1QCZA

Crystal structure of e. coli pure, an unusual mutase that catalyzes the conversion of n5-carboxyaminoimidazole ribonucleotide (n5-cair) to 4-carboxyaminoimidazole ribonucleotide (cair) in the purine biosynthetic pathway
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
162
structure length
162
Chain Sequence
b'PARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE
publication title Crystal structure of Escherichia coli PurE, an unusual mutase in the purine biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 49
structure length 162
sequence length 162
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 1qczA00
4ZJYA 2NSHA 3RG8A 3TRHA 4AY4A 2ATEA 4ZMBA 1QCZA 1XMPA 3ORSA 2FWBA 4YCDA 4YCJA 2FWIA 5BOSB 4ZK2A 5CVTA 5C5DA 3RGGA 4ZC8A 3LP6A 4AY3A 4B4KA 5BORA 4YCCA 5CTJA 5CLJA 2FW9A 4JA0A 4GRDA 5CLIA 2FWAA 2NSJA 3OOWA 5CLGA 2FW8A 4Z7JA 1D7AA 1U11A 2H31A 2NSLA 5CLFA 2FWJA 5BOSA 2FW7A 4YCBA 2YWXA 2FW1A 2FWPA 1O4VA 2FW6A 3OPQA 3KUUA 5CLHA
chains in the Genus database with same CATH superfamily
3L05A 1EVEA 3N2IA 5L51A 1RRFA 2G9NA 3FYUC 3AR3A 1FRZA 2PSJA 5CYPA 3LQ4A 4FWIB 5ALDA 5ALXA 3WFZA 2G9UA 5C52B 1QHYA 2IL1A 4FDUA 5CG1A 1J5EB 1L4MA 5CNKA 4CMHA 2ENWA 1KETA 4A1OA 1AIPA 4WLOA 4BV8A 4PWYA 4L4RA 3G2MA 1S2MA 4UZEA 3FWHA 3NEYA 4WCFC 2B7BA 4Z9BA 3TB4A 3UMRA 1AB5A 5DM0A 3C15C 3WI7A 1D6SA 4FLFA 4RK0A 4DJEC 1V35A 1XZJA 3PF8A 3SZLA 5JQWA 3PUVA 3L06A 3WYEA 1Z7WA 2WIAA 4TVKA 1ORTA 2JLCA 1Z0JA 2X14A 2M1ZA 4INPA 3E5MA 1N4AA 5D3MA 3INRA 2DOKA 3FHTA 1CR1A 1V1MB 1DAEA 4RD1A 2ZS7A 1FFXA 2VHYA 5EXSA 2AN1A 3N2YA 3NC1C 5FR2A 5TQ0B 2BZSA 3VR4D 1RQ7A 5DEIA 2ZJ6A 3UZUA 3CPEA 1KEWA 1TIBA 2HDNB 2QZ4A 2O0JA 4HEA1 1D4OA 3O0DA 4ZOQI 4ZYXA 2YXBA 1GUBA 4IS3A 4KLCA 1DAHA 3DDWA 2BFBA 2OECA 2R1VB 2BUAA 4U1RA 1F51E 2VHUA 3ZXXA 2F1RA 3KSRA 3FMGA 3CB4A 4YN3A 3BG5A 4A0QA 2IX3A 1KDVA 2QQ5A 3GN2A 3I58A 1QS0B 4J49A 4TQ9A 1FUKA 4YK7A 4X20B 4CKYA 3Q8LA 3RO7A 2MYPA 5IJAA 4PN3A 3AL2A 2C07A 1P0IA 4TXHA 1JR6A 3AJDA 3TZKA 1BRTA 3HJGA 2NUAB 2WHYA 1YDHA 2ZBVA 4Q3EA 5JXIA 1E3WB 3KXDA 3UWDA 1N6PA 2DLNA 1CIPA 2P6MA 4M7OA 2W2LD 1U9JA 2VSXA 4WOBA 1YA8A 5EY5B 1ONPA 1X1RA 3CUVA 1F2TB 4RK4A 2FH5B 3MOGA 4CEIA 4B83A 3PXUA 2WKSA 4ZEOA 2GHTA 2Q0HA 4MWCA 2MJLA 2SCUA 2IUSA 1OBOA 5DXJA 3VV3A 3U44B 3BE8A 4C22A 4WNYA 4YRDA 1E2BA 6REQA 2J3DA 4PLZA 2H57A 4Y9UA 3IAXA 1PLLA 4QKQA 1RCFA 1Z75A 2PGNA 1KDRA 1U6IA 3GJQA 4QOGA 3RSFA 1UWVA 1EUYA 2P11A 1C1YA 2VWHA 2Y1EA 4S12A 3QA9A 5K0EA 5TJHA 3WMEA 1Q3TA 1T36A 4HFRA 1GL9B 5CCBA 1GTRA 2C31A 2ABWA 1BAPA 3LDUA 4QA9A 4EJMA 5LP1A 2O8FA 3IOEA 3BZWA 2J0UB 2QSYA 3WLSA 3GVPA 4ER0A 1AD2A 3DBIA 5ESDA 1EXNA 2O9JA 1BNCA 3JWIA 2H1SA 2RONA 3BMQB 1P2FA 2H18A 5A7HA 4MW0A 5DSXA 3ZXUB 3BS4A 1KRWA 3LL7A 1EM8B 5EEHA 1R7RA 2NVOA 4ZXPA 4ARIA 5CB6A 4L02A 1KY2A 2BM1A 4ENPA 2ZYGA 2GJKA 3HDGA 4ID9A 2R79A 4N6OA 3G2LA 3I9V1 3KRTA 5FUYA 3GW8A 3SXJA 1U3GA 4AXXA 4DQLA 4YJ2F 4FIDA 1S2LA 4TLCA 3HXLA 1XG5A 4PW0A 5EKSA 4COKA 3GLFA 5H4GA 3OWHA 1LC3A 9ABPA 3BICA 3JALA 1FQWA 4J9UE 1GEEA 3UJ9A 2WTEA 1VKJA 1EFRD 3RTBA 5BV7A 3OEYA 2C7PA 3FJYA 2ZE6A 2CW5A 1V9SA 4PQFA 4YLEA 2G71A 1KGSA 1E9EA 2Y1CA 1LQTA 5AP9A 1C0PA 1HE3A 1LX6A 3UCXA 1A0OA 1RCUA 4ETWA 5BN3A 2H31A 1V16A 2I03A 1W1WA 3JQPA 3M6XA 4I4TB 2EXXA 1FCJA 3Q6MA 1QH9A 2G0TA 4H18A 5EJ4A 1LSJA 3HWWA 1UP7A 5AW1A 4M60A 1N2JA 1YAHA 3RVOA 1C9EA 2E7ZA 4FGZA 1WMSA 2OD7A 3KQPA 2FPSA 3R0VA 4H6VA 1EK6A 1PTJA 3QG5A 3HPQA 1QTIA 1UOOA 3H0KA 3GRYA 5HRCA 1GRNA 1G8MA 5CAEB 3DG9A 4UHBA 3S6JA 3ER8A 4ZTUB 2AS0A 1NM5C 2F1JA 3OZVA 3TQRA 2QW1A 4W9NC 3M3DA 4BFLA 3TLMA 4BVFA 2XNSA 2W9XA 2Z98A 3KIPA 4ODIA 3N74A 2ONKA 4LMBA 4BTLA 1DO0A 4H7HA 3TQHA 3LCVB 2G09A 1YOVB 2OKCA 4RD3A 4X3PA 2GVZC 3G0GA 1N2SA 1VB3A 5AXDA 1K1EA 2DC1A 2RHRA 3DVSX 5CB0A 1UMDB 1KEEA 4JUAA 3RUDA 3T15A 1Z35A 5L7WA 1HT3A 1MO6A 3BEOA 3ESYA 5KVQA 3TRFA 3IBFA 4ZGWA 4NJOA 3VR2A 3EIOA 3U1BA 2XBMA 1P1HA 5TT0A 4IDEA 4FBGA 1KEPA 3T95A 1KZGB 3BFKA 3WGYA 2I54A 3BD8A 4WK6A 3R9XA 2XB6A 3QE9Y 5G0WA 2IF0A 3ZQUA 3HJNA 2PYZA 4IIVA 4RWZA 4V39A 3DZHA 2ARKA 1X7ZB 3E9EA 3F5FA 3QU4A 4PVCA 5SV2A 3VVBA 2WA1A 3TR5A 1T2NA 1XVUA 2O4UX 2OBLA 1JLLB 1X1BA 2IHZA 3PXBA 1P61B 4MW1A 4H7IA 4YJHA 1MD9A 1BE6A 3GRRA 4B6SA 3LVBA 3QYJA 4ON9A 5EP3A 4ZYYA 1JNYA 1OVGA 4EQ6B 2V3CC 2WWHA 2C2ZA 4WD3A 2R66A 1FFCA 4O4JB 1XTKA 1XCGB 3HNPA 2FRDC 4G24A 4A2PA 1I3CA 3CU5A 4A6DA 2FUEA 3K0BA 1D2MA 2E5FA 2WTNA 3IP3A 1ZOSA 1P7CA 2NU7B 3CMMA 3DEIA 3EC1A 2XGGA 3D81A 3FAZA 1LBTA 4HQRA 1TMKA 4P9NA 5M3BA 3PVCA 4CLEA 4EYGA 3K6KA 3RKUA 4MHSA 3EBPA 4U7WA 4EL5A 4EUEA 1AO3A 3RLFA 5EZYA 4WK2B 3WIUA 4PNEA 4FOTA 2EV9A 4JFRA 1GAEO 1VPLA 3EXEB 2NZYA 2GJAA 1X8JA 4Q1DA 5L53A 2JH8A 2HC9A 2K2WA 5LIRA 3ELUA 2J5RA 1PR1A 3RYCA 2PY6A 4E5MA 3AVOA 3SDSA 2A9VA 2XUHA 4RVFA 2IOYA 1A2KC 3IEUA 3MD0A 4HPJB 4C06A 5KJ6A 1SURA 1QO0A 1Z08A 4FNMA 1W6UA 5JYEA 4RTLA 2H08A 1VSVA 2X6TA 5FLEX 5JIBA 2P2SA 3M6WA 1SC6A 4K05A 1YRAA 3BMCA 3DC7A 3DV0A 3K2BA 3OESA 4KXNA 4R1SA 5FBQB 4RF3A 3UJBA 1B00A 2HNBA 4EG0A 4YR7A 4LYEA 4JJGA 1NLMA 4JKIA 4XX0A 3WGMA 4JOCA 2V59A 1V95A 3TW6A 2X1VA 2GKOA 1I3OA 1TYEB 2CNWA 