1QCZA

Crystal structure of e. coli pure, an unusual mutase that catalyzes the conversion of n5-carboxyaminoimidazole ribonucleotide (n5-cair) to 4-carboxyaminoimidazole ribonucleotide (cair) in the purine biosynthetic pathway
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
162
structure length
162
Chain Sequence
PARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Escherichia coli PurE, an unusual mutase in the purine biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE
total genus 49
structure length 162
sequence length 162
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 1qczA00
1U11A 4ZC8A 5CLJA 1QCZA 3TRHA 5CVTA 1D7AA 3LP6A 3OPQA 4YCCA 4YCJA 4ZMBA 4AY4A 2FWPA 1XMPA 2FW8A 4ZK2A 5BOSB 3RGGA 2NSLA 1O4VA 5CLIA 3KUUA 5BOSA 2FW6A 2NSHA 4JA0A 2NSJA 4YCDA 3ORSA 2FWAA 2YWXA 3OOWA 5CLHA 4B4KA 5C5DA 2ATEA 4YCBA 2H31A 2FW9A 2FW7A 5CTJA 2FWBA 4GRDA 5CLGA 4ZJYA 5BORA 5CLFA 2FWIA 2FW1A 3RG8A 4Z7JA 4AY3A 2FWJA
chains in the Genus database with same CATH superfamily
2WD8A 3PVCA 5CLJA 3I0NA 4I2NA 1K7XB 1SZPA 2BR5A 4LECA 5FOVA 1JKJA 5THQA 3GDWA 3EULA 4WD3A 5U1PA 3N8KA 4Y2RA 1SU4A 5BNFA 2GAAA 3ND5A 2ZJ5A 1RRMA 5KINB 5TGTA 4KQIA 3L0CA 2QUBA 4CKEB 4KUEA 2RGWA 3LUJA 1A2BA 3UW1A 3VNVA 3FSRA 1W87A 1ZKDA 2V5UA 3OZDA 4QULA 5AW3A 2ZUEA 3ASVA 3NVKI 3SHWA 4BBZA 4WASA 2F8TA 1EA5A 3ILSA 1RQXA 1AURA 2GN9A 2NW6A 2WWWA 4W6QA 1F9EA 5BT9A 3PGKA 3VKFA 2E4UA 3HXPA 4ITRC 3ZWAA 3G0DA 1DAGA 2YV3A 5FUWA 3ULKA 3FGNA 4G4SO 4Y18A 1N3LA 1UWLA 1FS4A 2WIJA 1N2SA 2W2XA 1P9RA 3UUWA 3OJEA 2BHRA 4B9EA 3TJRA 4D3FA 1FSGA 1V47A 3BULA 2B21A 4MV3A 5DFAA 3AR5A 2WZCA 1G6HA 1PQWA 4Q1BA 1JEJA 2R7AA 1UANA 1W5EA 4A10A 3UXEA 1TLTA 4BCCA 2DHDA 3VGPA 2O0JA 2ZJZA 3I01M 1KQ3A 2BYTA 1QG6A 1TO6A 1GL6A 3NV9A 1N0VC 1QGYA 4CMJA 3FYTA 3LWZA 3LF2A 4OQQA 5M29A 2AX4A 1EP3B 1V1RB 4FDVA 4GPEA 3SSMA 4MVYA 1QGUB 1Q0RA 3IDSA 4EG6A 3U44A 1KMMA 2ASVA 4NJEB 4E2YA 3D6AA 4ZZ1A 4LJ7A 1Z5PA 5MN5A 1SELA 1B8OA 4YRKA 4URZR 5J58A 5LD2C 1NP3A 3K71B 3AG5A 3UGQA 3WHPA 4P9NA 1L5QA 2SICE 3E9ZA 4RKWA 4YP0A 2VJMB 2EZ9A 3FSGD 4ZOBA 1QGOA 1QHHA 4B7XA 5AOAA 1EGVB 5JVDB 3ZU6A 4DIMA 1F6BA 4K87A 3DBVO 4YRNA 2HCRA 2RKBA 2ZSEA 2AE1A 3AR9A 4FFBB 4DLRA 5KJCA 2XUGA 2OSVA 2ZRIA 2J0SA 5DB4A 1YBHA 2N1BA 4UHFA 5IARA 3H9EO 1P1KA 5ALYA 2FJPA 4EWLA 5TF0A 2ZJ0A 2G9NA 2BLLA 3T61A 1E9SA 3ICQB 9MHTA 1C7FA 1H0KA 2CXOA 3B1YA 1PJSA 5IC5A 5H9VA 1GNRA 4F4DA 4RL4A 4ZA2A 4DC9A 3KQHA 5JI3E 3UM9A 3V5NA 3CX4A 1PV1A 1XXHA 2NXEA 4IRUB 5JXJA 3OCXA 3QX8A 3ZZTA 2DVMA 1XZCA 4DDVA 1KAGA 1GKYA 2XAAA 2DFNA 3MELA 1SCNE 4EELA 2PV0A 1JKMA 2PXCA 3CZ4A 3JQ6A 1BN7A 1OTXA 4YFYA 5FTNA 3RABA 4QAJA 3VDNB 4EI9A 4CQNA 3HZRA 2JIDA 3BMQA 3QVSA 4B40A 1DG1G 2WWTA 1DRVA 3IJ5A 5AQEA 3TIIA 1DKLA 5I48A 1YZTA 2VKTA 3VTKA 4D4GA 5L3VA 5CURA 5G4KA 4UASA 4HV4A 3QI2A 3Q5EA 1F6DA 5CFRA 3BF7A 2QJOA 1I2BA 2FE4A 5AM0A 5E9WA 1I7QB 4EPRA 1W5AA 3F3KA 3G59A 3QTLA 4NCKA 2ZJ8A 4P33A 2B2CA 2BEJA 1ZRSA 3HV2A 3KJEA 3A9UA 3M82A 5GJVC 1LY1A 4EY3A 2UYOA 1I2CA 5B5SA 1J8YF 2ISCA 2IW3A 2TYSB 2WUFA 1VGVA 4YJ3A 2Q0QA 2QLTA 3SQLA 2ZJ3A 1G21B 2BEWB 2F9MA 1ZD2P 2QM0A 2WKQA 3T5PA 1G0OA 4WDQA 4REMA 5EMNA 3DAPA 3SBOA 3ZGNA 2DECA 1L2TA 3FGOA 3K53A 3WDMA 4QGSA 3TQSA 4EQ6B 3MAJA 3S40A 2VF5X 1HOTA 1QM5A 1RXUA 3GJ8A 4R2IA 4ERXA 5DPMA 2BGNA 2Q8PA 5CB6A 2ZIEA 3EVCA 5M7EA 4X1YB 4WAUA 1WSBA 1WHTB 3OIYA 1DPFA 2FR0A 2ZKLA 1US8B 4E03A 5IZ4A 3NFYA 1NX6A 3HFSA 3ZTYA 4KR6A 1G4UR 2ZANA 4F06A 1VLVA 1B41A 4P86A 4P58A 2A0FA 1G7RA 2XKKA 3KBBA 2Q2VA 1A9YA 1IEVA 2O3JA 1GTZA 1JQEA 2YMQA 3BMNA 4OV6B 3LUFA 1LLCA 2FVXA 1QGED 1UR5A 3SSNA 6NULA 1FDSA 4QM7A 3EFOB 4P6VF 2I0FA 4IX9A 1B0ZA 2PL9A 3H1TA 1D0IA 4QPPA 2J3LA 3WB2A 3KKOA 4MQMA 4RNDB 4AP6A 4DTCA 5JH7F 2OZKA 5AW0A 2GVNA 3L0ZA 2YCBA 3IERA 5AVRA 1TIKA 4NNOA 1KEUA 3CA8A 4M1QA 4MLZA 2QB5A 2KLBA 3H16A 1D5WA 2EZTA 3VHLB 4P0TA 1VIYA 4QBGB 1K98A 3NEJA 3F67A 1Z4IA 2M6LA 1JSZA 3BD7A 4FDTA 1J00A 4ZAFA 4Q1AA 3RF6A 3OM0A 3TLAA 5DLYA 3TQQA 1JMVA 2Q3BA 1DO0A 2DY1A 2W58A 3GLHB 4MW4A 5ERGB 4QT4A 4BFCA 1C9MA 1FMCA 2DHQA 1DEXA 3PHHA 3I92A 4NCXA 5IYZA 1UOEA 1NM5A 3DOIA 1WRBA 2P27A 1DG9A 1WR8A 2AMLA 2GNOA 3O1IC 1Z35A 2ZI3A 3P0HA 3V4OA 1K5DA 3F4BA 4M9XA 3OHSX 4W9MC 2CD7A 2GKGA 1JEYA 2Y27A 2W2KA 3M1YA 3WLNA 4OD0A 3IP9A 3TZ6A 1HDXA 1HYGA 5AI6A 5C81A 3L8YA 4ENQA 4B3JA 2P2LA 4F2WA 4DAEA 3F74A 4IIJF 3MF4A 2CHVA 1W0JD 2IT1A 2J0UB 2C57A 2VYCA 3A8TA 4YDRA 3UB4A 1MXHA 1KNQA 1TD9A 2CLIB 2GZ3A 3ND7A 3C41J 3D2CA 3MCZA 3OLCX 2ZIXA 2Y4OA 1ES9A 5I8ZA 5H9WA 1ZIDA 1Z08A 5IU6A 1DG3A 3QVUA 3HB9A 5K6TA 2VNIA 2WYVA 3NTUA 3QK7A 3M3PA 5LQAA 2ON6A 4ND3A 2ZI6A 5I7VA 4CKZA 1T8UA 4G0YA 2QU8A 1T5SA 1XE3A 4CMIB 4CODB 1XT6A 5C1DA 1YQDA 2I55A 1NY5A 5IULC 5CNKA 1NRJB 2VYFA 5J5CA 1NNI1 1O0BA 2Q6VA 2UYCA 1E0KA 4FZ3A 2PVPA 2DJ5A 4DCSA 2WIGA 2XGSA 4WZBA 3BWXA 1Y1LA 2YX1A 1E6LA 5K3DA 2W8BB 3PENA 1NNUA 2ERXA 4IJ6A 1IOZA 4UFPA 2XI4A 3VR4A 4BO9A 2F3TA 2WDPA 3GCDA 3ESYA 2QSZA 4B83A 4FLEA 1CEYA 4QQFA 1CS0A 1E94E 1YU6A 2WMNB 2C4MA 4YRGA 1OWLA 4K9PA 3Q8LA 4QUEA 4HXFB 5LXTB 4F97A 3X1ZA 1G2PA 4GOKA 4R1OA 4II3A 4GLJA 3P4XA 4D9FA 4FZ5A 1NT4A 1T91A 