1XKLA

Crystal structure of salicylic acid-binding protein 2 (sabp2) from nicotiana tabacum, nesg target ar2241
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
258
Chain Sequence
EGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIEELRTLYDYTLPLMELMESLSADEKVILVGHSLGGMNLGLAMEKYPQKIYAAVFLAAFMPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSMFFGPKFLAHKLYQLCSPEDLALASSLVRPSSLFMEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHMAMLCEPQKLCASLLEIAHKYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords salicylic acid-binding protein 2
publication title Structural and biochemical studies identify tobacco SABP2 as a methyl salicylate esterase and implicate it in plant innate immunity
pubmed doi rcsb
source organism Nicotiana tabacum
total genus 78
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xklA00
3D5EA 1QE3A 3UUFA 5DLPA 1CPYA 5C8XA 1C7IA 4Y2QA 3QVMA 2DHEA 3WWDA 5AK5A 1SCQA 5DNWA 2C0QA 3IURA 1TRHA 4CFSA 1XQVA 4E15A 1G5FA 2VEOA 2QTBA 2QVBA 4AQDA 3KOOA 4KR0A 1HQDA 3B5EA 3IA2A 1ZD5A 1VA5A 1LZLA 2XT0A 4P9NA 1VXRA 2XUFA 3I6YA 3W05A 2QJWA 3AZPA 1P0QA 3ZV7A 4W1PA 4B80A 1P0IA 4UBJA 2C5GA 4WCVA 5LZ2A 4WJLA 3HRHA 5ALYA 3KDAA 4PNZA 1CUVA 2XUPA 2Y2VA 2Y1KA 2VJBA 3VVLA 4U2CA 3BIXA 1UOPA 4Y2YA 4GXNA 5HF9A 1E66A 2EEPA 3BL8A 1SC9A 4LXHA 3NOXA 4QDOA 1DQZA 3YASA 4AO7A 1U8EA 4OB6A 2WLSA 4QWMA 4PSUA 5ALQA 1H2WA 5DTJA 3O4HA 5JATA 4Q34A 2AJ8A 5AO9A 1K8QA 2XMGA 4EY8A 1UK8A 4EY4A 1THGA 4DM7A 3WJ2A 1MAHA 5DNVA 1W6RA 1AMNA 3G0CA 1MX5A 1MNQA 2XI4A 3ZI7A 2ZSIA 4Q05A 4WFJA 3NGMA 4YX9A 4KE8A 3WK7A 1BEEA 3ESBA 4OD0A 3O4JA 1LPNA 3IUNA 2PSJA 3U0VA 5CXXA 5A7HA 3WL7A 1VE6A 1R88A 5AKGA 5JIBA 5A7GA 2GZSA 2HA3A 1BRTA 2ACEA 1XRNA 4J0GA 4IH4A 1UK6A 1NU8A 3C43A 4BAZA 4KACA 1GXSA 3M3DA 1LBSA 4UHFA 1Q0RA 2O2IA 4CG3A 4DNQA 4B84A 2DHCA 3FVRA 1XZCA 1CUZA 4PQEA 3C6BA 1QO7A 3LIPA 3O9MA 3R3ZA 2HL6A 3G7NA 4AMYA 1ODCA 4GBGA 4C4ZA 2ECFA 1HDEA 1N5MA 4U2BA 5T4FA 1MPXA 1W52X 4UHCA 3ICVA 4B7ZA 5ALLA 1ZI9A 1UK7A 5C8ZA 4WDQA 5AM2A 4BTLA 2HM7A 3BJRA 1N8SA 3L1HA 3AIOA 1EI9A 3KSRA 3E3AA 3DOHA 3WLAA 3VDXA 2OAGA 1CR6A 2W22A 3B12A 5ALMA 5AKXA 4OB8A 4HRXA 4JNCA 1XZLA 3WJ1A 2XMDA 4EY5A 2XMZA 4PO3X 4UBNA 5AK4A 1QGED 4EZIA 4G9GA 4B0OA 3B3QA 4X71A 2B20A 1H22A 2XUQA 4AO6A 4M0EA 1LPBB 3D3NA 2V98A 3V1LA 5C81A 4B0PA 3DDUA 4OCZA 3WK9A 4OPMA 1UXOA 1BCSA 5C8VA 5AH0A 3ILSA 4G9EA 1QJ4A 1KU0A 2QUBA 1DQYA 2OAEA 5C7YA 2J3DA 4U2FA 4HXEB 3UUEA 2AJDA 4FBMA 1DWPA 1W1IA 1UKBA 4M0MA 5D3ZA 1CUDA 1J06A 2HFJA 2ROQA 5H3HA 2Y6UA 3C5WP 2ZYHA 4PSDA 4FDMA 4A23A 5DYYA 1P0MA 2QUAA 3BF7A 3DOIA 2H7CA 4W1QA 1ACJA 2PU5A 4N8EA 1ZD3A 2AJLI 1VLQA 1UWCA 1XRRA 4HXGA 5AM0A 5ALGA 2VJAA 1MU0A 1E8DA 5AKKA 4BZZA 5LZ4A 1VOTA 2VF2A 2XMRA 3ZWQA 1R3DA 2OGSA 2BUAA 2GYUA 2WUDA 5AKLA 1UKCA 2FX5A 2V97A 4Y2UA 3DQZA 5T4HA 3LCRA 1G4HA 4G5XA 1ZI6A 4C4YA 4EB0A 1FFEA 4CCYB 1BN7A 1JU4A 2G63A 3FOBA 3SWWA 3P2MA 2J3QA 2X76A 4U2DA 3WK6A 3G0IA 4LYEA 2V9ZA 3U1TA 2Z3ZA 4EY7A 2JEYA 4XWGA 5FXMA 2DQZA 1XQYA 4JH0A 3VJKA 3STYA 2CBGA 3SC2A 1H23A 2PX6A 1BE0A 1A7UA 1XRPA 3VJMA 3ESDA 1JI3A 3OOSA 4G8CA 1XLWA 4TGLA 3WIOA 4C01A 2BJHA 1XZFA 1D07A 1IMJA 1UOQA 2WILA 5AM1A 5ALEA 1MX1A 4L9AA 2I3ZA 3ZLUA 3DYVA 4ETWA 2ZYIA 5JARA 6YASA 4MXDA 3RKSA 1QLWA 3A6ZA 5D7BA 4UFOA 3H0CA 3LS2A 2C58A 4H7HA 1AX9A 5SYMA 5FDFA 1G66A 4KAFA 1ZD2P 3ESCA 4X85A 5AK3A 1KU6A 3WL6A 4IQ4A 3ZLVA 4BZWA 4K6HA 4C4XA 1CUCA 1MX9A 1CUJA 3C6ZA 1EDEA 1QOZA 2PSEA 4M0FA 1QIKA 3N0TA 4KEAA 3QPDA 3C8DA 3K9BA 3PUIA 1R9MA 1E5TA 1IVYA 5CH3A 2LIPA 4EA6A 4BRZA 2UZ0A 5K3EA 3FLAA 1CUUA 4D9JA 2WIFA 3QH4A 5CT5A 3EBLA 1ETHA 4B85A 1QO9A 1CIJA 1OILA 2OQIA 3H19A 4LIPD 5ALSA 2JGKA 1BN6A 3PF8A 4MQMA 1DX4A 3WKDA 2OCGA 4QE3A 3S2ZA 1XZJA 2QKYA 4P92A 2ZVDA 1DINA 5ALNA 4C89A 4NZZA 4K5QA 4AN0A 3AJAA 1O6FA 1VXOA 3H2HA 3AUKA 5HK8A 3HLKA 4OSEA 3I6MA 3DCNA 3RM3A 3D2BA 1GGVA 1TIBA 3IUMA 3M83A 5EGNA 1IZ8A 5AI4A 3LIIA 4KRYA 2OCLA 1F0NA 1ZD4A 3L1JA 4C6HA 1O6GA 1ZGBA 1TAHA 5IVHA 1PJAA 4CIAA 1SCKA 2XQGA 4ARAA 4W9RA 5DYTA 4HRYA 2YASA 3QMVA 1FSSA 3JYHA 5HCUA 2QOEA 1F6WA 1NX9A 1WHTA 1CUWA 5AI5A 3K2IA 1QIFA 1HKHA 3R3XA 1AGYA 1WB6A 5BV7A 4H0CA 1EX9A 1ORWA 2WSLA 4X7BA 5AM4A 4AN1A 1YAHA 3X3HA 4EUSA 5HF5A 4JYMA 1VE7A 4UUQA 4BB0A 1K5PA 5ALRA 3W2TA 4F21A 2C4HA 1LPAB 3D2CA 3PE6A 3WL5A 3WA7A 4Q3KA 4G1FA 1WB5A 4DTCA 5DWDA 3C87A 3HI4A 2OLEA 5CTAA 1XZEA 3JWEA 2XUDA 2C0PA 4WFIA 1LPOA 1F0PA 2WM2A 4QDUA 3ED1A 2WHRA 3ANSA 5KBYA 5K3DA 1EH5A 3RK4A 2QT9A 2PM8A 1AQLA 2C7BA 5JAUA 4UBLA 5AM3A 3DJYA 3T4UA 4KE7A 1DX6A 2FJPA 3TEJA 3WK8A 4X91A 3I2GA 4B83A 3STWA 4G8DA 3H2IA 4IO0A 2AJCA 2X8BA 3G9TA 3M81A 1K4YA 3V9AA 5JZBA 2IX9A 1XRMA 2JGJA 5JAPA 3AFIA 2YH2A 4PW0A 1ODTC 3FSGA 1CV2A 3DS8A 5KWIA 4X95A 2VA9A 4RGYA 5K3BA 2GBIA 4BRSA 2PSFA 4FTWA 1MTZA 2DSNA 4AMZA 4L3WA 3ANTA 4WFKA 5HKAA 2XUOA 2PUJA 1EXWA 4KE9A 1XKLA 4V2IA 5K3CA 4QA9A 2EDCA 5EHQA 5K5EA 1WM1A 5ALTA 3UMJA 1J1IA 4J0HA 1EVQA 3V1NA 1CUFA 3FCXA 3STUA 3VKFA 3WWPA 1LGYA 3BDVA 4ITVA 5CH8A 2WJ6A 3LP5A 5HK9A 3W06A 5AOAA 1IUPA 1LZKA 2X5XA 3O9VA 4PF1A 3WKAA 5CURA 4ROTA 2Z8XA 5ALZA 1EHYA 1T4MA 4KAAA 1N1MA 3DYIA 4O08A 1UK9A 3FWHA 2O2HA 1BEZA 