4YA6A

Crystal structure of ligo-apo form from sphingobium sp. strain syk-6
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
295
structure length
270
Chain Sequence
MQDLEGKVAFVTGGGSGVALGQAKVLAEEAQMKVVIADIRQDHLDEAMGYFSQKNVAVHPVRLDLTDRAAYAAAVDEAEQVFGPVDLLCNTAGVSQFGPIEKATFDDWDWQMDVNVNGVINGVMTVMPRMIERGQGGHILITASMSAFVALPTTGIYCTTKYAVRGLAESLRVEMPKYNIGVSLLCPGGEAVFAGLKRVIEHGFDPVDLGRVVLDAVRNDRFWVLPYPEFAEGQKARDQEVIDAMMSYADHPDYARRMKIREQMKRDMPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C alpha-dehydrogenase
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
source organism Sphingobium sp. syk-6
molecule tags Oxidoreductase
total genus 103
structure length 270
sequence length 295
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ya6A01
3V1TC 3AU9A 2OXIA 2DQ4A 5G4LA 2WD7B 1PGPA 3GF4A 4R16A 4WGGA 1PJQA 5TLSA 1PR3A 4YAKA 2Y0DA 4P8RA 2X0NA 3NV9A 5KNLA 1DAPA 3O8QA 1D1SA 2CY0A 3GPDG 1EDOA 1A4UA 4UREA 2ZIZA 4BNXA 4UULA 1E6EA 1ML3A 1R16A 4D0RA 5CG2A 3I1JA 2B5VA 1EBUA 2EP7A 4UUNA 3KV3O 2V6GA 4FS3A 1T4DA 4ND3A 2BRUA 2Z5LA 5TT1A 1VRWA 1RWBA 1DIHA 3JQ8A 2NSDA 4M49A 3GDOA 1PSDA 3AY6A 4IJWA 4PZEA 4YWJA 2CVZA 2H9IA 5JPIA 4YCAA 1P33A 4BKOA 1F12A 1DFHA 3KVOA 4ESOA 5JYDA 1VE9A 5A9RA 2QRJA 2GCGA 4ZQFA 3OQBA 4WNCA 3WTBA 1AXEA 3OA2A 4XYLA 1AUPA 1PL8A 2DBRA 1GAEO 4KMSA 1GYQA 2BD0A 2A94A 4A0SA 4Z0TA 1SO8A 2P4HX 1HDCA 3HG7A 1E0DA 4XQEA 3BMNA 1TLTA 1ARZA 3S2FA 1HWYA 4GWKA 4CM4B 1ORRA 1A9ZA 3VH4A 4DYDA 3K73O 4NBUA 4LCJA 1JA9A 1ZK4A 2PD6A 3GGPA 3OICA 1DC4A 2JD0A 1IUKA 3ETEA 1NQ5A 2W8ZA 1PEDA 5A03A 3BTVA 1ENPA 3WLFA 2IZ1A 1ZK1A 1HXHA 4YACA 2YV2A 4M1QA 4XEHA 3W8DA 1R4MB 2VZ9A 5CG1A 4DBVO 4M54A 4CLEA 4RCVA 3WGYA 2PZLA 3GG2A 4D3FA 4FSHA 4BQRA 2HK8A 1H2HA 3NJ4A 1Z73A 4LSWA 4BNKA 4Z9XA 1F14A 4DPMA 2Q1SA 2PZKA 1E92A 4Q3DA 2W90A 4Z9YA 3H2SA 1E7WA 1QORA 3P7MA 5T5QA 1T2FA 1ZMTA 1I3NA 1LDNA 4FFMA 2ZQYA 3ZWAA 1BVUA 4NG5A 1LQTA 2WYVA 2WYWA 1OBFO 4EZBA 4N54A 2WEKA 4FCCA 5C5IA 3OFSA 3JQ9C 3AWDA 1TB4A 3VTFA 1H9BA 4AJIA 5JCJD 1NQTA 4L0QA 2IYPA 4XYMA 4Y9DA 1E6WA 3LC2O 4TMFA 1T1SA 1I2CA 5HA5A 4NMHA 4NIMA 1YRLA 3WNQA 5IZCA 1M76A 2AEJA 4CM5A 2Y67A 1O5IA 5IDWA 2RIRA 3DHNA 3GAZA 1SPXA 1H2BA 3PDUA 5FI5A 2AQKA 3UKOA 4EEZA 5A1TA 2VTDA 3FNFA 4I5FA 3LYLA 3QVSA 4PCVA 4KP7A 4YRBA 3W1VA 4FBGA 2Q4EA 3SLKA 4JBHA 5KIAA 3BYZA 3TZKA 3U9LA 5AXBA 4TWRA 3BHJA 4URFA 1PQWA 4JP2A 3WSWA 3MWEB 4GX2A 2E4AA 3COSA 1DDOA 2DU8A 5G0TA 2CF6A 3IUPA 3ORFA 3F5SA 4QFCA 2BGLA 3I9NA 1WW8A 2NQTA 1EK5A 1LDMA 2Y1FA 3NGXA 2VHXA 4QEDA 2A4KA 4JQCA 2CVQA 1QYDA 3DZKA 1SB8A 3LF2A 4OH1A 5KOIA 1UAYA 4ZN6A 2UV8A 4AJOA 4W99A 3ZW9A 2GN4A 2HK9A 4NZ9A 5F5LA 1C1XB 4HY3A 4IGFA 3CSDA 3OQ1A 3O9ZA 4IIUA 3FPLA 3I9OA 3PP8A 1YWGO 1JAYA 4R3NA 4B3HA 4FJ0A 2O2SA 1C0KA 2IDZA 3GFGA 1HDYA 4MVJG 3K2EA 2BELA 4YJFA 2ZYDA 3NT5A 5FYDA 4EDFA 2D8AA 5EL0A 2P9EA 4GX0A 1NQAO 3VVCA 1ISJA 3F4BA 4WASA 1J4AA 1DOHA 2FR0A 4GVXA 4W7IA 4WK6A 3ZZNA 4BB6A 4WLOA 3LVFO 2XPCA 3PJFA 4PG4A 4BB5A 5TSDA 2WWRA 2DVMA 5GY7A 1VL8A 4LGVA 4CODB 4DVJA 4Z3KA 1U3UA 3ITDA 4BL5A 1ISFA 5EJ2A 3RUCA 3O38A 3ONFA 1U7HA 3PIDA 3OEYA 4M8SA 1D4FA 1GL3A 2OFPA 3ZGYA 3ITKA 3ZWXA 4Z6KA 1DIGA 1MP0A 1Q1NA 2VZ0A 3SC6A 4J7CA 2W2KA 4MO2A 5DZSA 1QV7A 3ZWBA 4CMEA 3CPSA 2GZ1A 2AG5A 2X5OA 1NPYA 1LLUA 1JKFA 2XXJA 2ZTUA 1DC5A 3Q9UA 4XR4A 1WAMA 4R68A 1UDCA 2NLOA 2AMFA 4M55A 3ROMA 2AA3A 5DP1A 5T8KA 1LUAA 4J2HA 4AJHA 3Q6IA 1LDYA 4GMGA 1X0VA 4YTEA 4Z0PA 4EUEA 4CM3A 3AUUA 5IF3A 4IQ0A 2PGDA 3PQDA 1O94A 3I52A 3GEGA 3NGLA 1ISHA 3FF4A 1P45A 2X86A 2PWZA 2EW8A 3W4IA 1KEWA 3QHAA 4O5OA 3L77A 4MKXA 1D7OA 5A9SA 4BO2A 1ONNA 3KHUA 1I2BA 4CV3A 3HZZA 5COBA 2WM3A 3GQVA 4AJ4A 2C2YA 3PK0A 4ALKA 5IXYA 4E5MA 1U4OA 3RUEA 3RBXA 5I7SA 2NUAA 1J6UA 3GUCA 4LRSB 2GR9A 1P1FA 4IZHA 1IYZA 2GSDA 3MOGA 2R00C 3FWZA 3NTRA 3OEWA 3GEDA 1FMCA 4RF4A 4N18A 3LLVA 4K6FA 3H5NA 5AVOA 3A14A 4LCEA 4CM9A 1BW9A 1VM6A 1CQIA 3KRTA 4Q3BA 4P4NA 3L6EA 1K2WA 3WQSB 3ZU4A 4JP3A 4AJKA 2OL4A 1Z75A 3D1LA 4FPXA 2AQ8A 3RCBA 5KTKA 4JJGA 2J3KA 3EAGA 4BNIA 3ENNA 3GVPA 3IMFA 4TROA 1JWAB 2JHGA 2PFGA 1ONOA 1I8TA 3ZWCA 4EUFA 3ETDA 1QR6A 3JD0A 3C8MA 4JK3A 3DFUA 5I9NA 4IDDA 2IZ0A 3TOZA 4D45A 4GLOA 4R1TA 1ZK2A 5COQA 1ZSNA 4R54A 5BNFA 1ZZEA 1KIFA 1HDZA 1V0JA 2Q1UA 4CLRB 2FPPA 1X1EA 4S1VA 2B36A 1I10A 4DUPA 4XYGA 3D5TA 1RPNA 4IDGA 3QLJA 4OXNA 1UDAA 4BNVA 4DQVA 4XYEA 1XLTA 3DBLB 4BHTA 2E48A 1LDGA 3NRCA 3ST7A 2D2IA 3ZNQA 4MP8A 1I33A 1KY4A 4KQXA 3AW9A 1ZVMA 4D43A 2AE2A 1SMKA 2VYND 3DOCA 3SX2A 1HZJA 1PTJA 2C0CA 3I9LA 4RZHA 3VKVA 1PJ3A 1WXDA 4LISA 3TSCA 3IAHA 3A9WA 3L6OO 1V3UA 4CUKA 3QY9A 1Q7CA 4B3JA 4BOYA 1LDEA 1GUFA 1M6HA 2PY6A 4CMHA 1T24A 2OP1A 4CQLB 3BMQB 4ALMA 1QG6A 3BTOA 1LX6A 1KOLA 5JNLA 2QRKA 2Y1DA 5B12A 3D0OA 1JAXA 1ZXLA 2BKAA 1XSEA 2X5JO 4KDEA 4E2XA 2C5AA 5KWEA 2B35A 1JLLA 4XB2A 4E5KA 3EZYA 1OC4A 1A5ZA 1WZIA 2EW2A 1IPEA 1N9GB 3BXXA 4IDAA 4WUVA 4XQCA 4QECA 1HETA 4BNLA 5L53A 3H8VA 2P9CA 3GFBA 2OOSA 2PD4A 2VUUA 1A71A 1EVZA 2Q4BA 3D7LA 5JLAA 4IMRA 3UH1A 1VJTA 2VYVA 2AXQA 5L9AA 4E6PA 4YVFA 3FPCA 2PGLA 1I36A 1B0AA 4WEOA 1BSVA 2H5LA 3AM5A 2VOJA 1DC3A 4CL8A 4L4XA 2BMAA 2I65A 4CLDA 1YDEA 4UUMA 4FC6A 