3HJCA 1RJ9B 2YW9A 3L4BA 4ZICA 3W3AD 1V35A 2GRAA 4PAGA 3IT3A 4XDZA 2C8LA 4ZRNA 5I7UA 2XHEA 2QAGA 3HBLA 2AG0A 2RGCA 1Z17A 2Y05A 3GD7A 2AZXA 2NVWA 1LPBB 4XRGA 4B33A 1JAYA 3VR2A 4CLHA 5CDUA 7ADHA 2VCEA 1YI8A 5DH9A 4RH1A 5IBRA 1K5GA 4EVSA 2GEJA 3B6MA 2G3YA 3WNDA 3DNMA 1RP7A 2CVHA 4KZPA 1L1FA 1C41A 2C1XA 3AONB 4NMMA 1VLZA 2DTEA 1QFXA 2D7JA 2XGOA 3AB7A 1FPMA 1G20A 3PRKE 4H7EA 5BY2A 4WEOA 3WMXA 1ISPA 4MV4A 1ND5A 4R1LA 1TVMA 2ZAGA 3BD9A 2UXDB 3M49A 4EYQA 1Z6AA 4JJGA 2UZ3A 4YQFA 1EK2A 4L3WA 4QSHA 5DSTA 2EYUA 4F46A 5A9TA 4XEUA 5BUZA 1UPXA 3OPYB 3QBTA 4HI0E 5DZSA 1FFSA 1HYHA 1K5HA 2G25A 2Q6KA 1IDN1 5AI5A 4I4TF 3T5GA 3LY5A 1PT7A 1QHNA 5CNIA 4BKPA 2X40A 9GPBA 4RTJA 1KH1A 4U7HA 4BTLA 2GPSA 1WMDA 2MINA 1MOPA 2AG6A 4GZ6A 2RHLA 2J41A 4NENA 1PZFA 3UAXA 3SKYA 4Q9IA 4BXOB 3F7NA 3GPCA 1IJBA 1PL8A 2QVGA 5D01A 3AUXA 4DM4A 1NVAA 4KGZA 4EY6A 3X1WA 2V7VA 1VCNA 4HEA1 2BL4A 3T9CA 4AMGA 1KKMA 3WL3A 3NIDB 4P4TA 2DG2A 4GXNA 1OYWA 2Q7DA 4DFDA 1N6PA 2PH3A 4OQFA 2WTBA 4BO0A 4YUAA 2FDCA 1ZH0A 3N6XA 2WVJA 1Z18A 3DHWC 1ZVVA 2HSZA 4GVLA 4CM8B 2Q4RA 4DA6A 5DLPA 4UTNA 1LW7A 1SVWA 2XDAA 3PLRA 2VJBA 3G0OA 3G88A 3PUYA 4J9VA 3W78A 3ZLVA 5HUJA 2QM3A 3QPVA 1JAIA 2P1RA 2B9EA 2AUNA 3CLRD 3VR4H 3WXBA 4IDBA 2FF7A 3NDIA 1RHMA 1TRKA 1FK8A 3S5JA 4RIHA 1OMOA 3IVRA 4KX5A 3UJBA 4OTZA 3O8RA 3EXHC 3B89A 3IODA 1I7PA 3ROZA 1YVPA 2I3DA 2QRGA 1J2JA 1KIMA 3H4IA 3LNTA 4CKEA 1DX6A 5HK9A 1ISSA 4WBNF 2IODA 5F7ZA 1ILWA 2A7QA 1NNEA 4KEAA 1YC2A 2X0NA 1XXHB 3TL6A 3DTVB 1N9GA 5K09A 1BE0A 1EDZA 6ABPA 3HMKA 1E77A 2YYYA 1JR3D 2VDLB 2Y0BA 1S2IA 2B1JA 2XT0A 2YUTA 2RHMA 1WMBA 3A1FA 4YT4A 2B8TA 3BDVA 4OUDA 5AVJA 4B8YA 4L27A 5JRJA 3QQ5A 2GNPA 2YVLA 4DUGA 4YCDA 5K3FB 3ZHQA 5K8IA 1L7QA 3BDIA 3DYBA 4Q4HA 1FDWA 3PR2B 3TLCA 3D4BA 1EFRD 3AHEA 2PGDA 3OZTA 1Y5NA 4KQEA 3L77A 4NZPA 1QVVA 3DJFA 2GA8A 3EVAA 2HMAA 1JAZA 1KORA 1HRKA 1T3LA 4G41A 1QYXA 4U6NA 1XZDA 4MVJF 3DDZX 3HVHA 4Y1RB 3SG0A 1CEEA 3RWBA 2LP4Y 4Y7CA 2VUSA 1T15A 1VM6A 2YOHA 3MINA 3NAQA 4YAEA 1DT5A 3VPGA 1D2HA 4NE7A 3PC2A 4FTWA 5LXTF 1HGXA 1KO5A 3ZW7A 3RV4A 1KSFX 3ZE2B 1GDTA 3CUUA 4ERNA 2O8VA 1ORIA 1E5QA 3ZU5A 2JA2A 4EA8A 1E2DA 5K03A 1UDCA 3SJCA 4DJTA 5H16A 2M1ZA 1TYDE 5CX4A 5D87A 1US8A 3QWAA 2VJPA 1JR2A 1HDOA 4O29A 1RAFA 2NV0A 3MMXA 3IXQA 3EQ9A 4BVAA 1UMBA 2ZB7A 2GRUA 3RSCA 4TLLB 3RAFC 1L7MA 2YFHA 4HS4A 1SXJD 1FDUA 3PKIA 5CVJA 4MVJE 4JQOA 2B0CA 3JATA 5GIOE 5ADWA 1A95A 2O2SA 2WQ7A 2Q9BA 4PNZA 4NP6A 1CVLA 1VLLA 2VNSA 3GJ6A 4IJMA 5A4FS 4M1TA 4OQLA 4ZVVA 4HQ0A 1U7ZA 4TL6A 1VGQA 5TRTA 2Q9CA 3GAAA 4JBYA 1N2BA 1L7XA 1USKA 2VP5A 1CPYA 2ODEA 7YASA 3AKZA 1GKIA 3DZJA 3FA2A 3LC0A 3WRXC 2D7DA 3IEVA 3HUEA 1S2GA 3ITNA 3LSYA 4REQB 4A0RA 3K2QA 4GQAA 1T8RA 5JFGA 1A9SA 3ZBPA 3LO8A 5EL0A 3IPXA 4MXDA 3AJ9A 3V4FA 4E08A 1FNSA 1JDZA 1P1RA 1P6QA 5AVWA 3D31A 4H0FA 5J4HA 4LDQA 5CYFA 2ISSD 3ZW8A 4RD4A 1COZA 2P8SA 3PEUA 1ICEA 2UUOA 3UY4A 5ISMA 2ZBPA 4RZUA 1H8EA 5KQMA 4BE7B 1Z4NA 3H5NA 1U0OC 4YJ3B 5KSOA 1F0NA 2CWWA 1HZJA 4J29A 5B55A 1Y33E 1JEYB 3NC4A 3GP5A 1QBGA 5HBGA 2D3WA 1PG5A 4Q00A 3ZKWA 3D3WB 1OD6A 2XA2A 3U3XA 2I6UA 1ZX1A 2GF2A 2WZQA 4IH4A 4Q24A 4IW3B 3RWOA 4U2GA 5HZMA 4GRIA 1P7WA 1JIXA 4FYXA 4MVWA 4MLPA 1YRHA 2RB5A 4PYQA 1WXXA 2IPMA 3GLVA 4MQLA 4DBLE 4GOMD 1E66A 1U8TA 2YYSA 1JJ7A 1TB4A 2YIVX 1HLPA 4N7BA 4AN1A 1P0QA 3E81A 1PE0A 2AOXA 2HA6A 3R77A 4J0IA 1ML3A 3K0KA 3MWLA 2GJ9A 3B70A 4PANA 4DWOA 4C7OA 2D2VA 3JWIA 3E3OA 4CU5A 3C1UA 1EA7A 5BMVF 2C98A 2X4LA 1J49A 1D8TA 2GLUA 4NOJA 4QFDA 1RBMA 1BXGB 4FOTA 4P82A 4XUCA 3T3HA 4RZQA 2YWXA 4HDKB 3N0VA 1A72A 2EG5A 5B6IA 3P94A 2GEBA 3ZH9B 4G26A 1Z6QA 2X41A 2HU5A 2ZVDA 1GT91 2OFWA 4X0EA 5JNVA 4JR0A 6AT1A 4ZI5A 2BGLA 4EKYA 2ODPA 1XTRA 1NC1A 2PSHA 4OMUA 5ENVA 1IOWA 5CA1A 2GOYA 2ODBA 2V0CA 2K2WA 4NXMB 5IF9A 5HKKD 4UHCA 2H9YA 4KDFA 3NDJA 3H99A 4G1BA 4KXQA 1SU7A 3AHCA 4RK0A 5IC6A 3I3SR 4PZUA 3T7SA 2OGUA 5JFTA 2DUMA 3F7OA 3KZXA 3IQDB 4BGDA 1HV8A 5LQUA 4TSRA 2HPVA 3MCAA 2GTPA 2ERYA 2P3QA 2X0KA 4NJOA 4WFIA 3V2GA 5I7FA 4IIDA 2A94A 4R1SA 3ZGVA 2WUWE 4IO0A 4N5HX 4HH3C 4H6PA 3LYUA 4NULA 3QMPA 3ZWPA 4UTZA 1FFHA 4KDEA 1I32A 3HADA 5EIBC 2AFIE 3EUWA 4AO7A 3KSRA 2EL7A 2P9ZA 3ZXXA 2DR0A 2X8WA 3N2NA 4NZOA 3CGGA 3WDSA 4G37A 5EWJB 1C4OA 2VUIB 2GO1A 3HRIA 5K2MA 4NZZA 1V96A 1TQ8A 2JFXA 3AFNA 4OJNA 4II7A 4PU0A 3NRBA 4P7FA 2PVCA 4X7MA 5CH8A 1CTQA 1T0UA 5KNLA 3AYZB 2DFDA 1Q0LA 3L4JA 1RRCA 1XEAA 1IHDA 3AOEA 1GZ6A 2HADA 2PRSA 3JX9A 4RE5A 1ZXXA 4J4TA 4ALIA 3QU4A 2H2FA 2WD7A 3OLYA 5ELXA 4TYWA 1J1IA 1FFDA 1GKUB 1ZK1A 2VJLA 4V38A 1U2EA 1KYQA 1KI8A 1VPLA 4MVJM 4Z9FA 3KVVA 4ATNA 1EINA 1Z4PX 1GPBA 2WK1A 2XDYA 2J4DA 5TY0A 2FW7A 3OX3A 3NBUA 5DJ5A 1L4EA 5DWQA 2IZ7A 1TYBE 3HACA 1LRJA 1RAHA 2VPQA 5FL3A 5GWXA 1SN7A 3RR2A 4G3XA 5M34A 3T1YB 3H2GA 3RUIA 5F35A 2BONA 3OLWA 3AHIA 1WXDA 4C21A 4ZVPA 2Q6TA 1Z6XA 1O4WA 4FLFA 4TV9B 5FRDA 1YUMA 4YCJA 2KX7A 4DMLA 2RGDA 1MVNA 2QUJA 5J2UB 2V59A 2VK1A 3KSDO 4S2UA 5JTTA 4YVFA 1H4SA 2PT6A 5E6RA 1D07A 5JYBA 3CUTA 2AN1A 1Y3FE 3H5OA 3DMRA 1HOXA 1F20A 1IUPA 3TZBA 1BN6A 4Y98A 1G3QA 2CLLB 4FYKA 4FHFA 3F6RA 3ZVRA 2PQ2A 3ZHOA 4ID9A 4DLPA 3HZZA 2GXAA 3ZXYA 2O57A 3NRCA 