1T9GS

Structure of the human mcad:etf complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
228
structure length
228
Chain Sequence
LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, electron transport
molecule keywords Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial
publication title Extensive domain motion and electron transfer in the human electron transferring flavoprotein-medium chain Acyl-CoA dehydrogenase complex
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2004-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1t9gS00
1M8FA 3LE8A 1QQTA 3ZUGA 1JIIA 2J08A 2ZP1A 1KP2A 1X6VA 4YP6A 3FG9A 2A88A 5TS2A 1JEEA 3IUEA 1EFVB 1K4KA 5K0TA 2AG6A 2X1MA 2X3FA 4MW0A 2CV0A 1KAMA 1NUTA 1O95D 1TYDE 3KFLA 4YP5A 2WQ7A 3UC5A 4NX2A 4GRIA 2XRZA 3JXEA 3GLVA 4CDMA 4NAHA 4ZCSA 5KWVA 3COYA 5TEWA 5F23A 3H9BA 1H1TA 4ND6A 1ZJWA 3CLSD 1XNJA 2QTMA 4Q93A 1RQGA 3ELBA 5DASA 1JIJA 1R6TA 4WSOA 3IH5A 1O6BA 5KHAA 4FZJA 4U63A 2WSIA 1DNPA 3P0JA 1J1ZA 3CLUC 1EUYA 3HGMA 1IRXA 3TZEA 4F3RA 4AS1A 1NYLA 2WQ6A 2DPLA 4NZPA 4MULA 2Z3VA 1KKUA 1KAQA 2O5RA 1I6LA 1JIKA 2PZ8A 3ZGZA 4MW5A 3FNRA 1VBKA 2RD2A 2EL7A 4ZT6A 1QRTA 2JANA 3SEQA 1MB9A 1Q11A 1NUQA 4I6JA 5H7XA 3N9IA 1SURA 2YY5A 3A04A 1P7PA 2CYBA 4U8HA 1ZUNA 4YBRA 1PFWA 2V0CA 4MUHA 3FETA 4MVXA 4QREA 3CVYA 1G59A 1H3NA 1JGTA 3P0IA 5H16A 4QRDA 1NUPA 5DK4A 3M5WA 1MOPA 3COZA 2VXOA 4K03A 1JECA 1WOYA 2YXNA 4NDAA 3U1VA 4E1AA 1WY5A 2EJCA 1OWPA 1F4LA 3SEZA 1GLNA 2IJGX 2TS1A 3IMGA 1IHOA 2BYTA 1VL2A 2J4DA 3AIIA 2A1UA 3AKZA 3F3MA 1OWLA 1VLHA 3HFJA 3E27A 3KT8A 1JZSA 3P52A 4S1OA 5EKDA 2OV4A 4NATA 1NUSA 3TZLA 1GN8A 1YUNA 4HPWA 4YP7A 1KORA 2AZXA 1LI7A 1I6KA 3A2KA 1U7DA 1XNHA 3IVXA 4DDHA 2RE8A 2R5WA 3K9WA 3KT6A 4HJRA 3QE4A 3D6VA 1EFVA 3H05A 2X1LA 3ZJUA 2A86A 1YI8A 4HK4A 2C5SA 1LW7A 1OWNA 1H3EA 1YULA 4G5YA 4MVYA 3A05A 4F4HA 5AHWA 1IQRA 2JA2A 4MW9A 1M8PA 2GKSA 3CR8A 4I6EA 2Z09A 1WXEA 4GU5A 4XFDA 1A8HA 1U3CA 2ZUFA 3DV2A 1N3LA 1O94D 1OBHA 4ZT4A 3CVXA 3ILVA 1N2HA 4OJMX 1M1ZA 3ND7A 4CT0A 2PFSA 2HZ7A 2I1LA 1O96A 3FIUA 4ARIA 1CT9A 4PBTA 1VBNA 3RK0A 1NI5A 4EGAA 1T9GR 1TYAE 4G5FA 3K32A 3ZXSA 3SZGA 1PFYA 1JHDA 2A4MA 3VU8A 2A7XA 3ND6A 1N2IA 1PFUA 3OTWA 1QJCA 2GOYA 1XNGA 1J09A 1K97A 1M83A 2O8VA 4EFKA 1ZH6A 1N2JA 4OUDB 1O95C 3ZXIA 1G8HA 1N2BA 3ND5A 1F9AA 4KPUA 1B6TA 4MWDA 1JILA 3SDBA 2AKEA 1WZ2A 1GZUA 3CLTD 3DO8A 4RUKA 3CLSC 1MBZA 3L92A 3MLBA 4DDMA 3PNYA 4UZEA 3X1JA 3VRHA 4MUJA 1BS2A 1YIAA 3CLTC 1R6UA 3IVCA 1QU3A 1O96B 1NZJA 2G36A 4MVWA 4AQ7A 1X8XA 3TQIA 5J5AA 3IUBA 1N78A 1TEZA 2A1TR 1KH3A 3P0HA 3UMVA 3UK2A 1MJHA 1T9GS 2VTBA 1IQ0A 1GTRA 5JBNA 1N75A 3IODA 2DETA 4EG7A 2GM3A 2D54A 2YWBA 4RPIA 5TGTA 1GPMA 3X1MA 3G5AA 5K0SA 4DDKA 2BTEA 1PG2A 1EUQA 3VGJA 1IFXA 4ZT5A 1T6XA 4MUEA 3RBAA 1D2RA 2PXHA 4EG3A 2J5BA 3INNA 3MUEA 2A84A 1WXFA 2Z08A 2NZ2A 4KPUB 3Q4GA 4Q16A 1OWOA 3AG6A 4DLPA 3CLRD 3PNBA 1H3FA 1G8FA 1PG0A 1O5TA 4NAUA 4ZCRA 2DXIA 2H2AA 4ZT3A 3FI0A 3SYTA 3PRHA 3OP1A 4MQ6A 4MUGA 1N2OA 1KQNA 1J70A 5HUHA 2CV2A 1O97D 4MUFA 4R0NA 3HL4A 3FY4A 1JMVA 3ZIUA 4MW4A 1O97C 3AFHA 3NV7A 4TS1A 1J1UA 2DEUA 4KKVA 2A1TS 2VTBB 1N2EA 4R2MA 1J20A 2IELA 3N8HA 4OUDA 4U7JA 4CDNA 1KH2A 3HMQA 4PBRA 4MUNA 1O0BA 1WJGA 2JAXA 1GAXA 1V47A 2NSYA 4MW7A 1OBCA 2E0IA 3FWKA 2DUMA 3RJZA 1NSYA 1K4MA 1KQPA 1UFVA 1IQUA 3NBKA 3GUZA 1GTSA 1O94C 3Q12A 2YWCA 3ZJVA 1I6MA 2E18A 3IMCA 1O0CA 5LFAA 1NURA 4DE5A 1F7VA 5HUJA 4ZCTA 1VBMA 1EFPB 2D13A 2QUHA 3A4IA 3GMIA 5TEVA 1QNFA 1S4MA 3H99A 4WNYA 4L2IB 3UOWA 1MRZA 3ZJTA 5FNZA 4BWVA 2QTNA 4A91A 2CT8A 1N77A 4JXZA 4MWEA 2CUZA 3CVUA 4DNXA 3COVA 1KH1A 2E89A 1M8KA 3FOCA 4DJAA 2IP1A 4JFAA 1QU2A 3IDFA 4EG5A 1COZA 4ND7A 4J75A 1IVSA 3FDXA 4MW2A 3FH0A 4I6GA 3KT3A 1WQ4A 3G6KA 1MAUA 1WKBA 3MLAA 2HGZA 2D5BA 1YIDA 1OD6A 1ZH0A 4PY2A 4EG6A 5LLTA 1F7UA 4MUKA 2OQ2A 3HZRA 3IOCA 3RK1A 1Q77A 1K92A 4HJXA 3SP1A 3UY4A 1FYDA 3G59A 4QBTA 5IHXA 4MAFA 3MMXA 3AL0C 4P2BA 4KR9A 1EXDA 3IMEA 1Y42X 3PXUA 3X1KA 2CSXA 4EF6A 4R2LA 3CLUD 2H29A 1WXIA 4MWCA 3AG5A 5LM3A 2QJTA 3QTTA 2DLCX 2CYCA 2QJFA 5IJXA 3H9CA 1J21A 5KCMA 3C8ZA 2PZBA 1EJ2A 1NUUA 2E21A 2PG3A 3PNVA 1N2GA 1G8GA 3CA8A 3LOQA 3N2YA 1WQ3A 3IOBA 3QTBA 3L93A 1M8GA 1ULHA 2QUKA 4CQNA 4EG8A 2CYAA 1MB2A 1M8JA 5J58A 4H3SA 1N1DA 3D6UA 1HYBA 3RFFA 1V8FA 3CVWA 2WB2A 1EE1A 3Q10A 3CLRC 1JZQA 1Q19A 2J09A 4ZT7A 4ARCA 1QTQA 3H97A 1EFPA 1YUMA 1PFVA 1I2DA 4KR6A 4JYZA 4MUIA 3FHJA 4L2IA 3COWA 1R6XA 2CFOA 2PZAA 1U3DA 1TFUA 2QUIA 2XRYA 1ILEA 4ZT2A 2X0KA 3TNJA 3TQOA 4XSVA 5DB4A 3DLAA 4JXXA 4PBSA 4G6ZA 4YMIA 4ZCQA 5FO1A 1KQOA 3IVGA 1WXGA 5J59A 3RHSA 3SZ3A 1KR2A 5FO0A 3KT0A 1WXHA 2QJOA 4EG4A 2ZUEA 3DPIA 2QTRA 1Q15A 2QUJA 1TYCA 2B7LA 1NP7A 2DR2A 5DEOA 1TYBE 1QRSA 1T6YA 2V0GA 3ISJA 4MWBA 5HG0A 3TS1A 1LI5A 1IH8A 1U7XA 4K0RA 4X0EA 3HV0A 4EG1A 3NBAA 4MLPA 3BL5A 1OWMA 4KR7A 4JZYA 3IOEA 2J07A 4ZCPA 2DERA 3N05A 4MW6A 5BNZA 1T6ZA 3I05A 3S3TA 4J76A 4XFJA 2PIDA 1KP3A 4MVCA 2A1UB 1TQ8A 1MAWA 1XJQA 2CV1A 1FFYA 1MC1A 3CVVA 2HMAA 3MXTA 3LCJA 1QRUA 1U0BB 4MW1A 4UZFA 1JEDA
chains in the Genus database with same CATH superfamily
