3EIXA

Crystal structure of selenomethionine labelled staphylococcus aureus lipoprotein, htsa
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
290
structure length
290
Chain Sequence
b'ASTISVKDENGTVKVPKDAKRIVVLEYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLIIADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKLINKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYLKGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRDVWARSRGLISSEEMAKELVELSKKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HtsA protein
publication title Characterization of staphyloferrin A biosynthetic and transport mutants in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transport protein
total genus 100
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3eixA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3eixA02
3BE6A 3AERB 2PS9A 2RG7A 3U7QA 3MINB 5KOJA 2PS0A 5AFSA 4WN9B 1M1NB 1M1YB 2XUZA 4TKUB 2O1EA 5M2QA 3MWGA 2Q8QA 1QH1B 4OVKA 3LI2A 5CR9A 4B8YA 5GGXA 3K1AA 1N4DA 4G07A 4LJSA 4TKVA 2OV1A 2Q8PA 3AEQA 4PAGA 3EIXA 5M34A 4MLZA 1G20A 5KHLB 4UDOA 5I4KA 5KOHB 4NNOA 3R5TA 3PDIA 1KAEA 3ZKAA 3AETB 4FI3F 2XH8A 3MFQA 1ESZA 2OV3A 3CX3A 3U7QB 1K2VN 5KOJB 4N01A 1QGUA 2ETVA 2WHYA 4UDNA 3HXPA 4FKMA 4INPA 4BBPA 2XV1A 4FNAA 1TOAA 1EFDN 4XPIA 2M6KA 3MD9A 4HMOA 2R7AA 1QH8A 3K1AB 4TKVB 3EIWA 3AEQB 4M7OA 2AFHA 1KAHA 2OGWA 1G21A 1G20B 4HN9A 3PDIB 2XDQA 4WNAA 4ND8A 4MX8A 4OXRA 4WZBA 1XVLA 5B58T 5HX7A 1QGUB 4WZAA 2M6LA 1M34A 2PRSA 3AEKA 4IRMA 3TNYA 1FP4A 4INOA 3ZK7A 4XPIB 1L5HA 2YNMD 3MWFA 3AESA 1K0FA 1QH8B 1K7SN 5JG7A 3HJTA 3ZTTA 1K75A 2YNMC 5BVHA 2AFHB 3AEUA 4MO9A 4MDYA 4PM4A 3ZK8A 2QI9F 1G21B 5JOQA 3PSAA 2WI8A 5FLYA 5CX1A 1N2CA 4HMQA 4WNAB 4ND8B 4FILA 4WZBB 5JPDA 4DBLE 2XQVA 2X4LA 4WZAB 1M34B 2AFIA 2PS3A 4LS3A 3AEKB 3UJPA 1MIOA 1KARA 5M29A 4WESA 1FP4B 5BVGA 4K3VA 2MINA 1L5HB 2R79A 1H1LA 4UTPA 3AESB 2PHZA 3AERA 3ZK9A 2XY4A 1PQ4A 3HH8A 3MINA 3LHSA 5JJ5A 5BVHB 1PSZA 3AEUB 4WN9A 1N2ZA 1M1NA 5HDQA 4CL2A 1M1YA 4TKUA 4GICA 5CX1B 1N2CB 3GI1A 1QH1A 4G09A 3BE5A 5GGYA 3NU1A 3R5SA 2XDQB 5M3BA 2AFIB 4OXQA 3G9QA 3TLKA 3TEFA 1MIOB 4HMPA 2OSVA 4WESB 4NNPA 1N4AA 5KOHA 4H59A 5BVGB 2MINB 3PSHA 3AETA 1H1LB 4H0FA 4UTOA
chains in the Genus database with same CATH superfamily
1J97A 2F9FA 4TVSA 3D4LA 4R1PA 4AQ7A 1KVQA 4Z7QB 7YASA 2W2QA 3Q8MA 3HACA 5JAPA 3N86A 2JANA 1E3MA 4ETNA 5EE3A 1EK5A 2JGRA 3G68A 3RVNA 2O05A 1CP3A 1QNFA 2QYTA 2Z58A 4RMHA 3RS8A 4NYMQ 4PFKA 4DQXA 1E8DA 1C9EA 3S4YA 1I32A 5BRAA 4KGXA 2R6FA 1GQOA 1Z73A 3CX4A 4UAVA 3TQCA 4HV4A 4TKVA 3ROEA 4B3GA 4GBMA 1C0IA 3CUUA 1LTHR 3TNLA 5BRNA 3HU2A 3KNZA 3AI2A 4FR5A 4NBSA 4F11A 1DC4A 1Y8AA 1C7FA 5JZOA 3V1UA 2XCLA 4UCFA 4EI2A 1OBHA 1G16A 1YZHA 3CZ4A 1R10A 2X7XA 4RA6A 4XJTA 1VECA 4UTRA 1JMVA 4B17A 1Q6YA 1MO3A 1SC4A 2XXJA 3H42B 4JKOA 1UT5A 4HQKA 3R4CA 1T2CA 5KNCA 2OCGA 2XZTA 4ZALA 3RRYA 3L0YA 4HDMA 3MOIA 3VI4B 5B6IA 2ZKLA 2OZVA 2YBDA 1SVLA 4QU9A 3UXYA 2IHZA 3I34X 3KB2A 4ENUA 4ZTUB 2VLBA 1TUBA 5DBGA 1W0KD 4B34A 4GEKA 2O2EA 4ZTZB 3COWA 2ZIWB 2CDAA 3G1TA 4IIVA 2NU9B 4M8LA 4LW8A 2O3SA 1GT91 4LY0A 1UJ6A 3G0OA 3LECA 3O2JA 4D0GA 3GUCA 1OWMA 1W5EA 1FLDA 3TD9A 4BFWA 4MQBA 4BFYA 1RLOA 2IEIA 3O90A 1AHNA 2JIQA 2VKTA 2X9LA 2ZVJA 2JIOA 5AW6A 1I1NA 5KTMA 3I04M 3K70C 4ZVLA 1A50B 4MWBA 1X7ZB 4Q9IA 4F6RA 3SPXA 4JKIA 3D9QX 2IF2A 2XTAA 3FMVA 2Z6AA 4CWAA 1IVYA 4O4HB 3H2IA 4OM8A 5FOTA 3RGGA 5HTOA 2ODQA 4G5RA 3DBRA 4UBNA 2R68A 2NVUB 2ZU6A 4C2AA 3M34A 1MDFA 1P19A 3CW9A 4OHYA 1T3ZA 1K8ZB 4RNCA 4K6HA 2Q7XA 2H4ZA 5BWOA 1DPFA 1S3GA 4KWCA 5D5QA 4GD3Q 5E0KB 4Y7DA 3I9V1 1LLUA 3RS4A 1IN6A 1FSSA 2Z4SA 3S44A 4EHDA 3L7LA 1GL7A 3CZPA 3GJ0A 3T7CA 1G5HA 1XU7A 2UYQA 2XCUA 4EYEA 5A0FA 3BVPA 3EIHA 3PQ5A 4JEHA 3SFVA 1U2RA 1D8AA 3SOPA 3ZBQA 5C32A 4PE5B 2AEJA 2VP2A 3L1HA 5LQCA 3P0HA 1SAYA 4MRRA 1LX6A 1X7DA 3HB5X 2NT4A 4W5WA 1YUNA 1MDBA 4V0NA 2H57A 4BLSA 1FW6A 4H17A 3VSBA 9MHTA 1SVNA 3EQZA 4M54A 1VIYA 4TXMA 3I5MA 5F3RA 5EQJB 2JZOA 3T9BA 3ZWOA 4DADA 1T3HA 1RAHA 2EGGA 4JMPA 1P0IA 5GWXA 3H1BA 3R77A 3NWPA 5IBRA 4DA8A 2Z4TA 2IIVA 5EP3A 4ER0A 4ZI7F 3CT6A 4MW0A 4N47A 4WCFC 1FNCA 1LJUA 1Z6XA 2IEYA 3IVCA 4NJEB 4HSEA 4LY9A 4G25A 4AY4A 5JNTA 2ON6A 3KALA 1PWEA 4YRCA 2B5WA 2D7CA 2F8LA 3LT1A 3MJVA 1NL3A 1PR1A 3WL8A 3HFRA 4DQVA 2RG7A 4QLBA 1DI0A 2PE5A 1E32A 2PS0A 4FYPA 3UG7A 4JSRA 4P5PA 1AH2A 2HRRA 3K3PA 2BJHA 4LSZA 1XZPA 2GZDA 1U8EA 3CZRA 4KRFA 4R5MA 1AK2A 1RZVA 4IUCS 1K6MA 2C1ZA 1S8OA 2V7WA 3RUIA 3L7NA 3GLUA 5HS4A 5D7NA 5IJ9A 4JLWA 5AT1A 3W9YA 3T5MA 3AUKA 1PG5A 2B1GA 1M6VA 3DNPA 3FI0A 3IQFA 3Q7RA 3SXUA 1SULA 4GL2A 1T15A 3OUUA 4L8FA 3ZWQA 4DMMA 4B3BA 1SCAA 5IC5A 1LEHA 2D2FA 2X1MA 3S2IA 4F8JA 4D9KA 5KVVA 4QGBA 4IDNA 1VBMA 4JL5A 4DCTA 2K4MA 3MFQA 4HBZA 2FWJA 3GPBA 1GGKA 1VZ2A 4F0JA 2KB0A 1M1ZA 1WCWA 1Z5NA 2GS9A 1EH5A 2Y27A 2ZJ8A 4BRWA 2Z3ZA 1W88A 1YHZA 3P9IA 4NECA 4PFJA 3HU3A 4HEJA 4PAQA 4G37A 1YJBA 5KBYA 4MRPA 3K1AB 1OZHA 3Q40A 4BO8A 1ESCA 1P7YA 2PZJA 2ZBEA 3NOVA 3TWOA 3PXUA 4ON9A 3KKOA 3TGPA 1B0UA 2P3SA 2WFAA 4Q19A 2D1QA 4DA6A 1WHSB 2EVWX 4J90A 2V58A 4KO1S 3FPKA 3OPYB 2IL1A 2SBTA 4NC9A 1Z5OA 2H4HA 1ZSYA 1DDOA 