3VO9A

Staphylococcus aureus ftsz apo-form (semet)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
304
structure length
295
Chain Sequence
b'ATLKVIGVGGGGNNAVNRMIDNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFETQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 80
structure length 295
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3vo9A00
3JAKA 3HKBB 4ZOLA 1OFUA 3JATA 3ZBQA 4O4LA 5JQGB 4KWEA 3HKEA 3N2GA 5MN4A 3E22B 3WGMA 4U39A 3JASA 5BMVA 4O4HA 2Q1YA 4B45A 5MN5A 5MN6A 3JAWB 3UT5B 1FSZA 5GONB 5J2UA 4WBNA 4DXDA 4B46A 5FNVA 3WGLA 5LYJB 3N2KA 5LXTA 2BTOA 5CA1B 3RYCB 4O2BA 4X1KA 5CB4B 2RHHA 5KX5B 3WGNA 1JFFB 4X1IB 4E6EA 3ZIDA 5EYPA 4O4IB 5JCOA 1W59A 5ITZB 4ZI7B 5LOVB 2VAWA 4O2AB 5IYZB 5LP6B 4U3JA 4YJ2A 4I50A 4IIJA 3HKDA 2XKAA 5IJ9B 1Z5WA 1TVKB 4FFBB 3RYHA 4TUYA 3V3TA 3RYIA 4ZOLB 4O4LB 4DRXA 3HKEB 5LA6B 5M7EA 2BTQB 3RYFB 4I4TA 5BMVB 2VXYA 4O4HB 5IJ0A 5JH7B 5J2TA 5C8YA 5KMGB 5J2UB 4WBNB 5FNVB 3VOAA 3HKBA 3N2KB 5LXTB 3ZBPA 4X1KB 5JQGA 4I55A 5LP6C 3JALB 1RQ7A 4LNUA 4X20B 4TV9A 3E22A 4EB6A 4YJ3A 1Z5VA 4TV8A 3VO8A 5EZYA 1TUBB 4YJ2B 4ZHQB 3UT5A 1W5AA 4HNAA 4IIJB 2RHJA 4X1YB 3JAKB 5JVDB 4F6RA 3JATB 4IHJA 3CB2A 5CA1A 3JARA 4TUYB 3RYCA 2RHLA 4M8IA 3RYIB 5KX5A 3N2GB 2Q1XA 2VAMA 4X1IA 4XCQA 3JASB 5EIBD 3HKCA 5CA0A 2R6R1 1FFXA 3VOBA 4EI8A 4I4TB 1W581 4O2AA 5EIBC 3R4VA 5IJ0B 1SA0A 5IYZA 1W5FA 4O4JA 3VO9A 5J2TB 4X20A 5C8YB 2RHOA 1TVKA 4FFBA 4O2BB 2R751 3M8KA 1RLUA 5JCOC 5EYPB 4I55B 4LNUB 5LA6A 4TV9B 3VPAA 2BTQA 3RYFA 4U3JB 4EB6B 1W5BA 2VAPA 3JAWA 3M89A 4I50B 4YJ3B 4TV8B 5GONA 3WGKA 5JH7A 3HKDB 5EZYB 5LYJA 4EI7A 5KMGA 3RYHB 4HNAB 2XKBA 5CB4A 4F6RB 1JFFA 4IHJB 4DRXB 3JARB 3JALA 4O4IA 5ITZA 4ZI7A 3RB8A 5LOVA 3HKCB 5CA0B 4EI9A 5LP6A 1FFXB 5JVDA 3WGJA 1SA0B 1W5EA 1TUBA 4ZHQA 5IJ9A 4O4JB 4X1YA 1RQ2A
chains in the Genus database with same CATH superfamily
1O94A 4RTKA 4Q3DA 5ALOA 5AJUA 3LIIA 4ALMA 3WS7A 1YS1X 5KKNB 4QTUB 1L1FA 4HLUA 4L4ZA 4OXRA 2QTBA 2J31A 2VPIA 1YXMA 3BQ9A 1KYYA 2BH9A 3K7EA 4V0QA 1F6DA 1POWA 2PL1A 2V03A 1RYDA 4QFCA 4YFVA 5AT1A 4HCJA 4QPNA 3C7AA 4DIEA 2XXBA 3C4JA 3A1VA 1I3MA 1LI5A 1N7IA 1CDZA 2VJQA 4ETMA 3SICE 2IA5A 3UT0A 1E6LA 1Z2DA 2J9YB 4FHFA 4KMSA 5JZBA 1V5EA 1U98A 5IXJA 4C43A 3KSUA 5ARCA 4ZVTA 3OUZA 1VFPA 3KK0A 1SVUA 4QBKA 4XB6B 3EVBA 5I8WA 5IKMA 2YNMA 3D2CA 3EFEA 3EY4A 4FXOA 4EPVA 3IMGA 3SGLA 4BE7B 5COBA 1GAJA 3OU6A 3F6PA 3AB3A 2Z2JA 1ZN9A 3PNSA 5ANRB 4WN9B 4QFMA 3RO7A 1JEAA 4L4YA 3VHXB 4B3XA 5KQMA 1H4SA 1PDWA 2CK3A 3BFJA 5B5SA 3IEIA 2VF5X 3SEQA 3TQSA 1ELOA 1UDCA 1T4BA 2PSDA 1NUSA 1P9RA 2WAMA 3GAMA 1T25A 2LBPA 4GSKA 3ZZMA 4NCIA 2XOXA 1OIWA 5I7EA 1HZZC 5JWRA 1XT6A 2Q5FA 4QM6A 2NZ8A 3MLEA 2E87A 2Y3IA 2JW5A 4B71A 4V24A 2WKQA 3MTAA 5FNVB 3RRFA 1EA7A 2ZI6A 1NMYA 4CKZA 4LVNA 4NESA 3NTRA 2GD2A 4OSOA 4QU0A 1FJHA 5GOZA 3JQGA 5F23A 4CMEA 2IGBA 1MQ9A 2ZTLA 3F6EX 3VU9A 4CMBA 1VYHA 4HJXA 4YMGA 10MHA 1Y5MA 2V1UA 2CUKA 2PQ6A 5A6VA 3JQ7B 5IANA 3QVXA 3MVEA 4TS4A 2IOFK 5CLIA 4Q4AB 2H17A 2EZUA 2QN9A 3MCWA 4N0EA 4TRJA 5EGSA 3JQ8B 1UK8A 4Q66C 5FWXB 4PHHA 1UBJS 2GSDA 2HZ7A 1I2MA 5TF4A 1L7DA 3VV3A 1CETA 3O2SB 3INRA 4MXDA 2BM0A 1QP0A 5JLAA 1KI6B 2CE7A 2P5YA 4PXSA 1QR2A 4DR3B 4FC6A 2HT1A 4O2AA 5CPBA 2I4MA 1XRNA 4RBNA 3N8HA 4D8XA 5DM4A 1QG2A 4EGAA 1KP2A 1RRMA 1NW7A 1PZHA 3L4SO 4FX2A 4MYUA 4WUTA 1HYGA 1H1DA 1OXSC 4HDOB 1Z6PA 2F17A 5A4IS 1Y48E 4LV5B 4ON9A 2AKAB 3U19A 2C3UA 2VDWB 1OXMA 4QL3A 5GONF 2HXYA 3RVOA 2X0IA 2XE6A 2A1IA 3LZDA 1JQ3A 1ZH2A 3N7TA 4A82A 2O52A 3CZ5A 2O1XA 5C8VA 3VR4H 3DAYA 4KI0A 4AKGA 2YWBA 3SE7A 1TJ5A 1HC7A 3VTFA 4YJGA 1RWPA 4KXWA 2BOVA 3R0XA 2AI1A 1ODFA 4O4IF 4RMNA 5BQXA 1VSUA 3Q5DA 1DRUA 2JCVA 3U4DA 2BKVA 2CLFB 3V1KA 4V0ME 1QSGA 1I6WA 2WKRA 4OX9Y 3L0PA 3JRWA 2WUWE 1XPUA 4ZO4A 1YL5A 2UZIR 4E5NA 2JEZA 3ADOA 3AFOA 5JNLA 1KOLA 4ZCQA 3PVZA 1EG7A 3EZYA 2CFSA 4F0JA 4W5OA 2WBLC 4KG7A 3RBAA 2BEVA 4JELA 3ZS8A 4ZMSA 2F3PA 4H27A 3LUFA 3ZCPA 4JYPA 2DLCX 1KHTA 2AEMA 4IIEA 1BE8A 3OZRA 4PFKA 2PRJA 1J0DA 2XDYA 3UMRA 3I2KA 3SEFA 4ML3A 3Q9LA 3G9ZA 1X8XA 5EHQA 2CXOA 2VWGA 3LDHA 2QN8A 4AMVA 1Z83A 4K40A 4HAVA 3FD8A 1T13A 5D7BA 3A1TA 1LKZA 2CL0X 4MWSA 4WBSA 5GZ1A 3NDJA 3WL5A 1T2DA 4YN3A 2FF5A 4JBWA 5ESXA 5JCOA 2V3VA 5KYKA 2Z58A 3KETA 4C04A 4G0WA 3TGLA 3A06A 2JPDA 1RI1A 4MQMA 4UTZA 4FMBB 2JGJA 3EK2A 4HGQA 3L4JA 1PVOA 3QVKA 2Y93A 3WK6A 1P29A 1WQ4A 1D4AA 3C15C 3L9XA 1MO5A 4BMOB 5EE9A 1JBKA 2Q4OA 2VT3A 4O1HA 3VTZA 3BIJA 4BO3A 2GHIA 4MDFA 1YMUA 1A97A 3TXAA 3TE6A 3OCWA 4JGGA 4MCIA 3ZVNA 3NYIA 5KYNA 3O31A 1EFRD 3BS4A 2A7XA 2VUSA 3D3JA 4QARA 4MKFA 3S4YA 4WBNB 2A57A 2BLNA 4DA6A 2NP7A 1KNXA 4EITA 1G5IA 1GPDG 1WCWA 2FPIB 1E6EA 1B42A 4E4YA 2J8ZA 2N3ZA 3EPKA 1KSJA 3L4EA 4CKBA 5FBHA 4I19A 4FFPA 4AUNA 1QHIA 4YCDA 4KO8A 1ZCAA 1NYTA 3G2MA 3LCVB 5D3MB 3TLCA 1A5BB 4F5DA 2EX4A 2BBWA 3PKJA 4EY3A 1T6NA 1Q7BA 1KJNA 4KAFA 4DCMA 5JJKA 2XQIA 1XLTC 1LX6A 4OGLA 5HF8A 1OJLA 4JITA 2OM6A 4EBBA 2GEUA 3KLPX 4TROA 1JEEA 5KNDD 3W6UA 2BBTA 1A9QA 3E7FA 3W9UA 1R4NB 2ICAA 2HTFA 1RAAA 3G2PA 3O03A 3AG5A 4XIIA 2AK3A 4GOOD 2J5RA 2C1EA 2IT1A 1N0WA 5FUWA 1P8AA 