1V8PA 4HPXB 3C5EA 4C0KA 3KFLA 5JAMA 4G0NA 5AKJA 5H5JA 4TROA 1JEQA 3WZMA 3S55A 4I0WB 2NMVA 3M81A 1T4CB 1U81A 1XZLA 2HSEA 4GL2A 2C2WA 2H1IA 2VDUE 3UWMA 5ADUS 4RTMA 3DSRA 1V2GA 1UQUA 2QMOA 1Y1TA 1XXHE 3RC9A 2HDNB 1GAQA 1WPRA 1GT6A 2YJTD 4LYAA 3SEFA 3RSFA 5AVTA 4I4IA 3RYFB 4ARVA 3EEOA 2LR0A 3PE3A 4IFBA 3KQYA 3HBAA 2XNSA 5TIIA 2FWRA 3AW9A 1WLSA 3DLPX 2XOKD 2VZ9A 5JD5A 1G20B 3EXIB 4LFCB 4FEGA 1YF3A 2JL1A 1HL7A 1WIWA 2FPXA 1QPGA 3KXKA 1SVLA 1VE6A 3ZWWA 1PVOA 4UVGA 2L82A 1FSSA 2A3NA 1EFAA 2RKOA 3GBSA 2NO4A 3W5SA 1GSOA 1EBBA 1SCDA 4NZYA 2J7PD 4YAFA 5D5HA 3TXAA 5IFLA 5BN1A 1K6IA 3UXHA 3WGTA 4DGQA 4F3NA 4XWWA 4P5DA 1CVRA 2DAPA 3ENKA 1P9LA 1C7ZA 1YQ9A 3JWPA 3K4HA 1CKEA 3PEVA 4TWIA 3OCUA 4AKIA 5ALIA 4LC9A 2BCGY 2WJHA 3ORQA 2OYCA 4B3BA 2QAGC 2QVZX 3AB8A 5FEUA 4PQYA 4ZALA 2RGXA 1NF3A 2VSNA 1QZZA 4YT5A 1OASA 2BF7A 4ZT6A 1RPNA 4RV5A 1PZMA 1U9YA 2XCIA 4OSOA 4UVDA 5HS4A 2PSSA 4KPYA 1XQ9A 1MX9A 1Z6ZA 2QRPA 5AXAA 2JCBA 4GOOD 4QLBA 4KFTA 3O3NB 1PS0A 3JRXA 1KZGB 3S2EA 4MP6A 1GFSA 4A8HA 3GG2A 4DLVA 1LV7A 3PFWO 3VU3A 3MINB 1BVHA 4QU8A 2BUAA 2R68A 1QR6A 1X92A 3SXPA 3EODA 5B3KA 3OEEA 1HLDA 4O4LA 1M34B 2B99A 2PKXA 3H7AA 2HI0A 3GFQA 4RHYA 1EFVA 3L1VA 2BGGA 4A8JC 3VTZA 4NAVA 4NG5A 4OGWA 1K3TA 2XVMA 2OCIA 3LKVA 2JJ1A 1IY0A 4ZCLA 5FOSA 3CCBA 5J1SB 1WF3A 1WXWA 5H82A 5BQFA 2WIKA 4IZHA 3SFZA 3DEAA 3ROEA 1B7GO 2WMDA 2P0EA 3Q9UA 3H9UA 4ZZIA 1J23A 1T6XA 2HJGA 5DU2A 5IM4A 2X15A 4Y0NA 5ALZA 4N8EA 1E9DA 3KTAA 1GAXA 3NEPX 1NLUA 5EZ5A 4ER6A 1T9GS 2Z04A 4REOA 3PXXA 1YDWA 4L5CA 1T9HA 3VZSA 2VXYA 3VDMA 4B4VA 5I4BA 3PC8C 1EBFA 1NVEA 3V1NA 4IQGA 3NBXX 1Y6RA 3LZDA 1PFVA 3F49S 1XR3A 2OCKA 3H84A 2ENWA 4Q05A 4ZK2A 1H65A 1XVAA 3LC1O 2OXRA 1R18A 2O48X 3PBKA 5DBFA 4FHCA 4QBKA 1E79D 2HRRA 1BAPA 4HGPA 4YT8A 3DLHA 2CLEB 4UBMA 3N59A 4E46A 2YHUA 1U1DA 2Q8QA 3O4RA 4Z4CA 5ECWA 4IDHA 5BSWA 2H7XA 4B4KA 2D0OB 5J4VA 2IKQA 2J6HA 1EGAA 3GZ4A 1U3DA 5EGNA 3R0VA 3W8FA 1JHXA 2QZPA 4HGRA 5E9AA 1NVKA 2ROQA 4H27A 4EFDA 1KWKA 2W0MA 1ULHA 3HYNA 3PU6A 2C4NA 4DSTA 3AH8A 4NFYA 3TRHA 3PT9A 1X87A 1OH7A 2Q3DA 1W48A 3KKEA 1CZNA 3D6HA 4YC7A 5KNCD 3TLJA 1F8XA 1H69A 2Q3EA 3IJEB 3FFXA 4N03A 5D3KA 3IA7A 4AU1A 4S05A 2OP1A 5EJ7A 3MWFA 4IKPA 4CMEC 3TYXA 3AJRA 3PEEA 2R2AA 2NTJA 1SEVA 4JFRA 1DRKA 1PX0A 3OWXA 4KUGA 4RM2A 4EW1A 3ZVLA 3C6XA 3FUCA 4GNRA 1DX9A 2BV3A 4ZDKA 3EVZA 2RHCA 2JFQA 1J99A 4CLOA 4U6SA 4UE6A 4DSNA 4RIFA 5JAOA 1EE9A 1G9XA 1MB2A 2GZAA 1XKXA 1QR2A 1T10A 2BUBA 2XDQB 3N74A 3U3ZA 3VO9A 3BCRA 1T0BA 3L43A 4N7JA 1EWQA 4G5GA 4B6FA 1J22A 4BP1A 2OFXA 4PRKA 5LZ4A 1BWRA 2IXTA 4HQFA 2Q5EA 2IZ6A 1UMBB 3CUYA 4K9OA 3JQGB 3WO1A 2J0QA 1TAUA 1M1ZA 2FQYA 3TBKA 3QP9A 4AWBA 2HLHA 2H2IA 1BGXT 4J2TA 1BO6A 1LI5A 4J1QA 4O2AB 3GFRA 3K5HA 1YVEI 2H29A 3REOA 1DP4A 5JAQA 2X76A 5AMXA 4BNIA 5BNTA 1BYIA 4ZVQA 4IWNA 4UU8A 1QHSA 4G1FA 3KVRA 4QJBA 1A7AA 1OSNA 2GJAA 2WSSA 5I7EA 3DDNA 1I3OA 3UB3A 5FIUA 3OO0A 1VHTA 1CUWA 1UJCA 4P54A 4EBFA 4LPKA 5ESWA 2VNAA 4QJ3A 4Y2PA 1G8GA 3FMIA 3B12A 1YQXA 4GW3A 1ZUNB 2ABWA 1H2ZA 1DUIA 3TM5A 2G0NA 4Z6KA 4MITA 3KKZA 4KO3S 2G80A 2H1LA 2RARA 3F5SA 3OU7A 2IEDA 4RMIA 4WOJA 3T41A 1E60A 1KXZA 3VKVA 1WP9A 1CWUA 3DBRB 3D1JA 2XWQA 2GZ2A 1MXFA 1DL5A 1ZJYA 1WU8A 2EX4A 4WBNB 2AXPA 1JJVA 5HW0A 3M89A 1CFZA 2JA1A 2QLJA 3CVJA 3G8BA 4KPGA 4MEJA 1JYFA 2OZLB 5ALJA 1E2LA 1SB9A 4M8NE 2Z95A 3TGWA 4TYPA 5C46F 4V2UA 2E2WA 4HWKA 3FYUC 4AD8A 3C8MA 1VPDA 2ZKIA 2CXPA 3B38A 4UZSA 5DGIA 4A8PA 5BR7A 3THWB 3FWHA 2VL7A 2OHJA 4DSZA 1AOXA 4JWKA 4H1WA 1LZLA 3Q9NA 5F1OA 3CBQA 5LYJB 1NSTA 2GEUA 1U1EA 3RK0A 3DLTA 1AU9A 1S9HA 1YQGA 1Z8FA 2MSDB 3G82C 3O4GA 3FLEA 4JL8A 4P80A 3ZY5A 5D3ZA 4P0PB 5GZ1A 4EKGA 3P2IA 2WU8A 4A6DA 1H2FA 3HUDA 4K9DA 4AX8A 3RBVA 3HJTA 5J59A 1FFWA 2GFHA 2VNJA 3FZEA 1PJAA 2J9RA 5EMJA 4O5AA 3MT0A 3KVYA 5FUBA 2ESRA 3EXG2 4YRCA 3B5JA 2LCIA 2OBLA 4KBYA 2ORIA 4L6CA 1P72A 2J1LA 3FWPA 4TV8B 3M6UA 1F8FA 2QN8A 4XVUA 2G9VA 1O54A 3GRVA 4G8BA 4B6JA 2J45A 521PA 1OLSB 4UUBA 3VSAA 2AUTA 2NU7A 4DDWA 3L0PA 3EUFA 1H5QA 2FDRA 3RTAA 3U80A 1GA4A 2BKEA 2ZE5A 1KZ1A 1DRJA 1TCUA 2JAPA 2SECE 3QE9Y 1D4OA 4X3PA 3R7AA 1UM9B 3Q2OA 5EKSA 2FU5C 4MW9A 1J8FA 3A28A 3ZZ1A 1DHTA 1GR1A 4X94A 1RRPA 3BWDD 4CIAA 3G8DA 3FAKA 4B45A 3LMKA 4HSGA 5JIBA 1ESZA 5CNJA 1XJWA 1DCKA 4R05A 4DREA 1QGZA 1WD5A 4Q4JA 5CXQA 3B7PA 3M1LA 3OZFA 2JK1A 4HP8A 2IH2A 4C78A 1Q21A 4PW0A 4OXYA 5JO0A 4L4XA 4K6MA 2IYAA 2VDOB 5EHIA 5F4BA 1FA9A 2QLBA 2NP6A 4ZAGA 4GFDA 5FOXA 3D81A 1ZZEA 1N9KA 1P2GA 1FSZA 2WWFA 3IJPA 3DV2A 2GD2A 3SYTA 2RONA 1AO3A 2ASEA 3RJTA 4FPXA 1A97A 2XPCA 5EE1A 3H2HA 4ZCRA 5BSGA 2BZ1A 2M6RA 2XCOA 4OHKA 4XIFA 5G0TA 4ESVA 4JHXA 2VHUA 1PD0A 1RFLA 3G3EA 3RHTA 3HBFA 5KTSA 5CX1B 2B5VA 3MM4A 5GONA 3ER8A 2GPAA 4DUYB 2FW0A 2TMYA 4P3KA 1CRWG 2D0DA 3BORA 1IY1A 3JQFC 5FWDA 1RWKA 4NBTA 3H83A 1IPHA 1P75A 3PHCA 3Q2KA 4D81A 1BH6A 1M2GA 3QFSA 1O9BA 1QFJA 2E82A 2X8JA 4YJ3F 2Y68A 2FMHA 4HUTA 5A4AA 4HNVA 1NDHA 3HCPA 1DIHA 1M1NB 2VJQA 3I04M 3ETLA 4LC0A 3DL0A 4D9IA 1QDUA 4MGKR 2Y77A 2DPXA 3DVAB 4NOMA 3WGHA 1XYGA 4EOGA 2J5BA 5BUQA 4H3KB 1MAHA 1EXDA 3FNEA 3Q6NA 5JVDA 1EWRA 3GQBB 2AQIA 4FMCF 2R6FA 2O5EA 1TXGA 3U7IA 