1T9GS

Structure of the human mcad:etf complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
228
structure length
228
Chain Sequence
LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extensive domain motion and electron transfer in the human electron transferring flavoprotein-medium chain Acyl-CoA dehydrogenase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase, electron transport
molecule keywords Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial
total genus 55
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2004-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1t9gS00
3KT6A 4CDMA 2JANA 2PFSA 1EXDA 2RD2A 5KCMA 4BWVA 5H16A 3N05A 1KQPA 1O94D 3AKZA 1T9GR 1PG0A 4KR9A 1N1DA 3TNJA 1MB9A 2PZ8A 1IQRA 1PFYA 4CT0A 3D6UA 1G8FA 4XFJA 1JHDA 2BYTA 4GU5A 1J20A 3ILVA 1WOYA 5AHWA 1ZH6A 2QUIA 4OUDA 3CLUC 4I6EA 4I6GA 2GKSA 3SEZA 3IVCA 2QTNA 2B7LA 1VBNA 5DASA 2IP1A 1JIJA 1H3NA 4ZCTA 4RUKA 2QUJA 3KT3A 3CVUA 1T6XA 1PG2A 1VBMA 2WSIA 1JIKA 3UK2A 5K0SA 1H1TA 4MULA 5DEOA 5KHAA 2J08A 1OBHA 4MW7A 4MWEA 4MWBA 4YMIA 3SEQA 1NUUA 2QUHA 2DXIA 4JXZA 2QTMA 3HV0A 3MLBA 2R5WA 5FO0A 4ND6A 3M5WA 4S1OA 1M8PA 1WXEA 2D5BA 1G8GA 3Q4GA 1O97D 1JEEA 4MW4A 2QJOA 3CVWA 1OWNA 2VTBB 3IMEA 3VU8A 2CV1A 3FH0A 1O0CA 2J5BA 3AL0C 2IELA 4XFDA 1NI5A 3TS1A 2TS1A 2C5SA 2O8VA 1Q11A 1MAUA 1KORA 1TYBE 3AIIA 3SYTA 3ND6A 4MUNA 3IH5A 3COVA 4NDAA 4Q16A 4MUKA 3HGMA 1F7VA 1J09A 4DJAA 4PY2A 1TYAE 1HYBA 3MXTA 4NX2A 4EG4A 1WKBA 1NUQA 1QQTA 2XRYA 2CV0A 1U7XA 1ZH0A 4K0RA 3P0HA 3G6KA 4J75A 3ZJUA 3DV2A 3I05A 1M1ZA 4EG1A 2E89A 1RQGA 2E21A 2RE8A 1WY5A 3HL4A 3MMXA 1TFUA 4YP7A 3FHJA 5KWVA 2DEUA 3UOWA 3H05A 1QRUA 3RJZA 2PIDA 1M8GA 3A4IA 1NURA 4XSVA 2WQ7A 2WQ6A 1A8HA 3HMQA 1QJCA 2YXNA 2CYBA 3LOQA 4PBTA 2Z3VA 3HFJA 3QTTA 3IMGA 5HUHA 1D2RA 4MVXA 3GMIA 1TEZA 5BNZA 1OWMA 5H7XA 2CSXA 4ZCQA 3RK1A 4ND7A 1K92A 3FY4A 3PNVA 4OJMX 5TEVA 4JYZA 2CT8A 2CUZA 3RFFA 3ZXIA 3TZLA 3IVXA 3RK0A 1EFPA 1G59A 2PZBA 1NP7A 4ARIA 4ZCPA 3QE4A 5HG0A 2HMAA 3IMCA 1FFYA 1XNJA 4I6JA 4QBTA 2A84A 3NBKA 2DLCX 1N3LA 1R6TA 1EUQA 4ARCA 3IUBA 3N8HA 5J59A 3L92A 1IH8A 1NUSA 2CYAA 3Q12A 2D13A 1NSYA 1VLHA 2IJGX 4MVCA 1NUTA 3COWA 1QNFA 1YULA 4DDKA 1QRSA 3COYA 1NYLA 4JZYA 4CDNA 5F23A 1V8FA 1PFWA 4KR6A 3CR8A 1N2HA 4P2BA 1GAXA 1N75A 1KP2A 2Z08A 1M8FA 1MC1A 2OV4A 3IOBA 2EL7A 1U0BB 4UZFA 3KFLA 5FNZA 5JBNA 4DLPA 3MUEA 1H3FA 4HK4A 3AFHA 2AKEA 2CV2A 4WNYA 1Q77A 4YBRA 1PFVA 2GM3A 1J1UA 1U7DA 3OTWA 3SZGA 3SDBA 4QRDA 1XJQA 2YWCA 4DDMA 1Q15A 3UY4A 3ND5A 4ZT3A 2EJCA 4JFAA 1O94C 2J4DA 1YIDA 4X0EA 3HZRA 2ZUFA 1COZA 1JZSA 1WXGA 2ZP1A 1O96B 3IVGA 1JZQA 3SP1A 3FWKA 4EG5A 4DDHA 3CLSC 4YP6A 1GZUA 1IQ0A 2ZUEA 3FNRA 1U3DA 1N2GA 2XRZA 2DPLA 1KH2A 2X0KA 4OUDB 1GPMA 2CFOA 2DR2A 3IODA 1I2DA 1QTQA 3P52A 3X1JA 3H97A 4DE5A 1M83A 3CLSD 1EUYA 1IQUA 1KR2A 4U63A 1KAMA 1N2EA 1WQ4A 3CVYA 4MW2A 3ZXSA 2V0CA 1O96A 3CVVA 2VXOA 1U3CA 1TYCA 1WQ3A 3F3MA 4MLPA 1OWLA 2QJTA 1YIAA 1VL2A 4ZT7A 4E1AA 1ILEA 1F4LA 4Q93A 4MWDA 4RPIA 1KP3A 3IUEA 1O0BA 4AS1A 1J1ZA 4A91A 3MLAA 1OWPA 4ZCSA 1JIIA 2A1UA 1MJHA 4L2IA 3OP1A 3PNYA 4MW0A 5LFAA 1O95D 3ZJVA 3G5AA 2AG6A 3H9CA 1MB2A 1WJGA 3A04A 4ZT4A 1G8HA 4QREA 3A05A 4ZT5A 2DETA 2VTBA 4MAFA 1EJ2A 1YUMA 3AG6A 1O95C 3CLUD 3NV7A 4GRIA 1T6ZA 4HJXA 1O5TA 2JA2A 4H3SA 1B6TA 4MVYA 1MAWA 3IDFA 4KPUB 3KT0A 1LI5A 4MW1A 3ZJTA 5TGTA 4EG6A 1M8KA 1GTRA 4MUEA 3N9IA 4R2MA 4MWCA 5TEWA 1M8JA 1OBCA 1IVSA 1QRTA 1OWOA 3AG5A 1F7UA 1WXFA 1DNPA 2PZAA 3CA8A 4MW9A 1WZ2A 2A88A 3TQOA 1UFVA 2BTEA 3FIUA 4MVWA 1Q19A 4TS1A 4MUIA 3GLVA 4R2LA 1KH3A 1TQ8A 3DPIA 2X1MA 4NZPA 3PRHA 1CT9A 1J70A 3S3TA 3KT8A 1TYDE 2NSYA 4JXXA 5EKDA 1EFVA 3CLTD 2E18A 1LW7A 4YP5A 4ZCRA 5J5AA 3INNA 1MOPA 1WXIA 1ULHA 2X1LA 2A86A 2GOYA 1XNGA 4PBRA 3ISJA 3FG9A 3DLAA 3NBAA 4EG8A 4F4HA 3PXUA 4EGAA 4EF6A 3QTBA 2A1UB 3FETA 2WB2A 2V0GA 3X1KA 5LLTA 2D54A 1JGTA 3IOCA 1IRXA 1I6KA 1KQNA 3LE8A 3CVXA 3E27A 3X1MA 1I6MA 1Y42X 1EFVB 2J09A 4K03A 3BL5A 3LCJA 4G5FA 4KR7A 2CYCA 1OD6A 1V47A 3PNBA 1K4MA 2YWBA 4HPWA 1P7PA 4HJRA 1GTSA 2JAXA 3CLRC 2E0IA 4MUJA 3UC5A 1S4MA 1KKUA 3FOCA 1FYDA 1JMVA 4R0NA 1QU2A 1LI7A 2X3FA 3N2YA 5IHXA 2AZXA 3DO8A 1KQOA 3FDXA 4NAUA 2O5RA 4FZJA 3RHSA 1K97A 3ZIUA 1NUPA 2PG3A 2I1LA 3L93A 2QTRA 4MW5A 3G59A 2A1TR 1JECA 1YI8A 1BS2A 2DUMA 3P0JA 2Z09A 5DK4A 4J76A 4U8HA 3IOEA 3C8ZA 4G5YA 4F3RA 3FI0A 3GUZA 1ZUNA 1XNHA 2A4MA 5J58A 3ZGZA 1EFPB 1T9GS 2H29A 1JILA 1YUNA 3RBAA 3TZEA 2QJFA 3CLTC 4MUGA 4ZT6A 3A2KA 1WXHA 3ZUGA 1VBKA 4EG3A 4MW6A 4EFKA 4MQ6A 4EG7A 2A1TS 1O97C 2DERA 1F9AA 4KKVA 3U1VA 1MRZA 3SZ3A 2OQ2A 4WSOA 1KH1A 4L2IB 3Q10A 1EE1A 2NZ2A 3K9WA 2H2AA 4NAHA 2A7XA 1N2JA 1X8XA 3H99A 4PBSA 1PFUA 4ZT2A 1N2OA 1N77A 1H3EA 1IFXA 1QU3A 2J07A 4CQNA 2G36A 4U7JA 5IJXA 1O6BA 3D6VA 3K32A 4UZEA 2YY5A 3ND7A 1X6VA 1J21A 1N2IA 1R6XA 3JXEA 4MUHA 5TS2A 5K0TA 4DNXA 1N78A 2HGZA 1K4KA 1NZJA 3VGJA 1ZJWA 1N2BA 4NATA 5LM3A 3CLRD 1I6LA 2QUKA 3COZA 4KPUA 4AQ7A 1KAQA 1MBZA 1T6YA 5DB4A 4G6ZA 5HUJA 3H9BA 3P0IA 3ELBA 5FO1A 1SURA 1IHOA 4MUFA 2HZ7A 1JEDA 1GLNA 3UMVA 1R6UA 3TQIA 2PXHA 3VRHA 1GN8A
chains in the Genus database with same CATH superfamily