1KXJA 3ZDQA 3CZ9A 3IMEA 4PO1A 4IKPA 4Z86A 5DJ5A 1MJNA 2CJYA 2GKOA 3N9IA 1SIBE 5BRJA 2NSJA 1XEFA 4FIDA 2P78A 1G59A 4W99A 3TNDA 4NBSA 4LJSA 1BU5A 3NGLA 5G40A 2YXEA 5JWHA 3LK6A 4Q9LA 4JUFA 1U63A 2XE7A 3V4RA 3I9OA 4OHMA 2EYQA 4QATA 2ENUA 2XZDA 1A2OA 5KSPA 4C0HA 3HABA 5ECWA 5KTYA 4KPEC 1EFRA 1SIWA 3IIJA 4BO2A 4WJZA 4F9FA 3AESA 3TPFA 4CHTA 1TNDA 3FNHA 4ZDJA 5EWJB 2IIVA 1BU8A 1U8YA 3PUYA 3AF0A 4O5AA 4DPMA 4HRVA 3AW9A 2FI1A 3NALA 4E3ZA 5CBPA 4ZOCA 3HM9A 1T9GR 3GFSA 1YRAA 5E1DA 1PDOA 3RRXA 2VPYA 2E6UX 2NSHA 2X0DA 3ROQA 3CW2A 3TL6A 5EJ5A 1PT5A 2ZYGA 1CC1S 1ZWKA 1N5DA 3I2HA 4GBED 2BMDA 3F98A 3NYQA 2VC2B 4BU0A 1N3LA 2XMCA 3H84A 2Q1TA 2FZLA 5C46F 3UPUA 1QF7A 3I58A 2AG8A 1P5RA 4ASUD 3IHLA 5DRTA 2P9QA 5DRYA 4PSCA 3KG2A 1LLFA 2YCLA 2A84A 3VDNB 4GPD1 1VQ1A 1AU9A 1PK7A 2QAIA 2ROQA 2NO7A 2ZOSA 3NTLA 4GPEA 1U0TA 4X92A 5KNDA 3BD7A 3TIFA 3VZQA 4OUDA 4EG3A 4U2KA 2VNAA 4CF5A 3MBKA 3NHRA 5SZIA 3PWZA 1IN5A 2C9YA 1E4YA 1BA2A 1M9NA 4PFJA 1JTEA 1QFZA 4RAQA 4BKUA 1V41E 3LO5A 2HEGA 1CULC 4H08A 1PFYA 3Q15C 4NHOA 3RU2A 4B84A 4P82A 4NC9A 4Q9KA 1TU0A 4ZIRA 3UJAA 1EEHA 4IV5A 3L5KA 3QEOA 4O4HB 5AK5A 3O8LA 4DG9A 5BW4A 3BRSA 3ESXA 1PGOA 1WCXA 5B37A 4OP3A 2Q4EA 3WK8A 3TFOA 4P86A 2GF9A 2PSJA 3IBSA 2EEZA 1CNEA 2OWEA 4MUYA 2J0VA 1A9OA 4MVCA 5BN5B 2Y1OA 3EH1A 1DUVG 4DDMA 2WOJA 2CLSA 1FY2A 3JQCA 4JL8A 5C1DA 1BS1A 1WKCA 3GP8A 1H6AA 5PNTA 1F2TB 1Z35A 1SXIA 3OICA 3TIXB 3B12A 1E2GA 3GZJA 1F12A 4PG6A 1UH5A 1KZGB 3JRXA 3WHIA 4H77A 1ORIA 2P0AA 4MUKA 1NNSA 3IUPA 3PCTA 4JJ4A 1KVRA 2ZYUX 3WRYA 5A0VA 2REQA 2A0FA 1KYXA 2XTAA 3O4GA 1ZVVA 1KKUA 4TXNA 1M6HA 4EF4A 3EEYA 2RHLA 4OHZA 2NU9B 1UXJA 1Y5IA 2R25B 1NTRA 3EF3A 4ASUA 3ERCA 2L42A 2QX9A 5KI6A 1Y6GA 3F78A 1M1NB 1CS0B 4RXUA 4D9BA 1UZNA 2R11A 5EJEA 1TAQA 4BC0A 4YCNA 4QE3A 4EHKA 5IJAA 4WEQA 5KINB 1TQ2A 2NADA 4OPMA 3JVEA 2Y68A 4XGQA 1U3VA 3IMKA 3KCQA 1ZP6A 2AOTB 3JS5A 4J91A 5D6NA 3H2GA 2AG5A 2EZ8A 2QXYA 4R1LA 2HIGA 3BN3A 1QYDA 1ZFNA 3MB5A 2RHWA 4RLQA 2BEWB 4CTNA 3CKLA 2J0QA 3QY9A 5TPWB 4OOFA 4FOLA 2FN9A 3WGKA 5JH7A 3BSWA 2XBUA 1P4HA 4IDOA 2FPGB 3USZA 1S1MA 3K20A 2OQIA 1PTKA 3WIDA 1ST3A 4HYEA 3GFVA 4I66A 1TM3E 2BTEA 3BIOA 4FGZA 3FKJA 4L4XA 3AF6A 1O08A 1H1TA 1U7ZA 2LDBA 3BORA 3IQFA 1EXNA 2J9XB 4LVOA 5IX8A 5AVOA 4U7JA 1D9ZA 4GMKA 1JV2B 2IW3A 4RKFA 4RPIA 1ZN7A 4ZMRA 1VG9B 4PZ0A 5IN4A 3NGXA 4YRZA 4BCDA 2OC4A 2B4TO 4OHWA 1VJCA 2VTDA 3E82A 3D0RA 5KDOA 3KELA 5KYWB 5HPYB 3ZBQA 5JQGB 1YQEA 3ER6A 1MOSA 4NOLA 2Z2KA 3C1UA 1M1YA 2J3KA 3Q2IA 3ODPA 1B26A 1OGJA 3WE7A 4JN6B 4CIWA 3CVUA 3VC1A 1Q77A 2AX3A 5AWFC 2Q3FA 5G0VA 3ZD7A 4Z3KA 2PSFA 1CUFA 5I47A 1H3EA 3NETA 4OL9A 1I94B 2EFEB 1YI1A 2OXRA 2SHKA 2IUFA 1NT4A 2BFEB 2RHMA 5HQTA 1TYCA 4Y2UA 2FSGA 1OZ0A 2D1SA 2LE0A 2NZXA 4TTAA 3FPCA 4DDWA 5KWEA 1MO6A 4KLCA 2D1YA 4NABA 1A9YA 1M5TA 1TPZA 2H2FA 2ZRJA 3DZCA 4XSGA 3SG0A 4AJNA 1J7JA 4E0BA 2XZLA 3WMXA 1JEDA 2KS6A 3OFVA 2A86A 2FPLA 2O57A 4HN9A 4LEIA 5KYYA 1AQNA 3GZNA 5KVCA 2C98A 2QLJA 1KFBB 2R6ZA 3V8NA 2H06A 4QBGB 3RYIA 4QT4A 2WWVD 3RS2A 1YB7A 4HPXB 1BYUA 2H63A 5AVRA 3CRVA 3ONNA 4CL8A 5FNVF 1CQPA 1OCEA 4QODA 2JIRA 4RF2A 1H05A 4QGBA 2E18A 1YDGA 3ZHYA 4CM4A 5DLYA 1YQXA 2VNKA 1PWHA 2P9BA 4UBMA 2FSIA 4IILA 4EHHA 5CYGA 2R3SA 5IU6A 2D0DA 3K0KA 3R6TA 2Y05A 3ZBPA 1G2QA 4OI4A 2Q5EA 2DPMA 5DYGA 4TXMA 1FEZA 3PQ7A 4TYQA 3HSSA 3NRCA 4WZ6A 1I3KA 5ALDA 4JODA 4MUMA 2WIAA 1FDRA 1O6GA 1Y5NA 2XUIA 3I61A 1ODJA 1SIOA 1YMQA 3AOEC 1Z0KA 4RGVA 4WZAA 3TNLA 5JOQA 1JFRA 1KGDA 2ZE7A 4PU0A 1U8CB 1UMDA 2G9NA 4HDQB 2G82A 1BX1A 3G1UA 3HACA 4G24A 2WWHA 3GT3A 3EVDA 1AK1A 4QUKA 4A0QA 3TRDA 5CFNA 4NBNA 2HK8A 3TQQA 3P71T 3PUWA 1YC2A 2KLBA 4NZNA 1PG5A 3Q2OA 3F9IA 4OXNA 3SJAA 1EWTA 4L5AA 1XR3A 3ZGZA 4KN8A 5L6MB 2QT1A 1G17A 3AXSA 1CUYA 5D5QA 1WUJS 2B69A 1EHYA 1JTVA 2QRGA 1IZYA 1OLXA 4MS3A 4P4LA 1T6YA 4DTIA 3EN0A 3K72B 5EHXA 3F3SA 5KZMB 4UCXA 2NAFA 2D13A 2A7QA 1GAXA 1IHDA 2BTQA 1MOQA 3N3BC 4G1VA 1JWAB 1XEWY 5L4NA 2B4YA 4UBKA 2WD7A 5E0KB 5GJBA 3C16C 4PLGA 4QGGA 3RWMB 2J7PD 3L40A 3GN2A 3R23A 1H66A 4DXAA 3QWBA 1EQ2A 4TZTA 4MYHA 4WFJA 3DOOA 3RABA 5L7WA 1HNXB 4GOXA 1E3DA 2IWRA 2NXJA 5ALHA 3A4IA 1AMUA 1KDRA 1UBKS 1VSVA 2XZPA 3AI7A 3DMTC 3N6RA 3URKA 4D9FA 1DO0A 2D62A 2EU8A 2FFHA 2KB0A 1Q0SA 1V5FA 3EIQA 4XA8A 1SA0B 1IVNA 1G0OA 3M3HA 4UUAA 1MZVA 3PR3A 4C6RA 1CJKC 3HUUA 4QU8A 1VLHA 4F4UA 3SIWA 2E21A 3LLVA 1JPJA 3TM4A 4X7BA 3WRXA 2QMEA 5CLLA 4URXR 2C83A 2CFIA 1Y7LA 3GMIA 3OQHA 3VDQA 3LA8A 4EB8A 4GOND 1D2CA 3FF1A 4Y6QA 4Q39A 1MX5A 4NBKA 3M34A 3SIRA 3U62A 5I7RA 4NBRA 3L1UA 2IYEA 4ER6A 4BGEA 4Y9DA 4U2BA 3NEJA 5EVJA 1JU3A 1D1TA 4RPJA 3MERA 3LQ2A 2RHHA 1PJSA 2C00A 2R47A 3KT3A 2OCBA 2VBIA 3CNNA 3C8ZA 4BNJA 3RUFA 1KL7A 1KP3A 1KDYA 2HK9A 2E48A 4JUDX 4YAJA 4DEXA 3FTCA 3U3OA 3E9CA 3C3WA 1V96A 4KV7A 5J63A 2HB6A 2D06A 1VL1A 4C6TA 3ITKA 4RVHA 5K01A 1DBQA 4CUZA 2K4MA 2MSEB 2Z9CA 2Z8ZA 3NASA 7ADHA 2E49A 1GAEO 2WSYB 1F6WA 1OZAA 2A0XA 5TGDA 4WBNF 2A30A 1D8AA 2QM0A 2J7PA 2QTLA 4NBWA 1H6BA 1RAIA 1POXA 3IPCA 1DQPA 3L0DA 1NA5A 1XHEA 2IPAB 3GELA 3WP0A 1JW9B 5TY0A 3RTAA 1EK6A 4GHWA 3L7OA 1MW9X 4CUKA 4ENSA 4RW0A 2XWSA 