4MJLA 4AD8A 1JPUA 2FOIA 3ET4A 4GRIA 4J7XA 2FG5A 4LWOA 4PE5B 2ZM5A 3H6HA 1J56A 2ZIXA 5LN1A 3RARA 5DOZA 2JKVA 1EZ4A 1CUGA 5MHTA 3I5XA 2O54A 5I7WA 1BOFA 3N8HA 5I7FA 1C7EA 3EUEA 4IYJA 4R84A 2RK6A 4BN4A 2F7SA 1WP4A 2CVPA 3KPVA 1DTWA 4RX1A 2V4ZA 1TM2A 4RPGA 3EPLA 1PFGA 3Q85A 3STYA 1ZRNA 5ALGA 2VT3A 3KTDA 4M9CA 2QBYA 4YT8A 3OCZA 4TOIA 1WXHA 1XRRA 2JHFA 3HU2A 3I2YX 3SQLA 1PGPA 2HRBA 4B82A 3MJDA 3AZQA 4CM1A 2OY0A 1C9DB 1F60A 5GVRA 3ZDYB 1Z0SA 3E9ZA 2XVXA 3QX8A 3C1TA 1BVUA 4B0OA 2YV3A 3HN7A 2PUCA 3UJPA 4F7DA 3GO4A 1E7YA 1PBTA 4UHJA 1LVUA 4CM8A 1I4WA 4K6GA 2NAPA 4KN5A 1GYQA 1NP3A 5PGMA 1MDBA 3PNKA 3GV0A 4EYQA 1JDSA 1I01A 5LU8A 5HILA 2FUG6 1WRBA 2PH5A 5BOSA 5JCPA 3NRJA 3P9XA 4MUYA 2Z2XA 2I2WA 3P8ZA 4KOAA 2WWVD 5CIYA 1DBVO 4G9GA 3RUEA 3GC6A 5FNVA 3K70D 4YCSA 1E1RA 5KCMA 2J6HA 4P53A 2GPWA 5IKEA 4EX7A 3DBRB 4JBIA 3ICQB 2OV3A 1TKCA 3KAQA 3D2AA 3O9MA 3DE0X 2P5YA 5ERGB 2OCAA 2BGKA 2HEGA 4F96A 5A62A 1MABA 3RVKA 1D4AA 1L6IA 2WD9A 4CHTA 4RA6B 1T8TA 4RORA 1UXHA 5EG5A 1W6RA 5HG0A 1MNQA 2RGCA 4NXMB 5JI2E 2X0RA 3MCWA 2OCKA 4YV7A 3EZ7A 1SWWA 3FVTA 3MERA 1ECBA 4HK4A 3SJUA 3TR0A 3WAGA 3EXIA 1XP8A 3FKJA 2QN6A 4M9UA 5IJWA 3LT2A 4D8YA 2AR7A 4TL7A 1XNHA 3DOOA 2FLWA 1V96A 3AY3A 2QVXX 3JTMA 1XC7A 2N9UA 2P5TB 2V3WA 2VOJA 2B2CA 1N3IA 2OV4A 3ZHSA 5KYVA 1X8KA 3GFBA 4DLXA 2E1RA 1EAMA 2WNSA 4OKIA 2OLJA 2F9MA 4NFHA 3TOSA 4RQBA 4D56A 1LH0A 1BS2A 1DZ3A 3DCNA 2KQUA 1FXUA 4IINA 3BJMA 3SR0A 5DNUA 2CSUA 3GMTA 1OYYA 1KWKA 1H85A 4BU1A 3N7AA 3V3TA 1KJIA 1NNLA 1ZGCA 2WQ7A 3L8MA 4QASA 1ZY2A 1SPBS 2NUTB 3AFIA 1GHTA 2FE4A 3HY3A 4L6IA 4EHDA 4B85A 5JOQA 3GPLA 1UBLS 3ENWA 3OZCA 3ZWKA 3LUPA 2WJWA 5BNWA 3D7MA 1Z4PX 1VSQA 4KE9A 2FPRA 2VYCA 5AESA 4OGLA 4PSAA 2VA8A 5A9TA 4I1PA 2XVZA 1YF3A 2DUWA 2F1OA 2ZB7A 2AZMA 3PKIA 4Y0NA 3X3HA 1PT8A 5FHQA 2X7XA 2R9VA 4DCTA 1FDSA 2ZSDA 5BWNA 3TDMA 3NVKI 3GPDG 2C94A 5FA5A 4OH7A 2GHRA 3RSQA 2BKAA 5AW3A 5JAIA 1SGWA 3ZD7A 3VJRA 1C0KA 2PBLA 1IBRA 4KFTA 3FSRA 1GRVA 2I9KA 3BB1A 5AKJA 2ECFA 1X13A 2HMUA 1P2GA 2VSQA 3K8YA 4HAWA 4US0R 4YUXA 2O2CA 3A36A 4IO0A 4JVMA 1BC5A 4YCCA 2M6SA 5DHFA 4UAJA 5THXA 4YQFA 1GY8A 1AZSC 2F55A 3PHIA 2JANA 1H1LB 1O0SA 2LD4A 1KFKB 3A25A 1E92A 4MS1A 5AM0A 4LJ9A 3CG4A 5F4ZA 3SY8A 1C3XA 4GOKA 4BO1A 1W1UA 2AX4A 4YAIA 1OX6A 1Z6YA 2C4VA 1KF0A 4I8XA 2WM9B 4I5EA 3KQOA 3TKLA 2O8DA 2VCHA 3LWDA 4I8DA 1DIBA 3DAOA 4CQMA 5DULA 4LNUB 4WERA 2Z8YA 1T9GR 3ZU6A 1W8DA 3BA6A 1P1FA 2XW6A 1YK1A 1H5QA 4MMXB 1G21B 2GLTA 3F4KA 4OHUA 3G85A 5JQGA 3VPGA 5KYWB 1J23A 2XAAA 1YGYA 3SZOA 5MFZA 4N41A 1KAMA 4CG2A 1GD1O 3DWFA 4QWWA 4YUZA 1PS8A 3HCPA 6AT1A 3O2NA 1B3BA 3UO8B 3GLHE 3S55A 1NF3A 4E6EA 3K0SA 1IZ9A 3KKZA 3ZNOA 3TW0A 5DYWA 5IT9A 5EPEA 3NDIA 4DCVA 2ZU6A 2JFVA 5FJIA 4CQNA 1M2NA 2QTNA 5K45A 5FJJA 5BMVA 1ZA2A 3QKSA 1O5OA 2R7AA 1KBOA 4M0PA 2C2XA 4EG1A 5AVQA 5TF4A 5B30A 1ZG3A 5FO1A 1QJ4A 1K9VF 5LCXA 4Z4QA 3OECA 1FFYA 3R77A 5FULA 3CRW1 1C9NA 1E6UA 2ANCA 3ANTA 2VP5A 2C9DA 2B5WA 4LJSA 1E1CA 3H5IA 5EHGA 1UBFA 5B7QA 1GPNA 4YJ3F 1QRDA 4GQBA 4O1MA 4XD7A 5IZCA 4AI6A 2ZB2A 2P67A 1JXMA 5FUXA 3EGEA 5JWOA 3EAQA 3G0CA 4E03A 1GKLA 3DL2A 3NEPX 3NP7A 3BZUA 4P4TA 4D8WA 2C4WA 4PAMA 3WGTA 3FY4A 4DKJA 2PPVA 2ET6A 2R00C 5CXSA 5M04A 3BBPA 1PJ2A 4B3CA 3LY5A 1UJ5A 2NU6A 1KBZA 1E7MA 1F20A 1VPDA 5ALNA 4B9EA 4KX5A 3KQSA 1U0SY 4DWOA 1CD5A 4LHYA 4LZJA 1ONSA 4XCXA 2RC5A 3MCVA 1O96A 3L9WA 4ENTA 4W5JA 1E6CA 1PTJC 1ZISA 4HDQB 3TW8A 3WLAA 1G6HA 3EXHA 4I1IA 4YA6A 1KP2A 3Q9NA 1H66A 3R6DA 2QZZA 4KC0A 3DTNA 1QOQB 3QE4A 2VYNA 3VHRA 4PAOA 1J33A 1W2HA 3BQ9A 3K16A 3LP8A 4IM7A 3HU3A 2ATIA 4JB2A 4L08A 3TM4A 4C29A 4CKXA 1WB4A 2NV0A 4HG2A 4DSNA 1HE5A 3IE0A 1ISPA 5M34A 2VLIA 2NYUA 3GT3A 4QYXA 1D2AA 3KETA 1X7YB 4FEAA 3JPWA 5IAJA 3QY9A 3KCNA 2ZAIA 4S0ZA 2IHTA 4PHGA 4OM7A 1MB2A 3PHCA 4OK5A 2HL6A 1BFKA 1GP2A 1IL0A 3TG8A 4UBIA 1GUDA 1GZ5A 4G09A 1EESA 4P2GA 4HL6A 3T1VA 5JATA 3NH6A 1HZJA 3EXFA 3W3AA 3K71B 4NJMA 1EVLA 1WQ3A 1DQRA 4F5ZA 4WZAB 5IT0A 3RI3A 4B8YA 4TM8A 3TNJA 1COWD 1JA9A 1I4OA 1NUPA 1UBRS 1X2BA 2C99A 2IPNA 5JJCA 4FMCB 1LVHA 3IT2A 3I6YA 4JYBA 3Q9UA 1JG1A 1L4KA 2QXYA 3K1AB 2ZB3A 1UT8A 4CM9D 5KHOC 2I8LA 4MR8A 2ZTMA 4JUIA 4HWPA 5IC4A 1IJEA 1EFPB 1YI1A 4RFVA 4N0MA 3KXKA 3H8JA 5FNVF 2PX6A 2GBIA 2HH9A 1S7GA 4TQGA 1JILA 4AIRA 4URFA 3ZVNA 1GKYA 4FFSA 3P4UA 2OHVA 4RZQA 2CXTA 1HNNA 2A88A 2P1DA 4ZYTA 1I32A 3MRXA 4EZEA 2IITA 4UTPA 1GEGA 3KQLA 4QODA 2M9MA 2H0QA 4Q6WA 4KJXA 3HCOA 3R2JA 3JRXA 4RK6A 1CPYA 1V1JA 2BKUA 2Y67A 5TQVA 5DK6A 3ZWOA 1NY5A 2OGTA 1DWOA 4Y2YA 5F1YA 3A58B 3OEHD 3VZDA 2ZZMA 3WRXC 2CNNA 5ICMA 1EGHA 1LBIA 1SG6A 2QA5A 2W8BB 3N2GA 1P5FA 3Q5EA 2QMUA 3VU1A 4URYR 4A0HA 3E82A 1QR2A 5AW6A 2NV6A 4CEJB 1JJAA 1Y33E 3OKAA 4IH9A 4UCWA 2ZWOA 4I4NA 4UKDA 3RYTC 2XUQA 5DU2A 1Y3DE 2JCVA 1TM5E 4K7JA 1KVTA 2B9VA 3I37X 1ESMA 1L5WA 1U2PA 4ALMA 1RQGA 1IM5A 4KEAA 2UAGA 4MPDA 4TLAA 5FPTA 4IGAA 3ZCXA 8GPBA 4TVOA 2QAIA 2Z8YM 3ROGA 2PLNA 1VJDA 2B82A 4X0EA 3TH5A 3K2EA 2G9VA 4GZLA 3I2IA 1LVGA 4JA2A 3EWSA 4P3PA 5HZKA 3KHUA 4ZT6A 3D3KA 4AW9A 5E1DA 5I4KA 2Q50A 3LYHA 4IMJB 3RYIA 4EAQA 4ZIRB 3GHHA 3D4OA 1PZXA 3LT0A 3QEJA 4C0HA 2XYVA 1FF9A 4CV3A 4HFMA 1PNTA 