4TZKA 3D5QA 4CR7A 4MKRA 4A5OA 1HDRA 2C2XA 2TMGA 1T26A 2YV3A 2Z1MA 2YFHA 3I4CA 3A28A 4CM4A 1PJBA 4BV9A 5TIIA 3DQPA 3PRJA 3OQ6A 4UVGA 2HMSA 4BO4A 3UOGA 2G76A 3P2OA 4YT5A 2Z1NA 3JQ7B 5ENDA 3W8EA 1P31A 3H2ZA 3KEOA 3RVDA 3WGHA 4IS3A 4E13A 1H94A 3JQGA 4XIJA 1NAIA 4RVDA 3R3SA 1U8XX 4J91A 1LQUA 3AOEC 1AXGA 5F1OA 2VRCA 3GRPA 5HS6A 5LDGA 3RQSA 3TQHA 3CE6A 3G3EA 1MX3A 1PJSA 4RVUA 2J3HA 4XR9A 4OXKA 4B4OA 1QMGA 5EPOA 3NJ8A 1M66A 3ABIA 1X15A 1XDWA 1E7QA 2IEBA 1LC3A 2ZB7A 3U5TA 3OMLA 1YS4A 1XWFA 1E5LA 2DKNA 1UH5A 4WCFC 4OSPA 3UXYA 4W9NC 4XDZA 4MVJI 3DBHB 4CQMD 5ER9A 3DL2A 3HJAA 4XB1A 2FP4A 1NP3A 4PG8A 3WIDA 2BI8A 1HDGO 1N2SA 1KY5A 1U2GA 1XU7A 5G2OA 1YBMA 3DEYX 4UVHA 1DSSG 3GZ4A 2J8ZA 2BLLA 1KVRA 2OHXA 5G4KB 3A1NA 3GK3A 4GSKA 3VDRA 4YAEA 2ZB3A 3GGOA 1SNYA 3V5NA 1KVQA 4M87A 4YYZA 2Q1WA 2GO1A 3I9MA 4D3DA 5B4UA 3CXRA 4R01A 3JQFA 4ID9A 2NWQA 3NT4A 2HRBA 3PWSA 1NVGA 2JD2A 3BAZA 3L6DA 5G0VA 2QG4A 3GHHA 3KM0A 3VH1A 1E6UA 4ALIA 4BNFA 4O6VA 2RH8A 5ER6A 3WG9A 3ROQA 1GD1O 4MVJH 2OGUA 4HNGA 5I7EA 1WDMA 2CDCA 2I99A 1I01A 4XGKA 1FDTA 1LTHR 4BNWA 2D1YA 3EUWA 5KJFA 6ADHA 5L45A 4LVUA 2J5QA 1C1XA 1NFFA 3VOSA 1V6AA 3MZ0A 2W98A 2R2GA 2IRWA 1M6WA 3CEAA 1VJ1A 2Q46A 1P1IA 2X4GA 3ADOA 3R3JA 4B79A 1P1RA 1IB6A 1BTOA 3ZU5A 1H5QA 4PG7A 1TA4A 2VUTA 4ZVVA 1ULSA 1HYEA 4NPCA 4EYEA 4JNKA 3E9QA 2X9NA 5JBIA 4XIYA 5HRUA 1Q0HA 4Y6SA 2O3UA 2C07A 4QFDA 1PIWA 3OA0A 3RU7A 3S8MA 1ZSVA 3UICA 5L4SA 1EVYA 2B0JA 3C7CB 3JD1A 3F5QA 3GZNB 4R69A 1F8FA 2JL1A 1MB4A 5CDYA 1YL5A 4E0BA 1P0CA 1EUZA 4MINA 1VL6A 4MVJM 1BXGB 4DQUA 2UVDA 2ZJ0A 3EVTA 3M2PA 2H6EA 2FZEA 1AGNA 4ZICA 3JQAB 4AVYA 5C7OO 3JD3A 5HS4A 2D59A 5ILGA 1Y81A 3C24A 1C0PA 3QIVA 1TEHA 2OMEA 3I9KA 1X1TA 3BIOA 2Y99A 4YDRA 3WICA 1N92A 4I9HA 1C1DB 1F06A 1K0UA 3G1UA 3RROA 2FRDA 3HHPA 2UAGA 5T6BA 4MDHA 5ICSA 1E3WB 2J3JA 3U4CA 2IXBA 5I8WA 4RF5A 3U62A 1Y8QA 3LU1A 4CUZA 3G79A 3PZBA 3PHHA 4YRDA 5CPFA 3IDSA 4FFNA 3WQQA 2EWMA 3FSRA 2QRLA 4W7HA 1ADBA 3RUFA 2X0IA 3C1TA 4IUYA 1N1EA 4KQWA 3A06A 4NK5A 1HSZA 2IXAA 4BNNA 4CLXA 2VCYA 2UYYA 1GV0A 2R6JA 4WPGA 3W6ZA 3JD2A 4LN1A 5ES3A 1V3VA 1FDSA 3LLSA 4D41A 1PQUA 2H1SA 1HL3A 3MWDB 4BV8A 2ET6A 3H9JA 5A5FA 5GZ1A 3L4SO 1NFRA 4PLCA 5IN5A 3MJSA 3RFVA 3OETA 5I7FA 2BFAA 1IL0A 3GVXA 5BT9A 5KVCA 3DAPA 3E5RA 3QSGA 1NQOA 4QSMA 4PG5A 5A3VA 3M1AA 1GQ2A 4GQAA 3SEFA 5CAEA 2I9PA 5KVQA 1RJWA 1LRKA 4L4RA 1E3EA 4UUPA 1LBEA 4MIOA 5BR7A 4BS9A 3ZU2A 1LSOA 2BHLA 2PNFA 2DFVA 2EKPA 2X9VA 3NAQA 3K31A 4CPDA 2QZ9A 3WDSA 2HJRA 4PLVA 5AXCA 2I67A 2ZB8A 5ENVA 4TZTA 4KUHA 2GLXA 5TT0A 3FBGA 4BO9A 1U8FO 1ISGA 5T67A 4DA9A 5DCUA 5DOZA 5CEJA 3TRIA 3K92A 2VRBA 4I08A 2GDZA 1BVRA 1Z6ZA 1B2LA 3V2UA 3QP9A 5ITVA 5THKA 4XDYA 4RF3A 4KUEA 4WOKA 1EDZA 4R5HA 1O95A 3ASVA 4I5DA 3RKRA 3HQ4O 4PGFA 1Z74A 3GY0A 1DIAA 4AJJA 1M67A 1MV8A 4OYRA 5FFFA 4E32A 3ZHXA 4Q3CA 2Y66A 2GF2A 4KOAA 2WE7A 1PGQA 3NUGA 4GH5A 4CLRA 4HXYA 2GZ3A 4E4YA 4A73A 4MVJA 5U4QA 1NR7A 2O7QA 2X58A 2ZTLA 2WE8A 4NBVA 3DBLA 3U4IA 4N7RA 5EMHA 2PGJA 3IP1A 4OOFA 4E2ZA 4J9VA 1NYTA 1CQJA 1KBZA 3D3WB 5A02A 3MJEA 1DAOA 1KS9A 4J0FA 2GPTA 4KTVE 3ZU3A 1PU2A 4WJZA 4AJLA 3RJ9A 2O2YA 3IJPA 4BNJA 3TL2A 4BMSA 4HFMA 4FOSA 3HDJA 4IZIA 3O03A 2G82A 1YDWA 4UVIA 2YV1A 2PZJA 1BHSA 4MPDA 4HFJA 1AE1A 2Y1CA 1SBYA 2E49A 3CUKA 4FD3A 3GN1A 2OO5A 3MJCA 2DLDA 3UCEA 3BMQA 4CQLA 3SVTA 4YA6A 2EIHA 1IHXA 4Q9NA 4U6SA 3ANLA 1HSOA 4AFNA 3GPIA 4A26A 4TSKA 2ZYAA 5T64A 4EJMA 1DJNA 2W4QA 2I6TA 2Y0EA 1QYXA 4QTZA 3ZWWA 4MIEA 2FR1A 1GADO 1O89A 2LDXA 1E7RA 4I5EA 1GUZA 3RAJA 3E8XA 1YO6A 1WDKA 1FDUA 1Y8RA 1VKNA 1N9GA 2NQ8A 3ZV6A 5IN4A 5A05A 3IL2A 4R1SA 4CMGA 4E5NA 1IHYA 1ADCA 1X7HA 1YQXA 1PJ2A 1NPTO 3GMSA 4HX5A 5BSEA 4R1UA 2D0IA 1W0CA 2EHDA 1CEQA 2GD1O 4MKZA 1EK6A 1R6DA 4J43A 4RGBA 5EQFA 5U1PA 1QV6A 4MP6A 3WLEA 4LRTB 4YQZA 1JN0A 3Q2KA 1GZ3A 4I9UA 1NVTA 1UXKA 3S2EA 4TRRA 2EP5A 4BO8A 3OJFA 3DTTA 3ADPA 1LEHA 4JLWA 1W8DA 3WGOA 5DT9A 3LDHA 3GEMA 1UXGA 2A92A 1EQ2A 3JQ7A 5ICMA 3WGIA 4LW8A 4DTIA 2NVBA 2NTJA 3DONA 4AJ2A 1LXCA 5KVVA 4QO7A 1ZFNA 5TF4A 4CL3A 3AUAA 3SLGA 4XJSA 3B70A 3EHEA 2UDPA 5DP2A 1EMDA 3I5MA 1LI4A 2X0RA 3JTMA 3WXBA 5C3MA 2IZZA 3WB9A 4DPLA 3Q11A 3VDQA 3DMTC 4IINA 4PLFA 3HDYA 4L8VA 3VPGA 1YVEI 4DMLA 4CM9D 3UAGA 2P9GA 3ENKA 4Y6RA 3HE3A 3EY4A 2GGSA 4HKTA 1N7GA 3GNQA 2B4RO 4BKUA 4BNUA 5DCWA 1Q0QA 1VPDA 1WMBA 2HKIA 1GR0A 1JW9B 2C7GA 1O6ZA 3DBHA 2YHUA 2Y68A 3ON5A 5JO9A 3CMMA 5I9MA 4NBTA 4CMJA 4RVSA 1PZHA 3BHMA 2FSSA 3WMXA 1H6AA 3GUYA 4FFOA 3TN7A 4CV0A 3PGJA 3E1KA 5U9CA 4P38A 1X0XA 3KLMX 5JDIA 3WGQA 2NTVA 3KTDA 4GSLA 4B4VA 3PXXA 4QXMA 2I3GA 5GMOA 4FC7A 1EFKA 3JQCA 3U4HA 3WGTA 4I9NA 3ONEA 4EEXA 3EGOA 3AI1A 3DBVO 5JDCA 3D4OA 1CIVA 4JJFA 3ASUA 3LT0A 1CETA 1RYEA 4DQXA 3LC7O 2PH5A 1LA2A 4BO0A 4EBFA 1ZEJA 3ONDA 6LDHA 2NVWA 2FPGA 3WOHA 4YB8A 3I9JA 1U2DA 3KZVA 3I3OA 4IXTA 4CM7A 4CMIB 4W82A 4ZQHA 4BIIA 1FK8A 1UZMA 4J9UE 5JAMA 1YBVA 1HE5A 5A5EA 2G0TA 3MJVA 3UVEA 4B7UA 1FXSA 2X5KO 2VUSA 3NX4A 3K9QO 3V8BA 3PTZA 3CZMA 3U3XA 4E2WA 3ZW8A 2B4TO 1EUDA 2ZJ1A 3WNVA 5BNIA 1J49A 3E9NA 1GYPA 1MLDA 2VNAA 2BFMA 2YYYA 3N58A 3OHSX 4H7PA 1U1IA 3E48A 1MA0A 1UXIA 2PD3A 2B69A 3KYDB 3NDJA 3PHIA 3ZN2A 3GDGA 