1QCZA

Crystal structure of e. coli pure, an unusual mutase that catalyzes the conversion of n5-carboxyaminoimidazole ribonucleotide (n5-cair) to 4-carboxyaminoimidazole ribonucleotide (cair) in the purine biosynthetic pathway
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
162
structure length
162
Chain Sequence
PARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE
publication title Crystal structure of Escherichia coli PurE, an unusual mutase in the purine biosynthetic pathway.
pubmed doi rcsb
source organism Escherichia coli
total genus 49
structure length 162
sequence length 162
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 1999-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 1qczA00
3KUUA 4YCBA 5CLJA 4GRDA 2FWPA 2FWJA 2FW9A 3OOWA 5CLIA 5BOSA 5CVTA 2FW8A 3LP6A 2FW7A 5CLHA 5CLFA 5CLGA 3RGGA 4ZK2A 5C5DA 3ORSA 2NSLA 2FWIA 2NSHA 3TRHA 1U11A 4ZC8A 2FW1A 5CTJA 4ZMBA 5BORA 2FWAA 2H31A 4YCDA 1XMPA 2NSJA 4JA0A 4B4KA 4ZJYA 1D7AA 3OPQA 4AY3A 3RG8A 1QCZA 2ATEA 4YCCA 5BOSB 4YCJA 4AY4A 2YWXA 2FWBA 4Z7JA 2FW6A 1O4VA
chains in the Genus database with same CATH superfamily
5F77A 3WKDA 4AX8A 4GE3A 4D9HA 3H65A 2HPVA 3ZHXA 5ILQA 4BX0A 4C76A 2M32A 3I34X 1VMAA 2VUHB 2H1VA 3DDCA 1CTQA 1RXEA 5DZSA 2RFLA 1I80A 2ZXFA 2NTEA 4NZZA 1S9DA 4EPYA 1UMDA 3CX6A 1W49A 4FUQA 5EJ6A 4BNWA 3SQOA 3KP1A 3PUKA 1P1RA 1J9EA 4B6QA 1M1NA 1KYTA 4HDAA 5EI5A 1WXXA 2O54A 1JR6A 5LMUB 1ZN8A 2DH6A 2X76A 1E79A 1WMBA 1ZLXA 2XVXA 1DEXA 3IHKA 3FWYA 4OQQA 3LC1O 4LZJA 1ADYA 3P4UA 4G1CA 3VYRB 2QSUA 4PTYA 4BXOA 3R5FA 3HSSA 1UK8A 4UOZA 2VDNB 4NYIQ 1DC3A 4CW7A 2ZYWX 2WNIA 3VGJA 4IHKA 3R6TA 1YRAA 3AL3A 4G5YA 1T2DA 4MWOA 3K0AA 3I9NA 4RY2A 5M29A 2PQ6A 2XYQA 4YUVA 1MR3F 3P32A 1X8XA 3GDFA 4NYMR 2O5RA 1M1YE 2HSZA 3E9MA 2J07A 1SGWA 2ODPA 3I04M 3KXLA 4I55F 2B8EA 5B3KA 3HDTA 3R6WA 2IXAA 4Z4CA 1QG0A 4K9KA 5DTIA 4N0MA 1V9LA 4JQCA 1BHSA 1JILA 3WJ2A 2IZZA 3TEFA 1WNTA 3AT1A 3IDAA 4ZJZA 1SXJD 4AU1A 3ESRA 4B2PA 2YICA 3C6KA 4GS5A 2B2XA 2P90A 3FVQA 1NN1A 1O96A 1H0SA 1CQJB 4TPKA 4J0KA 1XMXA 5FHQA 5C46F 4GAEA 4GYKA 1JR4A 1GTJ1 2YJ4A 1UANA 5U9CA 2G09A 3O4IA 2CFCA 3LC2O 3TRJA 3KSDO 1VSTA 3T0IA 1Z88A 1N3LA 1RTKA 7ADHA 4F6CA 4GICA 2F90A 3D54D 3OCYA 5DW3A 5SY4A 4HGOA 4IY1A 3UV7A 3ZQKA 4AECA 4E2FA 3CCFA 3BF8A 2IU4A 3DV9A 1NULA 4ZVQA 3WQSB 4IAOA 3O95A 2IYAA 1W5SA 2J6CA 3E8MA 4J75A 2ASVA 2VLIA 1GQSA 3CT6A 1BRTA 3TLZA 4BNXA 1RS0A 4EG3A 4CU5A 5CA0F 3REGA 2A2ZA 3AJDA 4L8LA 4RTOA 1I0IA 4C1BA 4MR7B 3IQWA 1YTUA 1IB6A 1IE3A 3ZZNA 3E8SA 3GOQA 4L28A 3Q7SA 4MAFA 1HTWA 1Y4AE 3WZLA 4FTWA 4R6WA 4ZJUA 4ZQHA 