2OQRA 2HYIC 3NVAA 1DLJA 1JEQA 4LY0A 2DY1A 2NWQA 3ITDA 2HV9A 2PUWA 4H7KA 4ZALA 3E9RA 3IXMA 1XYGA 5EP4A 5FYQA 3B3JA 1X77A 4BKUA 4MVJI 2Y1DA 3EA4A 3ZVMA 1Z6TA 5D2CA 3WFIA 1BROA 1DAOA 1RYNA 1Y0BA 5KQRA 2HK6A 2YYAA 4TMZA 1M6EX 2JFYA 4GXQA 1F6BA 2O3UA 3KYJB 4QELA 2BGIA 4YDHB 2WOOA 4B44A 5I7EA 3TLJA 3KL4A 5LUAA 2FZ5A 2GILA 4GLFA 4O2AB 4F3NA 4WOPA 1E18A 1R4MA 4GZ3A 3WSVA 1RHRA 5BWOA 4EFMA 3O8LA 4KGVA 1VXOA 2ZRFA 5DHUA 2BRUA 3LY9A 4IJ5A 4JI5B 4G4JA 3THSA 3ASZA 2JZCA 3HBMA 4AO6A 4JZYA 3H6KA 3A1CA 3EUFA 3RUAA 4XSGA 3MFYA 1KJYA 5I9TA 5JQGF 1U0BB 1XJ5A 4MWSA 2NN3C 4I36A 4Z9XA 4WZ6A 1MO2A 2QV0A 1RVDA 1VSTA 3M6MD 4QFMA 4ID3A 1ZU4A 3ZJVA 3JD4A 3KZCA 3UMVA 4D3XA 2RC6A 4ER3A 4OEHA 3OFSA 4QAQA 2H9IA 3F90A 4EA9A 1FFGA 1Y98A 4J0KA 1KMMA 1LXCA 2PFGA 1NVMB 1T0PA 1GTVA 2YYYA 1MRNA 2CL0X 1MJNA 3D8TA 2SNIE 2CLDX 2P9QA 1ZI9A 1J00A 3A9TA 4JC8A 3C4VA 4PX3A 3EQ7A 3U4GA 1RRMA 1SCNE 4EYSA 1FTWA 2R1TA 5ITVA 1JAHA 4LPKA 3JY6A 3PA6A 3FTNA 2FUNB 3OY7A 4LC0A 3L8EA 2BDEA 1IEXA 5K6AA 5C7IO 1T1EA 4ZDIA 3VNVA 1G8YA 3HYRA 1JG2A 2X22A 2H1LA 1P4HA 1Q21A 4TN1A 4X1KA 2AT1A 3B9BA 1ZXLA 1TTQB 3MWKA 3ER6A 4B4UA 3Q8MA 1VYVA 2XRYA 4AJ9A 3MWFA 4RCYA 1T1GA 2G77B 2I99A 3D8BA 4PPGA 4Q1AA 2D0IA 2PZBA 1C3EA 3TIIA 3WRYC 4B9AA 3IP9A 2HSGA 4IDHA 5BWBA 3IT0A 5CXUA 1H2XA 1V7QA 3RASA 4JROA 1AQYA 1QONA 1V1MA 4HDMB 2XNKA 4RETA 2PT5A 4OPMA 3NHKA 4D44A 4IICA 1ZWLA 4DCUA 1J6UA 1FQKA 2ODTX 1UT6A 5HZGA 1DIHA 4IX1A 4KSYA 5DLEA 3N2NA 1LI5A 2CBXA 4EY4A 2IJGX 3EEYA 2MT9A 1FQJA 4LISA 4MV7A 2FOXA 4Q19A 1J7KA 1ZNWA 2PQ6A 1IZ0A 4XOIA 4LGMA 5BT9A 3DBHB 1YSCA 2WSYB 2UUOA 1U7WA 4HEA6 4TXLA 5AUNB 3W78A 1M3SA 2PNFA 4V3BA 4RBNA 5DBEX 5J5VA 4CU5A 1S0UA 3PNPA 1JKJA 4X20A 1DKOA 3CBGA 2QDKA 4R01A 1L5OA 1VE9A 1CXZA 3WL3A 4EUNA 1M2WA 3M33A 5JW6A 1ZHOA 5LMNB 1JAIA 4KYTA 4ZMSA 3ROMA 3OWOA 5EQDA 1AHIA 1W36D 4K86A 5EJEA 5E9QA 3AJEA 2EU8A 2MSDB 3JASB 3AOEA 4YRPA 3SZMA 2ZCUA 4HB2A 1Z22A 3N8GA 2PEYA 1F2TA 3PC8C 4X1YA 2ODAA 1YB5A 3NEAA 1MMFB 4KBGA 4QDJA 2WJHA 3S2GA 5HKBA 4EGJA 3G8YA 1RYBA 4QOIA 1E32A 4G5RA 1Z34A 1UZUA 2L82A 3SE0A 1OYWA 1Z0DA 1NXOA 3U44A 3HMKA 4F3CA 1VJGA 2FPXA 3FN4A 1E2DA 3R3YA 5A3QA 5ITSA 1RWWA 4MAMA 4CLRA 5KJEA 3VR3D 3CW2A 4JGBA 3S1AB 5JO0A 3I09A 4C07A 4WJKB 4L5YA 5TDHA 3D31A 5K0CA 3MJSA 3SYMA 1J9EA 2G36A 3R3SA 3B52X 3GL9A 2BMFA 2J46A 2BGNA 3HJUA 5TB5A 2QGZA 1MIHA 3HS3A 1OZFA 5BR8B 4ZICA 4CVNA 1IHOA 2G67A 1S96A 5AKZA 2PZMA 3L40A 2VBFA 1QBKC 5LJIA 4BNWA 1B41A 3BORA 1RRPA 3R4VA 5E1BA 1Y8QB 4TUYB 3WGGA 1RYMA 2JLAA 4QUDA 1ECLA 3SSAA 1NZFA 1EM8A 5ALWA 5H4HA 2DYKA 3BJRA 3IKJA 1HY3A 3DV9A 2WIDA 1XTTA 1JKMA 2RGBA 2C04A 1L8OA 2NGRA 2IHYA 4NTZA 5D5PA 2HGZA 5EXEA 1MG0A 1OXVA 3KVOA 2SICE 2WJPA 2YRXA 3LLUA 1BSVA 3WKDA 3CJTA 4FILA 4F2GA 3E7XA 5K2OA 3G59A 2OYSA 3DJYA 1P0CA 4TMYA 1RLIA 1T9AA 4NQZA 5T64A 1KJNA 2OORC 2XMPA 2PGAA 2C59A 3A4IA 4MCHA 3U1TA 1QF9A 1HDXA 1RJEA 4A92A 2QUJA 4HNTA 3T34A 5KSYA 2QMQA 1OI4A 4FE3A 4U39A 3VC3A 1KOGA 2V58A 3EVAA 3WWYA 4QXAA 4KMRA 1P2VA 4J1SA 2QP9X 2O57A 1EGQA 5KB3A 1UQTA 3P0FA 4TWRA 5CDFE 2YW9A 1VA5A 2J3QA 4MAFA 1ZX1A 2GTPA 2IOFA 2BHTA 3QLUA 4GX2A 5GVSA 1CRQA 3V1TC 2E4VA 4MUXA 3E27A 1MO5A 1ZK2A 3LLSA 3D6MA 4X45A 1E2MA 1NXSA 1GA1A 1UMKA 4DDTA 3PTLA 3QA3E 5CTAA 2WE7A 5IDQA 1GG2A 1PJCA 3AIIA 5CAEA 3A1NA 3ET5A 1QCYA 5KTPA 4KQFA 1W46A 5I01A 1WXEA 2LRHA 3DDCA 3LKVA 4FZVA 1KFBB 1NUSA 4AJHA 4FKBA 2YASA 3JQRA 3ESRA 3NB0A 5IEBA 1BG6A 5B2FA 1A98A 3KWLA 4Y98A 1IG3A 1Q3HA 2PGJA 3A11A 3G0IA 4A9AA 3AF5A 3FGOA 3DHEA 3KQTA 1YOVA 4PZZA 1EJ2A 1PJSA 5A3JA 5C5IA 2AE1A 1EHYA 1N2OA 5KTOA 1XWFA 1CR6A 3M34A 1TZ2A 1EK2A 3TOVA 4UD2A 1AGRA 2X76A 4U2DA 1T6XA 3SXPA 4DNQA 1KOFA 1UMDA 3M81A 1Y89A 3HXOA 2EKPA 5K20A 1EQAA 2MOKA 4CNBA 3GGOA 2R8PA 4N0QA 4UNIA 1OXMA 4TL6A 2WMNB 1G64A 1SKBA 3F6BX 3IC5A 2Y27A 3NAGA 1SBTA 3ZY3A 3A2MA 1AC5A 2QRZA 4J75A 4OXRA 4AWXA 1TCVA 1RW4A 2VQ3A 3L07A 1AV7A 1MFZA 3M8KA 1WUYA 4S1TA 3I6MA 4NYMQ 5DT2A 3N39C 1HR0B 1A97A 1THTA 2IELA 2V7QA 2BJVA 4L72A 1GUAA 1X7ZA 1ZC4A 2FW1A 1PJQA 3DKIA 3RTDA 4F1WA 3AVXA 5FDFA 1BYIA 1JJBA 2R8ZA 4CR7A 2WM2A 3DTYA 3T6KA 1O7JA 3WQSB 2R6AA 3DMPA 3Q7SA 2E4WA 4IIJF 2RJNA 5FI1B 2NVBA 1V48A 3Q0IA 1ORIA 2JJ2A 1JFFB 3EZ9A 3OG9A 1PN3A 2AK2A 1L7NA 2BEKA 3IB3A 5EXTA 3MA0A 4CKEA 3THWA 4LOHA 2JAOA 3U4MA 1IY1A 3JU3A 1OTHA 2R62A 2Z3ZA 4Y2VA 4IHJF 3SYNA 1I36A 3HCEA 4IXWA 1IXKA 5BY2A 2IEZA 3ECSA 1E2GA 4Y6RA 4X7MA 2JCSA 4ZDWA 1ZINA 2HPZA 2WTUA 4MLDA 2WFLA 2BGLA 3G13A 1VG9B 3I2HA 1BKYA 2C9BA 3A4YA 1BMFD 1L7XA 4M86A 4PG7A 3UENA 1UZAA 1IAQA 2IIVA 2SHKA 4NH0A 3EXEA 2GXQA 1X1DA 3T5GA 1BXGB 1ZJ5A 2E37A 1LQUA 1RHQA 1V4BA 4JQZA 3WLPA 5AH0A 4O08A 1QOZA 1IVYA 2R3SA 4U2CA 5B1YA 4C5BA 4GEKA 4MIOA 4Z7QB 3M6UA 1EK0A 1IOZA 1P1KA 4C01A 1FFWA 1G9SA 4BRZA 4GBMA 4IZHA 4KXLA 4BP8A 2OCIA 4PLPA 5KOJA 5FBHA 1JFSA 4JI6B 3VNRA 2YYZA 1U5CA 1WAMA 3MCUA 5DBOA 2WSSA 2OD9A 4YONB 1VGRA 4Q18A 3U09A 1QOPB 1T3GA 1ZOLA 3LOPA 1DHRA 1SNYA 4EFLA 3PQ8A 5DI9A 3QKWA 5H5JA 2JA2A 5IKXA 1HT2E 2B4YA 4QVKA 4PR3A 4RLQA 1BW9B 3VZSA 3WGVA 3B48A 1WZIA 4OI1A 3WLJA 5CB4B 5AVZA 3TQFA 2VK1A 1HMYA 2A1IA 3GLQA 4IXTA 2W71A 4C20A 5LL6P 1IUOA 1RE0A 1FRNA 