3VO9A

Staphylococcus aureus ftsz apo-form (semet)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
304
structure length
295
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFETQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
total genus 80
structure length 295
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3vo9A00
4EB6B 5CB4B 3N2GB 2Q1YA 4ZOLA 5J2UB 4U39A 4TUYB 4X1YB 3WGLA 5IJ9A 4X1KB 1TVKB 4I55A 4EI9A 2RHJA 5J2TB 3WGNA 4X20B 5LP6A 1Z5VA 4B46A 3JARA 5M7EA 4O2AA 5KMGB 4ZI7A 5GONB 1Z5WA 4B45A 5ITZB 4O2BB 3RYIA 5LYJB 4ZHQB 5JQGB 4FFBA 2VAPA 1FSZA 1RQ2A 3VO9A 1RLUA 4YJ2B 3E22B 3JATB 4WBNA 1OFUA 5BMVB 5LXTB 5JCOC 4IIJA 4O4LA 2Q1XA 3VOAA 5JCOA 4DXDA 3JASB 3VO8A 4TV9B 4U3JA 4X1IA 2BTQA 2XKAA 2RHHA 4F6RB 4LNUB 4DRXA 4O4HA 4O4JA 1TUBA 3RYFA 3HKBA 3CB2A 3HKDB 2VXYA 3N2KA 5EIBC 5LP6B 3RYCB 3M89A 5IYZA 3WGJA 5CA1B 5J2UA 2R751 5EYPA 3HKEA 2VAWA 5LA6B 2R6R1 5EIBD 5LP6C 5CA0B 4TV8A 4X1KA 3RB8A 4IHJB 1SA0B 4I4TA 3JAKA 4I50B 4O4IB 3RYHB 3HKCB 4O2AB 1W59A 4YJ3A 5FNVA 3JAWB 5JH7A 5LOVB 5MN6A 4X1YA 4O2BA 4O4IA 3RYIB 3VPAA 5EZYA 4FFBB 2VAMA 5IJ0A 3RYHA 3UT5B 3ZIDA 1JFFA 5JVDA 2BTOA 3VOBA 3N2GA 4ZOLB 5IJ9B 1W5BA 5KMGA 4ZI7B 4HNAA 1RQ7A 3WGKA 1W5EA 1FFXA 1TVKA 3JALB 4I55B 5JQGA 2BTQB 3WGMA 4X20A 5C8YB 5KX5B 4EB6A 5MN5A 5MN4A 1W581 5CB4A 1W5AA 4LNUA 4M8IA 4IIJB 4TUYA 4O4LB 5ITZA 4TV9A 3ZBPA 4X1IB 4XCQA 5J2TA 5IYZB 4YJ2A 3JATA 3JARB 4WBNB 5LXTA 4F6RA 5EYPB 4KWEA 3HKEB 4DRXB 4O4JB 5GONA 4TV8B 2RHOA 4IHJA 3JASA 5LYJA 2RHLA 4U3JB 4ZHQA 1W5FA 3RYCA 3ZBQA 3HKCA 3E22A 4YJ3B 5FNVB 5BMVA 5KX5A 5LOVA 3M8KA 4O4HB 3RYFB 5CA0A 5EZYB 3V3TA 3R4VA 1SA0A 5IJ0B 3UT5A 5JVDB 5CA1A 4EI7A 3JAWA 4EI8A 5JH7B 4HNAB 5LA6A 1TUBB 1FFXB 2XKBA 3JALA 4E6EA 3HKDA 3HKBB 4I4TB 3N2KB 3JAKB 4I50A 5C8YA 1JFFB
chains in the Genus database with same CATH superfamily
4EB6B 2EC5A 4C5CA 4FM9A 1ODJA 1ZJWA 5IRCD 1FXSA 3UKJA 5T3YA 2CFRA 4I9NA 9MHTA 1M6NA 2FWAA 1U2ZA 2VJYA 3GGPA 2GD0A 3HVRA 1DUIA 1WHSB 3NVMB 5A02A 3BWVA 4MX8A 3UOAB 1XRMA 1XHEA 2JGJA 1LBIA 1U65A 3FBGA 1NP7A 5GV7A 4QTXA 3FWPA 5GVRA 4CKEB 5F1PA 2X58A 4L22A 5JAOA 3LQYA 4HYEA 4UD2A 1IHDA 5BN3B 4HLNA 4IIVA 5IJZA 1RQ2A 1NGSA 3OCYA 2E4UA 5A0TA 1I24A 2VJKA 4E30A 3R7BA 1YR9A 4M0CA 1TIBA 5ES3A 4AY3A 3DVAA 5BXQC 3PFNA 3L1UA 3RVQA 4CHTA 5IKMA 2JAOA 3Q9SA 2ZZMA 3OEED 1OGIA 3CH7A 1D9XA 4WFKA 3CWQA 1JDZA 2EFCB 2EJUA 2VPQA 4GX2A 4ZYXA 1JRLA 2J9ZB 1VPTA 2WKWA 3ONVA 4U1RA 4XEUA 3AOGA 4GWLA 4OG2A 7REQA 5ILQA 3DTTA 3CRRA 1ENPA 3KCNA 1WUIS 1RR6A 3R20A 3SFZA 4O3MA 3EODA 5IK2A 1CS4C 5GM2A 3MJVA 3WYDA 3KJZA 3QOYA 5E9QA 1DAMA 1XF1A 4NZMA 2Q3EA 1SBIA 3GD7A 3EZFA 3OCWA 4HH1A 4YO7A 2ZS7A 2QN2A 2NAFA 3IEXA 3PC6A 3OOHA 4RDHA 4UTOA 1PJ4A 1VHLA 1DXOA 2BF7A 2IQIA 4G01B 4Q18A 2ZUFA 1R4NA 3EIUA 3W2TA 2MTBA 1FYVA 4R2XA 2FK7A 1DOZA 3ZDYB 1ZNWA 3NC0C 1O9HA 3GU3A 1F60A 1F38A 4BNZA 2ZJBA 3O0DA 2WPNA 3W6UA 1XTZA 4UUMA 1U9YA 2MSKA 4EHNA 1U0HC 1E5LA 3KPYA 4DADA 1XT6A 3A2MA 4RE5A 2JIOA 1JFFA 2ZPUA 3O21A 4AROA 1Z6ZA 3H4MA 3IDQA 3DSRA 4RQUA 2PT7A 5T4EA 2XWJI 4C01A 2PX2A 3LBIA 2WUVA 4G85A 1ZN9A 3GFTA 4FEYA 2OTCA 1I7SB 3ZJTA 4ND4A 3WNQA 1PZGA 4Z7OB 3BDVA 1U28A 5C8YB 3D9QX 3A6GA 1A4XA 2C2MA 3R0VA 1I32A 2C8KA 4ARVA 3PV0A 2ODNA 2P3QA 4FI3C 3CNBA 1TJPB 4CM1A 1DKQA 4GPBA 2F8MA 3WGUA 1E1CB 2PRZA 3GA5A 3H1EA 2F2TA 2RHOA 3G2OA 2JGRA 3H83A 2ZR8A 1NN0A 3N2ZB 3VPXA 2ZQ5A 1V35A 3EZLA 4BTLA 2Z1NA 1TNDA 1BU5A 2XNCA 4JVMA 4TL7A 4EYQA 3HKCA 5KUTA 5C1IA 4GSKA 2QX6A 5EWJB 1W2HA 3CPSA 4XGIA 3WWCA 3T3GA 4CIAA 4CM7A 1I4WA 1PDOA 1Z6QA 3DF7A 3E5RA 1NW3A 3LDUA 5TQ0B 2P9FA 4RIFA 5H4GA 3E9EA 3PQEA 4KDFA 4ZARA 4F86A 1Y1TA 2FPPA 1J21A 3C4QA 3LGSA 4XVQA 3WK6A 3LO8A 1R10A 3I04M 4UZEA 4WBXC 1XD8A 4B0PA 2FSVA 2ZXFA 1GN8A 2FQQA 3F3MA 3RC9A 3UY4A 4E6EA 1VTKA 1QYDA 4MYDA 4NCIA 3H1FA 1QDLB 2O20A 4ND3A 4XRGA 1DJQA 4MDYA 2DUUA 3ORHA 4HYYA 5LCXA 1ZW1A 1K9SA 2QAIA 1KDZA 3WK4A 1V39A 2CSXA 1SD2A 3NYIA 3L07A 5BSVA 1DAIA 2CMGA 1C0LA 2W2QA 2XVMA 3ER9A 2BIFA 2RB4A 3P9RA 2DR0A 3SHWA 1HC7A 1WUKS 3KKNA 3T5GA 4E5VA 4KRGA 5M04A 4LEIA 1U2GC 3CG0A 4MKXA 4WN9A 4B7UA 5GWXA 4G0UA 2CDRA 2IKSA 2RH4A 3I9MA 2AYZA 5DEIA 5C8ZA 4U2DA 2AF3C 1ODLA 4N5HX 1J0EA 2B1QA 4EUSA 2R8BA 2GZ2A 4KKVA 2OB2A 1R00A 1M1YE 2XYGA 1ND6A 2DWPA 2VP6A 1DKLA 1ZRHA 1L8QA 3WFZA 1NPDA 3W4JA 4KE6A 3SHVA 5E7MA 4H77A 3I61A 1DAEA 1H2WA 1SZCA 3LPNA 2FPLA 5BT8A 1UBTS 2ODBA 4JT8A 4B9EA 4PTYA 4H17A 4BX8A 4U5XA 4Y1RB 4OHOA 4D4LA 1AKQA 3BRWA 3CPEA 3BMNB 4ZICA 3T52A 4N39A 3CW8X 2XEXA 2XYPA 3C3AA 1I0LA 2Q6IA 2WDPA 2R00A 4DLXA 1J9ZA 5JD4A 1QHHA 3UUGA 1NNI1 3VPCA 1W25A 4YUVA 1UMKA 2IYRA 5FOUA 1ODIA 4G09A 4CMIB 4GMKA 1FFBA 1QAQA 2XTZA 3T5AA 3ICQB 3H9BA 5GJBA 1OXBB 4B40A 3CE9A 1CJVC 4XYBA 4CXMA 2CMDA 3RHFA 3M70A 4MITA 3SJZA 3AEUB 4F5DA 2AHOA 2E4WA 1HYGA 2VUIB 4UPDA 4IXNA 5CFRA 2EATA 1MNAA 4XGQA 2RJNA 3ECSA 2XQVA 2A14A 2DP4E 3G1WA 3JALB 3ZGOA 3MMPA 3K8YA 1KE1A 1K6IA 1M6EX 6NULA 1V2GA 1G2QA 1ZA1A 1HX7A 1L2TA 4D56A 3HL4A 2YWRA 3K0FA 4DIKA 2NYVA 2PKXA 2PEZA 3BDIA 5DTIA 2PZKA 2DFTA 4HUQA 3FOWA 1QSGA 4AJ1A 1RDFA 3N75A 4HDMB 1J49A 3DZIA 3L8EA 