4YA6A

Crystal structure of ligo-apo form from sphingobium sp. strain syk-6
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
295
structure length
270
Chain Sequence
b'MQDLEGKVAFVTGGGSGVALGQAKVLAEEAQMKVVIADIRQDHLDEAMGYFSQKNVAVHPVRLDLTDRAAYAAAVDEAEQVFGPVDLLCNTAGVSQFGPIEKATFDDWDWQMDVNVNGVINGVMTVMPRMIERGQGGHILITASMSAFVALPTTGIYCTTKYAVRGLAESLRVEMPKYNIGVSLLCPGGEAVFAGLKRVIEHGFDPVDLGRVVLDAVRNDRFWVLPYPEFAEGQKARDQEVIDAMMSYADHPDYARRMKIREQMKRDMPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C alpha-dehydrogenase
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
source organism Sphingobium sp. syk-6
molecule tags Oxidoreductase
total genus 103
structure length 270
sequence length 295
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ya6A01
1H9BA 1X7DA 1ZNQO 3ZWCA 2I65A 4GH5A 3SXPA 4OHUA 3C7AA 4GLLA 5GZ3A 2AQIA 1D4FA 3Q1LA 1M76A 1TT7A 4WCFA 5G2OA 4N5LA 3I83A 3S1LA 3IL2A 3JQFC 2PGLA 1IYZA 1K5HA 3NDJA 2X7HA 4IBOA 2C7GA 4HKTA 1Z74A 4NH4A 2ZTVA 4B3HA 3DAGA 4CR6A 1MFPA 1LLDA 2OMEA 1RM5A 2VWGA 4DYVA 2NV6A 3ZNNA 5CDYA 1YBAA 3UCFA 3VZSA 2EKLA 3EAGA 1I01A 1AE1A 2DM6A 4LCJA 4A5OA 2RHRA 2VHWA 1ISHA 2ZTUA 3R3JA 4DMLA 2Z95A 1LRLA 1C1DB 4BO5A 2A9FA 2ZCUA 2W4QA 5DOZA 5JAQA 3TZHA 1KVTA 4GKVA 3G17A 1HDRA 2DPGA 3K96A 3HB4X 3MWDB 3WQQA 1EVJA 4HX5A 4IUYA 1GADO 1PEDA 1UZNA 1LDBA 1ZSYA 1V6AA 2BLLA 3NJ8A 4DLBA 5TLSA 2PFGA 2OUIA 3E03A 4L76A 4TSKA 5BSEA 3FTNA 3HG7A 5IXSA 1U3WA 5CDSA 1GUZA 3C1AA 1U5CA 4XJTA 5IXYA 2NADA 2OBNA 5A02A 4WUVA 2IEBA 1JKJA 2GNAA 1JWAB 4TKMA 3WNQA 5B4UA 3GHYA 4Q9NA 2BKAA 1B8UA 4F46A 4CMHA 5JY6A 5IDQA 1O95A 1DLJA 3EYWA 3IAHA 5HM8A 2I99A 1QKIA 1R0SA 3WGQA 4ZICA 3AU9A 4HFJA 1M6WA 3EC7A 1FJHA 1NBOA 4OO3A 2X1HA 1Y6JA 3AI3A 4OQZA 3DAFA 1S7CA 1GQQA 3C7CB 5EINA 1BRMA 3E9QA 4CR7A 1DIGA 2Q2QA 1GU7A 3JD4A 2E48A 5B4TA 2BFPA 3BHMA 4JJIA 2D4AA 1Z73A 3KYCA 3LVFO 1IZ0A 1UR5A 4DBZA 2J3KA 1ZVMA 2Q4EA 5HS6A 3IC5A 4RVHA 1N8KA 1BW9A 3R3SA 4FS3A 3WQRA 2NVUA 1H6AA 3BAZA 2P4HX 4MKXA 3PK0A 4YT5A 4E21A 5BSGA 4BB6A 4ZD6A 2HO5A 3D64A 2IZZA 3TZQA 1KYQA 1ZFNA 4RZIA 2ET6A 3KV3O 1O5IA 4DPKA 4CV1A 1SPXA 3SC4A 2FPIA 2YHUA 3GPIA 4TRMA 3U62A 4IY1A 3X2FA 4EUHA 1P45A 5BNFA 2LDBA 4MVJG 3QVOA 3H3FA 3I9LA 4OJNA 1DC6A 1DHRA 4XDYA 2BH9A 3FCOA 4EEXA 2ZYDA 1IHXA 4IJUA 5C5IA 4W82A 2VRBA 1FXSA 3L77A 2R00A 3ROPA 1H0KA 2CUKA 2Q1SA 2Y1OA 1PJBA 1J0XO 2VUUA 3QVXA 2IXAA 4XJSA 2GASA 3NDIA 3W4JA 1ZBQA 4IZHA 3F6YA 3WGZA 4E6PA 4JX8A 3S2EA 1GFSA 4LGVA 1E1KA 1WW8A 3QVSA 1N1EA 3AOEC 3F4LA 4DBVO 1AUPA 4XEHA 4PFJA 4LK3A 1Q0QA 3QW2A 3BTOA 4Q3CA 3LZ6A 5I9LA 4IJWA 3Q2IA 4E5MA 5KCZA 3FNGA 4CV2A 5DNAA 2VT2A 3U0BA 2RIRA 2X22A 2C7VA 4IS2A 3ZW9A 3W4IA 4ZRMA 1LSOA 1GUFA 4NBRA 3KEOA 1E3IA 3GLQA 4CM4A 4OMUA 3ITKA 3BMCB 3JQ9C 4WOKA 3BIOA 1T24A 2O3SA 3AY6A 3RKUA 3WG9A 4FC6A 3EDMA 3WS7A 3H9GA 1SB8A 4ALIA 3WGOA 1T4BA 2Z1MA 1PL8A 1UUFA 1E3SA 1XQ1A 2I3GA 2VTEA 4OSPA 1FDUA 3IKTA 4Q3AA 4JXKA 2DFDA 2AG5A 3B6ZA 2FMUA 1HRDA 4QT0A 4UVHA 1SCUA 3CSDA 5EN4A 3NTOA 4K6FA 4ZQGA 1YGYA 4XYEA 2DBZA 2HMWA 1UP4A 1CQIA 2BELA 4KZPA 1EK6A 3VPXA 4IXWA 5ITWA 4Y6PA 3HNPA 4YAKA 3WDSA 3KVOA 4R51A 3OQ6A 1M6HA 2EKPA 1O6ZA 1B3BA 3RIHA 2DC1A 1Z7EA 4N5MA 4IM7A 4E2WA 3L9XA 4BHTA 1ARZA 1KC3A 1PX0A 3S2IA 3VH3A 5I7SA 2OXIA 2QX7A 3V1TC 4L75A 2Y66A 2NU8A 1VPDA 1TVEA 1XU9A 3JYQA 3EW7A 3P2YA 1PS0A 2JFHA 3VTFA 1X1TA 4BQRA 1QYDA 2JKVA 3OIFA 2Y0CA 4ILKA 4RF3A 1XG5A 1NPTO 4CL8A 3L9WA 1ZJZA 1ZEJA 2FZWA 3O26A 1HE2A 5CG2A 5DP2A 3JD1A 1HDYA 2FSVA 2Q3EA 4CUJA 4MJLA 3I4FA 4F3YA 4EEZA 4WLFA 4NFSA 1DIHA 3OFSA 5JXWA 2C20A 1IOLA 1FMCA 5L9AA 3BZUA 3DQPA 4R4JA 1WAMA 3PZBA 4J3FA 4CLEA 1OAAA 5TF4A 6LDHA 3MCVA 4XR9A 1NAHA 4U7WA 4BNGA 2V6GA 3L6EA 5BNIA 4OL9A 2HMVA 3R1IA 4W9NA 2PNFA 3QWIA 4WGGA 1N7HA 1RM3A 1H6CA 1PS9A 5A04A 3JYPA 2PH3A 3DDNA 1B0AA 4GBJA 3DTYA 4YJHB 3A14A 1Y8QB 4YWJA 3GGPA 4RLSA 5GZ6A 1MG5A 3PLNA 3WX0A 3AFMA 4Q3BA 3VPGA 3G79A 3TNLA 3QVWA 1ISJA 2ZK7A 3G3EA 3DZFA 1VJ1A 3DMYA 3IJRA 4AL4A 4YEDA 4ZQHA 3FSRA 4WNCA 3BXXA 1Q7BA 5ER6A 4EITA 5L40A 3F46A 4NU5A 2W2LD 1L7EA 3MZ0A 1NVTA 1MB4A 3ZWXA 3JQDA 5I8ZA 2A92A 3EZYA 3PDUA 2HJSA 4S3MA 4NK4A 3DFZA 5HRUA 4XQ9A 1B16A 2B5WA 4BNLA 2RH4A 1LC3A 3D1LA 4PRLA 3FTPA 5A9SA 2B4RO 5DZSA 4CMIB 4E2XA 1OC2A 4XRGA 2HRBA 4HBGA 4CQLA 4O63O 4IDAA 4DLAA 1EE9A 1NR1A 4RZHA 5FFFA 3WIDA 2PTGA 1VL8A 3CZMA 3ST7A 5J23A 2VYVA 3D5QA 1JTVA 1N7GA 4AJEA 3JYLA 5H82A 3AI1A 1TEHA 4INAA 4EUEA 3COSA 5A03A 3WLFA 5DCWA 2FN7A 2OP1A 4LMRA 1HSOA 2Q1UA 3PXXA 2FOIA 1UAGA 1FK8A 1HKUA 1HWYA 4XA8A 4UEOA 1DIRA 3QWHA 4A73A 4Y8VA 3TZ6A 1Q0HA 3DR3A 3JQ8B 4HADA 4NQZA 3H3JA 1MLDA 3MWEB 3QV1A 1R4MA 3ZWOA 4AJ4A 5MDHA 1IUKA 4UVGA 3Q11A 4CLHA 1U8FO 4ALLA 4IQ0A 2Q50A 4CMBA 1I3NA 3UHAA 3WFIA 1FDSA 1PSDA 1YXMA 2PH5A 2ZATA 3ROQA 4I08A 2QRJA 3BTUA 3RUDA 2HMTA 5IDYA 1KY5A 4FFNA 4CV3A 3AI2A 1BDMA 3DONA 1J4AA 1LI4A 2GDZA 3ABIA 3DOCA 2DU8A 2VHVA 2IYPA 4J4BA 4G2NA 5DBIA 5G4LA 2BI8A 3E8XA 3JQFA 3OEWA 5EMHA 5A9RA 4NR0A 1ZUD1 2B0JA 2CDCA 4ZVVA 1ISIA 3GEGA 4OQYA 4DPMA 1ADFA 2P9CA 2F1KA 1FDWA 5EJ2A 2ZTMA 4O6VA 1YL6A 3DHYA 3JQGB 4QO7A 4GKBA 1LXCA 5G4KB 2P9EA 1GY8A 2UDPA 1E6UA 1T1SA 4Z6KA 4L73A 3AFNA 2X58A 