1NXWA 1Q0LA 3LA6A 4R1UA 1SUCA 1MC8A 3MIZA 3Q7QA 4CM4B 1CSEE 2JAXA 2R68A 2W22A 5L7YA 3S8EA 1SHZA 3P9YA 1A69A 3IMKA 1G2IA 3VTAA 4F7WA 3A9SA 2NO0A 2OXTA 1XI2A 2DHEA 3FA2A 2V1XA 4TSFD 1W34A 1KDOA 1NW6A 1A71A 2PO5A 3TNLA 1NVVR 3ILYA 1DAIA 5EMMA 3LT1A 2B98A 2AKEA 2BLLA 2VF2A 4XA8A 4B6FA 1V6SA 5K3FB 1YQTA 1EHCA 1Z15A 4ASUA 4A36A 2QX9A 2X8WA 1BHQ1 1SHTX 2WU1A 4J1TA 1CZKA 3EW7A 3IUBA 3NI2A 3H8SA 1M6VA 5K0JA 3GEDA 2Q2VA 3QFRA 1E98A 1DFGA 1FLVA 1X1CA 4LXHA 4MWDA 1EXVA 3OOHA 3ZD6A 2AUTA 2AD1A 1WKCA 1ZL0A 2JFWA 1GZUA 3GX1A 4A0GA 5JROA 5KNDA 1PO7A 3PCRB 3CINA 2YY6A 4P38A 2QX4A 1DB3A 2ZUWA 2W6ID 4KSBA 5E2AA 3O4FA 2J4CA 4R6WA 2Y92A 4A0FA 3K0AB 1VP9A 4RA6A 4IIFA 3HJHA 4JBXA 5CU7A 2HWYA 3K9LA 2AYZA 5AXAA 2KSQA 2IEBA 4UBKA 4F3RA 2OCBA 4H0FA 2RHGB 1H0HA 4FZ3A 1NJ2A 1FIUA 4Q16A 4CLDA 4F9EA 5JSQA 3H5OA 2VRCD 2EKBA 2XMCA 2VDKB 1WTAA 1C4WA 2R25B 1DIRA 2NYAA 3HB4X 3ISTA 1EE2A 4FNOA 3AR2A 3RR2A 5KYXA 1N0IA 4ZT2A 3ZWQA 3HUEA 1GQQA 1Z0FA 2D3TA 2A78A 2ZCVA 3CG0A 5CXXA 2I1WA 2JAHA 1T9BA 5KUTA 2Q1SA 1ZH2A 3OJCA 4I99A 4W8HA 4IVRA 1L5HB 3IRVA 3TSZA 1CQWA 3NHLA 5AYVA 3IALA 3JX9A 4HWTA 4A6EA 3GUZA 3CCBA 5IJZA 1ZI8A 4GWGA 3LX4A 3EH2A 2ALJA 4V0RA 1HRKA 3CLKA 2NUTA 4PNZA 2XTAA 4I1OA 3IIIA 1E6EA 3MELA 4C4TA 4WA8A 1LDGA 3ZJTA 4MARA 3A26A 4YAWA 2LKCA 4NIMA 1IRXA 2A0YA 1U8EA 2JFHA 1VRVA 3C6BA 3PQ5A 1VMEA 3TLAA 3HJAA 5HUHA 4M1MA 4ZVPA 3DR3A 3L7BA 5CGZA 3GLIE 3CEMA 1JHRA 1GR1A 5IAEA 3VYVA 4DMCA 5JAHA 4U3JA 1Y8ZA 1BKSB 5CFRA 2HB6A 5I7RA 4P3OA 1XCJA 1DFIA 2FQYA 5FBLB 4PGMA 4DUYB 3A1TA 2IZZA 2VATA 1GCAA 5JMWA 3OZEA 3H2IA 4FYPA 3GARA 4KRXA 5E4YA 5KNBH 4QARA 3OF2A 2GCOA 1U3FA 4KXXA 4NY1A 2G1UA 5DIZA 5HIMA 3D2CA 3UKJA 1H1LA 2XEDA 2V74B 3CB2A 4ICIA 1SA0A 3D0KA 5A0FA 4BECA 1XMIA 5KMGA 5KNCA 1J9GA 3SICE 3OEWA 3FM9A 1Z18A 5L4NA 1FNDA 3EEBA 3FCYA 1V8DA 1YB2A 3F3YA 4K9MA 5AHOA 1TJYA 1N5IA 1CZOA 1Q17A 3IVXA 3N3AC 3QHAA 3QVXA 5DTQA 3W2FA 5I8WA 2VP3A 1XWWA 3JR3A 2DUUA 1ZEJA 3U7EB 1N2EA 3VVMA 4Q9AA 5C1PA 1G21A 3M3PA 4HMPA 5T6MA 2HOQA 5CURA 3Q5GA 3W5CA 1F7UA 2NU8A 4RF4A 2B25A 5A1TA 3TLZA 2ZT8A 1XQXA 1SD5A 1S8NA 2CHVA 2GBCA 1YCGA 3HZZA 4GHWA 2RGEA 4RJTA 1F2UB 4ZT3A 1KOLA 1ZRSA 3D8HA 3DVRX 3LQ1A 2GVDC 1V2HE 3IUQA 4FHEA 1T9GS 4M1OA 3AHFA 4ZYUA 4X66B 3X2FA 3GNQA 3OO0A 1RFGE 1ZHFA 2VPIA 5CDHA 3UFXB 1B0UA 4H4EA 3OQIB 3AERB 3UUEA 4Q4HB 4WK4B 3VZRA 2VHQA 4QYWA 1PZEA 3MRSA 1SKQA 2OO5C 4DV0B 2Q5CA 4QJ5A 2DFLA 2FWAA 1IU9A 5C1DA 2QYSA 4MPTA 2DBZA 4YREA 2EX4A 4EKEA 3QLTA 4IJUA 2Z2ZA 5HE9A 3KSBC 1ADFA 4DA6A 3GXBA 2ZFUA 4RK1A 3AVUA 1RXYA 2NZ8A 3AXTA 1JSZA 4FDLA 4XJSA 1DTSA 2OT3B 4G1VA 4OGWA 4Q02A 1QGZA 4XVQA 4BKOA 1OREA 2REBA 2DPYA 1C2TA 4C9BA 5C1IA 1SVWA 2W4IA 1PD0A 2O7NA 1BJRE 1EM6A 3GG9A 3M7IA 2MINA 3EH1A 3B53X 4ND5A 5H3CA 3UJ7A 3KV1A 4G63A 2AHRA 1XTVA 3H17A 4U7PB 3I72A 2W6MA 5SY6A 2CV2A 3NDJA 1KEVA 2IV7A 1UJ6A 4KR0A 4PSVA 4WBNB 2VJOA 3F6SA 3LUFA 3OPYI 4CGZA 4B8WA 3G0OA 4N48A 3SSMA 3FCOA 5BQXA 2PA3A 3QYAA 4PWZA 4G8CA 1ZD5A 2ZT6A 2GS9A 3FPFA 2BMWA 3EGWA 3BBLA 3MTJA 4BZZA 1C7ZA 3KT6A 3O95A 3UYLA 4AY6A 2Y99A 4PPFA 3T7TA 1YJBA 4ALNA 2OBMA 1XQVA 3CEPB 3CH4B 5J40A 1HQCA 4I8IA 3W8RA 3W6ZA 2VT6A 3AUAA 4GR5A 4NU8X 5AW9A 5JY1A 5DWDA 3K0CA 2XAUA 3OEED 4L07A 3NHBA 2NU9A 1NAIA 4OUDB 4UNPA 1OWMA 2JEOA 3HUDA 1NOKA 4ZDJA 4HWRA 5F35A 3RTCA 3ZV5A 1R0CA 4Z4CA 2NAFA 4WADA 3LS2A 2F64A 4NV1A 3CZMA 4B8ZA 1QTQA 3AV0B 4U7JA 1GSHA 4QQNA 1T2VA 2I9PA 4FLEA 3V6MA 3GUVA 3K2IA 1ACMA 1V9LA 2CKMA 1ZFNA 3GFRA 1EX6A 4TTRA 1T43A 4D9KA 4LJRA 3C7CB 3MSCA 4JJ6A 1NRJB 3PPWA 4O4HF 2WV9A 4UOEA 4G0VA 4YCBA 4H1WA 2A0FA 4HNAA 1D4FA 2OCYC 3G5UA 3K1AA 1YS6A 4IIYA 2I7XA 1Z33A 2WJAA 2AEFA 1F3LA 2WT4A 2ZP1A 1CK4A 2OVFA 3FPJA 1EFPA 3GWZA 1XR3A 5K3SA 3GFQA 4O59O 1E5QA 2AFHE 3GZ4A 5AI8A 3SZRA 5JCOC 1XAIA 2WG0A 3ILSA 1K4YA 4WEOA 4MQ4A 4ZARA 5JC8A 1XZKA 4HX5A 4C3UA 5HQ3B 1MEOA 1C7RA 2D0PB 4O2BB 5J1TB 1LLCA 1YNSA 4FOOA 3E2MA 1YA6A 4EHKA 4B31A 3B82A 1CS0B 4O4IF 1AKTA 2GBLA 1OJ7A 1NHGA 2L2QA 4TMXA 1JVNA 3B7WA 3DDHA 3VZBA 2VPQA 2DGDA 4FWBA 3TDNA 4CKWB 2Q3MA 3NOQA 4JSRA 5IC5A 4Y3UA 2DQZA 3U49A 3ENQA 3FHLA 3UAWA 5A1JA 3O3MB 5CB8A 4EHAA 2VDNB 7ABPA 1Y6ZA 2W8BA 1GFIA 4G65A 2Y76A 1ZJWA 4CEJA 4ENRA 1RXWA 3NKVA 3OP1A 3PF9A 4X97A 2B4RO 1SXJB 4A6XA 3W9SA 1KSGA 4MUBA 4NENB 1IOWA 2WM3A 3NCHA 3DH0A 4JBNA 4W1RA 3ZQ6A 5L6LB 3BH0A 1Y7HA 3A8TA 5CFOA 2DHDA 1M7GA 3DPSA 3HRHA 4MW7A 2IU0A 3F4LA 1GGVA 4ERNA 3JVUA 1KJ9A 3C87A 1BIFA 3INTA 4Q9LA 2Q99A 3O4VA 4A2QA 4D81A 2O8CB 2QDXA 3LQ2A 2B5OA 1HQDA 3HJBA 2D5IA 3NETA 4LF9B 4MDEA 2O05A 3KT3A 1BXKA 5SZIA 1I3MA 4L3OA 2J45A 5EYPA 1IWPB 4J0CA 2PFKA 2YJNA 4ZIRA 2GD1O 2Q0SA 1BH2A 2XB9A 4BQQA 4BEJA 4YT2A 1LQ2A 3PQ3A 3FR7A 4V0QA 1JZQA 4P33A 1KQFA 4TL8A 2RH8A 4YO8A 1C3OA 3MT8A 2VP2A 4CNQA 5FPKA 1ZCBA 2EL9A 3D2BA 5KNBD 1H3EA 2FN9A 3DKPA 4RHCA 4BRUA 2HBZA 3GUHA 4ZC8A 3QUQA 5I7AA 1PW5A 4I9NA 4ZAWA 2WJVA 1AZWA 1IN1A 3LO8A 1DOZA 1RDFA 2AC4A 4KQWA 1FP7A 5AM2A 3IUSA 2XQFA 1VSBA 1I14A 4F1KA 3K9QO 4UULA 4IJWA 2YW2A 4P58A 3TIXB 3VU8A 4DIDA 1RXVA 4H15A 2Q6KA 1YS9A 5IULC 3ERCA 4LOJA 3NALA 1XNJA 5FLXA 2OXFA 3BDVA 3WK4A 3PITA 1YRQA 3PNBA 4QL3A 1C4KA 4TV8B 1JEEA 3EMBA 