3EIXA

Crystal structure of selenomethionine labelled staphylococcus aureus lipoprotein, htsa
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
290
structure length
290
Chain Sequence
ASTISVKDENGTVKVPKDAKRIVVLEYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLIIADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKLINKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYLKGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRDVWARSRGLISSEEMAKELVELSKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of staphyloferrin A biosynthetic and transport mutants in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transport protein
molecule keywords HtsA protein
total genus 100
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3eixA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3eixA02
4MLZA 4ND8A 2OV3A 1N2CA 4BBPA 4TKUB 4N01A 4WN9A 5M3BA 5JJ5A 2PS9A 3LI2A 3MWFA 5KOJB 2WHYA 4GICA 5BVGB 3AEKA 1QH8A 4FKMA 5AFSA 1QGUB 3ZK7A 1N2CB 1QH1A 2M6KA 2QI9F 3AEUB 4OXQA 3PDIA 3PSHA 3R5SA 3TNYA 2MINA 3G9QA 1G21B 2XUZA 4UTOA 3AERB 3HXPA 3AEUA 1N2ZA 5BVHB 4NNPA 4XPIB 3TEFA 4UTPA 1M1YB 2XY4A 2AFHB 2Q8QA 1QH8B 3ZTTA 3AESA 2RG7A 1QGUA 4WZBA 5CX1A 1QH1B 5HX7A 3R5TA 5M29A 2PS0A 4B8YA 3ZK8A 4INPA 3AESB 2OGWA 4FILA 1EFDN 4H0FA 3MINA 4MDYA 4WZAB 2X4LA 3NU1A 4OXRA 4MO9A 2YNMD 1M1YA 3TLKA 1K7SN 2AFHA 1M1NA 3MINB 2ETVA 4INOA 1K2VN 4WNAB 1N4AA 4DBLE 1G20B 1MIOB 2AFIB 2PHZA 3K1AB 4PAGA 5M2QA 3ZKAA 1PSZA 4HMOA 5KOHA 3PSAA 5JOQA 4TKVA 5M34A 4FI3F 4HN9A 3CX3A 4ND8B 4TKUA 1KAEA 2XV1A 4WN9B 4K3VA 2XDQB 4PM4A 5BVGA 5KOJA 3EIXA 1K0FA 3AEKB 1XVLA 2PRSA 4HMQA 2XDQA 3AETB 4LS3A 2O1EA 1ESZA 3HJTA 3MFQA 4H59A 2MINB 2OV1A 1M34A 2WI8A 3BE6A 5KOHB 2XH8A 1G21A 3AERA 5BVHA 3HH8A 2OSVA 5GGXA 3UJPA 2Q8PA 4LJSA 1TOAA 4XPIA 3PDIB 5GGYA 4MX8A 1M34B 4UDNA 1H1LA 3BE5A 3ZK9A 3AEQA 1L5HA 4IRMA 5CX1B 2YNMC 4CL2A 1N4DA 1K75A 3AETA 2R79A 3MWGA 1FP4B 3U7QA 5CR9A 4G09A 4G07A 3MD9A 5JG7A 1H1LB 5FLYA 4WZAA 1L5HB 4WZBB 2R7AA 1KARA 1PQ4A 1FP4A 3U7QB 5HDQA 4WESA 2XQVA 4FNAA 4WNAA 1G20A 1MIOA 2AFIA 3K1AA 2PS3A 3AEQB 5I4KA 4UDOA 4OVKA 4NNOA 4WESB 1KAHA 4TKVB 5B58T 5KHLB 1M1NB 4HMPA 3EIWA 3GI1A 2M6LA 5JPDA 3LHSA 4M7OA
chains in the Genus database with same CATH superfamily
2ZAMA 4C4ZA 2J5BA 1YNSA 2ZRAA 3SR4A 4N01A 4BNDB 1VXRA 2C59A 4DCGA 4HVAA 1V25A 3R77A 3VKHA 2QTHA 1Y3BE 2RGGA 1CP3A 1Q91A 1Y8CA 1YKGA 2Y0CA 4M8SA 4TN5A 3VSEA 4E1VA 1LPNA 1KK1A 4ZCQA 4HDAA 4O4IF 5B1IA 3S8MA 2ORIA 4JLNA 2JFXA 4Y0AA 3W2TA 3A0UA 4DC0A 1GL6A 1XDUA 2H7XA 3AI7A 4MV5A 3C8MA 5JLJA 1NI4B 2LD4A 1S02A 4XVRA 1ELOA 4GI5A 2Z2IA 4XD7D 3QVWA 2Z8ZA 2LWIA 3BJEA 3WNBA 1NBIA 1DT5A 1JI0A 2MSWA 2XVYA 1KGDA 4BB0A 3NIWA 5FR2A 1J42A 1HEYA 2ZPAA 5FWYA 2P4HX 3PHJA 4QU0A 1QO0A 1Q84A 1DUIA 2UYQA 1L1EA 4QXQA 5LM3A 4FYVA 1E9FA 4B8ZA 3WA7A 3O1IC 4JJKA 2YJTD 1FSPA 1BNCA 4BQSA 4WNCA 5GP1A 4BLVA 3BJIC 1E98A 3NBZC 1GGNA 5FT9A 2HCRA 5F3DA 1E7SA 2PBZA 2O5CA 4LE0A 1Q1AA 3LG2A 3AF0A 1K7XB 2GAOA 2ZI9A 5JRJA 1MAWA 2RB4A 1I0IA 4RY0A 1RKBA 1GG9A 1BQEA 1ZH2A 5DHSA 1WA5A 2P68A 2HA3A 2J3LA 2RK3A 4C0LA 3ASUA 4R1NA 5IF9A 2WR8A 1M5UA 1MJNA 1DXOA 1EP9A 2PY6A 3TIFA 1QKIA 3CX6A 1UJBA 3OM8A 1SHZA 4NBKA 4WXEA 2F3QA 4W6QA 4IP0A 5LD2B 4CLDA 1TF7A 4FDLA 1ZVVA 4RKEA 3MS4A 2R8EA 4Q4JA 1WDKA 2OVFA 3GLVA 1TEVA 5AESA 1LRLA 2ZYVX 1I9CA 1QTIA 3PDUA 2MR5A 2Q5QA 4JBXA 3TW8B 1KWKA 1YVDA 1CEQA 2DBVO 1GIAA 4NY1A 4ZQHA 4ZREA 2IHUA 2CJWB 4RVHA 5JARA 1IBRA 4BMDA 1SD5A 2D4HA 2IYOA 4BHTA 1TMYA 3SNKA 5I7EA 2WNIA 3RFFA 1HDZA 3EXHC 4NVRA 1MC1A 2AVNA 2HHCA 3F4BA 3H2KA 1RZ3A 4DABA 2EKDA 1ITZA 2B20A 1Z2EA 2G28A 4N1AA 4YA6A 1IAQA 3C3XA 4FHEA 2AG5A 4YROA 1B1CA 1V6CA 3O75A 4M8LA 4LJ5A 4D1YA 5T8KA 4P86A 3WHKA 4F9EA 1NMYA 4JXKA 1W5EA 4EJFA 2EL7A 4AYXA 3QEOA 4G0OA 4NZYA 4TUYF 5EP1A 5JYBA 4U9IS 1EX9A 5JAPA 3PP8A 4RNDB 1SY7A 1YQXA 5I51A 3CA8A 4NMHA 2UUOA 4CR6A 1WPQA 2A84A 1YZTA 1J0XO 2A94A 4UBNA 3LDUA 2G4LA 2CE7A 3L77A 3GEHA 2BZGA 1M8PA 3NIGB 3R7DA 3RJZA 4U4AA 2H29A 4QDKA 1UAYA 1HKUA 2JVKA 4YRRA 5D8DA 1D1PA 4EMBA 2PJZA 4EKGA 4YMIA 4CFYA 3JSAA 1I4DD 2J3IA 1T2VA 3T95A 3IIEA 1IXZA 3KLMX 4KIWA 2CHGA 4OY3A 4RM3A 4I1UA 3PEWA 1DKOA 3DW1X 2B0CA 4B4DA 1EGMB 3PI6A 2OO5A 2G1UA 4D45A 1KR5A 2DR3A 3K0HA 2B98A 4OXQA 5CURA 3J81A 1Z8DA 1RQNA 4YGYA 1K6EA 3WWEA 3AEUA 3UPTA 2DFLA 4CTJA 1JAXA 1E2LA 2ETXA 4WXMA 1EI9A 3MGBA 4UAJA 4ZVNA 4TM7A 2JASA 3WWDA 4HWSA 4ER0A 3AO0B 4CXMA 1M1YE 2WG0A 1BXKA 1OR8A 1XLTC 2JGIA 3GGGA 3JPYA 1YMVA 4FFDA 3NORA 4B34A 3UQZA 2BFOA 4RD2A 5KVSA 3Q6NA 4CEHA 1SKBA 4TS3A 3LZDA 3MG9A 1WETA 4YQYA 2EX0A 4R8KA 1B15A 4TL6A 2HO5A 3GHHA 3EBLA 4NCHA 2H1LA 4P53A 4TXLA 4OA5A 5A5EA 3T34A 1GPLA 5L6LB 2AFHA 1RZUA 1JXOA 1USVA 1O5OA 1IHPA 2ANBA 2ZRFA 3I5MA 2RIRA 3L7JA 4XE5A 1KYZA 3OJLA 2IV2X 2WTUA 2P9GA 4XFJA 3EQ2A 4FLFA 1UZAA 1F51E 3UJ7A 2IZ0A 3EULA 5T5QA 4ZC1A 2V7WA 4C4SA 2HA0A 1KY2A 5BVGA 2Q5JA 1R8SA 4O2BA 3WLRA 2X0RA 4C5BA 3MTDA 1WUJS 4PXAA 5A7FA 1FFAA 2VDNB 1KC3A 2FPLA 4J07A 5HCIA 4EVSA 5JIBA 2YWFA 3QY9A 3RSCA 3U2QA 5BOVA 3BGDA 4RTKA 3RU2A 4EGFA 1BCRA 4Z8XA 4FU0A 1YQEA 5AMXA 5ADHA 2OV1A 4YV7A 1SOVA 5EXSA 4DCVA 3BZBA 4AZ3B 4ADSG 