1T9GS

Structure of the human mcad:etf complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
228
structure length
228
Chain Sequence
b'LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial
publication title Extensive domain motion and electron transfer in the human electron transferring flavoprotein-medium chain Acyl-CoA dehydrogenase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase, electron transport
total genus 55
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2004-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1t9gS00
1M8GA 3DO8A 4KR7A 1QU3A 2QJOA 3RBAA 3P52A 3IOEA 1KP3A 1LW7A 2X3FA 1GPMA 3ND6A 1TFUA 3ZIUA 4J76A 5IJXA 3TQOA 3HFJA 1TYBE 5HUHA 1PG0A 4ARIA 1R6UA 1JZSA 5LFAA 1NURA 1VBKA 1KQOA 1VLHA 3H97A 1GTSA 1FFYA 1O94C 2Z08A 4NAHA 3OP1A 3ZGZA 1G59A 1YUMA 3M5WA 1B6TA 1H3NA 4PY2A 5FNZA 1U7XA 1WOYA 4JXXA 2R5WA 4GRIA 4KPUA 1O5TA 2A1TS 1KP2A 3RK1A 2QJFA 4ND6A 3VU8A 2YWCA 3X1JA 2GKSA 1Q77A 5KHAA 4HJXA 4RPIA 5TEWA 4MW4A 4MQ6A 1NUUA 1O96A 3KT8A 3UY4A 4AS1A 1S4MA 1J70A 3FHJA 4ZCQA 2RE8A 3H9BA 1I6LA 4NAUA 3RK0A 1O94D 1KH2A 3GUZA 3RJZA 1JIIA 2ZUFA 2CV0A 3S3TA 4OUDA 3ZXSA 2XRYA 1X8XA 3ND5A 4G5YA 4YP6A 3SYTA 2A4MA 1EXDA 4DDKA 3QTBA 1JEDA 1OWOA 2DUMA 5KWVA 1EJ2A 2QUIA 1N2HA 1NUPA 4ZCRA 1X6VA 3FY4A 3RHSA 1KH3A 3SP1A 2VXOA 1NI5A 2D54A 3L93A 4ZCPA 3TQIA 3AL0C 3L92A 3QTTA 3IODA 2XRZA 3NBKA 2DERA 1V47A 1N75A 4EGAA 3IVXA 1O6BA 4KR9A 5LLTA 1N1DA 2IP1A 1RQGA 4MUHA 3ZXIA 1OWLA 3IUBA 3JXEA 1WY5A 4J75A 4PBTA 4PBRA 2O8VA 4NDAA 1GAXA 2PIDA 5LM3A 3CLUC 1YUNA 2CYAA 3CVVA 4ARCA 3CA8A 1QJCA 1O0BA 4AQ7A 3FIUA 4MW1A 1JEEA 3TNJA 4JXZA 1F7VA 1OWPA 1R6TA 2DEUA 1K4KA 2CV1A 2Z3VA 4MW5A 2J09A 3ND7A 1T6YA 4HJRA 1JZQA 1YULA 2CUZA 2HGZA 1NUQA 1J1ZA 4EF6A 2AZXA 4S1OA 1I6MA 2YY5A 3INNA 3N9IA 1LI5A 4QBTA 4MWDA 3VRHA 4E1AA 4MAFA 3SZGA 1GTRA 1KKUA 1I6KA 3U1VA 1T9GR 5J5AA 4EG4A 5DB4A 3MLBA 1N2EA 4XFDA 3ISJA 4CDNA 2DR2A 3FETA 3CLRC 1Q19A 3IOCA 1GN8A 3SEQA 4QRDA 1VBNA 4ZCSA 4I6GA 1IFXA 4MUFA 1TYAE 1WXFA 1KQPA 1YI8A 2CSXA 1J21A 1TYDE 1WKBA 1N2JA 1OWNA 2A84A 2BTEA 2DPLA 3Q12A 1H3FA 1LI7A 3D6VA 2TS1A 3DLAA 1UFVA 1N2GA 1G8FA 3F3MA 1MB2A 1QU2A 1BS2A 2QUJA 4H3SA 4MVXA 1F4LA 3DV2A 3FOCA 4F4HA 1EUYA 4MW7A 1IRXA 4GU5A 1QRTA 3TS1A 3CLRD 3CVUA 1N2BA 2PFSA 4WNYA 5J59A 1G8HA 4FZJA 5F23A 3BL5A 4DDHA 5TGTA 1IQ0A 4YBRA 3AG5A 1JHDA 1M1ZA 5H7XA 4Q93A 3VGJA 3A4IA 3COVA 1QRUA 4MVYA 1ZJWA 3C8ZA 4MW6A 2WQ6A 1MBZA 1T6ZA 1YIAA 3N8HA 1PFUA 1N77A 4I6EA 1JIKA 4ND7A 4YP7A 1TYCA 1N2IA 1A8HA 1QQTA 1IVSA 2J07A 4ZT4A 1U3CA 2VTBB 1MJHA 4R0NA 3CVWA 5DK4A 1J09A 2GOYA 4CQNA 1IQRA 4MWEA 3FWKA 2CYCA 1KH1A 3OTWA 4F3RA 2ZP1A 3P0HA 3SEZA 4P2BA 3COZA 1PG2A 3FI0A 1Q15A 4I6JA 2JANA 1IHOA 4U8HA 1K97A 2J5BA 1ZH6A 4XFJA 3E27A 2H2AA 3H05A 1OBHA 1O95C 2WSIA 5K0TA 4CDMA 2WQ7A 2E89A 4HK4A 1MOPA 2D13A 2PG3A 1OBCA 1ZH0A 3KT0A 3HGMA 3IOBA 2HZ7A 3A04A 4UZFA 4MW9A 1T6XA 1T9GS 2QJTA 4XSVA 5J58A 2E18A 3UC5A 1MRZA 1PFVA 4PBSA 1XNJA 1CT9A 2DLCX 3ZUGA 4MW2A 3X1KA 4EG3A 1U0BB 4MWCA 1O95D 4U7JA 3MXTA 2AKEA 1WQ4A 4K03A 3Q4GA 3H9CA 4EFKA 2X1MA 3COWA 3COYA 4JZYA 3X1MA 1FYDA 1NUTA 4K0RA 3CR8A 2VTBA 3LE8A 4L2IB 2QTNA 4EG8A 2QUHA 5K0SA 3PNYA 2X0KA 3PNBA 5EKDA 4MULA 1WXEA 4A91A 2BYTA 3NV7A 4EG7A 1M8KA 1QNFA 2IJGX 2OQ2A 1QRSA 4MUGA 1NP7A 1R6XA 1ILEA 3CVYA 1XNGA 3MUEA 1F9AA 3IMGA 3SZ3A 1MAWA 1KAQA 1PFYA 1VL2A 2X1LA 1NZJA 1J20A 4MUKA 4X0EA 1VBMA 2DETA 1EUQA 3HZRA 1N3LA 3PRHA 1TEZA 3RFFA 1YIDA 3A2KA 1K92A 2EL7A 3FH0A 1KORA 4MW0A 1WXGA 2JAXA 3QE4A 3UMVA 1J1UA 1H3EA 4NZPA 1WZ2A 4EG5A 3N2YA 3FNRA 4G6ZA 2AG6A 1WJGA 2E0IA 1WXHA 2A7XA 1NUSA 1SURA 2QUKA 3LCJA 4YP5A 3CLSC 3K9WA 3CLTC 2J08A 5KCMA 3A05A 3IMCA 3KT6A 1JECA 5JBNA 4EG6A 3IUEA 1GLNA 3SDBA 1M83A 2CYBA 4G5FA 2H29A 4WSOA 3DPIA 2NZ2A 1N2OA 2B7LA 2EJCA 3H99A 3Q10A 3MMXA 1QTQA 3K32A 4R2MA 2A86A 1KQNA 1WQ3A 1EFPB 2PZ8A 3P0IA 1EE1A 3IVGA 3GMIA 3PXUA 5IHXA 5H16A 4DLPA 4EG1A 2QTMA 4MLPA 2V0GA 1H1TA 1N78A 3G5AA 2Z09A 3UK2A 1TQ8A 3G59A 4L2IA 3N05A 1NYLA 5BNZA 2A1TR 3CLSD 3CLTD 3ELBA 1KR2A 3KFLA 5AHWA 3UOWA 2C5SA 1I2DA 4DJAA 1P7PA 1OD6A 4DNXA 3AG6A 1MB9A 2A88A 4ZT3A 2J4DA 4DE5A 3CVXA 4MUIA 1O0CA 1Q11A 1JMVA 2A1UB 5FO0A 1EFVB 3FDXA 3D6UA 4NX2A 2PXHA 4MVCA 1NSYA 2PZAA 3ZJUA 4KR6A 4RUKA 2YWBA 2E21A 2GM3A 3KT3A 2O5RA 5HUJA 3G6KA 1U3DA 4HPWA 4UZEA 4TS1A 4NATA 4Q16A 2ZUEA 4ZT7A 3AFHA 3NBAA 2WB2A 1JGTA 2OV4A 4JYZA 4MUEA 3TZLA 5HG0A 4R2LA 1Y42X 3HL4A 1DNPA 1M8PA 2HMAA 2IELA 3MLAA 1IH8A 3GLVA 1XJQA 3AKZA 1XNHA 1ULHA 4JFAA 1GZUA 1MAUA 5TS2A 3ILVA 4ZCTA 3P0JA 1O97C 3IMEA 1HYBA 2JA2A 4KPUB 1D2RA 1WXIA 4MUJA 1V8FA 2DXIA 1KAMA 1M8JA 2G36A 4MWBA 1F7UA 1M8FA 4OJMX 2CV2A 3FG9A 3IDFA 1EFPA 2QTRA 4ZT6A 1O96B 4U63A 3IH5A 3LOQA 4YMIA 1MC1A 4ZT2A 2CT8A 4MUNA 4KKVA 1IQUA 5DEOA 3TZEA 4DDMA 3HV0A 3I05A 4ZT5A 1JIJA 2I1LA 1PFWA 2YXNA 2CFOA 4OUDB 3CLUD 1OWMA 3HMQA 1ZUNA 2D5BA 5DASA 3ZJTA 5FO1A 1U7DA 4BWVA 1O97D 4CT0A 2NSYA 3AIIA 4MVWA 2PZBA 2V0CA 3IVCA 5TEVA 3PNVA 1COZA 4QREA 2RD2A 1G8GA 1K4MA 2A1UA 1JILA 3ZJVA 1EFVA
chains in the Genus database with same CATH superfamily