1F0PA 1YB2A 4E94A 2YY5A 3PSAA 2Y1WA 3H1BA 2FI1A 5LDHA 1W88A 1ORVA 4OHBA 4YHBA 2A84A 2BD0A 2SKCA 3R76A 1KBOA 3S1AA 1OJLA 2QSYA 1J5PA 1OXKB 2HKIA 3LYHA 3SIRA 1R0CA 4OKNA 4U2FA 2EWVA 5JD6A 5LOVF 3HJFA 4FKZA 3DE4X 3ROFA 2FN3A 1SAYA 3WHLA 1QKKA 4ND8A 1ABBA 1NR1A 4A3SA 5GM1A 3I8XA 4TQ9A 1C50A 4B3MB 3B8EA 5ERYA 5DMXA 1TM4E 4PN3A 4EKEA 3W2FA 1VLHA 2NYVA 3MWJA 3ENQA 4KV9A 3TW8A 5JXGA 3QV2A 2R1VB 3M5PA 3DEFA 4Y2GA 5JQGB 1GA1A 2Q1YA 3GT4A 3OAAA 4PO8A 4BZWA 2YASA 1XRMA 3UJ8A 3I9V6 1PGNA 1QH0A 5EZYF 5ALNA 3DMYA 1J1UA 5CBPA 2CYBA 3C8UA 3DZHA 5EJMA 4Q7KA 5ED4A 2M6KA 2GJKA 2XYRA 1LVUA 5FI0B 3L8MA 2PN1A 3L5OA 1AXGA 4IHJB 4RF3A 3U1TA 3F3MA 5JWHA 4ZYVA 2HUNA 1L3BA 1M8JA 4H4CA 1Y9JA 5FWAA 3GZTB 3FNBA 3A4MA 1AGRA 4HB4A 1DAOA 2J6BA 2QTAA 3CWCA 3ZUGA 1MORA 4AJJA 5FOUA 1F3OA 5EMLA 2OQRA 1HEYA 3IHKA 4LK3A 4MTCA 1VE9A 2G40A 1NE7A 3EPRA 3WGGA 1RWBA 4WEQA 1U8YA 4BUCA 2IOQA 2WC1A 4UDXX 5BV8A 3WL6A 1DWPA 1E69A 3Q1KA 2CXUA 2CVQA 4GC9A 4EZIA 1ESMA 2HWYA 3E15A 4GMXA 3TN7A 3IE1A 4E2XA 3C97A 5ANRB 4WXMA 4P22A 4UE2A 1TU3A 1NZFA 1YCHA 2Z5GA 2IXGA 3D1LA 2ZREA 4NBUA 5IAEA 2PWAA 3LLMA 2E4VA 1BSVA 1ATZA 1M34A 3BWEA 1VMDA 2NU9A 1HEUA 4NBSA 4TL8A 4WCFB 4ARAA 2BFDA 3RU3A 4BP8A 5K6AA 4GR4A 3L7LA 1UFQA 5AK5A 3SZ3A 2FWAA 4P1ZA 2NYAA 3PPWA 3LA8A 1NUTA 4QDXA 4OXXA 5BRJA 2I5PO 1B23P 3E6AA 2IPAB 3RBZA 2DFVA 1KZ7B 2BKAA 1HC7A 3FNIA 2E87A 3FIJA 3M33A 2QTHA 3R23A 1ULSA 4TMXA 4RBNA 4H0NA 1LPMA 1ZVMA 1CJKC 1G0NA 3BRQA 3KLMX 3IIEA 4O2AA 3LVQE 3ESQA 4HRAA 1P74A 2YWHA 3HU3A 5HILA 1LPAB 1M2FA 3BFXA 1BDMA 5DM1A 4G1CA 1E2NA 3GFGA 4JGIA 4CM5A 4RTSA 1LDMA 4BO8A 4ZCMA 1TC1A 4ENPA 1F7UA 1SK8A 2Q0HA 1CQPA 3BG5A 1DFHA 1CNEA 2XUDA 3STTA 4NPCA 3AKDA 2BDEA 3UOWA 1B76A 4BE9A 3MHPA 1TW2A 4M0DA 5JECA 3BTUA 3D7MA 1DBQA 2GCOB 3DB2A 1E8DA 1G9SA 3DUFA 2G6TA 1TF5A 1C0PA 3M9WA 3MGKA 3TEMA 4D45A 4N41A 5EJFA 2Y66A 4CDGA 3RB8A 4DDKA 5I7AA 5TC4A 1PV4A 3AL2A 4AQYB 1QCZA 4HB3A 4Y2TA 4JLAA 3OIUA 5FWYB 4YMUA 4NBNA 3OTGA 1TKRA 3BKXA 1W75A 4G36A 1JFSA 1KY5A 3LO5A 3GGSA 4XR4A 4Q12A 4FR2A 2DB3A 2L0XA 2ZFUA 3S2UA 4H4EA 4DR2B 4ZJZA 1V1MA 3KQVA 2BLNA 1EKXA 3NALA 1MJFA 4FS3A 1OU0A 2XKBA 4E1BA 5IT5A 3U4MA 1ZCZA 2EC5A 1II8B 3LY8A 2H00A 1XKTA 2UV8A 3G1UA 3B48A 1MABA 4GX0A 5H0IA 4LCEA 2KMLA 1O94C 1E98A 4M1SA 2PY6A 4KB5A 3VGJA 2APJA 5BWBA 2MJLA 4GOLD 1ZC4A 3DZFA 4GSYA 2QYHA 2QUZA 2W8BA 4TWBA 5DTQA 5BPHA 2VOEA 2ZYUX 5GPBA 2AR9A 3ZDYB 1OPXA 3RVQA 1AZWA 1NLMA 4IJQA 2AJLI 3ZJ5A 1JPNA 3DM5A 4HN4B 1CS0B 4RQUA 1IQ0A 1B8PA 3BXEA 5CB0A 3P2KA 1VJGA 3H5TA 1KGSA 1RFGE 4JB8A 3ZCTA 2WSBA 4D0NA 3ESXA 3IXLA 1IVNA 1ISJA 1FDTA 3G2LA 4DIUA 3TQOA 1QV9A 2FP3A 4X97A 1A9QA 3KOZA 2VEDA 2X86A 4R0VA 4C5BA 1LNSA 5AJTA 1OLUA 2Q27A 3QPBA 4RPLA 1VKHA 4M49A 5IJ9A 3LQFA 3AY0A 1C8BA 3CRMA 1BCRB 4RX1A 1GV1A 4QDJA 3LP6A 1A76A 4RYDA 4N4AA 1AA6A 3MCTA 2QGFA 5CGQB 4F71A 2JJ2A 4E30A 1H8ED 1GCAA 4TMVA 1R15A 3Q7PA 3DEKA 5THKA 4HXEB 5IHXA 4O3MA 5TNXA 1HNNA 1LI7A 1WXQA 1JS1X 1MGPA 1VSBA 1T9CA 2AK2A 3EOAI 1VBKA 4FHDA 4RJIA 2A2ZA 4UBJA 1TUGA 1DC5A 1ZHFA 4TN5A 2XTMA 1J97A 5T3YA 1EESA 3BL6A 4M9SA 5FCDA 4MQ6A 4Q9DA 1R5NA 3RKRA 1Z6PA 2A8YA 2OZLA 1AZTA 2GVDC 4KFRA 3UMCA 4XWOA 1RQNA 2IIPA 3U5ZB 3HKCA 1M34E 4FYPA 4DV2B 4PPYA 2J5KA 4OBBA 4I55F 1NHWA 3T3EA 4M2LA 1MBZA 2LUOA 3L01A 1U28C 3OHPA 2G72A 4MUAA 4O63O 4EHFA 4YAUA 1NAIA 1ILEA 3HXKA 2O3UA 5B1EA 1L5OA 3KXDA 4XLLA 2J09A 4LY6A 5ES3A 4HNAB 4I8XA 3SS9X 2VHEA 1P4GA 1RWXA 5BWMA 1H4QA 3ROQA 4Y67A 5CMLA 1ZMOA 1XUOA 4CKXA 3TJZA 1I3MA 1O8BA 3IC5A 2V1XA 2O0MA 4H35A 2VTEA 3IELA 1E0DA 1P9WA 1UIMA 4WXRA 4MVJP 5CLQA 5JDCC 1CJUC 1L7AA 2VHQA 1FFAA 1XLTC 1HT3A 2PDAA 3VOAA 3T1OA 2L19A 1KEVA 3BE4A 4XXHA 5K3SA 1J8VA 3RUDA 2NV2B 3CW9A 1DKMA 3HVRA 2FPKA 2IYTA 5BN3A 4RD3A 1M1NA 3NBAA 4FD2A 4NKRA 1HKUA 4MWBA 1ZESA 4MGIR 3AF5A 1R0SA 4YBRA 5ALVA 2YC4C 5HX7A 4QODA 1I0LA 1NF2A 5BXYA 4ALMA 3K20A 4RVGA 1EAMA 3M5DA 3K2IA 1AH2A 1RYMA 3TSYA 4AJEA 4LFBB 2JC3A 2NZ8A 2HXYA 3NR2A 4MDEA 3OZSA 1VYTA 3FLBA 3PQ2A 3Q7TA 2E5WA 1VOTA 1R9GA 4A0GA 1TI7A 3WICA 4OKSA 2VJOA 4PYJA 2NSYA 1MIOA 1V7ZA 1WLYA 5B6PA 2WFLB 1U9IC 1FFYA 3AO0B 3RYIA 4ETWA 3GJSA 4LBZA 3OO1A 3R09A 4ZQIA 4XYLA 1M2HA 2CW5A 2W6QA 2B4QA 4MGEA 4Q4JB 5EJAA 4A27A 2ZOSA 5DNAA 1EUCA 1IZ7A 1QU3A 1MIHA 4DTIA 2JZNA 3CURA 5I3ZA 4MRVA 3SCZA 3GJ0A 1YONA 5DT2A 3JVUA 5HXAA 1KWGA 5HNKA 1UIRA 5GONF 3RSOA 1CT9A 3UO8B 1L7VC 4RKYA 4YCAA 3E2IA 3R0QA 2R5FA 1LX6A 1R0RE 4ZU1X 1XB2A 4RHXA 1IXSB 1KVQA 5AVSA 1A4UA 4N5IX 3WGIA 3E27A 1E5XA 3WQSB 4WNIA 4F2GA 4L02A 2R8PA 1THMA 2XT9A 5CT5A 3GRAA 4QU5A 4CDNA 2PRKA 3PUVA 1MB3A 4CG0A 3ZE0B 2OESA 3HNOA 2C59A 4I1IA 4A2PA 4XJTA 5KQLA 1OKKD 5A5DA 1GQYA 1HE3A 5DX8A 1Y89A 4YJFA 1V2HE 2DBRA 3HUTA 4C01A 4D4KA 4CEJB 4JVOA 5B37A 1W73A 1SUCA 3EGVA 3NT2A 5T8KA 2E3JA 1N92A 3QYPA 1IQUA 3PDIA 4FJ0A 5DIZA 4WK2B 1PDWA 5EJ8A 4I1PA 1X0XA 4R41A 4BYMA 1UC5B 3A1TA 2XTNA 1RM5A 1SOVA 1MB0A 2QRMA 4MQUA 3AP2A 4FR0A 1G2QA 2OECA 4WWHA 2EX1A 2X6RA 4RHTA 3OOYA 3CEJA 1ZMXA 2WJYA 3KJQA 1GZ4A 2JCXA 4BNDA 3KQNA 3WLIA 4ZKDA 1DIBA 2KE5A 4NK4A 2IDMA 1HFEL 1U9JA 1FW8A 1TIPA 2I03A 2FSVC 2W6JA 4LQCA 1FNBA 2X5OA 2XGMA 2NXNA 4XM0A 4CM1A 4F96A 