1DAKA 3EPLA 1KSGA 3SLRA 5F3WB 3AYXB 4PZZA 1QFMA 3ILSA 5BOSB 1GITA 3Q6MA 3W2EA 4MX8A 5GONA 5LMCA 4TMWA 1NVBA 4BNFA 4URHA 4W7HA 1TK3A 1UK8A 1TCCA 5B37A 3HXOA 3E9ZA 1JKJB 1V9LA 2LUOA 1PZMA 2EIHA 2JI9A 1RWWA 4YJ3B 2VF7A 3CF6R 5J4HA 1GNSA 4YQEA 2CCKA 4MKZA 1U8FO 5I9SA 1FZQA 1I0LA 1ZU4A 1ZG3A 1VIDA 1D4FA 2GRJA 2HA6A 5EJ8A 1LTQA 1PR0A 3ADOA 1SH7A 1D07A 1CWUA 2CYBA 1BYUA 2OBFA 4OBEA 3LWZA 2I2BA 3T3PB 5T3YA 3AUXA 2WVAA 4IXNA 4NDAA 4PRZA 1X13A 2ZE5A 3EX7C 3PX7A 1GAXA 4LK2A 3H9GA 3NTLA 2I3ZA 2WLTA 1XAGA 2ZVQX 3FFWA 3SE7A 3RYCA 1M8FA 5EXEA 1RVV1 2BW0A 3A70A 1AA6A 3GCGA 4ARCA 4X3PA 1BX3A 3R3HA 2PLRA 4LV6A 1K9VF 3KSMA 1JSCA 3ULKA 1QIGA 1WLSA 3LFUA 5C8DA 5C9ZA 5LQCA 1G59A 1NGSA 4UVDA 4IJMA 4A23A 1K97A 2EZ8A 3CGGA 3IQHX 3ZIUA 2ST1A 4P4TA 2H2IA 2FP3A 3I5YA 1KU6A 3DGFC 4Z4FA 2R8RA 3W05A 5BVGB 1W29A 3UV7A 4Q3CA 2ZRLA 3P2OA 2DY1A 2XOXA 4ALKA 3FNGA 4JI3B 2HNKA 3VHXA 4DJJA 3DBLA 1AY0A 3D6JA 4NBTA 4OH7A 2DFNA 3LSYA 3LA6A 5FOQA 4NNPA 2HTFA 3UV3A 4Q1EA 3VO1A 1GKIA 1R6AA 1NW6A 2H2HA 2C0PA 1JI3A 1R8YA 4U8HA 1U2QA 2EW2A 2QVCA 2NVBA 3OQPA 5A5FA 3BBLA 1XXHA 2D4AA 3FPGA 5JYCA 4MROA 2FSGA 1PWZA 1DC7A 2FPIB 4MAFA 2Q1YA 3LY8A 1C0LA 4LJKA 1TKCA 2IZOA 2DLNA 1P91A 5F64A 5AW0A 3PJDA 4CGZA 1H65A 1XZKA 4GOKA 2ZVDA 3SX2A 2O2SA 3F1LA 2B82A 4C78A 5IKEA 2EFEB 2QD4A 5INTA 2NIPA 4UCWA 4KW7A 4Q1CA 5IDXA 2GO1A 2OXFA 4AROA 3NC4A 1O95A 2E0IA 3LY7A 4LJ4A 3B6KA 5D5QA 4X44A 4JWKA 1KS2A 2BMEA 4G25A 2DBYA 3U13A 4KR7A 2Q1UA 1FU7A 2D00A 3WNVA 3KRTA 1EWTA 1E1CB 3NH6A 3IOMA 4QRIA 2Q3EA 3ED1A 2J07A 3JALA 1A4UA 1Z6XA 3QXCA 2Q6KA 4OTZA 1WD7A 1UFKA 3CQ9A 1XVLA 1LX7A 1A4IA 3R5FA 3WK5A 3WK9A 2CVZA 5JSZB 2F1OA 3FJYA 1W2HA 3LOUA 3LL4A 5E3IA 1M34A 2XT9A 1BRMA 3GP8A 3LVBA 2C8JA 3ESAA 3IAFA 3M6UA 2H2WA 5EXDA 2XB9A 5TQ2A 1BX0A 3QJGA 1E8MA 4ENQA 2IPXA 1MLDA 2RK6A 4MUKA 3A14A 5FL3A 2YYZA 1I5OA 2DHQA 3AJDA 3ZQ6A 3MXOA 1BFDA 3OKCA 1V9CA 1OAOA 2QLBA 3DKRA 1YHZA 4Y30A 3EVZA 3OE4A 3BQMB 3LNTA 2FQYA 3U6BA 4OHUA 4HNAB 4CMIB 4Z4GA 1XAJA 3DMPA 1SHLA 4MR8A 3W7VA 5G4KB 1CVLA 1BHQ1 3UC9A 1A69A 5JS1A 1IQPA 4EG1A 4PTLA 3QIVA 4JJZA 2R8ZA 3KZOA 5F7OA 4RKRA 1MOPA 2GK6A 3DAOA 3TMAA 3IPYA 4K05A 1RRCA 1QF6A 4G0YA 2YV3A 3EGVA 1ZK3A 2VUIB 4CTNA 1KMCA 4GXNA 4MQEB 1P9OA 1IATA 3C97A 4XIGS 4EJSC 4HBZA 3JQ8B 3R6GA 2Y92A 3I45A 1T8YA 4R05A 1VKHA 5FRDA 4ZHQA 2R68A 2PFSA 2JW5A 2WWGA 1AUVA 1Z0UA 4IV0A 4Z3KA 4IDFA 4V3CA 1L4MA 3OEEA 4X93A 1JFTA 5H68A 3IE0A 3JALB 5FOTA 1T8UA 3MUFA 3TLYA 1QH8A 1XMVA 3O3OB 3H17A 4EUSA 3JQRA 1FFGA 1QIFA 2WYHA 3G68A 4B74A 5E7MA 3I1IA 2VF2A 4BFTA 5G1PA 3B3GA 3ZR4B 3Q5DA 1PQWA 1FFWA 4JITA 5HNKA 1I6MA 2C8KA 4GHWA 1BWSA 5J2TA 3GLGE 3PL1A 1P2TA 4FYIA 2DR2A 2FEOA 3QNWA 1KH3A 2HF8A 4Y0NA 4YP9A 5J9FA 4PQFA 4C21A 4ZYUA 1DCMA 5G2OA 1Z7WA 1PZFA 1CLEA 2G83A 5BXQC 1N34B 2PMDA 3C4QA 5UKDA 4ZODA 2J08A 2WTMA 1OB5A 1U63A 1JAHA 3IP1A 4L8WB 3DR5A 1PSDA 1I10A 3QMPA 3H9JA 1D2GA 5LQUA 3P9SA 4F3KA 1X7WB 3EY4A 5FV7A 4QLBA 3JAWA 4CKEA 2I4OA 1JILA 1W8DA 2JL1A 3HVUA 2H18A 1TUGA 1HQCA 1E2BA 1OYYA 4Z0TA 1NNLA 3G2NA 4QVIA 1MZPA 1QTQA 4JH0A 3WC4A 3HL4A 1NASA 3R40A 4F8EA 3KT6A 4OYHA 1TVEA 4QJ3A 4OEHA 4E1AA 1ZGGA 3C1AA 4ZK6A 3GCZA 3P0HA 1CR0A 3L6RA 5LC1A 1UJ4A 3BMOA 3HBLA 1GZUA 5BUSA 1G8PA 4FI3F 3RSLA 3AMVA 5B3AA 5AK0A 3GAFA 3N28A 4O6VA 4HYYA 4EP1A 2LW7A 1KP2A 3DVSX 4NE9A 5EJ4A 1ZX1A 3TNDA 4KEAA 1GYRA 4UREA 4GLFA 4BLRA 5ITZA 3LLSA 4FFRA 2Q5HA 3JARA 3C6ZA 4LDNA 2BR5A 1LW7A 3K2BA 4MLCA 3UXHA 4AULA 3A9CA 4O4JB 5AIBA 1R88A 3I61A 3KB6A 1SG0A 1EUDB 2VWGA 4PO1A 2GEJA 2XUJA 5DMHA 2V1UA 2FZGA 4EY7A 3RHTA 2JIDA 1ZOOA 1NIJA 1JQJC 3EXAA 1U65A 1YJXA 2QWXA 3B2NA 1OC4A 3VOSA 2H1OA 1ISHA 4YXWD 1JB9A 3OJOA 4AF6A 4J0GA 4PRKA 4QNMA 5K1ZA 3ZWKA 2EJBA 3I32A 2VA9A 4RQBA 5DP1A 3DFUA 3KJNA 4EHJA 3ET4A 1E2HA 1XMXA 3LKBA 2O2EA 1WXGA 5EKXA 4IKPA 3DLIA 4RVUA 3HYRA 2CUKA 4OSOA 5FLEX 4X64B 4EH1A 2Q9BA 3H4TA 3PFFA 4JI0B 2XLBA 2AW5A 5I4CA 3D64A 2ZCUA 3WWZA 4E08A 5SY9A 2CN1A 3OD5A 1XVIA 2ZB8A 3RUAA 2P35A 2GPYA 3C7TA 3JAKB 3RVBA 3TLCA 3CVVA 2KJQA 3HQ4O 1DX4A 4NJOA 2B0JA 5FHQA 4D82A 4FDVA 3CLUC 2OCXA 1RBQA 4LBZA 2PZAA 4U7JA 5EIBC 5IDYA 2X58A 3DFFA 1KTVA 4ZVVA 4BRWA 3PUKA 2IUTA 1JL3A 5KUTA 2X15A 4EPRA 4QXAA 5K99A 5J23A 5DV9A 3UAYA 4CNQA 2QUJA 3FPLA 1P3DA 3JQAB 3LGAA 1DAEA 4ND8A 4FOLA 4IICA 4X24A 1DIOB 4QC2A 3ZWYA 1H2AS 3TN7A 3WLJA 1GAWA 4DXHA 2NUAB 2ZK7A 2W2PA 2ORVA 4QBIA 1Y81A 3WLHA 1RJEA 1QYCA 1XMIA 1L1QA 4PR3A 1I36A 4E2YA 1QO0D 3KDAA 4ENTA 3DCNA 1D09A 1U2PA 4LXYA 4YCNA 4MDEA 1UMBB 4ZTBA 3T7KA 3ABSB 4L78A 2MYPA 1JKIA 2VNIA 3EUWA 4KE9A 4RVDA 4D9HA 5LPNA 2WVJA 4I14A 1E3MA 3DEKA 2B61A 3L0IB 1P31A 3M1AA 3O03A 4ZU3A 1RYYA 3L2OB 3QNUA 4HWKA 2XE7A 1CQIB 3I3SR 2FSUA 3IAAA 4BN5A 4O3FA 2WVHA 4BNZA 4Y1RA 1YS6A 2X1MA 3AVTA 1R9NA 4KR2A 1EQUA 4X7PA 1LDYA 4AIIA 4DCOA 2R1VB 4WSOA 4F1JA 1YKFA 3OTIA 3KKMA 5IEBA 1N9ZA 4QAQA 5LCXA 5TLSA 4NATA 3JVIA 5EMLA 5T4BA 3W1WA 2RKWA 3DE2X 1NDHA 3PXDA 4WFJA 5L9AA 1OFHA 5MN5A 1JFSA 2O5VA 1B4DA 1QKKA 3U1TA 1KBQA 5EIFA 3U62A 3CE6A 4KWEA 5HCUA 1T4CA 1JS1X 3DWEX 3TRJA 1TUIA 1RLMA 4TT3D 3TCXB 5A03A 3T5MA 1NMEA 2EG5A 2ZOSA 1BIFA 4YMVA 3GFSA 4E5DA 1FQKA 4I55A 1RJDA 4H4CA 1NNUA 1MIOB 4KQWA 