1QCZA

Crystal structure of e. coli pure, an unusual mutase that catalyzes the conversion of n5-carboxyaminoimidazole ribonucleotide (n5-cair) to 4-carboxyaminoimidazole ribonucleotide (cair) in the purine biosynthetic pathway
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
162
structure length
162
Chain Sequence
PARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE
publication title Crystal structure of Escherichia coli PurE, an unusual mutase in the purine biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 49
structure length 162
sequence length 162
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 1qczA00
5CTJA 4GRDA 3ORSA 3RGGA 1U11A 3LP6A 2FW8A 4B4KA 3OOWA 3RG8A 4AY3A 3KUUA 5BOSA 2NSHA 5CLGA 1QCZA 2NSJA 1XMPA 4Z7JA 5CVTA 2FWIA 4ZJYA 2H31A 4AY4A 4JA0A 1O4VA 2FWJA 3OPQA 2FWAA 5CLJA 4ZMBA 4ZC8A 5C5DA 2YWXA 4YCDA 4YCJA 2FW6A 2FW7A 2FWBA 2FW1A 1D7AA 4YCCA 3TRHA 4ZK2A 2ATEA 2FWPA 4YCBA 5BOSB 5CLFA 5BORA 5CLHA 2FW9A 2NSLA 5CLIA
chains in the Genus database with same CATH superfamily
4UHKA 1OQAA 1XDSA 5AXCA 4F71A 4GRIA 4U6NA 3ZWYA 4D42A 2I9KA 3B1JA 4R2WA 2D2VA 1J70A 4QHSA 4NC9A 2D0DA 3VNVA 3M1AA 2VDNB 3GRUA 1CRZA 3K4PA 4JEMA 1A9OA 4HGZA 3ZLVA 1IFXA 2C4KA 2A5FA 3GDFA 1G16A 2GBGA 1MV8A 3ADPA 4YDQA 4MA4A 2AOUB 2Q5CA 2W7TA 1CY6A 3OEYA 4JI7B 3ZZUA 1N1MA 3IVCA 4DCPA 3A6PC 4ZFNA 3DBRB 5FUVA 4BVGA 1AKEA 2YV5A 3UV6A 3ZE1B 5CDSA 3TLZA 2RFLA 2WE7A 3PENA 3HJAA 1UIRA 5L95A 1CCWA 3GV0A 3HR7A 5BN3A 2OB1A 5AJYA 4QGSA 3NV7A 1PS0A 2XY4A 2V7PA 3LIIA 4IXNA 5F51A 3ZCUA 3C39A 3I4CA 4NULA 4B4KA 2IVZA 3R6TA 5KVSA 1JDTA 3A28A 3L7JA 2YZKA 1X0VA 2XMZA 4Z7NB 5H70A 4TMFA 5E8JA 2YV3A 4ZQHA 3KB2A 2R85A 1GPMA 5B7GA 4UM7A 1XRPA 4OYHA 5AI4A 1BMFD 3B60A 3A06A 4MVJH 1AMOA 3VHLB 1RKBA 1XPUA 1G3IA 3TCKA 2CLHB 2B35A 1A2OA 4PCUA 3AWDA 2P4HX 3HBNA 5EG5A 3LBHA 1TF2A 4WOCA 3IQIX 3OZAA 3MQ4A 1N1GA 4CI9A 2ZSKA 2AN1A 3E7XA 2I29A 1HLFA 4PTYA 4ZQEA 5JS1A 1PAUA 1O6FA 1DELA 2MU1A 3DTVB 1UMCA 4KNWA 1T9KA 4MQLA 2VQFB 4ABYA 2AD5A 1VCNA 1ACMA 3V7NA 1QQTA 2VRWA 4BQIA 2QMOA 4V2IA 3W5UA 5TPWB 2WYVA 4EGFA 4KYUA 1JT2A 1EDDA 1OZGA 2EKDA 2WJ6A 2WT9A 3BMCA 2HW8A 1B8PA 2PHZA 1NJGA 2HB6A 3CEMA 4X1IB 3L6DA 3O8DA 2C9MA 5U1PA 4ARBA 3FHTA 3DOOA 5AM2A 5HG0A 1MIOA 4AYWA 1D3AA 1JEEA 3GGOA 3HKBA 3HYLA 3QXGA 5JNWA 4IHJF 3Q8KA 1ZVMA 1IE3A 4M38A 3CX7A 5EINA 3P45A 1AF7A 1AE1A 4PZYA 2AWOA 3HPQA 1F5SA 3KFXA 3NORA 4KLRA 4WY8A 1PD1A 1RHJA 1S89A 4HQFA 1T9CA 3R5SA 4EFDA 3EA4A 4ZEMA 2WRZA 2QNBA 5JQWA 3MFQA 1TM4E 4HDRB 1LKZA 2WNIA 4JB0A 2B4YA 4B3FX 2J45A 2M6SA 3AFHA 4HLNA 2QU7A 4PGGA 3RB8A 5FUYA 4OFWA 1ECPA 1RJFA 4DNPA 5AR1A 4MCHA 1H0SA 3DSRA 3ETEA 2HUNA 4BX9A 1RJGA 3G23A 1WL8A 1JJBA 3V42A 2GO1A 4V1CB 1ZI9A 2WWWA 3N86A 3L77A 4QGFA 4ND5A 3GWZA 4PINA 1Z6YA 1EP2B 5DXFA 1KEEB 1IPHA 5KNLA 3DAYA 4AS3A 2LKCA 2HX1A 4ASUA 2P3OA 3GL9A 5CBPA 2W2KB 3QWBA 1KO5A 3C8DA 4PXAA 2GCOA 4D4JA 3I2GA 5BSHA 3WP0A 3QXXA 1IWPB 1JF8A 3CZ4A 2JJYA 3GT0A 4PWYA 4A6PA 1BHQ1 3A2KA 2IPNA 2Q5LA 1V16A 3QVKA 5CLFA 4BO6A 1Y6ZA 3HJRA 4FR5A 1C3OB 4HRYA 5IVPA 5EIXA 1NW6A 2FPMA 3G89A 1IIBA 3B53X 2FF7A 3RGGA 5GINE 4IDHA 2F48A 5DHRA 1GQFA 4REQB 4CTOA 1YBFA 2VHCA 4UBOA 1OGIA 3ZY3A 4DMUB 2BGTA 3K20A 5JDCA 2I03A 1QRSA 2GRAA 2Q2WA 4ZAVA 1LDYA 1Y1KE 2EHJA 2PKWA 3C6MA 2GERA 3EAQA 3QE3A 4FR2A 2A9PA 3H1BA 4L7VA 5KCZA 1KS2A 1L7VC 3HP1A 4QGHA 3Q0EA 1CEQA 4JIMA 5REQB 4EP1A 2QTAA 1AA6A 2XQJA 1OUMA 2PYZA 3KBOA 2ZUWA 3D0QA 1QIKA 3TO5A 2ANBA 1GZVA 1XALA 4PSAA 5F2EA 3L7IA 5K3SA 1MN6A 1MEJA 3N7AA 4DIDA 3QPVA 1ODSA 2O2HA 4RU1A 4S1PA 4AZTA 1CUEA 1JG3A 1VHJA 1YRHA 3VC7A 3ZY6A 1PZFA 3W5JA 4ISCA 4PNEA 2IS2A 3I3OA 4GSKA 2BMDA 4O8CA 1M6HA 5E3IA 5AESA 3X1XA 5JFOA 3GZJA 2CNNA 2KS6A 2ZSUA 4A8JC 5LD2C 4TX1A 1MOPA 1EMDA 4WCFC 3D2BA 3L7CA 3C48A 3CRMA 3U0BA 5JQGA 3THXB 4EUEA 2I7DA 5IUJC 4ZO6A 3VC1A 3R7SA 1THTA 2VP6A 2O7NA 5LN1A 3F3SA 2XKAA 1Y6QA 4ZN6A 2IYVA 2NVBA 3FXAA 4BV2A 4V1CI 3QRWA 4WY5A 1O5TA 1X7HA 5BW5A 1SQFA 2XEXA 2HTFA 2H9YA 5JTUA 3H65A 1MO5A 3AEUA 5KTYA 3ZTYA 1ZCZA 2OSVA 2Z1MA 4V0ME 3PC7A 3RUHA 3ZE2B 4R5HA 2BHTA 1E59A 1OBCA 2HHLA 4MR9B 3E27A 3WQSB 4LJRA 1DT5A 1NMZA 2FW0A 2F1JA 4ZQFA 2RGNA 4GS5A 5E1MA 1KQNA 1F4VA 2ETXA 3BF8A 1ZRMA 4JLPA 4DM4A 2QRVB 3ZDAA 4EDFA 4EY3A 1AA9A 4ZIRA 2YC4C 3LO5A 2PM8A 1DXYA 2Q2QA 4PGAA 5D3QA 4CKEB 1R4MA 1W0JA 2H5JA 1GUDA 2Q07A 2Q5FA 3I04M 3TE7A 3BXHA 1HOTA 1NJ2A 3KYDA 1SUAA 4EYOA 4X7RA 3BBPA 1PFQA 2C99A 2FA9A 1TTHA 2OD7A 5EIBC 2ZIZA 3Q15C 1QTNA 3OF5A 3G2OA 1Q57A 1G3QA 2BISA 1KDRA 4P2BA 1DDOA 2GGSA 1ZL0A 3ZWKA 2EZUA 1DKUA 1GU0A 2OG1A 4X5OA 4C4TA 1Z56C 3U4QB 4UUOA 3COSA 5BW4A 2FWJA 2CWWA 2PZEA 1I4OA 2FDCA 4S1NA 2XH8A 1RKVA 4NENB 4OYYA 1M7HA 3ZHRA 4EK9A 1R50A 2GRJA 1RE1A 2ATXA 2XGOA 4TV8A 3FR8A 3O2SB 4KOAA 4RVGA 4UHJA 3KWJA 5HQ3B 2I6TA 1XT6A 1YDFA 3ETJA 4NONA 5BW6B 1NJ6A 4F7WA 1EUYA 3H5IA 1U1FA 3ZNOA 3VPFA 3ULKA 3UUEA 1XCOA 2AJCA 3GCWA 4DADA 4TUYF 2WU3A 1SCUA 4OK3A 3H3FA 4ZI7F 3ANMA 3K0FA 1MAAA 4PZ9A 4RABA 1P2FA 2PSJA 3E22A 4UTXA 1H1LA 1OC4A 1ZN2A 1MTZA 3MMNA 4ZQCB 4YRDA 4MHTA 3DTTA 3SEAA 4F85A 1KYTA 2NIPA 2O8VA 5BNWA 3Q9SA 2ZYSA 1VFNA 2VOJA 2NTVA 