4OFBA 2QVZX 3UMSA 2YVQA 2SKCA 4G4GA 3RAPR 5BUCA 1PQYA 1KPIA 3B1KA 2DR2A 4YO7A 5IG2A 5FPQA 1C50A 3P9RA 4GE0A 5HGXA 4HRAA 4AO7A 1CY6A 1OXBB 1TT5B 4W82A 1SBCA 4CV3A 2VHJA 3RS9A 1EINA 1QK3A 1U9IC 3F5FA 4I1OA 4B3BA 2AXQA 2Q7XA 3H05A 4J90A 1HFKA 2A9QA 2C77A 1K06A 2QRJA 3ASVA 1WKVA 3ZWOA 4G4JA 4GMXA 1UBOS 3FYUC 2CUTA 3SKVA 2A4KA 3HYRA 2PKQO 1O4WA 4PHFA 5L40A 3M4XA 3U5TA 1TJNA 2BN4A 3ETHA 5CEEA 4HMQA 1XWWA 3ZXXA 3OZIA 4JYBA 3WLAA 5L6LB 1JIUA 4ZU3A 4K9NA 3SQDA 3FH0A 4KR2A 5BT9A 4GF5A 1LY1A 4TQUS 1ZD8A 2NO5A 1PW5A 3U7JA 4A15A 2C7RA 2YWXA 1N8NA 2CYCA 2C9CA 4QDKA 1YFKA 3REQB 1VSBA 1YDWA 2ZEJA 5LA6A 3FVRA 1YRWA 3P19A 4NNPA 5IJXA 4BO8A 5LLTA 1EVJA 3JZMA 4L4SA 3H86A 3T5AA 2BKUA 4TRNA 3WK4A 5I9LA 2RE8A 3EIOA 1ISRA 4DB2A 3OPNA 3EQZA 3OZ7A 3PFHA 4GWGA 1BH6A 1JJVA 1LWNA 3MJSA 4NH0A 2NUAA 1TCVA 3HFGA 3RRBA 5B4TA 1XCGB 2Q3BA 2YZNA 4MEJA 4AKIA 3AJRA 1YR3A 2FMTA 1Y8CA 2AQIA 4XM0A 2BONA 3H1AA 5JHHB 1QH9A 2KBFA 4EI9A 1T1JA 1IL0A 4P08A 3LK7A 2Q99A 5EEHA 4F56A 2OFOA 4NJEB 2C29D 3G2KA 1X7XA 2HU5A 4WKGA 3Q7EA 2H9IA 4GDFA 3GJ4A 3N28A 1YTLA 3GMDA 3S7ZA 2P1RA 4IRMA 4IH1A 4YHBA 4NARA 1XCJA 2ZSDA 3FR7A 3GFBA 4G5GA 4QRHA 1GRRA 1WS6A 4PAGA 3EUAA 1HK7A 3NVAA 4CLRB 1SPBS 5DNAA 3CUEF 2C5BA 4PWZA 1M8JA 3SC3A 4ALNA 2IYYA 3TCKA 4NFYA 4DOMA 2GA9A 4RFSA 4YT5A 2GZ3A 3LBNA 4DCVA 2BGGA 3I8XA 3WV5A 1CBUA 2J9GA 1A5TA 1ECPA 2GEBA 1EM6A 2F3UA 2R79A 4MJXA 2IBSA 2OLKA 1VKRA 1X9HA 4YI3A 2O2SA 4GOKA 3WMGA 3QLUA 5TQ2A 5CA1B 5A62A 1Q7EA 1J2JA 2C9MA 2VSQA 3B1JA 4JQYA 2W4IA 4CEJA 3PJDA 4UPVA 3F7NA 2P3SA 1CQJB 1V7PC 2VJYA 4UM9D 5BV2P 1B8OA 1OFUX 3LGSA 3BILA 5LOVB 3FNBA 3KR9A 3R3ZA 3WLRA 1S7GA 2OZEA 5EZ5A 1C1YA 5FPPA 1G5HA 5IKEA 4HDSA 4O4HF 3ZHQA 4OTZA 4RMJA 1O1YA 4S2EA 1AXGA 3TOZA 3JVVA 3VYRB 5B12A 4CIBA 1PT7A 2IQIA 3I5MA 3DBLA 4NY1A 4TLLB 1BNCA 3U3RA 3PYXA 3W79A 2ZU0C 2BKXA 2GN8A 4AFNA 4CW7A 5JMWA 2G17A 5AK4A 5FFMA 1NRIA 2GN4A 3QZUA 5BMVB 1PNVA 4P93A 2VSXA 2WG0A 2B61A 3CX4A 2BKAA 2PGNA 3GH3A 4HXGA 4PFQA 4R98A 5GQSA 3SU8A 4Z4GA 3ANSA 1C5KA 3EARA 3UM9A 3H3FA 3WP1B 3VR0A 3DZKA 4HR7A 3WO1A 2OHGA 2EG5A 2NTVA 3G89A 2F3TA 4GOJA 4UFNA 3KT6A 5DSTA 3PKZA 5TS2A 4DM7A 4MIKA 1NV8A 1L5FA 3O4FA 2DT5A 2FHPA 2PVCA 1U9CA 3A6JA 1DCKA 1N5KA 1OQAA 1SWWA 4BFWA 3RQSA 3OIFA 2OGZA 2ZP1A 3ZHSA 3QBDA 3DE2X 3KOZA 4HAIA 2AOWA 3QY0A 3QOWA 5JADA 4OGKA 5CNKA 4DZRA 4Y67A 2ZDGA 4MAAA 4OX9B 1JAHA 4JJ8A 1RM5A 4D8VA 3S1AA 2R1VB 3JZAA 4B3GA 1EP3B 1X7GA 5CVEA 3AUYA 3MTQA 1L4LA 1SHLA 2W6NA 1CZKA 3A58B 3LOPA 1UBEA 4JP8A 5EIFA 4ZEVA 3QXHA 2P4QA 4AX8A 1XZFA 2QTMA 2D5AA 3GDWA 1VLVA 3G82C 2JGRA 3M8KA 4OHYA 2CFTA 3PT5A 2GAJA 2NQTA 1ZIXA 4RHFA 1GUZA 1WZNA 4Q3LA 3RT7A 1I5RA 1VIYA 2DLDA 1DAHA 2E82A 2Q4BA 2GOYA 2PL5A 3FCEA 4IMPA 4JHXA 3ZX4A 1VIMA 2BE7A 2ZBQA 3D9QX 3FOBA 3PD1A 1G1AA 4R41A 3T34A 1RQRA 1D07A 1NSTA 5GM2A 3PC7A 3A9VA 6REQA 4HNUA 3J80A 1GA4A 1K8XB 3O9MA 5EZYB 1RQLA 3EDRA 2VUHB 3WKEA 2XB9A 3Q7QA 5FOVA 3RNOA 3VTKA 4D9IA 5BQ3A 3RUDA 1CS4C 1JIKA 3BHNA 4GLLA 2CYBA 3WWCA 3H4TA 3KLMX 4QJ4A 3ZVRA 3LVFO 2HYDA 3OPXA 2DTXA 4DLLA 4EUKA 4H0FA 3LLMA 5JHGB 3GLIB 1ABFA 1LVHA 3NXKA 2B8TA 1OI2A 3RJTA 1GCAA 3W4JA 3H8VA 5JO9A 4X97A 2CNOA 2OAGA 3CUTA 3EGWA 3LXUX 3NCHA 1MABA 4NJOA 3NHLA 2P8JA 2X2PA 2NUBA 2TMKA 1UC8A 3H97A 1GQOA 1E1LA 3IRVA 4NNJA 2JS7A 1FYFA 4BMCA 3COZA 3DYBA 1QJ4A 3ODGA 3PHLA 3CUUA 4A27A 3ZD6A 1U1GA 1GLVA 4O2RA 2LWIA 4WLUA 3UANA 3SQXA 1UWCA 1ZH0A 2X0NA 3I92A 2IZ6A 2PFGA 3TAXA 4EEZA 3R5KA 4EMBA 3O4HA 1PBTA 4C08A 1Z29A 3OJWA 2BBSA 4ITVA 4F04A 6LDHA 5HK9A 4OY3A 3AJ9A 1LVUA 1GYPA 4YRKA 5JTTA 2C95A 5B7NA 3I2FA 2G1JA 4TLDA 1IHXA 4BP9A 3F90A 3HMQA 3NOVA 3R0IA 4ERNA 2NV6A 5KSZA 3EVZA 1JA0A 3VDRA 3D0OA 5IULC 2OESA 2QHXA 1U2GA 5TB5A 2HWKA 2B36A 3T94A 3PVCA 4YQZA 3IP5A 3WB0A 1PEAA 5A6SA 1JHDA 1X38A 1L6RA 4I50A 5BQFA 1L3BA 1SURA 3QOFA 4Z9YA 2N0SA 4F1JA 2J59A 2QN6A 3TUZC 1KDZA 2DU8A 2ZCVA 2E55A 1YUMA 4KLZA 1NQWA 2B7BA 1PJ3A 1UKBA 1QKIA 1G6KA 3MCUA 1O96A 4HNHA 1E5LA 3PGKA 1VA4A 2OQRA 4ZAZA 1OI7A 1X70A 8GPBA 4D0NA 2JBAB 4LV6A 4G1UC 4CDMA 4AICA 3DAHA 2FN3A 2Q5HA 1T0JB 4ZEXA 4F1KA 3PQ6A 3NNNA 1ORDA 3AM1A 2EP8A 5E9AA 3BTVA 1IOLA 4UEOA 2VCEA 2YWFA 2W2NA 4MVXA 4BLTA 4RTOA 4AP6A 2FWJA 2QU8A 3BGWA 3FPEA 3LP6A 4JB8A 4Q24A 3O74A 3OPYA 3IO5A 4OF4A 4UCFA 2Q8NA 1TUBB 1SCJA 3EXHC 1P39A 3OTWA 4JR1A 3FG9A 4B2LA 1TAUA 2R87A 2IEBA 5L3SB 1RLIA 4PLCA 3LNTA 1I3CA 1Y3FE 3BJRA 3C6QA 3DXXA 5L51A 1QFJA 4HAXA 4RKYA 3MHPA 4JYCA 1J2YA 2EZTA 3FTPA 2H2WA 3EGXA 3IO3A 1QP4A 4IVQA 2J7KA 1Z56C 4J03A 3YASA 2IHKA 1OLSB 2ZRFA 3LZ6A 3N74A 3U3MA 3RAJA 2JA1A 5IDXA 2HQOA 2J87A 3L1IA 1FZQA 2WYHA 2I71A 1FX0B 3QTTA 5IFLA 2WWRA 2ZZNA 2HHHB 4LF4B 1Y9ZA 1NV9A 2D0IA 3QLTA 5FDFA 1DC8A 4JZKA 1TUGA 2IIBA 1LGYA 1XJWA 1U7HA 2A1TS 4FXPA 2QYHA 4ZT6A 3IJEB 1L4UA 4L22A 2EW2A 4Z9FA 1P7ZA 4INAA 4MS1B 4CR7A 5AKXA 4ROSA 4RIFA 4CEIA 4EVIA 4KE9A 5LYJA 3AJDA 1K27A 3ENQA 2R1TB 4HPWA 3UMFA 5IZCA 2W2MA 5DHAA 3ENZA 2ZUVA 1K63A 2B8NA 1FMTA 2EDAA 3MT0A 1Z88A 2R00A 1D2AA 3PZBA 4HB4A 2J5QA 2Q5JA 1IXZA 2CKMA 3KQTA 3AZPA 3HDYA 4ZI7A 4QG3A 3M1LA 1XRJA 3DBHB 3D1JA 4F4HA 4AD8A 1GG9A 2PUTA 3KYDB 