4YA6A

Crystal structure of ligo-apo form from sphingobium sp. strain syk-6
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
295
structure length
270
Chain Sequence
MQDLEGKVAFVTGGGSGVALGQAKVLAEEAQMKVVIADIRQDHLDEAMGYFSQKNVAVHPVRLDLTDRAAYAAAVDEAEQVFGPVDLLCNTAGVSQFGPIEKATFDDWDWQMDVNVNGVINGVMTVMPRMIERGQGGHILITASMSAFVALPTTGIYCTTKYAVRGLAESLRVEMPKYNIGVSLLCPGGEAVFAGLKRVIEHGFDPVDLGRVVLDAVRNDRFWVLPYPEFAEGQKARDQEVIDAMMSYADHPDYARRMKIREQMKRDMPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C alpha-dehydrogenase
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
source organism Sphingobium sp. syk-6
molecule tags Oxidoreductase
total genus 103
structure length 270
sequence length 295
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ya6A01
5IAAA 1E3LA 3AUAA 4E21A 4E12A 1HDYA 4J9UE 4FR5A 1LSOA 1ENPA 2VUTA 4DYDA 3ZU5A 3VC7A 2Q2WA 4CM1A 1LC3A 1GPJA 1XDWA 2O3TA 4H15A 4I1IA 5JLAA 3OIFA 5COAA 3E6AA 3UHAA 5JDIA 1ISIA 2EKPA 5T8KC 3G1TA 1I32A 3OJOA 4WECA 3ORFA 1LDMA 4FB5A 1TXGA 3KRTA 2NLOA 5G0TA 2Y1DA 1IULA 4WKGA 2ZTMA 3CIFA 1K6XA 5CPBA 2O7QA 5JAQA 3DZBA 3GAFA 3W1VA 1M6HA 1X14A 2YHIB 3FHLA 1NAHA 4PFJA 5EINA 4BO1A 5TT0A 5CDYA 3HB5X 2OGUA 2IRWA 4P4GA 2HMVA 3S55A 2Z5LA 2P68A 5IDXA 1YO6A 1M6WA 1L1FA 4M1QA 2Q3EA 2CMDA 4E4YA 5HBRA 5AXBA 2HDHA 3GDOA 4IY1A 4ZHSA 4RDIA 3HDHA 3QWIA 5IG2A 3GVPA 3I9MA 4BNWA 4II2A 3PDJA 4HY3A 5A9SB 5JDIC 1VC2A 1YQDA 1GR0A 3L9XA 1IL0A 3HN2A 1HDOA 4XX0A 3A4VA 3FBGA 4MVJF 4AVYA 4YAJA 3JD4A 4HX5A 3INTA 3GZ4A 4XYLA 1DDOA 2E4AA 4HFJA 3KBOA 1BTOA 3VHRA 3NT5A 2FR0A 1OBFO 1BDMA 5A9TA 3TL3A 3NKLA 2D5AA 1CQJA 2O3RA 1S6YA 3GEGA 2YJZA 4D3SA 1ISGA 3ZHZA 1LX6A 2O4CA 1OI7A 1IUKA 2ILTA 1LRLA 1VJ1A 4XRGA 1ULUA 3ZV5A 2DKNA 1N9GA 1PZEA 4Z9XA 5A3JA 3C24A 4UEKA 4EEXA 3GDFA 5JPIA 2DBRA 3JQCA 1LRKA 4K6CA 4NU5A 3H6KA 4CMGA 3OH8A 4B3JA 3GY0A 3CPSA 4UAGA 4E5MA 3E48A 3H3JA 3WGTA 4CM3A 2C7GA 4XWYA 1L7EA 1JWBB 2PNFA 3C7AA 1N2SA 3GHHA 4PLWA 3ZWVA 3OQ6A 4GI2A 3AK4A 4GGPA 3DTYA 5IN5A 3DBHA 5H82A 6ADHA 3SEFA 2I5PO 2EXXA 5L3ZA 2FPPA 1RM0A 3OJEA 3H2ZA 4F3YA 4YAGA 4URFA 3DZKA 4AJJA 3WICA 3V5NA 4MO2A 1I36A 4JJGA 4KWIA 4UULA 4FFNA 4WOJA 5G4KB 3WGGA 4OIMA 3PJFA 3E9MA 1H5QA 2OL4A 4YTEA 1O9BA 2NTJA 3AM3A 3JQ8B 3JQEA 3K73O 5EQDA 4MVJA 4I9HA 4PLPA 3WDSA 4NNJA 4TZKA 1R12A 2JHGA 1ZK2A 3O8QA 3K31A 1IOLA 4E5YA 1PS0A 2VTDA 4R9SA 4GLOA 5CHEA 4CLRB 1Z45A 3GFGA 3JYOA 5ICSA 1UUFA 2E37A 1YRLA 1MFZA 3MTJA 1ZMOA 3LU1A 1QMGA 4R5HA 1EUCA 1YDWA 4J1NA 3UXYA 4NFSA 4BNYA 4CLOB 1YQGA 3ADPA 3TZCA 3GVXA 4YJGA 1PJQA 1B8PA 3V1YA 1SOWA 1UDBA 1UXJA 3HQ4O 3V1UA 4NFHA 4PRKA 3ZCXA 4KTTE 1NNUA 3DB2A 4IDDA 1MGOA 4R1SA 3EAGA 2GGSA 6LDHA 4FD3A 1TEHA 3GN1A 3K92A 5KIAA 4RPHA 2D59A 3QA9A 4J16A 5TSDA 4BGIA 2JKVA 5C7IO 2R00A 5FYDA 1DFGA 5ICMA 2EKQA 2DUWA 1RM3A 3WNVA 3RC2A 3NAQA 1FMCA 4OKIA 2IYPA 5F21A 1B26A 4F6CA 3ZWXA 4RJTA 3SVTA 1R16A 5CP8A 1XU9A 4JBHA 1HSOA 1PWZA 1Z75A 2EV9A 3S8MA 1PL7A 4A26A 3U62A 3GLQA 2EJVA 3TN7A 1DSSG 1T4BA 2C82A 4GSKA 4J2HA 1ZMTA 2JFGA 2WYVA 1LDGA 8LDHA 1Q0LA 3A28A 2QYTA 1MXFA 3I4CA 5KWEA 5CPFA 3AOGA 3GNSA 1YL5A 5JE8A 2D1YA 2HAEA 4QT0A 3HWRA 4LVCA 1U9JA 4IJVA 3WG9A 1SBYA 3T7EA 1LLCA 1YONA 1U3TA 3FWZA 4YJDA 5JCJA 3EY4A 2D8AA 2H63A 5DF1A 3RBVA 3W6ZA 1JW9B 3JD3A 4UVHA 2DBZA 1C1XB 5IXYA 1R4NA 4CM9A 1CDOA 4OXYA 5A9RA 1PGNA 4WLVA 4TWRA 1ZNQO 3KYDB 4D3FA 3BHJA 2DLDA 4W7HA 1NFQA 2A4KA 3K96A 5KKAA 1BXGA 3RI3A 4NBVA 3GVIA 1Q7BA 4G81A 2GDZA 3HADA 4RORA 4JQCA 4MVJG 2HJSA 3S2EA 5IDQA 2VTEA 3NDRA 4DQVA 1NHWA 1TT7A 4RVUA 5JY6A 4RF2A 4YJFA 1GQ2A 3OQBA 2E49A 1GUFA 1HYHA 1W6UA 2H6EA 4OAQA 5AVOA 4CR6A 3FNEA 2GYYA 4XA8A 4U6SA 4YCAA 4X54A 4Z0HO 5KVQA 2HKIA 3JQ7B 3HFSA 2DTDA 4FJ0A 1Y81A 5CDSA 2CD9A 1ZSYA 2G5CA 4PVDA 5L95A 1JLLA 2FHSA 3ZWCA 1DFIA 2NACA 4FPXA 1BSVA 4BMVA 5HS6A 4D43A 1RPNA 3H9UA 1U3WA 1Z74A 4ALLA 1W4ZA 5ITVA 2I67A 1E77A 4YYZA 2OUIA 5MGBA 4IZIA 3RAJA 3MTGA 3DBRB 5I8WA 2CDAA 1B2LA 3TZKA 2JL1A 3WIDA 3GF4A 4IUYA 3FBTA 1R0LA 4PZCA 4XB1A 1K89A 3KSUA 2PKQO 3V1TC 3UCXA 3W6UA 3AJRA 2EP7A 3ROMA 5L7TA 5JC1A 4KUEA 2NM0A 3FCOA 2O4UX 2AMFA 3F46A 5DCYA 1OOEA 2WE8A 3KXDA 5FEUA 5DCWA 3IOYA 1Y5MA 3LT4A 4CJXA 1R66A 3NDIA 3GGOA 2NVUA 4R69A 3UKOA 3INRA 3LC1O 4YAIA 4RF4A 1NYTA 3AOEA 4GAEA 4J4TA 2NWQA 2V6GA 1U2DA 1B14A 4NQZA 1B3BA 5IDYA 2HK8A 4HKTA 1JKIA 1SNYA 4U6QA 3ZGYA 2NU6A 4Z3DA 5A03A 3DONA 1EVYA 4XIJA 4K1LA 4YR9A 3D64A 5B1YA 2ZYGA 5LDHA 3IKTA 4MJLA 1L7DA 5A06A 2H9IA 4TQGA 4OYRA 1U8FO 2G1UA 4QXMA 4JP2A 3WFJA 2FZWA 4ZD6A 1SEPA 2VNSA 1EK5A 3PEFA 1HTBA 3BMCB 1ZSNA 1EK6A 1F06A 2P2SA 3DZIA 3FRJA 4R68A 1N1GA 2G82A 2P9EA 4ALJA 3DDNA 1N1EA 5F1KA 3I9JA 1IZ0A 4XDZA 3F3SA 3BXXA 4B7XA 5L4NA 3MZ0A 1IHXA 3ETDA 3ZWBA 1E7RA 1F8GA 1ZSVA 1P1RA 3AOEC 2H1SA 3CH6A 3CE6A 5IZ4A 1ZEJA 1JWAB 4CR8A 3QJ5A 4DQUA 3JQFA 3VKVA 3WGIA 4B7UA 4MIEA 3IUSA 2CF6A 2Q49A 4E33A 3O4RA 1ZK0A 3RC7A 5JCXA 1UR5A 3AUTA 1JQBA 1N8KA 4PLCA 3PYLA 2ZTVA 1WDLA 5BSHA 4JLWA 5DCUA 2UUOA 4NJMB 5KVVA 1SEVA 5TF4A 1EBFA 3E9NA 3KETA 1DJQA 3RU9A 2VYNA 1P9LA 3FR7A 4WOKA 2VRCA 1Z7EA 2V6BA 1Q0HA 1C0IA 4IXTA 3ASUA 4QO8A 4BNIA 3UOGA 2QIOA 1PJTA 4QO7A 4R01A 3TPCA 4KDFA 3E5RA 1LSJA 3JSAA 