1M8GA 4BVJA 2XUAA 1H2XA 2I3ZA 3L4BC 2DPXA 1QU3A 5CA0B 3PC6A 1DC4A 1KHHA 1E1CB 2QVBA 3L7JA 4WE3A 4DREA 1Y9EA 4PC7A 4BC0A 1GPNA 2J67A 2HYDA 3THRA 1JA0A 3HFJA 1YR8A 2AE1A 2GHIA 3B1XA 3OQVA 3HKDB 1MIHA 3OJOA 3SJZA 2HTEA 3H2IA 3QMPA 5HZKA 4BTEA 3FCAA 2FZGA 4YHBA 5L4LA 4K2AA 3H42B 4RK0A 4AF8A 5LU8A 4RADA 4PS0A 5AHKA 4LZJA 2V7QA 2Q29A 4LXQA 1XRJA 4R54A 3FOEC 2B8WA 1WEHA 2GPJA 5HKBA 2C3MA 4NRDA 2C7BA 3U4QA 1HM5A 2EERA 3JR7A 2HSDA 3SZMA 2PMCA 3KJGA 1WOYA 1NGSA 4GZMA 1LF0A 4U6NA 2POCA 2DTEA 2C20A 3U2QA 2QEQA 2IEDA 3AF0A 3KKOA 3IO3A 3UMFA 2YVKA 1KAHA 1YIOA 3GQBB 5FR2A 4JI4B 1QFJA 5TEWA 4KOAA 5BMVA 3VNVA 3GA0A 2XOXA 2O59A 4DXAA 1GWNA 2RGNA 3DGEC 5JRZA 1MJ5A 1ZGGA 2ZFUA 4L50A 2OXIA 3S8EA 3SSAA 2PK3A 3IALA 3P9XA 1H4TA 1DC7A 2D2FA 3FA2A 4OB6A 1NOKA 3SR3A 5KQGA 3H9BA 1LTQA 2EW1A 3CU5A 3U6BA 3G7NA 2YIDA 4GMHA 4AW9A 4DLTA 5FH9A 1E2PA 5C7OO 5K4GA 1OAOC 5JC8A 3AEYA 1PEAA 1UEJA 1BXGB 5B4VA 2FG7C 1C1YA 5HIAA 5IXJA 1KSFX 1GAJA 1FF9A 1RWXA 3Q2IA 4QPDA 3GLGA 4BVHA 1Z6PA 1U7UA 1XD8A 2ZRHA 1H2WA 5KSYA 1XK7A 4EA7A 4JH0A 1I10A 5H70A 1L5FA 2MSNA 4PM4A 2WJJA 1T0IA 1VXRA 4DIFA 4WQMA 3BF8A 1DDOA 1NI5A 5A3JA 1NN0A 1SRRA 4ZCPA 2I7VA 3ACDA 4LMRA 3JU3A 3V7WA 2Y0BA 5MDHA 3ISTA 5BSRA 4QAQA 1CUUA 1PVDA 1G8PA 3LF1A 4AWXA 2Y76A 3OECA 3ZWXA 2GX6A 3HVUA 1P2DA 5EUCA 2NZVG 2P3SA 1OJLA 2PX4A 4UDNA 3Q7EA 3U7FB 1RAAA 3TTUA 3EIXA 5G0UA 4M54A 1KEWA 2F90A 4G67A 4IXTA 4OQZA 2F6RA 2QVYX 4EZEA 2XVZA 3HJGA 5KQLA 3EMDA 2BPOA 4CM4B 3KSRA 1N9KA 2NTVA 3LRPA 1PE0A 4JUIA 3K05A 3UXMA 1YUNA 4WZZA 3ZVNA 2J0UB 5FNVB 4NH0A 2H5IA 3R1IA 4ZYTA 4OL9A 1FXWF 1KEUA 4JHLA 5DN9A 3STYA 5L9AA 2DWPA 2QLJA 1K4KA 1Q7TA 5BSUA 2HMUA 3JRXA 1QDEA 2C4VA 4ALKA 4M1YA 4ETMA 5FUBA 3RS2A 3BBPA 2CL6X 1SQ6A 4MO2A 5EERA 3SHTA 4QT0A 4M2LA 3AERA 1JQKA 2GCGA 3BHJA 2JEZA 1YA4A 2Z95A 5FXMA 1JHVA 3S55A 3A4TA 3E9CA 4NE2A 3OH8A 1UBKS 4XLTA 2R44A 4X85A 3NFRA 3OZUA 3Q3CA 4HFRA 4B87A 1IAVA 4KQMA 4FKBA 1VHTA 4QHSA 3RS8A 1BS9A 2WSLA 3LQ2A 1EXWA 1OFVA 2FPPB 3T06B 2MIIA 2CD9A 1V7CA 3DUFB 3N9IA 3KTAA 5CYGA 5JO9A 4ENWA 4ZFNA 5K8UA 1L4HA 4I46A 4PSCA 3AKEA 4NH4A 1KKUA 4N8SA 2J7KA 1O08A 2CXOA 4F4JA 1E6LA 3CXUA 1HNXB 4M8KA 1NW9B 4PIMA 2BELA 3PCXA 3FSGD 4FQ8A 4J4HA 4UAGA 2AQKA 4M60A 1VG0B 1N2EA 2PLWA 1NU6A 4TVKA 4AO6A 5D1NA 3D6AA 1RRMA 4DV4B 3KS9A 2CBZA 2Y9MB 4CEIB 1U2QA 4FYIA 5JH7F 1EP9A 4CIXA 1PS8A 4NZMA 2XYGA 4G1BA 2FX5A 4HGOA 1N6LA 1T3GA 3LKBA 2QLLA 2RI1A 3OETA 3PXAA 4XYEA 1TYDE 1XCLA 3LC1O 2P6RA 2FCRA 1ZGBA 4OHPA 3PFFA 2FSPA 4HDSA 3V2GA 3VPAA 5JVDF 1VG9B 3EDCA 3I9FA 4XM0A 3QXCA 2EFYA 4C3ZA 2YJ6A 3OJLA 1XP5A 1U3UA 4C4PA 4F9FA 1XMOB 4WWHA 1CTQA 1H3FA 4URUR 5D85A 3WAGA 2V7EA 3B8HA 5H59A 4OGFA 3T3MB 4GLJA 3WDMA 2RHWA 1RC8A 1X7YB 1TM4E 2XZDA 3C1UA 2ZYDA 2OLKA 1F12A 1OR8A 4Y6RA 2XA1A 2ZATA 4P92A 3I0ZA 4UCXA 4YROA 2C82A 4MW7A 5UKDA 3H65A 4DRYA 4K81B 4QU5A 3GC6A 4AQYB 4QM7A 4DR7B 2RGWA 2CJWA 1E7SA 2W98A 1N2BA 2B3DA 4PNPA 3V55A 1DT5A 1EVYA 1LVGA 2CHUA 1FY2A 3UAYA 5JAHA 1C30B 4J0QA 2AXPA 3TE6A 1GL3A 1YB2A 3DZ8A 1J7JA 1QHYA 4RTPA 1LZKA 4I2NA 2RMKA 1I3CA 3ONDA 2WMOB 1W73A 4HD8A 1YE5A 4OYLA 3PNPA 3W9SA 1ES9A 3ZLTA 3FYSA 3PVCA 3H2SA 1IXYA 4HC4A 2XT6A 4ND7A 5FB3A 2DKOA 2VWGA 2ZIEA 4OM7A 3VJKA 3RAEC 5C31A 1C8VB 4FGUA 1U8FO 2V59A 3JQAB 3GXBA 3IP8A 4HEHA 4EEKA 5JQGB 4B3HA 1JFTA 1HEUA 1PJLA 4IMRA 2DY1A 3QFCA 2OFOA 3B1JA 4U2KA 5IEJA 1SHJA 1TMKA 4TMXA 2HU8A 3LL4A 4MIKA 2BEUA 3JD0A 2PSFA 3KJZA 4PAQA 3T9EA 221PA 2GRAA 4MGHA 3OPNA 3GGGA 2J7PA 2IV7A 3R40A 3DBHB 3R9WA 1XCPA 3E03A 5AYVA 2IBSA 1EH5A 4NXMB 5U1PA 1R10A 4N49A 3M1IA 3FOBA 4HS4A 4EFDA 2WNHA 2H2FA 2V98A 3BIJA 4L5IA 1PEDA 1CRZA 1SVSA 3OLCX 4MHSA 3C8MA 4HQKA 3WOVA 4QOEA 1WMBA 2XKKA 3HB1A 3DMDA 4JL8A 4KE6A 2ZJOA 1KVQA 1NXXA 5F1PA 4RHXA 2ZAOA 1C7ZA 1O9HA 3FTPA 1R9NA 3H5LA 4UNQA 3LF2A 4S1TA 1XDUA 4TWJA 4E2XA 3DCJA 4DB4A 3K1AB 1JU3A 4MQ5A 3HGMA 4RMHA 2C2KA 3NHLA 4GKAA 5KQPA 3GCZA 1ZW6A 3EDRA 4RORA 2II6A 4L74A 4GO1A 3BRCA 1X7DA 3T4EA 4MEJA 5JMOA 1OX4A 4CKCA 5AVRA 2P62A 4IDFA 3UC5A 4L07A 4MYUA 1SKBA 5AVTA 3LYHA 4KRFA 1JU9A 4XB6B 5EP2A 3RRFA 3KHUA 3NTLA 3SXUA 5KDOA 2O8BA 4UZSA 1SOUA 2GMWA 3LNTA 3NVDA 4QHYA 5B7GA 3ZUGA 5TQJA 1NVFA 3B9PA 3IOMA 4EYSA 1PJ3A 3QBEA 1B74A 1MJNA 3DO6A 5COQA 2IGTA 4A5OA 4FT4A 4BP1A 1EMDA 3KEOA 4CQMB 5MGBA 2F8SA 3Q4GA 1R0XA 4XRGA 3MFQA 3PITA 3B6EA 1F0PA 1SEVA 3RRBA 1I2BA 4DQVA 5JEDA 2D2VA 4RQAA 3NEYA 4HH1A 3IP9A 3GUHA 1V5FA 2OV6A 2JI7A 3WRXC 2IY7A 1UDWA 3DAFA 4FR5A 4O2AF 4Z4CA 2R751 1K5PA 1E1LA 3TF5A 4I1RA 1Y89A 2LV8A 3ICEA 1V3TA 4UPDA 1HFEL 3ET5A 4HSGA 2P3LA 4P7FA 5IBQA 3SHQA 1JQAA 3UA3A 4B3CA 3HCNA 4CKXA 4DCJA 1XZMA 3NV7A 2NW6A 1NXOA 2A4KA 1CHNA 1P9NA 4OAPA 4A0RA 4AYXA 2V5AA 2VR1A 3OQ6A 4NOKA 4HVLA 5JZMA 1JWLA 1JDZA 1M5TA 4ICIA 3WL7A 3ZE1B 4GR9A 2C84A 1LXCA 4KVAA 4KC0A 1EM8A 4PNEA 5CD1A 1N5RA 5JS2A 4ZMSA 3PXEA 2ZIWB 3M7IA 2VTKA 1ILEA 2C0PA 1HMYA 2CNWD 3LP5A 4NU0A 4QJ4A 3TEJA 1J2TA 2Q0SA 2WKPA 4BFUA 1A95A 1NZJA 1O58A 2HN9A 3OQNA 1A4IA 3SLRA 5JNLA 3MT8A 2G04A 5L3VA 5HP4A 1N3LA 5I5GA 2GAJA 1S5PA 3A2KA 4QBIA 3VZRA 1CUZA 1P3Y1 1P2UA 2X4DA 3ICVA 3FH0A 3NPAA 4BNDA 5BQPA 1NJGA 3UMVA 5LQCA 1B8VA 1NXPA 3DNPA 4Z0PA 2JJ2A 1S01A 2C9CA 1IM5A 