4J1NA 5B37A 4PLGA 5DDIP 1BXGA 1B3RA 1OMOA 4GI2A 3HSKA 4E31A 3UFXA 1BXKA 1DFIA 3CZRA 3JQAA 4TVBA 5L3ZA 5IXSA 2VYVD 4LSMA 1FJHA 3NDRA 3ZWYA 1EE2A 3QVWA 1E3JA 3AM3A 3RC1A 1SOVA 4II3A 2OZPA 1MGOA 4PN3A 1C1DA 2HDHA 3FWNA 4TVOA 1GZ4A 4L74A 2HCTA 3DZHA 2O3JA 3RFTA 1R12A 1E3WA 3D4NA 3RBZA 3TZ6A 4JIGA 1I0ZA 3WFIA 5IZCC 4HFRA 4CQMB 3EK2A 3OJOA 1KYQA 2QQ5A 3RUIA 4AICA 1GQYA 4BNGA 4NQZA 3JQBA 1UDBA 2X0JA 5JAZA 2NM0A 3TZQA 1HZZA 4Q3EA 1A7AA 1PZGA 1XG5A 2Q50A 3KBOA 4R41A 4YAIA 2Q2WA 4OAQA 4IDBA 4UVDA 1HLDA 1LSSA 1E3IA 3TZCA 4PLPA 3AY3A 3GC6A 3H9EO 4G2NA 5KJEA 2Q49A 1N8KA 3ZWVA 3RSHA 1E3SA 4HP8A 9LDBA 4PLHA 1O9BA 1OI7A 2VRCD 2P91A 3AU8A 1L7EA 1NBOA 1E7SA 4CMAA 1JWBB 1ENYA 4XX0A 4HNHA 5AYVA 3BMOA 3GT0A 3HNPA 4GVLA 1D3AA 4EI2A 3S55A 3IOYA 1P3DA 3E03A 1HE3A 4YJHB 4J4TA 4O0LA 3MOIA 4FFLA 3PLRA 4CM8B 3GMDA 2P2SA 1I3LA 4YQYA 1D1TA 4ZU3A 1Y5MA 4CMKA 2O50A 2Q99A 5JW6A 1HE4A 1J0XO 2PA3A 3NYWA 4I5GA 4A10A 1ADFA 4MOWA 3ZHBA 4YT8A 4OQZA 1H0KA 2ZB4A 3OIGA 1HYHA 4B7CA 3VVBA 3PJEA 1G6KA 5CP8A 3WJAA 1NM5A 2GYYA 4XWYA 3KETA 2WD7A 4PFJA 1RKXA 4NFYA 3OM9A 3H3FA 5IFLA 2VWGA 3EVNA 5TJ9A 4L76A 4RORA 2E6UX 5TQVA 5BSHA 1J5PA 3AFNA 4RVGA 1V35A 4P4LA 2EKLA 2P4QA 2HQ1A 2F1KA 4PLWA 3KXDA 3HB4X 1VKOA 4RDHA 3FR8A 2CFCA 1ZMOA 1T1RA 1XU9A 4E30A 2GN6A 4CMEC 2PKRA 1H93A 3NKLA 4BNYA 1CERA 4ND4A 3P2YA 4KZPA 1LDBA 1XGKA 1UR5A 3ZV3A 5AQ1A 4FR5A 3OECA 3K2BA 3HN7A 2AHRA 2CSUA 4UEOA 1MXHA 3W6UA 4AJNA 3IKTA 5I7VA 2BGKA 5T8KC 1NXQA 1ISMA 1SZJG 3GOHA 3ZNOA 2D5CA 4MJLA 2ZCUA 1YBAA 4D3SA 1ZNQO 5G0UA 3PZRA 3H5AA 2AW5A 2YQ5A 4RL6A 1PS8A 2ZKLA 4ZA2A 1SAYA 1W4ZA 4WLVA 4Z9FA 2PZMA 3QWHA 4RJTA 4PG6A 1LJ8A 1MXFA 2UUPA 3D4PA 1B7GO 5H81A 3PYMA 4CM6A 4ZQEA 4FOOA 3ANNA 3M6IA 4NI5A 3UCFA 4I8XA 4YJDA 5IJZA 3I6QA 1JVSA 2CF5A 4CLOB 2PKQP 1HYGA 3WSVA 1F17A 1OFGA 4Q39A 2EG9A 4J7XA 1R0LA 3PPIA 2VTEA 1R4MA 1P44A 5GZ3A 2PLAA 2JD1A 2QIOA 2O4CA 1QRRA 3Q9NA 4ZRMA 3EC7A 3UF0A 3PLNA 4DL9A 4EW6A 4EUHA 3HDQA 2NU9A 3F6YA 1K6JA 3JQBC 4GAEA 4XGNA 2HMVA 2FPIA 3JQDA 4J4HA 3SC4A 2BGMA 1PR9A 3FR7A 4OL9A 2DTDA 3VZPA 4IMPA 4BKPA 1GCUA 1JQBA 3GN2A 5J23A 3FBTA 1QXSA 3H5RA 2YDXA 1GPJA 1K89A 4K28A 3JQEA 1GV1A 4CV2A 1LLDA 3T7EA 2VT2A 4E21A 3DZJA 2VWHA 1H9AA 2I66A 4B4UA 3GVCA 3KOUA 3DAFA 2C54A 1YB1A 4OHUA 2CVOA 3DBRB 3CTMA 4NU5A 3HDHA 1DRVA 1DXYA 4BVAA 1VSUA 4IPTA 4D46A 1JDJA 2WJPA 1K6IA 3STHA 4ZGWA 4RV9A 1E77A 1R66A 3AY7A 3X2EA 4OKNA 2WTBA 1ZSYA 2ZYGA 5TGDA 4IJVA 1NPDA 1Q7GA 3WGZA 3LT4A 3VZRA 4BGVA 4CUJA 4F6LA 5K6AA 5MGBA 3G1TA 8LDHA 2HSDA 3MCVA 2BFOA 1R0SA 4XD2A 4F45A 1ZCJA 1DIBA 3PDJA 4D0SA 3JSAA 3RUDA 1SEPA 1ULUA 3L4BA 1NNUA 2G5CA 3PHJA 3M2TA 3F47A 5I9LA 1UZLA 1U7TA 4XZ3A 1HKUA 2NVUB 3OF2A 4U7WA 3WGGA 1RM0A 4FIZA 4IIVA 5C7IO 1WWKA 1U3TA 1UXJA 5AOVA 1ID1A 1I5RA 3PI7A 3G49A 2C29D 1PGOA 5CEEA 2RAFA 5FWNA 1A9YA 3IUSA 4OSOA 3G0OA 1T2DA 2NU7A 2AQIA 2O4UX 3GNTA 1SEVA 1RM3A 1ZBQA 2IE0A 1XR3A 4A03A 1YXMA 1OZAA 2YW9A 2JCXA 3W4JA 2IODA 4PRLA 2AQHA 1WNTA 4OO3A 3D3EA 3NEPX 3VC7A 2ZQZA 4K6CA 5L40A 4W6ZA 4FFRA 5A9TA 3DHEA 2YDYA 4RPHA 4J1TA 4MVJD 5DULA 3RBVA 4PZCA 2JCVA 1P74A 1DEHA 3WIEA 1V3TA 3IJRA 4GKVA 5L51A 1PWZA 1Y6JA 1YQDA 5G0WA 5CDUA 4DBZA 4XRRA 3DWFA 3TFQA 1LLQA 4AG3A 3L0DA 1QLJA 3GRKA 5L7TA 3EYWA 1ZIDA 2OUIA 2RHCA 3K30A 1DPGA 1R4NB 4KWIA 4TRNA 3KYCB 1F0YA 4CMIA 1W6UA 5IG2A 1A7KA 4D44A 4AJPA 2CUKA 4U0KA 1Y9EA 4BMNA 5DN9A 4BO6A 4AJ1A 2W2LA 1E1NA 1H6CA 2CDAA 3ZV5A 3OH8A 5I8ZA 5CFZA 1E1LA 3DB2A 3NDIA 3GLQA 3PHGA 2HLPA 4YRAA 2QYSA 3QWIA 1YB4A 3CH6A 1HT0A 3VAZA 1YJ8A 4OIMA 4ZQGA 5EESA 2HJSA 2ZATA 4YJGB 1DLJA 3OSUA 4W4TA 4KWHA 3UGKA 3MEQA 4HFNA 3OIFA 2QX7A 4YBZA 2VN8A 1YH3A 1IE3A 1N7HA 1GTMA 2Z95A 4HUJA 3VH3A 1BXZA 1ZK0A 1VI2A 4NHEA 4YT4A 2FR8A 1P1JA 5DBFA 5BSGA 2JFHA 2DTXA 1X7DA 3PFFA 4DXHA 1LRJA 4CMCA 3E18A 5LCXA 1KETA 2EEZA 3RUHA 1NHWA 2HMWA 2PR2A 1DB3A 2IYOA 1G0OA 2YJZA 4JJIA 4RQUA 3WS7A 1DLIA 5CDTA 3FRJA 4XQ9A 4WKGA 4O59O 1WPQA 3VPSA 5JAQA 3WWYA 1I30A 1ZJZA 2Q3EA 1LSUA 2O48X 3INGA 3LT1A 1WP4A 2QW8A 3JQ9A 4J7UA 1BDBA 2Y1EA 4ILKA 4WCFB 1YE3A 3FHLA 2D5AA 2ZCVA 3FNGA 4M86A 3TZHA 4B7XA 4IY1A 4C7KA 1X14A 3DMYA 1KEVA 3E9MA 2Y05A 2FY8A 4MVJE 3ROKA 3KUXA 1XQ6A 4P4GA 2NV6A 3JQFC 4ROSA 1YB5A 4BNZA 1CWUA 4X54A 2XXBA 3DO5A 4A7PA 1YOVB 4YT2A 1T2CA 3T4XA 3F1KA 3RD5A 3S2IA 3DTYA 5JXWA 1T2AA 2IEDA 1IPFA 1PX0A 3EMKA 4BKRA 4F6CA 1K5HA 4DIBA 3V2GA 5L7YA 3R1IA 4B4WA 1ZKMA 3DOOA 3UCXA 4FDAA 2V65A 4EJ6A 1PZEA 3EZLA 3QWAA 4Y6PA 4YJHA 3WR5A 9LDTA 4JX8A 4TKLA 1B8UA 4D7AA 4CM8A 3PGXA 2OBNA 2EGGA 4LVCA 1NHGA 1EVIA 1ONPA 1U5AA 4ALNA 2A9FA 1HF3A 4XKJA 4C7JA 2RCYA 3Q3CA 1NASA 3F46A 3F3SA 5EIOA 3HADA 4E3ZA 2B4QA 1G1AA 2NU8A 1Y9AA 4MVJP 1GZ6A 1BDMA 2ILTA 2YQ4A 4WEQA 2YFQA 4FW8A 3BMCB 3K8ZA 1R15A 2GN8A 1ENOA 3RFXA 3WFJA 4J0EA 4TKMA 3VPFA 3Q2IA 2DUUA 1GFSA 1KVTA 3LC1O 1L7DA 4GGPA 3QV1A 1HTBA 5DCYA 1FDWA 4HBGA 1NTOA 4ND1A 1NFQA 2V6FA 2GN9A 3MTGA 5L4NA 1D8AA 2EJVA 2QZZA 3LK7A 2O3SA 1ZUD1 3UHAA 3I4FA 2JAHA 1B8PA 3OJ0A 3R0IA 2FOIA 4JBIA 5IDYA 1B15A 1K3TA 4RLHA 4ZJUA 3FNEA 2JFGA 1P9LA 3C1AA 1XA0A 1FF9A 5K0ZA 3KLPX 4LK3A 1HLPA 3LF1A 3MTJA 5CPBA 4YPOA 2GERA 1ENZA 2VHYA 1EEHA 2NADA 2H63A 3IIEA 5KJ1A 