3EIXA

Crystal structure of selenomethionine labelled staphylococcus aureus lipoprotein, htsa
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
290
structure length
290
Chain Sequence
ASTISVKDENGTVKVPKDAKRIVVLEYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLIIADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKLINKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYLKGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRDVWARSRGLISSEEMAKELVELSKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords HtsA protein
publication title Characterization of staphyloferrin A biosynthetic and transport mutants in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 100
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3eixA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3eixA02
4ND8B 4G09A 2XH8A 1K2VN 4TKVA 3HXPA 1QGUB 2M6KA 2AFHA 1PQ4A 3AEUB 4WESA 5CX1A 3EIXA 3MINA 1N4DA 4WNAB 2R7AA 1QH1B 4WZAB 4M7OA 1N2CA 4WN9B 2MINA 3GI1A 3ZKAA 5HX7A 4UDOA 4PM4A 4WZBA 4N01A 5FLYA 1QH8A 2PS0A 3BE6A 1G21A 5KOHA 4HMQA 2YNMC 3AESB 1XVLA 5M34A 4LJSA 4MDYA 1H1LA 3AEKA 3LI2A 1L5HB 4GICA 4TKUB 2WHYA 3EIWA 4ND8A 5KHLB 2R79A 1FP4B 3PSAA 1G20B 4H0FA 3U7QB 1QGUA 4G07A 4HMOA 3NU1A 4CL2A 3AEUA 5JOQA 2XQVA 4FNAA 5GGXA 4INPA 2XDQB 3ZK9A 4WNAA 3MWFA 1QH1A 4OXQA 1M1YB 4WZAA 4MLZA 4WN9A 5GGYA 5BVGB 5M29A 1PSZA 4K3VA 4XPIB 2OSVA 2Q8PA 4PAGA 5JG7A 5BVHB 2X4LA 3AESA 3CX3A 1M1NB 3TNYA 1MIOB 2O1EA 4HN9A 3PSHA 4TKUA 5M2QA 1FP4A 4UTPA 1G20A 3U7QA 5JJ5A 5I4KA 5AFSA 1ESZA 1EFDN 2OGWA 3ZK7A 2PS3A 2XV1A 2AFIB 3MD9A 4UDNA 3UJPA 4DBLE 2RG7A 2XDQA 1KAEA 5BVGA 2XY4A 2WI8A 4XPIA 2Q8QA 1K75A 3TLKA 5M3BA 1KAHA 5BVHA 3K1AB 3ZTTA 1M1NA 1QH8B 1MIOA 1N2ZA 4INOA 3AERB 2PS9A 5KOJB 4HMPA 3AETB 4LS3A 1L5HA 2M6LA 4UTOA 4BBPA 1M34B 3AEQB 1K7SN 1N4AA 3PDIB 4FKMA 2ETVA 2AFIA 3BE5A 2PRSA 3ZK8A 1TOAA 2XUZA 1KARA 4IRMA 4TKVB 2OV1A 3G9QA 2AFHB 1K0FA 3HH8A 3R5TA 2YNMD 4MO9A 4WESB 4OXRA 1M1YA 5CX1B 3MINB 4FILA 4B8YA 1N2CB 3LHSA 2MINB 2OV3A 3K1AA 5HDQA 3R5SA 4WZBB 4OVKA 3AERA 5JPDA 3MFQA 5KOJA 4FI3F 1G21B 2QI9F 4H59A 5KOHB 2PHZA 3AETA 3HJTA 4NNPA 4NNOA 3TEFA 1M34A 4MX8A 5CR9A 1H1LB 3AEKB 5B58T 3AEQA 3PDIA 3MWGA
chains in the Genus database with same CATH superfamily
2P78A 2PGJA 2RJOA 3G8AA 4LJAA 2VOEA 1KDVA 2Z6QA 1FYXA 1Z13A 3RSLA 2PO7A 2IVZA 2GSDA 3HXPA 1WZ2A 3BIOA 5TSDA 1ONBA 1TYAE 4KBFA 3ENNA 5F9FA 1KHTA 1QVZA 821PA 4IGKA 1KOGA 2P9EA 4FR5A 4IBOA 4B4WA 3RQSA 1D1QA 4J0EA 1X19A 4OOEA 2QUZA 2VPZA 5GONA 1TAUA 3JQ6A 2Z83A 2D5BA 5I8PA 2WG0A 1L7RA 4AULA 1VLZA 3AI2A 1JEQA 1ZHHA 1UBUS 4M89A 3DLTA 1B6TA 3O82A 4J75A 1R0KA 2BBSA 2GYVA 4HQFA 1NVXQ 2CF5A 1G20B 2JFHA 4N18A 4CQLB 3OPYA 1CB7A 2NZYA 3AH8A 2XUIA 4CG2A 1JZQA 2JBAA 4BQRA 3S55A 5KTOA 4GC9A 5HRAA 4OI2A 3V9AA 4KXWA 3NAGA 3OJFA 1WSWA 5GJWC 3REGA 5HR5A 3HL4A 2NYUA 3BGVA 4E31A 3QHQA 5MN5A 1LPBB 4IIVA 3KBOA 2P5TB 3VQTA 1TC2A 1A71A 5FR2A 1XWIA 3DE3X 1HL7A 4BLUA 4DLVA 5KHOC 4OLJA 4WOCA 3SC6A 1JJIA 5CFRA 1WXQA 1WV1A 2XTMA 3OE7D 4J7AA 2GARA 4IDDA 2NUAB 1AQJA 1IC6A 4AT1A 5K20A 2C4WA 2Q0HA 4CWAA 4NQRA 1UMBB 1GCUA 1IEWA 2FGJA 4FYKA 1U0GA 1UPCA 1QRRA 4URXR 3HEAA 3L8HA 3TMKA 4DLUA 2NADA 4LHYA 4U7WA 3ERCA 2W42A 1TFRA 1KDOA 1L7DA 2D6FA 3OZFA 5CVDA 1NLUA 1UM9B 3W5BA 2P0AA 1TFUA 1QOPB 2A58A 2VVTA 3KZCA 4HR7A 5F2OA 5A9RA 5BWOA 1P0IA 1J2TA 1QKIA 2ZCUA 1I3MA 5JI3E 1GYQA 5KYYB 4UAJA 4UASA 4RNCA 1VYTA 5EIAA 3RYFA 5CJJA 2VJBA 4DS3A 3LF1A 4A2QA 4QHSA 4R8VA 3Q85A 5JFOA 3Q8XB 3AVUA 2ZTLA 1QF7A 1NRWA 2V3WA 4LW8A 1CQXA 1KU6A 4GGPA 4HXGA 2BBTA 4Y0AA 3WI7A 3O1JC 4WX2B 3AF2A 1SBZA 3H2BA 3PE4A 5IT0A 1UXOA 3QEKA 2IYOA 1YHYA 6LDHA 4HLCA 3D6VA 3GNSA 1P33A 2EQAA 4G0NA 4PLZA 4RPCA 1N5RA 1AHNA 1WLSA 4HAZA 4G5GA 2ECFA 4FQ5A 1GTSA 5F76A 1C0EA 1QB7A 1C1HA 2I1VB 4GO1A 1OIXA 3O03A 1EBBA 1M6EX 1FFAA 4DEVA 1XP5A 4WLFA 1IDN1 1VCHA 5K6AA 1MP0A 2WFZA 1ZGAA 5HF9A 5LLTA 1IBMB 2XGJA 2Q4BA 1LEHA 3GLVA 2VIIA 1NI4B 2ODEA 2EIXA 1E7QA 3MPOA 4W7HA 5TQJA 4R9NA 4CNQA 2KS6A 2BEUB 3EZ2A 3LP5A 4LYYA 3UHFA 4NX2A 4ZCPA 1NM5A 2P11A 1AKEA 1CDOA 1NC3A 3WV4A 3IBSA 1RZVA 1UC4B 2COKA 3CV3A 1V71A 3GUUA 4WZAE 5F3DA 5KYWB 2EGGA 1CRLA 2YJZA 3WDKA 1J5EB 4C0XA 1EE2A 2XZTA 3SU8A 1ULSA 4E7OA 3AKZA 4MVJF 3FUVA 3Q1KA 2IOFA 2GPBA 2XE4A 4B5LA 1E4EB 3BA1A 1ZN8A 2H4WA 4RU1A 1RKBA 4EFDA 2GPYA 2X42A 5JIBA 1YNSA 2PL5A 2GDJA 2FDCA 4ZYTA 5ALQA 3O8BA 5LP6B 3SN6A 5KOHA 1TA0A 2B1IA 1JGTA 1SPBS 1R10A 1YU6A 1H22A 1M0WA 2K6GA 4EA6A 5JISA 2FDXA 1Z4KA 4I9UA 4UHBA 3FYUC 5AW0A 2PL9A 3D5TA 5IRCD 1E5QA 3RYIB 2GPTA 3GUHA 2CCJA 3DOOA 1FU8A 4H16A 1V1RA 4M9CA 4NR0A 1VIVA 3C8MA 4MAMA 5EIHA 3T1VA 1RI3A 1I4LD 3N8GA 1JHUA 2CBZA 2EYUA 16PKA 1GQOA 3BIWA 4B3FX 1P8JA 3K9NA 2QMEA 3QQPA 2QUJA 4OUDA 4XGKA 4TLEA 4BMSA 5GOTA 4BNIA 4ZYYA 1PJBA 2H51A 1ULAA 4Z0NA 5B30A 2LGJA 4B0OA 3PLRA 5BRNA 4DN6A 3TJZA 2AZXA 3QUCA 3F2VA 2QW0X 2XE6A 4GWGA 5IN4A 2FUNB 4PIPA 3B2QA 4E03A 4BO2A 3AC0A 4IF6A 5BW5A 1I1QB 2OO3A 3HRIA 3LV8A 3SHVA 4BV9A 5BMVA 5ELLA 1KVTA 4KQ9A 5K6RA 3SHOA 3MWLA 4IX9A 2EFJA 1Q50A 3L9XA 2RJNA 3LG2A 2XSZA 4XB1A 3VPXA 1LKZA 3E7PA 3NTUA 3MT7A 3WK8A 1VRWA 2GF9A 2XXJA 3TK1A 1CY0A 1IHOA 