1EWTA 2C9OA 1UFRA 3T5TA 3TFOA 1XRMA 3E4DA 1ZBDA 2QAJA 3AEUB 4M0LA 3BF7A 3P9PA 4AB1A 2C3YA 1OYYA 4BMNA 1UC5B 1X8LA 1SFRA 1Y5NA 1JHMA 2RCNA 1TCBA 4WCFC 2UUAB 2OOKA 3KU4A 3M9XA 4KR9A 4OJKA 1I5RA 3L07A 4PYLA 1AXRA 2X8WA 2ZE5A 4P84A 3VPBA 2W98A 2ADMA 2O14A 3PBKA 3NBXX 1FTNA 1TF2A 2JBAB 3WXBA 1KWGA 4CLOA 4RJKA 1PEYA 5E9WA 1N2XA 2AZTA 2LXNA 3W6NA 3ADDA 3QPAA 4CM8B 1L1QA 3CLUC 3QVGB 4BFYA 3TZ6A 3ZE2B 4C0WA 2GKSA 1HNXB 2QTTA 2XNJA 2WDPA 2XY4A 1VMEA 5FI1B 1MTOA 5GJCA 3Q2OA 2BELA 2PZGA 2G88A 1MT0A 3D1JA 1MX1A 4BN4A 1OYVA 5CNJA 1PR4A 5AK4A 1ID8A 1XK7A 2AE2A 4HS4A 5AKGA 1X86B 3CR7A 5EIBC 3ZK7A 4CL2A 3GB9A 3OJEA 3KZOA 5AKIA 5FL7D 4XJTA 1UT6A 3MM4A 1X8JA 1NPYA 3ITDA 4FEEA 1MZPA 1WUJS 5EXEA 5KOHB 4LBZA 1AHIA 1YQEA 2JBHA 1DOAA 3A6ZA 1TX4B 4OKSA 4X90A 1P5ZB 3GVXA 3OCYA 1CUAA 4MULA 1YKSA 2HCTA 3A6LA 4J1TA 1ZW1A 4RCVA 4RK0A 3SKXA 2GMWA 2VJMB 1RM3A 4NS1A 6YASA 4YDQA 4BQNA 3TW0A 3LT1A 2H1LA 5KSWB 3OFNA 4OSEA 2BFCB 1XG5A 5JW6A 5JSKA 3CUEF 2ENUA 3C48A 3OIGA 2OHHA 1HGXA 3PPXA 4V1CB 5A06A 3I9V1 3B6MA 5BN3A 1BE0A 4I7EA 1H5QA 1YTLA 4MVJI 1I0IA 5MDHA 1EFTA 3Q7EA 1BX0A 1MKYA 2QLTA 4FMBB 4LXQA 4UD2A 4EHAA 4X00A 1E2MA 3MQ2A 5BWCA 4PONA 3N2ZB 3T5BA 1OH5A 1M8PA 5EIHA 2RG7A 4HWGA 3GZNB 3RLIA 4TYNA 1L3IA 2VJLA 4AZ3B 2QLJA 3U4AA 3DO6A 4ETNA 4ERXA 2A57A 2FSIA 5LQJA 1JEEA 1QLJA 1UXOA 3ZHUA 1RWBA 4NSNA 3IPXA 2F90A 3JQBA 1Z17A 2HC9A 1U1CA 2A0UA 3H0EA 1BWSA 4UUNA 1GDTA 5BQPA 3I04A 4QO8A 3V80A 3U0VA 1LSSA 2VDUE 4ZYVA 3SFZA 1Z5VA 2PX0A 2JFWA 4B2IA 1DMRA 2IYNA 3GLHB 3TS1A 3LC7O 2CXQA 4AJHA 1E2BA 4BZPA 3OUTA 2AOTB 3WGGA 1HOTA 2JLUA 2HA0A 1DC6A 2VPQA 1DI0A 1QVWA 1NN0A 1NAHA 1QGUB 2D1FA 1UCFA 1G7RA 2F9FA 3N0XA 2Z6QA 3IUSA 1NXOA 2PX6A 4E5NA 4QOEA 2R96A 3EDRA 4LV5B 1Z6ZA 3OY2A 4Q6WA 3FJYA 3CY6A 1E92A 2OCBA 3A4VA 3ZCTA 4KK4A 2E4YA 1K7SN 2OCPA 2WWFA 4L5BA 4U9IS 3SSMA 5JMWA 1LY1A 3ZNNA 5ELLA 1RQGA 2C5FA 1E2QA 2BGRA 4N5LA 1MEOA 5EIEA 4QODA 5G02A 1NVMB 1WU8A 1KIMA 3QU7A 4L4UA 2Q2QA 1ZYUA 1Q0ZA 4RAQA 4XW2A 4ZZ3A 4E32A 2FDCA 2NX2A 1K3UB 4C1NA 1UZNA 2GJ4A 4XWWA 5F9FA 4XPIA 1XD8A 2YR0A 3A4IA 2P2LA 3VYWA 3BTUA 1W44A 1YZUA 4HPXB 4A2CA 2FQ1A 2PWZA 5TPZA 1WCXA 3SQDA 2Z58A 4HT3B 1C50A 5LM3A 1W85B 4WKNA 5BSTA 3TEJA 3QEKA 3FF1A 1ADJA 2PLNA 3B51X 3HC7A 4OKIA 3UWPA 5EUMA 2ZUTA 3KZXA 3T4EA 1Q1NA 3IT1A 3NYWA 2ZVQX 3IEXA 5BNZA 1OWMA 1TVCA 1MOQA 4ZCQA 4GEGA 1QCZA 1P60A 4BHTA 4J0HA 3ZCVA 3PNVA 1A7JA 4GMGA 4LF5B 1TKAA 1BXZA 1BA3A 1NW5A 1XZDA 2PKRA 4G26A 4GXQA 4JYZA 1EX7A 2QP4A 4HDRA 1WMEA 3H9QA 2EP5A 1N5MA 3EZXA 4QJBA 4N3AA 1V6SA 1WCV1 4DS3A 2HLDD 3DVRX 3MN1A 4BGVA 4EY5A 5JI3E 3DDNA 3LIPA 1MCZA 2W2TA 3KBBA 4ZO6A 2IV3A 4F21A 4P0TA 4JLSA 1PWZA 1XJCA 4YMSA 2RBEA 5K4GA 5FL3A 4QGSA 1IYZA 2QL6A 1ECGA 3F71A 4YRGA 5FLXA 1FFYA 2E4AA 1C9NA 3BAFA 1N1GA 3ZOKA 4EL5A 1MIOB 4TWBA 5F76A 4EEKA 4FMCB 2QAGC 1W88A 3RLFA 3I6ZA 5B4UA 3A2LA 3O8QB 4B8WA 3LJKA 4BUCA 3LYHA 5GVSA 3ZQKA 4OATA 1NVAA 5JY6A 2Y1LA 2GN4A 4JJAA 4TZ6A 1G8AA 3GBPA 3ZTWA 1J2RA 1R66A 4LFCB 1DAPA 4XX1A 4DLXA 4F56A 1PHRA 3K1TA 1M73E 4G1UC 1E3EA 1A9PA 3EHEA 1EM8A 1FU7A 1TRHA 1F6BA 3QUCA 4DMLA 2FYTA 4JBXA 4WD3A 3K9BA 3BB3A 1BN6A 3NRCA 4CDNA 3QIVA 3GN1A 3QFHA 4KR6A 3P9NA 3Q9SA 1JPVA 4ZVKA 5JNUA 3JRWA 1RWMA 4S35A 1RXYA 3UKDA 4B46A 2O5VA 1QP4A 1NONA 4RF5A 1XDZA 1J8MF 4M6WB 5SY9A 3U0BA 4QT0A 2G1KA 1C7FA 3RADC 3HDGA 2DBQA 4FFOA 2YIVX 4FX2A 1EGMB 2QMUA 4B85A 2OB1A 3KLNA 4XPIB 4GSLA 1F2TA 2F43B 1JJ7A 4B6QA 3FOFC 2RK3A 1NXXA 1O3YA 2MINA 3GPDG 3Q7IA 3C45A 5EWLA 2WUVA 2IHUA 3BRWD 5BXYA 5ICCA 3QEMA 1MQAA 2ZTUA 3JVEA 1HDIA 5DIFA 5BSKA 5DJ5A 5IFLA 3N2NA 2H7CA 4KNYA 4KIJA 4MJ7A 2VNAA 1UBRS 4BLRA 3FPEA 1JDPA 3DFIA 1JTVA 4LYJA 4ZT3A 4JI0B 1KAOA 1E9DA 1A9OA 1GL6A 2B8WA 2EKZA 4E1BA 3L7YA 1CERA 4I55A 4RTMA 1Q83A 3I3OA 2R5NA 2DT5A 1WNTA 4GVPA 4O4IA 1IXKA 2DCMA 3IOMA 3TIXB 1ZMBA 1J39A 1RYBA 4ZGBA 5AR1A 1U0HC 2EQAA 1I4LD 1JG4A 1M66A 4FE4A 4UJ5A 2JFHA 4BAGA 4ZQEA 2DTEA 1EQUA 4GFDA 4Y3UA 5J5CA 3UKOA 3VZBA 4D56A 1KERA 2GBPA 1ZCJA 3ZBTA 4Y9RA 1R0KA 4HAVA 5CXUA 2XGMA 5AOCA 4EI8A 1M6NA 3IEUA 4J90A 2QW1A 1C3VA 5AI0A 4HI0E 1EJ0A 4YRPA 2F17A 1MIOA 1VDZA 3HYLA 5EUBA 1NOJA 1EA7A 1NW4A 1XRSB 3WLSA 1M9NA 3S99A 1WMSA 2OENG 1SU8A 2JLSA 2V0CA 3T34A 4IXDA 3UT0A 4U2BA 1O96A 4FFRA 4HVCA 2X0EA 2IYXA 4JT2A 1VKRA 4OQQA 4LY6A 3T6KA 2WBLC 5LP1A 3WYCA 3ZPXA 4RE5A 1S3FA 1KAHA 4UASA 4N18A 1NTRA 3F3MA 4R1MA 2ZWVA 1XRLA 2D59A 4PO9A 1K5DA 1SQ5A 1HZZC 1LDGA 2DLNA 2PKCA 4E1AA 3EXIB 1QZZA 3TLXA 1F3LA 2Y2VA 3E3NA 2YICA 1QHHA 3PT9A 1Y98A 2DJ5A 3ZVRA 3E05A 3FBTA 5JXJA 2AMJA 5EJ2A 4IGAA 2EARA 1O54A 2YX1A 1Y6RA 3U56A 4AZ0A 1KTIA 2YINC 3C8UA 4K46A 5F1PA 2ISSD 2P6PA 3HDQA 3A4MA 2J48A 2ATXA 4CEJB 4ZGWA 3EN0A 4YRCA 4UM7A 3HG7A 2HO4A 4UTNA 3UHJA 4H1WA 3K05A 1RMQA 1YDHA 2ONKA 1AHHA 4X3CA 2PL9A 4MWTA 2BCGY 2YJNA 4LYEA 4MAFA 2AUTA 1R8XA 4YI5A 1TFRA 2JAUA 5KQSA 1JXOA 2H1WA 5CK4A 1N36B 1JXAA 1YRBA 2OECA 3HV2A 1FY2A 1VL1A 2WPDA 3OFND 2G9ZA 2NT4A 4QTUB 6LDHA 1NG1A 2BM0A 2X1HA 1T1IA 4NG4A 4R1SA 3ZE9A 4OI0A 3VSCA 3KTAA 3GPCA 4ZQFA 1MAWA 3AEQB 3IDFA 3CQ9A 2AK3A 4BGIA 3I9FA 5I51A 2I55A 3W5CA 2PYDA 2IYEA 3C3WA 2Y6VA 4MW1A 2AF4C 1PIWA 1KS2A 