3JQDA 4RZXA 1RKXA 4KE7A 1H2BA 5BQFA 1DBVO 1JIIA 3KUUA 3TD6A 3UJ8A 1X6VA 1N2XA 2GTIA 1O95A 3QYAA 5ES4B 2BSAA 1S02A 4X5OA 2PUBA 4OHRA 4L22A 3FG9A 4DGSA 2Y4NA 1MJFA 4UNPA 1U8FO 4B2PA 2JIPA 1EFVB 2C00A 2QMUA 2QPLA 1NDQA 1NV8A 2P9GA 2YNMD 1CS0A 2P2LA 3B2NA 4MR9A 5ALLA 3KFLA 4Q1DA 1CY8A 3L04A 1SVMA 5AIAA 3S40A 1WMEA 2H1CA 2CXPA 2F8TA 1VC2A 2XDQB 4NOMA 3NKVA 1QANA 5BRAA 2QP4A 4AKGA 4QPJC 3CNNA 3JVIA 4B2IA 3FZGA 4PYLA 3FGZA 2C4HA 5DNCA 1H1TA 3WHIA 4HS4A 2J3JA 5AR1A 1WV0A 3ELBA 1CY4A 2CXOA 3HVIA 2WF8A 5DM4A 1U7OA 4L6IA 4IJMA 1BEEA 4L4UA 1UJBA 1AGXA 3I9NA 1JSCA 4W4TA 3ZWOA 2ADOA 2P4UA 4QBGB 1NXSA 2QZ9A 3EMVA 1OT5A 3MTAA 1Z6QA 3IO3A 3AFMA 4OKIA 3ZGVA 1J06A 2W98A 1ML3A 1T5BA 2FOIA 3OCZA 3BL6A 4D96A 3VA7A 5FBWB 3N7TA 1GRRA 3M3DA 3OU6A 2XA2A 3NXKA 3RUHA 5BRNA 4ZYLA 2OHHA 3C1AA 3D8NA 1JTVA 1ULTA 3AETA 4P2GA 1ZH8A 3FGOA 1I4DD 2VG8A 3DZ8A 4QNRA 4BLOA 3KKEA 2VRCD 4MKXA 4EB0A 3T1VA 1LK5A 2X4GA 2VJBA 1CIVA 1SOVA 2XQJA 3CZ9A 1I0LA 4OL0A 2O05A 3WLFA 5EIBD 4NPCA 1T34A 1VIDA 2G5PA 4LCJA 4UXJA 3BSFA 4L8GA 5CD1A 4WY8A 3U09A 3I62A 3JYNA 5E1OA 1N8KA 1LDNA 1RVDA 2CLMB 2QRQA 3KOWA 4BO8A 3T35A 3WLOA 2J9RA 5GWXA 1WSBA 4X1KA 1ZSVA 4TLDA 2MMGA 2AIRA 3M2PA 4R9SA 1BQEA 1KP9A 1HZJA 2VZLA 2QAGA 2QEQA 3BD6A 1CDDA 3L7CA 2H2WA 4EGQA 3AO0B 2EJCA 1XLUA 1E2DA 3SEZA 3TM5A 1IHOA 3SOPA 5B4VA 2E5LB 1E1CB 1VL2A 2GK4A 4TMFA 5A4FS 2OBNA 1OX4A 4OGKA 3RYCB 1RXUA 1A77A 1PVOA 4TKUB 4NATA 5J2TF 4X64B 5EHQA 1FL9A 4WDRA 4DLXA 4KPGA 4DCPA 2YDYA 3FKQA 4BFXA 4F5ZA 3PPWA 1LY1A 4BWYA 4UREA 3TG8A 1YIOA 2FSUA 4MQFB 5FHRA 5F4BA 2VDMB 4YALA 2F8MA 5JD5A 1E0KA 1MC5A 5K8TA 4ZPJA 5DP2A 1BU8A 2HXSA 3CTMA 1IPEA 3JYLA 5I7WA 3M7IA 4GPAA 3QLJA 1VPTA 1MQ9A 3NYRA 2H18A 4LCEA 2OQRA 4YJHA 1ID8A 1AO0A 3HVKA 1MEEA 1YZGA 3RVMA 4EENA 2WVAA 2ZB3A 5FD8A 5HZHA 3PVZA 1OWNA 2YR0A 5K3EA 4GPTA 5M7EA 4LNUB 4XM2A 3GB9A 3E5RA 5HGXA 3OE7D 3PIIA 2L2QA 2NV2B 2YCLA 3WGGA 2WFMA 1I7QB 3FPJA 3H2KA 4MKHA 4MW9A 5JNWA 4OBBA 4FFLA 3HLYA 1Y3AA 4QSMA 5K03A 3ZTTA 1FTQA 1A8HA 3HUFA 3DE2X 3AUYA 1WCYA 2NLOA 4D5EA 3C8UA 2IL1A 3W5DA 4OB8A 1KARA 3U61B 3UJ6A 2J45A 4P08A 4LTNA 2YWHA 3O9ZA 2RI0A 4BO5A 3DOEA 2O3SA 1YQ9A 4WK2B 1TE2A 2X13A 4M6WB 1YR1A 3C97A 1L8AA 1JPNA 4W5NA 2BDUA 3Q5GA 1V8OA 1ZC3A 2FKAA 2ZSHA 3H0EA 4L0CA 2ZI3A 4EF5A 1XI2A 2VXCA 5KC8A 2O1WA 3KBBA 1FXWF 2C96A 5JAZA 5CPFA 1U80A 4UEKA 1ODIA 1PQ4A 3DEHA 1JQ3A 2ZIEA 4KI7A 3EJ6A 1W5EA 3U5TA 3L8MA 4NABA 5HS6A 4GNKA 5DOZA 1DRWA 4IIFA 4H7PA 4ZAGA 7YASA 4EX7A 1U4NA 4K9DA 1EFLA 2H85A 2VPQA 1UT5A 1G2QA 1KOFA 1LV8A 2FPWA 2J3KA 1UDWA 2ZB7A 4NENB 4ETMA 5GADl 4D3YA 1GUBA 1K6XA 8LDHA 2PXXA 2XCOA 3SQLA 3EF0A 1A5TA 1M83A 3QBDA 3MGAA 3OCJA 1R6BX 4RF5A 3JQ6A 5A06A 5JZSA 5F51A 4HYQA 3R0ZA 2V5UA 1NMZA 2NXCA 2QSJA 1ZYUA 3E9ZA 3GPIA 3CBGA 2A1IA 5CA0F 2HBZA 4YUAA 1DE0A 1G7CA 1P72A 1YTLA 2BUCA 5EZYF 4N76A 1KHHA 5L7YA 3KU4A 4JJEA 4C1NA 3NTLA 1ZK2A 1XZ8A 1ZBQA 3PEVA 2FAXA 4AX4A 2H0AA 2D06A 4QTTB 3TDMA 4F8EA 4J3FA 2QQGA 3W34A 4CKWB 2A57A 4UTVA 4W63A 2QZ4A 3ZVNA 2V9ZA 3LNCA 3ESZA 3D7KA 3HKDA 3L6UA 3MCWA 3PYMA 4G0ZA 2ZVJA 7ABPA 1R4ZA 2CNWD 3KJIA 4E5MA 1T8TA 1TLLA 2EXXA 2OGSA 3HYSA 2YWXA 5E1BA 3WL8A 4A0RA 1EP2B 1ZVMA 4Q7EA 3ZHBA 3LBYA 2ZBQA 3SHFA 1Z5GA 2A1TR 2N46A 4MI1A 2IXGA 2LW7A 3D3EA 3PQ3A 5HK9A 3DBLA 3JWJA 2RGGA 5TQVA 4PVCA 1L6RA 2P2GA 5EJAA 1Q0TA 1T8WA 4GP7A 1MRSA 4JH0A 1E2HA 3PRKE 5ALUA 5ICMA 2Q0XA 2RGYA 2ZYGA 5DULA 2AFVA 1KU6A 4W6ZA 3VPCA 2BUAA 2GMWA 1QCYA 1GPMA 1XLTA 2WJAA 4EPVA 3VAZA 2DUNA 3U0VA 3HJCA 1Q12A 3OJEA 4P4NA 3HUUA 3WA7A 3K5HA 4LJ9A 4Q15A 3D7SA 3LWNA 3OA0A 1Z07A 4PPGA 4Q9NA 4BKQA 2C9ZA 4YECA 2EJTA 3ESBA 1KFCB 5C3UA 1P0MA 4OQQA 3KQMA 3WSVA 4O2LA 2QZJA 4P7BA 4F9FA 1HF3A 5JECA 4ENUA 2PUAA 2FZ5A 4KPUB 4R1QA 3GJZA 1GPAA 3HYNA 4DLNA 4QQFA 3R7AA 1G4HA 5EVCA 1G63A 3VPGA 1HG0A 3BWYA 3R4CA 4O2AA 5DF1A 1EP3B 4V39A 4V03A 2Z8YA 5J4KA 2HPZA 2K7FA 3RH0A 1HT1E 3JTEA 2I7DA 2VNJA 3VR6D 2DU8A 3T3MB 1PQWA 5FBLB 3FFTA 2HWKA 1V5WA 3ZWVA 2JFXA 5A2GA 3QBTA 2ZI6A 2P5UA 4MLDA 1YK0A 3PX7A 5FPPA 4P9NA 2Q8QA 4BNXA 1PZGA 3ZY4A 3JQ7B 4KV7A 2PX0A 3IBYA 3Q98A 4XYBA 3UAOA 2QRPA 5KOHA 2XHZA 2PE5A 3BH6A 3ZXYA 4ALMA 3HN2A 3VR2A 5M5BA 4POAA 1A7JA 1P2VA 2XYGA 3PNSA 2XUKA 4X1YB 4FW8A 4KQMA 1JKIA 3VSAA 5EXEA 1L5YA 1SU7A 3R9IA 1PJBA 2OXEA 2Y27A 4P8RA 4DY4A 1FSPA 2KX7A 4MUNA 4QXOA 5LQKA 1M1YE 2BFBA 3GCZA 5H3LA 4TMYA 5AOCA 5IZ4A 4HWRA 3AUFA 4NYIR 2YY6A 2WB4A 3OO1A 3E53A 4QWWA 5DN9A 1GAEO 1RE1A 2HXYA 3SLKA 4AF7A 4EHBA 2X58A 5DO9A 4QVGA 3IQGX 3BM5A 3NT4A 3AF6A 1XB2A 2Q8NA 2ZDQA 3AW8A 2GESA 2J48A 5AM5A 3I1YA 2ODPA 2ZUTA 4KJXA 4DVJA 3BXGA 5JVDA 1K5DA 1ZGZA 2Q3FA 2V6FA 4NE7A 3OLXA 4G84A 2C95A 3FOFC 3EHEA 3G9XA 3B7WA 3G7UA 4ZHSA 4OA8A 3FBWA 4KE9A 4EFNA 2NU6B 3H5WA 1AZWA 2C2HA 4F1KA 1XZIA 5K99A 1ECLA 3DFKA 2A0WA 5C80A 4OLAA 1L5SA 1QHNA 5ALYA 5P8WA 4HDQB 4M1EA 1QNFA 3GJSA 2VJMB 4WNYA 5K8IA 5K6RA 3FVQA 4QOFA 2DBQA 4RLQA 2NX2A 1MRZA 1TCAA 2CJPA 3QPBA 3T9CA 4TRRA 4D74A 1NN1A 1QVRA 1N0UA 3NFRA 3NUZA 2Q4TA 3I5XA 1W4RA 1OGYA 2CT8A 4MWEA 2CUZA 1QRAA 4BL5A 2JHPA 4XWOA 1TQDA 3D8SA 5EUMA 2ZJ8A 3F3SA 3GH1A 5G53C 1Y7IA 3CN9A 1J42A 2JIRA 1VL1A 2ZB4A 4JFAA 4C4RA 2WVHA 4GRAA 5IH7A 5HBGA 1YDEA 