3ZWYA 3ITDA 4J7XA 4WLEA 4ZU3A 4FJ2A 4BOYA 3OECA 2O48X 1HF3A 1VRWA 1I33A 2I6TA 1PS8A 1SZJG 3F4LA 3I9OA 1YVEI 4RVFA 2WTBA 1QYDA 2PGLA 1NXQA 2X0IA 3F1LA 5DULA 5L7YA 1ADFA 3EZLA 3L6EA 4ZVVA 4AJ2A 4HWKA 1H6CA 5L9AA 4RQUA 4D42A 2JD0A 4E5KA 3PZRA 4L4SA 2Y99A 2WJPA 3EVNA 3DOCA 3H9GA 4YT8A 1MA0A 3WMXA 1G0OA 4RPGA 4AJ1A 3GUYA 2UUPA 2VYVA 1CJCA 1EMDA 2YYYA 2Y68A 3KEQA 2PV7A 4XJTA 3WQQA 1SAYA 4RO0A 1PR3A 1D8AA 1ZK3A 2GZ2A 1VL8A 1YL7A 4DUPA 1DBVO 2JHFA 2WD8A 4PIVA 4CQLA 3AW9A 5L4SA 3MEQA 2HO5A 3D4NA 4LSMA 2VOJA 3H7AA 3E82A 4O0LA 3LVFO 3ZHYA 3AWDA 2Q4EA 3QW2A 5FI3A 4J91A 1WWKA 5TLSA 1UAGA 2Y1FA 3B6ZA 3QVTA 3INGA 1O94A 2VOEA 3OA0A 3GH3A 1QYXA 4A2CA 2W4QA 3VZQA 1XG5A 3LQFA 3D4OA 3AI1A 2G17A 1GCUA 4OOFA 3MOGA 3L0DA 4RVGA 5AYVA 1HLPA 1PU2A 2JCYA 4D0SA 2CVOA 2PD3A 2O2YA 1TT5A 3V8BA 2OZPA 1DIRA 3TRIA 2RIRA 4BNNA 3OSUA 5A1TA 4YAKA 3CMCO 4B3IA 1B16A 1I01A 2YW9A 5CDUA 3DMYA 1J4AA 3E9QA 3F4BA 1LSSA 1RJWA 3PVZA 2HMSA 4N18A 3WJAA 3OP4A 2AQ8A 2ZYDA 1EFLA 4G65A 4MIOA 3M6IA 1DC4A 1NASA 1ZJZA 4QUKA 2NNLD 4Q3CA 1H9BA 4Y67A 3PHLA 2TMGA 3L07A 1DAOA 2PFGA 1ML3A 4Q3BA 4EW6A 2PA3A 4FFPA 3WLFA 5IFLA 2NTVA 4U0KA 4TROA 1KBZA 1XELA 4CPDA 5G4LA 3IJPA 2GNAA 3TSCA 1XSEA 3KUXA 5L53A 5G2OA 5KJ6A 2PLAA 4CMIA 1NWCA 2DVMA 4I5GA 2B37A 2HJRA 4BKQA 3WTCA 4J9VA 9LDBA 3DZJA 2FSVA 3PJDA 4QQRA 1VL0A 2C0CA 2JFHA 3V2HA 3VPSA 4TKLA 4CV1A 3K5PA 4FGWA 4ZRNA 3L6OO 2AE1A 2VWGA 3KOUA 4CQMA 1SC6A 3FTNA 4RF5A 3N7UA 2A94A 3GVCA 3LSYA 4E2WA 3GEDA 5TJ9A 3GHYA 3CKYA 3HSKA 3GG2A 4OO3A 4TVBA 2WE7A 4ALKA 2PZKA 2QQ5A 1UJMA 2AG5A 3PHHA 4AJ4A 1NPDA 3I3OA 1UP6A 2IYOA 1UDCA 3D3EA 2B4TO 4IIVA 4BNMA 1E92A 2XF8A 4DRYA 3H3FA 1PR9A 2R6JA 4CM4B 3JQ9C 1P45A 1E3WB 1TI7A 1UAYA 4W9NA 5A4DA 4IDEA 1BHSA 3M1LA 4PLTA 4GKBA 3VDQA 1ZBQA 3KYBA 4EZBA 2VHVA 2UAGA 1OC4A 3G17A 4Z6KA 3CINA 2VT2A 4O6VA 3B20A 4DXHA 1YS4A 5BSGA 1I0ZA 4XYMA 1N9GB 2UYYA 4F46A 3DHYA 3RKUA 4IS3A 3JQGA 7MDHA 1KVSA 1CQIA 2ZCUA 4BMNA 1MG0A 2OBNA 3Q1LA 1U5CA 3PTZA 4YT2A 1QV6A 2FR8A 4RVDA 3LLVA 4N54A 4WCFA 3GEMA 1O5IA 1E6WA 5EJ2A 3FD8A 4I9UA 3U4CA 4W9NC 2HMWA 3DBHB 3DO5A 3H8VA 4JBIA 5BSFA 3EMKA 3U09A 1X1EA 1O8CA 5CG1A 1IB6A 3NTRA 3UUWA 1D3AA 3QSGA 2W8ZA 1QXSA 3IAHA 1K6IA 3DTTA 3HE3A 2OP0A 2A35A 1W73A 3AI3A 3B1FA 3VZPA 2CFCA 2FRDA 1QYVA 3LT0A 1WMAA 5JBIA 1GADO 4JCOA 3O8QB 4DPKA 1DO8A 4PLZA 4RPJA 4YRDA 3HDJA 1I30A 1K0UA 3KTDA 2PD4A 3ZN2A 2YZ7A 3L77A 4HUJA 1E1NA 1HSZA 1LBEA 1QKIA 2WD7A 1N7GA 2CF5A 1A7KA 1PWXA 4J2OA 4MKZA 4Y8VA 4DPLA 1NQTA 3DBLA 1MFPA 3C3XA 4GVXA 2BHLA 2CSUA 4WJZA 3JQAA 3IP1A 3D4PA 2V7PA 1CEQA 2I3GA 1FDVA 4I08A 3Q9UA 2UVDA 3DL2A 3AY3A 1KERA 5U9CA 2B4RO 4UUNA 3SLKA 1NFFA 1AUPA 3I83A 1JKFA 3ZWWA 5BT9A 3TF5A 2DFVA 2E82A 3PRJA 1CWUA 3RCBA 3B1KA 4MVJD 3GMSA 3ONEA 3G3EA 1U1IA 1Y8QA 4A7PA 3CXRA 4EUHA 4FQ8A 1H6AA 3D5TA 3DXFA 4I5EA 5A04A 1YL6A 2XAAA 1PJLA 4XQ9A 1UXHA 4B8ZA 2AG8A 1Y6JA 3M2TA 5DN9A 3RUEA 5JS6A 3FPLA 1P0CA 5J23A 3ZU3A 2QRJA 8ADHA 1NVTA 2YV3A 1WZIA 3OMLA 3JV7A 1YH3A 1EBUA 2VHYA 5A5EA 5CAEA 4WLFA 1BGVA 2RH4A 3ENKA 4M8SA 3KLMX 1NP3A 4D3DA 3PI7A 3VH3A 1NM5A 4OSOA 2J3JA 3JTMA 3UW3A 2X58A 3TQHA 4PG5A 3PWKA 2B83A 3AU9A 4GQAA 5I9MA 4GMGA 4FC7A 4J1QA 4PG4A 1A27A 2AA3A 2JD2A 1R4NB 3W4IA 1D7OA 1HYEA 2POQX 3FPCA 3I4FA 5JAIA 4TRRA 1ZXBA 2V6MA 2Q46A 2ZKLA 1PJ3A 3GC6A 3QLJA 1Y5RA 3OQ1A 1LQTA 3BMNA 4DC0A 2D2IA 1BXGB 2EGGA 4UVIA 2W2LA 2Q45A 3DWFA 3ZNNA 4DGSA 4NHEA 3MJEA 2DBQA 1DIGA 2Y93A 3UGKA 1Q0QA 4U0JA 1AHIA 3H5AA 3ITKA 2OXIA 4YJFB 3S2IA 1I2CA 4IDFA 1X13A 1JVSA 1CRWG 1LLUA 2TMDA 2D3TA 2VN8A 4DMMA 5I7SA 3GQVA 5COBA 1HE5A 3W8FA 5JCJD 1AXGA 2C54A 2WMDA 1LQUA 4GWKA 2OOSA 4GKVA 4CM9D 2PGJA 4IJKA 2ZATA 2E48A 4IGFA 2OO5A 1I3KA 3BYZA 5ENDA 3ZNPA 2ZTLA 4IM7A 1A7AA 3IS3A 2HMUA 2VWHA 4DIOA 3KYCB 1DLJA 2EW2A 3QQPA 2VQ3A 1Z82A 4R1NA 1YB4A 1ENOA 2AQIA 1Q2XA 2P5YA 2JFFA 1U5AA 1ONNA 2C2XA 4L73A 4IS2A 2VT3A 4AFNA 2FY8A 3F47A 5GMOA 1C1DA 3KO8A 4M86A 1H0KA 3LF1A 1KVQA 4IQ0A 3EC7A 2G0TA 4WEOA 1HLDA 4EITA 5B37A 3OFSA 3KSDO 3BMOA 3GMDA 3RUCA 4GGOA 5KCZA 1LDEA 1A9YA 1U4OA 1VL6A 1C0PA 4YVFA 2NSDA 1XEAA 2NVUB 1XA0A 4AJLA 3ROKA 2CY0A 1PQUA 1N7HA 1ENYA 2YV1A 3CUKA 3Q9NA 4GX0A 3VOSA 3ZNOA 2O3UA 5DZSA 4B4VA 4R5MA 5AXCA 1S7CA 3ZDFA 5KJCA 2FMUA 4RVHA 1ZFNA 3BTSA 1YWGO 3WGHA 3FTPA 3I52A 4R16A 5DOZA 1ISFA 4CODB 4L75A 3WR5A 4IDGA 2QYSA 1A5ZA 4HNGA 5I7VA 1QV7A 4A10A 3VPXA 3SLGA 1I2BA 2J6IA 5AXAA 1G1AA 3DEYX 3AI2A 3H9QA 4HXYA 1T4DA 3O9ZA 4NPCA 4Z0PA 3JQ6A 4J0EA 2NU8A 1KY4A 5HS4A 3WFIA 4WGGA 1RYEA 1T1SA 3PPIA 3Q2KA 3HN7A 3FN4A 3DZGA 4NIMA 2Q1WA 2Y67A 2ZB3A 4PLYA 1JKJA 4UVDA 5G0WA 3WMWA 5IF3A 1P44A 1R6DA 2DU8A 3OEYA 1KEVA 3PQDA 4BO7A 4R1UA 3S2GA 4EI2A 3OEWA 3JCZA 4CM5A 1KEWA 1XCBA 3R3SA 1JN0A 4LSWA 2VCYA 2YFQA 1KETA 2YFHA 2YUTA 4J1SA 1EVJA 3QVSA 1U3UA 4E2XA 5HWSA 1H2BA 4NZ9A 1DHRA 2AEJA 2DC1A 5TRTA 3UF0A 4GBJA 4P8RA 5KJ1A 4PG8A 4KMSA 3AFMA 1VE9A 4UVEA 1DPGA 5JFOA 3ZWOA 3LT1A 4L0QA 3DQPA 1E3IA 5KKCA 3ASVA 3L4SO 2X9NA 1T24A 3D1LA 4MINA 5AOVA 2P91A 4CMEA 3WGOA 4BGEA 4BNJA 2I3AA 5L4LA 4KQWA 4NMHA 4ID9A 4KUGA 4ILKA 2I66A 5JC8A 3ICPA 4BKOA 3KM0A 4WE3A 3E1KA 4J7CA 4JJIA 2Y0EA 4ZRMA 5T5QA 1BVRA 1CYDA 3IC5A 4JX8A 3T4EA 3MJTA 