1S1CA 2DWQA 2V3VA 4RDHA 2B82A 5F5XA 1JKFA 1DO8A 5J59A 3ZV6A 4UNIA 2G17A 1LVUA 5IM5A 3NJ4A 3ZDCA 4KK3A 5SYAA 3QIAA 2EATA 2QG9A 1WVMA 2N47A 1JR3D 1POXA 4Z4CA 4WLUA 2ZS9A 3K71B 4LZJA 1SCKA 2GPJA 2QQEA 3V2GA 2UVQA 3OOJA 3HTXA 1N3BA 4TKMA 4X85A 2GTPA 1RWOA 2VPTA 2XADA 4WNCA 1NLFA 7YASA 1NE7A 1Z6ZA 3AETB 3RIMA 5ECWA 2UUCB 1Z4JA 3ZE9A 4L02A 1H4SA 1I7PA 2IYEA 2V1XA 4KITB 4LQCA 2ATIA 2VA8A 1E2DA 1RACA 2HLNA 3LX8A 4FN5A 4ZVTA 3TO5A 1QHNA 4P4SA 1NXOA 1IIBA 1S4MA 2J5RA 1LC3A 1X0XA 3WGZA 4E4TA 4CKBA 4UBJA 1KEKA 3OLZA 5C9ZA 1JALA 4OHPA 3EVCA 2BFCA 3ZEAA 1W96A 3ESBA 4JX8A 4EY7A 4IINA 4J3JA 1RPTA 4TSRA 3UMFA 1I9GA 2BFFB 4JBNA 2WWGA 4Z7JA 3ONNA 5LFAA 4DR1B 4MH0R 4A1FA 2M98A 4Q4AA 3DDZX 4HPWA 5CNMA 4QBHA 2Q5OA 5JEDA 3DFUA 3SYLA 2IHTA 2WVHA 2VC2B 1PV2A 1PR0A 1L4BA 1PEYA 3GT0A 5UKDA 4O8ZA 1MTZA 4L6IA 1TM1E 2A5GA 3B82A 5C8YB 4XVUA 3RIXA 4K6OA 1ZU5A 4N49A 1AY0A 4KUGA 1LVHA 1Q92A 3TLEA 1W0CA 4E2FA 2QN8A 1HDOA 4QOFA 4RDIA 4B6EA 2ZBRA 5TC4A 1GGMA 1XTTA 1JHAA 2PAAA 2QLMA 4RZHA 3DE7X 3I04M 3GI1A 2HAEA 1D6MA 4HZIA 1A2BA 4N3BA 5CG1A 5K09A 2C9OA 2FG5A 3EB9A 5CW1A 3RUAA 4DA9A 1E5VA 1H6DA 3GQVA 4KGVA 1A8SA 4A5OA 4AICA 4F04A 3Q5GA 3FGNA 4KO2S 4OKSA 3V3KA 2A67A 2FWAA 3ZPXA 3ZDBA 3KHUA 4YIHA 4PNPA 3ZHQA 4N7JA 2DFNA 2DWPA 2BF7A 4RKWA 1HRDA 1TTPB 3X1WA 2ON6A 1JHXA 2H1LA 3R6GA 4CN8A 1SXHA 4AP6A 3C70A 3WWPA 2A0FA 5C7IO 5CFOA 3S8YA 1KDPA 4QBTA 2KI5A 2JLXA 4FBGA 3OQNA 4FGLA 1JT9A 1T0HB 3ONVA 4FOTA 2IXGA 4IJMA 4BX3A 1WWKA 3D0OA 3DF9A 2JD1A 2VK8A 2Q2WA 3T61A 2FPIB 2NVUA 5JJKA 4PZZA 5C7LO 3QBEA 5CLGA 4ZFNA 4O3MA 3FTNA 5CYFA 3V7YA 2BPOA 1CY1A 1DFIA 1C8LA 1QH0A 1QYWA 2HC9A 2X14A 1ECFA 3DCJA 3P94A 3QPBA 4TKUA 3L4KA 4P4GA 2VQEB 1BVUA 4KV7A 3ZJVA 3P9QA 3OG9A 1YJCA 4XJTA 4DLTA 3TSYA 1H0KA 5BWCA 2NIPA 2IX3A 5BQXA 1B8VA 2GJ9A 2XTZA 2HWXA 1ODSA 4RJKA 1KY2A 5HE9A 5IULC 5ECDA 3KVOA 1QGED 2X86A 3L9WA 4IMRA 4JEIA 3L1UA 4EI7A 4DG9A 3UAWA 4HQ0A 5EKUA 1GQQA 1BMDA 1MAAA 1I4DD 2IEYA 2XRFA 4P9NA 4XJVA 5M3BA 1EE1A 3WP0A 2CLEB 2Q2QA 3N70A 2PR2A 2H3EA 4X71A 3ZTTA 4HNAA 3VDNB 1OW3B 4DSAA 2DAPA 2Q41A 2WJGA 5CX4A 1CVIA 3E23A 3TCKA 1C0IA 1YQGA 1H94A 2YW2A 1V95A 3EFHA 2ZXUA 1YZHA 2HZ7A 3I5AA 2JGIA 1H2BA 3V7WA 3VPDA 2VTBA 3BREA 3LVBA 2YZGA 5EGSA 3KJGA 4CVNA 4UU7A 3SVLA 3LU1A 2ODWA 3BE5A 1BJKA 2VF8A 4FYXA 4DA0A 1C1XB 1RM4A 1INLA 3PNBA 3UFBA 1KZ4A 4BWGA 2Q1YA 5LQKA 1XFDA 1BDMA 4OXXA 2C3YA 5T4EA 1P1CA 1D0IA 4KR6A 1RWWA 3WNZA 1V1MA 3AEZA 4XX1A 5CX1B 1KAQA 1VGRA 4EA8A 4HAWA 3MWKA 5CNIA 2RHCA 3RNOA 4EHFA 2PNFA 4RPIA 2X9GA 2PRIA 4B74A 4YAKA 2PSEA 4UAGA 1YB6A 3PCXA 1PJ4A 2C31A 3C3AA 3IAS1 2V9CA 3QUQA 4U63A 2VUTA 4O0LA 4P7BA 3ZWDA 4QQKA 4W4TA 1LQ2A 2IE8A 3T5CA 2AF4C 1G63A 3MRTA 4L74A 5CR9A 1DVRA 1DINA 5GAJA 4PINA 1K98A 1E20A 1UJ6A 1AXGA 3CE9A 3KPJA 4GVXA 1N36B 2C9ZA 2PMDA 5HK8A 5DYIA 5FWXB 3HXQA 2R47A 4N5DA 5BW8A 4IDNA 4K1XA 4BVFA 2DWUA 1GSIA 2JH9A 3V32A 5FDFA 2JCBA 4WVFA 1TPZA 4LY0A 4RV4A 4I19A 3G2OA 4N8EA 4AURA 1FFYA 1ZXXA 1N4DA 2EBUA 3BRQA 4W63A 1WW8A 1D03A 3EIOA 1A96A 4Q05A 5E9WA 3ZWCA 4IICA 4FDVA 4L4SA 3TDKA 4G36A 3GGGA 2QLTA 3IUNA 3D8SA 1KS9A 3HYLA 5FUVA 3WGUA 1Q21A 2NSDA 3P4XA 1E5XA 1V9CA 4HMQA 2ZR8A 1W44A 4RQTA 4X1YA 5CA1F 1REQA 1TMKA 2IZ1A 1M8FA 2AB0A 3FHJA 3LT1A 2NZJA 5IBPA 3SBEA 4LJRA 1XMVA 3I09A 3L8DA 4ZA2A 4YY3B 2WE8A 4WJKB 4ZOLB 5CB8A 5DTQA 5FAXA 5B2ZA 4IUDS 3ET4A 4QWMA 3FOCA 3WYDA 4BE9A 3R0JA 3IYLW 1X8XA 1E0KA 1GUFA 1Y4DE 3EW7A 4M9UA 5EKTA 2JAWA 4BV3A 3A2KA 4JLBA 1GSOA 2VHUA 5CDHA 4IDOA 2CCGA 1WY5A 1Z0ZA 2BM0A 4WA7A 5KKAA 4FWIB 5L3QB 3RU3A 1Y9AA 1M6VB 3AO0B 5IJ9B 1EWQA 4RSGA 1LUAA 2QSJA 3RQIA 4HDRA 4O4HA 1Z2OX 4BGEA 4RJIA 4RXMA 3DEIA 3NONA 2OR3A 1T5HX 2C99A 4F46A 1QGZA 3ZVLA 1Y63A 3EDYA 5JAMA 3KS9A 2EKPA 2CHQA 3MWYW 1E98A 4L9WA 1EFDN 4LYGA 1W1UA 2YZNA 1QNLA 5C4IA 3G8BA 3AKCA 1EK1A 1GTL1 2BLLA 4N9QA 2F4VB 3IQXA 1HDRA 2CXPA 2Q5QA 3LRTA 3ZHSA 2F3PA 4AZWA 3VAZA 2GD0A 3DEKA 3OFKA 1SIBE 2J0UA 4LYAA 3BORA 3FPLA 3F7OA 1JUDA 3TMAA 4KLZA 3GZ4A 4JWTA 3K35A 3ETLA 2ZBQA 3IAUA 1T2DA 2N9UA 5D7BA 5KQMA 3EFOB 2J3MA 5DBOA 2YHSA 3FFBA 4FNOA 4QAJA 4UZFA 4Y6RA 4DXDA 4G0VA 3D2AA 3F96A 1Y4ZA 4NZPA 2B3DA 4BB0A 2AC4A 5TPWA 2X4IA 1F14A 3N6XA 3P2EA 1ZNZA 3UH0A 4RZ2A 1H05A 3TZCA 4D9NA 1LPSA 4JA2A 1JR2A 1ZRNA 1F0YA 2QE6A 3H16A 4M53A 2C2KA 1AQ6A 5DHTA 1W0JA 1E77A 2NU9A 3RUCA 4ZYUA 4RULA 1P61B 4A8JB 4NZOA 2MSKA 1PJSA 1P4JA 4FR2A 3GB9A 2QD5A 3KK0A 5DBGA 2C5HA 3EEQA 3GK3A 2CUKA 4XWYA 1H2FA 4V1CI 2OE2A 4UOZA 4BLRA 2BMWA 3OVMA 4NNOA 4BVAA 3UJDA 3A8TA 5IZ4A 5K2OA 4LDAA 3PDIA 2WDPA 3KB2A 4XSVA 3HCCA 1RMQA 3MJRA 3AZOA 4HOYA 2IUTA 3OLCX 1Z0JA 1Q7RA 4AY4A 3GA7A 3LKVA 5JH7A 4PC1A 2XCOA 2BDTA 2IELA 3CVWA 2C5GA 4MMXB 2PJDA 4U9HS 4EB0A 2B9VA 3D8RA 3RSGA 5BR8B 4IIJB 1YOVA 4LF4B 1STOA 4CEHB 4S2UA 3QH4A 1ZVMA 2WWFA 2QN3A 1X1RA 1RJFA 2EOAA 3QEAZ 2IY9A 4YRKA 2GCGA 5DMHA 1U9CA 1YZFA 3BE6A 4OP2A 4J3NA 3LUPA 2GHTA 1VYVA 2O5VA 3R77A 4L3VA 4Q18A 1U7XA 2F1IA 3CW8X 4XWWA 1PR5A 4IXTA 3H9JA 3T9FA 4BFWA 4DA7A 4QFMA 1J0EA 4J2OA 2DX7A 2OECA 3CUWA 3EARA 1DC5A 1PWZA 2TSYB 2GESA 3D2LA 3FCAA 3N5KA 1W76A 3AFGA 4KOAA 2JHFA 4UATA 3B9BA 1G5PA 3QXXA 4FC7A 4JOBA 3NOXA 2PA3A 3MTJA 5A2QA 2O8FA 