4AF6A 1BIFA 3EYWA 3ZLVA 3GHHA 3L8GA 3RRBA 2WM8A 3M6VA 5T41A 1CD5A 1TQ8A 2OCPA 2IE0A 4GRIA 1N2JA 3GDGA 4M0PA 2N46A 1LWNA 2QLLA 4F3NA 2OHVA 3ADDA 1FEZA 1Q1ZA 1UKYA 1HE5A 2BEVA 3CUWA 1AX9A 1J90A 2BGKA 2QZ9A 2GPJA 3C1OA 1OH6A 3VDXA 1DAFA 1YQUA 1YZYA 3KB8A 4ES6A 4FQ8A 2J0EA 1BXZA 4FFWA 3TZHA 5IM4A 1OF1A 4AJ1A 4RD3A 3V4FA 3FPJA 4B85A 1KS2A 2IPNA 2WF5A 4OMDA 4K9MA 4RIEA 1YJQA 2AH5A 4WCDA 4E5UA 2F3QA 3PNBA 1P44A 1FYEA 4PZAA 3RU2A 1ZOSA 5LXTA 1ZQ9A 4JUBA 2OTCA 4CKWB 2AR7A 3JQRA 4I66A 5CA1A 4IZ6A 4O33A 4P86A 1I3OA 3P19A 1SXJE 4FZJA 3K53A 4C6RA 3C24A 4QDOA 1FLVA 1HFWA 1PQPA 1ZJ4A 2QT9A 2EX1A 3AC0A 3HH8A 4PHHA 3A2MA 3TD2A 1BH2A 2BONA 4X44A 3L0ZA 1UBTS 2WTUA 3HEAA 4BJ1A 4LC9A 5CBKA 1BE8A 1MORA 3OEEA 3EVGA 3RWOA 2HQ1A 1D1SA 1LWOA 5G41A 3NRCA 4L7QA 1BGXT 2OV6A 1GV1A 5B1HA 3ZS8A 5MFPA 2QW8A 3DBOB 3IDSA 1RJGA 3PUKA 2VUHB 5KOHA 1MZPA 3W5SA 1T0UA 2ZSAA 4MW1A 3ICVA 4U0JA 3I8OA 3CZMA 1R16A 3BWXA 4UCQA 3CVWA 1QHXA 4EX6A 1ZGAA 1Z2EA 2YWFA 3DV0B 2D2IA 4QPCA 1IXZA 4R4JA 1PJ3A 5DJ5A 4C0QC 4ENVA 1G1AA 3BRQA 1XRQA 2JFPA 1YNOA 2Q4BA 2WTAA 1X1RA 1N0VC 4P4TA 4FHGA 3VZPA 4FYWA 3DLIA 5TY0A 1DRWA 1L3IA 1UEJA 3NDBB 2C99A 4B8YA 2J9FA 4W8GA 3WZMA 3OCJA 1Q83A 4RMJA 1OGIA 4XLTA 3KAJA 1JDZA 4ZVNA 3ZHUA 2JZNA 1E2KA 3FLEA 5L7WA 2RHCA 3K5IA 3IEIA 3OCXA 2B4YA 2H2FA 4R05A 3DTVD 3HXOA 5J4VA 4ASUA 4URXR 3FD8A 4K3UA 5JYEA 4IWXA 4G8DA 2QA5A 3ZEIA 1BD3A 2JGNA 4P7JA 1B8UA 5IJXA 2WJVA 2ZUVA 3Q8KA 1ZU5A 3SVZA 4HYTA 5K99A 4HDOB 3GRAA 2HDWA 3K0AB 3FZQA 4Y1GA 4B7XA 1ENOA 1GQ2A 3C2QA 1QNLA 3NBMA 4G9BA 3V8EA 4DZZA 1J1UA 4TMYA 3S1AA 5AKJA 4G5QA 4X61A 1IHXA 3DCIA 4CU2A 2Y1WA 2AN4A 4HWKA 3ZHTA 2DFNA 2ZTVA 1E1QD 4QAQA 3UN1A 3KTDA 5C31A 1W2HA 2AFIE 4KXMA 2XTNA 4DJTA 1X2EA 3RWBA 2PU5A 3ZC3A 3BWEA 4G5GA 1I9CA 2XZOA 3R9XB 2EL9A 2V8OA 2YICA 4J2OA 4B33A 4HT3B 1UINA 2SECE 4FOTA 3S5JA 4DNQA 4QICA 3EGVA 5CM9C 2PH3A 1PEYA 1V3UA 2CL6X 2X14A 3CIOA 3FCSB 3TLCA 3QX3A 1TO1E 3AOEA 5FA6A 1T4BA 1RXSA 1ZW6A 2WYVA 4FZVA 3AW8A 1U3GA 2CEKA 4KUEA 1B42A 1KEUA 4BQPA 3R7WB 2PBLA 4V24A 1E1LA 3H5WA 4YVFA 3ASVA 4A4DA 1MG5A 2FWIA 4PONA 1I9GA 4WERA 4E5VA 4CN8A 3F90A 1L8QA 3D3WB 3EE6A 3H4VA 4YRGA 4BMVA 1WCYA 1F8XA 2C4WA 3EEBA 4GI2A 3C3KA 3Q9LA 4KW7A 2VUUA 3D1JA 4OU5A 4BECA 2FFQA 3CPHA 4IL5A 1NY5A 2TYSB 3ETCA 2Q3FA 3MGAA 3H9JA 2YXLA 2OBNA 2OCLA 1RTKA 2VPXA 2X8WA 3M4JA 2WJHA 3OLCX 4U7TB 4G0QA 1RJ9A 3W77A 5SYNA 4QX6A 3OFSA 4PV7A 2AYXA 3WK6A 4UTPA 4JD5A 4TS9A 4ZYZA 4R6XA 3N8GA 3LXUX 1I7NA 2WKPA 3C3AA 5E3HA 4LCBA 3MWEA 4PCAA 2G5PA 3C8HA 4MMYB 2MR6A 1JVNA 1NXWA 1RRVA 1RXEA 1YBMA 1D4OA 2E6KA 3N6RA 3AKCA 1GGNA 4HNGA 5CEFA 3CX7A 1X92A 5HRAA 4NLLA 4IG9A 4CLRB 3FHCB 1PT7A 2FVYA 3KJXA 4RK7A 1GQQA 3CX6A 1G2OA 1HLDA 3SEFA 3D6MA 4PW0A 1AN9A 2YN0A 2HSJA 5FFNA 4FUTA 1V4BA 3ON5A 3GRFA 1ZNWA 1LDGA 3A1SA 2WWFA 5CFOA 1HQYE 3MQFA 1UDXA 2BKXA 3L0BA 2WAOA 2XXAB 4WDRA 5DM1A 3A04A 1W52X 5C1PA 4OIFA 1DZIA 2ATIA 3D6JA 4A16A 1E1CA 4BUZA 1AQJA 2BGRA 3ESDA 4PC2A 4FE3A 1CUUA 1CJVC 4GOJA 1NVKA 3EZNA 1VPLA 3IAAA 5B2EA 4MPPA 1ZN8A 1NAHA 3MGGA 3V8RA 4I9FA 2R00C 1HY3A 1F8UA 2YZ2A 3ZGXA 1NZDA 1AK1A 1D5CA 5TIIA 3FWKA 4RIFA 1GNSA 3H1TA 5I01A 4CM7A 3CTPA 2QR2A 3ZNQA 4G07A 3GLIA 5IJAA 2ZZMA 1EVIA 4DG5A 1R6TA 1Y7TA 1ZM7A 1OD6A 2V7EA 5FYQA 1E77A 5CB4F 1A2QA 3DAGA 4DM3A 4D41A 4H6WA 2IYLD 3MAAC 4Y0VA 4RTKA 3JQ9C 1OXUA 1YZGA 3DJFA 1GEGA 3B7WA 3D59A 3I8SA 4KLCA 4LYGA 4YJ3A 1TCUA 5EHZA 3TAXA 3X1WA 2HW8A 5DX1A 2M1XA 2P1RA 4DR1B 3NDIA 1S9DA 3O8BA 4EATA 1SCIA 4MCJA 1QF7A 2Z5LA 1RKXA 2Z09A 4G84A 4KQKA 3GLQA 4P8RA 1RMTA 3QBJA 1GYRA 1PS0A 1IN4A 1RWPA 1SVOA 2CL7X 4F7WA 1OBFO 3S1LA 5C35A 2VDQB 4ZOBA 1BJRE 1LPBB 4Y7CA 4BV9A 1P6UA 5TQVA 3V4LA 1OVGA 3BK1A 3T06B 3ZZMA 1PT8A 3TKYA 3WADA 3GZJA 4JLKA 2PT7A 5HQTA 3ZCUA 4LC0A 1Z2CA 4L27A 2XUIA 4WXEA 1ATZA 4BCDA 5HGXA 4YYEA 3AV0B 2CK3A 3KB1A 5FULA 4JJIA 4OQYA 4YIHA 2BGIA 4ZZ2A 4D4JA 1R0KA 3D5TA 4DIFA 1FZTA 4IXMA 4C0KA 1QUEA 1OAOC 1U1CA 3RWMB 1OCEA 1PDVA 3MXOA 5CCBA 4RCYA 5IJ0A 4TVBA 4V2IA 1CY0A 3FVQA 4JEIA 4XCXA 2YFQA 1NI5A 1UJCA 4XPIB 4NZYA 2HIGA 1JTFA 5CVVA 2FZEA 4D99A 2FJUA 3UJDA 3NDRA 2D7JA 2PD3A 1X7WB 3HJTA 1ABEA 1H2YA 2XCIA 3IKJA 4JDUA 5HFAA 1PWXA 5FH9A 5K8JB 2F3RA 3U61B 2P6NA 1J20A 3AEUA 1KDYA 4TV9F 2Q3BA 3Q88A 2QU7A 3HADA 1P18A 4OY3A 4YFYA 2FHSA 2AB0A 2JCGA 1LVUA 2VDWA 3WJ2A 1YA6A 4KXQA 5CYPA 3RABA 4ARZA 3AVPA 1XRPA 1ZKDA 4BAGA 5K3EA 3PPXA 2QM8A 3GJQA 3MWYW 5TQ2B 1JU9A 1ODFA 2VCYA 3B82A 5CH8A 4E6EA 2BTEA 1RTTA 1H9AA 2NOAA 3GGOA 1CQJA 3IUQA 1T8TA 1IN7A 2MDTA 4GZ3A 4PPQA 1X1CA 1G3RA 4Q4AB 4ZOLA 4OLHA 3SDSA 1I24A 2NZJA 2YZGA 1WM1A 1TK9A 4JR0A 1IZZA 1YL7A 2WF6A 1CRQA 1M10A 2BEKA 1X8KA 3AIIA 4KRXA 4O2RA 3TCXB 4R0MA 2R1VB 4MYCA 5DGTA 3E9YA 2M6RA 2VP3A 5JECA 3KSAC 4CLEA 3BH0A 3GI1A 2R6AA 4YCMA 2AFRA 1ULSA 2NZWA 4LY3A 2ZSBA 1VKJA 2WJPA 4GM1A 2SKDA 4IICA 3NTUA 3CNHA 3QE9Y 1VSVA 3T3EA 3MJCA 5JZVA 3RUAA 3PC7A 5AW9A 4G0ZA 1N3IA 4X1OA 2Y1CA 3O6VA 2L17A 5JMPA 2VSFA 5DWVA 4EHKA 5KX5A 2O1XA 3I4FA 3FVTA 4TV8A 3RAFC 3R24A 3U7QA 4FYHA 3KR2A 3ORRA 3QPAA 4CQLA 2GCGA 4LPSA 4PO9A 1N2OA 1EK2A 3BGIA 3RIXA 3TNFA 3WMFA 4RKYA 5JNWA 1H2RS 4KBFA 4TUYA 1NW9B 1NYRA 2B0JA 2JFFA 3ZS9A 5IT5A 2C7BA 