3UQYS 2C8LA 3HDQA 2RB5A 3AR2A 1FVHA 3GEGA 4WCFC 3U3XA 3IQZA 2QMZA 3UFXA 4ERXA 3PQ2A 1M2HA 3PGXA 3D81A 4TPKA 1XN4A 4QD3A 3JQ9A 3AZPA 1W96A 3JASB 3OFVA 4BNKA 4Z99A 2AQHA 1N2IA 4NS4A 2JIMA 1DQNA 1NKTA 2RHWA 2D1TA 3RSOA 4LF8B 3IKMB 2A3NA 2KSQA 5JAIA 5JYEA 3S28A 2FW8A 2MU1A 2VH1A 1QWOA 3CZMA 4NYMQ 4H4DA 2OBNA 5HK9A 4TL7A 4TMZA 4EPTA 1T9AA 3P32A 5LYJA 4DC9A 5DTEA 2CKMA 1YK1A 5CEFA 1I3LA 3P20A 3PTAA 2ISQA 1DARA 4IZHA 2OP1A 1NKSA 4QHYA 5CCDA 2JAHA 3H11A 2O2YA 3S1AA 3TDMA 4LOJA 3TINA 5IWCA 2BM0A 3ABZA 3S3TA 5ALEA 3U16A 4MRMB 2HUNA 2QTBA 1EYZA 4HAIA 3DNMA 2O7NA 4D96A 5L7TA 1H3NA 2IKQA 5CH5A 1OA1A 5ENDA 1ID1A 2QX4A 1XCBA 2ACEA 4D81A 3ESZA 4CEIB 1IQUA 1OZAA 4IDOA 3WIVA 1EIZA 3FFBA 3LPMA 5JS7A 3UCEA 2O0KA 1KEWA 3B9BA 2ZR0A 4OI2A 4RK5A 3FLMA 4LUCA 3PXAA 1NVEA 5ICMA 2UXDB 2WQZA 4RPJA 4FZ5A 3OWHA 5JV5A 1NOKA 4P4NA 5ALNA 5KYNA 2GETA 4DA0A 1X70A 3HU2A 3Q10A 4PG4A 5DYYA 4CF3A 4DMLA 3EARA 4INZA 4XOUA 1KIMA 4XDZA 4M86A 4F4IA 3RU3A 1MABB 4DF3A 3VDRA 2PT6A 1T6ZA 4CE6A 2VHJA 3A4VA 2R6FA 4HAOA 4QWMA 1JLKA 1U9YA 4U0JA 4WCVA 3RT9A 3SI7A 4BWVA 4JJ4A 1CRZA 1Y3IA 2IUFA 3MWJA 1XRPA 2VJKA 4JLPA 3AT1A 3GZTB 5EJ6A 2VSXA 3DAFA 3UHAA 5KX5F 5KJ1A 2NXWA 3SG0A 4G84A 5EHGA 4PBTA 1M66A 4YT2A 4OATA 3IIKA 1BH6A 1SK9A 1QO9A 4G8JA 4JLDA 4GWGA 4KP7A 3EIUA 5FORA 4FK8A 1C7FA 4NFLA 1Q0TA 2ZUEA 2XA9A 1TK9A 3A6EA 5TEVA 4ENUA 1LX6A 1HT2E 3ZIAA 1XCMA 4Q3LA 2W71A 1JAIA 1N7HA 2Q5IA 3OLQA 1OI3A 1WE2A 2UDPA 4H6PA 4Q00A 4TLBA 3NPMA 4GW3A 4UUNA 2ZIGA 1I4TD 4NCBA 3K9BA 2IPAB 2G9QA 1ZSVA 3ROEA 3W78A 1HGXA 4Q9IA 5JD3A 2OCDA 1RP1A 1K66A 5ILQA 2QQ5A 1I1OA 4LEIA 3GQBB 4C7BA 3N05A 3D7SA 3PYMA 4EG8A 4Z49A 5BT8A 3K94A 3MWEA 2WQ7A 1LW6E 1QZZA 1P61B 3FZGA 4LDPA 2AYXA 2P78A 4R8RA 3WWCA 3IIJA 3NU1A 1M1XB 1ZWKA 3I9MA 4PLYA 1G60A 1B14A 2GSWA 1DRKA 2OOKA 3FUCA 1RXCA 4XX0A 3U61B 3ZLBA 1XYGA 3RG2A 1YI1A 5D3QA 4QOEA 4TX1A 1AF4A 4FJ2A 4R9SA 4JU9A 4TWBA 4FNOA 5KTSA 1NI3A 2WUDA 2BGNA 2CNBA 4PS0A 3N2LA 1V2GA 4RZHA 3VR6H 3CUYA 4RIIA 3FOEC 2XQKA 2X8BA 3ZHXA 2XSZD 1K0FA 2C7GA 4QPPA 1LNQA 3RSFA 3JQBC 5CT4A 1UF9A 1T3HA 3CM0A 5KTPA 2D5LA 2C9CA 1NJ6A 4GI1A 4NBSA 3BHMA 4QLOA 4C30A 2PWYA 3CMMA 1HTBA 5A3JA 3G13A 1E4EA 1Q3HA 2OSVA 4G85A 5E6RA 1JIQA 1G2OA 5FUXA 1P77A 4Y1RB 5TRTA 1Z17A 3VR6D 1F1JA 5EIOA 1KH1A 1QX4A 5L4LA 2CDAA 4YTEA 4NZPA 3G8DA 2EW8A 2C2GA 3DKPA 1NVVR 1BN7A 2QW1A 1EP2B 1YZ3A 2GN8A 3GLQA 3K30A 3RFUA 2H07A 4ZPJA 1GRVA 5AXAA 1NQVA 1H2ZA 2IXAA 1S6YA 2BGIA 2QL7A 1GNVA 1S96A 1W4RA 5C1PA 4LHYA 2E1RA 3DBHA 3SIWA 4D8YA 1JPJA 2PA3A 3BIXA 1E3SA 4CTMA 1N0IA 5A2GA 2VHWA 2NZ2A 4RXUA 4WOKA 5ELLA 5IC5A 2DHEA 3KP1A 4YAEA 3KPWA 2ZT7A 4LY3A 1Y6FA 1ZVKA 4WWHA 2IITA 5KQMA 2GLTA 3QUCA 1DX9A 3ITNA 3D3WB 5DSZA 4YPOA 2H48A 2NO4A 3LLCA 3C3WA 3DAHA 4P7JA 1BWQA 1C1YA 2QD5A 5C7LO 1I9GA 1IDOA 1EVEA 4X1OA 3TX6A 2NGRA 1WVIA 5CMLA 2RGRA 1H0RA 3D3JA 1M10A 1L1FA 2HF7A 4X9XA 4W63A 4WUVA 3B82A 1MVLA 1PWHA 2BFMA 3TW0A 3LOQA 3MM4A 4EZIA 4LZAA 4NMLA 4JBIA 1RI4A 1TD1A 3DCYA 3Q7RA 1E7RA 3OZSA 4M0MA 3ITDA 2O8DB 1GU0A 4J1SA 1CY1A 2NO7A 2V97A 1R50A 3I42A 4IOMA 1RPNA 3IVCA 1S5PA 3E9YA 3BG5A 4KL8S 1ADFA 3RV4A 1MMFB 5BV1A 2Q5LA 1KY5A 3CU5A 3HL0A 1NRIA 3MYYA 3QVTA 1HNNA 1BMQA 3IAS6 1QIJA 4JJEA 3NLLA 2J9GA 4WKGA 1DFGA 5EJIA 1DSSG 3OIUA 2I2AA 4PZEA 1UXGA 3BT7A 4NH0A 3F47A 1Y1QA 2C2OA 3PIRA 3JAMA 3IP6A 1ZNZA 1UK6A 4E32A 3OP1A 1XD8A 2VN8A 2OKGA 4GD3Q 5E0OA 2FSVC 1QGUA 1PYGA 2G76A 2J30A 1HE8B 3OI7A 3QA3E 4CMKA 3COSA 4HNVA 2UZIR 1ND5A 4RH0A 5HJ7A 3T7SA 3B8EA 1WEHA 3KR9A 1J07A 3E7XA 4QUGA 3N8GA 3LC7O 5TQ0B 2RI1A 3F74A 5IK2A 4JENA 2KYRA 5LR6A 2W6MA 3WIOA 4CUZA 3LKDA 4DJ5X 1OYWA 9ATCA 2ATVA 4LQCA 3NXKA 1BGWA 4IDCA 3NHKA 4PPFA 4C0BA 2Q4RA 3A3KA 3WQQA 1NSYA 4AN0A 1T24A 1B93A 1T5HX 2CSUA 4GMHA 4X20A 4CQMB 2FQ1A 4JFRA 2BGTA 1HYHA 3DV0B 3GRAA 4GECA 1BE1A 1O6BA 1VRWA 3K9LA 3AGPA 4UE6A 2YZMA 4HN9A 2C42A 2HQBA 4HNQA 5B1YA 1WBBA 1AK2A 3C7AA 3GRYA 1QOZA 1E6WA 2OBMA 2P9HA 1L7XA 3I30X 2FPOA 3W3AA 3S2FA 1GZSA 2HD4A 4ACAA 2VTKA 2WMYA 3OT5A 2GA8A 2VQSA 2A88A 3MTEA 1JHQA 4YJ2F 1D7AA 2J0UA 3UMSA 1B16A 4BXOB 4G24A 1NP3A 5HS4A 2JKYA 2XF2A 2MINB 3UENA 2YY5A 1AMUA 2B83A 3MRTA 3VKUA 3U19A 5AVSA 1B7GO 2GK7A 4JUDX 5CYGA 1Z0JA 5EKTA 1GGVA 3EPKA 1FMJA 5ARDA 4H7DA 3SS8A 2WHXA 2XXAA 4KNYA 4HUQB 3PBKA 3O3NB 4ZP1A 3DJYA 2Q6TA 3QFFA 3FSEA 3QJ5A 4JVMA 1XJQA 3GWZA 5L6MB 5EIHA 4DIUA 3E7PA 3VZRA 1NJ8A 1ARZA 5FLYA 1GQYA 3AHFA 4LG1A 4WKOA 3VYTB 3PC4A 1YZYA 1P0FA 3OZIA 4D9NA 4LGCA 1PEAA 2AZ4A 2YNMA 3DEJA 4YUZA 2PYIA 1IMOA 1WXFA 2GTHA 1XTKA 4YRIA 2IXTA 1M7GA 4N6OA 2O8FB 4M36A 4EQ6B 3IHWA 5EESA 3QVVA 4UW9A 1YJBA 1PJZA 1VG8A 5JXIA 2G82A 3CVWA 2JLAA 4C5CA 1ZL2A 2AXEA 2ZJBA 4WK4B 3HCRA 4ER5A 2ADOA 3ZE1B 3N76A 2CJYA 1R8JA 4PO8A 3BTVA 5AM3A 3VYUB 3IUJA 1U2ZA 5D3KA 2R3SA 4PZ9A 3VHRA 1W4BA 3RTBA 3UYKA 1ISIA 3IELA 1DOHA 4IIXA 1RRMA 1LJLA 2VPTA 2WE8A 3O21A 3PJGA 4OLJA 4R83A 1JQ3A 4BZZA 5KYXA 1GV0A 3B70A 4MMYB 4BQQA 1EFTA 4XEHA 4DUPA 5H7XA 1QHEA 4EATA 4TYNA 2C2BA 1XAIA 1WUYA 1S3FA 4B6FA 4EVQA 2BBWA 3E9MA 4BKRA 1ZGZA 2GILA 4DR7B 4TZ6A 3L84A 2Q2QA 2O19A 1Q3TA 5BSVA 4HFJA 1DIAA 4JELA 1UC4B 3QELA 2Q7XA 5E1BA 2YN0A 3TH5A 2ZREA 3ABQB 4PSAA 1R0XA 1ZJ4A 