1P3DA 4TVBA 3DAPA 4QFCA 3RKRA 2GGSA 3ZWVA 2G82A 3U9LA 1CEQA 3BTVA 1DFHA 1V3UA 3GQVA 5COBA 4WPGA 4CV0A 1SBYA 3N7UA 3OJOA 3ZHZA 3CTMA 2E4AA 2CDAA 3PIIA 1EVYA 2C5EA 4GVXA 4FDAA 2PY6A 4K9DA 3JQAA 1C0LA 4PIVA 1KVUA 4Y9DA 3WGYA 4IIVA 5A5FA 1XELA 3DOOA 1OI7A 4HFRA 3KBOA 4O1MA 4JP2A 4BUCA 4D46A 4P8RA 4RVDA 1EUZA 2YUTA 3F47A 1XCBA 1PGJA 2AEFA 1RPNA 5U4QA 1KVRA 1IPFA 3DC2A 8ADHA 2DKNA 5CEFA 3I9MA 3F1LA 1H93A 4R69A 2B4QA 2V6FA 3BMNA 3DHEA 3DOJA 1E92A 3E9NA 3GA0A 3B20A 2AHRA 4YA6A 4KWIA 3TN7A 4PLGA 4RORA 2OHXA 3ZV4A 4YDRA 4R16A 3TZCA 5LCXA 1XHLA 3DBRB 4RLHA 4B4OA 4Z3KA 1YJQA 3LQFA 1K89A 1B15A 1P0FA 2VOJA 3C1TA 3RASA 4FCCA 5KKCA 3OA0A 2CD9A 1A9YA 4QQRA 3SJ7A 4WOJA 3GFBA 4N7RA 3HE3A 1I3KA 3T4EA 1HZJA 1UP6A 1P9LA 2G0TA 2J6IA 2QQ5A 4GI2A 1P33A 1KEPA 1IZ9A 3DMTC 1TXGA 1AXGA 4PVCA 3RWBA 1VE9A 3ZWPA 1PJSA 1XIVA 1E3LA 3O9ZA 3PFFA 4Y98A 5A9TA 1BDBA 1I2BA 5L4NA 4Z9FA 1GEGA 4B7CA 4GPD1 4MIOA 4Z9XA 4L4RA 4JCOA 2DFVA 3PDJA 3ZV5A 4CLRA 1PU2A 3NT5A 4WCDA 5DT9A 1VC2A 4XZ3A 1BXGB 2VWQA 5ADHA 4BNZA 3LC2O 1JW9B 3UW3A 5KOIA 3KETA 4R5MA 3Q3CA 7MDHA 3AUTA 1I5RA 1IPEA 3PJFA 4ALJA 3NTRA 4YBZA 4Z9YA 4ALKA 3B1KA 3B70A 3JQ7A 4YAIA 3C85A 2I3AA 4RVUA 3TQHA 4MDHA 4OKIA 1QSGA 2BI7A 5DCUA 1PQUA 2VUTA 4L4SA 2A35A 3AOEA 4O59O 5JCJD 3SBOA 4BO2A 2AQHA 5KIAA 2RH8A 2ZQZA 3KYBA 4YQZA 4G81A 3GMDA 5JO9A 3DBLA 1JAYA 4AICA 5HA5A 4URFA 4FGWA 2HDHA 2GCGA 2HAEA 1NPYA 1NQ5A 1GCOA 3HHPA 4LMPA 4PLFA 3CE6A 3ZV6A 2Y0EA 3PRJA 3JQ9A 1DIAA 4ND1A 4XR4A 2JJYA 3ENNA 3KYDA 1G6KA 4RPJA 3IJPA 2YDXA 3I9OA 4E4YA 3PWZA 4XCVA 5F21A 3IIEA 3FWZA 3C8MA 4U0JA 3A1NA 3RBZA 3O8QA 1PGQA 3QJ5A 1WP4A 4D0SA 3IUPA 5ICMA 4MVJH 3PHLA 3I3OA 4NU6A 4E33A 3OBBA 4Y6SA 4F45A 3WBBA 4MVJA 2ZB7A 4CM8A 1WDMA 5L7YA 2ZJ1A 4XQCA 1VJTA 1EBUA 5KJ1A 1HYHA 1RWBA 2O3JA 1A4IA 4KQXA 4EUFA 2VWPA 4CQMA 1WMAA 2OO5A 3ZWNA 1WDKA 3Q9NA 3JYNA 3TFOA 6ADHA 3BMQB 3D7LA 2RBEA 1YWGO 1HE4A 5DBFA 4YRBA 1VSUA 4WNIA 2P2SA 2NVWA 3K9QO 4K6CA 5DCYA 5H83A 3L07A 1GYRA 1Y8RA 4ND5A 1DJQA 3PLRA 1DDOA 1T2EA 1TLTA 2JCYA 4Q3EA 5CAEA 2X4GA 5CFZA 2JL1A 3QSGA 2X0RA 3V2HA 1NQOA 1A7AA 2JHGA 4FFRA 4M49A 2VOEA 3H65A 3OEYA 3NYWA 4YJFA 4NK5A 1GZ6A 2XXBA 4PZCA 1DSSG 3OJEA 3VDRA 1HZZA 2J5KA 2XOXA 3ETEA 5I7VA 4I9NA 3UVEA 5BNTA 5T64A 4PG6A 2YZ7A 4EDFA 5DULA 3W6ZA 3MJVA 5TIIA 4XWYA 1PZFA 4BNHA 2VHYA 3AK4A 1N1GA 1E3WA 1P1KA 1KEWA 1PZEA 3E5RA 3PHHA 3WLEA 3GVIA 3NT2A 1CWUA 2NLOA 3WJ7A 1LTHR 1LEHA 2JD2A 4E5PA 4PG4A 4FIZA 2BRUA 4RDHA 5KVQA 3SLKA 3ETDA 1B7GO 4TROA 2CZCA 3FD8A 2VN8A 3AM5A 2H6EA 4H16A 3OJ0A 3K6JA 9LDBA 3ICCA 3R0IA 3BHJA 1O94A 5KJFA 1EUDA 3QRWA 4Z0PA 3V1UA 1O89A 2GD1O 1J49A 1TB4A 1UZLA 1P1RA 2P68A 5F5NA 2FPGA 1HLDA 1PWZA 1Z75A 4M87A 1V3VA 1E5LA 4XB2A 4JN6B 5K6AC 1QYXA 4YRAA 3UH1A 1UXGA 1EE2A 4LRSB 2DUWA 5HBRA 4BVAA 3FWNA 3D5TA 4YRDA 1YB1A 1RM0A 3PHJA 4L9RA 2VZ0A 2EW8A 3GPDG 2E49A 3GVXA 2PD4A 2IDZA 1T2DA 1A7KA 4ZQEA 4DMMA 1SC6A 1W4ZA 1LRJA 4W6ZA 5EQDA 5GZ1A 4DA9A 4RO0A 3C24A 2YY7A 3GVHA 1C1DA 4RL6A 4RVGA 1D3AA 2DAPA 3PYXA 4YT2A 3LT0A 3AUAA 3DL2A 1LC0A 1Y5MA 4ZQFA 4XYLA 5TS3A 3V1YA 3UICA 3H2ZA 3NUGA 5KVVA 1A72A 5L95A 2Q1TA 5KVSA 4E5YA 4YYZA 1DFGA 3K73O 4PG7A 1MV8A 2HK8A 1NP3A 2CDBA 1I32A 2VYNA 4GX2A 4BGUA 2WE8A 2H1SA 4H15A 4TWRA 1C3VA 1ORRA 1EDOA 1I3MA 2QRLA 1QXSA 4XYGA 1OC4A 4JQCA 4ZHSA 3L6OO 2O4CA 2ZCVA 1LUAA 3MJTA 3F9IA 4PCVA 2A4KA 2GLXA 4FJ2A 4UUPA 3ZU4A 1RM4A 3OF2A 2VZ8A 3EVNA 2GUGA 3KRTA 3NX4A 3RC9A 3NEPX 1BTOA 2AA3A 4Q39A 4ZN6A 2YJZA 2C0CA 1GPDG 4O5OA 5F5LA 3ZW8A 4RPGA 2GN4A 4I5EA 1C0KA 3HDHA 4J7UA 3WWYA 1YOVB 1PJTA 2B35A 4J9UE 3S55A 2FZEA 3GNSA 4BNWA 1HE3A 4PLZA 3UCEA 4RF2A 1BG6A 5JAIA 4WLVA 3KSZO 4MP3A 1WNTA 3GFGA 5JE8A 3TF5A 1Z7BA 3ZDFA 1B8VA 2TMDA 3K2EA 3DEYX 2CF5A 3TOZA 4P4NA 2BHLA 4M86A 4AJIA 1Y1PA 5T6BA 2J8ZA 3TPCA 3DBVO 4DREA 3QVTA 4FFOA 4NDNE 2ZQYA 4CL3A 3DZGA 2P5YA 5A06A 1MC4A 1IE3A 3I23A 3ZI0A 4PGFA 3OETA 2C59A 3EVTA 1QLHA 3PGJA 5TX7A 1YO6A 4EW6A 1V8BA 2B37A 2J3HA 4RF4A 4YAEA 3FI9A 4BNYA 3IP1A 1WPQA 2HKIA 3A4VA 3OICA 2AE1A 2FSSA 3LT2A 4J7CA 3GY0A 3EUWA 5IN5A 1WMBA 1KETA 2GF2A 2GZ3A 2YHIB 3TSCA 3QIVA 4C7KA 1PS8A 1DFIA 2ZYGA 3WTBA 3ZN2A 2B36A 3GN1A 1PR9A 1HSZA 1UXKA 5I8WA 2Q4BA 2BF7A 3PZRA 4B7XA 1BVRA 5IZCC 3EMKA 3IUSA 4CMJA 2W2KB 2BMAA 3E5MA 2C54A 4D3DA 2EF1A 2WDZA 4I9UA 1JKFA 2JCVA 1H6BA 2B83A 3F3SA 3QLJA 3GVPA 1HDZA 1MC5A 4ZJUA 5TQVA 5FI5A 1F8FA 4P38A 1HDOA 2ZTLA 5C7OO 1ZO8A 4YT8A 5A3JA 2P9GA 1D1TA 1NWHA 1Y7TA 2IRWA 4GX1A 4PLTA 2BGKA 3UAGA 3UXYA 4IPTA 1R15A 4XIYA 4CUZA 4JLWA 2Z5LA 5CDUA 4L4XA 4OAQA 3JTMA 4MP6A 3BMCA 4NIMA 4W4TA 1GPJA 4AJKA 3VH4A 1PIWA 2RCYA 2JHFA 1LQTA 1PQPA 2NQ8A 2PZKA 4OM8A 4D3FA 2HSDA 1H6DA 1EUCA 2PZLA 4UUNA 5JDIA 4BGEA 3MOGA 2XPCA 3DMTA 4QX6A 3D3WB 1F17A 4TZTA 3W6UA 1KVQA 5U1PA 2DBVO 2W8ZA 4UEKA 4NI5A 3CEAA 2BFAA 5JAZA 3NV9A 2HK7A 1W6UA 1MX3A 1KEUA 1PJ4A 2GERA 3WMXA 2RAFA 5JC8A 5JFOA 4PG8A 1GV1A 1YS4A 4ZRNA 4BO4A 2G76A 5IDXA 1VM6A 2AW5A 2IODA 4J9VA 4HV4A 4IIUA 4ONEA 1NFRA 4CMAA 1N2SA 3IDSA 1T2AA 4IZIA 4LVCA 4II2A 2PV7A 3TWOA 4D3SA 1K6XA 4XDZA 4JBHA 1XDWA 2H9IA 3CMCO 1ZXLA 2NACA 5FWNA 3S2FA 4LCEA 1MGOA 3VPHA 5LDHA 3GNQA 5T67A 1F06A 2XAAA 2WYVA 2VNSA 3E9MA 5A4DA 