1DARA 3MYYA 4CZ2A 1O9GA 1ULZA 1GGNA 2VK1A 3Q8KA 3A6DA 3WLLA 1S3SA 4FFRA 2YW9A 2VYQA 3FZGA 4IGAA 2NUTB 3MRTA 2COEA 4N47A 1L7EA 4GBJA 1DJNA 4ZARA 1LBIA 3NBMA 4R2MA 1BHSA 3N86A 5EAIA 3SR0A 3UWPA 1H2WA 4AG6A 1G8GA 1ZM4A 3COWA 5EJ2A 5U4QA 1Y0BA 4LMRA 1SU8A 1X3LA 1W9MA 1XZPA 2R68A 3CQ9A 3L8HA 4G5SA 4GM4A 4J0KA 3PRJA 5KOHA 3NHYA 3SJ7A 1DO2A 2FUCA 3C7DB 5J2UA 1USUA 3WGLA 1LDGA 5M2QA 4ZTUB 1A77A 3R09A 2GCPA 4OGFA 5HFNA 2GF0A 5CDSA 3RYCB 3ZNPA 2ZUBA 4PPYA 2C5SA 4TQAA 5ADUS 1Y6QA 1TJ3A 3IB6A 1DHTA 1JZTA 1MPTA 1VXOA 2VL7A 4KKVA 1SUBA 1V3QE 2FP3A 3WI7A 3DEIA 5AHKA 4DSTA 1GPLA 2ZR0A 1U2QA 2QUKA 3FPJA 4AY4A 2R8ZA 1UJ4A 4R1MA 1HBJA 4WOPA 1LSUA 5DX0A 4GX0A 3EDCA 2CLEB 4FFBB 1NBEA 4P2BA 5FULA 4PNPA 4ZRMA 3V3TA 5E9WA 3PRYA 4DLWA 1N2CB 3OPQA 3ZKWB 3S2FA 3TSYA 2HNBA 2ERXA 2ZREA 2SBTA 1SKQA 3JQ6A 2GEJA 1KK1A 3C3AA 3CH6A 4OG2A 2AXNA 1C81A 4L5IA 1EH5A 2ZITA 4RZIA 5ITWA 4KXUA 4KAXA 4RVCA 5CM8B 5AW8A 2A88A 2XTMA 1RI5A 4H6XA 3ILXA 5GOTA 2HMAA 1WV1A 4IHAA 1QIFA 1DKUA 2F3RA 1Y7IA 2YOFA 1TE2A 3NWJA 1OLUA 4PBTA 1RWBA 2GK4A 3ID6C 1E7WA 4ENTA 2Q3DA 3DOUA 3GNQA 3A6LA 3NP9A 1C7QA 4IHKA 2H59A 2LZ0A 4GC5A 5HGJA 3VRHA 4QOSA 3RU9A 4BNDB 4EB6A 1I4LD 2ASEA 2V55B 3MLAA 1K88A 2XODA 4EEKA 5BVHB 1D2EA 1QV7A 4CG0A 3KC2A 3DZDA 5BR4A 2IV2X 5FEMA 1TQ6A 5G0WA 5IBCA 2GO7A 3GK3A 5FOXA 4R2HA 4O1IA 2NMVA 3F9CA 5BVGA 2VN8A 2BFMA 1BRMA 3I9NA 2RHGB 1XU4A 4HQKA 3SYLA 2HCJB 4EYGA 4ZYXA 2ABWA 3D6NB 3GEBA 2GUWA 4LDQA 1VJ1A 1L4FA 3OE7D 4H18A 2JLUA 3HBNA 1L5QA 2P4EA 3ADDA 4WN9A 3ZNNA 4O3MA 1GM5A 2X40A 2G0NA 3KJHA 3SOZA 4BRZA 4PNZA 2IH2A 5JJLA 1PSWA 1EPUA 4MI9A 4RENA 1GVHA 1H4VB 1L5OA 1Z34A 4XB1A 5CCDA 5L3VA 3AVUA 4E2YA 2WW8A 3P52A 2QJWA 1WXGA 4YT8A 1LZLA 4DJDC 1SUPA 2QB5A 2XF8A 3OWOA 1G20A 1PJ8A 1C3EA 5F7JA 3R75A 3T7EA 3U39A 2MSLA 4N3NA 3EEBA 1TDJA 1HEIA 1KE2A 4R9UC 2JI9A 4LZZA 4LXQA 2ONZA 2Q46A 4DKXA 4IMRA 1QCCA 1NVKA 4LDRA 4X45A 4F4IA 5LQJA 1R2QA 4GXRA 4XLTA 3TPCA 2VDRB 3FSGD 3BX1A 4BLQA 3KKZA 4RD0A 1Q19A 1D6NA 1S2OA 3CPSA 3JQ7A 3P20A 4HP8A 5JAQA 3H5AA 1V6CA 3M6VA 4Q4AA 5KU1A 3MTDA 1Q0PA 2HIMA 5F4ZA 3VAYA 3FDZB 3L9WA 4H0NA 4IJVA 1DMSA 2Z98A 3ITNA 3DC7A 1M0TA 5FOSA 5TLSA 3VSDA 1XZJA 3PWTA 3T4EA 2F1RA 2PTHA 5KQLA 4LYAA 2O1SA 1YF3A 2A1UB 2R8BA 3IA2A 3FUVA 3UK1A 3C6MA 4EYEA 1R9JA 1JKXA 1XMJA 3MMPA 5KYUA 3U6KA 2QYSA 4CDNA 5LJIA 2QMHA 2JFQA 3GT4A 4DPKA 2R6HA 2YHAA 4KE6A 1V8DA 1ZUWA 3OT4A 1Z5UA 3KSZO 2JFHA 2DHQA 3OE7A 4R8KA 4J3NA 1SU6A 1GRQA 2VOJA 2O20A 3T0FA 4F6CA 1XEWX 2D7JA 2O48X 2VDWA 3CLTD 4YJ2F 5TXGA 1MG5A 1X19A 3UV6A 3BIXA 5H81A 4L8YA 3E8XA 2IHTA 1A98A 2WUVA 4LA4A 3JZFA 3UOGA 5LKRA 3NWPA 2C3MA 2R2AA 4ZCIA 2IY7A 3TOXA 2XKAA 2ZJ2A 3D1LA 3DFIA 2YWEA 1LTHR 3FMGA 2B5VA 1HEYA 2YASA 3KOXA 1WEKA 3PNKA 4PFSA 5AI9A 1VHTA 4TYWA 4C78A 5BXYA 1FJXA 4XIGS 1XMQB 3O2NA 4KXXA 3WKAA 4YCSA 2PKRA 2M2IA 2JI6A 2J1LA 4CWAA 4ZGBA 5CD1A 1FDVA 2JAXA 3E3MA 4AJPA 3JWHA 1DIOB 1JRLA 2XMRA 2IYXA 2PWZA 3MWKA 3OCZA 3OCXA 1GQSA 1OIVA 2JJ1D 2BRUC 4Q7KA 4QOIA 3FSGA 5KEIA 4TTSA 3GG2A 5GV8A 4TTPA 5CURA 3LCMA 2F9FA 4N0MA 3UWOA 4ZO7A 1BE6A 3KU4A 4Y98A 5AI5A 1MJHA 3R5JA 1FMLA 2Y99A 1J99A 1SKYB 3EEIA 5U1PA 1EK1A 1YK1A 1AZSC 4RPHA 3AF4A 3SDSA 3IHTA 5ERGB 3BMNB 3MYRA 3BKWA 1IXSB 3MFYA 2NU8B 3IE0A 4WPGA 4P3YA 4XTCS 5AOVA 4BJ6A 1L3IA 1T91A 2Q1UA 2WUDA 3FMVA 1HDCA 4GX5A 2ZZKA 4LXIA 4D42A 1DOAA 2R62A 1A1VA 4OP1A 3F97A 3N2IA 1H1LB 4AT1A 3FHLA 3DE0X 5CA0A 5DH9A 1ZUNB 2G4LA 3HCPA 3T5GA 3F4BA 2WJ4A 1VL8A 5IBPA 5JCZA 3U7FB 3PI7A 2Q0QA 3DMNA 4KDEA 4A0RA 4D96A 5J4VA 1NQAO 2LKDA 1QRRA 4MIOA 1NW8A 3IAFA 1J97A 3GLGA 2IPXA 2XGJA 2ZTMA 3A4YA 3AHDA 2GSWA 3DFZA 3ENNA 3ME5A 4NFLA 3V8PA 4A0SA 4BGIA 1HORA 1REQB 3GJZA 4B3HA 2P40A 4RF5A 1QO7A 1LI4A 1ENPA 3KZOA 3VAAA 4C4XA 3R9WA 2VDMB 5KWSA 3TKAA 1FIUA 2CV1A 2HRBA 2JCBA 4C06A 1DWPA 1GCIA 2LP4Y 4UMEA 1XTBA 5IAAA 1MQ8B 1XMPA 3VHQA 2C5FA 3BL6A 3AILA 2ODPA 1VKJA 1AKVA 1OUMA 3DMFA 3QEJA 5I4CA 5A2GA 1LW6E 2NV2B 1KEPA 5AFSA 2UDPA 1J5EB 1B8NA 3OCCA 3D02A 4NNOA 4BP8A 3C8MA 5DO9A 2AJDA 1DPFA 4GFDA 4IO1A 1QK5A 1EYZA 1KMIY 1EMDA 1NZFA 1U1EA 2JJ1A 2W2KA 3DWIA 3MJHA 5FR2A 1ZH4A 2AMVA 2PL3A 4EG7A 1TAGA 1ZY2A 2X15A 1M34B 4YVFA 5IJ9A 4O4JB 3F3KA 3BXXA 5D3MA 1X92A 2YJTD 3ITDA 4E94A 4MDEA 2BI7A 2V6MA 2C97A 4HEA1 5DYNA 4FNMA 3M9LA 4MGZR 4KIUA 2RHRA 1U2SA 1OY1A 3ZDDA 1E5QA 1K6XA 4L6AA 1DX6A 4EX7A 1TJ4A 1J90A 4C4ZA 4KXVA 2FMIA 3RG8A 2D2EA 5MN5A 4FYHA 1G42A 4BIIA 3EBLA 4RDHA 1AUVA 1JI3A 2E2WA 2EG9A 2ZCUA 2C54A 4J0IA 3RV3A 1SHJA 5G3ZA 4J3JA 2GT1A 5J58A 4X1KA 1YQQA 5CTAA 3QYPA 3QVGB 2XIJA 4ZOAA 3QX9A 4MUAA 5EKTA 4D6XA 1DBSA 3DQQA 4DT1A 4DR2B 1YI8A 2BHSA 3U4QB 5B3JC 1UQUA 3Q8MA 2BHTA 1DJLA 4BO4A 2X3YA 3C45A 4OMUA 4TVKA 1IHUA 2PQ2A 3BWBA 2VI5A 1E2KA 3LVRE 3PJRA 1SVOA 4GPZA 1RAHA 5BXQC 5DLPA 1F8FA 4EHNA 5C35A 5BOSB 5FNZA 2VEDA 2XUPA 3OP1A 3EVAA 3CLRD 2FVXA 3OJXA 4BZPA 1H4TA 4YP7A 1EGMB 3BDAA 3GPCA 4PYMA 2UVQA 5LUBA 2Q5IA 3IIIA 1C7FA 4RLFA 4O2BF 4TKMA 4R0NA 2MJLA 1NW4A 1XMSA 4PICA 2WFMA 5ENVA 3FR8A 2ZYHA 2V9PA 1ZGAA 1JPNA 3KZXA 5AKLA 5L3ZA 4EKEA 3PIRA 1JKMA 1ZSVA 5GVSA 3I2IA 2Z4RA 3I5UA 3CXRA 5DLQC 2O8FA 