2CVQA 1F2TB 4XUDA 1YRQA 1GGFA 4IVRA 4L8WB 3R6TA 4O4IA 4RWEA 4EQZA 4FMDB 3A31A 5JYEA 3MIIA 4LDJA 3FTEA 1YI0A 2Q9CA 4P84A 1YRAA 5AHRA 4P5DA 2B92A 3VKVA 2GM4A 3GD5A 4P36A 2LDBA 4L85A 5AKEA 5DM70 4HDNB 4Q3NA 1C9JA 1EXNA 2RE8A 2ZDHA 2HFKA 3MERA 1MNAA 3W5UA 1GPJA 1XQVA 1U2EA 1VKZA 2EAUA 3AKYA 3IOMA 5HBGA 5I4KA 5IKMA 2A30A 2IL1A 5C1DA 4CEIB 4GMDA 1AT1A 2C04A 1E1MA 3R5JA 1C80A 1MR3F 1G6KA 3CB2A 2LP4Y 4A3SA 3KEQA 2D62A 3LLSA 2YZ2A 1F1BA 4FCWA 3K20A 3HJFA 2QT1A 5BQOA 1XKLA 1NLZA 2ZR0A 2QUBA 2ZBDA 2HADA 4JJ8A 5H4HA 4ARZB 4BFXA 2V0NA 2YRXA 2OWEA 3B51X 3LP6A 3A37A 1W85B 4I2VA 4NF2A 4DCUA 2R1TB 2YMMA 1PHPA 1VB3A 2E3JA 3ES9A 5ILQA 3SC2B 2CVHA 3DT6A 2FSVC 3TXYA 3F6RA 4RD4A 4ARBA 2IHJA 4H1HA 4BFUA 4IMIB 2IEGA 2PZAA 4PR0A 5L9AA 2QU7A 5DLPA 3P2YA 4F60A 1JNXX 4QTYA 3GFQA 3GUCA 3IE0A 1DB3A 2QY9A 1HI9A 3NEJA 3K92A 4YJDA 1J8QA 5JD6A 2A5LA 2E4ZA 2PX5A 2Z1DA 1X42A 1GTJ1 3L7BA 3MEQA 4GPIB 1UMCB 4Z3DA 4X44A 3WLSA 1IQUA 2YMPA 2IHBA 3ZK8A 5JROA 3L40A 3N75A 1V3VA 2GJAA 4OXNA 4DZZA 4E0BA 4G9EA 1ITZA 3IURA 5B1YA 2YNMD 1TYDE 4Q82A 1MRSA 1T8RA 5EQDA 4PYOA 5GJBA 1QU2A 1EA7A 3IB3A 4C7BA 1Z47A 1VYHA 3TSOA 4GKAA 3FDZA 4Z0TA 5LMNB 2R25B 4DUGA 1VYUA 4OVKA 4DNFA 1OLUA 1Z2PX 5AXBA 1VC2A 3RSHA 2B20A 4GPBA 5DX0A 5LC1A 3WYBA 4AK9A 4FSHA 2AQHA 3O3OB 4B9AA 1HYHA 2QPLA 4LECA 4UULA 4ZU6X 3WL3A 2HU8A 1J5XA 2AJ8A 2QRJA 1U7PA 4FB4A 3W7VA 4KZPA 5FBZA 2IXBA 3KQPA 1Z8NA 3WV5A 1C50A 4PXAA 1P2SA 4UUNA 2RBEA 5I7AA 1SWWA 5JD3A 4X63A 2GLUA 5K2MA 2ZIXB 1RXYA 1N7HA 2QP3A 4FNMA 1VPTA 3AI7A 3H8SA 4V0NA 3PKJA 3ZXSA 1NVFA 3J7AC 4QM6A 2PXHA 3SBXA 4P2GA 3ACCA 3X2EA 3IQDB 3I53A 3JR7A 3K0EA 2I2XB 2OD9A 2W2VA 2XVMA 3V33A 1BW9A 3H1BA 4FKZA 2DR3A 3HFJA 1G21A 2H1HA 3M4ZA 4H3VA 4KQEA 1EX1A 3R7AA 3DKPA 2GKSA 3TNFA 4CV1A 2Q3DA 1SZPA 1NG9A 4FSDA 2I3ZA 1F17A 1IB0A 4P6VF 5CG2A 4CUJA 1L5YA 2WM3A 3KB8A 4CTJA 1JBQA 3K2EA 2D5IA 1UK7A 8OHMA 2BCGY 5J4YA 3AK4A 3ZX5A 4CT0A 2LPMA 4ZPXA 2DT8A 2WSIA 4HAYA 4HMOA 2JAXA 5IDWA 4YJGA 4L5AA 5DGHA 4TYQA 5KO2A 1ZJ5A 4CKXA 4QDZA 4EL5A 4LYHA 1BQ4A 2Y0EA 2CD9A 3CKYA 3GN2A 3IPYA 1I2DA 4IKPA 3GBVA 4GR5A 2EZ4A 2BMJA 2WKWA 4ZXPA 3PJFA 2O7NA 4CM6A 2GNAA 3TTYA 3QLJA 2QTRA 1ZIOA 1CF2O 1XZFA 4MGHA 1NF2A 5F7JA 2E4WA 2LE0A 1S9DA 3W3AH 3QVUA 3D1JA 3MWDB 1PWHA 1RI4A 3QMVA 1I2AA 5EY5B 5ADWA 5MGBA 3V4VB 2O2IA 3L5OA 4I50A 4UXIA 1WXXA 5DXAA 1DJNA 2EERA 4QPPA 3SXPA 1W30A 5JJIA 3MELA 1MX5A 5J47A 1JHPA 5CM8B 2VR1A 4OU4A 4U2CA 1DQPA 1XZMA 4KYUA 1K8XB 2X6QA 2DBVO 3ZBPA 1A5SB 4KOEC 2JFOA 2REQB 5GZ1A 5I5GA 1Q12A 4I8DA 4W8OA 5HDBB 1KAHA 1LLQA 1MOZA 3SX2A 3TQHA 1CV2A 2O0MA 3ETCA 3F4LA 3G9UA 3I5YA 4E14A 4RS4A 3FX2A 4K81B 1SVUA 4BMPB 2ZSFA 4PPFA 1S3IA 4LZPA 2JIQA 1DXOA 1TQ4A 3R3SA 4BLTA 3JZFA 4IFBA 3E4DA 1E8DA 4P7GA 3SYKA 3O3NB 3BGDA 4C76A 4GOKA 4UOEA 1TUEA 3GF4A 2GX6A 4KDRA 3V34A 1ZBQA 2XQFA 1Z2NX 5TQ2B 4RD6A 3OJWA 4POOA 3PNYA 4NJMA 4KMSA 2PT7A 1S2OA 4MROA 1NAHA 3VR4D 4TZ0A 5KQSA 2KLBA 4AXBA 4ROTA 3RG2A 1QSGA 3FFTA 3V9PA 5L3SB 2VS1A 3O9ZA 3ZWNA 5BQ5A 2JHGA 2HMTA 1W5TA 3CYFA 4NC9A 3JS5A 4TMXA 3C7CB 2J30A 3CFYA 3G0HA 4CGYA 1SEPA 4NCIA 1RQPA 3UAZA 3VYSB 1U0FA 1YJQA 5FEMA 4OI0A 1PUXA 4RA6B 2GCOB 3OEHD 3EPLA 4CXMA 2Y71A 1OJLA 3HEMA 1B3RA 5EE1A 1S7GA 4AMBA 2QRGA 3AB8A 3UAOA 5EXEA 4H1UA 4E08A 1MGPA 1WUHS 1YB7A 3DAGA 5EPUA 1JFLA 1Z7GA 2QPTA 1QVRA 2DMRA 1RWVA 1N25A 3E7WA 1NR5A 2O7QA 2O19A 1B26A 1IRIA 1K5GA 3TM4A 1ZEMA 3LH5A 3PYLA 5TQVA 3BERA 3IT3A 3ZDXB 1O54A 1XVTA 1XAIA 2QT0A 4H7FA 2O14A 4YDRA 4YWJA 2B61A 3CVYA 3E7DA 1R1DA 3L8YA 1AKVA 2O3QA 4CIAA 1UBJS 1YL5A 1XPRA 4FE7A 1K9SA 4C30A 1BVYF 3LI2A 2IP4A 4WUVA 4TXLA 5H82A 3S2SA 1KH1A 3MUOA 1EGAA 4LZZA 3T15A 3I4FA 2QTZA 5IAAA 3EVFA 4H0FA 3IAHA 1XKTA 1TO6A 3H65A 3PTLA 4IHJF 4I3HA 2C7VA 4KK4A 1L7EA 3RK0A 5DF1A 4D2IA 3HBJA 2WUFA 1Q6YA 1I2BA 2CGEA 1UPXA 3DZHA 1N0IA 3HUFA 4TRMA 1PLJA 2NP6A 5JWOA 5BMOA 2ERCA 3VNRA 2OENG 1GKLA 4EF4A 3ED5A 2RK3A 3R09A 1M0SA 3D6UA 1W48A 1CQIA 4JT8A 2HI0A 4BU1A 4BUJA 1BS1A 1RM5A 1T4CB 3A28A 2RH4A 3D1LA 3GQBB 3IFSA 4QELA 3JQ8A 4Z2YA 2I5PO 4BNDB 1E9BA 1N3YA 2WUWE 5GINE 1HETA 5EI5A 4R54A 4DM7A 8LDHA 1P5ZB 1LX6A 2H08A 3C3YA 3IUYA 4QDJA 4XTRA 4ZOAA 3PDWA 3CLKA 1HQCA 1F4PA 1TC1A 4HFJA 3ROEA 4K9DA 2NPFA 1M1YE 1HZZC 3O8RA 3EF1A 3GEHA 2DR0A 1OFGA 2WOOA 2ZJ0A 4MNTA 4QBIA 4DBLE 3UAVA 5KU1A 4CTMA 2NOAA 2J9XB 1N6HA 3NANA 3KQUA 3VH2A 5ITZB 5TQ0A 3LPLA 3UG6A 1URPA 1Y5LA 3Q2KA 1XTRA 1IL0A 1HE2A 3VPHA 1FVHA 3LHDA 4C7KA 1BGXT 4DUZB 1LDNA 1L7QA 4WCFC 2NU6B 2A9JA 2IZ7A 3PX2A 1MIOA 1ZK3A 1U9IA 2WU1A 3OQIA 4R0MA 2JB9A 4RDCA 3LE8A 3ZE2B 2OAGA 3TKYA 3OLYA 4MV4A 1B8UA 1YZUA 2R6DA 1WZCA 4PCLA 3H7IA 3TI7A 1ORRA 3DMHA 4Q7LA 3OUUA 3ZWPA 2W6ID 2JGNA 1TB4A 1NVUQ 1DKRA 1VCNA 2B8NA 3BJRA 3IHTA 5IAEA 3WTBA 1B6GA 1J8YF 4NCHA 3EWNA 3WOVA 4D80A 3U39A 2F8SA 2J33A 3BMOB 4OV6B 1WUIS 4X45A 1VZ2A 3G2KA 3S2GA 8ABPA 5CJPA 3SEZA 1T8TA 3HN7A 4X8OA 1RLIA 3I1FA 4MW0A 2J5BA 2ZYIA 3VR5D 5FUMA 4TKLA 2QAGC 2H00A 1CNMA 2Y4OA 2NXJA 4AX8A 4TTTS 4YCAA 1MV5A 2Q1XA 4FFOA 4UMFA 3UK7A 2TS1A 3T4PA 3DD1A 4EG1A 1JDUA 1JE1A 3LY7A 5F2KA 1OUMA 3E1SA 3L1JA 3N0RA 3UK0A 1FL9A 2WNHA 3MXTA 1MW9X 1A7AA 4QVKA 5FOQA 3LTNC 2RGYA 4U7FA 3U80A 2H59A 