2J3EA 2WC1A 1W6UA 2PZAA 4JAVC 4QYMA 1SUAA 2ZDHA 1HXHA 2P2NA 4HWPA 2PSJA 3ZHOA 4D6PA 4MDHA 4D4MA 2FV8A 3LUCA 4B0OA 2DPHA 3CWQA 4R2HA 4RXMA 5HMLA 4COOA 2Q4TA 2ZFUA 3FOCA 1M54A 3G1WA 5BQFA 5EMLA 5TX7A 1WUKS 4GI7A 4D8WA 2HNBA 3D2AA 2VYQA 3RV3A 1U4OA 3HY6A 3SYTA 1ZM2A 3FRJA 5DK6A 3ZX5A 1JEYA 5FEMA 5I5GA 3TN7A 3ABOB 3WB9A 1RRMA 3R6GA 3AEYA 1KSHA 1SXGA 3WKBA 3NB0A 2ZWIA 4RVHA 3D8SA 3ZCXA 3HFGA 2ECOA 2ORVA 1ZL2A 4J0CA 2G76A 4MGEA 5AVSA 3L7JA 1QE3A 2BMVA 5HIJA 3L07A 5JPCA 5THQA 3ASUA 1BX3A 1SXHA 1PFUA 4HDCA 1PU2A 1ZRNA 1G21A 1W0JD 2F00A 2R7LA 3E9EA 3GCXA 3A27A 4TKZA 2WWHA 3TIIA 3DR5A 3C7DB 3FOWA 3SQLA 3VH4A 4B09A 1UDRA 2TRSB 3M6AA 3OMLA 5I8PA 3LXMA 1U6JA 4I19A 3PL5A 5TSDA 1Q0ZA 4DCMA 4ZU3A 1T5HX 4KPUA 2XMPA 3GGSA 4MVJA 5H4HA 3A0UA 5C3MA 4BTEA 3BM5A 4GLJA 4FW8A 4TMVA 2JLXA 4GBED 4OX9B 3NJ8A 3PV0A 1FP4A 4LHXA 3GRYA 2H7CA 2Z8ZA 3Q11A 4I99A 4IIGA 5C37A 5J4LA 5AXCA 4BNDB 1BD4A 3H17A 4CM1A 5LFAA 4EHJA 3JQ6A 4ZFNA 2ZSIA 2OORC 4EFDA 2OY0A 3LX8A 3BDAA 5THKA 3MELA 3CUKA 1IBRA 1XTTA 2CFTA 2DBZA 2YC2C 2CLIB 5FTMA 4GPTA 4Z1MD 2WHPA 4J7CA 1E7MA 4UULA 1E1RD 3KAKA 4O29A 3QNWA 5THXA 1CFZA 1EK6A 1O89A 2IEAA 2KQUA 4WLNA 1RZRD 2AFIA 2XMZA 3C8UA 5IZCA 1PFWA 1U1DA 3RTDA 1II8A 2PKQO 3MLAA 4YB8A 3T54A 4DUZB 2HHHB 5KYKA 2B7LA 3EIQA 5FL7D 3IQIX 4QPNA 2RFLA 4CMAA 2IXEA 5AJWA 4AFNA 1H3FA 4DXAA 4D3SA 1T5TA 2W8BA 2ATXA 1D0IA 1B0PA 4OGGA 4A8JA 5EUQB 1NLMA 1USIA 5DASA 4MUEA 3SSAA 5C8YB 3A4VA 1N78A 1P9WA 5GIOE 1I3MA 4GG1A 1WMBA 2FN7A 2PWAA 3QLTA 1JXOA 1O77A 2CBXA 3GGPA 3HCOA 4JX9A 3ZDXB 4D4LA 1VE7A 4L16A 4YLYA 5C8DA 1WKCA 1U0TA 3HL4A 2J9XB 3OQHA 4RL4A 1EXWA 2VO1A 4O2AF 3TE7A 4S04A 3PDHA 3H1AA 4ALNA 2D62A 3OE7A 2BBWA 4M37A 1FFAA 5FPKA 1QIJA 1VIVA 1NN5A 3P9ZA 1BVYF 5M7EA 4MW9A 1SCBA 3CWZA 1MLDA 1TZKA 4YRFA 4D7AA 3U56A 5KOYA 3C3DA 4TWJA 2F48A 2VEOA 3DXFA 4I50F 1N9ZA 4XQ9A 3SWWA 2GYWA 2ZI4A 4U02A 3KTAA 5DCLA 3DDZX 4D2IA 1RRCA 3DEYX 1Q44A 5H9WA 5KAPA 3BWMA 1KKUA 4INZA 2XGJA 2DTXA 1QP0A 1TQHA 3MMSA 4MV1A 3AXSA 4P9NA 1MRNA 5DVZA 5C46F 3F7NA 1E2MA 2C88A 2VRNA 3STHA 3A06A 3WSTA 4IV8A 2H18A 5HG0A 1HL3A 3EW7A 1PX2A 2B78A 3EX7C 3LUHA 4BO4A 4GPD1 3VDRA 4GQAA 1V1RA 5B12A 3PNSA 2WKSA 4LGMA 4LYHA 1NMXA 4RZIA 5DMXA 3TQIA 2HIHA 3A8TA 1E94E 1Y8QA 2DQ4A 3JYLA 4YACA 2IYOA 2A33A 2IPMA 2EQAA 1ZONA 5G1PA 1BH6A 3ZZUA 3M3PA 1DLIA 2J09A 5IFLA 1G2PA 4DA7A 2GD2A 4X92A 1DFHA 1GN8A 2RONA 3MUNA 4N5IX 1BMTA 3SAJA 1XP8A 1KO1A 3H0KA 4ARCA 4JH0A 2LDBA 3KOWA 2LCIA 2Q2WA 3OWXA 2JHAA 1P1RA 1T5OA 3DUWA 3DVRX 3I9LA 5B5SA 1DXHA 3VU9A 2X4IA 1TFRA 4WLOA 1N5RA 1N1MA 1UBOS 4YP5A 2W6JA 1RWKA 3AB3A 4YRIA 1X1AA 3QXXA 2AX3A 2RGBA 3KVYA 2HPHA 4F1JA 1WCIA 2WOJA 3BKXA 3CNEA 4UDXX 2CMGA 3RPEA 3T3IA 1F5NA 4AP6A 3DDUA 2QLFA 3UC9A 2LE0A 3U1TA 3DE6X 2I1QA 5CPFA 3ME5A 3EB9A 1TJ5A 4Z9XA 2XQKA 3ROTA 2EX0A 4GLLA 4QSMA 4FP9A 5KNDD 1OBCA 5J47A 3ND9A 4GXNA 1OB2A 3BTOA 4OMUA 1WCV1 3TZ6A 1GDTA 1O6CA 3QJYA 3UB4A 3L0DA 3ZWYA 1V6AA 4YV1A 4NZ9A 3L6OO 3PSAA 2HDOA 2EIHA 4DABA 1WZIA 1EFCA 3QWIA 5FPPA 3SU8A 4EGJA 3IPAA 2XBUA 3G0CA 1JBEA 4IDOA 2ZR7A 1Z45A 5HKBA 2H4XA 2VTBA 4TXJA 3MJDA 4DOMA 5DI3B 3HBMA 4IQ8A 3Q12A 4LYYA 4I5GA 4XLZA 1VMIA 2IUYA 1DCKA 4NTZA 2UUCB 1G3IA 2R9VA 3QEMA 3ZNOA 2AFHE 3RARA 3VU1A 4L0CA 4F3KA 1SZJG 5BVHB 1U0LA 2HK6A 1QAOA 3KR1A 4AMVA 1KI2A 3S99A 3NG1A 4L02A 1Q0QA 5EWMA 3SI7A 4HGZA 1A95A 3GEMA 1QYIA 4OLJA 5FBZA 4GECA 3ZTYA 4QYIA 3FI9A 1VBKA 1GQSA 2LKDA 3L6DA 1NMEA 4I4TA 2I2AA 3OEWA 3IP5A 3P0JA 2HA4A 3GEPA 2GZ3A 3BAFA 4Z0HO 3AVXA 1ZMTA 3MBKA 1PTKA 3PJGA 1C3OA 4XUDA 3E0XA 1OASA 2P5UA 4F46A 2EDAA 2VP9A 4NBNA 2Z2IA 3TKLA 1N32B 2GCOB 2RH9B 1SH7A 4U2CA 1ZBQA 3ZV4A 1NX6A 5H4GA 4AKTA 5FPHA 4PBSA 4A5SA 4Q7QA 4F93B 3UMGA 4KVAA 1XDDA 2FN3A 4L28A 3SZLA 2QE7D 5EJEA 5TMPA 1QOQB 4KO2S 2C9YA 2PT9A 3EVTA 4INAA 4CCWA 3PCTA 4L51A 4UVEA 3D81A 3IBCA 3NVMB 4K88A 2Q8QA 1M76A 4KRGA 3SS8A 4B2IA 5LIPA 1NVTA 1R00A 1B2LA 4ZIRA 1I36A 2A35A 1PNVA 1LDMA 2B1QA 2GPBA 2N75A 3B1WA 3QE0A 4MV5A 4XI9A 1LNQA 2YASA 3Q3EA 1SXQA 3PPIA 4L9SA 1CZHA 3AZQA 3A11A 4HK4A 2M1ZA 5LOVA 4QQ8A 1JEQB 4QOHA 4G9GA 3ZKAA 3IT0A 2IBTA 1C80A 3KYJB 3FCUB 1EE1A 1SPBS 1VE6A 4KL8S 1J33A 2NU8A 1NLYA 3O4JA 1ZUHA 2FPGA 2A4KA 1J8VA 4HX9A 1BU5A 1XIVA 3V4RA 1MABB 1F5SA 2CLHB 1E9CA 4J6FA 1S2NA 1DCTA 3GRZA 1S2MA 2OYCA 2BZGA 1FK8A 4M60A 4Y1RB 1ADGA 4DJFC 2FX5A 3R3WA 1CJUC 1V95A 1LX7A 3OEYA 4PLTA 1SG6A 4ZO9A 3IL2A 3H13A 2BFDA 3PKZA 1Y1SA 2G04A 3I28A 4QVIA 1D2HA 4YI3A 3C5WP 5J5VA 4KK4A 4U6QA 2GA9A 2RHGB 5BWMA 1Y6RA 1L8OA 2GYVA 2QG6A 3KPYA 4TQ9A 2W37A 3E7XA 4LSMA 4XDZA 1RYYA 2JLBA 3KK0A 4CR8A 3KPWA 3IP3A 5KKCA 4D3FA 1X42A 2I4RA 4DQ0A 3LVBA 5KWSA 4LRXA 5FUXA 2FEKA 4DLKA 1AS0A 1ZD1A 3PFNA 5I9MA 4DB2A 1QDEA 3BULA 3P1JA 3GHYA 4TL8A 2JGMA 1DFIA 2ARKA 2OM2A 1Z12A 2QTVB 2WWGA 3GFRA 5LQAA 3E5MA 4JT2A 3W3AD 3X3HA 2P4HX 2X15A 3PEEA 3U26A 3UTDA 2F9LA 1I3LA 1KMHA 1SQ0A 1JU3A 1VFPA 2AMLA 1KVSA 1B0AA 1GHTA 1JT9A 2O2JA 4EG0A 4EG7A 3KT3A 3VR6H 1XKLA 2FUNB 4FMPA 1DAGA 3COYA 4G0YA 4HQFA 1YZQA 2OV4A 1LBQA 4IUYA 2ZXUA 2X9GA 1SKBA 5E6SB 1V25A 1XPUA 3B70A 3P26A 3SICE 1P3JA 4BP9A 1OKKD 1HBJA 3A1VA 5A04A 3KFXA 4FLFA 4LYDA 1JQAA 2ZYTX 1JT2A 1RDFA 2DUWA 