1WOYA 1E7SA 3N58A 3IDFA 4DNQA 2D5BA 2WM9B 4F11A 2GPAA 4ZOQI 3QKSB 3KR0A 3EFBA 3U7GA 1XLVA 5HNKA 2XQJA 1Y7TA 4J2TA 2W6OA 3JTEA 3MIIA 4CKYA 2WSBA 4ADSG 2RBGA 2SKEA 1QTQA 2JKZA 2FR1A 1UBGA 3N2NA 4QOEA 1H5QA 1JGTA 3R9KA 3P4YA 4B4WA 2WUFA 5FD8A 5KQGA 1NXSA 5AYVA 4OJQA 4AQYB 3FLAA 1K5HA 4O33A 4OMFG 4P5PA 5CDFA 1FTGA 3R7DA 3K09A 4KQMA 3C5HA 4IV8A 4MZXA 2WICA 5TT1A 3X2EA 1F8YA 3W1EA 1Z0IA 2XDWA 4EMSA 1Q0RA 4MRMB 5I9IA 3FOAA 3CR3C 2YC4C 5CHEA 1TL7C 1JEJA 3A2MA 3I9JA 3AC0A 1DTWB 4RSMA 1GRVA 5B30A 1J21A 2D8AA 3UNXA 1M74A 1O58A 4AUKA 1XG5A 1G6Q1 4FWTA 4D9KA 1NX6A 4RVGA 4F8YA 4LWZA 1MORA 1NLYA 2XYPA 3ET5A 3ESQA 3JCZA 1ZJ6A 2OWDA 3VPDA 3EVGA 2EFJA 3B1FA 2XKBA 3ZGXA 2YVAA 1O2DA 1MAUA 2P65A 4D4HA 4LDAA 3O5AA 1Y42X 3ZVLA 5JXWA 1UFOA 4JVSB 3A14A 1ZXLA 3F3YA 5I48A 1NVXQ 3OTIA 4UE2A 2REXB 4CKCB 1BHQ1 3G2QA 2C3YA 2A58A 3N8IA 1CERA 3AR9A 2B99A 4Q3AA 4XJTA 3PEYA 3SQWA 3ZE9A 4MR7A 2AS0A 1SCBA 2PZBA 1PFKA 4ZOLA 4MI3A 3IJPA 4XRRA 2H07A 1LSJA 1E9BA 3OIUA 4AJ1A 2IU6A 3THOA 1WF6A 1J9GA 1WVIA 3K6SA 5FBVB 1CQXA 2AE1A 2OP1A 3FI0A 5KHLB 1X1EA 2NN3C 3KTDA 5TVGA 1RHJA 1PQUA 5CM9C 4DMMA 1L5HB 3AI3A 3SWWA 3T3OA 2AOTA 1WPRA 4MA0A 2F00A 2A9JA 1UBHS 3OTOB 2VPXA 2E1PA 4OKNA 5C37A 3FUXA 4E31A 4KJZA 4K28A 4C2AA 1E58A 2BEWA 3MS4A 4BWVA 3EY9A 3GJTA 3QUAA 5TPWA 1FQKA 1RKXA 4BY9E 1HYBA 2OTCA 2C94A 3R9XB 4DR4B 3FIJA 3UTCA 5JSKA 1NFFA 2XYQA 4XVUA 5AIBA 4YJHB 5F3DA 3O7WA 4LHSA 1KVTA 2VDJA 3BF8A 2ODEA 5CEJA 3PNBA 1DC3A 2F1KA 3CZMA 3V6LA 1UT8A 3GW8A 5HUQA 2DSTA 1UZAA 4OHUA 3AY0A 3JXEA 5KTMA 3CUWA 4FEYA 5E2BA 1Z4QA 2G9RA 3OFND 3FYUB 1E3QA 1XQ1A 1ESNA 1GP2A 4XVCA 4BLUA 2QZ9A 2GYUA 2AE2A 2OO3A 2R84A 3N05A 3FUUA 5AP9A 1S8NA 3LZCA 4H1UA 5KYWA 1I3NA 3LX5A 2V5UA 3OMWA 3QPVA 5A1TA 5JQGA 2PE5A 1PVDA 3ZDYB 4A6DA 1MT0A 2HRRA 1ZDMA 4ILKA 2Z5VA 2H2IA 2YJ5A 3D8UA 5EP1A 4BNZA 4IHJF 1K2VN 1DLIA 1KJ9A 3TRFA 5BSFA 4X1YB 1BGVA 4RZ3A 4J1SA 5DM60 3CRMA 4XARA 3H0CA 4JJFA 1IONA 3RJZA 1KXZA 2QGNA 4FB4A 2EEPA 1VRVA 1WB6A 4KXYA 4P8RA 5AR1A 1QP8A 1VJRA 4WLEA 4EI8A 3WFIA 3R7FA 3ITEA 2GXUA 3DFKA 3LSYA 4YT2A 4L50A 4WFIA 2YZ2A 1NRJB 1W2GA 4UD2A 2AUMA 3AVPA 1N5RA 3DR5A 3NRJA 5ELMA 3FRIA 5HEKA 4YDQA 1B73A 3PFWO 4KIGA 1O8CA 2EKLA 4G37A 1NOJA 2XB6A 3IBYA 3OT5A 2A6PA 2HO4A 4PXAA 1ENZA 5CNMA 3TN7A 4Q4JA 4OJYA 1XZNA 1YULA 2CNWD 2ZUTA 3D6MA 1VLQA 3MTJA 1ODLA 2K2QB 3UN1A 5LMNB 5CAEB 3WSVA 3RKUA 2VJAA 5JANA 2RIRA 1SY7A 1HOXA 1ZD5A 4FBGA 1WOMA 4ZYWA 1U0BB 1M33A 4LI3X 4G5XA 4UDXX 2BGLA 3OFNA 2XUOA 1GARA 1PW7A 3ZWNA 1TFUA 1F9AA 3SXUA 5HJ5A 2PGOA 1MG0A 1Z6GA 2YQZA 3EZNA 2ADOA 2BSXA 3HL4A 1A7AA 2JZOA 4XVQA 1SK9A 2RH9B 3B5JA 1JBQA 3TW8A 3C3XA 2NSYA 2FLWA 1P6XA 1DOZA 4YLGA 4CKEA 3O3MB 3R74A 3CPJB 3B3JA 3UO8B 1G60A 1W75A 3L84A 5F3RA 4HDRB 3ZLBA 2AFIA 1HYQA 1WD5A 2YIMA 4KQJA 4U0JA 2CHGA 2P3OA 2NU6B 4ZVNA 2QLMA 3RARA 3SMVA 2EF1A 5CYPA 3TOCA 1KEEB 3AVXA 1CUIA 3G0BA 1G4UR 5FAKA 3IEMA 1J8QA 4EVSA 1P72A 2BJWA 1GLGA 3L06A 4N9WA 2DQKA 4HAUA 2RB5A 3GLVA 3LKDA 4UBLA 4D6YA 3FVVA 3O90A 3PPVA 3QVLA 4I9GA 4YCAA 3W90A 4G5QA 2IZ7A 4D0LB 4P4UA 2PMEA 2X42A 3JAMA 2H9AA 2F1HA 3F5MA 3GXOA 3G5UA 2TECE 3MCTA 4B7CA 1OXXK 3HO6A 4R8MA 4EDHA 5GGYA 3DDZX 2EX0A 3DR3A 3ES9A 3IKJA 3RYTC 6CHYA 3TDKA 4N8DA 5D8DA 4YR9A 2IODA 1T0PA 4J43A 2WIGA 4KQCA 1RWWA 7REQB 3INNA 4JLAA 3AV3A 3PR1A 2CNWA 1C14A 1JAYA 2JHFA 1F5NA 4IIHA 4DLZA 2B3DA 4OH7A 4CDGA 3UV7A 4UNQA 4ZP1A 5CLJA 2AOXA 5IPFA 3BEDA 4CM8B 5JECA 4PX9A 1SJ9A 2G40A 1MEOA 1VMDA 2H1WA 4ENRA 1V95A 3P0JA 2WKPA 3HPQA 4HD8A 2HXSA 3GFGA 4S3MA 2EQ5A 4Z0NA 4A16A 1T4CB 2BFBB 1FDIA 3BFXA 4I55F 5JT1A 3U4HA 5JXIA 4AM8A 1TRKA 2C4NA 2XGMA 4QQKA 3V1LA 9LDBA 3DF9A 1HETA 4WVFA 3RRMA 1K3TA 1U9YA 2DWQA 1D7OA 2O3RA 2RGRA 1GU0A 1HT0A 4TV9A 4U6QA 2GXQA 3PDJA 1JMYA 1T6BY 3C97A 1ORHA 3GVPA 1R0BA 3HJGA 2K7FA 4BFSA 2PVSA 4IDFA 5LU9A 3WKCA 1ISGA 1DEKA 3G8DA 5C4GB 1ZC4A 2ZRMA 1AGPA 3DZ8A 1XTIA 1E96A 4KX3A 4PIPA 4B6GA 2ZPAA 5KYXB 1HFJA 3PC3A 3MINB 4TXJA 3VR3D 3PLAE 4TN5A 4BUZA 3Q40A 5JSYA 3HLTA 3LI2A 1PNOA 4ONEA 3WBKA 1OFVA 2JLXA 3I3OA 2X23A 1FSGA 1G9SA 2FSVA 2Y9MB 1F9EA 2D2VA 3V2UA 4S12A 16PKA 2AQKA 3JPYA 1RQPA 1P44A 1AGNA 2P2SA 2O5CA 1WHSB 1A1SA 4PVCA 4TKUB 1JALA 1F2UB 5CBPB 1JSRA 3IAHA 4D81A 4JP5A 4K86A 1QUFA 3N5CA 1U8ZA 4NEQA 3C3DA 1K3UB 3E9EA 1W30A 1Y89A 3IUYA 4I4LA 3LFTA 4NK4A 1RZUA 1SPXA 2XQVA 4E11A 2A33A 3DO8A 3BXFA 4RABA 2CW5A 1PJZA 4EY5A 3MMZA 3C7CB 1NAHA 4KMRA 1THTA 3EZLA 3IEXA 3PE4A 4AZ3B 4N9QA 4FM9A 2R6JA 3GP5A 2QE6A 2QZSA 5TQ0B 4GIBA 2I78A 3MCAA 3AYXB 4H7JA 1JKIA 1JHQA 2CJFA 4LJRA 4KJXA 4MCHA 4MV5A 4E3WA 3M6WA 1XDBA 4C6SA 5CBKA 1BRTA 2WHEA 3WQHA 4O4LF 4R84A 4KTTE 4US2R 4XVRA 2HQ1A 3ZIAD 3LT2A 5DDIP 1EFAA 1N8KA 1HQCA 3T1NA 3A7DA 5CTJA 3SC6A 3E0XA 5AKEA 1NP7A 4Q4HB 4ZV4A 4EB0A 2VTBA 2WT4A 1JHUA 1U2TA 4C5BA 2Z1DA 1BXZA 3VR3A 2QVBA 3OP4A 2OHFA 2C4HA 4L8LA 4DVGA 4XB2A 3RTBA 3DD5A 4AI6A 3NDBB 1IAVA 3FCCA 1NSFA 4NIMA 4WLFA 4TWJA 1OYWA 3SPXA 1O3YA 2OKGA 3FCUB 3AXTA 3O1LA 4DLXA 1IBRA 2ZBFA 3WJ2A 1RPJA 1AOXA 1P19A 1PS9A 2A5JA 2TYSB 5IYZB 2KYRA 1KRXA 2B6HA 1MN6A 4FMCF 1JQAA 2PKXA 3CLSD 3ND6A 4FYIA 4NZ9A 4UD6A 1YASA 