4K9QA 2Z4RA 1LPNA 1ZNXA 4OHPA 4NYJR 3FVWA 4RVHA 1BWPA 2SICE 4HFJA 4HEA1 1GTRA 1XZBA 3ADPA 1GEGA 5F3WB 2LTAA 3M4JA 1RSZA 5AVWA 3F6PA 3U31A 1HDYA 4HQ6A 4IDEA 2Q5LA 1UBTS 3VZPA 1M2NA 2JA1A 4WWHA 3TL6A 3F5DA 4RJTA 2A67A 3MWYW 1XJWA 3VU1A 1XZGA 3N70A 2IU3A 1X3LA 2VDJA 4FSHA 4QE3A 4MKZA 4WGGA 1E2DA 3GLVA 1NX6A 3N0TA 5JADA 1TQ8A 3QYJA 4JKOA 4Q4AA 3TLJA 4BNYA 2X9GA 1W93A 2EBFX 2FSPA 5H9WA 1IATA 2XMGA 2ZRBA 4WBNB 1C4OA 1RRKA 3GRAA 4QGHA 4I4IA 5GM2A 5T57A 5TVGA 5LU9A 1C1XA 2IHKA 4WBXC 2VDLB 4FDTA 1EINA 1C4KA 3CZPA 3ULKA 2Z2ZA 1RDFA 5A5GA 1NE7A 3N1UA 5BRAA 2G8LA 1QHHB 4B71A 3THXA 3T3MB 1IEXA 4MHSA 3HCCA 4XRGA 3EZLA 4MQFA 3WB1A 1OR8A 1JIXA 2H4HA 4A4DA 3HCEA 2ZIXB 1BKDR 3DB2A 3O2QB 1E2HA 5JG7A 4MIOA 2D1SA 5CFMA 4WFIA 2A1UB 4YT2A 4IHQA 2OGZA 3B60A 3CRRA 4RNCA 3Q8MA 1NVEA 1II8A 3PHBE 5CXQA 2E82A 3GLIE 4QJ3A 4Q3EA 5I8WA 2GJSA 3WISA 3MZ0A 3D6TB 1C2TA 2AOUB 2GM5A 1NQAO 1C5KA 2VZ8A 3VI4B 1HLDA 5B6JA 3DMPA 3L79A 4EQ6B 4DHWA 1ATZA 3T3GA 1U1GA 2J0SA 2HU7A 3B5IA 3ZUPA 1USUA 1MOSA 1YA8A 3F6RA 4NENA 1U0EA 1H2EA 1ZSNA 2WB4A 3OX4A 3AM1A 4TMXA 3A7EA 3NQ41 3PC3A 4YASA 4C1BA 4QDOA 1P4JA 2CJWA 2P68A 3DBHA 2VJQA 4HLNA 5AVJA 4B3JA 4OFZA 3M3DA 4H0CA 3FOCA 2AV6A 3HU3A 1JMVA 1NHWA 4RF3A 1GPWB 4LWPA 1T4GA 1D3AA 3QP9A 4PXAA 3PXDA 4GGPA 2JGMA 2F67A 3DO8A 2X13A 1Z7EA 4R2HA 3OT4A 4MP3A 1QYVA 1GG9A 1VOTA 1Y8RB 5IDYA 3TJMA 2DHRA 3QA3E 4WRRA 1LSOA 4DM7A 1U1EA 3EC1A 4FONA 1FYVA 1WZCA 3R7BA 3G59A 4G5GA 3HKBA 3ZWWA 2DH5A 5F73A 4EHFA 4BNVA 1JBKA 5FUBA 1I80A 3AYXB 1I24A 2DFVA 1I5OA 4G85A 4RLQA 1Z5UA 2OK8A 1WD7A 4ZIRB 3CE9A 3SE0A 5DM70 5K99A 3A06A 2QSUA 1R0WA 3FFWA 2WUFA 5HBGA 1CY2A 2Q3JA 2VP4A 5HYVA 1JG3A 5IW8A 4L8FA 3H0KA 1YZVA 1SPXA 4KWTA 1R0YA 2FSSA 2NVBA 4BJ5A 5GM1A 2VTEA 2F62A 1EFKA 4L8GA 2REQA 2IQIA 3TBHA 3DHEA 1J8QA 3JAKB 4F8YA 1D4ZA 4R40A 2JCVA 2O2GA 2XRFA 3ZKWA 5DM2A 1U2GA 4MPJA 4LMBA 5HGXA 3NOQA 3DJFA 4YRIA 3H5LA 3Q7SA 4COKA 4WTOA 2OQ2A 4FT2A 3WKAA 2C61A 3OF3A 2YVQA 3Q7PA 2NZ2A 1OZGA 2GRJA 3RRNA 2CMGA 3UHAA 2O2HA 1XDDA 3AIOA 5ELXA 2YQ5A 1XXHB 4FE3A 2I91A 1C8LA 1JA0A 3DF7A 1ZHOA 1QU3A 2J9ZB 2CLMB 4EVSA 1KY2A 2XECA 4WZAB 4Z7QB 1Z18A 4H2DA 1IXZA 1DU4A 1VI5A 3HA5A 1GUYA 4FCWA 4EQ6A 2V1UA 1E1YA 1R18A 3PEYA 3F96A 2HGZA 2HWYA 2IE0A 2QR3A 3F5SA 1XN1A 1K8QA 1BZYA 3HXTA 3G2OA 4NL4H 1YNSA 3NOVA 3HUTA 1UP7A 2QUKA 3RBVA 4D9NA 3AVVA 3FUCA 1MBZA 3KCNA 1COWA 5ER6A 4YUVA 4OHYA 2NUAA 2YQ4A 3EE6A 1GNPA 2ZSBA 3KDSE 5DB4A 5L3RA 2P6MA 1JW9B 1Z13A 1XK6A 4M55A 3FDFA 4EY7A 4FUTA 4RPJA 3ZI7A 2R2GA 4JYPA 8OHMA 1IB6A 4L6CA 3IPAA 1USKA 1J06A 3C98A 3HFRA 4RF4A 3WWPA 4EGQA 4CDMA 4OQYA 3HNOA 5H3CA 1NT2A 1E1NA 1SUIA 2D0DA 3W2HA 2P9ZA 2IZZA 5H16A 2HRQA 4YACA 5T4EA 4XGNA 2C2HA 2HIGA 5EJFA 4IH4A 4R5HA 4IL5A 2IZ7A 1SCUB 2C7PA 1BCRA 4X5OA 2QIPA 1IVYA 1VCOA 1XKQA 1YBVA 3EWAA 1VSVA 3FZQA 4WK2B 5EFZA 5LU8A 3EGDB 1P3Y1 2FDRA 2YWDA 4AMVA 1TGVA 2H92A 5K4AA 4AS2A 2RGCA 5AYVA 2FPGB 4MA4A 3ZOZA 1KEZA 1SUBA 4HQFA 4CL0A 2A9VA 1PL8A 1UXGA 5LP6A 4CGZA 2HGSA 4QU0A 3P45A 2KI5A 1KZ1A 2YZ2A 2VPIA 3NEAA 1WMBA 3JRNA 3IXLA 4FFSA 4UD6A 2AOXA 1WL8A 1D04A 3WYEA 1RYFA 4CFSA 2ZJ6A 3FVRA 1E94E 1HUQA 4BQOA 3LI2A 4M0KA 2PS3A 1AKRA 4B0PA 4S24A 3B6EA 5FPSA 2CZCA 1BGWA 2L42A 6PFKA 1K08A 4CEIB 3O8OA 1CEEA 4JGBA 3ZE7A 1CNMA 1Q3TA 2ZRIA 4CUJA 4JP1A 1JIKA 1O4WA 4F3KA 3C3YA 1RWWA 2DSTA 4EJMA 3L05A 4CKYA 4FHEA 2WUGA 3KR2A 4WZZA 4B73A 5L51A 1OXTA 1JHPA 3D3QA 4TTAA 4BMZA 1YI1A 3LWZA 2Q0SA 3T7IA 3P4UA 3W6UA 3A26A 3Q11A 3VNQA 1X80A 1HA3A 1UXIA 1EXMA 1Q1ZA 1X7ZB 4RZIA 3AVWA 1CU1A 1JEYB 4BASA 2WMYA 2BMDA 4QJ5A 3V4VB 1UMCA 1BCSA 4CF7A 5DBGA 3NM6B 1R5OA 3E70C 3P2OA 2NUAB 2ZXUA 1JT2A 3WRVA 2H2FA 4TVOA 2CL6X 3EXHA 3UT5B 3CSSA 4ESVA 2QDKA 2W5UA 3DLBA 2C00A 3BG5A 2COEA 1WHTA 4N47A 1JU4A 1RZ3A 6GPBA 2PS1A 3EWNA 4FYKA 3NDPA 2P8SA 1ZU4A 3QJ5A 4O4LA 1ZITA 3BWCA 4EPWA 3P1JA 1NI5A 3U3MA 3FPBA 3MBKA 5DWDA 2QUAA 3B5EA 1EZZA 3DVAB 5ALIA 2PNJA 1XGKA 1HT1E 1WZUA 4LS3A 5DZSA 3PQ6A 1PZNA 5P21A 1G1MA 3IIJA 3VR3A 2G1JA 1D6SA 4S1WA 1C80A 2JBWA 3SKVA 1QB7A 1YJXA 3W5SA 5B3JC 2J0EA 3E18A 1X2BA 1G8PA 1YJCA 2JHPA 4RDXA 2AUNA 1GGJA 5FBQB 1UBLS 3CUYA 3FM9A 2E85A 2IYYA 3D6MA 2Y99A 3FLMA 2Z4SA 1M1ZA 3RKSA 4MV0A 4DWOA 3L8YA 2I29A 4LE2A 1SUEA 2FE4A 4XVHA 1NRXA 5DM0A 4KUEA 1N2CE 5LYYA 5TLSA 1C3EA 1O8BA 1OIWA 4KX5A 1J0AA 1FFAA 4KEAA 3RHFA 4MRMA 1JS1X 2FJUA 1YZHA 1Z25A 4B4WA 3U6KA 1M2VA 3LUKA 4IM7A 4J4HA 5FBVB 1XL1A 4PGMA 4QXQA 1EE9A 2X9QA 4YRMA 3IJPA 3LCVB 4J4BA 5DNWA 3EGIA 3V4ZA 3VISA 4PSDA 1H4QA 4CWAA 2B8JA 2PKQP 5LXTA 4EMBA 4MA5A 1DINA 4OBEA 3CH6A 4TTRA 1NLZA 2GRUA 1DBVO 2FN4A 3I58A 1S7CA 3AOEC 4C6TB 2JG3A 2O8FA 3QVVA 4GS5A 3RSFA 2W0MA 1Z3IX 4JJ7A 3RS0A 4UBJA 2PKWA 1ST3A 1TE2A 4FMCF 4M0DA 4OF4A 3A3NA 3WYNA 2CDBA 3HP1A 1P4HA 3SMVA 2ZRFA 5CH3A 1M67A 1K63A 1OA1A 3B7PA 1U0JA 5FPQA 3EIHA 4M8SA 4ZVPA 1P9NA 2GZMA 5HG0A 3K2IA 3HVIA 3V33A 1E58A 3LUCA 1JLLA 4YMVA 2RGXA 3IMCA 5FQNA 1EKXA 3CCCA 4UE6A 2CF5A 2E49A 2AZ4A 3NNSA 3PVSA 2H2WA 2GEJA 2FR1A 1HV8A 1RYYA 1LKZA 2HJSA 3NWBA 1S3SA 2DP4E 5T4BA 2B6NA 1QTIA 4D9JA 1OTYA 3DFZA 1OVGA 3IUBA 4H7HA 4OB6A 4UTXA 2WD7B 3F9RA 5E2IA 1NN1A 3AL3A 4WX2B 5JFOA 1NXVA 