2ZYTX 3K0AB 3P9SA 2A7XA 1KYTA 2NNWB 3VHXA 1V8BA 1GVHA 3GUYA 3ITEA 1UWCA 2W8BB 3A1TA 3D9QX 2G1JA 2ZRCA 3NPMA 3TRIA 3K9WA 3TSZA 2WF6A 2GAAA 1XDWA 5BV0A 2W2VA 1XYVA 3KDAA 4KQHA 5E1OA 1LLDA 4R1OA 2XV1A 3KZVA 4D0NA 3IUEA 4BO9A 5I7HA 3DEAA 1RWMA 2CLKB 1WVMA 1Z74A 4G5FA 1H2ZA 4WSOA 4RKFA 2O9JA 4CKBB 5FOQA 1G8SA 4PX3A 3OCVA 1RI1A 3PS9A 4RJJA 4WFIA 4EDFA 4QT4A 1Y82A 4P6VF 5F35A 1R6AA 2P3QA 1YZLA 3EASA 2CNBA 3P0IA 3QV1A 3KCNA 4HEA6 4N3GA 5F4BA 1L5HA 3MTQA 4WY2A 4CKYA 1WNFA 1RXYA 5K1ZA 3OFJA 1NFRA 2VSXA 3F78A 4MLPA 1UFKA 2GHRA 4FBMA 5EXTA 4IIGA 5REQA 1XNQB 1N78A 4RVHA 1KY2A 3NYRA 2MJLA 1BMQA 1NYLA 1FXSA 3JQDA 4ZOLF 3N6RA 3R5XA 3PWSA 4J0HA 5DBHX 2VJKA 3AUSA 4M49A 4W5WA 3ZZ0A 4LYHA 5HZHA 1GSAA 4LV6A 1T2EA 3IUNA 3GHHA 3P96A 3VR4H 5JXJA 2JH9A 3NWJA 5DI9A 3TX2A 1DG1G 1RI2A 3HNPA 2EKQA 2EKBA 2NXNA 5BSFA 5AI5A 1JFFA 1SCNE 1QFYA 4CL2A 3CZPA 3LUJA 1ZEMA 1CD5A 2JIOA 4YCLA 1I7PA 2NN3C 1W88A 1MQ9A 1M5UA 3BCUA 4UAJA 1MHPA 2AX3A 3P9QA 4LY9A 1VOTA 5DM1A 4E13A 2P9EA 1LPSA 2C95A 2I2XB 3MOGA 2I7XA 4HRVA 3S2FA 4EHIA 2GSWA 3T12A 5DN6D 2JEOA 3FPKA 4TS1A 5K05A 2X42A 2GNOA 3ICPA 3LNCA 3MA0A 3R0JA 3W2FA 4MQFA 3WLRA 4BKRA 2WR8A 2HRZA 2ZR7A 2KW5A 4IIJB 5GAJA 7MDHA 2AHRA 3LC7O 4DQDA 2H11A 3ZWKA 2IELA 2G9NA 3SJAA 3NDRA 3DBVO 5FTNA 3LKDA 4E5VA 1GPWB 4OAOA 3B5IA 4HNRA 2OAEA 4Y1RA 1YRBA 2FF5A 3EIOA 4KPFC 3TLAA 3GR6A 3DDZX 4EF4A 3O3NB 2CLHB 3CX7A 1LW6E 1NQWA 1X1CA 2W6MA 4J8PA 2WJZB 5I8ZA 4BX2A 4TYQA 1ZR2A 2IZ7A 4HMPA 1XEWY 1II8A 3EG5A 3TLMA 3P0FA 4FU0A 2AE2A 4V2UA 5LYJF 1QHSA 2ECOA 1H5NA 2QN3A 3T7AA 5IT0A 4RTSA 2CV2A 2O19A 4D9IA 4A3SA 5ES4B 2QRVA 3BJEA 1U3TA 2R6ZA 3IH5A 1L1RA 2RHTA 2TMDA 3WR5A 4WKBA 3F97A 1PHRA 3RVKA 3WLSA 1C1DB 2I54A 4ID9A 4YMIA 3HXKA 4MKHA 4JA0A 4P4UA 1BXKA 1U9IA 4PWZA 5BQ3A 1RJDA 3OTIA 3Q9LA 2WA2A 5KOHA 2AG5A 3B13B 3NS7A 1NM5A 5KZMB 1UFOA 5IU6A 4B83A 5FO1A 3QEBZ 5KTTA 3GG9A 3PC7A 4G9BA 1GFIA 4Q9LA 4CT0A 1Z9BA 2OECA 3MT0A 4FN4A 4C9BA 5K3OA 1JH9A 4DLUA 3KB1A 1NRXA 1F8FA 4NYIR 3I53A 4FE4A 1K6IA 3IMFA 3OT5A 5YASA 4XQCA 1NBME 1RACA 2BHTA 4XEHA 4KMRA 1Z5OA 4IH1A 4CI9A 4KQGA 3DWEX 2H59A 3UXEA 5HK8A 4YJ2B 5C81A 3DO8A 2RGDA 3FUVA 1YJCA 1BH2A 4KDRA 2AZTA 1DJOA 2ZRAA 3RC8A 2E1RA 4GLOA 2AFHB 3P52A 4PYKA 3PKZA 4BNXA 3I1JA 1S4QA 1Q21A 3NAMA 3P9CA 4W5JA 3N8DA 1TYBE 3VX4A 4HYTA 2RKBA 2HLDA 2C88A 1DCFA 3BL6A 1P77A 3KB8A 1WZUA 3L2OB 3QG5A 1KQOA 3RODA 4CNBA 4Y67A 6ADHA 2XW6A 4DB2A 2WM3A 2C2BA 3I2FA 1T4BA 3O74A 4I14A 4BFCA 4PAWA 4BUJA 3UFBA 3BE4A 1KYZA 2JPDA 5E7QA 5HF9A 1KY3A 4R3UC 2C3PA 3REOA 3X2FA 2QAIA 3V1TC 4LE2A 3D5TA 2BKXA 2CXRA 2IS2A 4AY4A 3G0GA 2XLCA 3UT5A 3QNUA 4HDMB 3JQGA 4RIIA 3X1JA 4WESB 3NALA 3ZGVA 1OV6A 3KR1A 3ZY4A 2PNJA 4IDDA 1QM5A 5F77A 5G4KB 4J7XA 3VJMA 1X8JA 2VQEB 4DV7B 1OASA 1TJNA 1TO6A 1WHSB 1Z13A 1O96A 4C7BA 1KIAA 3CEAA 3RS7A 4HYYA 3WLTA 4D56A 2I6UA 1JHOA 1D4ZA 4C6TB 2QP9X 4K0KB 1J70A 2DYKA 1FYEA 5IM4F 1TK3A 2B99A 3NAGA 3N0VA 4FX5A 3TECE 1KK1A 5JLJA 3TQQA 2C9BA 5DMHA 3NU1A 2FRXA 4KLNA 3FCEA 5ERYA 1HRKA 3I61A 4GMKA 2FMHA 3CGWA 3S3TA 4LWZA 2PKCA 2V7PA 4RELA 4S0ZA 3TQHA 2WLTA 3DSRA 2Q7OE 4EKNB 3P45A 2EHJA 3RV4A 2A94A 2ZIGA 1IN8A 4FMPA 5BYKA 1JVNA 1B0ZA 1G6OA 2PVPA 4NSNA 1WDTA 4HDKA 5KTOA 4G37A 1BTOA 1H66A 5LZ2A 4EJSA 1KJQA 4TYPA 1RSZA 3VSEA 4HX9A 2OAGA 5EN4A 1A4UA 3KKLA 5DU2A 4NCIA 3N3AC 3TQIA 1X8LA 3MRXA 2P11A 2VVTA 1UKZA 1BJRE 3C3KA 3D6HA 2FW0A 4LBVA 4YCSA 3IODA 5H4GA 4BKPA 3TJMA 3NBKA 2DM6A 1T36B 1U9JA 1ZICA 1QHHB 4MJ3A 5LLTA 1HF3A 1OXSC 3KXPA 4UVHA 4OHZA 4CKEA 3QYPA 1DJMA 2YFQA 2WV7A 4LJYA 1XK6A 4YDSA 3VVBA 2WDPA 3ZXIA 4CKWB 3G5LA 3F1KA 1Y98A 2J5KA 2BJVA 3WLIA 4ADSG 1E7YA 5KOJB 1H93A 1JAHA 4PLVA 3U7EB 4YC7A 2O57A 3KXIA 5AD1A 2JLRA 3FIUA 1IN6A 5AIAA 5EJFA 3X1WA 2JI8A 5EWLB 5FA6A 3X0DA 3I5MA 4JB8A 4FIZA 3FFXA 4EQ6A 2BLLA 1OLUB 5AI9A 4DUYB 2XPCA 3D6FA 1IVYA 2Z58A 2ZBQA 2GN8A 3BZUA 3TNDA 3DE1X 4M86A 4AO7A 4MW5A 4R1MA 4UTZA 2NZWA 4PNHA 4A73A 4AAYA 2WMNB 4RC9A 4KR0A 4EVQA 2DF8A 5HHTA 5JYBA 3KXKA 4URWR 2QM8A 5E3HA 2ZZMA 1K89A 4QYXA 2XUJA 3VDXA 4DLSA 3NDIA 1D1SA 5JAMA 3GGJA 1UXIA 1FBTA 3HC7A 3KJIA 3W9YA 5K99A 4G1VA 1PQPA 3R3YA 5LUAA 4C4AA 1QQBA 1ECGA 4FONA 5EKXA 3W5AA 3T0IA 1YE3A 2O8EB 4CCYB 3GLHA 1I6MA 2WUEA 3AU9A 2XWPA 1PTJC 3EC7A 1T10A 2QVGA 3HEAA 2BEWB 3QVSA 2AN1A 3SHWA 5C5DA 3OX3A 5M5BA 2MR6A 1A9XA 4E5PA 3DTVD 4ZPJA 5CX1B 2G6TA 4MP8A 3HACA 4PHHA 1T9GR 2XB8A 2XKAA 3DEYX 4L1KA 2X7XA 3R4VA 4BGVA 5J5AA 4QBGB 3WQQA 3ESBA 5AK6A 4GM4A 4KU4A 4NK4A 1ODCA 2O3RA 4LY3A 5A4MS 4DDWA 4WOPA 5SYAA 1IB6A 1XTTA 5HIIA 1RYBA 1JSZA 4UUPA 4GOOD 1R6BX 5EHNA 3S5UA 1O89A 2AKAB 2B21A 4KYUA 4ACAA 3GEBA 3RTCA 1KFEB 1VJ1A 3GG2A 3KR2A 1E3TA 3RIHA 4RKWA 1KRWA 4N5IX 3IXQA 3A6EA 3AR3A 1FMLA 2BMFA 5JI3E 3GZTB 4DLNA 1HDCA 3VTAA 4QFCA 2HYIC 5EGSA 4KFCA 2PKQP 3H0CA 1YR1A 4TTPA 3WWYA 2BTEA 3OQBA 3SMQA 1VTKA 3FFTA 4REOA 3OT1B 3O4JA 4RS3A 4YRBA 1JA1A 4WKOA 3OZIA 4Y1FA 4QU9A 5D5PA 2C00A 1BE1A 3O9ZA 2EX0A 4RZUA 4BCCA 1B8PA 3C3PA 4CLRB 4QKQA 4OLAA 3DV2A 3CIFA 5HIMA 3B9RA 3U13A 4F96A 4F4HA 2FQQA 4CFYA 1E4EA 5CCEA 1AGNA 4ZAFA 1XTIA 3E53A 3KQVA 4A0QA 2JEYA 2B4QA 3EOZA 1QRTA 4PPYA 1C3OB 4UREA 4EY5A 4DCNA 