3OKFA 1Z5UA 2OE2A 1WS6A 3JARA 3OCYA 4W1QA 2UV8A 1ZZEA 2CB0A 2V7UA 3FZNA 4M9RA 4U6NA 5F77A 3TSWA 5CYGA 5MGBA 3QHAA 4JT8A 3VR5D 2D8MA 4HZUA 1N8KA 3OM1A 4DDKA 3L82B 1IM8A 4CV3A 1Z75A 2Q5CA 2VH5R 1TKBA 3AP3A 2ODNA 1QCYA 1ISJA 1WY7A 5G0UA 1C9JA 2QI9C 1OWPA 1P9LA 1IM2A 1QIFA 4IDQA 1Q77A 4OJMX 5E7QA 1GZ7A 1Q1AA 3RIEA 1U8AA 2DPYA 5J2TB 1A5ZA 1JB1A 3ZWWA 4BN5A 4DMCA 2AZMA 5AVUA 2ZYDA 3WTBA 1KO5A 1GSOA 3G6WA 1L5FA 5TPZA 3AETA 1IXSB 1Q17A 4E22A 3WIEA 1CQXA 4F9GA 5IF3A 5DPMA 1N5MA 1PNRA 1RIIA 3I2FA 4L5CA 4LWZA 4MEBA 5K1ZA 3CLUC 2J3MA 4ZQIA 5JVDB 2QORA 1ZOOA 2OVBA 3L79A 3AHJA 3FGZA 5EIBC 4NS1A 1FDVA 1KEEA 4X94A 4RVFA 3GIDA 3QLUA 4YRBA 1CIVA 1TQ2A 4BDTA 4IQ4A 4WAUA 3MWJA 3F97A 3ZXUB 4BMOB 1G4AE 3WQRA 4LOIA 2N3ZA 1TO6A 4HAIA 3K9HA 3NGLA 1ISHA 1TUEA 3OC0A 5IMSA 1GCUA 4QJ4A 3NBXX 1R4NB 1TYBE 1N2IA 1QE0A 3BRSA 3GUHA 4IIDA 3TW0A 2EBUA 4RACA 3SYMA 3V9AA 3L7DA 4HTFB 5T5QA 1GYPA 3D6VA 4FMBB 3HHPA 4WBSA 3ED1A 5IXSA 3JAWA 2Q99A 3GP5A 5A1JA 3T9CA 4NFHA 4MZDA 4A2CA 4HMOA 5I4CA 1MOSA 2CFOA 2O2GA 1B00A 4EFNA 5LVAA 5CDGA 5EZ6B 2ZU0C 4FCTA 3C3WA 4XOUA 5ANRB 1XJWA 4F2WA 4XEHA 1IPHA 2W9XA 2YMQA 3ITEA 1NSTA 2QRGA 3HJCA 4B79A 2FW8A 2OUIA 1M5UA 2WWTA 2E49A 2JL1A 2ZBGA 4PBRA 5F1OA 1IONA 2DWCA 3KOXA 3T95A 1PBTA 2UXBB 1XXHB 2RHWA 4M21A 1QMGA 4D9GA 4QUGA 4TWZA 1ZCFA 4LSWA 2O8VA 2OHFA 1KPGA 4DWJA 3U3DA 2WW8A 1D4AA 5HK9A 4IGAA 3A3NA 3LRXA 3DC2A 3FY4A 2C2MA 3QF4B 3VPBA 1G20E 1LSSA 1R6UA 4FLMA 1FU7A 4NBTA 4P3PA 2FRDC 1NV9A 2GLUA 3DZBA 3LQYA 2QI9F 4XGIA 3SQWA 3A0RB 5C4MA 5JCJD 2Q9UA 5TQ0A 2WUWE 4GDMA 2DSNA 4EUFA 4JASB 4XM2A 4ZWNA 2ZTUA 4XFJA 1ADYA 2IOFA 2WHXA 3PXCX 3RBXA 2PX5A 3DZJA 4XLLA 5CB0A 3IURA 4R2LA 2RI1A 3LG2A 4KCGA 5H59A 3RIGA 5HRCA 3FTPA 3KU1A 5JXIA 2J6CA 4G0OA 3SSNA 4P53A 1UOOA 4AAYA 2O3RA 3D2CA 3QTBA 3L8EA 1DRJA 3HL0A 3PFKA 4N5MA 4XWYA 3MPOA 1XNQB 4UNIA 5FI1B 1P7VA 3LHSA 3VSEA 1ZG3A 4EW6A 3DL2A 3DO6A 2R0QC 4CMEC 2PX8A 3KT6A 3EQ2A 2ABWA 4B5LA 4F3CA 2AN5A 3O8NA 2I0FA 2XKBA 2X5XA 3VJKA 2B2NA 4G8CA 4YWJA 1Q1BA 1BZYA 4QPDA 4ZU1X 4F12A 3PJEA 1RAGA 2ZITA 4JQYA 1YD7A 2HO5A 1KTIA 1B41A 1BFKA 2P2SA 2QRPA 4HXGA 4LQLA 4U1RA 3QFHA 3V1LA 1JFFA 4RLFA 4JI8B 1AQUA 2QMUA 4HXEB 3PSHA 1KWGA 1CYEA 2PWPA 3GYBA 4YUZA 1DKNA 3UMVA 2JF0A 5ALPA 3H9QA 3HYRA 4H31A 4CM8B 4JP3A 2VT3A 3ZCRA 2QE6A 3CPEA 3STVA 1EIZA 2IU3A 2PZ8A 3F1LA 5MN6A 4OATA 1ONBA 3LPNA 1KVTA 2FG5A 2W6IA 1SQ5A 1P1JA 4HF7A 4LZLA 4R51A 4CI0B 3TOSA 3VH3A 4REOA 1CUZA 3R7AA 1FLAA 4H35A 5HKAA 4LF8B 3IFSA 2XLCA 1XKXA 2WUEA 1N3YA 1XDUA 2XWQA 3N2GA 4PRKA 4Q15A 1KJZA 4XX1A 3SS7X 3X0DA 1TQDA 1J5EB 2Z4RA 2M6SA 1C9YA 4D9NA 2QTFA 4BFCA 1T8WA 3CUTA 4QNMA 1TD1A 3DQPA 1Z35A 5KWVA 1NOKA 5ILQA 1MD9A 3UA3A 4FKMA 5AKKA 3H11B 3PQDA 3R09A 1XMSA 4BE4A 1NBME 1T25A 3CNQS 4JJEA 4BEWA 3I2IA 3O0DA 3ZGLA 3PC6A 2PX4A 4DV7B 3KOYA 1H8EA 3HXTA 3WIUA 4TTIA 1LS1A 1OT5A 1DWUA 3BG5A 3G2QA 5EWLB 2Z43A 4ZCQA 4V2UA 5GZ6A 5LB4A 3WRYA 4C05A 5JY6A 4OLBA 1C4WA 3QUSA 2MYNA 3WWPA 1XMQB 2MYPA 1MJNA 2ZI6A 1GADO 2VXBA 3OX1A 2QOEA 4HYEA 4BJ5A 1KR5A 1J2RA 2W6CX 1YXMA 4KQ1A 3F4KA 3NT4A 1NQWA 2PYDA 1HDXA 4Q39A 3RVQA 2VOEA 3IGFA 2DY0A 4BX0A 2ATEA 2VQ6A 2Z2ZA 3FFAA 3L7MA 1MOZA 3PHBE 2YVLA 2ZUDA 2FPPB 4CEIA 2ZJOA 4JL8A 2CDNA 3IUEA 3QV2A 1FFHA 1MC5A 1C8VB 2PXAA 3KJZA 4WBNF 3PJRA 4DWWA 3KR0A 2YNMD 3OSUA 4E3ZA 2JFGA 2PTHA 3INGA 1X7HA 2IXDA 1PWYE 2UDPA 4OJTA 1G5IA 1IULA 1Z0ZA 4B3CA 4E03A 4RKQA 4DL9A 4M0EA 1X1TA 2H3EA 5EHXA 2RDMA 1JHQA 4UBIA 1U7ZA 1VCIA 2IYUA 3EEFA 3LCUA 4PLPA 4WZBB 2GB4A 4LZPA 2XE6A 4ZICA 3HA7A 4RE5A 3IMEA 3JAMA 5DN6A 3ZZ0A 4JLUA 5HF6A 2FE1A 3L93A 4DJAA 5KJ1A 1F9EA 1FU8A 4V1CI 1RAAA 2JI8A 3ND8A 2O0LA 4PXYA 4C21A 5AYVA 3PR1A 3D3QA 2IFTA 2D00A 3NASA 5EMMA 4DMLA 4JJGA 2HFJA 1T9ZA 2DX7A 2PHZA 3JAKB 1VHLA 1MV8A 1Z0KA 1WXEA 3AERA 3LLMA 4QDTA 2EWMA 4UC0A 1CRLA 3GLHE 4XVRA 5DLDA 3VQTA 1UMDB 3RC9A 4RANA 2WIBA 3SHVA 1HA3A 2Q21A 1ZRMA 3BSSA 2RHDA 4ISCA 5I5EA 4MV6A 3SQDA 2CXXA 1KXZA 4R9SA 4IH4A 3Q72A 3CB2A 4OQQA 3AG5A 1F2TA 1P80A 1PW7A 3T99A 3BIJA 3R6LA 4GBGA 2V6IA 5B3LA 4PSCA 4TPKA 5L6MB 3I72A 2PBRA 4NZPA 4D57A 1ANKA 3MMXA 5JAMA 1W7AA 1BKSB 1OA0A 1EX7A 1PYGA 2VZ8A 4TRRA 4LI0A 4UTOA 4O2LA 4NABA 1OLXB 1M66A 2JEYA 3SR4A 1A8SA 1NG9A 4LZZA 4L22A 3V00A 4DB4A 5BV7A 3AUFA 4EG5A 3TRIA 4F1WA 3C7AA 3NT2A 1SHJA 3W5CA 2J5KA 2YX1A 2H1OA 2EBHX 2HYDA 3ONWA 3I58A 1NBIA 1P9OA 3NP9A 2VHXA 1D6SA 3C6MA 2EFGA 4IJQA 4H6VA 3UWSA 2C2WA 1KYTA 2X0EA 1IPEA 1PDOA 1WB5A 2ZRMA 3E6AA 5GV8A 4B6GA 1YE5A 2WVGA 3NDPA 1XZLA 3D3EA 4LE1A 4JMLA 3KT8A 2BUAA 1UFRA 1P81A 1E6KA 1P8AA 1T5IA 3WK7A 5IJZA 2F2TA 2CWDA 2DVMA 3C5VA 3PJFA 5JFOA 5LLTA 1JYEA 5KKNB 1E61A 4LUCA 3UJHA 3WGMA 3P4UA 4X6UA 2AI1A 4TWBA 1P5HA 2BHSA 2QP9X 3GAMA 4JI3B 1T0BA 1TAHA 2XCQA 3DEZA 4AB1A 2JFWA 1R9NA 4REQB 3D4BA 4RPCA 3B1VA 4GHWA 4J76A 1K66A 1PJQA 1L4HA 1JIQA 2NV0A 2UYOA 3KHSA 3NEAA 4FEYA 3OQVA 4LEIA 2CUZA 1JE0A 2J9ZB 4PGFA 1OXVA 2A5YB 4UPDA 5T57A 3V1KA 3QHPA 4BNKA 3K0FA 4JP1A 1UT6A 4M0KA 3NCHA 1NGSA 3FAKA 1NJSA 2ZXFA 5H80A 2GDZA 1TMOA 4QBFA 3DVAA 3FPBA 4RVUA 3R8XA 1QR6A 1H6CA 1VE3A 3DLTA 3DM5A 4WW0A 3TGWA 3UTCA 4DUGA 1CUFA 4QU5A 4AZ0A 4JLBA 2AI3A 5DCUA 1QVVA 2P9HA 2QAGC 3GQBB 3AIKA 