3VO9A

Staphylococcus aureus ftsz apo-form (semet)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
304
structure length
295
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFETQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
publication title Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 80
structure length 295
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3vo9A00
5LOVB 2BTQA 3N2GB 4X1KA 5EIBC 4EB6A 3RYIB 4F6RB 3HKCB 4KWEA 5BMVB 4M8IA 2Q1YA 2VAPA 5EZYB 1RQ2A 3RYHA 5IYZA 2RHOA 3WGMA 4IHJA 3JALA 5LA6B 4LNUA 4I50A 3HKBB 4O4JB 4YJ3A 1W5AA 2Q1XA 4DRXA 5CB4A 4YJ2A 2BTQB 5J2UA 4O2AB 4ZI7B 4EB6B 5GONB 1RLUA 1JFFA 4X1YB 2R751 4DXDA 3N2GA 3RYCB 1RQ7A 5LP6B 3RYIA 4LNUB 4FFBB 4I50B 4F6RA 5EYPA 2VAWA 4YJ2B 5J2UB 4DRXB 3V3TA 3HKBA 5J2TA 4O4JA 4B46A 3R4VA 4X1IB 5C8YB 4O4LA 2RHJA 5ITZA 4O2AA 3M8KA 4ZI7A 5GONA 4X1YA 3JATB 5EYPB 5IJ0B 5JVDB 5CA1B 5LP6A 3JAWA 4FFBA 5MN6A 3JARB 5J2TB 1FSZA 3ZBPA 5ITZB 4O4IA 4O4LB 4XCQA 2XKBA 4EI9A 4TV9A 4X1IA 3E22A 1Z5WA 5LYJB 5KMGA 5C8YA 5M7EA 5LXTB 4B45A 1W5BA 3JAWB 5IJ9A 1OFUA 3JATA 5IJ0A 5JVDA 4O2BB 5CA1A 4O4IB 3VOBA 3JARA 4TV9B 1TUBB 5EIBD 3E22B 4I55A 5KMGB 3VOAA 1W581 5LP6C 4ZOLA 5IJ9B 3WGNA 5MN5A 2BTOA 5LYJA 4HNAA 5LXTA 1W5EA 4U3JA 3ZBQA 5JH7A 3RB8A 2R6R1 4E6EA 5FNVB 3JASA 4I55B 4O2BA 2XKAA 3VO8A 4EI7A 5MN4A 3WGLA 4WBNA 4ZOLB 3HKEA 1TUBA 3WGKA 4O4HB 3N2KA 4HNAB 3ZIDA 1FFXB 3HKDB 3VPAA 4ZHQB 4U3JB 4X20A 3WGJA 3RYCA 5JH7B 3RYFA 4IIJB 3JASB 4U39A 1SA0B 5CA0B 1W59A 4I4TB 4WBNB 5JCOC 5FNVA 3HKEB 4TV8B 4TUYA 3N2KB 3M89A 4EI8A 4X20B 3UT5A 5JCOA 5JQGA 3RYFB 1W5FA 4O4HA 3JAKA 1FFXA 3HKDA 4ZHQA 4X1KB 2RHHA 3VO9A 1TVKA 4IIJA 5KX5A 2RHLA 5LOVA 4TUYB 1SA0A 5CA0A 1Z5VA 3RYHB 3CB2A 5IYZB 4I4TA 3JALB 4IHJB 3UT5B 3HKCA 5JQGB 5BMVA 4TV8A 5EZYA 3JAKB 2VAMA 4YJ3B 5CB4B 5LA6A 1TVKB 1JFFB 5KX5B 2VXYA
chains in the Genus database with same CATH superfamily
2MHCA 2VDLB 3B1KA 3TDMA 4X1KA 3UJHA 4CXMA 2WF9A 5FOTA 2KJQA 5DHPA 1MABA 4EZIA 1R64A 3C7DB 2JCYA 1FXWA 4LKRA 4XUGB 1FVHA 2ORVA 2IEZA 2PH7A 3PZBA 4KXLA 1H6AA 4XB6B 5JXGA 4IFTA 1WBJB 3HCWA 4GE0A 2VK4A 3D6HA 1OTHA 3P2MA 4RC9A 3ZKWA 4GL2A 4KXQA 1IE3A 1JSXA 5DTJA 4B6FA 2AZXA 1TYCA 3LT4A 4Z1MA 3FPEA 3FNRA 3OLXA 3VKGA 3DMTC 1E1YA 2YJNA 2AXEA 3BWEA 2HA0A 4W9RA 4JYMA 3KT8A 4WJLA 4Q4AB 4LF5B 4NAHA 3KOUA 1UZLA 2C57A 1Q3HA 3H19A 2MR5A 2IVFA 3THSA 4EITA 1FUUA 3QKSB 4X94A 1EX6A 3WMFA 1WCWA 3AINA 3EW7A 3GHYA 3ORSA 1MMFB 4IWYA 2V1XA 4FB5A 3U49A 3HUUA 1DTWB 1S9HA 1XUOA 3EZXA 5D8DA 3HJBA 4HBZA 5JSHA 3CT6A 4I1SA 1NYLA 4AJ4A 4L16A 1NW8A 4W9NA 5MN6A 1C14A 2J5QA 3SR4A 3OIUA 4B3MB 1ZGBA 4MQEA 5FPPA 2GJ4A 1K66A 2AZ4A 3DZGA 1EFVA 4CIWA 4UM9D 2CNWA 4A4DA 4J0IA 2D5CA 4FE7A 3CKYA 2HA6A 2DVMA 1Z68A 1GKUB 2CGEA 1U11A 2WHRA 3P0EA 4HDRB 1OH5A 4D6XA 1ADFA 1W0JD 3KYDA 4HQ0A 4INAA 4O4IB 5EUBA 2Q07A 3QHAA 2Q5EA 2ZB8A 4HY3A 3KBOA 3QFRA 5KVVA 2AEFA 4I55A 4D6YA 3WK7A 4RHTA 1NF2A 1W34A 3A2LA 3PV0A 3S28A 5KOHA 1PWYE 1QQ6A 2ZAMA 5HNKA 3QIVA 3PQCA 3OQMA 1E1QD 4KTTE 2H52A 3AFNA 1VCIA 4FD2A 2GVZC 3MMSA 4YMTA 1H3NA 3U09A 1LQUA 3PNVA 3TQIA 2F8LA 4HGZA 1NOKA 2A86A 2CFOA 2GCGA 2ZSKA 5DRTA 3GRCA 3TLJA 5HTOA 5EAIA 1SK8A 3EWIA 1T5DX 5E0KB 1JMVA 1C4OA 4NFHA 4RF5A 3RHZA 4PAQA 4LSGA 2OBXA 1QHXA 5CDFA 1FRFS 1F14A 1JIXA 3LXMA 5DASA 3WIOA 2PCLA 4XRRA 4AMYA 3JVUA 3G3EA 2AUTA 2JLBA 1GSOA 3EF1A 4GC5A 4I4TB 4J94A 3EXIA 3I05A 1ZH4A 3ND6A 3HGTA 3R6WA 1Z37A 2XCQA 2DJIA 1XTBA 1M2EA 3D7LA 1XZLA 1EAMA 5I9NA 3RSQA 3SLGA 4DM3A 4F3TA 2GAAA 1JN0A 1MJGM 1S7CA 2AE2A 4RPLA 4M3NA 4UQPA 1G8PA 1GTJ1 3H5AA 3MF4A 1EK2A 1B6SA 1J7JA 1TJYA 4MW6A 2OSBA 3HA2A 5DO9A 3TLMA 3KPJA 4H0FA 1GQFA 1ZRMA 4Y8VA 2VEOA 4X45A 5FLXA 3TLEA 2NN3C 1EFKA 3VX4A 5F9FA 2WWYA 4FZ5A 4MVJP 1EJ6A 2HQ1A 3OEHD 2JGRA 3OSZA 5H02A 3K9HA 4HWGA 3G7SA 4AG3A 5LOVB 1QV7A 4MWCA 1Y9DA 1QFYA 2ZSFA 3C48A 3WBKA 1RLTA 1JR2A 3PKZA 3AR7A 3GGPA 4D8VA 1Y37A 3SXJA 2B37A 2VZLA 2GO7A 2GA8A 1WB4A 3EPJA 1G9SA 1R9GA 2WHEA 4GOND 2EGGA 3DEJA 4WUTA 1L1FA 1A77A 5DM0A 1U1FA 2H1IA 5IH3A 3QPBA 2JFZA 3M6AA 2JI4A 4DTIA 2H4XA 2BZSA 3PC4A 4QJ3A 2RBGA 2YJ6A 4H1HA 1J5PA 3LWDA 3D2BA 2YJGA 3UKOA 1KTIA 2F1IA 2PUDA 3ZD6A 1JNYA 3RYIA 1PAUA 3G1WA 3I6ZA 3ILSA 4HH4A 4ADSG 2ZYSA 4AX4A 2DHDA 4NJMB 3WADA 4L4ZA 2R84A 4LJAA 2JLCA 1SGWA 4BP3A 3QMWA 5KYYA 1HR0B 1I6KA 1AHIA 2AN4A 3R4VA 1P74A 4ENUA 3RVQA 2EX0A 2RHJA 2DT8A 2A35A 4FKMA 1GTRA 4DRZA 3QV1A 3UFXA 1SEPA 1BEUB 3UPDA 2ZBRA 1T4GA 2I3ZA 4ZQBA 3VSDA 2A4MA 2WVGA 2RE8A 5ALMA 1MX1A 1N5IA 2NVUA 2VDNB 2F3QA 2XT0A 4YAJA 3IT1A 4XX0A 3S5UA 1BE0A 3R20A 1ZVVA 4C7OB 1UJNA 4EJ2A 3NEAA 5LP1A 4D9NA 4WKBA 3QNUA 1QAQA 2NVWA 1E6WA 2J0QA 1Z38A 4S0ZA 4LZZA 3TE7A 1SKYE 2OTCA 3EHDA 2ORED 3QRWA 3W5DA 2H8KA 3TJZA 3LV8A 1AD2A 1PZNA 3KQNA 3PIDA 4PG4A 1T10A 5BQPA 4EY4A 2AFIA 5CK4A 1QPBA 2JCSA 2HO5A 4UU8A 5DMXA 5D1HA 5AUOB 4LOJA 5I3CA 1GM5A 1R74A 1NN3A 2RAPA 3GUYA 2I76A 4Y2PA 2GPJA 4QYTA 2GRUA 4C14A 1OWMA 1A82A 1FTQA 3NIBA 4RSHA 1Z5OA 3V4ZA 5HVNA 5JCPA 1P81A 1HNXB 2Z0MA 5DISB 4CKZA 2QRVA 3HR8A 3I1YA 1QAMA 1J49A 1AK1A 2GJKA 2VCEA 2ZWIA 3EXEA 3HWRA 4KXNA 4OJQA 4IIVA 