3L4BC 5AXCA 1B3RA 1U7TA 1QP8A 3VDQA 3K92A 4D79A 2YYYA 1DC5A 3DTTA 1O0SA 1QLJA 1K6JA 3CIFA 4B8ZA 3GUYA 4E3ZA 1Y81A 2EP5A 3JD3A 1ISMA 4NBWA 3QP9A 3AY7A 3TRIA 3V2GA 1HYGA 5G0TA 1VJ0A 1ZXBA 1QV6A 3ZWBA 4WEOA 4WLOA 3I9KA 1MXHA 2YV2A 3D3EA 4LN1A 4IS3A 4D44A 5L51A 1IULA 5F1PA 3LC1O 2RHCA 4GGPA 4R9SA 3UGKA 4CLOB 4ESOA 2HMUA 1ONNA 1P31A 4UUMA 3HDYA 4XYBA 3A06A 2YQ4A 5TSDA 3VZQA 3EHEA 1HL3A 2OZPA 1VL6A 3BYZA 1YQDA 4RPHA 4YJHA 1C0IA 4ZU3A 1IY8A 1Y8QA 4YCAA 4BO6A 2HUNA 3U4DA 3KLPX 3WSVA 3PHGA 3OJFA 1QMGA 2HQ1A 4Q3DA 2VCYA 4HFMA 2X5KO 4PZEA 1MFZA 1R4NB 1L7DA 3CZRA 1PQWA 1G1AA 3LF1A 4PLVA 4MOWA 4BMNA 1GQ2A 1QG6A 1VSVA 1H94A 1T1RA 4AJ1A 5BQFA 1EK5A 4GGOA 1ZH8A 4KQWA 1Y9EA 2Q45A 3VPSA 5JYEA 3UOGA 4WKGA 3Q2KA 3H9JA 3VVBA 3V8BA 4YT4A 1DC3A 1E7QA 2Y93A 1X7HA 4D43A 1F14A 1ISFA 4N18A 4GL4A 2V65A 2D59A 1EVIA 1NFQA 3WWZA 3LT1A 1JQBA 4OYRA 1B8PA 4J1QA 2FR1A 1JAXA 2ZB4A 4CMIA 3ZHXA 5DOVA 3RCBA 4L8VA 1X0XA 1AHHA 2UVDA 3O38A 4NJMB 3KEQA 1MXFA 1MP0A 1GYQA 2O50A 4BNVA 3GZNB 1VI2A 1BMDA 2NWQA 1U28A 5L7TA 3U5TA 3CINA 3DZJA 1LBEA 3HUDA 3GUCA 3DZHA 4IJVA 2CVOA 2X9NA 4TRJA 2Q49A 2WE7A 5EERA 2VQ3A 1Q0LA 4XD2A 1M67A 2Y67A 4ZA2A 1F8GA 4F6CA 1EFLA 1B14A 3MTGA 4TQGA 1X7GA 4JIGA 5HTOA 3VC7A 1C1XB 4RGBA 2DVMA 4C7JA 2PKQP 1RYDA 1V35A 4IJKA 1I2ZA 2YFHA 3V5NA 3G0OA 3JQ8A 1X1EA 2YFQA 4DL9A 1KS9A 3JQBC 2UAGA 3SLGA 2X0JA 4BNJA 3N74A 4II3A 3RFVA 4G65A 4Z0HO 1BVUA 3ETGA 3M2TA 3ZHYA 5A05A 4CM9A 3I4CA 3E18A 4E0BA 3NKLA 4NMHA 2NUAA 2FR8A 4MVJP 1W73A 1G0OA 2NSDA 1KVSA 1P1JA 1HXHA 3PI7A 5C37A 2WD7B 4M8SA 1P44A 4BOYA 2F00A 1QV7A 3KHUA 2YV1A 1CDOA 3OIGA 2WM3A 1LDYA 1IHYA 3NTQA 4YXFA 4IQGA 4Q3NA 3DO5A 4OXNA 4XIJA 4G5HA 1UH5A 3DWFA 1PWXA 1YH3A 4EJMA 3UKOA 1DAPA 4E5KA 2IYOA 5K6AA 1N9GB 4ZGWA 2WMDA 3GVCA 4A10A 3MJ4A 3KSUA 3FR8A 3WGHA 3W4KA 5GMOA 2X23A 4B8WA 4QTZA 3A28A 1E7RA 4E30A 2VYVD 1NASA 4IINA 4B4WA 2C07A 3JQGA 4RCVA 5AXBA 4PLWA 1IL0A 5CEEA 1LLCA 3KLMX 5G4KA 3JD0A 5AYVA 2D0IA 2H5LA 1DLIA 2TMGA 1ZK3A 4P22A 1XLTA 3OM9A 1SMKA 2UUPA 3WB9A 4I1IA 3UFXA 1A71A 5F1OA 4A0SA 4EZBA 1HF3A 3VZRA 3BMOB 2DTXA 4LISA 4EGFA 2EJVA 2H63A 2VUSA 1ZJYA 1QYCA 3F5QA 3ZU2A 2HK9A 1TT5B 1X14A 1M2WA 4WEQA 5THKA 2VZ9A 3GEMA 5EIOA 3INGA 2VTDA 1ENOA 4E2YA 1SOWA 4CUKA 5HWSA 5KJEA 5L4LA 5G0UA 3W8EA 2HRZA 4TRNA 2EEZA 2EIHA 1ONOA 4CJXA 4J0EA 3L0DA 3PHIA 5JDCC 4A2CA 4DIBA 3SVTA 1ZK1A 2D2IA 4YJGB 1DRWA 5I7FA 3WGTA 3ZU3A 4HUJA 2DPHA 3HDJA 3GRPA 4YTEA 4R41A 3MOIA 4B79A 3I9NA 4ID9A 5CPBA 3M2PA 1ZEMA 2G17A 4CLXA 1H9AA 2O2SA 3DBRA 3GEDA 1XU7A 1Z6ZA 3GDFA 2BFMA 5ENDA 4CR8A 5L4SA 1NQAO 1ONPA 3KXDA 5I7EA 3PGXA 4UREA 4MKRA 2C5AA 5DN9A 4UVEA 1A27A 1NNUA 3G1TA 4J2HA 1UAYA 3U3XA 2PZMA 4LSWA 3GRKA 4H3VA 4U6SA 3ORFA 2Y99A 3DXFA 3I1JA 2DLDA 1NQTA 2VHXA 1NVMB 2NQTA 2BD0A 1LDEA 2V6MA 4CODB 1VLLA 3OHSX 4DGSA 5BSFA 1CIVA 2XXJA 1G0NA 3E1KA 3UCXA 4E5NA 1UDBA 1EEHA 4LW8A 4MIEA 1I36A 2X9VA 3BTSA 4M89A 4QUKA 2BFOA 3JQAD 4IDFA 4PG5A 4E12A 1GD1O 3L6DA 5LDGA 5TJ9A 1NXQA 4QECA 3ZWYA 1BXGA 1WZEA 3DBHB 4P4GA 4AFNA 3ONFA 3RUAA 4BNUA 5IZCA 5L53A 2D3TA 4NBTA 2DBQA 3AOGA 3VHRA 1Y5RA 2FWMX 1RYEA 4FPXA 4GSKA 1ZK2A 4BNMA 3I6QA 5CDTA 1DJNA 1D1SA 2QHXA 5JW6A 2LDXA 3RSHA 1ML3A 4GVLA 2NU9A 2J3IA 3WXBA 4CLDA 1PTJA 1GQYA 4W7HA 3DZKA 3Q9UA 1SAYA 3ZHBA 4BKUA 1SO8A 2VWHA 3KB6A 3GH3A 1KOLA 1UXJA 1NR7A 1WVGA 1V9LA 4MVJF 1Q7CA 3GZ4A 4Y67A 4E2ZA 3ZZNA 1P1IA 1JDJA 3LDHA 3MJSA 4BKOA 4NNJA 4R5HA 3FNEA 1ADBA 2WEKA 5JPIA 5ILOA 4W9NC 4MVJE 1OOEA 5IDWA 1Q7GA 4CMEC 3DZIA 3Q6IA 5IAAA 4R54A 2AQKA 3LLVA 1NHWA 4BB5A 4PLYA 3P5SA 3GGGA 4GX5A 9LDTA 3VPFA 3NGLA 4LSMA 4XGIA 2Y1FA 2IXBA 4U5QA 1F12A 1SEPA 3M1AA 4J1SA 3D4PA 4XKJA 4DIFA 3ANNA 4OSOA 3VZPA 4BV8A 4MVJI 4EJ0A 2R2GA 3ULKA 5G0WA 2D5CA 2YQ5A 5ILGA 1U4OA 1LRKA 3BMQA 1KEVA 1FDVA 3BA1A 1HETA 5AXDA 3U4HA 3LU1A 4R3NA 4AJJA 1E1MA 4UVDA 4AJHA 3K31A 1HLPA 4J0FA 3HQ4O 2OFPA 1QYWA 4R1NA 4NHEA 1XGKA 2GRAA 4XQEA 1EDZA 3RUEA 5GY7A 5JO0A 1I33A 3E48A 1R37A 2GPTA 1NTOA 3F1KA 3H4VA 1GR0A 2CVZA 3RC2A 5JAMA 3KZVA 5JY1A 3L4BA 1DO8A 1ENZA 4J43A 2BGLA 1VKNA 4KWHA 4FFPA 3ROMA 5FEUA 3OECA 2Y1EA 4RQUA 3B1JA 4L74A 4AJNA 4BNTA 1X0VA 1YKFA 3QWFA 1N5DA 5TJHA 1OFGA 3IKVA 3VH2A 5I9MA 4CM5A 2GN8A 4ITUA 2IEDA 1BXKA 3CMMA 3QWBA 1LSUA 3E82A 1DRUA 2AEMA 1D7OA 1I0ZA 2YDYA 4XX0A 5AXAA 3VKUA 5HS4A 1PJQA 1E7WA 3H5NA 1AGNA 1JN0A 2BGMA 2CF6A 2E37A 2IE0A 4I5GA 2ILTA 4JBGA 3STHA 3S8MA 4ALMA 1H2HA 1U4SA 2AG8A 2AQ8A 4TMFA 4D7AA 4YQYA 5T57A 2FR0A 2PKRA 2ZB3A 1CETA 2WSBA 5JC1A 1E7MA 4JNKA 3FN4A 2Q99A 1ULUA 3ZNPA 3ZNQA 4KMSA 3GNTA 4MKZA 3WYBA 3CH6A 2NTNA 3WR5A 3VAZA 1HYEA 3H9QA 4GMGA 4W99A 4WCFB 4CQMD 2PZJA 4YPOA 2PWZA 1YVEI 1ULSA 4JK3A 2Q2WA 1U2DA 3PPIA 5K9ZA 2X5JO 3IP3A 4YB8A 3ENKA 2A94A 2AMFA 1O9BA 1UP7A 4NJOA 1P1FA 1LLQA 2VRCD 1DAOA 3CUKA 2QZZA 4IXTA 1P1HA 1M66A 4FJ0A 3SC6A 3OP4A 1R0LA 1SZJG 3RJ5A 1LSJA 5DBGA 1LSSA 3PQEA 4DTIA 1BWSA 3GAFA 3I9JA 3H5AA 1I2CA 3DZBA 4X54A 2CY0A 3ANLA 4DQXA 2Z1NA 3TDKA 4EYEA 4BNIA 5JMPA 1A9ZA 2W98A 2P5UA 3FPCA 1UXHA 4GQAA 5JS6A 4UVIA 3LK7A 1JA9A 1LNQA 4IDBA 2CVQA 2NTVA 3TL2A 4LVUA 4FBGA 5FF9A 1J5PA 3GGOA 2DTDA 3LC7O 4D0RA 2UYYA 2OORA 4KTVE 4RVSA 5TT1A 1ADGA 1K2WA 1YL7A 