4ZOQI 3QEJA 1UANA 4EOGA 3WLKX 3FCUB 2MSWA 1L8XA 5JSZB 4RGYA 5KYWA 2H4WA 4W8GA 2ZJ6A 1MAAA 3KSUA 5KU1A 3TGWA 3ZCSA 3VH2A 4U2CA 5K0FA 4YCCA 4NHOA 3BC1A 1MV5A 1OQAA 3A4IA 3MIIA 3RYFB 1MD9A 3DOJA 3ZNOA 4B71A 1NMEA 2KLBA 3C8ZA 1HSZA 3G2LA 3HI6A 5CW2A 1OHHA 2IEIA 4IWYA 4GC5A 1KEZA 3D8TA 3REGA 4B81A 2QE6A 2CDAA 3EXFA 4UFOA 5AK5A 3OX4A 4UUOA 2RFLA 2Y1GA 3B7PA 4OJKA 2IRWA 4GQIA 3SLGA 1G1AA 2Y1LA 1A8HA 3ZJYA 1I6WA 1QV7A 2QVLA 5KTNA 2FSVA 3WNDA 1NBIA 2BISA 3LUPA 3IMKA 5JQWA 1Z47A 1RMQA 3FNHA 2QQEA 2OHXA 3A58B 1NXTA 4KI0A 4JBGA 4PFQA 4RIFA 5JVDA 1WZEA 1T9ZA 1MTOA 4X6XA 4UPEA 2IH4A 2EIHA 1OVMA 3JAWA 1JG1A 4GI3A 3HYCA 1EAYA 3SBOA 1C7FA 2JJQA 3TOZA 1OZGA 1OU0A 3C6QA 2Q5OA 3DEKA 4OIFA 5ESRA 3RIMA 2XE8A 3WYCA 4GNRA 2FJUA 3CW2A 4PFSA 2IFTA 4I6JA 1E4VA 4XW2A 4IUDS 4IF6A 4KO3S 2HCTA 3I1YA 2ZEJA 1NDQA 2J5BA 2JIDA 3V97A 4FYHA 3TW8B 1VLLA 5ECYA 3G7SA 2VK1A 3PPIA 5CEEA 4HMQA 5TDHA 4PTLA 5DGDA 1SY7A 2WUVA 3OOJA 4PYRA 4BEWA 3AKYA 4LK3A 3BWYA 2W42A 2V1UA 1SJ9A 3RNOA 2ISSD 2NSLA 3KTFA 5A9SB 2OBLA 1G3UA 3WGVA 5J43A 4Q66C 4DLXA 3SIWA 2WF5A 3ZJ5A 4DV6B 3BAFA 3HYRA 1ZGAA 4GLFA 2WBLC 4DIOA 1SN7A 5EP4A 1C41A 2YS7A 2HDNB 4LJ9A 4GQBA 3A6PC 1JMYA 1W52X 4LDRA 3PHIA 4KGVA 1O2DA 4M9CA 4QX6A 4RETA 4BGIA 3I30X 4MWZA 2QAGC 3AP2A 4G0OA 2DPGA 1K8QA 1G38A 2BW0A 1JSXA 4ZAXA 4HNUA 2PIAA 2YV2A 4PBSA 5GVRA 4DMLA 1LA2A 5HOEA 1XNJA 3OTQA 4HBGA 4A6XA 4MYDA 1JZTA 2DPYA 3LYUA 2X76A 3CW9A 2GJKA 1V1RB 4FUTA 1RFLA 3WV5A 4D6XA 1ZLYA 2WT8A 1ETUA 2ZR9A 3C6MA 5IRCD 5CCXA 3VSCA 1Q50A 1IEVA 3FPBA 3NANA 2WTXA 2FUG6 4G3XA 4LNUB 4EGJA 2GEFA 2GWRA 1FJ2A 1JLRA 2CD7A 3GYBA 4IZ6A 1UIMA 2BCJQ 1KVUA 2J6IA 2R1VA 2HWKA 2X1MA 3EUWA 4H4CA 3COYA 2FMTA 1EVZA 2GT1A 1CS0B 2F2TA 2GUWA 3T3OA 1ZAKA 4R1PA 4FMCB 1ST2A 1Q20A 3EGEA 1YCGA 2PLFA 1EG7A 3OKFA 3P8ZA 1P60A 1SHZA 4MULA 4WBXC 1QMPA 3M5CA 2BYTA 5HR5A 4EG7A 4PLCA 5A1TA 3EG9B 2GZAA 2IHBA 1E0SA 5I45A 1D6NA 5LLDA 5KYYB 2CJFA 4OB7A 4TT8A 1QRSA 3TAXA 2CWDA 4QASA 4HBZA 3HA7A 3UH0A 1PR0A 2V4UA 1XN4A 3AJAA 3I9KA 3QPVA 2J6HA 3E5HA 4HYEA 2B0CA 1I4LD 3EFOA 2OO5C 2PLAA 4B75A 3R6LA 4MWSA 3GIDA 2HA5A 4W1QA 4UCFA 1SPXA 4P3KA 3UJ8A 1G20A 3OZRA 5LOVF 3IHWA 2VDQB 4R9RA 2PSDA 5JY1A 3O8CA 2I66A 5KNLA 1UXKA 2OD9A 4RM2A 1P81A 1QFZA 1CHDA 1UBCA 5LR6A 3K6KA 1MHTA 5DH9A 2PBLA 2JC3A 2JFVA 1E2DA 4RD4A 5K20A 2BZ0A 3NW9A 3L84A 3L05A 2JRLA 3QX8A 2FFBA 2ZTHA 4G6ZA 2BUCA 2PEZA 1B41A 1LLFA 4G8DA 5LWHA 1GL7A 1NUSA 2DQYA 2IODA 4OGWA 4RENA 2DBRA 1XCBA 2HSGA 4Y2TA 3O38A 5T4BA 5FPPA 2JFQA 4II2A 3U7GA 4MOWA 2UXBB 1B2LA 4EABA 2VI5A 1W8DA 4OQDA 2VBIA 1QTIA 3L7LA 4G0XA 1DL5A 4JI1B 4D9HA 5F1YA 3H87A 1V43A 3NM5A 3ZWCA 5BWCA 3SDBA 1FP7A 4YB8A 3QU7A 2E5WA 4G89A 4RD2A 4JYCA 3PXGA 2FG6C 1KO8A 4EY8A 2M2IA 1HKUA 4MZDA 2EJCA 3Q10A 2QRPA 4R2MA 1BEUB 5C5CA 1N36B 2VNIA 2D62A 4RDCA 2QXTA 5KU7A 4OX9Y 3T95A 3GMIA 3RFTA 1UDAA 3S1LA 4XYLA 3C3MA 2OC4A 2B7CA 3RTDA 1CUJA 5CT8A 3WTCA 3P9YA 2MSKA 4D41A 5COBA 1G3MA 3L06A 3TO5A 2G6BA 4Q4CA 2EV9A 1BDHA 4C7OA 4GZ6A 5M34A 1RAEA 5I9SA 1EEHA 3DB2A 4DA8A 3B1FA 1WPRA 2X8JB 1MO5A 1BJKA 1FL9A 3AFNA 4PC1A 1KJNA 3ZDAA 4CEJA 3NYWA 3CLTD 5JRJA 1ISJA 3EYAA 3O2NA 5AI0A 3TJRA 3VJLA 2C1EA 1KY4A 2NM0A 5B36A 3Q9NA 3PGXA 1JJFA 4MRNA 4E15A 3ZHZA 1JHUA 2D1FA 1OD6A 2VP5A 4H4EA 3FUCA 3QY0A 4I66A 4CIDA 3H83A 3HPRA 2WHQA 3ASVA 5J40A 4YWHA 4MVJM 3FPFA 3UCEA 1VBFA 1GL6A 2VQDA 5FI5A 1EK1A 1YQEA 2R6HA 4RULA 5H80A 1A98A 3F3YA 5TMEA 4DSNA 5I8WA 2A58A 4KFSA 1NSYA 2FSHA 4DLLA 3E8MA 3ZJUA 4FINA 4L8LA 2OZKA 2RH5A 2R68A 1R6VA 3OSUA 4UEQA 5EWMB 3TN7A 3K70D 4E70A 2NVWA 2JLWA 1OT5A 1KI6B 4DT1A 2WIJA 3ZK7A 4B3MB 3ENZA 1I3NA 1R3DA 3QEKA 4DMUB 1LPNA 5AUOB 1E59A 3TMYA 3N2GA 3UKDA 1NW4A 4AS2A 1U3WA 4U0JA 3HB0A 1H6BA 5JCPA 2GK7A 3EX7C 4JLPA 3K72B 2I67A 1IBMB 1X1RA 2AOTA 5G0WA 4QXQA 2WM8A 4DBVO 1ZM9A 3E22B 3GLVA 3UV6A 1OI4A 2WIFA 5DKFA 5GONF 2PVSA 3GJZA 4AN1A 5DNYB 2QA5A 1DVRA 1GU0A 4M89A 3EH2A 2VZ0A 3R7SA 4MA4A 3OD5A 3QENA 3DLCA 1QLJA 3V6LA 3P2OA 2WQ6A 3KYDB 3MEQA 9ATCA 4NU8X 4RFSB 3S8MA 4ZOLA 3W77A 3EZFA 3NQ41 4A0HA 1OPXA 2ZI6A 3B1KA 2XOKD 3UGKA 2R6CA 3FCSB 2D7CA 5J4YA 3QE2A 4DEXA 1IN5A 2RC6A 1RYEA 2VS1A 4L57A 3B36A 5LVAA 1H4QA 1E9SA 2J9FA 3RTBA 4DKJA 4LHWA 2XYPA 1SG6A 5C51B 2ZW9A 3WWCA 4G26A 2IYVA 4DR1B 5DEOA 1JHMA 5AJXA 5B3JA 4NCJA 1F38A 5CBKA 1PJ8A 4ND8A 5LP1A 3FOFC 3DZGA 3AM1A 3CUEF 2FVXA 2R8XA 3HMQA 3PU6A 5FI3A 2GFIA 1KFJB 5DYYA 5FAXA 1U1CA 5FLYA 4AIIA 1KI9A 1R0RE 4IFTA 4HLUC 1JFSA 5EI5A 1AK2A 5E9AA 2OHOA 1CQXA 4PXSA 3HBJA 2BEKA 4Y9DA 4OQPA 5CAEA 3A3PA 4WVLA 5F9FA 4IICA 2H1CA 3D2LA 5AKZA 2C2ZA 4FCVA 3LMKA 4G24A 1QZUA 5J2UB 1QDLB 3UAVA 4CG0A 1BU5A 3GJYA 2H1WA 1EFVA 4Z9AA 4E30A 2CLLB 1SULA 1IY9A 2Q5IA 4KGZA 3A36A 2PN1A 4HGRA 3RVOA 1RJFA 1RYYA 4LDQA 5B30A 4ZARA 2XTJA 4TX1A 5HFNA 3TIIA 3ZHTA 3O7WA 1C1XB 1H0KA 2I29A 1OTXA 2FJ0A 4OLFA 4AD8A 2ZANA 5DWQA 4JLBA 3VV3A 2JFWA 1XP8A 3R44A 1VPWA 1Z3IX 3DTVA 1P2SA 4JR1A 3KLOA 4IDAA 3NB0A 1X94A 3NUQA 4EJFA 2CK3D 1E5DA 1G41A 1QZXA 2ZVDA 1I7DA 4Q0MA 5LMCA 5LYJA 3A9CA 1VG1A 3IESA 1DQYA 2GBGA 4UTPA 3T7JA 3ZQKA 1U5BA 3AVYA 1YUMA 3I6ZA 3RLIA 1IU9A 4JQOA 1WZNA 4YONB 5CIYA 3QFTA 3E6AA 