4OLAA 3NVKI 1SQ0A 4DLKA 2XLBA 2Y0EA 3CE6A 1C8KA 4HDMB 4JKIA 1VECA 1H2HA 1GTZA 5EKUA 1CJVC 5HF8A 4YUAA 3WGHA 2VA9A 4P0QB 3WGJA 3H2KA 5BSWA 1IK4A 4RAQA 1Z5NA 3DUFB 3ZLTA 2XT6A 3VJLA 3KHSA 4B6GA 4OK3A 3HA7A 3Q3VA 4LQ4A 4XWGA 1V8ZA 1QG2A 1JU3A 1HDXA 4JJ6A 4O59O 3HCCA 1UL1X 2EKZA 4EHJA 5HS4A 2YBEA 5DTEA 1Q0TA 1SC1A 1K0FA 1LFDB 4PTYA 3RYFB 1R0WA 3L7MA 4K6HA 4LV6A 1ACJA 3C3AA 1YR2A 4PHGA 4EYOA 2CCGA 2JS7A 3PNPA 1OXMA 2IHBA 5FWXA 2VUUA 1N2ZA 4G56A 2MU1A 4RTKA 3FHTA 3IQFA 4MKFA 4O0MA 1KS9A 5CT8A 3ISVA 1T5TA 3E03A 3C15C 3BSFA 3PYXA 2C4WA 1TCBA 1I30A 3F3KA 3OCCA 4ARZB 3QENA 1GADO 1BU8A 2Z1MA 4UTNA 4QDJA 1QHEA 3DSRA 1W36C 7ABPA 1CUYA 4X9XA 3PCRB 4G5SA 3BSWA 4HDNA 4CM3A 2FPWA 4ILEA 3L8HA 5BRAA 3QY9A 1OZAA 1GA4A 2AC2A 1GSHA 2ZE6A 3H5VA 4XOIA 3RKSA 3F6YA 5FKJA 3RRZA 1KVUA 3ADKA 4NZ9A 4LS3A 1BNCA 1OOEA 3N2EA 4WGFA 1V96A 4AYXA 5B4UA 3HP4A 3C1OA 3FB1A 1A4XA 3EGEA 5GONB 5BYKA 1MABB 3DBLA 1XF1A 5EZSA 2A0XA 4A27A 4X71A 3RIHA 2WUVA 1E79D 4C1NA 4X61A 4ODIA 3D59A 2AFHE 4CFZA 3MFQA 1OKKD 1QYCA 1FMCA 3SSNA 4UARA 4HTAA 3RSHA 3ZKWB 1U99A 4OJKA 1Z0SA 2DZDA 5ITZA 4CL3A 1U9IA 3LBYA 2X8BA 3L0IB 2O8VA 2JIBA 5K8VA 1G0OA 2GFIA 2W83A 3IXLA 3MWDA 4EDFA 3UGQA 5P21A 2ZJ0A 5CFQA 4JBYA 2YWEA 3U0BA 4CTNA 2HMAA 4WT7A 1YTUA 2MWMA 1ZVMA 1QIJA 3V1KA 4RIIA 4CCSA 1KOGA 1B0AA 2F59A 1XKLA 2OBNA 2Q45A 1D7AA 2BGRA 2CUKA 1Z5WA 2Q28A 1TLLA 3AY7A 3R41A 1I3OA 1ODIA 1MC1A 3DZFA 4X1OA 2HXSA 3VR0A 2RDMA 4BAUA 2QZJA 3H99A 3IAUA 4KPUA 4RPIA 4MDYA 1PK9A 1JVSA 2FWMX 3KFVA 4MQEB 1NBMD 2NPOA 2R25B 2BD0A 3O03A 1TCVA 4DV2B 3P9CA 4WFKA 1M9NA 4P83A 3LKDA 1CJTC 4DZRA 4YEDA 4LGMA 3ANTA 1XCMA 2Y1WA 3DOOA 2D62A 3IP7A 3MBOA 4BKUA 1NVTA 2PKEA 4CLXA 4HLUA 1E7SA 2FVXA 5AKEA 1A04A 2TYSB 3H9QA 2AR0A 3C1TA 1HT1E 4FR0A 4I55B 1ST3A 3ZWXA 5KOHB 4OQFA 3PENA 4CKBA 4HT3B 4TVOA 3L0DA 3PCXA 4IH1A 3X1DA 1CRQA 2NACA 2P6RA 4S3MA 3C74A 5B7NA 3PUXA 1QE3A 4R8VA 3DP7A 4BTEA 2CEKA 1GPJA 1JYEA 3NQ41 3OO1A 4FIZA 2AG0A 2YQZA 3F5FA 1MAVA 4NQZA 1ZBQA 4QUGA 3W2HA 3W4IA 5BRJA 1BFDA 3BXHA 5L7TA 3CX4A 1T1RA 3W4KA 2BEKA 3U62A 4A1OA 4YH1A 5DM60 5I6DA 1J56A 2RGBA 4NV0A 2CWDA 1PFUA 1VDMA 3MRSA 4RTSA 1IJBA 4ZYYA 1U2DC 4JENA 3MSXA 3EXIB 5C9ZA 2V4MA 2ZAGA 3NRCA 1U04A 1JFRA 1Y4AE 5CVUA 4OHUA 1PUXA 3WRXA 5HW0A 1T8SA 4AURA 1U5CA 1QIKA 2GM4A 4LJ9A 4P0TA 2ZRAA 1P45A 2XZOA 4HADA 1XDGA 2CMHA 3ZGYA 1YFKA 3HEAA 4JITA 2CXQA 3BGIA 1HYGA 4MWBA 1J09A 2XVYA 1D1SA 3B2EA 3NX4A 4MMXB 1NW4A 3G5TA 2JIQA 4B7XA 1JGTA 2DKOA 4FT4A 4MVJI 1OV4A 3AB7A 3WTBA 4C88A 4DNXA 4ETIA 5IJZA 5JY1A 4UHHA 5ALQA 2ECPA 1MHTA 1ZRNA 2N3ZA 4KW7A 3D6NB 1Z82A 1G7RA 3T3MB 4PFQA 2XGSA 3IP9A 1KI9A 4MV0A 1T9DA 1FJ2A 1UMBA 5CXXA 2VNIA 1UDAA 3U7HB 2UXCB 3H5WA 5L45A 4FGSA 5ESRA 2EQ5A 3CRZA 4N40A 4OHCA 4HQKA 3Q3JB 1Q0ZA 5DHFA 2C7QA 4X65B 1U8FO 1A96A 1NPYA 2YBDA 3Q3GE 4QE3A 3R24A 1SWVA 1SVSA 5DNVA 2Q4RA 5EP2A 5T8KA 4A1FA 4BQNA 1CBUA 3W2FA 3WMEA 3N5KA 3GMTA 3RTAA 1ZUIA 1CETA 5JZ9A 4AP6A 2C83A 4HNRA 2QP3A 2HNKA 5E9AA 1BVYF 4Z0TA 2A78A 4F93B 4BP9A 1XXHA 3RFXA 5KYYB 4K81B 1N5LA 2CXTA 4V1CI 3RBAA 3P45A 4CDMA 2V5UA 1YRHA 2W6NA 1LSUA 1QBGA 3KJQA 4L0DA 4W6QA 4ZEXA 4EHLA 3LFUA 1Z7BA 1JT2A 3FMGA 3WJ7A 3N2ZB 5DGHA 1M2NA 1M8JA 2YC2C 4LPKA 5HKLA 1HKHA 4QPPA 2JLVA 1NVWQ 2ZYWX 1FYDA 3M7IA 1HDYA 4RGBA 4D3SA 3WGQA 5TPZA 4P4UA 5LQRA 3STXA 3K4HA 1ZDMA 2VSFA 1DGQA 3NUZA 4TS1A 3QG5A 5I7AA 4YCNA 4EB3A 2FOIA 3OX3A 3OCUA 2VH1A 1IDOA 1EP2B 3NH6A 5GY7A 5JCXA 2AFIB 2L19A 5B2EA 1IHYA 1N3IA 4MXDA 4YJGB 4CV3A 5IFKA 1PJCA 3K8OE 2JIPA 3TH5A 4AT1A 3K0KA 3QYJA 1TC2A 2Y9MB 5IC6A 1AQUA 3DF9A 4A0RA 3OZVA 3F7NA 3GIWA 1Z4NA 4IOKA 2CXPA 2H4FA 1V37A 4BNMA 4FWIB 4O4HB 4KBYA 5F5LA 1T0JB 4U2CA 4YLEA 4N9WA 2QRVB 3H0EA 1ECPA 3EXEB 3PWSA 4CEHA 5TEWA 2PJUA 2ID4A 1R4MA 3F5MA 1XNQB 1V1MA 3VH2A 3W6OA 4YRLA 3RS4A 1M2OA 2JD1A 2J3MA 1H8EA 1YD7A 3B7PA 3THXA 3R0XA 1C50A 1IUPA 4MI1A 4BN4A 2P9ZA 2LCIA 3EPKA 1G5HA 4LYJA 5DBHX 2KLBA 1ZG3A 1IPFA 2VDWB 2UZIR 3NKLA 4PBSA 4AZTA 2VJNA 3H5RA 5AJTA 4HNVA 1DX4A 4C4OA 3PWKA 2VFAA 4ID3A 4NY1A 1PZEA 4D41A 4OX9B 2FEWB 1A9XA 5CJ2A 1N5DA 3D7RA 3ROTA 1JHVA 2NYVA 1M0SA 3GGCA 1EI9A 3A14A 4FW8A 2FCRA 4CMHA 3MTAA 4OVKA 4CWAA 3VR2D 2R4QA 2PU5A 5BPFA 3CR7A 3LF1A 4Y9RA 1QP0A 1TF2A 4MH0R 3HS3A 1Z07A 3GLHE 5D7BA 1L7MA 2EHDA 4N3BA 5T3YA 4B09A 4B35A 1KI4A 1TM5E 2ZREA 3LCVB 5CLQA 2VPYA 4XQGA 3TVTA 5I4IA 1Q92A 1CT9A 1XAJA 2X9GA 4HDCA 1KO7A 3DW3X 2C29D 1MO6A 3EXAA 1IWOA 4U9IS 1ST2A 4XXHA 3CVYA 4AG5A 2CLCX 4N6OA 3JXEA 4IJ5A 1X8LA 2B20A 3W9YA 4P5DA 3L0CA 4EY5A 4NCAA 3BA6A 4HDNB 4FMPA 5C7LO 2H7CA 2YWXA 3PG5A 3I6YA 4Q4LA 4UUBA 1YCGA 4KVAA 1I1HA 2O1EA 3D81A 4TTRA 2YQ5A 4G5XA 4RHCA 3FMFA 4I1IA 5KWJA 1BJKA 3Q98A 4RD2A 3O8BA 2CDBA 1KVTA 3DBLB 4BGIA 4C43A 4G5HA 4JU9A 3AJ8A 2X5JO 1XRJA 3P0JA 5CH8A 1R8QA 4DEVA 4OB6A 3I2IA 3ZYZA 2VDUE 2C2HA 2Z95A 2BZ1A 4J1TA 4QNMA 1EDDA 2V6BA 4F06A 3DL7A 3GF4A 4HAVA 1NNSA 4ISBA 1D4AA 1RAHA 1SU6A 2UKDA 1HEIA 3HBJA 5ITZB 5L9AA 5ALSA 3H3XA 1WDMA 4ZOQI 1NWCA 3UG7A 3W8EA 5K8UA 1B00A 1M76A 3NAZA 4FW9A 3DEIA 4MR7A 5C3MA 4PLPA 5AJXA 5JEDA 1W5BA 3NPMA 5PNTA 4QRHA 1Q20A 3SQLA 3UA4A 5KTSA 1AZLA 1A98A 