4HDSB 4JSTA 4A73A 5DULA 2WF7A 1L7XA 1S2OA 1WCIA 2HQOA 1PFGA 4XCXA 4NEHB 4PAQA 4UHCA 2GA9A 2RGUA 4XLZA 3DHVA 4D2IA 4KTVE 1PSWA 1WRBA 5C7OO 4HS9A 4Q1FA 3VR4A 5CMLA 1TECE 2AJTA 2J5KA 4YRRA 5DNAA 3S5UA 4AP9A 4LK2A 3WB1A 3AKEA 3RSHA 3DVQX 3GZNB 1NF3A 3Q1KA 1CS0B 2DQZA 3Q4GA 5DTIA 1RWVA 1NATA 3HC7A 3AKZA 1W4AA 1X92A 2FP3A 1I7QB 4N1AA 1DBRA 3C24A 2PEZA 3OIDA 2DU8A 1CU1A 1JWBB 1PP4A 2DWCA 2VNIA 4EL0A 1TPYA 4LFAB 2XUDA 3UWPA 4E46A 1A5TA 1KVQA 4BKOA 3P2IA 4K6FA 3B6EA 3GLHB 4IMJB 3O74A 4QHYA 5TIIA 4W1QA 3THYA 2PMBA 3UG7A 3BSFA 1D2NA 1JDPA 5EZYA 4JLAA 3ZHBA 3NHLA 1CNFA 1TX4B 2D1TA 2EX1A 5GGYA 1ZKDA 3IIIA 1T2UA 3KYJB 3P5BA 5DN9A 1XKXA 3KFVA 1GDTA 5CP8A 4FGSA 4OHBA 2QTVA 4JV5B 4J6FA 4FK8A 1KXZA 1TTTA 1H0RA 3HA2A 1EDBA 1D7OA 3KQPA 4AS1A 3RM3A 4TLAA 1YTLA 4C7VA 4OU4A 1CFJA 3I5AA 5C9ZA 2E4ZA 4EG7A 3HM9A 3DEAA 1PV2A 2X42A 1TPZA 3R75A 3UENA 5CCXA 3CLVA 2B4RO 3DTYA 1SPBS 1DJPA 1UODA 1V1JA 1XP5A 2VRBA 3OHPA 3PDWA 4FQ5A 1G41A 2WUDA 4Z9YA 2XXAA 2A1UB 2FPLA 2J5QA 3KE8A 4IFBA 2A3NA 2D7CA 1C8LA 3OFJA 4MSUA 3WZLA 4G0VA 3GPDG 4OJQA 1HO3A 1ZONA 2C8KA 2HU2A 2AMJA 1XA0A 1XZBA 4C20A 4JBIA 2XZOA 3K1AA 2YYZA 2I71A 1W2GA 4LGCA 1RAGA 3VAZA 1TJ3A 2PFGA 5KZMB 4NMXB 2EG9A 5IVKA 3CNOA 5LVAA 1NA5A 1EK1A 2VDRB 3W2FA 1D6JA 1KEZA 3EIOA 1A8UA 4XGNA 5ADWA 3PZBA 4NU6A 2TMGA 4GBJA 1X9HA 4HLUC 4YRFA 2QW1A 1W93A 3MWEA 2VLIA 1GAWA 3OIYA 3JYNA 2TS1A 4TTRA 3U4DA 3H2HA 3VPAA 4ARZA 4EHKA 4MS1B 1GSAA 4UC0A 3OESA 4S1VA 4JBNA 1MB9A 1Z06A 3SR3A 2RGCA 5FUWA 1QB8A 1N6KA 1KO7A 2JANA 2DZDA 4ZVRA 1WETA 2VYND 4LTNA 5U4QA 4LI3X 1LDMA 4UVIA 3R7AA 1J06A 1A9SA 5BWCA 3FFWA 1UPBA 2R11A 2VBFA 2I4NA 1RYFA 3CV3A 3N7TA 2O5EA 3QMMA 2FPKA 5DRTA 3ZS9A 1W48A 1R6UA 2EXXA 2VPWA 2Z43A 3B6KA 4X24A 4EM6A 3QP9A 2PLAA 5KDLA 1FP4A 1M2HA 1P7WA 4XKJA 2JH9A 3ZWQA 5G41A 1K3UB 1B74A 2ZVPX 3MK31 3I2HA 3QVSA 1IUOA 4LW8A 4N5NA 3QW4B 1BXKA 4EDHA 5GQSA 3CCBA 5IULC 4Y98A 2CEAA 2D5IA 2XHZA 3L82B 3MJFA 4MEAA 4YDSA 3T52A 4KXFB 1OB5A 1BAPA 2YY7A 2R47A 2R5NA 3KJFA 3OKFA 4YAFA 4WUVA 1HYEA 1KVUA 1RAIA 3OJLA 3IEKA 4UBJA 5FTLA 1T2DA 1DO2A 3DC2A 2IQ5A 1P4JA 1CD5A 3SAJA 1ZSVA 2H48A 4YRBA 4QULA 3RHSA 2BLNA 2VQEB 4DN6A 3ODGA 2NMVA 1IULA 5FD8A 2EDAA 5K3FB 4YMGA 5IP5A 2HQSA 4YJ2F 1P8AA 5A5GA 4K9LA 4PR0A 4TS3A 1I2MA 2P62A 3W6NA 5AW2A 2I3BA 2XWPA 1XF1A 5CTJA 4EJFA 1JJ7A 3TLJA 4JJFA 5ALEA 5L7YA 4TZTA 5A5FA 3JQPA 3JQEA 2OP1A 2HBZA 4MS4B 1XEAA 2NX2A 3JR7A 1UBFA 4PHFA 4J0JA 3V4PB 1Q95A 1P72A 4Q1CA 3PNPA 4NU8X 4F6LA 5HJ5A 2ZB3A 3ZV4A 2H7CA 2B2XA 2VH1A 3QFRA 1J2UA 2MYTA 4B35A 5I6DA 3WMXA 4OKIA 2A94A 3FNHA 3V1NA 2GVNA 1A9XB 4BMCA 2IHNA 3IQXA 1ZINA 1KMHA 4MKZA 1R9GA 1NU8A 3CLHA 4KXNA 1AS3A 4Q3NA 4GPTA 3DHNA 3NPAA 3PQ8A 3EZFA 4J2OA 2G9NA 3W5DA 3L43A 4FNOA 4QEZA 1OX5A 3K6KA 4MYCA 5GVRA 4ZICA 5C0OE 1YH3A 5IJ0B 3UQZA 3NYQA 4CM9A 3JPWA 3VKHA 4A5OA 4ARAA 5HP4A 3SJBA 3EYWA 3O8LA 4MX8A 4C6TB 1R0SA 3HB4X 1A9TA 3WRXC 1BFDA 3LQ1A 4L9RA 4LXXA 3U4HA 2OENG 1QKJA 1KH1A 1N0VC 1Q1AA 4F2DA 3THWB 1NBMD 4KNYA 4AY4A 1U7TA 3KJEA 1Y3CE 3KVRA 1CB0A 1DKLA 3EFHA 2NZUG 4HDNB 5IYZB 4UARA 5LSAA 3TLMA 3T1HB 1WJGA 1LY1A 5HS4A 4B3RB 1XCJA 3UJ7A 4F9TA 3C3KA 3I1FA 2VUUA 3LCVB 4PYMA 3QUSA 4EF4A 4C2UA 3VZDA 1U5BB 1AZSC 2PCLA 2V96A 4RV9A 4XYBA 3CLTC 3UJ9A 3QPUA 1DX9A 2DPXA 3E18A 4A3SA 4RDCA 2V9CA 2V98A 4LZZA 5KQSA 3DYVA 1CVIA 3PP8A 3FDFA 4MGKR 5DBOA 2J7PA 3HVKA 5FOWA 1TM3E 1WXXA 5J4LA 3A4IA 1GCGA 5HZGA 3MTDA 2JJ2D 2HJVA 4XCVA 3EWAA 5F3RA 1Q83A 2GBPA 4M7OA 1YQWA 2Z5GA 1U8XX 4GRAA 4BMXA 4DYVA 1T36A 2ID7A 4Q7KA 5IK2D 4B09A 2FZVA 4GICA 4MPJA 3KUCA 2Z83A 4MRMA 3ZHOA 1UOOA 4G41A 4XVUA 1R4NB 1T9GS 621PA 5AVSA 3UCEA 5CCDA 5ITWA 2XB2A 4Y1GA 1LUAA 1E66A 3BXZA 1H3NA 2OAGA 3PPWA 3V8NA 5CFNA 1F3OA 4LISA 2G4CA 2UUOA 1IDN1 2NNLD 2BE9A 3DE5X 4UHFA 1E6LA 2FN4A 4D9FA 1O94D 1I36A 4KO1S 3TSWA 4WLFA 1WXIA 3LWZA 3GGPA 2I4RA 2ZUSA 2DQ4A 3I34X 4WECA 1LDGA 5IAJA 3U7QB 2ZG6A 1Z7YA 1XPJA 2JLSA 4CMEA 3NOXA 5GY7A 1JEYB 4TOIA 3V48A 5DB4A 1DBVO 1N9ZA 1IYZA 5H1YA 1U2DA 1CUDA 3ANYB 1ODKA 4BLSA 3RVBA 2NYUA 2H07A 4P0QB 3ABOB 4BMYA 4B75A 1UMKA 5NLLA 3EPJA 1LXCA 2B83A 3W04A 1KQPA 2GYUA 1L5MA 3JQ7A 2DBQA 3JZAA 4MJXA 3KT6A 3W79A 4ACAA 2QUHA 3UMGA 1CQIB 3X44A 2ATIA 4RHYA 1IHUA 2CF5A 4EIWA 2WJGA 1I5EA 3RYIB 2WJWA 1UBHS 3HXQA 3PXGA 2ZUDA 1TFUA 4RPGA 5L45A 2HD4A 2WYWA 3CF4G 3MSXA 3K09A 4Y2YA 3MOIA 1GZ5A 3FOBA 2X13A 4RJIA 4GMKA 1N32B 3R9XB 3GDWA 4N0MA 1J1IA 5EGNA 1C4WA 2A5GA 5LZ4A 4D6PA 3QOXA 4L5BA 4IV8A 2POCA 4DLNA 4IBOA 3QV1A 1MAVA 3SP1A 2BAGA 2E7ZA 3ITNA 3PU6A 4NWIA 4P4SA 4PCVA 2PZLA 3UJBA 4GGOA 4L3VA 3TE6A 1OBVA 2WWFA 2NT4A 1H4VB 4Y9SA 3FGZA 3PS9A 1YA6A 1T15A 3LI2A 3P0HA 1II9A 4RD1A 4FNMA 3OTIA 4EYGA 3RU9A 1E20A 3KSRA 5K99A 3HNPA 1T3TA 2BELA 1VHWA 3V4OA 2HJGA 4J0KA 1QHGA 2JIQA 2PSSA 2VSOA 3DMDA 3H8WA 3EZYA 4Q7LA 2G40A 1H5QA 5ENDA 3D6VA 3ZK9A 5EPOA 1ZAYA 2ECFA 3BRWA 1GXSA 3MWGA 4NARA 2Y0BA 4QA9A 1T10A 1EGHA 1M5UA 4XUCA 3ZGYA 5BVHA 1HH4A 2I1LA 1RXYA 2AG0A 2NZYA 1JFFB 1TM1E 3MHPA 4MPTA 3VU8A 3JQAA 5A7HA 2IV2X 1TJNA 2P9GA 3G7UA 4HEHA 1JT9A 4O2BB 3UZUA 1DTWB 3QPWA 3GN1A 3OMLA 3U3MA 4YUAA 3HZHA 3PGXA 5JAPA 2WHEA 4IDCA 3RIGA 5A3JA 3B48A 2PX8A 