1FFCA 4J0DA 5KWJA 1DT5A 2ZYRA 3O0DA 4QDXA 1R9NA 3PF9A 5CRIA 3G9XA 5ISMA 3AINA 1QIIA 3WKBA 1XZIA 3H2KA 4DNPA 4ZI5A 5AICA 3ZLTA 5E2IA 2ACKA 4UFNA 4NS4A 4RE5A 2DCMA 1HBJA 4YPVA 2HFKA 5JAOA 1A8UA 1G42A 4AO8A 4BCDA 3QYJA 2Y2UA 3LLCA 4Y7DA 4BVJA 3Q8WA 2PVSA 5JYCA 2XE4A 4X94A 4HXFB 4ARBA 1WPXA 1OXMA 4UBMA 1QIJA 2O7VA 2DR0A 5ALFA 3R40A 3TGLA 4H7KA 3MUOA 4JEIA 4FMPA 5AIBA 3HC7A 5ESRA 4RNCA 5ALJA 4B82A 5BWBA 4GDMA 5DYWA 2NW6A 3E1GA 3FYUA 3WK4A 2FUKA 4RPCA 5I7UA 4CG2A 5DTIA 3OTQA 4Y2PA 1W75A 4AZ3A 1ODSA 1LLFA 5IKXA 1CUGA 4UBKA 5EHNA 3AZQA 2JBWA 2AXEA 5AKZA 1F8UA 2XQIA 4Y2RA 3IUQA 3G0DA 5AKYA 1XLVA 4GECA 5ALPA 3D4LA 1P0PA 5I9IA 5IVKA 3G0GA 3GUUA 5AOBA 1VJ5A 2WHPA 1QFSA 1CEXA 3HXKA 1CUIA 1FFBA 3SX4A 1ZJ4A 4S0XA 3SK0A 1WB4A 3IB3A 4KAJA 2BGNA 1YA4A 5JD5A 4BYMA 3PICA 2HRRA 5KREA 5LZ8A 1WPRA 2Z3WA 2WUGA 1CVLA 5K3AA 2XUHA 3VISA 2WUFA 5JAHA 5FRDA 1MO2A 4Y2SA 4FFVA 2QXUA 5E4TA 1XLUA 2RGUA 5CMLA 2B9VA 3PI6A 5EHZA 4X90A 1HPLA 1XZKA 2WIJA 2VT7A 2WTMA 4X6XA 3NUZA 3E4DA 1TCBA 1LPMA 4FBLA 3OURA 4CI9A 1ZICA 2QJRA 5CBKA 1S8OA 2JEZA 5E4YA 2PU7A 1H2XA 3WZLA 4FNMA 2CZQA 4QDTA 4FFWA 2XUAA 4MWSA 4LXIA 3QITA 2VJCA 2WHQA 1XZGA 3C5VA 1JFRA 4DMCA 1EB8A 3JW8A 3TRDA 3D0KA 3D59A 1JMYA 1XRQA 4FWBA 3IULA 1B41A 4DLNA 5SYNA 4BATA 1JJIA 5LKAA 4I3FA 4LYDA 5HF8A 4QWWA 4UHHA 1JKMA 1Q84A 2IIVA 2DHDA 4DNFA 2WFLA 3QPCA 5FKJA 3A2LA 3EQ9A 4DSZA 3WKCA 2GBCA 4K6GA 5J3JA 1TKRA 2WUEA 1YA8A 4OYLA 4ZXFA 5IVIA 2XDWA 1QTIA 1YS2X 5EIHA 1LBTA 3H2GA 2JGFA 2OGTA 4BP9A 1MJ5A 4H7FA 4UFPA 4F60A 2XUKA 4EY6A 1QIGA 2H9YA 4GLBA 3PFBA 5E4JA 2VSQA 4ZRDA 1FJ2A 2HA0A 2XQFA 1H2ZA 1ORVA 3QM1A 1XZHA 2HIHA 4KE6A 4XVCA 5DNUA 2DFPA 2QXTA 2PPLA 3DKKA 2J4CA 4IH9A 1FFDA 4IHAA 4X93A 3OM8A 4ZWNA 2OG1A 1ZI8A 3HSSA 3NWOA 3O4GA 2ZJ7A 4H7IA 4H7JA 1GQRA 5EIAA 5A62A 3FNBA 1AUOA 4B81A 1U65A 3W04A 5LYYA 5LZ5A 4K6KA 3QPAA 4FHZA 4BC1A 3HACA 4BDTA 1AZWA 3BDIA 1GKKA 5T4EA 3I1IA 2OPHA 2I3DA 2XLCA 4QNNA 1E8NA 2HHAA 2I03A 4BE9A 2PL5A 4XJVA 5T4BA 3T52A 3C6YA 5I8PA 2PKYX 1VZ2A 2I78A 1JJBA 4E14A 5AJHA 4MYSA 4TVKA 4BVLA 1J07A 3WYDA 4Y2JA 1XZAA 1YCDA 4FLFA 1MN6A 1CQWA 2HA2A 3KD2A 1CUYA 5HQ3A 5JALA 1LPPA 4OB7A 2BUBA 2WFMA 2GYWA 4OUKX 1E3QA 4U2EA 4A16A 4BCCA 5HKBA 2WG2A 4ZGBA 4NMWA 5AKJA 2XLBA 3MGAA 3FYTA 4QLAA 4I19A 4XIIA 4MEAA 5JZSA 5BOVA 1HL7A 3E0XA 2E3JA 2WFZA 4FNGA 4J7AA 4OU5A 4FLEA 5AK6A 2HU7A 4G4IA 4BP8A 4DGQA 3STTA 1W4LA 2RAUA 4BCBA 2VQ6A 3G9UA 2O2GA 1X70A 3H04A 2R8BA 2RIPA 3IBTA 2GYVA 5LZ7A 3IUJA 1A88A 1X2EA 1WOMA 3G8YA 3ZPXA 3WL8A 1TCAA 1PFQA 3DKRA 1QIDA 3N2ZB 2Q0XA 1U4NA 3WK5A 5AI8A 2K2QB 5CXUA 3L1IA 4X00A 3FLEA 4OYYA 1XKTA 4H7DA 2B4KA 3HZOA 4JYPA 2JGLA 4B6GA 3G02A 1TQHA 1CLEA 3H17A 5ALHA 3C70A 1UT6A 5JZ9A 1R1DA 3VVMA 1USWA 4W63A 2QRUA 3F9CA 2VAVA 3G9ZA 4UHEA 1X2BA 1LNSA 3PFCA 1EVEA 3F96A 1RWQA 5A71A 3QZUA 2ZJFA 1L7QA 2G5TA 4E46A 5FLKA 2FJ0A 4J0CA 3C8HA 4GEGA 2WKWA 4UPDA 3KWJA 4J0IA 3R3WA 4RE6A 2RHTA 1A8QA 1XQXA 3D7RA 3HEAA 5AOCA 3H1BA 1JJFA 1SOMA 4GHWA 2QM0A 4Z49A 3WWOA 2Z8ZA 5AI9A 1UZAA 3I28A 1T2NA 4L72A 5JASA 2CB9A 1GT6A 3VJLA 4BC0A 4AZ0A 1R50A 2RI6A 1IZ7A 3ESAA 2BUCA 2XMCA 3BIWA 3O95A 4F5ZA 4EBBA 3M82A 4W1SA 3FYUB 1IUOA 2VATA 5AI6A 1DU4A 3G0BA 2GBGA 5JADA 3A2MA 5EI5A 1L7AA 1Q83A 3IVMA 5K3FA 2BCEA 4C88A 5A6VA 2HA6A 3ICWA 3C6XA 3FCYA 3WI7A 1XFDA 5ALXA 5ALVA 2JIDA 4Q1VA 1YB7A 1CUEA 4X6UA 5LKRA 1LPSA 4BE4A 1ZOIA 3FVTA 3CCCA 3MVEA 4BDSA 4MJ3A 3OPMA 4AX4A 2CKMA 1AURA 5LZ9A 1MNAA 3H1AA 2WHPB 5JANA 4KYVA 1N5RA 1I6WA 2HU8A 2H7YA 2BKLA 4QDZA 3FAKA 5BWCA 2XUJA 1Z68A 3H18A 4BVKA 1ISPA 2BAGA 1EDDA 1GKLA 2HA7A 4DIUA 5AI0A 3STXA 4DYHA 1RP1A 4LHEA 4LXGA 4KJXA 4QLOA 5DJ5A 2XMSA 2XB6A 4HS9A 3AILA 5HFNA 5AKEA 4Q82A 3I6ZA 1DWQA 4HTAA 2G5PA 3FYUC 4DMHA 3BWXA 4WY5A 1E8MA 1ZJ5A 2HRQA 1CUHA 3QBJA 3WYNA 4Y9SA 5CT8A 4DNOA 2PUHA 3MUNA 3F8SA 3IIIA 5FUMA 3PUHA 4WY8A 3Q0TA 1HLGA 2HADA 4Y2TA 3I2FA 4HVTA 4N8SA 2WIKA 5LLSA 3C45A 3CN9A 2RONA 2OCIA 4UBIA 1PV1A 1EDBA 2QMQA 2Y6VA 3A2NA 1QIEA 4AXBA 4H7EA 3WWCA 3F98A 2CMFA 3GBSA 1TCCA 1VZ3A 2VT6A 1AC5A 4PSCA 1Y37A 2ONCA 1CFJA 4G8BA 3V1MA 2D5LA 3D2AA 4U2GA 5EFZA 3GA7A 1DTEA 2ZSHA 2WFLB 2XQKA 2HDWA 3HYSA 3DNMA 2CUTA 4BAUA 4IH1A 3FSGD 4MYDA 5EHXA 4ZREA 2PBLA 4FOLA 3AZOA 1QIMA 2HU5A 4DMKA 3W9UA 3CXUA 1KEZA 3KWFA 4FLMA 2JF0A 5HFAA 3DLTA 2QZPA 1C4XA 5F4ZA 1MT3A 4EHBA 3EQ8A 4NVRA 1QFMA 2VTVA 4G4GA 4X3CA 3KXPA 2VAXA 3I1YA 4MEBA 4Q3LA 4L0CA 3RLIA 1DWOA 3HJUA 3DL4A 1GPLA 3TJMA 2IITA 4N5HX 4XX1A 2VJDA 3R3UA 1YAJA 2OXEA 4H35A 5IH7A 5CT9A 2PSDA 4J3JA 4CG1A 5LP1A 1UFOA 1SFRA 5AIAA 3VXKA 3H2JA 3AIKA 2BFNA 4UHBA 4B9EA 3W9BA 4H18A 2YYSA 4UHDA 2O7RA 2C5FA 1M33A 2V96A 5D3KA 1JT2A 4QZVA 1ZGCA 3OC0A 5IVDA 4AB1A 3WMRA 1XZBA 1R4ZA 1YASA 3DL7A 2CJPA 5AKIA 5HZGA 2J4FA 4DSAA 3I2JA 2JGEA 1IUNA 2D0DA 3AIMA 3WZMA 1WHSA 3QMMA 3V48A 1CUSA 3OG9A 1K6EA 1C7JA 5HQ3B 4UBOA 2HA5A 2W6CX 2G4LA 2WIDA 3HABA 4QEKA 4E11A 4X92A 4N5IX 1RYYA 1WCYA 2Z5GA 4N8DA 4X97A 4I4CA 3GROA 1BROA 4PV7A 3IDAA 2WG1A 3I2IA 3R3YA 5CH5A 2ZJ6A 1QONA 1YR2A 1EK2A 1GPKA 1GPNA 1W76A 4K2AA 1VA4A 1AKNA 3WIBA 4Q3OA 3EQ7A 4KRXA 1EB9A 2CEKA 3WKEA 2B61A 2PSHA 3S8YA 2XMQA 4P93A 7YASA 1DT3A 1VKHA 2H1IA 3V1KA 3DEAA 3F67A 