3DFZA 4PZDA 4ZQBA 4YAJA 2I5PO 3A4VA 3ICCA 1XKQA 3AI3A 3IQDB 4J49A 5CHEA 4RF2A 4HWKA 1UP7A 1YQGA 1UP6A 3PEFA 5F21A 4ONEA 3ULKA 3FCOA 1E7MA 4N5LA 3DHYA 4S3MA 2WMDA 4WECA 3TNLA 2OORA 3JQGB 4GL4A 1HE2A 3GDFA 3MJTA 2JCYA 1QP8A 1PWXA 1C0LA 3B1KA 3K96A 4XYBA 1ZK3A 1DBVO 3PFWO 4IQ8A 1EE9A 1GDHA 1XQ1A 3JQAD 3RASA 2GUGA 1CF2O 4CLOA 1MC4A 1YKFA 3JQ6A 5CDGA 1PL7A 1Y7TA 3U49A 3VZSA 4BNHA 5JSFA 3QVOA 5TC4A 3I23A 4PLTA 5T57A 1PJLA 1Y1PA 4U8GA 4BUCA 3BHIA 4GGOA 3L9XA 4U6QA 3IKVA 4DMMA 1UXHA 4DC1A 1PQPA 5TJHA 4B8WA 4J90A 1JKIA 2GASA 4BO7A 2F00A 2R00A 1WDLA 4TRJA 5HBRA 3HN2A 2HMTA 2HUNA 1UZNA 4IS2A 4NNJA 4U0JA 3PQEA 5ADHA 4L75A 5COAA 4JXKA 2FZWA 1HEUA 1T4BA 2JHFA 2XOXA 4QO8A 2YZ7A 3FN4A 1NX6A 3RI3A 1GYRA 4IJUA 4J1SA 4B8ZA 1EQUA 3DOJA 5HWSA 1X7GA 2YHIB 4BKQA 2OBYA 1U3VA 4IGEA 4KDFA 4MVJF 4EJ0A 1C3VA 4TQGA 4UVEA 4RPGA 1NWCA 3DBRA 3ZWPA 4DLBA 2P68A 1SC6A 5JO0A 3GA0A 3ZDFA 3RJ5A 4WNIA 4RPLA 5G4KA 3RUAA 4J6FA 3U09A 1GQQA 1WZEA 2CNBA 3ZHYA 4BO3A 1VJ0A 2O23A 1PJTA 1JKJA 3HFSA 3GNSA 4TRMA 4ALJA 1T2EA 2PK3A 3WTCA 5JAIA 3IP3A 4FN4A 1BMDA 2WD8A 2EERA 2FWMX 8ADHA 2VQ3A 4O63O 3HB5X 2JFFA 2O3QA 2CDBA 4J2OA 4DRYA 2NVUA 4DWVA 1XHLA 3JYNA 4J1QA 2AEFA 1UAGA 4IDCA 1CDOA 3V1YA 3WJ7A 4U5QA 1TI7A 4BO5A 3OIDA 3PHLA 1VSVA 1PGNA 1HDXA 1VL0A 1DHTA 3AUTA 1U5CA 3KSUA 3FTPA 4NJOA 4E5YA 1HDOA 2C20A 4NU6A 1KEUA 2CMDA 3ZCXA 4CM1A 2UUOA 3B6ZA 4GX1A 5JMWA 1B26A 1RYDA 4R5MA 5G0SA 5KKCA 3ZWNA 1N1GA 4NBRA 4FB5A 2X7HA 1ZJYA 1IY8A 4OXYA 4WCDA 7MDHA 3GZNA 3TF5A 5L95A 1R37A 3QVXA 4L73A 3PWZA 4RVFA 5A06A 2EGHA 5ITWA 4GLLA 1U9JA 4J3FA 1QYCA 1PS9A 3AUSA 4Q3AA 2CZCA 3RWBA 4RZIA 3VH2A 5C7LO 1ZW1A 1DHRA 3FI9A 3U4DA 4NFHA 4WLFA 3N74A 3PYLA 1B16A 1H6DA 3AFMA 3I83A 5JCXA 1UP4A 3QE3A 2DPGA 2V6MA 3BTUA 3JYPA 2WYUA 1Y8QB 3ZI0A 4PVDA 3FNHA 4GKBA 3VKUA 4PIVA 2ZK7A 1R4NA 3KYCA 2PTGA 2X6TA 4NJMB 4GPD1 2E82A 4IXWA 2X9GA 4UEKA 4H3VA 3R6DA 1OAAA 2G17A 3F4LA 3M1LA 3KSZO 5JCJA 2RHRA 1OC2A 4MP3A 1BRMA 3AJRA 1XEAA 1Z7EA 3INTA 4I1IA 1KVSA 2AE1A 3N7UA 1RM4A 1V9LA 3U0BA 2POQX 3LQFA 4JBGA 5JFOA 4M89A 1TT5B 4YJGA 5LC1A 3UN1A 2JJYA 1QYVA 2CD9A 1PGJA 3WMWA 1GEEA 4XA8A 3ZV4A 1DFGA 4YEDA 5B4VA 1U28A 4P22A 3SJUA 2DBVO 3H9QA 2X22A 1DIRA 1ZH8A 3PJGA 1SOWA 3ETGA 3K5PA 1PL6A 3JYQA 4L4SA 3BTSA 3WBFA 3QW2A 4QX6A 5F5NA 1CJCA 1LLCA 2P5YA 4XCVA 3AOEA 4NR0A 1PJCA 4N5MA 4IJKA 3AOGA 3F9IA 3PJDA 2Y1GA 5IZ4A 4Y8VA 1Q7BA 1U3WA 2V6BA 3INRA 2B83A 1ISIA 3UUWA 3E5MA 4NK4A 2Q2VA 3WBBA 5JMPA 3RC2A 3QVTA 3O26A 4OQYA 3HWRA 2JAPA 1Z7BA 1WVGA 1EUCA 4IM7A 3O8QB 1I2ZA 3CINA 4WCFA 1ADGA 3AI2A 2NU6A 4W9NA 5BSFA 4II2A 2X23A 2XAAA 3PVZA 5L7WA 4DYVA 2DTEA 2P5UA 3QRWA 4WE3A 1NVMB 5AXAA 1B3BA 1VLLA 5JDIC 1E7YA 4MIYA 2PKQO 2J3IA 3QWFA 1GUYA 4QT0A 3C7AA 3ROPA 3ZHZA 5KJCA 1DRUA 2WSBA 2J6IA 4B3IA 4GX5A 1YOVA 3JQ8B 4E5PA 2D4AA 1LC0A 2X1HA 1I3KA 3Q0EA 5JDCC 3T7CA 2Y93A 4PRKA 4BO1A 4RQTA 4UEJA 3T4EA 2O7SA 4OJNA 3V1UA 4C4OA 2NTNA 4K1LA 3NTOA 4JROA 1G0NA 1KC3A 3ZNNA 3H4VA 4DIOA 3WYEA 3W4KA 4BQPA 2Y1OA 3GHYA 2SCUA 4DPKA 4RPJA 5BNTA 1PJ4A 3H6KA 5HTOA 1IZ0A 1MFPA 4NBWA 4HADA 4DGSA 5A4DA 2Q45A 5JC8A 4DLAA 1B8VA 1OOEA 5TRTA 3DXFA 2C5EA 4Y67A 2VT3A 3RIHA 1R0KA 3MJ4A 5ILOA 3BMNB 1C14A 1QLHA 1C0IA 3H9UA 3D3WA 3GVHA 3ICPA 4G81A 4N5NA 3KYBA 1YGYA 5F1KA 5DBIA 2O3RA 1I24A 3SXPA 1IULA 1V8BA 2A35A 3CIFA 3NTQA 3BMCA 3NT2A 1KC1A 4L9RA 2J5RA 3G17A 4ZD6A 3RKUA 1Y5RA 3HUDA 4D42A 3S1LA 5JE8A 4A27A 2ZTVA 4CR6A 3PYXA 1MG0A 2VZ8A 1E5QA 3H65A 3DC2A 4R51A 3TWOA 3VTZA 1N5DA 1Y8RB 3ZNPA 3P19A 1H6BA 1NAHA 2EKQA 1YONA 4NH4A 3WQRA 5JYEA 5AXDA 3SBOA 3V2HA 3ZWOA 1EFLA 1UJMA 3GAFA 5A04A 4CV1A 3C7DB 4G65A 3WYCA 4ND5A 4HV4A 5K9ZA 1Q0LA 3ZH2A 2BF7A 4RLSA 3JYLA 4OGWA 4WLUA 2DM6A 4WLEA 2VHWA 5GZ6A 1XELA 2VWQA 4KUGA 5A3JA 3AM4A 4JN6B 1E1MA 4BGIA 1M2WA 1U4SA 2ZTMA 1CRWG 4K9DA 3RU9A 3P5SA 4R9RA 2FSVA 5DBGA 2W2LD 5BQFA 3B1JA 4UUOA 4IBOA 1K6XA 2XF8A 4FFPA 2FHSA 4ZRNA 2AEMA 1DO8A 4R3WA 5DNAA 5DF1A 3AK4A 1DJQA 4Q3NA 4RDIA 3EW7A 4JCOA 1JU9A 3JCZA 4O1MA 4CMBA 1GPDG 5JY1A 1YJQA 3I6IA 3E6AA 4BNMA 4WLNA 2DC1A 1PS0A 1MFZA 1HRDA 2OP0A 1M75A 5TX7A 4RPKA 1FDVA 1YL7A 4D79A 3TFOA 3TJRA 1TVEA 5CDSA 5IDQA 4GMFA 1XYGA 4EITA 3QA9A 1S7CA 1X13A 3LT2A 1MUUA 5B1YA 4J16A 1KVUA 1P0FA 1P1KA 2NNLD 5IAAA 4DLLA 1Z45A 5CEFA 1XCBA 3B20A 3C1OA 5TS3A 3C85A 4G5HA 3ZWMA 4E2YA 3GGGA 7ADHA 2C7VA 2DBZA 1BG6A 2EF1A 5TNXA 2RH4A 2BH9A 1QKIA 3OP4A 2Q2QA 3PWKA 1LNQA 2FMUA 3OBBA 4GBJA 2DT5A 1GCOA 4OKIA 4RO0A 2BI7A 4YJFB 2VYNA 2VOEA 2HU2A 1NR1A 2HMUA 4DIFA 3L9WA 4IQGA 4CJXA 1NWHA 1E1KA 1ZEMA 1UUFA 1A27A 1CYDA 4R4JA 4CR8A 1QYWA 1RM5A 4IDEA 3TL3A 2DFDA 4CLHA 2EXXA 3EDMA 5L4LA 2YHIA 1B14A 5KKAA 2HAEA 4XGIA 3FTNA 2Y0CA 3WYBA 2TMDA 3KO8A 4H15A 4KTTE 1GY8A 2GZ2A 3GH3A 3OJLA 4R1NA 1QSGA 3BA1A 4R9SA 3X2FA 3H9GA 5B4TA 4E12A 4NFSA 3H3JA 4Z0HO 1MG5A 1A72A 3TPCA 3L07A 2C82A 1AN9A 3DZIA 1SB9A 2YUTA 1L1FA 1AHIA 4LMRA 4BGUA 2W2KB 3DR3A 2PV7A 4OOEA 4OM8A 1PZFA 2JKVA 4UAGA 1O8CA 3VZQA 3F1LA 4H16A 3UW3A 5FI3A 2RBEA 3JYOA 1YL6A 3KSDO 2VHVA 5MDHA 4YXFA 4FGSA 1DC6A 1VC2A 2D3TA 1ZO8A 4PLZA 1A4IA 1O0SA 3RC9A 5F3RA 4FJ1A 4QUKA 5FF9A 1P77A 3VPXA 1TXGA 2DAPA 3PIIA 4EGFA 1Q2XA 1ZXBA 3QQPA 1I3MA 2BFPA 