1XHEA 5UKDA 1F06A 1UJ4A 1JYFA 3VYUB 1NVVQ 5BRJA 4E32A 2R62A 2C8JA 3DM5A 4PO3X 3T5BA 5HW0A 3D8UA 5CTAA 3AUKA 1WVIA 3C3XA 3HBFA 1Y82A 4X6YA 1G41A 2ABWA 2JAQA 2CDNA 3BL5A 3CE6A 3EIUA 3GJYA 3L02A 3QPAA 4PLVA 4R5HA 3SZOA 2O8BA 4UDOA 2IUUA 1D4AA 2FZ4A 1NVBA 1KJYA 4HTFA 1OX6A 4CV0A 1LWOA 1NT4A 4I46A 2RIPA 2X8JB 5FXMA 3HE3A 1NDUA 1XELA 4BNZA 4E7OA 1U4SA 3CVUA 4HAUA 2O4CA 1XX6A 1T5IA 3ZE0B 5EG5A 4JGIA 3QU5A 3DOHA 4RS3A 1XALA 1RAHA 3T7RA 2CSUA 3EMKA 2I6TA 1PT6A 2Y0BA 1VKOA 4NY1A 3V6MA 4BNYA 2JHFA 1SA0A 4LAFA 4C43A 2C9DA 1AGYA 1A97A 2I2WA 1THZA 2BFEA 2KBEA 1RYDA 3C45A 2XTNA 5L3QB 4OQDA 1XEXA 3M83A 2AMVA 1EK5A 4ZAYA 1T3SA 3ZW9A 2YNMD 3GK3A 1D2AA 3WGLA 5GP1A 2H5IA 2IZ5A 3CG0A 3AR8A 5C53B 3MWJA 3RAPR 1WNFA 3GH3A 5AXBA 1PI3A 2ERYA 2PMKA 4R7TA 4AJIA 3OPQA 1U8CB 3JQAB 3H18A 4ABTA 1K9SA 4G9EA 4AJ9A 4Q4JB 4ZVRA 1SMKA 5I9SA 3VVBA 2DR2A 3V7WA 5E38A 3H04A 1UKYA 2BUBA 3OQBA 2H48A 4Y8VA 1JJFA 1V7PC 2FQXA 3GJSA 4GNRA 4RMJA 5EWLA 4TWAA 2LUOA 2JI8A 3SN6A 1MH1A 1NXQA 1VJTA 2V4MA 3AHCA 3NWPA 4B44A 4QODA 3ZDAA 3B48A 4YP5A 4AJLA 2OHFA 3DOIA 4J0IA 5AM5A 5JZSA 1QPBA 4WAUA 2R48A 2GCPA 4HVTA 2WTMA 4PAWA 1VLLA 1U11A 1AK9A 1OVMA 2FW1A 1AKUA 2RGGA 5C8VA 2NXNA 3O8BA 1V47A 4C01A 4B4KA 2GUGA 3ICOA 2WPDD 4IICA 3MINB 2HXSA 5IJZA 1C81A 3CEMA 1XTVA 1Q3HA 2C2ZA 2J3QA 1XD9A 5G3ZA 3SS8A 1GEEA 2HZ7A 2ZI4A 1DBPA 3V1TC 1AHPA 2EC5A 4LQ4A 1PLKA 2CDBA 5BN5A 2AHOA 1DTWB 5BR7A 5KS2A 2H18A 3SK0A 3CLTC 1JKJA 1GG8A 4EI8A 2JBAA 4CM8A 3WGQA 4DV6B 5BNIA 1CR2A 3LE8A 4OHBA 3AVTA 4GI1A 4N3GA 5AHOA 2OMEA 3ADBA 4NL4H 1A9TA 4WBXC 1SXGA 2ECFA 1G3QA 1K2VN 2I7CA 3C1OA 3WAKA 3OOJA 4TTTS 2UZ4A 1F6WA 2IE0A 3RU9A 3BIJA 2B37A 3TINA 4LWZA 2H7XA 4S1WA 1TM1E 2KI5A 2JASA 3ZWPA 3B1YA 4C7XA 5I7OA 1P31A 3DJFA 3LNTA 1SVMA 1HO3A 1L4GA 5ELLA 4B4DA 4E12A 3SCZA 2FPMA 4X65B 4EHKA 1OI2A 2H4FA 4DLLA 3KO8A 1ZCZA 4ES6A 1WHSB 5JAQA 3U17A 4Q4AA 3WGUA 4N40A 121PA 3BZWA 5I51A 2W2KB 2XOKA 4HWOA 3NEJA 2JLAA 3W79A 2WJJA 4RSRA 1A98A 2SHKA 3O5AA 2DQKA 4E1VA 2X58A 4ZVSA 2VG8A 3QLUC 1I3OA 1O97C 3NC0C 2FTKE 4YMSA 4EATA 4BO4A 1GTRA 4JV5B 4QM6A 2C83A 1CW2B 2Z6VA 1NPYA 4WLUA 5BYBA 3WOVA 4DCNA 3BMNA 4BP3A 3P9ZA 4NEQA 3PP8A 3LZCA 1AV6A 1DQRA 1AQYA 4ZEOA 5KDDA 3PC2A 5B3JC 1CZLA 1FJ2A 1TYAE 2BR5A 5EESA 3Q3VA 3BFVA 4LCJA 3VVLA 3KQPA 1ODFA 4M49A 4UBMA 1MJGA 1UBOS 2NO1A 1OYVA 1J39A 1HGXA 3N8DA 1CUHA 3PUYA 1TPYA 1XN4A 4FIZA 2ZIXB 3K6SA 1OH8A 1QMPA 1MPXA 2P2DA 3M5DA 2CLKB 3RRBA 1T0JB 1BS9A 1DJQA 3VA7A 2JLZA 1X3SA 2VH2A 4KFSA 3SMVA 3ZW8A 3OKCA 3GVPA 4K81B 5K6RA 1Y9ZA 4JHLA 2GEJA 1R5BA 5HK8A 4Z4HA 2EP8A 4HMQA 4LJ6A 1LBEA 2IWHA 1TT5A 1FOEB 4GPTA 4KRYA 