4DG9A 4WBNA 4ZI7A 4KRFA 3L9WA 4D9BA 3GGCA 4MP8A 3L7IA 1E1NA 3KZMA 4UCFA 5DNEA 3QITA 3P2EA 5CYOA 3L05A 5ALSA 2C4MA 5FYQA 5I7FA 1Z6TA 4RMNA 3K8QA 1CPYA 2XB8A 2VT2A 1SBZA 2V7VA 1GNQA 4L72A 3PXGA 4DA7A 4D4IA 2PSFA 2HJVA 3B7GA 2EBUA 1UOPA 1IQ0A 3H5WA 2FEXA 5JLAA 4KQEA 1ZR2A 2PEYA 4LPSA 2A3RA 1KO8A 3WAJA 1PX2A 1E2DA 4IRXA 4JUFA 1UPFA 2VO1A 2O8BA 1VPWA 4DZRA 1IPFA 1U2EA 1U9JA 3K09C 1LBHA 1UWLA 1OGIA 4P4SA 4DDKA 5BRJA 1BS1A 5LB4A 5F7XA 2PYZA 2Y9MB 3WMFA 1HT0A 3UMJA 4BMCA 1THZA 2VJBA 3FMVA 4CN8A 2YZKA 3G23A 3LHKA 1YVUA 3H5OA 4FINA 1FFHA 3QNMA 1TJ3A 1P1IA 1BE0A 3BL6A 4TZKA 1XG5A 3GJZA 2VHTA 4UD2A 3DEZA 1VL0A 3COVA 1GVNB 3K9CA 3GAMA 2QTVB 4G65A 3D6TB 3KHSA 5IUNC 4QQKA 4PBSA 3PE6A 4G81A 1KYVA 1F20A 3A9WA 1PJQA 4PR0A 1QHXA 1TD9A 3LBAA 1F9AA 1R10A 2JA2A 3FMFA 3P27A 3LUPA 1M83A 3GBVA 4KPEC 1GQFA 2F9FA 1NY5A 2GS9A 3ECSA 3FMOB 4QOFA 4RF3A 4HAUA 4Y9DA 5ICSA 1TOAA 3DF7A 3SZ3A 4ZJZA 1M67A 1PTJA 1UWVA 2E5WA 1NATA 3WTCA 5EGSA 4EG5A 3HABA 3KV1A 1PL7A 1KXJA 2QX9A 3LUCA 4X61A 3QYJA 1PT6A 1R12A 3I8XA 5BW5A 1QG6A 4HAXA 3PRYA 4IJ6A 1QGAA 1N6IA 1JH9A 3GUZA 1JDBB 4H18A 4JSYA 3ND5A 1XZFA 2L17A 3NBXX 3NV9A 4RSHA 4CM3A 5GADl 1Z6GA 3P7MA 2F17A 1VIVA 2QOEA 4LE2A 3VU1A 1P3Y1 1U28C 3QHAA 2P6PA 2HCBA 3N5CA 1E1KA 2YCBA 3T9EA 5JCPA 2C4UA 5ALIA 1ZM7A 1K68A 2WPDD 3S5JA 1M1ZA 1KYQA 4EWLA 4EYOA 3JYNA 5HUHA 1TC2A 4X8OA 3EPJA 5BXYA 5FV4A 1EUQA 1JR3E 1NLUA 2FW6A 3PDWA 4IW3B 4IUBS 2FUNB 3OJXA 2FX3A 4YY3B 5K4HA 4ILKA 4NZMA 3KBOA 5A4MS 4M49A 4MR9A 1YJ8A 1GA1A 5F77A 1NT4A 1I3MA 4P3YA 4KGDA 4XSGA 3GFFA 4K7JA 3A2KA 2COKA 2ROQA 1RACA 1M2WA 1A7JA 2QPOA 4IF6A 3PQ6A 2QZPA 4A92A 3R6WA 3KOWA 4JD5A 1E77A 4EOGA 1U0GA 1W75A 2FF7A 3NHBA 2ZBUA 4UVGA 4X7RA 3KE9A 1ECPA 1A9XB 3SFZA 3GRUA 2X3FA 2A67A 4ZVOA 3N3BC 3NBAA 3U4GA 2GPTA 4ZT2A 3PPVA 1EDDA 5JAHA 2NN3C 3CLTD 4K28A 1KOGA 2CB9A 4ZYLA 4D02A 3NWOA 5ALKA 4QUKA 4X62B 2IPOA 4EKEA 1V8BA 3NHWA 2YXNA 4NU6A 4U2KA 4D42A 1NTOA 4EX6A 1QCDA 1PZGA 4J4BA 3UB4A 2B36A 1M2OB 3ZX5A 4BN4A 3ZQUA 4EM6A 4LXIA 2B6HA 1XC7A 3NQ41 4L9WA 4RDCA 4V0ME 5GM1A 3VKVA 4DCMA 3KKPA 3P9XA 1AHIA 3H04A 1YRBA 2C2WA 3D5EA 1IAVA 2ZJ0A 5KJFA 1Q11A 1XDDA 1YE3A 4Q37A 5GONF 3W5IA 1UKYA 2HCJB 4UU0A 1Z7GA 3LRPA 4NJEB 4EHHA 1Q2XA 5T7BA 5K0BA 4LMBA 3ZQ4A 3N2KB 2VZ9A 5WRFA 1KQNA 4NICA 1B00A 5K8CA 4PPYA 3QVGB 1QIIA 1P7WA 1X87A 2WWYA 2VHEA 1UPBA 3S5UA 5AHWA 3SF0A 2O2DA 1LPMA 2XBLA 4LKOA 2HDHA 3T0FA 1HFEL 1KTIA 3E9EA 5KOJA 3JQ8A 4K6HA 4CYMA 5HQJA 4GKKB 1R4AA 4R8VA 3FFAA 1Y8RA 4QATA 2R96A 1L4GA 5DXJA 2I80A 2V96A 4OQMA 3RHFA 1C1DB 2I78A 3SOZA 1FJXA 1V3QE 2ALJA 1Z6QA 3B51X 1OVMA 1P0CA 3I6ZA 1JQDA 4I2VA 3PYXA 1XMQB 1GKYA 2WJAA 1S1CA 5AJYA 4TYMA 3QWAA 5LP6B 4HTFB 1QYIA 3UAWA 3IFSA 5IMSA 2HU7A 1V11B 1XT6A 3U4AA 4AZWA 3OECA 2D7JA 3WKAA 1FZTA 1M6HA 5DBOA 1TM5E 4REQA 1UANA 2CMFA 3FVTA 2JLVA 2CWWA 1F2UB 3LAWA 3RYFA 1SQFA 4HB0A 1A7AA 4COOA 5I7OA 3JATA 4KN6A 1NBWB 4MINA 4G5QA 2ZRMA 1T4BA 1EVIA 2PQ2A 3ZWXA 2KPOA 4P2GA 4FE7A 3VYWA 4B3XA 1OJ7A 1JZTA 1QHSA 3T12A 4IWYA 2UYOA 4D9FA 1WX1A 1W2GA 2F3UA 2WJVA 1ZSYA 4JQZA 4YHBA 1JEOA 5FJJA 1AURA 2VP6A 1YRQA 3LY5A 4X1IB 2R6CA 1FXSA 4YV0A 4HDMA 4YT4A 1I7DA 1EJ0A 1CY0A 3G2OA 5I9MA 4U02A 1ACMA 2C0CA 2FWBA 1TFUA 4G97A 1E1QD 1Z39A 2HU5A 3RF7A 2W6NA 4MUYA 3TZHA 4PZLA 1OHHD 3IQFA 3D31A 4JXJA 3ZVRA 3TOCA 1CSEE 3BXPA 5JADA 2ZRIA 4KIJA 1NJGA 3O4RA 3R7BA 5K09A 1HDEA 3D2CA 1YFKA 1MD9A 2FKNA 1IU9A 1GZ4A 3BF8A 4L0DA 3NHMA 1MOQA 1XNJA 3IUPA 4GUDA 4Q9NA 2O5RA 3V33A 2BMJA 3SOPA 1QX3A 1SQ0A 2HRRA 5F33A 3I5AA 3QA9A 1Z63A 2XCTB 1ZI6A 1N1MA 3ML1A 4IXWA 4NDNE 1IWBB 3RE1A 4B6SA 4DL9A 3KQHA 5F7JA 3GUVA 4Z7OB 3PQEA 1X7ZA 2L2QA 3NM4A 5BMOA 5AKKA 3T9FA 3TTVA 5CLFA 6AT1A 5LP6A 3RQIA 3JAWB 3GCXA 3P94A 3K96A 1VJGA 2GF2A 4KWIA 3EXFA 3V1LA 1SHUX 3OSUA 4A27A 4UPDA 4KQ9A 2Q3JA 3U1VA 4CIYA 5EQFA 1EA7A 2UUBB 2MR6A 1UEXC 2AR9A 2B2CA 5G0TA 1XVTA 4MRAA 2RG7A 1RQPA 4YRDA 3X2EA 5JH7F 3H99A 4NBWA 4DV6B 2GKOA 1R5OA 1ZCAA 3OTWA 4RDHA 1ZNYA 4GBED 4ITVA 3RB8A 4BVEA 1CW2B 1OD6A 4BN0A 5KYUB 1FQJA 3KT0A 3RVKA 2JLYA 4PX2A 3A3NA 5JMTA 1R5BA 1C5KA 3FNIA 1I7PA 2IW1A 5DLEA 4DJTA 3ICOA 2R8YA 1GTVA 1VE1A 3QF4A 4HDQB 3AFOA 3QX9A 2RH8A 3D2LA 5ALPA 4ID3A 1U7XA 2AS0A 1R0ZA 4CDRA 2W6JD 3IYLW 1A76A 3K6SB 2UYYA 5LIRA 5ES3A 1SBCA 2QL6A 5AOVA 2BE7A 1TVMA 1TZJA 1ZFNA 3M5DA 1YBAA 3QVOA 1KAOA 4FUTA 5H70A 4D0RA 4TXHA 1F0YA 1DZ3A 4GMFA 2Q3HA 3EF0A 2CLIB 5FUBA 3ZVLA 1L5RA 3C3YA 3FYCA 5FO0A 2PKWA 2BBSA 3DDNA 1ML3A 1PJCA 4HMQA 3T61A 4CV1A 3SNHA 3TLMA 3VPCA 3V8BA 2J5KA 2NM0A 2AXNA 1I7LA 4EHKA 2VBGA 1DC4A 3TAXA 4YV1A 7MHTA 4B7UA 121PA 2BFAA 2OQIA 3JWJA 3A4MA 3R41A 2N47A 4J90A 3FX2A 4PHFA 3LYLA 4YP7A 1WCIA 4L02A 1FUIA 3BREA 2HX1A 5EOVA 4CU5A 5I7HA 1LK0A 2VEOA 4CT0A 1NR7A 3OMXA 3O8NA 5BV7A 4ILEA 1ZVJA 4EITA 2QMQA 2BLLA 4B1FA 1Z4KA 2QTWB 2VYQA 1YJAA 3PRHA 1PJ4A 3ZTYA 1Q14A 2DTDA 1JJ7A 1R0CA 1W5AA 2CNWD 1ZM2A 3MJDA 3TAUA 2BUBA 4ZCLA 1E58A 1HYBA 4C89A 1P8JA 3GC6A 4RZIA 4XR4A 1SUPA 1A5TA 4FT2A 1EB9A 4M0UA 1OU0A 2FZVA 4GX1A 3RGWS 3QWIA 1T2UA 1RS0A 2XADA 3E4DA 4JA2A 1J0CA 3UWDA 5DEIA 4RK1A 3ROMA 3EMKA 3KJEA 4RYLA 2RAPA 1FVXA 1UPCA 2OO7A 1V95A 2PXHA 3KWJA 5L3SB 2OP0A 4HV4A 3IB6A 