3PYXA 4YV0A 2NYAA 3K3PA 3HP7A 3VYSB 3WYBA 2J46A 2N1MA 3DAGA 1Q1AA 5E7JA 4FB5A 4MLZA 4NFLA 2FR8C 3L1IA 3G2KA 3GUVA 4DABA 2MYUA 3WA7A 2VJMB 3R5KA 3KT8A 3AHIA 2H16A 2YDXA 3QZUA 1U0RA 1JEYA 4GKJB 3Q5DA 4C0XA 4FYJA 3OJCA 3RARA 1QCDA 3DVRX 4DQXA 4E4RA 3FHJA 1ENOA 1KE2A 4YAOA 2DR0A 1ZGHA 2BTQA 3DT8A 5T3UA 4D2IA 2WJPA 1BKSB 2ARKA 3K9CA 4WPGA 1CY1A 1EZ4A 1QIFA 3BKWA 1L7QA 2R7LA 3L6BA 4FYYA 3AHDA 1NPTO 2P6NA 4LKOA 4RHCA 5JJBA 1CZLA 2ZUFA 1VC2A 2D7DA 1YOVB 1RC1A 1OKKD 2Y1OA 3CISA 1NMSA 3WG9A 1FBNA 4EPYA 2WU1A 3ND5A 3E7XA 2EX4A 1R5OA 3NDPA 4UBKA 1Y1PA 1Y5IA 4E32A 3CW8X 3ZBPA 4TWRA 2R79A 3CPJB 1MJGM 1SGWA 4HGPA 1EP2B 2G9ZA 2YZ7A 1RDFA 1WMAA 2QR5A 4NE7A 3JWHA 4W5TA 3RANA 1AV6A 3ZWBA 3ZTWA 2B4RO 2FDRA 3U17A 4LDNA 4K6HA 4LVOA 1OGYA 3AQ4A 3DV0A 2NVUA 3HO8A 1CQZA 1JR3D 2ZZKA 3PQEA 2X9QA 4AUKA 2Q0QA 2AGVA 1U2DC 1Z45A 5FPKA 4ZU1X 3AL0C 1ULAA 2F17A 3QM1A 2IS4A 1X1AA 3ROEA 3UW1A 1BSVA 1NBHA 1IJFA 4R2HA 3K8OE 1EBUA 4GXQA 2H2WA 3WNCA 1IZYA 1I1QB 1LCIA 5EJAA 5ALYA 3EVTA 2EZ4A 5FPQA 4F2DA 5PNTA 4YV1A 5HA5A 4FC6A 3FWYA 1IXKA 3KQMA 3P9NA 4I1UA 5G02A 3WLQA 2WM2A 4DA7A 4X91A 1HQYE 1SVIA 1U2GA 2QX9A 1GAXA 2F3UA 2X8WA 1XQWA 1ZD2P 3HEBA 2Q46A 1MPTA 3M3DA 3PJFA 1YCDA 4O0LA 1UL1X 3ANLA 1WXWA 3OLXA 3WHKA 4XCXA 4F1KA 1CW2B 3E81A 1B42A 2VBFA 2YW2A 5IM4A 3DR5A 2O07A 1SZPA 1XT6A 3I9OA 3L8MA 2Z9CA 4ND3A 2QD3A 1D2HA 1WF3A 3B3JA 2I7CA 1JLMA 1UFQA 2J09A 2NXJA 3UJHA 4A9AA 4BQNA 1T6YA 4C6HA 3KBBA 1OZHA 5K3SA 3UAWA 1LV7A 3EHDA 5BW8A 3Q8XB 4P7JA 2JASA 5BPHA 1NUQA 2WMDA 2VHVA 3F47A 4MKIA 1Q0UA 5JDCC 3E61A 3IHLA 2XI4A 3MLEA 4OSOA 1IEXA 3ONEA 2XHZA 1PGOA 1SRQA 2YY5A 3WK9A 5D5QA 3NM4A 5BUCA 1Q84A 2I8LA 1W25A 2ZE5A 4KXWA 5DNWA 3U5TA 1A97A 1KC1A 3B82A 3G68A 1OLXA 1XXLA 4XJSA 1RE0A 3RWOA 4A2PA 1Z0UA 1PT6A 1WXXA 2CNLA 2GS9A 3BRSA 4G23A 3K31A 3RVBA 5A9RA 1KYWA 4O3FA 3W8DA 4OBBA 2Z1MA 3K20A 1BYUA 5B1HA 3O8QA 1YRYE 2HWYA 2OQVA 4DAOA 2L69A 3DHNA 3NOXA 3FETA 3UJBA 2IH2A 1RNLA 3D0OA 3UK7A 4QYTA 1NW3A 2UDPA 4DCTA 4I6GA 1IFXA 2CSXA 4UATA 2BSQA 3WK8A 1AKWA 3DEHA 2DUUA 2IIPA 1OUMA 3G82C 1J06A 2IBMA 4PRZA 4M21A 3UHPA 4D79A 5JSFA 2QBYB 1Y3BE 2AJ8A 3DDCA 3DM9B 3DLPX 1O77A 1GTJ1 4YJFB 4H18A 2VLIA 4NG4A 4P4SA 2VQ3A 2WWTA 1F4PA 1X70A 1RJ9B 2FPSA 4AJ4A 5HJ5A 5HQ3B 1THTA 2X5KO 1SNYA 1H42A 3SC2A 4P86A 1EZ1A 2CMHA 3DD1A 4N01A 4G5GA 1VMAA 4PINA 1CK4A 2IU6A 3HSSA 2PVCA 3NWBA 4C0QC 4ESEA 4KL8S 1B0PA 3EGCA 1QRDA 1FYVA 4RD0A 3TS1A 1Z22A 3H8VA 4IKOA 1SH7A 4LSGA 2GQ0A 3RSLA 4JI7B 3EFBA 4CZ2A 2HL6A 1ZCJA 1N92A 1H8ED 3EXAA 3UK0A 4NBNA 4DAEA 1R16A 2QT0A 1RU3A 3JVVA 3GDHA 4OXXA 4C5BA 4IEEA 5IHPA 4NJEB 1UAYA 2QDXA 3MAGA 3M9WA 4UHEA 4P0PB 3IQGX 1UXGA 1DCKA 2H6EA 5DE3A 3T52A 5TS3A 3HYTA 4JYMA 1QRUA 4XQEA 4MVYA 3FNBA 2IXBA 3PEVA 1ZWKA 1OXTA 1QYRA 3R6TA 4JX8A 4L4UA 3HKCB 2C7VA 1I3MA 2OQRA 4ZC1A 4TRRA 2DHQA 2PU7A 1M34E 4ZT5A 3RJ9A 4MS1B 2PH3A 3LL7A 3SN6A 4BJ3A 1M3SA 1T4DA 1VMEA 3O3OB 4FOOA 2H2DA 5LJLA 4LF9B 5HJ7A 3QUCA 3ZE8A 5B1IA 1R4MB 1H2EA 1O03A 4LOLA 2SHKA 3ZW8A 3AUJB 5CLFA 4CMEC 1JXAA 2QUBA 4KZKA 3WGZA 3BA6A 1S1MA 1N9GB 3EQ6A 3FPAA 4U00A 2FPMA 2VTBB 2OCDA 3KNZA 4X41A 5BSKA 3ABOB 1UJBA 4FVTA 4IIHA 2HCBA 3NXSA 3TAUA 2PQMA 2UYOA 1OIVA 2AVNA 3IEVA 4C05A 1X3SA 5DWDA 4M6WA 1Y9ZA 4RK1A 4F1JA 4F3RA 2R47A 5LQMA 1VZ2A 4LWPA 4TV8F 1R8JA 3OZTA 2RH9B 2GRUA 3ETJA 3INGA 1TQHA 1XU9A 1ZYUA 1F0NA 3CURA 3FNQA 4I50F 3HXTA 2AYXA 5AM4A 2EZUA 1PO7A 4LNAA 3NAZA 4F1WA 1XMJA 1ZDMA 3SOZA 4N40A 2PL9A 1KS2A 3D5QA 4QNNA 4M0EA 1P44A 3CCCA 3F49S 1ND6A 4HV4A 1GKYA 2IP2A 4YCJA 5F33A 4BJ5A 3F6EX 3AW9A 4HP8A 1ZMRA 4KDEA 2JCVA 4LNHA 1E8MA 1MOPA 3MTAA 4FWBA 1L5WA 4LXIA 3FB1A 3OU6A 2K6GA 3ZE9A 2Z8YM 3M81A 3H3JA 4J1TA 5AJZA 2VF4X 2GJ8A 3V4OA 3HA3A 2YL2A 4ZREA 3V7NA 3RT9A 2GAFA 3T9CA 1D7AA 1WB4A 1X92A 1GGKA 1O8BA 3DF7A 3EDQA 1FX1A 5E2BA 2OO3A 1KEKA 1QH8B 3OJFA 3N5KA 1IC6A 5KNCD 3P7MA 1YS2X 4R9SA 5CLGA 5EMNA 4LUCA 4QUIA 3KSBC 2BIFA 1Y1LA 3C8HA 4UU1A 1OLOA 3L49A 4Q3LA 2EX1A 2Y1XA 1ZBQA 5LMZA 4AZ0B 1GXSA 1FP6A 5LKRA 2P6UA 1E2HA 3HNOA 2RAVA 4MB6A 4US0R 5TT0A 2ZQYA 1Z75A 1JIVA 3OJEA 4NK5A 3WMEA 5CBPB 1WQ4A 5K2OA 2RGNC 3B7WA 2UYGA 3AWDA 2F3TA 4E2YA 2FFRA 2O7RA 1JSCA 2E87A 1Z25A 2G25A 2J6CA 2P4SA 5DSTA 3UXHA 4D8TA 1QLHA 2ZRLA 4HRYA 4W7HA 4YXWA 2FEWB 2OPBA 5FBVB 4ERXA 1L8OA 5CH3A 1ZFNA 1CQWA 3WL3A 2QQFA 4MUXA 1RABA 3KZOA 4FBLA 3PTZA 2B92A 2IW3A 2QTNA 3Q87B 4OQNA 3WGHA 2GKGA 2H17A 1W0JD 1JQEA 3D7RA 1LJLA 3KZXA 4LOAA 2BFWA 4CR6A 2H7YA 3HCEA 3QPDA 3BWEA 1TAHA 4U7GA 1T8TA 1DAHA 1QKJA 3F7NA 4E6EA 1GVNB 1M8KA 1QNFA 2E82A 4YFYA 5EFZA 1QIKA 2FX3A 3HGQA 1QNLA 2PKEA 3LCRA 3GLIA 1BYIA 4I4TF 1MQ8B 2QRJA 2NQTA 1HR0B 1E3EA 2DFTA 1HLGA 1R6XA 2QSUA 2O06A 3QOWA 5T41A 3LZ6A 3HUTA 4O4LF 1VI5A 3M6FA 5DHAA 5DX8A 4BNGA 4O6VA 5LXTB 1XEFA 3TDKA 1UMCA 3R8XA 1TCUA 2ZE6A 3D2CA 5I4CA 2DETA 3B3QA 2Y2UA 4PVCA 3ZLJA 4ZEMA 3QI7A 4G84A 3I04M 2C57A 2XGJA 3ETEA 4UMDA 2ZJ0A 1EKXA 2WIDA 5K6AA 1W5TA 1FDUA 3TMKA 5C7YA 1R88A 1CETA 1II0A 1CFJA 3D8RA 4FI3C 3ZHVA 3JRNA 4CF6A 5CA1B 5CB4A 3QBVA 4O1MA 1QYCA 5FWXA 1L5OA 2E0IA 4PSVA 2VQFB 1GYQA 3BMOB 4KYTA 2P4HX 5L95A 3LCVB 2RHHA 5TPZD 1JVSA 1ODJA 3O2JA 2QMZA 4C03A 