4RWEA 1HE3A 4TQ9A 4YRMA 1LZKA 1Z0SA 4JX8A 1TPZA 2PMBA 2PANA 1MP0A 1YA4A 4LSGA 2C07A 3HWRA 3RWMB 1L9XA 1VMIA 1A3CA 1BOFA 4Y9TA 4CU2A 4HUTA 2WT4A 4X7BA 4DGSA 4DLPA 5LMCA 1QO9A 2GN8A 1NJGA 2VAVA 4GBED 2GYWA 4RGQA 4PNEA 1NBOA 3WYCA 5JEDA 2XBUA 2HBYA 5BSWA 5IFLA 1AKQA 2Y92A 1S0UA 3B2NA 3HJBA 3IE0A 5C4IA 4JEHA 5TGDA 2HC9A 3Q7RA 5HFJA 1IQ0A 1E2DA 2JA2A 4AMYA 1AJEA 3BE6A 1S8NA 2O6LA 1M6VB 1GR0A 2V6IA 4Z9FA 3KJGA 1XRQA 2BOVA 5FLKA 1G6HA 3GZJA 1VIDA 4OHCA 3ANSA 2ROQA 1UEIA 1W5FA 1VLHA 4GH5A 3UJ6A 4O59O 4BLWA 2AVNA 4G56A 4JASB 4YRSA 4NEHB 4Y18A 1EFVA 3EVCA 4OXQA 4PBTA 1MORA 3FYDA 2Q07A 1ML3A 1WMFA 1U0RA 1Z12A 1KOGA 2WJPA 1U0OC 4KI0A 4PLHA 3ROTA 1ZGJA 3PQ3A 4CL3A 3SJUA 3I8XA 4WZZA 2B8WA 1NXWA 1E2EA 1D3AA 2O3UA 3M4XA 2EZUA 2HBRA 4FFNA 3BTUA 2W6ZA 4MV5A 4DR4B 3VSEA 4XPIA 1Y8QA 2IXBA 4PYKA 1CYEA 3T1NA 3VJKA 3CJQA 2O1SA 4J90A 1I2BA 3T41A 1BMFA 1EP3B 1J21A 3PGKA 1TDJA 1TUIA 3BE5A 4OO3A 3ZZMA 4W9NC 3NV7A 1AKMA 4DJ5X 3IHLA 4MRRA 2QV0A 1T0BA 4IO0A 4PQYA 4OEHA 4AMUA 3A3PA 3FR8A 3DBHB 3LKBA 3PITA 4LHXA 5MDHA 1YS7A 1TVEA 2A86A 1VSQA 1FX0A 3HYLA 3MJEA 4O4HB 3V7FA 3GAMA 5JCOA 3E3MA 1CU1A 1E3WB 4RHTA 4LE0A 3VU9B 3CVYA 5IVHA 2JF0A 3GMIA 4MW1A 3HVRA 3OESA 5HNKA 1LBQA 5JSUA 4M8LA 4X64B 1VRWA 3DEKA 2XUZA 1SUDA 2IBMA 3KT6A 2XMZA 4V0SA 5B5SA 3MCZA 1Y4SA 1EEHA 2IVFA 4KPEC 1NF8A 4ZCIA 3ZVKA 4C3OB 4KQKA 3RAGA 3ZV6A 2JCGA 2HQ1A 3ER8A 2PRKA 1Z47A 2WQZA 4ND1A 4UTXA 1ZZEA 3DP7A 3H2YA 4LHWA 4ALLA 3AESB 4IDPA 4W6ZA 4HUQA 3MXTA 5I4IA 3UT5B 3HP4A 2QXUA 2W4QA 2UZIR 5JOQA 3K9LA 4JODA 5LLDA 1L7NA 1EM6A 4A2QA 3NLLA 1W44A 4DKJA 2HMYB 2FPGB 3MOGA 4BBPA 1QP0A 4MR9B 4PFSA 1ZD8A 2B3TA 2WSMA 1W0JA 3DZDA 4MRAA 4P93A 4FS8A 4TKLA 4YDRA 5H9VA 1R8SA 3O0DA 4K0RA 1WCYA 1PD1A 4G1BA 1NR7A 2F1JA 2JB9A 3DFIA 1UBNA 2Y2VA 3RRYA 3O8QB 1D7OA 5A03A 2GZ1A 1W96A 5HA5A 2HFJA 5AK3A 2PKYX 1U9CA 1T13A 1A7JA 2BELA 4IDDA 1OW3B 2VYVA 1D4OA 2X2OA 3PUJA 1PTJC 4KKVA 5KNBD 4F3TA 1M2HA 4UNRA 1NVDA 2Z1MA 521PA 1PJCA 2EOAA 2J5BA 3K94A 3ISVA 2HU8A 2REQB 5FULA 3R41A 4PZ0A 3GEEA 2GM5A 1U1EA 2XUAA 3LYAA 3NWEA 1WSAA 4HQKA 2QUJA 4K87A 4PVCA 1D1QA 1K3FA 1RQNA 2A1IA 3CF6R 4ANFA 4GI7A 4LRTB 3BGIA 5HKKD 3H99A 4IKPA 4U2BA 1N6IA 5CGZA 2GO1A 3E5HA 4R0NA 1Y6RA 2HK6A 3A4MA 3DZ8A 5B1DA 1TE2A 3SEAA 4BP8A 1CUUA 3OSZA 2X5OA 2QTFA 1GVNB 3I32A 4DIFA 5IDQA 1I1NA 3IIIA 4O2BB 1U3WA 2ZGVA 4M89A 5DTJA 3RYFB 3WFJA 4E09A 1U3CA 2V1XA 2BHLA 3BFPA 5BNWA 1C3JA 2DFVA 3BPSA 2YWDA 1W9MA 4L2IA 4NENA 5M3BA 3X43A 1SUIA 5KWJA 3EGCA 2YV2A 3CZ9A 3F6RA 4D79A 2WWFA 1HWYA 5B36A 2DLNA 3EC7A 4MDYA 4UM9D 4I08A 3HA2A 4EWLA 1P9LA 1VJDA 1NWCA 4PYNA 4YRLA 3RVSA 1W4AA 