2DUUA 4HGPA 7MHTA 2FF7A 3D54D 2BFPA 3JWHA 1E64A 5DXJA 3KAPA 4OFBA 1QFJA 3HJAA 5BPHA 2FPGA 3GJYA 3O84A 1OXVA 5EJ2A 4MIEA 1KRHA 2QMYA 3WRXC 2OUKA 1JF8A 5LSAA 3K9BA 1SK9A 3BH7A 1ONNA 3UOAB 4B3BA 3GVCA 2I34A 5KWSA 1KJZA 2PQMA 4G63A 3QJ5A 5IKEA 2XYQA 3F67A 1U3TA 2XGOA 5HUJA 5EHGA 3ZQJA 3J81A 1Y7HA 1YDMA 4YJ2B 1JZSA 4WXYB 2J3DA 4CV0A 1PYGA 1XRPA 1FTSA 4G4IA 2MMCA 3JU3A 4H2DA 4KQJA 4C4ZA 1DHRA 2VCYA 1Y7LA 2H2DA 3FYTA 2IH4A 1GU0A 3P9CA 2PLAA 1U1DA 3G0OA 3OPXA 2EG5A 1AA9A 1G8JA 3QE9Y 3ETNA 1HMYA 2EG9A 1N0UA 2HKIA 2V7VA 3N05A 4XPIB 3SXUA 1XN4A 3ZVMA 3AUKA 2J3KA 5SYMA 3VPCA 2VQFB 3IEIA 2W6ZA 4PVDA 4FFDA 2XXBA 5K01A 3TW4A 3P4YA 5I7VA 2EX4A 2JFFA 3EZLA 3GDGA 2OHJA 4J16C 1F48A 4JT9A 4QE3A 4RXTA 5CB6A 3A1EA 4NYJQ 2H06A 2ID7A 5KX5A 5DRTA 2WIFA 2PUJA 3OZXA 5EVCA 4R2WA 4JUCA 1DV1A 4MVJP 3ZD9A 4MZXA 4NOJA 4Q00A 1RRPA 1Z12A 4IZOA 1T9GR 3EPPA 3IEPA 3BJZA 1FDSA 3F90A 4TWBA 4D43A 2FMKA 3ZJ4A 1H3NA 4QRDA 1AK2A 5JDIA 4QATA 3CVXA 1G8YA 2VTDA 3EXHC 4QTZA 1E9FA 3TVDA 4OJYA 3EN0A 1KK2A 4B73A 2PD3A 4CF7A 1TU0A 3M9XA 3EEOA 1QUEA 4C4YA 2VATA 2HJHA 1QQ5A 1RCUA 1VCIA 5FTJA 3TX6A 2FZLA 2P9YA 2VEDA 3K2QA 3FYUB 1I7NA 1K86A 3WMEA 1QH8B 2KWIA 2W93A 4Q47A 3RU7A 4BEBA 2UZIR 3M8KA 4XI9A 3ZCRA 2XNCA 4GR4A 4IJUA 4PICA 4F3RA 2IUSA 3EQ2A 2QD2A 4KE9A 4LS3A 1PQUA 4OP1A 1ST3A 3PJDA 4G85A 4GQBA 2FGKA 4PTYA 3WLIA 4HF7A 5IBRA 1QM5A 2XVXA 2GA8A 2YINC 3HC7A 5FBLB 5T4HA 3PNOA 4BB9A 1I7DA 4DLBA 5HM8A 4CLDA 3NKLA 1KYVA 4MRAA 5L4SA 4JB8A 3W34A 1R6DA 3CA8A 1ISHA 1IZZA 1PRYA 3M6VA 5KYVA 5LZ5A 1CUEA 3FHLA 3NHWA 1NYRA 1EAYA 5ALLA 1BSVA 1P62B 1SVOA 1N1GA 4QGFA 4BNTA 5KNCH 2D00A 6REQB 5FV4A 5J4HA 1QP4A 2YICA 3V1LA 4QPDA 1RYMA 1VL2A 4WZ6A 1D9XA 1QR2A 4KAXA 5JS6A 1ADYA 4NZ9A 3VR2D 1FFWA 2G67A 3AERA 3CS3A 1RS0A 1D4FA 4IO1A 5DEIA 4ZT7A 5KOJA 5D1HA 2F55A 2PGDA 2B3TA 1WPRA 4PG6A 4RW0A 4N39A 4AS2A 3AF6A 3EJWA 3HO1A 2Q3FA 1IHXA 1JA1A 4IOJA 2XA9A 5HTKA 5EZYB 1A8QA 1QIIA 4XJSA 3DF7A 1L7NA 2E5FA 5BO5A 3ML1A 4GLBA 1UOPA 4ZGWA 3WISA 3ZV5A 2FQQA 4DAOA 1Z0SA 2D4HA 1W88A 3KQSA 3PCRB 5AK4A 2O8DB 4X7PA 4K2HA 3ZIUA 4C4XA 1UXHA 4LQLA 4YRRA 6CHYA 4OLFA 1FF9A 3ULKA 3D6TB 4B6PA 3R74A 4MQBA 1X15A 3OBBA 5L45A 3L77A 3HB4X 1U2TA 3SKXA 2VZ0A 1I3NA 4KWEA 5DH9A 4KBGA 3WQSB 3KJQA 4B83A 4NEGA 3DMPA 4A6XA 1P80A 1M75A 2AG1A 4IEEA 1GT91 4W5QA 2PS0A 3BIJA 3FCUB 2IU3A 1G2IA 1X1AA 4IJVA 4ETWA 2GOYA 2OZLB 3E15A 1NNI1 2XRYA 4IXMA 1QTQA 1ZM3A 4Q02A 2EYQA 1ID1A 4W9RA 2I6FA 2Q5CA 4LY9A 5A0TA 1FJHA 1FLDA 1KJ9A 1DDOA 4NJOA 2GQ0A 3ZLUA 4TS9A 5FADA 1PX0A 5FLXA 1P9LA 2BGGA 3O4HA 3NAMA 1SBCA 4DE5A 3T3GA 2YHIB 2AVNA 3QPVA 4J0FA 2YMQA 4W5OA 2FQ1A 1U2SA 3O93A 3O8QB 2X2OA 5A3SA 2IW3A 1JXMA 2WHRA 3II6X 4PZCA 1RDFA 4OLAA 1SQ5A 1N5DA 2PX4A 5ALVA 1TM3E 4BRUA 2HPZA 1CQJB 4H60A 2G8NA 1KNQA 1DU4A 4ALIA 1GQFA 4RZQA 2O1EA 5IUNC 4RELA 2OQ2A 3MCWA 5CPFA 2I87A 3PUKA 1ACLA 3PPVA 4PHFA 3WGQA 2HWKA 1YQTA 2B4AA 3GGOA 1F8UA 4XFKA 2RG1A 1RI1A 1X8KA 4M0DA 1T9DA 5AWFC 4FTWA 2PRZA 1XPUA 4OQFA 2O8BA 4HV4A 3NM4A 2HOQA 4K8RB 3CLRC 4RTNA 4BO5A 2IOHA 1PGJA 3KUXA 3BICA 4X8LA 1XV5A 1CFZA 4RMJA 5AJHA 1NJGA 4EB3A 5I48A 4X8MA 1JQBA 421PA 4BATA 3L0YA 1IY2A 1EJ6A 3CRNA 3WWZA 4YAOA 2KX7A 1GAWA 1XLVA 2HA7A 1QFYA 4B4DA 1LC0A 3WQQA 1H0HA 2OXIA 4NULA 1RHRA 3FN4A 5ITWA 3EBLA 3GDOA 4Y1FA 3A3PA 2YWDA 3G1WA 4FOLA 1RHKA 4L76A 4KQ6A 5G0SA 3F9CA 2NWQA 3D6AA 4ESHA 1FTQA 1L5OA 2FWBA 2IQ5A 3I12A 4JVSB 1E0SA 3RSZA 1E2KA 3WBBA 2YHBA 5D85A 1S4QA 5EQFA 3MQFA 4HB4A 4R7TA 3SMQA 3WJAA 2ZDQA 1UJBA 4UFNA 3V7UA 2AFHB 5F7ZA 1MTOA 4DSNA 1EJ0A 3BXOA 3L7IA 1H69A 3QVTA 4IMJB 5I9TA 3T7AA 3UJ3X 5KDLA 2B30A 4B3IA 1OLXA 2YRFA 1NFRA 4E2XA 4HNTA 3IQIX 4Z1OA 3E48A 2WK1A 2CFIA 2DH6A 4MWOA 3OA2A 1SHJA 2AR9A 4LI0A 1P1BA 1W73A 2BHTA 3I3SR 3I6YA 1NBEA 1W4BA 1Q16A 4ZAGA 5TR9A 4NNPA 4ZO6A 3P9YA 1O6BA 3DYIA 2OOKA 3QA9A 3SHTA 1W1IA 3WIUA 1VJ1A 1KI3A 5A1TA 2XUKA 3HWX1 2CE2X 4HDMA 3I6BA 4LPSA 1JHYA 5AKKA 3HU2A 4MVJD 2QN2A 3AV3A 3QOYA 3WNQA 1CHDA 4H1TA 1Y1KE 1KPGA 4YN3A 2BM8A 4RPHA 3RVOA 1MHPA 2H2HA 2HWUA 2XMCA 4FCTA 2OD7A 4RVNA 3TS1A 1MMFB 2D2XA 3BHMA 3FTPA 4UDOA 2GN8A 3R0VA 2Y92A 4BQNA 5LU9A 4JJGA 2RI6A 4FGZA 4MCAA 2W5UA 2XXAB 4KVGA 1J8DA 3IAM1 2DFTA 4FMPA 3N3BC 1IWPB 2ZSKA 1H1LA 4JB2A 2ZOSA 4QOIA 1ENZA 2HK8A 2FEXA 4DGSA 4O25A 3CNNA 5CA0F 1GDHA 2RI1A 4HAIA 3BMCB 2K2QB 2LTAA 3ZQUA 3SY8A 1V39A 3AWIA 5ALOA 5K7SA 2X0DA 5MN6A 1R0BA 2YV2A 3M2TA 5ALRA 3OT1A 2E4VA 5LA6B 4HJXA 4YQFA 5AVVA 3SQWA 1LXCA 5DNUA 3LQ2A 1R9NA 3MPUA 4AQ7A 1TIKA 2FQYA 4BZXA 4INZA 3T3NA 1C3LA 1ONOA 1QFSA 5DULA 4BQIA 2FEWB 1HDCA 4OD0A 4B71A 4XEUA 2REOA 1RJEA 2H92A 1TYEB 2BZGA 2JJQA 3N0WA 2CVOA 3O1IC 3PI6A 3R20A 4C08A 3OE7A 4TT3A 5GM2A 2ZETA 1L4GA 1IOWA 3CRRA 3UPDA 2IS6A 1G55A 2IFTA 4INJA 4V0LA 1RPJA 4GOXA 5EKXA 4OXYA 4URHA 2VWQA 1KP9A 2HU7A 3HXKA 2OBFA 4UCQA 1C2YA 4ZCSA 3MGAA 1W4AA 2VP6A 1M0EA 3DOUA 4EJ6A 5G1PA 1O96A 1PUIA 4P3KA 1BA3A 1KI7A 1XB2A 1JQKA 3QX7A 4YV0A 1GTMA 3M6IA 3PRYA 3MMXA 1J33A 1DG3A 2QRMA 3B6ZA 4MKXA 1QK4A 4AJ1A 4ABYA 2IHUA 4KE8A 4YHBA 4BVLA 3RAFC 1JAYA 3HKEA 3QNUA 1ZCFA 1YKFA 2X3UA 5INTA 1ZU4A 2B1RA 1F4VA 3PT9A 3L0ZA 5AVOA 1YFJA 2ZTUA 1N78A 2G71A 4IIGA 3KDAA 3RT7A 3MUFA 