1L7EA 4AG6A 3TG2A 2K7FA 1W44A 4EHFA 1OHHA 1PK8A 2WIAA 3HVRA 1AXGA 3TKLA 4R2WA 1HK7A 2C9BA 3QBTA 5B1SA 3SF8A 1E3EA 3ROPA 3CRNA 3COJA 3REOA 2H4WA 3AUKA 5AD1A 1TGYA 2X8JA 1HDCA 2ATCA 4U3JB 3VNAA 2JG3A 1UL1X 3GLTA 1UH5A 2G7MC 3ME5A 2W7TA 1BXRA 5FI0B 1QF7A 3IBGA 2VNAA 3PDCA 3RIHA 3C43A 4G5HA 2F7SA 1F4VA 4Z3DA 5I7SA 5J1SB 1N2GA 2BGUA 3GLGA 2Q3BA 1L4UA 4W8GA 4R1MA 2HQOA 2LE0A 2V6BA 1LD3A 1QBGA 2XOKD 3H9BA 3HCWA 4R7GA 4DTCA 3IMCA 5J3JA 3ELUA 3MWDA 3BRWA 1Z25A 2FZ5A 1DC5A 4RBNA 5GJWC 4F9TA 1JZSA 4Z5XA 5EJ2A 1T9HA 4TVKA 1ZWLA 3UJ8A 5KB3A 3LX5A 3KEMA 3VZSA 5AJHA 5HF8A 4FC6A 4DDVA 2RCNA 4K9OA 1DIRA 2QX8A 3B38A 3PXBA 4DLBA 1RZRA 1ONNA 1PD0A 3GRKA 4I1OA 4MTCA 4AP9A 3DZJA 3IAUA 3GUHA 3OU6A 4D99A 1CS0A 3BDAA 1Q5PA 2CXQA 3GHYA 2GZRA 4GKVA 1RM4A 4B2YA 3GW8A 2X0EA 1BU5A 4KPYA 4X54A 2HY7A 4RENA 4G0VA 3FUVA 2Y1GA 3EVFA 2XOEA 2P0YA 1Q95A 1NE2A 1TIPA 3RRNA 2EV9A 4CMAA 4M76B 2Q49A 1UXIA 2C3YA 1PR2A 4JLSA 1L9XA 3Q3IA 5HQ3B 1P0IA 1RWVA 2ZR8A 3S7ZA 2CLMB 4TWZA 3THYA 3PD7A 1N8TA 2HK8A 2UUCB 2ZS7A 1NAHA 1SC9A 3ISJA 3MQ4A 4ND3A 2VJNA 3EVDA 1V16B 2WTEA 2OEPA 3FYUA 1L5QA 2NUAA 1JIVA 4O5AA 3ZWOA 2H54A 2I3GA 3KSZO 4Y2TA 3KDSE 3QW4B 1JQEA 4LC9A 3UPUA 3D2BA 4K3UA 4RS3A 5IM4A 5F98A 1PR4A 1S4MA 16PKA 2BCGY 1AKNA 2Q5FA 2QA5A 4O4LF 4F06A 1J99A 2GCGA 4JLMA 1T4GA 2RHTA 4J49A 3CLRD 4HAWA 4DBLC 1I0ZA 2I7DA 3CCFA 3PR1A 1G21A 1YE8A 4XM0A 2PGIA 5LBIA 2DSNA 4YPFA 3D0QA 2ZZMA 4J6FA 3RDPA 2O54A 2YXLA 3NP9A 2BVNA 2DF8A 2W90A 1XD2B 1AU9A 3DKKA 2PRKA 4C06A 4JQOA 4Y1FA 4KR3A 1OW3B 2CFIA 2I71A 4U7GA 2O57A 3U3DA 1E0AA 1KVUA 4G07A 1E5TA 1QAMA 1CQJB 1HT3A 1U94A 1MBZA 2OHXA 3LHFA 3MAAC 3MD9A 1KI6B 5CHEA 4OJKA 2C84A 4K26A 4KV7A 4DRZA 1TUEA 5COAA 5MGBA 1KYXA 3ELDA 2JFZA 3MS2A 1QYWA 2AMYA 1YZUA 4XYBA 2HW8A 1CJSA 4YJ2A 3WMXA 4DKJA 1KQGA 2BFWA 3HI6A 1KS9A 1FPMA 3G2JA 4GR4A 4GQBA 1Y5RA 3TD9A 1RABA 1K7FB 4QYSA 4S1OA 1XTVA 2WUVA 3WGGA 2MSDB 3ZWWA 5J40A 5CLIA 1R8XA 4LVNA 4XCXA 5FFNA 5T4FA 3GI1A 2XCLA 1P4AA 5HTKA 4EYQA 3ETJA 4Y2VA 2OHVA 3KHUA 5F1KA 3STHA 3SYLA 3IOBA 1NVTA 1PQUA 1T1RA 3ZH9B 2QLFA 4EMTA 2N0SA 3HBFA 3OPYB 5IT4A 3BUSA 3HJNA 3MWFA 1SC3A 3TQRA 3P26A 1PG2A 1IE3A 4NNJA 4KTVE 3NKLA 3ZK7A 2BRUC 3GR6A 4Y1GA 5LYYA 1U8CB 3B20A 3N8DA 4L51A 1Z28A 4YMSA 3GLUA 3CGWA 4ZQCB 4YAOA 1KIFA 4IVRA 1NVDA 4DPMA 1MEJA 3JQFA 1FVFA 1S2DA 1YS7A 2O06A 1JA0A 3EBOA 1H2BA 2ZAIA 1ORDA 3MWLA 4MZXA 4FYPA 1U1IA 2CDRA 3CH7A 2GI4A 3IALA 3WGMA 4C43A 2Q5OA 4O5OA 2ZSBA 3GFRA 3HB9A 5DDIP 4EMUA 5KWSA 4HLUC 4FI3C 4F2PA 3OIVA 2OG2A 5BSKA 1IZZA 4E5MA 3A7DA 1EHCA 3ZLJA 3L6DA 1PJLA 1VPEA 1UFRA 2OBLA 2ODBA 2W11A 1PJSA 3FGOA 3OZAA 3QU9A 4L8YA 5ITWA 3J80A 1C3EA 5IJZA 1JA1A 2X0FA 1E5LA 1EHIA 4UU7A 4FB4A 5CB4F 2D0IA 2EDCA 5IT0A 4KXYA 1Q17A 5ALQA 4D8UA 1JEQB 3AVWA 2ZDQA 1LS1A 4J9VA 4CM9A 5FTJA 3RWOA 4DEVA 2CT8A 1X92A 1L4YA 4MW0A 4OSEA 4O3MA 1TF2A 4TRRA 2HU8A 4BFUA 4I3FA 1IOZA 1EM8B 4QL3A 1L5LA 2TECE 3EY9A 1VIYA 2QLNA 5AUNB 2F59A 3PFKA 3QV2A 1Z6PA 3OM1A 3GRVA 3OT4A 2NO9A 3Q3VA 1DQYA 4C6RA 1YR1A 1JHZA 1MJ5A 1Q77A 2IX3A 4BXOA 4EMSA 1QAQA 3M5CA 2H2AA 4DGSA 1KMNA 1V1JA 1W36B 1PGQA 3LS2A 4YI5A 4B0OA 1KJJA 3V3TA 2HBQA 4B44A 3SQDA 4YP0A 4K9KA 5FD8A 4MMZB 3DE4X 3T7AA 1XQ9A 5BR1A 3PD1A 3TLAA 1H1DA 3DOHA 3TWOA 4YJHA 3T3NA 3MWDB 4L0QA 4L2IA 2BGRA 1HX7A 4NENA 4TTVA 4QJIA 1JR3D 2WKQA 3WIEA 1RYHA 4HNRA 3IJEB 3TKAA 5CFNA 2DGDA 5IEJA 3VSDA 2Q50A 1DP4A 5L3ZA 5DCLA 4HY3A 2BWJA 2GYVA 3C1TA 2BFFB 1PZHA 3VR3A 2NO6A 3VJKA 5FOUA 1K8RA 4FBMA 3KWMA 3EEIA 3CW2A 1KNXA 2RDMA 1AKVA 4ZQEA 3SR3A 3SF8B 1QLWA 4MTLA 4N0QA 3EDQA 3V7UA 3MCTA 5K8UA 7REQA 4RXMA 4PLVA 3T15A 1FMCA 1VJTA 3KNZA 1R3DA 1IWPB 1OWMA 2C4VA 3OCUA 3V1MA 1H05A 4UHDA 4MW7A 1OXKB 5EIAA 1K7CA 3PA8A 4WEOA 4ER7A 2VLIA 3FNBA 3ND6A 4KRYA 5CB4B 2ZW9A 3PIDA 4FXPA 3QOWA 1VI2A 5FL7A 2HK9A 5F9MA 1N2HA 5CA1F 2K6GA 5CNMA 3RC1A 3IHKA 2EWWA 2WRZA 2QYOA 4QDTA 4ROSA 1X6VA 1QHIA 2IL1A 3BORA 3TS1A 4M3NA 2IZZA 2PKYX 1U2RA 1U2TA 2QLLA 1SKYE 4FONA 3OHPA 1ODJA 4PFSA 3V8QA 1ONPA 1Y4UA 1WHTB 4JP8A 3RTAA 3C24A 5I01A 1MAUA 1LI7A 3EBPA 5EJMA 3GLFA 4U6SA 1NMQA 1WCIB 3HYLA 5CK5A 3OF5A 4JJFA 1J0BA 2FW1A 5IASA 5IPFA 3DD1A 3S2UA 3COWA 2AJDA 1SPXA 1MGPA 3EDOA 3ZDFA 3T1QA 2AN3A 1MB9A 3T1NA 4E2ZA 1B8PA 4U6QA 4PSVA 4W4TA 5EJ7A 1C1XA 2VL7A 3M33A 3PHBE 3C7CB 3SYTA 4BLSA 1AO0A 1ZS9A 3W9BA 3K9QO 2FW9A 1SCJA 4GS5A 2QTLA 3FRIA 4JUBA 1QR2A 3ZIDA 2KI5A 4CODB 2ZWMA 1T5LA 1WSDA 2RH9B 4PZAA 4ZIRA 5F1YA 4TM8A 5IUKC 1V71A 4ZI3A 5A6SA 3F7OA 4MW6A 4IDAA 1O89A 1ANKA 2Q2OA 3DTNA 1R27A 1YI0A 4TQ9A 3ZW7A 1V47A 1PHRA 2X5JO 4J7UA 4J91A 1U6IA 4TMKA 3WOVA 4KREA 4P5DA 3E3MA 4AMBA 4C6TB 3CF2A 2PFKA 1II8A 3WRVA 3FNEA 1J8DA 4V02A 3K4PA 1A9YA 4ZCMA 1ENYA 5DYGA 1NPYA 1VYVA 1SVKA 1JYEA 4RLQA 3CJTA 4IILA 4RMHA 2A4MA 5JI2E 3BWYA 2CVFA 3CUVA 3SYNA 5FULA 3IBYA 4EPXA 5C1BA 3BMNA 4DV3B 1UZUA 4MIYA 2EWMA 1A82A 4TQUS 1RT9A 1QB7A 5KYYB 4FHGA 3SD7A 3QVMA 1ESZA 1RYDA 2OFOA 1F5NA 4J76A 1CETA 4YQFA 4ND5A 1NUUA 3WJ7A 1EFVB 5DHUA 1OT5A 2W2LA 4BOYA 2ADFA 3KB2A 4BTEA 2OXCA 1GARA 1ONBA 3O4JA 4PZUA 1L7VC 3EZXA 3UKDA 4GM1A 1NU8A 4CQLB 2QRVB 1PRYA 1Q2UA 4H7FA 2IEYA 2IZ6A 3ABRB 1CUZA 2REOA 4D9IA 1JDBC 2XTNA 4I4TA 2FR1A 