2AE1A 5GZ6A 2RIRA 4JLNA 3W2EA 3SSMA 5F9HA 2YV4A 3EFBA 3PUZA 2YMPA 1GGFA 2XYRA 1KBOA 4KZKA 2O5CA 1Z5OA 2AOXA 4EYOA 5E0KB 2VPPA 4PY2A 3ILYA 4F1JA 5JMWA 1SN7A 1WHTA 1W2HA 3OLZA 4XPZA 4DG8A 1UJNA 4TYPA 5K05A 1IAVA 1ZNWA 1K4YA 3ZOKA 3BMOA 1CVRA 5CX1A 2XUFA 3IMKA 4MGYR 3X0DA 2V8OA 4OLFA 2ZRHA 4OX9B 3FYUC 1JBQA 4CIWA 2FSIA 2H2FA 4L8YA 3SR3A 1CK4A 3TZBA 1Z36A 3OEHA 4I7EA 2X23A 3KALA 2VDVE 2OYRA 3F96A 3WLJA 4ZKDA 5BXYA 5HHTA 1NYQA 2WVJA 3NHPA 4JDUA 2QTBA 3HBMA 4LHYA 4DL9A 1XROA 3H19A 4YDRA 1EXDA 3CB4A 2AXPA 2WYWA 1Q20A 1DUIA 2FPGB 1TUEA 5KTRA 5CM8B 1Z4PX 2G71A 4PSDA 3ROFA 4HEA1 5H8WA 3AX6A 3CR7A 3WKEA 4BTEA 3RVDA 1PG5A 5E0OA 3R5JA 1LPAB 5FBHA 1AKEA 3BRSA 5E7JA 1E32A 2E21A 1XDWA 2I1WA 2ZSEA 3NRCA 3HCOA 4JOBA 4RKEA 4TSFD 2GCEA 3PL1A 1CJKC 3C6QA 3F49S 2ZREA 3I4CA 2GPSA 3KSMA 3LW8A 4KO8A 5TQ2A 3U60B 3GNQA 1RBMA 4K28A 5HRCA 3AEKB 1XEXB 2I6XA 2DPMA 3MCAA 4IOLA 1NYTA 3U1TA 4C04A 1YBAA 1ULHA 1II8B 3HB4X 3PHGA 1BCRA 4HUQA 2QTHA 5DT9A 2WIJA 1E5VA 2X2PA 2XGMA 3G5TA 3PQ4A 4IF4A 1Q2UA 2CYAA 2JCYA 1HE3A 2PQ2A 1CEXA 3C1UA 1ZH4A 1YB4A 2OV2A 3FMFA 2X42A 3HBNA 1EX9A 1N1DA 2XQFA 2Y4OA 3DAHA 1GNLA 4RAOA 3UJAA 1E98A 1W30A 3P4UA 3V1YA 1YOVB 1T9KA 2H5JA 4BQQA 4MKFA 5K3AA 2PH5A 3QP9A 4IXTA 3EDOA 3R9XA 2VJPA 4AKHA 4HAWA 5SYMA 1E6CA 3AONB 4YRLA 1JB9A 4ZT7A 2Y1XA 1SCDA 1Q0HA 4LJKA 2RH4A 2QNIA 1KDVA 4TT3A 3OD5A 2JI6A 3OM0A 1M7BA 3N2KA 4MV6A 4WL0A 2ZJFA 1J2EA 1X38A 4OHFA 1KY4A 2WZBA 3M6VA 4R8SA 1JEYB 4P4GA 4IKEA 1WCV1 3BICA 2QIOA 3JY6A 4J29A 4Y1EA 4EGFA 2GBLC 1XCGB 2GILA 2FX3A 4I50A 3VKUA 3AR2A 3M89A 2O8EB 1FQOA 2Z9CA 3QM1A 1NMQA 4EP1A 4CCAA 1TZBA 1WQ1R 4JGGA 2O0MA 4JOCA 3GLFA 1UADA 1YBFA 3OQVA 4OCZA 5AXCA 1L7PA 5KPDA 1UBNA 1Y37A 2PMDA 4Z86A 4CMIB 1I2MA 4EY5A 4KYIB 2K6GA 3HXOA 4DIDA 4MRAA 4DYVA 1PJCA 3HCAA 3R24A 1TYCA 3GMTA 1V5IA 1IJFA 2CJXA 3N0XA 1TLTA 4PGAA 1TIKA 4FHFA 3RS4A 4R0MA 1UXOA 1N1EA 2DR2A 1F0YA 3QXGA 2RGNA 1C2YA 1UQTA 3Q7RA 1R0SA 2ZKLA 1ZGGA 5HG0A 2NM0A 1DJPA 3BIFA 4G8JA 2NPFA 3TK1A 4ZOCA 1QGDA 4CT5A 1Q91A 4CKCB 2DUWA 4B3SB 2V97A 1UJ6A 1ETHA 2DQYA 3CE9A 2WAOA 4HGOA 1KXZA 4X0EA 4WACA 1FVHA 1NVBA 4F45A 1VOTA 3KB2A 4OB6A 2B99A 3D31A 4K3UA 3BL5A 2WFLA 2OPBA 3QLTA 4U6QA 3AIKA 2F62A 3HA3A 3OLWA 3EEBA 3FMGA 2NZ8A 3PDUA 1EIWA 1T6ZA 2XMGA 4BZZA 1J9ZA 2HSJA 5CVVA 2PIDA 3W2FA 4XVRA 1JQAA 1TQ8A 4QUDA 5CJJA 2CDCA 4ZAYA 5JWHA 5JAPA 1UKAA 1BA2A 3K0BA 4RL6A 5DYGA 5AKKA 2O2YA 4L6CA 3GDWA 1IG0A 4ADSG 4B84A 1IOVA 2EZUA 4Y1RA 3DEAA 4MI6A 3WYEA 2JFPA 2ZPUA 4A8PA 2JKYA 5LQDA 2QR5A 1JEDA 3O74A 3QEMA 4OFBA 2ZI7A 1V6AA 3ORRA 5AK3A 4IUCS 1YL5A 3C2QA 4GQAA 1M6WA 4H16A 4I2VA 5CA0A 3EXFB 1C0EA 1C3VA 2NU7A 1Q7BA 2XKKA 1V7QA 2LDXA 1L8LA 2D5CA 5FJJA 2VWGA 1XEWY 1KRXA 4RLHA 1VI2A 1FDWA 1VRWA 3IV7A 3KKLA 3PQ6A 4G0NA 3P0FA 3ADOA 1UDCA 3CPJB 5FPKA 1XFAA 3IKJA 1MO3A 4OYRA 5DNDA 3GLVA 2IYPA 4B8ZA 4IOKA 2AFHE 1ZGHA 3EXHB 3G0DA 1QR6A 4ZQCB 5TEWA 2CFTA 4X6LA 1ZSYA 1UBJS 1H2RS 3SX2A 1NBOA 1UKCA 1ZKDA 2XMRA 3A9WA 4JZKA 4MYDA 3SSOA 3T52A 4CFSA 4EX6A 2W8BA 4L16A 4ZAXA 3VPSA 2QU7A 4LRYA 3SAJA 5HPYB 5TMPA 1D4OA 1Z6PA 4A2CA 1LKZA 2NZWA 4PPNA 1TX4B 1XL1A 1DNPA 4ENQA 2VK2A 2F90A 4G41A 4UCQA 5BNFA 4PCUA 3SHVA 2ARKA 5F64A 4B5KA 3MN1A 4IHJB 3UICA 5I7FA 2BKLA 4L5YA 1IK4A 3O4RA 3TZEA 2VBIA 1E6UA 3P94A 4PFQA 2PEYA 2XB9A 2PA3A 4HR7A 5JJIA 4NBVA 2NAPA 1COWA 4XFKA 2Q3CA 1UBCA 2C84A 3D7MA 3NH9A 4N65A 2PX6A 1GFSA 1O8CA 3CUKA 2IGTA 4AY5A 4YX9A 4TGLA 1SKYB 2QD3A 2FE1A 1FYVA 2Z2XA 2X7XA 3A3KA 3H5NA 3AJ8A 1Q11A 1NUQA 1YS1X 4L50A 4GZ3A 3H1TA 1WOMA 1JDBC 2CZGA 5H7XA 2Q62A 4DBLE 4QZVA 1H8HA 5F9FA 4IH1A 3WFJA 4V24A 3I58A 1G3RA 4YBRA 3SHWA 2OG1A 3LYUA 2Z1DA 2Z5GA 5JYEA 1H2HA 1FVOA 2V0CA 1QTNA 1X1DA 3EMBA 1IRIA 1EB9A 3I4LA 2XWQA 4XRRA 4ZRDA 1RZRA 1RWOA 2Y1LA 3EQ6A 5DW3A 4J3NA 3D1JA 1IMJA 3Q7PA 2WJGA 4MR7B 1ZU4A 2PRSA 3M5WA 2O3UA 4TMTA 4C2BA 5JNUA 2Q6LA 1XTIA 3JYQA 4KN6A 2WWRA 2WY2D 1N9GB 2Z6QA 4N39A 3HKEA 5F98A 3A1VA 1ZVKA 1YCHA 2NO0A 4EBBA 4IGIA 3F3MA 1N6RA 3OPXA 3E27A 5LXTF 2QKYA 1JEQA 2RHWA 1NIPA 3CO0S 3P4XA 4IHQA 2HLDA 5EKDA 4D8WA 1OJ7A 1G5QA 4EI9A 4ENTA 3H2ZA 2BY4A 4UVEA 3IDQA 2VT7A 3WO1A 1RJEA 2UYOA 1PL0A 1YS6A 4PXAA 1VI5A 5B55A 2V98A 1T15A 3DBHB 1R88A 3MTIA 5G0WA 3EGIA 3TAUA 4GC9A 5AKIA 4YCSA 3CISA 3QE4A 2QZSA 3CH5A 5I7UA 1K5PA 4URVR 1QH8B 2ISQA 3JAKA 1SUEA 3BGSA 2VYND 3MGGA 4DWOA 4C2UA 3HHPA 5ALRA 4PF1A 4HK4A 3E35A 4PPQA 4D1YA 3ETLA 4M76B 2O2ZA 5IT4A 5DNYB 1IPHA 2ZJ3A 4AFNA 5DTQA 1JQBA 1PJRA 5LDHA 5EN4A 1G5HA 1YULA 4QJ5A 4C2AA 4X66B 2R62A 1PS8A 1OXTA 6ADHA 1VRVA 2YWGA 1AQNA 3AWDA 1M8PA 5LU8A 4OLHA 2FN7A 3TF5A 3OCYA 1IVYA 5GOTA 1I2CA 4JLKA 5IFLA 2QB5A 1XF9A 1DX9A 2FZEA 2HRCA 3OP4A 3QIVA 3ZU2A 5KYWB 2PSFA 2IS4A 1TVMA 1BVHA 3G5LA 1ONBA 1IHDA 3OZRA 5J63A 2IIVA 4IX1A 3OFSA 3EIXA 3DC7A 2NP6A 2HN9A 1N9KA 4YXWD 1HQYE 4ARIA 3OZTA 3WYGA 4BMPB 4A1OA 2UVQA 5FYDA 1Z28A 3G2MA 3A06A 4IOMA 2COKA 1MLDA 4BMNA 1TT5B 1XZMA 1R2QA 4KWEA 4X20A 4JLSA 5HKKD 3S2EA 2CLOB 2I22A 1FW6A 4D25A 5GZ1A 2H2DA 3ZWKA 2ZDGA 4B44A 3SIWA 1N57A 3RS2A 4V1CI 2Y1DA 5G41A 2IWRA 3EW9A 5CLQA 3DTTA 4XOUA 5BNWA 4OJKA 2EZ9A 2FHPA 5TQ0B 2OILA 2WF5A 2H4WA 3QZUA 2ASEA 2W48A 