1ULBA 2C7OA 3CWCA 3TMAA 3P5SA 3ZV5A 2HJ9A 4Q9JA 3TFWA 2AI3A 4LF7B 3Q7IA 3EXHB 3THYA 3H5NA 2RGDA 3R0JA 3OIGA 1GG5A 4RXTA 1KH3A 1SXJC 2JI4A 1TQHA 2PGAA 3FMIA 4KQIA 4MUNA 4YRJA 5T3YA 3H42B 3ZW7A 4REQB 5KNBD 3FETA 5P8WA 4DJTA 4NJEA 2Z1NA 4GR5A 4KBYA 1DOHA 1Q7TA 1U0SY 2RSLA 1ZM9A 4MUFA 4MWDA 4TKLA 1Q2UA 2X8LA 5EJ6A 2E0IA 2RC5A 5CK4A 3TXXA 1JDTA 4U9UA 5M34A 1U3WA 5FFNA 2R6CA 4CN9A 4CLRA 1C1DB 1W93A 4JI3B 4PR0A 4BWGA 1FS4A 3ZIAA 1WXEA 1VCHA 1VMAA 1EVZA 2GM5A 2Y1EA 1L7PA 5B1IA 3OUTA 5C2JB 1N0HA 1W4ZA 3GGPA 4GDMA 2ZBVA 3TPZA 1AKRA 3E3OA 1E64A 1Q6ZA 1LLUA 5CA1A 2X4IA 2H2DA 5CEFA 2A35A 1Z4KA 1Z2CA 3COJA 2HY7A 3L6OO 4QAQA 3PSHA 3FJ1A 3MJRA 4FSDA 4MV3A 5H3LA 3AFGA 4X3PA 1CQJA 1WDMA 3KE9A 2PEYA 3KOUA 5DXFA 1J5XA 4W9RA 4BFXA 2V3CC 1L6IA 3D5QA 5EJFA 1CLEA 1QZUA 4RVFA 3ZNOA 5ADHA 3T3HA 4G6ZA 5AJVB 1RM3A 2IP4A 4XKJA 4F06A 3GLFE 1FFSA 3LQFA 4QJ3A 5B6PA 3AWDA 4GXQA 3W7VA 1OWMA 1JHRA 3MK31 3LUBA 5EOVA 3W7AA 4QA9A 4QUIA 1X94A 4RK7A 4OGGA 1GTRA 1R12A 1ZD1A 3EDYA 5EFOA 4NOMA 1W8IA 3ACDA 1XZLA 3HO8A 1C9NA 2OHIA 2AC4A 3MWLA 1KK2A 4EHJA 5KNBA 5FUBA 2WFLB 2O3UA 3PBKA 3FNQA 3Q8LA 2O0MA 4FLMA 2CJWA 3X0DA 4FE3A 3WMRA 1QKJA 1U1CA 4HWSA 5E8JA 5AI8A 3T06B 5KTSA 3S1SA 3ROGA 1YNOA 4IJQA 3JQ9A 3NPMA 4K5QA 1GPYA 1L5YA 2XCTB 3QEMA 1Q0UA 3QA3E 4BVJA 4LVUA 5CX1A 1JN0A 3U80A 2JC3A 5FV7A 3RFXA 5F9FA 1B3BA 4RSHA 3MGKA 1OFUA 3T1QA 2MR6A 1GZ5A 3W5UA 2I62A 3A1NA 1P9WA 3PENA 2Q9CA 3QFFA 4YIKA 3HXOA 2JI8A 4RTQA 5ILOA 4YHHB 1ZA1A 3QWHA 4ZN6A 5LBIA 1THMA 5DBOA 1YFLA 1A27A 3I01A 5FPHA 3AHEA 3RBZA 5BV0A 2OCPA 3KQOA 3KV1A 3N0TA 1GQQA 4UMVA 2BCEA 3HCBA 3L7NA 1Q0QA 4G5YA 4LG1A 2XBMA 2CMKA 4QUAA 3IE1A 1PLJA 1Y6FA 2OCLA 4J49A 1YE5A 5IAJA 1LSSA 2IE8A 2VYVD 4KN9S 4ZHQF 3HWX1 1M1ZA 4ZQHA 1L4NA 3IEKA 4DV6B 2Q5QA 4M9UA 4PZUA 3RAEC 3AHCA 3DVSX 1NOKA 5KOJB 1JAZA 4X5OA 3TDMA 1AK2A 1ZWLA 2H2GA 1VL0A 3Q3CA 2XKKA 2BWJA 2VA8A 2FPPA 3G5AA 1RCFA 3M9WA 4L3VA 5D5PA 1TIBA 2BY4A 5ERYA 3REFA 1I4TD 4CQLB 1NKVA 3R0QA 1BYIA 1RMYA 2XWPA 3N2LA 2LCIA 3TZ6A 1JFVA 2FKAA 3DGFC 3ECSA 2IF2A 3TD2A 3UBMA 3GLIA 2AMLA 4D1YA 2D5CA 2B83A 3AERB 5TS3A 4Q3CA 1T3GA 1Y1TA 3KSRA 4JOQA 1AUOA 1X80A 4B4OA 5J2TA 1ZHOA 2XY4A 3WC4A 2IS4A 2PUHA 4P7JA 1GAWA 3OQOA 1P5HA 4W9MC 3MIZA 5KCMA 1QQTA 3N2KB 4FN5A 1JDVA 5I4IA 1XKQA 3SQNA 3WK7A 3OT1A 3HJUA 1A8SA 4ETNA 1K98A 2AMYA 2XVXA 4OH1A 2YZGA 2ZULA 3HR8A 4RFVA 1DQRA 4IFEA 1ZNWA 1O94C 2G6TA 2ZQ5A 4EF6A 2EZ9A 4ZAGA 1W5AA 2JHAA 4QGFA 3BMQA 4TWRA 4HLUC 4ACBA 3I2JA 3HGQA 5DYIA 1F5SA 4G2TA 3K96A 1Z36A 3PC6A 4ZI2A 5G2OA 4B9EA 3RPEA 1IIRA 4K0KB 3MBIA 4WJLA 1H8ED 2I55A 1F8UA 3BHIA 2CF5A 3MAJA 1EJ6A 2CWWA 3OZAA 4QC2A 3OURA 1RJFA 3T7RA 3ACCA 1FTQA 3HUDA 1R6VA 2B1RA 3LGXA 1P17A 2VYVA 1GPWB 2W0SA 1QYIA 3C5WP 1EXWA 2QE7D 1JSCA 2ID4A 3CNHA 3W6ZA 4Z4IA 2YNMC 3B6IA 1Q21A 3IELA 5TRTA 5JE8A 3PEUA 1RIFA 4S05A 3SE0A 5SYAA 4EPRA 4ESEA 4MPRA 4EY6A 4N12A 4PZPA 1Q17A 1ZMRA 1RYHA 3IVGA 3QLVA 3ZU6A 3TCXB 5CP8A 4JYZA 1T2NA 2I4NA 2WZCA 4RHTA 4M1MA 1X39A 2JBAA 1XNJA 2FGJA 2WM3A 1RRVA 3UYLA 4XE5A 2B3TA 3RYHB 5BSVA 3ZWAA 2IUEA 3AUUA 2P9HA 3GI1A 3ZHOA 5JRDS 1K0FA 1RJDA 3V32A 3FWYA 4MKXA 5LP6A 3IEVA 1PUJA 1YGYA 2C7BA 2WJ6A 4FCTA 1RLMA 1S4MA 3PS9A 4F45A 3G2IA 4UOQA 1TUBA 3ESRA 3O26A 4Y9UA 3G2OA 3D59A 3DLBA 1M6EX 1ICEA 3I01M 1V1MB 2XHEA 1KSHA 3LCJA 2ZB2A 3PUZA 4CMEC 3SVLA 3SDBA 1FP4A 3TSOA 1TMYA 3WGMA 4I8IA 1HF3A 3IR6A 3GLHB 2X0EA 3SMQA 2WWXA 2WIKA 1BE0A 4R69A 3HU1A 4W6QA 1YRQA 2VHWA 1UZLA 4YJFA 4ERXA 5K9ZA 2CCJA 2Q1SA 4UTPA 4BWYA 2FN8A 1RACA 3R6LA 3NORA 1L1RA 1E7QA 4CCSA 1H8EA 3LDGA 4OI2A 2Y1FA 4Y1EA 5IT4A 1N2JA 3WLMA 2PWBA 2Q41A 4X1IB 1C4WA 4OU4A 3LFUA 5CFPA 2KQUA 1CUEA 3PLNA 1QYCA 2QE7A 2W2TA 3ETDA 2ES4A 3GRVA 3E81A 3F71A 3H17A 2ECQA 2DUMA 2V1XA 5JRZA 3L1VA 4B83A 3W77A 2QQEA 2DR0A 2QJRA 3GHHA 2GUGA 3IPAA 3IV6A 3R6WA 4M83A 2O2EA 1XDSA 2QJOA 2CMGA 4KNWA 4DM3A 1RI2A 4EFLA 3ADBA 4OQQA 1NBAA 4GLOA 2W70A 5KQSA 1PJQA 3GUYA 2R97A 3P2YA 4AP9A 5B3KA 1AB6A 1A04A 3RVPA 4NPCA 1KQNA 4ZJUA 2B9EA 4U2FA 2GVDC 1N9ZA 3DBVO 5DGIA 1L7RA 1OPXA 4QUEA 2JJMA 3DWGA 2PBLA 2ATEA 3KEGA 4GP9A 2NUTA 3B9QA 3SKYA 5HDBB 3ELUA 3H2ZA 4DCCA 2HJSA 2O5VA 3PZRA 3S2ZA 5K4GA 2QW1A 4G0MA 3L7LA 4S1VA 1V43A 3K9WA 4K46A 4POAA 1ZW1A 2Y67A 3CV3A 4RX1A 4X54A 4M9CA 2VF2A 2A5LA 3SJCA 2RGUA 3GF4A 2OD2A 3V97A 5DX1A 3UXYA 2NG1A 3JQPA 4H3SA 4MEAA 1HTWA 1W5TA 3R7WA 3AHFA 4TUYB 4W8OA 3RYCA 4CFZA 4LJ4A 1KO7A 2ECKA 2GAIA 3PNLA 2BDTA 2F2TA 2VLBA 1UBSB 1U7OA 3FDFA 3FXAA 2FUG6 2NZ2A 3FZQA 2MCFA 2AD5A 4EQ6A 2CT8A 3ROEA 1DBIA 2VIIA 2R7KA 3HN6A 4HDMB 4ND6A 4Y0NA 4YEDA 3LUKA 1VPWA 4N76A 1GV0A 1SVIA 1X2EA 3SEAA 5EPOA 4NV0A 2AG1A 3NHWA 4FFBA 5E6SB 1HYEA 1DC5A 5JCOC 3BDIA 4HXFB 1N2CA 1Z5OA 4RH1A 3ZKWA 3FHTA 5EYPB 3DHYA 2QMYA 1Z62A 2YV3A 4M54A 3ZD8A 4C20A 4IS2A 1M0SA 1JJ7A 5CYFA 2ZSHA 3I12A 1XLTA 5JCPA 1XJQA 4HUQB 1SNYA 3PPIA 3H6GA 5K6AC 1NP6A 1XDUA 2RGCA 3ONEA 4GW3A 3QF4A 1EA5A 1LS1A 1E5DA 3B1XA 3QITA 3VO2A 3CUVA 1C9KA 1ARZA 2O4UX 4BYGA 1E0KA 2O2DA 3FKSD 5IP5A 4CMAA 3LRXA 4G0UA 4OQ4A 2E4WA 5IHXA 1MIHA 3NWBA 5H80A 1IDOA 2P2ZA 1YZLA 3SF8B 2OQVA 3N76A 3RS8A 2IKSA 4MJLA 