1J09A 4LSGA 4BJ6A 4H4EA 1T0IA 4DOMA 3D8RA 1EM6A 2B94A 3CIFA 1ZZGA 3TSWA 4BZQA 2C31A 1XYVA 3NRJA 4J9UE 4GC5A 4N47A 4RTNA 2X86A 5EPOA 1XIVA 2G72A 4DCNA 1VHTA 4IKEA 1S3IA 2R4QA 3DUFB 3U4QB 3HWX1 4WHMA 2PQ6A 3NHPA 5ENVA 1CFZA 1GGKA 3NWPA 4D9KA 2FEMA 1SRRA 4WY5A 1N0WA 2XWSA 3MJRA 3BSWA 3R7NA 3S70A 1SWWA 3O2NA 4I8IA 3MC1A 4ARZB 4D3FA 5IBCA 3BRSA 3DVAA 2QROA 2ZI6A 3KQMA 4ZC8A 2ZTVA 2FZCA 4P35A 2C5AA 4OI1A 1ECLA 3BXGA 3INRA 2Z56A 3L92A 1OX4B 5AK5A 3JD1A 4NOJA 3NBFA 3K0SA 4DADA 4BBAA 1QHHB 5BYBA 1PBNA 2A14A 1RYEA 3PGA1 1WXXA 1X94A 2C0QA 3IP3A 4NONA 4UM8B 3RS7A 4JJGA 2PKQO 3LLVA 1V4BA 3UHJA 3WXMA 4S05A 2QTZA 1RM3A 3C3BA 3G5MA 3LVQE 3AUTA 4OCZA 5I48A 5JVDF 1K0UA 4V0MA 3EVAA 4A2WA 1ABBA 2DPYA 2DE0X 1VQ1A 2UZ1A 1J2JA 4BLOA 1ZLXA 1ZGJA 2JLXA 2XUOA 2W43A 3SZGA 4U5XA 1V5FA 4RV4A 4AK9A 3B6ZA 4RJTA 3CNBA 3JRXA 4CMCA 3CZ9A 3EGWA 3MN1A 1HOXA 4ZWNA 4KKXB 3OZCA 1G21B 1KL7A 1RXIA 4PC6A 4HNUA 3THOA 4IGAA 5CT8A 3SYRA 2GB4A 5DTJA 2ZJYA 2ZVJA 3I64A 5K2OA 3GLRA 4J1NA 1LQ2A 1YB1A 3V80A 3VUFA 2XTJA 1K5DA 4OHFA 4QGFA 4HVLA 3M0EA 4LYAA 4NCJA 4CCWA 1UM9B 4DR2B 4QRHA 1RPZA 3A2NA 2IYVA 3GFOA 5ADUS 1LSUA 2AOWA 3E3LA 5K3EA 3BN3A 4YI3A 4E03A 2WOJA 3ACDA 5AICA 3ZBTA 3IHTA 5A1TA 2HC9A 5JEEA 2ZRQA 1B74A 1TVKA 1DELA 1I32A 3HZZA 1W1IA 3IQWA 3DE6X 3FBTA 3DXFA 3K0AA 1M1NA 4EA7A 5AW2A 2X2PA 4OHVA 5JSYA 5AO9A 3F9RA 3KLPX 3Q2IA 5L3QB 4CVNA 7GPBA 3BCUA 1VKNA 3OCCA 2G63A 2EWVA 2MSEB 4ND8B 3TRIA 3R5JA 2GWHA 3F1KA 3MTAA 1MDFA 1L7BA 2BAGA 4LWOA 1FDWA 1DVRA 2WIKA 3K0FB 3LGXA 5IAJA 5KAMA 1LF5A 5CM9C 3VTFA 3X1YA 5HGXA 3IJ5A 1RE0A 4B3HA 4W5OA 3GROA 4DXDA 3RK0A 3UCXA 5DISB 1NLFA 2WHQA 3AQIA 1W85A 4HG2A 4A1OA 4NPAA 1WUKS 1N3YA 3FVVA 1WV1A 4F85A 5KQGA 3W6PA 2JFVA 4M4SA 4N0DA 4OO3A 2FUEA 1NLMA 4B0PA 4CKBB 1Q15A 4DS3A 3G79A 4H31A 1P62B 1ISSA 2VK8A 2A5JA 1G2PA 1TO2E 3R0QA 1XX6A 4FYXA 4G0XA 4S0XA 2EERA 1WW8A 1XYYA 2WT4A 1VP9A 3QW2A 4N3BA 4QFBA 1XZHA 2H9IA 1ISMA 1TK2A 1VDZA 1VJCA 1DIHA 2H2FA 1QFXA 1KE2A 1FBNA 2W70A 5HKKA 5K5EA 3C3PA 1OX5A 3L1JA 3V46A 4Q39A 3P5BA 4XTRA 1C0EA 3K35A 4KIUA 3O8LA 3QE9Y 4I81A 2WUFA 3HCOA 4EJMA 5K6TA 1SUWA 1XFAA 5LXTF 1C7QA 3LLMA 4UARA 4D92A 2C5GA 2OCAA 3EJ6A 4TQGA 2XRYA 2JI6A 3B3FA 2BKAA 3FN4A 5TC4A 4BEWA 1YZHA 4EF4A 3L8EA 5C1IA 4WZ6A 2JGKA 3QUQA 1ZK2A 1FCJA 2PGAA 4OX9Y 4MVYA 4KUEA 4P8RA 5E9WA 4HT3B 3DS8A 5HE8A 3W5HA 2RGEA 5A0FA 4AM8A 2X0IA 2YJGA 1MX9A 3M7IA 4WINA 3GUCA 3PPWA 5I8ZA 2DTXA 1P2GA 1YR7A 1B6TA 1RLIA 2EFDB 1PFYA 1NVFA 2J09A 1KAMA 4NF2A 4RKQA 5IVDA 1KDVA 4EHIA 4GT1A 3F6YA 3DKIA 1WSAA 1H0SA 1J1ZA 1RRPA 3TM5A 2WYIA 4RHTA 1S9DA 1E3QA 2O8NA 5T8KC 3SX4A 3TE6A 5E9JA 1YQTA 3D3QA 2J6CA 1N6LA 2PZGA 3D3KA 3GX1A 4GSYA 1OWLA 3DLHA 2YRWA 1Z88A 4UU1A 1W25A 2BL4A 4WFQA 3T3IA 4DTIA 1GPAA 4EKDA 2M1ZA 1J4AA 3QLTA 2Y1DA 5JCJA 1L7QA 4WDQA 1CJTC 3CUEF 4MV7A 1V3VA 3OMWA 1DEKA 4JT9A 4MVCA 3IIIA 5LP6C 3DTVD 3WL8A 1JG6A 1J20A 2JFUA 3ZC3A 4CKBA 1GKKA 3H9CA 4Q7EA 3PDJA 4UXJA 3DLAA 2P1DA 3L8MA 1C50A 4XPIB 3IH5A 4KE8A 4Q66C 1WF3A 4QJBA 4GNRA 4PAWA 2WSSD 4RC9A 4B3CA 5CP8A 3TSYA 5JZMA 4XASA 2OV6A 2WTXA 3EVEA 4A8TA 1ISPA 4LVOA 1UDWA 4HFRA 4JYAB 1AGPA 3BCSA 5K3OA 3EUEA 3E22B 5DYTA 4DA4A 3H0KA 5KNBD 1OXMA 1F06A 1MO5A 4I1IA 4QUDA 4FN4A 1WQ3A 4XRRA 1TYBE 3LZCA 1MT3A 3FTCA 1Q1NA 3B6IA 3IE1A 2XMRA 2I76A 2C7QA 1RBYA 2F48A 4ZZ2A 1ULSA 1GTG1 4EK9A 4YDHB 1GA6A 4YASA 4ZZ0A 1USKA 1KA9H 1RMTA 1TAQA 5DLYA 1QHGA 3OFNA 5IN4A 2Z9DA 1MCZA 1Z22A 3SZLA 3KJFA 3KUCA 1DC6A 3E2MA 1GTJ1 2FN8A 3JWIA 1QQ6A 2HHJA 3I6BA 3OFJA 2G5CA 4X1YA 2GF9A 4Q47A 1TA0A 5B1DA 1A2QA 2J5RA 3HNOA 3IESA 1EWVA 4B75A 1VTKA 2VPQA 2PZLA 3GFGA 1N6PA 3EZ7A 3QXSA 3RR2A 2HYIC 3ED5A 4HEHA 3X0DA 5C8ZA 5HRCA 3LRXA 2NU6B 1FP1D 1FRVA 3HEMA 1S2IA 2FMHA 3N2YA 3ZE8A 3MLAA 3W5AA 4BATA 1X86B 3V3KA 3TG8A 2P6NA 3RU9A 5FCDA 2GNPA 1F4PA 3DVQX 3I52A 1Y3CE 2I4IA 2PL3A 5HWSA 1CQWA 1NUAA 1U3VA 2D1SA 1P5RA 3QBEA 1NVAA 4Q0MA 1DKLA 3AFGA 1TIKA 3GDWA 1JEAA 2OENG 3E0QA 3I39X 2C92A 4ITRC 1L5HA 3A3YA 3VZCA 2KWIA 1NUSA 3C15C 4LHZA 1FP4B 1BS9A 3NBYC 1Q3KA 2ACVA 1CQZA 1VSVA 2VTEA 2VJAA 1X7WA 2J3KA 2EEZA 3OZBA 1AK1A 2FY8A 4IH4A 2R1TA 4MV4A 4IIVA 4PRLA 3UJHA 3WWYA 2IYRA 2H17A 2O0LA 2VTBA 4YLYA 2Q1TA 5IYZA 5BR7A 1PZXA 3N8NA 3ZU5A 2GBLA 4EFLA 5B3JC 4RLHA 4JLAA 5DPMA 1VFNA 2CXTA 3E3OA 3LF2A 3EGDA 2YDYA 3UGJA 1FA9A 4I1RA 2Y1XA 1XTBA 1W4LA 2O7VA 5C5EA 3BEDA 3WLMA 2CMGA 4MQMA 5EYPA 3KLBA 4J1TC 2C7PA 3KU4A 2NPFA 2W22A 1N5JA 4GX0A 1ZP6A 2DPMA 2KBFA 4KVGA 3GPIA 3G9ZA 2YFKA 2ICAA 3JD0A 4RHFA 2F8SA 1MO6A 1DXQA 4BVAA 3HM9A 2P9EA 4EVRA 3W1VA 4XWAA 5IH7A 3CWQA 1EK5A 4EHDA 1OROA 2GYYA 5E9AA 4TZ0A 2UXBB 1C9EA 1KJ9A 2J9YB 2X8LA 1BAPA 4X60A 4ZTZB 1WULS 1G4AE 2A1TS 1HETA 2QSYA 1OSNA 3FPAA 3PUHA 1M1UA 5CVDA 5ALFA 1SXJA 1SD2A 3ZVMA 2I55A 1UBUS 2Y6VA 2AV6A 4M6WA 1QOQB 3T5DA 3Q8LA 5CDSA 1S4QA 1Z3CA 3A06A 4F04A 3R1IA 2J3DA 3HTXA 1EJ2A 3R0VA 3LNCA 4I9HA 1Z4MA 4G1CA 2ILVA 2DFKB 5HXAA 3GPLA 1LDEA 4ZAXA 1FRQA 4O4IB 2C1ZA 3RS3A 2GZSA 5CXQA 3K8OE 4RNCA 3IVRA 1JALA 4G56A 2VYFA 4OQPA 3KD3A 1Z4PX 4P7GA 5H83A 4INAA 5I8WA 2NVWA 2F1KA 5U9CA 1EE1A 3O94A 5G0SA 3A6DA 1Z38A 1MX1A 1S3GA 1YOBA 3D6AA 3T8YA 3UFXB 4RV5A 3UB3A 5BWCA 1GDTA 4HDRB 1JHPA 