4E7OA 3COWA 2ZU0C 2RK6A 3VOSA 4KPEC 2YJ6A 4MYDA 5B57C 3TCNA 5CB4F 1XB2A 1WXFA 5HZMA 5AQEA 1JDZA 5TS2A 1RFLA 4QXQA 1XCGB 1RPJA 4BJ3A 4BP8A 3HFGA 3SX0A 4DXHA 1CJUC 3NWJA 3RTEA 3QLJA 5BQOA 4G67A 1OFGA 2X6QA 3SQXA 3X1WA 3ITDA 1GNQA 2CBXA 1DJQA 4HB3A 4FD2A 4IM7A 4RENA 3VR5H 1U28C 1YQDA 2ZZKA 3QWHA 5A0FA 4ZO8A 1VXRA 1QPBA 4HNAB 4ROSA 2JLYA 2EZ4A 2PL1A 2QTZA 4MUHA 4K3UA 1B4DA 4YRCA 4HTFA 4D1YA 2A2ZA 2LIPA 4KVZA 2WDPA 1UT6A 5IN4A 5DTMA 3J80A 5JISA 4IQFA 1RP1A 4OMCA 3TD6A 1CUGA 1JHOA 1JQ5A 1QX4A 1EP1B 1ZGAA 4A0SA 1H3EA 3GFQA 2IPLA 2AXNA 3IP7A 1UOPA 4G9GA 2I4MA 4NSNA 2ACWA 4BX8A 2XNDD 2ZSAA 1N25A 1GZSA 4HHEA 3MLEA 1EBFA 2WYIA 1L1QA 3CXRA 1SRQA 3VC3A 2E82A 2PWBA 1XD2A 3FWHA 3JQBA 4PANA 3KWMA 2PQ6A 4QDUA 3AR6A 4Z0HO 5I9BA 3N2LA 5E1BA 3S7TA 3WG9A 5ITSA 1JLKA 3K9FC 4RFSB 3VI4B 1G4HA 4GKBA 2PH3A 1NYTA 3Q7TA 4I9GA 1IQRA 5AICA 1R37A 2J8ZA 1S01A 1N7IA 4JOBA 1NXOA 4KW7A 4MAMA 4TL9A 1VFPA 3PLNA 3MA0A 1RZRD 5ICGA 2JAHA 5LQJA 1LNZA 3ETHA 3K32A 4DCJA 3UJ8A 2IPAB 4MQEB 3KL2A 1ZXBA 1RM0A 4LDAA 5FWNA 4RTPA 2WKPA 3IP3A 3UN1A 1AQJA 3KJXA 3JVEA 4B0PA 3OJ0A 4FFOA 4KPGA 4Q48A 2HIGA 3CN7A 3TQOA 2PX3A 3G1WA 2BF7A 4JELA 4E5NA 4RQBA 1LZKA 2VPIA 3SI7A 4MV1A 3TMYA 5DEOA 4B3JA 1PU2A 3AWIA 3PR2B 1GY8A 4D4IA 1WHTB 3IUNA 3A4YA 4JQSA 4JVSB 2W4IA 4OFXA 2ZVQX 5KYGA 3HB5X 3VDNB 1NVFA 3B8HA 5C5CA 3W4KA 1XNGA 1OV4A 2NZ2A 4R51A 4Q03A 4UCWA 5K01A 4S0XA 4AN0A 1GQSA 3SZMA 3C16C 4IJWA 2FGKA 4OQXA 3V97A 4AUEA 1XU7A 1TGYA 5E7JA 5IXSA 5K20A 3REQB 2FZ5A 1W76A 4IVNA 5TEVA 4ARCA 2BMFA 2BGMA 1PKEA 4LNUA 3VNSA 1AKQA 1O0SA 1NJFA 1YDWA 3ZUPA 3PL5A 1LRKA 3UAVA 1VCHA 2CB9A 3E7WA 3EUWA 3PPXA 4GSYA 4OOEA 1PT9A 1D07A 5AVXA 4EYQA 5LNK6 5A1TA 1DIRA 1NLYA 3TAUA 2XOKA 2XGJA 3OCVA 4CM3A 1EWKA 4G1CA 2DWOA 2AN9A 1LBTA 4BO8A 1CQJB 1RRKA 2O50A 1K89A 1XMSA 4JYCA 5IH3A 1ZIXA 5DOZA 1CUSA 1PGNA 3P52A 5C3MA 1QZUA 1M34B 1NAHA 3FWKA 1GKYA 4EB6A 5BNZA 821PA 3BGWA 3A9VA 3AC0A 5IM5A 3T38A 4KQEA 4AN1A 2J3IA 4JL5A 2OQVA 1G60A 2XDWA 1E7RA 4JROA 3PF8A 1Z0DA 2VN8A 3N8IA 4QPCA 3RG2A 4ZOQI 4QG3A 2QTNA 4N8EA 2JBAB 1BA2A 2B1GA 3SF0A 1C3XA 3WSTA 3LY9A 1MQ9A 1T5DX 1I5OA 4ESHA 2ZI5A 1PVDA 1ECBA 4UD2A 4ZCSA 1V35A 5C46F 3LV8A 1MH1A 5ETJA 3OQNA 4Z4QA 2PD4A 4ZOEA 5FT9A 3UFXB 3L7YA 3DOHA 1GTVA 1OH7A 2CXUA 1EWRA 4L5CA 4Z51A 4D9BA 2JZOA 4E4TA 2IV3A 4AY6A 1XEWX 1RYZA 1LSUA 1Z07A 1STOA 2HNAA 3GVXA 1SC4A 2BJVA 3NIWA 3M4YA 1V48A 5FOTA 4C4YA 2ZQZA 1GTMA 2Z8YM 5LYJA 3P96A 1UPXA 3RYFB 3TFWA 4XGKA 4CIVA 2WZCA 3TW8A 2GPJA 3WQHA 1YA4A 3FKJA 2KE5A 4DA0A 2BCJQ 3P9NA 2GNPA 2GEVA 1ZH4A 1BYUA 2H2GA 2YRFA 4G85A 2W8BB 1YB5A 2X1LA 4KE8A 4LDRA 5DN6A 4QBIA 3OECA 2RD2A 3OEED 2Z0MA 4BJ1A 1POXA 2QRPA 3B6JA 4ITVA 3WX0A 3ZWPA 2BM8A 4UTVA 2NWQA 3G82C 3GZTB 3OP4A 4M3NA 4P5EA 3GJYA 3DDCA 2NN3C 2QS9A 3MTAA 3OCZA 3A2NA 1R74A 1TAHA 3NHUA 4B34A 3OQMA 2VSFA 2AI3A 2PH1A 2I2CA 1K3FA 3RC1A 2VHXA 3VPHA 4BV3A 3TG8A 3K72B 4LX0A 2WUGA 4IDBA 3RCBA 1WP4A 1ZZEA 4HEJA 4CL3A 4RQAA 2BGNA 2AYYA 5C1OA 3II6X 2MSDB 4I1YA 1QP8A 3ZDYB 2PN1A 4YJDA 2RHOA 4NLLA 1AV7A 2QTRA 3Q40A 2ZZNA 3QYPA 4NPHA 2PJZA 4TMWA 4Y9DA 3F5QA 4PRZA 4EY8A 4ND2A 5D01A 5H4GA 5LM3A 3MGGA 4PCAA 4KQJA 3KVOA 3MCUA 1GILA 3C3MA 1MHPA 2YOHA 3Q3EA 2YZGA 3HWSA 4RO0A 3C87A 2AE1A 4IG9A 2GM5A 2G67A 5GAJA 4EYEA 4ND8A 4JKIA 3E3MA 3OQHA 4K03A 2RGDA 5IDWA 2KSQA 2GYVA 1L3IA 3C3JA 2WBLC 5AI6A 4RZ3A 4TT3D 5AVTA 2CXNA 1DX4A 1G6OA 3CYFA 3DS8A 5F4ZA 4C14A 5D51S 3WI7A 1XTTA 1BJRE 4PPYA 1X1BA 2WILA 5JH7F 1GTZA 1CLEA 1C1YA 4Q9LA 5JFGA 3KJHA 1UDCA 5TVGA 4KO3S 1RCTE 4ZYUA 4E3WA 2WHQA 4JXKA 5KVQA 3DQPA 2Y76A 5JLAA 1UBMS 4FEGA 3S8YA 1VZ2A 5EHIA 1ZH0A 1LC0A 3SE0A 4F86A 1F2DA 2VAMA 2OAQ1 3DFIA 4GKAA 2W90A 3KLBA 1NNUA 1P2SA 3F6BX 2J7PD 4RTLA 3BM5A 3K9GA 1SC6A 2OWDA 1E4VA 1ZITA 2A5DA 5JRDS 2A88A 3IJPA 4BO0A 1CUHA 1U8TA 5H59A 3WA6A 2I78A 2WD8A 2KI5A 1F48A 4IIXA 1UBSB 1HK7A 2YH2A 4WKPA 4WW0A 2TRSB 2XT0A 3DEIA 3NTLA 4DLVA 3KHSA 5HIAA 1B0PA 1H2WA 1V8FA 2QN7A 3GUHA 3OKAA 1FDVA 1Y1TA 5G3ZA 5SY6A 3SLRA 2B98A 1Z0ZA 3EE6A 4TQGA 2B92A 4I50B 3MGBA 1E18A 4LXTA 2DGDA 3KLMX 2LKDA 2MSNA 2YXBA 3NU1A 3R0QA 4HFMA 4RKEA 5PGMA 1TI7A 4X92A 5TS3A 5LDHA 1C9KA 3L7LA 3D3QA 3DXXA 1FMTA 4BAZA 1GQYA 3HCWA 3WQRA 4K8RB 3NC1C 2ID4A 3GUVA 4E6PA 1A9PA 2D1SA 2PKXA 1WVMA 4MKRA 4Y1FA 3TI9A 3NMUF 2OCBA 2B8NA 3DXFA 3BKXA 3T12A 1HQDA 3W2GA 1IZZA 4XIYA 4UAGA 3ZI7A 4XA8A 4BP9A 1KRWA 3INNA 3OLXA 2ZROA 3HMQA 3AFOA 4KQFA 1IRXA 3EAGA 4DIOA 4J0GA 1G6KA 3O92A 4B17A 2ZE8A 2R4QA 1YOVB 3RJTA 2P9EA 3RWBA 3EGEA 2ZS7A 1G5FA 1AHNA 5BR1A 4QEDA 1KY2A 1Y9EA 2Z8XA 1JNYA 3MD9A 3AR7A 1GPWB 1TUBB 4GUDA 4RPLA 3RTAA 2DHCA 4AIRA 5F3WB 4PLWA 3ORQA 3B51X 3PUKA 4E2YA 5B7PA 4H3HB 3A6KA 2JGEA 2VF5X 5DHQA 1RMTA 2DBRA 3BDAA 2C4NA 4IILA 1O6ZA 3IAUA 3W6PA 4E1VA 4UOEA 4DFDA 5JQGF 3FNGA 2BM1A 3DMTA 3GQBA 2PUBA 4G0UA 4AZ3B 3ND8A 5CT8A 5CHYA 1CQWA 4CL2A 4OXXA 4PAWA 2HXSA 3DNMA 3KKPA 5F4BA 2C3YA 1U7OA 2PZBA 3DOIA 1P9WA 3K5IA 4LYGA 1U3VA 2A67A 1DARA 4O4HB 3PNKA 4G0OA 3R5HA 4FCTA 4KACA 1GPAA 1NQTA 2LCIA 4JSRA 5SY4A 5F2NA 2YIDA 2R1UA 4I19A 1WUTA 1D5WA 1E4OA 2X0DA 5CVTA 2YYSA 3DZCA 2G09A 2I62A 1L5YA 3TNFA 2WG1A 3NTRA 4J0QA 4KXXA 