4TMWA 4JJ7A 2BI4A 1N5IA 2IH2A 4X00A 2OFOA 1ODKA 1DJQA 3D7LA 2F62A 1EZZA 2PRSA 4Z3OA 3DZCA 2MSLA 4ND3A 2N42A 3R3UA 4IRMA 4J1TC 2HSEA 1RBMA 1VMDA 1JDSA 4BC0A 4HVLA 2ZJOA 5DK4A 3K09C 3RODA 3HFRA 3IHKA 4Y9SA 3LHSA 5D84A 4E1BA 1OT5A 1UEIA 2JFZA 3IBGA 3UMBA 2IPOA 3KL2A 3CGWA 3PI7A 4MPPA 5J2TF 3UVEA 1J9ZA 2ERYA 1VG8A 5A04A 4I55F 5LQDA 1SKQA 2IYNA 3OCVA 1P3DA 1KJYA 4WFJA 1L8XA 3ZYCA 1W19A 5B3LA 1KOFA 1BCRB 1N0WA 1X38A 4KN8A 3OIGA 4Q37A 2HMSA 4V39A 4UZSA 4D9GA 4TLAA 3HBLA 1Q83A 2ZAOA 5F52A 4Q4HA 2RKOA 1YWGO 4ALKA 3QE2A 3HCNA 3RFTA 2X7XA 1GIAA 2PBLA 1Q1AA 2B1QA 5IXSA 3QA3E 3M5DA 1YACA 4M98A 2OG2A 4NRDA 4L9AA 3V1NA 4KRGA 8AT1A 4MUJA 4RZIA 5K8UA 3LJKA 1AS2A 2P7HA 3ZXIA 4OHZA 3THXA 3GRZA 3D0KA 2IPNA 3RJMA 4XVHA 5IT9A 4W5WA 1HO3A 3LC1O 2AG8A 3AJDA 4LMRA 1G64A 2CDBA 2W83A 5F33A 3NVMB 4F7DA 2R8BA 4OFWA 5B4VA 2DUJA 3LQ1A 1NUSA 4EHBA 1F2DA 2P2ZA 3DMTA 3HCPA 4RPLA 3Q0EA 1EFRD 4AROA 4LYDA 4ONEA 3ZOZA 5CK5A 5CB0A 5BSTA 4XIFA 4OSPA 5GZ3A 3OJOA 1EJ2A 2H9AA 4KQWA 4MKRA 5IF9A 1R6XA 2G9QA 4L27A 4A6DA 1ECJA 1EWVA 2HF9A 1U3WA 3ABQB 4HGZA 5E6RB 2IVFA 1E18A 4FBLA 2C57A 2OAQ1 4QLOA 5CAEA 4X66B 1NOJA 4ZHSA 5LP1A 1XDWA 4F9EA 3I62A 1A98A 2AUNA 3ESXA 3TW0A 1E2PA 5DASA 3UMGA 2YIMA 3PRHA 3H13A 3VBEA 1NT2A 2V3CC 2AH5A 4U9UA 1SURA 4FZ3A 5SY6A 3ON5A 4OLBA 5FT9A 1PVVA 4ZMRA 1TIBA 3OKAA 3PD1A 5DYGA 4I9HA 1G8AA 3H4IA 1PZFA 2NUPA 3F7TA 2X22A 3OQBA 3WX0A 5C1BA 1U8EA 2IK8A 4LV8B 3EGOA 3BK7A 1L4KA 3DCYA 4HZUB 4LUCA 5G0WA 3SG0A 5JQGB 5IWAB 3KQLA 4OX9B 2QJFA 2HN9A 4EG8A 1C3JA 4JQOA 5D3KA 1CRWG 1LDYA 3VM6A 1JR3A 4MUHA 4ENSA 1Y7PA 1TT5B 3UT6A 4FSXA 2G3YA 1R37A 2EWVA 2P75A 2O8EA 3W5JA 3ZWYA 4C5BA 4IX1A 1ZLXA 2ZRFA 2V7EA 3U48A 1Y5IA 4N4AA 4AG6A 1DARA 4Y9TA 3GZTB 1EX9A 1UBFA 4IWNA 3IDOA 3Q5DA 4WNYA 1V7ZA 1XTPA 2Y1LA 4BBAA 1EVKA 2BL4A 5E9JA 3NBQA 4LXIA 1JTEA 2IOYA 3OKFA 1BVRA 4X3PA 5FIUA 2G36A 2J59A 4U6QA 4YEDA 3SHWA 1KTIA 2ZT5A 4LSMA 5ALDA 5GP1A 1E8NA 1V8BA 1VL0A 3DQZA 2IEZA 4QDXA 3T3HA 4WBNA 2RB5A 1N2BA 3ELYA 3VH1A 2CJYA 1FUUA 2YIDA 4OHWA 2YN4A 3D6MA 3Q8MA 3VZSA 1O9HA 1WP4A 1CY6A 2JK1A 2Z8XA 3LC2O 1N5LA 3M5CA 1N2IA 2C98A 4F7WA 4OHRA 2ZQ5A 4WFIA 1R16A 3HKBB 1Z8DA 5ULLA 2O05A 2BM9A 3Q7PA 3TLBA 3TNDA 5KSWB 1NKSA 2BFAA 1WMFA 1ELOA 5B53A 3TVTA 4DMUB 1HQYE 4YMGA 3M33A 2Z6VA 1Y8CA 2PZBA 2AZMA 2AX4A 3C48A 2O5RA 2X77A 1T5BA 1THTA 3GPBA 4JDPA 4NAVA 5FPKA 4TXJA 1K68A 2IDZA 3GRRA 2PZJA 5L7TA 2X1LA 1FP2A 2IY7A 4P4NA 4WOBA 4I66A 4XM2A 2V7QA 1MOSA 2X8WA 1YSCA 2NVBA 2QVLA 3HWRA 1RRGA 4XCVA 3N2EA 2EF0A 2B34A 4MA0A 2IBTA 1CEQA 2H17A 2QX6A 3E22A 3QLVC 4RMNA 4LOJA 4CL8A 1BXRB 1PVOA 1T6BY 2JD2A 3G2QA 5EAIA 5K0GA 2BGMA 5KVVA 4ETMA 3BGSA 4PYIA 1OZ0A 3HCAA 2K87A 2RAUA 3TAXA 1DTWB 3F8SA 4JCOA 5KQLA 1QH8A 3H2IA 2IHKA 1PGNA 4TUYA 3ZCTA 5HJ5A 5L53A 4UHDA 5F98A 3KWJA 1EM6A 1AMUA 4BWYA 4L8YA 2GZDA 1OTHA 3C7KA 5L6LB 4TVKA 3E6AA 1E9EA 3A9CA 4UTXA 3KT3A 1F7UA 1OIVA 5H4GA 3BL8A 5JHGB 1F06A 4UPEA 5DMXA 2W4IA 4EEZA 1OI4A 5FTKA 5DHQA 3AR4A 4YAJA 4C78A 1O58A 2NSYA 3ZE1B 1OCEA 1XNGA 2HRZA 3BWEA 4EITA 3O4JA 1QH1A 2VK1A 4OAQA 4AQYB 1NJ8A 1F3LA 2P9BA 3PC6A 3QE3A 5TE9A 3KVYA 1JTFA 2Z2XA 3VSBA 1ISJA 4C07A 3FAKA 4U0JA 3VTFA 3R0XA 5E2BA 1JTVA 3WYNA 1TGYA 1MEJA 1YXMA 1I3CA 1NBMD 1T0BA 3DNFA 1RXEA 3CH4B 1X7XB 4HWPA 2ZJ7A 1T10A 4NFYA 4BOYA 4DCOA 5HQTA 4H3KB 2J9ZB 4I5FA 2OWDA 5E1OA 4A73A 5JYBA 3CG0A 1KMCA 4GD3Q 4EWLA 4WXRA 1TDJA 2Z2YA 5M2QA 1H6AA 1LLDA 2XUGA 1KMMA 1XMPA 2DLDA 2Q62A 4KFSA 4NABA 3GPCA 4EKNB 2WFLB 5JMTA 3JD2A 1J20A 5AHXA 3OMWA 4LHXA 2M1XA 4G5FA 2G6TA 4P53A 1Y7IA 2YC4C 1QGOA 4HGYA 1H85A 3KT6A 2JF0A 3M34A 5FWYB 3ZGOA 1CNEA 3JZAA 4MUFA 4TVBA 4UVGA 3RUFA 1RNLA 3FWHA 4GMFA 4ISBA 2XY4A 3IHWA 5J1SB 1TIPA 3KKLA 5AQ1A 1KJIA 5K0JA 1DC8A 3PUXA 5IHXA 1NJ1A 3LDGA 1U94A 3OFJA 4UNSA 2ET6A 1RWMA 3VDXA 1TTHA 4QLAA 4HAOA 5KVQA 2OBXA 2CJWA 3V7FA 3A4MA 4OHUA 4HLUC 1PBNA 4B43A 1ISIA 1O89A 4C3OB 3F9RA 3WA6A 2QTGA 4B8WA 4GI1A 3VR6D 2RD2A 3O1HB 2XOEA 2BGKA 2GZMA 1PFUA 2JLAA 3MJEA 1ATZA 2WW8A 5B3JA 4ZVQA 2ACEA 1Q0TA 3BDVA 3DZJA 4TTAA 2JIPA 2XB2A 1NUUA 4M1SA 2IWHA 2QKYA 1NE2A 4G2NA 3T0GA 4QNMA 4WNIA 3IT0A 4MCHA 3UA4A 4WESB 4BB5A 4Z4IA 4R1SA 1ZI6A 2GS9A 3KFLA 1QOZA 3O8QA 4PRZA 4ES6A 1Y3HA 3K2IA 5ADVA 3I0ZA 1A0OA 5EZQA 4JOSA 2GAAA 4K6MA 2WWYA 3I9V1 3AHDA 1HLPA 5KUTA 1VL1A 5HRCA 5DNYB 4TV8B 2R6AA 1MXFA 5C1IA 3DDHA 3HP1A 3X1ZA 1EUQA 2L2QA 1ONPA 2R8EA 1A69A 4HWRA 4KQIA 4REOA 1P60A 3CR7A 4UM9D 1BCSB 3NWBA 4DIDA 5JNVA 5LIRA 1ODIA 1O8BA 1ZIPA 3HUTA 2WILA 2DETA 4UUMA 4H3SA 1II8A 1Y4SA 3CPEA 3QKSA 3BFPA 4NYJR 4B85A 4C7MA 3IAM6 2Z04A 4Z7QB 4IAOA 2FPPA 3K6SB 2PUHA 4ZQEA 4ZARA 1SZDA 1FQWA 2PSDA 1ESCA 3N2KA 5JCJD 1PJZA 3GT4A 5JJCA 5EJ4A 5LWHA 3EVAA 4WNAB 2ZJ6A 3DOHA 4G1EB 4D4HA 4P82A 3FJ1A 1E9RA 1XJWA 2BIFA 2H8GA 1E2FA 5EJ5A 2HMYB 3EZFA 2ICAA 2YXLA 1G5RA 3EF0A 2WV9A 2XODA 5LD2C 2WAYA 3OE1A 5BOSB 2X7JA 4NBLA 1P1IA 3E7FA 2PL3A 2M6SA 4KR7A 1V37A 4LFCB 4CV3A 3OUZA 4H6PA 3E2PA 4FT2A 1IXRC 4ENWA 4TM7A 5FNVF 3D4LA 4ED9A 3OCJA 2ZCVA 1GG5A 1SK8A 3OOEA 4K6CA 4RK5A 3SS9X 1L5MA 3PRJA 2OOSA 4JEUA 1DRUA 1P4RA 1KI2A 3MSCA 5LM3A 1X9HA 3E5MA 3GBPA 3OJ0A 2HY7A 4RAQA 3W5AA 1M2VB 4QYTA 1QKKA 2GZ1A 1GGHA 