1JU4A 1QQ7A 4BKMA 4ZYVA 1ONOA 4JBXA 2N0SA 3GNLA 3L7IA 2IDKA 1KI1A 2PS9A 4YMLA 1T9BA 5BRNA 4PGFA 3L01A 3USCS 3GT4A 2DQKA 3A1FA 3D4NA 4KPUB 4NVRA 2VUIB 2JHAA 1FUYB 4G5FA 1CHNA 1BHJA 1N9ZA 1C1XA 3GUUA 4HFNA 4L76A 5GWXA 1O6CA 4C4ZA 3KKNA 1F0YA 1FUEA 1ZXLA 3H2ZA 4NDZA 4JI4B 2Q8QA 3P2IA 3ESRA 4PYKA 1IVYA 4WLNA 1NVFA 3NDIA 4NAVA 4L9AA 4XEUA 3RGWS 2XF2A 4QYXA 2ZFUA 1S0UA 3RAJA 1HSOA 1WTAA 1KFJB 5EXXA 4GC9A 1DG1G 1WP9A 3N8HA 1U0GA 1HT3A 2QTWB 4GBED 4LV8B 1YQ9A 2QIPA 2YXLA 4R3WA 4DQVA 2ODBA 2BUBA 3JQGA 3IBCA 4EGJA 4CKBB 5L6LB 1PDVA 3SYMA 4QTUB 3ZI7A 1QCZA 1XYVA 3LQ2A 4V24A 2CE7A 5B4VA 2B98A 4WAUA 4H0NA 4JSYA 3UAYA 1TVKA 1AQLA 2HSGA 3HNPA 4C5AA 2IP4A 4JL5A 2WSSA 5HRAA 2ZM5A 3LZDA 3WGOA 2ZZMA 5HFJA 4W7SA 2FN8A 4HOYA 2XCSB 4Q3KA 1XB2A 2V0NA 1R4NA 5CH5A 2XZPA 2EF0A 1ADYA 4ZDJA 3BK2A 2CJWA 5JMOA 3H4IA 1Q22A 3SICE 4MR8A 3SS7X 4Y1FA 2Y1EA 2YVKA 4R4JA 1PNQA 2KE5A 2HLNA 4R6XA 5AUQA 1WTCA 3Q1KA 4FE4A 1U2GA 1FQJA 2GHIA 1JAIA 4BTLA 2OMKA 1TCAA 1QMGA 1VKNA 2JJ8A 3O2JA 3RFVA 2NTNA 4DABA 3WZ2A 1HRDA 1VIDA 5JAUA 3IV9A 4OI1A 3LYLA 1GG5A 1OVGA 2YN0A 2ZE7A 5EJ7A 1BQ3A 5AVRA 4DSTA 3VSEA 4PN3A 1EUCA 1U4NA 2ERYA 5CTJA 5DBIA 1F3OA 4YQEA 4S2UA 3ROEA 4KFRA 5MHTA 1CUUA 5AESA 3G79A 3TQSA 3TZBA 1KFEB 4EKDA 3OJFA 1MAHA 1HQYE 1Y3CE 4HNHA 3LT2A 5EWMB 1TC1A 3ROXA 4Q4CA 1XU7A 2C42A 4JQZA 4R0NA 4ZAFA 3UJBA 4CFSA 5KOYA 4U7DA 2DFNA 2PNFA 3VNBA 3AU8A 4PY2A 3SOPA 1KDVA 4GRDA 4DCVA 4W5QA 2Z58A 3MLBA 1VHQA 1YJCA 3NHFA 1T9HA 4OQDA 4CKYA 4DPLA 3C6QA 2P1DA 5KJCA 1WHTB 3ZLVA 1BFUA 3LS2A 4JOSA 4A82A 3BSSA 3G59A 3GVPA 4GOJA 4QT4A 2RKBA 3LVQE 2JKZA 1IZ0A 3JU3A 2CL0X 5LPNA 2PSSA 3LBHA 5K2OA 1SCAA 4MGIR 3QXJA 5LQMA 5E6SA 1OB2A 1Z0ZA 5K09A 1UP7A 3GMDA 1V7CA 3CTMA 4YRCA 4ZTBA 4Q1CA 5K0NA 4RD3A 2IXAA 5J9FA 5AW2A 4QBKA 4N7JA 1XWFA 1HRKA 1PG5A 3G0GA 3NS7A 3V8QA 4PPNA 1UIMA 2I1VB 3FFTA 1XXHB 1EHYA 2G70A 4Q1EA 1EJ0A 1PJZA 5CB0A 3HM2A 2IL1A 1LF5A 1BW9A 1DO8A 3FPFA 4FPXA 5LIRA 4FFDA 4M88A 1XROA 3ADOA 5CFNA 3HM9A 4CT4B 4IDBA 2R11A 4GKJB 4DBVO 3O47A 3RGGA 5CT5A 4TKUA 2TSYB 4R71A 2I55A 2ZRGA 4NARA 5LXTA 3OZBA 1E89A 4Q18A 2A9PA 3EOAI 1NA5A 3EFHA 2DQYA 4Q7KA 1KAHA 2QY9A 2ZYDA 4GECA 1HURA 3WYAA 2PZJA 5CB4F 1W36B 1A97A 3G88A 5ERYA 1RQNA 3OKCA 3B3FA 5TVGA 521PA 3WDMA 2QRQA 3QVMA 2VP4A 3SE7A 4NC9A 5AUPB 3N7UA 2VVTA 1D0IA 3WGKA 1EESA 1I7SB 4B80A 1JVBA 1ZOLA 1L5ZA 2EIHA 2J8ZA 5J47A 3VUEA 1IK6A 1EZZA 2BM8A 3AEUA 1DTSA 1SXHA 3BHMA 3IAAA 3KVYA 2QRZA 5G0UA 1AKEA 2ZJBA 4M1WA 4Z99A 3SZMA 4IX9A 2OBYA 2CJPA 1TM4E 4HAIA 5C8VA 1ZM7A 3KHUA 4PF1A 2PJDA 3E4CA 4YROA 4TV8B 2IUYA 4WIAA 1L8LA 2A9JA 3RS2A 5BR7A 5LN1A 1X1AA 3ZVMA 1GT6A 1IHOA 2CD7A 3BCHA 3EGVA 3P4XA 1Z36A 4RDHA 3T34A 1KQGA 1AKNA 1R4MB 4CEHB 4E3ZA 5AMXA 5K0LA 1M2OB 1H93A 2I2WA 4KGXA 2AG5A 2I65A 2IFTA 2XCUA 2Z2IA 4QX6A 3THXB 4MWZA 3D3NA 4M89A 2FRXA 3WLRA 2I4OA 4EA6A 4IR7A 4UDNA 3ID6C 1CHDA 2L2QA 2O5RA 3MGAA 5IKOA 2QE7A 5BYBA 3S1AA 1OH7A 4AY2A 2NV6A 4B7CA 1N7IA 2A5JA 2WAAA 5CFRA 1D6NA 4EVIA 1Y89A 1PYDA 1F17A 2P67A 4E13A 1AUQA 2IYFA 2OXIA 2JNWA 1S2GA 2D00A 2XCOA 3AI2A 3KZVA 3WL6A 2AN9A 1M2VA 2ASVA 2Q1YA 4AC9A 3SVTA 4CMGA 3OJEA 4C2TA 3FHOA 5L3ZA 1RMTA 3VDQA 2CVOA 2YIVX 3DFIA 4H7DA 3NWOA 4D9MA 2BC9A 3AYZB 1XVTA 3C5HA 2HBQA 3M3PA 1XJQA 3BS4A 5CNJA 3JYOA 1I4WA 2WIKA 1H4QA 4G0UA 3CVJA 1BD3A 2SBTA 3IV6A 5HQ3A 3Q6MA 1P9RA 4E12A 3IAFA 3DFFA 3R23A 4C5CA 4R83A 3CRRA 3CLSD 4HYTA 3AL0C 3V4FA 2EU8A 3O7WA 1N8KA 3FCSB 5IN4A 4O4JA 3DHYA 3QF7A 5EINA 3O2QB 2PRJA 2WI8A 1KOLA 2RHMA 1ANKA 4BX3A 5H3HA 4DC0A 4BEWA 2I3GA 1J22A 2ZS8A 4PFSA 4A2PA 4B3XA 3E82A 4I3HA 2FFQA 3MAAC 2C96A 5GV7A 4AZVA 3LRPA 4BOYA 1MB9A 1WVGA 1IH8A 3E3LA 2JFOA 3KPVA 4JGBA 1AE1A 2IOFA 3K09C 3PNSA 4DPMA 3MAJA 1PGPA 5FFNA 3I2KA 1DE0A 1R8SA 4AMUA 1U9JA 2C0QA 3AUTA 2FZEA 4KX3A 2XTZA 1K06A 3VOBA 4WKPA 2ZUEA 1DFIA 3GD5A 4MR7B 4QUIA 1KWKA 1WV0A 1GRNA 3VR4D 3WK6A 1TMYA 1JE0A 4IGKA 2B25A 2CFSA 3T7DA 3MT8A 5K45A 2MDTA 4W5HA 4XSHA 2V7GA 2OCAA 1QHFA 1RYNA 1WBBA 2BL4A 2B34A 3FD8A 1E7RA 1JHAA 1GHTA 1NM5A 1U2QA 3IXMA 3ZWBA 4BC0A 2O3UA 3KCNA 1EFAA 1W19A 3LFHA 3EVFA 4PHTA 4ZQCB 3DCYA 1OIWA 4B75A 3PWTA 2W00A 2WVHA 3E61A 2RCNA 3SAJA 3T52A 1L2TA 5C3UA 3ZX5A 4BE4A 1RAFA 1C1XB 1SOUA 1WUHS 2J9FA 3AFGA 4MIOA 2QLLA 3GFGA 3U4MA 4US0R 4K05A 2R68A 4ZOAA 2P5TB 3QPAA 4AZWA 1CDOA 4ZYUA 4GZ6A 5FLEX 1YAJA 2XADA 5IMSA 2CHVA 1F5NA 2OC9A 3HVJA 3Q6IA 4LMBA 3UUGA 2M6LA 4WI1A 3D64A 3O8CA 2JK1A 3CRW1 1PT5A 3BWVA 3N3BC 5ALNA 5K3FA 3RR2A 1BMDA 1W8DA 1AH2A 5BY2A 2XB2A 2RHLA 4XGRA 1B3BA 3KZOA 8OHMA 1XRMA 2QVGA 3L1UA 3REFA 4EEZA 2HB6A 1YS1X 4JT8A 1ZR4A 2YV4A 2QRNA 1QYWA 1SJ9A 4ND4A 1IYZA 4YWJA 1VJ1A 2P41A 3PFFA 3MVEA 3QWBA 4HRAA 3W2GA 3AOEC 3B48A 4N5MA 1QM5A 3R5KA 4O8ZA 3TGWA 1TVKB 2XIQA 5KNLA 3OPXA 3PNBA 3GLGA 2NO1A 5SY6A 1AN0A 2ALJA 4KQJA 5IUKC 1I3NA 1I4LD 3LL7A 4Q48A 1QF6A 1R4NB 4XM0A 3EPRA 1FRVA 5K8JB 3FBWA 4HK4A 3VR6A 4G4JA 4AJ1A 1FZTA 1FBNA 1HZJA 3UYLA 2CJWB 2QG4A 3C3YA 2GD2A 3IKMB 4MR8B 5AKGA 2O3RA 3C6YA 4MJ3A 1XVAA 4PBRA 4TL8A 5T57A 2Q6VA 5F2OA 2VBCA 1N34B 3ZV6A 1QE5A 1QSGA 1ELOA 2J67A 3ZCPA 1ZLYA 4I6JA 4M1ZA 1EWVA 4ZQIA 2GUGA 