4MQLA 3CCBA 3GZJA 2ORYA 1CRLA 3PDCA 1BS9A 2EDAA 4MWTA 4GI1A 5ALIA 5A2GA 4YASA 3STVA 2WTNA 1UOOA 1CQZA 4DMFA 4G4JA 1OCEA 2OGZA 1ACLA 3FLBA 1XROA 3QMWA 5YASA 2DQYA 1EA5A 1CUXA 3O4IA 5ALOA 4BBZA 5JD4A 1U2EA 1EINA 3GELA 4YK7A 1J2EA 1UKAA 5FV4A 1XZDA 1BU8A 1L7RA 3EF3A 2XUIA 2ES4A 3DD5A 2WG0A 3F97A 3R41A 5ALKA 1GQSA 4F0JA 4C87A 1CUBA 5AP9A 2XMBA 1Q0ZA 4CCWA 4OU4A 5ALUA 3BJMA 4CIBA 5LIPA 4Y2VA 3R3VA 5AM5A 4B9AA 1XQWA 3I2HA 4BTVA 1QZ3A 4CCYA 5FP0A 2XQJA 2RHWA 1H2YA 4J0KA 4TPKA 5CW2A 1XRLA 1EK1A 2XUGA 3BF8A 4H77A 2R11A 2WU4A 5EIEA 4W1RA 2OQVA 3RARA 2WJ4A 1JMKC 5A7FA 2QR5A 2WQZA 4J03A 1BCRA 5FOQA 3WA6A 1YS1X 1MAAA 2AJBA 4Y2XA 5AHXA 3K6KA 1CUAA 3CN7A 1QIHA 1Y7IA 2H7XA 1TK3A 5CT4A 2GBFA 2YXPX 4X6YA 1XZMA 5K3FB 4HAIA 1NU6A 2ZYSA 4A5SA 4ZV9A 3I2KA 1THTA 4J0JA 4BAGA 4FKBA 1ZIXA 2WJ3A 2HA4A 4GWLA 5CT6A 4LKOA 5ALDA 1B6GA 2GZRA 5HF6A 3WQHA 2BGRA 3FBWA 1YSCA 4HZGA 2WU3A 1Y7HA 1A8SA 3EIOA 2JGIA 1QTRA 3R0VA 1GZ7A 1FFAA 5FPPA 5FPQA 1YB6A 1ZIYA 2WIGA 3BE8A 5JD6A 3BXPA 2JGMA 4ZV7A 4GW3A 3A70A 3GFFA 1K63A 3WWEA 1SCIA 4WDRA 5AKHA 1JU3A 5ALWA 5D6OA 4P08A 4INZA 2P8SA 2QS9A 1E89A 2OCKA 4JUIA
chains in the Genus database with same CATH superfamily
5LC1A 1QE3A 3UUFA 3OJLA 5DLPA 5FV7A 5C8XA 1C7IA 5JCJD 4KLCA 1T3SA 2ZIFA 1USIA 1ZUD1 4RTQA 2K7FA 1ECFA 1QWOA 3RAPR 3IT3A 3MWFA 1FFWA 3FLMA 1QFYA 3WWDA 6REQB 3EPHA 3PT5A 2Q1SA 2ZJOA 3RVNA 5FTLA 1QVRA 3N05A 4Q03A 3ZIDA 3VR0A 1IIBA 3H1PA 2PX0A 1TQ8A 2HRCA 3T0IA 2P8JA 5JSQA 2WEKA 2AZMA 1TRHA 1KP3A 3MFYA 5EPEA 5DM1A 5EWMB 3D2LA 2O8VA 3BJEA 4KR0A 3GD5A 5DGXA 2YJTD 3B5EA 1RPNA 2CVZA 3GFBA 1E4YA 2CKDA 5DGDA 1YBAA 1VIAA 3H7IA 3I6YA 5KNBD 2QZ4A 2VXOA 4OSPA 2V5AA 4CLEA 3ZDZB 3AZPA 3N28A 1L7DA 4CKWA 4CLOA 1PLKA 4AK9A 1Y6JA 1U3UA 2RAPA 1MO3A 1DIBA 5EJ7A 2CWWA 3W79A 1LI4A 4Z1OA 5K9ZA 2IYQA 1DCMA 2AKAB 1XPOA 1BS2A 5I9LA 4MUFA 4OP2A 1P1CA 3ZHCA 3M6LA 2GAIA 4JNKA 3VYRB 1T8SA 2R6DA 4CEJA 1QOPB 5FAXA 1R0BA 3KDAA 3OEYA 3E8MA 4QTTB 4BPRA 4HAUA 2Y2VA 1JNYA 2Y1KA 2C9ZA 2O1WA 3BB4A 5D7NA 4BGEA 3F6CA 5L3VA 5HUQA 1YA6A 4ND2A 1UOPA 2B8WA 2XB9A 4A5OA 2NZYA 2XKBA 3DM9B 2PAFA 3FOFC 3EA4A 3AP2A 3GFPA 3GVCA 5IMSA 3KE8A 5HF9A 1OPXA 3AJEA 2EKQA 5FWXB 1N4DA 2WF5A 2YZKA 2EEPA 2GRUA 1K89A 4XPIA 3AY6A 5ENVA 4Q93A 3GGDA 2C7PA 3BE6A 3WYFA 4QDOA 3IVGA 5JZVA 2O2DA 1R7RA 1DQZA 1YJXA 3YASA 4LHWA 4IX1A 2FQWA 4KXWA 3HA2A 2B6NA 2I7DA 4DDWA 4OB6A 1CE8A 3CPEA 2RARA 3E58A 1H4TA 4G5SA 3L9XA 5ALQA 2Z9BA 5JSFA 3A9RA 5IAEA 3S6JA 5B57C 4CIYA 5CB4A 1A9XA 3F3KA 3UWPA 5KYYB 2BP7B 2RDMA 2QW8A 3BWEA 3GJ3A 1DG9A 1U2TA 3Q7QA 4R41A 1KQNA 3W5CA 2AJ8A 3WGNA 2C9OA 1T13A 1ZN2A 3W6UA 4CDNA 4EY8A 1V1MB 1JSZA 4TTRA 1U5CA 2H4ZA 1U1IA 4H17A 3AI2A 4PGFA 1ML3A 1C3OB 1OKKA 4QOIA 3MT9A 4DFDA 4DM7A 3WJ2A 3HCOA 1BA3A 1CQJB 2C77A 2QYHA 3E9ZA 5BWLA 1QRSA 4B8YA 1RHJA 1WXIA 4Q9NA 4L9WA 1K8RA 4GNKA 2NX2A 4V0RA 3G0CA 1D03A 1MX5A 3QV2A 3RTCA 3VBEA 3OFSA 3LVRE 1RDFA 2XI4A 3S99A 1W9MA 3V2HA 3GFSA 3JD4A 4RM2A 1AQIA 5AW0A 4Y6RA 5BV1A 3NGMA 3WHLA 5L3QB 5A6SB 3IAEA 5C32A 4N76A 4LRYA 3TRKA 1B8PA 4KE8A 4RA9A 1LK5A 1BEEA 4O59O 3GGJA 4URWR 3GLGB 5K09A 2J5QA 4OD0A 1PJRA 1NW9B 2ZROA 4MQBA 3FRJA 3U0VA 4J49A 4MVJM 5AVRA 2NV0A 4HS4A 1BFDA 1JQAA 1NAHA 4HFJA 4X8LA 1PTKA 1Z2CA 2Q3JA 5A4KA 1JQLB 4NXMB 1IN5A 2XOKD 4LJRA 3A1FA 3GRRA 2EU8A 1KORA 1EESA 1NBIA 3DCYA 1HFJA 1KAOA 2G83A 5AJTA 4Y18A 2F48A 5HMMA 2HDNB 1QHHB 1Q22A 3CLRC 4MGEA 1Y82A 1V6SA 2DHQA 2H9AA 1YULA 3A4IA 1NKSA 3NC1C 4UCWA 3EIHA 4IRMA 3RVMA 3BSSA 3CW2A 3LECA 4PIMA 5CXSA 4Y9RA 1A1SA 1JYFA 1M34A 2DY1A 1E0JA 3L0OA 2YOFA 4QPNA 4KH0A 1SULA 3M5WA 1N5JA 1UK6A 1DC4A 3P4YA 5CVTA 3NTQA 4KACA 2Y71A 5L3RA 4XXHA 4P7FA 3M3DA 4L2IA 2AA3A 1WP4A 1RR6A 2O2IA 4G65A 1SXJD 1ITZA 3DG9A 3MGKA 4HBGA 5DSTA 3E5MA 4BMNA 3C6BA 1UPAA 1YOVB 5DN6A 4YJFA 2W4MA 1NULA 3EMVA 1GSIA 2H29A 2HL6A 4ZMRA 1W1UA 2FEOA 5K4HA 5BW8A 3M4XA 4J91A 1CZHA 1AG9A 1BX1A 3ZWAA 4EW3A 4DJ5X 2BHTA 3K2QA 4BU1A 4D4GA 3ZHBA 2HWUA 3CBQA 1XNRB 2DKOA 2ISSD 2B30A 2HBQA 1OF1A 5CEEA 1HDEA 1HLDA 3GXOA 5A3JA 3DJFA 5L6MB 3ICVA 3DZFA 5GJBA 1IN6A 1XAJA 3QBEA 4M1WA 1KVUA 2GI4A 3N8HA 2G1JA 3G8BA 3H97A 3TKYA 1HE8B 1WQ4A 2A84A 3H65A 4KODA 3JASA 3JARB 2CB0A 4MRMA 4NK4A 4DV4B 3W2FA 2G9UA 4ZTUB 1KZ7B 4HYTA 4KXQA 4N7BA 1SBTA 3BJZA 4RULA 4H16A 5FR2A 2J9RA 1UMBB 1C2TA 2HM7A 3GGCA 4C4XA 1WUHS 4F84A 3IVCA 3ZX4A 4YJ3A 4RX1A 3FCOA 4WFQA 1G3UA 1O95C 1TFRA 3N2KA 2H4YA 3I5XA 4B44A 4ER3A 3V1TC 4L4ZA 3KSRA 3REOA 4R9SA 1QDLB 2UYHA 2ERXA 4M8SA 3OICA 4HATA 1SVUA 2OAGA 4UCFA 4J3NA 4M0LA 2W22A 4R5MA 3OZIA 2ZIWB 4OB8A 3LCMA 2BMFA 3LA8A 3SYLA 2CXNA 1QH8A 2CGEA 2Q4EA 3OTHA 5IN4A 1IMOA 4JNCA 4QXPA 1YC2A 1CW2B 2XMDA 5CDUA 4OMCA 4RJ2A 3W5VA 3EPJA 1SXHA 1Y63A 4XM0A 3DVQX 5CCXA 4NJMB 2TMGA 1DEHA 1GLGA 4G85A 4YRSA 1OU0A 1Z2AA 1NZFA 1E1QA 3QOFA 2Q45A 1N6OA 2G7MC 4URUR 4RMHA 3IDOA 3KOYA 1YMVA 5AW4A 721PA 4ESOA 3TEFA 3C7KA 3FKSD 5J4YA 2Q2OA 2VRWA 3D3NA 3ZW7A 4CG0A 3MCAA 3WYBA 4AAYA 1G1MA 1GQYA 3WGYA 4ZYLA 3G5UA 4UM9B 2NSYA 4AJEA 3J7AC 3ZYZA 2GQ0A 3LOUA 1GP2A 1AKVA 2NVOA 2XBUA 1BCSA 1FX1A 4LFCB 1JXAA 4D45A 5C8VA 5KU1A 4X1IA 1O95A 1G1AA 1M1YB 4QUHA 1QQ7A 4G9EA 1DKPA 4L3VA 3CLSC 3VR4H 1JLRA 1FYEA 2E82A 