3EIEA 4PEVA 5EA2A 5KCZA 3SJZA 5L4LA 5BVHA 4B43A 2CXSA 1X8LA 4DYDA 5LNK1 3Q1LA 3V8RA 1BKSB 3LQ1A 4GICA 3H9UA 3QENA 4UAJA 3WIBA 2G9QA 1BZYA 4BN5A 2I65A 5I5GA 3BKXA 2VQEB 3W6PA 2I8LA 1IZ7A 4NRDA 1E3IA 5HKLA 1LI7A 5LQSA 2JFZA 3LT0A 1J2RA 1Q12A 1U3CA 4XDZA 4G09A 1U11A 1EFDN 3DOJA 5FYDA 3V1UA 2PGIA 2CUZA 3VX3A 1V45E 2LPMA 5ITSA 2CY0A 3K9HA 1L0BA 3R6DA 4RY0A 2J6BA 2WTXA 1E1KA 1AHHA 5A4KA 4WL0A 3OM0A 3BK2A 2R85A 1KVSA 3USCS 3KAKA 1T5BA 2Z5LA 2H8GA 1JZSA 2BFFB 2WMYA 4IIUA 4W4TA 1I4WA 1FFBA 1UADA 3KT8A 5AH0A 4RDCA 2IXGA 5LM3A 1ZBDA 3A1UA 2I03A 2A5FA 1Y1PA 5DTJA 5I7HA 2R6AA 1S4QA 4HFRA 3QPAA 3ICWA 1Y3CE 2X1LA 3R5SA 3VI3B 1ULSA 2B21A 2RGNC 3B5IA 3O92A 4QUBA 2G28A 2ZRAA 3DE4X 4LOIA 3HEBA 3KVNA 2JAQA 1A7KA 4V38A 3KQWA 4W6ZA 4MWBA 4OQZA 1PWEA 4LHEA 4I1SA 5FBKA 5CDUA 2VHUA 4JUIA 3ZJYA 3FKSA 3L18A 1A9TA 1IAQA 1XCBA 3SBXA 1ZUD1 4K3UA 4C22A 2WP8J 3SLGA 3TCNA 3WIUA 1NBOA 4Z8XA 3VBEA 3NUZA 1EB9A 3QMMA 2V0CA 5AW7A 1CPYA 1IG3A 3FWZA 1ADYA 2DHDA 2AEFA 2I99A 2H18A 4LHZA 5EKDA 1MHTA 1UWVA 2JVJA 4X7PA 2BGIA 3GO4A 2FSUA 2GTPA 5HMLA 4ITRC 2QTAA 4BP1A 2AWOA 1RWQA 3BZBA 3CNOA 3TQCA 3NIFB 1BCSB 1TM5E 5B1HA 4UNNA 2KE5A 3H9BA 5LPNA 2ZXUA 3MJDA 2H7XA 1ESEA 1PLKA 1NSYA 3S3TA 1O57A 3SXJA 1G4AE 1DEHA 1C7ZA 4WFQA 2FP4A 4PAWA 1P7CA 3LQYA 2H1VA 5EJIA 3VYTB 4R1QA 3ZHCA 2XYHA 3Q5GA 5IJ0B 1T36B 1KE1A 4BJHB 4HDKB 4CXMA 5KNCD 4XPIA 1NN0A 1V1RB 2YDXA 4IQ8A 4ZC1A 1WZCA 1ZOSA 3STYA 2WMDA 3QA9A 4RYDA 3SX2A 4D9MA 4DCGA 1KMNA 3C41J 3QFSA 3NBZC 3VGPA 1KO5A 2P2YA 1K7YA 5HM6A 3NKFA 4FQ8A 5GJWC 4XR9A 2WWTA 4B3CA 1UFQA 1ZD4A 5GONA 1TADA 3OOJA 4I8XA 4TZ6A 3CG0A 1EFCA 1V8OA 1CY8A 1RW4A 4FI3C 4FSXA 4JT2A 1HMPA 4CF7A 1E2IA 1G2OA 4F6RB 4KMMA 1QGZA 2VJLA 2R8EA 1OW3B 1SOAA 3G0GA 5E6RB 2Q9BA 4JV5B 1Y5LA 4O4IA 1JHVA 1U5BB 4RO0A 3RFFA 3UF0A 2SECE 3U9TA 1T1GA 4YT4A 1AQLA 1TOAA 1VTKA 3EG9A 3Q3IA 3TG8A 1QYVA 1UMCB 1NXTA 2VAVA 3L4BA 2C59A 3BMNA 1EUDA 3JTMA 5C7IO 4U7FA 4KFRA 2VF8A 2WV7A 3EYWA 2NU8A 3KKQA 3TI7A 5FL3A 1ORWA 2IW1A 4QHTA 2C4VA 3T5MA 1B23P 2H2HA 3F8WA 4N5NA 4QICA 4Y2PA 5HIMA 1WDWB 2C9ZA 1H1LA 4M60A 3IHKA 2X0FA 4B6JA 2FX2A 4XR4A 3E2IA 4I9NA 3PL5A 1HV8A 3IX7A 4X6LA 2FMFA 3K8QA 3WRYC 4DV0B 5FADA 1MVLA 3L0ZA 5LXTF 5WRFA 4EO9A 3TZEA 1LW7A 3VVLA 1NOIA 2Q5OA 1GSIA 3K4PA 4QXAA 4UZSA 4CGZA 5HZHA 4U7TB 1VHLA 1MX1A 3MGBA 1JFFB 3OJCA 1REQA 5JYDA 1WHTA 1PS8A 3WRWA 5M5BA 1QOPB 2F9MA 1U2DA 3LE8A 4B6SA 2WU1A 4LQ4A 5KNCA 1LC3A 3RNLA 3TX2A 1BDMA 3KUDA 4C7VA 1P80A 1R6AA 2A2ZA 5B58C 2BSAA 2GLTA 4XAQA 2AUTA 4IR7A 4LC0A 2FWNA 2E89A 2RGYA 4RKRA 4KFCA 1WUYA 1MD9A 1TQ8A 4BBJA 4RIEA 2VHXA 3KKLA 4FMDB 4ZV9A 1VIVA 1E99A 1H22A 2R65A 3KJXA 4L2IB 4K03A 4F7DA 5LWQA 4GUAA 3HNOA 1VDMA 4YPOA 5C4MA 4Q9AA 3PUXA 4G25A 2QORA 2UZ1B 3E70C 3QUCA 1PT8A 1M34A 4BAGA 3GDHA 1L8LA 2HHJA 2Q7OE 4D8UA 3ZY3A 4EJMA 2C0CA 2O50A 5E9QA 1C9DB 2P8SA 4PYRA 3QE2A 4OKSA 2QZZA 4RIIA 3DOFA 1AS3A 3BE8A 3DT8A 3QJYA 4NPHA 5CM2Z 4EY8A 5AVQA 2O19A 4TV8F 1RJ9B 2Z2YA 4TVOA 4OA8A 5IS2A 2Z2XA 4Y2JA 5FLYA 2XH8A 5A5EA 4AMZA 1JB1A 4X1OA 1JH9A 5AJYA 1J1ZA 1XCLA 2Q9AA 2RBKA 1WB4A 1N8SA 3KFVA 1M2VA 3EHDA 4JUCA 1YRLA 4YJDA 1GUDA 3M5PA 2R8YA 5BMOA 5HBRA 1GNQA 1SG0A 1XB2A 2P3LA 2WG1A 2JD0A 3HXMA 4RK1A 1YDMA 3OWHA 3N0XA 5FV4A 3NTUA 4I4TB 2V98A 5FR1A 2QNRA 1KMQA 4ZPJA 3UT6A 3RC2A 1W76A 2CD9A 1QHHA 4NAVA 1GN8A 4DBVO 4B81A 5J3JA 1XZEA 5DT9A 5BOSA 4H59A 1XCMA 2G63A 4UTRA 2PJRA 1V25A 4IWXA 2D3WA 5ALJA 4ICIA 3SSAA 4AJJA 1MBZA 3BMCA 1KIAA 2W9XA 5K3SA 1J23A 1NWHA 4BFLA 1FTNA 1ZMBA 4V0LA 3T7IA 3VA7A 2Z4TA 1A95A 3AJEA 4RD3A 1XRQA 4I1RA 2VDLB 1PV2A 4QLAA 1QB7A 4MUGA 3WGUA 1OU4A 3URMA 4LOAA 1W85A 4DRXB 2FPOA 4MMZB 3DEAA 4U5XA 3R3VA 1BC5A 3B85A 2PV7A 2HV8A 3LYUA 3QKSA 1B2LA 2ANCA 5HYVA 4D9HA 2I0FA 3KUCA 4K6CA 3QI7A 2C03A 2OXFA 4QOJA 2WHQA 4EO7A 2E4ZA 2WMNB 2O1WA 4JIMA 5ALMA 4DV4B 4B75A 2FZWA 3UK0A 4RGBA 4IH4A 4PYLA 3KHTA 1A8UA 4UXIA 3WR5A 2GYYA 2WINI 1AF4A 2C9OA 2H00A 3IALA 3K73O 4ZCPA 1Z26A 2G8LA 1VLLA 3JWJA 1LNQA 2WV9A 3HB4X 3X2FA 3ZZTA 5M3BA 4ATNA 2YDYA 3GARA 4CFSA 2NAPA 4JXKA 2GN2A 1M6NA 1CQZA 2OY0A 3DV0B 2P62A 1CZNA 5JAHA 4IIGA 4XUCA 4RE5A 3B1YA 2PR7A 2UUAB 1BVUA 3GUUA 1FSPA 1DTWA 2I80A 4K05A 3RGGA 2QX7A 4PC2A 4D8YA 1NI3A 2A9KA 1ES9A 2XGGA 1O6BA 3CVVA 1X1CA 3ZOKA 2FFBA 4RV9A 3RBXA 3TVTA 4KFSA 2ATIA 4CG2A 2WF6A 2X4GA 1R8QA 1NONA 5CT8A 3T7AA 1XU7A 3MPUA 1OWNA 5I7FA 4CT4B 2C2KA 4ZICA 3N0WA 2BP7B 5C34B 5A5VA 1T0UA 1G5FA 4RF4A 3JQBA 4INJA 1SO8A 3CA8A 3ZWYA 5KNBH 4ZYTA 1VE1A 2CLCX 3ZVMA 3ZGLA 3SZ3A 1LDBA 4MARA 1F51E 2HO5A 3IHWA 3H2JA 1A5SB 2X13A 4JVMA 2OBMA 3IAUA 4RY9A 4EZBA 5I4BA 2DHRA 3T38A 4DV7B 1EFKA 5K3BA 4B6RA 5HCNA 3UFBA 3MQ4A 1H6DA 4P3PA 4TMWA 4XWKA 1I6KA 1BWPA 1M2WA 5DHTA 1FNCA 3Q11A 1C0PA 3C6KA 3PUKA 3V55A 2B25A 3KHKA 2D1RA 4WA8A 4WKNA 2C5HA 4G9GA 2OSBA 4GE3A 2A94A 4M0FA 2JG3A 4KSBA 1C7EA 4ZYZA 2CNLA 2XIQA 4XCXA 4F71A 1I7QB 1NI5A 3QXGA 2VEOA 5IWCA 1XD2A 2P2LA 1C3VA 4X41A 2RHJA 2H52A 1MGPA 3DXYA 3P7MA 1JBEA 1OA1A 4Y9SA 1L5HA 3ZE6A 2JHPA 4Q3KA 1V6SA 4JCOA 3WRXC 4OIMA 5JUWA 4NG4A 4DUGD 1TPYA 4Q7QA 1ZONA 2JJQA 4LSGA 2HQBA 4U9IS 4R0VA 5DZSA 1ONNA 3K2QA 