3A1SA 3AGPA 1X8XA 1ZW6A 2JBAB 5J43A 5FWAA 1X7XB 4EG6A 1ZA1A 1KGDA 2PUJA 4MVJP 4YP7A 5LNK6 3DDOA 3D1LA 2YIJA 3I1FA 1KH3A 3FFAA 4YWHA 4B3TB 2ZIZA 1F06A 2QJWA 1YZVA 1C7QA 2AG6A 2N1BA 2R7KA 2VJQA 1Q7BA 4YI5A 3MLBA 1QWOA 4QJIA 3Q2OA 1OFUX 5GGXA 4OBBA 3K5HA 2WWIA 5KSPA 4DSZA 1YFJA 1VHTA 1Z5OA 2X86A 4QBGB 5HX7A 4OLAA 1UJMA 2V7TA 5AK6A 5JCOA 3VO8A 5MDHA 4LF6B 5A5VA 3K6SB 5BP7A 1IVNA 2H3HA 2W83A 3JW8A 5I7VA 3O4HA 1L9XA 3ESCA 1OFVA 3GYBA 5B1IA 4A23A 3OCUA 2RSLA 1IULA 3FNFA 4M9QA 4XVUA 1JDPA 4J0FA 4LHZA 4DA4A 1U28C 3F8SA 3R0XA 3WZLA 9MHTA 5IM5A 3EHEA 4MWZA 4MV1A 4NU5A 1U04A 4FGKA 1E1QD 2AC2A 2JFNA 1J8DA 2IDZA 3EZYA 1OH6A 4NNJA 2PUGA 2IY8A 3G9UA 5ESWA 2QX7A 3T5PA 1IMJA 2VH5R 2IV3A 5ICFA 4LX8A 1JH9A 1GSOA 2GPNA 1L5YA 1VB5A 3MT7A 1O5TA 4QQRA 4FXPA 3STUA 2OHOA 3JD1A 1XDDA 3OFKA 1BGWA 4HYQA 3IVCA 3WK9A 2HA6A 3JYPA 3DFMA 3PG5A 2YZ2A 3AF2A 3F8TA 2UZ3A 4P4LA 1O6FA 1GAXA 3CC8A 2GN4A 3CPSA 5FFNA 4HDMA 4U6QA 3V8QA 3KZOA 5H9WA 2IYQA 1GCGA 1RRGA 2HF2A 3VR1A 2ZTUA 4NZPA 5LLDA 2BBOA 4C1NA 5T3YA 4UDNA 4X1IB 1QQ5A 2OHIA 5E9JA 4BO9A 4MRVA 5AKLA 4NBUA 3RSGA 5DN6D 4CUJA 2E3JA 3MJTA 4YCDA 3PEYA 1Z26A 1TFRA 3Q11A 4KX3A 1JXQA 4PV7A 5DDIP 3GPBA 4XYBA 3GLTA 4II2A 1J49A 1DSSG 1D1QA 1KYZA 4O33A 3RFVA 1TLFA 2TECE 3IHTA 2FR8C 2A5JA 1O08A 1BGXT 1JDTA 3PIIA 5EP2A 4BFSA 1U7HA 5A3RA 4MDHA 5KTNA 2PVCA 3Q98A 2JLUA 4II3A 3RFTA 1YZGA 3V1NA 1JALA 1SBZA 2PWZA 2ZRAA 1VPTA 3LZCA 5D85A 5BVGB 4LYGA 3F5SA 4ZHQB 4UUPA 4NJEA 4MQFB 2XRZA 3JASA 4C87A 1GVHA 5JASA 4TZ6A 1TW3A 2BMEA 4RIHA 1F17A 1X38A 1ISJA 1P39A 3KYDB 4LQ4A 5BQPA 4QJ3A 3ZVKA 3SR3A 1PVOA 1EDDA 4C7JA 2CUNA 5E3HA 4GPAA 4YYEA 3ZNPA 1Q1NA 4FJ0A 2ACKA 3PUJA 3LHDA 2AUNA 3D02A 2P6PA 1E7QA 4M8SA 5GV8A 4DUZB 1T26A 3LXXA 3WIVA 1U94A 3EYAA 4LV8B 3LHFA 2QW8A 1VKOA 2VT2A 4YP9A 4F3KA 3THYB 3E7FA 5B1HA 3TRKA 3ABQB 1XA3A 1BDIA 3W5VA 1B6RA 4B2PA 3M4NA 3VPFA 4LI3X 4JXKA 4Y2GA 3IJEB 2AF4C 4GMDA 2FMIA 2H4XA 1PFUA 1QGUB 5IRCD 1TUGA 5FOXA 4QBFA 2GPYA 2I66A 2TYSB 2JRCA 2IGBA 3C3AA 3THXB 4TUYA 2PS9A 1AA6A 1LS6A 2F9LA 4BUCA 1KQNA 1JBKA 1YQUA 5L3VA 2H5JA 4LXYA 1AK1A 1NQXA 3II6X 4RO0A 1T9ZA 1XZ8A 2PZAA 1SM4A 3LGAA 4GXTA 3GD5A 4W7HA 1XJCA 3E2PA 4UVHA 3VR6H 4WK0B 1XMVA 5ADHA 1J25A 4G37A 1C9MA 1DEHA 3P20A 4BHTA 1N2CE 2VDRB 2ZJ7A 2DAPA 3KVVA 3QITA 4B6QA 2A30A 4CQJA 1YB6A 1LLFA 2Z2YA 4QREA 5TNXA 3DLBA 2PVPA 3UH1A 3QM1A 1POWA 1D04A 1JVBA 2OC9A 3ANLA 3F5QA 3HB5X 3JQGB 3EF0A 3H2BA 1EG7A 4OA5A 2FN8A 3GEGA 5CT6A 4RAOA 1ZH0A 3E3LA 1IEWA 1BDMA 2R8XA 4EZBA 1VYHA 2BFNA 2ZXFA 4DV2B 1I1NA 3HA2A 1UM9B 4NYJQ 3QWHA 1CRLA 2XVYA 4RVUA 2R96A 3LUGA 4G4SO 3RAPR 1C50A 3MQ2A 5HR5A 5JT1A 4L1KA 4BQFA 4S35A 4GUDA 1CUBA 2QLTA 3ABRB 5B64A 1RHKA 1W19A 1WZEA 1H42A 2DKOA 1NJ8A 2WVHA 2UYQA 4GLJA 3FTCA 3COWA 3EZ6A 1FDRA 3T5DA 3NP9A 2M6KA 4LF7B 2Z57A 4DJTA 3ZDAA 3THOA 3RSZA 4E12A 2V6GA 3ORYA 2C77A 4EI8A 2YWEA 1NAHA 3CF6R 2WG1A 1LDNA 3L7IA 1L0BA 4OJNA 4ZYLA 2GH1A 1QANA 3LCUA 1J21A 5KYUA 1XHFA 3W3AH 1D2RA 2OGWA 1YR7A 4GD3Q 3IHLA 4C2UA 3KB2A 3ZU4A 2J41A 3INNA 2P9TA 4BNZA 3G7NA 4WDQA 1V6AA 3LYLA 2F3RA 5ESRA 3SF0A 2ZRPA 3ZZUA 1P9RA 2MSNA 4KPYA 2JA1A 4RTSA 4OJTA 4GVXA 1GNLA 2FK8A 3FGNA 3GLHB 1BXRB 5GAJA 4EHIA 6YASA 1A9XA 1L6RA 2IF2A 2GCGA 2EFCB 2IPXA 1P2TA 3SJCA 3PXCX 4N5NA 3U5ZB 5EJGA 2QRUA 3EWAA 4J94A 3LPAA 2MR5A 3OFJA 4MV5A 5FWYB 4LCJA 2CLCX 3U81A 3ZHOA 2HMAA 2QS9A 2W0SA 2D7DA 1O3YA 1VHQA 2FR0A 3LWZA 3P2JA 3WNVA 1S5PA 2ZUSA 4X41A 3EIHA 1SBNE 1A4UA 1XXHE 2HIAA 5FV4A 1SPXA 1MJFA 3F67A 2RGNA 3LW8A 2R11A 1IQ0A 4NBRA 3WIOA 5EHQA 3SM9A 2D1FA 1K7YA 3TMKA 1P77A 5JAMA 4EO4A 1JFFA 5ERYA 4DLAA 1PYDA 4J91A 5FTMA 1T9KA 4XRRA 1Q7EA 1WLSA 5G4KB 2G4CA 1L4BA 2MYTA 2ZAMA 3LV8A 3GLUA 2HPAA 4XD2A 2Q9BA 2P0AA 5DHQA 1K27A 3JATA 4PIVA 4D9HA 3B12A 2IBTA 1P2UA 4QAJA 2CE2X 1O8BA 4OFBA 1M7BA 3V4SA 1J99A 1MQSA 2IOHA 4BBJA 2X7HA 3L2OB 2WJ3A 4MA5A 4AAYA 1QG4A 2GF0A 4R9SA 2HUPA 4FUQA 1G5TA 5TQ2B 3NBUA 1EBBA 3DOCA 1M8GA 2WIGA 4LX0A 2DEUA 1OH8A 1K7XB 3FYTA 4YFYA 5FTJA 2B34A 3W9BA 4DW8A 5ALZA 3VYSB 4ZVSA 3VBEA 3PEUA 3MMPA 2GPAA 3BWDD 1WCYA 4G1UC 1V5IA 1EJBA 2ILTA 4RLHA 2L19A 5LA6A 1EE9A 1E63A 2ZTLA 2JDID 2ZI3A 1M75A 2CMHA 4K3UA 2RK3A 2WB4A 4INAA 4LRQA 4N5MA 2I80A 5B12A 3G3EA 1DTEA 1FXSA 4PZUA 4YAEA 1F5NA 3SPXA 3WICA 1GT6A 2C5FA 4G97A 2UZ1A 2R5FA 4IRUB 3TOXA 4BVAA 4TTIA 1D2NA 4DB4A 2WK1A 3NKLA 4FCWA 3HJRA 4YGYA 2O0KA 3VDRA 1KP3A 1CJVC 1NNEA 2EJTA 2RGDA 3EULA 3QPUA 3IGFA 1VYTA 1BW9A 1TO2E 1WD7A 3G5AA 3TAUA 1ZVMA 3FPHA 4K46A 1EG2A 4KGZA 1U7ZA 4QNNA 4D4HA 1E7RA 1K8XB 1PP4A 1WW2A 1W48A 1T35A 3D6NB 4OXXA 4WTOA 4RKFA 3E22B 2PAAA 3NKFA 5EZ6B 1M8FA 5MN4A 3RAEC 4Q15A 5KWEA 1PFVA 1U0LA 4BO8A 5C31A 1QYXA 3BHMA 1MR3F 3MOIA 4JB8A 3RPEA 5T4FA 3MBKA 4UAVA 1G1AA 5SYAA 1Z2PX 1CY2A 2Y68A 1PDWA 5JD6A 4R8SA 3A6EA 4AO8A 2O14A 3IXLA 1RPNA 4AU1A 1BQ4A 1U3UA 1AZTA 3WLIA 3L92A 2VK4A 3GUYA 4KV7A 4L5BA 4XSVA 4EZIA 1S2GA 3CRNA 4RJIA 2ZJYA 3A3OA 4AJOA 2IYTA 4I4CA 4TMKA 4CBVA 3WOVA 4OX9Y 4C5CA 1W5SA 3BXGA 1OFGA 3KB1A 1IHPA 1LSSA 2D06A 4PXSA 5CUQA 2CL5A 5FOVA 5JNRA 1V5FA 3TBHA 4NATA 2KW5A 1ADYA 1W4ZA 4E5YA 6NULA 2PRYA 4KR9A 2IKSA 1Y9DA 1QM5A 3EISA 3IMFA 4MYUA 3D3WB 