2X8AA 2PX0A 5REQB 4TV8B 3GNQA 2V5UA 2I22A 2XCRB 1SVOA 1JSZA 2G08A 3A32A 1I5OA 1BA2A 1OX6A 3TNFA 1P5FA 5CDTA 4W5WA 3E35A 1ZIYA 3BWMA 3O74A 3QWIA 4RMGA 1DAGA 3FUUA 1GZ5A 4KIUA 3RG8A 2PT6A 4G4IA 4PX5A 1S89A 3KOOA 5KU7A 1U8TA 1JG7A 1V3QE 2FZGA 4M0DA 5JCXA 3G7UA 2OKCA 1K75A 3TLAA 5L7WA 4B33A 3A9SA 2H9AA 2VUUA 2C5LA 3SVLA 5FBQB 3TDKA 1B6RA 1LF5A 3D1LA 3FJ1A 4Z3OA 1EFCA 3V4FA 2CHUA 2ZE6A 1SD5A 1QK5A 2WP8J 1ZVVA 4NYJR 3EWAA 2WUWE 4FD2A 5EWLB 4HWTA 4P0QB 2IRWA 4CTKA 4K6FA 3H0EA 4F5WA 5JOQA 1AOXA 5ALPA 4BQIA 4ZYWA 1VLQA 1DSSG 1O58A 1QFZA 2ZZKA 3KVYA 4BZXA 3KUCA 3WOHA 1JSLA 221PA 1Z34A 3D3QA 1KIAA 4X8OA 4F3KA 3ZCSA 2FMTA 1ONBA 1OFTA 3VTKA 2JBHA 1OXMA 3RK4A 3VR5D 2DQYA 3R24A 1PQ4A 5M29A 3OIGA 3G0GA 4DMCA 2VK4A 4IXTA 1DEHA 4X94A 3VV3A 2ZM5A 1DKMA 1X38A 5CNJA 3X1KA 1RFGE 1BC5A 3IA2A 3MWYW 1SXGA 3ROXA 5CPFA 1N5DA 4DPLA 1RHJA 1RWBA 2R4UA 3AQIA 5NULA 1V6CA 5AW0A 5GMOA 4ER0A 4J9UE 2AK2A 1CR1A 1XX6A 4YDSA 1JKXA 1T13A 1Y9AA 2JPDA 4KH1A 4Y30A 1T3HA 2WAXA 3BJEA 3O47A 2CNNA 3EMVA 2EJTA 4P4SA 3RYCB 4IGFA 4DR2B 2BDUA 3KXIA 4QDXA 5IH3A 3QKSA 5A7GA 3T1OA 1IB6A 4U63A 1JIQA 1M6WA 3KVNA 5KQRA 1EX1A 1NQOA 2H2HA 3AXTA 3FVQA 3RYTC 5H9WA 1SC1A 1YONA 2XMQA 3DMPA 4LJAA 3T9AA 3UATA 3THYA 3HKCB 3JQ9C 1YHYA 4EUKA 1C9DB 1QP0A 4L6AA 1W46A 3UJPA 3QEMB 4B87A 1LSUA 5LXTF 1G21B 1BCSB 4GPIB 4AZWA 5EJ6A 4HUJA 2J3HA 3UT5B 3I6IA 2WIDA 1A97A 2F3PA 3DAFA 4LRSB 4QJ3A 3RRZA 3N2GA 1SVMA 2D00A 1WL8A 2GD6A 2JCBA 4Q1EA 1KY4A 3R7SA 5LWQA 1K7XB 5GZ6A 4LK2A 3M3DA 1OA1A 3DL2A 1MQSA 1OBHA 5I4BA 1WCWA 4RK5A 4L3OA 1J99A 2AOWA 4EUHA 2CCGA 1RXIA 1Z8HA 1WVMA 4O4LB 3KE9A 1ZD5A 1YMQA 2UYHA 1V6AA 1XL1A 3FHTA 1XD2A 2X1LA 2A57A 3FFTA 4BO9A 4PC2A 1YHNA 2PSDA 2Y2VA 4FSXA 4WBNB 1SOAA 2YHAA 4HXEB 2AEEA 2Q0HA 1M2OB 4KLZA 3RCBA 1OWMA 1ISMA 3K8ZA 2HU7A 4HFMA 3D6TB 1NJ1A 1LBSA 1E1DA 1KAHA 2XWSA 3PFBA 1EQUA 1J25A 3K5PA 3U60B 3NRCA 4BPBA 1VZ3A 1T5HX 3VZBA 3M4XA 4M0KA 3K2IA 2OB1A 4KN6A 5D7BA 4C7MA 2ENUA 2DECA 1T8YA 4L5IA 3WLMA 5M2QA 2XTAA 1VIAA 2FGKA 2GVNA 1KYTA 2WKRA 4AJ9A 4DQLA 1FYDA 2I2WA 2F1IA 2WABA 1RLMA 3B1VA 1SIBE 3KAPA 4I19A 3R3VA 4I6GA 2AJLI 2WW8A 1QFYA 2LPMA 1ODKA 3EXIA 4EUFA 1CR4A 2QAGB 3KQYA 2XADA 3GT0A 3SXUA 3VTZA 5JS6A 5BR8B 2RK6A 1NYLA 3EFHA 4LFCB 5JLJA 4NS1A 3A1CA 5J5CA 1JT9A 5JEEA 2HRRA 3DL0A 4NFLA 3E84A 4BNWA 1YRBA 3IKJA 2OVFA 1CETA 3ZQJA 1TECE 1Y9EA 4X20B 1AMOA 2P41A 4IXWA 3HHEA 4F8JA 5K6AA 3PUIA 5EIHA 3DDOA 3DTYA 4NZYA 2YBDA 1U8EA 5I7EA 4DTIA 2VHQA 2B8NA 3PBKA 3TOXA 4P98A 4Q9DA 1FU4A 1HRDA 3QPVA 4OQNA 2VSQA 3MRTA 3JQ6A 1MH9A 1QKJA 3UK6A 1XDGA 1KJ8A 3TLCA 4GIBA 1PBTA 1KI3A 1SBNE 2VYNA 1SK8A 3BSYA 2X6QA 1E9RA 3GT7A 1X7YA 2J6IA 2ODAA 3OT4A 1G8JA 1Z6GA 4GM0A 4FNGA 4PGAA 3UJHA 3VR6A 1FIUA 3SR0A 4OCZA 3CLKA 3WQRA 1XO1A 4E08A 5CK4A 3W2HA 3LCVB 4JJ8A 4KAFA 1QHGA 3GOQA 4F45A 5LP6B 2H92A 2I0FA 1AGXA 3NJRA 4IDPA 4K2AA 2JFVA 5E8JA 1IWOA 5BNTA 5C2JB 5C1OA 1A9XB 1T8WA 3D4NA 3L7BA 4TTSA 3ZEAA 4F4UA 3THWB 2VUSA 1P3Y1 4FYKA 4QT4A 3FYDA 2H4FA 4BAGA 4FFWA 1GQRA 3ZKAA 4HLDA 4BV3A 1ZRMA 3BTSA 3T7EA 4ENQA 4BJ6A 4KLAA 1I5EA 1XZAA 3GZNB 3HB0A 1U3GA 1YAHA 1X7DA 1JDJA 1DADA 3LFUA 3LVFO 4EKGA 2RGYA 1F9EA 4KN5A 4E5SA 2B21A 1U80A 4ZKEA 4F2DA 2VTEA 5EZYA 5KOYA 2YVAA 2QT0A 4QYIA 4M1YA 4ZVVA 2PBFA 3QBJA 4LDNA 1USGA 1IY8A 2V7UA 5TX7A 2QL7A 4EY4A 2NO0A 1ZD2P 3RLFA 3E81A 3HXMA 3HVJA 3MAGA 1UJCA 3AKEA 2IEIA 4IMRA 4O8CA 4CMBA 2ZLBA 4RPKA 1JQKA 2C7BA 4JXXA 2QTHA 5KVAA 2A1TS 1DKPA 1DBSA 2DY0A 4G0YA 4KJZA 1NBME 2ZJ0A 1HQYE 4MV3A 5DBHX 3T7DA 3HSSA 3OZDA 1TT7A 4E5KA 3HA3A 3HHPA 4MRRA 3E5NA 2NSLA 1XA4A 4C2TA 1NC1A 4F6RA 4NPAA 1UBUS 1Z6YA 4L78A 4D9KA 2AG0A 3VKFA 4QXRA 2VK1A 4RDIA 3Q3GE 1SCUA 1GPNA 3FNGA 3WYNA 4AG6A 4CTOA 4E2WA 1G64A 4FMPA 3SEFA 4V0LA 3SEAA 2IZ7A 2WM2A 2Y4NA 1NPTO 3A7EA 4CL8A 5BPFA 1QANA 5KTRA 2XNSA 2NYAA 3RUHA 3THRA 2X9VA 3UJBA 3Q7EA 4GP9A 5C3UA 1XRNA 2BCEA 2JIZD 5EUCA 2FN3A 3AOEC 3K4HA 5BSGA 1RXCA 2PX6A 1LZKA 5JAHA 5L3SA 4LYHA 1EP2B 3S2GA 2UUBB 1XXLA 4MLCA 3TR5A 2H63A 1P6QA 4O2BF 4M1WA 3ES9A 5JZBA 2DETA 3O3CA 4LBYA 2BRUA 4HPJB 2VNIA 2JFGA 2V7TA 4G25A 1LH0A 1N0VC 5GQSA 3Q8XB 3WTBA 3V4RA 2IVFA 1ORWA 4R8VA 3PXCX 1UMCB 5K8LA 1KNXA 2WAOA 4HS4A 1B0UA 4R8RA 3ROEA 3SLKA 4GXTA 2D2VA 4TT8A 1P9RA 3BA1A 4M9CA 2G07A 4R2MA 4L8YA 4L02A 5CU7A 1A27A 1FBTA 3ZZ0A 1JLLA 3DB1A 5FWXB 4PC7A 3TX2A 5HZKA 1YULA 3BSWA 3KJEA 1L5RA 4Z8YA 1XOIA 4WBSA 1N2OA 5JSZB 4RHYA 4MVJP 4X7RA 3AJAA 1QQTA 2ZBUA 3HGMA 3VU9A 4PTZA 1PE0A 5KC9A 4FC7A 1BHSA 1OXVA 1LTKA 1WKVA 3DV0A 4XVHA 4ZDWA 2FZCA 4A03A 5LLDA 2VSOA 1JWLA 1OE0A 4EGJA 1G7SA 4BVLA 3ZDRA 3D2CA 3NH9A 5KI6A 1PJ3A 2TMKA 4MW2A 4Z4QA 4RUKA 1LU9A 4O4JA 2FEOA 4UNIA 2UUCB 1H2AS 2BEVA 4Y9DA 3LFTA 1KI8A 2ZQZA 2VCHA 2EQAA 3K2QA 4PVDA 1L3BA 2OV3A 1QFSA 1FPQA 3S28A 4BRSA 1B8NA 1OBFO 1M1YA 1A8QA 1T0UA 3I2FA 3RKSA 1WXFA 2PX4A 2QAGA 2X4LA 3TLMA 4DYHA 4DNPA 2AUMA 2F55A 1TLLA 1JHQA 2YWJA 1SGWA 3CBGA 5A9TA 2CBGA 5BXYA 1OV4A 4O2AB 3EVAA 2QTCA 1X9IA 1UK6A 2G17A 4XJTA 2V7BA 1UQUA 2AJ8A 1JL3A 1TKCA 2F1KA 3GELA 3PPIA 1JSRA 4PPNA 4MP8A 5C4MA 1KGSA 1Y5LA 1HNZB 1ZEJA 5DNVA 2WSYB 1IQRA 4O4HF 1IIRA 