2OAEA 1RC1A 3CPJB 1BW9A 2ZTHA 3SMQA 2FV8A 3PQ7A 4ZI7B 1KWKA 3DE1X 3QEMB 4CUKA 4MV8A 1PJSA 2C1ZA 2H00A 4RABA 3O8QA 1AXEA 4HXEB 4YCMA 2YY6A 4MUIA 3UUEA 2EC5A 4DXDA 1HYQA 4GH5A 2VK4A 2RFLA 2ZM6B 1N75A 4Q4AA 4PLWA 3VU8A 4MV3A 1N3LA 5E1DA 4NATA 3G0OA 3PUJA 4ND6A 5ITZA 2PZ8A 4MX8A 2EJUA 2G04A 3PEVA 1W1IA 1UKBA 3NBXX 3SJZA 4IRUB 3PJRA 3ESXA 2YQ4A 1EXMA 3NPMA 4LPKA 1JKFA 5I9TA 3WLHA 4LXUA 1X92A 4PQFA 3WP0A 4OO3A 1LTQA 2GD0A 4NMLA 4UDOA 3T4EA 5BVGB 2R25B 3AMVA 4H1HA 2NTJA 1B0UA 2HFJA 5A9RA 3GLGE 2ROQA 3BB3A 1Y9AA 3C5WP 4ZU6X 1N5KA 1Z18A 3ABIA 5K4AA 3DZIA 3K1ZA 4NMHA 5A4JA 1G5PA 3I52A 2HBRA 1Q1GA 2CFTA 4LZAA 2WTEA 4IUDS 5DYYA 3TW4A 2FUCA 4W5WA 3PX7A 3RT7A 3G2NA 5CLHA 5CX4A 1E3MA 4FU0A 1WNFA 1HFWA 3N8IA 1OFUA 1OZFA 3CRVA 3K6SA 1P0MA 2QUAA 2WM8A 3GMTA 2H7CA 4BFSA 3HWX1 3LYLA 1L4BA 1QM5A 4IDDA 4LG1A 3GLFB 2HLPA 4FGWA 1WCV1 3F3MA 3KZCA 2JD1A 4J6EA 1W36B 3GF4A 4N8EA 1XCJA 3L8HA 3VR2A 3GDGA 4FUQA 4BBAA 3D7LA 1LVGA 3L7OA 5I7FA 3V4LA 4MV5A 4R98A 2PUTA 2ONYA 3MCVA 2VDLB 2XCIA 2IODA 3LT1A 4RHFA 5TGDA 1O97C 1R8XA 5AVJA 1QYCA 4JGIA 3LPAA 1X7XB 3AR5A 1NBAA 4E1AA 4HXGA 4LJ6A 3SVTA 1DELA 2PD4A 3I3SR 2VJAA 3PGLA 4R8LA 4AKEA 4S12A 4CLHA 1ZSNA 4LOIA 3LDUA 4Y9TA 1NXWA 4PVCA 2Y93A 4OHKA 2E18A 5CU7A 4NDAA 3B6ZA 2W48A 4M8NE 2FMHA 1KL7A 1VLZA 2ZRFA 1GUZA 4LGCA 3GFGA 5ULLA 1UINA 4UMEA 1KE2A 5KYWA 1QOQB 1QHXA 3AX6A 1VOTA 1G0NA 2XODA 1E58A 3IQXA 4I1IA 1KYQA 4NFSA 5KHLB 2V7TA 1GAJA 4CF7A 4I55A 2ZTLA 1J0XO 3HYRA 4MYRA 4JC4A 5EE9A 5KMGA 5SV2A 3U80A 2NU9B 1Z4JA 2V97A 3H11B 4Y2UA 3PDIA 3TIFA 1W2GA 3DQZA 3VI3B 2REBA 1JU9A 1Z17A 4FSHA 3ORRA 2AZXA 3LCRA 4QQRA 1ZA2A 3EVAA 1ZIPA 2WJJA 1G4HA 4GWGA 2B3DA 4G5XA 1E9EA 1NVAA 4C4YA 4DKXA 4EJSC 1E64A 4EB0A 1FB5A 3AL2A 4MWOA 4V0OA 4NBSA 2AS0A 1BN7A 1QO0D 2I2AA 2PBRA 2R97A 2X41A 1NBMD 3FOBA 2R96A 4K87A 4ZOBA 4YRZA 2J3QA 2ZPAA 3WLKX 4YV0A 1QVWA 2QD3A 3HJAA 4L51A 3REQB 4A2CA 1MG0A 2BJVA 1QTQA 1M9NA 1D7AA 4D44A 2Q1YA 2OKCA 3H5WA 5C1IA 2OC9A 2PV0A 2WJHA 3BWMA 3GVPA 4PZ0A 4MUBA 2J09A 2HQOA 2W4QA 2P1ZA 2FEMA 4DR4B 5SY4A 1C3XA 1S6YA 1SG6A 4HH3C 4HFMA 3L7DA 5G02A 5IBCA 2VC2B 3VJKA 1U1FA 2NUTA 4A0QA 2WDPA 5H59A 4NONA 1M2EA 2AXPA 3CFYA 1BCRB 1VB5A 3CRW1 4M0KA 2DLNA 3RIEA 1NXPA 3X1KA 5KJ6A 4O33A 4US0R 4E4RA 5KC8A 2XNSA 4F45A 2PX6A 4OFXA 2AWNA 1A9OA 4TXNA 4EYQA 3P9QA 3Q3CA 3BPSA 1KNXA 1J20A 3T3PB 4G8CA 1Q19A 2D1FA 4X9XA 4I4TF 2P2SA 5HG0A 4EJSA 3ZDFA 3OJOA 1XZNA 4S1PA 3EIWA 1SC6A 3FMGA 3T15A 4L73A 3BH6A 5KCMA 3HEMA 1IMJA 3M4ZA 2EJCA 5DGTA 2V9PA 4HQNA 3AETB 5AM1A 4K9DA 5DW3A 1OA0A 5ALEA 3UWKA 1L5WA 2QMOA 1M1YE 1RWNA 2OCYC 3ENNA 4IIEA 2DYKA 2I3ZA 3Q6NA 4PC3A 4UXIA 3DBRB 4OBXA 4ETWA 1LBHA 3CF6R 1D2GA 1NY5A 1V6AA 4KN5A 5E1OA 3TLXA 5TEVA 4BNHA 5JARA 1FF9A 3QFHA 1J21A 2HC9A 2V45A 3IR6A 4YP1A 3H7AA 3I62A 3QVKA 4QUBA 1DKLA 1YDWA 1WCIB 3C6QA 1U81A 2FPPA 4K28A 4MXDA 1U2GC 4NJEB 5GMOA 4CU2A 4R3NA 5JD3A 4N48A 1GGEA 2VHCA 1ZKMA 5D7BA 2XTJA 4RNDB 2B0JA 4CLDA 1ZRHA 1OJLA 1R4NB 1V95A 4GE3A 4I50B 4RD0A 3SICE 4F3TA 1BWSA 4ERNA 2H2GA 2C58A 7ADHA 2AIRA 1WUIS 4ZU3A 5LN1A 3MWYW 5ENZA 5K0CA 4U0JA 4NAUA 2GXQA 1JW9B 4HQKA 1UBOS 3UA4A 2PMWB 1Z0FA 1TPZA 3NALA 4DBLC 1KZ4A 1IXSB 4Q1FA 2C5BA 3GPDG 3KAPA 4MJXA 4KAFA 3ROFA 2M6SA 3ESCA 3I6BA 3CLVA 3QE3A 2GN2A 2RHMA 1JLLB 1OV6A 5EJ2A 2FZCA 4GYYA 3ZGZA 1O96B 1T43A 3EDRA 2K2WA 5CB8A 3ORYA 1N5IA 4DRYA 4BO2A 3B9RA 3HKEB 3P8ZA 1KU6A 2HPHA 4JR2A 2A7QA 2JGNA 2VF5X 2PUEA 2YYYA 1SRRA 4QJIA 4TWZA 1V8PA 2ONZA 1OXTA 3L7IA 1CUCA 1MX9A 4GC9A 4ARZA 4Q3CA 3SPXA 1SOAA 4DQXA 3AVYA 3Q9SA 1N2XA 1RWBA 3ZE9A 3HBJA 2YJGA 3GLFE 3N0TA 2O3UA 1JSCA 3DPIA 1ILEA 3EXIB 2QJTA 3RAGA 1P45A 2GTPA 2QTVB 2G09A 4RANA 1NBEA 3K9BA 1REQA 2PBFA 2VXBA 5ANRB 3ROEA 1C5KA 1P91A 5K8JB 1OY1A 3OQIB 1XEXA 2FQQA 3UJ7A 2BRUC 3A28A 5FLXA 4K9PA 2PXAA 3GCDA 1Y5RA 1FP4A 2I66A 3TG2A 3WGIA 3FLAA 4MNTA 1EGVB 1Z7YA 4RK1A 4A6PA 4AZSA 2WIFA 1Q5PA 2MMCA 3PU6A 2AOUA 4B85A 3FNRA 3EXEA 4QOEA 4WOJA 1CIJA 3GUVA 4ZVMA 2PWBA 1S0UA 3H19A 2ETVA 3QE2A 2OFXA 3GEPA 1LJ8A 1CS4C 5SZJA 1H4QA 3MLAA 3NTLA 3PF8A 1VJTA 3OCWA 1SPXA 4O25A 1M8PA 4R51A 1E63A 1RFGE 3QKRA 1XZJA 1HFEL 1PR0A 2YHIA 4C89A 3M6AA 4RK0A 4NZZA 1Z15A 2CJWA 3AJAA 1EWRA 2VPYA 2WOOA 1VXOA 4CLOB 4CKWB 3H2HA 1NW3A 3H0EA 3EGOA 3AUKA 3OKFA 4ZARA 1PGNA 1SXGA 4MGZR 4XQ9A 3UK2A 3RC8A 4HDNA 3N5KA 4JQSA 3HN6A 3AM3A 3AOEC 2FU5C 2RKOA 4BGVA 2BFPA 3MD0A 5TQ2A 4A26A 1NJSA 5HJ5A 2BRUA 1TIBA 1U7OA 1DXQA 3DHNA 3TNDA 4CEJB 2QSYA 1CEYA 4R1TA 3T8YA 3HWSA 4FSDA 1IFXA 1IZ8A 1ZPDA 1W94A 4FGUA 2AC2A 4UNPA 1D1QA 1HGXA 4GL4A 5COAA 4W7SA 1X8LA 4MW1A 4KRYA 4RLSA 4JT4A 1ZR2A 1F0NA 2JGDA 2COKA 4RWEA 4WLVA 2NSHA 4DCTA 5KYKA 4GFDA 5P8WA 5LMUB 4XPIB 4JODA 1MVLA 5LA6F 1DX9A 4GXRA 3RS9A 1VSBA 1FTNA 2E4AA 4PAGA 1WSBA 3QKTA 4DIKA 1NQAO 2YASA 5IC5A 1CE8B 2XNCA 2E1RA 1FSSA 2EQBA 2WIBA 4TLMB 3ZEIA 4DZRA 5HCUA 4HMQA 4ZJUA 1GV0A 1K9SA 2Z2XA 4BN0A 3QY9A 1B42A 1J49A 4QXMA 1A9XB 3K2IA 2B3TA 4WK4B 1QIFA 5CB4B 4RTRA 3EIQA 3L0CA 3STYA 4B3MB 1E9DA 1R8SA 1WB6A 2RKBA 3A6EA 5BV7A 2QD5A 4S05A 1SG0A 4MKGA 5AM4A 1GSHA 2QRVA 1U7XA 2EQ5A 3EFOA 1GCUA 4AN1A 5JCZA 1H6DA 3EG5A 3X3HA 3I9FA 3EY9A 3LXXA 1U2DA 1B6RA 4GKKB 3UYKA 3GJSA 