1SR8A 5JS8A 2J1LA 1A5ZA 1L7RA 3BDVA 5GVSA 2WQ6A 1EUCB 2VP2A 1RJEA 4FI3F 1R15A 2ODAA 4L50A 3S68A 3BCSA 3AUYA 1E7QA 1OY1A 3EZ7A 4RS3A 1R50A 3RSCA 3IKTA 1Z6TA 4HAUA 1EVYA 1P4RA 4HUQB 4JGGA 3RUHA 4EL5A 5JNRA 3N28A 1C2YA 2ZWAA 1UJ4A 3ILHA 4IQGA 3AF6A 4UTOA 1ICIA 4FZ3A 2IYVA 2PKRA 3GYGA 1QK5A 5EP4A 1XZFA 3L6UA 4NZYA 4ZHQF 2E1RA 4J9VA 4P36A 2ZQ5A 3C6ZA 4HS4A 4RKYA 3FF4A 4ZVMA 4Z1OA 2G25A 3IQWA 3QVWA 3WFIA 1MB0A 1V95A 2NMVA 2WABA 3DQZA 5HK9A 4AS2A 1NMZA 4O2RA 2KQUA 1DPFA 4KK3A 3WB0A 1W49A 2WWIA 4V38A 3CF4A 3A0RB 5E6SB 4EB0A 4K1LA 3I2JA 3OEYA 3E81A 2WZDA 1YZNA 3BK1A 1TRKA 3PI6A 3EW9A 3JW8A 2QE6A 3LUPA 2XUFA 3KPWA 4D9EA 4J0DA 5GOTA 1J33A 3VTKA 4G8DA 1N92A 1FQOA 3T9EA 2VPXA 3WWEA 4BBAA 3C3XA 3PGJA 3T5DA 1S1CA 4NZNA 1L9KA 4R16A 2H1VA 3HVRA 2DM6A 1NQVA 2H1LA 1V8BA 2CL6X 3CWCA 3IAM1 3AF3A 4TKUB 1OFIA 1XQ9A 5DYNA 5EMJA 5DK6A 5FUXA 3T94A 3WWCA 2E6KA 4E1VA 3BJIC 3AF5A 1G2PA 1WXHA 3QMPA 3BZBA 2DRIA 3G9UA 1NT4A 3WDKA 3R0ZA 4RDIA 4QPJC 4XWOA 4MW2A 4TX1A 3LQYA 3VXKA 2JFUA 2IHUA 5A3VA 5T41A 3U4CA 3EZNA 3UJCA 2YTZA 1LDBA 2P2CA 5BW5A 3UK2A 5I7OA 1K6JA 1JEAA 2V7UA 1KJIA 4Z3KA 5K8IA 4O3MA 4DQUA 2DETA 1ZM9A 3LG2A 4NCJA 3SR0A 3PR1A 4K28A 2PJZA 3ROGA 1EUYA 3ESBA 2VLBA 4DLXA 5GMOA 3ZVKA 5JADA 4JUAA 5IZCC 2GYVA 4CUKA 1IG3A 4X91A 2I2BA 3HDHA 5DLPA 2J6IA 3FZGA 4JIMA 1ISMA 4LGVA 4L6IA 2HPHA 3DYVA 3KT0A 3VKFA 1KR2A 4D44A 2JIOA 2GYYA 2HKIA 3DOHA 4EKEA 3ER6A 4M36A 1Z18A 1S4MA 2G06A 1U0NA 4RMHA 4YPVA 1L7XA 1QUFA 4TTQA 5BWLA 2EHJA 3N3AC 2PLRA 1AUPA 5ESXA 5G4LA 1AKVA 4KVGA 3MWKA 4AYTA 4CF4A 1RU3A 1X9HA 1JLKA 4KRFA 1XG5A 1YVUA 2P11A 5AI8A 1PIWA 4MVJF 1KOJA 3S1AB 1YR6A 1U6JA 4IJQA 3SVZA 4DUZB 1VB3A 2C1ZA 3I6MA 1XTVA 3CUKA 4ISCA 2B3DA 4MWDA 3NNDA 4EPWA 4RV5A 3F7TA 3B8HA 2VQFB 1VQ1A 2FWIA 1SHLA 5ELMA 3STUA 4C30A 2C7BA 3FFAA 1U65A 1ZNQO 1M2VB 2IQ5A 4B0OA 1JEYA 2IH4A 3EVTA 3DBOB 2K7ZA 3UV6A 1YVDA 3WBFA 2NV0A 3D1JA 3GUVA 1YTLA 4WKOA 4QXOA 2A9KA 5JYBA 3OD1A 3WK4A 3DOIA 2Q3FA 1KMIY 3QPCA 3SQDA 2C8VA 5ERXA 2F4VB 1W2GA 3IC5A 2PKXA 2Z3WA 5L3VA 1K6MA 2BISA 1MGOA 3QE3A 4N82A 4EHBA 1CZLA 2GXQA 4U7PB 4B82A 5HQ3B 4PPQA 2IUFA 1SXQA 1ZSNA 1QFJA 5FUYA 1NRJB 5LBTA 2PMFA 4KQ9A 3UTDA 1Z3CA 1YBHA 3QX8A 4MKGA 2LCQA 4OL9A 4JHLA 1G7SA 3P8ZA 1DRUA 4GPIB 1JJVA 4D9GA 4IEEA 2QQ5A 1ZINA 1AXGA 5FO1A 3PUKA 4E15A 1KRHA 2RI6A 3I76A 2FLVA 1XPRA 4ZOBA 4Q1FA 4DIBA 3KJXA 3Q5EA 4MCHA 4DPKA 4GUAA 2UYYA 1AC5A 1CTQA 1A9SA 1WMSA 2DUNA 3P2YA 3PPWA 5CB8A 3HB1A 3PP8A 5G1PA 1TFUA 4F91B 1WSDA 5JXHA 4XRGA 2JLSA 2X42A 3E8SA 1EXDA 2NZYA 1TEHA 3MTGA 1J0XO 4L5IA 4L9WA 2ATVA 1JYSA 1NJFA 1U81A 4W5WA 1PGOA 3PE4A 3V7NA 8ADHA 1NKVA 1EM6A 1LW7A 3NRBA 4X7RA 4HAXA 1KBZA 2L82A 1D0VA 1DIRA 1WD7A 4QEDA 4V0KA 4ZA2A 5EKTA 4DV6B 2A84A 3QE9Y 3PUVA 2BGTA 6LDHA 1QTQA 1Y42X 1YUBA 3EXFB 1WVIA 3RJMA 4BNVA 3I5UA 3WNVA 3C70A 1T4MA 2G80A 5JO9A 1QR2A 5A2GA 3FZNA 1I3CA 2DBRA 4O63O 2RI1A 3KTAA 3ONDA 1CF2O 2A4KA 1XNJA 2GM5A 5TNXA 2XAAA 4S1OA 3KYJB 3BK7A 3D1VA 3PUJA 2JD0A 4W4TA 2GDZA 1R6BX 3FCUB 4PEVA 4ZVRA 3GRRA 4C3VA 2AQKA 1QNLA 2YMMA 2WG1A 3C6KA 4HGYA 5I8PA 3RC1A 4YMIA 2VP3A 3HJFA 4OSEA 1J8VA 3ZVLA 4KR2A 5ERGB 4XQCA 2WZCA 3E18A 4DNFA 3TUJC 4DS3A 2EWWA 4B4WA 3RFCA 2HYIC 1XGKA 4RZIA 2FZCA 1VHTA 1E6MA 3WB1A 4F56A 2RIPA 3L04A 3EYAA 1LUAA 5C8YF 4DV1B 2GN4A 2PA0A 4HXGA 5TDHA 5K3FB 3F3SA 4AWBA 3TPFA 3PC2A 1UIRA 1QCDA 3AHDA 3H11A 3L0OA 4RKWA 1MVOA 4BMOB 5GTDA 1WMBA 2QTHA 1H94A 2WF8A 4JFRA 3N2GB 1Z73A 3CKMA 4M54A 4NOKA 1LW6E 4ZT4A 4JSTA 2BONA 3EZ9A 3MIZA 1LRLA 1BKSB 3ZCRA 1MAAA 4L51A 1B43A 1YNSA 4TKLA 5F21A 3QWIA 4PC3A 1XP5A 4MUXA 1A9RA 5G1NA 1VPTA 3E8XA 4RESA 1DFHA 3CISA 3DL2A 3CJQA 5F1KA 3WWZA 5EIXA 4PNZA 2BE7A 2YC4C 4PHFA 4CMEA 1NR1A 1W87A 1N8TA 4MVWA 3DE1X 1B42A 4KTVE 3U7QA 3ZU3A 3B6MA 5JTUA 4QFCA 1XHFA 4Q19A 3EIOA 4G81A 1STOA 3HEMA 4MV8A 3V97A 4PAGA 1FTGA 1ZLXA 2VI5A 4HPJB 3SJZA 2FRDC 2NXEA 1J1UA 3QVLA 3SXUB 1RNLA 4A2QA 1GN9A 4GQBA 3FB4A 4E94A 1MRSA 2Z8ZA 1JPVA 1RPZA 3PEWA 4YRPA 3FSRA 3Q12A 3PC8A 1KETA 4C06A 1E6LA 3CZ4A 3IEKA 4EVQA 2WQ7A 2B99A 1NR5A 4HWSA 3HXPA 4KJZA 1NWHA 2JI6A 3LW7A 3UF0A 1MV8A 4PIPA 1BOOA 2OHOA 3IJRA 4L0CA 3E3AA 1P7ZA 2PGXA 1ZHOA 1TPZA 3C98A 3T61A 4WBNF 2YL2A 2XECA 2WVAA 2Z2YA 3L6DA 2FPLA 2E4XA 4X93A 1FYVA 5JVDA 1EDBA 1G3RA 3BGSA 3RJTA 4ER6A 4RZUA 2BZGA 3I8SA 4B32A 4YT4A 2HLPA 1IHPA 1KY5A 2W8BA 3BXPA 4XYMA 4C0JA 1UK8A 3EIHA 1H05A 4MQFA 3WYDA 3V32A 1H85A 4XGQA 4ND8A 2BJHA 3Q88A 1EP3B 1P0PA 2H06A 1L1QA 4YPFA 3ZOKA 2Q0HA 3BXOA 4WVLA 5FA5A 2OYRA 2EKPA 2EZ4A 2J5BA 3D6JA 2ZG6A 4KSYA 1VLHA 1UJMA 5MN4A 2WJ3A 5IKMA 1PGJA 4UHBA 3TBKA 5I45A 1T5HX 3C7KA 5AM3A 2E49A 2FUG6 3LOQA 2WG2A 3QKUA 2X19A 4ZJYA 4IGFA 4L6CA 4AJLA 1X7HA 3HRIA 1TJ3A 3PE3A 3RFUA 4F6CA 5JAZA 1Z8NA 3G17A 2AC7A 1ZVQA 2QTBA 3EY4A 3FSEA 5FTJA 3A4YA 3GIDA 4H3KB 2P75A 1TO6A 2QHXA 3NM6B 2ZBUA 1SQFA 1YK1A 4PYLA 3GEGA 4EHAA 4DYDA 3C3DA 1FA9A 4O0LA 5CR9A 4NCKA 3NHUA 3G2HA 4OMFG 4NPHA 2CJFA 4BO6A 4XAQA 1U7UA 5HOQA 2AOTA 4QXMA 4X5OA 5FFFA 2VF5X 1D4OA 4J9UE 1RLOA 5DNCA 4WLOA 1NX9A 2RGGA 5T4HA 3JRWA 1DP4A 2VDPB 1EM8A 4LDQA 5FLYA 4DWVA 2PTGA 1R4ZA 1P4SA 4JLSA 3KQWA 3MJFA 