2GN1A 1NA5A 2YZ7A 3EIXA 4JUBA 4B84A 2J85A 3ZS8A 1M1UA 1Y5MA 1GD1O 4H27A 4ZAVA 2QT0A 1KI6B 2W71A 3MD0A 2VHWA 2WJ6A 3T12A 1KIAA 1NATA 2XT0A 2ZSJA 4X1IB 3F7MA 4DLLA 1NVVQ 1NYQA 2J5QA 3KOWA 1TC1A 3WGQA 4ID9A 1RRPA 4FFVA 1I9GA 1OGIA 3O3OB 4B3HA 2ZI5A 2VUIB 4KE9A 4ESHA 5FDFA 2BVNA 4JT8A 4R41A 3C5CA 5JNVA 1ZY2A 3K31A 1L5FA 3L04A 3CPHA 3EXHC 8LDHA 2P9JA 3SZMA 1SXHA 3LLMA 1U0BB 5CM9C 4C9BA 2PZEA 1HQYE 2V7UA 3L7IA 4P22A 1MX5A 5IH7A 2IXAA 3A3PA 4ZJZA 2HU8A 4WIAA 4NFHA 1M75A 2GM3A 1V43A 4EW2A 1N32B 1V5EA 4H6WA 3F2VA 4Z99A 1BROA 5AHRA 4KQ2A 5TRTA 3SXUA 4P53A 2OMKA 3VQTA 4MO9A 1L4GA 3UV6A 2QRGA 2FZWA 4O4JB 3H2IA 2ETVA 4WUVA 4TV8A 3T0GA 2XE7A 4HDOB 1MGOA 3S2EA 3ABZA 1L5LA 4EPVA 621PA 5JO9A 5EZQA 3PR1A 5ANRB 1WP9A 2NN3C 4FGSA 5EKSA 3VOTA 1RLMA 4BJ6A 2NTVA 2ERYA 2ZSKA 4DNFA 4EG5A 3FPFA 3CLSC 2PMWB 2WHEA 5ILQA 1IQ0A 4CN8A 3R8CA 2WD8A 2Q9AA 2UYHA 1U4NA 2J3MA 3TTYA 5IJWA 1L1EA 2QT9A 1BMFA 1GILA 1CRLA 4JL6A 3UJ9A 1B4DA 5H81A 4WASA 2CFOA 3A3OA 3DLTA 1KSJA 2F00A 3IODA 4GOND 1GV0A 4GUDA 4JI1B 2W58A 2Q3MA 4NWIA 3B20A 3CB4A 5KSPA 5ALJA 4FM9A 1TIPA 2GCOA 2W93A 3QNUA 3LECA 3G2MA 3CH5A 5H83A 3CZ4A 2QSYA 5KAPA 4O5OA 3GJQA 2AXEA 3H5VA 2GYYA 2QRQA 4KLZA 1U2EA 3ODPA 5K3FB 4YJKA 4YRZA 1BDIA 2VXOA 4OSOA 3NBZC 3ROFA 2XYHA 1N7HA 1A8UA 4C5BA 1Y1QA 2IXGA 4Y2JA 1DP4A 3B3GA 3ICPA 1ZRMA 1T5IA 3X44A 5IAOA 3NW9A 3GXOA 3HKEA 1F2UB 1N6RA 3H65A 1L5GB 3V48A 4EIWA 4HDCA 1IXYA 3R7WA 1OYWA 1YI0A 4LZLA 2ZYIA 4GKBA 3LAWA 3MT0A 3TLBA 2YMLA 1VMDA 5FKJA 1G3QA 2WKSA 1V96A 1XZIA 2DQZA 2ODPA 4GX0A 5KIAA 1JIIA 3T38A 4CDGA 1QQ7A 1QWOA 3DMRA 3EDCA 2AN4A 1PSWA 2VSQA 4HH4A 3TRIA 4BTVA 5FI3A 3D8UA 3ENNA 2AR7A 2IY9A 3EISA 1MQSA 3PC6A 4MRSA 1AB6A 4D44A 3AF1A 2NOAA 1HYQA 4MI3A 5MN5A 2IEBA 4RYDA 4L4XA 2IYZA 2MTBA 4R1NA 1KU0A 2JIMA 1L7DA 2YUTA 1Z7GA 3LYUA 2GRAA 3BX1A 5L7YA 4EWLA 3DE4X 4DILA 3TM4A 5LQKA 2D2FA 4JUCA 3MWJA 1HYGA 1Q6ZA 3IDZA 4JP2A 4U6SA 2V3VA 5TT0A 4R01A 5KNDH 1ZD3A 2WF5A 4D99A 2PMFA 4COOA 2ADFA 3NIGB 3V32A 4ZYWA 1L5SA 2MJLA 5CT5A 4BCBA 4DA7A 4KPUB 4IAOA 3F0TA 4URVR 5I7RA 1RLUA 4HF7A 1BSVA 1E69A 3RSHA 1HSOA 3ZIUA 4F46A 1UKZA 2JJMA 3ZHBA 2O7VA 3UGJA 1JHUA 2WAAA 5KUTA 1Y63A 5AKYA 3RIXA 4GE0A 4ZOAA 5I7VA 5DBEX 4F4CA 4QYSA 2O2SA 1IN7A 2ORIA 2EGHA 3BKXA 3B82A 1NXPA 4MVJE 5DHQA 3HWWA 4KDFA 1LBTA 1RTKA 3OJCA 1XQ1A 1S4QA 4KYUA 4QFCA 2UYOA 1PNQA 5K0NA 4ENWA 3AVYA 2W6QA 2CLFB 2VJOA 4IFIA 3SQMA 3K0CA 4TQGA 5EHQA 1Q19A 2IYOA 3NYQA 3U7QA 2X1MA 2BGWA 3QX7A 3KQVA 5JHHB 1JQJC 4KJZA 3X1XA 2E4ZA 3EQ2A 3WV5A 4PYJA 4L4SA 5DISB 4BB0A 4NXMB 3DL2A 3VR3D 2ZRKA 3FAKA 3GEDA 1SCAA 4GPBA 4MEBA 5LQRA 1U7HA 3E8MA 2H4XA 3UIEA 5GOZA 4Y0AA 3VR4H 2VNSA 5J5AA 1BE1A 4JITA 3X1DA 3QVGA 4R69A 2V5VA 4YAWA 3LUDA 1PGJA 5FBWB 5K8TA 4NXNB 1AXGA 2PK3A 1USIA 1ZCBA 2CDCA 2CLOB 2XCLA 3BFXA 4LY9A 1T4DA 3OE7D 3REOA 4DC1A 2YXBA 4UOZA 4EGAA 1CS4C 4FZRA 4N54A 3KXIA 3HU5A 1J7JA 5C8DA 4KBFA 3F7NA 3T4XA 3LFHA 1MB4A 1FTWA 4ZEMA 5LIRA 2MT9A 3C74A 3S2GA 4RSGA 3B1XA 3KQTA 4OPMA 2VDQB 3E2PA 4OYLA 4BNHA 3NFYA 5A4MS 5REQA 1MO6A 2FNAA 4K6CA 4NNJA 1I6MA 4TSFA 5CR9A 1NMQA 1BFKA 3ZY6A 3D4LA 2Q4TA 3S81A 4G0YA 4J0EA 2J09A 1O6CA 4Y2TA 1YHNA 3KBOA 2L19A 1LH0A 4JV5B 2BIFA 3VMMA 1KI8A 1V7QA 4KXYA 4C2BA 1EU1A 3TN7A 5B57C 3LD9A 2VDVE 3PNBA 1KJ8A 3JQAA 4XIFA 3E22A 4B5LA 5EHZA 2Z8YM 4I8XA 3DYVA 2ZRAA 3IAUA 3R3UA 5CT4A 1AOXA 1O4VA 1R0SA 3O4GA 3GVIA 4EATA 4X1YB 4AO8A 2K6GA 1YOBA 3OZUA 3VSBA 3AETB 1N9GA 4I19A 4Y6LA 5I7OA 1YUBA 4AIRA 5CCEA 2J46A 4FZJA 4Q66C 1K97A 1P0PA 2I4RA 2P2SA 3IJEB 2FH5B 3ZZNA 3REQA 1R88A 2D3WA 4CG1A 3PF9A 3FCEA 1GGFA 1JECA 3AUXA 3RNLA 2Z09A 2HQOA 4WOCA 3ZHYA 2DUUA 2XCQA 4U8HA 4YRFA 3ELYA 1ZM3A 3QFRA 1GG2A 2ICAA 1V45E 3G49A 5HEKA 4YC7A 4HQRA 3KPVA 3A8TA 3EVBA 1VHQA 1G1AA 4OQZA 1JX6A 4QBIA 2DKFA 5TQ0B 1Y5RA 3LBHA 1WTCA 3KXDA 1PT5A 2NPIA 3NHUA 4TLEA 4XDHA 2YWXA 2BZGA 4UVIA 1TIBA 1YUNA 4OOEA 4AN0A 1WDTA 1PGNA 3CM0A 4Y6QA 3GDFA 4GP9A 1LC0A 4MUGA 5TF0A 1J4AA 1QBGA 4BX9A 1YJAA 1AA6A 4TN5A 2EJUA 3W7VA 5EJ9A 3EXAA 5IKEA 4PLFA 1I4WA 1EVJA 3S6JA 3GJ3A 4GOJA 2Q3FA 4BBAA 4DUGA 5KX5A 4J4TA 1I7DA 2QVLA 3UBTA 4W8GA 3GLIB 1YQGA 2VBGA 3C3MA 4LZZA 1GNVA 1QIMA 3E1GA 4G36A 2Q62A 4TMFA 5EE5B 5DNDA 5FBZA 2I2WA 2V03A 1ES9A 1ORWA 5AESA 1OFTA 1WUHS 4YJ3F 3VYSB 2R7MA 3SIRA 4G81A 3LRTA 3AT1A 3FOAA 4H1TA 4J94A 1FQOA 3RROA 4AY3A 5BW8A 1LD3A 1OH6A 5LN1A 3GLGA 3UO8B 3K0SA 3J81k 4EUSA 4JP5A 3D6VA 4CT5A 4UZEA 3D64A 3UGTA 4YJGB 1YDWA 4F9GA 4TN1A 1N34B 4HSEA 5A4AA 4LMAA 2CXUA 3AP1A 1N78A 2D8MA 4JC8A 1T6BY 1XCOA 2H48A 3HU1A 4NATA 5FQOA 2C7QA 1ZJWA 2NVWA 1YZTA 5A3RA 1YKFA 5C7YA 3E22B 1L7OA 1VB3A 1KAQA 2AEEA 3T1QA 3ROMA 1IZ7A 1G0NA 3IP3A 3WDMA 3OCCA 3QVUA 3VNUA 4UW9A 3OT1A 3VDMA 3DZJA 1X87A 3G23A 3H9JA 1IHOA 3O8NA 1TZJA 3QHQA 5EE1A 5BP7A 1VE1A 4I81A 4R8SA 2YNMD 2ZLBA 1XA4A 1Y3FE 1OKKD 2GN9A 3I12A 1ZXLA 2D5CA 3MCAA 2BMWA 2REBA 1Y8QA 4P3KA 4D8WA 4UNSA 3D5EA 3HO8A 3KKOA 5IKPA 2PUEA 3ZGLA 4C7KA 1J2TA 4MDHA 2YYAA 3LG2A 1OU4A 1T43A 1DXHA 3QSYA 2HJHA 4Y2HA 3OQMA 4MNTA 5GADl 4PTLA 4HEJA 4DT1A 1N1DA 5B1IA 3H5RA 4C03A 2ZS9A 2RGNC 2JIZA 2VEOA 4CT0A 4DEVA 2ROQA 4RE6A 3LC1O 4ZQCB 5HP4A 3QEOA 1VC2A 