3NRCA 4BV9A 2EIHA 2WEKA 4DYVA 4BO9A 1J0XO 2IDZA 1ISMA 1YOVB 2SCUA 1W0CA 4JIGA 4P38A 4Q39A 4EYEA 3BHMA 4CMCA 4BNGA 5CFZA 1HE4A 4UEJA 2CVZA 4PGFA 2AQKA 1UXGA 2BLLA 2VYND 4YPOA 3UVEA 4CMEC 1TB4A 4XR4A 2C5EA 5CDGA 2VRCD 3ICCA 1MV8A 4JK3A 3ZU2A 1QR6A 3GRKA 1DC5A 1LU9A 4ND1A 2D0IA 5HM8A 1ONPA 5JAZA 2AXQA 2X22A 2YQ5A 3R1IA 4MOWA 2F1KA 3HUDA 3ST7A 4CQLB 3CSDA 4CLDA 1UH5A 3ZV6A 4XQCA 4IIUA 3ADOA 4Q3AA 1B3RA 2C20A 2ZK7A 3X2EA 1HXHA 4J49A 1BDBA 3E5MA 4WNIA 4ONEA 4EBFA 1BRMA 1VPDA 2QZ9A 5JSFA 2IODA 5DT9A 1O0SA 4BHTA 1J5PA 5H83A 5DP2A 4J3FA 1GD1O 3AY6A 2R2GA 5TGDA 3N74A 4E0BA 4W82A 5I8ZA 4QTZA 4GVLA 2VZ9A 4GMFA 1I24A 2VYVD 2XOXA 2XXBA 4GWGA 4UVGA 5TS3A 4RPKA 3MWDB 4W99A 1V35A 4AJPA 3FNGA 5GZ1A 3NUGA 1DFHA 3JQ8A 4EDFA 1FK8A 2PD6A 2EKLA 2PR2A 4HFNA 2NTNA 1PJ4A 3E8XA 4YACA 5DBFA 3ZHXA 3TNLA 2W90A 1TT5B 2ZQYA 4ZJUA 2X23A 4N5LA 1ZK4A 3UH1A 4L4RA 4KDEA 4I5DA 1ISHA 1YGYA 1R0KA 4J43A 4XD2A 4AL4A 5BQFA 2IZZA 2O2SA 1BMDA 4GX1A 4CM8A 4FFRA 4LN1A 3I5MA 4A27A 2AQHA 3DZFA 4A5OA 5THKA 3FNFA 1QP8A 4CLOA 1WAMA 2ET6A 1V8BA 2DM6A 3BHIA 3FSRA 4FC6A 4FN4A 4ND4A 1WLYA 1GEEA 3P2OA 3OBBA 5K0ZA 5EQFA 1D1SA 2OORA 4ZQHA 4B79A 2AW5A 4RZHA 4ND5A 2HSDA 3T4XA 4OXKA 1Q7GA 5FFFA 2GERA 4NI5A 3RROA 5IN4A 1T2AA 3O38A 3QWFA 3ZV3A 4CMIB 1P1FA 3G1UA 3GUCA 2P5UA 1FF9A 5ILOA 2GCGA 2Q1SA 2J5KA 3VKUA 1HYGA 1GUYA 4IXWA 4J7UA 3QWAA 1R4MA 4FFMA 3OJLA 2GN4A 1H6BA 1XQ6A 2GN9A 4XZ3A 5EN4A 4CQMB 5EL0A 5DBGA 2P9CA 2B0JA 2GZ3A 2PH3A 3HG7A 3OA2A 4XB2A 1BXZA 4ITUA 4XEHA 4CM7A 1PGPA 4PG6A 2X6TA 2ZB4A 1MC5A 3ENNA 2WWRA 3LF2A 1J6UA 4YXFA 1JAYA 2O3SA 2PTGA 2BRUA 2YHUA 2DBVO 4W6ZA 1JAXA 2VWPA 2XPCA 4OGWA 4JBGA 3I6IA 3QY9A 2FSSA 5JO9A 1PZGA 4UUOA 2EHDA 5JYDA 3HHPA 2GN8A 4D79A 5DOVA 3OM9A 3KEOA 5DDIP 4IINA 1LC0A 1GDHA 2X9VA 3WLEA 1KC3A 3D3WA 3NT4A 4WLOA 1YDEA 4Q3NA 4ROSA 1SO8A 4BNTA 2Z1NA 4CQMD 4WPGA 1BVUA 5G0VA 1ZZEA 2X0JA 1LEHA 3JQGB 1NPYA 4QFCA 3VH2A 2WM3A 3K30A 1QRRA 2IXBA 1DRUA 4YDRA 4YT5A 4KOAA 1D4FA 1A72A 4S3MA 4XR9A 5JMWA 5KTKA 1KC1A 4WCFB 1ZW1A 2QRKA 3F5QA 2V6FA 1X7HA 3WTBA 5A3VA 3OF2A 1ZO8A 2NU7A 3JD0A 3DAGA 3QWBA 4M89A 4CUKA 1ZH8A 1FDTA 1P77A 1U4SA 2NQTA 3Q3CA 1HRDA 3RUIA 3GT0A 1UP4A 5C5IA 1DLIA 1MC4A 4YB8A 1P1HA 5GY7A 4MDHA 4ND3A 1LJ8A 4PCVA 1FDUA 3I9KA 1Y8RA 2CDBA 4FFLA 3PFFA 4MKXA 4Q9NA 2UDPA 3TOZA 1EFKA 5T64A 1HETA 1HZZA 4XKJA 1E3SA 3S1LA 2Y1GA 3BIOA 4NR0A 4GX5A 3GNTA 1BW9A 1V3UA 4UREA 4RZIA 1YE3A 2HU2A 4LCEA 1B0AA 4YA6A 1VSUA 2X8LA 1OAAA 1LXCA 2YDXA 1KVRA 3C1AA 3RC1A 3LDHA 4OQZA 1ZXLA 4GPD1 5U4QA 4JROA 3IJRA 1KS9A 1X0VA 4I9NA 2WD7B 4B4WA 4J1TA 1LA2A 2UV8A 2Z95A 4M54A 1ZUD1 2RAFA 4ZQGA 5THQA 4BKPA 4XDYA 1E7QA 1J49A 3COSA 5TC4A 1AXEA 1CIVA 1R15A 4NDNE 3UCFA 2HLPA 5IJZA 1DC3A 2QX7A 3EK2A 3JQAB 3NTQA 4Z0TA 4MVJI 4ZGWA 1NVGA 1IY8A 1NFRA 3R6DA 2B69A 3R3JA 1SB8A 4DIBA 1VM6A 4A03A 5T57A 2BD0A 2YV2A 3IIEA 1GY8A 3TDKA 1DAPA 3RJ9A 3ZWPA 1NQOA 2QZZA 5L7WA 3SJUA 3C7CB 3GGPA 4BO0A 2BKAA 2VZ0A 1EVIA 1I5RA 1SB9A 1Y8QB 4XIYA 1VI2A 5GZ3A 4AICA 4BL5A 2GLXA 3BMCA 2X1HA 3HB4X 1BXKA 3DFZA 4I5FA 1ARZA 3WQSB 4HP8A 1KY5A 1QYCA 3JQ9A 5F5LA 4PZDA 4XQGA 3H9JA 2WSBA 1X0XA 1KEUA 3RKRA 2JCXA 2PKRA 1ORRA 1AN9A 3JQAD 1B15A 1QORA 4YAEA 1C0KA 4XQEA 5ENVA 4WNCA 3BAZA 3PWZA 4TKMA 5I7FA 1EZ4A 3VZRA 1DIAA 1H9AA 4XJSA 2PZLA 3V2GA 1KVTA 4IJUA 4E31A 2ZIZA 3VPHA 1WVGA 2I65A 3X2FA 3A9WA 2IZ0A 4NK4A 3DHEA 3JQBA 2NQ8A 1UDAA 4K6FA 4L74A 4JN6B 4RDHA 3P7MA 4BS9A 3DOOA 2X0NA 4A73A 5JYEA 3U5TA 3CMMA 4TZTA 4JNKA 3PJGA 3MOIA 4YT4A 3BTOA 3GPDG 3B1JA 3V2UA 4MP3A 4CR7A 3ONDA 2EWMA 3BMNB 4MPDA 2Y0DA 5JXWA 1I3LA 1HDXA 3C1OA 3IQDB 3NYWA 5C3MA 1M67A 4PRLA 4FOOA 1FXSA 3ZWAA 2X86A 4DWVA 4DC1A 5JY1A 4OQYA 3PXXA 9LDTA 3IMFA 2X0RA 1Y9AA 1YJ8A 3ETGA 1OZAA 2BGLA 3STHA 3VPGA 3IP3A 3IKVA 3IL2A 3PYMA 3Q6IA 1RWBA 3RBXA 4YJHA 1ENZA 3H2SA 1LDBA 3JQBC 4UUMA 4CUJA 1YKFA 2JAPA 3ETEA 4RQTA 3H4VA 3F9IA 2CNBA 1GTMA 2D4AA 5COQA 3ZWNA 3WIEA 1H6DA 1EEHA 4MKRA 3OHSX 4DBZA 1VJ0A 2HUNA 1ZEMA 4A0SA 3SBOA 2QG4A 3GNQA 5BR7A 4FBGA 4U7WA 3SXPA 2W2LD 5BNFA 3KB6A 4CM6A 4Y6PA 4IDAA 4DLBA 4M49A 3K8ZA 2HK9A 3DAPA 1SPXA 3GDGA 4Y98A 3RWBA 5CEFA 4XCVA 1HT0A 2I9PA 1P1KA 3GAZA 1GZ6A 1XU7A 4BGVA 5F5NA 3IDSA 5JW6A 3TJRA 2A9FA 2YDYA 1FJHA 1H94A 4XGNA 4OM8A 2FN7A 3A14A 1E1KA 4WK6A 2FOIA 2VUSA 1MX3A 1KIFA 4DVJA 3DR3A 3BMOB 4QFDA 2EGHA 4IZHA 3WWYA 4AJOA 3QV1A 2J3HA 3DC2A 2PGDA 1M66A 1HDCA 2VHWA 2DT5A 2W98A 5ES3A 5ILGA 1NQAO 3L4BA 1XQ1A 1I10A 1PS9A 1K5HA 3LT2A 1X7GA 5LCXA 4YJGB 3U3XA 4P4LA 4DIFA 1A4IA 3Q2IA 4YBZA 2NU9A 3RFXA 4MP8A 5EESA 3DBVO 1K3TA 4KQXA 3P5SA 5C7OO 1LTHR 5TJHA 2EJWA 4DQXA 3EVTA 1CETA 4II3A 3NJ8A 4E13A 1B7GO 3PK0A 3UCEA 2A92A 1QYWA 4FIZA 4TRNA 1ZJYA 2O50A 3MJSA 4LRTB 4R41A 3TZHA 2X7HA 1SOVA 1HL3A 1T2EA 3GZNA 3RQSA 4YWJA 3L4BC 3PQFA 5TIIA 4Q3DA 1P33A 2F00A 1YB5A 5ER9A 4CMAA 1WW8A 2PK3A 4H16A 1PSDA 3KZVA 3RFVA 1E1LA 4RGBA 1WZEA 2FR1A 2Q99A 4Y6SA 4CMJA 2OBYA 1PJCA 5G0SA 3F1KA 2EF1A 2PZMA 4D0RA 2X4GA 3FF4A 3F6YA 3ANNA 4QSMA 3WBBA 2PKQP 3CTMA 4JXKA 3D7LA 3ABIA 4BO2A 5HTOA 3ROPA 5KVSA 1UXKA 2CVQA 4DPMA 1HE2A 3RC9A 4EJ0A 2EEZA 4INAA 3IUPA 1PEDA 1GL3A 4U8GA 3DAFA 5FWNA 3TL2A 1E7MA 1WNTA 5L51A 2Q1UA 5FF9A 