1Z16A 2PD6A 4B4UA 4IDQA 4CV1A 2XCQA 2JDID 1YZGA 4MUEA 4BLQA 1HDEA 2Q1TA 3PGA1 1J2UA 4QYSA 1YZHA 4TYNA 1RRMA 1LPSA 4XCQA 3OPXA 3EFEA 1VE3A 3GDOA 4X5OA 2YFKA 3G0BA 3DFMA 1W0CA 1KIAA 2QW0X 4R1TA 4DA0A 1ZI8A 3TW6A 4BJ1A 5HK9A 4LGYA 2PUDA 4LZLA 2MDTA 2DRIA 1JT9A 2VCYA 2VDVE 3O6VA 5AJHA 2F8TA 2LKDA 1G42A 2D1SA 1X70A 1JZTA 2Y99A 2ISSD 2WU0A 4FYJA 2VHYA 4XVUA 4UBIA 1OZGA 2BFCB 4J1TC 5AESA 1U2ZA 4X8MA 4IJKA 4NH0A 4PBRA 3I1YA 3WGMA 2LBPA 2VVTA 4YCJA 4C3VA 4DY6A 3QH4A 1KAHA 1A4UA 5CFQA 1DS6A 1BQ3A 4KO1S 1BYUA 1IB0A 1V5FA 4IZOA 2F7SA 1ZCFA 1E98A 1W0KD 5D5PA 1J56A 5J1SB 2AMJA 3LLVA 3AETB 4FFBA 2X23A 3DXXA 2O1EA 5FBVB 5HM6A 2QJWA 1STOA 3ZNPA 2NUPB 1L8OA 2PKXA 5BV8A 4JJ7A 1KL7A 2J3KA 5I47A 3ELBA 4IIDA 1GYPA 1NV8A 3HKCB 3CLUD 1FLNA 1GUAA 2YW9A 4CLOA 4U0JA 3KDAA 1L5NA 5LM3A 4NHOA 2V0CA 1BWQA 1CQIB 2JFBA 2IYLD 3DEHA 1EM8A 4YX9A 2D4AA 3Q3CA 5FIUA 3TS1A 3DYIA 2LDXA 4GE0A 3RYIA 2QUZA 3WNQA 2AMFA 3NCHA 1Z17A 3H5OA 3RK1A 2ALJA 1L5QA 1P2GA 1LUAA 4DLSA 2GKSA 3A4IA 3D6HA 3DVQX 3DZIA 3INYA 3L6CA 2GK4A 1BOOA 4OUDB 3MG9A 4QGGA 3S2EA 2X0IA 1W76A 2AI3A 4B9EA 4C4SA 5AKKA 1VDZA 4E6PA 5C7IO 2DQSA 1U4OA 1CQWA 4L9WA 1KVRA 4J0GA 3TTUA 3D6UA 1Y1PA 2FX2A 3DLCA 4AN0A 4ATNA 4EZIA 2HRRA 5HJ7A 2ZI3A 2YIVX 2IQ5A 4GZMA 4MYHA 5KDLA 4M1MA 3AM1A 4P4SA 1ZHHA 3VZRA 3V33A 3IP9A 2FEPA 1LSUA 4XD7A 4QXMA 4HDNB 2IVZA 3IO5A 4EW2A 2PUTA 3F97A 1XV5A 4TKUA 4FWTA 3NWJA 3WLNA 4Q82A 1CHNA 3QRWA 5EE0A 1MQAA 1Z62A 1L7RA 1JNXX 3NB0A 4GVLA 4DDKA 3C1AA 4O4HF 1LVHA 2QZZA 1EK0A 1HLGA 1NZJA 3BYZA 5KJ1A 2M1ZA 1Y48E 1UFOA 3UFXB 4EB6A 2PU7A 3CUYA 4HRYA 4C0XA 3JALA 3PR1A 3GQBB 3VHXA 3AVVA 2UZAA 4Q7KA 3NMUF 2OK7A 4URFA 2PKWA 5DF1A 3OZVA 2ADOA 1GT91 1LQ2A 1RXSA 2E4YA 2CDRA 3A9SA 3CBQA 4TRMA 1P7ZA 3UM9A 1LPNA 1R2QA 2X6QA 3R3JA 4GZ5A 1DJPA 1XMVA 1MF7A 4RMIA 4YJFA 5EHNA 1Q21A 5K3CA 4QYIB 4YAFA 1FFAA 1T5TA 4NPCA 4DB2A 3VDXA 3S2ZA 6REQB 4CGYA 2QV7A 3Q7EA 4AJ4A 1L4BA 3BH6A 3HCNA 4DCTA 4EUKA 4IZHA 4LY6A 2YJ3A 3KQVA 5BMVF 4BRWA 5IRCD 4FJ2A 1NR5A 2YRXA 4M37A 3W1WA 1N36B 1KA9H 1R6XA 1R1DA 2GAFA 3A3YA 1Z4JA 4PU0A 1JVNA 1RYHA 4PIVA 1L7AA 2VHVA 4H6WA 4DREA 2ESRA 3IDQA 5JJLA 2W2QA 1FTSA 2VH5R 4HWSA 4ND8A 3SY8A 4LF7B 3C6BA 2WYIA 2ZQZA 2YN2A 2W8BB 3GPIA 1ZM9A 5AQ1A 4I9NA 4IGIA 4K3VA 1YR2A 4D0NA 4KE7A 5AIAA 3DLAA 2WP8J 3NP7A 4JYMA 4OHXA 3ZVNA 3NIFB 5BN4A 2HOQA 4CT4B 3CZ5A 3P0EA 3TOXA 4B6PA 1PLJA 2V59A 4A6DA 4AG6A 3VZDA 1P4SA 1ZMOA 1UOEA 2FSFA 1ZS9A 3LNCA 2ONCA 1PYGA 3E7XA 3SYTA 4HDRB 4QIHA 2QJTA 2FRVA 3M1YA 4G5HA 1XLVA 3CF0A 3P2MA 1GXSA 4LOJA 1NZFA 1U6JA 3A6FA 1YR6A 3RK4A 2IV7A 3ZI0A 3EZFA 2QOEA 1L6RA 2GFIA 1ULUA 1H22A 