2AI3A 5TJHA 1DCKA 2P3LA 3X3HA 3MLBA 4BEJA 1JIXA 1Z0AA 3WGKA 1PQYA 3W1VA 1V8FA 2GMWA 1SK9A 2B0CA 3DGFC 3DYIA 4RIIA 3VYWA 3ZHZA 4EF4A 4AICA 1ZLXA 2PX8A 1RQXA 4ZT2A 3D4OA 1T29A 1EM8A 2NSYA 3H8VA 1PX0A 4R1LA 4WKBA 4YAGA 4KRYA 1F1BA 1X1DA 1TMOA 3IQFA 2WVGA 3L0YA 1QS0A 4O08A 4GKVA 3JQFC 3TMAA 4BGVA 4I99A 4F96A 1U0BB 2QG9A 2FHPA 2X0RA 3K0EA 5AM0A 3BH7A 1J7JA 2WWTA 3ON5A 4JYCA 5DGTA 3TUJC 3PHJA 1J9EA 3EVTA 3VTFA 2YXBA 1CUFA 1CEYA 2MU1A 3I53A 4BP1A 4WX2B 1QMGA 3EBLA 1EP3B 2HLPA 2WHPA 3KZVA 1A9ZA 1G7TA 2V6IA 1VECA 1RE1A 2G9UA 2N9UA 1GL9B 1EIZA 2Z2XA 3BMNA 4WXMA 4E3ZA 2FF5A 4KXNA 4BB9A 2NUTB 1T5TA 5AVQA 2VJMA 2Q0XA 1I1NA 3DV9A 4FQ5A 4IQFA 4UQPA 1U4OA 5LDGA 3V7WA 4ZMBA 5BRNA 5H3HA 4YPFA 1E2HA 1LDEA 3ZPXA 5JXJA 2PGOA 1XDUA 2MSDB 2WFAA 4W6ZA 1Q1NA 1EE2A 1J0DA 2N75A 1RAGA 1YA6A 1NLYA 2CLLB 4G5FA 1RYFA 4IIHA 2XBMA 3IBFA 4GU5A 2GILA 3MYRA 2CVFA 5DNDA 1R1DA 1QB8A 2EU8A 4BQRA 3U0BA 1JQEA 1YMVA 3A05A 2JFYA 3DAYA 3CX8A 5B6IA 3BB4A 4MVJH 4OP2A 3WK9A 4FUTA 4K9OA 2IW1A 3UV3A 4PCVA 1AUOA 5A9SB 2QU8A 4PXSA 4FNAA 1UZLA 3C0KA 4G8DA 2M6KA 4XWGA 1Z38A 2BZGA 4URUR 3GJXC 3QWFA 1O3YA 4JWTA 1RKQA 2IZZA 5FL7A 5DNCA 5EUQB 2FWPA 3HA2A 3DQQA 4NC9A 5DI9A 1AO0A 3NVAA 5AHWA 2QN1A 3FF4A 1SHUX 4RA9A 4NPCA 3CSSA 4FKBA 4URZR 5M5BA 5J4VA 4ISBA 4QJIA 2O8EB 2Y3IA 2QD1A 1UP4A 3OTIA 1BS2A 3TJMA 1SO8A 4TSFD 4N0PA 2CB9A 4QUKA 3O73A 1UKEA 1PJAA 1DKOA 3OF2A 5MFPA 4XPIB 4E11A 1U6JA 4NX2A 5CX1B 1C0KA 2AFHA 1YDWA 3EPPA 4DE5A 2HH9A 1HYHA 5HCNA 3W3ZB 2AZTA 4HS9A 4UBJA 1Y9DA 4FS8A 4HN2A 4I14A 5K6RA 4ECAA 4GGOA 3QZUA 1VCMA 1YKSA 2NVOA 3TRIA 3KPVA 4HDRA 3V8MA 4CIXA 4NCJA 5TR9A 5BN4A 4BNDB 4LMPA 4ROSA 4JDPA 1MZPA 2VIIA 1FEZA 3DH0A 2W9XA 1M0WA 2PRKA 1RPNA 4XDGA 1PWHA 1AQ6A 721PA 1HZZC 2JJ1A 2JI6A 4IOMA 4FZJA 3PSHA 1R6TA 2JKZA 3F46A 3LK7A 4C2UA 3AEQA 5C7OO 5CW2A 3R6GA 2ZYSA 1ZUIA 2FPIA 1XZBA 5ALLA 1KVUA 2X7JA 3WLRA 3SZ3A 1IAQA 1CK4A 3I2JA 1QOZA 4DA7A 5AWFC 4RLQA 2HTFA 3UMCA 1H5NA 5AKXA 3NCTA 4ZCIA 4YACA 1CDEA 1M1XB 4F9GA 5CB4A 3RIMA 4UDOA 2P3OA 1KO7A 4WD3A 3VR1A 2WUFA 3H9EO 1V47A 2HDNB 5EXSA 5JWHA 5IUNC 4HI0E 4C6HA 2ZAGA 3TSWA 2QM0A 1K4KA 4G4JA 4WCFB 3BUSA 1FYFA 2GZSA 1U8AA 1W47A 4Q66C 3KBBA 5CFPA 2R6DA 2Z0MA 4PG5A 1M5UA 3I9V6 3L7IA 4PBSA 1VP3A 1W88B 2QLBA 3NALA 1QIMA 3QK7A 5IXYA 3LZCA 3K9WA 5A0FA 1NP6A 3P9SA 2FZ5A 3UCEA 1NF3A 3E7FA 5IASA 5BT9A 4ZN6A 2YJNA 5TE9A 4F4JA 5F76A 1K7YA 4OKSA 4LZZA 4E1BA 2A5JA 4HEA6 4Q0MA 5F7OA 3TQOA 5I5EA 4UHKA 4L2IA 4A8JA 3HCEA 5SY4A 2PZAA 3T38A 1HT0A 1F0NA 4C6RA 5PNTA 1Z33A 2DPLA 4OKIA 4IDNA 4DRZA 1I4OA 2IYOA 4EG0A 3NBZC 1PDVA 4IZOA 4RMIA 3T0GA 5IFKA 1DRJA 3I58A 2VQDA 3AVQA 1CY6A 5CUQA 1H42A 3OPNA 2IODA 1RYEA 2Y1KA 4X1YB 1QH8B 3NTXA 2XZDA 3PXEA 4B7XA 3K1YA 4C2BA 3R5TA 1NYTA 2PBLA 3EIOA 4MHSA 1PYDA 3ISTA 3M6WA 2RMKA 5JALA 2AFIA 1GEGA 2FKNA 1XZFA 3EASA 4K6OA 4YCSA 4ZI7A 4O2BB 1DEXA 1V9SA 4MYUA 1KU0A 3O4RA 2QRVA 5I4KA 2ZVQX 3BE4A 4CV3A 1BX1A 1T3SA 3KOXA 2MR6A 2BKAA 2P0AA 3JATB 4TLEA 5E9AA 2VRBA 1R12A 1ESDA 3URMA 5HRAA 4JR1A 1PS0A 1WW3A 4KQXA 1H22A 2NU8A 2UU9B 1LX6A 3L4SO 4L51A 4N54A 1ZK0A 1EKXA 4DJEC 1E1MA 4GXQA 4JL6A 3T4UA 4RTNA 1L5SA 1LFDB 4CFZA 1SXJB 3T34A 4LOKA 3D7SA 1T3TA 2D1RA 4HWGA 1KC1A 2Y1OA 2YOHA 3W8DA 4BMVA 4X62B 2HBZA 3QXCA 3LUHA 1AKUA 1R3DA 4BJ1A 4CW7A 2V8BA 4H3VA 2XRYA 3FTDA 4E3WA 5I5GA 1X13A 4XYEA 1MH1A 4ALJA 3EWIA 5J59A 1QGUB 1GNSA 2RHMA 4LRTB 2HAEA 1SCDA 2H5IA 2P9HA 2QVCA 4QAQA 4JNKA 5JZOA 3T7KA 1G16A 2G9ZA 1H6BA 2J41A 2VYND 1XZQA 3ADKA 5F1OA 2WHEA 1CU1A 1FRQA 2QD3A 4CBVA 2G4CA 2H0QA 2J33A 1QZ3A 3R0XA 4I3GA 4R2JA 1K66A 4U02A 1Q77A 3KYBA 4AULA 2VHZA 4M99A 4DDTA 1UJBA 4DQ0A 2A0YA 3IHLA 2CYCA 1G42A 2NTEA 2JA2A 1OWOA 3CKYA 4PZDA 1C1DA 1HDYA 2ZATA 4RGVA 4XFDA 1GZDA 4D0NA 1SQ5A 4A2CA 3GLFE 3CUWA 3WDMA 1HNWB 5ALXA 2BGKA 1BDBA 2A5FA 4L4ZA 4ZDIA 3CEAA 3R6WA 1RYMA 3QUCA 1EFVB 3BOSA 4X8MA 5MN5A 3OD5A 4CGZA 1NMQA 1KRHA 2CK3A 1MC4A 2JAHA 4P92A 1NNEA 2JLCA 4FZRA 2ATVA 3CZPA 1CR6A 3R3SA 3TEFA 4AK9A 4D81A 5U9CA 3R74A 1DTWB 1NXSA 4RTOA 5DH9A 1WABA 2GYWA 2NAPA 1Z88A 3E18A 4GI2A 4EG4A 4KB5A 2CYAA 1RKBA 2EW1A 1DTEA 1DXYA 5DM4A 5FO1A 4PPFA 2HJSA 3A26A 1L7OA 1SXJD 4G2TA 4TSRA 5LOVF 3VU3A 1Z73A 2DTXA 2PFSA 2HWWA 5EE3A 4ESEA 4RZQA 1XDDA 4AG5A 4YMGA 1CZNA 4ZJZA 4CG0A 1VE6A 1ZCBA 4FFMA 4FFDA 1IRIA 3W9UA 2Q29A 3FWYA 2QLNA 3OETA 2AQIA 4DCUA 1NR5A 3TVYA 4J8PA 5C81A 3W5AA 1QNFA 1XQ6A 2XMCA 3CBQA 2GBFA 4GVPA 2ZRCA 5ALOA 1MLDA 4GBGA 2R6ZA 3V7NA 1VQ1A 4C14A 1MPXA 3RSCA 2C3PA 1VG0B 1JMVA 2JF0A 4GVXA 3RASA 1JSCA 1QZTA 3NIFB 4F8YA 2FX2A 2OPHA 1SD1A 4GC5A 3AEQB 4J0DA 1WP9A 2PMFA 4HRAA 4NCBA 1ZD8A 1KORA 2A9VA 3G2JA 3AI7A 4ZGWA 4JBHA 2ONYA 4NU5A 3OCVA 1F4LA 1YRWA 3VJLA 3CH6A 1XNGA 3GAMA 5C7YA 4OKNA 5DU2A 5I8WA 4MSUA 2ZI6A 1YS7A 1JHUA 2GBGA 3MJTA 3PWSA 1XTPA 1J42A 1EVIA 1GZ3A 1NV9A 1ZL2A 2CXXA 1YI0A 2BISA 2Q6VA 4REQB 2QSUA 3WBJA 3WR5A 4BGIA 2C2WA 3DEZA 1U9IC 1BXZA 1UQTA 4NATA 3U44A 4TS9A 1L1EA 1Y8RB 1Y7TA 2YMLA 2C59A 5AQEA 1E8NA 1RAIA 2VTVA 1V3UA 4FYPA 4BP8A 5K3BA 1YBHA 4BV9A 1MABB 4UFNA 3BD7A 4ZQCB 2LDBA 2DTEA 3AEKB 4WSOA 1MA0A 1OI4A 1AB5A 3V48A 1YRYE 2B6NA 3LM8A 