4BO6A 3D5QA 3OJ0A 3QHAA 1NHGA 5EMHA 4OJNA 2GF2A 1DXYA 1EDOA 4RPLA 1ADCA 4CUZA 4KUHA 1UZLA 1T25A 2OP1A 1HZJA 1GCOA 4J0FA 4MVJP 3H65A 3TWOA 4BNVA 4CM4A 3DZHA 2BH9A 3I1JA 1E3WA 1T26A 2Q2QA 5C37A 2GUGA 4OH1A 3PHGA 5KJEA 3GRPA 4DMLA 2C59A 1P3DA 4XRRA 3AU8A 4G2NA 1JTVA 2W2KA 4IDCA 3TZQA 4P4NA 3EGOA 1NAIA 1G6KA 4OL9A 4LMRA 4MIYA 1LUAA 2Y1OA 1EUDA 1PZHA 5U1PA 1DOHA 3P2YA 4EJ6A 1QLJA 4O1MA 4DTIA 5ADHA 5JO0A 3WYBA 1E6UA 3SX2A 2NADA 3RVDA 4YQYA 4FGSA 4ZQFA 3AM5A 3FNHA 1GU7A 4NBTA 3NV9A 1DHTA 4F45A 2PZJA 2P9GA 3BA1A 4RLSA 4B7CA 2O7SA 4PVCA 1CF2O 4DREA 4QEDA 3C7DB 4K26A 4TRMA 5JAMA 1H93A 4Z3KA 1U7HA 1NWHA 3VPFA 2FWMX 2VRBA 2VWQA 3EDMA 1IPEA 2DPHA 2V65A 3BMQA 3QIVA 5AQ1A 3LZ6A 5ITWA 1X15A 3EUWA 1DB3A 4NU6A 4Z9FA 2C2YA 4Z9YA 1TVEA 4GH5A 4IQGA 3W8DA 1DIBA 2GD1O 1F0YA 3NGXA 4FS3A 5F3RA 4DL9A 3CEAA 3WGZA 4HNHA 4UEOA 7ADHA 2LDBA 3Q0EA 5A5FA 2JAHA 1PL6A 4HBGA 1NVMB 3GPIA 2BF7A 4AJNA 5B4VA 4IPTA 4CM8B 4EJMA 3HDQA 3U4IA 2HMTA 2VHZA 4AJIA 1EVZA 3PLNA 2HK7A 4BNZA 2BI8A 1PGQA 1UP7A 4IMPA 4ND2A 2Y1EA 4PLFA 1UXIA 4RF3A 4TMFA 2Y0CA 3NT2A 1YQXA 5HA5A 2HQ1A 2J5RA 3ANLA 3TFOA 5H81A 4IQ8A 3W8EA 1LLQA 3K2EA 4R3WA 3UFXA 3TZ6A 3LLSA 2BFPA 3B70A 4FDAA 4J4HA 4L9RA 1MLDA 3C8MA 4KTVE 4PLVA 5KOIA 1MUUA 1NX6A 3DHNA 4ESOA 1XIVA 1N5DA 4MVJH 4N7RA 1XR3A 3PGJA 4FSHA 1GQYA 4N5NA 4BNLA 3JD1A 3HFGA 4LRSB 2YHIA 2O3JA 1GV1A 4CL8A 1R4MB 3ZV4A 5CDTA 1MXHA 2Q1TA 3KHUA 4XGIA 3RIHA 4CMHA 1UZNA 1OMOA 3CZRA 1YJQA 3ON5A 3PQEA 5JDCA 5AXDA 3ULKA 3U4DA 3QVXA 3ZU4A 3VH1A 5DBIA 2BMAA 2IEBA 4CMKA 5A02A 2OFPA 1K6JA 4L4XA 1NPTO 1XGKA 3ZW9A 3EHEA 4ZICA 1WXDA 3KV3O 2J3IA 3U9LA 1T2FA 1HDZA 1IPFA 5A9SA 1A71A 1CERA 4LVUA 1PZFA 1O89A 4OSPA 1GZ4A 5GZ6A 2P4QA 1ULSA 3JYQA 1F12A 4WEQA 3UAGA 2X5OA 3NEPX 1XLTA 3WNQA 4BV8A 2Q2VA 3ONFA 4B4OA 4BMSA 2R00C 2ZB8A 1A4UA 3NJ4A 1LLDA 3QVWA 4MP6A 5IDWA 2B4QA 2RHRA 1NR1A 1X7DA 4R1TA 1OFGA 3D3WB 2VZ8A 4NBUA 1LI4A 3QVOA 5JDCC 4Y9DA 5JMPA 4KP7A 2IXAA 5B4UA 3BTUA 4IGEA 3ZI0A 3EZYA 3GGGA 3LC2O 1BWSA 3H9EO 1BG6A 1EQ2A 3QE3A 1RYDA 1EE2A 4L76A 4J90A 2Y05A 1R0SA 4KWHA 1OC2A 3NTOA 1EUZA 1U8XX 2DAPA 2GO1A 1PTJA 4BNUA 3T7CA 2RCYA 1KVUA 2ZTUA 4OXNA 4WASA 1V3VA 1SMKA 3ANMA 1YBAA 4HADA 4GLLA 1GZ3A 4PLHA 1XKQA 4HFMA 4R54A 5KNLA 1Y7TA 1GAEO 1NBOA 4Y6RA 2GN6A 4WUVA 2CDCA 2I76A 4N5MA 3S2FA 4ZN6A 4D45A 3N58A 3A06A 2Y1CA 5TNXA 3M2PA 1Y8RB 1GEGA 1IHYA 1KEPA 3KYCA 2ZJ0A 3PJEA 3MCVA 1KOLA 4BO8A 4K9DA 5G4KA 4C7KA 2HRBA 5BNIA 3OJFA 3GK3A 1IZ9A 3PFWO 1Z6ZA 3F5SA 1JU9A 2ZCVA 1BW9B 1X1TA 3I9LA 2YQ4A 1EE9A 5TX7A 1RM5A 1F17A 3TFQA 4CMBA 1GYRA 4E2YA 1LNQA 3D0OA 1WDMA 3PZBA 3RU7A 5FI5A 5TQVA 2XXJA 3PDUA 3WGQA 4LCJA 1D1TA 2WDZA 5C7LO 4BO5A 4CLRA 2WYWA 2B5VA 3TOXA 4AJKA 3GG9A 1U7TA 5K9ZA 2X5KO 4MVJM 1WPQA 4D46A 3MJ4A 3K9QO 5T67A 3VTFA 1DC6A 4E32A 1PGOA 1JDJA 3AUSA 4BGUA 3H5RA 4MVJE 3WQRA 3JYPA 1F14A 1PX0A 3LC7O 4XYBA 3MJVA 4BKRA 1GV0A 1WMBA 3H5NA 2FZEA 3WBFA 3WSWA 4Q3EA 4BKUA 1PJSA 3VH4A 4AJEA 3C1TA 1Y9EA 3HDYA 1VJTA 2GASA 1EDZA 1P0FA 1AE1A 2DTXA 4LISA 5IZCA 4TSKA 5JNLA 1HE3A 4CLHA 4CV2A 3OETA 1IYZA 2EERA 4CV3A 4NH4A 3ZW8A 3WSVA 1TLTA 3ZWMA 1XYGA 1Y1PA 4J6FA 4BNXA 2NV6A 4IBOA 5L45A 1VKNA 5BNTA 2Y66A 3Q11A 4L8VA 4XYEA 1P1JA 3RD5A 4QX6A 4YQZA 4ZQEA 2B5WA 1VSVA 4HV4A 4XYGA 3WXBA 3L6DA 1DIHA 1GUZA 5HRUA 4H7PA 5MDHA 3AM4A 3HZZA 3NX4A 4EEZA 4NFYA 4F6LA 3O26A 4ALIA 2DTEA 1I8TA 1Q7CA 1NR7A 1NQ5A 2H5LA 2O3QA 3FI9A 1ID1A 4QECA 1ONOA 2AHRA 3EW7A 4JGBA 1U3VA 4W4TA 3PHIA 1ZVMA 3PIIA 4IJWA 3WWZA 3OIDA 3DOJA 1ZKMA 2Q4BA 3NDJA 2EW8A 2X5JO 5IZCC 3U4HA 3OICA 3E03A 4I8XA 3PP8A 4PG7A 2BGKA 1C1XA 1HDRA 3QWHA 2BELA 2BFAA 4E30A 3G79A 4R51A 3JD2A 3KYDA 1HWYA 4NBWA 4FJ1A 3GA0A 5EERA 3RFTA 2ZB7A 1I2ZA 1LDNA 1P1IA 2HRZA 4LMPA 4PZEA 3UN1A 4BQRA 3KSZO 1LRJA 4BUCA 2JD1A 3RUDA 1B8UA 1PQPA 1Z73A 3JQFC 4D44A 4M55A 2G76A 2IE0A 4YJHB 4EUFA 4R9RA 1R37A 3HNPA 1G0NA 1PL8A 2GRAA 3PHJA 3W4KA 1YOVA 1YBMA 3CZMA 4C4OA 4DLLA 4E6PA 3AUUA 1QG6A 1LSUA 4RL6A 4YRBA 1O6ZA 1MB4A 4NK5A 4BIIA 3JQ7A 4E5NA 4LGVA 1T1RA 1A9ZA 3BZUA 3G49A 4GL4A 2D5CA 3M1AA 3LYLA 3FR8A 3DFUA 4BB5A 4YRAA 4R3NA 3VZSA 4TVOA 3DBRA 4YEDA 1E7YA 3VTZA 5A05A 3DMTA 5F1OA 2FPIA 3GOHA 1GQQA 4D7AA 1M2WA 2PY6A 3GN2A 1GPDG 1K2WA 1P31A 1E3EA 3K2BA 3RJ5A 2B35A 1ADGA 1GYPA 1U28A 2DFDA 2QRLA 3OIGA 1C0LA 2GSDA 2ZQZA 3AY7A 4DLAA 3GR6A 1RM4A 4JJFA 1DRVA 3PGXA 5ER6A 3DBLB 3VVBA 2NVWA 5K6AA 1YXMA 2Z1MA 1YB1A 3BTVA 1E3JA 2IEDA 1ISJA 5L40A 1MP0A 3HJAA 4XGKA 2NUAA 1T2DA 4KZPA 2AEMA 2EG9A 1Z7BA 1FDWA 4DA9A 1DJNA 1V9LA 4W7IA 1W8DA 3DMTC 5B4TA 4DBVO 1ZIDA 4LK3A 4RV9A 5B12A 5T6BA 3SC4A 2PWZA 5I7EA 3WYEA 2BGMA 3WGYA 3VVCA 1V3TA 4EGFA 1DRWA 1H2HA 4BQPA 3ZHBA 1V6AA 3GFBA 4FCCA 2I99A 2JCVA 2LDXA 4BB6A 1JVBA 4S1VA 1WDKA 2FPGA 4BNFA 2GPTA 2WYUA 1HEUA 5K6AC 1B8VA 2BFOA 5TT1A 3GVHA 2ZYAA 3GZNB 4TRJA 4ZA2A 4B4UA 1YBVA 1PIWA 4RVSA 2X9GA 3WOHA 4HFRA 4ALNA 1VLLA 4AJHA 2QW8A 4CLXA 3U0BA 2HCTA 3RSHA 2GR9A 3NGLA 1I3MA 2J3KA 4PN3A 2P4HX 1I3NA 1NTOA 4FOSA 3WJ7A 3G0OA 3QRWA 2BFMA 1O95A 2AEFA 4NJOA 4OMUA 4P22A 5CEJA 2YY7A 1HKUA 1Q1NA 2J5QA 5DP1A 4PLGA 2C7VA 2CUKA 3K6JA 4O63O 1QLHA 3MJCA 3WX0A 4E3ZA 4NJMA 3R0IA 4OHUA 3I9NA 1M75A 3KLPX 4NG5A 2RBEA 2PH5A 