2REBA 4MUJA 1N2EA 2RAVA 3PC8A 5CA0A 1PR0A 1RFLA 2CBXA 2D2XA 2EL7A 4I1OA 4AWAA 1QIIA 2GVDC 5CJPA 1SN7A 4HLDA 4LWOA 4P31A 4ZQEA 2PN1A 4M55A 3VFDA 4GG1A 1ZWLA 3ZVMA 4K9SA 4QQRA 1XEWX 2F3QA 4DJFC 4O2BF 2PT9A 3QF4B 2UYYA 4RKQA 4ZQBA 4ZA2A 4KO8A 4GGPA 1TMKA 1Z5ZA 4Q4HA 2O8FA 5E0OA 3KVNA 1MQSA 3OX4A 4R1QA 1W4LA 2VIIA 5C3MA 3CNOA 4KQWA 3SJZA 4YXWD 2GAIA 1AC5A 1A5SB 1EGVB 3ZJ5A 4KIUA 2I55A 3ZGOA 4KGVA 1J2RA 5AHKA 4PF1A 1VC2A 1NMSA 1E1QA 1YZKA 2DQYA 4WV3A 1ZH6A 2HSWA 1P39A 1SKYB 2AG5A 4N3AA 3TOZA 3GRKA 2W7TA 4HJRA 3GPCA 1RYZA 3OLWA 2FR8A 3Q9UA 4HX2A 2Y77A 4L8VA 2G67A 3M5WA 4MICA 1KBZA 1E7QA 4UHDA 3L8DA 3U1VA 3X44A 5F7OA 4ZTZB 4AI6A 4G0VA 4QFDA 1MZVA 3AUYA 3B2QA 4OPMA 2ZSHA 3QNMA 4TT3A 3T1VA 1QF9A 5BVGA 4R1OA 1RVDA 5BSKA 3FJ1A 1VJ5A 3LOUA 2GO7A 2QPLA 1IC6A 1GG5A 2AZMA 1KRXA 1IHPA 3EZ9A 3F9IA 2NSJA 3I28A 1WSDA 5CHEA 3LKZA 3RHFA 5HEKA 4C89A 4INJA 4G37A 1GPUA 4QELA 1XF1A 2WJGA 1GFWA 4KQCA 3OF2A 3P5SA 4AXXA 3BBLA 1UAYA 5DBFA 2C7VA 2JEYA 3EVZA 3LC0A 3QVKA 4AO6A 3SXJA 1P6UA 4WK4B 1SUAA 3OEEA 5IVPA 3OVMA 2JIPA 3OT5A 1B16A 1XT6A 1XHLA 4ZKDA 1QRRA 3VC3A 3RB8A 4YV1A 3OQIB 1EQUA 4ITUA 1FQOA 3RUCA 3WBJA 2BM0A 3QEMA 1QXSA 4JJEA 1A95A 4NYJQ 4BVHA 1WZ2A 4PYJA 1HDXA 1R3DA 1MO6A 1CG6A 4FEAA 5JXGA 3WFZA 1MAWA 2ACKA 4C4TA 1Q2XA 1EDEA 4V1CB 1YK1A 4HK4A 2NMVA 1XPJA 5B58T 1GZ3A 3HSKA 4JJAA 3V8RA 5EEGA 4CDMA 2AI2A 5JJ5A 2LR0A 4YY3B 4BLOA 1E0SA 1WOMA 2B9EA 4HRXA 3R9XA 3BREA 3NVAA 4JQSA 4B71A 3MWKA 5BW8A 3ZJUA 1J42A 2FPKA 3FUTA 2B8JA 4FBGA 1AQUA 3ASVA 1P6XA 2P0AA 2B2CA 4W9RA 4AZ0A 3BTSA 2G71A 4AO8A 3EGDB 3I6IA 4GXNA 4DA7A 3S2GA 1GSHA 5JDCA 2MSCB 1X1RA 2WAAA 3P19A 4G23A 4UHKA 1P3JA 1VHLA 2HRCA 1IN5A 1GADO 1XCOA 1NE7A 2DUUA 3AB8A 2B25A 3OE4A 1XVTA 1O0BA 1KI3A 4BCBA 2Q7DA 4P7BA 2Z2XA 1PJRA 3HK2A 1G5FA 2QM0A 2BAGA 3TMAA 3LXRA 4H6VA 1JAYA 3LSYA 1QK5A 5AM3A 3DCIA 2GUWA 4BV2A 4CLRA 1CQXA 2EJCA 3R3YA 4UBKA 3AU8A 5CH5A 1KJJA 5AI6A 3REFA 1Q0TA 1G21A 1LCIA 1F0NA 1RQXA 2HY7A 4KVFA 4MP6A 2DUMA 3UK7A 4DC0A 4E5NA 4QAJA 3OU2A 5BQ3A 1E5LA 4PPFA 1DIBA 4G89A 1AQJA 3H9JA 2NO7A 3PENA 1UBEA 5AVYA 2RJNA 3CV3A 1OLOA 2HK8A 4LC1A 3TLEA 2VZLA 3BX1A 1LLFA 3KYJB 2IKSA 1H0KA 4Q9LA 3AV0B 2FUG1 3G9XA 1BE8A 3EG5A 3O8NA 5I7RA 3SFTA 5GJWC 5JVDA 2CB0A 4PR0A 3IL2A 3PA8A 1PNVA 4P81A 2XXAA 1KYWA 3DTVA 5FUYA 3GGSA 2R97A 4L5IA 1W5AA 1AY0A 1DJLA 1U9ZA 4C22A 1GQQA 2PYIA 1V45E 1QLJA 4QRHA 3WP0A 4ENVA 1NXPA 3AK4A 3Q0TA 4J1NA 4LKRA 1A9ZA 2ZAYA 3IO3A 3F7MA 2FGJA 2HZBA 5AHXA 5A9TA 2O2CA 4F8EA 8ADHA 4GECA 4OI4A 1FRVA 4NTZA 1KEZA 1X42A 1XEXB 2XF8A 2O57A 3E6AA 4G07A 5ALGA 4CL0A 2IYQA 4GIBA 5KC9A 3GDHA 4L3OA 3D6VA 3M49A 