2ZYRA 4NBRA 5LQSA 4A16A 4C6TA 2C00A 3LIPA 5C2JB 4CL0A 1VIDA 2QSYA 1QRAA 2UAGA 3T5MA 4H7KA 1OI7A 1R8JA 3MTDA 3FE2A 3GRCA 2ZAIA 3R2JA 3ORQA 1Y6JA 3OJEA 4N3NA 1BE0A 1PJQA 2BGJA 2YXBA 3FRJA 5ALYA 2V8BA 3F1LA 1Q22A 2HK7A 3DR5A 1Q84A 4LZOA 1LDMA 4H6WA 1KAGA 4ZD6A 4TQUS 3SR3A 3V8QA 2ZUCA 4ZHQB 3IR5A 1PT8A 3K0BA 1Q5PA 2VP9A 4Y2UA 5JHHB 3FCCA 1DAFA 3OIDA 4UCFA 5AICA 4A2WA 5BURA 1OWOA 3AINA 2R8RA 5CDGA 5TMBA 1NXXA 1H42A 5IF3A 4M1EA 3NR2A 3SZOA 1FQJA 1RJGA 1XCOA 1CE8A 1Q3KA 2AYYA 2EDCA 1DFHA 1FXWA 1U2DC 2WJHA 4LOHA 2ILTA 1YUBA 5LB4A 1ZRSA 2VRBA 4RD1A 2OKGA 4QAQA 1YF3A 2XXAA 2WWTA 4ECEA 3CT4A 1DXQA 4HHEA 4J1NA 2W98A 4IH4A 4O4JB 1L4EA 1YZYA 5CPBA 1JA9A 1DXYA 3LBFA 3IKTA 2IBSA 3O2JA 5KINB 2VZEA 3G1TA 5F1KA 1YJ5A 3BHNA 1UK9A 3PZBA 3TZKA 2GFHA 4HFNA 2HX1A 3CH6A 1Y4AE 1H9BA 4Y0NA 1TQ8A 1O8CA 2VJMA 2WG1A 1RXCA 1W47A 3T5PA 4RV9A 1DKQA 2QR3A 5CB4A 1T1GA 4QEZA 1FMFA 1IN5A 2C78A 2YWGA 3BTSA 3WLMA 3EDMA 5HUQA 3G88A 3O8DA 5KYNA 5JZBA 1PAUA 4Y6OA 2NU8A 1N2CB 1IUPA 4Y1RA 3A1WA 3PWKA 3C6QA 2CWDA 3R9WA 2A7QA 1J0CA 1KYTA 1L4YA 4JIMA 4DILA 2CLFB 1X3LA 3TFWA 2TMGA 2VUUA 2QU8A 1P18A 4F5DA 4S0XA 2I33A 2I54A 4MS3B 3U5TA 5C51B 3RWOA 3A06A 1JFVA 2R66A 3V4RA 4OCZA 4WXEA 1R7RA 4TKVA 1WCV1 4DEYA 4RHUA 3OEWA 3U0BA 1VCOA 1Q7CA 1K08A 1XDZA 1Z5ZA 3K3PA 4WCFB 2HR1A 5ICCA 5T64A 3UGQA 1EGMB 1NX9A 2MINA 1KOLA 3WLHA 3PEYA 4EHKA 3FF1A 3OZUA 3R1IA 2WJ4A 1GXSA 4D44A 2CBXA 2ZBUA 1U2QA 1VJGA 2YZ7A 3IDFA 4FJ2A 2YFHA 3I2IA 2ODAA 4QDTA 1G2PA 3QKRA 2VSQA 4GQAA 3EULA 3LXXA 2EWWA 2I3DA 1JLMA 2YJNA 2XQIA 1YTLA 1DG1G 3ZWWA 3CRQA 3F3YA 1JG2A 3BD6A 5IMBA 2FETA 1HE1C 3E3LA 4MRMA 4R0VA 5BN3A 4I4TA 2A35A 1YR7A 1MA0A 4OKIA 4FK8A 4QSHA 2V74B 5DGDA 2Q4EA 4MI6A 4AI6A 1JDBC 1A95A 3IPXA 3N7TA 2JL1A 2QAGB 3KAJA 3R6WA 1EWYA 5KJEA 3RTGA 3L01A 4XCXA 2Z5GA 3HVJA 3CB4A 5JAZA 1Y9EA 4RKFA 4RJJA 2V6BA 4NEHB 3A10A 1QC5A 1U0SY 4OK6A 4AZ3B 4NENB 4YRBA 5A5EA 1FTGA 2PYZA 2BKUA 2G76A 3RS7A 2VDUE 3H1PA 3B7PA 1HG0A 3ESDA 4GYWA 4JMPA 2JC3A 3FPJA 4FDMA 5LBTA 5JFTA 2D13A 2ECOA 4TL7A 5IW8A 3S3TA 2QDKA 5M7EA 4R84A 3A36A 3B85A 1O0BA 1GNRA 3FKSA 3QFFA 4WUTA 3NJRA 1K0UA 4RLSA 3ZW8A 2ZWOA 1ACJA 1Z4PX 3IAXA 1ZMXA 2QROA 2ZJBA 2QGFA 4I6JA 4MYTA 1F8XA 4QQFA 4GRIA 4DMFA 1NNUA 2PH5A 2AFIB 3BRWD 4I4NA 4AZ0B 3RVSA 4J0KA 4NH4A 1SCUB 3NAQA 1NYTA 4G4GA 1ZGGA 3CRZA 1QIDA 4RNDB 1T3HA 2DHCA 2EW8A 5HA5A 3OCZA 2XQGA 1I4EB 1MDBA 3ID6C 4EY4A 4X6XA 1E6UA 4N0QA 4WACA 4RVDA 1EFPB 1ZONA 2AS0A 5BVHA 1F2VA 2P6UA 2GPAA 2Q3HA 2NO9A 4LBZA 1XA4A 4K40A 1LRJA 1JYFA 2GN6A 4PZLA 3PIRA 3DGFC 4J7CA 3QW2A 2FP4A 1U90A 2YYZA 3L4JA 3QMMA 4A6EA 3B3GA 4C01A 1XVUA 4RHTA 3FF4A 2QXTA 1SXJE 2AOVA 2YN0A 3WNCA 1SB8A 2A1UB 2G28A 5IJ0B 2H31A 1PT9A 1A50B 1LVGA 1PWYE 3G02A 3OU7A 1LDGA 5CT5A 1TLLA 5FHRA 1Q95A 2CZCA 1HTBA 3BCHA 1DELA 3QVKA 1OI2A 2YNMA 3EEBA 3P2MA 5ICFA 4ARSA 1HFKA 1FDVA 1L5QA 1QDUA 1TVKB 2WPDD 4RIEA 5G3YA 5B1IA 5LOVA 2I91A 1CBUA 3G5AA 4O2BF 5C37A 1H6BA 4OAOA 3IP5A 4FGUA 2PRYA 1Z8FA 2MSNA 2FSGA 2H8KA 1DC4A 5IYZF 3VOAA 4LRUA 4PRKA 2A9RA 3I9OA 5CGZA 5BSRA 2BDUA 3DWGA 3EXHB 2ZE6A 4CKZA 3AG5A 1E58A 1JU4A 1QF9A 1K2VN 1X92A 3N2GA 1EX6A 3EAGA 3F73A 1JPNA 2F1HA 2I71A 3OAAA 4GKBA 2AD1A 1DIBA 2AG6A 1EK2A 3BSYA 2C95A 3FMFA 3ICOA 2Q49A 3PE6A 3DWFA 4QUIA 4M8KA 3I01A 5DDIP 3RU9A 4L4YA 2ZEJA 3LWZA 1H93A 2ALJA 2I6QA 1QPGA 1ULHA 4PVCA 5I7OA 1J7KA 1NFFA 2GK4A 1UJMA 3I4LA 3KT0A 1Y6FA 1V16A 1VBKA 2NV6A 2NXWA 4MW2A 1U5CA 2XHZA 1V4BA 2FR8A 2SCUB 5ESXA 1BROA 5DCLA 3IC5A 4YRJA 2YWRA 3VVMA 3CHYA 4M36A 1PL6A 1X7GA 2JCYA 3H1TA 2ZB3A 4FWBA 4YJ3A 2YWEA 3HA2A 5CP8A 4BL5A 4UFPA 2R7LA 3E8SA 2WHYA 2DTDA 3FH0A 1R64A 4OHOA 5DM4A 1A7KA 2PT9A 1WQ3A 3KC2A 3M4YA 4MIKA 1R0XA 3DZ8A 3NWPA 3ZU2A 3S27A 4HNSA 4O63O 4LRXA 2X1HA 2CFRA 4JLSA 2XTAA 3EOBI 4HXYA 1U8FO 1U7OA 3JQGB 1NURA 3N59A 1MC1A 4R9RA 1AVTA 5EHNA 4LQ4A 2J4FA 1R6TA 3Q41A 5DTIA 3SJBA 5JAPA 1C3XA 1QIEA 2XMRA 3IO5A 1AB6A 3NC1C 3Q15C 1OTXA 1YI8A 3S8MA 1A2QA 1NF8A 2Q1UA 1QG0A 2OD2A 3DLAA 1GRCA 1Z7EA 2DT5A 1PYDA 2QD1A 3GU3A 3K4HA 4WXPA 4MDEA 1U63A 1O2DA 4AKTA 1KDTA 2ZFUA 1JBKA 1OH7A 1W34A 4G1MB 2DKNA 1O97C 2V03A 3D5QA 4JAVC 2ORWA 5JYCA 2XX3A 1R88A 1PWEA 2QHXA 1YZGA 3MN1A 2UZ1B 4Q9IA 5EMHA 2ZIGA 1YQDA 3GLHB 1CJVC 3LT2A 4X8HA 1L3IA 2I2CA 4BVBA 2GEFA 2P3LA 2IH5A 1VG1A 3QM1A 3OICA 1TADA 2M2IA 5LB2A 2BFDB 1A27A 1T5DX 2ECQA 3HR4A 4QXQA 3T7RA 4XCQA 4FX2A 2XWPA 4JEMA 1EEXB 1UODA 1X8JA 3QELB 4ZOBA 5CMLA 3TL2A 3S70A 3RPEA 1BAPA 4LGMA 3PC3A 4D0NA 2BUBA 1Q0LA 4RD2A 4UTOA 3I9V6 1KJ8A 1KMHA 2WU8A 1NJSA 3SC4A 4QVGA 3OF5A 1PK8A 5REQA 3DP7A 3WLEA 4HXEB 4E1AA 2J9GA 2V9ZA 4OBBA 4PO1A 1LBQA 1BA2A 3HU3A 4Q01A 4XGQA 2ZYGA 3D8HA 4EW1A 4C7VA 5DHRA 4DSOA 1E59A 1O0SA 3IOBA 1X1BA 4PC2A 5DKFA 4EA7A 3FGPA 4RLFA 4L4ZA 5E6SB 3VR4A 1IJBA 4Z86A 3PHHA 5I8ZA 3JQDA 5EHXA 2MU1A 1NDQA 4ZAFA 2Y8EA 4EG7A 5MFPA 1I0IA 1ZFNA 3D8BA 3L8GA 3JQ9C 4QJ3A 1ESMA 1Q0RA 2ZJ3A 3L05A 4OQMA 4P93A 4MQ6A 2ID4A 2UZ0A 3O8NA 1L4UA 1MOQA 1OWNA 1VDMA 3LQRA 5KYTA 4YO8A 2HV8A 3A27A 1UXGA 2Q5IA 1C9EA 3KLOA 3QLTA 4BFCA 4B3SB 2VUHB 2P4UA 3OEHA 4B5KA 4YLGA 2BN4A 1M8KA 4G26A 4DWWA 4UD6A 3NWJA 4KMOA 3LOUA 2NO1A 4L6CA 2VOJA 3D0QA 1TD9A 3KOUA 2JD0A 