1RKXA 4K28A 4FFOA 2VNAA 4WCDA 3JYNA 3SC6A 1GYQA 2C29D 4NBRA 3WB9A 5KVCA 4GX2A 4M87A 2VUUA 4ALMA 4B3HA 1HDGO 1ZK1A 5EPOA 4U5QA 3EYWA 2RH8A 1WP4A 4WLUA 3SJ7A 4J4BA 1VKOA 4CL3A 3UICA 2CZCA 1PJBA 5I9NA 1UZMA 1QSGA 1JA9A 4H3VA 3RUHA 5CG2A 3W4JA 2AE2A 4IDBA 4RCVA 4OOEA 2C07A 1EQUA 1XWFA 4G5HA 1MG5A 1U2GA 2W2KB 3PLRA 4JP3A 3RBZA 3WYCA 1KYQA 1T2CA 5BSEA 2GZ1A 3QP9A 5LDGA 3I6QA 2C5AA 2JJYA 3PWSA 1LDYA 1AGNA 1E5QA 4E5PA 3JQDA 2VHXA 4D41A 3U49A 1E7WA 5KJFA 1ADBA 4B8WA 4BNHA 1M76A 3ZNQA 5DNAA 3L9WA 4C7JA 2Q50A 2EP5A 3RASA 5I9LA 2IZ1A 3PIDA 4LW8A 1E5LA 5LC1A 4ZQBA 4BNKA 1C1DB 1PQWA 3ZH2A 5F1PA 1SCUA 4R4JA 2DQ4A 4OKNA 3VDRA 2OMEA 1E6EA 1PJ2A 1TA4A 2FP4A 5G0UA 1GFSA 4FW8A 4O59O 1PGJA 4E2ZA 1E1MA 3VAZA 4EUEA 2QHXA 1F8FA 3BMQB 4BO3A 4GSLA 3C85A 3A1NA 1FDSA 2NVBA 4IMRA 2OHXA 2DUUA 4CV0A 1E0DA 5CEEA 4UUPA 3RUFA 1N92A 2E6UX 2O23A 3ZZNA 5IXSA 5T8KA 2RHCA 3AFNA 1C14A 3E18A 2B36A 2J8ZA 4BVAA 4WCFC 4WLNA 1P74A 1IE3A 1AHHA 3RUAA 3P19A 2ZJ1A 1E7SA 1C3VA 2BI7A 3KVOA 3LK7A 5EIOA 4BO4A 1DEHA 4CLEA 3JYLA 3O03A 4AG3A 1XHLA 2DPGA 3I23A 4RLHA 3WS7A 3FWNA 4O5OA 3MWEB 1V0JA 3ROQA 1ZCJA 3PYXA
chains in the Genus database with same CATH superfamily
3W6PA 2YZMA 5IAAA 3FOBA 1M8PA 2IW1A 2YMLA 2BSQA 1CVLA 3H86A 1YK0A 3Q7TA 4LFAB 3BERA 1ENPA 3OZAA 2IK8A 4MB0A 1IVNA 2FMKA 2Q2WA 1EGAA 3EBPA 5EI5A 2R86A 3UFXB 3RB8A 4JVMA 3UHAA 4H08A 1SHUX 1U11A 2FWNA 3MAAC 4G63A 3SXJA 4PYKA 2ZIEA 3ZD6A 1I32A 4WECA 3ZHQA 1LDMA 3MTQA 3AL0C 2QN9A 1E2IA 2WHXA 4JLOA 2IYNA 5G0TA 3K35A 1YZHA 2Y9MB 4JBLA 4D02A 1RKQA 3W1VA 3HGMA 2IITA 1JJIA 3QKTA 4J75A 4O33A 4JEIA 4X93A 4BO1A 4RZ2A 3RUPA 2ZRAA 3BH6A 1M0EA 3OOEA 4P4GA 3U0VA 4PXYA 3ORQA 5IDXA 1WZNA 4K86A 1M6WA 3K3PA 2Y0PA 1DX6A 3EH1A 4EB6B 1KJZA 3T5MA 3BWMA 2VDKB 4O8ZA 1ZC3A 1MENA 4H7KA 2DKFA 4M1KA 2VPPA 5HSGA 3OQMA 1KS2A 1EG7A 3HI6A 4DMKA 1SKYE 3KQSA 2GN2A 2ORIA 4GOJA 1ABBA 3SR4A 1Q21A 3C2QA 1OGJA 3B9QA 1IONA 2FLWA 4HY3A 5A9SB 4Y6LA 3IPCA 2R7AA 5IJ0A 3LHFA 3FCYA 4D6YA 1HDOA 3ABZA 3INNA 3QPVA 4MVJF 4AVYA 4B74A 3LA8A 4JKIA 4YAJA 2C7BA 1QVWA 3HZRA 1E79A 3H2IA 4LOLA 1E8DA 3COZA 4ND7A 4RX1A 3CCFA 3B2EA 4KZKA 3NT5A 2FR0A 1I1NA 5EZ5A 5ILQA 1RXEA 1ZNYA 4GYWA 5CH3A 3TW8A 3DNPA 2P8JA 2SNIE 1YA8A 2D5AA 2VJQA 5CW2A 2JGMA 1TJPB 1X9HA 5DYNA 1S6YA 3BWXA 4BMCA 1P3JA 5J4HA 4D3SA 1OB5A 4ZMBA 1ISGA 2XECA 3ZHZA 1TUBA 2F8SA 1LX6A 1SOUA 2A7XA 1C7IA 1QIJA 1IUKA 2ZW9A 3LKDA 4MB2A 3FPAA 1E1RA 3UJ7A 4XRGA 4L9AA 3F71A 4UEKA 3B7WA 1G16A 2HRQA 3VBEA 5CJPA 5JPIA 1AKYA 2DBRA 5FPPA 1Z15A 3JQCA 1LRKA 4CMGA 3QPUA 3H6KA 3Q7PA 2X4IA 4K81B 4OD0A 1H0HA 4I1PA 1XDUA 3VNSA 1ZRMA 4LQDA 1BYIA 5IM5A 1YACA 4HWTA 4CM3A 2C7GA 5CLHA 2QTCA 3ESYA 5GVRA 1R6BX 1N2JA 1JEJA 1ZCZA 1N2SA 1GVHA 1J24A 3I34X 2QXTA 3SXUB 3NGMA 5G3ZA 5H82A 3WLOA 2FPPA 3P52A 4B7AA 3SFVA 3U3KA 1JU4A 1DG9A 5AVJA 4QJ5A 4URFA 3DZKA 3IR5A 2D2XA 1P72A 2ZR8A 3RHZA 1AQLA 3A6EA 3NVMB 1I36A 1Z12A 4UULA 1V7QA 3R6TA 1K7CA 5G4KB 1W30A 5JROA 4OIMA 3RDPA 4ARZB 3GCWA 3PJFA 1CNMA 1BHO1 3L8GA 1NZFA 4IOKA 4IIEA 3RT1A 4HHEA 3R75A 1J20A 3L0ZA 1CV2A 1KJYA 5JD3A 1VYUA 4EHNA 3WDSA 1XD9A 5LOVF 1QC5B 2YWHA 3RTEA 3O8QA 4OSEA 1J5EB 5LDDC 2POCA 1IOLA 1L7OA 3UOWA 3AZPA 3ZQUA 1E4VA 4GLFA 3W9YA 1N7IA 2ODEA 1U0TA 4URYR 5JBNA 3DWEX 4R9SA 5DK4A 1WNFA 5JH7A 1NVFA 3GFGA 3LPNA 3AKEA 4C7OB 2H0QA 1UUFA 2GQ0A 3CH4B 3GELA 3QY0A 1P5FA 3FSJX 4DA4A 1MFZA 1YMVA 2HREA 5EUBA 4L2IB 1R8YA 3LU1A 1QMGA 1SJ9A 2CLLB 3GFQA 1YDWA 4J1NA 3UXYA 4NFSA 4WY8A 4KXNA 5EMKA 5K8CA 3ADPA 3T3OA 2BONA 4CEJB 1J9GA 3DP9A 4MKIA 3TVTA 1DI0A 4YJGA 1R0XA 1PJQA 3C5HA 1DJLA 3LY5A 4E14A 1UC4B 4O2LA 1FUIA 3SX0A 5IYZB 1YKSA 1WMEA 3NUZA 2J45A 3HVKA 3MMSA 2J32A 4JKOA 3KVNA 4M21A 1MOSA 1R6VA 3LMKA 1Y1KE 4WNYA 5HUJA 3MT0A 3PENA 2ZWAA 3S99A 3L0SA 3D8TA 4EL5A 3GN1A 3TBFA 2C9BA 5KIAA 4B9AA 4QU5A 3M6LA 3K09C 4A4DA 4W8HA 2D59A 3KR2A 1N5OX 1RYZA 4HZUB 4RFSA 1R6AA 2VS1A 3ZDYB 2G36A 2ZWOA 1DFGA 1FNNA 5ICMA 5FA8A 3WNVA 3K72B 3IULA 4JBWA 3RC2A 2N0SA 3CX6A 1FMCA 2UVQA 3BRWD 3V1KA 1H69A 1T8WA 4LS3A 2FFHA 1FMLA 5CP8A 1EHCA 4KLZA 3S8MA 4TTIA 2CZGA 4N5DA 3U62A 2CV2A 3GLQA 3OLWA 1VBMA 4HX9A 2EJVA 4LQLA 1P6QA 2C82A 2JASA 3T3PB 3AG6A 4AUMA 5FV4A 4J2HA 2JFGA 4PHTA 2IWHA 2YTZA 1ZHHA 3A7EA 4X44A 2QYTA 1MXFA 1NIPA 4LZZA 3UJPA 4WUTA 5KWEA 1TYDE 1Z0KA 3IESA 5JE8A 1LV7A 1ZOIA 1P6UA 1IXKA 1GZHB 2D1YA 2HAEA 1GA6A 2GVZC 4LVCA 1U9JA 3ICEA 1SBYA 2QRNA 1SXIA 1WHTA 2ZRPA 3ZD8A 1NW7A 3AVXA 1U3TA 2ZAYA 1H2AS 2W6QA 2IV3A 1RLUA 4H1HA 4ITVA 4AKHA 1W9HA 3A9SA 2HHLA 5DF1A 2VEOA 3GQBA 3GGCA 2RHGB 2CCKA 2C9MA 4X65B 1OIXA 3MSXA 4XH9B 5DKFA 5DW0A 4DDWA 1CDOA 1AKRA 4MGYR 4TT3A 2X6QA 2RI0A 3RSOA 4P5DA 2PMCA 2W2MA 4O4LF 1Y1RA 5HQ3B 1Q7BA 1CHDA 3EVBA 1I94B 2WWWA 5AK3A 5G3YA 3PL1A 1Y6RA 3C0KA 4I2NA 4OQPA 2I8CA 4MVJG 5D00A 2WVJA 3S2EA 4G9EA 3DE4X 2C4WA 3DLPX 2WUWE 3P2MA 4JL8A 5IDQA 1NHWA 3ACBA 1U99A 3QKUA 2FJ0A 4FVTA 3I1IA 3OT1A 4TX1A 5HMMA 4J0QA 2G88A 4MJXA 2J6CA 2OCYC 4AZTA 1KDTA 4OJTA 2ZXFA 2CLIB 1JE0A 4N6GA 4K6MA 2HZBA 4XSHA 2NZVG 3IT0A 1DOZA 3U7QA 3FNEA 3ZH9B 4CT0A 2GYYA 3EEQA 1AMOA 4HDCA 1QRUA 2G7MC 3O8LA 3B1ZA 2F8TA 2AR0A 1O96B 1VKRA 2V7WA 3L5KA 3LBYA 5KVQA 4WL0A 3TCXB 5DGXA 