4QE3A 3AESB 4M1KA 2FZEA 4B09A 1PWYE 1SOUA 1OC2A 4JJIA 1NF8A 1Q0LA 1XA3A 1ZJYA 3H97A 2A0XA 4ZMBA 4F5ZA 3KT8A 2XQGA 4MS4A 3VX4A 4QUEA 4KNWA 4IFIA 3PC2A 1P1CA 1JU4A 3AU8A 3EC7A 3NGMA 3UZUA 5KOHA 3I9OA 3K20A 4YR9A 3FI9A 4DQXA 2AJLI 1P4JA 1KOJA 3V1YA 2GOYA 3COYA 2XV1A 2QRMA 3V7FA 3WR5A 3ZE0B 3QX7A 5T6BA 2QDXA 4HDKA 4LECA 5HJ2A 2Q7DA 7AT1A 4D25A 2ODNA 1DG9A 1TXGA 1FNBA 1T6BY 1Y80A 2AUNA 1VRVA 2O48X 3C5VA 1ZJ6A 3NC1C 1GL3A 4LHXA 4TV8A 5JS2A 2OB1A 4OJYA 4R8MA 3DOIA 1L2TA 4HRAA 3MUNA 2GZDA 2JIZA 3URMA 1E89A 4E94A 3QUTA 1QS0A 3D7NA 2OQVA 2R751 2HJHA 3ZCXA 1BDMA 4A6DA 5ALMA 3PHIA 1OX6A 2CNKA 2XX3A 3VHXB 3QHPA 4JJ8A 1GVHA 1WDTA 4QELA 1N3BA 1NN5A 1XZMA 1GRNA 2XYVA 3IQXA 4UFPA 3HKDA 4MCIA 5DOZA 2WJ4A 3EW9A 1TZKA 4P0QB 1US8B 5C2JB 2FZKA 3OLCX 2Q27A 2FPIA 2OVBA 3OTOB 4E70A 2OGZA 4UAVA 1DV1A 4JEUA 4PGAA 1EMDA 3RUIA 4AS1A 1LSSA 3WGTA 1P7VA 4N39A 4FFBB 3L02A 1XRQA 2I6UA 1DFIA 3LO8A 3TVDA 1YS4A 2I3BA 1AXRA 1TYEB 3GRFA 5NULA 1TCVA 3CRW1 3GJSA 2LKCA 1YIDA 2DWCA 5K0NA 2BFPA 3HC7A 3HXLA 4TKVB 3ZH2A 1X1DA 5BUCA 4I7EA 3K09A 2Q0HA 4JASB 2GQ0A 2BE9A 3AUJB 3R5XA 4GR9A 5JSHA 2ADMA 4RZUA 2X2EA 3U9TA 3HKBA 3OPYA 1CJVC 4G4GA 4PS1A 5AJZA 4DE5A 4K9MA 5DN6D 4GGOA 3O4HA 4HDSA 4UJ5A 4DSZA 3BTSA 5C8VA 1GFWA 4B32A 2J87A 1VIAA 2VOJA 1LJUA 3G85A 1GL9B 3Q1KA 4M7PA 3Q12A 5ICCA 3FGZA 4TGLA 2PAAA 1PO7A 2EFHB 4CLHA 1KDRA 4JAVC 2PPLA 2FR8C 4BFXA 2YJZA 1VDMA 4MO2A 3AP2A 3KTOA 2DUWA 1IM2A 3F6EX 1EUDA 1PEKE 2AJBA 2HIAA 5IJWA 4XWWA 1DUSA 3L4SO 4P81A 4UD6A 2R1ZA 1Q6ZA 2PV0A 1FQWA 3L01A 2OXTA 4B73A 2ZZKA 1P0PA 2IF2A 5AVRA 3F5DA 2J7PD 3KEOA 4E07A 4ZT4A 3DZIA 2QIOA 2YASA 4WZBA 2WAOA 3THSA 4NHEA 3HJBA 5FOWA 1T29A 3ZY2A 3M6MD 4P80A 1IYZA 4EFDA 4MICA 3E03A 1JFVA 6PFKA 2DFDA 2HT1A 2C96A 1A2OA 4GI2A 2ZRNA 1VHLA 3RHSA 3OPMA 4DC1A 1FX0A 1BRTA 2O14A 1PTJC 4Q19A 4PLWA 1XZPA 1JDVA 1DO2A 1U1CA 2B1RA 3IC5A 4D97A 1FFXA 1DTEA 3NOXA 2PD6A 4AT1A 8AT1A 2BTEA 1R6TA 1BROA 1KMMA 2IPNA 3PEFA 2FMUA 1KKLA 1YI8A 1YJCA 2WFZA 5FBRB 3UT6A 1RSZA 5I3CA 1W36C 3OF2A 2AMLA 4MVWA 4NJMA 3ZVNA 4KO1S 4JP2A 1MNQA 5K3FB 4OQXA 3HXTA 4Y6SA 3SQOA 4ER6A 4ZV4A 3GBSA 1DKPA 3ZEAA 4S3MA 4DBVO 4WERA 4HQNA 1NI5A 2JARA 4K6CA 1VGQA 1XL0A 5CX4A 3LCRA 4MHSA 4F38A 3FKJA 5IK2D 4DMMA 4URYR 5A4JA 3OZUA 1DZIA 3SN6A 3BWMA 3EHEA 3N7UA 3OX4A 1M6YA 4ZEMA 2H57A 1XCJA 4BO8A 3FLAA 1E2IA 3PNVA 5BVHA 1VL6A 1ZOSA 4A6XA 2G07A 4X63A 3U7RA 4GL4A 2JI4A 1NPDA 4GC9A 5ED4A 1DMSA 2Q3MA 4C7OA 4E2XA 5L4NA 2ZAYA 4R1PA 4RCZA 4EW2A 1NHGA 3PKIA 4MKHA 3LCUA 4MLPA 1ZICA 1QCYA 2AA3A 3EOZA 3G5AA 1UQUA 2QHXA 3ITEA 4RE5A 3R7LA 3JV7A 2HPZA 4N5IX 5CD1A 4QNNA 2IEBA 2QMYA 4DLPA 1R0RE 2GPBA 1G7SA 1IY0A 1B2LA 3I6QA 3PT5A 3WGUA 1A7KA 2CNDA 2CV2A 4UHCA 4C05A 5CYFA 1RXUA 4MHTA 4AI6A 1XXHB 3ICPA 3KETA 3BKXA 1OAAA 1QDLB 1T13A 2FR0A 2R1TB 1H0HA 1CJMA 3BZWA 3LH5A 1JSZA 4FNAA 4LDJA 1XQ1A 2VAXA 1VMIA 3FYHA 1ZA2A 3L7CA 4GZMA 5J5VA 1C14A 3RIYA 4Q5IA 1UBOS 2XYPA 1AJEA 2C61A 2DJIA 1E7WA 2C9MA 4G3XA 4MKRA 1KFBB 2XRMA 3OA0A 4NOLA 4BMPB 4YCBA 3I83A 3WMGA 4Q3EA 1FTQA 1LC0A 4GMXA 1JMYA 1KI6A 1R00A 2XWPA 3A6GA 3D6HA 3H2YA 3K53A 4ZVKA 5GJVC 1SVLA 4QXOA 3F5SA 2F9MA 3L1UA 2CXOA 3MW8A 3AHEA 5D3MA 4BQPA 5LMUB 1W0CA 3WYGA 4XVUA 4YFVA 3RNLA 2H92A 4YCLA 1X77A 2KLBA 3H1GA 2FOLA 3IXQA 4L4UA 4QTXA 4JP1A 1LTKA 4QUHA 2W6IA 1FRNA 5AKZA 2QW8A 4LYDA 4IFBA 3R7AA 1NVVQ 3A4LA 3SC3A 3QRWA 4YUWA 2B78A 3N3AC 3KKZA 3R4CA 4RJLA 2FDCA 1STOA 3SSNA 1Z18A 4N3CA 5AKGA 1LRJA 2QMEA 5CFOA 3DWIA 5EQDA 5K0SA 4LI0A 2NOAA 1D3AA 5KYXB 4QQNA 1P72A 3WHLA 4CLRA 4X84A 1R6XA 1PGPA 5TMPA 3GLGB 2P0AA 1B8OA 4EI2A 4YDQA 3DNPA 3OZEA 3E0XA 5B2FA 1DKRA 1JDZA 3OC6A 2PH7A 4IWXA 3H2ZA 4IDHA 1Q1ZA 2I6TA 2MMGA 4KMOA 4QU8A 3EGOA 4UKDA 1CUAA 4CKCA 3W7BA 4UZSA 3L7YA 1UCFA 1TM7E 1SQ5A 2VYVD 1HZZC 1ZIDA 2CFCA 3QQPA 5DOVA 2IU0A 3VXKA 4BB9A 3V6LA 1H2HA 1R4NA 2W58A 1XRSB 2R85A 1LDGA 1WY5A 2Q9AA 2ZJ3A 2FHPA 4W5QA 4QUAA 3G0OA 3I53A 1ZD4A 4XWGA 5LWHA 1M6VA 1O94A 4W7IA 2PM8A 2CW5A 5IC4A 2F3TA 5KVAA 3ZE6A 1QGED 3JAKA 4NOMA 1Y3DE 2AQIA 3X1WA 1WU7A 2NZVG 3QPDA 2BSQA 1L3BA 3LVFO 1N33B 1Y42X 4PYKA 4TTPA 5TJ9A 2XUHA 2GBPA 4K3VA 1EXMA 2FB9A 3RODA 2HQSA 4HGQA 3QU2A 4YRAA 4CZ2A 3U1BA 1CJBA 2A57A 3U5ZB 1ZK1A 3QMVA 4N12A 1X74A 1GFIA 1MNAA 2X6QA 4KLRA 2R7LA 3G9UA 1DE0A 1US8A 1J2RA 1D2CA 1JHVA 1GPNA 1PW7A 2DFPA 1P4GA 3BFXA 3R3WA 2EQ5A 3BHNA 4FP9A 4HWOA 4L8LA 4B71A 4RTSA 2VP2A 5J58A 3J7TA 1ZI9A 2O52A 1UT6A 4AJNA 2OK7A 3ND7A 4W1PA 1P1HA 2AI2A 2W8BA 2DRIA 1UMBA 1RQXA 4DY4A 4Q6WA 1GQ2A 1QS0B 5IVKA 4IDEA 2ZJ7A 2IYLD 4I6EA 3SR0A 2HK6A 2XWQA 1N3IA 4ENWA 1J33A 5JI3E 1GUFA 4B46A 3A9VA 1HL7A 1R6DA 2GJ8A 1MO3A 1LQUA 1QONA 2AOVA 2AT1A 1ULUA 2X7HA 3IOYA 3LP6A 4IGKA 5BSEA 1EFAA 3ZDCA 1PCXA 2ZJ4A 2A1TR 3FAZA 4ID9A 6ADHA 3M6VA 2WIJA 3T4XA 3U44B 4B2IA 1QE3A 3HDJA 2BFFA 2ENUA 2XUKA 3PPIA 5ELMA 2NUTA 4DR5B 5JYDA 2AJ8A 2R84A 3CURA 5TNXA 1AN9A 5IJ0A 2C2YA 2XQVA 2EF1A 2R65A 2R8XA 1X2BA 2DY0A 2F8LA 4CJXA 1X19A 1Y6RA 1JIJA 2VDJA 3B3QA 3FG9A 3UMRA 3WKCA 3ZI4A 2WD8A 4F96A 4ZN6A 1NP7A 3OAAD 3FOCA 2G9NA 3CMCO 3OD1A 3AM1A 1NJ5A 2P3LA 5BORA 1KK0A 3PK0A 4M8IA 4G26A 1IOLA 1KJIA 1XPOA 2Y0EA 1XTTA 3A1CA 4EHLA 2YIDA 4KBYA 1TZ2A 1GYQA 