4M89A 3UGJA 3TQQA 1L1RA 3NHFA 1RYFA 4BTLA 1Z0ZA 2H5IA 3KQKA 9ATCA 5EIFA 1HDEA 3B2QA 5FH9A 3NHJA 4OUDB 1QLWA 1W6RA 2NQ2C 4U2FA 3V1NA 3DHEA 3GAMA 4KITB 3A6EA 3BEOA 1CFZA 3DDSA 3HR8A 4HDCA 2HF7A 2QUAA 1WLSA 1X74A 5IM4A 3QEJA 2XV1A 3W04A 1JSZA 4DUPA 3VJLA 3QMWA 3CLSC 4ZVKA 1R16A 4WA7A 4G0VA 2ZU0C 3FSGD 2D7CA 4OQXA 1AUXA 2BCGY 4JUAA 3ZY2A 1VCIA 2KMLA 4PAOA 3K8QA 1QHXA 1JFFB 3MBOA 4HGQA 3WL5A 1G8PA 2X9QA 3H1PA 3T5TA 1PK8A 4HKTA 4JJ6A 2GJKA 2D4HA 2DF8A 1XZHA 1NW8A 3QFTA 4WERA 4PW0A 3B9PA 1YZFA 4IZOA 4YJ3A 1XDZA 2FKNA 3LCUA 2C82A 4KRXA 1MHTA 1VMDA 2FK7A 4R16A 3ZTWA 1STOA 4BDTA 3UK2A 1ZCBA 1E9VA 4DRXB 3SE7A 1KDPA 3OEWA 4B82A 2HU2A 2QTVB 4OQNA 3QYFA 4XTCS 4FI3C 2GDJA 4IG9A 3PR3A 1HZZC 1PJ3A 4NL4H 4WIAA 4FYHA 4GF5A 5J23A 2OAEA 1L5QA 4L5AA 5A9RA 4BMVA 1JKJA 1NI3A 1D2RA 2ZIVB 2DT8A 4EG3A 4XUCA 4PO3X 1JR6A 1N33B 4NYMQ 4YMVA 4G5XA 1NVVQ 3LHIA 2AQHA 2QLBA 4H15A 4Q16A 2NG1A 2BBTA 1ONPA 3B38A 5FI1B 3AG6A 4HLNA 3SFZA 4BX3A 4F3CA 4J43A 4ZV4A 1CRPA 2D7JA 1PG0A 3OT5A 3K1TA 1CUYA 2P5TB 1I4TD 2ZT7A 3IKVA 2YJ5A 4I5DA 1OI3A 2FZVA 2I2DA 4GMDA 4LY3A 4NJOA 4ENVA 2GJSA 1F3OA 1UM8A 4ARBA 1ZESA 3WWCA 1G20E 1LS6A 2QGZA 3ZUPA 1EFRA 2Q07A 3ROPA 1XYVA 1DQRA 3KHSA 1GEEA 2BH2A 4IIJB 4LJ6A 3T99A 4J0FA 4ETIA 2NMVA 4C4OA 3ZHUA 3K70B 1VIMA 2I8LA 3FYTA 3PP8A 2BIFA 4Q4JA 2NPOA 2NZVG 3SQNA 2AMFA 1M2OA 3AFHA 2IA5A 2OHVA 3C24A 1A4UA 2CC2A 1UFRA 3U49A 3S27A 2ZKIA 4LDNA 3I0ZA 4LXIA 3UXHA 2I54A 1NOJA 2D2XA 4Z8XA 5HJEA 5I01A 4EDFA 1X8LA 1R27A 3HZZA 1TAUA 2IELA 4WJLA 1XN1A 4X1IB 1U0OC 2W4QA 1JG6A 2ESRA 4DNPA 3NYQA 3ZHXA 4IP0A 3KQNA 1F1BA 1W59A 4RQBA 3NWBA 4LC1A 4DUGD 1GAXA 1PVDA 5AJUA 5BRJA 1XG5A 3FXAA 4RZIA 2G04A 3NAMA 3HVHA 4AAYA 3I42A 3R75A 4KNWA 4N18A 3QBJA 4LQLA 2NO6A 3G7NA 3HLTA 3K35A 2ZSJA 2A9PA 4Q1AA 1JR2A 3EJWA 1DINA 2HWUA 3DBOB 4HDNA 1FUIA 1GLVA 1DIHA 2P41A 2WYVA 3GLHB 1XRQA 3GRYA 1NC3A 4YAJA 5EP1A 2OP0A 5FBRB 1KO5A 5LPNA 3FM9A 1YKFA 1DQSA 3ZQUA 2XZLA 4F92B 1VRCA 5EL0A 1F7VA 5CMLA 4U3JA 5ELMA 4A15A 4DJDC 1BRTA 2NQ8A 2PH1A 4MARA 3HGTA 4G36A 2WTEA 5TEVA 3D7RA 4JJIA 1S4MA 1FFHA 4ZAVA 3JD3A 3K30A 3D3JA 3A36A 3K09C 1B41A 3KX2A 2IXBA 1W88B 3NOQA 2V1UA 1Z6ZA 2IYXA 3GT0A 5IZCA 4KBYA 3UN1A 3W7AA 3LDAA 1U8YA 3EXEA 4KXNA 4MR8A 1M73E 4BZQA 1HO3A 1F8YA 1DUSA 4TVSA 2EDCA 4TZKA 4ZZIA 1XQ1A 4M7WA 1QDEA 3X1YA 3QW2A 2EBUA 1VPWA 1C1DA 4AJ2A 4BLQA 5D84A 4WNCA 5JD6A 2IYQA 3L1VA 3K71B 1C0KA 1S2NA 1VSBA 1IVSA 1UAAA 2ZYWX 4K6KA 1R50A 4GS5A 3UB2A 2SCUB 3NEAA 1YI0A 4AT1A 3B36A 2HGZA 1LA2A 3FROA 1WTCA 1HRDA 1QRRA 3A1EA 3E1SA 3E5MA 3I30X 3N07A 2J4FA 4UCWA 1DMRA 3HZRA 1IDOA 1FPQA 4LHVA 4TV9B 1SUFA 5EJ5A 5IRCD 4MK4A 4CL0A 4BE7B 1XKLA 3M1AA 1DOHA 4JT4A 2P9EA 3HC7A 1GDDA 2I0FA 3EXIA 3QMPA 4PYOA 5FOUA 5AWFC 2VQFB 3NOVA 4HF7A 1G5FA 4BUJA 3P2MA 1L5FA 1PHPA 2ZAMA 3HCCA 2F67A 1I24A 2V9CA 4YUVA 2F00A 5AXAA 3AHJA 5TR9A 2G67A 4G0XA 2XUHA 2Y76A 1RQ7A 2HCJB 2OBYA 5KDOA 1G8AA 1NFFA 3LFTA 1AQYA 5HW0A 2NXJA 3FBTA 5KVQA 1SCQA 5TMEA 2Q1XA 4EF6A 1WX1A 3VKGA 4UZSA 1YVUA 1UXIA 4F3YA 3HJUA 3PUKA 4M9XA 3HB0A 2WMYA 2FFRA 2WJVA 1QCZA 3GR6A 3L01A 3QFRA 2R5NA 4XYEA 2DKNA 3UMFA 4C4TA 1TQHA 4EAAA 1G291 3AKCA 1VLMA 4TLEA 2HT6A 1DC7A 2QTLA 2H00A 2R60A 2QN3A 1ODTC 3B9RA 4E32A 1T5HX 1RKBA 3KJFA 5F12A 4D4KA 1I7DA 2C2KA 1C0PA 4DCMA 1F4PA 5FUXA 5TXGA 4YXFA 5EJEA 2XRZA 3NR2A 3TJRA 3WGIA 2UUBB 2C7BA 4HD8A 5TIIA 2QW8A 4UEWA 1Y4ZA 2YICA 3LUHA 3BMXA 3LT0A 3OZUA 1OYVA 5HIIA 1ORTA 2QRVA 1L5ZA 1PYDA 2H4YA 1FSSA 2VHCA 2W2PA 1TYZA 4QXQA 5I9LA 1BHQ1 3C6MA 4PICA 1POXA 3OVMA 1SBCA 1CLUA 2WB2A 3NDBB 3L8GA 2UZ4A 3I2YX 3LLSA 3J81A 1ZOPA 2XE4A 2NTVA 1A98A 1VG8A 2Z57A 3CMMA 2PZJA 2I2AA 1UXJA 4YNBA 2RHCA 2CSUA 1EWKA 3MJVA 5FIUA 1KYWA 1QGYA 3OZ7A 4CM9D 4QFMA 4L2IA 4J0KA 1XTZA 1B43A 3F0TA 2XQIA 2YJGA 3HCNA 3LCVB 3ZY3A 4D8YA 1JHZA 4PTZA 4DLRA 1FBTA 4XW2A 1GGKA 2VTKA 1AKQA 1O89A 4J7UA 1LF5A 5CH5A 3T54A 2X0KA 1PT5A 1WNTA 3LGAA 4MS4A 4WCDA 3TNJA 5DB4A 2A4KA 3DLAA 5CLHA 1PV4A 3IB3A 4JT2A 2FSHA 3Q9NA 2OOKA 3H9QA 5J59A 4OSOA 1L1EA 4J6EA 4KQ1A 3TQRA 1NE7A 3JD4A 1ZK0A 3I45A 2ECFA 4NMMA 1CZKA 1USKA 2BEKA 2DCUA 1TVEA 2CMDA 1UP4A 2HA7A 3WV5A 2EKPA 4G1EB 4MHTA 1N25A 3JWIA 4TTJA 5LUAA 2V4UA 3EDRA 4KXVA 1ZGJA 4EUKA 1YV9A 2XXBA 3RC3A 1V71A 3BCUA 3QHAA 5B37A 1FFSA 1IONA 1V7PC 5L51A 1UPTA 4QOSA 2GN1A 1KSGA 5T5QA 1IXKA 4G67A 3ISJA 2ZJ4A 4XB6B 3RYFB 1KVSA 4FZ5A 4BRSA 3AR5A 2X3YA 6NULA 3AZQA 3DMFA 2IOYA 3OQIB 1QHYA 4CIVA 1IBLB 2D4AA 1EAMA 1NUAA 1Q0QA 3QU2A 4H7JA 5F2EA 1N2CB 3BDVA 5IEJA 2ZT8A 1E1MA 2WJHA 2CVZA 2R3SA 1V37A 4MWOA 4MQBA 5A9SA 3CRVA 1EMDA 3DZFA 1TT7A 4UM7A 1U0LA 4X94A 4RPCA 3CCFA 3C3CA 3DQZA 1FU4A 4FPXA 4PZ9A 1QHHA 4LOKA 3GG9A 3L0BA 1WP4A 3S3TA 3FTFA 2XVMA 1KP3A 1JFVA 3K5PA 4K7JA 4NV0A 4BNYA 4Z7NB 3HXMA 8MHTA 5D8DA 3GFRA 2BD0A 3L43A 3IV6A 4TS3A 3G0HA 1YQTA 4ZQIA 1MC1A 3CVVA 3B1VA 2RGCA 1PJSA 2H2HA 1OI7A 3L8ZA 5CDTA 2HK9A 2P5SA 1USGA 2Y0BA 1K9VF 5EXSA 3AUUA 1HFEL 1NJ2A 2PCJA 2GBIA 3BCHA 2G0TA 2QF7A 4DLBA 4UAVA 4DAEA 1HNWB 2JFVA 2R86A 1FK8A 1BX0A 1QQTA 1KTIA 5F7OA 3P2OA 4BLWA 4OV6B 3T5BA 4BX9A 3GZJA 4KLRA 3LTEA 4P53A 3RROA 4F1WA 4HN2A 3TM4A 2JFZA 3I01A 3PHIA 2XQKA 2R8OA 