1QMPA 2BISA 8OHMA 5B6PA 2AZ4A 3IIIA 3JVDA 4IV8A 2ZZKA 2XUKA 3E84A 4JUFA 4PVDA 5JISA 5L95A 1YBHA 2NACA 4BMVA 4HNAB 4D43A 4RL4A 3MS2A 4NCHA 1U3WA 4ALLA 1TD1A 2EDCA 2GEVA 5CUQA 2OUIA 5DW3A 4ZXPA 5MGBA 5FUXA 2PM8A 2YY5A 2L0XA 1XJWA 3MINB 4OY3A 4F3RA 4OUDA 3A31A 5ENZA 5L3SA 3G2PA 2GEJA 1NMXA 2N9UA 3BB1A 3BQNB 3KSUA 4FQ5A 2BFEB 3WNZA 3UCXA 2Q6VA 2QNBA 3EAQA 4GOND 3NYRA 4KLAA 4XWAA 3QELA 4OU4A 1VMDA 3ROMA 4EHFA 4C06A 5JC1A 3A9RA 1ZMRA 1TVKB 2HJVA 4PC2A 4C6TA 2O4UX 5C4GB 2Z4RA 3P0HA 2VG8A 1VOTA 1OOEA 3EZ2A 4BDSA 3AUKA 3KXDA 4D82A 1IJBA 2IP1A 2NO4A 2ONYA 3IAXA 5CR9A 1Y5MA 3LT4A 1KH3A 2FN9A 2WWIA 3WMGA 2D1FA 4HVTA 2CYBA 3INRA 1BX3A 1VGRA 4GZ5A 4RF4A 3L93A 2NWQA 1K8YB 4LRUA 3SSAA 4CKCA 2NUAB 1W5TA 1II0A 3QVJA 4F1WA 5IDYA 5BVGB 2R8EA 1YJXA 1ZOPA 3K1TA 1CR1A 2MWMA 5EIEA 2E4YA 5E7MA 2ZE5A 3CE9A 5B3KA 3LL4A 4M38A 4Z3DA 5B1YA 1EVYA 3JWIA 4K1LA 2Q7OE 1QQBA 1JIXA 2ZYGA 4MW2A 2H9YA 2P78A 1N75A 2H9IA 2DXIA 2G1UA 4NYIQ 4JP2A 5BR4A 4O1HA 1SEPA 2VNSA 3PD1A 4PAGA 1EK5A 4X6YA 4BP1A 4EY5A 4DR7B 1Z4JA 3VJRA 1ORDA 3GEBA 4ZXFA 1ZSNA 2P2SA 4PCUA 3U5ZB 4HN4B 4RBNA 3H2KA 2G82A 2INGX 4TVSA 2B8EA 4ALJA 1T43A 5LIRA 2DHRA 1IZ0A 1P0MA 3AVPA 3I9JA 4B7XA 1KFJB 6PFKA 5L4NA 1IHXA 2MYPA 3ETDA 3KNZA 3ZWBA 3M49A 4HAXA 1F8GA 3NQ41 4IFBA 2WICA 4EUSA 4RIGA 4BZWA 1M34E 3DWIA 2Q8QA 4WI1A 3TYXA 1WQ1R 3CE6A 3EVFA 2QD4A 4U7DA 3EY9A 3PXDA 3ZW7A 1F8UA 4OGGA 4YAFA 3M89A 2IS2A 3JQFA 3FHTA 1ECGA 1VFNA 3NEAA 4A0RA 3WGIA 4MIEA 3BS4A 1GGKA 1UK6A 2NXWA 4LHVA 2A0YA 4MWSA 2IHZA 3DOFA 3RC7A 4E5UA 3BD8A 1TJYA 1FQOA 3MUEA 2CK3A 2QM8A 2B7BA 2H57A 4MR9B 4V38A 5BSHA 1Y89A 2WZCA 4JLWA 3E3NA 2GM5A 1CKEA 4JVOA 1NN3A 1LPMA 1SEVA 1EBFA 1R3DA 2FX3A 3MJHA 1DKNA 1DJQA 4PSDA 1XEXA 3KETA 1P2SA 1D5CA 4JMPA 3FR7A 1DKMA 3TUJC 2Q41A 2LCFA 1XCJA 4LE2A 1Q0HA 3LSTA 5EJ9A 2FYTA 1X7WA 4OM7A 5FYDA 3UWSA 3TPCA 4ENRA 5JNRA 3G0HA 3E5RA 4YJKA 3KOMA 3GAAA 1VRCA 2AOUB 1WEKA 2ZIWB 4J7XA 5CMLA 4A0HA 4NV0A 3OECA 5FO1A 1RWXA 4TYWA 2O8EA 2HFJA 1RZ3A 1SZJG 2BKVA 5D01A 5B7PA 2PFSA 2WTBA 1N1DA 5DULA 4HQKA 1ADFA 5C8ZA 1VA5A 1H6CA 4KPGA 4D42A 2GEKA 4R6XA 1K8QA 1S0UA 2PSHA 2WTNA 2X40A 4MB6A 1FX0A 5TQJA 4RNCA 3WGVA 2Y99A 4E5KA 1Z7YA 4AF8A 3N0VA 3HJRA 1MA0A 4GXRA 1G0OA 4HZIA 4RPGA 4UOZA 1S2GA 3JY6A 4YT8A 4HTFA 4KR3A 1L7BA 3PTLA 2IYEA 4LZPA 1B0PA 2YYYA 3DBOB 5A3SA 1QM5A 2EWVA 1SAYA 4H0FA 4XJXA 1MD9A 2ACKA 3BGVA 3RSCA 3RSQA 2JDID 1PR3A 1RJGA 2WHPB 1EE1A 2GZ2A 4MI9A 1A8QA 1DBVO 3BK7A 4RJ2A 5JBQA 1OKKD 4N8DA 4RELA 4Q66C 4DMGA 2VZLA 3NAMA 3MEQA 3PGA1 4Z99A 3K1YA 3NNNA 3H7AA 2HBYA 3BFJA 4IXNA 3T7KA 4HATA 2Q8PA 4LNUA 5CH5A 3M6FA 2C61A 1KI9A 1EFRA 2GZRA 821PA 3O90A 3WOVA 4LY9A 4NBKA 2F9FA 2C9CA 1LK0A 1TEZA 2SBTA 4M0UA 1X1DA 5G53C 1E2BA 3TFWA 2SKDA 3WLTA 1QYXA 2XWJI 3H5LA 4NAVA 3ZGZA 4ZCTA 4Q7QA 4BMXA 1HQCA 4KEAA 1SZPA 3D4OA 2YJ3A 4CGZA 4BNDB 4P31A 2QW1A 2ZBDA 1DXOA 3RS0A 3ZWDA 3HHEA 3MOGA 5BWOA 5DBEX 5AYVA 1MZVA 1L7AA 4UASA 4DOMA 1QFSA 1D6MA 5BUCA 3P0RA 4NV3A 1A7UA 6AT1A 3OZBA 2DECA 2B25A 3SYNA 1ODSA 1V6CA 3TTTA 1XK7A 2ECPA 2GEFA 1JG1A 3LCMA 4HMQA 2HF2A 3Q8XB 4D92A 4B3CA 5JAOA 3TRIA 3A1WA 4EOGA 4KYVA 4N0MA 3BWYA 3A2MA 4JCCA 2HIAA 2Z2YA 4KPUA 1JHPA 3CNNA 3RSZA 3AGQA 4X41A 1Q7EA 3SD7A 3RYFB 1XF1A 5J1TB 3SICE 4B3IA 5IKXA 2FQYA 3LUGA 1I01A 2VXBA 3RTBA 2VBIA 2P7IA 3B38A 2JCSA 3E9QA 3IEXA 1B74A 4QPPA 3ZBQA 2XZOA 2CLDX 3T35A 4LZWA 2AQ8A 2ZYDA 3OZWA 4G65A 5IXJA 1O97D 3RLIA 5KAPA 1YVUA 1Z6QA 3HVUA 3JR7A 2PN1A 2XX3A 1H9BA 2X14A 4CCYA 2ACWA 3L07A 1U0HC 4U2CA 5E1MA 2C2ZA 2PFGA 3DL4A 4AW9A 1V2HE 4EW6A 4FFPA 2P62A 5IFLA 5SY6A 3UKJA 3CRVA 3SHQA 1YCFA 5K0JA 3STUA 4D9JA 2ZI5A 3WK8A 4N76A 1COWD 1RYBA 1B43A 1C30A 1Z0AA 3KD2A 4U2KA 1ETHA 4YRQA 2D5IA 421PA 3FFBA 3I9V6 5G2OA 1GPMA 1QCZA 2OE2A 1JQJC 4J1TC 1NG1A 2VLBA 5A2QA 1WL8A 2R96A 4I5GA 1PBNA 4BJ1A 2Y1KA 4BKQA 1AH2A 3WTCA 1ZIPA 3EQ8A 1RHRA 1N25A 3PJDA 4M0EA 4QQRA 3L01A 2C0CA 4URZR 2FCRA 3H9BA 1C8LA 4HRXA 2ZLBA 3ZJVA 3K5PA 4ZRNA 4N47A 3L6OO 4ZPJA 2AWOA 3JAWA 3KOUA 5KHOC 2FQXA 1FZTA 2Y1LA 4HGNA 1XHFA 1XZIA 4OHXA 1J8QA 2C9DA 3BC1A 5TGZA 3THXA 4OEHA 3GEDA 3HN6A 4TKVA 4FFBA 3WZLA 3GHYA 1YZKA 1P2VA 3ID6C 2AMYA 1G9TA 3GG2A 1YAJA 2OILA 3VAYA 2QQ5A 3ZGXA 3KFLA 3CPEA 2L69A 1O2DA 1BMFD 4LC1A 4DJFC 2W22A 1P18A 5CB0A 3DS8A 4Q3OA 2GO7A 4NDZA 2IYOA 1GSOA 1YIDA 3D3EA 3RNOA 3BK1A 4MWDA 4EYSA 5CT5A 2CCJA 1ZD5A 2P9TA 2PTHA 3G1WA 5JQGF 2OHGA 1TZ2A 3K1AA 5AJHA 5EIFA 4DRYA 3K0FB 2FW6A 3H3FA 1L5HB 2R6JA 2D6FA 5F7XA 1Z0ZA 3LD9A 1UAYA 1KYYA 4FZVA 4IDEA 1BHSA 4L8GA 3ZDCA 2WHRA 1CQJB 4PLTA 3WLSA 3V42A 1NBAA 4EZBA 2XEXA 3AILA 3HV0A 5BOSA 5LMNB 3B82A 2VK4A 1K98A 2EFJA 1E89A 3KEMA 2FQWA 3GFSA 3B20A 3TOVA 3GMIA 1RWNA 2YVKA 2FSUA 3PNSA 3T38A 2I4IA 3ME5A 4F46A 1EUDB 4JLKA 1GAJA 4BAZA 1RFLA 1Q0SA 3CUSA 7MDHA 5I7UA 2VRWA 5BW8A 2FN8A 2GVDC 4X0EA 4ZTZB 2I3DA 2XZPA 3HBLA 3NHUA 3HU1A 3Q1LA 5BQXA 3JS5A 2FR8A 4MWTA 3UUFA 4N7JA 3GD5A 1PFVA 3E8SA 4N54A 4WCFA 3DVSX 1WLSA 4B43A 3NONA 3G8CA 5CXQA 2OHIA 1T4CB 5IT9A 3FD8A 3W9BA 4QNNA 3EIHA 5AVUA 1AGRA 5JJBA 2HNBA 3ND5A 5L8VA 3H8VA 1R0YA 2YNMD 5LXTF 6CHYA 1X1EA 2JLRA 4W8GA 2I80A 4B3TB 3QEOA 2GN0A 2GILA 1KMHA 1IB6A 5DXJA 3UUWA 3OMXA 4TKUA 