3ZHCA 1C9EA 4CCSA 4PGGA 3AYXB 4WKOA 3P9CA 3UMGA 3VH4A 2LIPA 5I9IA 1K4YA 3COWA 2ZYGA 3DAYA 1N2CE 3IOYA 3CV3A 1VJRA 4LWOA 4WZ6A 1AXEA 4KOAA 3AFGA 1ZVQA 1TU0A 1JFVA 2IW1A 3KT0A 1YD7A 3CWQA 1TPYA 1B15A 4HNQA 5KWSA 4D25A 4Q3KA 3QVWA 1DC8A 3SKXA 3CCFA 3RS5A 2REQB 1IXYA 2PGJA 4BC0A 2F55A 3LTNC 5CIQA 5JZSA 4KYVA 4XCXA 3RQIA 2C5AA 2C54A 3DW1X 3LCJA 3G6KA 1ULAA 1VKJA 1DPGA 1ENOA 1J0AA 2VQ6A 2C20A 3KFVA 1BH2A 2MIIA 3MA0A 4MW0A 1EDDA 4Q82A 5K0TA 4MVJI 4FYIA 1P4JA 1KOFA 2RI6A 4W8HA 4ZREA 4JJIA 1U9ZA 3ZK7A 1LTQA 2FJUA 4MX8A 2VF2A 5E8JA 3ZDCA 1OREA 4EUFA 4MYDA 1JJFA 3NYIA 1XD8A 1GR0A 2VS1A 3OQJA 4C4RA 3A3KA 2FQQA 3T1VA 1SCAA 2B4RO 9LDBA 2YVKA 4XWAA 5E4YA 5FO1A 1SXJE 1CDEA 3UCXA 3X1YA 2QT1A 2O8EB 3HP7A 3DR3A 1ECBA 2C5EA 3OT1B 1GDDA 4QARA 5IM4F 3PUWA 1G98A 3UJ7A 4D8UA 4KLRA 2NUBA 1QRUA 1OWOA 1WV1A 4J76A 4JBGA 1KA9H 1QWSA 1VKOA 1VSTA 2BFFB 2INGX 3QPUA 3A6KA 3X1KA 3ZGXA 4IEIA 3EVBA 5E3IA 1ZSVA 1MW9X 1LBHA 3VNSA 2GZRA 3T4UA 5AUOB 2QJTA 2QVXX 1UPAA 2O8DB 1DBPA 1M5TA 3FHCB 2GZMA 4L4YA 5EC8A 3IRVA 1DLJA 4OXNA 5FOTA 3NKFA 1N0UA 3OE7D 2ES4A 4C03A 1OKKA 3UAGA 1K88A 1GPDG 2WQZA 1YAHA 3KV3O 4N3GA 1GG8A 3W6ZA 1P2TA 4DKJA 1K6JA 3VU0A 1JUDA 3K8YA 1RLJA 2BM0A 2EFDB 3HJUA 5AW8A 1L4GA 3DE5X 4MWEA 2VK2A 5BSUA 2ZCJA 1FFGA 2GHTA 4WE3A 3MILA 1W47A 5DGXA 3HN7A 3I6QA 1QHYA 3K2BA 3FDXA 4WNAB 4EF4A 4QOJA 3CFYA 4HRYA 4HLQB 2G09A 3CN7A 5JBNA 4YNBA 2WUDA 2KWIA 4PXSA 1VLJA 4WGGA 5H4HA 1EFLA 3MBKA 1YIOA 3EF0A 4MIEA 1LBQA 3ONNA 2AFHE 2F4NA 3C87A 3JD1A 4INAA 3ZK9A 3I61A 2ZWMA 4XIIA 2Z4TA 2FQXA 1XIVA 3LK7A 1N5RA 2IDKA 4R68A 3T3DA 3DFUA 4TKLA 4AULA 2ZI7A 1B8UA 2GUWA 1KXJA 2FP4B 1CULC 2H1SA 2PWZA 3OE7A 4LXQA 4UTRA 1E8MA 3HYLA 2EKDA 5EGSA 4DY4A 1UJ2A 3G0CA 4F9EA 2E9SA 1VJDA 4M7PA 4PFQA 4S2EA 3GLFB 1X8KA 2V6GA 3WIEA 4MK4A 4Q6WA 2OBYA 4ZJUA 3WQRA 2GTIA 4KXNA 3WJAA 2VRCA 5JBQA 2NZUG 4HQNA 1NF9A 2AWOA 1AO0A 1OX4A 3MTBA 1NR7A 2WINI 4IFEA 4BQIA 5KNDD 2HTEA 5ALRA 3GJTA 5FFNA 3IAHA 4KL8S 2KM1A 2WD7B 4EFMA 4WLFA 4ENTA 3HGQA 2W8ZA 1H2RS 3BIJA 5KQRA 1CUBA 2UXCB 4DYHA 1SOUA 4AZTA 2BE9A 3OEYA 2PMKA 2QJRA 2QNIA 4AF8A 3HO6A 3N2KA 1NBIA 1GOTA 5JAIA 3VMFA 1XX6A 3P97A 5K51A 1UOQA 2EW2A 1U0NA 4BNZA 3HB1A 2KI5A 3ZDZB 4R3UC 4WPGA 2DH6A 3O0TA 5A7FA 1XEFA 3PEFA 3TLGA 1EG2A 2C3MA 2Z6AA 2RC6A 2CLMB 3AERA 3ABQB 4LRSB 1N2CA 3HVUA 4HZIA 3OM9A 1TQHA 2HA0A 4RZ3A 2EGGA 3BXZA 2VWPA 2P0YA 4S1WA 1A96A 3VFDA 4CETA 3EVGA 3JD4A 1QV6A 3T5AA 1ETHA 4Z9YA 2CJXA 2VUHB 4H7KA 4LDZA 2RHTA 4NYMR 2YXEA 2JFYA 2ZPTX 4UZEA 1J2EA 3ZIDA 4Y2QA 1BWQA 2Y6UA 3ICCA 1JR4A 2PTHA 4GSKA 3L7JA 4BX8A 4ZTUB 3AXSA 2BEKA 2EZ4A 5LUBA 4B81A 4GBMA 4F93B 4L4SA 4JX9A 1FTYA 2MCFA 4HLUA 1JG1A 4HQLA 1ZGAA 3IHLA 2HC9A 2XW6A 5AW2A 2WKRA 2ZAOA 2XB9A 1N6NA 5TX7A 3WYBA 5B1HA 3KKPA 1X7WB 3ANNA 4MUHA 4YRLA 3NB0A 4L0DA 4EARA 4E3WA 2BELA 3IHWA 4LX8A 4N40A 4RA6A 3UWPA 5LP1A 1NQAO 5L3ZA 4JLUA 2GM5A 1UM8A 2QL5A 3OECA 2H0AA 4DY6A 4XWKA 3U61B 3HEMA 1SBNE 1QVZA 4BO4A 4XZ3A 3D7KA 3FROA 3AJAA 3BZUA 4PYNA 5LVAA 2BBTA 1ODJA 3L4EA 2BMDA 5FB3A 4CM3A 3H2KA 2J3QA 3DONA 4G67A 1KU6A 2LD4A 3C3CA 3AI7A 4TYQA 1KO8A 1AQNA 4URFA 3ZYCA 1GGNA 2NZWA 4OK3A 4PAQA 2Q5LA 3L40A 1KFCB 4DOMA 3CX3A 5LBTA 2VP0A 3ZHSA 1USVA 1XG5A 2P68A 2P9YA 4A1OA 1VLMA 2W6OA 1OB2A 2QUHA 4JOCA 2KBFA 4E1VA 1HG0A 3MCWA 3R0ZA 4BAUA 4V24A 3BM5A 4KRGA 2FK8A 1LUAA 1XA3A 1OA1A 2JF0A 1PX2A 3HRHA 2XUZA 4KQ9A 4L5IA 4RESA 3TW4A 3V46A 3WADA 4C0JA 1DKQA 4YRBA 2P6MA 2R84A 3IUEA 4D6PA 5A03A 1W25A 2NM0A 1J06A 2BHNA 4NYIQ 1S3FA 1ECCA 1KU0A 4N6OA 1E3JA 3FJOA 4JBHA 4TUYB 3SR4A 4DRYA 5FWXB 3OJFA 2VBGA 2CJFA 1YVDA 2HPZA 3O73A 4ZZ3A 3O9MA 2ARKA 4CU2A 3LAWA 1XWFA 2PLAA 3W7AA 4KK3A 3PC6A 4HDMB 4LY3A 5BN3B 1E1MA 3CLSD 3FOBA 4HWSA 5LQMA 3V1YA 4F3RA 2ZIWB 1E6UA 1O96A 3FTDA 3WKBA 4D3YA 1TEHA 3A4YA 3LL7A 2JI9A 2K87A 4PBSA 4R9NA 4PIVA 4C2UA 2OCDA 5DV9A 3AFIA 2NZ2A 2ZATA 5ALUA 1F6WA 3TEJA 3REQA 5CITA 2QP3A 4ZAWA 2O6HA 5K8LA 1OX5A 4KNWA 4HDRA 4LXGA 5AW5A 1HDEA 2IV3A 3ZCRA 4JCCA 4ARIA 2I6QA 3JZAA 2EIHA 4UEQA 3U3MA 1E7WA 4BNHA 1QTIA 2A9QA 2D62A 5EKXA 4QLAA 3K3PA 4LOKA 5FUXA 2IEBA 2Q21A 5JARA 1M0WA 1ZUIA 3W6NA 1WETA 3CRRA 1DI0A 5IDVA 2PX8A 4X8HA 3P19A 4Q9KA 4DA8A 3TZQA 1GGHA 1XZGA 3NBQA 2RGAA 5E2AA 3WOVA 4F6RA 1ODFA 4EY4A 4MQBA 5EERA 2C4UA 2YWCA 2L2QA 3SS7X 4PC1A 3V32A 5B57C 5AVYA 2AVDA 3TIFA 5DRYA 1J4AA 3LP5A 4BTEA 1LFAA 2AT1A 4AQ7A 3UHPA 1YTLA 3O03A 6ADHA 2M2IA 2GJ4A 2Z6VA 3FYUB 3WR5A 3W5CA 1EWYA 3K09C 3PR1A 1F2VA 4Q93A 3SYLA 3TIXB 3ZHZA 2VATA 3IE0A 5AYVA 3ZTTA 3W5UA 3LRXA 3OCCA 4FX5A 5FA8A 1SBIA 5L7YA 5KNBA 1ST2A 3RGWS 3CVXA 3ORYA 1JJAA 1CSEE 4PZ0A 1FB5A 2WHYA 1WMFA 3NBYC 1KMQA 1IONA 4LHWA 4A5SA 1EGMB 4JL5A 1YNSA 3SX2A 3TIGA 3TNYA 4MRPA 4NHOA 3EASA 4KV7A 4WGFA 5DE3A 1F17A 4EGFA 1ZOPA 3RG2A 3I2KA 3OIVA 4PG8A 3WBKA 2BKVA 2HGSA 4UHDA 1XOIA 3LS2A 4MI1A 1ZEMA 3I76A 1CP2A 1L5ZA 2Z9BA 2ZB2A 3B6IA 3W7BA 2W42A 2LCQA 1DT3A 1SD2A 1W96A 1U2SA 2AD5A 2AI1A 2AR7A 4UMVA 3O1LA 2W22A 4MW2A 4RIIA 3W5HA 4YV2A 4YMLA 3F96A 1XVIA 3FY4A 1YS1X 3N3AC 3U31A 3U6BA 1ESDA 3Q3HA 3LVFO 4IIVA 2O6LA 4MCAA 3DAOA 2PMEA 3VYUB 4DV1B 3CNHA 1MG0A 1I24A 1E7YA 3H2BA 3ILVA 1ZR2A 4JI7B 1XQ6A 