1IONA 3AG6A 4X1IA 5IM4F 4AZVA 5IHXA 2QRUA 3IUSA 2H29A 2ZVPX 5HJ2A 5T67A 5JBNA 2MJLA 3H75A 2GZAA 1JEEA 1LPAB 1OROA 1Z56C 2P68A 2ZTMA 4MGIR 4OPMA 1A5AB 2F48A 1IXYA 3HKBA 3JQ8B 3MLEA 5HE9A 3OQPA 3U5ZB 2FR0A 1CF4A 3CGGA 4PZCA 2AJBA 3MT9A 1E9SA 1E6KA 2Z8YA 3LX8A 4CLOA 1SEPA 2HHJA 5JASA 1ZUNA 1MFZA 4RKFA 4TQ9A 4DBLC 4TL8A 4OQLA 1FYEA 1TOAA 1N5KA 1Y3AA 2P69A 2WF5A 2OBNA 4UEKA 3V8PA 3DDWA 4DG5A 1ZD9A 4CR7A 2KBFA 3K0AA 1ZWKA 1XN1A 1UJ2A 1Y3CE 2Z4SA 2WYWA 1EWKA 5CDFE 2IZ5A 3CX4A 1JDVA 3W90A 3AM3A 4KQ1A 1GL7A 4R69A 2J6BA 3AV0B 4EUNA 3HDQA 4X60A 3UWDA 1CUHA 1NDUA 3WOVA 4C4SA 4ZOLB 1LJ8A 2H1WA 2VBCA 2OA0A 2Z4TA 1VYHA 1CZUA 2BE9A 3IELA 2AT1A 3VAYA 3OWHA 1M7GA 3OE4A 4IBOA 3DEHA 3NFRA 4J0QA 3NU1A 4DY6A 5EJ4A 3T0FA 1PI3A 3JWJA 1GZ7A 3HJFA 3GVHA 1QPBA 5AVYA 3KPWA 4OHMA 3PENA 1Y0BA 5HKKD 4A2QA 5JT1A 1FDTA 1DQSA 3HWX1 4DSOA 1E77A 1P45A 5E4TA 4ZQFA 1TGYA 1X0VA 4AG3A 1RXVA 4C0BA 2AW5A 2MYTA 3WQBA 1M34A 4TTTS 1RCUA 2J4DA 2JFQA 5G3YA 5DM60 3ILXA 5CGQB 1M8JA 2CV0A 1W5FA 3SSOA 7MDHA 4UM8B 1YOVA 2GT1A 3EGDA 1YS9A 2AFHE 1W49A 3QI2A 1M7BA 5FOVA 3PDIA 3ZDBA 2AC2A 1UBMS 4J16A 2B4YA 3ZWOA 1SXJA 2CHFA 3DE0X 3FA2A 3AGPA 3DTVA 2V1XA 2QR3A 4AQDA 3CPJB 3A9WA 3O4JA 5A3RA 1XMVA 2I67A 2NU7B 3MRVA 1EBUA 4Q16A 4RBNA 4K9RA 5E2BA 4EH1A 5IK2D 2CYBA 2IP2A 2MOKA 1U8CB 2YASA 3JQBC 3L1IA 1RBZA 3R1IA 4HCJA 5G0SA 4XRRA 4X0EA 5AR1A 3O4GA 4PZ9A 1X19A 2QRMA 821PA 4Z49A 5FBHA 1E1YA 1KQPA 2Q3MA 1TA0A 2GD1O 2H2GA 2WJHA 3GRVA 2OY0A 1VIMA 2FRDC 3RWMB 1D3AA 1Q20A 2CVOA 1VL2A 3LQFA 3OH8A 5BSRA 4W5RA 1H2YA 3SK0A 4ABTA 1OFGA 1BWPA 1GTZA 2EFYA 2OV4A 4ZU1X 5T4BA 3N0VA 2DUWA 4JP3A 1SKQA 2OCIA 3Q41A 2YJ5A 3OCJA 1MORA 2GO1A 4UUPA 2Q27A 4Y0NA 3ZG6A 1HETA 1KSJA 2XV1A 4YS6A 3QX8A 2W83A 2WU0A 3CISA 4NZPA 3DAGA 5FA6A 1R7RA 2NZ8A 1NBEA 3WGIA 2QYTA 2TS1A 4TWZA 1V4NA 5AW6A 1BQEA 3ZCTA 3A3KA 1U7HA 3GRUA 4CKXA 1XNRB 2DG2A 1V37A 3NR2A 1CJCA 4Z53A 3BIXA 2IV3A 4N9WA 3CB4A 3TD9A 2JFPA 1JPVA 1DNPA 2IYAA 3I5YA 3D0QA 1P6XA 3IB3A 2R87A 4GWGA 2NU9B 1FUIA 2IU3A 3KHUA 4OAPA 4CQLA 2DFNA 5JS7A 1TF2A 4XWTA 1KEZA 1TQ2A 2IBMA 2P65A 3OLVA 1W19A 2QN7A 3QIAA 2PJZA 5ICEA 3ZDAA 3EZ6A 4J94A 4CCYA 3V8VA 4H18A 1WR8A 3RS0A 4JYMA 3ICVA 3WDKA 1DIOB 1NLMA 1W36D 2I2FA 1GNRA 4ASUD 4CU5A 3K9FC 1UEJA 3IOBA 4HBGA 3B8EA 1A2OA 4HQFA 1S2NA 3G6KA 1LS6A 4MQ6A 3HN6A 2HXGA 4MI1A 1ZGCA 3GMTA 2VXOA 4X93A 2RAUA 2XX3A 4LSZA 1PTJC 2ZRDA 1P3DA 3KWMA 3N8KA 3T15A 5JVDA 1NXOA 5JARA 2QEQA 4IXDA 3G88A 4MYRA 3U4AA 4ZYZA 1PD0A 4MLZA 2QW1A 3VJRA 1SHJA 1ABFA 1ECGA 1U28C 4G65A 3ODGA 4CJXA 3TF5A 2V3WA 2ZRJA 1SB9A 4FIDA 4RJ2A 2XWBF 1GNQA 3KXDA 5EXPA 4N0DA 4HWRA 4QU8A 3AUUA 4NU8X 4G56A 4NE9A 4NMXB 4PICA 5CK5A 4HTAA 2GEDA 4HDNA 1GU7A 5HRCA 3C39A 3NYWA 3GN2A 5C37A 3UUWA 5E1MA 4YXFA 1HDRA 1V1MA 2H18A 4K9MA 3IDAA 2WWVD 2W6CX 4RMNA 4NMMA 5CIQA 3T41A 3MC1A 4BFYA 3WKDA 3ROPA 4PAOA 4EYEA 2VP9A 2NZYA 1WBJB 1P62B 4LJRA 4D6YA 1H8HA 5G41A 3A1VA 3IP8A 2B35A 2ZUBA 3OJEA 4KRFA 1UAYA 4HADA 4DREA 3IMKA 1KBOA 1F3LA 3QLEA 2AC7A 2WMNB 3CT4A 2FPGB 1HLDA 2Y76A 4ERNA 1DRWA 1O08A 2Q0QA 1RXWA 5J23A 1MN6A 3N0TA 3GYBA 1UKAA 1E3SA 1VSBA 4X63A 1M0EA 2QTGA 3IODA 4YRJA 4CCSA 3VI3B 3A4MA 2ET6A 3PXUA 1FRZA 2F1RA 2FWMX 3Q6MA 5KHOC 1J1IA 4KC0A 2GJKA 3F7MA 5EXXA 4CLRB 3R3JA 1QWSA 2HFKA 1N6NA 2ZRIA 3HB1A 1VKRA 4JBGA 4X7MA 1KSGA 2O5RA 1SPBS 4S1OA 3T12A 4CPDA 2FXVA 1G6OA 1QZXA 3NC1C 4W9NA 4RFLA 3R7FA 4I55A 3BZBA 4AIRA 4G67A 2GEFA 4LYAA 1LPPA 1NQVA 2HM7A 2Z2IA 3ELYA 1XQWA 1UH5A 2ZG6A 5DSTA 3GPBA 4H0CA 5AKHA 3PXGA 4CKYA 4MUJA 4Z4GA 1AZTA 2JVIA 1M6HA 3EDQA 3B1KA 5ITZB 3UWOA 3MWJA 1TVCA 3BH6A 2QUJA 4HNHA 4E4TA 5LYYA 3TRHA 1SEVA 1C0IA 1BSVA 1HTWA 1OV6A 5FL7D 1M10A 1WDWB 4BRWA 3EQ2A 4NNPA 3QXJA 1YZTA 4BNGA 4MYHA 1AUVA 2VWPA 3Q87B 4RKYA 2CLCX 2M2IA 2R60A 3JASB 2ZSJA 3M9XA 4J0KA 1PD1A 4LGCA 5EI5A 5JNVA 5HXAA 4OBEA 4PU0A 1H0RA 4X9XA 5KREA 1RYBA 4DEVA 1VIYA 2QOEA 4N8EA 3ZJYA 5AKEA 4DRXA 3TPCA 1TUBA 5BOVA 3GH3A 4ZU3A 4EP1A 1XLTC 1CQJA 1IULA 4OFBA 2HPAA 3WKCA 3M2PA 3AESA 1QMPA 5TSDA 2I80A 5A5FA 5KKAA 1EXMA 1AKYA 3OCCA 2ZPAA 1VDZA 4BAZA 4TV8A 5AXBA 1V95A 3D4BA 3NHKA 1ISHA 1WSWA 4KIJA 1E2MA 3QVUA 3H1AA 5DYTA 5A03A 3IAAA 4EFMA 2H1FA 3ID6C 4ID3A 5EE0A 1E5XA 1M66A 3R5SA 2FJ0A 1HDXA 3FLEA 3QENA 1YACA 3QU9A 4DHWA 4FGSA 4DTCA 4JYZA 3AHEA 3MGBA 3AVYA 4YAWA 4EMSA 2XDQA 2Z5VA 2NADA 1EMDA 4O0MA 5E7IA 3Q4GA 3GYGA 5K20A 2G0AA 2ZDGA 3IQHX 5A6VA 5LU8A 3BTUA 3VR5H 4JJ7A 1ISSA 4H4EA 2DB3A 4BGUA 4QWMA 5CTJA 1DBRA 1UWVA 4KYIB 4PCAA 1C4XA 4IGKA 4EB6A 4LXQA 2PL1A 3HB5X 4HWKA 3X1ZA 1FDIA 1Y3BE 4W7SA 4XEHA 1C29B 4FOOA 5KHLB 3PF8A 4R9VA 1CYDA 2ISCA 4XTCS 1R6AA 1ZBQA 3W79A 2XOKA 5KTSA 1E4EA 1ORVA 3IQXA 2VHTA 3JARB 5LPNA 2KS6A 3CUVA 3TOCA 2YTZA 1O77A 3QV2A 1PK9A 1JWBB 3PD7A 5TMDA 2BH9A 1PZXA 3E7DA 4I8IA 3RNOA 2P27A 2FP4A 2QRLA 3RREA 4DS3A 4HLUA 1PT6A 4TXJA 4C0LA 1PVDA 2GM5A 1B0AA 2W2OA 3D6AA 5JEDA 1DJMA 4WCFC 4CKBB 4CCYB 1DFIA 3K0CA 3EEQA 2FOIA 3VNBA 3S27A 5K8TA 4YJ2F 4JOSA 2EKLA 5BQ5A 3VPFA 3DHNA 3VA7A 1MB2A 1XNJA 5B57C 1FPMA 2GBLA 2D4HA 2JCSA 3KOMA 1HDIA 4MWBA 3SICE 3G5TA 2XMSA 2HHCA 5B36A 4W9NC 1HI9A 2EL9A 