5TT0A 1CJCA 2WJPA 3JQBA 4IDEA 2I67A 4CMGA 4BNNA 1YDEA 4XB1A 1SOVA 2OL4A 5T8KC 3WNVA 4HNHA 1ZSVA 2I76A 4BO3A 3FHLA 5ES3A 1ZK0A 3P2OA 3OH8A 3Q0EA 5BT9A 1E7YA 1EQUA 4J4TA 4ZQBA 5U9CA 3INRA 2V7PA 1E0DA 1IB6A 2QW8A 5AQ1A 2EW2A 1K6IA 1WDLA 4FW8A 1YOVA 4CM7A 1LDMA 3KYCB 3PFWO 3TL3A 4NFHA 3GHHA 3RFTA 4BNKA 4IDGA 4RPKA 1R66A 4DQUA 4FFMA 1BW9B 4C4OA 3TJRA 4E32A 4B4UA 2NVUB 3ZU5A 1AHIA 1JLLA 3RUHA 1UZMA 4FFLA 5CDGA 1ZMTA 4DWVA 2C2XA 4MINA 1CYDA 3ANMA 2EP7A 4IDCA 1VL0A 1PL7A 1PL6A 2JCXA 3LYLA 3GDGA 5EESA 2Q1WA 4D41A 1HDGO 1U3VA 1NWCA 2Y1DA 4A26A 4DXHA 3OA2A 1EQ2A 1WZIA 2PD6A 1WXDA 2FHSA 1K0UA 3ROKA 4MP8A 1GCUA 3X2EA 4BKPA 3K8ZA 5DDIP 3SEFA 3E6AA 3WICA 3GC6A 3RC1A 2PGJA 3RFXA 3CKYA 3PIDA 4XQGA 3GDOA 3H9EO 3RROA 1YBMA 4N54A 3NGXA 1XR3A 2D8AA 4KDFA 4BO1A 3AU8A 5JNLA 4B3IA 2JD1A 3RUFA 1HDXA 4IGEA 3PJDA 1ENPA 2O7QA 2VYND 2YHIA 3ZH2A 3C1OA 3ZCXA 3RJ9A 3M1LA 4BMSA 4FC7A 4I5FA 4H7PA 2DBRA 4R9RA 5K0ZA 2OGUA 3DHNA 4MIYA 5ER9A 2X6TA 2W2KA 2SCUA 1NAIA 3VTZA 1MG0A 1XYGA 3KOUA 3FR7A 5F1KA 3JSAA 4OXKA 4K1LA 4BIIA 3PVZA 4GLOA 4BS9A 4A7PA 4BNXA 5CG1A 1EFKA 1V3TA 3TZKA 2GN9A 1U1IA 3WJAA 5JDCA 3SJUA 1ZW1A 5DF1A 4CM4B 3PP8A 2C82A 2JAHA 4FR5A 2O7SA 5ENVA 1ENYA 4EBFA 3NDRA 3WGIA 1ZK4A 1U2GA 2G1UA 2ZYAA 3INTA 3H5RA 3ITDA 4FD3A 1U3TA 3K2BA 5JSFA 5CPFA 5DP1A 3LF2A 1M75A 4MPDA 3UN1A 4NBUA 1DBVO 3WOHA 2WYWA 4DUPA 1P0CA 1U5AA 5TC4A 1I24A 4BKRA 3WFJA 3NT4A 1I3LA 3PWSA 1UXIA 4BO9A 4U8GA 1NVGA 3H2SA 2P4QA 1XWFA 2HU2A 3I52A 5G0VA 1PGOA 1WLYA 4WASA 1QR6A 1U8XX 4B3JA 3D3WA 3WIEA 4TVOA 3EY4A 4WE3A 1X13A 1Q2XA 4BMVA 5KJ6A 3FBGA 2W2LA 5JYDA 3WQSB 2VHZA 4S1VA 3T4XA 4R1UA 2CSUA 1YRLA 2I6TA 3GK3A 3QY9A 1GL3A 3EGOA 1EVZA 4IGFA 1W0CA 4DRYA 3EK2A 3SX2A 4JBIA 3GMSA 2OBYA 5COAA 3HFGA 4R3WA 4I9HA 1GZ4A 4ND2A 3KTDA 3UUWA 3JYOA 3NJ4A 3AUUA 4BV9A 1GEEA 1CERA 4I8XA 1WWKA 4J6FA 4CMCA 3QE3A 4BQPA 4NPCA 2B5VA 3KSDO 4GX0A 1VKOA 2ZKLA 4PLCA 4WLUA 3GN2A 4YJDA 1U7HA 2UUOA 4CM6A 1B26A 3IQDB 3U49A 3H7AA 4Z0TA 3MJCA 5KKAA 5L3ZA 1AN9A 4OOFA 1ZZEA 4DYDA 1CQJA 3S2GA 1XSEA 1N92A 3R6DA 4B4VA 1DIBA 1RKXA 2DQ4A 2Q46A 2W90A 4JROA 5B4VA 4FQ8A 4CLOA 5MGBA 2FP4A 3ZGYA 5TGDA 2QYTA 4R1SA 4GSLA 1KERA 4BNFA 2R6JA 3JCZA 5L45A 3AUSA 2DUUA 1HE5A 4UAGA 5AOVA 2I66A 4CMEA 4OGWA 2NU6A 4HNGA 3GG9A 3GOHA 3EZLA 3U4IA 2GYYA 5C7LO 4OH1A 3O03A 5A3VA 4GMFA 4EJ6A 3IOYA 2X0IA 1R6DA 1VRWA 2NVBA 1Z45A 3H9UA 1ZMOA 4J90A 3PJGA 2QRKA 1R4NA 4E31A 1LDNA 2QZ9A 1E1NA 3LSYA 4R01A 1GYPA 4WCFC 3K5PA 3GAZA 3O4RA 5G0SA 5IN4A 1T2FA 1E6EA 4WECA 1I30A 3D0OA 1OZAA 4J7XA 4J4HA 1E1LA 2ZJ0A 5A9SB 4BO0A 4CM1A 2X9GA 3HZZA 4AJPA 1T25A 4CQLB 4OXYA 1DOHA 5C3MA 2POQX 4M55A 3HN2A 4F6LA 4UULA 4J91A 4AJLA 1QRRA 3WYEA 4BO7A 4O0LA 4U6QA 4OOEA 5KJCA 3ADOA 5IZ4A 1TA4A 3HN7A 4NJMA 2PKQO 3M6IA 2I9PA 3RUIA 3GZNA 4QO8A 3ADPA 1K3TA 2B69A 5LC1A 1LLUA 3ZWWA 2P91A 3FNFA 1T26A 4HWKA 3JQ6A 1JU9A 3QQPA 2UV8A 3ZWAA 3OMLA 1HTBA 3ASVA 3OQ1A 1E3EA 4I5DA 4RVFA 3I5MA 4HFNA 4KOAA 4UEJA 1DRVA 3ON5A 4YVFA 2YV3A 1R4MB 1NX6A 3WTCA 1F0YA 1E6WA 4XGNA 1LQUA 2EHDA 4MVJM 1FDTA 2GZ2A 5EL0A 2PD3A 1C1XA 1GAEO 3PWKA 2Q2VA 3PQDA 4J49A 4JJGA 4PZDA 3D4OA 4CPDA 1XA0A 4Y6RA 3WGGA 2GO1A 1YE3A 1YBVA 4D42A 2WTBA 3F4BA 3HDQA 2QYSA 4YAJA 2J5QA 4NFYA 1E3JA 5C7IO 1GDHA 4BGIA 5EPOA 1OMOA 1XEAA 3F5SA 3LT4A 2B4TO 4WK6A 3TFQA 1EMDA 4AVYA 1GZ3A 5IG2A 1NM5A 4BGVA 2WD7A 1LX6A 1HDCA 1X15A 1I8TA 2EXXA 4JP3A 1PJCA 4KUGA 3ASUA 2IZ0A 4DC1A 2FRDA 3HJAA 5IFLA 2EGGA 1LJ8A 1QYVA 1YQGA 3ONDA 3KO8A 5CEJA 1GUYA 1AXEA 4PN3A 3JV7A 2VNAA 1JKIA 1NPDA 1YB4A 4FN4A 2CMDA 2EG9A 3QHAA 1PZGA 1DXYA 1V0JA 3VKVA 2V6BA 3FBTA 1E7SA 4J2OA 4NZ9A 4XRRA 1N9GA 4PLPA 3W1VA 3D4NA 2ZB8A 3RQSA 1W8DA 1U3UA 2DT5A 2EJWA 4WJZA 5FYDA 2CNBA 3GF4A 4TRRA 2OP0A 5KWEA 1R16A 2I5PO 3HADA 1C0PA 1LU9A 5KTKA 5TRTA 1NFFA 4RJTA 3PYLA 4HXYA 1B2LA 3MEQA 2E6UX 2G5CA 5KVCA 2E82A 4QEDA 1UJMA 4JGBA 3AJRA 2Y0DA 2D5AA 3AY3A 3C3XA 2R00C 4AJOA 4Z3DA 1UDCA 1PGPA 2GR9A 1E5QA 3G1UA 3HFSA 3JQAB 4K26A 4WLEA 2PR2A 2PK3A 5ICSA 3ZWMA 2JFGA 3FNHA 3I6IA 3ICPA 3BMOA 5JBIA 3OQBA 4CMKA 5FI3A 1H2BA 5B37A 2AEJA 3RUCA 1GV0A 1RJWA 1TT5A 1T2CA 3KM0A 5JMWA 5IF3A 1R0KA 4IMRA 3CXRA 4ND3A 1DPGA 2EWMA 3RC7A 3AM4A 2O3TA 3MJEA 3T7EA 3QA9A 2OOSA 4CM9D 2FY8A 4K28A 3RVDA 2O3QA 4CM3A 5JCJA 3BMNB 1KY4A 5T8KA 3ZV3A 3ONEA 1QORA 2JAPA 2HJRA 1XKQA 3V2UA 1NHGA 4QSMA 3K30A 4DLLA 1CRWG 4OKNA 2NU7A 4YJGA 2Y1GA 3CPSA 1EZ4A 1YJ8A 4AG3A 2HMSA 3QWAA 2HCTA 4YR9A 4BKQA 2Y05A 5L7WA 4D45A 1DEHA 4KDEA 4RF5A 4E13A 3WBFA 3A9WA 2ZIZA 3N58A 3KUXA 5A1TA 5TNXA 3GT0A 1D8AA 3BHIA 1ZCJA 4BL5A 3AWDA 4KTTE 3PQFA 1O8CA 3FRJA 1FF9A 2D1YA 4TKLA 1SB9A 5B1YA 1JVBA 1Q1NA 5JDIC 1A4UA 1TI7A 2J3JA 2NNLD 2C2YA 1HEUA 1PJ2A 3WSWA 3PYMA 3T7CA 4JJFA 1A5ZA 3P7MA 5KNLA 1BXZA 4NG5A 4DQVA 2AXQA 1KC1A 4ROSA 4CLRB 2EERA 3RD5A 2GZ1A 1YONA 3NRCA 4LRTB 2EGHA 4A03A 4MO2A 1DHTA 4KP7A 4NBVA 4FB5A 3U09A 3GR6A 3AM3A 4QFDA 2CFCA 4YACA 4AJ2A 1PJLA 2EV9A 2YW9A 1ADCA 5BSHA 5IJZA 2O48X 2JD0A 3DB2A 2AE2A 2HLPA 3DBHA 1GTMA 3JQ7B 3OSUA 3VOSA 3IMFA 3P19A 5ITVA 4QXMA 1YDWA 4FOSA 3U4CA 1NYTA 5EQFA 4DPLA 1BSVA 4DVJA 4XYMA 4PVDA 4DIOA 3PTZA 2X8LA 1Y9AA 4ALNA 1I10A 4R68A 4FJ1A 1L1FA 3G49A 4DC0A 3DBLB 