1RYFA 3EMDA 1EFUA 3HB0A 3BGDA 4UMDA 5FPPA 1TIBA 4D02A 1TJ3A 3V7WA 2HHJA 3DPUA 1FUKA 2C97A 3IUSA 4X6LA 3OWOA 1XTUA 2PUGA 1I13A 3IQIX 4V1CB 4IMIB 2I9PA 2J6IA 2MR6A 3PQ5A 4ZGWA 3HEBA 3CEMA 5LZ8A 2HPAA 1KJWA 1UAGA 2YINC 2XKJE 3DOJA 2O05A 4LYEA 4I19A 4M22A 4TXHA 3U0VA 3VKGA 3GRRA 3V9AA 4AY5A 5DBIA 1ZUNA 3OFKA 4K6KA 2PTGA 2IHVA 4ZTZB 3CBGA 1OI7A 3OM8A 3UH1A 1XZEA 2EJCA 2RHBA 5P8WA 1C1DA 1YCDA 4ZOQI 4B3RB 4B7CA 1CRLA 1MJNA 1SBTA 3A3YA 2OGSA 2ZBDA 3B9RA 2WSMA 3FUTA 1Z8HA 1GUAA 1QK3A 3NETA 3SICE 4CEHB 4AKSA 3STVA 1E2HA 1JMKC 1FUEA 2FR1A 1X7DA 2ZS7A 1XP8A 1RZUA 3UB2A 1BCSB 1UMDB 2WNHA 4BMXA 4CMAA 4G5RA 2NO1A 1AGNA 3GRZA 1KK2A 4ZO7A 2PANA 4D8WA 2UVPB 4HUQA 3RHSA 2A9FA 1QIFA 2AOUA 1U4NA 3AHGA 4K03A 4E5VA 5JV5A 3D8HA 4EABA 1JPJA 4KN5A 2HIMA 5E1MA 4ZHQA 4AY2A 3DQZA 3Q85A 2IHYA 4GG1A 2G70A 4GYYA 1M5RA 4BMYA 2OV1A 3JASA 4D56A 3OT1A 1YA6A 2D5BA 1GDHA 4C6TA 4DV0B 3FFBA 3TNDA 4DMFA 3L9WA 2EFEB 1H4TA 3VI4B 2FPLA 4BFLA 1GTJ1 1GQQA 2IUEA 2BFFA 2PUTA 3STXA 2XD9A 1B74A 1M67A 3OX4A 3TSCA 1V16A 3PTZA 4KG7A 1X38A 3TAHA 1MGOA 1FP1D 3KPWA 2ODAA 3NDRA 4W99A 1U9CA 3RYHB 3IBSA 2BMJA 1E3WA 2QD4A 2X9LA 3KELA 4TMKA 2X0EA 2O5CA 4U0JA 2IL1A 4HADA 2QDXA 3BREA 4BNXA 4DMCA 2FZWA 3KR9A 3OD5A 4A23A 4PYRA 5KTTA 2JIZA 2WR8A 3AERB 1TZBA 1NVVR 1X8LA 4AY3A 5B64A 5YASA 3WIBA 5EJEA 2QEQA 1K9VF 4LBWA 3B36A 3B3GA 3S70A 3QF4B 2ZCUA 2HU2A 4D92A 4Y9DA 3NAMA 3JD2A 3TDNA 4M9UA 1X86B 3GEBA 1U7OA 1X9GA 2XSZA 221PA 3NOVA 2VH1A 3EY4A 1KQPA 3ABSB 3PNMA 1P6XA 3Q6MA 3V1TC 1U0EA 3IQFA 4LYJA 1T2FA 2XCUA 1IU9A 3QIAA 4M37A 4C0QC 1S02A 3BAZA 1VE1A 4Y6PA 2IFTA 2OVFA 3PHLA 3W5JA 4HAOA 4DUPA 3UF0A 3KQPA 4HVCA 1Z83A 3OCVA 1UJBA 2A0WA 4AJOA 4QOGA 2HSWA 3TSOA 3FLAA 3MIZA 4JLMA 3MPOA 2ZR7A 4MHTA 2BI4A 1E1NA 4YASA 3VVBA 4Z4QA 1R12A 5EE3A 4FFVA 4WBXC 3L7IA 2AE2A 1J8MF 2W6ZA 1A8PA 1ZIXA 3OPYI 3WLJA 1I4LD 1XTBA 2AKYA 4MW5A 2H06A 2EXXA 4DM3A 4YJDA 3UPUA 3EH2A 1W5SA 3I5XA 4OI1A 4G5QA 3EXFB 2VJNA 3U7EB 2QAIA 1VJCA 5TVKA 3B20A 1WUJS 4CL3A 1U3UA 2X0FA 3WLMA 1KFKB 4KSYA 2G8LA 3I9MA 2E1PA 2PHZA 2WICA 3GLFE 1E2JA 3ADKA 2IDZA 4KE8A 4AJKA 2A30A 2LIVA 1Q0PA 3AWDA 1KZYC 1TFUA 4KX3A 4AXBA 1WVGA 4K9RA 1L4YA 1M7GA 4O4LF 1FP2A 3RDPA 3RKUA 4BGEA 1MNAA 3EGXB 4I4TA 4LE2A 3WLAA 1ZGBA 5CUQA 2FV8A 4NBKA 1VFNA 3ZCVA 4PYIA 4JI1B 1GAWA 1OYOA 3H11A 1T35A 3GPDG 4M9RA 3GLHE 5NLLA 1EAYA 4I6GA 1N0HA 5IF3A 3QHPA 4CCAA 4XVCA 2ZSDA 1VPWA 4ZP1A 1JKIA 1N2XA 2WAOA 3BXXA 4U4AA 3ONVA 2QYSA 4JLVA 2NU6A 2R8RA 3DDWA 4P7KA 2QUAA 1E18A 2HLDD 3QJGA 1V8ZA 1BMDA 4HD8A 2DH5A 3G0HA 3KK0A 3TTSA 3WWCA 4OLAA 4INPA 3M4JA 3KTFA 1DBWA 1OBOA 5IS2A 3KJFA 1GL9B 2GH1A 3FKQA 4H7HA 2JFHA 4HGQA 4TYMA 1CJVC 1D2RA 3PGJA 3ND9A 1YZHA 3KB6A 1YFJA 5T3UA 2E0IA 3MTQA 3OM1A 5I47A 4Y2HA 1CLEA 4CRWB 2VI5A 1T13A 4NY1A 1ZPDA 2PBFA 1AKUA 4WTOA 2GETA 4DBZA 3R6DA 1ZS9A 1TQDA 3R3UA 2D5CA 5JSHA 3DE6X 1Z2EA 3CLTD 3KC2A 2XQVA 4AKHA 5EOVA 4YUWA 1XLVA 4HDRB 2W2LA 2Z0MA 1O2DA 1Y7IA 3KJXA 3HNPA 4F4FA 1VCHA 2CL7X 1XNRB 3DE7X 3P2MA 1WW2A 1L6IA 1NBWB 4YAOA 3VU9B 4DR5B 1U94A 3PK0A 1E3IA 1T3ZA 2QMQA 1TK9A 2W5UA 4NIMA 1DAEA 3D6UA 3FB4A 4EL5A 2J4CA 3O38A 2GWRA 4Q3EA 2WYWA 5EUQB 4CDRA 3WMWA 5DXFA 1CUXA 5CBPB 1XJQA 3T6KA 4GBGA 3NHPA 1G41A 1REQB 4R8VA 1T1IA 1YFLA 3IE2A 1N2EA 3CLHA 4WOKA 1VL6A 2F1KA 2O8CB 1W0KD 1Z2NX 3KUXA 4C14A 1E5DA 2RHWA 2QGZA 2ZK7A 3DKRA 2O4UX 4A82A 3ZPXA 2HYDA 4LI0A 3O1HB 4F0JA 2XXAB 1H8HA 1GPH1 3EJWA 3MWEA 3T06B 4MVJH 3WGZA 1LRLA 2GJSA 1PR9A 1XXLA 4MQEB 1IIBA 3DXZA 5B4TA 2XZTA 4E70A 1UKCA 2DR3A 2CV2A 2WI8A 2PEYA 2ZRFA 3QU2A 4OHYA 2XYQA 1XZQA 3R3SA 4EG5A 4XJXA 2Q1TA 3GXBA 2YWFA 3I73A 5FADA 4M0FA 5IBPA 2DHEA 1TA9A 1E3QA 1XU7A 3H6GA 3VDQA 4J0HA 2D06A 2QRVB 3RT7A 2N46A 3WDKA 4FFRA 1W1WA 2F62A 3V1UA 3BKWA 5AVUA 3P9PA 2ERCA 3ZQKA 1TTTA 2FMTA 4BKMA 3GBVA 2ATXA 1W94A 3GCXA 1JAHA 1JR3A 2PZFA 2FNAA 1M3SA 4LVOA 1V5EA 2Z43A 4UAGA 3WSTA 2O5VA 2JLUA 1QRAA 4Q21A 5DLQC 5A0VA 3NWEA 3VPBA 4V0RA 2PJRA 3CE6A 5JVDF 4V3BA 4RF5A 4AIRA 3SC6A 1MO3A 2I22A 1PP4A 1SJ9A 2RIPA 2FFBA 4KQGA 1E2EA 2IC5A 3DV0B 3EC1A 3K9CA 1K7EB 2C0QA 2O7RA 4MAMA 5JNWA 4GYKA 2IS4A 2BKXA 1GCGA 1JHYA 2GNAA 4UE3S 5GGXA 1L4MA 4WFQA 4A8JA 4AT1A 1ZITA 3K0AA 5KAPA 2C2GA 2X5NA 3IPYA 1HQYE 4RHFA 4U02A 3ZE7A 1R8JA 5P21A 1D1QA 5FBKA 2P6UA 3Q7IA 121PA 1XF1A 4GPZA 2NVUB 5JCOC 3FTFA 2R0QC 1CX9B 1DB3A 1R8QA 2W2TA 2O7SA 3N3BC 4FI3C 5B53A 4RH3A 4O4IF 3FCEA 5T4BA 3H2SA 3RS9A 3QPAA 3O92A 1BEUB 5FD8A 2FHPA 2RGNC 2IYVA 1DADA 3E1GA 4JJ8A 5FORA 4KYUA 2P2NA 1E9BA 4PSUA 1PR4A 3FUXA 4XASA 1VJ0A 2O1WA 5EPOA 2J31A 5IW8A 5AICA 5IXJA 2IUTA 4YLYA 4X85A 1UAYA 3WGUA 1NULA 2HTFA 1W59A 3A04A 3D6NB 4MYTA 1LPOA 1U11A 1XKLA 4PX5A 3R0XA 3G2NA 1W8DA 4ECAA 1XP5A 2GDJA 3DCIA 4FMPA 3WA6A 3T5MA 3A6GA 4LF8B 3PR3A 1YL6A 2VSFA 1HFWA 1W4AA 1RE1A 1JU4A 3VTAA 5LIPA 3SBDA 5AKXA 1KAQA 2WOOA 4DMRA 3KDPA 4JXXA 16PKA 2MTBA 3JQ8B 2Z5LA 1TK3A 5C5IA 3HABA 3W04A 4XJSA 3L7AA 4COKA 4AP9A 4DQXA 3D3WA 3BK2A 3B1VA 5JCOA 3FR8A 3UPDA 1JQBA 2QD1A 3CIFA 1Z56C 1JSXA 3HXQA 4YDHB 2BRUA 3AUTA 3R40A 5C8DA 3FMPB 4HR7A 3PXDA 1DUSA 3BH6A 4M9CA 3UWSA 4C7BA 3OLVA 2GB4A 4NCIA 2H9AA 2OM6A 3N0TA 3NGMA 1R6AA 4XYBA 