3HBNA 4DLKA 3RK1A 1QXSA 5LZ7A 3CNHA 1B8NA 3DTTA 3GP3A 4DIKA 3EHDA 4BFUA 1P39A 3JASA 4Y2XA 2Q6IA 4O2AF 3ETHA 4JR2A 3AI3A 3S29A 3BJRA 3B9PA 1FRZA 3BDVA 3QG1A 4IVPA 4LE1A 4Q1AA 2FW9A 2Q3HA 1DQRA 3F5FA 3GP5A 3I72A 4C14A 4DCJA 4DPKA 3HDJA 3EPKA 1J42A 3AUYA 5SZHB 3ZN2A 3K05A 3MCUA 3LBHA 4RMJA 4X7PA 4TMZA 2G7ZA 4RH0A 2KSQA 2ESRA 1QCYA 2WMNB 4NTZA 1HSZA 1QKIA 2WD7A 1Y98A 4V0LA 1N7GA 5AVTA 2CF5A 1X2EA 1A7KA 3G68A 5DASA 5ALMA 4RESA 3N70A 4J2OA 5LQCA 3IUQA 3U4QA 2CNWA 4QU9A 3EUEA 1VHDA 3OFVA 1QHIA 2JJ1D 3C3XA 1H2RS 4WJZA 1LZKA 4LF6B 3TZEA 2HA5A 3CGGA 5CW1A 3A4TA 1FDVA 2DWCA 3FETA 5U9CA 1QNFA 2PEZA 4F8JA 1AUPA 3O3MB 4DDUA 3ZWWA 3TF5A 2JVJA 3EIQA 2E3JA 3PRJA 1D9ZA 4UU0A 3ESQA 5F76A 3FPEA 3RCBA 2P8SA 1GGMA 1ZC4A 4KVFA 5EIAA 3GMSA 3QU7A 3VR5H 3G3EA 1JDSA 4W63A 4F21A 1Y8QA 2XUJA 4KBFA 4ER3A 3CQ9A 1ZD3A 5AQEA 2XEDA 4WCVA 3N5KA 4F4UA 4CG0A 1MABB 3W8NA 1CNFA 3KSRA 2ZSBA 3AEQB 3K2QA 1TK2A 2RKWA 4X61A 1EESA 3M2TA 3SPXA 1YJAA 2WT9A 2FPLA 5JS6A 2RC5A 2J7PA 4WBSA 3IYLW 1J99A 1A5AB 2R1TA 3L41A 1Z37A 3ZU3A 5MN5A 4GI3A 1NVTA 2CXUA 2OV8A 2I4OA 3AB8A 1XTQA 2GEBA 2UYCA 1C3EA 1G3MA 3IKMB 4AN4A 3GBVA 3ILVA 3TJMA 3K6SA 1GPYA 1Z6GA 2A0KA 2O8BB 1EBUA 4WLFA 1NUPA 1XVVA 3TO5A 4B4KA 3ENKA 2H4XA 1CZNA 5JVDB 5I4BA 2ZOSA 2WV9A 1NP3A 3PI7A 4KR0A 1NM5A 2Y27A 2J3JA 3BILA 2G25A 2HYIC 3FAZA 1KDZA 3JTMA 5ALQA 4Y2PA 4PICA 4Z8XA 2DJ5A 1V47A 4YXWA 4J76A 5IHPA 3PWKA 4GMGA 1E2UA 3I2KA 5ALDA 2AA3A 5IDVA 3W4IA 1CJUC 1D7OA 1HYEA 4TN5A 3FPCA 1E4OA 3LL7A 1JZSA 5KS2A 4PGGA 1ZXBA 2ZKLA 2G28A 1RQRA 2WB4A 1E9RA 1SU6A 3VKHA 4PPFA 3OQ1A 3BMNA 1G7RA 2D2IA 4K5QA 4EO7A 2FMFA 2IQIA 2IX9A 3QITA 2B21A 2JC3A 5L6LB 3HUUA 3T9EA 3DWFA 9ABPA 4QLOA 4QUIA 3PFGA 3IPYA 3MJEA 2VQFB 3TR6A 4MYCA 1G41A 2DBQA 1W85B 4EBBA 1Q0QA 1B1AA 3FNBA 1AHIA 3H5AA 4N3AA 4YJFB 1QQAA 1NM5C 1EJ6A 1I2CA 5C34B 4CQJA 3C6YA 4IDFA 1C9YA 1U2SA 5AIAA 1JVSA 1CRWG 1K75A 1FFDA 5CVCA 3TD9A 4DMMA 4EHKA 4UM8B 3KU1A 1R5OA 2BOVA 2FUNB 2IGBA 2QTAA 5JSYA 1GQSA 2NT4A 1G7CA 1X9IA 3QE0A 2HYDA 3NTUA 2XCSB 1B76A 2C54A 1W2GA 4E1BA 2J3EA 3COWA 4CM9D 5CXSA 4M98A 4ZT7A 3BEOA 2ZATA 1YBFA 5ALJA 4BJ6A 3NKVA 2E89A 1I3KA 4EMSA 3A10A 2QMOA 2QTRA 5ENDA 2GJ8A 2AJCA 3L7MA 2ZTLA 1M9NA 1D2RA 1Z08A 4TN1A 2E1PA 3S1SA 1JKMA 3WP1B 4IMJB 2ZI7A 1LF5A 2ZJAA 3FSEA 2V9CA 3F6CA 4WADA 1JEYB 2AVNA 2AQIA 3FHJA 3C74A 3LWDA 3STXA 3X1XA 1AQYA 3ZDXB 1U5AA 3EBOA 1X1RA 4IS2A 4GIBA 1M8GA 4GPEA 1I7QB 1PR2A 2FPWA 3TBKA 4QUJA 2ZIVB 1O08A 2FE4A 3UBMA 3UMFA 2FLKA 3SZGA 2GZSA 1LPAB 2XMCA 3P9ZA 5EXEA 3BD7A 5FH9A 2E21A 3K0SA 1SCJA 2QXUA 3CONA 1Z6XA 3KSDO 1LPBB 3A6LA 5FBLB 3RUCA 1AOXA 3WAKA 2W6NA 4AMUA 5KCZA 1A9YA 1U4OA 2XLCA 1Q15A 4YVFA 2NSDA 1XEAA 4QBFA 5IT5A 3EQ6A 2F64A 1UMDB 2NVUB 4MA4A 4OCZA 4DWOA 4DZRA 5AW9A 5LKAA 1BXRA 3EEYA 1N7HA 1ENYA 1SUWA 3CUKA 4GX0A 4ZU1X 3ZNOA 1DELA 4B4VA 2WWYA 3EYAA 3C1UA 1DJMA 2F67A 2FMUA 2LCQA 3BTSA 2RJNA 5BMVB 1ACLA 4DARA 7MHTA 1LK5A 3H11B 5DOZA 1ISFA 1U4NA 1AU9A 3FVRA 3CW9A 1DCMA 4L0CA 5IW8A 1NRIA 3VPXA 4XCXA 2OFOA 3BJMA 3EDQA 1FVHA 1UBFA 1YUMA 5K3EA 3H9QA 2ZIXB 3HB0A 4X6UA 2PIAA 1BQ4A 3M9XA 4HXYA 5AO9A 2ZPTX 4NPCA 3OAAD 4Z0PA 3JQ6A 4DV5B 6NULA 5HS4A 1UC9A 3FZQA 1XZQA 5TVKA 5CBPB 3E35A 2WIDA 1A9XA 3LGXA 3ZI7A 1GT91 1KPGA 3DZGA 2ZB3A 4KMMA 4NIMA 3P0JA 4G25A 4DMRA 5IF3A 3IBFA 3P9RA 2CHGA 4JI6B 1P44A 1R6DA 3BXEA 4UM5A 3ZZ0A 5JXHA 1EM8B 3OEYA 1KEVA 3OO1A 4MGZR 2OBLA 4JJZA 2O0LA 1BS1A 2LW7A 1E2LA 4BLOA 1OXMA 2FMTA 2QG6A 5FI1B 1JN0A 4LSWA 1AB5A 1E1DA 1TJ3A 2VCYA 2XTAA 2FZCA 2YFHA 3INYA 4HH3C 2YUTA 3WQHA 4E46A 2WWHA 5HWSA 3W5SA 4HPXB 4L5YA 2XKBA 5AW8A 4IP0A 5JJCA 4UCQA 3BE4A 4GBJA 2I1VB 2CNDA 4IZOA 3AFMA 2CVPA 4UVEA 1E2MA 3YASA 5JFOA 3R3WA 5FBKA 2V96A 1YR2A 4UAJA 4ZVKA 3VZCA 4L0QA 5ICCA 3O8CA 5FIUA 2M32A 2XUAA 2B6HA 3CCCA 3CISA 5KKCA 4ASUA 2X9NA 4EB6A 5F51A 2M6SA 2Z4SA 2Z9BA 2H2HA 2VDPB 4BNJA 1BCRA 3JPWA 3I8XA 1UBLS 2OHVA 3DMFA 5KYVA 3TKLA 4QBHA 3MT7A 4I9FA 1PZMA 1XTUA 3JALB 2B8JA 1FRQA 3PFCA 4GBMA 4WJKB 4G0ZA 2W6ZA 2OKCA 1EJBA 1GU1A 3B13B 1OXUA 3ICPA 3U7GA 2YBDA 4WE3A 4NKRA 1JB9A 3WNBA 3OZCA 4NYMR 1FVXA 4X3PA 2Y0EA 2W58A 2Z2IA 1GVNB 1P5JA 1BVRA 4IO0A 1VCNA 5T5QA 5CA1A 2FW1A 4NCNA 3U3DA 3U3RA 4A92A 3GW8A 5BUQA 3U48A 2C92A 5D5HA 3T5TA 1NBME 2GZAA 5D1HA 5F2OA 2WEKA 4DYVA 3DO6A 1J0XO 1KK1A 2ZRLA 4P38A 4RSMA 2GDJA 3T61A 3V4OA 4F4FA 1WCIA 1L5QA 3GUHA 3IO5A 1HE4A 3ZK9A 5C5CA 3IQWA 2Y3IA 2Z6VA 1G1MA 3KQUA 2VYND 4YPOA 1RW4A 1NF3A 2R8RA 3ZEIA 3L7IA 1W75A 1BN6A 4R01A 4XR4A 4EJSA 5CDGA 3VX3A 3EVAA 2A88A 4ZK6A 4RENA 4MQ5A 3WYNA 3SVZA 5JAZA 1CU1A 4DF3A 1OHHA 1CZOA 4M1ZA 3CT4A 2YQ5A 3UXHA 5JNUA 1OWMA 4CQLB 2WZQA 3HJCA 1UPCA 3CSDA 3VR0A 5C52B 2E1RA 3GRAA 1AURA 3NU1A 3S2ZA 4E1VA 1PWYE 1TJ4A 2C2OA 2G9VA 4XFDA 2RG7A 3ADOA 4Q3AA 4X8LA 2CDNA 2P2NA 4BJHB 3X2EA 5LQDA 3R3UA 3EZNA 1CULC 4YDHB 4YUWA 3W5BA 3HKDB 1BRMA 4FR2A 5F73A 3FMOB 4L3WA 4BHTA 2IH5A 3QGMA 2CUZA 1J5PA 1I51A 3NBUA 1VKJA 2C9OA 3ITEA 1FUYB 3KQKA 2QTBA 5E6RA 4PXSA 4YIHA 3MAGA 1CZLA 3B2NA 5BNZA 4W82A 3TLZA 1S96A 3LK6A 1Z5PA 5M7EA 1ONSA 3HA5A 4J94A 3VR6D 2F3SA 3DAYA 3SR0A 5BVHB 2SICE 4FOLA 4EJSC 3T4PA 1I24A 2XOXA 1Z4MA 4UVGA 3VHQA 4P0PB 4RPKA 1W47A 