2V7UA 3NAMA 2R48A 3GFTA 1MABB 2QB5A 3U9TA 1DG9A 1YB4A 3VYRB 1LDBA 2C2OA 2CFCA 2Q6IA 1X2EA 3ZCSA 5CYFA 5D1NA 4EHFA 4JJ4A 3C1OA 2NU9A 1AKYA 3AHIA 3CG4A 4HZIA 1BCSA 2MR5A 2YNMA 3SSOA 2VAWA 2XMBA 4J0HA 1TRKA 5ERYA 1KF0A 3K0HA 2BTQA 1TC1A 2H1IA 3BRWD 3HN6A 4UTRA 3BCSA 4LF6B 1YMQA 5C7IO 3DFMA 4R1MA 1PFUA 1MDFA 3OQBA 1BEEA 1WE2A 5IBQA 2R751 4Y2JA 2VHWA 3VXKA 3P27A 5FR1A 4BFCA 2PKRA 4NFHA 3SQOA 3NALA 1VI2A 4UPVA 4KVAA 1WU8A 3QYJA 4YRKA 5KYUB 5TMBA 4AC9A 1BE0A 4AN4A 3RT1A 5K51A 3FVVA 4BUJA 1VG8A 4AECA 4B6OA 3IEXA 1R9MA 4QBTA 1YZYA 4XVCA 4CCSA 3ZIAD 4I6GA 1FXSA 1S1CA 2UYOA 5HFJA 3WZMA 2R2AA 3RHTA 5B1EA 3EPKA 3COVA 3HXPA 1BS1A 1FYWA 1P3DA 3BQ9A 4TV8F 5CUQA 3GA7A 5J4VA 1EFTA 4LF8B 1AOXA 2E9SA 3TLEA 2BEUB 3E35A 3UTDA 1UBUS 1OKKA 1WKCA 4GSLA 3SN6A 3VJRA 3TPFA 5BV2P 3ZD6A 4GZLA 4ZOLB 4L4XA 4Z9BA 5F1PA 5A7FA 5JNTA 1GPKA 3E0XA 1JEOA 1ODCA 4NNJA 2H2IA 3C43A 3FFAA 2P2GA 1N2SA 3ANSA 2P9ZA 3NM4A 4ZYXA 3CX4A 3LK7A 1I4LD 3L07A 4YP0A 3F9CA 2EHDA 2PKCA 5CIYA 4AJKA 1MJGM 4ZTZB 1LBSA 1JHAA 1KZGB 4ZVKA 2X86A 3RS3A 4DILA 1WXEA 3PWKA 3HDYA 3MELA 1FRNA 1ZICA 2JPDA 3SD7A 4KQ1A 5FLYA 3LFUA 3LC1O 4W7SA 1UK8A 3IPCA 3GMDA 3OEHD 3QUTA 1UBCA 3OE4A 5SYAA 1OU4A 3W5AA 1JPJA 1E2GA 4EQ6B 2Q3EA 1EK5A 2HUPA 2QSJA 4ZKEA 4JK3A 5DK4A 1GPUA 1EUQA 1T1IA 3R7FA 1CZRA 4NZZA 1V4VA 1S3IA 5F9FA 2CD9A 2OR3A 1P2BA 3HA3A 1VIDA 1QCZA 1I33A 2QLLA 4FDLA 4HNSA 5AJHA 1NZDA 1ZUD1 3CZRA 4RZIA 3MJVA 3ZWNA 1T4CB 4W8HA 4W9NA 4BPBA 5EZYF 2JD2A 2RJNA 4JR0A 4FUTA 2YW2A 4HAZA 1IBLB 5IJZA 4FINA 3UB2A 4P3XA 3RI3A 2YS7A 1NWCA 5JZ9A 2W00A 4QELA 4PFKA 4UXIA 2PSEA 2PX0A 3QJYA 4ZU3A 3DOJA 4R9RA 3RUFA 2YIMA 4GXNA 4CDMA 4DLZA 4ABTA 3DZHA 4EFLA 3V4SA 2P40A 3D1VA 2BRUC 2ZRQA 4OUDB 1D6NA 4YAJA 3TXAA 1DUVG 3DWEX 3K73O 1MA0A 2PSHA 3RW9A 3WMWA 2YOGA 4G5GA 5ELXA 3U3KA 2I7VA 2ZUVA 2A9FA 1ZJYA 4Y1EA 3NVAA 5B55A 3KG2A 4G01B 5CG2A 1ML3A 2VDUE 1IAQA 1I24A 2XE6A 3PCRB 4RD4A 4WKCA 3OOEA 3OPYA 1VE9A 4YMSA 4R8LA 3RNOA 5L9AA 1G1AA 1GCIA 1M10A 2JFQA 4N5MA 2GZ2A 3TZHA 4OKNA 3JZDA 3NBKA 3QU4A 2E18A 1KJ9A 4F3TA 2VXYA 5I9TA 2ZUTA 5ER6A 1E8DA 2YQ5A 4ETWA 5AKJA 3Q7PA 1MT3A 1C14A 4R1QA 3RFFA 2FWNA 1G59A 2PVCA 4JKOA 4RIIA 5JNUA 121PA 3TNYA 1AKRA 1XLWA 2Q1YA 1RI1A 3AHJA 3IAFA 3W2EA 3ZIAA 5LZ9A 1YS2X 2PRKA 1GGHA 3UAWA 4QOJA 2FWRA 2YW9A 3TOZA 4IQGA 2HLPA 4DM7A 1UINA 2BI7A 2MINB 3DFKA 3GRAA 4URYR 1WBJB 3VR2A 4B8YA 3COJA 4BNZA 3BQNB 1H2RS 1C7EA 3SHWA 1W5AA 3P2OA 3R5FA 3EOAI 1X9GA 2F7SA 3CPHA 3H8JA 5KHLB 1Q1ZA 4KXUA 1CNMA 5EZQA 1ECFA 3PDUA 3W9YA 1RHMA 2H11A 5DU2A 3Q8XB 1GZUA 1I14A 4MVJG 3W3AH 1FTQA 3LWNA 3FVWA 4F04A 1GAXA 3A26A 4PAMA 3A3YA 1IMOA 1QK5A 3OQIB 4PO3X 2WU8A 4Q7QA 1W34A 4X6YA 2C4MA 1FRQA 1XDDA 3AFGA 5B1DA 5JZSA 2WWRA 3A1NA 3EXG1 1LBEA 3TLGA 4BECA 3D3WB 4M7RA 4OQFA 1A5BB 1E0AA 4G5QA 3NEAA 4LMAA 2HA3A 5K03A 4M1YA 3I83A 2P3QA 2AFHA 1WIWA 2HIAA 1XRSB 3I52A 3HADA 2D0IA 4IFIA 4HLQB 4QDXA 1DWPA 2VP9A 2O57A 3A36A 1VL5A 3H16A 5KSYA 3WWEA 2O8EB 1LV8A 1U8YA 3FVTA 2UZ1B 3ZU2A 4BASA 3EOBI 2PNFA 3H18A 1Q2XA 2GBFA 2I34A 3EGDB 3L84A 4H15A 4UDNA 4ZCLA 4EG4A 4KXWA 1B8OA 3JSXA 4HAUA 2WC1A 4GAEA 1MJ5A 1EUDA 2Z56A 3PFGA 4G26A 1K7CA 1M0EA 3ITKA 1JIQA 3DV0A 1L5HA 2JGNA 1PUJA 2ZQ5A 3TK1A 3ZBPA 5ALVA 1VGVA 3DMGA 3S44A 4XIJA 3TBKA 1EH5A 3HYCA 2NSYA 3F47A 3RRJA 1LVUA 1QKKA 4R9SA 1TZCA 4INZA 4UVDA 3C8MA 5M3BA 4BVHA 4X3CA 2X1MA 2CNOA 5KINB 3BD8A 5K8CA 5CU7A 2KM1A 3JQRA 1F2TA 1ZKMA 2IXBA 4GMGA 1BW9A 1QGYA 3OF3A 1T34A 5DZSA 4GVPA 3MYYA 3VYWA 3TD9A 2NU8B 1A71A 2J33A 3H3JA 1T9AA 1XVUA 4AO7A 1SG9A 1JR3E 1UUFA 2RHGB 3UXMA 1NPDA 1T3LA 1UL1X 1LNQA 3FDZB 1W88A 4Y2SA 3VC2A 2X8JB 2FZEA 2QOEA 1ZN7A 3EZXA 1K06A 1KK3A 1W2HA 2XYGA 4WLEA 5CEJA 2I6GA 3CCCA 2P78A 1NY5A 1ZMXA 4K6OA 1QFJA 2QZSA 4A1FA 2R68A 3HVJA 2XUPA 4GDMA 4ANFA 1KRXA 1EJ2A 1K7EB 3O8QB 4GVLA 3CS3A 2WR8A 3E9DA 3RTBA 3T9BA 1R5JA 1LA2A 3IESA 4Y6GB 4A9AA 3I3SR 4F6RB 3AERB 1NV9A 1PDWA 4ID3A 2FJPA 2AKEA 1YUMA 5ILGA 3DDOA 1DC5A 3P97A 3PKJA 4QYTA 1D09A 1NONA 3GH3A 4HVTA 4K87A 4KJZA 1JUDA 4J8PA 1SD5A 3YASA 2FFRA 2Z5FA 4QICA 3CVXA 5AHRA 1RWBA 1MFPA 3WGHA 3VU9A 3P0RA 1N2IA 4HWSA 1CJSA 4LDQA 4X1KB 1AXGA 3H8VA 2VC2B 2VA8A 1P1HA 1JX6A 4RWZA 1WNFA 4YRLA 4D46A 1XROA 5JR3A 3RU7A 3FYHA 5CITA 1K75A 1WXHA 2I80A 4IVPA 3TLCA 3KB8A 4O5OA 3L4BA 5CB6A 2QVZX 3HCBA 1XJ5A 3F8TA 4XIGS 1C7RA 1M0WA 2EJUA 2FKAA 2O1WA 2RHHA 3PVZA 4YJHA 2OHFA 2J48A 4ZAYA 3DV9A 1M6YA 1NMQA 2B2CA 1X7GA 4UHEA 5B2ZA 3KJGA 3ZWAA 2V6GA 5GV7A 1AJEA 1Z8HA 1ZNQO 1DRUA 2VNKA 4U7PB 1UH5A 2D62A 4KE6A 1S2DA 2AA3A 2QL5A 3N2GB 4WZ6A 5AWFC 3JZMA 4TKZA 2GM4A 4ND4A 1M2KA 4EEZA 5EJ5A 2Q2NA 1TO1E 1IMJA 2H4HA 2N47A 3TOXA 5IZCC 3V32A 3SVLA 4PYQA 1R7RA 4FE3A 4I1IA 2C2MA 2IX9A 4GW3A 5DHUA 5F2OA 1PBNA 4PTLA 4D74A 1H4SA 1PGPA 4BAUA 1N9KA 1W5BA 2QR3A 5HQTA 4YCAA 1WNTA 1DO8A 3EZ6A 4B7ZA 3M6FA 1YC5A 3RE1A 1W4RA 1G4AE 3NBZC 3JVVA 4UQOA 4ZO4A 1EQ2A 3ZW7A 3EEYA 3QELA 3KZVA 2YFHA 5EA2A 3H86A 4DG5A 4ER3A 1F7VA 2BDTA 3EW9A 3SHFA 1P45A 3OJFA 1H5NA 2FPIB 1AK1A 1NAIA 3BWVA 1FYVA 3NQ41 3M2TA 4G5OA 4IWXA 3IEIA 4DCTA 4IJ6A 1YQEA 4U0KA 4H4EA 5B64A 1GRQA 4IIVA 1F6DA 4J1TC 1QR2A 2M9MA 2IZ1A 2IX3A 2GAJA 4GG1A 3EXHB 