3TCKA 4Y1EA 5ARDA 2H7VA 1WB4A 3AEKA 5BORA 3SMVA 1YFJA 1O58A 3UMRA 3UWMA 4XYLA 1XN1A 5HUJA 1SK8A 3K70D 4NEHB 4AWBA 1YC2A 3CCBA 4WLUA 1B0ZA 1M2VA 3A58B 3DAOA 4PZUA 1HV8A 4WNCA 1LY1A 1YB7A 3WS7A 1KEKA 1A9XB 3K96A 4K2HA 2XRYA 3FYDA 1KERA 2V54A 3GFQA 3NZEA 5SICE 3HB1A 4WKBA 4AJ4A 1GLGA 1N75A 1Z15A 3BL8A 3I6QA 4PYRA 1BFDA 4LYFA 4MR7A 3VSDA 3OKAA 2D59A 1WP4A 4UTXA 4NJMA 4RDCA 4RHEA 5DCWA 2NPIA 3ORYA 1CVLA 4E32A 1SUWA 3OFND 3B8HA 3JX9A 2PA3A 3AR5A 5TPWB 1GP2A 3TX6A 4URZR 4UE2A 2FG6C 4A8HA 1SKAA 1QBKC 1NKVA 1P1FA 4BMSA 5CLGA 4D9BA 1D1QA 3N05A 4WK6A 3LO5A 5FTKA 1U7OA 5A9TA 2HBRA 1EWQA 3RK4A 5KS2A 4BVFA 3G2KA 3ACCA 3BFPA 4Q9JA 2WT8A 4OFXA 4ZT6A 5A4FS 4QRHA 1D7AA 1P7PA 2DHRA 3GJZA 1SXIA 3HC7A 3B3JA 1U1FA 1PUIA 3L8MA 4D98A 3IXLA 1NE2A 3ENKA 3KQPA 2QTTA 5IMBA 5SY6A 3SZGA 1DC7A 3AEZA 3T3DA 3U80A 4EP1A 5JMOA 1Z47A 4J4BA 5ECDA 3LYHA 4KC0A 2BMJA 5IUKC 3PFBA 2QVBA 3C43A 1IEXA 3KXDA 4M76B 2RHHA 3KVNA 4CMBA 5YASA 5KYWB 4CI9A 3FYUB 4JV5B 3C5CA 1LPOA 1DSSG 4Q00A 2OAEA 5BNZA 4ZT4A 1T0IA 1HI9A 2I76A 4MIYA 3EIEA 2XR1A 1CY7A 4IGKA 3COJA 1SA0A 2ZYUX 3O75A 2VLIA 1JDPA 3T94A 1JN0A 1CDDA 3QVUA 2Q8PA 3ZN2A 2WWIA 1NVWQ 2PANA 2VJMA 3ZWCA 3ENZA 1N9KA 3R5TA 3IP6A 2F67A 3F8SA 2DFKB 4LBZA 1JHRA 1FMFA 1FP1D 3PFIA 3PUJA 4M1TA 1PO7A 3E3NA 3R5JA 2LP4Y 2XI4A 4TLMB 1KZ7B 2XNKA 3KSBC 2O8CA 3DCYA 4OYLA 2O59A 3MLBA 1D3AA 3VZRA 3DW1X 3WLSA 1EWYA 4Y6GB 2CE7A 2XXBA 2AHRA 4NFYA 3LM8A 2O2HA 2ZAMA 3EFBA 4DCCA 4ER5A 1QH8A 1VLVA 3UT6A 1UBKS 2C0PA 3T1VA 1AB5A 4DRZA 3VU0A 3F78A 5JQGB 4UNQA 1U0NA 1P5FA 1W85A 2Y9MB 4OHMA 3REOA 4XCQA 3BWCA 3UOWA 1KZ4A 2XT6A 3UHOA 4O4LA 1XKQA 1TIBA 2CLMB 2OR3A 4CKXA 2YWBA 2JBWA 3K0SA 3HQ4O 2HIAA 1NLFA 1IUKA 1C7EA 1T8RA 4BGVA 1GTVA 3F6CA 5KNBA 1GDHA 5HOQA 1PFKA 1W581 3U2QA 3DLHA 3M33A 5KQPA 3NIWA 3PNMA 5IARA 1BGVA 3JD0A 3QXJA 1XZIA 3FNFA 4WE3A 3QVJA 4X1YB 4OQPA 3NTVA 4N03A 1U0EA 1QBGA 1H0RA 1C9NA 4P22A 4ZT7A 5LP6C 1U1GA 2O50A 3GIWA 1NLUA 4JR2A 4ARIA 1YOVB 3H9GA 3KWFA 3QEBZ 1UKCA 2OMEA 4EF4A 1KZ6A 1YS6A 1WEHA 1NBMA 1ZVMA 2QRNA 4E5SA 2P79A 4YMLA 1D6NA 5IASA 1H3NA 3SK0A 2ATCA 4GI5A 4P98A 3P2KA 3PRHA 4AO7A 2Q28A 3F6RA 4P5EA 5TMDA 2PZMA 1KYYA 3NOXA 2C8JA 3E03A 2HA2A 1NZJA 2VHTA 2OQ2A 4JJFA 5LA6B 4OTZA 4PXAA 3VNVA 1GKKA 2PRIA 1ESEA 1NJGA 1GRQA 4M99A 3VNSA 1Z2AA 1M8FA 2ONZA 3OTOB 4YR9A 2VQFB 2DH6A 3WISA 4GKJB 1OXBB 1IBSA 1RD4A 5EEHA 1BVHA 5CHYA 2C82A 4L74A 4BLQA 4CIYA 1ZZGA 4CL2A 1EDDA 3Q6IA 2AKYA 2CF6A 4FYXA 1EVEA 4H9GA 2CCGA 3WFZA 3N75A 1XL0A 2N0SA 2P2YA 3IV6A 3V8VA 1S01A 5IF9A 1ZCZA 4QEZA 2BEWB 4ZCTA 1C8LA 1VSQA 1LV8A 3RKRA 2QSYA 2AFVA 1P2BA 1VLLA 3BTSA 4TROA 1H3EA 4HMPA 4OP2A 4NNPA 3QG5A 2QN9A 2IU4A 4U2DA 3HY3A 2QIPA 1PR5A 5SY9A 3QPDA 1SHTX 4ZD6A 1PZFA 1UMKA 3SJ7A 4A7PA 2HCRA 1P4GA 1PK7A 2ZSDA 2WTBA 4BNTA 1V7QA 1UL1X 3P7MA 2ZS7A 4AY5A 5HJ5A 3LUAA 4WN9B 2W2KB 3OAAD 3QOWA 4KIJA 4QQNA 1TW3A 2PMEA 2ZUFA 1F12A 3JYPA 3STWA 3AG6A 3HEBA 1ZR2A 1L5KA 3LWDA 4PG6A 2A9PA 1W48A 5DGCA 4EDHA 4I1UA 2Y68A 3H05A 5CA0F 1I4EB 2GPYA 1ISFA 4YT5A 1DEXA 1OZFA 2QTMA 4I1IA 1GAXA 4R1NA 1KMNA 2V6JA 4K9KA 4X5OA 1MVNA 2B8EA 1BDHA 1C3JA 2C0CA 4DMRA 2HSZA 4DV4B 4G8JA 2C07A 2NU9A 1OVMA 2VL7A 2IWHA 5D86A 4PWYA 3CVYA 2D6FA 3FPSA 1MKYA 5LP6F 3SIXA 1EVLA 2RHJA 5JIBA 1F1JA 4MGKR 1UFOA 4KBGA 3T4UA 3PC3A 4FXPA 2HQOA 1MX9A 5I8ZA 4DARA 1BMQA 1QU3A 2WF8A 3F98A 4M83A 5A3VA 4DIMA 1H0KA 1NFRA 4QLOA 1YK1A 5HDBB 4CVNA 3I1FA 3ZDRA 2PGDA 1X7ZA 4L4SA 2JFZA 1FP2A 1YZ3A 4NESA 2QUJA 4TZ6A 2VQEB 2WNIA 4O4HA 1RRFA 3BH6A 1EQAA 1TF2A 3IR5A 4I8IA 1Z39A 1EVQA 5CYFA 1G8PA 4R1MA 1V37A 2B4TO 2NVUA 2OHOA 2WT4A 4MLDA 4TTSA 1ZRHA 1K63A 4R2KA 4EJFA 1IG3A 4RHYA 2MMGA 3A7DA 1SD2A 1KKMA 1QGUB 1JRLA 1PS8A 2H4JA 1Z17A 3JR7A 2EKLA 1OIVA 4LE2A 3CF6R 3FMFA 1NKSA 5I7AA 1X2BA 3R7SA 1FQKA 3HB4X 3BFXA 4UE3S 2PUCA 4F3YA 1WZNA 5FTLA 5K9ZA 1UK8A 4QO7A 1V1MB 3WGYA 4ZVSA 2OAGA 2YOHA 1GGVA 1ZL0A 4AYWA 4ZI7B 3OJXA 1P60A 3DMHA 3EDOA 4GM0A 3JQBC 3WRVA 4L78A 3I09A 1VCHA 5L4SA 3QPVA 1EG2A 4EJMA 1Z4JA 3AF3A 4R7TA 1D7OA 1TK3A 2LIVA 2YJ4A 3H5NA 1ZD4A 2YW2A 2NZUG 3AEXA 5IYZF 2WSLA 3UJPA 1R8QA 1TA0A 4KXVA 1IZ0A 1LB1B 1TA4A 1TADA 2UKDA 3H4IA 3MZ0A 3FSEA 1H23A 1U7WA 1WUTA 4NJEA 4WEQA 1GQYA 4X1IB 4GR5A 1NN1A 1RLJA 1APBA 1SUBA 3OFJA 4MR9B 3ER6A 3KJHA 3DGEC 1CETA 3GJ6A 3MNFA 3L1UA 3WYBA 2YV4A 4DDHA 3IVGA 1YVEI 5A9SB 4PYMA 2BRUC 2YYZA 1RAIA 2YJTD 2ZRPA 1W5BA 1G8GA 2GTPA 1PUJA 3QMMA 2G9UA 1E9RA 3H2BA 2GJSA 3B1JA 2DERA 1WULS 3OJFA 2BR5A 3VPAA 1JG6A 1NBAA 4II2A 3NH9A 4M7WA 1YHYA 1DUSA 1DV1A 3BZBA 4KHPB 1EWTA 4BFLA 2QXYA 4QXMA 3AUTA 4C2UA 1XD9A 1PTJA 2X2PA 4PCVA 1U28A 5FQNA 4LF7B 4DPKA 1YONA 2XF8A 2Q27A 2R3SA 1Y63A 4LDPA 3AKZA 1FC0A 1TDJA 2E55A 3Q41A 3V80A 3F3SA 4N18A 4G1MB 4ZT5A 4WIAA 1Z26A 2I62A 3F0TA 1VCOA 5JSFA 1M1NB 4CCYB 3O95A 3IMFA 1E60A 1EWKA 3W4IA 2RH4A 2TMKA 4DBLC 3TRHA 4RFSB 5KQGA 1D07A 1UC9A 1G291 2EF0A 2YRXA 3K1AA 2JLQA 4E5YA 2IE8A 1R27A 2VOJA 3QI7A 3UPUA 2IV7A 3LPAA 5K0SA 2JLUA 4HEQA 1Y3IA 1WHSA 1AZSC 2ODWA 1YU9A 4CT5A 4ZAWA 3EG5A 3OPYA 4EPXA 1JQJC 2PO5A 4CF5A 4G97A 5EGSA 1XQ6A 3W2HA 5G3YA 4EA6A 4BNUA 1GU1A 3A1EA 3ROGA 2OCAA 4A92A 2QTNA 3QKIA 2H5IA 4LWQA 5AMXA 4BVAA 2HWXA 3GDWA 3BN3A 