3WGYA 1HYEA 3USZA 4PFJA 4UAGA 1JNXX 2PZ8A 1J22A 1G3QA 3SC2A 4F8YA 4HLUA 3TLGB 2D0DA 2WJZB 3J81k 4JC5A 3H84A 3PHCA 2BZ1A 4QM6A 2WTBA 5BN3A 3I58A 4B6EA 2D5AA 1UKAA 4NV3A 4R01A 3VR5H 2QXYA 1I80A 5CW1A 1WVGA 3ONDA 4MIOA 3KS9A 3I2FA 5COBA 2O5EA 3U26A 4IOJA 1YOVB 2RKBA 4XQGA 2Z8YA 1F3LA 4BX0A 3DHEA 3UGKA 4LZLA 1I33A 1VYUA 4Q4HB 1Y1KE 2Q9UA 5K0FA 1WQ4A 2BUCA 3G2QA 2G8LA 3JR3A 3NHAA 2LNDA 4LE1A 4J3FA 3ZLTA 3OETA 4N5LA 4QYWA 4MUBA 2OM2A 1AB6A 1JHUA 5AKLA 4RTJA 3MPOA 4KZPA 1G4HA 4JGGA 2F55A 3FHJA 1UMDB 5LZ4A 1A8UA 1RFLA 2XMDA 2V0GA 1F1BA 1QB8A 4IMIB 2HBZA 7YASA 1W94A 4IIDA 3MF4A 4DMHA 2ONCA 5JZVA 1V7CA 3NTUA 4MYTA 4XCQA 1HLDA 4BMXA 3GDFA 3VDMA 1E6KA 3IMKA 4FCWA 4MA5A 4BBJA 4CMBA 3OIYA 4LYYA 4Y2GA 1Y0BA 4U0KA 4EBFA 2VHQA 1JNYA 2JAXA 5IJ0B 3FB4A 3B7PA 3G0GA 3EZ9A 3DONA 1UQTA 4JLUA 5KNLA 1FS4A 5DWVA 3N8HA 4DV0B 1E1DA 1WR8A 3CLRC 3ZS9A 1NVUQ 2AK3A 1B0AA 3D3WA 4P5EA 2V7TA 1PS0A 5TXGA 1QHFA 4MYRA 2QVGA 2CVHA 1P2BA 2FX2A 1WXQA 2G36A 2B5VA 4KO4S 4Q3NA 4FVTA 4IOLA 1CUVA 2B8JA 2HQRA 4BNNA 2SHKA 4OHKA 4LMAA 5FTNA 3UG6A 4CFZA 5J4VA 1HV8A 2RBGA 2JEYA 2O0MA 3DXZA 4FQ5A 4B40A 1ZRMA 4BFVA 3ER8A 4ETMA 5EI5A 2ZS8A 1XZLA 4H59A 4MAMA 5J2TB 5AXBA 1II8B 2MSNA 1PKEA 2Q41A 1ESMA 3OPNA 3LYUA 4JKOA 1ZCZA 4AQYB 1JKJA 4DIBA 1PJ3A 4NG5A 4OB8A 4WQMA 3VTZA 1SC4A 1U2SA 1Z2NX 4F2WA 4HWTA 2QNBA 2EHJA 4PSKA 2VZLA 3ENZA 2VRBA 1T1GA 1U1GA 3OZWA 4J2TA 2EQAA 2XWBF 1M2OA 1N2BA 2XUQA 3EJWA 4PLTA 3O8QB 4AZSA 4PYJA 1B0ZA 2OHIA 2OLJA 1BCRB 1E66A 2W2TA 3N6RA 4LISA 4PZDA 4EO4A 1C3OB 5CCEA 5KNDA 1L7NA 2AQ8A 3KTDA 4AF8A 5CBPB 2ZJZA 4LBWA 1UM9A 3HU1A 5F21A 3QK7A 2J41A 3GFBA 1C4WA 3BMQB 2GEUA 2IQIA 2ZIVB 3B1ZA 5JVDB 2EJCA 4CEJB 5B53A 3L0YA 4MPJA 1Z0DA 2ARKA 4FFSA 1MJGM 2XDYA 4ZCTA 5J2TF 4FGLA 4HKTA 4PANA 2WILA 5EN4A 3D0KA 5G3YA 5BSRA 3JD4A 1ZN2A 4L3VA 1FX0B 4CF7A 2L18A 4L15A 4RA9A 5CPBA 1JF8A 1NONA 3F96A 1VFPA 4RY8A 2ID9A 2V65A 5BW6B 2WWVD 4DCUA 4J16C 2GTPA 2FFQA 1D4OA 2X8JB 3P9IA 2O3QA 1NXTA 3LL7A 3O74A 3U3JA 1E94E 3EISA 3F8TA 4HEA1 4JK3A 2P6UA 4KN5A 4Y2UA 5G41A 5JNTA 2VUTA 3ACBA 3QYPA 3JSXA 1HKHA 2CJXA 2I54A 5IDQA 1C1DA 3AVQA 1C2YA 1CE8A 1NF3A 4P4UA 3VFDA 4QVGA 4BO0A 4OL9A 1CY6A 4ZHQF 2Q62A 3NPAA 1J0AA 2BGMA 2B25A 1DG1G 1NJSA 1QHHA 2WKSA 2J46A 3GA7A 2GUWA 3GJ6A 3GZNB 4LOKA 2VAPA 3Q9UA 1SK8A 2H4FA 4O8ZA 2O6LA 3QLVA 4J75A 1HDOA 1VYTA 2H5IA 1E2NA 5DBHX 5EQTA 4CMGA 1U2GC 4E30A 4B5KA 3FPEA 3ZZMA 1I1HA 4F4HA 1MTOA 2H2GA 3SQNA 3Q4GA 4MWSA 1NW5A 4MGIR 2JJQA 4DW8A 2GERA 2OC4A 3HUEA 4IXTA 3VMFA 5CGZA 1JAZA 2FVXA 1C9KA 8LDHA 1JDSA 3MTGA 4QG7A 2EGGA 3LQ1A 4KXMA 1SVMA 4LJYA 2H2DA 1KWGA 1XKTA 4I9UA 3I9KA 1BXGA 4MWTA 5ALLA 2ZT8A 2YWBA 3W4JA 1SM4A 3BA1A 4BNIA 4F5WA 1DBPA 3L0ZA 3KTAA 3VVBA 2BCEA 4MYSA 4A0QA 3LU1A 3NWJA 4EY5A 1CYEA 4LPKA 5IAAA 3VVLA 2XTAA 4B82A 2HUPA 2OGWA 2FE4A 3AUUA 4GP7A 2PKCA 4EBBA 5DP2A 2BFDA 3QBVA 2I7XA 2IEDA 4BVLA 3GEEA 3KZKA 2VWQA 2C03A 1GJRA 4NAVA 1EVJA 1ULHA 2I1WA 3NWBA 3Q8XB 5F76A 4BWYA 3INTA 4UCQA 4WPGA 1WUIS 3WYNA 5A5DA 4MI6A 4HAVA 4IEEA 5CEJA 1F60A 1JBKA 4OOEA 4CKWB 4GPAA 4Q4JB 4DZTA 1LBTA 4OHYA 4AKTA 2O8CB 1OPRA 3VVMA 1JHMA 4JY7A 4C76A 1MB4A 1L3CA 2PDAA 5FWAA 5JANA 4X90A 1C3LA 4V0RA 2YDXA 4FSHA 3W5CA 3WK6A 5HJ5A 4OQZA 1YFZA 3OFSA 1R5JA 4HWGA 1UOQA 4ROTA 2RFLA 2ZROA 1YCHA 2V74B 3JQ9C 4LW8A 5BW8A 2PRSA 5CA0F 3D6UA 5DTMA 4JZYA 2HSEA 3IVAA 2HHAA 1AN0A 1Q92A 1U9IC 5AHOA 3ZY3A 3ASVA 1PFQA 1CJUC 1QNLA 2D62A 3DCJA 3GVXA 3PQ5A 1V8ZA 2GFQA 4KQ1A 3NTRA 3M4ZA 4GX5A 4EECA 3NALA 5HKAA 1QOPB 1G0OA 3IEKA 4M8NE 2JLWA 5A2QA 2H08A 3H1TA 3DZ8A 1LPPA 3N86A 1HWYA 1IZ8A 4LOAA 3WB2A 2A0YA 4BAGA 5JECA 1L7AA 5LDHA 5HTOA 1B73A 3VDNB 4KX5A 4E4TA 2B9EA 3H3XA 1DLJA 1HT1E 1SQGA 2PD3A 2PL1A 2JS7A 3DH0A 3F5FA 3L8CA 3K92A 2VJMB 4L7VA 5E2BA 3IVXA 4L8VA 2ZB4A 4UHFA 2BJHA 4DUZB 2P9JA 1Z6YA 4Z9AA 4NXNB 4YXFA 1T9ZA 2WT9A 2CJFA 1MFZA 1HDRA 3I6YA 3ZPXA 4CM5A 4D98A 5DM70 1E9RA 5JCXA 2DETA 1OFVA 3I4FA 2VP3A 1WCXA 3K72B 4O02B 4G5GA 5AI6A 5LBUA 2XGJA 5BUQA 1H2RS 2JFQA 4RANA 2DFTA 1CULC 5AOAA 5I4KA 1T5BA 1PN3A 1BJTA 1Y1RA 4NU8X 2J0SA 1ZNXA 3O38A 4B3JA 1MAAA 2H4ZA 2CL7X 2IDZA 2UZ1B 4P4SB 5BY2A 1QCCA 1IOWA 1ZJZA 2YVQA 4Q48A 2FWPA 2B21A 3AL2A 4PLPA 3R7WB 3RREA 3RVMA 3R3YA 4GXRA 4YAWA 4CIVA 2BEVA 2QU7A 4MI3A 1ACJA 2YXDA 1F8YA 3TOZA 1EAYA 2DHCA 1XZNA 1YFJA 2P75A 3UMBA 2PS9A 1F38A 4BQRA 2QL5A 1QYVA 1W93A 2IIQA 2X14A 2P1ZA 1DAPA 4EPYA 1F6BA 1B6RA 2W5UA 3QKRB 5EE0A 5E6RB 1A2BA 1BHJA 3H9UA 1OI4A 5HVNA 1UXOA 2XE6A 3D2AA 2ONZA 3F4LA 2VDKB 3R09A 4LRYA 4A2PA 3SZRA 4KODA 2ERCA 1Y9AA 3T1YB 3AZOA 4FFPA 4BL5A 2H1HA 4YGXB 2CXRA 3K5HA 1A9RA 1SPBS 1WQ1R 4YXWA 4WJKB 4WKPA 4DA8A 5FLXA 1LRKA 1QUEA 3G7UA 3B2EA 3AESA 3NDIA 4HQLA 2R6HA 3AL0C 1C7RA 4AX8A 2CL0X 5C53B 1NQAO 2NO1A 5JSQA 3DL0A 1T4MA 4WFIA 2OA0A 4EGAA 1JT9A 1Y5NA 2IWHA 1HY3A 3EFEA 2VBCA 1NSTA 2XMQA 3OLZA 3JQDA 3KJGA 2EKLA 3NXSA 3PCTA 3B89A 3NX4A 4D0LB 1Z36A 2RHOA 4LHSA 4D4GA 4ARVA 1Z7BA 1HDYA 1ZZEA 3FUWA 3MJFA 3TLKA 3W5JA 4A5OA 1NQTA 2R2AA 4RA9B 2ZS9A 4N6GA 4MARA 2RHDA 2NU6A 1EDZA 2ATEA 4L3WA 3BGOS 3UH1A 3VC1A 1RIFA 1CFJA 4G37A 3MCZA 4KPFC 3WO0A 1UC9A 2H9AA 1G20E 4P4GA 3BWEA 4FPXA 3PUIA 4MVJD 1W19A 2FRDA 3QM1A 1H9AA