3JQEA 3LLSA 1BGVA 5THQA 2QIOA 1MA0A 1T4DA 1XQ6A 1DB3A 4EI2A 1YB5A 1PGNA 4KUHA 3VVCA 2O23A 3HB5X 3KYDB 4B7UA 3HWRA 1LDGA 3RI3A 3RU7A 3W8DA 1R12A 2X86A 3WMWA 2O4UX 1YQXA 4A27A 2NTJA 3O8QB 2GN6A 3H6KA 4GWKA 4WLNA 5CP8A 1ISGA 3RBXA 1DC4A 5T5QA 2X5OA 4IMPA 1ZIDA 1LA2A 1ZSNA 1JWBB 1PJ3A 3OJLA 3OIDA 4BO8A 4CM8B 2JFFA 1YL5A 3PEFA 3VH1A 2C29D 4M54A 3RBVA 2EKQA 1S6YA 4UUOA 2PA3A 4J16A 1OBFO 4J1TA 3MTJA 2O2YA 5F3RA 5H81A 4CQMB 3L4SO 2O3UA 2X0NA 3AW9A 4N5NA 4ND4A 1EBFA 4J1NA 4GAEA 3UF0A 2GSDA 2VT3A 3DFUA 1C14A 4FGSA 3JQCA 4FOOA 1ZKMA 3HSKA 4RDIA 1Y8RB 1SNYA 2WYUA 2QG4A 4L0QA 5JCXA 3FF4A 3RU9A 3FPLA 3B1FA 5B12A 5COQA 2Y1CA 2PLAA 4HP8A 8LDHA 4M1QA 1PZHA 2FPPA 4TZKA 1P74A 3H8VA 4YJFB 1ID1A 5BR7A 1UDAA 1SEVA 5JLAA 3TOXA 1CF2O 3PJEA 5AVOA 2VRCA 1J6UA 4KUEA 4U0KA 2WWRA 1KBZA 1E77A 3GG2A 4HY3A 4R1TA 4YAGA 4W7IA 1JVSA 4P4LA 2NM0A 1HT0A 5I9NA 1U9JA 3WYCA 3IS3A 4PRKA 1H5QA 4RQTA 5A5EA 4PLHA 1E3WB 1PR3A 1Z82A 4RV9A 4IDDA 2O3RA 4OIMA 3JD2A 1MUUA 4XGKA 2J5RA 2IZ1A 2WD8A 1BHSA 1P77A 7ADHA 3RAJA 4FSHA 4RPLA 5CHEA 2XF8A 4MVJD 4IQ8A 1KIFA 3ZNOA 4GWGA 2Y68A 3W8FA 2DTEA 3NAQA 3C7DB 2PGDA
chains in the Genus database with same CATH superfamily
4E5UA 1MX5A 4KPFC 1ZNQO 3F2VA 4LF5B 1K8ZB 1WF6A 1G6OA 2X40A 3KT0A 3PWTA 4P54A 1F5SA 4GH5A 3C7AA 4A2WA 2VK1A 5EWJA 4QQ8A 1D4FA 3ZIDA 4TMTA 1CE8A 2HRQA 5DXFA 2M2IA 1WM1A 3DZ8A 3S1LA 4QYWA 3NDJA 5GINE 2X7HA 3NIFB 4IBOA 2H2DA 4FNOA 4V0OA 1Z74A 3LFTA 1X6VA 2QTVB 3DAGA 1IQRA 2QMZA 4FYHA 4HNRA 4TT3A 4DCVA 4L3OA 2OMEA 2VWGA 3NBUA 4DB2A 3GA5A 2NV6A 2F9LA 3K1YA 3UMGA 5AVXA 3ZNNA 1RMTA 4GUAA 4LXIA 1LPBB 2G77B 2DYKA 4G24A 3ZI7A 1I01A 3MUFA 5AJHA 1AE1A 5E6RA 4LCJA 3RAGA 1E9BA 4K05A 4C0AC 1YVDA 2VHWA 4ISCA 3KKKA 1RAHA 3G0IA 3R3JA 2Z95A 1P6UA 1ZS9A 2BFCB 2ODBA 2NXEA 2RB4A 1QCYA 3D6TB 3HDTA 3L40A 4TM7A 3ESQA 4UE6A 3TZHA 5I9BA 1UK7A 1HDRA 3K96A 3E9YA 3HB4X 3PXEA 3WQQA 5E95A 1BJRE 1UZNA 1SKYE 1VFPA 2GA8A 3E81A 2YJNA 5GJCA 1V6AA 2BLLA 3H2GA 2WMOB 3KU4A 4IIGA 4DLBA 2BFEA 4KAJA 2PFGA 4Q24A 2FPLA 3E03A 4I4TB 4L76A 4TSKA 1QB8A 2DUMA 4M7WA 1UQUA 5HOQA 5CDSA 1GUZA 2YOFA 1TM2A 1U5CA 2ZBDA 4XJTA 2NADA 2G70A 4NP6A 2BKUA 1T1IA 3FYSA 3WNCA 1FMJA 2H9AA 2GNAA 4TKMA 3HKCB 3GHYA 1W87A 4Q9NA 1ZM3A 1QE5A 1QVWA 4RS4A 1I4TD 5EIWA 2RG1A 1EWRA 1O6FA 2BFDA 2H3EA 4OHRA 4WOCA 4WX2B 5JY6A 2WVGA 2X3YA 3HV2A 1SVSA 5CB4F 2M1ZA 1ESCA 4L16A 5HM8A 2QYOA 1WQ3A 2C03A 1R0SA 2EQAA 2I99A 4G3XA 1TPZA 2BMDA 4A23A 5AQEA 3O31A 4B46A 4KR3A 1WMDA 3CKMA 3M4NA 4KHPB 4PSCA 2D3WA 2PT9A 1RBMA 1ZD2P 2VJYA 2ZJ2A 3DLAA 4OO3A 3VZDA 1QQAA 3SJCA 4EHIA 1M6YA 2ZR9A 4PPNA 4GEKA 1SVKA 1S7CA 3GGSA 3D8TA 1SA0A 1ZLYA 4MICA 5DMXA 5EINA 2C58A 3E9QA 4QAJA 4CR7A 4ENQA 1GU7A 3FMGA 4LXGA 2E48A 1SXJB 2CE2X 4OP2A 3LP5A 4KN9S 2GA9A 3ETNA 3W6OA 4EY3A 4JJIA 5TPZD 4JLAA 1Z73A 4UUBA 4QU8A 3KYCA 4G63A 3W5JA 3VV2A 3R0XA 4DBZA 3KSBC 4BXOA 4B81A 2Q4EA 2JLAA 1U2PA 3IC5A 2PWBA 2R85A 4B33A 2ZSEA 3T38A 2WPNA 2NVUA 1FB5A 1H6AA 1ODKA 2P90A 3BAZA 3HNRA 4QU9A 1RC1A 4CTMA 3BWXA 2JH9A 3H84A 4MKXA 4YT5A 3WADA 3GJRA 1C4XA 2P7HA 3NORA 3B6IA 4PE5B 2UXBB 4RZIA 4ZT2A 4PNHA 2DLCX 3CONA 4PINA 4CV1A 3LHDA 4C5BA 1NLMA 5EWMB 3ESXA 1J20A 3OCJA 3AYZB 3Q5GA 3QLVA 5KWSA 2E4XA 2LDBA 1W88A 2WTMA 3PC6A 3HXKA 3UJPA 1DHRA 1UBTS 2HX1A 4FVTA 1DEXA 4JFAA 3ZGLA 2XUKA 4RJ2A 1L6IA 2BH9A 3FCOA 1UOOA 4MLPA 2ZYDA 5DTQA 4EEXA 1CZRA 4KR9A 3QYFA 2QUAA 3O47A 3L77A 4JYCA 3ROPA 1H0KA 4DLSA 2Q1SA 1SXIA 1U2TA 2Y1OA 3AFIA 2H7XA 3EHDA 4EG7A 2XYPA 1NVWQ 1WMFA 3QVXA 3SQNA 1KMHA 4G4JA 2A88A 3BD7A 5LNK1 2WZQA 3CPEA 3K0KA 2IXAA 4LCBA 4XJSA 1JVNA 3SVZA 4WBNA 3WGZA 2A1UA 3DAOA 2V8OA 3F6YA 4E6PA 3LKVA 4NCNA 3J81k 3QOFA 3S2EA 3C6BA 1SD1A 4U3JB 5JMTA 1WW8A 4G86A 4R1QA 1SHUX 3EG9A 3PE4A 1JWLA 3AOEC 2RAUA 3BWBA 3F4LA 1NNSA 4WKPA 4XEHA 2QD4A 4L4UA 4MCJA 4MA4A 2OHOA 1V7QA 1QMPA 1W25A 4Z8YA 5KCZA 4GGMX 4CV2A 2VT2A 2ETVA 3U0BA 4ND7A 1EG2A 1E18A 4OMCA 5D00A 5ALJA 1ODTC 3CXUA 3OE7D 3PR3A 2XXAB 1CP2A 2OCGA 4EHDA 1KYXA 3KEOA 1J09A 3GLQA 4CM4A 2WSLA 2X1LA 3DB1A 2Q5LA 2TYSB 3M9WA 3O3OB 3IQWA 4E51A 3QVMA 4ER6A 2O3SA 3AY6A 3RKUA 3AP2A 1KI1A 1BFKA 4FC6A 1P4HA 3ET4A 4RK0A 5ECDA 5EQJB 4ALIA 4MV6A 2JVIA 1MJGA 2HNKA 3RJMA 1QFMA 2JEZA 1S5PA 2VTEA 1C7RA 3C5EA 1S8NA 5FEMA 4BE7B 5BSVA 3IKTA 3CNEA 3P52A 4G1MB 2GT1A 2DFTA 3A9TA 1SCUA 4B2LA 3QBJA 1B1AA 4LDAA 3IP9A 5EHGA 2Z9DA 1CJTC 2IYZA 4XYEA 3RYTC 2MT9A 1DO0A 3ZR4B 1T0HB 1XX6A 2QLLA 3BICA 2AK2A 3JAWB 1HC7A 4RGYA 4B17A 5ITWA 4Y6PA 1OWLA 4FDTA 4B3MB 1OYYA 4I50F 1B8NA 4EHAA 3HNPA 2ZBEA 1Z5WA 3H5IA 4YAKA 2UZAA 4PWZA 4ZVUA 4RAQA 5I5EA 4DCNA 1ORWA 3A31A 2XWBF 5JISA 3OJCA 3OQ6A 1J1ZA 1M6HA 1SOAA 3DFFA 5A1JA 1QVAA 2IGTA 4QAQA 3RIHA 2DC1A 1QF6A 4OHVA 2ZWMA 3L9XA 1HTWA 1KC3A 4WK4B 3VH3A 1BX3A 3INNA 3WO0A 1D1QA 1D2EA 1WXHA 3OU7A 3HZRA 5HZHA 1TJ3A 4TLLB 2C4NA 4HPJB 4L75A 3V1TC 2XQIA 3ZCVA 4DNOA 2AVDA 2W11A 1TVEA 3USCS 4IFBA 5GOTA 3E9DA 5JWRA 1Z4QA 4HLCA 5EY5B 3SOPA 5D1HA 4I1OA 1XZAA 1LW7A 2EG5A 2GXAA 3VV3A 2VDNB 1OLSB 2BOVA 2HGZA 1VLJA 4LHEA 5AJXA 4AULA 1QYDA 3EQZA 4ASUD 3RYCB 3IP7A 3OIFA 2AJCA 4TMYA 4MGEA 2ODNA 3OX1A 1L1EA 4RF3A 3OG9A 3WLLA 5JXJA 3DWEX 5JD5A 4UHEA 1GTJ1 5CG2A 3JD1A 