1KDRA 2J59A 3MD9A 5JC1A 5EXSA 2ENUA 2VF4X 4RV5A 2CB9A 4H6XA 3EIWA 3TS1A 4B84A 4LA4A 2OGSA 5HQJA 4DT1B 3IH5A 1JJFA 4ZQGA 5CXUA 1LQ2A 3N9IA 3K32A 1O6ZA 1U5CA 4A6XA 4A23A 4BDSA 2W4QA 5L3RA 2GYUA 5TT0A 2PVPA 3RVKA 1W49A 3MTQA 5CM2Z 4R69A 4BKOA 4GUAA 2EXXA 2QVYX 3LL7A 3ZWAA 2QUAA 3QVGB 4KB5A 4CKWA 1Y7HA 2QX6A 4GSKA 5BYJA 1N34B 3QI2A 2GEDA 3QFRA 2QTRA 4R2IA 4DLSA 1E18A 3NXKA 4BNZA 1DARA 3CW2A 4PQGA 4Q93A 4LGVA 2R1ZA 4H1UA 1L7EA 5K6AA 1ZXLA 4AF8A 3WP1B 1P0MA 1MH9A 3K8OE 2CD9A 1QFXA 3V97A 5ERXA 4B47A 1V0JA 3DKPA 1JDVA 4LC1A 1OC2A 1R0CA 5JATA 2WUDA 4FGUA 1TJ4A 1RBMA 3P20A 1JAIA 3DLPX 1HETA 3PRYA 5HW0A 4NYMR 1PVOA 3H2YA 3WKEA 2AK2A 4Q9NA 1JLSA 2VYVA 1MB4A 4PZEA 5DWQA 4HSGA 1J2YA 3DV0A 4M1ZA 4TMWA 3VPFA 4J2HA 2PR2A 2Z9BA 2VHVA 2QLJA 4OA8A 2HTEA 1BG6A 1LPMA 4ZO4A 3T7EA 3TLGB 3TXXA 3HJBA 3QOYA 2JFNA 3RREA 5AK0A 5LQRA 3L6CA 3ZWBA 3TTSA 5BSUA 2Q5EA 2O8DB 1NXVA 1IAQA 1KDZA 4INJA 3WBFA 5BUCA 4YP7A 5ICMA 3E70C 1XQ1A 4KMMA 1CUWA 5HBRA 2ZETA 1EX6A 2B8TA 4OAPA 3GYGA 4BX8A 4FQ7A 1JIJA 3H8WA 2PFKA 1OFUX 3GMIA 1OE0A 1UXGA 3G7NA 3T1NA 3NANA 2QZJA 5H02A 3EVCA 2NAPA 2CFSA 4X3CA 3NM5A 4WDQA 1W5TA 1U9IC 4Q3BA 2AEMA 4UTZA 4MQLA 4P34A 4EJSC 3K0AA 1M6NA 4YP0A 4WT7A 4BRSA 2I2CA 3IAS1 1ES9A 3GLTA 5JNVA 1O0BA 2E4WA 1Z0IA 1V4VA 5BSKA 8AT1A 1N1DA 5KYYB 1PR0A 1R88A 1Y5MA 2E2WA 4IJUA 3JASB 3DF9A 1E2JA 4JA0A 3IERA 1AKQA 3IIJA 3O2QB 4Y6LA 1LQUA 1WW8A 3MCVA 3R9XA 4YONB 2FWMX 4KOEC 1Z3IX 2C9OA 1FA9A 3IBFA 4UXHA 3V1MA 1EFPB 4OK5A 4JS0A 4MV9A 3T3MB 1HR0B 3LUJA 1M0TA 3KELA 4X7PA 4B3SB 1JG1A 1R7RA 3DZFA 5KWIA 4LRSB 2B8NA 1DWQA 3UEOA 2FN8A 1ZW1A 2Q3MA 3R7WA 4P84A 1T6YA 1K3FA 2X4DA 1UP4A 4MUXA 1SNYA 2XJ9A 5E1BA 3EY9A 2IYEA 1H2AS 5ISMA 2FR8A 3HVIA 3HM2A 2XLBA 3IPCA 3D3WA 4PXSA 3MTEA 3D4PA 1W8DA 2I2BA 3QMWA 4PYOA 4V02A 1WVGA 2GCIA 3T5CA 4GX5A 3OQMA 1ZX1A 3PRJA 3NAMA 5H5JA 2C7OA 3E27A 3KXKA 1C9MA 4LTMA 4TQGA 3IQGX 4MKHA 2HV8A 2WDZA 3LT2A 1KK3A 2HRCA 3ZWPA 1YZLA 3EQ9A 5T67A 2KBEA 4KO4S 4KXWA 5KTYA 5CDUA 2WQ7A 1QV6A 4ZEOA 1BROA 1FDIA 1GV0A 2IEDA 1SCQA 3WYCA 2RB4A 3ZJVA 2AC2A 2NSLA 4LJKA 2ZUCA 3HA3A 1K0FA 1TB4A 4G56A 1Z29A 1K75A 3TB6A 1DKLA 2FCAA 3K72B 3OOWA 5FQOA 1C7QA 2PZLA 4QO8A 3QPCA 4P58A 3U09A 1JAZA 3OE1A 4HMQA 2Z2XA 1UOPA 2XOKA 2L42A 4TSRA 5DRYA 4JBXA 3TSCA 4CLRA 1RRGA 2EP7A 5C1OA 1AKTA 3JVEA 4ALLA 3WAGA 3TIGA 3F47A 4I81A 4ZRDA 2OC9A 1LF5A 4L76A 2MJLA 4Z86A 3QNUA 2FY8A 4EHNA 1W4AA 2OL4A 3ANSA 2XXAA 3EQ7A 1OWLA 4MEJA 3HKBB 1HF3A 5ALVA 3ILXA 1XC7A 3M9WA 4KG7A 4W7IA 5DK4A 1SFRA 2Z1MA 2CBZA 3VR1A 3TW8B 3AJEA 2CXHA 2MWMA 4PYJA 3WQBA 1Q7EA 1Q0LA 1GGEA 2DP4E 1NUUA 2YY6A 3ROXA 3OPVA 4YWHA 3RV4A 1OLSB 2DOKA 1O6GA 2EFEB 5CB4B 4MUNA 3V55A 1ZVKA 3JPYA 3PC2A 2OCKA 5TB5A 3WL3A 2ZUTA 2J9YB 3LWBA 1PZEA 3NT5A 2P4EA 2QN8A 3UM9A 3FM9A 3IRUA 1EDEA 4G89A 2VZEA 2G71A 1E5XA 1NXTA 2GXQA 2OV2A 3BA1A 3BL5A 5EZSA 3T9EA 1KL7A 4DWOA 1PGPA 3OTGA 4FS3A 3IE1A 1OI4A 1EFRA 2BMWA 2IIBA 5G4LA 5AKIA 2DPGA 3DQZA 4TOIA 3UJ3X 3FWNA 3LPMA 5EMKA 4RIGA 4TM7A 1UEIA 1US8B 5FT9A 3LOQA 3W7VA 2AOVA 1PQUA 2O8BA 3IMCA 3EGDB 2JIZA 3T7RA 3Q5DA 4X84A 2Q3LA 3BJEA 3RC3A 1IZ8A 1JHDA 1L9XA 1Z07A 3PHHA 4U2EA 5KYNA 4IKEA 4KREA 1ELOA 4Y2TA 1HYGA 5AJHA 1XNJA 4R8MA 4TTPA 1XQ9A 2DC1A 2ZT5A 4P7FA 1KQNA 3Q6NA 2P6MA 2QL6A 1ZR4A 4WCVA 4CNBA 2Q1WA 4MQMA 1NONA 1HG0A 3SEQA 4GR4A 2WAXA 4HDKB 1N2GA 1DP4A 2ZBQA 3TIVA 5JDCC 1Q20A 1S8AA 1ZSVA 5BT9A 5G2OA 3SZUA 4RORA 5DN9A 1ZNYA 5G40A 3WV5A 2POQX 1IRXA 3H5OA 3KD3A 3DMTC 1HQDA 3IXQA 1H0SA 5KJEA 1HZZC 4QSHA 4CLXA 2O7RA 1YKFA 2PBFA 4IV5A 1WIWA 4XPIA 4PLVA 2D1YA 1R9GA 4L50A 4TV9B 4D9HA 3ZXYA 3KV1A 3ELDA 3K0CC 4X8OA 1CEXA 1V96A 4LV5B 1X7WA 5A0TA 1IZ7A 5EJ5A 1LFDB 1XLTC 1G8AA 2G80A 2FX2A 4FYMA 3RD5A 3ICWA 1S6YA 3T7IA 4HH0A 2WQZA 1CRZA 4MX8A 3OCWA 1YIAA 1T10A 3A1DA 2GT1A 4TKLA 2VFAA 5G4KB 4E13A 3AKEA 3IOYA 2PKWA 3QVOA 1C7ZA 3EXEB 3PUVA 3RVSA 5TQ2A 3UK1A 4C0BA 3BB4A 5HP4A 4ALIA 1NP3A 4INOA 4OHZA 4MICA 4WV3A 2IGBA 4J16C 3VX3A 1R6BX 4Q4AA 1GZVA 2ZCUA 3UAWA 3P9SA 1G1MA 3AF6A 3JRWA 2RGYA 2BD0A 2ZJYA 3VO9A 3LWZA 5G0SA 3H7IA 4BL5A 1K2WA 4LF6B 3UK2A 2JA1A 4YQYA 4E14A 2R1VA 5I3CA 3DL7A 5ALDA 2Q3EA 5IDQA 4FNGA 1WY5A 1NJ1A 1TECE 2IQIA 2OHGA 2I22A 3JQQA 1F20A 1HTTA 1KJ8A 1M34B 4GW3A 3WHLA 2A0FA 2B94A 1XR3A 4LTDA 5I7UA 1JILA 4FYVA 3ESQA 5LMCA 2C8VA 2LXNA 2D0IA 1P4AA 3DPSA 3SC2A 4Y2XA 1XV5A 3QELB 1F2VA 2NLOA 2QX4A 2H1CA 4WMLA 4XJSA 3JQPA 5FJJA 1KEVA 4OGWA 1H05A 1LTQA 3E2MA 3Q7SA 4YO8A 5GV7A 5HIAA 5F2KA 3DZDA 3NKVA 2GUWA 3FUVA 1VCNA 3OZTA 4KQCA 4LRUA 1ZLXA 4O0LA 4ZU6X 1MO5A 1WUYA 1MB0A 2BTQB 2OUKA 2VDLB 3ZU2A 4Z7NB 2NO1A 4QJ3A 4LDJA 3AL2A 1O95C 2YRFA 2FQWA 2JG3A 3UGQA 2GJ9A 4MINA 3YASA 2I1LA 1TRHA 1UBJS 3HSKA 3ZD8A 3C4JA 1RI4A 2FW6A 3F74A 4E1AA 3VKVA 1F1BA 4X0EA 5B1SA 1L5ZA 1KP2A 2PXXA 4BFTA 1JHAA 5IKOA 1O0CA 2B4RO 1F4LA 4Q34A 4RX1A 1J9EA 2GVDC 2ZULA 5EXEA 4BHTA 4CPDA 2EZUA 3FYCA 4HGNA 1CUBA 3M6LA 3SN6A 1X1EA 5HE9A 3VYTB 4ANFA 5JSUA 3FNRA 3HGQA 3AB8A 1GAQA 2ZB2A 3LUGA 3NI2A 1FVOA 3QYJA 3WFIA 5LNK1 1VDZA 4N0MA 4WK4B 3NC1C 4BRUA 1V26A 4C89A 3AWIA 3DSRA 5LUAA 2WMDA 3BDIA 1DU4A 4QFCA 1U3UA 2RGNA 3AY3A 3N7UA 4P3XA 4Q9KA 2VZ9A 3WWDA 2I6UA 1XAGA 4W5HA 1H2EA 2G1PA 