4FQ8A 4XRGA 3KEQA 3CMCO 3CKYA 4ND2A 2GNAA 4E33A 5KVSA 3DAGA 2I76A 4NDNE 4GWGA 1I32A 1IZ9A 2B37A 3FD8A 5IDXA 2WDZA 2DBQA 4XQGA 1SCUA 3VPHA 5HM8A 3QJ5A 5EN4A 3HFGA 3QWBA 1BGVA 4JGBA 3BZUA 1EZ4A 5A9SB 1Z82A 4BGEA 2QHXA 3ANMA 2G1UA 2YY7A 3S2GA 2X8LA 2VNSA 2PH3A 3D64A 3Q1LA 3VHRA 3IS3A 3DZGA 2E37A 5EQDA 5H83A 4LMPA 4YR9A 5JS6A 3JV7A 3KYDA 1TT7A 2Q1TA 1WLYA 2EJWA 2HO5A 2EV9A 5KCZA 4WOJA 1LSJA 2O3TA 3E82A 1WMAA 4DC0A 3DZBA 4RVHA 3GVIA 5DOVA 1JVBA 4XJTA 3JD4A 4IDFA 4F3YA 4A2CA 3GG9A 2AG8A 1BW9B 1W73A 5THQA 4BNTA 4NJMA 3WX0A 3WWZA 3O4RA 1MC5A 4ITUA 4ALLA 3RC7A 5C37A 4Y98A 1GEGA 4Z3DA 1JTVA 2DUWA 4AJEA 2VWPA 4PVCA 5EERA 1GU7A 2B5WA 4FJ2A 5FEUA 1EBFA 4CQMA 2VHZA 5F1PA 1KERA 5JC1A 1TT5A 2FN7A 1S6YA 2I3AA 1F8GA 4PLYA 1P1HA 3C3XA 4QQRA 5EINA 3PQFA 3H7AA 1XIVA 3BMOB 3LSYA 4FGWA 4DREA 5K6AC 3GR6A 2HK7A 4INAA 4ZHSA 1AHHA 2V7PA 4K26A 4YAGA 5JY6A 4OMUA 1LU9A 1LRLA 1EVJA 1T25A 2DPHA 1BWSA 2LDBA 2HRZA 3LZ6A 3DZFA 1KEPA 3TDKA 2C59A 4BMVA 1IOLA 2NACA 3SJ7A 3DDNA 3KB6A 3OJEA 3IC5A 2QYTA 3L4BC 5KJ6A 1DRWA 3B1FA 2GRAA 1E3LA 4AL4A 5LDHA 3TOXA 5H82A 3DMTA 3W8FA 4F46A 3K6JA 4J4BA 2J5KA
chains in the Genus database with same CATH superfamily
3KEMA 4GSYA 1Q57A 3ZCUA 3EXFA 3ADKA 2VNIA 4U9UA 3G0BA 4RZQA 5JR3A 1G2OA 4ZAYA 4R16A 4RYLA 1E9CA 1D1QA 1QPBA 2CK3D 2Y0DA 2APJA 1R7RA 4G8BA 4YCNA 1W0KA 4HZUB 3PT9A 3AR4A 4BX3A 1DQRA 1W5FA 4GRDA 4NPHA 4ZVKA 2F67A 3NHBA 4MQBA 2CY0A 3OZTA 1ILEA 4IJ5A 2CJXA 1EDOA 1N6KA 1F51E 3F49S 1MAVA 2I3DA 5EIAA 4GC5A 1ML3A 4IG4A 1R16A 3KHKA 4I3HA 1MAAA 1W5AA 2Z5FA 1PFUA 3NO4A 2EP7A 3HXTA 4D0RA 3SQMA 3KV3O 3HWX1 2FKNA 4HD8A 2NSYA 4FE4A 5TT1A 2OQ2A 2AW3A 2V1XA 2XUJA 4N9WA 1N5LA 3UGJA 1IN6A 3EW9A 3GDOA 3KDSE 2AD5A 3C6YA 2W2TA 4PFQA 1Z0ZA 4YWJA 4YUAA 1I6LA 2H9IA 1AQIA 1GNVA 4YCAA 4D8VA 1Q21A 4BKOA 1F12A 3KVOA 3TCNA 2QRMA 3DL4A 3LPNA 5A9RA 3CLTD 3ICVA 4JLPA 4S1NA 2B5OA 2XCQA 2F8SA 2OFOA 1DAGA 3MAJA 3MMPA 1QYRA 4ND8A 3OA2A 3R74A 3U13A 5ALPA 1K06A 1AUPA 4M9SA 1TLLA 1OASA 1CIPA 2YCLA 1GAEO 5HIIA 2BD0A 3N2KB 3N75A 3NCHA 1U0HC 5CFNA 3HNRA 4W63A 2P4HX 5I48A 1HDCA 1ZYUA 2OAQ1 4JUDX 3A0RB 1NNEA 3BGDA 4XQEA 4RJLA 4JI3B 1CUHA 3ZHTA 3ZVKA 1ZGCA 3SU8A 4YLYA 4Q02A 2JRLA 1DTWB 4JUCA 2V9ZA 1A9ZA 4KXNA 3SJAA 4BRZA 1OJ7A 2I6XA 1XKLA 2CMFA 4E7PA 2UVPB 4LTNA 1MB9A 5TR9A 5JMOA 3Q5DA 3DT9A 3OICA 4LZZA 4AKGA 3MVEA 1IUKA 4II7A 2W8ZA 5A03A 5AJVB 1EDBA 1BHQ1 1JIJA 2IP2A 3UFBA 3K3PA 4ZVNA 2P4UA 3T0IA 4X24A 5JFTA 3FVRA 2V8OA 3FVVA 1X19A 3QXGA 1R4MB 3W8DA 1FUUA 3VI4B 2FFQA 3C3KA 1FYWA 1C30A 3O9VA 2C92A 1KI4A 4M54A 4WN9B 2WFMA 5DSTA 5BPFA 4PX9A 1WKCA 3ZE0B 1M1YB 1X1CA 3FFBA 4JVNA 3EWAA 3RHFA 4BNKA 3PXEA 5TEWA 1W5EA 3ABQB 4DPMA 2CXTA 4DR1B 1NVKA 4F8EA 5L3SA 1COZA 4Q3DA 2W90A 3U3MA 4F7WA 3C8ZA 1NP7A 2FPIB 1L3BA 5T5QA 4ENTA 4H0CA 2ORED 2QVZX 4ODIA 1N2EA 4IDQA 3OOJA 3BREA 2H85A 2QUBA 4EZBA 2BEWB 5EY5B 3RYCA 1H0SA 3GX1A 3U9TA 2J5BA 4RTKA 2REOA 3FNIA 1H9BA 1YZ3A 1I1NA 2FQ1A 2Z8YA 2IYPA 3TTSA 4BGDA 1E6WA 1Z0FA 2Q4RA 3LX6A 3FHCB 1I2CA 2H8KA 2I0FA 4HDSB 4TMFA 1H8HA 5A71A 4DCUA 4NIMA 4F4CA 5IZCA 1M76A 3RS2A 1YB2A 4FNOA 1H3FA 4LNAA 2HO4A 1H2BA 5IDWA 3WMRA 2B3DA 3WB1A 3WAKA 1EH5A 2AQKA 3EA0A 1ZJWA 1IBKB 2YS7A 5J63A 5LZ7A 4GOXA 5E7IA 4JBHA 2P77A 1AO3A 1D5CA 5CFOA 5AXBA 4TWRA 3BHJA 4UD6A 1PQWA 4JUIA 1L7XA 4PFSA 4QBIA 3W7AA 3WP1B 5HJ5A 3MYRA 3NWEA 2DH5A 2JLCA 4M9XA 4YDSA 1NW8A 5ITSA 1MRZA 1SXJA 5CIWA 4J3NA 2ZVQX 3F5SA 1G5TA 3EEIA 4NOJA 1LDMA 2Y1FA 1L1EA 2C9MA 1PWEA 2O57A 2CVQA 3GRYA 1KMCA 1Q0SA 2IXDA 2ZOSA 3F7NA 1QOZA 3HFJA 3E0XA 3Q10A 1XTIA 1UAYA 2J9FA 3ODGA 3UMCA 2UV8A 3C41J 4MRVA 3BFKA 2PIAA 2XQJA 1WSWA 2GN4A 3EFEA 3LHKA 3R3UA 3L84A 4BN4A 4YV7A 2HK9A 4NZ9A 4XLZA 5F5LA 3WL8A 1EWYA 1HO3A 1NL3A 4HY3A 3LL4A 5AUQA 2VPXA 2NV0A 1VCHA 3OQ1A 1BO6A 1E5DA 5AKIA 1FB5A 1D2HA 3QQ5A 3AR7A 3FPLA 3HKCA 2N9UA 1P9OA 5ALUA 2OB2A 5JZMA 3EPKA 3CF4A 4B3HA 3PF8A 3V55A 1ZGJA 2NU7B 2O2SA 1C0KA 3O4FA 4QJIA 4EX6A 2C9ZA 3K32A 1P4SA 3GFGA 2BF4A 3K2EA 3M0EA 2BRUC 3EC1A 4YJFA 2ZYDA 3GQBB 4KAXA 4E1BA 5KYWB 3WISA 4EDFA 2D8AA 1U8UA 4GX0A 1NQAO 3RU2A 4MGIR 4AUKA 3M89A 1DOHA 4RHCA 2B4AA 1BGWA 3RVLA 1CJTC 4QOJA 2WQZA 4BB6A 5C8YB 2OBLA 2XPCA 2YWBA 3GROA 4W7SA 2XMQA 3R6GA 1GUAA 5TSDA 1S89A 3KUUA 4AYTA 1JZTA 2GXUA 3PSAA 4LGVA 3SG0A 4ZOCA 2YWFA 2P6NA 3LWZA 4TL6A 4CODB 4BL5A 4OB6A 1C4KA 1SXHA 3RUCA 2GYVA 3OT5A 3HBMA 4PFKA 1SVSA 3KALA 1MIOB 3IQZA 1DXQA 2QN9A 3FVTA 1Z3IX 5KUTA 2F8MA 5FUWA 3ZGYA 2OFPA 3MCUA 3NWJA 3WJ1A 4BJ5A 1U7PA 1SPBS 1QIJA 1NC3A 1VPLA 3HBFA 4X65B 2C7OA 1L7RA 1MP0A 3RTBA 2AUMA 2RHGB 4OI1A 3ENVA 2W6IA 4J7CA 3H5TA 3IP9A 4UFPA 1HLFA 1ZLYA 3ZWBA 1ZJJA 1UBFA 2YWCA 4NZMA 4KPYA 3L8ZA 4G1MB 4NYIQ 3HJBA 3LIIA 4KWEA 1Y4DE 4YAFA 1ECCA 1JKFA 5KNBD 4MHOA 1DC5A 5ICGA 1QRSA 1VG0B 4R68A 2C7PA 3UJCA 1VHWA 2NLOA 4YX9A 5FI1B 2CNLA 3F97A 5DP1A 3A3KA 4ZEWA 2E18A 1YS9A 1ZMRA 3LO8A 1JPJA 4JQYA 4KNWA 5JNTA 3LRXA 4EUEA 4J0JA 4CM3A 3TGPA 2B4YA 2O2DA 1G8SA 3TSWA 1IHUA 2IUSA 2FGJA 2WPDD 3K5HA 4JLAA 1TKAA 3PQDA 4DMUB 1JDPA 1G5FA 5DB4A 1Z4LA 1U04A 1M2HA 1CZHA 3NGLA 4OBXA 1ISHA 3SE7A 4G0VA 1GT6A 2BR4A 2EL9A 2ST1A 1JMVA 2C1EA 3DYBA 2SKEA 5EMLA 4CCSA 2EW8A 2J9XB 3W4IA 