4I8XA 4RHCA 1GCOA 4WZ6A 5LDHA 5KYXB 3GDOA 4KLNA 5JIBA 2BFBA 2OPBA 1A5SB 3MWLA 1XEAA 3QW4B 4E31A 1IY2A 1KMIY 2ANCA 2C9DA 3C8DA 3FGZA 4GOJA 3K4QA 1H8EA 4Q9KA 3JVIA 5CXSA 4RIGA 1P4SA 3T3EA 3DT6A 1UXHA 3WWOA 4HB4A 4UFPA 2DBVO 8ADHA 1V26A 1JG1A 3LY9A 5C1PA 1CZRA 3HP1A 1D6MA 3NAMA 2LCQA 5IFLA 4WPGA 4Z99A 4I1UA 3HO6A 1WMSA 5EP3A 3NHPA 6YASA 4W5TA 4YCDA 1HF3A 4DJ5X 4A0FA 5H81A 1BRMA 4QBHA 4WNCA 5IANA 4HFRA 2P3SA 1ZI6A 5EHIA 1KDPA 3MOIA 3N86A 4UEQA 1DQNA 1GQFA 1P44A 4PM4A 4U3JA 2OBYA 2BTQA 2HU5A 3SD7A 4DSZA 3HJNA 3STHA 2PTHA 3R0IA 4B09A 3RUIA 1KO1A 2C29D 2JVKA 3A36A 2A9RA 3EAQA 3NOQA 5DRTA 3VR3A 3I2HA 5EJ2A 1NU8A 4US0R 5EHGA 5DSZA 3IAHA 3OX2A 1Z13A 1JMYA 2WICA 5HSGA 4P1ZA 3AP3A 1KK1A 3O83A 5BYJA 2VSNA 3T5BA 3KLMX 2ZBEA 1YZGA 4O59O 5L8VA 5KYXA 3H5VA 1GU1A 5F7ZA 4KHPB 3HQ4O 3Q8MA 3ZGXA 4V0RA 3Q8LA 1R9MA 2ZIGA 5HKKA 4BX0A 4LQCA 1LWNA 1VMAA 1RWVA 4M89A 3QG1A 3WLQA 4V1CI 3PI6A 1KYXA 1VBKA 2Z57A 3SAJA 5E1OA 2CLOB 3K32A 1Q11A 2VHWA 1XG5A 2ADFA 2XNDA 5CHYA 3TAUA 4B79A 5A71A 5HF5A 2BFFA 4M7WA 1GG5A 1GTJ1 3SQNA 3ANTA 3EY9A 5JPIA 1SUEA 2O8DB 1Q1EA 2V4ZA 5HCUA 1I36A 1PF7E 2L69A 3WK8A 2C78A 3ESAA 4BKUA 4BVAA 2J09A 3F8TA 5DM0A 3PFKA 2NUPA 2V9CA 3HU2A 4IOLA 4BLVA 3UXHA 1H66A 1MQAA 5LA6F 4G86A 5AK4A 1QHFA 3H86A 1PUIA 1UMBA 3HJCA 4WADA 4DUZB 1CQZA 2L17A 1XCBA 4Q7EA 4YNBA 4BLTA 1W52X 3CZAA 3UJ3X 2ZYWX 3BTOA 2UUPA 2GPJA 3JD4A 4KVFA 2AUNA 3MELA 1ML4A 4MEAA 1NVEA 5FI3A 2J6CA 2YBEA 3UM9A 2E21A 2FE4A 1V8BA 1IPEA 1YJQA 3L0BA 3ZCPA 3KYDB 4ZJUA 3WMGA 3LYLA 2IOHA 3IR5A 4P83A 5ITSA 2RGCA 3SOPA 3VNQA 3DULA 4JEMA 3T35A 1NAHA 4RD0A 3SF8B 5GONF 1G9TA 3W2EA 4CUJA 5ADUS 1E3MA 3NDJA 3NKLA 2RHDA 1CIVA 1U0TA 2JGFA 3ITNA 4I50A 3C45A 5HDQA 4C89A 2FMUA 5CXQA 3WS7A 5KEIA 3INRA 2GI4A 3L8CA 5F2OA 5HRUA 1NXVA 2HMWA 2GWHA 4JJKA 4JZKA 4WBNF 2ID7A 1QHHB 4PIVA 3M4NA 2Z09A 4DOMA 4EHFA 2HSZA 2VF4X 3VYSB 1FW8A 1E3DA 1PWZA 1RZRA 3FTPA 2IQ5A 2GFIA 1J23A 3G82C 3OZCA 5BNFA 5KYUA 4C06A 2PJDA 4D9EA 2X5OA 3N5KA 5EJGA 1OLSB 1B7GO 1FFGA 5L4NA 3WSWA 3PHHA 2EX0A 2H52A 5IXSA 3PEFA 3M1AA 2J7PD 4L50A 3RAEC 4GOND 2QUBA 3GG9A 3HK2A 3G0IA 4GI7A 5KJCA 4I1PA 2Z6QA 3AM1A 4QOGA 4QD3A 1ICEA 5J2UF 1YB7A 5IBRA 3OFKA 5EZ6B 2I29A 4Q4AB 3DA8A 1H85A 3W3AH 4IMPA 3T1TA 2R68A 4J0IA 1SBYA 1DC8A 1XZMA 5AJYA 2R47A 3KLBA 5M3BA 3ZV3A 2FSGA 3GY0A 1GPUA 3TXYA 3NWEA 2P4SA 3WMWA 2NVBA 3GI1A 3ZQKA 1SKBA 3PNSA 2WTAA 4Z5XA 1WMDA 2C99A 4M76B 3D2BA 3W5VA 1FVFA 2DBYA 4QM7A 4IDBA 1HOXA 2KWIA 1HEIA 4OMUA 1BHQ1 5DP2A 3WRYA 3JRWA 3CWZA 4CETA 1T4MA 5LIRA 1JKIA 4ZDJA 2G9RA 2OT3B 1SHZA 5TPWA 4RHXA 4QLBA 1GAEO 1CERA 5EJ7A 4IX9A 2HOQA 3OZUA 3EG9A 4YJ3A 1JNXX 3WL5A 2HPHA 1BYIA 4RTPA 1CRQA 2EG5A 3CEHA 3S2EA 1O7JA 3C3MA 1Z45A 2C2HA 3DOIA 3L8MA 3RHSA 4BE9A 2OQVA 2JDID 5LQRA 2VPTA 4TKVA 1EE9A 3FNQA 4M88A 1MHPA 2JGMA 1GPYA 1QX3A 2CLHB 2FFJA 3BSSA 4Y1FA 3VOBA 1PS9A 3DKKA 3VVBA 2BWJA 3D59A 1U99A 4WZBB 3PNLA 2BR3A 4BP3A 1JQLB 2HADA 1P1KA 3KQWA 4O3FA 1PLKA 3EVEA 4IS2A 1ECCA 3GT4A 4PGGA 5KO2A 1G7CA 1X8XA 3D64A 3EA4A 5AVJA 2CFCA 1SOVA 2WF6A 3E9ZA 4JOCA 2A94A 1K3FA 2DUNA 2E4VA 2ZSHA 4DM7A 2QTTA 2QY9A 2DGDA 2PO5A 4P35A 4BNIA 5J2TA 1PZNA 3EGXB 4X7BA 4QJBA 5CT8A 3WBBA 5AI9A 4I3FA 4ZVRA 4U9UA 2GF2A 5JBIA 1JHAA 3PICA 1MIOA 1LZLA 4PANA 4X1OA 3H3JA 1JEAA 1DARA 5HFNA 4P3PA 4K7JA 4JJFA 1B15A 1W6RA 1GKIA 4HMOA 5BSTA 4IYRA 2Q3BA 1ABBA 3P45A 4QBKA 3B36A 1DI0A 5ALKA 3LKDA 3QF7A 5MDHA 1IZ7A 4MW9A 2H4ZA 3HV2A 1KQFA 1YVDA 4QOEA 3K9GA 3HR4A 1XLTA 1IUNA 4Y18A 1TO2E 4YCLA 2I99A 2BFEA 3A6EA 4Q9NA 1WU7A 1Q0RA 4RVDA 3ILHA 5LMNB 3L9XA 4RXUA 8MHTA 3VUEA 5LZ9A 4YYZA 4F56A 4HNRA 2YWCA 3L84A 3I05A 1EGMB 4LWPA 3VKHA 1IU9A 1J4AA 1ODSA 1XYVA 2AXPA 2R96A 3EDMA 4V02A 4WXRA 2HK9A 5LDDC 4EHHA 4B3GA 3O9ZA 4R8MA 5GIOE 4UPVA 1JQBA 4X1KB 1IH8A 3MTDA 5FI5A 3BILA 3LQ4A 1M0SA 4DR3B 1Q1QA 1AZLA 3IAFA 1RAEA 2SCUB 3TGPA 3L6BA 3O6VA 4NNJA 3ASUA 1F8UA 1I4LD 1KH2A 3FKJA 2WDZA 4BBAA 1VPEA 2OGWA 1DUSA 2AXNA 4D80A 4ZTUB 3KAQA 3BRWD 5ED4A 2VRNA 2J3MA 4KL8S 3I52A 1QNLA 4WBNA 4FT2A 3DCIA 2IP1A 1S01A 1DOHA 2VFAA 3QJ5A 4JWKA 1RP1A 1KY3A 4V3CA 3W4IA 1P75A 4B7AA 4U5QA 4QT0A 2HHHB 1W1WA 5THKA 4CG2A 4LXXA 4MVWA 4U7PB 4LXIA 2RI1A 2W42A 2XKAA 4EFLA 1J2RA 1O8CA 2O57A 3QPBA 4JFRA 4RY0A 3DZCA 1SVWA 1GZSA 3VHRA 1MX1A 3D6UA 1B1AA 2IHTA 2YXLA 3INTA 4ZRDA 3ZW8A 3QF4B 1MV8A 1BEZA 2WM8A 1OLUB 4LX0A 2ZJAA 5K3CA 4LZOA 1NYQA 2WM9B 3B6EA 1OU4A 2C1ZA 2HLDD 1EHCA 4QGGA 3ZIUA 5JY6A 2WHPB 4AYXA 2AN9A 1QOPB 4F2GA 1NASA 5KNDH 4ARCA 3DTVB 5BOSB 4OA8A 4OSEA 4K03A 2CNWA 1T3GA 4B5LA 5IZCA 2OE2A 3W3AA 1SKYE 5B30A 3GP3A 2G82A 1KAMA 2G9VA 3JQAB 5J4YA 5DNAA 3WC4A 3A4TA 5IDQA 3OM9A 3SY8A 4G0ZA 2I76A 2JGEA 3IKVA 2DPHA 3QWHA 1N8TA 3NHZA 2HSWA 4Q1AA 4IMIB 4BO2A 4N7MA 5DZSA 3UZUA 3KOUA 1O0CA 3HJBA 4D92A 3FFAA 2A88A 1YDMA 3KV1A 3TINA 2Z5FA 2PL9A 4MWCA 1G0NA 1UXIA 3ST7A 1U2EA 5TQ2A 1GG2A 2ECKA 2GPNA 3GROA 1ZDMA 1MAWA 1GFSA 5DGDA 3UJNA 3KFVA 4DC0A 4M8LA 3RIYA 3WLIA 1WV0A 3GUVA 4XCQA 4A4DA 2IHKA 4S1NA 4YHBA 2C42A 4ZVTA 1KDOA 3LUFA 3EJ6A 3GVPA 3PFGA 2L42A 1YJ5A 3L7AA 4TS1A 3WYCA 1NW5A 4I1SA 3QP9A 2XE8A 4HO1X 2REQB 2YVLA 