4RGQA 3OCZA 5DKFA 3GFBA 4IM7A 4L5JA 1MT3A 1HNZB 3HDHA 4R41A 4Y2RA 2XQIA 5T64A 4L4UA 5JI2E 3AX6A 1O5IA 3B1YA 3EIXA 4HB2A 4CM4B 5DNCA 5LQDA 4OL9A 3IJRA 5BMVB 2YHAA 4C4SA 2MHCA 3R9IA 4CEJA 2FR1A 4ECAA 2Y1GA 3VVCA 2JVIA 3R5HA 3F9IA 4IDDA 3I9NA 1XZFA 5C18A 5HUQA 2PU7A 4CFSA 1QK4A 2I6FA 1QH0A 1XG5A 4ZTBA 4Z0NA 1N2XA 1IEWA 4Z2YA 3U3OA 2HFKA 3HP7A 4WXHA 1WSBA 5F1KA 3USES 4ONEA 3VR4D 1QHFA 1A27A 4IH9A 3UXEA 4BNDA 3DOUA 1W6RA 4NZOA 1IOZA 2IBMA 1RYNA 2O06A 1GNLA 2BJWA 2CKDA 3FDIA 3GWZA 3K1TA 4HPXB 2CLDX 3E7FA 4KVFA 1UDCA 2A2ZA 1E9AA 3PDIB 4JU8A 2AEEA 2IYFA 3KWLA 3EG9B 3MJRA 3JYOA 1L1FA 1RE1A 1X9GA 3SLKA 1JIUA 1XRJA 1RSZA 3K73O 2AQHA 2AF3C 4Y8VA 2YDXA 3UGTA 4C3UA 1K88A 3UYKA 3ZK7A 1B8VA 1JFVA 1W1WA 4KQXA 2YHUA 5JNUA 2XCOA 2HLNA 4TTJA 4B4KA 3MOSA 1XMVA 2L69A 3KXLA 1Z4MA 2FPWA 1AS3A 4P3NA 3ITDA 3GLGE 1D2EA 3HBLA 4ZAFA 5EYPB 3UGKA 5F4BA 4MDYA 3FR8A 1WBBA 1KSGA 2FSSA 2OGUA 3N39C 3H1FA 4OH7A 3A37A 5CEEA 2WI8A 1ZMXA 2C84A 4LPKA 4O2AB 5AI6A 2VQDA 4EMUA 1K8QA 3MHPA 1NW4A 4LHYA 2BBSA 4FDMA 4QULA 4UOQA 2IZZA 3T38A 4ESOA 1WXXA 5A5FA 1ZOLA 1VRWA 1QHYA 2IHYA 4U7HA 3LHFA 3O8DA 1MAAA 2GJ8A 1PZGA 3RVDA 3G2OA 3P32A 2Q3JA 2BM1A 1NQVA 3TLBA 1EXNA 4GVLA 5TNXA 4TL6A 4E7OA 3BWDD 4CR6A 4UHHA 2Z30A 3ZYCA 3EF1A 3RUEA 4YAGA 4JI0B 1DX4A 2AD1A 1UK7A 4R83A 4DLZA 3GRVA 2XMGA 4J6EA 3A6FA 2WF7A 2JB9A 3FFXA 1J9GA 2G4VA 2CJWB 3P2EA 4H15A 4JIMA 4G23A 4NAUA 3SDBA 5CG1A 2QRKA 2J4FA 4QEDA 1GJRA 1GTMA 2X3YA 1PZXA 4RMIA 3GPLA 1OI2A 4HFNA 4DC0A 4PCUA 5KJ6A 2ONCA 2WPDA 3C6ZA 1E3LA 2CMFA 4LOAA 3W6OA 3K9QO 5JZBA 2NN3C 5FR2A 1JKFA 2O2YA 4K5QA 1ZH4A 4D3ZA 1VA4A 4KI0A 1OHHD 3BE8A 5ERYA 1EFKA 3IQEA 1ZIOA 4V0ME 1LGYA 3W2EA 4ZVVA 4BLTA 1IRIA 4MGYR 5EOVA 2QM0A 4QGSA 4A82A 1GZUA 4RPGA 2WJ6A 1SU8A 3MYYA 4LXHA 3EXG2 4K87A 4MKGA 5EIBD 3T4PA 3K0BA 2ORWA 1J42A 4RYDA 3BHNA 5C34B 3R6DA 3ZJ4A 1Z68A 3S8EA 5D2CA 4XFKA 1JLRA 3K0HA 3FUXA 3W05A 4MW4A 2Q1YA 2O8EB 1WVIA 2VDUE 3KIPA 1LRJA 1ZWLA 4MHOA 1R1DA 4S0XA 3JRXA 1RQ7A 1EUDB 2Q5LA 1M8JA 4CF4A 7REQB 3AY7A 4XSGA 1CZRA 4N3BA 3L8CA 1EJ0A 3G5MA 5IAEA 5CLJA 2IH4A 2C3MA 1K3TA 2I7VA 2OV3A 1CR0A 2OESA 1OY1A 5BWBA 1KH2A 3MF4A 1IY8A 1I14A 4AJKA 4KLRA 3JALB 4NRDA 1H8HD 1H2ZA 5BXQC 3DZHA 5LJIA 1NURA 3V1NA 1Q0RA 4E2YA 1KGSA 2CHFA 2FSGA 4LMAA 1T0JB 5EMNA 4NAVA 1XFDA 4R6WA 1BVRA 4YXWD 2OCIA 1L5VA 4QFDA 4RF4A 1OU4A 4OU4A 2IF0A 4TYPA 5K05A 1DCMA 5A9RA 5C9ZA 1PR6A 1ZK1A 3L8FA 2P9JA 1D09A 2PUTA 5AI4A 3TW6A 5CNIA 1D2MA 4G5FA 2KWIA 3T9AA 4O1HA 3FH0A 1QMPA 3NWEA 1TT5B 5DH9A 1MO6A 1URPA 3HG7A 3E5HA 3PGLA 5C5IA 4GDFA 2I4OA 1MCZA 5EG5A 1TZBA 2VH1A 4MHTA 5DI3A 5I3ZA 3LRPA 4C5BA 2ZE7A 1M5TA 4LJYA 3QP9A 2VI5A 5ITZB 3A4IA 2WZQA 4IJWA 1L7NA 2C7RA 5WRFA 1BS2A 3C15C 2JDID 5J5AA 5J23A 2J31A 4HQ6A 4UU1A 4DR5B 2Q5IA 3MD0A 3CU5A 2NACA 4ND6A 4YRTA 1IVNA 3E2IA 1X80B 5BVHA 2BZ1A 4H0NA 1WUIS 4IQGA 3SY8A 5AJTA 4F2HA 4LHWA 4EYOA 3KETA 5AW5A 3ILVA 5DBEX 1Q50A 1TUGA 2F1HA 2PZFA 3TRDA 4I4IA 3ZVNA 2QTBA 4QQRA 4LDRA 1DO8A 1XK7A 2ZPUA 1KTVA 3KPJA 1J2TA 2DT5A 5ICGA 2GO1A 1KOLA 2H85A 3IJPA 4PTLA 4FTWA 4ZCSA 2QAIA 4JNCA 1I0ZA 6ABPA 3WIBA 1PVDA 2GCOA 3O3OB 4EHLA 1ZI9A 2P2CA 2C8LA 3JD2A 3KZKA 4JLAA 2RGUA 2IWRA 1K97A 2JVKA 5EZYB 1OBVA 1R0LA 3WGNA 4JITA 3DB2A 5CFLA 4LXUA 5EC8A 1OGJA 4KPYA 1RMQA 2E21A 1GCIA 4CTJA 5B3KA 5L3QB 5BQXA 2RHRA 3CPSA 3AY6A 1A9TA 3B8EA 4WASA 4YRKA 1DTWB 5KHAA 1NULA 4XWGA 3KJGA 3M82A 1X8LA 4ZYYA 2X9QA 2DHEA 3B89A 1L5RA 5DHPA 4OBBA 2ZR9A 3A9WA 3MMNA 1GFWA 1FP7A 4ZAVA 1JEQA 3WIVA 4H3KB 3G2HA 3ONEA 2EJUA 3H7AA 3Q9UA 4GLBA 3UUWA 4BVLA 2QHXA 5JAHA 5GZ3A 1KWKA 5EQFA 4UEKA 1UF9A 1P31A 2H1SA 1HEYA 2F1KA 3OPMA 2HIMA 1DIAA 2BY4A 4FFLA 4FOLA 1JDBB 1MABA 4W4TA 3TVTA 3VNBA 4BEVA 1AK9A 5LWHA 3BS4A 1J39A 1JNYA 2LZ0A 3ROMA 3WQSB 2RG1A 1F2UA 1W4LA 3UK7A 3ZJTA 5HE8A 1G7CA 1Y1KE 3CEPB 4Y1RA 3W8EA 1WMDA 1NW3A 2I66A 4KXYA 1GD1O 4U63A 4WZBE 5KC8A 3GRUA 4XOIA 4XB6B 2C2OA 1KYXA 4PO8A 4PGHA 3LX6A 1GXSB 4L95C 4N6GA 3KOMA 1S7GA 1J21A 1DMSA 1ZK0A 5J40A 3OBBA 4LOJA 2PUGA 1YS9A 2X86A 1AF7A 4TZTA 2FMFA 2YFKA 3BK7A 4XX0B 3UJ7A 3Q87B 5DP2A 5KCZA 3STYA 4NBUA 3CUSA 4I1RA 4LNHA 4EEZA 1SUDA 2GZAA 4D45A 4MWZA 3GA7A 3LDHA 3V4SA 1DIRA 2Z56A 4BE7B 3WGIA 3M6FA 1ZISA 2G9RA 3F3MA 4ZVQA 1GYQA 3FKQA 4DWVA 3P9QA 4YJHB 1JBKA 2QTVA 4NCKA 5DBOA 1KRWA 3HYLA 1RHJA 3FKJA 2AWNA 2H2DA 5E8JA 5IM5A 1T6ZA 1VG8A 1RXYA 3NV7A 1IPFA 2OKCA 4MWEA 2ZLBA 4PYLA 4W99A 4YCSA 2XYPA 5JS8A 1S89A 2WQ6A 5LU9A 3I6ZA 4C01A 5AJVB 1EE2A 1ECGA 2ACWA 4V3BA 1NR5A 1DOAA 4A6EA 4YRPA 1DC3A 3ZNNA 1XTRA 1DIGA 2VHYA 3TNYA 1B2RA 3A14A 4JQSA 3IESA 5E6SA 1C8KA 5KAMA 1E79D 1BE6A 2VKQA 2V3WA 4E31A 3CLTC 2R97A 3CBGA 4C4XA 1DDGA 3AOEC 2ET6A 1UAAA 4UPVA 1FUKA 1QPBA 2FHPA 3IQDB 3L7YA 1A88A 3NBFA 2H9IA 3T5AA 1W0JA 1N6PA 2WVJA 1E1YA 2PFSA 4UMDA 1T5BA 4I4CA 5D6OA 1IQPA 1NY6A 5HILA 4DIOA 8LDHA 1FJGB 3NUGA 3ZHZA 1K9VF 1JB9A 2A5DA 4P31A 3RB8A 1CFJA 4ND8B 3UFXB 3VVBA 3WGLA 2H92A 4KYIB 1RBZA 1USUA 4MVJM 5JSHA 2OQVA 3H5TA 3DOOA 1DADA 2W4IA 5J2TA 1RPAA 1F14A 2AW3A 2G0AA 1M6HA 1B8OA 1NDQA 2DUMA 5FA5A 4A10A 1W1IA 1G8MA 2BR4A 3D6UA 3EC7A 4K7JA 4OCZA 1ZHFA 3L4BA 2I8LA 2NU7B 3EHDA 2HU5A 3WYEA 3U1BA 4G0VA 4ALJA 1DE0A 1TM5E 2HHCA 