5ILOA 3DHYA 2JIZD 1AKYA 2P7IA 1C8VB 2QM8A 2X0RA 4Q1VA 4E13A 1IBKB 1MH9A 4BZZA 1UBGA 4D3SA 1FRQA 1WOYA 2GTHA 3O8OA 1FMLA 2FLVA 3R3ZA 5LZ2A 3FDFA 4QU9A 3V8VA 1WDTA 4QVIA 1ZNXA 4Q9KA 3CNLA 4JLPA 3A11A 3QVMA 2OLJA 2BFEB 4X1KB 2GUWA 4KIGA 5C8YF 4RTRA 1F5SA 1E2HA 1NMXA 1PLKA 4HLDA 4RFSB 4ETNA 2QUIA 5HCNA 5KVSA 4LF6B 1GUZA 1M7BA 3IUJA 4ND8A 1AUQA 3RC2A 1Y9JA 3JASB 4M8SA 3PDCA 3ZWVA 4QU8A 1EXWA 1DDIA 1YH3A 3ZY3A 1GDDA 2EEZA 4YT5A 4JITA 3ZU3A 5AW6A 1B41A 4AJ9A 1JDPA 1N2JA 5H9VA 2OPBA 2R7MA 3ND7A 1C7RA 4A15A 1T9CA 3E35A 2BUAA 3A05A 4MPJA 2OBBA 1PTJA 3DFIA 1E7WA 3P0HA 3RSCA 4QLBA 1ODCA 4OAPA 3PGJA 1VL8A 1KY3A 4YASA 1KDRA 4X6LA 1O97D 4GMGA 3EGIA 2I2WA 3JXEA 5KTKA 4GT1A 2Z09A 2AN3A 1TT7A 3W6UA 4O4LA 1O95C 1IN4A 1JIQA 4EUFA 3LX5A 3OUTA 4XIYA 1FZTA 2Q4OA 4G1VA 3RS9A 2ZSBA 1NDHA 3PQ6A 4HAXA 5C46F 4N1AA 1GV1A 1SNYA 2IYQA 3L5KA 2VNKA 3HZHA 3OM1A 3OZIA 4IZ6A 3MTQA 3ZYZA 2XYPA 4E3ZA 4ENQA 5B7NA 5DBIA 2B5WA 2I9PA 3QVGB 4HN4B 5IT5A 3NOVA 1OH6A 3JW8A 4ZJPA 1U3DA 3NDPA 1Z6TA 4NZZA 4JZYA 4QYIA 4MR9A 5KTYA 4BKPA 1KYQA 4JP2A 3O91A 4PY2A 4G5XA 5DI3A 4EF6A 4K9OA 2JAOA 2C54A 2DPXA 4KVFA 2O8VA 3GUVA 1GLNA 4G0MA 4FGWA 3TQSA 3VNVA 3B3AA 2FG7C 5I9MA 1SCDA 3NBUA 5KYGA 2HPHA 3LX4A 3OPYI 3ZXYA 3KYJB 1TJNA 3GLIB 4F3KA 4F9FA 2W6IA 3QJYA 2NPOA 2PKQP 2C3MA 3R3HA 2YDXA 4OMCA 2WE7A 3UJHA 3E9EA 4MB2A 5JVDA 2FH5B 3ASZA 4KTTE 1O1YA 4LWZA 4HSEA 4CR7A 2WT8A 5F73A 3I8XA 4NLLA 3L7YA 1NUAA 3VR5A 2ZRCA 3JD4A 3W9BA 4IV5A 5DN6D 4IWYA 4UUOA 3N8HA 3AX6A 2AF3C 4CCYB 4DPKA 4J7UA 5P21A 3ZZ1A 4J6EA 1Y3CE 1NNEA 5GM1A 3GRPA 4HL6A 1UT5A 1ZC3A 2HPAA 1E9CA 3VNAA 5CEJA 4FIZA 1KGSA 4JEHA 4WDRA 4IDCA 2IXTA 4IHAA 5BSMA 1TQ6A 3B3QA 5IFLA 3K94A 1UKBA 3BSSA 4UU0A 3EA5A 5K8VA 5H16A 2F17A 3EXG2 4FFMA 1VL5A 2BH9A 2J7PD 4KJZA 1KH3A 1CJMA 3LC0A 4P3XA 3GIWA 5FBKA 3ZS8A 4CPDA 3I1YA 2CFOA 1T1SA 3T06B 1WDMA 2P4SA 1JEDA 4QTTB 3SIXA 8ADHA 4LCBA 2BKXA 3GGSA 3EXFA 3IV6A 3PA8A 3FSRA 2VHEA 3OX2A 3T3EA 1WNTA 4PM4A 3TOXA 3VSEA 5G0TA 3ED1A 1AV7A 2BR3A 2NTNA 2XTNA 3AQ4A 3CJRA 3RC7A 2F8TA 3C5WP 3KPVA 2ADMA 3S44A 1E62A 2C2BA 5B1SA 5CLHA 3JR3A 4RANA 3E9NA 3I3OA 4ZQHA 1Y5NA 1SRQA 2DFLA 5TLSA 4D98A 4OIFA 1GVHA 1I80A 5LP6F 1ZOOA 2VHTA 3KYDA 4FYPA 3V2HA 2B4TO 4B84A 3A0RB 2DECA 4AG3A 1FNSA 1YBVA 2IYVA 3VR3D 1A4UA 3B20A 3IP3A 4WEOA 1BMQA 1WD7A 4WK4B 3W4KA 4WE3A 2B37A 2JA2A 4GLLA 1FS4A 2PKXA 4LMAA 5ALIA 3GOQA 3FI0A 1L7BA 3K9CA 1H66A 1N6IA 1JMYA 1TJYA 2HMAA 4RGBA 3EXEB 3KAKA 1M2EA 3ZR4B 1GUDA 1O95D 1UJ4A 1E2EA 2ODTX 2W00A 1E8MA 4E33A 4P54A 3OY2A 2DWCA 3U7FB 3RHFA 3SLRA 4QYWA 1V4VA 2F43A 3BXHA 3H04A 4X1IB 5K3AA 1I51A 3W2HA 4EYEA 1M1NB 2IXEA 3HJCA 3JYNA 4RTSA 1XNQB 4HY3A 2W6OA 1QDLB 1C1DA 1W1WA 4HJRA 4J49A 1CERA 1XDGA 4ZOLF 4DJFC 4EUEA 7REQA 3U60B 3BWCA 4MS3A 1P6QA 3EIUA 1B4DA 2GRAA 3PLNA 1E3TA 4Y2XA 5BW6B 3PT5A 3QUTA 5K8LA 5JZVA 3FFXA 3KETA 5JRZA 3OQHA 4U7TB 2VQ6A 3KYCB 2WWWA 1T2CA 2C4TA 4GXNA 4KAJA 4YK7A 3U5ZB 3ORFA 4KC0A 2QXUA 2ORVA 2Q8QA 4NSNA 3RK4A 1F7VA 1K06A 1GGEA 3BXEA 3DMNA 3LYAA 5FBQB 4EQ6B 3TF5A 2QX9A 2P3SA 3R3XA 4XOUA 1Z5VA 2V45A 2PCLA 5FO0A 1U28A 3U3DA 2G7ZA 3KEMA 3PIIA 5A7GA 1E9DA 3M1YA 1YU9A 2E6UX 5GMOA 3T99A 1NPTO 3LXMA 1ZWLA 1I6MA 1UXKA 1E9SA 2DCUA 2HA2A 2JLCA 3GHYA 3P2IA 4HQRA 2SKEA 4DCSA 2ZJ4A 2HRRA 4M37A 1YB1A 2C8VA 3HZOA 1P19A 1V5FA 4PN3A 1V11B 4MUNA 5AXAA 3SF8B 2O2XA 1GNPA 3MCUA 3LDFA 4R1MA 3K05A 1MB4A 3EDCA 3OMLA 2J48A 4MA4A 2HB6A 1ONSA 4GPAA 1EFTA 3IQFA 2AK3A 3V4OA 2PGLA 5FKJA 3N7AA 1KYZA 5DU2A 3I2JA 3HA7A 3ROXA 3W4JA 1FDWA 1UANA 2REXB 3IXMA 2RGNC 3VR2A 5DT9A 3DOEA 1UT8A 3DJYA 2PHZA 3FTQA 2WV7A 2HJ9A 4FLEA 1XGKA 1TF2A 2ACKA 4GEKA 1EQAA 3WKBA 5B58T 1U1FA 3BMQA 2JIBA 3T9AA 2RGDA 1JFFA 4I1OA 4QFCA 2Z2KA 2BBWA 2CJXA 2IKQA 3KYBA 1EPUA 3AVQA 3P2JA 4FMCF 4V02A 3LFTA 3MGGA 4EENA 1AXRA 4G0OA 2IW1A 2C5FA 2PBZA 2VAVA 3KZ1E 4LE1A 3EC1A 3MINA 3KKQA 3NH6A 4R8LA 5A02A 5H9WA 1JSCA 5BV0A 4BKUA 4CQJA 3DUFA 4PPQA 3WK4A 5L3VA 1EFPA 1MQ9A 3DJFA 3I2FA 3P45A 4A26A 4CLRB 3JQ7A 1BG6A 2WWHA 1W52X 5EJFA 2P6PA 2VNAA 3EGXB 4IG4A 2EARA 4TMTA 2YXNA 5EKDA 2DQZA 4PLVA 3ZH2A 5D00A 2QBYB 1V41E 4QO7A 4YRIA 1BIFA 3NLLA 3ZE7A 5EE3A 1XDSA 4Q21A 5BWBA 2PVPA 1P73A 5DGXA 4E32A 2PG3A 1UKCA 2JDIA 5K3BA 4BIMA 1UL1X 2DY1A 3HVIA 4U3JA 5ED0A 4B6JA 1KMQA 1NW4A 2PH7A 2QE7D 4XDYA 2ZIUB 3H9GA 3GLGA 3BAZA 2PZMA 3O73A 2LIVA 4Q0MA 1VSUA 2FUEA 3ELBA 4AM8A 3IJPA 4RWZA 3TZQA 1COZA 3BL5A 4C7XA 4DSUA 4EM6A 1RI2A 3I58A 5BVGB 4ZAXA 3EYAA 1T91A 1COWD 3UT5A 4E09A 3CSUA 2AN9A 5KSPA 4UVIA 1PQPA 4G5SA 4RVFA 3H1EA 2A8YA 4LGVA 1DV2A 1LNZA 3VVLA 2UZAA 3F5SA 5DGCA 4AMYA 2VDQB 1A7JA 3KSRA 3BH0A 3Q3EA 4PANA 5C8DA 3VAAA 4DLXA 4UM9B 3JALA 5WRFA 4KH0A 1ZVVA 1LFAA 1JEJA 4FMBB 4RIIA 4RKQA 2H18A 1WUTA 3TIGA 5CVEA 1GAQA 4LJ7A 5DYWA 3IKLA 1B93A 1NGSA 5ALUA 2PNJA 2RG7A 1N9KA 4FMDF 4DZTA 1ENYA 2C77A 3GRVA 1SC9A 3ZI0A 1NQUA 2HJGA 5CT9A 5I4BA 1HWYA 2RHHA 3KD3A 4WADA 5CXXA 1ZR2A 4MW7A 1TUBB 5KTNA 4F2PA 4C6SA 3TOSA 2I55A 4Q4CA 1TCAA 4PSKA 2AWOA 3VFDA 1PFVA 2X5OA 2H65A 1CVRA 2GTIA 5H7XA 2YYSA 4ZN6A 2GBLC 1ZGJA 1WDLA 3TUZC 4FBMA 1LCIA 3OC0A 1H2WA 4RSHA 2RCNA 1RRFA 4C0BA 2O8CA 4BV2A 4DT1B 2X9LA 3ONDA 5T8KC 3UT0A 3OZDA 5LUBA 2GWHA 