2JGNA 1C50A 1M1NA 4PQEA 1AKWA 4Y2QA 2OXRA 4HZIA 4DR1B 4CL0A 2OAP1 4OB8A 3DD5A 4QO7A 5BOSA 1XHFA 3AVPA 3LC0A 2JA1A 3COPA 1L7XA 4HRYA 1U02A 1FC0A 4BLSA 1HE8B 4Q4AA 1EFLA 3S7ZA 3PC8A 1JZQA 1L7BA 3G5LA 4FW9A 1SKUA 2XUHA 3MGGA 3IV6A 1HYQA 4UFOA 3MOSA 4KDCA 3T7JA 5E0OA 3TNJA 3OEHA 2XE7A 1N0UA 2ODPA 3A1NA 3WGGA 1H3NA 3UJ7A 2DY1A 1TT5A 3N2KB 4X61A 4RHEA 2XB8A 1K6JA 4K46A 3ABQB 2Z2YA 2WD7A 1GGFA 2V97A 3I1YA 3LVQE 5MHTA 1KOLA 4EJFA 4H6PA 4JUAA 1YQQA 5LZ7A 2VHXA 5EZ5A 1BNCA 2G40A 3UGQA 3V1MA 4TMWA 3W7BA 2JH3A 3E58A 3F5MA 3KSUA 3UG6A 1ZZEA 1BCRA 5BQOA 5K99A 4BC0A 3BMQB 2PAAA 1QQ7A 4H6WA 2YCBA 5AOVA 4CNBA 3EVBA 3LPCA 3CONA 4MQ5A 5G02A 3GX1A 5BW5A 2FYTA 1BVRA 3O75A 3EQZA 1YIDA 5LD2C 1MIOB 5I9IA 2C7RA 1CY8A 5CT9A 2BM8A 4CEHB 1XVUA 4KDEA 1FMTA 2A6PA 2PKEA 4JLKA 5TPZD 2RHHA 4WNAB 4TRJA 3G3EA 1ZS9A 1OFHA 4GQBA 1XFDA 1ZL0A 3TL3A 1SNYA 2HD4A 3G1TA 2C7VA 4MW7A 4MJ7A 2IYYA 1KE2A 3WAKA 1GLVA 4J91A 5F9HA 2WPDA 5GOTA 3TD6A 2LKCA 3B3AA 4HGPA 4UU7A 1FJGB 4LDAA 1P1IA 2VJAA 3V4LA 3E3AA 3VYRB 4YV1A 2ZK7A 4PLGA 2AJDA 2EF0A 2PCJA 5BO5A 4FOTA 2BGLA 5A5GA 1CUSA 4YT8A 1J22A 2ZYRA 4B3XA 1EDZA 2RCYA 4LY3A 4OFZA 1UWLA 3WL8A 2QY6A 2WIAA 4L0CA 3O7WA 4JVNA 3VYTB 4ME6A 3NKVA 4EY7A 1B93A 1IM2A 2BC9A 1HPLA 1FF9A 1Y8RA 2IOQA 3D6FA 3T7CA 3UN1A 3ZNOA 2F1OA 5IMBA 2V7WA 3WWPA 4YXWD 4OSPA 1UBRS 3N2IA 1TQHA 3HFSA 3OD1A 2YJ4A 3W2IA 1XPRA 4YRRA 3N87A 1FW6A 1X2BA 1RW4A 3E2MA 3WGZA 2R79A 1UDCA 1XLUA 4QNRA 3BXFA 1JTEA 1BAPA 2GAIA 2WR8A 3D4LA 3MMXA 3IP5A 5ESDA 1A88A 1I4DD 4XPIA 1YH3A 2DWCA 2OZKA 2A59A 4YH1A 4DT1B 4M38A 2JLZA 2FWNA 2I8LA 3WNBA 4BKPA 1WXGA 3QEBZ 2VDKB 2X2OA 2X4IA 2C94A 5DE3A 5DPMA 4E5YA 5IKXA 1EK1A 2IUEA 4P3NA 4JEHA 5CDYA 4UEWA 1QU2A 3N8DA 3PGA1 3CMCO 5I7RA 1E9DA 1HYBA 1SB8A 3S70A 4IDHA 3DEKA 3DW3X 1X7XA 4WJKB 4EO7A 4R84A 5E3IA 5AW4A 1XPUA 3I1FA 5KWEA 2F3TA 2V98A 5LQJA 3KV3O 3WRWA 4DYVA 4LCJA 1AK2A 1YBVA 4LMBA 3AR9A 4X41A 5G4LA 2C4WA 3ZV5A 5ITVA 4IVQA 5AW5A 3ODPA 3GJTA 3R3ZA 1CJTC 4JU9A 2I6UA 2IHUA 2NACA 4M1TA 3LC2O 1JIKA 4QLAA 3U7HB 3JQ8A 2RI0A 3K15A 4NEGA 1E9BA 1R0YA 1GUDA 3H9QA 2W37A 4WESB 5AJTA 5FR1A 2OHJA 1X14A 5SY9A 4A8JC 2GPTA 2C4KA 1TVMA 4BL5A 1WMFA 5C3MA 2CSUA 1HO3A 1JHYA 1O87A 2Z2ZA 2BEVB 3CH4B 1HMYA 4P5PA 1KY5A 2ZKIA 5DBGA 1KPGA 2VDRB 2LTAA 3UAGA 1G9SA 2XMZA 4LJSA 4QASA 3JU3A 1C7ZA 5BYBA 4B47A 4F5YA 3I45A 2PO7A 4BE7B 4Y9RA 5F23A 3HFRA 1UKCA 3PVZA 5I9SA 1IY9A 3FWNA 3UOWA 2C07A 1RIFA 1Y8ZA 2FMIA 4LY6A 1RS0A 4EPWA 4S1PA 5U1PA 3EQ7A 2R44A 1JP7A 3G13A 4RGQA 1V1RA 4RL6A 1M8PA 5CT4A 4EFKA 2WYOA 1NW7A 1PSZA 3QPAA 5FJIA 1RAAA 1YIAA 2G71A 3VISA 1X0XA 3L4KA 2XYQA 3V1TC 5EHQA 4CDGA 1QIFA 4MHTA 3E22B 1U8YA 2X4GA 5BURA 4AQYB 3H2HA 2FPUA 1BH2A 3UJ8A 4G37A 4XI9A 2HT1A 1GZ6A 2EP8A 2HF9A 2K7ZA 1Z0IA 2FY8A 1YDGA 3LHDA 3R3WA 3QLUA 2IITA 2YZGA 1T3ZA 3GMIA 4G81A 1ECLA 4KQFA 3ZKWB 4D9NA 4H1WA 1GKYA 3T99A 3KKOA 5HNKA 1PG5A 2FZLA 3K1JA 4L85A 5AHOA 3DFFA 1SVNA 4U2FA 2XGGA 3KSDO 2ERXA 2PWZA 3BHNA 5J63A 3MJSA 1I3CA 3H8WA 3V4PB 2OAEA 2HSJA 2O0JA 3MQ4A 4NK4A 4M8KA 1Z17A 3A9CA 4JDUA 3FZYA 1Q84A 3D8UA 3Q3EA 2FU5C 2RGWA 3QXHA 4HB0A 1VLHA 2QMUA 4LC9A 1KKUA 1C30B 4BQFA 1H65A 2EW2A 2WAMA 3M5PA 5CYOA 4XUEA 5HQ3A 2CWDA 2VJBA 3O2SB 5H80A 4L74A 2PR7A 3A2LA 3SBOA 5LQUA 3I0NA 4M7PA 1NJ2A 1LNZA 2J0VA 5LOVB 4NFYA 2ZSDA 4QFDA 3CRQA 3WGYA 3H11A 3PUWA 2WU3A 2ILTA 1RLTA 1OI2A 3CF4A 4R2HA 3FIUA 1KJJA 4FOLA 2WM3A 5KBYA 1SUWA 3L43A 4LC1A 4NOJA 4L76A 2X6TA 4Q05A 4AO7A 5TMPA 5HS6A 1A7UA 3MOGA 4D0SA 1OTXA 2Y1GA 1L4MA 2EHJA 2PMCA 5I7OA 3AR7A 1B3BA 1U1FA 1XMXA 4BXOA 4HL6A 4DV5B 4KQEA 2XHEA 4U2EA 1Z7GA 5FUXA 1QO7A 5A6SA 4KK4A 3PS9A 2WV9A 4GM1A 5EQFA 3FTNA 4BMSA 4Y2UA 4UTRA 1UODA 2H6EA 2J3JA 4YAJA 4TWAA 2WUDA 2VRCA 1NVBA 1USIA 3AW9A 3OT5A 2VLIA 3DEIA 3L05A 5EP2A 5H3CA 5DN6A 2HKIA 3G85A 3JQAD 1D5WA 3I4CA 4RXTA 3ESYA 4NBRA 4DA6A 4IFEA 1SH7A 4UQOA 5ECYA 1KYQA 2DT5A 3IIIA 4MO9A 3ZBQA 4WACA 2GK6A 4V0OA 2YUTA 3RBVA 4B71A 2H59A 5DNEA 1EU1A 3UV7A 3TSAA 4X00A 2HJGA 4FYXA 1FU8A 5DM1A 5HKBA 5FLXA 1VFNA 4AJPA 5KYTA 3KTAB 1EHYA 2XSZD 3EOZA 4F0JA 1HLGA 3F7OA 4K9KA 4EA8A 2RGDA 4RHUA 2OV6A 1GFIA 1F48A 1Q91A 3WGVA 4FYVA 2VBFA 5FTLA 3DXXA 1H5QA 1RWOA 3OJFA 2EP7A 5T57A 1BJTA 1Y4UA 2V54A 3IKTA 3MSCA 1VIVA 4X97A 4CKCA 3GGDA 3LHFA 4NP6A 1H0SA 3C6KA 2IEBA 1MCZA 1PJ8A 1TTQB 2I3BA 1V5GA 4CMJA 4E7OA 4PZPA 3T1YB 2ETVA 3IT3A 1DEKA 2GM3A 1NVDA 4HFJA 4B7CA 1H2BA 3KQMA 1ARZA 1K88A 1L4EA 2FKAA 2BHTA 3B70A 3KR1A 5K3SA 1LVHA 4E15A 4HPWA 4DMHA 4KQCA 1E2QA 1T9HA 2DQZA 1X74A 3OPYI 5KAPA 4P0PB 1T6XA 1U3VA 2WKSA 3QV1A 3THSA 4MMYB 2XZOA 4KSYA 4QG7A 5CJ2A 1SRRA 1ZI8A 3THOA 4BX2A 2GN4A 3HNPA 3VSBA 1EQ2A 1OZFA 2AZDA 3L0IB 5EIOA 3KFXA 1I30A 3O1JC 1Z82A 1R0ZA 1W30A 2A0FA 3F67A 1XKXA 3E6AA 3OC6A 2A4MA 1WW8A 1G2PA 5BORA 3ESRA 4K9QA 1U0JA 5KOJA 4IGIA 1FJ2A 2AV6A 4HDKA 5ICSA 5B58C 5TLSA 3IHTA 3ER6A 5DHQA 3E05A 1ZRSA 3V2IA 3ZY6A 2MR5A 1MF7A 4Z86A 4A8JB 5FPHA 1VBNA 1IUOA 2B1RA 3BE8A 3FUVA 3EPLA 2COUA 3EYAA 3B82A 3NPAA 1T2VA 2YY5A 5TARA 2O3UA 5EYPA 3U40A 5CA1B 1DO0A 1CX9B 1RTTA 1WXXA 2JLSA 4K26A 1AUPA 5EMMA 3T9BA 4G41A 4LOLA 2VPYA 3G8DA 2XYHA 