1HDYA 4MB2A 2F1RA 5AW4A 3TPZA 4DVGA 1E79D 1VQ1A 4N01A 5IHPA 2DMRA 3I32A 3NZEA 5ALEA 1IOLA 3MXTA 3PZBA 1II8B 1OAAA 1S8OA 3VNVA 1S2MA 2WWFA 4FE4A 4Q7MB 3SHQA 2Z9CA 2I4TA 4U7WA 1RQXA 3DF7A 4PX3A 1JR6A 3UT0A 4PQFA 2X3UA 4JT8A 3I42A 4ZJYA 2CFRA 1MOSA 1PS9A 4B6SA 1T36B 3C3KA 1V4NA 3OI7A 3DDNA 5A04A 3U44A 4B73A 3UH0A 2ZSIA 3AXTA 4ZMSA 4HN2A 4Q3BA 4I66A 1QANA 3D6JA 2HJVA 3QW4B 4N76A 5CA1A 3P2JA 5ICFA 1GNTA 4D0GA 2V5VA 4D9NA 2HF8A 2ZK7A 5JAHA 5J4VA 1YDFA 2L2QA 4ZT6A 4JHLA 4O4LB 1QZZA 4MS1A 3W34A 4G9EA 1EK2A 3IJRA 4YEDA 5CFMA 4ZQHA 4ZYXA 1F48A 5L8VA 1ST3A 5CB6A 3GDHA 2C2MA 3DE3X 2B99A 2ZTHA 3AXSA 4BLQA 5I8ZA 3G13A 3HU2A 4YCNA 1EFRA 3IFSA 2A4MA 3IJ5A 1XRLA 2NP6A 1FSPA 2FYTA 2B5WA 2LCIA 2NYRA 4DW8A 1OXVA 4UDYX 1Z88A 3ENZA 3FTPA 1ZOIA 1AGRA 2B4RO 1K92A 2WWHA 3G2QA 1OC2A 4KXLA 4NBNA 4UBNA 5H5JA 3TIGA 1ZD9A 3WP1B 4CQLA 5EJ8A 1AMNA 4O63O 2RCNA 1ZX1A 1MB2A 3I04M 5DHFA 2EAUA 2HBZA 4I8IA 3TRJA 3ORYA 4K2HA 2QENA 5HKOA 4GFDA 5J23A 1ZH4A 3B2EA 1N7GA 1V6CA 2G0AA 2PS0A 2WZCA 3A2MA 4CEHB 1U31A 5L6LB 4MR9B 2JIQA 4RIEA 3NBKA 2XQFA 3NBAA 3TR6A 1C3LA 1A9RA 1NKSA 2WJJA 1Y4AE 1DAFA 5E2IA 3W3AD 4LMRA 2P0AA 2XTZA 1JBEA 3G82C 3K1AA 1HSOA 1MIHA 3SQOA 2Q1UA 5LJIA 1GT91 2JLZA 1JQAA 1NONA 1UAGA 2BN4A 2I4IA 2WPDA 2ZWIA 3FOFC 1RTTA 3LIPA 1K6MA 5CA0A 5JSQA 4AT1A 5JJLA 1DIRA 4CGZA 1GZUA 4A73A 4JT9A 1SBIA 4C7XA 4HADA 2VI5A 1NW3A 3QEMA 2R2AA 4OJTA 4X3PA 1MLDA 3GRFA 3MSXA 4GRDA 3QA3E 4AJ4A 1IUKA 1VHJA 2CKDA 3KAPA 4NEHB 3V8RA 4EW1A 4KIGA 3OZUA 2M98A 4UMFA 3SR4A 1RI5A 3Q7PA 4YMGA 3CYFA 3WGLA 2YNMC 4HC4A 4MUIA 1TAGA 3H6GA 2Q50A 1ACLA 4N6NA 3PUIA 3UHAA 3WFIA 5AW2A 1YXMA 2JBAA 1S1MA 3ROQA 3NI2A 3BRSA 4I08A 2QRJA 3BTUA 4M9RA 1M2OB 4F9FA 1CS0B 2KW5A 3OZAA 2OPBA 3IVAA 5JSZA 1MD9A 4X6LA 2ID9A 4RA6A 5JQGB 1F2UA 5JR3A 3JZMA 1LW6E 3DKKA 3NALA 2PBLA 2WM2A 4KRGA 4TKZA 2ZJZA 4GZ5A 5HFNA 1GSOA 3H83A 3K4HA 3SYMA 3DOCA 4AMZA 3OPVA 4P4UA 5G53C 2XMGA 4MUFA 5DBIA 2A5GA 4D8TA 1SXJC 4RADA 2H1OA 2OQ2A 4J8PA 3OU2A 1FFWA 3QF4A 4TWAA 3DDZX 3CRMA 5DW3A 5A9RA 4IMIB 2B0JA 4QQKA 1ISIA 3MGBA 3GEGA 4OQYA 4OREX 4LF9B 1E1QA 1HY3A 3HB7A 4MQUA 4BN5A 4LQLA 5BQXA 5IBCA 3BJIC 3IODA 1EVKA 1XCPA 1Z0SA 2FPXA 3B3FA 4KN8A 4LYHA 4ZCQA 1YL6A 1QFJA 1FDRA 2FU5C 1NZFA 4E94A 1ZNYA 1A04A 1PT8A 1F0PA 3JQGB 1A9SA 4MW6A 1LXCA 1IIBA 3N2ZB 2A5FA 2Q07A 4ARZB 3L04A 2J3LA 1UC4B 3ZY5A 4Z6KA 4X71A 4L73A 5E4YA 3BA6A 2X58A 3FKJA 4G5GA 4QVGA 3RV4A 4EHJA 2Y2VA 1QCDA 1EB9A 1VECA 5EJ7A 3OHPA 3BHNA 2ZYSA 4N0PA 3BQ9A 3ISJA 4RLQA 4ON9A 3V9PA 3RK0A 1FXUA 4DLYA 4JBXA 1DFHA 2ZYTX 1V3UA 4QM7A 4BVEA 4HQRA 2V55B 4K3UA 2VUHB 4WPGA 4CV0A 1SBYA 4DNQA 3GLGB 4P9NA 1X70A 3PIIA 4H1VA 2ODTX 2V4MA 2VVTA 4W8HA 4NZMA 4FDAA 2HCBA 4PIVA 3JQAA 1C0LA 2W83A 3B36A 4Y2PA 4Y9DA 4U00A 2A9KA 4NAVA 3W5DA 2FFRA 5THXA 4M1WA 5EIBD 5A5FA 1XELA 4OQ4A 1N8NA 1K7FB 1BOOA 2VP3A 4G26A 4HFRA 2O6LA 4JP2A 4M76B 4QOIA 4D46A 4D56A 1WMEA 3DKPA 4HSGA 3KLBA 4RJLA 1V26A 4RVDA 1GVHA 2JK1A 3DNFA 1RWKA 1CPYA 3T1HB 4BC0A 1KVRA 3GPCA 1IPFA 1OA1A 1T9AA 4FW9A 4G1VA 5KINB 1HTTA 3GT3A 4DDHA 4RLFA 1NXTA 2QTNA 1VMIA 3EXEA 4FFDA 3SYNA 4MQLA 3NPAA 4BATA 1KZ7B 2J7PA 1FDIA 1M1UA 1DWQA 1Y82A 2AHRA 2R4QA 3CUVA 3NDPA 4KWIA 4RGVA 4RORA 2W6IA 4M1SA 3ZV4A 5DJ5A 5JECA 4R16A 5BY2A 2OGWA 4B4OA 1YJQA 1DTWB 2XCQA 4E6EA 1BS9A 3SBDA 2CEKA 4AY4A 2OFOA 1PEKE 3CUUA 4LA4A 5HOEA 3PX3A 1B15A 1P0FA 2VOJA 2HDOA 3M6UA 3C3MA 3O93A 1P39A 2C7QA 3EZ9A 4YQFA 2VTBA 3PXUA 4KO3S 5IKMA 4WOJA 4KKXB 1CJBA 2MCFA 1WUJS 3MJRA 2I6XA 2PBZA 3HE3A 5BN4A 2AUTA 1HZJA 1UP6A 3T4EA 2B5OA 1E2BA 3DAYA 5B3JA 3RS0A 4DSAA 1IZ9A 1NMQA 4LAFA 4A3SA 3ZZMA 1HYQA 1KDRA 2D7JA 2CNWD 4F84A 4RMHA 4U9HS 5K3BA 4TV8F 1PJSA 1XIVA 2ZPAA 3NM5A 3PFFA 1KRWA 5TQ0A 1BDBA 1QH1B 3JQRA 1ORTA 4XGRA 5EZYB 3O8OA 3AEKA 5KAPA 2FZGA 4R2KA 5LBUA 3WDMA 1SH7A 4Z9XA 1ND6A 1P91A 3PDJA 3M83A 3OCYA 4HN9A 1Y7HA 3R74A 5JD4A 2WINI 3NCTA 5DGIA 1IK4A 5IS2A 1V1MA 2H08A 3NFYA 3IHKA 2GNOA 3V00A 1QRSA 1OZ0A 4BNZA 4Z4FA 3JXEA 4FYYA 1WZNA 3GW8A 5AJVB 3S1AB 4X60A 4JI4B 3UBMA 3Q3CA 2E89A 1N25A 2KS6A 2XTMA 3NR2A 3OT1B 3IKJA 1D0IA 4X1OA 4F06A 3N8NA 1IPEA 4AROA 1AU9A 3C7KA 3KXIA 4ALJA 3NTRA 4YBZA 3ZEIA 4ALKA 3GQBB 4DHEA 1GG5A 5CGZA 4YAIA 3C85A 1AO3A 1OBVA 4RVUA 2IHVA 1AM4D 2RB5A 1TU0A 1LH0A 3GZJA 3TQHA 4EM6A 5HXAA 5BW5A 1KSJA 1KO8A 4F4CA 3CLKA 2B2XA 1YCDA 3BE5A 4GIBA 4IR7A 3SBOA 3R0ZA 3I62A 4QHYA 1TZJA 1CJMA 3JARA 3CVJA 3N2EA 4GOND 2AQHA 3LBYA 2BGGA 4B47A 3K5HA 4CT0A 3AYXB 4HQKA 1UXOA 2ADMA 2V6JA 5EMLA 2A9OA 2JJQA 4JJ8A 4DLWA 5FOTA 3CX3A 1BCRB 3GP3A 2C88A 1TCBA 1JAYA 3R75A 3UFBA 4PZAA 5ARCA 1CVLA 1T5IA 1NQ5A 4PLFA 4ZCTA 4LMPA 4P34A 2F64A 3ZV6A 2Y0EA 3PRJA 1IM2A 1VRCA 4KBFA 4CKWB 3JQ9A 5J40A 5KYWA 2A67A 4XR4A 5B3LA 3DV9A 1DUIA 3KJQA 1G6KA 4ZT5A 3W7BA 4M0EA 4NCJA 3X43A 1N2CE 3C5CA 1WXIA 5INTA 3FWZA 1J7JA 4HDAA 1MNAA 4N47A 4TX1A 2KE5A 2ZS9A 3FLEA 4D3YA 2JPDA 5A2GA 4ND6A 2Z2XA 3E58A 3MD0A 3BSYA 4KLRA 4PHFA 5DSZA 2JFYA 4INPA 4S35A 5FAKA 1TUEA 4DLXA 3KR1A 4NU6A 4BZXA 1I6MA 4Y6SA 4XSVA 3BCHA 1KSFX 4MVJA 4RESA 3WBBA 3TEMA 1WDMA 1V5IA 2ZJ1A 4CM8A 1MN6A 5JQWA 4P35A 4MROA 4Z1MA 2J5XA 3FKQA 3OZCA 2VWPA 2JDIA 2VJKA 1W1WA 2OO5A 3L7KA 3Q9NA 4LDQA 