3ELWA 2FPIA 3PHHA 4Q4HB 3RBZA 3I9V1 3I5YA 2QRKA 3QF4A 2ZU0C 2CVHA 3WJ1A 2JBWA 3CT6A 3PFNA 4WZAB 2H85A 1J0EA 1RKBA 2EJWA 4XGQA 5HYVA 5DTRA 1GR1A 2VJNA 2BEVB 3IHKA 3OBBA 4RCVA 5FWAA 2BF7A 2Q3DA 3A1VA 3STWA 1EM6A 1POWA 5FUVA 2CK3A 1LFAA 2VDUE 3URMA 2IE8A 3CJTA 1HOXA 4DIDA 2RGXA 1L9XA 1ZNQO 4ZVUA 1N32B 3OZAA 1VG8A 4BU0A 3I6MA 4EG1A 2YIJA 3GD7A 1AQIA 3E48A 4UUMA 1H65A 1WW3A 4PLGA 4WN3A 3M6UA 2LGJA 3G2MA 4MV8A 1V35A 2ADMA 2IIVA 1DBSA 4EM6A 5IDWA 3K71B 4FFPA 3K0FB 2XIQA 3L18A 3LAWA 4KLAA 3CF4A 3MILA 4RLHA 2CVQA 3G5UA 3ELBA 3T0GA 1JXMA 1FPMA 1VXOA 1P0IA 2CL7X 4UEOA 5IN4A 3C7KA 4Q82A 1FNMA 3DHYA 4JWTA 5HS4A 1NJ6A 2E4UA 3H2JA 4KWCA 4EJ6A 2V7GA 5BVHA 2O23A 3NRCA 4TXMA 4QEZA 4TT3D 4QVIA 2Q7DA 4MUIA 3GHYA 3INTA 3AIOA 5I4IA 4K6KA 1QC5A 1RBQA 1ZK4A 4ZCIA 1PEYA 1RCFA 1OH6A 1AV7A 3FDXA 2HIHA 2BF4A 3JPYA 4GX2A 3WGMA 1A1VA 3DTNA 3CRMA 2VL7A 4LXUA 4O0MA 5JNTA 1OROA 2O4UX 4JLDA 3ZCQA 3RSSA 1QVZA 1OKKA 4GRAA 4RHFA 3VMMA 3ANMA 1U3DA 4XWGA 1L1FA 3CH7A 1NW6A 2AXNA 1S9HA 4TTAA 3UV3A 4V0ME 1EHIA 2XA9A 4QATA 1MC4A 2RHCA 2GLUA 1D6MA 3IAXA 3Q8WA 4S1NA 1IWOA 5FL7D 5LBUA 3RRXA 2J3LA 5GJWC 5IG2A 3HI4A 5KOIA 2G1PA 2ZU6A 1ZM2A 5HJ2A 3N1UA 2XSZD 4MUEA 3TZLA 3DKIA 2PR2A 3KAJA 1DC6A 5AH0A 4GUAA 4GSLA 1ESNA 1K0UA 2FETA 5ADUS 2YYAA 1T8SA 1Y6FA 3BK2A 3GEEA 4F5DA 3MOIA 5KYGA 3U4QB 3P9ZA 2ZETA 1ORRA 1GUFA 4JT2A 5DYGA 4ZO9A 1J6UA 2C2HA 4D4MA 5C8DA 1ZSVA 2YCLA 3CF0A 5TF0A 5HK9A 4HZGA 1V8FA 4UM8B 4Z1MD 2XGSA 3CWZA 5I7FA 4GI2A 4LHYA 2CLIB 1U0SY 2YVLA 3AP1A 4OJMX 4UNIA 4B17A 4OHOA 4AKSA 4DZTA 3B9BA 2BKUA 5BMVB 3MS4A 2QTRA 4O2BF 1S8OA 3K15A 1HT0A 1NVDA 2R8YA 1YI0A 3WGKA 2PD6A 1AGYA 4J2OA 3M4YA 4K8RB 4P82A 2C9DA 2GXSA 3KXLA 4H2DA 1RYNA 1BGVA 1MC1A 1W34A 2BFMA 2Q1XA 4DCPA 1AJEA 3H3FA 4OUKX 1QGOA 3TZEA 2VK4A 5EXXA 5G0SA 2F1HA 4X7RA 4UFPA 5AVVA 4V0LA 1PFWA 4MRRA 4UMVA 3KFXA 1AOXA 1W36B 3AI3A 3UMGA 5IZ4A 2BZSA 3EPJA 2B4TO 1Z2NX 4HWKA 3NOVA 4GWGA 4HKTA 3TSAA 4AY5A 3GLGB 4ZDJA 2PPVA 3NZEA 4KK4A 2NUTA 5GZ6A 1KPIA 1EDDA 1N0UA 1K5HA 3IA7A 4L6IA 1TZCA 5LDDC 2JZNA 5CVJA 4BNMA 4FMDF 3VHLB 1KERA 2CDRA 2E55A 2XQFA 1MN6A 4JROA 4MV7A 5AW4A 2CL0X 3UZUA 4ARZA 4I5DA 2AZ4A 4D25A 1OLSA 5AHOA 3NTQA 1LI4A 4PQEA 2A7QA 4JBXA 4A0SA 3ZKWA 4F72A 1JDBB 1U0FA 1HEIA 4X6UA 3ZIUA 3AEZA 4P4GA 5A02A 1T0PA 3RK4A 3ZVKA 2Y8EA 2Q99A 4L78A 4X94A 4CU2A 5CDHA 2BI4A 3QIVA 3RBXA 4P22A 4KR3A 2X1VA 3AB7A 3MWLA 4QFDA 5GJCA 1IIRA 3RIEA 3ZGZA 4TZTA 3TQTA 9LDBA 1GY8A 1BVUA 4LJAA 1T8WA 4IV8A 1LPPA 3OHMA 4NAVA 4WMLA 3GGSA 3O4HA 1X38A 1ZUWA 1MB3A 1SCKA 1YBMA 3RHTA 1KY5A 4GRIA 3KZMA 3OF5A 1D2AA 5AHRA 5B1DA 2YWCA 1W30A 1ZRMA 4IIYA 4IV0A 3OIYA 5TY0A 2HNBA 3NEJA 2JGIA 5ITSA 2ODBA 5G53C 1NLZA 1D6SA 2X5OA 3AERB 4KYIB 2GNAA 1ID1A 2HJVA 3F2IA 3TKAA 4C0WA 2H0RA 5IVIA 1XF1A 1M1NA 1Z0ZA 1OB5A 5JZOA 3T54A 1AZLA 2VDRB 3V9AA 4QA9A 3EIHA 5EIAA 1HPLA 2LW7A 4ND1A 1JXQA 5AO9A 3D7LA 3GRYA 2IHYA 2FPUA 1SD5A 4IKEA 4JR2A 5CH8A 4ZOCA 2FW6A 1EHCA 3I52A 4P4LA 4D4LA 5JTUA 3ZV7A 3MJTA 1OB2A 4HMOA 1PWEA 3Q40A 4MSUA 3WHPA 4JC0A 3KTAB 3S6JA 1P4AA 2OXRA 2O8NA 3I9NA 3PX3A 4W7SA 5DP1A 4B3JA 2Q9BA 1Z63A 4R5MA 2PHZA 3U4MA 4V0SA 3MJVA 3K9GA 3LT4A 3QTBA 4IX1A 2NU8A 1NWCA 3IQEA 2WG1A 5FULA 2FF7A 4LOJA 4X3PA 2C58A 2GD0A 2Y3IA 4KQXA 5AKXA 4YMVA 4NMMA 1Y4DE 1X1BA 4ZANA 5AJTA 2YN4A 4WKGA 4A7PA 3KHSA 4RK5A 2OORA 2E37A 2R8EA 3MELA 4OHVA 4JY7A 3TVTA 1B7GO 3WGTA 5AXAA 1WETA 3S0JA 3WZ2A 4DZRA 1QIIA 3CNHA 2YVAA 2OM6A 3GRKA 4LCEA 2IL1A 3FPSA 4JJZA 4M1ZA 3SF0A 3LOPA 3F9IA 4D4IA 3ENQA 5I3ZA 3GVXA 1N1DA 4KV9A 4DWJA 3EYWA 4HDSB 2X2OA 3KPWA 3MTIA 1VHDA 1RQGA 2H18A 2NO9A 5LBTA 4YCDA 1ZD5A 3RAJA 2W2KA 4F8YA 2I6XA 1UZMA 3HCAA 5I7OA 7REQA 2L18A 4WNAA 4EAQA 3NCHA 3GOQA 2PIDA 3OE1A 3ANNA 3OPYA 3O2QB 1P9OA 5F3WB 3CA8A 4O4JF 4ZO8A 1Z6YA 1YQQA 4AQ7A 1KR5A 1ZD8A 1N6IA 1UOPA 3BD6A 3G49A 1JP7A 3CX4A 3F5MA 3ORSA 1NW8A 3OUTA 1YZUA 3M33A 3WLMA 3L8CA 2IPOA 2JHAA 2I4RA 1Q5PA 3UHOA 1ELOA 1EDBA 4RYLA 2CJWB 1X1SA 1GZSA 4KACA 4LK2A 4LMPA 5LQUA 2DWCA 2A9OA 1DC3A 2EYUA 1IDOA 3QNMA 2WVGA 3KKNA 1E2KA 1TTPB 5A7HA 5EC8A 5J4HA 2HHCA 3EZ2A 3RJ5A 1VKJA 1DWUA 3WYGA 4FWTA 3X1XA 3VR5A 4FN5A 4KLRA 2QPLA 1J1ZA 1A96A 1G2IA 2HQ1A 3BWCA 4MI3A 4PWYA 5K6AC 3LFUA 2BLNA 3QFFA 4N7RA 4PGFA 2HPVA 4YASA 4A15A 2PO5A 2V6MA 4FTWA 2JI6A 4WBNA 2YS6A 2ZBPA 2WWFA 4Q1VA 4WHMA 4IEIA 3HJHA 2Q5JA 3FNGA 1TU0A 4KPYA 5KNCA 3GRRA 1P1HA 4DXDA 1NSTA 3BOSA 4KRYA 4CL0A 4DOMA 4BEVA 3T5GA 3WLHA 3DNMA 2ZAYA 2DX7A 1ZOSA 4HQRA 1QXSA 1N2SA 3PFKA 3IBYA 2BEUB 1SUIA 3CLRC 3G0IA 5D7NA 3FHOA 4YYEA 3K9BA 4OSPA 2PE5A 1CJSA 1PNVA 1J33A 5KSWB 1FP4A 2Q49A 4H6VA 1Z15A 1C8KA 2A35A 2CUKA 4N0QA 4NJMA 3MUOA 1NMYA 3BUSA 1U2PA 5F9MA 3DXZA 4TTQA 4J1QA 3PQ8A 5SZKB 3M3PA 4LCBA 1QS0A 2OM2A 3DMPA 3FYHA 4KO8A 2IYSA 1LNZA 1ZP6A 4J7AA 3IJ5A 3VNQA 4DQUA 4OHUA 3ROTA 2PZJA 4P33A 4F91B 1V9SA 1W0JA 1KI8A 4MA0A 1MB2A 1U80A 3V32A 3M6XA 4H3SA 5EJIA 3MBIA 1XWWA 3D4OA 3DW1X 3SICE 4E6PA 1AT1A 4R8RA 1UPBA 4RD6A 2B8NA 2G3YA 4MA5A 5EOVA 1OXBB 2WWGA 5C1BA 2GESA 3EXHA 1V5GA 1MIOA 4K40A 5JDIA 2D1SA 2GPNA 3E3MA 3EAFA 4JOSA 2O0KA 2N47A 5F2KA 1OX4B 1SXHA 4CKCB 4DW8A 1JJ7A 3B6MA 4WLUA 3U4CA 3WIOA 