3DBOB 1EA5A 3UBTA 4CIXA 3L77A 2N47A 3BRQA 4L72A 4CV3A 3VYRB 4JR0A 4Q1EA 4AJ4A 3RSQA 3MRSA 4ALKA 5IXYA 2E5FA 3O1IC 4E5MA 5B58C 5TV2A 4PANA 4ZO7A 1PKXA 4LHYA 4H1WA 1SOAA 4M4SA 3RBXA 4FDMA 2BOVA 4FHEA 2NUAA 3DNPA 2V4UA 2D0OB 3AUJB 3G8YA 1XAJA 3EOBI 3GUCA 4REMA 1DX9A 6PFKA 5AVXA 3CXUA 2P6PA 4LRSB 2AX3A 3OO1A 3UMJA 1IYZA 1UC5B 4BFCA 3NTRA 2A7QA 3ZE1B 1VYVA 4TWIA 1NLFA 3QA3E 1FMCA 4V0ME 4JENA 2OGWA 2Z0MA 1HDEA 2QT0A 3D4IA 5HIJA 3T52A 3H5NA 5AVOA 3A14A 1H5NA 2JFUA 4B3MB 2JJ1A 1EP1B 5EJ4A 4YP0A 1T0HB 3BIJA 4BFLA 4E4TA 5EZ5A 3WYFA 4WY5A 2XUGA 4MYHA 1RJ9A 4WZBA 3Q3VA 4YMGA 2RD2A 5CD9A 4JP3A 2OL4A 4C4AA 1V95A 1BJRE 3KVVA 1RI2A 5A0TA 2J3KA 1KYXA 4S1PA 5HF9A 3IQEA 3EAGA 4YRTA 2PGIA 2RGNA 3ENNA 3IT1A 3OOHA 5D1HA 3WK9A 2JHGA 4RY2A 3AVVA 4EUFA 1GTZA 1B00A 1LV8A 1Z28A 4X6UA 3V46A 4D8TA 4JK3A 5EE0A 1U3FA 1NLYA 3LUCA 4MMZB 4MO9A 5FBRB 2HDWA 4QYXA 4RUKA 1Y9ZA 4D45A 4GLOA 5I9NA 1A9XB 3ER6A 1KMMA 3IQFA 3PXAA 4Z3OA 1KK3A 1XLVA 1SCNE 1ZZEA 1FFXB 3ZPXA 2NZWA 3ELUA 3GA7A 4KZKA 2XEDA 2Z09A 4U7HA 2VP2A 3SQXA 3URMA 1XDZA 5IC4A 4CLRB 5LFAA 1RWNA 4C0HA 2HUPA 2PL9A 1C7FA 4WXPA 1EVLA 1I10A 3NAMA 1M83A 3D5TA 2H2HA 3R0XA 1YF3A 2FV8A 3GP5A 2F43A 2FUEA 1Z7WA 1OYYA 1UDAA 2VPWA 3STWA 4LRWA 4DQVA 9ABPA 5J3JA 2I9KA 1B1CA 4AROA 2LV8A 4OD0A 3B51X 3DULA 4I9GA 4QBFA 3N39C 3A4TA 2J3DA 3NRCA 3ST7A 5K7SA 2BTEA 2G8LA 4OGLA 3ZNQA 3DDCA 4C1BA 5CCXA 1KY4A 4X1YA 5C1DA 4KQXA 3S68A 2H4FA 3CG4A 3ZXXA 3FKSD 1SUAA 4F5ZA 2H2FA 2HJHA 3JSXA 1TM4E 1SC3A 5KNCH 4XAQA 2Z43A 5CM2Z 1PTJA 1JG7A 3I9LA 4LBWA 3VKVA 2VXYA 1E2LA 4BNVA 5I7OA 4LISA 2GZAA 4HLNA 1VB3A 3HS3A 2EVWX 1RDFA 3FYDA 1EUYA 3TTWA 5KMGA 3LPLA 3OWXA 4L51A 4DV5B 4BOYA 1OT5A 2HJ9A 4Q4LA 2IUTA 3UWDA 2HA3A 1OLXA 2RHBA 2XT0A 1G59A 1T9GS 4FQ7A 4CKWB 1M6HA 2PY6A 3ZGZA 2OP1A 4KRXA 3KU4A 2AYYA 3BTOA 3GJ8A 3UXMA 2QBYB 1TQ8A 1N2GA 3LE8A 1H05A 2DG2A 2GFQA 1NN1A 2Y1DA 1LJUA 4URHA 3RG8A 1XUOA 5TPZD 1ZXLA 4HUQA 4OREX 3ZKAA 1H0RA 3TSAA 3UWKA 2C5AA 4L5AA 3IBYA 5KWEA 4PBSA 4I46A 1R9MA 4TYQA 3TNYA 2IYFA 1VCNA 4JKOA 1KO5A 3ADDA 1WZIA 2NO9A 2Y1WA 3BXXA 4WUVA 4ACBA 4WKPA 2C0PA 3A1WA 3RYIB 5JVDB 2VTVA 3HCFA 3HY4A 2B7CA 2ISSD 2XQKA 3PT5A 2PD4A 2VUUA 3JWHA 2JFVA 5GVSA 2YXEA 1NY5A 3IT0A 2AXQA 2DUNA 4A91A 1R64A 1U2ZA 4M0MA 4QDOA 5REQB 2Q2OA 1I36A 2YBDA 3L8YA 2R8PA 3QJYA 1QHHB 3QVKA 4WEOA 4O2BA 3AJAA 1OA0A 4CL8A 4V1CI 1ZMBA 1TYCA 4R0VA 3DEIA 4PNZA 4EUKA 3E23A 3D5QA 5HUJA 2C2KA 4J7AA 3AF4A 3BD6A 3IEIA 4FWIB 4CBVA 4BFXA 1E2QA 5HE9A 5BWOA 1CJVC 2C2XA 4ARZB 4PS0A 3I5AA 1R6AA 1P5ZB 1I9CA 2YV3A 2Z1MA 1WO8A 2H0QA 3I4CA 3IXMA 3KYIB 3OIUA 1AY0A 2Y9PB 4K9OA 4XQ0A 4BV9A 2BN4A 3DQPA 3Q7EA 3PC6A 1SWWA 2HMSA 5FLYA 2Z6VA 3D7SA 1I6KA 3UOGA 2G3YA 2ZG6A 4A8JC 3AESB 3WRWA 2G76A 1DO0A 1RRGA 2DFTA 3FYCA 3U0VA 3W8EA 4M76B 3T7RA 5FWYA 2CFRA 3RTGA 4C7OA 2J30A 4JUAA 4F5WA 5KSZA 3M81A 4JGGA 3SS7X 4BQOA 4EG5A 1WEHA 3WGHA 5M29A 4NENA 3FZGA 4N12A 4CF3A 3H5WA 3KU1A 1ZOIA 3IEPA 1BDJA 2MR6A 2ZR7A 6YASA 4J91A 1G9TA 5HRCA 1AXGA 1N77A 3FTFA 4K0KB 1LNZA 4RVCA 2F3QA 4O02B 2WDPA 3AKDA 3G3EA 4BASA 2YMMA 4X1OA 2PX2A 1JHOA 2LKDA 1BZYA 2ODNA 3KUKA 3WLSA 4FSXA 2W6QA 2P5TB 1GPBA 1KH1A 2MYPA 3WIOA 1E79A 2ZBFA 3TB6A 4BN5A 3O93A 1WXXA 3HU1A 4HAXA 3V48A 3O5AA 5FPTA 2PPLA 5AD1A 3KB1A 4V0NA 3THOA 3SGLA 2R8EA 3KPUA 3TMKA 4HJXA 3U44B 2IP4A 4CF5A 1KJYA 3UXYA 4W9NC 5IWCA 4YUXA 5KYYB 1GTRA 2IZ6A 2YVUA 4G0OA 4MVJI 4CKCA 3DBHB 4DCGA 2ZREA 5LMCA 3HJAA 1RNLA 4FI3C 2FP4A 4A6EA 1NU6A 3WIDA 1XZ8A 4YLGA 1YB6A 1N2SA 4FHGA 1K3UB 1KY5A 3EPHA 5G2OA 1Y7HA 4TMTA 1NXPA 4C89A 1DSSG 1Z29A 2EBUA 2ZE5A 3GZ4A 2JJ2D 3JZFA 4G85A 5G4KB 4A0SA 2BBWA 3CO0S 4ER0A 1EXNA 4YYZA 4RMNA 4KE7A 2GEJA 2X7XA 3WWPA 5LIPA 3JQFA 1RI4A 2WZBA 2ID7A 2NWQA 2O2JA 2X4LA 5ERGB 5HOQA 3NT4A 2HRBA 4C76A 2G1AA 2G80A 4KH1A 4JWKA 5CUQA 1REQB 2OBFA 4QVGA 4RD4A 1N2CE 5G0VA 1E6UA 2YJ6A 3IAEA 3UJ7A 3COVA 4BNFA 2V55B 4G86A 1VYTA 4M1KA 5ER6A 3ND6A 4RTSA 4YHHB 4M1ZA 5BSWA 4HNGA 1W1UA 2OCIA 1J21A 5I7EA 1MVOA 2CDCA 2I99A 3OD1A 4OJMX 3T7JA 5J2TA 3PXGA 5LP6B 4FUQA 4EMUA 1A5BB 2XUDA 1MVNA 1T9DA 2D1YA 3EUWA 4BNWA 3AVWA 4XASA 3UKDA 2J5QA 1E61A 4AZTA 1NFFA 5F3WB 4XWAA 1V6AA 4LJ5A 3HDVA 2HFJA 2W98A 1B93A 1BC5A 3GL9A 1F20A 4LOLA 1P8JA 4K03A 3L0YA 4JLKA 1M6WA 4TYMA 4TUYA 2Q46A 3ADOA 3B1WA 3G0IA 4GI7A 2OCKA 4ZTBA 1JXQA 4PG7A 2XMDA 1XVTA 4IF6A 1DAEA 2UVQA 1HTWA 1HYEA 3Q98A 4G9BA 4JB2A 3E9QA 1D2CA 4NPCA 3I04M 2C78A 5CURA 3UT0A 5A0VA 1LVUA 1MB3A 1W1WA 1OU0A 5DHFA 4ARUA 1RJGA 1K0FA 2ZBEA 3TD9A 1YSCA 2B34A 1PIWA 3MT7A 1MEOA 4MWTA 1OFTA 1VE3A 1VRCA 3IHTA 4O2BF 4A16A 5B36A 3C7CB 1LPSA 2AMYA 2G9VA 3F5QA 3GZNB 4R69A 1F8FA 3OT4A 1YL5A 1LPNA 2RK3A 2WR8A 2C2ZA 1ITZA 2XUPA 5AW1A 1GFIA 2QSYA 3I9FA 1EXMA 4KXQA 2Y0BA 2JAQA 1FXWF 1NLUA 4CW7A 3M49A 1VL6A 2W00A 2FXVA 2UVDA 2ZJ0A 5BWLA 2EEPA 2H6EA 4FUTA 3FDFA 4KKXB 4Q19A 3L46A 4LQLA 2FZEA 3UFXB 5F33A 4CQNA 3HUEA 4OLAA 2HPZA 3JQAB 1ZX1A 3RF7A 1NW6A 2D59A 5CH3A 3RYHB 1Y81A 4PNHA 521PA 5BN4B 4WDQA 1TEHA 2ONYA 1FLNA 1E9VA 4YRSA 1N34B 1JQEA 1QK5A 3BIOA 1AUOA 5D8DA 3GJTA 2IIPA 4X1KA 5TY0A 2IY7A 4Y2QA 1P4JA 1W4RA 1C1DB 3HL0A 1SUBA 2IYYA 3L8DA 1JI3A 3CNQS 4FT2A 4R81A 4XSHA 2ZJ8A 2OILA 3COJA 