2FWMX 5EYPB 3VC7A 5B3KA 4LJRA 2NP6A 8GPBA 5K8JB 1TKBA 3DBOB 3P5SA 3QE9Y 2FRDC 2IITA 1N3IA 4GNRA 4I6EA 5JOQA 1DTSA 2IV2X 1ZJ5A 4ZU6X 4DMUB 5L3VA 3LK7A 1ABEA 4RX1A 3RC8A 3EUWA 3PTLA 3SIPA 3OC6A 3WLTA 4E2FA 4EI2A 3BCUA 2ZIEA 1PS8A 2VK2A 1XZPA 3DMNA 4LJ7A 3SI7A 1NY5A 3T1NA 5CFZA 4PIVA 1H6BA 4UUAA 4ZCTA 1ZUWA 1CW2B 3GAFA 5L7WA 1DJPA 4DNQA 2HSEA 4CMIB 4CQMA 1IBRA 1QTNA 3UJBA 3GBVA 2VNHA 4KVGA 1CS0A 1NP6A 3MUOA 1JKJB 3P9YA 3RC3A 4TOIA 4Q9HA 1PG5A 5ALZA 4DZTA 1SHJA 3ISVA 2F3UA 2XUPA 3UW1A 3SR3A 1T36A 4HKTA 1RYZA 3QVMA 4RKEA 1BG6A 3IHLA 5GONF 3TLMA 5MHTA 3K0FA 3MBIA 1I2BA 1NBOA 4MWBA 1L5WA 4NZOA 4UREA 4WBSA 5C32A 5FHQA 4FFDA 1EB9A 3AONB 3PDIA 5B1YA 3CRMA 2HWKA 3PFKA 4CETA 4DB4A 1YL5A 2R00A 1WPXA 4FDLA 2EP8A 2VP2A 2G83A 3OU6A 1KK3A 3RRJA 3K9LA 3VR6D 5CEFA 4GYJA 2FPWA 4DTIA 4KIUA 5EJ4A 2I9KA 3IT3A 3AB3A 1RQXA 1ZM9A 2WAOA 3B6KA 3R5HA 1VKHA 4WI1A 5KSYA 4E5SA 1QV9A 4I5FA 1LK5A 3BJIC 4Z2YA 2JAWA 4J49A 4MRAA 3R7FA 2ACKA 5KTMA 3NHFA 1RVV1 1FS6A 1PZEA 4FYXA 1UEJA 3JWIA 2EFDB 4WGFA 3FNIA 3Q3IA 3GW8A 1KRWA 3O2SB 1Q1EA 3DE2X 2WHPB 2WJAA 2OA0A 3UGQA 4RTRA 4FX5A 3TXYA 3NKLA 2I34A 3HJTA 2FJPA 2W7TA 1E4EA 2J5RA 3I6MA 3PD0A 4GYKA 1TM2A 3AESB 4JIMA 1I30A 3UQZA 4DT1B 3GT4A 4ZJUA 1G2QA 3HRKA 4BIIA 4EHLA 3N2KB 5JCXA 3B3FA 3B9BA 1J09A 4S2EA 3ZVKA 1ZIYA 1G42A 2OHFA 1YJ8A 3GJ6A 4LHSA 5FR2A 3KB8A 2G4LA 3S44A 1X42A 2QD2A 3C3JA 2RHWA 4TL9A 4R0VA 1U7XA 2NQTA 2ABWA 4GPTA 3S2SA 1EWYA 1ZH0A 3BMOA 1SKYB 1F14A 4K0RA 3AKCA 4GWGA 3QEJA 2PY6A 1BXGA 1BJKA 2R1TA 3G8AA 4XR9A 3MSXA 5F2KA 4B8YA 5DM60 1AS0A 4KMSA 5DWVA 1PQPA 2GZSA 2QD3A 3BWEA 5DGTA 5H5JA 4PQFA 2JC3A 3SZUA 3ZZMA 5KNBH 1R16A 4K2HA 3WWZA 5JXGA 3FLBA 5KKNB 5KTRA 4MWOA 1JQEA 1BD4A 1L7EA 3QXHA 4AWBA 3TO5A 4MJ3A 4HNHA 1R4NA 4IDDA 2BEVA 2X3YA 1ZC3A 4AJ2A 4B3GA 3KXLA 3RFTA 2XUZA 3EAGA 1W5EA 3HMQA 5CITA 1AKYA 1XX6A 3G2QA 5CD9A 1MPXA 4UEQA 2DTDA 1VMAA 3WGKA 2YXNA 3ZR4B 5C1PA 1JDNA 4IKPA 3U4IA 3SMQA 2BOVA 4ENSA 4F91B 1BAPA 5JS8A 1N92A 2ZIAA 2QQFA 1TQ4A 4JC4A 1RJGA 1EIZA 3RS2A 3RU9A 3BXXA 4F97A 2Q3DA 3WBJA 4ND7A 3T1OA 1Q3HA 2WV9A 3C3BA 3S2UA 3ZCRA 1ZJ4A 2JGKA 1ZQ1A 3JD2A 1GUZA 5E6SA 4AF6A 4OHWA 1H0RA 2CFSA 4ENRA 4ZCPA 4U7FA 4K9DA 1KA9H 1GADO 2GX6A 3LX5A 3OM9A 1R12A 2Q46A 3QV1A 5EIBD 3WK8A 1TJ4A 3I2KA 1I7PA 2QP9X 2XTNA 4XE5A 1EDOA 4KBGA 4LRXA 4O6VA 4FS8A 3C43A 3LF1A 4RGBA 4LOLA 1IUOA 2WU8A 3TVYA 5FP0A 1A9QA 4EFMA 3WR5A 5JAPA 4QUAA 3L92A 1IH8A 3T8YA 4ASUD 4B40A 1SQ0A 1Z8DA 2NUBA 1NSYA 1NU6A 2XI4A 5CDSA 4BO8A 4Q9DA 4RV9A 1SCBA 4JFRA 2UYCA 3KZNA 3JQDA 4TLMB 1VHWA 3HP4A 3IAEA 1YE8A 4YO8A 3FSJX 1IY1A 1TEXA 1Z2AA 4M0MA 4DQVA 3SZRA 1YZYA 2XMRA 5CCXA 4F1WA 1IZ9A 5AI4A 4CMGA 3AYZB 4R84A 1V0JA 2XAAA 4W5OA 1PFWA 3GPLA 2R48A 4FDMA 2QMHA 3CR8A 5LZ7A 3WYGA 5ESXA 4RIGA 4B6GA 2ZJ8A 2HA4A 4Y8VA 3IAM1 3PGXA 3G0GA 5HIJA 3PWSA 5AVXA 5E38A 3W9SA 5K3OA 3BAZA 4HXYA 2QZJA 1KQGA 4FLEA 4BB6A 5JSYA 1NFQA 1R4NB 2JL1A 1U31A 3VZCA 1G20E 2JH9A 5D6OA 3BXFA 2QTWB 5I47A 4Z53A 3QI2A 1PNVA 4HWTA 4HB2A 5IABA 3EGWA 1NTOA 3EPLA 2FEWB 2VF8A 1QWSA 3OTWA 4G8JA 2GXAA 1AM4D 4S2UA 4K9LA 1AH2A 2AH5A 1XJQA 4X45A 2IOFA 1G3MA 1GV1A 2QTHA 4MP8A 4RZUA 2ZR7A 3ROQA 5FFNA 4LCEA 2LGJA 4ZWNA 3AVTA 3P2YA 3SPXA 1Y7TA 2QMZA 1RCTE 1SIWA 1XTVA 2V98A 1A82A 2HRZA 4X94A 2WJ4A 1B00A 2L17A 1K89A 3IVGA 2NXCA 4JP3A 1RIIA 1RPNA 2ZYUX 3V2IA 4YJHB 4A26A 2E37A 3LQ4A 3WMFA 3WLQA 1QX3A 2CN1A 4LE0A 2YJ5A 4UPVA 3W05A 4AUMA 2HHCA 3MAGA 2PUCA 1W36C 3OLZA 2BKEA 1ZLXA 1VCHA 1JR3A 2XBUA 4HMOA 1T9CA 4OUDB 2O0HA 4D42A 1N8SA 3GVHA 1M6VB 1YQWA 1PTJC 1OA0A 3D6HA 3H86A 1H2XA 4QOIA 3DW3X 2WA1A 4HNUA 2XJ9A 3BMNA 3FXAA 4L5YA 1KFBB 3SXPA 2X9NA 3JQFC 4E5VA 1N2EA 1WQ4A 1JTFA 4ZODA 1H69A 4F4IA 4HN2A 2QIOA 3MJRA 3PXEA 3Q98A 4A1OA 4NQRA 3RIMA 4BDSA 4QLBA 4QX6A 1D2NA 1NBIA 1Z4LA 2NWQA 1IY0A 3OSZA 3PA8A 4H3KB 4XOIA 5A3JA 5FUMA 4WY8A 4MR8A 5KTKA 1K4YA 5HTKA 5KQMA 4HQOA 3IB6A 2PGAA 3G9XA 4XKJA 1LDMA 1ILEA 1RLOA 4Q93A 3A6EA 3HFSA 3OKFA 3P96A 4OLFA 5TF4A 3LTNC 2VCHA 3ETHA 4RA6A 1UKVY 5AIAA 1B42A 4B48A 1J1ZA 2BFDB 2WG2A 3D6AA 3V7YA 5TGZA 4ZFNA 1BFUA 4PLZA 3GY0A 2PVSA 2V3CC 3QBEA 2OO7A 3I23A 3W9UA 1NW7A 2HHHB 2VRCD 4R3UC 2FF7A 3UMSA 1EWKA 1ZLYA 4D98A 2NZYA 1IN8A 1P6XA 3ZWYA 1F0PA 1EDEA 5BMVF 1Y6FA 3ACDA 1R9NA 2A0XA 1GYRA 2I2BA 2PMEA 3WTCA 4AKEA 4FEGA 5EMMA 2BY4A 4TV9F 1S3GA 4JHXA 1N9KA 4NBTA 3F7TA 1JEQB 2C9CA 2FSHA 2VA8A 3GT3A 3COPA 1QSGA 3OQPA 4NBVA 4FNMA 4DQUA 4XD7A 3HSSA 2ACWA 2QY6A 4PZDA 2DKNA 4H6PA 4JYCA 3PR2B 3PIRA 2ZB8A 3PWTA 4YIKA 5G2OA 1D0IA 3IDSA 4YLYA 1EUDA 2HHLA 4US0R 4RL6A 4PNZA 2YW9A 1FNCA 2HWUA 1B7GO 5ALKA 5ECGC 1IU9A 1XRRA 2F48A 3EAQA 3KL4A 1SBQA 2WTXA 1XTJA 5LQCA 3M4NA 1B1AA 2JHCA 4PZEA 1XLWA 3ZCSA 1CFJA 4L9WA 5IAKA 4EMTA 1NGSA 1NKTA 1DEKA 4IIUA 2CCJA 4IJKA 3ZJTA 5TGTA 4KL8S 1KMNA 2ZTLA 3I83A 4E5MA 3NNDA 4EVQA 2B1GA 3TLYA 7REQA 2EFYA 3L0BA 1C0EA 1VRCA 2H8GA 2ZR8A 4N0DA 4WXYB 4ARUA 1MGPA 2JZNA 4P4SA 3R3YA 3CF6R 4YK7A 1T25A 2YHAA 4F93B 1RXWA 2ZCVA 4JLBA 5F4ZA 3CZRA 1GXSA 1V9CA 3EOBI 4OHCA 2IL1A 3CA8A 3H4IA 2Z04A 4GZLA 3KWJA 1XVIA 2MMGA 3H1BA 4AICA 1DS6A 4TS1A 4MUXA 2GBLA 2XCRB 2IDZA 4YBZA 4KW7A 1W36B 1J8YF 3DMFA 3IBTA 2XXAB 