3D7LA 1YWGO 2J87A 5DBFA 5D6NA 1HBJA 4MYHA 4URXR 2ESRA 1J5EB 5DCYA 1USGA 5F52A 3O6VA 4WKCA 4YRTA 3C15C 4D9FA 4IL5A 1TLTA 1Y6GA 2X4GA 1SCBA 1OLXA 3QSGA 1LVGA 1KK3A 1R10A 2WU1A 5LQJA 3OWHA 1TF2A 2VOEA 3JZDA 2PHZA 3OEYA 3NYWA 3OMWA 2ZRKA 4MARA 4MQEA 4MUMA 1I4EB 2QQGA 2C4VA 2NZ8A 1DSSG 2OBFA 5ED4A 4E4TA 2EFEB 1BFUA 1ZITA 2J5KA 3LUDA 1N75A 1GIAA 3R9WA 3MJFA 4HGYA 4NBLA 4EFLA 4JBNA 3IDQA 1RMQA 4HNAB 1I9CA 1XTJA 4L5BA 5DULA 1P8JA 1QS0B 2GKSA 2WHEA 1G291 4DZTA 3CISA 1PG0A 2ZB2A 4DM3A 1PZFA 4AS1A 3AUJB 2W93A 4LOIA 3RRXA 1HO3A 3REQB 1ESMA 1J97A 3T9CA 2XWPA 2ZRNA 4QGHA 4CDGA 1XNGA 4FHFA 1K7EB 2GEBA 5TQ2A 3WLEA 3EGEA 2UU9B 4NECA 3NT2A 4M8NE 1MHTA 3DYIA 3WJ7A 3O7MA 1DAEA 4FIZA 5EIBC 3AB3A 2VQSA 4CF5A 1M6VA 2VQFB 2YWHA 3SLKA 1SGWA 4OJQA 3Q1KA 4G0XA 3ZHRA 1ZM9A 4EMBA 1DUVG 1TAHA 3IT0A 1K68A 2DQYA 1SCQA 4WZZA 2FGKA 2QE6A 3K9HA 3WZMA 4F72A 5HPYB 3K6JA 1UAAA 3CUEF 1KJIA 2Q5JA 4EA7A 2GF0A 4DIMA 1XJQA 5JEDA 1O94A 4MJ3A 1FFSA 5FA6A 2Z4TA 5AKHA 2GJ8A 5IAEA 2XWSA 1Z17A 2GD1O 2I7TA 4Q4LA 3PICA 3PQ3A 4RH3A 1IMOA 3LDAA 1JTFA 4EZEA 1UZLA 1YR6A 1P1RA 2Q21A 4AZ3A 2P68A 5F5NA 4TQAA 1RQPA 4F7WA 1HLDA 1PWZA 1Z75A 3AR8A 1ESZA 3IH5A 4LXXA 1V3VA 1E5LA 3UAZA 2IQ5A 4FNGA 5AOCA 5KWIA 4GR4A 2QX4A 1A5SB 1TF7A 1CR6A 4LC9A 4WZAE 4PGAA 4ESHA 3H99A 2RBKA 1XLUA 3RVKA 5MHTA 1X7WA 3SX4A 1V1JA 2HMAA 1VPWA 3D5TA 3QE9Y 4JDPA 2JH3A 2YJ4A 1ZHHA 2DH6A 2VF8A 2EW8A 3X1XA 3Q8LA 5BR4A 1LS6A 1KEZA 1NRXA 2E49A 3LQYA 1S2DA 1TZMA 4YDQA 1RTKA 2IDZA 3ESAA 3O8NA 4BLSA 1BDHA 3MS2A 4M53A 4C2BA 1ORIA 3I1IA 3W8RA 3AJ9A 1CIJA 2OILA 2Q9BA 5CFRA 3V4VB 4NAUA 5JS7A 4DA9A 2C3UA 2YY7A 3BH7A 2VBIA 3GVHA 4MAMA 3MPOA 2DAPA 4QYXA 4YT2A 3DL2A 5IYZA 2NUTA 4XYLA 3SDBA 1V39A 5TS3A 1D03A 3FPKA 1FRQA 2K5UA 3H2ZA 3INYA 2WQZA 3OZBA 1A72A 3BT7A 2ZUWA 5L95A 2Q1TA 3I76A 4YYZA 1PVOA 2PUAA 2Z6UA 2DWOA 1TA0A 2XEXA 3ISVA 5AO9A 3SF8B 4TOIA 2CL6X 2ECQA 1C3VA 4H15A 3TW4A 2IY9A 3QUTA 3T61A 3C39A 5IEJA 4B2PA 2J9YB 3DVSX 2R25B 1OC4A 2AC4A 4YCCA 1K8RA 4YRZA 3MJTA 3F9IA 3O1LA 2HEGA 4OQLA 4FJ2A 5CH8A 2CLMB 2WHYA 2ZIUB 1LPPA 1RM4A 6PFKA 4KEAA 1O87A 1ESDA 3T3HA 2YWBA 1FFXA 1D2HA 1BTOA 3EC2A 3PU6A 2AA3A 1XV5A 2IXEA 2OSVA 3FGNA 2DKFA 3KE9A 2QMEA 3AHDA 1C0KA 2B9EA 3HDHA 4J7UA 3K9WA 1PJTA 2ERXA 2B35A 2WU3A 1NA5A 3AHIA 3M1YA 2QRMA 2ECKA 4BNWA 1HE3A 4PLZA 2OYCA 3OQNA 2H57A 1L7MA 1O03A 2G9VA 2JVKA 4XIIA 1XEXB 3NC0C 1LY1A 4G0ZA 5IUKC 2OBBA 1Y0BA 3K09A 1JLLB 4FFSA 4YMUA 4FHZA 1X80A 4YONB 2FEAA 1KKMA 4ZDJA 5D01A 1A88A 3BGOS 1RRVA 3OQPA 4GBMA 5EUMA 5HILA 3FHOA 3U3DA 4RULA 3DCNA 4PYRA 2Q3JA 3FGOA 1ZI9A 3IALA 1SUIA 2HXYA 1UCFA 2O0MA 4X00A 4CU2A 2I9KA 3ZDCA 1DEKA 1DP4A 4FFOA 4QREA 3HCEA 2YWFA 3T9DA 2GVDC 4LSGA 4RIGA 3I5UA 1FRVA 5JNTA 1UJ2A 3LX6A 4N3AA 4H7FA 3ZI0A 2C59A 2X15A 3EVTA 5EMKA 3PGJA 1DARA 1OWOA 1YO6A 3R2JA 1OLUA 2HWXA 3RYHB 4EW6A 2J3HA 2OQRA 4RF4A 4UC0A 3BSWA 2FF7A 1P4RA 1UMBA 2X8BA 5TGZA 2WF7A 4BNYA 1RR6A 3P9KA 2C7BA 5J4KA 3EEIA 1N2IA 3L8MA 2JI4A 1WZUA 4RMIA 1XPRA 4L8WB 4CN8A 3GY0A 2ZAOA 3TXYA 5EIAA 4AZWA 2QX8A 3NHUA 3OO0A 4GXQA 2GZ3A 2YHIB 3AG6A 3EPPA 3B8HA 3OX4A 3R4VA 3TSCA 1D6SA 3SE0A 4C7KA 3SPXA 5MGNA 2GILA 4NZZA 1PR9A 3H2HA 1RWNA 4IKEA 3IVXA 1ODLA 1E9RA 3PD1A 4FKBA 3L4KA 3BFXA 4DY4A 1EAYA 2H31A 4BKMA 2CHQA 2CLHB 2SCUB 1NSTA 3FDFA 3N2KB 5JJ5A 2J4DA 3E5MA 4Q37A 1YZYA 4OGKA 2FAXA 3QG1A 2BCJQ 2WVAA 1CU1A 3C6QA 1ICEA 1J90A 1H6BA 3BGVA 4OMFG 5BXQC 1F8FA 4BCCA 2OECA 2ZXFA 3QYJA 1I1OA 5C7OO 2I91A 4YT8A 4JVMA 4N0DA 3VKFA 2UYCA 5A3JA 1MB9A 1O58A 4D81A 3E22A 2WIDA 4IYJA 4GX1A 4PLTA 3K8QA 2RKOA 2GBFA 2WUWE 5DHQA 4R6XA 5K3EA 1JIQA 3ETJA 1R15A 4XIYA 1JL3A 1OGYA 2KLBA 3WMEA 5J9FA 4L4XA 2I3DA 3ZLBA 4WY5A 4YIKA 4MP6A 1P2FA 3HCOA 4EI9A 4W4TA 1GPJA 4UBMA 5AI6A 4ZT7A 3UTCA 4L50A 3VH4A 4ZV4A 5JS1A 1CRPA 1KR2A 3LCCA 5DLDA 4C2UA 2BDEA 2R6GA 2YWXA 2AJDA 1VBNA 2NQ8A 4KPUB 4RETA 3TSAA 3KD3A 1FNMA 4A92A 1CDDA 4D3FA 3T7KA 1PG5A 5HKLA 5IMBA 2OT3B 5BVGA 4QXAA 4TXHA 1DAKA 5D3MA 2FQXA 3HYSA 5CTJA 1B1CA 3UY4A 1PP4A 4ZOAA 1QIMA 3QKIA 3VZCA 4BFSA 3CPJB 2XPCA 3GJ6A 2FUG6 2XMPA 4MA0A 3TQCA 3EDOA 3W6UA 1ZD8A 1DELA 5U1PA 5JNSA 2W8ZA 3OJXA 4UAUA 3VR4D 3CEAA 4L6AA 4MPTA 1RZRD 4UZEA 3TUJC 4LJRA 2JGFA 1KI9A 4GZ3A 4WT7A 4H59A 1YDMA 4A36A 2YS6A 3V80A 5JC8A 4HNUA 2VSQA 3PEWA 1YS4A 5CLQA 5CNMA 1HLGA 2G76A 4ZRNA 1HL7A 2JGJA 4A9AA 2VJDA 3AZQA 1D6JA 1SC4A 4ONEA 4BWGA 1VJDA 4J03A 3X44A 3IDSA 3O4HA 3OT4A 4JI6B 5AW6A 4I36A 2PV7A 3TZEA 2HA2A 2ZR8A 3CTPA 1K6XA 4P7BA 3R24A 4EJFA 3EPJA 3F9RA 2PEZA 3CMCO 1VMDA 4MI9A 5F73A 4YP7A 1I7SB 5EP1A 3ZVKA 2QPLA 1W85B 2D0PB 2WU8A 4PC3A 1KBQA 4LCEA 1WY5A 3S2FA 1NP6A 2IYTA 1N0UA 2X2FA 3B5IA 4ZO4A 4ZZ2A 1QUEA 1K7CA 1AHNA 1ZINA 3E9MA 4L57A 3N6XA 3V4OA 1EEXB 1B3RA 1GNSA 1GQSA 1ZIXA 4EVSA 4W5TA 4I4IA 1OH6A 1M0SA 3MT0A 2Q6IA 1TQDA 4ABYA 4MQ5A 1NVAA 1UBJS 4LY6A 1O0SA 4N65A 3T5BA 2EFYA 1CHDA 2AZ4A 3CIFA 4QDZA 3GJ0A 1XRPA 3LK6A 2QD3A 4E3ZA 3PCXA 1XPJA 2EP5A 4KQ2A 5I7OA 3VJKA 2IHJA 3JD3A 4NBWA 3QBTA 1XZKA 3W3AH 4F1KA 5CA1F 5IAOA 4Y1RB 4FEYA 4PGMA 3V2GA 1HYGA 5G0TA 3RANA 4B6PA 2HJHA 5FHRA 4OHZA 2O57A 4WLOA 3IBCA 2JA1A 3TRKA 4D44A 5B2FA 3I5XA 2PMFA 3MCAA 5BYBA 2F9FA 3ZDXB 4GGPA 3UGKA 