA 2R8BA 2QVCA 4X85A 2E5WA 5I9TA 1QPGA 1V43A 3KQSA 4GBED 3D2BA 2WZBA 2J6CA 3DPIA 4EM6A 2A4KA 2I6UA 2G5TA 3KLMX 2ADFA 3MT0A 1TCBA 1VDMA 4MUNA 1WPQA 2G4VA 5IEBA 4R9UC 3VPGA 1TI7A 4AZ3B 1PTKA 1R66A 2BONA 3MAAC 2X0FA 4OCZA 3VR1A 4B83A 4PN3A 1LQUA 4BCDA 3ZWBA 3ORRA 5J63A 1CUVA 2XD4A 3GZNA 2HNAA 4FFRA 1SUCA 3STTA 1UBJS 5EKUA 1BE8A 3WLIA 2IEDA 3A6PC 2W6ZA 1MW9X 4Y2GA 1ZD4A 2RK6A 2BFBA 4LECA 3WL4A 1IK6A 1CBUA 3SE0A 2FVYA 4KLZA 5CT5A 5D84A 3UQZA 2XB2A 1XMVA 3VYRB 1S1CA 4IWNA 3CSUA 4NFHA 5GONA 1D2CA 1VP9A 1GILA 3EHEA 3QKTA 3AUUA 4I50B 2YJZA 1L2TA 1RQLA 1VCHA 2OFOA 4MVJE 1FVOA 4RIEA 1OF1A 3TLGB 5K8CA 2RCNA 2PLNA 1Q14A 3BFXA 3CLUD 3MWDB 4PSDA 4CL3A 4EI8A 2NSYA 5GGYA 3WGZA 4BRWA 5I7OA 3PQEA 2OYCA 2F9LA 1OXVA 2J6BA 3A9UA 3EBPA 5AKJA 4JFAA 5J3JA 3P19A 2BFMA 4WVLA 2GTPA 3HXTA 3ZE2B 1BXRA 1QHHA 4PAGA 3ZZ0A 4FMDF 4UTNA 1Z25A 1G7CA 4YV2A 3JD1A 1QVRA 4JQOA 3BRWD 2JIDA 2GRAA 1EP1B 3TOCA 2CLHB 4LXIA 3KQWA 5KTYA 3AVYA 2C2MA 3IJEB 1Z22A 4BLQA 3QVSA 1JQAA 5M2QA 2WF9A 4P4NA 1NVAA 1YB5A 2ZR7A 1MT3A 4ZN6A 5T3YA 4FT4A 4J29A 1JH8A 3Q98A 2X0DA 1GITA 1JR2A 2DECA 2G0NA 3CGWA 4KBGA 1UMBA 4LRTB 3ZYCA 1TAUA 4LC9A 4OQXA 3TSYA 4F4HA 4DLBA 2WT4A 4KUHA 2W37A 1ZQ1A 1JG1A 2C04A 3MIZA 5DB4A 5FLKA 5LWQA 1DJPA 2BMJA 2NG1A 3PHHA 5EJ2A 5LXTF 2EBFX 4P58A 5IZ4A 5ISMA 4WH0A 3GUYA 1Q2XA 1LPNA 3CUUA 1BFKA 3F71A 4P0PB 3KXDA 1KNXA 2QP4A 1W85B 2RHHA 2J08A 2KMLA 4OGFA 5K0LA 5HQJA 3DP7A 2SCUA 3PICA 1T2EA 1Y89A 4MGHA 2PLAA 5EUQB 5IJ0A 1KQOA 1OFUX 1L9XA 1PD0A 2Y99A 4RTSA 2DWCA 1AT1A 3Q7IA 5GZ1A 1AHIA 1RC1A 3H99A 1V9CA 2XKBA 3JQ8B 5TVGA 1P7YA 2PRIA 3K0AB 4D25A 1R8YA 2F3TA 2Q4EA 4X90A 5TXGA 4E2XA 4DA0A 3BQ9A 3FFBA 5FBZA 5T4EA 2GXAA 2XDYA 3DMYA 2MYUA 4O59O 2OXCA 1NBMA 1O77A 1IQUA 3LWDA 3R3JA 3HA5A 4WBSA 5PGMA 5KTPA 2X3FA 2E3JA 3KBBA 1WNFA 3IEIA 1PDWA 2HQBA 5A3QA 1LFDB 3PCXA 4Y6GB 4YRPA 3SS9X 1KZHA 1I01A 1Q2UA 1RCFA 2ZPTX 3GPDG 4M99A 1P9NA 3T06B 1YMQA 2OHXA 2WNSA 4DANA 1WVGA 5CDHA 1II8B 1GSHA 2IHUA 3QVGB 4GO1A 3JD3A 3AZPA 4IG4A 1XC7A 1F2UA 1N2JA 4O0MA 4Y6OA 3OCVA 1G5TA 2O4UX 4W5QA 1P0MA 3V9PA 1PK7A 1SCKA 1UBFA 3B85A 1W6UA 2QN6A 2XGGA 3EZYA 2IVZA 3NTRA 1ORRA 5JVDB 5DNYB 1CUHA 1GYRA 4OH7A 2F17A 3R7WA 4MKFA 1CR1A 4LUCA 2Q45A 4GQAA 4RGBA 3L2OB 3LA6A 4IJMA 1VIYA 2DJ5A 5LQSA 4J49A 1NAHA 2XE8A 4ND4A 3FYDA