2H9AA 5KINB 2I6SA 4AWXA 3T4XA 5JVDA 4RPKA 5EJ7A 4N54A 3EIFA 5KSYA 4Z1MA 1I3CA 3DD5A 3ND5A 5AVWA 2O2ZA 5DBHX 3BE5A 2NYRA 3K4QA 2VWGA 2FSPA 1L7PA 3MMPA 3Q9NA 4JC8A 4EO7A 1RZRA 1QVZA 4UVIA 2A0WA 2IOYA 3QITA 4D0RA 3G9UA 3W8FA 1EDOA 1K7FB 1EGHA 3QA3E 1RPNA 2OZLB 3BK2A 5CLHA 5FL7A 5AXDA 3TZQA 5UKDA 4BLUA 5REQB 1CRPA 2OD7A 3T9DA 4LJRA 2XQGA 4B76A 1SQSA 4H0FA 5P8WA 4XIFA 3BE6A 1R4NA 1ZIYA 4EMTA 3TG2A 5AD1A 4NCXA 1YB4A 2JCXA 4HTFA 4S0ZA 4GMFA 4FC7A 3QE2A 5JALA 1B6SA 2XQFA 1OI7A 1UC4B 4PU0A 3P9NA 5DM0A 5B53A 1KJYA 1Y37A 1T5LA 2BHNA 2FQXA 5JWHA 4IHAA 4RJLA 4AJOA 1Y9JA 4A0RA 2PUVA 3KJEA 4KNWA 3ZE0B 1QGYA 1NXQA 1AGRA 3H5RA 1BWSA 1EUCB 3EZ6A 5LYJF 3OETA 4B3RB 1JEAA 4URHA 2H07A 1JAYA 2HT1A 4BRZA 1AXRA 3D7KA 1T4MA 4KE9A 1IJBA 2ZPAA 1NNI1 2J46A 3Q0TA 4UXIA 5JRZA 3J81A 4UUMA 5DM4A 1XXHA 4ACBA 2P40A 1W5SA 3TW4A 5J4YA 1UKEA 1RKBA 3EBOA 3RBVA 2BWJA 3X2SA 1TKCA 2JAQA 1RWVA 3IO5A 4R9VA 2BGJA 5E7MA 4BO7A 4F7DA 1XI2A 1N2HA 4ZCPA 4I5EA 4AO8A 4R0NA 4RD2A 4R1UA 1G6Q1 3LDAA 3QF4A 4EMBA 5KMGB 1L5WA 1TA9A 3DE5X 4JLMA 3DCNA 1C14A 1ZN7A 5ICEA 2PV7A 1W9MA 5LJLA 3BREA 4FB4A 5JAQA 1HLFA 4TYWA 3ET5A 3I9FA 2O5CA 4JENA 2R6GA 3NC4A 5J58A 4ZVKA 3NAQA 1X8XA 3MT0A 2Y66A 1S2IA 3CN7A 3G2LA 3JVIA 3TXYA 5DLEA 1WA5A 1XJ5A 3IEUA 3KUXA 4RDIA 2F3TA 5HF5A 2A3NA 2V7VA 2OLJA 1LKZA 1GT6A 3MWDB 4TMTA 3WHPA 3WSVA 3AXTA 4JC5A 3E15A 4M98A 4J07A 3RFUA 3I6BA 1EK1A 1RWOA 1V3VA 1QZXA 3QFFA 1QS0B 4NBKA 2YTZA 2H1RA 1KPIA 1OUMA 1D03A 4Y2QA 4YH1A 5DTIA 1E2HA 2BM9A 2FH5B 3QMPA 2QXUA 1FTYA 4MP3A 1MW9X 4JWTA 4R1TA 2JLAA 3QVWA 4MQEB 5G1NA 5K3AA 2NO4A 3N2LA 4LXQA 2GKGA 2ONJA 3WL7A 4G36A 4F4DA 4LJ7A 4OK6A 4HFMA 1X3SA 3UO8B 3AY0A 3FWPA 4G01B 4B6RA 1B8PA 2VJAA 4CUKA 5KIAA 1U9ZA 2A1UB 2D5AA 3W7AA 4P93A 4OIMA 1KDTA 4NG4A 4CM8A 1Y1RA 1HNXB 4RDHA 2R8RA 2WSYB 3ODPA 3Q15C 5JCXA 4LTNA 1YVUA 4R1SA 4F2GA 3LLVA 2DWUA 5J1SB 1IJKA 4Q9LA 1QO9A 2A59A 2GXUA 4Z8YA 3VC7A 5K4HA 3WAJA 5GGYA 4EECA 4GMHA 4BO2A 3VHRA 3KOUA 3QJ5A 1UANA 2J0VA 3A3YA 2FWRA 2IPLA 4LOKA 5EIHA 1YDWA 3EXIB 1EVYA 5KPDA 2SNIE 2QRUA 5LMZA 4B2LA 1HX7A 1R6VA 5HJ2A 1Z5VA 1Y1LA 4KFSA 1H1LB 1J49A 3SLGA 3V7UA 3M4NA 3S2GA 4KYVA 4R54A 3VTZA 4UPEA 1YTUA 4XQ0A 3NR2A 2FW9A 2AI2A 4ZQCB 4ER6A 5K0GA 5L9AA 3V6MA 2XWSA 2CDCA 2RGAA 3H11A 4BS9A 4DBVO 2D1SA 5HWSA 5CUQA 3L7CA 4B81A 3OT4A 4Z6KA 1GFZA 1A98A 2V7PA 4NMLA 4Y2PA 5EWLA 1GGHA 1VDMA 3NHWA 3EVAA 2Y9PB 2MSWA 4XARA 1DKPA 3PVCA 4MPJA 5EMHA 2RI0A 4B3TB 3JD4A 1XYVA 4GYYA 4LVUA 1CEEA 5C53B 3R3YA 1JPVA 3PZRA 1SXJC 3RRMA 2A0YA 1I8TA 1JFSA 5AHWA 2PH5A 4KXUA 3VZQA 4BIMA 2VVTA 2OCBA 2EYQA 3KZNA 3PDCA 1SXPA 1D04A 2OP0A 1U90A 2W71A 3A25A 2FPPA 1Z4PX 1ORVA 4DJJA 3I2JA 2DR2A 3T0IA 1MENA 1R0BA 1XEXB 4M9XA 4PX5A 3IAM6 3AONB 1TYCA 4G1UC 1EP1B 4F2DA 1SBTA 1DCFA 5D87A 3OIGA 5KO2A 4ZZ1A 2P7HA 3CRRA 2JARA 2C42A 2OD2A 4XH9B 4XSHA 2HT6A 5GJVC 2O6LA 2Q5OA 4B3XA 4BYGA 2JGKA 2W42A 2R7NA 1OXTA 1XZGA 4FCWA 1OBOA 4YRAA 3WOVA 2Y99A 3U44B 1KIAA 3D8TA 4Q47A 3FMPB 2V7GA 3AR3A 3PFGA 1AV7A 2CVOA 2DUUA 4WZBA 4C7BA 2I87A 1U80A 2K87A 2EU8A 1QHNA 2CN1A 3BH7A 4IRMA 5TRTA 1VLQA 1UXKA 2YV2A 2FNAA 1ETHA 2ZE6A 4GEGA 5CLIA 4OAOA 2A30A 5EE1A 3E9QA 1E6EA 5ALSA 3REGA 3UHJA 4P83A 1XA3A 3HJAA 1YRHA 3ZHXA 2MMCA 2PA0A 3JAKA 3GUUA 1AIPA 2AE2A 4JVMA 4CKBB 3ER9A 2P2LA 2PGOA 2QYOA 2FEPA 5IJWA 1P2SA 4PM4A 1UMDA 3N7TA 1SOVA 1WPXA 2ZIEA 4BV8A 3R74A 4CCSA 4ENWA 3R0XA 2PT5A 4DLWA 4ZZ0A 1C3LA 4EGFA 3RVOA 1X74A 1Z2PX 3CRMA 4MUJA 4N9WA 5BY2A 1E99A 4KSCA 4YP6A 3PB3A 2EG5A 3BGSA 3RS9A 4BLPA 2GLTA 4EUKA 3KQLA 2VK8A 1X0XA 3KT0A 3TOCA 4WZZA 3KZMA 1JR3E 4AUKA 4ZDWA 4D46A 3AKDA 4L08A 1HEUA 1ZI6A 2AOUB 1FJ2A 2VH2A 3NFRA 2VUIB 3EEQA 1OLXA 3W3AA 5IZCC 3K8YA 4Q02A 5MN5A 5G53C 5HRUA 4RUKA 3O84A 3OICA 1PS9A 4MQ5A 7ADHA 5HR5A 3EZ7A 2SCUB 3ZWDA 4EG3A 4GYJA 3BMOB 2QUBA 4TUYF 4YQFA 4PQFA 2YCBA 3FYHA 1G2QA 1Z0UA 3CLHA 3RTBA 1GG5A 1DEAA 5HKKD 3JQ7B 1QVWA 3T7DA 4KXNA 1JX6A 1K8YB 2PBZA 2PIDA 2HUNA 3MG9A 4D3DA 2YWXA 4QOEA 2G1JA 4UUNA 1E3JA 4JYAB 3N5CA 3TG8A 3RCBA 2QROA 1BFUA 3PNPA 4YUXA 2QRQA 4QG7A 2GK7A 3S2ZA 2V7BA 2IYQA 2R6JA 2VXYA 4I5DA 2ENWA 3OPXA 4LGYA 3IUNA 2AR0A 4AP9A 1TTHA 4E46A 3OM0A 4BTLA 2QK4A 2ZIVB 1CUAA 1A9OA 4QHTA 2H9YA 3WKCA 4D9EA 4RMGA 4IV0A 2Q1UA 1W36B 1K86A 2M32A 5CGZA 1CJMA 3GL9A 3ONVA 2YH2A 5KC9A 3MWGA 3HJHA 3IBSA 3IYLW 5CJJA 4Z3DA 5CXXA 1THGA 1QIDA 2IYAA 2E9SA 3FNHA 4REQA 5AJUA 1FFWA 4QQKA 3VI3B 4BNHA 2WP0A 2W70A 4KXLA 4Q12A 2ZM5A 4WD3A 3BIWA 1M2WA 2GI4A 3UKDA 2ZWPA 4BOYA 4DHWA 5AHRA 5C8XA 3ONNA 3WLIA 2JLRA 2X8LA 4FUQA 1WXDA 3VTFA 1ZD5A 2Q0SA 1S7CA 4NNOA 4C1NA 5JMWA 1TVKB 1WBDA 2JJ8A 2WSSA 2YIMA 1H2WA 3E8XA 3WLRA 1LLCA 2VHWA 3O2SB 4QM7A 1JDUA 4RIHA 1WWKA 2GPNA 1J1IA 3H0EA 2OQIA 3NTQA 1KZHA 3GQBA 4N01A 2O23A 1EFVB 1TZCA 3PFWO 3I9V6 1W0CA 5H82A 4CQMB 1LS6A 2I2FA 2J0SA 5JBNA 1NJ8A 4U7PB 4ZK6A 1VJCA 2CLOB 4LHSA 3T5GA 3O7MA 3I45A 4ZHSA 3LKDA 4DILA 2YR0A 2C7PA 2XZLA 4OO3A 3RS3A 1R0ZA 3DXZA 4NCHA 3RGWS 3EBLA 2J32A 1A9XA 1OB5A 4HWGA 1YL6A 4B6PA 1FLNA 1Z28A 1U4NA 3A2KA 4J03A 1PKXA 5ENVA 1JZTA 2BBTA 3RG8A 1IL0A 2IPOA 1EESA 1EWRA 3DLCA 1BRMA 4G5YA 2CHEA 5D00A 2IZ0A 2BC9A 3VPSA 1YZTA 1C4KA 3KEOA 2LBPA 4CV1A 2PAAA 3VNUA 4DUY<