4XIGS 3EC2A 2CXQA 3KJXA 4LOIA 5B3AA 5EJEA 3NHPA 1IQ0A 2IXGA 3ABRB 2O8BB 3CTPA 4JODA 3S4YA 5KHOC 5EHXA 3LECA 1D03A 2X8AA 3TB6A 2YXBA 3AO0B 4MW6A 1MBZA 5DX0A 1YIAA 4LYFA 1QG2A 1MABA 1U2ZA 1UJNA 2OBFA 4UM9D 5H3CA 2B37A 3V2UA 4AG5A 2VHXA 4I6EA 5DK6A 3EMKA 4EMTA 3E7DA 2XCSB 3DOIA 5GP1A 1V9CA 1Z4PX 4H1VA 3ZLBA 2Y1EA 5TPZA 3FDZA 2CKDA 3RRMA 1APBA 1IWBB 1U9IC 1F5SA 1GD1O 4Z7OB 2XVMA 3I4FA 3OWOA 2DCMA 2PXXA 3O03A 4BO8A 1CVRA 3GJ6A 3AUFA 1CLEA 3EW7A 1Y3CE 3AXSA 5LQKA 2O7NA 1EX7A 4DHEA 4Z49A 4BQQA 1HTBA 3LUHA 1FCJA 1QHFA 3GJ7A 1JSRA 1CYDA 2JK1A 3P0HA 2W48A 4I2VA 1QP7A 1ZL2A 2N1BA 3TLBA 1GSIA 1XMQB 1KMHA 5AKGA 2XQIA 3R41A 3F8SA 5DYTA 4B6JA 1EM8B 3L0BA 4J2HA 2WG2A 5WRFA 4DZZA 2Q2NA 2ZSEA 4K9KA 4F04A 5SZJA 4AJKA 1JUDA 1KAOA 4XFJA 4YCAA 4AMVA 4ZV4A 3PT5A 3L46A 2ZRIA 5IULC 2A92A 3A1NA 4YJHA 3SBDA 1MGOA 1YQXA 2AI1A 3HEMA 4JC5A 3BMNA 4B2IA 1QRAA 2ZWVA 1W4RA 2D13A 3IDQA 4PEVA 1FLNA 4HEA1 1OBCA 5D84A 4TKVA 4U6SA 1O3YA 5LJIA 1QTNA 4BNDB 2HZ7A 4OMUA 3EZLA 3LXMA 4TT3A 4RF4A 3G2HA 1JDTA 2A5FA 3ESAA 4QTXA 2P5TB 5JJKA 4B31A 3I5UA 3VHXB 3A2MA 1AHNA 3DKRA 3I9MA 3IQWA 4HOYA 4MR7A 3KYCA 5ES3A 1QVAA 4B3DA 2RKOA 1LK7A 1VHQA 2QGZA 3GVCA 3C7CB 3AF6A 2YZKA 1P5ZB 3ED1A 3H9QA 2D6FA 4BASA 1QPZA 4REQA 5FL7A 4WOBA 4TKLA 1YFJA 1KARA 4FOSA 3OF2A 4WXMA 5D87A 1A7AA 1LPMA 2YZMA 1DJQA 2ZI4A 4W1PA 2XSZA 2BH9A 1Q0QA 1ZRHA 1QYWA 2YIVX 4XWOA 1L5HB 1U98A 4YR9A 4FDTA 4TV8A 1E5LA 1ZD4A 1RPAA 1AS0A 1US8A 3GFVA 1E79D 4ZAVA 1G8AA 3V7UA 4AL4A 5REQB 2C5FA 5H0IA 2KPOA 4U0KA 3K30A 4AZTA 2CFTA 2P8JA 2SICE 3H75A 4GPZA 4L7VA 3L0YA 3R4CA 4G4GA 5K0SA 1XMSA 4H15A 4EA6A 3NGXA 4XD2A 1PK8A 3RF6A 1E3DA 4EB0A 2ZS8A 5EJ5A 2ETVA 1Y3IA 4ZVTA 3BEDA 5TQ0A 3ENVA 1P72A 3V1LA 5JZ9A 4NDNE 3S7ZA 2FQWA 4ZEXA 4EJSC 1PF7E 4QQ8A 4U2GA 3TVDA 5A4FS 1FTSA 1NXVA 1JFFB 1YQ9A 1RR6A 3NHWA 1FZQA 3USES 5KSPA 5D7BA 1UPXA 1F9AA 1F48A 5CLQA 1W88B 4C7JA 3GVHA 3PFCA 2OY0A 2JGKA 1J20A 4IDQA 4AWAA 4MUKA 3HADA 4TTSA 5EZ6B 4F6CA 1TFRA 1OW3B 1PUXA 5LQNA 4PRYA 1ZY2A 2BBOA 2RAUA 3QBDA 3KD3A 4QRIA 1UUFA 3GGOA 2EL7A 4NV3A 1JEOA 2GR9A 1FTYA 5CVEA 4EPWA 1DX4A 2RGRA 2Y05A 2ZI5A 2ZSFA 4MQFB 3WGNA 3QE4A 1EVJA 1KDPA 1H3EA 1A71A 3EBPA 1JWAB 4R71A 2UUOA 2WU4A 5K01A 3LFHA 5CDYA 4PGGA 1NVVQ 5L53A 5DBOA 4OK5A 1T5SA 5KC9A 1CJTC 4V1CA 2QQGA 1E8NA 4Y1RB 3L01A 1NN5A 3AH8A 1FC0A 2CVFA 2W4QA 1V37A 4UUBA 2NNLD 1M2GA 3WKDA 3SX4A 1ZCBA 2WT4A 4GEKA 1M10A 4L8YA 2BUBA 2VHQA 5BQ5A 2CYBA 1II8B 4UTOA 4ZI7F 2ZAIA 4JP1A 5ABPA 4J1SA 4BMXA 3PC3A 2P5SA 4W5RA 1TTQB 1EVKA 3QRWA 1AO3A 3AI2A 2EBUA 4HLQB 1CLUA 4L0QA 2XE7A 4V3CA 4ZRMA 5AKKA 3V8BA 3PXUA 1YAHA 2YN0A 5KO2A 2QRVB 1N5JA 2R1ZA 4Z51A 3QU9A 2G4CA 3KL2A 5FBHA 3KOMA 4DLPA 2MOKA 4E94A 4ZYUA 1YT5A 5CNMA 3W6NA 2I1QA 3LUBA 2W2LD 4HTAA 4S1VA 4I4TA 1TJPB 3N2EA 4JITA 4BJ1A 4BUZA 5BWMA 4A10A 4DC9A 2EFHB 4RCZA 3AC0A 4PSAA 3KLNA 5KOHB 3Q3HA 1WR8A 2XXAA 3G1WA 1YMUA 4O4LA 4YECA 3SGLA 1H4VB 1GM5A 2A67A 3DVSX 1CFZA 2P9TA 3UAOA 5H82A 1BFUA 4BDTA 3I34X 4MV5A 3VVMA 1SD2A 3PGMA 1IK4A 2JIRA 2Y0PA 4FFMA 3RSCA 4DCCA 2JAQA 4L5JA 1O0CA 3TRFA 3M70A 5E7IA 4ESHA 5JC1A 3L6EA 2DUWA 3WQSB 4YAKA 4NMLA 5ESWA 3QKSA 1CUBA 2YRWA 3CUTA 4QUGA 1E3IA 1YR3A 1FUUA 3M4JA 4NY1A 3TJZA 2AF4C 2BV3A 2Z56A 4Q21A 3KR0A 3VXKA 1WSDA 1F0KA 1EG2A 2RB5A 1ESDA 2ZJFA 3FYCA 1KOJA 5CDFE 1XZLA 1VZ3A 3L7NA 4TSFD 5H83A 4QGSA 1E3MA 1SBNE 1V2HE 4XPIA 5JNWA 1JG7A 2B20A 4TROA 1FDTA 2JK0A 5K0CA 3ZI4A 4Z8YA 3IIIA 3ZWDA 4BE9A 3JYNA 1DEKA 1PT7A 3MLAA 2JZCA 2R7MA 3IKLA 5DPMA 2BC9A 1HZZA 2EWWA 5K8JB 1YV9A 3PJRA 3ILVA 5F4ZA 4P83A 1HFJA 1Q1QA 2VXYA 3I73A 4BNNA 2KQUA 4MRVA 4EPTA 3FWHA 2JA2A 3H5WA 3UT5B 1ZITA 1QJ4A 1S7CA 2BMJA 2PMFA 2VHZA 3JQGB 2AQIA 5TC4A 1YF3A 1M6NA 2HRDA 1MO3A 1Z0IA 4DF3A 5JMWA 1YCHA 3L0SA 3VR0A 4C5CA 1IG3A 2JIZD 1O96B 1H9BA 4GMXA 3GLHE 4AMBA 2I7DA 3BDIA 3IE0A 4AIRA 4FFNA 3HGTA 1ZU4A 5LLSA 5IH7A 5CTAA 3F90A 2UKDA 1JKJA 3EC1A 4RLFA 3QU2A 4IVRA 4IKPA 4UEKA 5CNIA 2ZSAA 1B14A 3K0HA 2P9FA 2HXGA 3ASYA 4EUKA 1FS5A 1FUIA 2QLMA 1SVUA 4X60A 1W76A 2PUVA 4Z9FA 2VHYA 2PT6A 3MJSA 3WBFA 1ECLA 2HRQA 2FSVC 1WW8A 2BHLA 5EWJA 3AEQA 2NSYA 2GPSA 4US1R 121PA 3OEHD 1XZBA 2ZJ4A 3OAAA 5ANRB 5IDVA 3RKUA 3WL6A 3VZSA 3NTUA 1S6YA 3AVXA 4S35A 1PNTA 4HDKB 3E15A 3U48A 5IKEA 1CRWG 4EJSB 1Y4UA 4U02A 3UJPA 3C3BA 5KTSA 2IHUA 3W7VA 2XF2A 1CVLA 2WABA 4A92A 5FL3A 3FGPA 1T2VA 1PV4A 1JHRA 2BDEA 5LZ5A 4KXXA 1CUIA 4GICA 4J0JA 4NV0A 5FI1B 3LYAA 3UV7A 10MHA 3OE4A 4J76A 5IUJC 4URVR 2PY6A 3PEYA 3MT9A 2I62A 4WZBA 1SK9A 4CKEB 3LBNA 2WT9A 3BJMA 3HB9A 1OAAA 5H1YA 5LU9A 3RVNA 2P91A 4CQLA 3ZDCA 4I55F 3NC4A 3M6VA 4MUYA 3ZH9B 3A2LA 4AX8A 1RQPA 4QQNA 2Z08A 1JV2B 1OFIA 1JBEA 4C7KA 4KCGA 1BNCA 5ER9A 4K6FA 4O2BA 4YIKA 4MZXA 5EHGA 4BNYA 2RK3A 1K7FB 3GT7A 1E62A 3DXFA 2BM0A 1ISIA 4PY2A 2O2ZA 2TECE 2ORWA 4YAEA 4N76A 3AVWA 5FCDA 3A9TA 2FUNB 2GZ1A 2H57A 3VNRA 4EQ6B 1SVWA 5CYPA 2C31A 3HDGA 4L5YA 3MMSA 4DG8A 4U7WA 3II6X 1T1GA 3KV3O 3QK7A 1ZVKA 3EEYA 4RKYA 1UC9A 3TTTA 4QDXA 3EQ8A 4YT5A 5G4LA 3KQNA 4CF3A 1T2DA 2BFAA 2ZTMA 2OCIA 2XJ9A 3WY9A 1QOQB 5A2GA 3OM1A 2HU7A 3A4NA 1Q0SA 2FZ5A 3DJYA 3DMGA 3HN6A 3R75A 3UC9A 4D42A 3LDFA 1SMKA 1R2QA 4GM0A 