4OGKA 4MW5A 5LP6F 1TOAA 2BN4A 2V58A 3L8CA 4PYJA 1JIUA 4LX8A 4RZHA 1ELOA 1I9GA 1Z34A 2G9ZA 1EHIA 2O2CA 4KQ9A 4IOKA 4XUGB 4BVFA 3WXMA 1GCAA 1RABA 3WGVA 2WTMA 1HZZA 3ACDA 4QYSA 1X74A 4L74A 3LT5A 1KFCB 4FGWA 5BVGA 3AVWA 4DLUA 1APBA 2FSSA 3BMOB 5A0VA 3BMNB 4A7PA 4HNHA 4RY8A 1LSSA 2UZ4A 1HUQA 3A1FA 4I0WB 3JTMA 4XB1A 3GA0A 5FR2A 2CUZA 5HVNA 1BWRA 1UBEA 2JFGA 2FVYA 4B3BA 4MXDA 4FJ2A 2REOA 4C2BA 3HP7A 3UC9A 4ZCIA 4X66B 3NUQA 2QIPA 4OLAA 1NVAA 3Q88A 4ZP1A 4PZPA 1QYWA 1QFXA 2AI1A 5C52B 5FO0A 1AVTA 1MC1A 1X1AA 1Q5PA 5AM5A 2CMFA 1CVRA 1OPRA 4C04A 2J87A 1YZQA 4ARVA 4EZIA 3AVOA 1HLPA 2H4FA 2OXRA 5E6SB 1JHZA 3ZDFA 4YMHA 1WMEA 5LP1A 4Y2HA 4B6FA 3OOHA 2ZANA 3P9YA 4JITA 4DREA 4CI0B 2H3HA 2V7WA 2FX5A 3G5TA 4FGLA 3CTPA 4P9NA 2NNWB 3X2FA 2R7NA 3AHDA 3PHIA 3GAZA 3DMNA 1H8HA 2PXAA 4AXXA 1E60A 4CYMA 4D9KA 1Y7PA 1J1ZA 3CINA 5BN5B 1XN1A 1QNLA 1TYZA 3FUUA 1T9ZA 1VG9B 3A4LA 1QGAA 4PR3A 4Q3CA 1JPNA 4UEWA 5FAXA 5BYBA 4BLQA 1KEKA 3RC7A 1OC2A 2INGX 3NNDA 3GNSA 1YU6A 1R0RE 4RTOA 4H3VA 1QGOA 5JAIA 4LTDA 2VLBA 3SK0A 5KNDA 1KWGA 1SVWA 1WMDA 4UHBA 2DT5A 5DNCA 1PZEA 1UP7A 2FEWB 4M0FA 4PW0A 5HSGA 2V8BA 1M1NB 1VL6A 4JX8A 3QTLA 1GUFA 4PZZA 1K08A 2FMHA 2MJLA 3BIJA 4H1TA 4AYTA 1VIYA 1GN9A 2ZKLA 2PT5A 4Q1BA 5T6MA 1DCKA 3SHOA 1JHDA 4MRPA 4YP1A 3A6FA 2XADA 3AOEA 3C85A 1CUCA 4XQGA 4PBSA 1JQDA 4UREA 5C51B 5AK4A 3LS2A 3M6IA 1XYGA 3LLUA 1SVNA 2H1LA 5TJ9A 3P32A 1Y4SA 5I4KA 1C9NA 4DIEA 3GJ8A 4PPGA 2FCRA 2HHCA 2QW8A 1AB5A 3AGQA 4NATA 4DA4A 4P92A 4WADA 3UJCA 5L4LA 4OJYA 1HSZA 1GR1A 1UPFA 3WR5A 4KHPB 3QU9A 1PDOA 1JVSA 4CUZA 1HE2A 2J3DA 1HYQA 3LXXA 4DQKA 3SSAA 4KREA 2XVYA 5LBTA 5JJCA 2WP0A 1RRGA 2C94A 2OPHA 4WEQA 3PNQA 2I2FA 5LQSA 1FSZA 3AI7A 3G02A 3CUKA 2E5FA 3DVRX 3MZ0A 3NBYC 4P31A 5I7AA 2YY5A 3H5RA 4B2PA 2GZSA 2IEBA 1QJCA 2CHUA 5KYNA 2CV1A 2WWTA 4AU1A 5LOVA 1PEAA 4P7JA 4DLYA 4TMXA 2ZXFA 1NZFA 3PPVA 3ESCA 1GT91 4NE7A 2H63A 1N6LA 1F6WA 3A9SA 2WV7A 5ITZB 3IT2A 1Z4KA 2D1RA 1SXQA 5HHTA 3B70A 2H0QA 1JWAB 4MQ5A 4GWKA 1N7GA 4HH1A 4CLHA 3LX6A 1TUIA 2BVNA 2REQA 3RV3A 2I91A 4F46A 4KHZA 2FEXA 5CB0A 1KJ8A 3TAXA 4OB8A 1GAQA 2IBMA 1O9BA 2W9XA 1JB1A 4TTVA 2FW6A 4A6DA 3P2EA 4S12A 3S5JA 4R01A 3WK5A 3OZGA 1GSIA 3I5MA 4DRXA 2IZ5A 3GUCA 4G1VA 3SJCA 4FCWA 4J16A 3I58A 4UUPA 3ZHUA 1EFAA 4OMUA 1X1EA 1DBPA 2V4ZA 1PNQA 3OZSA 3QPDA 4PLCA 4MR7A 3RS5A 3OPMA 3TZLA 1ITZA 1TEVA 1Z2DA 1KXJA 2MMCA 2HA0A 3MBOA 2YR0A 2QLMA 4WXRA 1K7SN 5BO5A 1NT2A 4ZD6A 2PSDA 1BS2A 2YJ4A 3OMWA 1YJ8A 1QV9A 4RD6A 3SGLA 4ZV7A 5K7SA 2QMUA 4HOYA 2GCGA 4KO2S 5E9AA 4C06A 3PDJA 4QU0A 2DP4E 4E11A 1O95C 2VEOA 2FXIA 2JCBA 3P9QA 3FFBA 3JD2A 2AQIA 3EIHA 5ALIA 5TQ2B 4HNQA 1F12A 3B5EA 1X8XA 3D6HA 3MBIA 2HWWA 1KTVA 3L1IA 5DNUA 3SBXA 5H80A 3JQDA 1JG7A 2ERYA 4JQYA 2QGFA 3ZH2A 4C4ZA 2AW5A 1IHPA 1A4XA 2C4WA 4EGCB 4R6XA 4XZ3A 5JVDB 4DDTA 4GL2A 1NVGA 1GA6A 5ANRB 3MGCA 3BTVA 4IIEA 4XWOA 2BFWA 1K5DA 2Q3BA 1J22A 1G17A 3IUJA 3UA4A 1M8PA 1SKBA 3KHTA 4Y2UA 2XMSA 1L9KA 5DGXA 5H7XA 1J5PA 2AJDA 4GIBA 2XKBA 5CXXA 1AQUA 2X5XA 5EI5A 1QG6A 1DFGA 1DAHA 1K97A 2UZ0A 4UNQA 4P58A 4ESOA 1EESA 1QO0D 3MM4A 2C2BA 1P77A 4LYHA 2YFQA 1AURA 1KQ3A 2PL5A 4F1JA 1XX6A 4WXYB 1CR0A 4TWJA 4RBNA 3JW8A 4JC5A 1VLZA 1E79A 2ID9A 5FFMA 3WYDA 5BSKA 5HZHA 2RKBA 5DMXA 1U4OA 3AF6A 5AOCA 1SEVA 2FLVA 1GARA 4JLWA 5CH3A 3REOA 3V6MA 4CKBB 4EABA 5C7LO 5LYJF 3R9WA 1B73A 1UEIA 4R9NA 1ISSA 3BC1A 5T57A 2IYXA 2G36A 3WRYC 4D8WA 5C7YA 4IG4A 2B30A 1PYGA 1RBMA 3HVUA 4P82A 5AVYA 2DR3A 5ALLA 5ECDA 3ZLBA 3GGCA 5LUAA 1XTUA 3IYLW 3QV2A 1W59A 3X1YA 2LCFA 2QYOA 2EFHB 2C5LA 4MUGA 2DC1A 1L9XA 4BVBA 3IHKA 5JWOA 5CFLA 3T0GA 2VZ0A 3NI2A 1G8JA 2AWNA 2NTYC 5JU6A 4EFMA 2P4EA 2AQ8A 5JS2A 1ADJA 3OG9A 1E62A 2BZSA 2VH5R 3Q7SA 4FGKA 2XRYA 4RH3A 1SIOA 2GCEA 1CUJA 2DYKA 2KW5A 3D7KA 3GIWA 5CEEA 2CDAA 1J7JA 4LCEA 2Y9MB 4XLLA 2PRJA 1UF9A 1IY8A 3B2NA 4H3SA 4B4WA 4D9IA 3ZY5A 5T4BA 4K26A 3BL5A 4B6RA 3CIOA 4BEWA 2EZ8A 4JJGA 3S29A 4Q7EA 4YY3B 2AFRA 1WUJS 4CM1A 1DDGA 1EHYA 1P39A 2ZIAA 4OBEA 3LQRA 1YZHA 4NR0A 5F7JA 5BWLA 3WAKA 4F92B 3NLLA 2R6DA 4HWGA 1UJBA 3TIVA 3JAWA 3PTAA 3KTFA 2CK3A 3WV4A 2Y99A 1V4BA 4BUZA 2V9ZA 4QOIA 4O1HA 3KT8A 3SMQA 3KQKA 1E1KA 5ARDA 2WA2A 4YT4A 2WOOA 3NBXX 4MWOA 2YWHA 4YA6A 1JFLA 3O4RA 3V4RA 4AKGA 2AHOA 3VV2A 2C9YA 3PXDA 1EXNA 1A8HA 4D9EA 1BQ3A 1NX6A 1X7WA 3C3BA 3OVMA 3N07A 2QV7A 2DUJA 2H2HA 1M2FA 1ZJ6A 3GEDA 4HPWA 1KZHA 3UHAA 2PRZA 1AQYA 1ECLA 2FR8A 1S7CA 4ZPJA 4JS0A 5JD5A 1XQ1A 4R1TA 6GPBA 2O2JA 4WJLA 5EJGA 1YRBA 4MIKA 1NIPA 3SQWA 3AESA 1NN0A 2GXAA 1U9CA 4Z9XA 4ECEA 2C9OA 1OXVA 1P18A 3H0EA 3TL6A 3STVA 3T34A 4QJIA 5FULA 4DMHA 1M7BA 4PF1A 3T5MA 2BBTA 1A1SA 3DOFA 2Q3LA 3H2YA 3KEMA 3RWMB 4BLTA 1ZD4A 1E5VA 1DVRA 1VRCA 1W73A 1QK3A 2EJVA 2FQ1A 1NM5C 2AZ4A 4IHJB 4YQEA 3TQIA 1D2CA 2QTFA 3ZX4A 5KKCA 2B3TA 3CNBA 4TV9F 5JYEA 1UDBA 4H7FA 2OP0A 4MITA 3VNAA 2XDQB 4JBHA 1O03A 1XZKA 3GLGB 4EG1A 1W96A 2GDZA 1PVVA 3V00A 2RH9B 3W5CA 2BEJA 3CVOA 3RYHA 2RIPA 1O8BA 1N5JA 4UJ5A 3OC0A 3L4JA 3LPNA 1Q74A 4KDEA 4F5EA 3MN1A 1JW9B 1C4OA 1R16A 3H0KA 4V0NA 1C1XA 2Q1WA 4IF6A 4CM4B 4Z4CA 5E2BA 4Q3BA 1R6DA 2FMIA 4ZVOA 2HK8A 1U4NA 2XQGA 3K0AA 4URVR 3PE6A 3CEPB 3H5LA 