3E84A 3SSAA 3I9V1 4X8LA 3C3EA 4KCGA 4MDHA 5T6BA 1E3WB 4C7MA 5FNVB 3U4CA 3KQNA 1WCXA 4FBMA 4QGHA 3IRUA 4RF5A 2IV3A 3CVXA 1GM5A 2VJNA 1O57A 3P8ZA 2BBTA 1JNXX 4N8DA 3ZD6A 2O1EA 4HYQA 4QDKA 3EZ7A 1RP7A 2OQRA 3PZBA 4GD3Q 4DQLA 4FFNA 2AHOA 3FSRA 5BQ3A 3CLSC 2QRLA 3QX7A 2Q4DA 1H2WA 2VJCA 3KD2A 1VG8A 1VGVA 3IIIA 4IUYA 1N1EA 5IXJA 1GT91 2P3SA 3JS5A 3JWPA 1W7AA 2X4DA 3A06A 2IXAA 5JATA 1S2OA 2JFBA 4WPGA 3RT1A 3W6ZA 3VHXA 2G67A 1PQUA 2IV7A 1COWA 1HL3A 2FZLA 2MDTA 3H42B 3MWDB 3A6JA 3GDWA 5DLEA 3EFBA 3GXBA 5EIHA 1RPTA 3VYTB 2GZMA 2VSQA 3BPSA 3L7YA 5IN5A 4FW9A 3RFVA 1Y8ZA 3PA8A 4RGVA 2PVPA 3EGCA 2HIGA 5CYGA 3E5RA 5E1BA 1I6MA 1NQOA 3AJDA 1WULS 3N7TA 4J16C 4MDEA 5C1OA 2P40A 4GQIA 2G4VA 1MO3A 1ZI6A 5CAEA 4FR0A 2I9PA 5HYVA 4ZANA 1PG2A 1PFQA 2RHOA 3LBNA 4WK4B 4B3SB 4BP8A 5C9ZA 2WTMA 3AB8A 1VZ2A 4CQJA 2DFVA 2EKPA 3BRSA 3NAQA 1V45E 4CPDA 3IEMA 2G36A 1U2TA 2RGUA 4PLVA 5AXCA 3BWBA 1VJCA 3EFHA 1ZU5A 2QA5A 5GTDA 3R41A 2XNDD 1YV9A 3QHPA 2QTNA 3Q7SA 4LHWA 2VI5A 2H5EA 3LTNC 2UYQA 3VOAA 2G9RA 1YC5A 3DWIA 2BDUA 3BULA 4LE1A 3N2LA 4AN0A 4O2LA 5BVGA 3K92A 4I08A 5LBTA 3A27A 4Y2XA 1H9CA 4AWBA 2IUUA 1BYIA 4Z2AA 3I3SR 3ANYB 5AW9A 1DTSA 3NPMA 4DQDA 1Z36A 3DPSA 4XDYA 3WKEA 4RF3A 3P9PA 3UPUA 1FQKA 2CC2A 4G1UC 1O6FA 3RKRA 3CLUD 3HQ4O 4TUYF 4J0IA 4MQMA 1M67A 1MB2A 1MV8A 3E2IA 4OYRA 3DNMA 5FFFA 3ZHXA 4E32A 2PZ8A 2HX1A 4L78A 5E6RA 1W9HA 1DJLA 3PFHA 4KOAA 4N47A 5GOZA 3T5MA 1I9GA 1M0TA 3D5EA 1N6OA 1YE8A 4GP6A 7AT1A 2FPSA 1O96A 4B4KA 5MFPA 621PA 1RPZA 3MLAA 4E4YA 3KKKA 5AKGA 3ROGA 1KKMA 3U1BA 3GLGE 1F0NA 1NR7A 2OGZA 1UBUS 3ML1A 3ZLTA 5AVVA 5I7WA 2COUA 4CT4B 3AETA 2PGJA 5J5VA 1Z38A 4G0ZA 1KDPA 3DVSX 2ORVA 3HACA 4GU5A 4MPJA 4PO8A 4UUAA 4YMUA 2WIAA 1DAOA 1KS9A 4H1UA 3OJCA 4J0FA 1A1SA 3ZD8A 1J8FA 1IUOA 1KP2A 1Q0ZA 2GWHA 3D8HA 5A2QA 3RJ9A 2O2YA 2PSHA 3AB7A 3IJPA 2WTUA 2V3WA 3QU7A 3TL2A 4BMSA 4QU0A 2W6OA 3VU8A 3HDJA 3P1JA 2B3TA 4N3BA 3JAKB 1X87A 2WTEA 1C3JA 1EJ0A 4MR7B 2IKQA 1DBPA 4MPDA 4MAFA 2Y1CA 5E8JA 4BC1A 2WJWA 1X80A 1E89A 1JIXA 2E49A 3EFOA 2MTBA 4FD3A 2Q07A 1NBMD 4MRNA 2F64A 3TQIA 3MJCA 3WK5A 2DLDA 4CQLA 4AP5A 4YA6A 1NI4B 1IHXA 4RU1A 3KT0A 4RQAA 1Z7YA 4LWZA 4MI6A 4U6SA 3WLMA 2JLYA 4DIEA 4ZT7A 4TSKA 3QNWA 4P3NA 4I4TA 4EJMA 1DJNA 1UC4B 4QU9A 3D7RA 2O8BB 2I6TA 2GBGA 3D0QA 4QTZA 3ZWWA 4I1UA 1NURA 3UJHA 3WB2A 4EHJA 3E3LA 3KIPA 4ZYWA 2O2ZA 3P52A 1E7RA 2G70A 4E07A 3W1EA 3I42A 1Y8RA 1VKNA 4TTAA 3RSCA 3IL2A 3JTEA 5CNKA 4BLOA 3PXDA 4GNKA 3IEUA 1X7HA 1YQXA 4GR5A 4LHXA 3FPFA 1IVYA 1DWOA 2CHGA 3PGMA 4FDLA 4IUCS 1Q2UA 1OAKA 1GA4A 1TYDE 2N75A 3FMOB 3KR2A 3EUAA 2IU0A 1OH8A 1D09A 3KKQA 2H1OA 1W0CA 1Z2AA 2NU9B 3ZQUA 3AGPA 4RK7A 3C0KA 4EKNB 1TM1E 2BY4A 2EHDA 4MKZA 1G55A 4J43A 5EQFA 2NAPA 2QUAA 3LWNA 4RGBA 4CCYA 4MP6A 3THXA 5I3ZA 4LRTB 1C8BA 2XUKA 3RU3A 1EB8A 3AKZA 3HJTA 1R1DA 2H08A 2GZSA 3O8DA 1NATA 1SXQA 1O94D 2YN2A 3O4HA 2XCRB 4LPSA 4ZI7B 3B5IA 4TRRA 2QRUA 2NZ8A 4G0MA 1XZFA 4PAWA 4U7GA 3NBXX 3T1VA 4H27A 1FMFA 1MOQA 3FKJA 2DFPA 3BF8A 5FXMA 4YJ2B 4JLWA 3WLNA 3VO9A 1URPA 5PGMA 3WDLA 3OUUA 2A92A 2H0RA 2WY2D 3TQSA 4OQQA 2J3QA 4JMLA 4DTIA 3OE7A 4AJ2A 3KWFA 4QO7A 4QXQA 1M1NA 5TF4A 3KKLA 4IWNA 2A33A 4TZ6A 1FSSA 3AUAA 4XJSA 3B70A 3WKAA 3IGFA 2O7RA 3QE4A 4AP6A 3WIUA 4E1AA 5DP2A 3HJRA 2QMOA 3JTMA 2QYHA 3OTIA 4Q4JB 4YV0A 1SA0B 3E27A 4B3XA 4ZT2A 2XYVA 2IZZA 2L82A 3C5VA 4M60A 4OYHA 4HLUC 3W2GA 4DPLA 4MCIA 1GLVA 3Q11A 3NVDA 5TS2A 3DNFA 4EHHA 3SY8A 5F7OA 1O7JA 1WKVA 4RBNA 4PLFA 1JHXA 2WG0A 1NJSA 3L8HA 4TSRA 3P9NA 4P7GA 1QIGA 3DCNA 3OM1A 3UUEA 3VPGA 3I37X 4N8EA 2WAMA 4CM9D 1U4NA 2H1VA 1XJWA 2PUDA 5DHQA 2P9GA 5DM4A 4Y6RA 5EYPA 1GRCA 5FTWA 3EY4A 5DNYB 3LNTA 3ED1A 5HF5A 3VBCA 3W06A 3HLKA 2EX4A 2ZJBA 3OTHA 1E6CA 2GXSA 2W7TA 1Q0QA 1E5VA 1WMBA 2PPVA 3QKRA 1XNJA 1JW9B 2O8FB 1IDN1 1XMIA 2LKCA 4XXHA 3ZHSA 5ALOA 1MJFA 4YGYA 3ON5A 3S5JA 4O4JB 3V8QA 5I9MA 4CMJA 1R00A 1SKMA 2FCAA 3O3OB 5K3CA 1PZHA 1N8NA 1Z4PX 1JQDA 3SKXA 2QN7A 3U7QB 4JJAA 2EKZA 4Z9AA 4UAVA 4OMFG 1B6SA 2W4IA 2FSSA 1L7PA 1R9NA 3MA0A 1V71A 4RVOA 1KEEB 3GRZA 4Q16A 1KTIA 4Y1GA 4L8FA 1I0LA 3KT6A 4MWCA 3OZEA 5FLEX 1KKLA 1DXHA 3ZTYA 3UJNA 4PC2A 4X91A 4R71A 4LJ4A 3GWZA 3B1XA 2H0AA 1HK7A 4FC7A 1EFKA 4IJMA 2OXTA 3U4HA 2CJFA 3O74A 2PUGA 3FCAA 5JADA 4Y7DA 4DKXA 3KOOA 4JEIA 4DQ0A 1VMEA 2BWJA 3DBVO 5JDCA 1TQ6A 2IHNA 3D4OA 1C80A 1RYEA 2QKYA 2XTAA 3M82A 4P80A 4EBFA 2ANBA 1RC0A 2P1ZA 3AW8A 4MGYR 2NVWA 2FPGA 3RUPA 2VBFA 1DEOA 1PYGA 1I5EA 1WXEA 3OZRA 2UZ1A 3FMFA 4I4TF 1U2DA 1SUEA 1USGA 3MS2A 5DX0A 4BB9A 1EG7A 5IM4A 5THXA 2JC3A 5HDBB 5IT4A 4IXTA 2QTWB 4IX1A 1CBUA 1E64A 1IN7A 2Z83A 3C15C 3NHKA 3ZCQA 5LQKA 1FK8A 1UZMA 1CC1S 3Q4GA 4PE5B 3Q40A 2A57A 1C2TA 1UKZA 1VJDA 1ZGBA 2OC4A 4B7UA 3TGWA 1FXSA 1XFDA 1CS4C 1L4BA 3NX4A 5BWNA 1G20E 4O4HF 4U2DA 1TEZA 1RWVA 5DV9A 4YMWA 1CUWA 2OT3B 4DG8A 2Q6IA 2KMLA 4E2WA 1EUDA 5EKTA 4G41A 4EHBA 3SXUA 2OCBA 4M37A 3GRUA 2YYYA 3P9IA 1J56A 2BFMA 3DDOA 4N3NA 1HR0B 2PCLA 2CNDA 3H2IA 4RD6A 4IV8A 4YIKA 2PD3A 2FDCA 3PHIA 2B92A 4HR7A 5EPEA 4XLLA 2H1IA 5FOXA 4QT4A 1FUEA 4UNIA 3BA6A 3OPYA 2OCXA 1W4AA 4Y2JA 3WKDA 4B2PA 4D9NA 1G291 1OWPA 1OMOA 1RYNA 4LMAA 5FP0A 4E31A 1T8SA 2WAOA 1B6TA 