3DKRA 3F9IA 5CA1F 3GWGA 1M33A 2DHQA 4WK0B 4DSAA 1PX0A 1YZFA 2I6QA 1NN0A 2VG8A 1RYYA 3QEBZ 2QV0A 2XAUA 3ZZ1A 4C04A 1QTRA 4MB6A 4U8GA 1Y1RA 3GROA 3OOJA 4M99A 2FK8A 2G8LA 1P2BA 3FTQA 1B14A 1P7CA 4I4IA 3CNHA 1J99A 4JC5A 4OBBA 2V6FA 4UPDA 2C7VA 3UYKA 3D6MA 4UBJA 1XWIA 5H3CA 2XQGA 3GHHA 4TTVA 4K86A 1FU7A 1GGMA 2X2OA 1RACA 1JJIA 2ODPA 2P65A 3OJWA 3TOVA 5IAGA 1DG9A 1X9IA 4ONEA 4RHFA 1GU7A 4RIFA 4BASA 4N3NA 4A73A 3NTOA 2GUWA 1JEYB 2RHGB 4K9QA 4OP1A 2NZVG 4YFYA 2QSYA 3H1FA 4YR7A 2XF8A 5IJWA 2G6TA 2V3VA 1RVV1 3D2AA 4BZXA 5B6JA 5EMNA 2YJ5A 1JEOA 3AKYA 9GPBA 1X6VA 1V6CA 4P2BA 3IPAA 3JARB 1OX4A 1RJ9B 4P7BA 2X14A 4C4TA 4JHXA 5B58C 2CLHB 3K8YA 1AURA 1GQ2A 1RAIA 4HB2A 4DR2B 4FKBA 4DJEC 3G2OA 2JH3A 2GXSA 4BFCA 1VKZA 4OOEA 2V45A 3G2JA 4NSNA 3ZU5A 2OV3A 4D7AA 3I61A 4C0BA 1Q2UA 1NKTA 1QZ3A 2C2OA 3AZQA 1KO1A 5EUCA 4HATA 5IJ0A 5JSZB 1PHPA 3FFBA 3V2UA 1N5JA 1RXWA 1QPZA 1X0XA 2G0AA 2F9MA 3O74A 5AHOA 1NG1A 3WLAA 4DA8A 3E35A 1ESMA 1YBAA 3H3JA 4HMOA 5EA2A 1UMCA 1T2UA 1PFYA 2J46A 2RHTA 3PGKA 4JB8A 1RRVA 4LYHA 4LY6A 4OXRA 3OQIB 1RC1A 2PQ2A 2PUWA 5AI5A 4EW1A 2X0JA 4E11A 2WM9B 1KSHA 3SXPA 2NNLD 3QW4B 2LR0A 4LECA 2CF6A 3HUFA 5KYNA 3K3PA 1RQPA 3IA7A 3RF7A 4HFRA 5DK4A 1KQFA 3M82A 2XDWA 2PH5A 3PGLA 1V8FA 3QOYA 3TTVA 2C61A 2ZT7A 4G9BA 2XWSA 1RMYA 2VXCA 3U31A 4AWAA 4OQ4A 5KNCH 1Z28A 1YU6A 2A14A 5LB2A 4PC6A 2FMHA 2ZS9A 1U2RA 4TZ0A 1F7UA 4QTXA 5DX0A 2V6JA 3CPSA 1YFZA 4JD5A 1UXHA 5EPOA 3RK4A 2GF9A 4HCJA 3FW1A 2DAPA 3BCRA 4FSDA 3BQ9A 1DQNA 4DW8A 2GPBA 2VQ3A 3KTAB 3LVFO 3T4PA 4GS5A 1IBLB 5CFLA 2XRFA 4NOJA 4DCOA 4BGDA 4IIUA 1WMFA 2KSQA 3AY0A 1L5VA 3RJZA 3AY3A 3ODPA 1X2BA 2CNWD 2GPAA 4MEAA 1XTJA 1KMQA 3A4TA 3GCDA 2HLDD 4NEHB 3G2PA 4CT0A 3KR9A 5KEIA 1CRLA 3TJMA 3RYHB 3WZLA 5DGDA 1SXJC 4FI3C 1JLHA 4HAWA 2GBIA 1OZGA 8LDHA 3DXZA 3GJ0A 3R4CA 3FDXA 4JEIA 2FXIA 2RK4A 4QG7A 1WQ3A 2FPUA 1VE1A 1VSTA 2O2YA 2VHVA 4HLCA 4XLLA 5D51S 2O50A 3TTYA 2A1TR 4R7TA 1U2TA 2JIMA 4F5WA 2ZKLA 1VHDA 1QIFA 2IU0A 1OLOA 2BHSA 1YCFA 3G85A 2P7HA 4ZKEA 3CW8X 2IC5A 3PNKA 1USGA 2E0IA 3H11B 1IZ8A 3MINA 1SD2A 3RS3A 1JFFA 3E6AA 4GRIA 1PYGA 5DHSA 2FPOA 5TEVA 1XZEA 4K9PA 4HX2A 3UMVA 1RQ7A 4DDWA 4FM9A 2FPGA 3GMSA 4S1TA 3UMRA 3GC6A 5D85A 1W46A 1ZI9A 4EYQA 3EJWA 3QLUC 3ENZA 2WFMA 4KQ1A 1E92A 2TS1A 1GFWA 5DT9A 3LGXA 3U7QB 1NZDA 3ZHYA 3NDBB 3MJHA 1EFRA 1YMVA 3IESA 3K05A 4AKEA 1JB9A 4QTTB 4I9UA 3H1BA 1RFGE 5JCJA 1N2BA 4DOMA 5GJBA 3MA0A 2ZJ1A 4BVAA 4BVHA 3TLGA 2PE5A 3TZKA 1S3IA 5KDDA 4IAOA 1Y3IA 2BHLA 3HDVA 2G1JA 1N5RA 3QKTA 5JS7A 4KRGA 2IYXA 4QSHA 1FQKA 1O8CA 3ORQA 1AT1A 4IIJF 5AUNB 3KX2A 3F1LA 2QUIA 1T36B 3MWEA 5CA0F 4V2IA 3OQBA 1NKSA 3CINA 2FX3A 4TMWA 3GGSA 5DE3A 4GSKA 3TFWA 2Y1LA 2ZP1A 1B23P 4YDSA 2CVQA 2Q7DA 4MEJA 4A5OA 2RB5A 2JAXA 4P3NA 1OYYA 1NJ1A 3FNIA 3GXOA 3I6IA 1YR1A 4DT1A 2Y1OA 1Y34E 1VTKA 3P20A 3TE6A 1XNGA 2LV8A 2X4IA 2B4TO 5BSEA 4KXFB 1HG1A 4EFNA 1IN1A 3C3MA 3B9BA 4CIBA 3PLRA 1TYAE 1MDFA 4P84A 3GAAA 2W8BB 3OD5A 3D7SA 2R5NA 4CM8A 2YIMA 2IOQA 3HNOA 3JD3A 2YW9A 4XOUA 4A6DA 4G0VA 1DMRA 2VATA 3DTYA 2ZTMA 1BWQA 3BERA 1J20A 1DDIA 4ZT2A 4MUKA 4WCFC 1XRRA 3G7UA 2RKWA 3FJYA 4WN9B 4X97A 4E21A 5KQSA 3RABA 1NRXA 5CGZA 2Q50A 4BNNA 2WU4A 5CXQA 1XVLA 3CGGA 4WECA 2VHZA 1JA0A 1FU4A 3FYHA 2RGDA 3DBRB 5FTNA 3PWZA 5DTMA 4GMGA 1T8WA 1M2HA 3W3ZB 3OUZA 3QTTA 4N01A 4UU7A 4OHZA 3UMCA 1N3YA 4FMBB 4WTOA 4RSGA 4JP5A 5EXDA 3N1UA 1AQYA 2ROQA 4D0SA 2X4GA 1M2JA 4EPRA 3D7NA 4Z9AA 3PU6A 1DO2A 3VZSA 1KYIA 1THGA 4JLJA 3LVBA 4LWPA 2V7WA 1RBMA 5ICEA 1GV1A 2C07A 4UD2A 2FPRA 4JB3A 3WS7A 4EELA 3O9ZA 2R00A 3H2HA 2VDMB 4NIMA 4TT3D 1DUVG 3MQ2A 4YUZA 3AWIA 1C9MA 1H0KA 1T5BA 1Y0BA 4DLPA 2HC9A 4CCAA 5JC1A 4RTNA 1KAOA 2QN1A 4KQEA 3GJ4A 1VZ3A 3O1JC 2CEAA 4NONA 5K0EA 2Q8PA 4TRNA 2QY6A 2XCRB 1J2RA 3GOHA 1RM4A 3KU1A 5AKJA 3TF5A 4POOA 1AV6A 4EG7A 1G8YA 3D6TB 3DKVA 1Z4IA 1P5RA 1O03A 1ZN2A 5F4BA 2PGAA 1EM8B 4D9KA 3SZLA 3R2JA 2ZJ8A 4KO2S 2YCLA 3X2FA 1YDEA 1YO6A 1NUHA 4YJ2A 5J2UA 1E3MA 1NP7A 3RSLA 1Y1LA 3UXMA 4EF4A 1VBFA 1Z5ZA 3TB6A 1GYPA 1T2AA 1NJSA 2X15A 2PX4A 3N0WA 1Z8FA 4GMXA 4PYIA 2DQ4A 1LA2A 1OCEA 3IT2A 4DR4B 3B89A 4RY0A 1NW5A 1ORTA 1HEYA 4E2ZA 3L6EA 2QJWA 5AD1A 1OT5A 1MT3A 1SVKA 2GEVA 1CQJA 2QAGC 2ZQYA 3JQ9C 3IR6A 3DQQA 4G0QA 1BXGA 3QBTA 4PCAA 5AVXA 1TPYA 3Q8KA 1NL3A 3V8MA 5DGCA 4MNTA 3IODA 3U3ZA 4I0WB 1Z6PA 3O75A 4OXYA 1OYOA 4PW0A 1G1MA 2C1EA 4FK8A 3GLFB 2DBYA 3NHYA 4KG7A 1QG4A 5DXFA 2X8JA 1XCGB 3GU3A 1GTVA 3Q11A 3BFJA 5C5IA 4QUHA 2BUAA 5IJAA 4G0PA 4L2IA 4GDFA 1XKQA 3MGBA 3VU9B 2H9AA 2V7EA 3WGTA 1XRSB 1NXVA 2FSHA 4KPGA 3HHPA 5BW4A 5JJ5A 1OX4B 2V9CA 1Q0UA 4EUKA 5KQRA 4PGMA 1LDEA 1UJBA 2W2NA 2WF7A 2OV2A 3HBMA 4HC4A 3COWA 3Q2IA 4RDCA 3R7WB 4REOA 4ALMA 1HWYA 3I5YA 2JBAA 1P5JA 1K3TA 2X58A 5JFGA 3KVVA 1J97A 1FFHA 1RE0A 2HPAA 3CF6R 4ECAA 2WFAA 2C4VA 5WRFA 1CY2A 1DKQA 4FYYA 1YZKA 4IJUA 4N49A 2CV0A 5ICMA 1SUWA 1RHMA 1NRIA 1H1DA 1ONPA 2EEPA 4R84A 4BYGA 1VXOA 2ZJ7A 3GZNA 5G40A 2HHAA 4DZZA 4HSEA 2XKAA 4J3FA 1JMKC 4XIFA 2OYCA 5D01A 1UMCB 3C14C 1X1EA 4JC8A 3A10A 1U7PA 2C3PA 2A7XA 5H68A 4B3DA 4DL9A 3KBBA 3BHIA 1CUJA 3U7JA 1BCRA 4GMFA 1EZ4A 3HPQA 