2OWEA 4L75A 3E8MA 1NMYA 3CRRA 3QOWA 4JLMA 4PSCA 5EIEA 3U7FB 2VH2A 1GAJA 3NS7A 1QHIA 3ME5A 1BDHA 2F67A 2AG6A 1YA8A 4KQGA 4XQEA 1CK4A 2HL6A 2RG7A 3QBTA 3WDMA 1A8QA 4KK3A 4DEVA 5GJCA 4HVLA 4YR7A 1BIFA 1FSFA 5AOBA 3BE5A 3SZ3A 4C9BA 5IM4A 4OMFG 2RHRA 3CKMA 4J9VA 1I7NA 1JR2A 1GNTA 3NDJA 1DBIA 1JSZA 2J1LA 5EYPB 2WD7B 3TR6A 4C6RA 3PUJA 1XVVA 4N40A 4E21A 3D6FA 1UR5A 4FOOA 4L02A 3WFIA 4MRAA 3CWZA 3UGTA 4IIBA 3P9ZA 4DBLC 5BN1A 4ZODA 2B9EA 2X3FA 3P0IA 1KGSA 3O8RA 4YCJA 3M6XA 3G9QA 3R7DA 5LIRA 4BEBA 1CFZA 3L0SA 4QLBA 5ICFA 2X5JO 4DT1A 3AUSA 4EBFA 2ZYTX 1OLSB 1R8JA 4HB2A 1OH8A 2FGJA 1QH1A 3BIFA 4CLRA 4GDFA 1L5GB 3UWOA 2XWSA 5C1PA 5HYVA 3S1AB 2IS1A 4OB6A 1KH2A 3EIQA 1MOSA 1RLTA 4DR3B 1X42A 1B1CA 3HS3A 3L7KA 1QYCA 1SKUA 1LDEA 3DGEC 2JH3A 2JIPA 2QL6A 3FWPA 3QF4A 5H3CA 3VR5A 1N3LA 4G5SA 4NRDA 1J09A 1XZQA 2H1WA 4FE7A 1Q0RA 3KOUA 2YWJA 4OBWA 1O5IA 5JNLA 1A5AB 3PKZA 3NPMA 2RHWA 3A25A 2A0YA 2A4KA 2OHJA 4OGGA 4PAOA 2X15A 5GOTA 1XL0A 4YRPA 4DLTA 4OK6A 2FSVA 1QS0B 1KI6A 1SUFA 3PQCA 3RJ9A 5GJVC 4GVXA 5GOZA 5K1ZA 3KHKA 5EWLA 4AVYA 4LRTB 4C0BA 5C37A 4DY6A 1G20E 3H13A 4NOJA 3IEPA 4FSXA 2JVJA 2QPLA 4L51A 5JSHA 2IUSA 2PJRA 3UH1A 3D0RA 5TB5A 2VPPA 3UWMA 3UMYA 1XI2A 4GLLA 3LPMA 5FF9A 3NRBA 3DCJA 1T9GR 3ET5A 2WM3A 3WS7A 1CHNA 3L6RA 3IE1A 2HCBA 4DV4B 4E31A 3CM0A 2Q0XA 3O1JC 3PDIB 4DMFA 1TJ4A 3JR3A 1HDIA 1U7ZA 4XW2A 4D0NA 5D2CA 3H5WA 2E37A 1A9ZA 3I45A 3RRNA 5KNDD 4L9AA 3AO0B 1JHPA 4GECA 4UM9D 4Z1MA 3K5WA 4TVOA 3CE9A 5E8RA 1RPTA 1FX0A 2QY6A 2ZRCA 2J3QA 3PXXA 4FFPA 4I2NA 3AP3A 1LPOA 4O2LA 4XLTA 1JAZA 4QQFA 2V7TA 4TMTA 2CJFA 1VLJA 1W4BA 4RJLA 4LQDA 1SU7A 4U7JA 3C97A 5DX0A 2OHVA 4CTKA 3EDOA 4DAOA 2WHPB 1E2KA 2BOVA 1V7QA 2ILTA 4BO2A 4R81A 4BP1A 3GBVA 1LQTA 4LXUA 1MXFA 1PR1A 4AXBA 1BG6A 3HO8A 3QG5A 4E7PA 3MT9A 3O83A 2WPDA 3WBKA 5HRAA 1IEVA 5CVEA 4QFBA 3N0XA 2LW7A 2R00C 1DX6A 3GMSA 4LBVA 4TM7A 3LW7A 3AXTA 3TGPA 3MWJA 3ABRB 3N9IA 1VDZA 2Q5IA 3AV0B 3NC0C 4OI1A 3RS9A 1HWYA 1E7SA 2FSHA 1R5NA 2VF8A 3DUWA 3KVYA 2ODQA 3RK4A 2TMKA 1PYOA 2NV2B 1MLDA 2PUFA 1NU6A 4GFDA 3RVJA 3W9UA 3WQBA 5DNYB 1L1FA 4Q9KA 1AHHA 1ZAKA 3DCYA 2PKQO 1HE8B 3OKCA 1PV4A 1E2MA 1G7SA 1YKGA 2XWQA 2VXOA 4MVCA 4FFLA 2AOTB 4RMIA 4NH4A 3TJMA 2FMFA 1TKCA 2HYDA 2QAGA 4M89A 5KHOC 1RMQA 4V0KA 3L93A 1WDTA 1ZESA 1FRVA 3QVUA 3G85A 4U4AA 1JKJA 2KHZA 4J4BA 4YFVA 3ZXXA 5M04A 3LGSA 4I5IA 5IC6A 4JUFA 2XIJA 4WKBA 1PW7A 1S3FA 3PCTA 3U26A 4TUYB 3UMSA 4UUQA 3PXCX 1NASA 5DVZA 1G8SA 2ANCA 3KAKA 4OD0A 3EGOA 4ZI7B 1DJMA 3EXHC 1V5EA 1IZ7A 3CN9A 4AWXA 2QLBA 1LPNA 3C6YA 5GTDA 1ZPDA 2XZLA 1ZZGA 3DUFB 4KIWA 3KSUA 1V3VA 1YNOA 2B5OA 4Q7JB 2QVGA 2FPRA 1DIHA 3AV3A 4LE2A 1EVYA 5CVCA 3L7DA 2YJZA 3SM9A 3U0VA 4J1SA 1U2ZA 2PGDA 1JSCA 3EY9A 4X8OA 4LN1A 1MAUA 1YJQA 3DP9A 4EKNB 4BYMA 5AKZA 1T5LA 4LUCA 4U63A 3UAGA 2ES4A 4MVJF 3S2UA 3TDKA 1QG0A 1J99A 2PJUA 4R9UC 1E3SA 3FTCA 1KI4A 4PLPA 2CDCA 2SKDA 1SUWA 3JYPA 1G291 4CQLA 3QXJA 1M6EX 3HKDA 4TSFA 4EHJA 5FWYA 3ZHTA 1MO3A 1YCHA 3M7IA 4RLSA 4WNCA 2YMQA 2HJWA 4A16A 4G23A 4BO7A 3OCUA 1U0GA 2ZYHA 5C18A 2E0IA 1GV1A 2IZ7A 1MHTA 4DQ0A 2L17A 1ES9A 1W0KD 4HDQB 4MUYA 4AJPA 4FR0A 2EJTA 4NYJQ 4YMVA 4MCAA 1ZMTA 1G8FA 3Q1LA 4I1VA 2VTVA 3FY4A 2ZLBA 3I61A 2VYVA 3ZKAA 3SC6A 3FNRA 4LHXA 1QBGA 4F2GA 1XOIA 2QJOA 4M6WA 5DGTA 1RJWA 4ZVLA 1T5BA 2AOWA 2RGEA 4YQFA 5G4KB 1Z0KA 5E9JA 2CJYA 1XCPA 1US8A 3I6ZA 1N2XA 1Y3BE 2O3QA 1K2VN 3CNEA 4RXUA 1JA9A 2EL7A 4XH9B 5KS2A 4AQYB 4R8VA 1GPNA 3FGPA 3EIWA 4NFLA 4ALIA 4EGJA 3AB8A 3QFTA 4LQ4A 5HXAA 1GG2A 1KZ4A 2IGBA 2ZYVX 3D31A 3GF4A 4WPGA 3QEJA 3QXSA 4WK6A 3B1WA 3UHOA 3OHMA 1Q6ZA 2WSMA 4HK4A 1OAOA 3IMKA 1L8OA 1YS6A 1YB6A 1W7AA 3W4IA 1QTQA 2G80A 2HSWA 1YULA 1E7MA 5B1YA 4MP3A 1ZXLA 2ZB8A 5LQKA 3ADDA 3PIDA 5F1OA 5KOJB 5A71A 4QQRA 1L1RA 1VL1A 2C54A 4M0EA 5F35A 4Q1DA 3DE2X 3Q2OA 5MGNA 1PJZA 1T2EA 3SXPA 4J29A 3O38A 2QUAA 4X9XA 5DOVA 4BLVA 1EFUA 1YZGA 2X9QA 4XIFA 4D3DA 3JQ9A 1I3CA 4WXHA 4BIIA 4EGAA 1RI2A 4O25A 4AKHA 2O20A 2GZMA 1FZTA 3W2HA 5BSRA 1QHHA 4YP6A 1RKUA 2V3VA 4NG4A 4DV6B 4IJMA 4FYHA 2BKEA 4QBHA 4RIFA 3KTDA 3D02A 5IBPA 3T4PA 5JJIA 1N2BA 2O8CB 1JR3A 4M49A 4ZAZA 3NBMA 3MAJA 2FOXA 3FCYA 4YEDA 1SCAA 5DYGA 4QECA 1SO8A 1DCFA 3EQ6A 1T9HA 2NYRA 3FD8A 3K16A 1GTJ1 4XUEA 3RS2A 1ZJ4A 2ERCA 4K9SA 3SX4A 3ZWVA 3QU5A 4LY9A 1NVVR 1EM8A 5FOUA 3WAGA 2J0SA 3GIDA 3IPXA 4AUMA 1VG0B 3L9WA 2VZ8A 5H9WA 1YL7A 5BWBA 3EFOA 3UICA 1OVGA 3EEIA 1QVVA 3U4IA 4KU4A 2CMDA 4XGIA 2OCXA 2I54A 2X9LA 3HB7A 1J0DA 3OZTA 4PQEA 1NJ1A 4GOKA 2A0FA 4XVRA 1KBQA 4UZFA 4PQYA 4RK7A 2Y4NA 3ANLA 4JOQA 3NVMB 3V2IA 4BV8A 3B6IA 3IR6A 4ALNA 2Q7XA 2WHXA 2ZVJA 3TGWA 1K92A 4JKYA 4ZREA 1Z0SA 4X00A 2QYSA 3A11A 3VO8A 1DO0A 2AEEA 1QYIA 2YZNA 3A8TA 3CUEF 5BQ3A 2PMWB 4RVFA 4QGAA 3V8PA 3V8BA 2ECOA 4LYYA 1IJKA 5I7HA 3RYTC 1Y6JA 2XAAA 3VOTA 1CUUA 3NRJA 3NOVA 4NPCA 4YJ2B 4A10A 3PJEA 1UPUA 4FGZA 3IB3A 2W2PA 3CLUD 3JYHA 4XAQA 3KXDA 4HNTA 5DSTA 1SOAA 2FWPA 2ZTLA 4TLDA 5THKA 3S81A 4S2UA 2W83A 4RSHA 4UMVA 3EN0A 1NVUQ 2ZB2A 2X2FA 3D8HA 5AD1A 2XT9A 1F1JA 2QX7A 3ZWOA 4G4IA 1XAHA 3I1IA 4FMDF 5LZ8A 4BNWA 1RW4A 3RS8A 3V1YA 3ZE6A 4RMHA 2GK3A 2OCLA 2GM9A 4KXLA 1T6NA 5FQOA 4BNKA 3DZKA 