3NX4A 3GGPA 2PRZA 2FKAA 4JCOA 4S12A 4ETMA 3FTEA 2HU7A 1QYIA 3KOYA 5EINA 4B4VA 2N3ZA 3WGZA 1GPMA 3BOSA 2FK7A 1F3LA 2V9PA 3ECCA 2JLYA 2IW3A 4HEA1 1NW7A 2JLCA 3CJTA 2ZIVB 3OEHD 4ZV4A 4FSXA 2I7XA 3O82A 2Q5CA 2PGOA 4MWBA 1ISHA 1DIHA 3HB5X 3KXKA 4IF6A 1VCMA 5DSXA 1DAHA 4L74A 1JDJA 3TAUA 4EGJA 1KFBB 1R18A 1Z15A 4AUKA 1D1SA 4ZWNA 1T2FA 4TVSA 1SHJA 4DCCA 1OB2A 1M54A 2EYQA 2AXQA 4KXWA 3W7AA 3FNIA 2VHCA 4X93A 3SKXA 4AJNA 4E14A 3FI0A 3FOEC 4PZAA 3DE4X 1J22A 3KB8A 3P0JA 4F5YA 1X1CA 3BMCA 3OICA 1ULAA 2VYFA 3KKEA 2YVUA 3KTDA 2ZM6B 4HY3A 2FE1A 2IH2A 1V8OA 4LF5B 4XTRA 4D8WA 2CXSA 5K0ZA 2A0KA 2AN1A 4RIGA 2AWNA 5DCWA 3UBMA 1LFDB 1GHTA 1Y5IA 1DELA 1TU0A 3BK1A 3KYDA 3KZCA 3LRPA 4B9AA 4B6FA 3FHCB 5KYXB 1JKJB 4KPUA 5K0GA 2RGBA 1EJ0A 1G7RA 1N7HA 3KKMA 2RSLA 6Q21A 2C03A 4YRKA 3ZWOA 4XQ9A 1QQ7A 2BUCA 2OO5A 3VZQA 3ZZUA 3GEBA 4TLAA 4K9RA 5JZMA 4D25A 3PE3A 5FLEX 1EUDB 3O3MB 3OX3A 4WNIA 3MGGA 3JR3A 7AT1A 3M3PA 1IHXA 1PSZA 1KWGA 5E6UB 1TD1A 4GZ6A 2PSFA 4CKYA 1UC8A 2ZTHA 4KEAA 4F12A 5F2KA 4HZIA 1PS9A 5JPCA 2RHOA 2YMQA 1DLJA 1VE1A 3ONVA 1W2HA 3ASUA 4RXTA 3LDHA 1OA1A 1AIPA 4MGKR 3PK0A 5ALIA 4Z4QA 2X9QA 4G0ZA 4JKOA 1AB5A 3DXYA 3A0RB 1OXKB 5LB2A 1JSZA 2V3CC 1L5GB 3PNKA 2F4VB 4HH3C 4AJEA 3KTAA 4J8PA 5JYBA 2J4FA 3KVRA 5K9ZA 2NZUG 5CURA 2G80A 2G8LA 5FLXA 4JBIA 2FSUA 5HKOA 1W88A 4R8MA 3Q8LA 3ILHA 3HKEA 2F55A 3HZZA 3B3JA 3I2GA 1I51A 4L5YA 3KL4A 4OK6A 2AQKA 2BGLA 5BT9A 5GJVC 1RCUA 2XQVA 4RZUA 2O8CB 1D2NA 4P2GA 3BMXA 5H3HA 1E9DA 2GCOB 3GCGA 1SB8A 2OHVA 1SIWA 2RH4A 4GZLA 2WJYA 3JQGB 1CEXA 5JCOC 2IIVA 2PTGA 1YS1X 3AR5A 3VR6A 2D0OB 5KTSA 5CD1A 4C04A 4AD8A 3RUFA 1Y9AA 3DR3A 3ULKA 3TLGB 2YY5A 2VHEA 3JD1A 3O9VA 2J8ZA 4GT1A 4M8SA 3E7DA 3SVLA 1NQUA 1PL6A 2W6PA 1H4TA 2XB6A 1U02A 2XE4A 3HXPA 3BFJA 2QXTA 3Q85A 3SZRA 3LT5A 5JXIA 2W22A 1P0MA 3IQFA 3PB3A 1XP5A 2FQQA 2WMDA 3LDGA 4IDAA 1U7OA 2CV1A 3AYZB 1QHNA 5IZCA 5DIZA 2DFNA 4BAUA 2UXDB 1T8UA 4KQ2A 1PS8A 2WFMA 1F2VA 2OCXA 2R68A 3DAFA 2NUTB 3BVPA 2IXFA 3VAZA 5JY6A 9LDTA 2I2XB 1MJHA 5A3SA 1R6UA 1SOAA 3P9KA 5COQA 1QX4A 1R5OA 3TUIC 2G9UA 1Z73A 5TY0A 5KSOA 1SC4A 3PI6A 3FTPA 1BGVA 3DNFA 3O7MA 4FFVA 2VI5A 4EPTA 5KQLA 4S0XA 2GPBA 4BNFA 1G21E 2AUMA 4S2UA 3TN7A 5L3SA 5FI5A 3V3KA 1QRDA 1YC2A 1VBMA 3CKYA 2EJUA 3RWBA 3UUEA 4EGFA 1N5JA 1OI7A 1QX3A 4Q3CA 4RY8A 3S2FA 4DV2B 3LQ1A 2R8OA 3HA5A 1A4IA 3SM3A 4FSHA 3QELA 5FRDA 1GCOA 4F93B 1JHZA 3EQ7A 1L0BA 5CA1A 5I7FA 3EDRA 3COWA 1C4OA 3KWFA 4R8LA 4H6PA 2UZ1B 4LYYA 1I7QB 1SBZA 2Y9PB 2IYXA 2DJIA 4M9XA 4DN6A 1MTOA 1KAQA 5JW6A 2PGJA 1OYWA 2VXOA 1SBCA 4Q02A 2VJPA 4NZOA 1ZHOA 2SBTA 2FEOA 3C7KA 3PNPA 1PYOA 2DY0A 4YRNA 