1DC3A 3SC4A 2VDJA 3ND8A 1BS1A 2YZNA 2QR5A 3LVRE 3P2OA 4G4GA 5DRYA 2VYQA 3WGYA 4UPEA 3MUEA 1L7NA 3K70B 1KFCB 2BDUA 2Y1FA 1Y1TA 4RADA 4RD0A 3F6RA 2X5XA 3DAGA 4U2DA 5BYJA 4BXOA 3EBLA 1Y1PA 4KDFA 3IIJA 3FJ1A 4QJIA 4RPGA 1M8GA 3E58A 4DG8A 1UPBA 5KX5B 4EPVA 2C9BA 4HQLA 4BB6A 1UPFA 2J07A 2FN4A 3CVVA 1DCMA 5HZHA 5FTKA 4JC0A 4QQFA 1OFUX 2XGOA 4U2GA 1N1DA 4CF6A 5CB4B 2WUGA 5B37A 4H6PA 3TLKA 1JH9A 3OLVA 1W5TA 1QQBA 1G42A 3NHMA 3LK6A 5FA8A 5ED4A 2O8EA 3JVVA 1XQ1A 2RGCA 2PX5A 1SBNE 1VSVA 2Q2NA 3TYXA 4Q9AA 1H3EA 2QVBA 4IV0A 3MRXA 3VNSA 1T9AA 5KWSA 3A70A 2Z5FA 3RYCA 5DNEA 1E9VA 3VR5A 1K5HA 3LLUA 4IJ6A 5BW6B 3HUDA 3HA5A 3OQHA 4PO9A 4ZCTA 5LYJF 4A23A 3C1AA 2BM1A 4GWGA 1GL7A 3IOEA 3JQCA 4QWMA 3DLBA 2DHRA 4E5KA 5FYQA 2OZLA 3VC2A 1TTQB 2AMYA 4R2XA 1W44A 4BLUA 3JS5A 1AY0A 1K8QA 3KLPX 3T7CA 2PG3A 3H6KA 3OPMA 3UGJA 2C4MA 5F78A 3EIQA 4EO9A 5AFSA 3CUEF 2OM2A 1XZHA 1NTOA 1Z16A 2VP6A 1RXCA 3MRTA 4AJ9A 4I1PA 3QELA 4X3PA 1YS6A 1UK9A 3BJZA 1H0SA 5JW6A 3U37A 4ZI7A 4QEKA 3AWDA 2O3QA 3E9NA 2DPLA 4J07A 1FFYA 2PWBA 3EC2A 3PJRA 1O58A 1NSFA 2WJ4A 2X23A 2O1XA 3RHFA 1QH1B 4J0HA 2WWXA 2VXOA 2XVAA 4YAWA 1R8YA 4D79A 3IB3A 1OFHA 4JR2A 3GDWA 4OB7A 4UXIA 4XCQA 1WPQA 3CNQS 4ZZ1A 2AD1A 4QU5A 2QRUA 3ZNOA 3OX1A 3THWA 3WLPA 3OZEA 5JWHA 3TLGB 1V45E 5E1DA 4DGSA 4YVFA 4ZU6X 3DH0A 4BLTA 5EIAA 1REQA 1ZCBA 2EZ8A 3BQNB 3N58A 4NJEA 3NBFA 4GAEA 3F98A 5I8ZA 3VM6A 4BEJA 1PNRA 4EBBA 1AQJA 3EGDB 2RB4A 4TXHA 3OP4A 4RQBA 4XWYA 2R3SA 3A4LA 4B76A 1JQEA 1ODCA 1Q1EA 3DDCA 1QRUA 2NSHA 2FZWA 3O4GA 4F12A 4AZ3A 1PJAA 3ASYA 2D0IA 5GZ3A 4FEAA 5DCLA 1G16A 3M6UA 2FMFA 1N2CA 2A5YB 2K7FA 3C8DA 4DT1B 5F23A 5F52A 3GPIA 2JLAA 4KKVA 4M8LA 4YP9A 5FCDA 3T9BA 4ATNA 2BGWA 3L5KA 3Q5DA 3SHTA 3U40A 3O5AA 2Z5GA 4KLNA 3I9OA 4IEFB 3PFWO 1HK7A 4ZV9A 4G8JA 5LJLA 4FT2A 3JQQA 3SBDA 3K8ZA 4R3UC 4XH9B 3RCBA 4GR4A 1XU4A 1WPGA 2RHRA 2DHEA 2W0MA 2W2LA 4L3VA 1G19A 4CM8B 1FK8A 2YZKA 1HTWA 3VI3B 1YE3A 4Z54A 2CDRA 4PFKA 1ZD5A 5I51A 3FPAA 3ZHQA 2G77B 3EDOA 5B1IA 1YOBA 3L6RA 3Q0IA 4W5TA 1A8HA 1UKEA 2R7NA 3WRYC 4Z0PA 3OVMA 5IANA 1J8YF 1P4AA 1XD9A 1X7DA 4F2GA 4MW5A 3MJSA 4J6EA 5MGNA 3JWEA 1YQXA 5CVVA 3TQCA 4CM4A 2XSZA 2H1RA 3DFKA 3IUJA 2QGZA 4OI2A 5LUAA 4FOPA 5K0SA 1W4LA 4KOAA 1MEJA 1UT5A 2WJYA 1SU7A 1TM7E 2ZW9A 5TPZD 2XYQA 3ZQ6A 4A2WA 4DJTA 4LHYA 5K3BA 2NTJA 5B2FA 2PWPA 4BO8A 1MEOA 2NO9A 4IQFA 2E7ZA 3KB1A 3WMGA 3BRWD 2W98A 3JQFC 4J0EA 1U8EA 1VCOA 2EBWA 2YS7A 3K9LA 3OZXA 5CLFA 3MPUA 4RPCA 5K2MA 1DTEA 2WDZA 1SXJE 2WF6A 5BUSA 5DULA 1OXSC 2HF8A 1O2DA 4OAQA 4AG6A 1BCSA 1DDGA 1JX6A 1O08A 3HZZA 1NUAA 3PC7A 1CFJA 2WD7B 2YASA 4S1NA 1BN6A 5LSAA 5IVHA 4RHYA 1N78A 5AM0A 1N7JA 3MCUA 4ZWNA 4GQAA 4H1VA 1CRZA 1LJ8A 2D8AA 4WEOA 4HWRA 3OTOB 5AYVA 2IOFK 2QEQA 4W8GA 1E7MA 4BKPA 3WKBA 4XYEA 4EBFA 4YJ2B 3OX4A 5J2UB 4KIUA 4KKXB 3M1IA 4UCFA 5CAEA 5ICGA 2F62A 3DAOA 1NP3A 3IVRA 4MQLA 5EG5A 1GL9B 5JNTA 4OAOA 2IS2A 2A0YA 4WZAE 5I7EA 1GTMA 3DVAA 3JATB 3PPIA 2FVYA 5I01A 3TIGA 2EDAA 2GNOA 2Y71A 3N75A 1W0KD 3JWPA 4RA9A 4MV3A 2W6PA 3RKRA 1BXGB 3G02A 4HYQA 1XALA 5DNAA 1XSEA 2C97A 1UBHS 4UVGA 4XFJA 3WV4A 4AUEA 4C6TB 5BR1A 3IJEB 7ADHA 1RADA 1Z8DA 1E1CB 4N6GA 5A5FA 3T15A 5KYWA 3KKZA 3PQ5A 3ABZA 3ZHUA 3OUUA 1SUEA 4E31A 1QQAA 2CNNA 2Q5IA 3DT8A 4E5MA 3AY6A 1V5GA 3G0OA 3JY6A 4PGHA 5HBGA 4KR7A 2X8JB 3ITNA 1RP1A 5ISMA 1IVSA 4BNWA 2X4DA 3DVSX 1QDEA 4MRMA 3BN3A 4OFZA 3FKSA 9MHTA 3EASA 4L2IB 3GRFA 4LOLA 5IKEA 1JXOA 1VG8A 1MEEA 4KVFA 1VBMA 2IHVA 1Q1QA 2RGAA 1VYTA 5THQA 5B6PA 1I7PA 1UODA 2HDOA 2X2FA 5LDGA 1SUDA 2XUKA 5IK2A 1U02A 5IUNC 2WINI 4IHJF 5F2EA 3OE7A 3SJCA 5J40A 1VMKA 4I50F 3ZBQA 4A92A 1UH5A 2L42A 2QT0A 3U4GA 1A9YA 1L7EA 2QMZA 4JYCA 1MX9A 3JQ8A 4WBNA 3KAPA 1HYQA 8ABPA 2BHTA 4Y9SA 4NBSA 3TECE 4PIVA 1VGRA 1M1XB 2P2LA 4ZHQB 2ZBVA 1EFTA 2BF7A 2G9RA 3AH8A 5TB5A 3UY4A 4ZHSA 1ZY2A 2J0EA 3K9NA 2QN2A 3L18A 4LOIA 5E1BA 2DULA 5FADA 3EA5A 5ILGA 1ORRA 2VCHA 4MICA 5IAKA 3D3WA 3AHGA 3JZMA 3V1TC 1BEZA 4N0EA 1X94A 4UBMA 1QHSA 2JH8A 4KI0A 3COJA 3QYFA 1LNSA 3ABRB 2XQKA 4GEGA 1WXEA 2QM8A 1BCRB 1RRGA 1PZMA 1XN1A 2BCGY 1WDKA 1ZMBA 2HSWA 4G9GA 1Y3BE 3H2BA 3NR2A 3UZUA 1UXKA 2XYRA 4YV0A 2AJTA 4QVKA 3ABOB 1G2IA 3O0DA 5AM1A 4DC9A 1CEQA 5I5EA 5IVPA 1YQTA 1ZZGA 3P7MA 2WB2A 5EPEA 2ZE5A 4MVJE 5HQTA 1NJ8A 2I99A 4TT8A 2VJBA 3HSYA 3NOQA 4Y2HA 2CUZA 4QYSA 2UZ3A 4BXOB 4G23A 5MF6A 3UWPA 4TRMA 3L8FA 2OCDA 2HU5A 3I9V6 1UZNA 4R41A 3E9MA 1OAOC 4UMVA 3F8WA 3V55A 1EIZA 5DX1A 621PA 1IY9A 2FG6C 3RV4A 4B2PA 4GVLA 3IBSA 2ZJAA 4WQMA 1C1HA 1NF8A 2VXYA 3HADA 3KJHA 1MG0A 1W93A 2IGTA 4ALIA 3W5SA 5SZHB 3GLUA 4XIGS 1B1AA 4I66A 5JZBA 3SNKA 3H3FA 5DTQA 1KF0A 3AXSA 2R44A 3AQIA 1DELA 1U90A 3L1KA 3OOYA 1OI4A 3IELA 5E7QA 5F77A 3I73A 2V8OA 3KFXA 4K40A 4WA8A 2J9GA 4LJSA 3N8NA 4RY9A 5M3BA 1KY3A 3ZCTA 2O8EB 1SK9A 2WW8A 1N4AA 1V5WA 1R4AA 3EDQA 4JLBA 3G8AA 5K20A 4RHUA 1JKXA 2VH5R 2GT1A 4BUJA 3URMA 4D5EA 4U0JA 3RYCB 3FDZA 2WWWA 4MQ6A 2YY6A 4RM2A 3KUCA 4GMKA 4K88A 1PQWA 2E21A 2EFEB 5EYPA 3UGKA 3V2IA 3GEBA 1E0AA 2P2ZA 3M3HA 2PZBA 3HKBA 1ZR2A 1JVNA 3KSRA 4LDPA 1F06A 2R85A 2OZLB 2W6JD 3K4QA 5DCYA 5CCEA 2LKCA 2A3NA 3T7SA 1ZAKA 