1TW3A 4XARA 4BWYA 3SIWA 1NURA 1TZMA 4D25A 5EEHA 1WE2A 3AH8A 1SBTA 1XRLA 3IJEB 1SU6A 3JY6A 3I32A 3QKRB 1Y5MA 3EXG2 2QRQA 4GPEA 3TNLA 1I80A 3C7TA 2B8TA 1RQRA 4UCWA 1NR7A 3AU8A 3BMCB 1K89A 5K3FA 3VSAA 3PRJA 2PVSA 4CKWB 5BUQA 1Q1BA 2DBQA 4AWBA 1F0PA 4EPYA 4ZCMA 2GGSA 2CVZA 3DD1A 4I55B 3I8XA 3ZWBA 4D4KA 1CJUC 2V7EA 4NOMA 5B2FA 3A3PA 3K2BA 5AIBA 3ZHRA 2FRVA 3OKCA 3SZGA 4IPTA 1MA3A 1BN6A 3RTEA 3HJUA 2EERA 3WWEA 2NU8B 2HBYA 2PK3A 2FVYA 1BJRE 3U0VA 4BVGA 3HRIA 4LBVA 4BFXA 4C03A 4EYKA 1GEEA 3FDZA 5K3EA 1I2CA 2RIPA 4MKZA 1ZXBA 4PNZA 2BEWB 2BW0A 1XP8A 3AF5A 3A2KA 3LDFA 1LLFA 4XYGA 4AZ0B 3CEMA 3KALA 1P0CA 1JQ5A 2IIBA 5D3MA 4LJ6A 1T2UA 3DZGA 2DCMA 2FW8A 3JASA 4GZ3A 4TTJA 5A5DA 2JKVA 1QJ4A 3GUYA 3L1JA 5K09A 1O96B 2HJ9A 2ZIAA 3FCUB 4FUQA 4GI5A 4LHSA 4FGLA 2I7CA 1NF2A 3EY4A 3GPIA 4TROA 3ZZ1A 4CIDA 1OB2A 2DVMA 4JLMA 5A9RA 2CUTA 2ZRBA 1QONA 3B6IA 4TS3A 1MO3A 1XKQA 3TB6A 1R15A 1KI1A 1N2XA 1NW4A 2AG1A 1UUFA 3BJIC 2PWPA 3E7XA 4U4AA 4RD6A 1LV8A 4RXMA 1NULA 1X80B 1HZZA 5LFAA 3OM1A 2REOA 1M33A 2A9PA 3LBNA 2P5SA 4D4GA 3RSHA 1N1DA 1K5HA 4QX6A 3E3MA 4LNAA 1J1UA 3SX2A 1E3IA 2C31A 2CDBA 3WYAA 1H4SA 3ZDXB 3LDAA 2WU1A 3DOOA 1RVDA 2EG9A 3P9NA 3DEJA 1DZIA 3GZNA 3E9QA 3V46A 3WTCA 4KR2A 2WINI 1Q0QA 4B85A 3IV7A 1Z5ZA 3ZVNA 2Q50A 2J45A 1MX9A 3PUKA 3EIEA 4J4TA 5CW1A 3SZMA 1VYVA 5DHUA 4YMHA 5HQTA 1T2CA 1XCMA 2Z5LA 1L5KA 1Y6GA 1DRKA 3JARA 4LDZA 2JFOA 3PGKA 1PFVA 3E0QA 3Q2OA 1TYDE 1YR6A 5JC1A 1E6UA 2BH2A 1EIWA 3NTQA 1PV1A 1OX4B 3IT1A 4TL6A 2QJOA 4YI5A 1OH7A 1KXZA 3KJNA 2PM8A 5A7HA 5K05A 4ARBA 4D9BA 3AKDA 2C7PA 5EMNA 1YB5A 1XL0A 3N74A 2UXBB 3QYAA 5BN1A 4D9CA 4UTNA 4TT3D 4DWVA 2VP3A 4WASA 5EZSA 5J47A 4ETWA 4B5KA 3QEOA 1UKVY 1XZLA 1ISRA 1S8OA 3I9KA 2XNHA 4C4PA 2EKZA 3ORYA 1N2JA 4Y2PA 2C5FA 5F35A 4XWWA 4FVTA 1LW6E 1H9AA 1ONNA 4WLEA 1ACJA 1LY1A 4LKRA 4TN1A 1X1AA 2QVBA 3U7RA 5B3KA 4Q02A 4KSBA 1Q0SA 3L1VA 4JSTA 3U9SA 1O03A 5LSAA 4X64B 1U6KA 2FG7C 3C15C 5E9WA 3RTAA 2VA9A 1IVNA 2NZUG 2YFQA 2E5LB 2YQ4A 1L5HB 1WM1A 3JAWB 4B9AA 5INTA 1RXSA 1R37A 5F12A 3H05A 4RF2A 3U80A 3GHYA 3ISVA 2IEYA 3WHIA 5SZHB 3P0JA 4WFJA 1B8VA 1QQ6A 4XA8A 2E82A 3FHCB 1K4MA 3OT1B 4HY3A 3GPLA 2OFFA 4MKGA 3W5SA 5LQNA 3VNVA 4Y6OA 4REQA 3TG8A 4XDHA 4AKTA 1FFAA 4J3FA 5J1TB 4DRYA 1DQYA 4TLMB 4IIXA 2FSHA 4ZV7A 4QBFA 1K7EB 5KVCA 1GTRA 4ZAVA 2O2DA 1JT2A 3FVVA 4N47A 3DT8A 2OSVA 1DAOA 3GLGA 2SCUA 1UEIA 4QC2A 1N7IA 2DKOA 3T3IA 1XTBA 1DX9A 4RS4A 2DJ5A 2W2NA 3MTAA 3VNRA 5I45A 1CBUA 1J5PA 1SMKA 1XZIA 2O2ZA 3PIRA 4JBIA 4M0PA 1FB5A 4RU1A 3L02A 3NYRA 3PUYA 4HTFA 2EJCA 1TA9A 2EYUA 3ROZA 2QE7A 1QF9A 4MCJA 4Q3CA 1RYNA 5JNLA 1UBGA 1HE3A 1JQAA 2OC4A 5EZQA 4TLAA 2E5FA 2XUGA 2FMFA 4OY3A 2NXWA 3HUEA 4TWBA 1XMPA 2O2GA 3ZOKA 1EPUA 3BRQA 4R4JA 4YMUA 3RUAA 5EHXA 4JA2A 2ZP1A 3N0RA 3EUWA 4UM5A 7YASA 2DR3A 4CV2A 3QELA 2R65A 4G1FA 4AC9A 3STWA 2NTYC 1ULHA 3O7MA 3WFIA 5CDFA 5KOJB 2WQ7A 2GEUA 1WEHA 1SOUA 5AW8A 5JDCC 3G79A 4F93B 4EEXA 5LBIA 3AF4A 2B4QA 4IJ5A 4QTZA 3TTXA 3UV6A 4ZT3A 1VJGA 2HCRA 4GHWA 4OGGA 5EPOA 1ECPA 5HCIA 3HKDA 3JSAA 3FGNA 4H35A 4YT4A 4HWSA 1Q12A 3OFNA 4O4IA 5C8YA 5GVSA 3W9SA 1FSGA 1AKNA 1N6IA 1CY0A 2NUPB 4ZOLA 1JDUA 4TUYB 1X1CA 3O8QB 1PLLA 1R5NA 1A9RA 3SSNA 3CNQS 1XJ0A 3FMIA 2W00A 5FFMA 2PTGA 3N58A 4TGLA 3K9LA 9LDTA 5JXIA 5MGNA 3OP1A 2RD2A 3UWMA 4DLPA 4H1HA 1VKNA 3AZQA 2J67A 5KNBH 2XVZA 2ZRNA 1GRNA 4LXUA 2VYVD 2AE2A 3U4CA 5CGZA 2P1DA 2REBA 3N5CA 3PR2B 2H17A 3ANMA 1U5BA 1H6AA 1P2BA 2D2IA 3L0SA 5FNVF 1NDQA 4A26A 2ECPA 1DWPA 2VHCA 1GVHA 2PIAA 4P81A 1QHYA 2QTMA 4GVLA 4AZ0A 4C6TA 5HJ5A 1YFLA 1T5OA 2AJCA 2ZSUA 4O4LA 5ELXA 1MGOA 3LDGA 4FYMA 4EGSA 4FCCA 1MJFA 1K6MA 4LK3A 2V45A 2EDCA 4ND2A 3RIGA 5KYNA 4LJ9A 3O94A 2O8CA 2B3DA 1ZMOA 1ICIA 3DV2A 1E3LA 2ZDQA 1LI4A 1F0YA 3EGEA 5H5JA 4BN4A 4MW1A 4MULA 4D9GA 1S1CA 2Y0EA 3UHAA 3ZYCA 3ETGA 3KEGA 2OBLA 3QX9A 1EGVB 4UBIA 3DZFA 1URPA 1YB4A 3DC2A 3DO8A 1J7KA 1JVSA 3JVDA 5COBA 4GMDA 5EGSA 4BFLA 2H2AA 3G1UA 4MPRA 4QYSA 3CO5A 3B7PA 5EFZA 2I6QA 2OOSA 2W8BA 2JNWA 3B9BA 2ZI4A 4YCMA 1XIVA 2FFRA 1P5ZB 1QR6A 1SVKA 4MVJF 4PE5B 5CD9A 5KOHA 2PLNA 3MUFA 1J5XA 3U3ZA 4BY9E 2R3SA 2VDPB 2RG7A 3ND7A 1SVUA 2FEKA 3NGXA 4FFBB 2UYCA 1U04A 4FCTA 5AW7A 1I3LA 1C3JA 1NT4A 1YVUA 3NQ41 1AXGA 1T2AA 4DBVO 5JDIA 1KMMA 1EH5A 4L8LA 2GXQA 5DHAA 4ZA2A 4PHCA 4HDQB 2UAGA 4X20A 2IOYA 4FJ0A 2ATIA 3P4YA 4II2A 5AUQA 3T7SA 2JCXA 3OCUA 5HFJA 4MIOA 3KXKA 1U9ZA 2Y67A 4ARIA 4JUCA 2ENWA 1CHNA 1KYVA 1UJ6A 2P8SA 3I76A 2DWQA 3G0BA 4ND8A 3IUBA 5FPYA 2I6XA 2Q3JA 1UWKA 4FLEA 2O8FB 3WWYA 1X92A 3H4TA 3PFIA 5JR3A 3F6RA 4UVHA 5K8JB 2BPOA 2ONKA 3OEYA 1NUPA 2VH5R 4MMXB 5DLEA 4EG3A 2FW7A 3LTNC 2PIDA 1JIVA 2J5QA 4I55F 4AUMA 4CQLB 3BL5A 2IBSA 3E7WA 5B1YA 1XZCA 1RD4A 1B26A 1M83A 3MXOA 4CF6A 1SN7A 2DH5A 2VH2A 5KVSA 4QOHA 5FI0B 9ATCA 5G1PA 1U31A 3SX4A 1E94E 3HJHA 3FY4A 1VJ0A 4GZMA 3JAWA 4WT7A 3M5CA 2I78A 1LRKA 3AVVA 5CCDA 3THYB 2UXCB 2P9EA 4RVHA 1N7HA 2AN4A 2PUAA 2V7GA 2EDAA 2BRUC 4DB2A 3U3JA 3HO8A 4F7DA 3RYHA 1EDOA 2GF0A 5HF6A 2XRZA 1WSAA 1FFEA 4IAOA 3D3KA 4JYAB 2BHSA 3BGIA 2C83A 1WY7A 4IKPA 4J9VA 2YX1A 3ZU2A 5KTNA 1B43A 1TVEA 3WWZA 