1P2FA 2X2PA 1P7YA 1YZKA 4IJVA 4WZZA 5JLAA 1WXGA 4JAVC 3ZCPA 4ECEA 4EIWA 1V4BA 4XFKA 1USIA 4L8LA 2H5IA 1UFKA 1ZN8A 5KC8A 5B1SA 2P1DA 2ORYA 3TBHA 3BBPA 3U9SA 1NQTA 1UDBA 1Z5OA 1Q7TA 1VMAA 3I8SA 4R9SA 4ZOEA 4X45A 4ZEVA 4TVBA 3B53X 2OY0A 2FAXA 2YFKA 3OKFA 4WXHA 3QI7A 1Q7GA 1O6GA 4RVFA 1KR5A 1OLUB 2R8ZA 4R81A 3P9IA 1ZW6A 2FLKA 2QPAA 3WGKA 5BPFA 2A3RA 4FBLA 1Y6GA 2OG1A 2HOQA 2ZRLA 2WU3A 2YCLA 3MGCA 3FGZA 1QNLA 3T7CA 5D1HA 3JSAA 4G81A 4DEYA 2JDID 1CU1A 4ER3A 4UU1A 4E15A 1WP4A 4JWTA 1SZCA 1XEWY 4R1PA 3WGYA 4WK4B 2FR8C 5KHOC 1G6OA 3KG2A 4EB8A 1LFDB 4RL6A 2C3PA 1OBCA 1QIDA 3ZDQA 5DWVA 5JASA 4G07A 4GDFA 4F11A 4M7WA 3C3KA 4YBZA 3T5CA 2FGKA 3IEIA 2D5IA 3O82A 4XTCS 5DYWA 5L4SA 2DSTA 2IEAA 2CNNA 2K4MA 3B13B 2B34A 3SS8A 3ZCUA 2V7WA 3K72B 3MUFA 5B1IA 4HDOB 4EUEA 1I4EB 1UJMA 3OURA 2E21A 1GTVA 2C4VA 3QBVA 1D8AA 5G1PA 3BTOA 3KJHA 3A25A 1VRVA 3ZWXA 3ZZ0A 1ZGJA 2WT4A 3G1WA 4DWJA 3QELB 4IOKA 4ZANA 4ZC1A 4KMRA 1J9EA 4FZVA 5KSPA 1AS0A 1KYIA 1Z6TA 3LUAA 3OU6A 3K8QA 1D9ZA 4LMAA 3T9BA 2G77B 3TZKA 3O8BA 4C6TB 2SNIE 4I50A 4R2WA 3S5UA 1TVEA 1FP4A 3EPJA 2XEXA 3BGSA 2IWRA 2GSDA 5ALEA 2ORWA 3UWOA 3A4VA 1X80A 3R5KA 4X1IB 4P0QB 3M4YA 1E58A 1M2VB 3M6WA 1UUFA 3VUEA 1WDWB 3IAM1 3R5TA 5A7HA 2UYGA 1U6IA 3JV7A 3E9YA 3Q0EA 3S2IA 2I1VB 5K6RA 2FR8A 2QQGA 4J0EA 4Z7QB 3O47A 5E38A 3THXA 3PUZA 2FEAA 1E1LA 3SLKA 1EVKA 2PAAA 4PG7A 4LHSA 5FNZA 1KAMA 2R86A 3O5AA 2B8EA 3IBTA 5KYYB 4ZWNA 4WJLA 2HH9A 4RMJA 2HGZA 1HT0A 1SVMA 2W11A 3SAJA 5A02A 1NVBA 1QK5A 4LXTA 4KR0A 1UPTA 5HQ3A 3KQQA 1CR1A 2Q4DA 4X7BA 5J2UA 1NQ5A 3ZGYA 3CNBA 6CHYA 4EYEA 3S8YA 3HI4A 5CXSA 4AUNA 4BZZA 1XDWA 1Q22A 2YVQA 1FS5A 2XYPA 5LP6C 2WB2A 4CCWA 2GX6A 1JEEA 1WPGA 3LUGA 1JSCA 3ZJUA 2QY9A 1WXIA 4IL5A 4QGGA 5KBYA 2JHPA 2QYTA 3QEMB 3LPNA 2WNIA 1Q1GA 5HCUA 4YR9A 2V1UA 3FVQA 3E5NA 2C00A 1MVLA 3MHTA 3I6IA 4MMZB 1QMGA 1ZJ5A 2COEA 4MYUA 3WAGA 3BXHA 1BD3A 3DDSA 3SQNA 3RYIB 4P4GA 1OXSC 1XU4A 3LZCA 1DC4A 3AINA 1X70A 2JGDA 5DYIA 1ODLA 4CQLB 4A6XA 4EO7A 2W6JD 4FM9A 2DU8A 1QTRA 1U9IA 1P62B 3ABOB 4Q66C 4URXR 4MROA 1FU7A 1SBQA 3M83A 3N7UA 1YHNA 5BSRA 5E2IA 2HMVA 3KALA 1MLDA 3SOZA 4XQ0A 2IUSA 1YK0A 3QMMA 4XB2A 2IYEA 1CY0A 2VTVA 4HB2A 4RVHA 3WZ2A 1LDYA 4MP3A 4OP2A 4DV3B 3QEBZ 3DF9A 1KY2A 3ZNNA 4KN6A 2JFBA 1BD4A 3UWDA 1XV5A 4LHZA 3DZGA 1YS2X 1Z6YA 3R5FA 4GI2A 4W5JA 5IABA 2CVOA 2QAJA 2QTLA 3ESZA 5K3EA 4LF5B 1LPPA 1E8NA 2C94A 1RJDA 5FI5A 1EEXB 4DV5B 1GTL1 1Q19A 4IHKA 1FFCA 4H15A 1OZ0A 2V7XA 1N8NA 4IDGA 4ITUA 5CBKA 4FHGA 4CIWA 2VR1A 2FSFA 5KPJA 2WTUA 3HQ4O 1OGYA 2OQIA 4BECA 1QIMA 4MS4A 1KH3A 4MCJA 3FCCA 5H1YA 1W76A 2GM4A 3CGWA 3MRVA 3JPYA 4EHAA 2X6TA 4K9QA 4JS0A 3BXOA 4Z54A 1PL0A 3C2QA 4DCOA 3MQ4A 3UYKA 8ATCA 1M2OA 1OI4A 3LQYA 1WDLA 5JMOA 4CUJA 5JQWA 1RYBA 4YRMA 3ICPA 1NP6A 2DERA 4YLGA 1VE3A 5JU6A 3I5MA 3TXXA 1K5PA 1ZLYA 2QUIA 4UQOA 2EBFX 5ARDA 1S7GA 1LH0A 3GH1A 2ZBUA 3BTVA 3JARB 5GTDA 3U44B 1HM5A 3LDFA 4OP1A 3EZNA 4JJ4A 3P32A 1K97A 2HZ7A 4RS3A 5CJJA 2CDNA 3ODGA 1L5LA 3LP8A 3DKPA 4CGZA 5INTA 3EZ9A 1DGQA 4EJSC 2PRZA 1A77A 1RI2A 1BU5A 2PKEA 1U63A 4WLOA 2GEKA 1P1CA 3I34X 5CM2Z 3TFWA 2NZYA 3G8YA 3ZDAA 1EM8B 2X8LA 2QROA 3BH7A 4K05A 2V5AA 1Q7RA 3LUBA 3N53A 3W79A 1BQ4A 4HDSA 1XZ8A 5IBCA 3O91A 3GXOA 2CFRA 1B16A 4HEA6 4OHUA 5ALDA 1YJQA 4L0MA 2ZITA 3LJKA 3B3FA 2Y93A 2QM8A 2VDKB 2ZT8A 4X8LA 5ALKA 3WYFA 5IASA 3E1KA 3KQKA 2G1PA 3W2EA 1X1TA 3OCYA 4CCYB 1E0AA 3NV7A 3SDZA 1KI4A 3PA8A 2FUKA 5ALTA 3S2GA 5BV7A 1UBHS 3CG0A 4CMGA 2WJPA 1NBAA 3DO8A 5F33A 4CFSA 3A9CA 4CMBA 3A1EA 4J0QA 2GBPA 4M38A 4QYSA 4AF6A 1YWGO 4G0XA 3IVAA 4JYPA 4OQEA 1T8YA 5DP2A 1L4HA 5BW4A 1WKBA 4PLCA 1A8QA 4W6ZA 1UKVY 4ZCQA 4Y6LA 5EIOA 1OA0A 3K0SA 2BGKA 1GYPA 2VJCA 3PTAA 4U2BA 5G4KB 4AYXA 2XQKA 1Z73A 2ILVA 4OY3A 4HLCA 5CLLA 5CA1F 4DCMA 3DCNA 3KJIA 3DOOA 3UT5A 1T4BA 3VZBA 3P0RA 4X62B 3PKZA 4RVDA 2G6BA 5C4GB 2SBTA 3AEQA 2XAUA 1BHQ1 1IY2A 3TUJC 4CIDA 5K8UA 4M0PA 2IU0A 1G21A 1HYBA 2BEWA 5GZ6A 3ZZNA 1AHPA 1LLUA 1N2JA 2QG4A 3I0ZA 4MIOA 4CHGA 2JCYA 1CV2A 3LCVB 4G23A 4D7AA 4GZMA 5HZKA 5ESDA 1ZOLA 4GPD1 4CFYA 1XLUA 4JV5B 1BMFD 3QFHA 3SZOA 2W90A 2QVCA 3PJFA 3SF8A 4IGFA 3JWGA 3ZNQA 5EJ4A 2YNMA 1JWBB 3SHOA 4RSGA 3P2JA 3FPAA 1WHTA 4CF4A 3JQDA 2ECFA 3N2EA 4R1UA 3V6LA 2O7VA 3G23A 4WZBE 3JQFA 1K08A 3BWYA 4R9RA 3RRMA 1DJLA 4MRMA 1GP2A 3W2GA 1SZJG 5JAPA 3FKSA 3NTLA 5C9ZA 3NKLA 2PKCA 2A9PA 2UUAB 5K0EA 1HY3A 2GN2A 2AMVA 5SZJA 5EE0A 4Z4GA 4MW1A 1VI5A 3QE4A 1RAGA 3EMVA 3LW8A 4AKTA 3BN3A 3D59A 3ZQ4A 1F14A 3WWDA 3OFNA 4RZ2A 4WNAA 4Y6GB 2PGOA 3ZD8A 2ADFA 3PFHA 1S8OA 4Y2YA 5K0NA 3IMEA 1VZ2A 4YXWD 4FE4A 2J8ZA 3KXIA 2MSWA 2QA5A 1UZAA 4UULA 4ZMSA 3R8XA 1FLAA 5F2OA 4BPBA 2QF7A 1O03A 2WW8A 1U1GA 1EH5A 2QVBA 1TKAA 2IYFA 3C3YA 1HTBA 3G02A 3BMOA 4Q3DA 4YV7A 4QT0A 3F0TA 4LQDA 1QUEA 3EPLA 1W85B 3B3AA 1NNSA 3MQFA 4H1VA 3RG8A 4KC0A 3CPSA 5E95A 2HIAA 4Q37A 4W5HA 5EIWA 4X54A 5ETJA 6GPBA 3JYNA 1CUAA 5EHQA 1NJGA 3VBEA 4I5DA 3A6PC 3NUQA 2FMFA 4WQMA 3ACCA 3DDOA 2JFOA 2R7NA 3OOJA 3VZCA 2YJNA 1X7GA 2HCJB 3NT4A 5E7MA 2PZJA 3GMTA 1X6VA 3DXYA 3RFVA 4LNHA 2I76A 4JI4B 1GAJA 1PZNA 3A2MA 1FJ2A 3B1XA 1ADBA 2OORA 3KOOA 1XELA 2HJWA 1XVVA 1PEAA 2C5HA 2X8BA 