3R9XA 5E2AA 2GT1A 3HKDB 3QW2A 4NZPA 3F97A 5FWYB 2XTAA 3DZHA 2IU0A 4OYRA 2V65A 3NU1A 1JEAA 3NHYA 2WAXA 3S29A 3TTXA 1CDDA 4KSBA 4C4OA 4YYZA 3U3ZA 2JI4A 4MR8B 2XMSA 1H9CA 4FKBA 4DOMA 1JH8A 1EGAA 5JCJA 3AM4A 2EGUA 4KXNA 4OB7A 2YJGA 1ZVVA 3KQSA 3ESQA 1OHHD 4B4VA 3RKRA 3C87A 1QFMA 3ISJA 1H2YA 4IFBA 4OXNA 1KO5A 3NBAA 4TPKA 3CRQA 3GROA 4H7KA 1FS4A 4YECA 8ABPA 5ILOA 2YIJA 4C01A 2Z5LA 2P40A 2C3PA 3PXAA 2OFOA 3VTFA 1HDZA 3NRBA 5DEIA 3OEWA 3HYTA 3OURA 5I7FA 3GFQA 2WZQA 3IAXA 3IRUA 1H0SA 4GOXA 3B70A 5AM4A 4ROTA 2W6OA 2XKKA 1KSFX 1JFRA 4AF8A 4WJKB 4HH3C 4B3CA 4ZVSA 5EHIA 4DG8A 1HZJA 3RJ9A 5JAUA 2JK1A 4M99A 3SZLA 3UPTA 2XB2A 1C14A 2XZTA 1EUDB 1Y82A 1T5HX 3VAYA 5BR4A 5TY0A 3JWPA 3QLEA 4Q4JA 3DE7X 4AX4A 2XQIA 4AN4A 5GIOE 1AURA 2VF2A 2WJPA 3V1NA 5JI2E 2OCGA 2DBRA 4IZ6A 5FWAA 3AZPA 5K6AA 2A9FA 3EIQA 3LVRE 1JVBA 3SDSA 2VHEA 4B4OA 3R41A 3F47A 1FYDA 4KXLA 4KN8A 3AO0B 1HURA 1ZK2A 2WHRA 2FW1A 2NXNA 3KAQA 3QITA 3GOHA 4KR0A 1IJKA 5KZMB 1PDVA 3QMVA 3HH8A 1MABA 3EDMA 2O5RA 3FKSD 3C6BA 2WIGA 3PUHA 2GAJA 3PTZA 1J9GA 3SFTA 5JSHA 4H1VA 5B4VA 4KWHA 4LRQA 3DCIA 3JY6A 3ZWXA 3QLVA 5CP8A 2A1TR 4ZARA 1BS2A 3OHSX 3KEQA 4RABA 5K0EA 1FRVA 1YBHA 3ZDZB 4UE2A 5K3DA 5KS2A 3LQFA 1JHOA 1ODIA 2W0SA 3AVOA 4N0PA 4NY1A 3SN6A 4G5YA 4PHGA 3EFOB 2O5CA 2HMTA 1C1YA 4Z8XA 2BW0A 1V8OA 1JYEA 1HE5A 4CMCA 3OOSA 4MTLA 5J58A 4Q1BA 4DV0B 3NHRA 4KV9A 3E15A 1JILA 2D4HA 4P92A 4N1AA 5HX7A 4HQKA 3O3CA 3EXFB 4QUBA 1P77A 1VBKA 2WTUA 1IZ8A 4RPHA 1N3BA 4LW8A 5C0OE 2A2ZA 3AHGA 1Q44A 1N5KA 4LBWA 3E3MA 1A4UA 4X65B 2D0PB 4W1PA 1WPRA 3C6YA 5EESA 2ODWA 4R16A 3H9UA 4TMZA 4Z1MD 1ORDA 3QK7A 1KH1A 3JVVA 2V59A 1O58A 2E1RA 5AUOB 1BC5A 3P9XA 4LN1A 4A36A 2HSDA 2MSDB 1H1DA 2EFCB 2OCYC 2XE6A 3Q3EA 2BUCA 4IZHA 2FZGA 5IG2A 2YZGA 4PBSA 1P9LA 3OA0A 1XMIA 3NBQA 4G0XA 1H2BA 1T5BA 5ITZB 3CR3C 2H0AA 1P5FA 1QONA 3VBCA 4ZCIA 2NUTB 4WN3A 5K6AC 5LJLA 2ZRDA 3H5AA 4Q3AA 1YCHA 3DQPA 4YR9A 1HQKA 1MPTA 3PEUA 1HE3A 3R8XA 1X6VA 4I4TB 3DDSA 1WSWA 2XLBA 2H4YA 4HD8A 2RHBA 3QXGA 1WUIS 4G2TA 3ADOA 1B1CA 4F3TA 2GBIA 3L3BA 1DGQA 1GR0A 4QPDA 4ZZ1A 1G60A 1N2BA 2XYPA 3QG5A 4ND8B 2AF3C 5K0BA 1VKJA 1MH9A 5HQTA 4JI7B 2R6HA 1I6LA 3BJZA 2HA5A 4C6TA 2O8FB 1PJBA 2O8EA 2X5XA 1NZFA 3MERA 1SXJA 2NUPA 1QF7A 4IFEA 4TM7A 5K6TA 4DY4A 5T64A 5DCYA 4QEKA 5TPWB 4J7XA 4G4SO 3PFNA 1EGVB 1Y8CA 5EL0A 1J24A 4W5RA 1UC4B 1KETA 2RIPA 2IW1A 3VKHA 5KYWB 1ETHA 3OJFA 1XC7A 1JR3D 3O75A 5A2QA 2WG1A 5DXFA 4KPEC 1WETA 5K8UA 3KQKA 5JMOA 1WO8A 3GMTA 4L4RA 1YZQA 2QI9F 5KCMA 5CJ2A 1PL7A 1ISPA 4Z3KA 1JFFB 2OLEA 4TWIA 4Y18A 3K09C 2BGMA 4KIGA 5K0CA 2NQ2C 5F7OA 5AW1A 4F86A 4BFXA 2QZ9A 1Q5PA 4X20A 4XGKA 3HPRA 1FP1D 4ZEVA 3IBYA 1Z0UA 3U44A 3ZGOA 1O7JA 1FVOA 3EGXB 4J6EA 1M1YA 3QX9A 2VP6A 5ALTA 3WB9A 4A0GA 3V4PB 4Q7EA 5I6DA 1V2GA 2AQIA 2W11A 2AIRA 1CNFA 4Z0HO 2JJ2D 4I6GA 1ZCZA 1KMHA 3BVPA 4LJ9A 1VBNA 3ZBQA 1GSOA 2A33A 1YSCA 4ZMBA 5HQ3B 1T4CA 2HJRA 3OP4A 4BECA 2FW0A 1E6WA 5BT8A 4V1CA 1Q22A 4KAAA 4PAMA 4UPDA 4DMRA 3P4YA 2HJWA 3PUJA 4W6QA 1ODSA 3ZEAA 5K8IA 5KYNA 4UTOA 4W5HA 1DJMA 1T9DA 3K0AA 1E1DA 1VL5A 3ABQB 5ITZA 3Q88A 1ZM4A 5J23A 1E2PA 1X1DA 4RJLA 1ZN7A 5THKA 2QQ0A 4JLUA 4L07A 1PEKE 2BEWB 2QS9A 4R9UC 4BKMA 2BGJA 3EF3A 4V0ME 3H84A 5C7LO 4I4TA 1N9ZA 4YUWA 5F2EA 3JATA 5K6RA 3B7WA 3RE1A 4AZTA 4OYHA 3A14A 4YHBA 4H6VA 3LPMA 1EAMA 1U6IA 2VQ6A 4JXZA 2PKXA 3I9JA 4ZZ2A 1MUUA 4PRYA 1BDBA 2BFEB 2PWYA 2QTCA 2C4TA 2ZVPX 4JBGA 2PEZA 3M5WA 4F8EA 4BEVA 5H59A 3BTOA 1CCWA 3EYAA 4K81B 2D5BA 1P4RA 1YB5A 3AGPA 3NLLA 4QUDA 1FZQA 3DPUA 5TMPA 4OK3A 4QEZA 3VYTB 8ATCA 3Q8KA 2UAGA 1MZVA 4JD5A 4LZAA 3ZU3A 1GPH1 2ZT6A 3UAGA 5LQUA 2C97A 3PSAA 1LPAB 4ITUA 2AFVA 4RKRA 5BUQA 4XM0A 1X1TA 2WYHA 2P77A 2FLVA 2OGTA 1DDGA 1LSUA 3FYCA 3LW8A 2YYZA 3M2TA 4K86A 3FLEA 4PHCA 4BO3A 4RIFA 5CGZA 3BGDA 1X13A 1TMYA 1XZKA 3DTVD 1NULA 1NYRA 3Q1KA 2JGRA 4G0ZA 4NBNA 2WLSA 4ZAYA 1SUPA 4J0CA 5D1NA 3STHA 3DTYA 4ZAGA 2ZPTX 1BQ4A 3EPPA 3A36A 2NO6A 2X15A 4IDPA 5DFAA 3NO4A 3TJRA 2O1WA 2GTIA 5IPFA 5CLLA 3IC5A 2AEFA 3G88A 4LPKA 1CR1A 3TOVA 2YYSA 5FOWA 4NJOA 4I4CA 4J9UE 1Q91A 3ICCA 1DFGA 4ZVLA 5ADHA 3CFYA 2H31A 2NM0A 3U2QA 4LDPA 1XEAA 1JVSA 5FI5A 1E7QA 2O3SA 2X6RA 3R7WB 4ZPJA 4DYHA 2Q1TA 4R3NA 3RUAA 4KLRA 1ISGA 5BSRA 3H04A 1QF9A 2M98A 1LDEA 4ARVA 4YAUA 1QQ5A 1AUPA 2J3IA 3GV0A 4YB8A 4C3VA 5BV7A 1BYIA 3A1FA 2AX4A 4DNOA 2FZKA 2OXIA 4DCGA 1V95A 3E0QA 3EC7A 5CDFE 1O2DA 5KHLB 4HDRB 1YE5A 2P1DA 4FZ3A 1EX6A 3EG5A 3PK0A 5G1PA 5KNBA 2O57A 5DGIA 5AOBA 3ZJUA 1RQ7A 3EIWA 2C77A 1HEUA 1EVZA 1QAOA 2OVBA 3UXYA 1S2DA 4CN9A 3OD1A 1M7GA 3FTPA 2CYBA 2Q4EA 1D0SA 5AM0A 1QPBA 1Z0AA 3IMGA 3A4LA 3CUSA 2CLDX 3JQ9C 3IP5A 1HX7A 2CUNA 4DXDA 2KB0A 3DEAA 4ER3A 3DZFA 5H7XA 1GCAA 1J5EB 1WE2A 3ESDA 1YB2A 1J8VA 3PFIA 4RSRA 2ODBA 3IEIA 1N5OX 5HKAA 5TEVA 2P6OA 2FQQA 4EJ2A 1H2RS 4PG7A 3F74A 3F6SA 3O0DA 1FDUA 4Z9BA 1U0GA 4IGFA 1EEHA 5DWQA 5HFJA 4ABYA 1XPOA 4EUNA 5E1MA 3RPEA 1DXOA 3I9NA 3PRYA 4LHXA 5FI0B 4GKJB 1I4OA 3ZQJA 3L7AA 3SNKA 2O2JA 2ZIGA 1M5RA 5JEDA 4EEXA 2YVKA 3WNVA 1FZTA 2JFPA 2LP4Y 3AUUA 2BEJA 2Z8XA 3B1WA 1P9OA 3DT6A 1MG0A 3R3ZA 3WDSA 4EQZA 2NSDA 2W6NA 2BFOA 5DH9A 4AP5A 1C8KA 2CE2X 1J9ZA 2O9JA 