1H1TA 3MWDB 4WXHA 1QVVA 5HHTA 5HMLA 4AJPA 3T7AA 3HL4A 5GZ1A 2LKCA 3LUPA 3NUGA 2WAOA 4UBMA 3T7JA 4EDFA 4IDQA 2HA2A 2PD6A 1OLXB 1HT2E 1RACA 3T06B 4YACA 3N2KB 4V0KA 5HVNA 1JLMA 1GCGA 1J97A 1I5OA 1U04A 1VDZA 1U0OC 2OCLA 2P0EA 2X23A 5DIZA 3W04A 3IT2A 5JIBA 3T9CA 2IIBA 1VDMA 1EFVA 1T36A 4HEHA 4M8IA 4OKSA 3WMRA 3T9FA 2OHOA 4MWGA 2JFQA 2ZTSA 4GOMD 1BMDA 2YS6A 4GX1A 4ZAGA 3WJ1A 2W2PA 1JR2A 4A27A 1NL3A 1UJ2A 1O94D 1OI4A 4F60A 4LGMA 4NZYA 1P80A 3FNFA 4MWOA 4REQB 2BBTA 2ET6A 1XMXA 4FC6A 3BHIA 4ND4A 4FN4A 4ZAZA 3HVRA 5HP4A 1YAHA 2RHJA 5DN6D 1D1SA 3M9WA 4B0PA 1T1GA 2V59A 1SA0A 2AW5A 5H68A 5IYZA 4QVGA 5LM3A 4Y2JA 4RVNA 4D8VA 1OFUX 1AUQA 4PYLA 1JJBA 1NVDA 1RI5A 5J4LA 1C7EA 3B5JA 4W5WA 2R7LA 4R1QA 1G5RA 3FUWA 3AB3A 1BMTA 3R6WA 4DRZA 1Q7GA 1JWLA 1KGSA 1T5BA 4AIRA 2MSDB 4N03A 2GERA 2HQSA 3ZX5A 3RROA 1FLDA 1PD1A 4QL3A 2DWUA 3D2BA 2R48A 2ZSDA 2J0SA 3UHPA 2QVGA 3O38A 1JBQA 2C94A 2Q6LA 2VP2A 3IRUA 3AXTA 4Q9IA 3ZV3A 3TTUA 1J2EA 1I2AA 1FF9A 3PR3A 4UTZA 2J5KA 3ENVA 1W6RA 4J7UA 4RADA 1CIPA 2H06A 5TQ2A 4LXIA 5DNUA 7REQB 5GJBA 1N2HA 2YXPX 3IHLA 3VSDA 2VPTA 5HBGA 2GN9A 3V8NA 4YREA 1FCJA 1EM6A 1QDLB 1Y1QA 2QP3A 5KQLA 1YRQA 4JITA 3ZJUA 1V8DA 3HG7A 4RPIA 1EB9A 3MG9A 4ITUA 4PS1A 2Z98A 3FDZA 3I58A 3IAM1 3N28A 3TSOA 5K4GA 4EI7A 1IN5A 3IALA 4GS5A 2WWRA 3Q3VA 2H52A 3RVPA 3C3CA 4MARA 4JODA 5AR1A 4DT1A 5H0IA 1Z4IA 4B0OA 1MIOB 3K4HA 2A9KA 2O3SA 1I4TD 1W35A 4RIIA 4R31A 1D2HA 1FFCA 2QMZA 4C43A 3DV2A 4OPMA 2XPCA 2H9AA 1TZCA 2P69A 3MXOA 4N9WA 4OGWA 3RS2A 3TRKA 4YRZA 5M2QA 3DBIA 2FSSA 3V6LA 4F7WA 1PZGA 3UMYA 5DYIA 5B53A 3PUJA 3VKWA 1EX9A 2FEAA 2D74A 1T8PA 5AM3A 1KKMA 4JC5A 2ZBRA 4D79A 3EVDA 4B40A 4K6OA 5DOVA 5B5SA 4G1VA 4DV3B 3KEOA 5DDIP 3C39A 3QUAA 4IINA 4MQBA 3AJ9A 2IF0A 4KMOA 2ROQA 4XEUA 4YV7A 1V8OA 2QRPA 3NT4A 1M2KA 3AEUA 5BRAA 2ES4A 1YDEA 2YVUA 4G4GA 4ROSA 1EGMB 3T5GA 1D09A 3OHMA 1N6KA 4MGKR 4CQMD 2GHRA 4JI5B 3TM5A 1ZZEA 3NPAA 5FNVB 2OENG 1HNXB 1WP9A 2UUAB 4X64B 5T7BA 2A6PA 3VH2A 1MC1A 3SHVA 2WM3A 4H3SA 4RUKA 1QRRA 1A1VA 1ZGJA 1WF6A 1Z47A 4B6FA 2ADOA 4DR3B 1A72A 5E2AA 3O8NA 1T9ZA 2OHHA 4S3MA 5JMWA 2Q4DA 5KTKA 3QHPA 5AWFC 1OX4B 4WGFA 4K9KA 1SD1A 5IS2A 1GAXA 2QWXA 1XUOA 3WTBA 2JH3A 3VYTB 5AKKA 5JSKA 1IM8A 4M8KA 4C2TA 1QNLA 4I36A 2NU7A 1UADA 2G1PA 1P77A 4CDRA 1FLNA 4KNYA 3K9CA 3GT0A 4JVLA 3IURA 4KE8A 3COPA 5C5IA 2REQA 5H16A 1P1HA 2VJMB 3UAVA 2OWEA 4HNAA 4BAGA 1OTHA 4H77A 4PCVA 1I1HA 1HG0A 2YIJA 4YRLA 5D8DA 1CUIA 3P26A 2CDBA 5KNBH 4Q9NA 5HTKA 5JATA 3V4PB 2UDPA 1SK9A 5T64A 5CH8A 1HZZA 1MAVA 1E3SA 2X3YA 2AOVA 4EFDA 5C8DA 5D51S 2Y1GA 3DM9B 3QKSB 1BW9A 4UREA 4F4IA 3RC8A 1YE3A 2IY9A 5JQGB 2J9FA 4U6NA 3RC1A 1NYRA 1CUCA 3SEZA 3A4LA 4ZCQA 1A0OA 1QRDA 3AHFA 3G5MA 4JROA 1C3LA 4C29A 1X0VA 2VR1A 4GPTA 4X3CA 5CB6A 4GM0A 1VMIA 2W7TA 5EHNA 4ZU6X 2Z95A 3NI2A 3DTVA 1M6VA 2JLZA 1DO2A 1L7VC 1YZNA 2ATVA 1ZUD1 2WFMA 1ZN8A 2RAFA 3G02A 5AJVB 5M29A 4BB9A 2A9OA 2VO1A 2JRLA 1AXEA 1R15A 2HLPA 4AB1A 2Y1XA 3EK2A 2QUBA 3AERB 3JQAB 1D2MA 2DJIA 2NTYC 2C42A 3NTQA 4WDQA 4Z0TA 5BWNA 3QYJA 4BRUA 2KQUA 4WV3A 3EE6A 1IY8A 1WXWA 1XQVA 2B69A 3R3JA 4ADSG 1P5RA 4Y2RA 1BDHA 1VM6A 1QGUB 2GAFA 2Z9DA 3RHFA 1W2WB 1LI5A 3UV7A 4A03A 4GQIA 1IEQA 5F23A 5J5CA 1HZZC 1RT9A 4YLGA 3ZWPA 1BJKA 1VJCA 1WSBA 1GNQA 2JHPA 4LZLA 4XVQA 1EK1A 4YJ3A 4G0UA 2W71A 3SJUA 5JZVA 3VOTA 3HUTA 1SVLA 1RLOA 3IOBA 4D4MA 1DBIA 1QIMA 1EVIA 1K0FA 1ZM7A 2R1UA 2VDNB 1GG8A 2PGAA 3F9RA 2HLDD 3L7NA 3PNBA 4RZXA 2PQ0A 1OQAA 1NLMA 2P3QA 4GP9A 3TGWA 2F9MA 1SXPA 2P5TB 2ID4A 4L7VA 1K6MA 3L4KA 4BL5A 1U28C 2Q5IA 2YRWA 1QCDA 1OVGA 2GLXA 3PGLA 4I5FA 4BFVA 2GTHA 5LXTB 1KY5A 4GI5A 4WBNF 1HC7A 2V3CC 1J1IA 3OZXA 2WSBA 3NBKA 1Q1AA 3O83A 2C5SA 3L8FA 3D7SA 4TT8A 3IXLA 3OE4A 4L08A 2HEGA 4EY7A 3KBBA 4B3XA 1KK0A 3NHWA 1EZ4A 3REGA 1WO8A 4QA9A 3H5TA 2DR3A 4XJSA 5CAEB 2PZLA 5DNCA 3CF2A 2WAXA 4IJUA 4CFYA 2EJUA 3VPHA 3W5HA 3CLTC 1AV7A 4KODA 3O95A 5GQSA 3O82A 3X2FA 1MHTA 3DHEA 2RONA 1DWPA 1YZQA 4BS9A 2P6MA 3VV3A 4HL6A 4MUYA 1CJKC 4IIJA 3DOOA 4MR9A 4Y0AA 4XPIA 1O4VA 4LC9A 2GXSA 3MRVA 3RYIA 2X0NA 3BDIA 4A73A 4QJIA 3KQLA 2BMJA 2CGEA 4DXDA 1DP4A 3IRVA 4ACAA 4FLFA 4JNKA 4IX9A 3PJGA 4BV2A 3CZQA 1RCUA 1F6DA 2PYIA 2YIDA 3BTOA 3PB3A 3D7MA 3S27A 4LDAA 5CA0F 1NJ1A 1Q95A 3V2UA 2ZREA 3AT1A 1N3YA 3VUFA 1RC0A 1TECE 1V8ZA 3AP1A 4WQMA 3TB4A 1LVUA 4F5EA 1H4SA 1WXFA 5KNDD 3KCQA 4WFKA 4YMWA 2QIPA 2Z2KA 1RZUA 4QDXA 2HMYB 1PEAA 2O7VA 3CM0A 4AZWA 3UJNA 1M67A 2A9PA 1F60A 2DPYA 1TM1E 2JFBA 4PTLA 4C87A 4IDOA 3HLTA 4D8XA 3U6KA 5J1SB 4ARIA 2RGDA 2VH5R 4B45A 4R9VA 3DE1X 1E0JA 1OA0A 1NJ2A 4LJSA 3RS5A 1OZAA 4EVRA 2X8WA 3SP1A 1XD2B 3IKVA 3IL2A 3SJZA 1E2QA 3L1VA 1V4BA 2HDOA 2AOTB 4G0QA 2BKEA 1Y9ZA 2CXTA 3GOQA 4X8OA 3G9QA 4GC5A 2K2WA 1KGDA 3ZBTA 4OXQA 4BFLA 4CG3A 4EHIA 1OH6A 2PQ2A 3H4VA 3F9IA 4M9UA 3OQNA 1ZN9A 2ENWA 2HA6A 4LVNA 5COQA 4AX4A 2H1WA 4GG1A 3THYA 2Y8EA 2GM4A 1H6DA 1WB5A 5JEDA 1W4RA 3IODA 1V95A 3OHSX 1Z17A 4DUGA 3TIGA 2HHCA 5J9FA 2F8MA 3L8DA 4GOOD 3DDCA 3MYRA 1GKUB 2Q3LA 4DIEA 3RVOA 1IBLB 4AZ0A 3Q3IA 1LPSA 4U7WA 1JR3A 3SXPA 5JSZA 4S2EA 1I0IA 3BRCA 4KQ9A 1DIOB 2ALJA 2O20A 3HY6A 2DZDA 3OWOA 4Y6PA 1K27A 2XE8A 2Q3MA 1ZGZA 3L7BA 3E5NA 2C77A