2IHTA 3PIRA 3GY0A 1PDOA 3C39A 4JYMA 3DEFA 4UUQA 4BB0A 1CR0A 2XB8A 1B6SA 1LC0A 2VEDA 3LSYA 4FHFA 4R8MA 3S28A 4A6XA 4AJIA 4B4WA 2Q5IA 4JBWA 3D2CA 1IM2A 3WL5A 1GTMA 1NJ1A 1SHKA 1V26A 1XEWX 2P2ZA 4TWIA 4YT5A 2ECQA 3VNSA 3VPDA 1C7EA 5HP4A 2O8DA 1HK7A 4WBNA 4RA9B 2ZRGA 3FGZA 1R16A 2GHQA 1K98A 1OXBB 3C87A 3D1JA 1GGJA 3SHFA 4C21A 2P9QA 5KSPA 4P83A 2OLEA 5CTAA 3U3JA 2IHKA 1II8A 1XZEA 4CCSA 1GARA 1YIDA 2HMVA 1S3IA 3VHRA 4WFIA 1WQ3A 1X1EA 1E0DA 1G2IA 1KBZA 1LPOA 1V39A 1YGYA 2D59A 2ZQZA 3E2IA 3FM9A 4D6PA 4EHAA 3PXAA 3HXQA 1OX4A 3QLJA 3JS5A 4KOEC 2IEZA 3G79A 3R75A 2OZEA 2YWGA 3H5LA 2QT9A 4TTVA 4NEQA 4YCJA 4AWAA 1P7CA 3Q7RA 4Q39A 2HIAA 4HC4A 3JY6A 1AQLA 1E3TA 3LY9A 5LBUA 1J8FA 3KQSA 3I45A 1FZQA 1XAGA 3FF4A 2XRYA 1DXOA 5LPNA 5JWRA 1GD1O 4G1CA 1FS6A 2QTLA 1KO4A 5ITVA 1K7SN 1OVGA 1M34B 2EL7A 5AM3A 3ETHA 3OFVA 2CDCA 1RBMA 4LSZA 5B12A 2GXUA 4UD2A 1Y1TA 2UAGA 2QLBA 5DWVA 5TDHA 3RBVA 4YB8A 4RTSA 2JLUA 3GRAA 3TEJA 4FC7A 4I9HA 3VNAA 1T6NA 2EWMA 4AECA 4L2IB 3CR7A 1SBIA 3K9WA 4N3CA 3R8XA 2PA3A 1DAGA 4OXQA 1JAZA 2GR9A 2VPTA 1HT3A 1WDWB 4LWQA 2H1FA 4RVUA 3UCEA 3V32A 2VH2A 4B83A 4JXZA 2M32A 3ILHA 1Y1RA 4DMUB 1R12A 2GUGA 2G4CA 4PZCA 4E22A 2ZAOA 4ALMA 3ODPA 2AJCA 2X8BA 1TK9A 3KB6A 4YJFB 3RUHA 2H51A 3A6HA 2ZJ5A 3GT7A 1WIWA 3IOEA 4YEDA 4BFYA 4DIMA 5JZOA 4M7PA 3V9AA 2RGXA 3AF2A 3O3OB 4P3XA 3UHFA 1S3FA 3IXLA 3AWDA 2DFLA 1MC4A 1TOAA 1MX3A 2QORA 4PO8A 4RHUA 1KDPA 4KXUA 2D2VA 3AFIA 2WWHA 2YH2A 4MRNA 2IFTA 3UJBA 3EAGA 4PW0A 3IAFA 4E2ZA 1CV2A 2L42A 3MPUA 5I4BA 4X95A 1FRFS 4MRMB 3JASB 1D6NA 5DXJA 4A8JC 2RIRA 2GBIA 1Z36A 3CV3A 5JXJA 2W2OA 5KTYA 3EASA 4ZOLA 2LCFA 4MB6A 3ZZMA 1ZXBA 3C7TA 4UOQA 5ICGA 2QM3A 1T6XA 3L7KA 8OHMA 4LDNA 3AI7A 5I9NA 2EWWA 3ETGA 2HIMA 4ME6A 1SWVA 4YJ3B 5CA1F 4E51A 5FO1A 2H5IA 4M1SA 3N2KB 2NYUA 4AUMA 1FQOA 1ZMTA 3T3IA 3TNJA 4NU0A 1ZITA 2HV9A 2DULA 4YRGA 3DAFA 3AJRA 1W0JD 2F90A 2PUJA 3V4FA 1UM8A 3B38A 2JAPA 1U3FA 3ADPA 4JLBA 5IDXA 1EXVA 3GAAA 1YFLA 1Z38A 1Z7EA 3VM6A 3JQ7A 1XKQA 3GO4A 5K3CA 1E2PA 2EDCA 2YN2A 2VH1A 1QH8B 2W6PA 3MOSA 4M6WA 4C29A 4QOJA 4MW9A 1E9AA 2GJKA 1U7PA 4UREA 1PJQA 1WM1A 2B6HA 5CK5A 5K5EA 5KDOA 2VQDA 1X7ZA 5I01A 1J1IA 5A9TA 2DGDA 3CLHA 1Y34E 2BJWA 4GMGA 3CUYA 1JXQA 1NOJA 1CUFA 4G1UC 1ZSYA 3DPUA 3QPUA 1T10A 1XYYA 1T9CA 3V4VB 3W2GA 3HCCA 5CYGA 1LGYA 4A8JA 1VDMA 1Z5GA 1JDPA 5EN4A 5HJEA 1C1DA 4FS8A 4PWZA 4L0DA 5HK9A 4KR3A 1IXKA 3N0XA 5IJZA 2JGAA 2ZUSA 5EWJA 4ASUD 1Q0HA 4F1KA 3HYLA 5EJ6A 5HZKA 1BCSB 1T2DA 2FG7C 4JT8A 4AJ2A 5GVSA 4X1IB 4BRUA 4E07A 1D8TA 2P65A 4FFOA 1ZJWA 4X3PA 4X7PA 5HTKA 4E1BA 3KSAC 3GDWA 4QL3A 1BW9B 4DLBA 3NG1A 5M34A 3I01A 2G1KA 4MDHA 3V7NA 3JYOA 2O5CA 1NVFA 1SA0A 2Q62A 4CT5A 1N1MA 1FYFA 2PMCA 1OSNA 1Q0LA 2BR4A 4O08A 5BMVA 4FT2A 3O8QB 4G2TA 3CISA 1QZXA 4HP8A 2O23A 4YTEA 1E2DA 4EI2A 2BBWA 1J5PA 2FFJA 1XVAA 5KYTA 1UBFA 1TU4A 3B70A 4Q4AB 4UEKA 3RODA 5GZ1A 3A04A 2WVAA 1CJKC 1PJCA 2RD2A 5ITZB 4GOND 1FTGA 3K53A 1XAHA 3CX4A 3IP5A 4O0MA 5ISMA 2Z2ZA 4FYXA 2HX1A 5K51A 3KVOA 3NIWA 3L79A 3OIVA 1KERA 2NXWA 3E05A 2VK2A 4JCCA 2WPNA 4JBYA 1BJTA 3HR8A 1Z73A 3Q7EA 2DUNA 4CQNA 2RGNA 2WVJA 2W43A 1UPCA 2GBLC 5E2IA 3RDPA 1U0JA 1RYHA 1YVRA 3P27A 1FRZA 3O3NB 3ZCTA 2IDJA 2QX6A 4KQKA 4NS4A 5JSYA 4KXVA 4G36A 4B79A 3JVDA 2IDMA 1EBBA 2HSJA 1N7IA 5H80A 2BFFA 3JZFA 1NW5A 2VSXA 4FK8A 4M4SA 3K6SB 3C7CB 3QIAA 2J0QA 5E4FA 5IUJC 2RGBA 2ZJ4A 4MQFA 5I47A 5H9WA 1MVOA 1J2JA 1QQ5A 3QXXA 4BCDA 4PYNA 3GRUA 3GRYA 3QYJA 1C30A 2B8EA 2GM9A 1GZUA 1JTEA 2Y92A 4Y7DA 2JCGA 3EWIA 1E77A 3MINA 4RM3A 2C00A 2HCFA 2JZCA 2PVSA 3OZXA 1M34E 5JYCA 5BNFA 3WV5A 1R8JA 3UVEA 3ITEA 2WD8A 4MV7A 3RC1A 2R6JA 3ZOZA 3FYDA 1MB2A 4KKXB 2HDHA 2ILVA 2ZE6A 3AF1A 2O52A 3R7WA 1H6CA 1UPTA 1AU9A 2F3RA 3ASYA 5C35A 5L45A 5AMXA 3WNCA 2PGNA 3HYNA 2EWVA 2O7VA 4Y9DA 1Z0KA 4MVJG 4JOBA 2JFOA 3VR5D 4Z54A 1AZLA 1H2RS 2GBLA 5KYWB 4H7KA 2AT1A 4O3FA 4JEIA 3GAZA 2J3HA 3IJ5A 1RMQA 2FNAA 4YRJA 2QUZA 1XK6A 5ADWA 3F74A 3GT3A 4L4XA 1ODKA 2PIDA 3S7TA 1VBFA 4I55B 1DJOA 3L6RA 2GWRA 2V6BA 4TM8A 4V1CA 2GPBA 3VMFA 1VPVA 3LYUA 4BLSA 4DCJA 4E5YA 4TRJA 5KMGB 1QKJA 4Q3EA 3PNYA 1ESMA 3GEGA 3PDIB 3FYUA 5L7YA 1KTIA 1NMZA 2X7XA 4BX3A 2GCEA 3QTLA 2I6XA 2GWHA 2CVQA 3NBKA 1MB3A 3IO3A 1GJRA 2Q1UA 2KHZA 3A9VA 4PYIA 1XEFA 2MSWA 4W7HA 5DTIA 3TD2A 3UQYS 1KEUA 3TTSA 5B6PA 4EJ2A 2XDQB 1EDZA 1FTSA 4PAMA 4PICA 4AZ3A 1AV6A 1F5NA 1KI1A 1LLFA 3HMQA 1NRWA 4MK4A 5KYGA 3VHQA 2Q5HA 1JFVA 4GPEA 1DZIA 3KJEA 2YV2A 4N3AA 2D3WA 2DBYA 3CRRA 3TOZA 4YRTA 5FA6A 1L3CA 1FLAA 4I66A 1JR3D 4JSYA 1Z5OA 3R6GA 4BFCA 2CNKA 4G86A 1T5HX 5KS2A 1QVVA 2EJWA 5BN4A 3O82A 5F9HA 1IEWA 3WDLA 5AKZA 1F8UA 4TS9A 4WZAB 2R7LA 2RH4A 2XWQA 5KSZA 2XQIA 2NUTB 2C61A 5MGNA 4DLTA 4HLDA 4Y2RA 5B1EA 1Y3CE 1AD2A 1G18A 4KK4A 3CZ5A 3CZPA 3HGMA 2FQYA 3ZWDA 4EWLA 5AKYA 1GAWA 4IYRA 1Y4AE 4KWEA 5DGCA 5EIFA 3CUEF 1IBMB 1P0PA 5IVKA 3AWIA 3E9CA 2O0LA 3G0GA 2HZ7A 3VTAA 4DV3B 3CVVA 1VJ5A 3HBLA 3K0SA 3G2OA 3UATA 1EX1A 1G7RA 2R8OA 1QFSA 2HTEA 2VHYA 1CEXA 4KIUA 4EJSB 1QRTA 1RPZA 1JEJA 4OHWA 3U7EB 1II0A 1WULS 3KUDA 4S0XA 1GPWB 5E3IA 3O4FA 1NJ8A 1E2GA 1WZIA 1J9EA 4Q00A 2FW1A 5AXBA 3V1YA 4XIJA 4BYGA 1TW3A 3E81A 4EFLA 2CLHB 1XI2A 2TSYB 3EWNA 