4WERA 4Q9HA 2HDHA 2NUAA 1O0CA 2HA3A 3CVOA 3QTBA 3MTIA 1E4VA 3NIDB 1Q11A 3VPDA 3E2PA 1N5MA 3I12A 1NXPA 3LC1O 4P22A 4TLMB 3U81A 3WSVA 5CBKA 4ESVA 4KV7A 3KQHA 4URXR 2X9QA 5KOJB 2IS1A 3DYBA 1XEAA 5KB3A 3OETA 3R0QA 2R6GA 1E9FA 4KGVA 4BRWA 5KZMB 5H0IA 1YKGA 4MJLA 3K6KA 3RH0A 1RJFA 1R12A 1U2ZA 2H59A 2VP0A 2QW0X 4OF4A 2O7NA 2Z1DA 3AFMA 5LKRA 1Z4MA 1MBZA 4A3SA 2XEDA 4RVNA 1GNSA 1WX1A 3Q0TA 4PQGA 5HKAA 2SKDA 4XX1A 4QRDA 3IT0A 4ZQEA 1Y48E 1PT7A 3ORFA 2FDRA 1VKHA 4S1VA 4JBNA 3THWB 5FPHA 4RK7A 4TZ6A 4PNEA 2BJVA 2C5HA 2CDCA 2YOHA 3BG5A 1MO3A 1Y8QA 1KP2A 5B3KA 3U5ZB 1E1KA 1VL1A 3TSYA 2JEYA 4I3GA 3FOEC 3VV3A 4MV7A 4EY7A 2B92A 7MDHA 3U4HA 1MNQA 2IXTA 2Z08A 4GI5A 4P7GA 4BLQA 5KTMA 4V1CB 1G6HA 1IEXA 3AIMA 2PFSA 2XNDA 4HGQA 4EFLA 2YCBA 4GKAA 1N2CB 5IC4A 2D2VA 1OWOA 1VGQA 3GW8A 2UUBB 1SPBS 2RGNC 2HQOA 4H2DA 2J41A 1Z0IA 2MSCB 3ZLBA 4RTMA 1CR1A 2TMKA 3BF8A 1LDNA 1JDVA 3IP3A 2JGFA 4EI8A 2OXFA 3H87A 4P80A 1UXGA 3O95A 1U80A 2YN4A 3INTA 2ID9A 2PSDA 3R9IA 4AMZA 1T9GS 1EH5A 1ZMXA 1D8AA 4B9AA 4EHHA 5C35A 1M6VA 4B3BA 1Z5VA 3HV2A 4LC1A 3C8UA 5JRDS 1I2DA 4CL2A 1YZGA 2R6JA 1PJTA 2CNDA 1B8UA 4K2AA 1XX6A 3CY6A 3MLEA 4KQCA 3F3MA 3ETGA 3FMPB 2LVBA 5HMLA 4QPCA 5DFAA 4MWSA 4GMDA 1VMEA 2JKYA 3K0BA 4JSRA 1TQ4A 2RK6A 2LGJA 4CM4B 4UUOA 4ZZ3A 4Z5XA 4F6RB 3V46A 3NC0C 1YDHA 2PRSA 4ITRC 2IY7A 2WAOA 2FZVA 4LXGA 1KI3A 4ZVLA 4RQUA 3RQIA 2C58A 4BTVA 4E5DA 1JWBB 3FGNA 3VOTA 4X3CA 4ZZIA 4I4LA 1K7CA 1G59A 2X1HA 5IHPA 2YQ4A 1NSTA 4D9BA 5JJIA 5AKIA 1GGFA 4PRLA 4QU9A 4B3JA 5G0SA 3QA3E 2I4RA 4YIHA 3P0HA 3DZ8A 4F1WA 3C8MA 4I4CA 4BO3A 2HRZA 1BCSB 2FN7A 3VDRA 5IPFA 1AKRA 4JKOA 3LW8A 2VBGA 3P9YA 2P62A 4F1JA 3KOXA 4F92B 2GVNA 4UULA 5C8YB 1TADA 1Z88A 1FOEB 3ZCQA 3E1GA 1XJ0A 2W7TA 2HT1A 1GGKA 3JZIA 1OH6A 3IDFA 1QFSA 2RSLA 3GP8A 3ZVNA 3SE0A 3UMYA 5CAEB 4WOPA 1YB4A 1M0TA 5LZ5A 1DWUA 1ENOA 1NUSA 5TT1A 3SZOA 2NG1A 4K9MA 3VR1A 1CB7A 1PZHA 3DVAB 3DZCA 3TRFA 3UC5A 3FOAA 1OBVA 2WP8J 4KGDA 3QBVA 1OILA 5HA5A 1DC4A 4NYMQ 3U16A 1ZL0A 4LN1A 1YCDA 2X5NA 4RA9B 1BVHA 3D3QA 1SXGA 3ZDEA 3HACA 4JJEA 3VV2A 2P4HX 1DX9A 1QF9A 2XD9A 1M72A 1B41A 2AOUA 2C8JA 3LC7O 3T5TA 1SM4A 3AIIA 3PDCA 1VC2A 5EIBD 3BRCA 3W6NA 1W4RA 2JI7A 2OILA 4HHEA 3SX4A 2YFHA 5CT9A 3ZDDA 2O2SA 2WE8A 2JARA 2YUIA 1T1SA 4Y0NA 5IYZF 3LK7A 1IJFA 3DD1A 1GY8A 3EVGA 5K0CA 1WDTA 2G5CA 1I1QB 5EIWA 1TZKA 4JNKA 3I5MA 2R6HA 2IHKA 3F1KA 3OIGA 4MRMB 2RH8A 4BGUA 3G2KA 1W88B 4DIUA 4EX6A 3PEYA 1KRWA 4X8LA 5K0BA 2YZMA 2OCKA 3CRMA 2GD0A 1OXBB 1TEXA 2Z6AA 5IM4F 4YRNA 3HU5A 1ZK0A 5FBKA 2B9VA 3QWFA 4PM4A 1EA5A 4X20A 1SBHA 3K0HA 3NIWA 4Y18A 1FMLA 4D3ZA 4OGKA 2XITA 2X6QA 1F2TA 3GY0A 4IDGA 4J0QA 3FXAA 2WWVD 1J1ZA 1VLZA 3UHOA 5KSYA 4F04A 4LJ8A 2Y92A 1W0JA 4JODA 5JJBA 3JQ8B 4WBNB 1DZ3A 2R1VB 2GCIA 3GJ7A 1WMDA 1F38A 1P19A 3PSHA 3TM4A 4DY6A 5AVUA 3L6BA 5FJJA 1T5IA 3GFQA 8ATCA 1HTTA 1JIJA 4HEA6 4LY9A 3LJKA 1L4BA 3FUUA 2V65A 1CY1A 3R7NA 3AG5A 1B8OA 1I1OA 2WJWA 3EG5A 4LE1A 5FO0A 5BP7A 2ECFA 3KUDA 3D3WB 2YOGA 3QUSA 1E1QA 2C2XA 2XYVA 3PIIA 4ZP1A 3G8CA 2DPHA 3OCYA 1SA0A 3NNSA 3L8CA 4IHQA 4F86A 3KAQA 4DG5A 4ZCPA 4LWZA 1E2KA 1P3DA 4HDKB 4D8XA 3CZRA 2XTJA 4YJFA 5DEIA 3O4JA 2EP8A 4J29A 1S2IA 5K0GA 2ZQZA 4L5AA 3NBQA 4JJFA 4BO0A 1X80A 1TX4B 1GCGA 5L4NA 4HI0E 4N76A 4QDZA 1HDOA 3SK0A 5D3QA 3DEHA 4MPPA 1RTKA 3TKLA 4RBNA 3VPSA 1GQRA 5M5BA 1CIVA 2VPTA 2X6RA 2COUA 4E1AA 4E7PA 4OLBA 3G9QA 5L53A 3L0SA 3K32A 2V4ZA 3WFZA 1CUZA 1JALA 3EC7A 4GPZA 1BGXT 1DFGA 2FN9A 3UUFA 3ZV3A 1XHEA 4RTPA 3U44A 1L8OA 2ABWA 2WKRA 5BSHA 4KMOA 1GCIA 5CP8A 2OZPA 3PDHA 5B58T 5D87A 2EXXA 3QXXA 4IIGA 1FFSA 1TUEA 4LFCB 1ZD1A 5SZIA 3NHPA 1QCYA 1LVHA 3BIXA 3OCZA 1RP7A 1JB1A 2QT1A 2WA2A 3P9SA 4QLAA 3RSGA 4D25A 1XZMA 4URHA 1Y80A 1VE7A 2CFIA 2H3EA 3IHLA 4JS0A 5AWFC 4JI3B 4BPRA 1I6WA 3T7RA 1HC7A 3R40A 3OEHA 4OIFA 5AI6A 2QJTA 5CRIA 4FXOA 2P0EA 4KFUA 3UJ3X 1WOYA 2Q6TA 3M1YA 1ZUHA 1EGMB 5EYPB 3QBJA 3ZDFA 4F4UA 3E3OA 5FOXA 5CA1B 1RJDA 3P9KA 1AIPA 3VSAA 1L7PA 1VPVA 1ZUD1 2FF5A 2XJ4A 3PS9A 4XIIA 4J7XA 2BKXA 3LQKA 4L4UA 2ZUVA 1XN4A 4Y1RA 2NUAB 1P1IA 3ZZMA 4LDJA 3UUWA 3KZNA 2ZANA 3GN2A 4R8RA 2AL7A 3VYRB 2AEMA 3ZLUA 4YJDA 5DKFA 2HBZA 3UMFA 5KWEA 1Z2OX 4H35A 4KH0A 2AEEA 2H1OA 2QBYA 1IHXA 4FYVA 1TUGA 1ZD9A 2YY5A 3KL4A 3NTVA 1SQ6A 3QY0A 4M1YA 2Q3LA 3IMCA 4HZUB 3CKKA 5IC5A 3IVGA 5BWMA 4MV9A 3UPUA 3L7KA 4NZMA 2W2TA 2MSWA 1JFTA 3COYA 1ZESA 4N9QA 3NTLA 5EJ8A 1FJXA 7REQA 1UDRA 4S24A 5C53B 4M87A 3OAAD 4XQ0A 3ZH2A 2X4LA 3SIPA 4HTFA 1D2CA 1C9DB 1XEXA 4XM2A 2AE1A 1NW3A 1F8YA 4EP1A 4QM7A 2NP7A 1IBCA 4CTMA 4PZDA 1TUBA 2KS6A 4Z49A 2WA1A 4WOJA 4KEAA 1X8XA 1ZIPA 5F64A 2EKBA 5K51A 2GZHA 1MXFA 2VJYA 4RL4A 4CV2A 3LDFA 5KTKA 1Y8QB 1Z7YA 1M6WA 4B5LA 1DBPA 4NMHA 3L92A 3M83A 2DUWA 5KVSA 1GU0A 2HDWA 2NGRA 2WJZB 5FNVA 5KTRA 2R1TA 3C7AA 4EMBA 3OZUA 5TPWA 4P32A 1P2UA 2Y4OA 3QV2A 4HNSA 5JOQA 4HLQB 3QWHA 1FFXA 1P9WA 1E3EA 3ASUA 4GZ3A 5JV5A 3WA7A 4WA7A 1MQSA 1GPDG 3PUIA 3U13A 3ZH9B 4XCXA 1QVAA 1XZIA 1W2HA 2B8WA 4K46A 3NHZA 3HFGA 3P1JA 2MR6A 5GOZA 3VMFA 3IAHA 2EAUA 2ZYHA 2PU7A 3B3QA 2CF5A 3F7OA 3H8JA 5DLQC 4P34A 3W34A 4D43A 4S0XA 3TI9A 4HVAA 1IOZA 