3CU5A 4R9VA 1JBKA 4XPIB 4LTNA 1I7DA 2BP7B 3GUVA 3RBXA 1E64A 3FKQA 3HL4A 4QGAA 4QJBA 2QF7A 1COWA 5IU6A 2R66A 3COPA 2IC5A 4FJ0A 1QGED 3K1TA 3ITDA 5JJKA 1G2QA 2G4LA 3W5IA 3ZDCA 1LU9A 4DSTA 1K7YA 2ZIFA 2CVQA 4IJ6A 4PPYA 4E5YA 5HQ3B 1I7LA 1ST3A 2GN9A 2GZMA 4L5JA 3DMYA 8GPBA 1NDHA 2IHZA 1L5YA 1XHFA 2XMDA 3AFNA 3GV0A 2FR1A 4FBLA 3JASA 3SHTA 3IELA 2CN1A 1RCFA 2DBQA 4FHFA 1ELOA 1JHPA 1NLFA 1X7DA 2JCYA 2HX1A 3ZYCA 1HXHA 2GAOA 2L17A 1OGYA 2ZKLA 1Z26A 4MGZR 1RACA 5B2FA 4Q39A 1P5HA 1ZD1A 3KYCB 3O2NA 3P2OA 4OF4A 4B3HA 4ZCLA 2FFQA 4EG1A 1Y9DA 3L5KA 4QBIA 3R7NA 2GARA 3SMQA 1R4NA 4FNGA 4KC0A 1NTOA 2OBNA 4MEBA 5CLJA 2ANCA 3R6GA 3LPMA 1D8TA 1SVSA 4NU5A 1L5ZA 2AR7A 3SX4A 4BQSA 4E7PA 3WO0A 4ETNA 3NUQA 4QJ3A 1RHJA 2FUKA 5CYFA 2B78A 3D6MA 1NVXQ 1X39A 3O4VA 4YJ3B 5G1NA 1W4ZA 3UCFA 4RHEA 3OJOA 3EA4A 2VQFB 2HLDA 4N5MA 3GN2A 1SAYA 1RRKA 3O9MA 5IH7A 4YJKA 5I9LA 2PIAA 2GXAA 4YYEA 1C1XA 3I39X 4S04A 2J6HA 2PJZA 1P4HA 2H3EA 1SD1A 3HRHA 3E9RA 3NHPA 3W5CA 3L1VA 1XLWA 4IGEA 2JHGA 4V38A 5ETJA 2IY7A 3BIWA 3TLMA 1RMTA 4REQB 4EA9A 4MS3B 4UCWA 1OXXK 4DARA 2OD7A 4JJGA 4ZRDA 5FBRB 1I0LA 3DLIA 5HF5A 2IDMA 4OHMA 1E96A 2ECQA 2GBLA 4X7PA 3U9SA 4WADA 2MINB 1EWTA 4QUAA 1WDMA 1J07A 3HHEA 2VK8A 1QC5A 4K86A 3W04A 2B4KA 5TPZD 5L4NA 3MXOA 3FKJA 2Z4TA 2PO7A 4LK3A 2BISA 2QU8A 1WOYA 2IX3A 3CF4G 1FFYA 4JB8A 1FUKA 4D2IA 4N41A 5HHTA 2PH5A 3L6BA 1MA0A 2C5HA 4I5FA 4GD3Q 3YASA 1Y1KE 2C84A 1GGVA 4OVKA 4GOOD 3KJNA 1ZU4A 3T3DA 5HDBB 2CE7A 1KYIA 1RRCA 1DL5A 3SQXA 3IRUA 2H8KA 3D1VA 3UWOA 4CKWB 5C1PA 4WXRA 3CNEA 1D9XA 1ZKDA 1OH5A 4A36A 2WJAA 1DU4A 1DOZA 1A69A 1GITA 1HMYA 2A1TS 2YN4A 4L2IB 4WNYA 4GRIA 4C6TA 1R6VA 5JBQA 1NY6A 1JDBC 1SM4A 2QTCA 5EL0A 3VO1A 5B4VA 2BGKA 1QBKC 4AAYA 3KVOA 4F2WA 2OQIA 2Z4SA 3LL7A 2OBXA 4GC9A 4LHYA 1CB7A 3AEYA 2CKDA 4HNGA 4PPNA 3U60B 5C18A 2FAXA 2XKKA 2QYTA 1EJ6A 1RBZA 1RADA 4RF3A 4UEOA 1GVHA 3ZHSA 1JEQA 1DIGA 3WL8A 4D92A 1X1BA 3PA6A 4GHWA 4WEQA 5IH3A 4ZGGA 5BMVA 2Z08A 3BB4A 4CTKA 4MKIA 1CZKA 2OGSA 1RPJA 1Z9BA 3F7TA 4EUNA 4RKYA 3AEZA 4MB0A 4A8JA 1PGJA 1EFPB 1KS2A 3OKAA 3BHNA 3IGFA 4JT9A 5DHRA 1GNLA 4Z3OA 4NZPA 1K5PA 1TCBA 2YV1A 1P2UA 5ALWA 1C50A 1ZCBA 3RSZA 2JGDB 1EB8A 5T67A 1EFAA 3I4FA 1UJCA 4Z1MA 4P0QB 5TQ2A 5TQ0A 5EGSA 3BWCA 1PU2A 5CP8A 2IYNA 3ZE7A 3KB6A 4QU5A 3Q3GE 4MQ5A 2ZITA 2VBGA 2R1ZA 4EB3A 1SFRA 3U4IA 4JOBA 2G9QA 1F0KA 1BCRA 2HSGA 4M1YA 4O8ZA 2SKDA 5AHRA 4ZAFA 4FKBA 1XZBA 4BFUA 4DA6A 1W94A 1YI8A 2DPGA 1PJQA 3RSHA 2KJQA 3LPDA 3V8PA 1QFJA 5DP2A 4KN6A 4NBWA 4ILKA 1KE2A 4EEXA 5JCPA 2EFGA 4NDNE 2EQBA 5DHSA 1CY7A 3TQCA 4KWHA 2EEPA 3T4XA 5CT9A 4FDVA 3UG6A 1MHPA 2Z5FA 3HGQA 