1KAMA 1GA4A 2AZDA 2FHSA 2X3YA 3N8NA 3BRCA 4OG2A 1YMVA 4QASA 1VIVA 2XJ9A 3DH0A 2HC9A 5A4KA 3HDJA 2IU4A 2VATA 4B2LA 2VT3A 3H1FA 1ETHA 1V3UA 2PMEA 4K9RA 4BWYA 5EGSA 3IKVA 3DL2A 5ALPA 1W52X 4PRLA 4LGMA 2QM8A 1LX6A 1Y7LA 5ESXA 4BKQA 5LQDA 5AJTA 1CZLA 3EZNA 3DMHA 3GEEA 3G2IA 1UZLA 2QI9C 1AXEA 1Q84A 1NUAA 1BE8A 2GUGA 1JJAA 1JSLA 3GLSA 3PVSA 2J32A 2PS1A 2H54A 5E38A 3ZDXB 1M2VB 3K53A 4FSDA 3VA7A 1ZI6A 4B3XA 1LLCA 1JI3A 4IJUA 2PXHA 3DLAA 3UMJA 4BQQA 4W7HA 3IVRA 3UT5A 4DR5B 4RETA 4DQUA 2YUIA 2W2LD 3CSDA 4URZR 2H2FA 1EK2A 4BTVA 4MDYA 1U6IA 2ZR7A 1ACJA 4WD3A 2QJWA 5BT8A 1R2QA 4FGUA 1NW8A 3PXAA 1R66A 1YASA 2DERA 3MS2A 4PFQA 4QPZA 4QFMA 4RFVA 3QX3A 3UG6A 1Y7IA 2QXUA 3K0KA 1DV2A 4NCHA 1P1BA 4N03A 2RI1A 1I9CA 3AP2A 1JDJA 4K9OA 1JQJC 4HT3B 3BEOA 3O47A 3VSAA 2Z2IA 1X77A 1UM9A 4Y1RA 4V0OA 1MENA 2VTEA 4I99A 1JEQB 2I2AA 1CYEA 1WS6A 3AUUA 3U7JA 4FYIA 3AF5A 2I6SA 4PSDA 3EDMA 5D00A 1AY0A 3R3YA 1DC8A 3KOYA 4GLOA 3RC8A 1RLJA 4DIBA 3MTEA 1G8KA 1N5OX 4A6EA 2ZWVA 1JEAA 1K8RA 1JZSA 1MAHA 3EBOA 4ENPA 3MOGA 1KAGA 2JLZA 4L16A 3I6IA 3QFSA 5E1DA 1SD2A 2H1SA 3AHGA 1IG0A 3OM8A 3SS7X 4HAWA 1JHVA 4OL0A 4ARUA 3OD1A 4PBTA 5JAZA 2EBHX 4J0IA 3UB4A 2AK3A 1D2HA 1ZH6A 4H4CA 3IIMA 3LC0A 2VTBB 2GQ0A 1OJ7A 4DCGA 3KOMA 1BMTA 2JF0A 4J0EA 4TVSA 2WW8A 1ADYA 4O2AA 3MT0A 1UK6A 4WV3A 4NICA 4IX1A 1Z5GA 3CUUA 2MSEB 3SM3A 2AFIB 2O1SA 4IJVA 5DM60 3Q6IA 3HKCA 4OXRA 1WW2A 4BHTA 1U81A 1II8A 4EG3A 3JRNA 2VSYA 3AY0A 3KXPA 2AE2A 1KY3A 2G3YA 1J8QA 4KVGA 5ABPA 1C5KA 1U5AA 3PT5A 2GD0A 5EXPA 4QDZA 4WOPA 3QJ5A 3E3OA 3EIXA 2MSKA 3GPIA 1ZVJA 4EPVA 5B5SA 1OF1A 2GXSA 2ZAYA 4PSUA 5JFTA 4U8HA 2VP3A 4CKWA 4YCLA 4AJ4A 4XDZA 1RCFA 2PL3A 3E48A 1W0CA 4ZEOA 1FFDA 2PX4A 3UM9A 1P73A 2AQKA 4JBYA 1ZRHA 4FZRA 2CN1A 1T8RA 4JQZA 4YJGA 2Q28A 4DDHA 3UJNA 2D1YA 1WWKA 4YJKA 4NMHA 4CN8A 5I7EA 2BFCA 1TA9A 3L8GA 3R09A 3PX3A 3AUFA 1M1ZA 2FSGA 2I6XA 5JMPA 3KDAA 3D4LA 5CAEB 3QY9A 5J43A 3N05A 5KCMA 5JS8A 4JLDA 1YBVA 4R2IA 4GI5A 4OV6B 2BSAA 3RYCB 1UEJA 1QMGA 1RRFA 1UZMA 2HHJA 2W48A 2SCUA 3OWXA 2Y68A 1XTPA 3G3EA 4HWTA 4OA8A 3LHKA 3OZFA 1UXIA 2GZ3A 1PUIA 1B8UA 3AHHA 3VPGA 1DQPA 4MULA 5HS6A 2D59A 4NK5A 3R5JA 2FUG6 1XRLA 2FDRA 1VHDA 3HDVA 1X3SA 2OEPA 4QJBA 4IVQA 1K4YA 3IRUA 1O9GA 1HORA 5B30A 1GGMA 1HXHA 2OO5C 2W37A 2ZYUX 5T6BA 3QE0A 3GJ7A 1CJBA 4CR6A 4D02A 4CEIA 5CNIA 2C61A 2HRRA 2IEGA 4MLZA 5LLSA 4CHGA 5JAQA 1SBZA 3VR1A 4YB8A 1LPMA 1KDOA 4AY5A 5FQNA 3HEBA 4KITB 2B1RA 4NFYA 2ATEA 1P1IA 2ZPUA 1EFCA 3GQVA 1PSDA 1Z82A 3W06A 3BGVA 2DJ5A 2BFDA 5CB4B 1NQOA 3EG9B 2VSNA 3PPIA 4IZHA 5F9MA 1L4UA 2XE7A 1N3IA 2OZLB 4WLOA 4BFUA 1JR4A 3ESYA 5ER9A 4CT0A 1DBQA 3BSSA 4M8LA 4DTIA 1AMNA 5SICE 4YX9A 5LOVF 1V41E 3O7MA 1KK2A 2LUOA 3VNBA 4EARA 2O4UX 1UANA 2VHQA 1PLJA 2Y71A 3JYQA 4GM4A 2WJZB 1TGVA 7REQB 4CL8A 2P1ZA 3ZQ6A 3LC7O 1DWUA 4O2RA 1WMFA 4Q24A 1C8KA 3F3KA 2PWPA 1Z3CA 3GJQA 4IXWA 3ZWCA 1GRRA 2HRBA 3RROA 2ZRJA 2CT8A 1G8HA 3PJDA 3ACBA 4N0EA 3NHRA 4QYXA 1IEWA 1N9GA 1SRRA 3FKQA 1ADFA 1U94A 4U3JA 4I14A 3N3AC 2YVLA 4HC4A 1VQ1A 1OSNA 2Q3CA 1YKFA 2W2TA 3TQCA 2MSCB 1M3SA 3A3OA 3GW8A 4IEIA 2WLTA 1FTWA 4WCFA 4CRWB 1KYYA 1LI4A 1SXJE 2XBUA 4CQMD 2ZUFA 3O84A 1XQ9A 4YDHB 2GNOA 3AHEA 2AT1A 1H8ED 2ZR8A 3Q3VA 1LSJA 4NBWA 1Z5WA 5JG7A 1BOOA 3FVRA 3OY7A 4TLBA 2HTEA 2OFPA 3CRVA 1BZYA 4EG6A 1X7XA 2PUVA 1SQ0A 4MVJP 2WJ3A 3N0VA 3N2KA 5CX1A 1YRAA 4XGQA 4FXPA 4C3VA 1ZR4A 4U7DA 1GNRA 1U2GA 5JCXA 1GU7A 1KMNA 1XK6A 3T1OA 4BN0A 4I1RA 5KQGA 3DT9A 3AR8A 3RIYA 2FN7A 5E6RA 5TMDA 2B1JA 1WV1A 2QGNA 4I8IA 1LCIA 3QENA 4LDJA 2EP5A 3CO0S 3WRVA 1Y1PA 5FB3A 2ET6A 4IYJA 2VIIA 3SBDA 3R7BA 4EMTA 3OZBA 3U7HB 2XUAA 3D43A 3BTUA 4DSTA 3ZDCA 2BGLA 3F1LA 1QVAA 4DC1A 4ER7A 5HFNA 4C3UA 1DINA 3I64A 4JI2B 5KKNB 5A9SB 1S3SA 4GEGA 3DVAA 5CBKA 2PLRA 2H31A 3IAS1 4QXPA 1JLLB 2O0KA 2OZEA 4AG3A 3E61A 2NZJA 3EXIA 1FDRA 4D81A 1NP3A 3ZZ0A 3H9EO 3DP7A 4Z7QB 2XODA 1Y4DE 3I01A 4FKMA 4QTUB 2BP7B 4L50A 1E96A 3JATA 4H0FA 2QN2A 1RQ7A 3FMPB 4ZK2A 3OLZA 2IOHA 3GXBA 5AKGA 2W71A 2JZCA 2HGZA 1WEHA 2P11A 1VPWA 4OLHA 4KGVA 2WIAA 2CY0A 1EP3B 4NJMB 4S05A 1JEDA 3L0DA 3PEFA 1MH9A 4NE9A 1JHXA 3NOQA 2O6HA 3TR0A 4E12A 1PZMA 2RAVA 3K6RA 3TM5A 1JXOA 3TRKA 4ZTUB 2R8XA 4R9VA 3E3AA 2Q1XA 2VWGA 1CZOA 1TM2A 3AFIA 4CHTA 1JR3D 3SX2A 3HJGA 1CPYA 3RTCA 4EHBA 5EP1A 4Q7MB 2ADMA 4L8GA 1DLIA 3C14C 3AY3A 2DQKA 3P19A 3TEJA 4UW9A 1NFQA 4CGYA 2VA9A 1JHRA 3A7DA 1OYYA 3RAPR 3BL6A 3T3IA 5D87A 5EJFA 3T7KA 4CDRA 4YCMA 3U40A 5KOHA 5C1IA 5KO2A 1XRRA 1GM5A 2CNBA 2YMMA 3PNSA 4LMBA 4XYLA 1FJHA 2VK8A 3T7DA 3CLRD 1R0WA 1EVKA 1YKSA 1EFVA 2C5SA 4N8DA 4KLNA 5JEEA 1K7XB 3B1YA 1DAKA 2ZJ2A 1UMBB 3JWGA 1E4YA 3UAXA 3C7CB 2D4HA 2CNLA 4M1WA 5LZ2A 4NIMA 4D80A 4DCSA 2YVQA 3QVXA 2YJGA 1BDMA 1TU0A 2BE7A 4CT4B 4B8ZA 3ZH9B 4WFQA 4JDPA 4MHSA 1N8NA 5ADUS 2JD0A 3NXSA 1RYBA 3KKQA 4PQRA 4CEJA 4Z54A 1MKYA 4LS3A 3AETB 2OFWA 2I6FA 3BYZA 4KXYA 3DDUA 4JI5B 3ORFA 3S70A 3AU9A 2IZ6A 4TS1A 3AIKA 4HAYA 3PGKA 4W9RA 4WESA 1NW5A 1W2WB 5KU7A 1HDRA 2JL1A 4LF7B 4I4IA 3FTFA 3KYIB 4Q4HA 4FHEA 1FW6A 1SC1A 1I6KA 3IP1A 1C2YA 1GPDG 1UMCB 2HGSA 2P67A 4MVXA 2ZBPA 4O0MA 5ELLA 3TLYA 4RM2A 1JHQA 4N4AA 1WX1A 2O2YA 3BE6A 2ZXEA 