3W5BA 3C3XA 1E6EA 4HH1A 2GBFA 2UZIR 3KJNA 4FSHA 2QRLA 3MXOA 5K0JA 1GGVA 3ZQJA 4IDAA 4FWTA 3G2PA 3E4CA 1KETA 3PDWA 1IHYA 1HURA 3VISA 5FA6A 4AS2A 1FSFA 1GGEA 1YR6A 4ND6A 2QDKA 5JE8A 2DHDA 3KB6A 4YRKA 1YB2A 5CBPA 5M2QA 5CCXA 2VHZA 5DSTA 1PGNA 2EFYA 3DVLA 3O47A 3TSOA 1TECE 2PH7A 5ALQA 1JJAA 1N4AA 1LK0A 5IASA 4AJJA 4I1YA 1QOQB 4INJA 1HTTA 1N6HA 4FZJA 4TSFA 2ERXA 4U63A 5FI3A 4BS9A 5L7TA 4AJKA 3A4LA 2Q1SA 5FBQB 4BBZA 3GP3A 2BEWB 4I14A 1CLEA 1MMFB 3FX2A 3H13A 3NU1A 4C0WA 3IHLA 1N3BA 4QYXA 4B7AA 2W2LD 1FYEA 3WRWA 2F2TA 5ITWA 1V8ZA 1G8SA 3ABQB 3RJMA 3CN7A 1V35A 2YVKA 4PQYA 4N0DA 2DE0X 2EWMA 1RWWA 2HHAA 4IIDA 2RGUA 3ABIA 3VV3A 3G0GA 1G98A 3C41J 1ZGCA 4IS3A 5IC4A 3N9IA 1UZAA 3W5HA 4B6OA 4U0KA 4JT8A 2XD4A 3W8FA 1NAIA 1G5IA 1QVAA 1WDWB 1ZRSA 1PT7A 1JSRA 3E4DA 2XF8A 3K6RA 3N2IA 3QFHA 4IXWA 3TR0A 1FFXA 1PZNA 2IXFA 3WP1B 1K6IA 1ZCFA 2D1TA 5KYGA 2UVPA 2RGDA 3C7TA 3PGLA 1Z0JA 1Z17A 1OXVA 1T9HA 2HA3A 3V00A 4US2R 1HNNA 2AI1A 2YV5A 3MJTA 2QV7A 4F9GA 4LMBA 4BKOA 4U8GA 3EA0A 3KAPA 3RUDA 3BIOA 1UBEA 3USZA 4Q3LA 2H7VA 1GLNA 2IP4A 3BULA 3FCYA 3UO8B 3AU8A 4IIXA 4M0DA 3UMJA 2R6R1 1NN3A 2C0PA 3N6VA 3PQ5A 3KAJA 4P1ZA 4B6QA 5ILOA 2OZLA 3N6XA 5EJ8A 2W6JA 2JEOA 2R1ZA 5B3KA 4KO1S 1GUFA 2H1VA 2G1UA 5D3KA 1W0JA 4S1OA 2XIQA 3QEKA 1U3VA 5A4KA 4K2AA 7GPBA 5CFZA 2OCBA 3P20A 4IO0A 2ZYAA 1ORHA 2WINI 3BC1A 5K3DA 1A96A 2G0AA 2XT6A 4P7FA 3A2KA 1NF3A 5EUCA 3V4PB 2AF3C 1B1CA 1XRPA 4UE3S 1YOBA 3K20A 2H0QA 2WIFA 3HU3A 4E94A 5LJIA 2HIHA 4TL9A 2JIZA 1YA4A 5AMXA 1EFVA 1MH1A 2FW0A 1QIMA 2I4RA 2YYAA 3CEAA 4CEHA 4I5GA 4CEJB 3VNVA 1P6QA 3LQKA 4MA0A 3SIPA 1E3WB 1TJPB 1Z13A 2VP2A 3MFQA 3VKVA 2YKGA 1Q50A 2PZMA 2QORA 3F7NA 2PCLA 2ADMA 4PX2A 3D4BA 1M9NA 1EQAA 3K0EA 3ZCPA 4Z1MD 4HDRB 4R7ZA 3VU9A 7REQB 2OGZA 2Q3HA 4WFIA 1XWIA 1FJHA 1YONA 4RS4A 1QFYA 2YUIA 1W7AA 4DEXA 5B30A 2OM2A 5DOVA 3SF8B 5FEMA 721PA 4OXQA 5IXSA 1J2TA 1EK5A 3AR4A 3FPKA 1TC1A 5CEJA 2VKQA 2AHRA 4TN1A 1GNSA 3LRTA 3GNLA 4A2WA 1V3TA 1FMJA 3SXUB 2VP6A 1Z8HA 2X2EA 2BHSA 3KK0A 2VF4X 4DWJA 3FRJA 3P8ZA 5TX7A 4PTYA 1CUFA 3QG1A 2QGNA 4EJ6A 2QD1A 4D8VA 3MMNA 3OCUA 5FPTA 4JIMA 3G8BA 4CIDA 3ETHA 1XTKA 4X7MA 1FUEA 1PTJA 3K0AB 2WTXA 5IFKA 3FWHA 4YASA 5F3RA 1C9JA 3KXDA 3LWZA 2EKQA 3MWFA 4EGAA 5C51B 4O59O 5T8KC 4XXHA 4ZPXA 2FFQA 3HY6A 3QOWA 3TNFA 2B4AA 1Y1PA 1FZQA 3DMGA 4UHKA 4ZYTA 4ZJUA 3IQWA 3RFUA 5FI5A 2F3QA 5BSMA 5ARBA 1OGJA 2W2TA 1N0WA 3HVUA 3L79A 4OUKX 1NW9B 5H70A 2C4KA 2B35A 5KCZA 1YFKA 4OBEA 4WXHA 4EZEA 2XMZA 1HT3A 3T0FA 4GT1A 3ZCUA 4X84A 4CNQA 1ZH6A 2VNSA 1IEXA 4HFNA 1PL7A 3PITA 1DKRA 1LTHR 3OX1A 4YFVA 1XU9A 1ZI6A 2EFHB 4B31A 2YJZA 3L77A 2XUDA 3E1GA 3KJHA 2PMKA 3B85A 2HK8A 9GPBA 1J97A 4R54A 5BQPA 2R68A 2OESA 4EHIA 3ORYA 3LS2A 4R2WA 4RV9A 1SHKA 1KVUA 1K08A 1GPUA 4TKUA 3MLBA 4BFUA 3I04A 2VT6A 3NRJA 4KO2S 2YOHA 2B20A 2KS6A 3KFXA 1I32A 1PGJA 3KOZA 4QTUB 4RK1A 4DV1B 4FKMA 4BO6A 5JZBA 2HJRA 1E4VA 4ZCLA 3GLSA 1MX9A 3W9SA 4PHGA 5KU7A 4UUOA 3ZE9A 3DWIA 3AC0A 1KIFA 3DLTA 5JY6A 4KHZA 1J8FA 4R9VA 3VKHA 3B78A 1WU7A 1N8TA 1XDUA 5C1PA 4YAUA 3SFTA 2QOEA 3BCRA 3I6ZA 3KXKA 3T41A 3UHAA 2OYCA 4C30A 2QBYA 3S68A 2EJWA 2X8JA 2NVUA 2XE7A 4HB3A 4M0UA 4N5LA 3V4ZA 4P7KA 1Y7TA 5BQOA 1FB5A 4D8TA 4EKYA 1UK6A 1A7UA 5JBNA 3OPMA 5DHAA 3RV4A 3GLIB 1K6JA 3GAZA 4JGIA 5DE3A 3OQOA 1BGXT 2OPHA 4DEYA 3HFSA 2IIQA 2VCHA 4H7DA 3GFGA 5EIBC 4CKYA 4D9CA 3S8EA 3SS9X 3H1EA 3BN3A 1T0BA 5K0FA 5G0VA 4LBWA 1GN9A 1UFQA 2WSYB 3GU3A 4ERXA 1JI0A 2CL5A 5ECWA 2VWPA 1RHQA 1Y80A 3I39X 4BGVA 3WAGA 1T2AA 1T6XA 3IT3A 1A3CA 1GKKA 5TGDA 5A1TA 1L7NA 2GR9A 4QT4A 4WEQA 3VTKA 1TLFA 4UM5A 3DOCA 3ETEA 1HDGO 2YYYA 3ZY6A 4M6WA 3KYBA 1IN7A 2IDZA 2WJ4A 1VHJA 5U1PA 2WKPA 2BONA 3DOHA 2BHTA 3B9BA 4ZT3A 3IJEB 4M0KA 5HXAA 2ZM6B 3IDAA 4QDXA 2ODEA 3PRHA 3A6GA 4MQ6A 3KTAB 4KXYA 1Z08A 3CT6A 5B5SA 5LIPA 4CF6A 1OIVA 3IIIA 1OASA 3DP7A 5ESDA 4O6VA 2PMEA 2BMJA 2ACKA 2VYNA 1B93A 5HX7A 2YS7A 1IHXA 3GNTA 5CGQB 5CLLA 4BLSA 1QCCA 3MIZA 4OAQA 5FUQA 4NENA 1I1NA 1YDFA 4LJ4A 1TO6A 1CQJB 3MS4A 3RW9A 3EZYA 3QRWA 4UHFA 1EA7A 2EFJA 4HXGA 3H7AA 2ZT5A 4N5NA 1VE3A 1KEEA 3KQLA 4GUAA 1T2EA 3BWMA 4C20A 2VS1A 3U4DA 2UUPA 2VSOA 1RWQA 1Z2OX 5KYVA 2W8ZA 5DWDA 3C6XA 1WJGA 3WR5A 3QWIA 1E3QA 1E0JA 1FU8A 1Y3DE 4EOGA 2HGSA 3QW4B 1JVNA 2B5WA 4K81B 1IN1A 3U6KA 4A0FA 2P1DA 1E66A 4QYWA 4D45A 1U8XX 3CZPA 4HGRA 3MEQA 4A5SA 1UFVA 2QYTA 4DR2B 3NIBA 1Y5NA 4GG1A 2ZSBA 2AN4A 2MDTA 4G5GA 2P9YA 3MTJA 4OMCA 5DI3B 3ID6C 3DCNA 4CKWA 5JSZB 1W47A 2Z83A 5ADUS 2VPTA 1DQNA 1T8RA 3IP8A 5C31A 1AC5A 2QVXX 2J46A 1KYQA 4RENA 1Z4QA 5HA5A 4MRMA 3PI7A 1LW6E 3L1KA 1KK0A 1DC5A 1QFJA 3HM9A 1CDEA 1EFPB 4GOKA 2G4CA 3TBHA 4G5OA 3D1LA 4HGYA 5LOVB 2BCJQ 4DABA 3M6XA 4IHJF 4JDPA 3UOWA 2EAUA 3HWRA 1JPVA 1W0CA 1UL1X 2WJ3A 4KAJA 4NOLA 4LDQA 5DGHA 5B1DA 4B6EA 2HOQA 2ZATA 4C7VA 3FVRA 2Q49A 1Y6ZA 2Q6VA 3HJNA 1FYFA 2W0MA 1QHIA 1M0WA 4RIGA 5LYYA 3RS7A 2H51A 1DKLA 5CVTA 3TVTA 3ZWQA 1M8KA 1TAGA 2IP1A 3L9XA 3AEQA 1D2CA 1ZNYA 3IDFA 3O91A 3PCXA 4O0LA 1WDTA 3WB2A 1SC4A 2NTEA 1ZIPA 4YJKA 1E60A 2YIJA 3BK1A 3L4KA 4Z4CA 5HVNA 1TCCA 2G88A 4KXMA 4RZUA 3ITKA 1LB1B 1C4WA 2QRKA 1I3MA 2MSWA 4P5DA 1AO3A 3P9QA 