5I7EA 1Z56C 3BXPA 2HBYA 4HEQA 3RVMA 1E1CB 2PWPA 3IJEB 1UINA 3UWSA 2OAEA 4MKGA 3R5TA 4UEKA 5EP4A 4KR2A 1FX0A 3PX7A 4B6OA 1W6UA 3QE0A 3ZW9A 1J8VA 4B6RA 4CMCA 2G5CA 1Z5UA 1Q1NA 4P92A 1O5OA 1W9MA 4KN6A 2IA5A 3AL2A 4RENA 3ST7A 1G5HA 1QS0B 3CUSA 4BUCA 1UEJA 1G4AE 4BX9A 4EHAA 1FLVA 2JCSA 2J0VA 3AFNA 3S1SA 2VJPA 3BEOA 1CUCA 2BJHA 4RCVA 3V55A 1Y5RA 4XX0A 3PVZA 2VHYA 1KOJA 3LUAA 2MIIA 4GZMA 4MP8A 4UM8B 3ZDDA 3OTHA 4II7A 4F1WA 3ASVA 2QQFA 1II0A 4R1PA 3NI2A 2AA3A 2QTHA 3CJQA 3ZD6A 2X13A 2C3OA 2Q6OA 5AESA 1KIFA 2XUDA 4ZCRA 1VE3A 3TSWA 1OF1A 1CF4A 2HWYA 3W4IA 3B9PA 1T0PA 4MVJA 4PBTA 4TL6A 4WZAB 2Q6KA 2D1TA 2Q7OE 2ZKLA 2WJJA 3IUEA 1OB5A 1Y42X 2CWWA 3COSA 4H77A 4YRAA 4N6OA 2R5FA 3ET5A 2O0HA 3EBOA 2P3QA 3ESZA 3AP3A 2OFXA 5M34A 2JJMA 2WSYB 4GRDA 2Q5JA 4MQUA 1WCIA 4YCCA 4K28A 2HZBA 3ODPA 4FGSA 2JGKA 4EJSC 3D3KA 5FJIA 2J87A 1XQXA 3E82A 4YDSA 2PLWA 4RY9A 3X2FA 4FR0A 5KSOA 2W48A 4N0EA 2ADFA 3VDRA 2RCYA 3ZIAD 3LBAA 3M2PA 2ZVPX 3DB2A 2ENUA 4GLJA 4GOMD 4MKHA 2IGBA 2XAAA 1FK8A 4L8GA 1EVYA 1N6LA 1F5NA 1PSZA 3ANLA 3VYUB 5BXYA 2FMIA 5FA8A 3RI3A 4RTLA 3HKCB 4QGHA 4DA8A 4DGQA 1K4YA 1USKA 1R4NA 1HOXA 1P9WA 2EBFX 4HLNA 4YCBA 1BMTA 2D5AA 4BNNA 1JXAA 4MUGA 3U62A 2OC9A 3MJHA 2BTQA 1R5NA 4DR2B 1E1NA 1XYYA 2A5YB 2PZFA 2V0CA 3A9WA 4YP6A 1CR1A 4Z8YA 3E3AA 2KHZA 3GNQA 2NQ2C 4D4MA 3G0BA 1YGPA 3ROZA 1WEKA 2HDHA 4U2KA 4HTAA 3FCSB 1U3CA 3MRVA 3UPTA 5J4KA 4RA9B 2QTVA 4KWHA 4IXDA 4J29A 3W7BA 3HXMA 2WI8A 2EQ5A 5LD2B 3COZA 1CZNA 3HWWA 4I6EA 5JWHA 3VVCA 1HX7A 2R6JA 4M0LA 1J97A 1N2HA 1N8NA 1SUIA 2EFCB 3KXLA 2DRIA 3T41A 4N7RA 5IAOA 2JW5A 2VKQA 1ZYUA 2ZJZA 4JY7A 2ORED 4URVR 1O0CA 2PFKA 1ZJYA 5DCYA 2BGLA 1SBHA 4WW0A 4DXHA 3DE5X 5DO9A 1CLEA 4JROA 3WLLA 1M2HA 1DSSG 1EHCA 2FF5A 3LPNA 3LK7A 4DARA 1T25A 3GFVA 3NNDA 4ZU1X 4ITUA 3S2EA 1M6YA 3UAGA 4XM0A 3WAKA 4NARA 4JBYA 4BNZA 3KZKA 2C2WA 1GY8A 3AY7A 5G0VA 1G2OA 3LRPA 2FYTA 1OSNA 3QY0A 3STYA 1JDVA 2F00A 3DEHA 4M9XA 2B69A 5A4IS 4EY5A 1HE4A 2ZSDA 2GZSA 2RJ3A 5KREA 3SFTA 1CUJA 3VO8A 2H1OA 1Q0PA 3T35A 3VO2A 3DB1A 1EKXA 1EDBA 1VKHA 4MR7B 4OFZA 4WAUA 1NJ6A 1XA0A 3SSOA 3TD6A 2RI0A 1OGIA 2OV3A 4BBZA 4CLOA 1PW5A 4ND6A 3KKKA 4IM7A 3U31A 4ZYZA 1HDXA 2NV2B 3BPSA 3FPEA 4LK3A 3KAQA 3DFZA 4PLGA 2I7TA 3UMRA 5AVSA 3EIQA 5DEOA 5LNK1 1CZLA 2J3IA 5EE0A 3UA3A 4Q3LA 1TNDA 4TROA 3LGSA 4UE3S 4ZCMA 2I2AA 4KHPB 1Z7WA 4G23A 3OX3A 3B1WA 3ZDRA 3H8VA 3JVVA 3T8YA 1GARA 1IBLB 1HL3A 4CMAA 4D4IA 1O9GA 4MQEA 1FUIA 5JCPA 2QZJA 2OV6A 3H97A 4NCNA 3RAGA 1NQXA 4RZXA 1Z3IX 1SC1A 3R7NA 1OH8A 5I47A 1DUSA 1GITA 1P2DA 3KJXA 3I42A 4BUZA 1KI6B 3F6YA 2P9HA 4KODA 2GJSA 4RUKA 4XKJA 4RD3A 4DQLA 5AVZA 1X7YA 4YJFA 3DLHA 4AF6A 5G1NA 1R4MB 2FWNA 4KDCA 4AFNA 2VH1A 4ARAA 1DBWA 3PPXA 5GV7A 5H5JA 3KLBA 4DQKA 1A9RA 4H9GA 5EP2A 5SZHB 3LT5A 3RB8A 1CUHA 4L95C 3NDRA 3PFWO 4HBGA 2JH3A 3PG5A 4UTNA 3CCFA 2CMKA 2G9RA 5KMGA 1C8BA 4NU8X 1U1GA 4KYTA 5JMOA 3A6LA 3E9MA 5GQSA 3TUJC 1QBGA 5I9NA 3FKQA 4TLBA 3Q4GA 1KQFA 3WL5A 1XNJA 3AEYA 3BOSA 1OHHD 3MCAA 3CMMA 2H48A 3GNTA 3EG9A 3MBOA 1T4MA 3FJOA 5CT4A 4Z9FA 4H4CA 5L51A 2A9FA 3U3RA 1T5SA 5AYVA 1FVXA 2O07A 4KQ1A 1ABEA 4D41A 3T7SA 2GYUA 3DO8A 3IQGX 1JHVA 2BRUA 2ZR9A 3AEXA 4MEJA 4N03A 3KBBA 1I8TA 3VU1A 4O2AA 4EF5A 5SY4A 3U17A 4JU9A 3PJGA 2XBMA 2AXQA 4WT7A 1AM4D 4YIKA 5BWLA 1US8A 4EYSA 4F4UA 5HIAA 1DRVA 4O6VA 4PE5B 5FPSA 4X64B 1ESZA 4EDHA 5KOIA 1XK6A 3M49A 2C92A 1HT0A 5DPMA 2GERA 4MITA 4A03A 1NW8A 2AHOA 2OBYA 3G3EA 3CF6R 3R9KA 1FUKA 2X0IA 4PAWA 1KQ3A 4EFNA 3BDIA 2P6NA 5A71A 1VKJA 3MQ4A 3MYRA 4I5DA 5EOVA 3WBKA 2DSTA 3AR6A 2IOQA 4DPMA 2R4TA 3MC1A 4MS1B 2P30A 5F23A 5HUHA 3M6FA 3OM9A 3ZH9B 2YQ4A 1H0RA 4DIBA 4MVYA 1ORIA 1C3OB 3E8MA 4NMXB 2ONCA 2WAAA 1XX6A 4WGGA 2NZ2A 2Y77A 4BAZA 1JDBB 2CT8A 5AUOB 4II2A 1JU3A 1TX4B 1GA4A 2G70A 3ZCSA 2IS4A 2OP1A 4Q3OA 1YK0A 5AW1A 1FLAA 3AOEA 4KIJA 1KEWA 1B74A 2XLBA 3NCHA 2JFNA 4NAHA 1Z0UA 3DC2A 2OYCA 3MCTA 3AP1A 3G9QA 1E1RA 1NATA 3LLUA 3CUUA 1HZJA 2XECA 4TXNA 5FFNA 4MHTA 4OXRA 1P81A 4WH0A 5CNJA 5K3FB 3W2EA 3TKAA 4ZWNA 3OH8A 3CTMA 4EUKA 1O4WA 3E1KA 2AQIA 1KP3A 4QDOA 4EPWA 5H3CA 4HQLA 1NDUA 2GUGA 3LWNA 5KWJA 2JGRA 1FTNA 4B75A 1KDYA 4KQKA 1EXDA 2R8YA 1HE8B 1RVV1 3AOGA 3T3DA 2J32A 5ITSA 3B6JA 1IXZA 5LDGA 1JLKA 1XD2B 4NU5A 3TLAA 1MZPA 1HFWA 1X7ZB 4JENA 2JKVA 5CD1A 5TGZA 1K6JA 1XEWY 2QOEA 2YQ5A 5F4BA 1XZNA 3KXIA 1UQRA 3BKXA 4IOKA 1CUIA 4AUMA 5JI2E 2BONA 4R8SA 2WM9B 1HOTA 2NSLA 1BS2A 1QHXA 3ILHA 1UFQA 2EHDA 2VP3A 4FJ0A 4IW3B 3GCWA 4NBUA 4TTJA 1PQWA 4HTFA 4GZLA 3X44A 2Z1NA 1LI7A 1MA3A 3HJGA 4G5QA 5AI6A 4QSMA 2BEVA 3BSWA 3DVSX 2ZIFA 4Q9HA 5TMPA 4W7IA 1C30B 2DQYA 3I01M 4RCZA 4OGGA 3WLTA 13PKA 4J7XA 1O03A 3UKOA 1VBFA 4TVSA 4NDAA 2XMDA 5IANA 1XVLA 4BNHA 3Q7EA 4XB2A 4Y2GA 1VI5A 3MJFA 1EHIA 2QL5A 3G2IA 1QVAA 3RC3A 2ZZKA 5K3EA 3GJ5A 4TWIA 5CA1A 2HU5A 2XKKA 1XZHA 2JIRA 3TIIA 5FPTA 1OVGA 2PAFA 1WZEA 1TCVA 1AO3A 3CINA 3D6HA 4KAAA 4UDXX 4DREA 3FSJX 4WXHA 3WHIA 1G8SA 1SKBA 3CUTA 4ALNA 3T5TA 4C87A 4U00A 4BNJA 1JHRA 2BP7A 3TB4A 2XMZA 4KSBA 2PU5A 5GONF 1TM5E 4MYCA 4B87A 5A05A 2LD4A 2X5JO 3LYHA 3TE7A 3UQZA 2TMDA 4CKEB 1PZXA 1U7WA 1I4TD 2NO4A 4BQQA 4X20B 2C7BA 5HYVA 1ZN9A 5G02A 5LMCA 2Q29A 1SOVA