4HOYA 4LSWA 4R71A 4G0OA 4G56A 1U8UA 1KPHA 5FBZA 3UT5A 5A3VA 4DARA 3WICA 4TLCA 5JD5A 3ZDEA 2ZBGA 1CWUA 2G07A 3CH7A 4BYMA 3T5PA 4HWGA 1NN3A 1Z2EA 4Q1CA 5BRAA 7REQA 4EEXA 4C03A 4PCVA 1IM8A 1ZNXA 3W3AD 2FPPB 3GD7A 3TM5A 1RXEA 2CD9A 3PPIA 2YW2A 1YBVA 4QQFA 3RUEA 3VO8A 1LLQA 4UM5A 2WUGA 4DJJA 4MP6A 2XUHA 4EEKA 5T64A 4EL5A 4MS4A 5K0BA 1UWKA 1RKXA 4O02B 1MO2A 3LBHA 2AKYA 2IYEA 4PLZA 5B1SA 3NNNA 1HQYE 4DWWA 4IUCS 2QXUA 5BSKA 2C7OA 1WZEA 3DFFA 1RLTA 2GZ2A 4ZO4A 1MT0A 3CF2A 1E2QA 3AR8A 3PI6A 2FXIA 1MB9A 2QAGC 4LVUA 3W4IA 4IFTA 1EUCA 5ES3A 5LMCA 1HT1E 4PBTA 5EKTA 2QLMA 1PG0A 4DV7B 1X39A 2CHGA 4YFVA 3FX2A 2GPWA 1RRKA 4FXPA 1ZIDA 5DHPA 2Q5JA 1TCBA 2GBPA 2BHLA 2GO7A 4Q21A 3IL2A 2ZI9A 3THXA 5F9FA 3LE8A 1YUMA 5FBVB 4QPCA 4ZKEA 2ESRA 2PUBA 4OTZA 4WSOA 4YJGB 1X1TA 3RHTA 3VV2A 4ARZB 2PQMA 3G5AA 3QP9A 5DTMA 4ZEVA 1S8OA 4LZPA 3GLKA 3G3EA 1ZK1A 3HU1A 2YRWA 5BOSA 3LI2A 4HWOA 1N0UA 3U39A 3G13A 4HG2A 4AMVA 1IPFA 1W29A 3RVKA 1FMCA 3I9OA 3K94A 4RJJA 2C78A 2QD1A 4MWSA 1RQ2A 4UUPA 2XF2A 1REQB 3RKRA 3OA2A 3B3GA 1RXUA 3IBGA 1WQ1R 2FMTA 1XDGA 4AY6A 1B23P 2E49A 2H8KA 2IVFA 2VJCA 4JI3B 4ZHQF 1T3ZA 1XEXB 3RG8A 3S1LA 4D9GA 2W98A 1WSAA 1T4GA 1EX7A 1JZSA 1PEAA 1FP4B 1H2HA 1CIPA 2OUIA 1EB8A 2QAGA 3OPYA 2GHIA 4R0VA 3D0KA 1RJFA 2AOUB 1I3LA 3LW8A 2OV6A 3EXEB 4FWBA 1BG6A 4DCVA 4GGOA 5JC8A 3TXXA 5EKXA 3AEXA 5FUYA 4NFHA 1DI0A 4L5BA 3AM5A 4DLNA 1ENPA 5SYNA 4R8RA 3WGQA 3UPTA 2BPOA 4BATA 2DR2A 3I04M 1E3WA 1MV5A 1MFZA 1VKOA 3EISA 3QKRB 1K6IA 5HF8A 4JYZA 1PTJC 1M83A 2OMKA 3BE4A 1FNBA 4HGNA 3CG0A 3TB4A 1GZVA 2YHIB 1Q84A 4KQ9A 2CJWB 2D74A 2DHDA 2IIVA 4IBOA 5ELLA 4UQPA 1ZZGA 1P2GA 1RJEA 5I7HA 2AC7A 2W2KA 2WFLA 1D0SA 5FKJA 4ZVVA 3SC3A 4CNQA 3T5DA 4G67A 4HDNB 2I71A 4BKRA 1QE5A 3A2LA 2JW5A 2Y0PA 5TQ2B 3TLMA 3WKCA 2EBFX 3U56A 1HURA 1QDEA 1XMQB 2NZ2A 3GH1A 1YQXA 2V4UA 4P36A 1WVGA 1TKRA 1TM4E 2FY8A 1KDVA 4MUHA 1WD7A 5JY6A 4CF4A 3N0RA 3C3CA 3MMPA 1UBLS 1E1CA 5KSYA 2XTAA 3ZBUA 3W77A 4AS1A 2QV7A 2OSBA 5FJIA 3TMKA 4RIFA 1FDRA 1LF0A 3V33A 4ZXFA 3F7OA 4DPLA 5ED4A 4MI6A 4V0KA 3P71T 5IP5A 4PRZA 3T9FA 4DILA 2ZBQA 2CLSA 1Z6ZA 2H31A 4QPZA 1TKBA 2JGDB 2WMYA 3GCXA 4F92B 2AL7A 2FEXA 4GVPA 3RYIA 1VSVA 2VJMA 3MEQA 2B7LA 3RRMA 4B7AA 2JGFA 2C2MA 2OGTA 3OLXA 3ORQA 4XFKA 3RYFA 4WZAE 3NHZA 4PQYA 1W87A 1RQ7A 4ZVTA 4QREA 4CV0A 3OZRA 1FUUA 1ZUWA 2F3QA 2VJYA 1BWQA 1E6WA 1XVIA 5DHFA 1PTJA 3AKCA 1E7YA 5AJUA 4EY6A 1Z5ZA 4WLEA 3SJAA 5FEUA 3UW1A 1XYVA 2NAPA 2GDJA 4GLBA 5SZHB 5LOVF 2G9VA 3QUQA 4BQEA 2R4UA 1PGPA 4XLTA 3U16A 4YS6A 1H2ZA 1Y5NA 4DCPA 3NHAA 4X5OA 1Q2UA 5I51A 3EVZA 1Q1AA 2QRVB 4KE6A 4W9NC 4C6RA 1K7EB 1FNNA 1L8LA 3EFOB 3AH8A 3TTXA 4XVCA 3ZXIA 1CZNA 2FPGA 1X9GA 3I58A 2QXTA 3DKKA 1SOVA 2QRQA 4RQAA 4EJ0A 4Z8XA 2HKIA 2Y1EA 3SYNA 4K9SA 2JK1A 3Q5GA 4IH9A 2JJ2D 1FFDA 3I73A 3M5CA 4RU1A 2C94A 2PCLA 3OM8A 1RM3A 3HSSA 3H4IA 2CWDA 4IQ0A 4O0LA 2O8DB 3QVVA 1IU9A 3KTAA 3V8PA 1XCLA 4I1UA 4KWIA 4XUGB 4WBNB 5FUVA 4E32A 2NPOA 3K5IA 2Q99A 4H7JA 2IXEA 4H7IA 3S2UA 3SFZA 3T9DA 5KNBA 1PYDA 1E7SA 3KZVA 3RRXA 1VHWA 2ETXA 1II8B 4AZTA 4KDRA 1HMPA 4TS3A 5AVZA 1ZC4A 1A98A 1AUOA 3GN1A 2JJQA 4B81A 1FXSA 2V7QD 3NETA 4N9QA 3W04A 5J43A 1P4SA 1OX4B 1T5DX 4V2UA 4PIPA 1PNOA 2PS9A 4N6GA 3V7UA 5C4IA 4KMSA 4N5LA 4B3SB 5KNLA 5FI5A 4G1EB 3WIDA 4K6KA 1IB0A 4FHZA 4L5YA 4BC1A 3L84A 1AZWA 4FE7A 3DAPA 2MT9A 2YBEA 1Y1KE 4Z0PA 1VI6A 4W9NA 4F8YA 2OPHA 1IEVA 3RS8A 2I22A 4EVRA 2M2IA 4EENA 2ZSDA 4QNNA 4YRBA 3KHTA 1O0SA 4JB0A 2GN0A 1E8NA 3D8UA 4ALKA 4BE9A 3PJGA 1NXSA 3ISJA 4M1ZA 3QTBA 1LDMA 1P17A 2I4OA 4I2NA 1STOA 4X24A 1AKYA 3GI1A 1OBOA 4CL0A 1O89A 5EQJB 1T9ZA 3GLHA 4ZT4A 3BS4A 4MRRA 2ZRQA 5K1ZA 4UU8A 2PKYX 1LSUA 1DDIA 3ICPA 1OGYA 2P1DA 3FJYA 1GFSA 4DLRA 5KWEA 1JJBA 1SUCA 1MAWA 4ZK6A 3QVOA 4BVLA 4XRRA 1BNCA 16PKA 4LZOA 4U02A 4Z0TA 3C5HA 2PXCA 1P7WA 2EBHX 4OSOA 2JVJA 3ZZ0A 2PS3A 2VF8A 3DFUA 3EMKA 4LWPA 4CN8A 4BFLA 4ER0A 5IS2A 2FPXA 1HETA 1Q95A 3FI0A 5CVCA 4OB7A 4RS3A 1FFXA 2QNRA 2FPOA 2RJ3A 3K9QO 2WFMA 3LKVA 3UPDA 1E3QA 4FI3F 4A16A 4BCCA 3BXGA 5LVAA 4DUZB 3OLVA 3MTDA 3D8HA 3L8YA 3IGFA 5BYBA 2A9FA 4NBKA 1G9XA 1O08A 4JI6B 3QG1A 5HKBA 4JI2B 2VOEA 2WG2A 4II2A 5D00A 3EZFA 4M9QA 4NMWA 4ZYUA 2XLBA 4J07A 3MGAA 5NLLA 4RMNA 4H3KB 5H16A 2ZAGA 3ZY2A 4BNDA 3R4CA 8ABPA 3DTYA 3GJQA 4M9CA 4QLAA 2W2XA 4RZIA 4ZOLB 5JJ5A 5JZSA 3HM9A 3TLCA 4XD7D 2E3JA 2VNHA 2VUHB 3OJCA 4IJKA 3ZZ1A 1ADJA 1GN9A 2R7MA 4MYHA 4Z9YA 4HYEA 1Z2DA 4DREA 2AOWA 1A8HA 4J7AA 4FFPA 3AHIA 3KPUA 4MW7A 3SJCA 3GQVA 3GGOA 3NP7A 4KXLA 2J3JA 3N2GA 2H54A 5E9WA 2XOKA 3W9YA 4EHFA 4BP8A 5TQJA 3JQ7B 3PK0A 4YLEA 5K8CA 1P39A 1T5LA 2Q3MA 4FR0A 1N6PA 1VQ1A 1E61A 3ICCA 5DO9A 4A92A 4LZNA 4M6WB 4P3KA 2KBFA 4CIWA 5CAEA 2XCRB 2PS1A 2VQ6A 2YNMC 1P7ZA 1KKUA 3A31A 2GJ9A 3QXJA 1X7ZB 1T1EA 4YAUA 2B4RO 3E0QA 4N6OA 2CXHA 3WBJA 4IMJB 3L1UA 3U9LA 1OZHA 2WNIA 3JWIA 3ILXA 4D0GA 2JRLA 1W44A 4X45A 2IS4A 4JI8B 5LZ7A 3BFKA 2D4HA 2Q6LA 1C7QA 5GINE 2O3RA 2W0SA 4M38A 3ZPXA 3MMNA 2B2XA 4A8JB 3IQGX 1LRLA 3OZUA 5BN5A 1WV1A 1SXJA 3IXQA 2Z98A 2FZ4A 4HH0A 1YFKA 4XDHA 1QIDA 1SUAA 3ZKWA 3JAKA 1U4NA 1MJNA 5EWJB 4NX2A 4ZQHA 3C3BA 4IQFA 5AUQA 1MH9A 3IV9A 1JFSA 2PVCA 2AMJA 3CURA 4UHJA 4X00A 4B3FX 