3DD5A 3FSGA 4ZCIA 1OY1A 4EGCB 1ZKMA 4YI3A 3RRFA 2QG6A 2A94A 3VMFA 3CWQA 3I8OA 3EGDA 1AH2A 3SP1A 3JD2A 2VK4A 4LHSA 2EV9A 4JBXA 5HF6A 1EK6A 2QYSA 4KV9A 4TUYB 3RWBA 1FYDA 4HN4B 3ZEIA 2E4AA 2K2WA 4QBTA 1HK7A 4U7DA 1HMYA 4KRGA 5A5GA 4HTFB 3L8EA 4N7RA 4S1NA 4K6CA 4UUAA 2K87A 2VP3A 5IABA 4MRVA 2IH5A 4B3MB 1SG0A 2AR7A 4L51A 5SZKB 2QXTA 3EVDA 1UINA 1KS2A 4QHYA 5JO0A 1IJBA 3GGJA 3U3XA 4LGVA 3SC2B 2YW9A 3FZEA 3SNHA 4M1OA 3RBZA 1AKWA 4A1FA 1JT9A 5ABPA 4KH0A 4X1YA 1IN6A 3C48A 2JBAB 3EBPA 5JSUA 3TZCA 1N32B 2WBLC 3VZBA 3NDRA 1M54A 4OEHA 4MRPA 2FSSA 2Y67A 1RJWA 2LDBA 3FSRA 1ZD9A 4W8HA 3W7BA 3BK7A 3FB1A 3LO8A 1VECA 1M8GA 2CVPA 1RRMA 4CQNA 2WICA 3ETNA 2FU5C 5BNIA 1Q44A 2ZR9A 3S99A 3ZNQA 2C20A 1EFKA 1XP8A 3EFOB 4RVGA 3I9OA 5ICGA 5LD2B 4BNGA 1XRNA 5I4CA 1JNXX 2QT0A 3TEFA 2IEIA 2AK2A 1ZUHA 2DR3A 3RTBA 1HYBA 3BRWA 2JZOA 3EIUA 3ET5A 3QY0A 5U4QA 2HA0A 4AJEA 1ZJYA 3QVUA 1SB9A 4QBKA 2FX2A 4QU0A 4TMWA 2NU6A 3U4MA 1IXSB 1ACLA 2GPNA 1EE1A 3H87A 3HU2A 1SFRA 3IBFA 3IPLA 2IC5A 4K8OA 4TV8B 2X9LA 2Z2KA 4X3OA 3AUKA 3LECA 3A4TA 1PFVA 4FX5A 5JH7B 1DPGA 2VJMA 3TPCA 3A1WA 4IMPA 1R6XA 3BHNA 5DMHA 2PZAA 2G1PA 4AUNA 5CG1A 2CHEA 1P2TA 4U2GA 2YQZA 1KZGB 1PBNA 4GYKA 4K9RA 2DBYA 2XRYA 3M6IA 2ZRFA 1G9SA 5D01A 1VL6A 2XUAA 3K2BA 1PN3A 5K0NA 3TIGA 1VGQA 3DZHA 4L7QA 2JLZA 2ZZNA 3EC7A 2E9SA 1ISMA 1LQ2A 1WXGA 2Y0DA 1I4LD 4JL8A 1ID1A 4KYUA 3RAGA 4KQ9A 3KLNA 4I4CA 4LDRA 4DUGA 1J8MF 4H1HA 1X7WB 3BOSA 3AR3A 2HUPA 3PFCA 2CB0A 4QEDA 1DKOA 4HWGA 1C9EA 5AHOA 2NYVA 5AI0A 4IGFA 4TMKA 3FD8A 1Z2NX 4CIAA 1W4LA 2I6TA 4LSWA 4X7BA 2QTRA 1Q15A 4QVIA 1E58A 1G66A 4RSGA 2JFNA 4B7XA 4XVHA 3FIJA 3IXMA 1MC8A 1CUJA 4UHJA 2WUVA 1T9CA 2Y3IA 2ICAA 1RABA 4PNZA 2EX1A 4W6QA 3L07A 2JLCA 1DIAA 2B4KA 2JZCA 3FLAA 3K3PA 1JXMA 3MOSA 2FDCA 4OJNA 4UEJA 1KI9A 1U7XA 2IKQA 3R8XA 4C7OB 1E2FA 2FPGA 2XNJA 4GVPA 2ZJ0A 3DONA 1GPH1 5B36A 3OLVA 1NI4B 1BYUA 2GS9A 4WBNB 4E2YA 4BUZA 2IPAB 5E6UA 1GRQA 1KFKB 1Z15A 4HQOA 1NTOA 4CKEA 4EB8A 2GXQA 5DCUA 5ECDA 2I62A 2BZSA 1L7DA 3NASA 4J94A 3T94A 1Q7GA 3CPEA 3F6CA 3QWHA 5KTOA 4MVCA 2AKYA 1IAQA 1KJQA 2YHIB 3C98A 1F3LA 2XI4A 1XEXA 5E6SB 3TRDA 1Y3HA 2HMAA 1ZH2A 2X5XA 4KMSA 1W49A 5AVXA 1G4UR 1X70A 1RAGA 1II8A 3SYRA 4BECA 4XJVA 4LZWA 3GUVA 3UT5A 4YMHA 3IDZA 1X42A 2CGEA 3OFND 1YS7A 2X8WA 4ZI3A 4ALLA 1GZHB 1LBTA 1VJGA 2WSSD 3ABZA 5EEGA 4UUPA 5H0IA 2IHUA 4HNHA 4GZ5A 1YOVA 3Q9LA 5TS2A 1JEEA 1OF1A 5EWLA 2NU8B 4GPIB 1K4KA 4ND8B 4F3NA 4R8VA 1RXVA 5EZSA 4A8TA 1GYRA 4B7UA 2WJPA 2UYCA 3OZCA 1N5RA 2XE8A 2GD6A 4Y7CA 2A0YA 2XITA 3CR3C 3QVGB 1UIMA 1XT6A 1YDWA 2FMIA 3KP1A 1E7YA 4J0HA 4IM7A 1GUDA 2C4UA 4GR5A 5IM5A 2P90A 2W00A 4LWPA 4E7PA 4ABYA 5F23A 4A03A 5FOTA 8ATCA 1EESA 1CRQA 4A26A 3DWFA 3NRBA 3GYBA 2BSQA 4NS4A 3M3PA 3ZNPA 4BASA 3ER6A 5I5GA 3P96A 2BGMA 1W1WA 4JB2A 4RULA 2P9TA 1WA5A 1IY1A 1PLJA 3D6MA 4MQ4A 4RJKA 3SJUA 3VHQA 3T3NA 2OBXA 2VQ6A 4XSHA 1OBOA 1JALA 1RNLA 5G4LA 2DT5A 2XMCA 5K3CA 3UJ3X 4BJHB 3MYYA 1SIOA 1I14A 5BW8A 3A70A 5DV9A 1SXPA 3Q41A 1SHUX 4CMIA 3ZGZA 2CHGA 1W2GA 2WM9B 2HMTA 3E9CA 3MRTA 3O93A 3Q3GE 4FGWA 4J4BA 1KJWA 4Q12A 5CCEA 2LCFA 4Q47A 2VIIA 4MSUA 3SEQA 3WDMA 5EFZA 4RDXA 3JD0A 3CZAA 1U0GA 3FCSB 3FSEA 3F90A 4RTKA 3LBNA 3A04A 5GIOE 2EIXA 3D4IA 3CEJA 3OC0A 2E3JA 2F59A 2B6NA 4JYCA 1KMMA 5LB4A 2Q5JA 1LBQA 1FNCA 3FKSA 3QYPA 4B4DA 4CLOB 5ADVA 4EPWA 3VZDA 1CY2A 3O7MA 4L76A 2FYTA 4QNNA 4P54A 2QA5A 1X1TA 1BWSA 1JWAB 2OK8A 1TA0A 4ZOEA 1FA9A 2ZWAA 1U28A 3CWCA 1SA0B 2GN2A 2IQIA 1OH5A 3UMCA 1FLDA 4J0JA 1HDCA 1SULA 1T2NA 2ZBFA 3P9XA 2FXIA 5KSOA 3IELA 1TYEB 3ECAA 5ALEA 3KXLA 1NMEA 3K9QO 3RU7A 1TQ2A 3KETA 1B6RA 1BJRE 2VH5R 4I0WB 3P52A 4IVPA 3U39A 8AT1A 1KQGA 4RTNA 2DP4E 4RL4A 4X7RA 3KR9A 5DLPA 4KX3A 4KDFA 2NGRA 4KQHA 3BVPA 4ER6A 4N0EA 2HYDA 2G7MC 3NXSA 2LNDA 2X1VA 3L0DA 2GERA 2CXHA 1KORA 3VC3A 4MYHA 4U7PB 1Q3TA 3F9RA 2Q5HA 2WC1A 1UUFA 3QSGA 1YSCA 3KVOA 1ZMXA 1ULUA 4IHAA 4PSCA 3T0IA 1MW8X 2HAEA 2ZRDA 3C6YA 4JYMA 5K4AA 3EXFA 1X3LA 1GGNA 5IXJA 4O4IB 1JQJC 1LK7A 5FPSA 3GLQA 4XWWA 2YFHA 3TH5A 1ZD5A 1I51A 2XJ9A 3B5EA 5AVTA 1NBMA 4BPBA 1FMTA 1MXHA 2QTAA 4FQ5A 2IQ5A 3NTOA 4B87A 1MQAA 5KREA 1AZTA 3FMIA 3VU1A 5AW3A 3THWA 4AZ3A 2G80A 4F4HA 3EXHA 1C1XB 3PXBA 3VDXA 4B3DA 2Z95A 3BFKA 2ZYVX 4H35A 4BO0A 3TOXA 2B1RA 4IO1A 3QEBZ 2PVPA 4IYRA 4X8MA 4HNVA 4RZ3A 4UUQA 2F9LA 2FDXA 4OO3A 1I94B 5DN6A 4WJZA 1YH3A 5CW1A 3PRYA 3UF0A 1C7JA 3RYTC 4JIGA 4KODA 3HBJA 1DZ3A 1CUEA 4N3BA 4XYMA 3ULKA 4DSOA 3AHFA 2TYSB 4B7CA 2NNWB 2VNAA 3HA5A 2IPOA 4LJLA 5LZ8A 3TPFA 3B48A 4EL0A 1O96A 2AW5A 3FIUA 2JGKA 4LYJA 1J2YA 4CM8A 1A9OA 1NMSA 3J7TA 3ZV5A 1T1IA 3K8OE 4GPZA 4ID9A 1G60A 5LMZA 3PWKA 3HH8A 2GK7A 1QDUA 2PUTA 4N5IX 4JJ7A 1T9GR 1GZVA 4GP6A 2OL4A 4WOJA 3THXB 3MCVA 3G13A 5AKGA 3RSZA 1XVIA 1PFYA 3ML1A 4C0KA 5A62A 4CMGA 1T1SA 2BFWA 3OIWA 3IA7A 2XGSA 1ZO8A 1PTJC 3JD1A 3LHSA 4URZR 3AUJB 3VAAA 1WWKA 4U2EA 3W6NA 4CN9A 1GM5A 2AMLA 3EE6A 3RGGA 2HIAA 3OTWA 4E5NA 4LHWA 4I55A 1DT3A 2CL7X 3ZE1B 3DXYA 4BV8A 4ESOA 4ENRA 1PK9A 1GQOA 1TM2A 2GYYA 1H1LA 4MR7A 5AM1A 2D2VA 3CIOA 4KAAA 3JYOA 3WICA 3TJMA 5AQ1A 3WLSA 2PS0A 4Q19A 2RARA 3FLMA 4PZDA 1HQKA 3M3HA 4XLTA 1BJKA 1N9GA 