2W37A 3EYWA 4D02A 2DHQA 4EFDA 3D1LA 1VLLA 5IRCD 5J59A 1M0TA 4J43A 2C4MA 2DHDA 4KVAA 2CXXA 1DQPA 1SCUA 1UOOA 1YASA 2OKGA 4IH9A 1Q1QA 3I62A 2A9OA 1G98A 4DIDA 3TKLA 2LE0A 3H1FA 3W8RA 2OYSA 4EYGA 2ZRQA 2EKLA 3ZD7A 2H0RA 2R8BA 5DOVA 1F8XA 2IGTA 3AMVA 4Z7NB 2XE8A 3CRZA 3VJMA 3RS5A 1Z6QA 2EYQA 2W6ID 3K9GA 1PJZA 2GVDC 4LNUB 1Z0JA 2Q1XA 3GNSA 4FJ0A 1Q84A 4LOAA 5K45A 4P2BA 1OPRA 3W7BA 5J4LA 2I3BA 4WMLA 3T5AA 2ZUCA 4MX8A 1BXRA 3PF8A 2QSZA 4Q4LA 2ZCJA 1DC3A 3C1UA 3LNCA 4P4TA 5DYYA 3S28A 3DM5A 3NT5A 2PBLA 2C7VA 3RTEA 3AFHA 2I8LA 3EMKA 2AKEA 1TAUA 1P72A 5BT9A 1DEHA 1ESMA 1MQ9A 1SC3A 3RVJA 3QVSA 1SY7A 1GSIA 5AWFC 3SZGA 1DV1A 1M34B 4BVFA 3AVUA 4M1ZA 3GZJA 4QM6A 3K6RA 2VAPA 4DDMA 1MO4A 3ORRA 1E5XA 3E7DA 1TC2A 4PX9A 3WKDA 4GKKB 4BKPA 2ORWA 3ICWA 4D0GA 4FGZA 4Q7LA 4QG7A 3JQAB 1BCSB 1NN5A 2YFYA 2O0LA 2IODA 4H7EA 4JMLA 5GMOA 3WMWA 4CJXA 3K1JA 4NABA 4BO4A 2VDRB 1J8DA 3EG9B 3FWKA 4OQ4A 2PT7A 1XYYA 3KYDA 4YP1A 1YZNA 3TMYA 2ZUEA 4EJFA 1P75A 3RR2A 2HADA 4J7AA 3SYMA 1T5OA 1Q21A 2EXXA 4WN9A 4YQEA 1Q7EA 2XUHA 3P52A 5G0SA 4A92A 1SIOA 4FCCA 4BFSA 4YQYA 5BVGB 1GFIA 3F46A 3MTJA 1QGYA 4G4SP 5DO9A 5DHRA 2FQXA 4JUFA 4ZVNA 3RWMB 1KR2A 1BHO1 2J30A 1KAMA 3STXA 3IPYA 2X8LA 1XEFA 4CVNA 1L7VC 1IRIA 1E1MA 2X5NA 1KVSA 1S1MA 2A7QA 1P1IA 3KV1A 3VA7A 4R8KA 1X7YA 2QL9A 3I01A 3FGZA 1HQDA 1OB5A 3PCRB 5AI8A 1W75A 2QJTA 4KXFB 5CVUA 3QVLA 3IE2A 4FN5A 4ADSG 1ONSA 3TR6A 3ZZ0A 1P3JA 4R3WA 1J6UA 1ZD9A 2MMCA 1H2WA 2ZBUA 2OD7A 5JLAA 2QB5A 4NAVA 4EY8A 4IJUA 3KSBC 2V9CA 3NX4A 3HCWA 2E4XA 4R8RA 4GQAA 2DE0X 5COBA 3JQBC 2B4RO 4FGUA 3HA3A 4JR2A 5I9SA 3KQUA 1MJHA 2AI2A 1IL0A 4NZZA 4GZ3A 4BGDA 5FBLB 2JLBA 2QTVB 4M1WA 3H3XA 1BVRA 2GYUA 4U2DA 3ZE8A 4BO0A 4DLZA 1W94A 3UHOA 5JALA 1XP8A 2J33A 5DHTA 1TM7E 5F7ZA 2LKDA 1XZNA 1YZ3A 4MGHA 1C1HA 1ZGAA 4J2HA 2CNNA 4FHCA 2DETA 3L06A 4OL9A 2ZOSA 2X0DA 1CR0A 3MJ4A 4AMUA 4BBPA 3DV9A 1JI3A 3VX4A 2PAFA 1EVQA 3TLKA 4QELA 4UBLA 3TDMA 1J0EA 1O5TA 2Y9MB 3DDZX 4HNGA 4LTDA 2AG5A 1QIJA 2Z1MA 1VQ1A 3AR2A 1US8B 2JFBA 1FUKA 3PNKA 4K3UA 7AT1A 3K8OE 3QHAA 4FHZA 3H16A 4LRSB 4UOQA 2IWHA 2G72A 2G63A 1E9FA 1AKNA 2G9VA 1IHYA 2ZJOA 3EPRA 4BTLA 2VSNA 1QKKA 5IJ9B 2ZJ3A 1WSDA 4JC5A 3U9SA 3GA7A 5AW3A 4X7MA 4ZOLB 1RI1A 2OAQ1 1GU1A 2NU6A 2FMFA 4YAKA 2C04A 2J3KA 3NGXA 3HBNA 2VYVA 4KXMA 4UVGA 1FFSA 5EP3A 3PQ4A 1RBMA 1U7UA 5TEWA 4JI6B 3O26A 2OK7A 2CVPA 2PLAA 3BMCA 3JYQA 4NBUA 3ZW7A 1G19A 4XZ3A 1D1TA 1Y8QB 3WGJA 4TXLA 3FZEA 1KDTA 3FTNA 1Z68A 1ZI8A 2A88A 2PM8A 1U0OC 1AKMA 3KKZA 3MCZA 3MEQA 3G7UA 4C0LA 1IONA 4TVBA 4XEUA 1ZONA 2O54A 1FFCA 2EP7A 2CW5A 2FZ5A 2G67A 2X2FA 1UK6A 1Z0FA 1ZD2P 4BVLA 3TQCA 3I0ZA 1WULS 1CY1A 3QI7A 3BUSA 3QPCA 2HX1A 2X6TA 1PZFA 1MJNA 4RHYA 1QPGA 3WNQA 2OAGA 4H18A 3KS9A 3LPAA 4MLDA 5DPMA 4DW8A 4QARA 2BH2A 5EZ6B 1LW7A 4PICA 4Z6KA 5AXCA 2A59A 4G86A 5A5EA 2GB4A 2WE8A 1A5BB 1G2PA 3ZK8A 3IQIX 4GVLA 4QVGA 2X1LA 3PGA1 5FWXA 2E5WA 3L7MA 4TQAA 1RABA 1HETA 1VP3A 2GEBA 5AMXA 1N7JA 1XVTA 3L0SA 1YVUA 2AL7A 3AQ4A 4ARBA 1MB3A 4OBXA 2CDAA 4MKRA 3MQFA 3VHLB 3X1KA 4GC5A 2AYXA 1I6KA 3GPIA 2YCLA 3JQGA 4L1KA 3EVGA 4RFVA 1RI3A 4UZSA 2WJHA 3LT5A 3BICA 5DX0A 5KPJA 2XDQB 1JKJA 1XA0A 1YR9A 3C41J 3D2CA 3CMCO 3QM1A 4JJEA 4TZ0A 2BEUB 1Z5OA 2NSLA 4EKIA 2LRHA 2O0MA 1EQ2A 5G0UA 4JK3A 1LLDA 3HJRA 4TUYB 2OGWA 1YHZA 3EODA 4O1HA 4OFWA 5CVJA 2HMVA 4HX9A 3A1CA 3M9WA 4BFCA 3PICA 1P7PA 1ISMA 1PNTA 4HZGA 3E9NA 4XVQA 2G9QA 3OAAD 3A0UA 1G7SA 2E0IA 2V7TA 4NV3A 1ORIA 4QUJA 5BSWA 1Y9EA 5IJ9A 2NACA 3JR3A 5FIUA 4BN0A 3K3PA 1EIWA 2Q99A 2X3FA 3D9QX 2QUZA 3K30A 4H60A 4M2LA 5KCZA 3OMLA 4U8GA 4QXPA 2BC9A 1LJ8A 3WK7A 4A73A 2IVFA 2ZROA 1HNZB 1CQJB 2IYSA 5ICFA 1G55A 4BNIA 5IT4A 3GJ7A 1NXSA 1BE8A 2LUOA 4TL7A 5LBIA 4NCXA 3ZW8A 4B79A 3CZ5A 2VYCA 3UCFA 2YVLA 3EXEA 4U0JA 4TLCA 5L3QA 3R23A 4BMOB 2XUOA 2WHPA 1QYCA 1VDMA 2DMRA 3FHCB 3Q15C 3GWZA 2O4UX 2C92A 3FRHA 5EE9A 5LA6A 3FMGA 3JTEA 1ESEA 1Z4QA 1E3WA 1E4EB 1EGQA 2A4MA 2CNOA 1AA9A 3JALA 3M83A 3WLKX 1XXHA 2HK8A 3UAWA 3IPRA 5KWJA 5KTPA 3I2JA 4ZOQI 5IFKA 3LYLA 4KQGA 3VKFA 4OXQA 1Q2XA 4RJIA 2JGFA 3O74A 2EW8A 1CQIB 2QK4A 2X7XA 1E9EA 2XOXA 3GCZA 4OQFA 5ALLA 2PVPA 3U80A 1QX4A 1SB9A 4EYKA 5AVRA 1NC3A 1TQ2A 2R1TB 1XEWY 4GDMA 4RD3A 2QRKA 4MVJG 3MGKA 5C5IA 1Z4NA 2RH8A 3KG2A 4MLZA 4QHYA 1NP3A 2RGYA 4GR5A 3RG2A 1OPXA 1CC1S 3BHMA 4RZXA 2V4UA 4OXYA 1AG9A 4LC0A 1W7AA 2X8BA 5AJYA 3V4SA 1GCGA 2QLFA 3T99A 4ZT2A 3LBYA 5G4KB 2R25B 2ZT5A 3ZE6A 1HE4A 2ZE7A 3QNMA 4NOLA 4PX2A 5KOHA 4N6NA 1SKUA 1YGPA 4JVNA 5BQOA 1I6WA 4F96A 2IS2A 4PZLA 5KTOA 3WZLA 2UYGA 3AUKA 4LJYA 3ND7A 4M83A 5C8ZA 3AP2A 3SIXA 3B5JA 5C1OA 1N6KA 1SVOA 2ZTVA 2PNFA 4DANA 4YRNA 1RPTA 4GWLA 5L7TA 4FVTA 4ZYXA 4TX1A 1XJ0A 2Y6UA 3NWEA 1K8RA 4UPEA 4PAGA 5AVZA 4B4UA 4ON9A 2OBYA 3TFQA 2JHAA 5BN3B 2JCSA 1FQKA 2Y93A 3ER8A 2N42A 3WFIA 4NU5A 2OP1A 4PHTA 1OW3B 4AQ7A 2D1QA 1DPGA 3ID6C 3DO5A 3WGOA 1YZKA 3ISTA 3C1OA 4FD3A 2BF4A 1ULSA 1ZD5A 1LK7A 1KXZA 3DOFA 3GRYA 1UJ4A 1I7NA 4U6QA 3AR7A 1AF7A 1U3WA 3ETLA 3WSVA 1DRVA 1DRJA 2XEDA 4MSUA 2D74A 1K3FA 1XRPA 3BL8A 4CTNA 3ZWCA 3D2BA 2CD7A 5DNUA 1HG0A 3A31A 1EXDA 3SHWA 1N25A 1XTIA 2RD2A 3U13A 3LDGA 3T94A 4UTRA 3N05A 3LSYA 