5GWXA 1M2VA 2BEUA 2LKCA 2PFSA 3A2NA 4QTYA 3T3MB 1BCSB 4WINA 3HDYA 5KTOA 4XYBA 4O4LF 2YQ4A 2C0PA 4F2HA 1M34B 1A2QA 3KKLA 2V7TA 3FTQA 2QVYX 1Z4OA 4RPHA 1XZQA 1O8BA 1RJEA 4IW3B 4BO6A 3KLPX 3QLTA 4HMOA 4MHTA 1QMGA 5FKJA 1W6RA 1ZU4A 4R9UC 5I47A 1GKUB 4R2MA 3A36A 2P11A 2YVKA 1JJBA 2P3SA 2XCIA 5AHRA 4P3XA 1TIKA 4KR6A 1H8HD 3CZRA 3ND5A 5B1DA 1H0HA 2XT6A 3OEHD 4CF4A 2F3UA 3LF1A 3Q9LA 1Q0TA 2GXSA 4CKCB 2PZEA 1VSVA 1UWLA 5F76A 3A6ZA 1QHIA 4IIJB 1CCWA 1T1RA 3RYFB 4D9CA 4GGOA 2ZKIA 5BQFA 2BGWA 4D8XA 2Q45A 3KQOA 1L8XA 3OEED 4HATA 1R0BA 3L0PA 1XZIA 1FX0B 4ZCRA 1E9DA 2WY2D 1S3GA 1U8UA 4YT4A 1I7DA 3HO1A 2PRJA 2BBWA 2HU5A 4IVQA 1F14A 1AKVA 1LJLA 1ISFA 2ZSAA 1NMSA 3JQQA 1IATA 4BBAA 1IVYA 1GGKA 3P71T 2D59A 4P5EA 2SNIE 4DBLC 2YN4A 3EGXB 1EVIA 2OLJA 2VPZA 3DSRA 3RSOA 3LT1A 1JQBA 3ES9A 3WWZA 1OIWA 1W2HA 5SY6A 2XDAA 5CA0F 3HKEB 3LZDA 5DOVA 3TKAA 5M5BA 2REQA 3L0CA 4GXNA 4NJMB 4CKEB 2RGWA 4L22A 5B58C 5BUCA 2WF8A 1QK5A 3NHSA 2IA5A 1UOEA 2DPLA 4OL0A 3NDBB 1U28A 3BZBA 3CX8A 3ZEAA 4PC1A 1LBEA 2Z8XA 3GUCA 3K5IA 2DWUA 3DZHA 1RYFA 1CUDA 3U7JA 1U3GA 1ODIA 2QK4A 2CVOA 2X9NA 3GFTA 4K03A 4OI0A 2MMGA 2FSGA 3GD5A 4OSEA 5EERA 4ZEMA 2Z2KA 4XD2A 1Q0LA 3UV6A 2Y67A 4L5YA 4RMGA 4Q01A 1EFLA 4HUQB 1B14A 4AZ0B 5IWCA 3ASZA 3UUFA 3VC7A 1NW4A 5D3ZA 4R1MA 1RE1A 1XZPA 1OI2A 2F3SA 2CJWB 3TW6A 1D4OA 2DVMA 4RGBA 4C7JA 2PKQP 2G1KA 3DGFC 4BCBA 3EULA 5DMHA 1KJQA 2OORC 4DWOA 5IK2A 1NSYA 4P7JA 2YFQA 1COZA 1QE3A 1WB4A 1P7PA 3HRKA 1WZ2A 3MWEA 5FBZA 2WSYB 4EVIA 5E1MA 2J0VA 1G5FA 2RGYA 3MMXA 3ER9A 5DHTA 3JAKB 1FYEA 2BMVA 2XKBA 4UQOA 3ETGA 2O8FB 2CHEA 2AN4A 3PNPA 3DO8A 3AKYA 4RD0A 4E0BA 2QM7A 3M70A 4BBPA 3P0EA 1PJAA 2HM7A 3D9QX 3VOAA 2UXDB 3Q72A 3GARA 3R23A 5DN6D 3PUHA 1D0VA 3DE2X 3LY7A 2HXSA 2F3TA 1KYVA 3NEJA 4ZMBA 4FCWA 4HMPA 1P2BA 2F00A 2WIKA 4KQHA 3VUEA 2QGNA 4IH9A 5FBWB 4G67A 4K5QA 3U17A 2EL7A 3DYVA 1JBKA 1IHYA 3OAAD 5A71A 3NTQA 4WFIA 4YXWA 5LQUA 3GLFA 3AVQA 1WUIS 4TRNA 1N6RA 1YQQA 5KX5B 2IX3A 2VP5A 5KTSA 2GPBA 16PKA 4GPBA 3PEYA 1UH5A 5ISMA 1OILA 1XCMA 5CFQA 1M8KA 5DCLA 4JLKA 2XYVA 1RMYA 3UKOA 3UM9A 1W19A 4C5CA 3IPYA 2V7XA 3HJUA 5BR1A 3D2LA 3L43A 3R20A 3KL4A 4I99A 4E5KA 3T99A 3T7SA 4JODA 4XUCA 2Z6VA 3DLPX 2QM8A 4DV0B 3KQWA 4LV8B 1NY5A 5FYQA 1BE0A 1OASA 2FEMA 3COVA 3CSSA 1XHFA 4B8WA 4C0KA 5AOAA 4D80A 1U8EA 1XFDA 4IWYA 1CC1S 4CEIA 3PSAA 3N70A 4B4WA 4UDOA 3RRJA 4G1EB 3TLXA 3F6PA 3FXAA 5HE8A 1PQ4A 2NO1A 2GSWA 3KLMX 4TTSA 4QDKA 1D7AA 1BWPA 1QQTA 2BCGY 1TNDA 4Y2YA 4MW2A 5ANRB 1Z62A 4KJZA 5C8VA 1DKQA 4NEGA 4S1WA 1PWYE 1J00A 3SS9X 2OCPA 2DULA 1E66A 1KHTA 1SMKA 3B3AA 3U9TA 3G85A 2H06A 2W37A 4UXJA 1BYUA 1X74A 4OY3A 4I1IA 4XPIA 2XGOA 5ALUA 3WB9A 1EX7A 3WLHA 3UJDA 4RVNA 3KVYA 1XKXA 3VZRA 3KUKA 4EGFA 2EJVA 1UPCA 2VUSA 2KQUA 4OLHA 2R6CA 1JEDA 1TT5B 4QBGB 4ACBA 6YASA 1V43A 2AXNA 4B45A 5THKA 5FTLA 1TD1A 4PW0A 1T1EA 4QUEA 1XQVA 3ZD6A 2F90A 3ZQ4A 5E8JA 2QW0X 3GEIA 2QAGB 1OUMA 4HGQA 5F2EA 4CUKA 3H11A 2J33A 4TSFA 3W8EA 5I9IA 1Q6ZA 4ZHQB 5DRYA 1CY6A 1E2NA 2CXOA 2PH7A 2Q6VA 4J0EA 1VE7A 3DXYA 1E2JA 5I45A 2R1TA 5KU1A 5DYWA 2PMCA 5JDCC 4RD1A 2XUHA 1IEQA 4TKVB 4XWKA 3RVJA 1O96B 1ZK1A 2D2IA 4ZKDA 4WAUA 1I6WA 1DRWA 1F6BA 3HGQA 8MHTA 4HRVA 3ZU3A 5AT1A 3R7LA 1Q7TA 4RM2A 4Q4HB 4MWBA 2C61A 4LV6A 3HWSA 1M1YB 5ADVA 4PYQA 1T4MA 4R41A 4ZEXA 4B79A 1UDWA 1AJEA 5CPBA 3PCRB 3FZYA 1ZEMA 4YMHA 4CLXA 3NC4A 3E23A 2VEDA 1WSDA 5JZ9A 4FX2A 2BM1A 3GEDA 2P30A 2BFMA 1SZDA 1WSWA 4NMLA 1NKTA 3KXDA 5ENDA 5BYAA 4K9NA 1V47A 5LLSA 1QP7A 3NYIA 4MKRA 3T5GA 1A27A 1NNUA 3G1TA 2ERYA 4J2HA 3U3XA 1IU9A 4LSWA 1ZQ1A 3GRKA 1Z12A 3DCYA 3MMPA 1K27A 2WAMA 3VR1A 1EYZA 2FWBA 4MUGA 5FL3A 4UATA 5AVRA 2AG1A 2CMKA 3JRWA 2VHXA 3FHTA 5KDLA 2ZJYA 3G2IA 2OO7A 3FLBA 5SZJA 1KDTA 4CODB 5BSMA 3QXXA 1Q44A 4WZBA 3IPAA 3G68A 4EG5A 2GVZC 2N0SA 4DCMA 5LQKA 2MR5A 1V96A 2JRCA 2LPMA 3ANXA 3IX7A 4MPPA 2AT1A 1LTKA 1KSHA 2H17A 3VZBA 4E2FA 2AFRA 3KIPA 2JLRA 1LLFA 4BAZA 6ABPA 2X9VA 4UTRA 3AF6A 4HGZA 2PFKA 3EC1A 3T3EA 2PAAA 2KSQA 2WWGA 3KQTA 3L6DA 2V59A 1U1DA 4F1JA 5FUBA 2IW3A 1NXQA 4RIHA 3RUPA 4QOFA 1T8TA 3ZWYA 2GPAA 4P4GA 4Y6GB 5DSXA 1L4GA 4W1RA 1PG2A 3J80A 3O2NA 2IS4A 1CY2A 4I14A 2JATA 2AKEA 1A76A 2QLBA 3G5MA 4NBTA 5AI5A 4EMSA 1JJVA 3NV7A 3F98A 4M6WA 2YCBA 3HRIA 3ORSA 2RGBA 3P32A 1ZH6A 2UZ1A 1BH6A 2VDVE 4XM2A 1QOZA 3I6QA 3SHFA 4F8JA 3E9RA 4G23A 1K6EA 2LWIA 3IIJA 3K0AA 5FBRB 2JLVA 5E6SA 4EH1A 3S27A 5HR5A 3ZDEA 2QHXA 5DH9A 1R0RE 3S7ZA 1YI1A 1P2TA 1ML3A 5DTRA 2AXEA 4MI3A 3W9UA 3WLNA 3KT6A 1CR4A 3M6FA 1G6HA 3EZGA 3V8VA 3T3IA 4EPVA 2XOKA 2DCUA 3RGWS 1SO8A 2VWHA 2IY8A 5CD1A 1UXJA 1AGPA 1V9LA 2GFIA 4MVJF 4XEUA 2YXNA 4E07A 3ZK7A 3NRJA 1T2NA 1DS6A 1ZRMA 4N82A 4Y67A 1P1IA 4E2ZA 5KMGA 4Z3OA 4KE6A 5HNKA 3MJSA 1K8XB 3QE0A 1KYWA 4R5HA 3ZWBA 4BQIA 1O9HA 1ADBA 1XD8A 3FNEA 3QX7A 4O4HB 1Z9BA 5JPIA 1VG8A 3MTAA 3BGWA 1YS2X 3Q3VA 4GXTA 4W9NC 3RTEA 5JCZA 3FGPA 3ICVA 1TZ2A 2ZJ6A 2BFWA 5IDWA 1OXKB 3FYTA 1PFYA 1EFDN 1V2HE 1G5HA 2QRVA 3IILA 1UZUA 2P2LA 1BFDA 2QR2A 2PZ8A 3U4MA 3C5WP 3KAKA 1NHWA 4BB5A 4DV6B 1M10A 3H1EA 4ETNA 5BNWA 2C83A 3Q41A 1MA3A 1U3FA 3DA8A 1AB5A 2JIZA 4GX5A 4LYAA 1DQRA 4LSMA 2IXBA 1TLFA 5ENZA 3O9MA 1I2DA 1XHEA 3QFFA