2B94A 3OKFA 1UMCB 4FZ3A 2CHFA 4Y8VA 4EA9A 2JIOA 1I7LA 1CR1A 1RZUA 1W2WB 4RIFA 2AQIA 2A9KA 2WU0A 1E79D 4KPEC 4DIOA 4E5YA 5IS2A 1FFAA 3V8RA 3NFYA 1S2OA 4I1UA 1U9CA 3HO8A 2C03A 2ZTMA 3IUJA 3O3CA 4ND4A 2JAUA 4O2BB 4PGGA 3VH1A 3ZC3A 4E1VA 5J4YA 1YT5A 3V6MA 1AK9A 1ABFA 3HLKA 3VOAA 2KB0A 1DEXA 1SXJE 2RK4A 2R7LA 2PUVA 3NHBA 4YRAA 4IVQA 2E37A 2QP9X 4JU8A 1OFVA 3DBHA 3AI2A 3O2JA 4RD6A 2GYUA 5BYJA 4C0LA 3B3QA 3RE1A 4II2A 3UG6A 2V0NA 4B80A 5EJ7A 1JIXA 2YJ3A 4FFWA 3FVWA 1N92A 1KPHA 1W8IA 4GM1A 3FBGA 5D6OA 5L3SA 4KEAA 4LW8A 2Q5EA 1FS6A 2EZTA 4LWOA 1JHQA 1MX3A 2GX6A 3LZCA 2CLFB 1NATA 3ZYCA 1KOJA 1EJ0A 3K0KA 4P86A 3V42A 2LTAA 3IEUA 4NF2A 1TCBA 2F43A 4OMDA 4DEVA 2GEUA 3R77A 3BL8A 3H2GA 3ORHA 5KTYA 3PL5A 3JZFA 3V2GA 2Q2QA 2P0YA 2Z5FA 1FPMA 3JYHA 4CUZA 1UKBA 1EDEA 3INTA 3WAJA 1DRVA 2VJQA 3TWOA 2VCEA 4WADA 5KYWA 4WKBA 3OH8A 3P9RA 3UAWA 5AQEA 2JD2A 4YLGA 4ZDKA 3OZGA 5EZ5A 4MO2A 1X92A 4DQUA 2EJUA 3RT7A 1VKJA 3MINB 5EE9A 3S70A 3UQZA 1BYIA 3OX4A 4QKQA 5J3JA 6AT1A 2HJSA 4XJXA 5HSGA 1QR2A 2OCKA 3K1YA 4Z3KA 3E8MA 1JR3E 1P29A 3K0FB 3TEMA 3AJDA 4C43A 3G9ZA 4CL3A 1OH6A 3GD5A 3NI2A 1TT5A 3PCRB 1NVTA 2FF5A 3AKYA 3I9KA 1RBYA 2AZDA 3EVAA 2J6IA 4BCDA 4MUFA 2RKWA 5IVKA 1U2EA 1C7EA 2YV3A 1PWEA 4D6XA 5FL3A 3AJEA 4ZOLA 2DFKB 2P78A 1UM9B 1XA4A 3SY8A 2I6GA 1KYXA 5THQA 1GTMA 1OFHA 3IR7A 1E4OA 1VXOA 2FI1A 3GJQA 1U6IA 1DC8A 2OE2A 5TPZA 4E31A 2DY0A 5JMOA 1G20B 1MU0A 3DHYA 3IDSA 2W2KA 3O26A 4KN9S 2WF7A 2IVFA 5CIYA 4AC9A 1XO1A 1DWQA 1TU0A 5BP7A 3GLGE 3COSA 3CZ4A 1FFWA 2GBCA 4G65A 5LZ5A 3RKRA 4XZ3A 4OUDA 5AVWA 4AJOA 1E8NA 2FFBA 3ZE8A 4M21A 4V0RA 2ILVA 3JQGA 1Z0UA 2VOEA 1W48A 3F46A 4Q66C 2IIBA 1X7GA 1ONNA 4QU5A 4BFLA 1T4GA 5KSYA 4YJ2B 1O9HA 4BNLA 2IY8A 1RLJA 2J1LA 3ZK9A 4HGNA 2PS1A 1QIDA 3KG2A 3DKVA 3FCOA 1UKZA 2OKCA 2O52A 3HMKA 5EWMA 1EZZA 3I1IA 4ENSA 2Q5LA 3SJ7A 4Q1VA 2OFFA 3QHPA 4A6XA 1Z5WA 4I9GA 1EP1B 2D2EA 1JZTA 1C30A 4BO3A 1T91A 5F4ZA 2J0EA 2OB2A 4BNIA 5CDYA 3HVJA 4OF4A 1MFPA 1CF2O 1P9OA 2DC1A 2QUHA 4EO7A 3VM6A 2A5DA 2XOKA 4EHAA 2ZRIA 4EB6B 5A5VA 2CXSA 2PS9A 4I4IA 3ZDFA 3O8BA 3MGKA 1ITZA 4JODA 1MZVA 2VYVA 3I23A 4WASA 4NCHA 1NE2A 3UMBA 1E5LA 2DH6A 2AF4C 3ZLTA 1EUDB 1TC2A 2AN1A 5CX4A 1N6OA 3JR3A 2GAJA 4KK3A 1NLUA 1XXLA 3NHWA 4MTLA 2QTVA 4NECA 4BZPA 2ZAOA 4X41A 3EAQA 3HYTA 4PAGA 1MAVA 4DTIA 1A71A 3BFJA 1J7KA 2V59A 2XDWA 4YMUA 1G21E 1QIHA 3TOCA 3C1TA 1JH8A 1YNSA 4NCBA 4LJRA 1D8TA 3C4QA 3CRRA 2YFYA 4MVJG 4OTZA 4CQLB 2XQGA 2P4HX 4N7MA 1QJ4A 1F2DA 2HQRA 1ZD1A 1NPYA 2WYIA 1YO6A 2FCRA 3MQ4A 5ESXA 4AP9A 1TNDA 3OCWA 2I71A 1EXNA 2QY6A 4QUJA 3ZX5A 1F7UA 1DADA 1ZCAA 3IOCA 2P2SA 1D0VA 3TR6A 3PUXA 5DYNA 5ANRB 2R1TA 4N12A 5BSKA 5HRAA 3QKSB 3DA8A 1ZINA 4RK0A 1F5NA 4TKLA 3OAAA 3V8VA 1B6SA 1BCSB 3JRNA 2CD9A 1LWOA 2RI6A 3E15A 3GEPA 5TMDA 3F5DA 4WZ6A 2W2MA 3U40A 2H06A 4BIIA 4MAFA 5AXDA 4YUZA 1PEAA 4FWIB 4IIJA 2OLKA 3JZMA 4QBFA 1BDBA 1C9NA 2ZB2A 2VJKA 1LZKA 1TAQA 3PXUA 2OCIA 1ZNQO 3G9TA 4G4JA 1ACMA 1A8UA 1WVGA 1FP2A 3SMQA 2DLCX 3HCPA 2B5OA 5LDGA 1R8YA 1Z7WA 2CUKA 1XP5A 1LX6A 4P3OA 1JHOA 5F7XA 1Z22A 3V3KA 3GA5A 2VSXA 2EBFX 2PEZA 3DB1A 4X1IA 5J5VA 3TPZA 3T1NA 3O3OB 3JQFA 1T9AA 2V6BA 3N2YA 3ZBUA 4CMBA 1Z63A 4BPRA 2I03A 1QKJA 3ZDZB 2JKZA 4OY3A 4AYWA 3Q7TA 3GJ0A 4RLFA 1PEKE 4I1OA 3E9NA 4R81A 1AZLA 1PWYE 2W70A 5E9WA 4RQUA 3ITNA 3N8KA 5JEEA 1PWXA 4Y2XA 2YX1A 3AR9A 3OCCA 3C3DA 1RWNA 3ON5A 3ZQ6A 4E13A 3GLHA 2IYFA 2X8BA 4PZCA 5CP8A 4ILKA 1DT5A 5K0CA 2Q6TA 1OFUA 3S7ZA 4ZU6X 3DT6A 2MOKA 2JLSA 4ZWNA 1PJZA 2DUJA 4JLMA 4WGFA 2FB9A 2VZ0A 2DSNA 1MH9A 2H1IA 3BBPA 4D3ZA 4CT4B 2WT4A 5L8VA 4LHZA 1DG1G 2ANCA 3GI1A 4HFRA 3PU6A 2F48A 4TTSA 5DEIA 4JYZA 4WN9B 1ZN8A 3RASA 3OMXA 2PX3A 4F11A 1D0IA 2FG6C 1W4CA 2EJBA 1NKSA 1W6UA 2GF0A 1U8EA 5H3CA 1O54A 5DNWA 1WL8A 1L4YA 2J87A 1U2DC 1II0A 3JZDA 1ZOOA 2VF5X 2HIMA 1P75A 1ZN7A 1Q2XA 1QVVA 3B6IA 1F9EA 2P9FA 2C8KA 3L7BA 4WZAB 5JCZA 1HDXA 3HDQA 3IVGA 1LC3A 2FSGA 2B1QA 1N5KA 3LHKA 1FUUA 4WUTA 4BKRA 2O8DA 3E2IA 3BXOA 3N59A 2JGDA 3GGSA 3T9AA 3WJ2A 1ISHA 1LLFA 1L7MA 1C3LA 4HAOA 4JBLA 5JQGB 4MDFA 1TM4E 2SCUA 2ONCA 3L7JA 5CFLA 2JFHA 1AOXA 5E2IA 2PLNA 4H6VA 4B34A 1A2QA 2REQB 4TV9A 1SXGA 1Q3HA 2REOA 4KACA 3NPMA 4ZV7A 3WKBA 4B4KA 1IQPA 1MHPA 3PENA 3IBSA 3ZHVA 2ZLBA 1PI3A 3GT4A 1Y8ZA 2BZ1A 1U65A 3NTQA 2H7XA 5DM1A 1RWBA 3VSBA 4BEBA 1FUKA 5CCDA 3QPVA 1OZFA 2IUTA 1AK2A 2VHEA 3MSCA 5COAA 4WQMA 4U00A 1YTUA 3VV2A 1M34E 1MNAA 3RSHA 4TYMA 3T9EA 5JFOA 3ZV4A 1QWSA 4JP3A 4BMOB 2RCNA 2XA1A 2OC9A 3U4GA 1P5ZB 2XB6A 2ZUCA 1F17A 4FJ1A 1EGVB 3HR4A 4WXYB 1M76A 3FMPB 4DW8A 2ZR8A 1OWMA 1U0HC 2QYOA 5F77A 5LB2A 2PWZA 4NHOA 5FA5A 1UAGA 4EY4A 1BHSA 5EP3A 1WW2A 1AHHA 2JGRA 2P8JA 3V7FA 4NAVA 1F14A 2BE7A 3B52X 5DT2A 2IEGA 2ZG6A 2KBEA 4J1TA 1D03A 4MV5A 5FLEX 3DL2A 1QXSA 4LAFA 2Y1WA 4Q48A 1TJ5A 3Q87B 4V2IA 5CYOA 1EFCA 1CY0A 4AG3A 4ARSA 2GEFA 4YAGA 1SKBA 1UH5A 1ZGAA 2M1XA 3WL4A 5FUVA 2ZSDA 3QH4A 4Y2YA 4ZI7B 3NP9A 2ZUSA 5AD1A 4BKUA 3WDSA 1TW2A 1EIZA 4AP5A 2HLPA 1V7CA 1PT8A 2FQQA 1OH8A 1GA4A 2TRSB 3GXOA 4J1SA 5J2UB 3EFHA 3TL2A 1HA3A 4LFBB 2ZIXB 1XRRA 4EF4A 3LP5A 4ZICA 4GOJA 1YHZA 2EJVA 3ZIAA 1LH0A 1BXKA 2HJWA 3KYJB 5TJHA 2BC9A 