3A4NA 3IMKA 3GNTA 3V34A 1ZA2A 4A6PA 5JAZA 1WPQA 4C43A 2E6UX 1G4HA 2HJVA 4KI7A 4MPDA 2O8FA 2DF8A 2BFBA 1DUVG 3C48A 2HSDA 4W1RA 3VPDA 1TCBA 1ZI6A 4JT4A 1Q17A 2OAEA 3QE2A 2P7IA 4R1MA 5A6VA 4E7PA 4ER5A 3EXHA 3IT2A 3NP9A 3G49A 1N4DA 1TMGE 3SYKA 2M98A 2QPOA 5I9TA 3ASYA 2ZIFA 3UMRA 1PT6A 3A6FA 3PJRA 1V26A 1MV8A 3B9BA 3LLCA 1VL5A 3C8DA 3C6ZA 4I5FA 3KYBA 1GZ5A 4PXAA 4UU7A 1U0SY 1ZN7A 7ABPA 5J47A 3KL4A 2V9ZA 1SOMA 4I1UA 5CXXA 4EPXA 3CKLA 4WY5A 1Z3CA 1GZ3A 2NO0A 3I5UA 3F73A 1DINA 1RZVA 1RBYA 2ID4A 3FFTA 2I34A 3KEQA 5TXGA 1I7SB 1NR5A 2GWHA 3ZJ4A 1U7UA 3T9DA 1QH1B 2GTHA 3CNEA 3SXUA 3LX6A 4FT2A 3WB1A 5JFOA 3DWGA 4IV8A 3HE3A 2DTDA 5LB2A 3IOEA 1O94D 1YDEA 1XU9A 3B51X 1JA9A 2R44A 2J9ZB 2PA0A 4E7OA 2VP6A 3GJ7A 5GVRA 4RA6B 3U3JA 4PCUA 5LDDC 5ALMA 3A6LA 3T3PB 4GKBA 3PTLA 1FFEA 1MB9A 4PO3X 5A9SA 1JI0A 4ML3A 1S3GA 1FYEA 4Y6OA 3MB5A 4HYYA 4XD7A 1YRBA 1W4CA 1T9GR 1H1LA 4EI7A 3IGFA 1YR6A 4LW8A 2XVZA 3T7EA 1N1DA 2DY0A 4XM2A 3UGKA 3VZRA 1ZNWA 1PFWA 3CVWA 2PH7A 4WH0A 1NXPA 2O2IA 2XRFA 4DADA 4DV6B 2CKDA 4UJ5A 3NUZA 4CM7A 1IVSA 2D00A 5SICE 3H65A 2RAVA 3GNLA 5JSZA 2UVDA 4MUFA 1Q92A 2G04A 4B73A 5B7PA 1C1YA 3NS7A 4UD2A 4GX1A 1WOMA 2ZU0C 4B2YA 1JB1A 4XX0A 5BN4B 3TX6A 3PHJA 2ZYWX 3RS4A 3VHXA 1DFIA 2WILA 4X20B 5HIAA 1JU3A 4HAIA 5AJYA 1DKUA 2QTRA 2P8JA 1WA5A 3F9RA 5KHAA 3B6EA 3VR2D 2ZDQA 3NLLA 4G1UC 3UMVA 3VKUA 2FY8A 4IFTA 4EDFA 1U6JA 5A0FA 1JF8A 4WLVA 4O4HF 4U7FA 3NX4A 3UOGA 1BGWA 5AW7A 1QS0B 2R62A 2H2GA 3I12A 2OPHA 1G3MA 1OFHA 1EZ4A 1U0RA 2GBCA 2I62A 3H9QA 4R6WA 2GK6A 2FCAA 2V6MA 4FUQA 4IOLA 3KQUA 1C3LA 1B6RA 1E1RD 1JDSA 5F3RA 1UC4B 2I87A 4ZYYA 1DKRA 4D26A 1KOGA 1NLFA 5JJBA 1YDGA 1HLFA 4GXRA 4CMHA 1Q84A 3RTDA 3PPYA 1G8FA 3P9KA 2M32A 3HKDB 3M6VA 5KZMB 1R7RA 3PDCA 4S24A 1I14A 1VJ1A 3FMOB 3INGA 4DQKA 4DGSA 2NIPA 2QIOA 2Q5OA 2XUKA 3MWDA 3OA2A 3THSA 1U2PA 1Y3CE 2QZSA 4XYGA 5CK5A 2H2AA 3PD0A 4DG5A 1XZJA 1Q0TA 4RZIA 3K0CC 1JSLA 1ZNYA 1LS1A 2PX6A 2YZ2A 5IJAA 1NIPA 3CZCA 3UH0A 5BSMA 3JSXA 5JPIA 5FPSA 1D09A 3UMBA 1EVEA 1I5EA 3G2JA 3IEXA 2B35A 5C37A 1T0IA 1NW6A 2DX7A 5HK8A 3HO1A 2WYUA 1EJ6A 3AHHA 3CVYA 1U2DC 2AJCA 4QC2A 1UPCA 1RDFA 3OJ0A 5JSUA 1CE8B 3ZV7A 4ZV9A 2D3TA 4BQNA 4QJIA 2VUUA 1SKAA 3DKKA 2ET6A 1VBMA 3FRIA 1G5IA 3R3HA 5CVUA 3NPAA 5AK6A 1QQTA 1R5OA 1NBHA 2HU8A 3IPRA 3OLZA 4R8KA 4MEAA 5BYAA 3IBFA 2XZLA 1H9AA 2W2VA 1ML4A 5IJ0B 1Z4KA 1DEHA 3DHNA 3NOXA 4DLAA 1CUIA 2H1WA 4RVUA 4CLRB 1SHTX 3WWZA 4A16A 3VR4D 1U3GA 3AHFA 5BW5A 1JPUA 4CNQA 1IN1A 1C2TA 2HT6A 4XVHA 3R7WB 1RC0A 1JR6A 5JSQA 5A9RA 2RCYA 1W581 3MTDA 4BWFB 4JXZA 1N5MA 2FJ0A 2AOTB 5HKKA 4ZAZA 1GNLA 1UDRA 2RHHA 3LBHA 4NQRA 2FSGA 4F04A 1VRCA 2GPWA 3HB7A 1N9GB 4MRSA 3EA0A 1B6SA 1DXHA 1KDRA 3KAQA 3VJLA 5BWLA 3DXFA 3KQSA 3OQIB 5JCXA 1CF9A 1ZCAA 1KDYA 1KP9A 4QELA 4XARA 3LM8A 1ONNA 4RK5A 3E4CA 3EJ6A 4Q02A 1N6IA 3EG9A 2GSWA 2DQZA 1H9BA 2XUPA 3OUTA 1EHIA 3GYGA 4ZVKA 1PU2A 1DQPA 1PJTA 4GMDA 3Q8MA 3CNLA 4MIYA 3OA0A 1DU4A 3G2KA 4MOWA 1Q0HA 1F06A 1JRLA 2F48A 2YNMC 2PGNA 3IAXA 3T54A 3WRVA 4BVEA 1ID8A 1JG4A 2AW5A 4O4IA 1BTOA 4BCBA 2WU4A 3WIVA 5HJ5A 5E3HA 1FSPA 2WTNA 2OHVA 2XZPA 4Z7OB 1GAEO 5A6SB 4BVJA 4F5EA 1EK0A 2XTJA 2C2XA 3V3KA 2WKSA 3QXXA 1TTPB 5DM2A 2YMMA 3MTJA 1W9MA 2VNHA 4V0NA 4C6RA 4CMKA 4E0BA 4IUCS 2BZ0A 3GT3A 1QK4A 2QMEA 4I4LA 2FUEA 5EEGA 4W9NA 4EPYA 2PXXA 4LRYA 1JHAA 3U4QB 1DRUA 3NHLA 3PI7A 3IA2A 3ENWA 2UU9B 2FQWA 2WF8A 1NA5A 5L6MB 4PGFA 4E5NA 3AV0B 3SDBA 3ED5A 2UZ4A 1VHJA 3ZD9A 1O0CA 3W2TA 2PQ6A 1INLA 3GMIA 1QVWA 2J9FB 3NIFB 2B1RA 2BCJQ 2CE2X 3PSHA 3A0RB 4KDRA 1BW9B 3M1AA 3ZY3A 3X2FA 4HDSB 1MT0A 2VTBA 5IT0A 3I6MA 4V1CA 1SCBA 3AL3A 4L4UA 2FOLA 3O2QB 4JHLA 4FDLA 4OHOA 3FVRA 1U1FA 1UJ6A 4OL9A 2HHLA 2P6PA 4YRJA 4DPMA 2CJWA 2XMPA 3D6TB 1F2DA 3VVCA 4NZ9A 1RRFA 4Q7LA 1VJTA 2R87A 2C1ZA 5EIXA 1G55A 4UM9B 1FXSA 2R9VA 4H16A 1NC3A 1RKQA 1B1AA 1W5FA 4H1HA 4MI9A 5E6UA 2B2NA 1BCSA 1UMDA 1SVOA 1Z75A 2BHLA 2B7LA 4JGGA 1I6KA 2ONJA 3KWFA 4EJSA 4P83A 2AW3A 2OMEA 4LZNA 4YK7A 1W7AA 2GZSA 1AS2A 2GYVA 1SKBA 4ZHQB 1PQYA 2MYPA 4U1RA 1O08A 1R4NA 1EFTA 1CERA 1T9AA 1ZEJA 3NHWA 5BVGB 1RLMA 1UAAA 2VSYA 4BIIA 4BV9A 5GIPE 1P4HA 5T41A 1OVGA 2HK9A 3WYNA 5HIKA 4DIFA 5EUMA 2RAPA 1R10A 4D98A 3O3MB 3PEYA 3BGOS 4MB2A 2ZVQX 1A7JA 3JYOA 3PIIA 5D7NA 2POCA 4HH1A 3JVDA 3E8XA 1Q1AA 3QKTA 2RG1A 4Z4EA 2O8FB 4GLLA 2GGSA 4C7KA 3R75A 5AVZA 1R5JA 3ET4A 2JI8A 2PNFA 2YXDA 1MABB 4MV0A 3CN9A 4I6JA 4IV5A 2X2FA 1PEDA 2GPTA 1T0JB 2FWNA 4CL0A 3PP8A 1E6KA 4BQOA 3CR3C 5EINA 5J43A 3D7SA 3EQ7A 3KZ1E 5FULA 1P0MA 1E7QA 3C1TA 1AF4A 2OV8A 3GLSA 1OY1A 4Z1OA 1IZ8A 1R0BA 5K3BA 2AZMA 3GVXA 3IQHX 1H42A 3OPNA 1T6BY 4F60A 3W5IA 2B3DA 2ZQZA 5KMGB 4D82A 2B8WA 5KWEA 3P0EA 4PBRA 1DC3A 3KYCA 3GLKA 4CI0B 5KX5F 3AETA 4F3TA 2GHRA 1IUKA 2Q28A 4L3OA 3ZX5A 3WX0A 1CDOA 4JI0B 4CEIA 4B74A 3KQMA 1KPHA 1UJNA 3RRNA 3QU9A 2PWBA 4HS9A 3A4LA 1KMHA 2IA5A 3QEOA 1UBUS 3DW3X 1J21A 1MX3A 2Q5IA 4KCGA 1JBKA 4TKVA 1OAOA 4L57A 5HOQA 1RM0A 1SQ0A 1XHFA 5B3AA 5LKAA 5J2TA 3WL8A 4G63A 1T1SA 2FG6C 4WV3A 4UXHA 1T1GA 4HAYA 4JA2A 2DUUA 3LXUX 4JU8A 1L4BA 3DDUA 1AKVA 1DVRA 1U3TA 2WG1A 3GUYA 1MTOA 3K6JA 4QFCA 3R9KA 3TK1A 1AKQA 3FHJA 1QDLB