3WZMA 3PKJA 2R6ZA 1UC5B 5AOBA 4N39A 4XGIA 1SC6A 1JKJA 2O5CA 2B2NA 2B4QA 2FEXA 3GEDA 2BBWA 3DVQX 5TMDA 1LWOA 2ACKA 4DKJA 2Q6OA 3KD2A 2FW8A 2GCOB 5EE3A 5JPCA 3X1YA 5AI0A 1UMDB 2DU8A 3FVTA 1XRQA 4DLTA 1FMTA 1HV8A 3ED1A 3Q5GA 3GJQA 3TSAA 3KKKA 1GNQA 3GMIA 4J16A 4OH1A 2QAJA 4W8HA 3PJDA 2YWCA 4Z53A 2QTMA 2HK7A 3E7WA 3M4XA 4BATA 1JQBA 3TLBA 1MZPA 2VKQA 4NAUA 3EK2A 2CLSA 3OPVA 4ZO7A 2OB1A 2ZTHA 4S2EA 1IZ7A 5HUHA 1KZ4A 4G9EA 4LF9B 2RD2A 1KXZA 2P9GA 2IYYA 4GH5A 3T9AA 2QTRA 1NQWA 4TM8A 2FPKA 3HEBA 1BDJA 2QA5A 4FCVA 1K4KA 4JELA 3E05A 4FQ8A 1O89A 1TL7C 3KKOA 4O4LA 3PNYA 2PANA 3CUYA 1FB5A 3DE0X 1F9AA 2PZMA 3OTIA 1BH6A 4R7ZA 1ZJ4A 2FFJA 4EKNB 2H17A 2HNBA 4KAJA 1V16A 3FFXA 4I9HA 2HJSA 3UIEA 4UREA 3WLKX 4ZGGA 1Y8CA 4MW9A 4YP0A 3SM3A 4EQZA 2HZBA 4BKRA 3D3JA 3FOFC 2XVMA 3ACCA 3A9SA 1E8MA 2VYFA 4OHRA 2FPPB 3H75A 4YNBA 4QG3A 1DKOA 5HGXA 1QOPB 3HCBA 4YCSA 2NLOA 3AB8A 1CRWG 2JAWA 2JGNA 2YNMD 4LZPA 4RPHA 4C0AC 3IEIA 1E79A 1GZSA 1JR3A 1OPXA 2CVFA 2WYWA 3WIDA 2PS1A 8MHTA 1BOFA 1JTVA 2H16A 2ZI5A 2J4FA 1UKZA 4Q5IA 1U7XA 1OKKA 1ADBA 3JWJA 4DMMA 5MFPA 3WQBA 2XWBF 3WL8A 1L5SA 4HZIA 1NFRA 4UFPA 4HSGA 1K3FA 4EG0A 3SI7A 3W6UA 1W4AA 3T7KA 2ZBQA 2ERCA 4Y6RA 4YGYA 1DAIA 4EJ0A 1QU2A 4N3GA 1U9ZA 4NBKA 2AOUB 3FGPA 1RT9A 1TIBA 3ET5A 3NHRA 2CYAA 1QR6A 2BOVA 5IT4A 1GZ6A 2VHUA 2O7SA 2XDQB 3CLUC 4ZO4A 1LLCA 2ZI7A 1IY1A 2ERXA 1C7EA 2H2WA 4NZZA 1RRPA 1F8FA 1R5OA 4EABA 5ALYA 5G4KA 1X38A 4IIJB 2R0QC 1CJBA 4DSZA 3AM1A 3S44A 1P77A 1U28A 1A8IA 5CA0B 1XL0A 2ZITA 3RASA 2RCYA 4MQ5A 3ZDZB 1XTQA 4HAYA 3EH2A 2XOEA 1ZYUA 2BFWA 3A6HA 1EBFA 2VRNA 3QSGA 4K2HA 5CYOA 3TOZA 4UM9B 2G9VA 4X20B 2WU0A 3TLXA 5K5EA 4HXEB 2I1LA 3L9WA 4ROSA 2XX3A 1PK8A 1F2TB 2W0SA 2XUJA 4OHVA 3BFKA 3N87A 4L95C 2G6BA 3RVBA 3ZGLA 4FBLA 4BNHA 2NT4A 3UW3A 2YV3A 3HWSA 4TM7A 1G8MA 2IIVA 2MINB 3CBGA 3Q6NA 4H7JA 5DYYA 1QVVA 2C2ZA 1QV6A 1HX7A 4L9RA 4MRPA 2I7TA 3OTQA 4R8LA 4JAVC 1WBDA 4A10A 2CSUA 3BTOA 1C3EA 3LYAA 4JOBA 5BUQA 1UMKA 4LJKA 1ISRA 1SUFA 1A69A 3KO8A 3M2PA 4E5PA 1K7XB 3LOPA 4L6AA 5DB4A 2NUTA 3UM9A 3E2MA 3FNQA 1PF7E 3GZ4A 3ZY4A 3CFYA 4BQIA 3B1YA 3QOWA 1QVRA 1L4LA 4AXXA 1NW9B 2VQEB 2ISCA 1MW8X 3B3JA 1IUKA 4OHOA 4QFMA 4WY2A 1YQEA 2H65A 3LLVA 4PS1A 2O52A 4YJFB 3ZI0A 2IXFA 3A4IA 5JFOA 2GSDA 1EFPA 3PFNA 2X7HA 4O02B 1O77A 3C24A 3EHEA 4HO1X 3WYGA 5K3AA 1W5AA 4CGZA 2ATXA 3DE4X 2VOJA 2O59A 2DH5A 3O2SB 4GSLA 1GP2A 1QYDA 4RA6B 1RRKA 3DLPX 4JMPA 1XCBA 1SXPA 4BMYA 3E15A 4ER7A 1EEHA 1XE3A 3S27A 2Q3MA 3D5TA 1GPLA 2J09A 4P86A 4V0OA 1UT8A 4BPBA 3V3TA 4BJ1A 3U44B 2ZSJA 4HJXA 3V48A 3D8NA 1D5CA 4KMSA 1YHNA 4RANA 4E46A 4O6VA 3OA2A 5FH9A 4TKZA 3QP9A 1BSVA 4COKA 1X1RA 3KVRA 2K6GA 5JARA 4B3SB 2GM9A 1QGED 2W2QA 3BXFA 2HLHA 3VTFA 4C4PA 4DQ0A 2PJRA 4R0VA 2WTBA 1Z6XA 3TXXA 4AK9A 4WNYA 1QOZA 5SYNA 4MA5A 4G6ZA 5FRDA 5GINE 1UM8A 4LF6B 1PLJA 1R37A 4TLLB 4B7AA 4UBIA 5EIFA 1P60A 4IDFA 1E6UA 1JKMA 1JU9A 3EGXA 3B78A 2WR8A 5FXMA 1LVUA 1VLMA 4MGHA 1T9KA 3INNA 2ZBEA 1SU8A 3JR3A 3OIFA 1GAWA 1QWOA 5F1PA 3N86A 1XZNA 2D0PB 3U9SA 3W4JA 4EJ6A 1USKA 4EPYA 1TU0A 4X1YB 1PJLA 1BTOA 5GM2A 4GOLD 2X0EA 3UAWA 3ZTWA 4PX9A 4KZPA 5J43A 4ANFA 1AB6A 4O5AA 4E08A 1JXMA 1BYUA 2QBYB 2FTKE 3IURA 3ZWYA 3WGIA 2FFAA 3RADC 3JRXA 3QLEA 1N2XA 1N6NA 2OHIA 3HVUA 2AHOA 4QDXA 5BV1A 2AN5A 2R6AA 5CIYA 1YFJA 4HGPA 1SNYA 4KAAA 4DLSA 1THZA 1J07A 1V3VA 2Y1GA 5D5PA 3UK1A 3TX2A 4IILA 4K9OA 1B8PA 4R51A 3IP1A 4LNHA 2O19A 4ZCQA 3USES 3BE5A 3HP1A 1R0SA 1CYDA 1Y8RA 3IO5A 3KJIA 4R40A 4WASA 3ZXXA 4D3YA 7REQB 1KYTA 2PLNA 4HTFB 1LLDA 1CE8A 1R0RE 1QK4A 1XEXB 4Y98A 3W0LB 4IP0A 3NBYC 3FUWA 1AKQA 2QYSA 2RC5A 2XMZA 3AVOA 2PT7A 1Q1AA 3G6WA 1WF6A 1M6NA 2O2XA 3IYLW 4R1PA 1DQSA 4Y1EA 4FINA 4HD8A 3KXPA 3CZQA 3O7MA 4LSMA 5LZ4A 4WY8A 5B55A 5JFTA 2NTVA 4FDTA 4PVCA 1FDVA 1KZ7B 3HKDA 3EXG2 1AQIA 3L2OB 3NV7A 3OU2A 4P0PB 3ZK7A 5JPDA 3CUVA 4RTQA 1H42A 1SOVA 1U7HA 2FX2A 2OWEA 2GK6A 2P78A 2R1TB 3U4IA 2JFGA 3ES9A 5BOVA 1VHWA 2I91A 2C54A 3SFZA 5KU7A 2POQX 3PRJA 4B47A 5BMVA 1I1NA 4GGOA 2REXB 1JL3A 4RMGA 4QPDA 5AJYA 5F33A 3RM3A 2J5XA 4IKOA 4KQMA 5TQ0A 1Q1ZA 2P5YA 2Q99A 3PJGA 3WNBA 1PQYA 2IBSA 4MA4A 4PTLA 2GRAA 3VU1A 2JC3A 4OU4A 2O7QA 4EH1A 3SS9X 3H9EO 4X7BA 2IZ6A 5DN6D 3W5AA 2CLKB 2GCPA 2JCBA 4M7RA 5CT4A 3UXYA 4YY3B 1EAYA 3L7DA 1O97C 4YRIA 5EJ4A 5FLKA 4BV8A 4NENA 1SCBA 3UAGA 3RVLA 1P1KA 2P0YA 3GFOA 2BFNA 4C89A 1PU2A 3MJDA 4BNYA 2VT6A 4QPZA 1JKJB 4UVDA 4E4TA 1E2BA 3NASA 2J59A 2FK7A 5DTIA 3FYUC 5KI6A 1DAKA 3ECAA 3NHLA 1UDXA 3MCVA 4MSUA 3ESYA 5FF9A 3L0YA 4AJHA 4TVKA 4BRSA 4PG5A 4BC1A 3U60B 4EJSC 5ESDA 3ZN2A 4MUYA 2RGUA 1NV9A 1Z5UA 3VR2A 1JBQA 1T3HA 3OFJA 4E14A 2Q5FA 3KE9A 1KJYA 3U7EB 5JRZA 4WV3A 1H2XA 4ARVA 4CIYA 1L4KA 1OROA 3CG0A 3OU7A 2QTVB 3IPCA 1I3MA 4DA7A 3G9XA 3E9QA 2HCBA 1I0LA 2DOKA 4TQGA 4CJXA 2OCGA 3D0QA 5CXSA 2XNSA 3LHIA 2WKSA 3KAKA 4L4RA 4LQCA 5REQA 3SZRA 4D0NA 1N2HA 3GLIA 2X0NA 2A9FA 3RU2A 1KNQA 1DWOA 3TRJA 2CLFB 2N9UA 5ESWA 5F7OA 4O4LB 1ML3A 1QGUA 1E2QA 2O05A 1NBME 2OO5A 4RD4A 4HN2A 1Y5RA 4Q3DA 4IKEA 4YUVA 3AGPA 5IP5A 1K2WA 5LYJB 4FQ7A 2OCXA 1V16B 3V34A 4RMJA 2FMXA 4BQEA 1MF7A 3OOEA 1L7VC 4J4BA 1EE1A