4TXLA 3L5OA 2HV9A 1I6LA 4NAUA 4R40A 3LQQA 4HNAA 4FNOA 3URKA 2ZSHA 1DEXA 3GLHB 5J3JA 2J3JA 1U94A 4MPDA 3U6KA 3QJYA 4CV3A 3LUFA 4XYGA 5DHQA 1E3LA 3EPHA 3A3OA 1A9XB 2PUJA 4H6WA 3KKEA 1XPRA 3KWFA 4LN1A 4ZCMA 2PT9A 4MVJP 3JV7A 3QPBA 3ZU4A 5KNDD 2P68A 4NZOA 5AP9A 4DMHA 3ZWYA 1D09A 4PO9A 2AFRA 4B0PA 1MUUA 2KI5A 1GGNA 3C6XA 3CZCA 3LRXA 3BYZA 3MYRA 1DG9A 2HHLA 3ONFA 1C3VA 3G9TA 3SQMA 2D54A 3I6YA 3K16A 3R9IA 4LVUA 4LDZA 3CZMA 3FX2A 1BOOA 1KU0A 1YKGA 2ZREA 4G1EB 2ZJYA 2XX3A 3DE3X 3PK0A 4XWAA 3QOFA 2J0QA 1BIFA 1KO1A 4RS4A 4BQEA 4MUHA 4PU0A 3R8FA 1OOEA 4BQFA 1A8PA 5DWVA 2R8RA 4E21A 2E4ZA 5JWOA 2JRCA 5HGXA 4C4TA 3H0EA 4FT2A 3TFQA 1SBCA 4LF6B 4K6OA 4C3UA 1IE3A 2B35A 1T35A 2IXTA 4LGCA 1E2JA 3EJWA 3PQ5A 4UXHA 2ZITA 2Z2YA 3U62A 2H1SA 3CG0A 3D3WA 3L0IB 1YB1A 4V0OA 1E4EB 1OIWA 3HE3A 4RTOA 2WJGA 4LFAB 5MHTA 5LZ4A 3PR2B 1RP7A 2VNAA 2XE4A 3SD7A 1E3SA 3U37A 5IJZA 3ROGA 1N5IA 1X80A 1L7BA 3QX7A 5A5DA 5A3QA 2IX3A 3RYCA 1AKRA 1CB7A 1GCGA 2GZDA 2O1SA 1LQUA 2PUBA 1FQWA 1ZZGA 1YRWA 3VZDA 4F12A 5K0BA 1EGHA 5JHGB 2UUCB 3O1IC 5KYWB 2Y1FA 2C7QA 1WTAA 3MNFA 3QU4A 2FLKA 3LVQE 4JC8A 4DEVA 4O33A 4BNTA 1Q7BA 2ZT5A 3Q2KA 3RLFA 1P5HA 3CSDA 3U4DA 5BSTA 2VNKA 2RAPA 3KQQA 4HZUA 2FXVA 4R3NA 1EB9A 1RFGE 1LI5A 1KI7A 1KO4A 3EXFB 3X1ZA 4E1AA 1K86A 4EO9A 5FUMA 2J5XA 3QMVA 4HNVA 1NBMD 2IYYA 2Z2ZA 1YS1X 1DBRA 3GFOA 3IOYA 2C4WA 4GR5A 3K1YA 2XF8A 4H3HB 3U1VA 1HX7A 1AX9A 3GARA 4R4JA 2F8TA 4XCQA 1AMNA 4G5OA 4E11A 1X7WA 5DB4A 1V6SA 1WXDA 5C8VA 3R7FA 4JGGA 5JVDB 2EC5A 2Q5EA 4P2GA 4X45A 5G3YA 4AJNA 3IKTA 1F4VA 1W5FA 3JAWB 5B2FA 3PA6A 1VYHA 3SYLA 5JECA 3G79A 1YMQA 1ZCZA 1ZNYA 3IOCA 4G4IA 4BO5A 1GN8A 3OY2A 3CZAA 1QUFA 3LPLA 5TGDA 5GGYA 1NY5A 4O4JA 4PQYA 1ESCA 3NHZA 4WGGA 4RTQA 4E5MA 1N7GA 4IMPA 2BGRA 4JLMA 4JLSA 1E6KA 4W5HA 1ZNZA 1AA6A 1E79A 5ETJA 3U7RA 4BRZA 5C35A 5HTKA 1KZGB 3W5BA 2QLNA 4C07A 2JLYA 1ULZA 4FE7A 3IILA 2EFJA 1VJRA 3RWMB 3ZBTA 1L5MA 1OMOA 2JJ8A 1G8MA 1CEXA 1P18A 2JCSA 2ZRFA 3K2BA 3OLZA 4PXYA 1KSHA 1LSOA 3F3MA 2AT1A 3PEFA 5HE8A 5T6MA 3SNHA 3GNSA 3UOAB 3CB2A 3K8QA 5BYAA 1PQWA 2FUG1 3BWMA 3R7AA 4K9QA 3FOCA 1CRQA 1MORA 4WXPA 3E5MA 3NIGB 3HKEA 5CB4F 1IRXA 3MJCA 4KN8A 1L4EA 2W6QA 3VUEA 3CVUA 4NHEA 3E8XA 5IVKA 2XCQA 4X8LA 2X0RA 3IUJA 4TL8A 1J8MF 4UKDA 1G8HA 4YEDA 1XTZA 1WUYA 3H9GA 3V48A 1I4OA 5IMSA 3Q15C 4LIPD 2MINA 1UKCA 1FFXB 2GJSA 1HE2A 5DBFA 3RYIA 3UWSA 4AN0A 2RHJA 1LNQA 3O75A 4Z3KA 3G1UA 4HFNA 5A7FA 4UBLA 1TEHA 3OD1A 4I9UA 3QKRA 3WYAA 3P0RA 4Q1EA 1DFIA 2CEAA 1Z5NA 5DM4A 2QDKA 1DC8A 3VI3B 2HLNA 4UTXA 4WKPA 4ZZ3A 5BN3A 4QM6A 2BOVA 2XYQA 1JYSA 3KSMA 4MVJG 4Y6QA 5BNWA 5IZCA 1AF4A 2XNHA 5TF4A 4P7BA 2WSSD 3A6HA 2ORVA 1AGPA 1W47A 1M0TA 2R1VB 2LVBA 4RESA 4M9RA 3T15A 3DVAA 2HQBA 5G3ZA 4WKCA 2G08A 3O5AA 3T5TA 4RH0A 1JFLA 1WCWA 5B3JC 1MX3A 1XQXA 4NYJQ 4ECAA 3A6JA 4X66B 3CX8A 1ZD9A 1SQ5A 5TXGA 3MAAC 3ITNA 2RHMA 1MP0A 3FWKA 2Q3EA 2P2CA 3CIOA 3Q2OA 2J6BA 1GPKA 3A26A 4HB2A 5JSKA 2W58A 3UPTA 2ZP1A 1T8RA 2EWMA 3OCWA 4IH9A 5P8WA 1P4SA 3FR7A 1X7HA 1ARZA 1EE2A 2EBWA 2F1KA 3PGKA 3QXJA 5ERGB 3UICA 1N2XA 4B7ZA 3TSCA 4EO4A 2ZLBA 3WADA 1EDZA 1RHRA 2WJ6A 2FW7A 4PG8A 2NZUG 1GILA 3ITKA 4W1RA 2WJVA 4R7TA 1AUVA 1ZH6A 1E1KA 1GCAA 3I09A 2IQIA 3ZZMA 2DQSA 2W2LA 1UBRS 3HRKA 3P5SA 3EFOB 4TQUS 1YBFA 4I08A 3CLKA 4AU1A 3AY7A 1TK2A 2G0TA 5M29A 2NUPA 4GIBA 4PZLA 1G20B 4HK4A 4JL6A 1RXSA 1DHTA 2FPGA 1KOGA 3BFKA 1SUAA 1RWWA 2JGEA 1ZH0A 2NYUA 3FLMA 1SCAA 3TKYA 2FNAA 2OAP1 3WMRA 4TXJA 4CV0A 4E4YA 3I2JA 2WHRA 3NP9A 4MVJE 1D4OA 1BROA 5DIZA 5LB2A 2LE0A 5T64A 3BXHA 1IOWA 4HX5A 1D07A 3FAKA 1K66A 1VGQA 1B8NA 2XWJI 3DPUA 1VKRA 4AMGA 3QKIA 4XPZA 1RT9A 1Z18A 5AW3A 3FE2A 2YMMA 2YNMD 2OCPA 4TWBA 4JQYA 3ZDQA 1TZBA 4YRAA 2CXTA 2DHRA 5M2QA 3KTDA 1J8FA 5AI8A 2QTAA 4JI8B 1T1IA 2HWXA 4HAOA 1Q74A 4QHTA 1XZNA 4RACA 4TSFA 4F3CA 1UBOS 3X1KA 3OICA 5DI3A 4HN9A 4RNCA 4DRXA 4MTCA 3PDHA 4LISA 4EEZA 3MXTA 3I6BA 1UXJA 5LZ8A 3PIIA 1Y48E 1KSGA 2JKYA 4RF5A 1ZVJA 2GASA 2C03A 2WAAA 4G86A 3GX1A 3T3PB 4AO8A 4ZEVA 3H9CA 4UBOA 2IPNA 5C8YA 4YJFA 4URZR 1C8LA 4XQ0A 1YL5A 3KL4A 5B53A 5BVHB 4JZYA 4QNRA 3AF1A 5DHUA 3OE5A 3EFHA 4EWLA 6Q21A 1DLIA 3O4GA 1X13A 2JVJA 3ZU6A 1H6AA 1ORVA 5DISB 3R3JA 4C7OB 3PI7A 1GZDA 2F1RA 4M0DA 2F1OA 5JAZA 1NG9A 4LJLA 3TTXA 2X0KA 4JJ8A 5CK5A 4BCBA 2IT1A 1TM7E 2PKXA 5TPWA 4CEJB 3AU8A 1RP1A 2X0FA 3R7LA 1H2YA 1Q6ZA 1NBWB 3AL3A 2JIZA 3MGGA 3G9UA 4CLHA 1W5BA 3IEKA 4TRJA 3D64A 1K5GA 4F9GA 4F9EA 1N0WA 1OYVA 3W3AD 1RRVA 1BQEA 2VT6A 4TTIA 1TLLA 2GETA 4OJQA 3GNLA 4EDHA 4EMSA 4IIXA 2RC5A 2OUIA 1B93A 3PR3A 3RSGA 5I51A 1EK2A 4EJMA 2X13A 2VWQA 3F98A 1NR5A 4CBVA 1PLKA 5EZYB 2P78A 3R24A 3KJHA 4DT1B 2QN9A 1R0YA 2C1XA 3LT1A 1W5EA 1MJFA 5I7WA 3N2GB 1WXGA 2Q6LA 1SC4A 3SSNA 4NZPA 2VZLA 5FUQA 5GGXA 3S2GA 1FDSA 3HA5A 3NJRA 1FFEA 1E9CA 1KI2A 1W29A 2AOTB 3PUWA 1SBTA 1PW5A 2W2PA 4JKIA 4NZYA 3T3HA 3UMBA 4UBNA 2XGOA 2B36A 2KBEA 5AW9A 1Y6ZA 2A6PA 3RU7A 4DNQA 1OGIA 5KCMA 3ORQA 2ESRA 2HLHA 2K7ZA 3A05A 4M0MA 1Z4KA 2PBZA 5JBNA 1CJKC 3PNLA 3H84A 1UKAA 3I45A 3D54D 3O8LA 1CEEA 1VCMA 2NACA 4LOHA 1BH6A 2ODAA 1T26A 3AEUA 3PUJA 3QXHA 4URYR 4ZOLB 3WICA 1DO8A 5AW5A 5IM5A 5KC8A 2VNH