4C0JA 1ULHA 1PJ2A 2HWYA 3DDSA 5CH8A 1XF9A 2BHSA 1PQ4A 2HMTA 2Q9BA 3BMCB 3IPAA 3ZHZA 2CXPA 2DWPA 5L8VA 4KWCA 2P5SA 4PYIA 2KQUA 4QZVA 1FOEB 1CV2A 3INGA 4RLQA 2IW1A 3AW9A 5FEUA 2ASVA 2G63A 2DRIA 1UBKS 3OUZA 1MIOB 3ZVLA 5A04A 1XIVA 3HKBB 3VHXA 1NVEA 2P8JA 4BZXA 5HK9A 2ZCVA 3BQMB 3ZDDA 1VJCA 1H66A 1EGVB 2ZRNA 1IPEA 2QYTA 4P53A 3LUKA 4L5IA 3RF6A 5EKTA 2HV9A 1Z5PA 3DC7A 3EULA 1UAYA 2NYAA 2H4YA 3NBQA 3O73A 4HGRA 3ZE0B 3TNJA 5JBIA 2GN1A 1H23A 2FMUA 3RU3A 2P75A 5M29A 2J0QA 4PPFA 1NRJB 5I5GA 3LF1A 3GFGA 2FB9A 5FFNA 5JXJA 1P62B 1V39A 3NV9A 1T25A 2X19A 3FCAA 2OV3A 3UPTA 3IAM1 4MHOA 5DIZA 4KPUB 3REFA 2XYPA 1E0SA 3TI7A 3VR6D 2EWWA 3DO6A 3OOSA 5JH7B 3PCXA 9ABPA 4BQNA 1XXHE 5HCUA 5FV7A 3U3ZA 3MT7A 1E3MA 1CT9A 1DMSA 1TCBA 1XKQA 3OLYA 2ZI3A 3CLKA 3F6EX 5KYWA 4W5QA 1HRDA 1WA5A 5ERGB 1XQ6A 2O3RA 2O3JA 3BB4A 4KRFA 1WKVA 1EGMB 2F43A 3P71T 4I1OA 4KKVA 2REXB 4JN6B 3AUAA 2QP4A 2VQ3A 1MG0A 4R54A 4YN3A 4CEHA 1FTNA 3NAQA 5EP4A 1TVEA 1Z39A 5CBPB 1LJUA 3HI4A 4D5EA 4PIMA 3KELA 2NADA 3TX6A 6LDHA 1A8IA 2GCOB 4G8CA 3VYSB 3KO8A 3EJ6A 3M70A 1L7QA 4UATA 4QJ5A 3ISTA 2FQXA 1GVHA 1UBTS 3DMYA 1Q21A 3ZE7A 2VKQA 1UDWA 4DOMA 2GCNA 2GWHA 2WWXA 3ANNA 1V16B 1J8DA 3GX1A 1Z16A 3Q3GE 3W5HA 4JC8A 4KXQA 3QLEA 2OM2A 3IILA 1SOMA 1W5EA 5KC8A 2G08A 2W93A 2WDZA 3PQ2A 4JEHA 2JI6A 4QGGA 3FJ1A 3UMRA 4L8LA 4C76A 1OXBB 3FHLA 1T2CA 1RLMA 1RRPA 4Y6SA 1VI5A 3I39X 5K0BA 2JK1A 4N3BA 2Y1LA 4YMLA 2H1OA 3LM8A 5EJ8A 2FP4A 5B1HA 1JMKC 4QPNA 1FFXA 1UJ2A 3HZRA 4HJRA 4QARA 4MUNA 4YECA 4EG5A 3Q3CA 4L95C 1B23P 3QITA 1CR4A 3F0TA 1U04A 1RJDA 4BBPA 2J0UA 2IYPA 3ZDZB 1ZCBA 1G20A 2OBBA 4DZZA 1RXIA 3NWOA 3UK6A 3OE5A 3VU3A 4B81A 2WWYA 2PMDA 2FPOA 4HVCA 1O89A 2VAPA 2NQTA 3I2JA 3DLCA 3INRA 1CSEE 3BAFA 1NKTA 2BTOA 3C6BA 3JQ8A 4NDAA 4REOA 4UE3S 4Y6LA 5G0TA 3ZD8A 4AG5A 4RX1A 4AJ9A 4C0SA 4L07A 4ONEA 1KYZA 2NSDA 2YYAA 4MTCA 1OX4A 3G8AA 4YAKA 4U9IS 1YR3A 2ZQYA 3FVQA 4GOXA 4AK9A 4EEXA 4Z5XA 1NC3A 4I3HA 3I53A 5AOVA 5B1IA 4X61A 1SK8A 3E5RA 4R71A 1HDEA 3TKAA 4LV6A 2RAUA 1XCLA 4K40A 5PNTA 4C22A 2HK9A 5JQGB 3ESBA 4F4JA 5AVJA 4DV5B 4J2HA 1YB1A 2UUPA 4JNKA 1D6SA 2C92A 3H17A 3IBCA 3QVGB 4JL6A 2F55A 3HA5A 2VPZA 4XYGA 3FAZA 4XI9A 1T5TA 1QQ6A 1ILWA 1Y8QA 4PYOA 3K3PA 1Z4OA 1FX1A 3AEUB 1RE0A 3WRXA 4QBFA 1HFJA 1TKBA 4Q16A 1YUBA 1XMVA 3TLAA 4BO1A 3QQ5A 1DMRA 1QTIA 4BP3A 4F5YA 1Z6PA 2WJHA 3ESDA 4G8DA 4LE1A 2R6ZA 5CHEA 2WF6A 3DNPA 4M22A 5CCEA 1AN0A 1MC4A 2WG2A 3RSCA 2VNHA 4ZVQA 4GU5A 3N53A 4BFLA 2C57A 1R4MB 2QX6A 1NVBA 4X90A 5JO9A 2R44A 3KYDB 4UEQA 1QMPA 3F5FA 3S1LA 5CLJA 5E0OA 2BMWA 3E2PA 3MWDA 4UCFA 1OTYA 1IRIA 1D2GA 5JNRA 2JLQA 2CHQA 4UE6A 5IRCD 3ZHQA 4DRYA 1BHSA 1OV6A 2AJBA 4AUNA 2NUTA 5DHPA 2M1ZA 1UC9A 1U65A 3E6AA 1VA5A 2GHTA 3CMCO 4O4IF 3Q10A 4QDTA 5EEGA 5GIPE 1FUUA 2HU7A 4QLOA 4XB6B 3MWFA 4D8XA 4IINA 4XJXA 3UW1A 4AWBA 1H9CA 3KB1A 1H0HA 1Z6XA 3X2SA 1UPCA 4M1MA 2EFEB 2XIQA 1YAJA 2ECKA 2GJ9A 3EG5A 5CM9C 3NYRA 3STYA 4UFPA 1PJAA 1RYEA 4TV8B 3CUSA 4AJ1A 2V3WA 1EJ0A 2GMWA 2D2IA 4EYKA 3DBVO 4N9QA 1FSSA 1GL9B 1SPXA 2P7IA 5B3KA 3GPCA 3JXEA 3T7TA 3U09A 4OATA 3WP1B 5FFFA 4RVOA 2HCTA 4RA9A 4NCKA 3VR3D 4GI7A 4GP9A 3U9LA 2DFKB 5JIBA 5EP3A 3NDRA 3UAZA 5GADl 2VJKA 2R3SA 2VWHA 4UUAA 9GPBA 3OPNA 1O8CA 1MU0A 4F9FA 5ICMA 3WMGA 3E22B 3QVWA 5JDIC 1CUZA 1H1LB 2ZJ3A 1PG0A 3PBKA 1FVFA 1MX5A 4MARA 4BTLA 9LDBA 1KY5A 3PC6A 3JAMA 1GG8A 4W5RA 1I01A 1R5BA 1WXQA 1Q6YA 2OGSA 2PAFA 1NUQA 1E6WA 2JAQA 2WU4A 1FLDA 4LYEA 1U6JA 3C6QA 3PRYA 4CMAA 4PONA 1EHCA 5ED0A 2MSWA 3INYA 4UEOA 4HDCA 4I9HA 3SY8A 1KKUA 1WCIB 2CVPA 2J3MA 1G2QA 4HRXA 2VP0A 3ADKA 3WOHA 2GFIA 3PWTA 4FP9A 3LZ6A 4HVAA 4N3NA 3H9BA 4NQRA 1V6CA 3SYRA 4F4IA 3HTXA 1AM4D 4WAUA 1YJXA 2DCMA 4QPJC 2F8TA 2QTHA 4P2GA 3OE7A 5E95A 1QVRA 1LVHA 2N75A 1GTRA 2VPQA 1BXZA 1WZUA 3Q6MA 3TW6A 3OZVA 3OHSX 2GBCA 4GQBA 2PKEA 4JXXA 2FMTA 4OU5A 2R6JA 3M34A 4BFVA 4J4HA 3RRMA 3LUJA 1C7FA 2J9YB 2JJ1D 2JRLA 2OC4A 4PC7A 4X1IA 3THYB 3MWKA 2QQ0A 3ELYA 1JA0A 5EZYB 3KX2A 1Q22A 4C7BA 1GWNA 1F14A 2R2GA 5HR5A 1ZMBA 4JA0A 3AF2A 4L9WA 3CSSA 4B7CA 2Z3WA 2EATA 2JGRA 2YTZA 4K6GA 3PUZA 2PUGA 2FEOA 2NXEA 2W6ID 3N58A 2ZT5A 5KBYA 5A05A 5C5DA 3BHIA 2QMYA 4XB2A 4CDGA 4OHZA 4NBRA 4TXHA 5EIBD 2V6IA 1QE0A 2ODPA 3FPGA 3UJAA 3DFUA 3EY4A 3SHVA 2EKPA 4RQTA 3WK8A 4CFZA 3MCTA 1JYFA 3LVRE 4FOLA 1RHRA 3IBFA 4QU8A 4C4SA 1LSOA 1B0UA 2XXAB 5BV0A 5ECYA 3EZGA 1IK4A 1Z2OX 1DIAA 1C41A 4RC9A 2UXDB 1PRYA 2BFBA 1D9XA 1RS0A 3EEFA 4TKUA 3C45A 5AIBA 4V1CA 4LYJA 2IHKA 3ZNQA 5BURA 6ADHA 2C3PA 5KAMA 1PNOA 3LC2O 4BNYA 1NLFA 3K1AB 3AYXB 3KRTA 5CR9A 1R18A 3MLBA 5HKOA 4N6NA 1CY8A 3G8CA 4NDNE 2VF2A 1UC4B 2CLIB 2QG4A 2BZ1A 1T2FA 1UKCA 3UKDA 2VUTA 2XWJI 2P9YA 1LD3A 3AFMA 3BB1A 3K5PA 5CFQA 5K3AA 4OHOA 3HXMA 3ENKA 2W2KA 5AXAA 2Q3DA 5BSTA 2O5CA 4WL0A 3D1LA 3MWEB 3OQ1A 4S24A 3GMTA 5T3UA 1T35A 4JXZA 1FNCA 2BHLA 3PQ4A 4LV5B 4ARZB 1Y89A 2Y8EA 3OZXA 1G63A 3DVSX 3OIVA 5LPNA 4H7PA 4IGIA 5CLQA 2P0YA 4CQJA 4B4UA 1U3FA 4RWEA 3FZQA 1PEKE 1U28A 3GJ0A 5BV8A 3PEVA 3IL2A 4XRGA 1QF9A 1E1RA 1QO7A 3OX3A 2GWRA 3RFVA 3ZNNA 1M7GA 4A8HA 2CKDA 3BF7A 1E2LA 2E48A 2PV7A 3NH9A 2RGWA 4KODA 2IXGA 5F7ZA 3SFVA 3V8MA 1QU3A 4CLOA 1KFKB