3S5UA 1UT6A 2DPYA 4GE3A 3RT1A 5JAQA 4MW0A 5AI5A 2OCAA 3F9IA 4I3GA 3LIPA 4AJHA 3ELYA 3UC5A 1GU7A 1CBUA 5A4IS 3QUTA 4GRIA 1SCAA 2MYNA 3AM4A 3JQ9A 4UNQA 1Z34A 2V6MA 3STTA 3UUFA 5L4NA 2AYYA 1LEHA 4FFMA 1IZZA 4BXOB 5L4LA 4NSNA 2QI9F 3FTNA 3FTPA 1TF2A 3PEEA 3BJEA 3PZBA 2V7EA 3A27A 2HDNB 1LVUA 4NYIQ 1F06A 1SCNE 1XHFA 1RI4A 1DFIA 1OZAA 2VAXA 3H9BA 3T7KA 3I61A 2C4TA 1XX6A 2IU4A 1V4BA 3O1HB 5B7PA 3ZJ4A 4DUYB 4XWTA 3BA6A 4JBYA 5CT5A 3SG0A 1R6TA 4DXDA 2GZ1A 3EULA 5CVEA 2QX4A 3A37A 1FVFA 4D26A 5A5FA 2PV0A 2QU8A 1E99A 2E5FA 3GIWA 4WECA 4YRPA 4BVJA 1XPJA 1OPRA 1NY6A 2J9ZB 1JFTA 1H2EA 5H83A 2O5RA 3SNKA 1N1MA 3CC8A 1NRXA 2WAXA 4JNKA 2FUEA 1N2SA 3NNSA 3WRYA 3YASA 5EYPB 4DR1B 1M2FA 5DIFA 2XSZD 1XSEA 4ZODA 4EGJA 1TD9A 2Z8YM 1IXZA 2RAPA 1YQEA 3FPGA 3M0EA 4OJYA 5KAPA 1RHJA 4KHPB 2XMPA 3VKFA 4DT1B 3RYFA 1MC4A 2I1VB 3K16A 3OQIA 4JWKA 2WKWA 3NKFA 1N5LA 5T4EA 4CMEA 4OP3A 5C35A 1AD2A 2XNDA 3IC5A 3U3MA 3HJTA 5LKAA 5ALDA 1CB7A 1NUPA 4KKXB 2ETVA 4Q05A 1BD4A 3DVRX 2GHTA 1DDGA 1KJZA 1HPLA 2Y6VA 3NIWA 1S8OA 4F56A 1H4TA 5AVKA 2JIQA 5ALGA 1BMFD 1K2WA 1VXRA 3BMQB 1CZRA 3EGVA 2XMSA 1NJSA 3GDHA 3NHAA 4Y9UA 1E61A 3DAGA 1SBTA 3C3WA 3R7SA 3WV4A 1S9DA 2YTZA 4Q9IA 4BV9A 2WTAA 4C21A 1KO1A 3MCZA 1UQRA 3DMNA 2AEJA 3GDFA 1GPWB 3K1ZA 3Q1KA 5EJIA 3PC8C 3T9BA 4DR7B 1C3XA 2JZNA 2H11A 4V2UA 4AYTA 2C9BA 4IEIA 4B8YA 4F4CA 1U28C 4EMBA 4HAXA 2OB1A 5LOVF 2WRZA 4Z4EA 1WDMA 5FTMA 5EMMA 2BFAA 3A9CA 4RGQA 5JJLA 2JI9A 4LKOA 1ZD4A 4A3SA 1JLLB 2XWJI 4HEJA 1U1GA 1N8NA 2O8NA 1X39A 3B1YA 3OC6A 4JI7B 3ANLA 2JFOA 2I4LA 4I9HA 4HB0A 4ZXPA 5DVZA 4ZU3A 1CDOA 4PYRA 1EWQA 4JSTA 3VJRA 1R8QA 2QRMA 1U3TA 4RVFA 2FPXA 2QAIA 3TSYA 3UIEA 3ZW7A 3FNGA 4DJFC 1YI8A 1AS0A 4HH4A 2P9ZA 1NQXA 2IHBA 2RGEA 4A92A 1V8DA 2GO1A 4TWIA 2JGEA 2WSBA 5LUBA 2P30A 1PWZA 1FFEA 4FU0A 4TZTA 3EEOA 3CZRA 4L4YA 4AZVA 1XTPA 1JAHA 3PFKA 4J9VA 4UPVA 2I9KA 1GADO 3RFXA 1SK9A 3GWZA 3MAJA 4TKMA 4Y9SA 3MWYW 5IAJA 5JPIA 2J0VA 2JHCA 1O94D 4TUYF 4EHFA 2OCGA 3JAMA 5IH3A 3CRMA 3EXHC 1PUJA 2CDRA 3N7AA 4UU0A 1N2HA 3QKWA 5CGZA 5A2QA 3A3NA 3T4UA 4JOQA 1Q21A 3ND7A 4OJMX 4J49A 3ONWA 2OA0A 3TE6A 2PFSA 2HZ7A 3BZWA 3BDAA 2AK3A 4EITA 4Q6WA 4F84A 2O2EA 1SU8A 1XDSA 4JI2B 2OZPA 2E4UA 2Y9PB 1C3EA 1RP7A 3HDHA 2ZYUX 4YLEA 4DREA 5BPHA 3U16A 3WLAA 1HQCA 2VPYA 1NI5A 4NI5A 4BJ1A 5CA1B 3AL2A 1UZMA 3KOMA 4G5FA 2E6KA 1H6AA 1IZ8A 2XCLA 3IBGA 1D4FA 2ZTSA 3L7DA 4LVNA 4OIFA 1T4DA 2A4MA 4NBNA 4N0MA 3DMTA 2PJRA 2VDRB 5BSEA 1BH2A 2IZOA 4PQGA 4UBOA 3FWYA 4KLNA 1PFUA 1ZU5A 4UBKA 2C9YA 1UANA 4JHXA 3ILSA 4ZEOA 3GA0A 2O0KA 1PNQA 1K97A 1U0RA 4BQRA 4PNHA 4HQNA 3GCWA 2LIVA 2ZTLA 4EFKA 5CFNA 4BMYA 2HRZA 2HSDA 3FE2A 2CHVA 3A9UA 3PDJA 2J5KA 4KL8S 3ND5A 3RTCA 3IKMB 1Q95A 1EG7A 1TKRA 4CTOA 2PT7A 3EDMA 2GM5A 3TQCA 1B6TA 3DG9A 3S2ZA 5H4HA 2GZMA 3QBVA 3IAAA 5FAXA 2OQIA 2NVOA 5J5CA 1GCIA 1TIBA 4FR2A 1H42A 2W7TA 3GLRA 1Z5NA 3D3WB 1B8PA 4H1WA 5JH7F 2OCDA 3JWEA 3PF8A 3O90A 2H59A 3VRHA 2IV2X 2PGJA 1YIAA 5IAKA 1I3NA 3PPXA 1Z12A 2XVZA 2CZQA 3GA7A 2BMEA 3H11B 3VZQA 5JDCA 5CK4A 2YWEA 1B1AA 4ACAA 3U7FB 4ARAA 4IQGA 3IOYA 2FPKA 4FDVA 2JFFA 1FMLA 3Q8KA 1XE3A 2C3OA 3E58A 1TJ4A 3EWIA 1FC0A 3N6RA 3DAFA 2ON6A 4UC0A 3VO2A 3O1IC 4CEJA 1E3WA 4OYLA 3M6WA 5JISA 1AURA 5JALA 2PUCA 3FFWA 4Z2YA 5LVAA 1F2TB 2CLCX 4C3ZA 2IKSA 3TZKA 3W05A 2FRDA 4HDRA 1CUWA 2XX3A 7REQA 2JVJA 3NC4A 4LUCA 2C5HA 3NNDA 4WVFA 4R6XA 3OI7A 4DR5B 4M2LA 5C8DA 3PX3A 3LDHA 3ABSB 3OMWA 4B79A 3SF8A 1PR3A 1PS9A 1V1MB 4WCFB 3BGVA 2PXHA 3W0LB 3WRXC 4EW1A 1APBA 3CZCA 3H3JA 3ICWA 5F78A 4ITRC 1UC5B 1WXFA 4AY6A 2JCBA 3KE9A 2HMWA 2J85A 4QAQA 1DI0A 1GPLA 2CBZA 2OXIA 2R44A 3HY4A 1XVLA 2A8YA 3PNBA 4GX1A 5TSDA 3LUPA 3MSXA 5EIHA 2FEKA 4N8DA 4D8UA 5K3SA 3TVDA 1XNRB 3LUCA 4Y3UA 4Z4HA 5HQ3A 2HWWA 1RRFA 2QHXA 2QN8A 4R1NA 4WOKA 1CYEA 3FI0A 4DLAA 3GFSA 4GC5A 4QGFA 3WXMA 4WBNF 4DY6A 1QMGA 2A7QA 3AU9A 3FGPA 4TTVA 4C2TA 4ZFNA 4FBMA 4YV1A 2YIVX 1YACA 4LE2A 1TQ6A 4WGGA 1JXOA 3MERA 4IG4A 1SZPA 1QZ3A 4PM4A 2J6BA 4GD3Q 4E30A 4LKRA 3ZKWB 3DAPA 2Z2ZA 3PK0A 4JROA 1W87A 4HQLA 4NCKA 3ZIUA 4CMJA 1TTPB 1D2EA 2Z0MA 3FNBA 3G2QA 3PTZA 2VPZA 3RD5A 4F6CA 1YF3A 3G49A 2X0FA 2D5IA 1BEZA 3RFCA 1GG5A 3UJCA 4JYAB 1AS2A 2PU5A 3JR7A 4KFRA 4EDHA 3DUWA 3QUBA 3R7NA 4PC6A 3WKAA 4MJLA 1ZUWA 4EPRA 5KOJB 2R4TA 4CKXA 3LNTA 3ZHTA 5B1HA 3L40A 2YMMA 3GQVA 3GRKA 2GPBA 4ZV9A 4I4TB 4J7AA 3UT0A 3ESQA 3LX5A 4EZBA 1AB5A 2KHZA 3WLKX 4OHVA 3DHNA 2QX9A 2YFQA 2H57A 2Z4TA 1XZQA 3GFQA 1K4MA 3CRQA 2H1HA 4MVJH 4U5QA 3BIXA 2OMEA 3C74A 3ICQB 5C3MA 1ANKA 1DAHA 5LWHA 4UU7A 3SBOA 3W8DA 3GEDA 4AY3A 4NS1A 4QXMA 3DL0A 2BMFA 4ZZ0A 3PTLA 1VBFA 4MIOA 5DTMA 1RYMA 1TMKA 2N1BA 4ZJPA 2HX1A 2QLJA 1A9QA 4GKBA 4GPBA 3DE4X 2IH4A 2KBFA 2RHJA 3HN6A 3R6WA 1P60A 1TZJA 4KLZA 4KTTE 2CDAA 4ARUA 4PIPA 4W8OA 2V4MA 3DVAB 3K9LA 2PM8A 2KLBA 3F4KA 4UDYX 3C3AA 5HE8A 3OTOB 1TKCA 1X1SA 3OE1A 3UK7A 4DQLA 1GNTA 2ZWOA 4IFEA 4X90A 4DV6B 3RF7A 1SCKA 2G06A 5CG2A 3GLIA 1P0CA 4F46A 3LDFA 4DNXA 2QE7A 5DDIP 4F9EA 5LWQA 2ORVA 4YCDA 2XW6A 2JEZA 4UU8A 4RK5A 4ZMBA 5B3LA 5EXTA 4MYTA 2VDPB 4EECA 1GCOA 4ZN6A 5JXWA 2R87A 2KWIA 4JEUA 2QLNA 1ND5A 2E4VA 1WQ4A 2FLWA 2Q1UA 2CLEB 3