3TBKA 3DMGA 3PKJA 1T4DA 5JRZA 3R7WB 4DBLC 1T6YA 3EHDA 2VEOA 1AKUA 3IQDB 2DTDA 2P8JA 4TVBA 2JFBA 5E8JA 3V2HA 1NXQA 1TKBA 3K0AA 3ECCA 4ARSA 4BJ5A 4E08A 2AFIE 4ITRC 1LDYA 4E88A 1X1SA 1UK8A 2VSYA 5T3UA 3VR6D 4DMGA 3KOXA 1H5UA 5MFPA 4D9MA 3NEJA 4JITA 4EO7A 3PRHA 1ETHA 5H3LA 3K1YA 1GQFA 2VRWA 3L1UA 4GC9A 1VLJA 2NADA 4FDAA 2X23A 4L85A 1O95C 3O7WA 3D43A 2ERYA 4DDHA 1U98A 5SZKB 4DNFA 3UPUA 3H97A 4L27A 1RZRA 3V1LA 1VA4A 1M2OA 3EUAA 2H11A 4RPIA 4XB2A 1DJQA 3CRZA 1A04A 2VQSA 4LIPD 3VPAA 4BNJA 2UUAB 2VDWB 4XM1A 5A4AA 4QDZA 1DCTA 3IA2A 3A1EA 4L0CA 1IN8A 1CLUA 5AHWA 5I4IA 1B0ZA 1MOSA 2ZQ5A 4P82A 4EF6A 1T9HA 3E8MA 1FSFA 1WVIA 1WP9A 4KQIA 3RROA 1X9GA 1U2TA 3DNMA 4GYYA 4C76A 5JAPA 4Z8YA 5GQSA 5LQCA 2ZI7A 3M1IA 1ZN8A 3QNUA 3QVTA 2SKDA 2EWWA 2YTZA 1SZPA 4D3YA 5F3WB 1NFRA 3DOFA 1US8B 4P36A 1PNOA 1N3LA 4L76A 5AJHA 3M4XA 3TR6A 1VE3A 3FCCA 4FFLA 2O2EA 2FMFA 2C2YA 1PJZA 1NBWB 2N46A 1QKJA 1Q22A 3GGPA 1TE2A 3OT5A 3LCJA 1FS4A 1ICIA 2HWUA 1W85B 4HRAA 1CR2A 4RVHA 1G7TA 1XEFA 4WXHA 2AL7A 3DJFA 4HHEA 4RV4A 5K0ZA 3M9LA 2YMQA 3PNLA 2O6HA 3VKUA 1Z5ZA 1P18A 2GLXA 2XLCA 1AUXA 1EVZA 1M6WA 1W0KA 3OCCA 2DHCA 2PS0A 1JYFA 1QRRA 2VJMB 3OUUA 4LI0A 2Q5HA 1HYEA 3EIXA 3SC2A 3LPDA 2EZTA 1OV6A 3M0EA 1TZCA 4YAOA 3C39A 1WLYA 1M2EA 3MC1A 5ALQA 2GESA 2ZPAA 3O94A 3F8WA 3MPUA 4G86A 2C4TA 3IPRA 3NAMA 4M55A 2EYQA 4MUGA 4EITA 1QVWA 2R5WA 2V4UA 1C9JA 3DF7A 3L3BA 4JJ4A 4QSMA 4D3ZA 3ICEA 2XB8A 2Q8QA 1NV8A 5IMSA 5ADWA 2VRBA 2X9QA 3IURA 1IHXA 2PIDA 2BEUA 3UC9A 1TLLA 5L9AA 3URKA 1PWHA 4YCJA 3GVHA 1H2YA 3IELA 3KJFA 3V42A 1FJXA 1XZNA 1NSYA 3LE8A 1XL0A 5IH3A 2O07A 4Q39A 4EJ0A 5M7EA 2YMPA 1ST3A 5BUCA 2RHTA 2B8EA 4EPYA 4QTZA 3RHSA 1PK7A 1RPTA 3GGCA 4IWXA 4UDOA 1B8NA 5FL3A 3RDPA 2FN7A 5HMMA 1L7OA 1T4MA 1RQ2A 3AERA 4Q4HA 3RAGA 4MSUA 4X93A 5JSZA 2JI7A 2WUFA 3GVCA 1IK4A 2XOKA 4NOKA 4WFJA 3URMA 3DD5A 3RSCA 3E2IA 2X0IA 4D42A 3DLHA 4YRGA 3P1JA 3AEZA 4XI9A 2A9QA 2O7RA 3JRNA 4C3OB 5JFGA 3LZDA 1JQ3A 2OCPA 2O1WA 1FSZA 1UINA 1QQAA 1QLJA 2GNOA 3GJRA 3RJ9A 3SJBA 5ADUS 3P52A 5EE3A 2V0NA 2JGMA 3REFA 3UATA 1J09A 4DQXA 1NYTA 2P7HA 4HTFB 4K6FA 3Q7TA 4RNDB 1NG1A 3ASYA 1U0FA 2X4DA 2VOEA 3TYXA 4WBNA 2REQB 2C3MA 1FTNA 3A1WA 3IO3A 5DCYA 1FVFA 1L3BA 1P3JA 1R74A 1U63A 5T41A 1VLZA 1KQOA 1X1TA 2B69A 2G1KA 2H7XA 2A8YA 4KIFA 4AM8A 3O74A 5A06A 3C7DB 1L5MA 2XYHA 5DWVA 5EIHA 5EERA 3UXHA 4NMLA 7YASA 3BKWA 1NVAA 1SCAA 3ACBA 2HU8A 3WLRA 4GI2A 2BMAA 1NJSA 5ENVA 3V7NA 4KXVA 3MCZA 3E0QA 4NI5A 4XGNA 4EY5A 4IVQA 3ZI4A 3BF7A 3DEYX 2D1SA 4Z3OA 4QTTB 1H6AA 4GVLA 5DI3B 3HN2A 5B2ZA 1G7RA 1D9XA 2PH1A 3OQ6A 2D2IA 2FG7C 2X8JB 4KN6A 3VH4A 3LYUA 5C34B 4CCYB 3NTLA 4ZAFA 3O8CA 3IESA 3TOZA 1GITA 1PSZA 3IV7A 5DIFA 1IXSB 2ISCA 4Y1EA 3C4QA 1QPZA 3JVDA 2CSXA 4WXMA 1KPIA 1MZVA 4ESEA 1A9PA 4JWTA 5CJJA 3F9CA 5IJ0A 1JBQA 4MTCA 3I4LA 3CFYA 5L8VA 3U0VA 4NR0A 5BQFA 2GK6A 3ZS9A 3SOZA 2H00A 1JYSA 3AF4A 4PZCA 3C3PA 4XCQA 1BE1A 1TGVA 2WFMA 4OQXA 4RV5A 4DT1A 2AYXA 1LEHA 1WOMA 2QF7A 4FYJA 3R5SA 4GPD1 4IFIA 3GEEA 5LZ9A 3G2JA 5KWIA 4MB0A 1AJEA 5IVDA 4JP8A 2Q1YA 1K97A 2FCAA 3HDQA 3C8UA 2CLOB 1A4XA 1G20E 3ETHA 1A7UA 1M34B 1RIIA 2DT8A 1T5HX 2IYRA 4Z8XA 3SQNA 3HY6A 1CS0A 1DE0A 1HTWA 3P2KA 3QXCA 3EGIA 2VUUA 1TO1E 4C05A 4MZXA 2WIBA 3EEIA 1CNEA 2CBZA 5JDIA 1XTBA 1MXHA 4HEQA 2YJ6A 1D07A 5D00A 3U7FB 4ZQFA 1Z47A 4G5YA 4HXGA 2F43B 3WHKA 4N8DA 2GXSA 3IQIX 4GL2A 4RVCA 4UFNA 3KUCA 4C88A 4NCNA 2LZ0A 1HT0A 2YWBA 4LMRA 2DLCX 3EXG2 3BWYA 3JWJA 1QAMA 3PQFA 1B16A 4A0RA 3PRKE 1B2RA 4D0GA 2IYEA 2SKCA 1AN9A 1TA4A 4YLYA 2C7RA 4OQDA 2C9CA 4LVNA 5IJ9B 2CL6X 2VXYA 3KELA 4A2CA 1R6UA 1HQKA 5KC9A 4DUGA 1IOLA 1Y80A 2MWMA 5MGNA 2WBLC 1IM2A 4Q7MB 5TT1A 4AO7A 2EZ8A 2HRDA 3S8YA 1KK3A 2PRIA 4KVAA 1PE0A 4IMPA 1NW9B 1XMXA 4D41A 2XR1A 1BWPA 1OWOA 2CE7A 1B74A 2MR6A 1YI8A 2QQFA 1U9YA 1LK5A 3IILA 4YQZA 5FT9A 5TJ9A 1D6NA 1FW6A 2WILA 1G8HA 2HHCA 4RVOA 1JTVA 1O89A 1AHHA 3WS7A 3HGMA 5DYNA 3Q3VA 1OT5A 3GJ6A 3GAMA 1PTKA 4ZVTA 2I4IA 4H0CA 3DHNA 2DWOA 3P9PA 1DKPA 4ZTBA 5ICEA 1QKKA 2VQ6A 3A6DA 3WGQA 1K3UB 1TMGE 2ZRCA 3H2KA 3NGLA 3PDIA 5AI4A 5FTWA 2WFZA 3H2JA 4Y6OA 4OHOA 1Y3CE 4X7RA 3TTTA 3KZMA 4KKVA 4FUTA 2HSWA 3BHJA 4R5HA 5D7BA 3ZQ4A 1YBAA 4WINA 1ZCFA 4CF6A 1NBEA 4TV8A 1GV1A 4DLRA 2MDTA 3T38A 5C8ZA 5F98A 1O57A 3EVBA 1Z6XA 2YFYA 4Y2QA 3VPBA 3D1JA 6PFKA 4FMDF 2ZM6B 2ZUCA 1ESCA 5T8KA 1EFTA 2J5XA 2F3PA 2K4MA 3PNQA 9ATCA 1YV9A 3P94A 1D8TA 3HP7A 4ZEXA 3W04A 4ENUA 1PQYA 4JJZA 3H8VA 4GPEA 1SKAA 3AJ8A 1ESEA 2ZIFA 4FGWA 2J0VA 4Q05A 1NVDA 3HP1A 4EMTA 3RFCA 3TLXA 1XF9A 2Z8XA 5A3VA 4B80A 2NPOA 6GPBA 5EGNA 2I34A 4FEGA 4K2HA 3Q3EA 3VPSA 2A14A 3ML1A 1EBUA 5IJXA 4Q24A 4OJYA 2C5SA 3MM4A 3K0EA 1UJBA 4CMAA 2CMGA 3N6VA 2QR3A 4YXWA 3VNQA 4B71A 3BIXA 4MP3A 2FG6C 2R8OA 2C3OA 3BD9A 5CD9A 2QX6A 3CPHA 3LW7A 4YX9A 1GM5A 4WMLA 1KAQA 1DVRA 1PX0A 2JLQA 4B7CA 3RE1A 1JKXA 1Z3CA 1Z4QA 3OE4A 1GZVA 5JZMA 5JH7F 3TFQA 4DM4A 5AKYA 3HJTA 4PYQA 3S8MA 2AIRA 4JEIA 1W87A 2XNDA 4M54A 3DXYA 3MFQA 2BP7B 3DLTA 2IOFK 3VBCA 1T0BA 3UGJA 2FZ4A 3PDUA 3QVGB 5JCJD 3AEKA 2QT9A 4RLSA 2BBTA 5E0OA 1TCUA 1TKRA 3H0CA 2PMEA 1EGMB 2I6GA 2IEGA 4OOFA 3AB7A 1E79A 2IIPA 3C6MA 3WG9A 5D5QA 4UPDA 