1DFIA 4TVBA 2PX4A 3T8YA 3AV0B 5L3ZA 3TW6A 3RW9A 3Q7RA 4WWHA 3HA2A 1YOBA 1F2UB 3CZAA 4ZCRA 3DFKA 4II3A 5B55A 5CCBA 3MXOA 4MB2A 4CDRA 3NTUA 2DWPA 3TVDA 2AI3A 1BX3A 4PXSA 2HDHA 4AQ7A 2LZ0A 2CXRA 4X60A 5B3JA 1VZ3A 2BKUA 3B5EA 3QBJA 3X3HA 1RABA 3B7GA 3RRXA 2OZEA 2PBLA 3D4NA 2BGGA 1UM9B 3QYAA 4MICA 4R2IA 1QHIA 3WFIA 1DWPA 2YWDA 4EJSA 1TUBB 3T9EA 1L5QA 1EWTA 3OJOA 1KYQA 2QQ5A 1PP4A 3CZPA 3DG9A 2J4DA 4BNGA 3TSZA 5AK4A 1OREA 5CT8A 2P8SA 4NQZA 3E58A 5BY2A 4W1QA 4DLYA 1UL1X 4KK3A 2YS6A 2BFFB 1N6IA 2NSHA 3CUSA 2NM0A 5JAZA 1M7HA 1WB9A 4Q3EA 1XG5A 3KBOA 1B42A 5EJEA 4Q00A 1RACA 2XB8A 1SU4A 5AOBA 4ZDWA 4J2TA 4PGGA 4ZALA 3F78A 1EIWA 2GD6A 3GC6A 5FBKA 4G8CA 1FW6A 3E22B 4E94A 3SS9X 3IAAA 2A4MA 2I62A 2RMKA 1PF7E 3WLHA 5HMLA 1OI7A 2AVDA 2C4WA 2VKTA 4I99A 3AU8A 4OHZA 4ER3A 2VTBB 5AVSA 5ALNA 1JWBB 1MO2A 1ENYA 3AEUB 1W8IA 1U6IA 2FW9A 1M2VA 4FGLA 4EYOA 5AYVA 4Q7MB 2X2EA 3BB4A 4IILA 5HKKD 5AM2A 2VJQA 3TIXB 2G5GX 1D3AA 3OZGA 3S55A 2C94A 1NMZA 2GCOA 3IOMA 3LBYA 1FLVA 1IIBA 3MOIA 1RXIA 4CM8B 3G2HA 4YQYA 4QVIA 1D1TA 2BZ0A 3QW4B 1Y5MA 3IR6A 1EEXB 1WXHA 3B3JA 2O50A 1JBEA 2GN2A 1HE4A 3PG5A 2PA3A 5A6SB 3ZI7A 4A10A 3ZHBA 4C6RA 2HNKA 1D1PA 1ATIA 1SD5A 4Z7JA 2NT3A 2ZB4A 1QVRA 3TBFA 3VVBA 2JK1A 2P4SA 4X45A 2QN3A 3JY6A 3KETA 2WD7A 2FSHA 3OAAA 1RKXA 2B1RA 3CF4G 3NXKA 2YOGA 4EYSA 3H3FA 2BDTA 1ZI8A 3B13B 4JELA 5JLJA 5TJ9A 4L76A 1LBQA 3ETLA 3ACCA 4RORA 5TE9A 2E6UX 5BSHA 2BM1A 3MTIA 4RX1A 4P4LA 2P4QA 3HR7A 4OPMA 3LCJA 1CUVA 1L1RA 2FEAA 3KXDA 1APBA 1IEXA 4RDHA 3EAQA 3H1PA 1C0EA 2DQSA 2TECE 3LPDA 2XITA 2F1RA 4CIBA 4RS4A 3RSZA 4CNQA 4RJKA 5HK8A 4HQ6A 2OG1A 1T6YA 3WKBA 1ZM3A 2ON6A 1P0IA 4U5XA 2QNBA 2E5LB 4R0NA 1H93A 3OY7A 4D96A 5CK4A 1I1QB 2ZLBA 5T4EA 5K0GA 1PKEA 1TYBE 1XGKA 3BJEA 5LA6F 2JJMA 3ZV3A 4WI1A 4C2UA 2BONA 2Z2YA 2G25A 3HN7A 4XDGA 5FWXA 3VYUB 4IGAA 4JY7A 4S1TA 1E58A 1RQNA 5IVDA 3HKBA 3HXQA 2BGTA 5T8KC 2B9VA 3VXKA 2R1TB 5EWLA 1SZJG 1L4HA 4DSZA 3N53A 4S12A 1NLMA 2D5CA 3ZNOA 3COPA 1YBAA 1L3IA 3CRVA 4LY0A 3DCYA 4HOYA 2Q3BA 2I1WA 3KQYA 4POAA 3TSYA 4D3SA 3QPBA 1GZ7A 5G0UA 3RR2A 1V41E 5GIPE 1DE0A 3DE7X 3H5AA 5I5GA 3F3MA 4KFSA 5ALVA 4C2TA 3NYIA 3UHFA 2Q41A 3BWEA 4RJTA 1LJ8A 1TPYA 1MXFA 2UUPA 3D4PA 4FHFA 4QTUB 4UBOA 1E1RD 1N1MA 3PCRB 3PENA 4GZLA 1IN4A 2LBPA 2FUNB 2RK6A 3AF3A 3G2MA 2JBHA 1M34A 3ANNA 2IYWA 3VJLA 2CKDA 1ABEA 4BWYA 4NYJR 4MV3A 2J4CA 3BIWA 2OV8A 4I8XA 3MWYW 3A8TA 4YJDA 1W0JD 5KYXB 2YZKA 2YZMA 4UPVA 2GDJA 2W71A 4KB5A 4UU0A 4Q39A 4U1RA 3SR3A 3N8DA 1IQRA 3T7TA 2EG9A 4GG1A 4RTNA 4NV1A 1KMIY 1WB5A 3QFTA 4B3BA 4NCBA 1W44A 1P44A 3RSGA 1U0GA 2PLAA 4MUJA 2NOAA 5AW3A 3RYCB 4QHYA 2ZS8A 4C4PA 1WZNA 1M6VA 1VBKA 2Q8PA 3TIVA 3RGGA 1EPUA 1EP3B 1Q1EA 3EIUA 2CLCX 4E6EA 4CNBA 1C1YA 1S4MA 2DYKA 3MD9A 4YRJA 1F6BA 1WQ1R 2B94A 3SM9A 4DL9A 5A7FA 2JIZA 1CUEA 3JQBC 4ZYVA 4XGNA 2HMVA 3MRXA 1AK9A 4JQZA 4BKMA 3D8TA 2QRGA 3S0JA 3WHKA 1PR9A 2WSLA 3D1VA 2ZT6A 1IU9A 4AKHA 3RK1A 4HEA6 4BKPA 1KR2A 2H17A 4FGKA 1Y3FE 3GN2A 1V5IA 5EZSA 2QDKA 3UYLA 1EZZA 2OQIA 3HJNA 2VT2A 3VVMA 4E21A 3VNQA 1JVNA 3ZIUA 4CG2A 1VL5A 4DEYA 1F4PA 1MQ8B 3H5VA 3GVCA 5C0OE 2JDID 1Q95A 2JLXA 4O33A 1JHPA 2AXEA 2VT7A 4HEQA 1JRLA 2C4KA 4BJHB 3MINB 3OKAA 1IUPA 3PFKA 2YNMD 3AGQA 4IPTA 2CNWA 4AU1A 1JDJA 2G0AA 1K6IA 4ZGWA 1T8YA 3TNFA 1E77A 2OUKA 3LHFA 3A2MA 4LXIA 4HGRA 1V8OA 2QY9A 4OKNA 3TEJA 5BR4A 3AEQA 4IJVA 4F6LA 4BGVA 1QDLB 4DJTA 1ZAKA 5K6AA 1KI2A 3OFVA 3G1TA 3TDNA 1R0SA 1NMSA 1OKKD 3OHMA 1VBNA 3OUZA 4IZOA 5L6MB 1C9KA 4DLWA 1IPHA 1RCTE 3IR5A 2FMKA 3QLEA 4D0SA 3R9WA 1NDQA 1Q20A 2ABWA 3OPNA 3JSAA 4MR8A 4A8PA 1P8AA 1ULUA 2ALJA 3L4BA 2AFIA 2HW8A 1YQUA 3KR9A 5HUHA 5AKLA 3F47A 2XMZA 2ERYA 1UZLA 4ANFA 4YIHA 4REQB 2OZLB 3WGGA 4K9NA 1WWKA 4YRZA 1UXJA 4JVSB 1E9BA 1ID1A 2CVFA 2EYQA 4R8VA 3VU9A 5ADWA 4TN1A 4LDPA 4W5TA 3B2QA 3QPAA 5FOWA 1UEJA 4TXNA 3LPMA 4Y2UA 1Z6XA 2WPNA 3G0OA 1MN6A 1ZBQA 4I4LA 3GLTA 4BN0A 1XR3A 4MW1A 4A03A 1IB0A 1OZAA 2X4IA 2JCXA 2YW9A 2HT1A 2IODA 4GP9A 2HA4A 2AQHA 3JYHA 4NAHA 1WNTA 4QAQA 1JLHA 1I80A 3D3EA 2ZJ4A 2RJOA 4K88A 4F11A 3RO7A 1FEZA 3GJ5A 4R9VA 2ZAOA 2V59A 2JFWA 2VC2B 3VC7A 1ANKA 2ZQZA 4JJ6A 1DKPA 1QIHA 4FOTA 1S02A 4YCMA 4BBPA 1RYMA 5A9TA 4C3VA 4MYSA 2R9VA 3G2JA 3O1JC 4J07A 4J1TA 5DULA 4C0XA 3LAWA 2FLWA 4C87A 3IJRA 3RPEA 1AO0A 2O05A 2NZVG 4WZAB 1MJHA 3ADCA 3DDSA 4P81A 4I0WB 4TV8A 5G0WA 2F9FA 1BS1A 3TFQA 3B5JA 4B71A 2CYBA 2XI4A 1QLJA 3L0DA 4BFTA 2CBXA 4WDRA 3PDIA 2FVYA 4IO1A 2OUIA 3AR6A 4KIGA 3ID6C 4S24A 5F2KA 3RAPR 1RXWA 3NBYC 5BWMA 2A67A 4CMIA 1F0YA 2H2IA 1W6UA 3ETCA 3L7IA 4ME6A 4ERNA 4BZQA 4X9XA 4RTJA 4DXAA 1YZVA 1MO5A 3EBOA 1V11A 3NBZC 1H6CA 5CM9C 1A4RA 1H1TA 2FFAA 3H11B 3OH8A 3DB2A 2FEKA 5I8ZA 1ZNWA 4YRPA 2F9MA 3C39A 4QOHA 5DEIA 2OLKA 5CB4F 1SVWA 4YRAA 2QYSA 4TTQA 5CHYA 1QH1B 3S2YA 1E8NA 1YB4A 4MQUA 3C4JA 1VGRA 1YJ8A 4G8DA 3VAZA 3E7WA 8ATCA 1RC1A 4GDFA 3K20A 1D6SA 2VRWA 3OCCA 3UGKA 1DLJA 1NUHA 1QDEA 3CZ4A 4W4TA 3MEQA 5K01A 2QX4A 2QX7A 3OIFA 2VN8A 3KVNA 2AJTA 1U2QA 4KIJA 1NRJB 1E9DA 4QODA 3EVFA 3SOZA 1SVUA 2DBYA 2BBSA 3D2AA 4K9RA 2ZTHA 1QLWA 2BFCA 2WB2A 1ISPA 2DTXA 1GDDA 1LD3A 1X7DA 2IYNA 4DYHA 1LRJA 1WDWB 4LQ4A 3E18A 1DBSA 1PRYA 3IEXA 1AJEA