4Q01A 2V8BA 4JT4A 3ZQ6A 1MTZA 2QL5A 5TJ9A 2CHEA 2PMWB 2CLHB 5J5VA 2GRJA 2UYCA 5BRAA 1LS6A 3PI6A 4YJHA 221PA 2OVFA 2VHCA 3PGA1 5FLKA 3TKLA 3EIHA 1EVEA 3V7FA 1OX4B 1VPEA 2TMGA 2Z8YA 1U9IA 3EVCA 3N59A 1NWCA 3OHMA 1G7CA 1CE8B 3KYBA 4XEHA 2ORYA 4EJSA 3JZIA 3H6KA 5JATA 2DEUA 1GZUA 3K15A 3HSYA 2QZPA 2QF7A 3TNYA 3UKJA 4A23A 1MJFA 2LR0A 3FYUA 3LL7A 4BMSA 3I28A 5LZ4A 5I3ZA 1DS6A 4OFWA 2A3RA 2PZGA 4IVNA 5J4LA 4ME6A 1KJWA 2P9CA 3FWKA 4QTYA 3PCXA 4I5EA 3R3UA 3JARB 1TIKA 2UZ4A 4I2NA 2Y8EA 4L85A 1ILWA 1G19A 3FLBA 2V45A 3P0RA 4OQFA 5G3YA 1PBNA 4UBNA 4EY4A 1U8EA 5HOEA 3QQ5A 1E4VA 4NFHA 5CUQA 5DYWA 2PG3A 3ZU4A 4CEHB 1U81A 4B2IA 2WF5A 3E15A 4LOKA 4X1YA 2CVQA 4I5GA 3FOWA 1K5GA 3AEYA 2OK8A 3C5EA 3NG1A 3DKKA 3U3DA 4N48A 2PANA 4G1EB 2IDZA 1EQAA 2CL6X 3WGHA 4KDRA 2ZSAA 2ZIGA 2IZ1A 1JXOA 2GEDA 3H1BA 3NJ4A 4DUGA 4FOPA 1SXJB 4LHVA 3IL2A 3IQXA 4KPUB 3KAQA 2N9UA 4FJ1A 4EUHA 1M6VA 5IXSA 3F9RA 5C4IA 1YZFA 4AS1A 1RQNA 4R2IA 1SCIA 1H2EA 4JLNA 1RHMA 4LNHA 4MIYA 3OFSA 3Q1KA 3CRQA 4Z99A 3SX0A 1LZKA 1RXVA 4L73A 4Y2TA 5BR8B 1EBUA 1T8SA 1DLJA 2GTHA 2JBHA 1R3UA 1WXWA 4E14A 1CJMA 1MDBA 3HUEA 4I1IA 4QJBA 2VHQA 4U00A 1NTOA 3KKPA 4ZODA 5HOQA 5D01A 1VIAA 4RULA 1Z8HA 3QVSA 2D54A 1RJEA 4P4GA 4POOA 1YR8A 3KZKA 2VDVE 5DB4A 1DTSA 5TNXA 2WQ6A 1LNZA 1QMGA 1T8WA 2C88A 2FWAA 2J0UB 1JKJA 1NG9A 2ZCJA 4OXQA 4Q7JB 3M2PA 2QDKA 1K8ZB 1JT9A 1F60A 3B2EA 4I36A 3KPYA 1RI4A 2DG2A 2AIRA 2ZTUA 1W36B 1NR7A 3RE1A 2E4YA 3JALB 3VJRA 3TQTA 3NDIA 4B3MB 1MB0A 2QRKA 1DAEA 3PP8A 3L41A 3T41A 5BSWA 3CMMA 2NU6A 3FSEA 5FI5A 4JDUA 3TL3A 4GR4A 4TYMA 3HA7A 1GNTA 5L3RA 1KEEA 2EKBA 1VIDA 1HE3A 2W37A 3KAJA 4G1MB 4Y2HA 3GY0A 1I6MA 2IFTA 3C0KA 1MC5A 3OZUA 4XVHA 4EI2A 1OILA 3N2GB 2CMFA 4DR7B 2VP6A 2VTVA 3U16A 1TLFA 1VL6A 1X77A 1P0FA 2GHQA 3CTMA 3FGZA 1GWNA 4IOKA 4UAGA 5JXHA 1QMPA 3C43A 1QGYA 1GQFA 3HBMA 4IGFA 3V7NA 1WV0A 1VE3A 3Q3VA 4ZDIA 1TA0A 2ZIVB 3QLUC 3VMFA 2WYVA 4L95C 5JEEA 5C8YB 4ND3A 5JD3A 4FLFA 5EXPA 3WGYA 1XVTA 4Q1DA 1U0JA 3BE5A 4BASA 3I6QA 4ACAA 2A78A 4P22A 1SUEA 3LBYA 3OC0A 3BFVA 4UQPA 3HLYA 1XXHE 2AHRA 5DNWA 1DDIA 3RSFA 5HQ3A 2XI4A 3QXSA 4MPDA 2ESRA 3AFHA 1PR2A 2QTGA 3KJEA 3M33A 3M89A 4KQ6A 4KR7A 2FAXA 2B1QA 2WJJA 1M6YA 5KNLA 1SVSA 1UT5A 2DC1A 4MO2A 2PLFA 4BNIA 3EH2A 3I0MA 1WXQA 3KJFA 1NPTO 3QVOA 1PVVA 4Y9RA 5LKAA 2W7TA 3HCOA 3H99A 1ORVA 4II2A 2QTNA 4TYPA 2I7VA 1AC5A 3DONA 2B5OA 3TR5A 3K1TA 1GCUA 2CLIB 2FX5A 1G98A 4RVDA 4DMKA 4TXLA 1T5HX 4K8RB 4LRUA 1I3LA 2H1RA 1KMHA 1JECA 3EGEA 3GLUA 4D0GA 4S1TA 2XMZA 1E1QD 4JIGA 1SHTX 4KWEA 3HKEA 1HE8B 421PA 2MYTA 1BEUB 2ORIA 4QLBA 4J0GA 4ETWA 3T0GA 4GLFA 1I5OA 2Q07A 1GUFA 4PZZA 1PHRA 1T3LA 4L3WA 3NTXA 2CLMB 2WVJA 2IK8A 3KZVA 1QAMA 1TECE 4IZ6A 4QREA 4NCNA 4DYHA 5IASA 1WHSA 4WNAA 4DC1A 2FEKA 4U6SA 4F3KA 4RORA 3DNPA 1P5FA 5EIWA 4M8KA 3MRSA 2I6UA 5K3FB 1QIDA 5E7IA 1U8UA 1MAHA 1U6KA 2VUTA 3EBOA 4MQUA 1BFKA 4MICA 4MQLA 3M82A 4DCPA 4YMLA 1BS9A 1A2KC 5CIQA 5AI0A 5JY6A 3V48A 4LUCA 2OKCA 3ND7A 4HAZA 2YZMA 4U2EA 3ISVA 4I6JA 1OFIA 1WVGA 5FHQA 4YCLA 1WEHA 3B8HA 3KOMA 4IXWA 2B9VA 3TLKA 4XYGA 5AUQA 2AN3A 1OAAA 3H5RA 5TQ0A 2A4MA 2F8LA 5F4BA 2C96A 3CZAA 3DG9A 2VTKA 5U4XA 3E8MA 1UJNA 5CK5A 4Z7QB 2E4AA 4NEGA 2PUGA 4M37A 3SHFA 2D3TA 2DUJA 1OYYA 3OZGA 4B3RB 1UFRA 2ZSBA 4OVKA 1FFHA 4Z0TA 1T9AA 1ZISA 4PZEA 4GEKA 4LGCA 4NX2A 3AR6A 2ATVA 1M3SA 3FAKA 1RYBA 3V4ZA 5FWNA 3JVDA 2L69A 4LGMA 5CFOA 1IXYA 2YC2C 2ZUDA 4UCQA 1WMFA 5FPSA 3SSMA 3P9NA 1FNMA 1ZU5A 4HGOA 3UMVA 1RNLA 2HL6A 5K8VA 3HBFA 3LKVA 4ZV7A 3AR3A 2BHRA 1UXGA 1CEQA 4WY5A 3MRXA 1E1QA 4KR6A 4G4SO 2DTDA 1F1JA 2J5XA 3PWKA 1R5BA 5ECGC 3WMWA 3AR4A 4FN4A 1PZXA 3IBTA 1Z3CA 5CG1A 2X5KO 1JX6A 2HA4A 1YZUA 1PCXA 2PX8A 2QENA 3MGAA 5H4HA 1ILEA 4R6WA 1TJPB 1O95D 3LPAA 4LSWA 1J06A 3ILYA 4R6XA 4OJNA 5K0SA 3P4XA 1DWOA 2GF2A 2Y4OA 3R77A 5T41A 3ZDXB 5IYZA 5JRJA 3WLHA 3B3GA 4CUJA 1ONOA 4KYUA 1XVAA 5ALQA 1QB8A 1RBMA 1VGQA 3G0IA 4TZKA 4HRXA 2OR3A 3HP7A 1QH8A 2Q21A 3QEKA 1C0KA 4IP0A 1XU9A 4EA9A 1MFZA 3EXHA 1U2GC 5JG7A 1LDNA 2VDPB 4D4JA 3Q72A 1XTVA 5HHTA 4X94A 1N7GA 4D9NA 4WGFA 1H2AS 1N6PA 2VDUE 1KDVA 2HW8A 4FDUA 1LRKA 3STHA 4HQFA 3OLZA 5I7VA 2EW1A 1AHNA 4MCJA 1MV8A 2ZB3A 1MO4A 2PIAA 2ZJ8A 1Y9JA 4IUCS 4S1WA 5BSHA 2QI9C 1C8LA 1QIMA 5LMCA 1RLTA 3OHSX 4YP5A 2A0WA 2BLLA 1OBVA 1ZG3A 3ZI7A 4NSNA 1NUTA 2WJ3A 2JZNA 4PGMA 3OTHA 4QFBA 3SBEA 4QEKA 5IH3A 4PG7A 3T15A 4M8LA 4HADA 1KVQA 2PBRA 1EFVB 1OFHA 1W5EA 3DOCA 2V6IA 3ZY5A 3MMSA 3BIWA 3DUFB 3OMXA 2QYOA 4CGYA 3LXRA 3OO1A 2O7QA 3OOYA 1K97A 2RJOA 1BDIA 2ZYVX 1XEXB 3S70A 4Q1VA 1UC9A 1RYYA 1PZNA 1BAPA 1RRKA 4IEFB 4FGKA 5AHWA 4PV7A 2DY1A 2WSSD 3ZXYA 3VM6A 5J1SB 1HE5A 4UDNA 5LL6P 4K9PA 2RI6A 5BSUA 4FW9A 2NX2A 3SSOA 2VBGA 2W6QA 1O95A 4PTYA 1U2PA 1YE8A 4IF4A 4LFCB 4HYTA 1NUHA 2YN2A 3IGFA 3LQ4A 3OE4A 5E6UA 3X1XA 4GVPA 2VFAA 4RL6A 3HDQA 2ZE5A 4MUHA 4U7PB 5JSQA 3L1KA 5COQA 3WXBA 2A9PA 2DJIA 1VP9A 2AFHA 2HA2A 5SYNA 1L7NA 3UJHA 5A5GA 2VK4A 3GEPA 2NPFA 2PT6A 4JLDA 4WIAA 4P5DA 3K5PA 4WY2A 1PJ2A 3CTPA 3HJHA 3HL0A 4JENA 2PT7A 2A3NA 1EJ2A 3GCZA 3FB4A 3LRPA 1SBTA 3O0DA 4IGKA 1SCUB 4DA0A 4F4FA 821PA 2HA5A 2WFLA 1DCMA