1KFJB 4BVGA 4B33A 4EX6A 3DDHA 3K1ZA 5AICA 1NW6A 2X2EA 1DWQA 3PCXA 3TNJA 3BM5A 4AJ9A 3WL7A 5L3SB 3JQ9A 1UM8A 1CIPA 1TU0A 2Z6UA 3H83A 2IWRA 3KR0A 4G4IA 4TYPA 3FTDA 3QF4B 1DWOA 3WYBA 5CM2Z 4NQZA 1KZHA 2BYTA 4ND5A 5HKLA 2WMDA 2X5OA 5ALYA 3UJDA 3V3TA 3I39X 1C0KA 4ZV4A 4NCBA 1VI2A 5L40A 3TCKA 3DR5A 5DMHA 3FTCA 1M7HA 4DLUA 4HYTA 4H4CA 3I09A 1T9KA 4MCIA 5G0VA 3MTDA 3ANXA 4JNCA 4DLAA 2DPXA 1JIJA 1ODKA 1P2VA 3W9YA 1APBA 1AZLA 4HL6A 3LPNA 3HSKA 2A3NA 3E2MA 1R0CA 4FMDF 5F5NA 1GT91 3NEPX 2ZYRA 3B53X 2DYKA 2DF8A 6AT1A 3PGLA 3KPWA 3RSSA 1LSJA 1E2FA 4ZO9A 3DGEC 4HFNA 5K0SA 1H1TA 2P0AA 5BV2P 2XH8A 1GNRA 1KO7A 2W2QA 5JAHA 3QYAA 5KQLA 5BUSA 2O2DA 1SVKA 3ZGVA 2KHZA 2Z5GA 5DM1A 5LB2A 3VSDA 3GFVA 4ZO8A 3A1WA 4MR7B 4N12A 4LC1A 5EVJA 3T3IA 2FSFA 3N3AC 3NTLA 3GD7A 1RRMA 3L1HA 4H35A 4K9OA 4R2JA 4TSRA 5HFAA 5LDGA 4BZZA 1OGYA 2W2OA 2WFMA 2GJ9A 2A9PA 3W1VA 2OBMA 5FO0A 5B2EA 3RG8A 4NK4A 1N8TA 2XITA 1DAFA 4JEHA 3WHPA 1TLFA 1MJGA 2MWMA 3GX1A 4GICA 3DZIA 5JS2A 3MWDA 4TMTA 3CVWA 2HXSA 2VTBB 2J5KA 4U9UA 3KJIA 1M2FA 2RKBA 1YS4A 4FB5A 1NVXQ 1JB9A 3DZBA 5SYMA 3DH0A 3HI6A 4WACA 1I3MA 1U2RA 3CEJA 5JE8A 2AG0A 2YV5A 3U37A 5JECA 1JKIA 1B26A 3ESYA 3WI7A 1FTGA 3PL1A 3VJRA 3OUZA 4QNNA 2YRFA 1Q95A 2R3SA 1KORA 3WWYA 2HI0A 3EFHA 5IM4A 4MRMB 1NASA 4UVHA 1Z39A 3E1SA 3ZLUA 4MUKA 4LRTB 3S5UA 4QICA 1QYDA 4EG4A 2H65A 1IUNA 2KWIA 3RU3A 4QASA 2IYFA 5A0TA 1CXZA 1EFHA 5K9ZA 1VA5A 5H0IA 3AUAA 4EO4A 3ZVNA 3AKEA 3ES9A 1X38A 2W4MA 3KYIB 3I9KA 4OOFA 3I05A 3W34A 4C89A 3LIIA 3WGMA 3DOCA 4D3ZA 4EG1A 2E21A 4ZMSA 3CT4A 1FMCA 5A4DA 3WGNA 2C7GA 1LV8A 1HDXA 3MMXA 5MGNA 1H8EA 4TRMA 1RR6A 3CUWA 3AI7A 4FNOA 4JVMA 3WJ1A 1D2GA 4DQKA 5ICEA 3HVRA 3H05A 2RFLA 1M8GA 2PIDA 1CUSA 4IZOA 3JASB 4TMKA 4D81A 1I10A 2LIVA 5DXJA 2HPAA 2C2OA 4FSXA 4UCFA 1OF1A 3V9AA 1U11A 4YT8A 4WOKA 4LISA 1T3SA 1S9DA 4RGYA 3ROXA 4PBTA 2C9MA 1NLFA 1QORA 2DBYA 3OQBA 2C3MA 1TVMA 1ZK4A 4PYOA 3B3JA 4OM7A 1HWYA 2A9RA 4RY8A 5FPPA 4MR7A 4XEHA 5JDCC 1A5TA 2N75A 3T9AA 5C8VA 1DIHA 1SELA 2AYYA 4YRDA 1D03A 1G3RA 4CIWA 3KFXA 4GG1A 3O93A 2C2YA 3GPBA 1JQDA 4WJZA 1UMBB 4F9FA 2H1OA 3TD9A 5CLIA 3OCVA 1DBQA 1XQWA 2VQSA 3KQPA 3MOSA 1KVQA 1SCDA 4PC2A 4RKQA 4WQMA 3UWSA 3USZA 5I9BA 4NESA 3IBFA 1BFDA 2VDOB 3UWDA 3RV4A 5E8JA 4HR7A 3OZEA 3GCGA 4D26A 4DUYB 4KR3A 3LVQE 2PCLA 5ER9A 4PEVA 1SEVA 4QBTA 3UA3A 1W6RA 5K8LA 2WDZA 1I14A 3QE3A 1E6MA 5JVDB 5SY4A 3TW8A 3ZJYA 1CB0A 3OWOA 5HR5A 2I4OA 4TKMA 4XVRA 4S05A 3RTCA 2GI4A 5C4MA 1P61B 5T4FA 2QJRA 1YWGO 1N8NA 2R8ZA 3OCXA 4N7BA 4XFKA 3U7RA 4QBKA 5JPDA 1NUTA 5DLDA 1UOPA 2OUKA 1QNFA 3MW8A 4NS4A 3SR0A 4ALMA 4C29A 2BFMA 2J59A 2P2CA 4PQYA 4RK1A 2P1RA 5ALUA 5FUXA 3O21A 3WGIA 3JYHA 2ZDGA 1Z0SA 4GMFA 9MHTA 2Z0MA 3A25A 3LBAA 4EB6B 5KYYB 4NEGA 3GJRA 3U3DA 4EW3A 2EBUA 1U0TA 4TKVA 4JEMA 1QDLB 1WP4A 2VWQA 1PK9A 4V0QA 4CRWB 4E94A 3MS2A 3GAZA 1XTQA 4MTCA 1KP2A 1L4UA 2Z08A 5EP2A 4KB5A 1DCFA 4R1PA 3OTGA 3GMSA 2AA3A 1S8FA 3NNNA 2WI8A 4P7BA 2O23A 4UZFA 3WL4A 4FFNA 4RULA 4H0FA 1GRRA 1XKTA 3FCAA 4LHVA 4W5WA 1P1KA 2XW6A 1OV4A 3LLVA 2PV7A 4YEDA 3D3KA 2I2FA 4NZNA 3QY0A 821PA 1FOEB 2OV8A 1YT5A 2SKCA 4G37A 2JFZA 2LR0A 2Z30A 4QDJA 3WLJA 5AK6A 1Z4PX 5IS2A 2DECA 2QXYA 3JAWA 2JGNA 3QOYA 5AI6A 3AI3A 3P2IA 4WH0A 2MSKA 1IG0A 4DV7B 3OFKA 1TQHA 2J4DA 3INGA 3H42B 4KJXA 3UH0A 4I9NA 1CUCA 4URWR 4GBJA 4F45A 3C3CA 4Y2RA 4XWOA 4DIUA 4EA7A 2EDAA 1DIAA 1JZSA 2JGAA 2PZJA 5IBPA 5EPEA 3LLCA 1VPVA 3JZMA 5M29A 2ZPUA 2QYTA 1H2HA 3L4BA 4GMHA 4W99A 2X5JO 2NU9B 1KPHA 4RCYA 3CIOA 4JROA 4P4UA 5DYTA 1U8UA 2X0KA 1F2UA 1JIQA 3B9QA 4NMWA 1GPYA 2ZUDA 3DDWA 4MKGA 4FB4A 3C6QA 4E5YA 3SJUA 5J3JA 1THMA 4U7HA 1QTQA 2HYDA 1P29A 1ZOLA 3X1JA 3ZHCA 3CLSD 3KU1A 2GKGA 4BNKA 2O06A 3B48A 4D80A 1YB4A 4KGVA 3HTXA 1SIUA 3KD3A 3TW8B 3H2SA 3QUTA 1D7OA 1BMDA 1QUFA 1N5LA 4CM9D 4KO4S 5TJHA 2UVPA 4W6ZA 1BKYA 1OC4A 2JDIA 1DAHA 5IBCA 3BEDA 1F5SA 1SO8A 1DRWA 3G5LA 1GYPA 3MF4A 3DZDA 3R5SA 3E35A 4MLPA 4Q7KA 4XJSA 3OO0A 3EXFA 1ICIA 3BL6A 2G0AA 2VCEA 3LKBA 2ZB7A 4P6VF 1PJRA 3LKVA 1JLRA 1KP3A 2GESA 3RRFA 4Q24A 4YJDA 2GEFA 5K05A 4FHDA 4TKVB 5KSZA 3C15C 2PH1A 1W19A 1VMKA 3FWNA 3RVQA 1D5CA 5KJFA 2A1UA 5ESWA 3QENA 5IZCC 1WB4A 3ODGA 3D7NA 1N5IA 1BMTA 2B37A 2B4QA 3B9RA 3MJFA 2CXTA 5FTMA 1KJIA 4D3SA 2XBLA 1SBYA 2BEVB 2HD4A 1LWOA 4Z51A 1QVAA 1DTEA 1U2ZA 3A04A 4DIOA 2OO5C 4Z1OA 1G8HA 4AIIA 2R8OA 1CIVA 1KS9A 2WHYA 4PGAA 4QREA 3VDQA 1EI9A 1UP6A 4C4XA 5B58C 1OBOA 1Y1RA 2A94A 3HWSA 2J9RA 2HIHA 2OM2A 3BXEA 3LQ1A 2A8YA 1S2OA 3PUVA 3R0ZA 4IWXA 2NU7A 2JCYA 2QR5A 2E87A 3KZKA 1HBJA 3HBJA 4LEIA 1UQUA 1BX1A 2AN3A 4NOJA 1WPGA 3DPSA 5C1IA 4QATA 4BO5A 1LI4A 4BEBA 3U7QB 2C9BA 2EFHB 2VHJA 3KR1A 4HH0A 1QHNA 2I1WA 2W2PA 4P7JA 4B9AA 1DAMA 3H13A 4BVAA 3EQ7A 1QGUA 2GAOA 4MUEA 4DF3A 1UKAA 1ECPA 1HRKA 1O57A 2ZS8A 3EZFA 3DW1X 2FKNA 1V8PA 1WU7A 3LRXA 3MIIA 5ENZA 1AF4A 1UFKA 5EXDA 1IVSA 4BKOA 1XMXA 2B36A 4IYJA 5DGXA 4AJEA 5KNDD 1UK9A 4P7GA 3GLUA 1IN5A 2IPMA 4C4SA 2HRDA 1L2TA 1T0IA 2FWAA 3FIUA 4K5QA 5FTWA 4DGQA 2BFFB 4KI0A 5LP6C 4W7SA 3SJ7A 4IJ5A 1AK9A 4R2LA 4EUFA 4ZIRA 1VKNA 4KREA 1RADA 2JFQA 3G2HA 4HGRA 1G9TA 4MUAA 4TRRA 2BHRA 2XX3A 4F2PA 1R6DA 4ARIA 2GJAA