3L7YA 3OQNA 2J59A 2DR2A 5A04A 2VK8A 3I45A 3LAWA 3NTVA 4KO4S 4Q03A 1GU0A 4BP1A 2JJ1D 3JWHA 1GNPA 4DDMA 4HADA 2DKNA 3PEFA 1YHZA 4L8FA 4FONA 4PSDA 2OXCA 3RSHA 4INZA 4BRSA 4UEWA 1BO6A 5CA1B 1JJVA 1DS6A 1E77A 1P7YA 4YJFB 1TL7C 2VF5X 2LVBA 4JU8A 2B1JA 3ZOKA 4BLTA 3MEQA 4RH3A 1VMAA 2NM0A 5JBIA 2IS2A 3NBAA 2P27A 3ZR4B 5BN4B 3U56A 3RFXA 3NH9A 1M5RA 1RR6A 5BVGA 2PUEA 1S3IA 1AM4D 5HZHA 3U6KA 4L9WA 4ZHQA 3RVQA 5DB4A 2CCJA 4HP8A 4MQFA 4NZMA 5KNCH 2J85A 4WZBE 4D7AA 1E9DA 3I8SA 4IPTA 1NWHA 1XT6A 1WS6A 2P9CA 2Q5FA 3MF4A 1T2AA 3LQQA 4XVRA 3AVTA 1CY6A 2O8NA 2ZJOA 2V7QD 1YC2A 1NJ5A 4NE7A 4E70A 4BWVA 3G8DA 1QU2A 2QXTA 2ORIA 4FP9A 1RBYA 1FX1A 1MORA 2OBXA 1HDRA 3CIOA 4RXMA 4CMGA 1T8YA 1JLKA 2BGUA 1E3QA 2FW0A 3CW9A 3HSKA 4EB0A 1AB6A 4TT3A 4JU9A 3UXEA 1A5BB 3D3EA 1S9HA 3BCHA 3THYA 1FDUA 3LOQA 4RQUA 3E05A 3SVTA 1DKMA 1IH8A 1E9RA 1Q7GA 2H17A 1MJHA 2V7VA 3D7LA 5G2OA 3B6ZA 1TTPB 1KQ3A 3PUXA 3SYTA 1UBGA 4F5YA 1XU7A 1J5PA 1PHRA 3R6TA 4NMXB 4I2VA 1M2GA 3IPLA 3OPVA 3UTCA 1TCBA 1IIRA 1PWYE 1SUFA 2FMXA 5J4KA 3KSUA 1T9DA 4ZOLB 5FP0A 2IXTA 1UL1X 1EP1B 1OY1A 4BNTA 2OFFA 3RS9A 1PFQA 1BE0A 2G1AA 4Q37A 1FY2A 4QGHA 5CA0B 4I1UA 4HC4A 1MX3A 4Z0TA 4FU0A 1SB9A 1DOAA 1AGPA 1JNXX 2FVXA 1C3VA 2ZRNA 1OYOA 1Y8RB 3L41A 3QW4B 4H17A 1Y6FA 1AVTA 2ZR8A 2C20A 5SY4A 3K5IA 1UFRA 3OLQA 1Z6PA 3ZWCA 3UJAA 4BX8A 2NVUA 2WZDA 2OYRA 4BOYA 4UNRA 5L3QB 2IYLD 4PG8A 5G3ZA 2ZXUA 1RAFA 2I22A 4KQ2A 5HKOA 3NHYA 2PUFA 1A5AB 3B1WA 2EEZA 2Q62A 2GPSA 1XZGA 3N0XA 3OZ7A 2C78A 1YBVA 2A1UA 1RJGA 1BHJA 4GOJA 2WYUA 4IUYA 5LB2A 1I6WA 2ORED 4RDHA 4HWGA 5DISB 4DJFC 4M87A 2XUIA 1XA4A 3GLVA 2GT1A 4X65B 2PT6A 3ROXA 2JK1A 3H19A 3GLIB 1PG2A 1WZCA 1BH6A 5G53C 1CQPA 2VYFA 3T4PA 3TLEA 2A86A 5T4EA 5A4IS 1UBKS 4U7TB 5DTEA 5C4GB 3ZYZA 1YS1X 1QWSA 2HREA 4NONA 2H2AA 3V7YA 1CYDA 3PFCA 4INJA 1EINA 4OBEA 4V03A 3QV2A 3P0JA 2KS6A 5IYZB 1C1XB 1KI3A 2ATCA 3QKRA 4YT5A 4NYIQ 1M1NA 2D6FA 3MTEA 4GBED 1Y6RA 3KU4A 1AKNA 2BCEA 2IBMA 4ITVA 3NHRA 5D51S 4DARA 1NASA 5DLYA 1UMCB 2JIZD 4R16A 1AUPA 4IKEA 1MLDA 3UBMA 3F3KA 4MCIA 1ODTC 3HXPA 3DDZX 4ZI7B 3GJTA 4I55F 4AMBA 2NTNA 5JD5A 3CUUA 3UG7A 2BI4A 5KHLB 4H31A 3CEHA 3OBBA 2XQIA 4PZYA 3UK6A 2Y9MB 2Q5OA 2CLHB 4KWIA 1TYCA 4REQB 4TTQA 5T5QA 3WK6A 3AWDA 5FORA 5KYKA 4JI7B 3CZPA 1NFQA 4FR2A 4IHQA 4QYSA 1ZH8A 1G98A 5B7GA 1T8RA 2Q6TA 2XV1A 5AJVB 5A0VA 2VDOB 3VKGA 3CLTC 1BXRA 2JLSA 1G66A 1QYDA 4BNVA 5C8DA 1ODFA 4OHRA 4UXHA 1N3YA 3V4RA 4NC9A 4DCPA 3KAJA 4R0NA 1L3IA 3IJ5A 3OU7A 1PR0A 1L1QA 3UT5B 2BF7A 1QCDA 1ENYA 2GOYA 1UKZA 2NQTA 4JJ8A 5FWYA 2QT1A 3DV2A 2X5KO 1PGOA 4X94A 2MYNA 4DY4A 2E4UA 2BFCA 1G8PA 1V8OA 2HK9A 4GPTA 1CULC 1XZIA 3HNOA 1PJLA 1QHIA 2GBFA 2D8AA 2QK4A 4PTLA 2VNKA 3ZEIA 3LXUX 4QGGA 1E4OA 4CETA 3UV3A 4OHCA 1WB9A 1P29A 4BMSA 5HQTA 5G4KA 2WRZA 1CUCA 3T7JA 4P22A 1TEZA 2PL3A 1EFKA 3E61A 3RH0A 5BQ3A 2YXPX 3JPYA 1ZMXA 5CVUA 4CR8A 2IHJA 3V7FA 2VUIB 1JX6A 1BA2A 2WWXA 1A88A 2AEEA 1H23A 4FWTA 2Y0CA 1TQ6A 1OLUA 1Z0UA 1UOQA 4BNGA 2P6RA 3A28A 1UK9A 5CW1A 3BB4A 5TQ2A 1UADA 3TAXA 3CV3A 2OAEA 3K20A 5J2TF 3W7VA 3DZGA 4KG7A 4KWCA 1VLLA 1UPCA 3ZH2A 5CEFA 5EEGA 1GSIA 2QTHA 4ZPXA 5AW0A 4QBIA 1GQYA 1ES9A 4LRUA 1ZO8A 1VJTA 2ONJA 1QAOA 1PR9A 1G16A 5IK2D 1L3CA 2FZEA 1L4EA 5EI5A 1FZTA 2C2MA 4DQ0A 3G1UA 4B81A 3VU9B 2H9AA 5D3KA 1I4TD 4O4LB 2VP4A 3AIMA 1UPXA 4OGFA 4HGNA 2Q6LA 4PX5A 4S1PA 4C4RA 1ENPA 3N76A 4PHTA 2O2SA 2Z6VA 1XVAA 2AD5A 3P7MA 3MJVA 2JARA 1WDMA 4KE7A 3T3PB 1KERA 4QUHA 5TEWA 3UHAA 1G2PA 1N7IA 1GTJ1 4C2BA 5TMDA 5I47A 1BMTA 3RJZA 3E3NA 1EPUA 5EXXA 2P68A 3AEQB 2QE7A 2Y1OA 1TA9A 3CR7A 3TTVA 3TE6A 5BV1A 4PX2A 2I67A 3ZU2A 3OU2A 2HF7A 1U8AA 4V1CI 3ND6A 4PANA 1JIUA 2VPZA 7GPBA 2BY4A 5CPBA 3FJ1A 1YWGO 2AFHB 1HNZB 3GG2A 1KMCA 4LYHA 1A77A 4F45A 1S3GA 1QIHA 1SCBA 2WKQA 1P4RA 3IVGA 4GZ6A 4NU0A 4K9QA 3T3MB 4D43A 3P0RA 2VA9A 5JE8A 3A70A 5KVCA 4PTYA 4TYQA 3HVJA 3I4FA 5T8KC 4MROA 2JPDA 4B79A 2A5FA 2GF2A 1EE1A 3LUBA 4LY9A 4K6HA 1GNVA 1N2GA 4WESB 2VDVE 3DWIA 3OD5A 4FCTA 3OPMA 3AJAA 5F2OA 1T2CA 5IASA 2XUZA 3UV7A 5LD2C 4W5RA 1JU4A 1ZM9A 1TA0A 3VR4A 4GOOD 1XZEA 1M0WA 1QHGA 1OLXA 2WYIA 1P3DA 1S1MA 2PX8A 1RM3A 2OV2A 4G6ZA 2HCJB 3N5CA 5E1MA 5JNVA 1I7QB 4WUVA 2FDCA 2YXLA 1S9DA 2FZKA 2QB5A 2N1MA 3EODA 3QWBA 4MKFA 2P0YA 4Q7QA 4B3DA 3TUIC 3U7QA 4AN0A 4KNYA 1DXQA 2YVKA 4D8XA 4AMUA 2ZE7A 1XIVA 1NULA 2A0UA 2C03A 1UWLA 2H8GA 4GPBA 4DJAA 1F0PA 2JW5A 2B83A 4FB4A 1SEPA 2WQ6A 2VVTA 3N3BC 2AW3A 5G41A 3RRXA 4A6PA 1U4NA 4BNXA 5LBUA 3L8CA 1UEIA 4H6PA 3W5HA 4B7ZA 3B1XA 4MTLA 1YBHA 2DBYA 4AN1A 1QTNA 1A8UA 1EX9A 1PL0A 1USIA 4QYIB 1YR1A 4U4AA 4YTEA 3C7AA 2Z95A 1YIDA 4HUQA 2ACEA 1W36B 5DX8A 1UKAA 4N5DA 1MNAA 4LCEA 4MUHA 4XB6B 4X63A 1R0KA 2W2LA 2VDWA 2NMVA 4O2RA 3EOBI 4IFEA 1NBOA 3KVYA 2OV6A 1DCFA 4YHBA 3SQDA 3SU8A 3ZKAA 2AMFA 2PRZA 4UTRA 3I61A 3CX6A 4F2DA 2QT0A 1PR5A 1ZNYA 3T3GA 2AN9A 2PH7A 5BR1A 4IJMA 3NBXX 3MWEA 1T91A 2BM0A 3KYCB 2WM8A 4IIUA 4PICA 3RQSA 4WLUA 2UYOA 4QLAA 3BFJA 1DBIA 2CWWA 3BK1A 3LFUA 5AVOA 5TE9A 2QM8A 1L5FA 2OZLB 4I14A 2P0EA 2PWBA 3KLNA 1AKMA 3AFGA 5CK4A 4LKOA 5E7JA 3JZIA 4D6YA 3RBXA 4MRSA 2HRQA 4PEVA 3ADCA 1GR0A 1QCCA 1HTBA 2OFPA 4J0QA 4FMBB 3JARB 