5J2TB 3ZE2B 4RTSA 2D5LA 5B4UA 4CUKA 3T9EA 1U0SY 2AOTA 2LIPA 2XCLA 2ZBVA 2B92A 3GH1A 1Y8QB 3EUFA 4CMAA 2VT6A 5REQA 2V4MA 2MINA 1DJNA 2G76A 2O1EA 2K87A 3TDNA 3L79A 2AKEA 5D8DA 3O03A 2CKMA 2GK7A 2BJWA 2W93A 3PCXA 4FFRA 2ZIWB 4L8GA 4NY1A 4AO6A 3T3NA 1Y7IA 5DX1A 3SFTA 3VHLB 1JDNA 4DNFA 1IRXA 5AXAA 1C4OA 1GPH1 4Y2VA 1II9A 1MQ9A 3BSFA 1O1YA 2XMBA 2YXNA 5JRJA 2P4UA 1CUDA 1FTNA 2GCOB 2Z56A 3BRCA 1X8LA 2P9YA 3KJGA 1I8TA 2XZPA 4L75A 4FGJA 4LDPA 4X3PA 3GLGB 3Q85A 3VVCA 4N3GA 3A04A 4LX8A 1J8DA 3RAPR 2QAJA 4IL5A 5K0JA 1WZ2A 3HGQA 1KO8A 1IBRA 2JFHA 3K2EA 4HDNB 2XUFA 4YMIA 3BMOB 3ZHXA 1KEEB 5IKPA 1IQ0A 1NKVA 1QGAA 1NA5A 3BB3A 3IEUA 2GNOA 4JLUA 4DV1B 3D8SA 4R98A 4B4WA 4R2LA 4E0BA 4L15A 4YUXA 1AQYA 1RRVA 3H5LA 1IJKA 4QUHA 5C51B 3SR3A 4L4YA 2RCNA 1NE7A 5AJHA 4UD6A 4YWHA 4ETNA 2OQ2A 3WLKX 3BS4A 4JU8A 5B58T 2XA1A 5CDHA 5ECWA 2VF5X 3MGKA 4A6EA 3K09C 4Q3EA 1YC5A 1UXKA 4MNTA 4OA5A 3FGPA 5TRTA 4MOWA 3WYFA 3G5AA 4O4JF 5E9JA 1KAOA 3PC3A 3ZCXA 1IB0A 1KHHA 4PNHA 4BO3A 4KR3A 1CUUA 1BU8A 5HBRA 1K6EA 2FA9A 4FMDB 5IEBA 3OQJA 5LP1A 4MINA 3L1HA 3SXUB 2IOFA 1NWHA 2B99A 1THZA 3AP1A 3LO5A 2WG2A 3ROMA 4IH1A 1IWPB 5C8VA 4LE2A 1I33A 2ZITA 1PG2A 3MAJA 2XNDD 4B3DA 4X90A 4BNNA 2PG3A 3O8QA 4CMCA 5MN4A 2FF7A 4IICA 4WK0B 2SKCA 3RV4A 4BQNA 4P3YA 5EQTA 4UAUA 4FDTA 3RROA 3ZZMA 2W4QA 1OZAA 4R81A 4ABYA 4PHHA 2WAAA 1IXRC 4QO8A 4W1SA 3ZU5A 4UZFA 5BV0A 2D0OB 2I34A 2MYPA 3P0RA 2OXFA 2G1PA 2GPWA 3E2IA 3FR8A 2O8VA 2FZEA 2AZ4A 4J0CA 1TQ4A 2C8VA 1BVYF 3MINB 3ZZUA 3BWDD 1ZMBA 3RT9A 4CEIB 4OYHA 3I2IA 1T4DA 1F17A 1Z4QA 2GHTA 2ZEJA 2CBXA 4LHZA 3WHKA 1ZHOA 2CT8A 1MXFA 3B1XA 2GEVA 1YJXA 3EGOA 1NRXA 1QGUA 3D2AA 3FYSA 3G2LA 4HNAB 3DKIA 1WMAA 1XVTA 4JEUA 3S99A 2RHBA 4MWZA 4Y7CA 4AMGA 5CITA 2AS0A 4NLLA 1L5ZA 3BQNB 4ZEWA 2BV3A 1P8AA 4NAHA 5F78A 2YN4A 4J43A 1VOTA 4F3RA 3PCRB 1T2FA 2G06A 2H48A 4KU4A 1U63A 2WIFA 3L8HA 3GFFA 1Z4JA 4K28A 3ZCQA 1ODTC 3HDHA 4RK6A 4S24A 5KOHB 2LVBA 3H5NA 3IBSA 3IS3A 5K0CA 1CF9A 1XHLA 2GZHA 3C87A 3P2MA 5DTRA 1WRBA 5EPUA 3ZJ5A 4FB5A 4EB3A 3A27A 4NPHA 1HDZA 1GPJA 4K3VA 2G0NA 2O2EA 4CIYA 1T6ZA 3BL6A 2UZ3A 2BSQA 3HWRA 1TJ4A 3JQ7A 2BFPA 3F7NA 1UPFA 4IS3A 2NUTA 3OLWA 3OIDA 3AR2A 4Q3OA 1DC5A 3T1QA 4TV9B 1KAEA 1MJGA 1NSYA 5EP1A 3SYKA 1H4VB 1OC2A 2Q2WA 4GR5A 4EO9A 1NBOA 3ZHYA 4EVIA 1UMDB 3DHEA 3FPHA 1YNSA 4PZZA 1Z8FA 4RIHA 4X8LA 5LQKA 2FR8A 3F6YA 1BDMA 3JAMA 3NBXX 1USVA 3NWOA 4RLHA 1M74A 1U94A 3QG5A 4QECA 4YP7A 3I62A 5ESXA 5FWYA 1ENZA 2M98A 2C3OA 5HZMA 1PL0A 5KDOA 1JF8A 1KI7A 1VG1A 2XCIA 1WQ3A 3VHQA 4F38A 2JARA 4LF7B 3D2LA 1HQCA 3MYYA 2ZWVA 3M5WA 4K05A 4DW8A 1XUOA 5F7JA 3ZV6A 3IBYA 2OR3A 4BFTA 4YRFA 3RUEA 2PSHA 2NLOA 3KQVA 3V8BA 3BVPA 2O0KA 4C0SA 1XR3A 2NTJA 3FNHA 2BFWA 5JANA 3H0CA 5LP6F 3ZE8A 3TZHA 1I3NA 4MRSA 2VTKA 3E4CA 4PRYA 1IY1A 1WUJS 3H3XA 1L9KA 3DZKA 3AC0A 2UVPA 4EFDA 5A62A 5LMCA 1DIRA 2WUGA 1N3YA 2YW2A 4WEOA 5G0UA 1BMFA 1N5MA 3DZBA 3M0EA 1XV5A 2LD4A 5CPBA 1OWLA 2IXFA 4NIMA 4WNAA 1PN3A 4R1MA 4H7KA 1RZVA 2D5IA 4AYTA 2D06A 1C3EA 3IDFA 1FVXA 1XRJA 1QH1A 2DH6A 3QA3E 3ZBPA 4CWAA 4ZVSA 2PL5A 3AHGA 2I71A 3GLIB 3FUTA 4Z9AA 2P9CA 4LXGA 1LKZA 4EVRA 1JR4A 2CUNA 3A1TA 4FFPA 3WL6A 2IXBA 4YRTA 4ANFA 2FZ4A 1N2CB 2BZ0A 3KWLA 3AEKA 2OWDA 3C70A 3PLNA 4DIEA 4NXNB 2EGGA 2XUQA 3KPJA 3R0QA 1NWCA 2XKKA 1XZDA 2CJXA 1Z7EA 2HDWA 1OC4A 1QB7A 3IMGA 3OO0A 4P08A 2GRJA 3MAAC 2GS9A 3M9LA 2FFAA 2GN2A 4AURA 3OMLA 1FE8A 2CXRA 2FDCA 1INLA 2C8LA 1UBSB 1KRWA 1E0DA 2EW8A 2FEAA 2QTVB 1H2HA 2WYIA 3D3JA 4B6GA 5B64A 1FNMA 4QATA 1PK8A 3A4VA 3IT0A 3PUJA 4NDAA 3PHBE 4H7HA 2DRIA 3VDQA 1VPWA 1TZJA 4K3UA 1YOBA 3UHOA 1IZ8A 4Q5IA 3QU5A 3I83A 4IFBA 9LDBA 5LNK1 3AZPA 4JR2A 2RH9B 4CTMA 2W6ZA 5HIKA 3B85A 4HVCA 4D1YA 3UW1A 4UU0A 3J80A 1SJ9A 4I08A 5H68A 3DLAA 4H2DA 3CLHA 1EFDN 1DAKA 2C2BA 1R9GA 3KFLA 3V1NA 4RSGA 1TGVA 1UANA 2N0SA 4XOIA 3EBOA 3IXLA 4GO1A 3RUDA 1FS6A 1E4OA 2AOUB 2IIPA 2ZRHA 3CNLA 3HC7A 4HDSB 2J85A 2P5UA 5JQGB 3BF7A 6ABPA 4Y9SA 4Y3UA 3GBSA 3KZNA 2GSWA 3LPLA 4JT4A 5C8DA 2SBTA 3BFPA 5KOIA 3U6BA 3OY7A 2V6FA 2FR8C 1ANKA 3RANA 5IAAA 1DAFA 3C48A 3IE0A 2ZS9A 3DWIA 3FJOA 4BO1A 3OQVA 3RLIA 4EA6A 4MUNA 1J6UA 1C9YA 3E9RA 4B2IA 3FOFC 3KSRA 2FPGA 2W6PA 1YFJA 1PEAA 1RKUA 3OQ6A 3QVVA 4QODA 2O2JA 4RMJA 3NMUF 3CZRA 1OYOA 3LY8A 3M6XA 2O2CA 5L7YA 3HJAA 5LA6B 3TBHA 4PSVA 1QBKC 1D4OA 2CF5A 2XPCA 3LC1O 4KEAA 2IP4A 2H0AA 3DXFA 1P80A 3EA0A 3F4LA 4MK4A 1FSPA 4UOZA 3EW7A 2WWYA 4I2VA 4AJOA 2YW9A 3C1TA 4OMDA 2QB5A 3D7RA 5AKYA 2NZVG 2ACKA 1CUWA 2XMRA 4XX1A 4PX2A 4KQGA 5JXHA 1NUHA 1F6DA 4K8OA 5I47A 1ZNQO 2ANBA 1G6KA 4B4DA 1W0CA 4OBBA 3R5FA 5DW3A 3WZLA 4LMAA 4P7FA 3RNLA 3TW4A 1PW7A 1WUHS 4Q7KA 2YV5A 1HEYA 2DLDA 3PE4A 1B8PA 4Z1MA 3ZWVA 5JZMA 2E2WA 3QHQA 4HNAA 4C7JA 1NHGA 3R09A 3IOMA 4GDMA 3T9FA 1MRNA 4OXKA 2DQSA 2QD4A 4KPYA 3QVLA 5EMJA 3RTDA 2FNAA 5ULLA 2QKYA 3GRYA 1XXHE 2G3YA 3U3KA 2QHXA 1GDHA 5J5AA 5KNLA 1SBCA 3QBDA 5KNBD 3TZCA 1JBQA 1T9ZA 4MRNA 1CIJA 1DVRA 4DN6A 1O89A 1EB8A 1RTKA 2X9GA 1E2PA 2J4CA 3Q3HA 4WLVA 4W8HA 2GLUA 1FTGA 3F6SA 1OLXB 4JITA 4ODIA 4WY2A 1L4KA 3ZY5A 3KJIA 5KNCD 4ZI7F 4GKBA 4B3BA 1M1YB 5H82A 2ZI5A 2UYQ