1I2DA 4ETMA 3UICA 5A0VA 5I7AA 2UZ1A 3FLEA 4C0AC 1KNQA 1DL5A 1L5FA 4KYUA 3KOUA 2CHQA 2N42A 1EK0A 2WM3A 3F5SA 4IG4A 4YRDA 3COJA 2GEKA 2R1TA 3EDOA 1RRGA 3GCZA 1EJ6A 1SA0B 4BO7A 3WAGA 4LRUA 3CEAA 3ILVA 4RF4A 5FR1A 3F3SA 5CVEA 2ZI3A 5BMVB 3G02A 2Q3DA 1JIJA 1OVMA 4XD2A 4QU5A 2HWYA 3UJHA 1IJEA 3A1DA 1OI2A 4IZOA 3H17A 4RAOA 3ZEAA 2CEAA 3QWFA 2BMJA 5D5HA 3AHFA 4YRPA 1UXKA 1YJQA 3NO4A 2OE2A 5EMLA 3ZCSA 3P96A 4E5SA 3L7BA 3VVMA 3W7AA 4W63A 3G1UA 5HOEA 1E99A 1IY8A 3NOOA 3F9CA 4W99A 1X77A 5M29A 1ZVVA 4WIAA 3RNLA 4HUTA 2AVDA 4V0SA 3LUCA 3WZ2A 1BYIA 4G63A 5LD2B 1Q1NA 3EVEA 4L78A 4W8OA 4D9NA 3LX4A 5DYGA 4R1LA 4BEWA 3OCVA 3IO5A 1E2BA 4XWYA 4YR7A 2F67A 3NJ4A 4EKGA 3ZBTA 5A4IS 4XJSA 1K6XA 1MXHA 4BGIA 2AW5A 1RWQA 3FZQA 5A71A 2PY6A 3QZUA 5ER9A 1UXGA 1T9DA 3FI9A 2BFFB 1E96A 5ITWA 1MOPA 1L7QA 1D2CA 2UUCB 2ZJ0A 3ENWA 5B5SA 4C0WA 1ZEJA 1LV7A 2VSOA 1NUHA 3T0FA 1TX4B 4J0CA 4JZKA 4OKNA 3A9WA 4K0RA 3WHIA 3TF5A 4MQFB 3AKZA 1LS6A 2WKWA 4NFLA 4UPDA 1P2TA 3OE7D 4CUJA 4D02A 1ZJZA 2QSJA 2QP9X 4J0IA 1Z34A 1C30B 2RGAA 3QBTA 4GKVA 3WRXC 4HT3B 5M2QA 5I8ZA 3MINB 2IF2A 4GLLA 3B6KA 3NKVA 2RHTA 4EELA 3FOCA 5I48A 2FMFA 1XQXA 3MMZA 1E3SA 1M72A 3D6HA 3FKSA 2FUNB 4F9TA 4DUYB 1IIRA 1KKMA 2INGX 2ATEA 4GHWA 4RGBA 1RADA 3V55A 4IY1A 1IZ9A 3RU9A 1FA9A 1P0FA 3HBFA 2IZ6A 3R7WB 1N2HA 1Q7TA 2WICA 4ZVOA 2H65A 3EVDA 3LY8A 2GK6A 1CY4A 4MP3A 4MWCA 2FSIA 3FSJX 1YDHA 4CIAA 5KVVA 5EJEA 3ETEA 4L72A 3G59A 1M6HA 1WA5A 1K2VN 5JASA 3L02A 1ISRA 2W90A 2W2NA 4Q1DA 1PSDA 8GPBA 4HQ6A 3V4RA 3HB5X 5GGYA 3OF3A 4LF8B 1NVWQ 3AV0B 1NM5A 3KXDA 4YJ2F 4AZ0A 4BC0A 3T7SA 4Z3OA 4AY5A 3AJ8A 2BUCA 3HCBA 3BIWA 3EC2A 1MDBA 4V1CB 3SYMA 3MUEA 1QAMA 2NQ2C 5B58T 3U3ZA 2RGYA 1OFGA 4F5ZA 4C2TA 3L6OO 3GK3A 5MHTA 1TVMA 3FYUB 4QXOA 5DHRA 2VATA 2QG6A 3MLBA 4Y7CA 3EZGA 4ECAA 4MI9A 2W6JD 1PJ3A 4CFYA 1DU4A 1Q6YA 4M49A 1DRWA 3FVWA 3WRXA 4LQCA 1RKVA 2EW8A 4D8YA 4IDBA 5KYVA 1L7AA 4OM7A 4BQNA 5DBHX 3HUEA 3WE7A 1EEHA 4B1FA 4EO4A 5LQCA 1RACA 1JA1A 1UC4B 2HTFA 2ZWOA 3M6IA 2QK4A 1G8JA 5A6VA 9LDTA 2HA6A 4AZ3B 3MD9A 2QPAA 2ZUWA 3LYHA 4MVXA 3FCYA 4EYGA 5JS8A 3U61B 2AE2A 3M7IA 1ZGHA 3ZD8A 3T61A 5ALVA 2QE6A 1QR6A 2TMKA 3F1LA 2HCJB 2M6LA 4NU6A 2O20A 4E33A 4AWXA 2EFGA 3P0RA 3F2IA 1Y9ZA 3NX4A 1Z8DA 4K6MA 4PX3A 1HT2E 4PLGA 1P60A 5BN4B 2PLAA 3W7BA 1LPSA 4U00A 4IHKA 3D6TB 1VJ1A 3I0ZA 4KTTE 4IIJA 4ZAXA 4A91A 4BE4A 2CNDA 1ADGA 4JZYA 1XHLA 1BDIA 3QENA 5D8DA 1ZL0A 4QJ4A 2WAXA 4LE2A 4DAOA 2COUA 1FIUA 5FOWA 1XRSB 3P0EA 1PNRA 2PFKA 4RLQA 4LGMA 1YS4A 2IYSA 2YFYA 1C3JA 4YRRA 1ZINA 3O92A 4OQQA 1YHYA 4GMXA 4JYAB 4F2GA 3IA7A 3H1AA 1B16A 1POXA 5JANA 4LV6A 3AHGA 4I4LA 4NAHA 3INNA 5KTPA 4L6CA 1V7PC 2HF7A 1OB5A 4KHZA 2FQ1A 2X3UA 2XUJA 4FFSA 1UT5A 1Z68A 4BVKA 3D3QA 4KUEA 3DTNA 2BAGA 1RMYA 1EDDA 3GN2A 1LA2A 3UT5B 4EM6A 2B8NA 4OP1A 1NYTA 1FS5A 2C54A 1EP3B 1X38A 2P2YA 4BUJA 4DYHA 5CPBA 3UNXA 1DARA 4B3JA 7REQB 2QMYA 4PZLA 3OJFA 4UM7A 4LF7B 5DJ5A 5DHQA 2H1VA 4HYQA 5EKDA 1N6IA 3AR2A 5KJCA 1USVA 4I1OA 3TTVA 2XB6A 4HS9A 4QRIA 5DW0A 3AILA 5JPDA 5LCXA 1J00A 3GNSA 3LNCA 4IV0A 2PO5A 4MS4B 2ZRPA 5AJVB 5H70A 4DY4A 4EGFA 4HB4A 3I6ZA 4FCVA 5DVZA 2FP3A 1QNLA 2C9YA 1UDAA 1VBKA 3UXEA 3GNQA 2J08A 2WTUA 2M6RA 1XTKA 1QRUA 5EQDA 1FFYA 2D5BA 3I4CA 4BEJA 4FW9A 1VSTA 3B1WA 1JL3A 3LLMA 4GXTA 1C0IA 1NBMA 2VL7A 4MVWA 3SBEA 4IHQA 4BNWA 4DDVA 2BEKA 3HRKA 3WYNA 1EUCB 4IF4A 1N1EA 3UMFA 3N70A 4ZT3A 1W2WB 4ZZ2A 2GM5A 5KAPA 5TPZD 1TO6A 3MUNA 4RL4A 3TI9A 4DG8A 3RLFA 4L0QA 1LXCA 2GERA 1DUSA 2GEJA 2JFYA 1PZGA 1T9HA 2E55A 1TZJA 4IW3B 3Q0TA 3WL3A 3THXB 4BPBA 4HZIA 1ICIA 2AK3A 2P4HX 1QGZA 3N53A 3PEFA 2CCJA 4FYYA 5JV5A 2H0AA 4IIBA 4TKVA 3FVQA 2V54A 4IDPA 3SI7A 4Y2TA 1C9MA 3HFJA 3AKYA 4IF6A 4MVJD 4ER6A 1DBSA 2REOA 4IGFA 4PPGA 5BOSB 2GASA 1Z4QA 2KX7A 3ENVA 4I2VA 2IPOA 3RSFA 4OBWA 2I7XA 3P94A 3DL0A 4KSBA 4ZC1A 3ZWPA 2FETA 4LBYA 2Q49A 3JZDA 2JFXA 3CN9A 3OZ7A 3R4VA 5LA6A 2HXGA 3BOSA 5LIRA 5FOTA 1W1WA 4UBIA 1LRKA 3QQ5A 3EIEA 2PA0A 4EQ6A 3OZDA 1SOWA 4IIFA 2EYQA 1W4AA 5F5XA 3NHUA 4AXBA 3KFXA 5GONF 4B09A 5J47A 2YUTA 3JQFA 3OMXA 5HKKD 4BHTA 3VQTA 1KYYA 3OP4A 1EZ1A 1ECCA 4GD3Q 2FGJA 2QAGB 2A5DA 3OPYB 2D1RA 4P5PA 4XGIA 5CJPA 1Z28A 2VRNA 1MABA 1QTNA 2J30A 3OQJA 4PG6A 3RIXA 1CF2O 2I1WA 2VDWA 3PE4A 5LB2A 3CWQA 3ITDA 3A9TA 2NWQA 4JENA 1ORDA 5T6BA 4MKRA 5ECGC 1O3YA 1V9LA 4UDNA 3WO1A 2E4VA 4CM4A 3MGGA 1J09A 1Z26A 2O2YA 4PYKA 4J29A 3GLQA 4KXMA 3H75A 1NW7A 5HXAA 1PNQA 4U7TB 1DV1A 5AW2A 4AURA 2FP4A 4LY3A 4UTVA 3TZEA 4U2GA 1ORTA 1UJ2A 1TMKA 1YKGA 4F72A 2EHDA 3S5UA 1WZCA 3FMPB 2P6OA 2XGSA 3L6CA 1N36B 1HEYA 1EFDN 5JFGA 2DBVO 2W2KB 1KVSA 2WFLB 1WJGA 2IEDA 2ZSHA 1RLOA 3GEBA 3UFXA 2C9CA 1ISGA 4P31A 1N2OA 3F8TA 3L01A 4EITA 2IE0A 1GO2A 5TF4A 3E2PA 2OR3A 3ANXA 3FHTA 1LSSA 2CUTA 2WD9A 3I83A 4TWBA 1IULA 2HK6A 2HU2A 4DUGD 4BN4A 1JEDA 3BH7A 5F98A 3SN6A 3VZDA 4IH1A 4B6QA 1DG3A 5A4MS 5KDDA 2FI1A 4TSFD 4ZQBA 2OP0A 1SUFA 5DM70 5DISB 2QN9A 1AGNA 1E1CB 1M6NA 4GR9A 1FSZA 3IAS6 1N4AA 2R86A 4KGXA 2AG0A 5LDDC 2D06A 1UBGA 1WBJB 2F7SA 4I5FA 1II9A 1K8ZB 4FOLA 5ETJA 3TLZA 3UJ9A 1ULBA 4OQDA 2BFEA 3MWEA 3AESA 2QZZA 4LX8A 3I01M 3WR5A 5LP6C 2HWXA 4GX1A 3CGGA 4DMKA 4TYYA 3RYIB 2VJMB 4QOGA 2GPNA 