3U19A 3QUTA 3DOEA 1PFKA 1QE3A 1I0IA 2YXEA 5KS2A 1GOTA 1L7VC 1GXSA 4RGBA 3WMRA 4IJQA 1W85A 5CVVA 4CT5A 1DC3A 2HJWA 2C0QA 4RD4A 2DSTA 4RJ2A 5DBHX 4BMCA 1ISSA 5IAOA 1FMLA 4ZI5A 5AMXA 4BAUA 4X9XA 4S3MA 3AM4A 3OC6A 1QQTA 1Z5GA 3DWEX 3HADA 5KJ1A 4WJLA 1L7QA 2YVUA 3B78A 2QMZA 1W4AA 4M46A 1MFPA 3HN6A 4I4TF 1BCRA 2VQFB 1SOMA 4JSTA 4ARBA 1YASA 4HAUA 4JYAB 4H1HA 1G38A 4C4YA 5IDVA 4AFNA 3G79A 3K8ZA 5ULLA 2BBWA 2DJ5A 2C7BA 3N0TA 4AIIA 2HX1A 1CQXA 4HQ0A 4WY8A 2XY4A 4H1VA 2RE8A 2X9LA 4F93B 2GEDA 4ZZ0A 4N0DA 4PU0A 1EFRA 2QPOA 4NBWA 1WMBA 1LDBA 2B9EA 2IE0A 2A4KA 1F9AA 4OM8A 5AVXA 4AP5A 4Y7CA 2O2GA 4DIUA 1MAUA 5DT9A 2QTVB 2DF8A 3IDAA 3F1LA 4WUTA 1RIFA 3JD2A 4LOKA 1VG0B 1AGNA 5SYMA 4E3ZA 5FUVA 3UWKA 2OBBA 3L7OA 3OTWA 3FCSB 3IULA 2A9KA 3EZLA 3RTEA 2D3WA 3X1MA 4D4KA 3PQ4A 2JFXA 1RI1A 2RB5A 2M6LA 2DR0A 4OQFA 4LOAA 4Z1MD 1I4LD 2JC3A 4BNNA 2YICA 1UXJA 4EARA 2W37A 4DMRA 3WP0A 1JDNA 2ID4A 2OHHA 2WPNA 1W0JD 2EIXA 3NUZA 3I01M 3D4BA 2J5BA 4UVEA 4YUVA 1KO5A 3MTIA 1SQGA 1U9ZA 1YCFA 2I8AA 1MN6A 2XMBA 3LGXA 4ZOCA 4AECA 1EVIA 1QIMA 2W4QA 3L8DA 5FNZA 5F1PA 2ZRLA 4XM0A 1ACLA 3LQYA 2EQAA 2FSVC 2A9OA 4EELA 2FVYA 2JVKA 3C74A 1P2SA 4D9EA 4JLDA 3SQXA 3RIMA 3WBFA 4AS1A 3R7AA 1QK4A 2YWCA 5GJBA 4G5OA 3H4VA 4V24A 3AY0A 4HTFA 2ZEJA 2QRMA 3GJ0A 5BNFA 4PZDA 1YL6A 4MMYB 5PNTA 2F4VB 3CSSA 4ZCRA 1EVJA 2FPWA 4ZAXA 3L6DA 2R6ZA 4MKGA 2FMHA 3JQ8A 1M2VB 1UR5A 4GLLA 5C0OE 2LCQA 2BM9A 3QJGA 2VKTA 2XYGA 4ZVOA 4JLUA 5BURA 4GI5A 4MGZR 2ATVA 1SG0A 1DBWA 3PPVA 5J9FA 4UU1A 1JAYA 5EWMA 3ZCSA 1LRKA 5SY9A 1M0EA 5DI3A 3MTBA 3FX2A 4QD3A 5FTKA 2Q7DA 3TZLA 3E4CA 2X8JA 3T7SA 5F33A 4CCYA 2VR1A 4HGQA 1UBHS 4RFSB 4WCFB 2PLFA 5NULA 4YQEA 1W5BA 3KCQA 2NV2B 5C7YA 4JVLA 3I04A 1HEYA 1E2KA 2G9ZA 3JQBC 3ZG6A 2V8BA 5CVTA 1ULZA 3AV3A 3CR8A 1BWRA 4KTVE 4FYXA 1NKVA 4PBSA 2YHSA 2B78A 4CKCB 4N12A 2AOWA 4Q7LA 1PT6A 2KMLA 4WEQA 2FGJA 2VQEB 2DULA 2HCRA 2QR2A 3CTPA 1NVTA 3BD7A 4YASA 4NEGA 2YC2C 1J90A 4IIDA 1KJWA 1OB2A 4RVGA 3UG6A 3ZBUA 2DWUA 2QTZA 3OE5A 4XQGA 1TDJA 4CCAA 3TB6A 3EARA 3HU5A 2B8NA 1AK2A 1G5HA 2HXGA 2ODEA 2MMCA 2Q4BA 5MN5A 3LD9A 1JE0A 2QLJA 3SHWA 3UNXA 5AOBA 2Z1DA 1ELOA 1RAIA 1N2CB 3ILHA 2HW8A 2Z3WA 1XCLA 3CN9A 1HF3A 4KLAA 4D9JA 3G8AA 4J1QA 3R3HA 1ULAA 2PD4A 3BIOA 4NECA 1QYRA 1A5TA 2HJVA 5CH8A 1OX5A 1TCCA 4M38A 3WWZA 4F86A 5J58A 2CLFB 1NY6A 4NE9A 3FKQA 3RVRA 3H42B 3FYCA 1O95D 3R75A 2EF0A 4R7GA 3EG9A 2PKXA 3T7RA 2COKA 3KO8A 1JUDA 1R5OA 3ANXA 1DCKA 1PR6A 5CDFA 1W94A 4I1SA 1WXGA 4WLFA 3GNSA 2ISQA 4PSCA 4XJVA 5FI0B 4B3IA 1I13A 1KJ8A 2QD1A 1PX2A 2HJRA 4PNPA 3ZWPA 3OLZA 4DDWA 3T3HA 5IBCA 1O0BA 2IHNA 1CJCA 4ND4A 4ZPJA 2DT5A 5KOIA 4FLMA 4UNQA 3SJZA 5KPDA 4IFTA 2X77A 5KYYB 1FLNA 1ZIDA 2XKBA 1OXKB 3H5WA 5F3DA 4EFNA 4IWYA 1IHDA 4I1YA 4RF2A 2C0CA 4JMLA 5JR3A 3G5LA 1CFZA 2QN7A 1I3LA 1OFIA 1O6CA 2CNOA 3OTHA 4RC9A 3ZD9A 4DHEA 5BWMA 1NUQA 1CF9A 2WIJA 3L0PA 4HLUC 4F5WA 2GN0A 3LUKA 4MIYA 1IBMB 2YS7A 3UAOA 1TYBE 2J3KA 1JSRA 1U02A 1WOYA 2BFFB 4GMGA 3WB9A 5L4LA 2D1YA 3I1YA 4BNMA 4H9GA 1RZVA 2K5UA 3MAJA 3WFJA 4RKEA 3RAFC 2CXHA 5HDQA 1FP2A 1KRXA 3MHPA 4YCLA 2FK7A 1YRHA 2IYPA 5LQUA 4RQAA 3W6NA 6ABPA 1FDIA 4K87A 4MQ5A 1YJ8A 1LFDB 1ZMTA 1EXDA 4ER5A 4MEJA 5GOZA 3MLEA 1JEDA 1NF9A 5H59A 2IZOA 3QE0A 4BFCA 5LZ4A 4ZCLA 2B1GA 1RQPA 5HIAA 3SWWA 4D4MA 2YHIB 1Q7CA 2BHLA 4MPRA 1J2RA 1IN7A 2EG5A 4YMHA 5JDCA 5JJ5A 3IA7A 3JR7A 2MSCB 1HDGO 3KD2A 1R0ZA 5HW0A 3D6FA 3CNHA 5EWLA 3M6AA 2CVQA 4CTJA 1XLWA 2O23A 2RJ3A 4ZYVA 4KVFA 5TS3A 1Z06A 2HMTA 3BTOA 1II0A 4MHOA 2PNJA 4IKPA 3ZDXB 2PX3A 1ZXBA 2K2QB 2ACWA 3DCIA 3HYTA 2C4NA 2EQBA 4UFOA 1IDN1 1J2UA 2REOA 4EP1A 2CK3D 4CE6A 1XXHB 3UOGA 4IFBA 3F1KA 3LP5A 1Y6QA 3OX1A 1H2BA 2SECE 2DLDA 4TYMA 2GXUA 4P34A 1OAOA 2ID8A 1MIOB 4OBXA 1KMQA 4MWGA 4UMDA 4HDKA 1D3AA 1JMYA 1P1CA 2X1MA 5KAPA 5IXSA 3VJKA 4Y1FA 3P97A 5SZJA 3OLYA 4EHFA 1RLTA 5K8IA 4GRAA 4YP0A 2IODA 3DVQX 3V4OA 5E6RB 1IZZA 2YYSA 1SRRA 3K9GA 3KZ1E 3DZCA 1TB4A 3I3OA 3H04A 2WYHA 1EWQA 4GI3A 2WPDD 2QN2A 1DAFA 3FSJX 2ZDHA 3WSTA 4NFLA 4NEQA 3HKDB 1JXOA 5AOAA 4YAKA 1XFDA 1IUKA 2QQ0A 2QTRA 3L8ZA 4ZODA 2E4YA 3W4KA 1QF7A 3KUUA 3OZTA 3HSSA 2VHXA 4RHYA 2JGLA 2FEPA 1QIEA 5LM3A 3ME5A 1KZ1A 4Y6LA 2JLRA 3TRJA 5FYDA 2NUPB 1M1YE 1DMSA 4RTQA 1NNI1 4FKZA 3NV9A 4BN0A 4IV8A 4LDJA 2XDWA 1VKNA 1TEVA 1E59A 1OXSC 2C1XA 4AN4A 4TTAA 3B3QA 3CLRC 2I78A 3D0OA 3NPMA 2WI8A 2J9RA 1N9GA 3TQTA 3D7KA 1NU6A 2BP7A 2CZQA 3OZGA 2CBGA 3R5XA 2V9CA 1AS3A 2QHXA 3U3KA 4RSHA 3QVGA 1MB9A 4KPUA 1B26A 1DKLA 1J70A 4JASB 2Y3IA 1ZD3A 2BMJA 4PYIA 4TKVB 4EB6B 1QB7A 3UBTA 5JISA 2C2GA 3H7AA 4QNMA 2RKOA 2PR7A 5AHKA 1EUQA 2PTHA 1CEYA 5F2NA 1E2PA 3TNYA 4ANFA 3KZKA 2VJBA 1Y42X 4TSRA 2PUHA 2F2TA 4WLEA 4K9OA 3ENZA 3RS7A 3U3JA 4EUFA 2QMEA 1VI2A 1UFOA 4OQMA 4J3FA 2Y4OA 5DYTA 1URPA 1NDHA 2IUEA 2Z6QA 2BH2A 1NBMA 4WE3A 4Y67A 5BN4A 3DBLB 1MJ5A 1T4CB 3BMOB 3D4PA 5BSRA 4JS0A 1ML3A 3ZJYA 3RIYA 4JP3A 3W6OA 4AJ4A 4HPWA 2GEKA 3BRSA 1RBMA 3SIWA 2XVAA 3KWMA 3PS9A 4R0VA 4BX2A 2GYWA 4YJ2B 4YUWA 1EFHA 1VMDA 1T8WA 3GT0A 3AQIA 4DMMA 4CIYA 3ILVA 2AOUB 1I2CA 2P65A 4C43A 4XYMA 5D3QA 3NWPA 4JELA 5BSEA 2H48A 5ILGA 4HGYA 5L3ZA 3GT7A 3E4DA 2P9HA 4UCQA 4F8JA