2IE8A 1JDUA 4WKPA 1UJCA 2YDXA 1I3KA 3DMFA 4L76A 4S1WA 5JVDF 3RYFB 1TU0A 1QZZA 2WTAA 4RQTA 3WSTA 4ANFA 2GAOA 1FMJA 1AXRA 5JJCA 1RWKA 1W46A 3NONA 1ZOOA 5HFAA 2R4TA 2HN9A 4KBYA 2YHBA 1JHAA 3B20A 1SHTX 4WADA 4GNRA 3IODA 2AZTA 2Z2IA 4D8VA 2XXAA 1WZ2A 5LDHA 2BH9A 1H2EA 2XMPA 1YQ9A 4YAFA 2NUPA 2OFWA 1T8TA 2GF0A 4G4SP 3O1LA 2YXEA 5ILGA 4JIGA 1RYDA 1UJ6A 2IOYA 1K4MA 4QYTA 5KTSA 4UNSA 4BNZA 1HEIA 3NWJA 4I9NA 2V3CC 4PX5A 1HTBA 1PEYA 1YZYA 5BPHA 2WSMA 1EWYA 1R6VA 2FPGB 4B87A 5KDLA 3IOMA 4KQIA 1E2MA 1T25A 1QV6A 3QHAA 4CDRA 1EE9A 3ZQUA 1W93A 2V5UA 4CTNA 1D2RA 2EERA 4JYBA 4YYEA 2SECE 1EBUA 2PUVA 3SY8A 5C7IO 1OTXA 3JV7A 4IWNA 5LP6A 1YTLA 2MSEB 1DAPA 3R9XA 1L1QA 1BHO1 4DAEA 3KTAB 1N7JA 2VDRB 5CVUA 4IEEA 2VJDA 3LY7A 2OXEA 4H35A 5I5GA 1QANA 5IH7A 2Q9CA 3F9IA 3K7EA 3HZZA 2NO4A 2NO0A 3OBBA 1A9ZA 2NGRA 3GDFA 4YUXA 1JP7A 3WADA 5JPCA 1OXUA 2XCQA 4OF4A 4C1BA 5CA1A 4BXOA 3LF2A 3T7EA 3IIMA 2VYND 1N2BA 4R6XA 1D2NA 2B4QA 2A0FA 2GPYA 2IY7A 3DT6A 4P5DA 4ZKDA 1N6RA 1UQTA 3VPFA 5AHRA 1A7JA 1E2IA 4G5YA 1J0AA 2XEDA 1VG8A 2WP8J 4GR5A 5LXTA 1F12A 3EHEA 3IP9A 1P31A 2VFAA 2ID8A 2QR3A 4RD1A 4RYLA 2XVMA 1ZHHA 2YWDA 4QUAA 3FNEA 2AEJA 3Q5EA 4MWDA 3LP8A 2X14A 4MVJF 4QZVA 3KQLA 3HB9A 2C0CA 3VKWA 4A73A 5KTRA 1ZGCA 2XAUA 3Q9LA 1NFQA 2B2NA 3PWSA 4UNIA 2PH5A 2J8ZA 2N1MA 3UAYA 1QCCA 2ZATA 3TZBA 1R4ZA 2AQKA 4ZAWA 3DL7A 3GLHB 4UDXX 3ZU2A 5H8WA 2CJPA 2NP6A 1F2VA 1KIMA 4H1VA 1GZ6A 1T5OA 1B4DA 3GHYA 1P77A 1TF2A 3JD1A 3M0EA 4P7KA 4P54A 4QGGA 4OUDA 2DPYA 1NMQA 4MHOA 4B3DA 4GGMX 1Q0UA 5CLIA 2CZGA 4WBXC 2D0DA 3RUPA 2QLLA 4XJXA 4TYMA 1Q7BA 2IYZA 3WQRA 1N33B 3NI2A 4TYQA 1E6KA 2RE8A 1JA0A 4YRQA 1SURA 1RWOA 1FUIA 2CXRA 2GD2A 4D8UA 1W5BA 3R6WA 1FFXB 3TQTA 3COZA 3QTTA 5CD1A 4AY4A 2WIDA 3HABA 4QEKA 4WXMA 4E11A 4X92A 1FQKA 5TEWA 4AP9A 1QCZA 2C2XA 4I4NA 1RYYA 5HYVA 4OHYA 4IFIA 3OI7A 5DBIA 1G291 4N47A 4QGSA 4MDEA 2GLUA 2Q5EA 4QHYA 1RKUA 1NZJA 1SO8A 4DBZA 2MR6A 5FAKA 3CNQS 3GZ4A 3I9KA 2V1XA 4JVLA 5BV2P 4BNDB 1UKVY 1A2KC 5TSDA 4XM2A 4ZA2A 3ZVKA 2JLBA 3LBFA 1JHRA 3EGXA 3KZOA 2NNLD 3S5JA 1MZPA 4NZMA 4PR0A 1QONA 2G17A 4TLDA 2J7PD 4DV6B 4YAOA 3LHDA 1RAHA 1W76A 1KJIA 1F3LA 4KDEA 1FOEB 3AUJB 3P26A 1KHHA 4PLFA 4XYBA 4C7XA 1F1JA 1CY8A 3HA5A 1VPDA 2E0IA 3C3AA 4KB5A 3N2GB 3T35A 4UU1A 4DANA 1JH9A 4LS3A 3D6FA 3I32A 4Z4HA 2DLDA 3KO8A 2EG5A 1EB9A 1ZSVA 2O3JA 2AOVA 3FMVA 2B61A 2MYNA 2QU7A 4MV6A 4R8SA 5TV2A 3WKEA 5JJBA 2AG1A 2ZK7A 5DK4A 4KQ6A 1WEHA 3T5TA 3PHLA 4P93A 2ONKA 1Z6PA 1HEUA 5CAEB 2VNAA 2J9YB 4JAVC 4UJ5A 2QN1A 3FCEA 3I9NA 3CCBA 3PFGA 2C9DA 3GRPA 3UWMA 1I2CA 2BMWA 4B34A 3JQGA 1CRLA 1D4OA 1UBRS 1KO5A 3K3PA 3PDCA 4Y1EA 3TVTA 3ZHXA 2PX5A 3CNHA 1D1SA 2ZU6A 3PHJA 1YZKA 4O4HA 4E5UA 1R5BA 1SHLA 1UKYA 3WB0A 2ZI6A 4DMMA 1SBZA 1J2RA 2ZUDA 5BN5B 2BZSA 2N0SA 1SXJB 1G2QA 2V0NA 3DT8A 4AF8A 2B7CA 3G89A 5DCLA 3ZKWB 1M10A 2QRZA 1DQRA 1X7GA 3I8SA 2REQA 1ORRA 1UOOA 3JAKB 4O5AA 4B6PA 5KVCA 1CQZA 1AH2A 1L4YA 1KQFA 1GL7A 3GB9A 1S8NA 1YRQA 4DCUA 1U9JA 2R2GA 2ZSEA 3NRJA 5F7OA 4JL6A 2P2DA 5KOYA 3WTCA 3ZHYA 4KDFA 2UZ1B 4H2DA 3A10A 3AY7A 3FPEA 4FFRA 2GVDC 2IGBA 3QU9A 2KM1A 1YR3A 2R1TB 1QYWA 5HEKA 3TBKA 1EA5A 3MMXA 2CE2X 3AY0A 4C6SA 3GLIA 1XWIA 1VE5A 2Z43A 3UZUA 3G6WA 3C8UA 3ZNPA 1IATA 4BE7B 3F47A 1BE8A 1PT9A 2OO3A 3ABQB 4RH3A 3HGTA 2I33A 3DMRA 1WUKS 1A77A 1JJVA 1XPRA 1U2EA 4IDCA 4YRNA 3TL2A 1EFKA 1D6JA 3PA6A 3PPVA 3U6BA 1RYBA 2IYRA 2GARA 3ZWOA 2Y1GA 3GX1A 2BHRA 3M9WA 4U6SA 2Z57A 4RCVA 1L8QA 1CYEA 3TDMA 3EZ9A 3P2IA 4C3ZA 1L7RA 3EF3A 1AB6A 2PEZA 1KYIA 2C5SA 2WG0A 3F97A 1QPBA 1ODLA 1VPLA 3PENA 2F3TA 3CNOA 5ALKA 1GQSA 4F0JA 3PFIA 4RKFA 1W0JA 1G8AA 1IHPA 1UXHA 5FTJA 4DEXA 1XMVA 2A0YA 3CVOA 1WDLA 2EFYA 4PEVA 4GF5A 4WOKA 1E6CA 3NWBA 1YJAA 4YDRA 5ALUA 4HRAA 3S1AA 2A33A 1QQAA 3JX9A 3ITNA 5IJXA 3NM5A 5LIPA 4YHHB 1VL8A 1KI9A 2AUTA 4Y2VA 3R3VA 4XGRA 3Q15C 1E4VA 3B5IA 5J2TA 1NKTA 1U8XX 3NNSA 4K3UA 3A4LA 1MA0A 1RS0A 1GLNA 4CCYA 1R3UA 2A1TS 3OIGA 4ILKA 3UW3A 4RTKA 1W0CA 4OV6B 2QPTA 2RHWA 1H2YA 4J0KA 3ZCQA 3VAZA 1N6HA 4TPKA 5CW2A 4DC1A 1SIUA 3TG8A 2XUGA 5JO0A 4JU9A 3GRKA 5KOJA 3IV7A 3K71B 3GRFA 2O07A 4ASUA 3GLHE 1YQQA 2Q8NA 4RJTA 3MSCA 4KR6A 1KMIY 2WU4A 3DD1A 1HG1A 2OQVA 4AJKA 3RARA 2ZPUA 1CR2A 2WJ4A 5GZ3A 5JH7A 4F46A 1WSWA 3SKYA 1HRKA 4OQEA 1I7SB 4EECA 2KYRA 2PNJA 1HYEA 5A7FA 3SYTA 4J03A 3EZ2A 3GAMA 4P33A 4P84A 4RTLA 2CV2A 4TQ9A 1ZU4A 4JR0A 5FOQA 2BCJQ 2HXSA 3WA6A 5DGIA 1YS1X 3W1VA 2WU0A 3ECSA 4UC0A 4YO7A 4AZ0B 1MAAA 3ZV6A 2O8CA 4IJQA 3BMCA 1SQ0A 4DR7B 3HXLA 3FOZA 3DV2A 4FHGA 3LF1A 3PL5A 3OFND 1EFRD 2RHRA 2ZSJA 3AFGA 4I8DA 2GXSA 4LE0A 4Y2XA 5AHXA 4CM1A 1L7OA 1UZUA 4FYWA 4AKIA 4ENUA 4DR1B 1DKUA 2HD4A 3ZV4A 1LNZA 1OXXK 5IEBA 3G85A 3CX8A 2H0RA 3IAUA 1YGPA 2EFJA 1FU7A 1XP8A 1K7YA 3I6IA 2YXPX 4X6YA 1RD4A 2LRHA 3H6HA 1XZMA 3SNKA 2G7ZA 4QLBA 4ILEA 4QDJA 1IJFA 5JPIA 3UM9A 3QLVC 3TI7A 2PZGA 4HAIA 4XUEA 1D6MA 4AI6A 3NCTA 3DLPX 1ZC3A 2VTDA 4BAGA 1H8ED 1PGQA 1WS6A 3JZIA 4QYSA 3UJDA 4UQLA 4WAUA 3RB8A 3V34A 3TCXB 3ISVA 2QL6A 2CNLA 5JXIA 5DRYA 2W2VA 3MK31 3ZGVA 4Q4DA 2HR1A 4FKMA 2Q7OE 2WVGA 5TMBA 2FR1A 2BGKA 4LKOA 4P3NA 1ISSA 4DW8A 4IIJB 1Z4OA 3FDJA 2FPLA 2GZ1A 1JSXA 2QGZA 2W9XA 3RGGA 4BIIA 4IGIA