1OC4A 3C6ZA 3CTPA 4LHZA 2VJQA 1PG5A 4GWLA 1GO2A 4JLBA 2VP6A 3NRJA 3F4KA 4GGMX 7GPBA 3NPMA 1P7WA 1KZ4A 4O4IB 4PSKA 1L8AA 4RE5A 1TJ5A 3GRCA 3ZPXA 4ZIRB 4WZBA 2P6RA 3WXMA 1XCGB 4MHSA 4YRAA 1RJWA 3AC0A 4REOA 5LP6B 2XVYA 2YVAA 3HEMA 1WW8A 2XNKA 3THWB 1NVTA 1SK9A 5J5CA 4OOFA 5LL6P 1B6TA 2HDHA 3H1PA 1QK4A 1F4LA 3PC8C 2QUIA 3DPSA 1NUHA 1Z33A 3WRYA 5DNYB 3CSUA 3DL2A 3K9GA 4Z49A 1LBIA 4BO8A 3VVMA 4QATA 1JDBB 3G79A 4XX1A 3NBFA 4BZZA 4RENA 2W6QA 2VP0A 3F46A 3M4JA 3NHFA 1GR1A 5HKLA 4D4MA 4HDMA 4QJIA 5HGXA 1RWXA 1ZZGA 4ZK2A 3KAKA 2O2SA 3USZA 5KDOA 2I54A 4DV7B 3SFVA 4Q6BA 2VNSA 3H2SA 2XIQA 1QVRA 2H5LA 1XWFA 4RTMA 1KBQA 3OX2A 1QHXA 2E85A 3RC2A 2A1UB 3WTBA 4G9GA 4EB6B 1S89A 3AJRA 5AKLA 3ZDFA 3VHXB 4DADA 2IHKA 3PNLA 5C80A 1I33A 1WF3A 3I04A 4UVEA 1OWNA 2XT6A 4RSHA 1WHTB 3Q5EA 1Q1ZA 2ZI7A 3AR3A 2HRDA 3D3WB 1KF0A 4PRZA 3SE0A 1NNUA 2VBFA 4QPZA 2FR8C 2BZ0A 2IUSA 5HMLA 3U7EB 4OHWA 3ZOZA 1ZM2A 3EXG2 4A6XA 2CJPA 5LFAA 1J5PA 5KTYA 5HR5A 4ZRNA 4YDHB 5TE9A 4HNVA 1G19A 5BQXA 2WEKA 3ZKWA 1XQXA 4D0RA 4CL2A 3ZHRA 2XDYA 4GKKB 4GLJA 1IAVA 1NMQA 4A1FA 1WMDA 1N3IA 1QV6A 3PNSA 2A9PA 2O14A 2FY8A 4BEBA 2HDNB 3TOVA 4E4RA 2R8EA 4C7OA 3MELA 3D0QA 4EO7A 3I72A 4YCNA 2XX3A 2OV2A 3JVEA 3Q8XB 3IC5A 1GV0A 1K9VF 4UW9A 5C81A 1KGSA 1DPGA 4JA2A 4E2YA 2VHZA 5DTMA 1L3IA 1P77A 5AO9A 5HG0A 1XZAA 1AURA 2IQIA 4Q47A 4JYAB 1VJCA 1KJNA 1ZQ9A 2WUGA 1U1FA 3LCRA 3RFUA 3S27A 1KY5A 1Z4PX 3UJ7A 1QTIA 1HDOA 2ZJAA 2WR8A 2QMYA 3HO8A 4JP3A 3VM6A 3SDBA 4PAOA 4MW2A 4RESA 3IFSA 4IILA 4FS3A 4OY3A 3KWJA 3AO0B 3TLKA 4EPRA 3IQXA 5AW6A 4BASA 4JUIA 3EAFA 2C9BA 4YJ2B 3K9FC 2E1RA 1C7FA 1L5VA 4LISA 1TCAA 3UW3A 1M8GA 2JAXA 4I5IA 1W36D 1J5XA 3AF2A 5KQMA 2WA1A 1VGRA 3ZD7A 4FDLA 5G1OA 4EJ0A 1T9DA 2KX7A 3O31A 4FOOA 4KKXB 4YROA 3UB4A 2R7LA 2AFIB 1DC5A 3A58B 1FYVA 3EARA 1BE6A 3UAOA 2C42A 5JDCC 2OCBA 1F1BA 3O8DA 5L4SA 3VZPA 5DM70 4V39A 1ORWA 1XZCA 3R40A 1X7WB 3L8CA 2I1VB 4URWR 1GYQA 1ONNA 3SZMA 4C5CA 1G1MA 4A27A 4DABA 4LDNA 3MJ4A 4BU0A 3BGOS 4XLLA 5GIPE 1HT3A 2VDLB 4OH7A 3P8ZA 3TDNA 1OXUA 2ZRJA 4Q1AA 4FQ8A 5JNRA 4JI6B 4CCAA 2RHGB 3BIFA 1SQGA 3UMCA 2HXYA 4PG7A 2Q3LA 1U9IA 2R85A 3QENA 4RQAA 4XGNA 4RMGA 2C7OA 2NN3C 5I5GA 3B51X 1II8A 3C3BA 4O2LA 3WMWA 5BXYA 2SCUA 3QUQA 3NFRA 3VZBA 3DDNA 4MKFA 2EX0A 4B46A 3QIVA 5ADHA 1SKUA 4HDKA 4O0MA 2J30A 2OYCA 4ZQCB 3TSYA 3UAVA 3UUWA 3W2TA 2GSDA 4CKEA 1AMUA 3COJA 2QRZA 1JG7A 1HKHA 1LC0A 1E59A 3CUTA 4DLAA 1IEXA 3ENWA 4M3NA 3P4XA 1P29A 5H4GA 2VNJA 5DM4A 5A3QA 1G6Q1 2QTBA 5LBTA 1DLIA 2V6BA 3H84A 4F21A 5A04A 3L07A 1SIBE 2G0AA 2P5YA 3W1EA 3QX8A 3CO0S 1U7HA 1Z6ZA 5KMGA 4CEIA 1WV1A 1OFUA 3AWIA 1YJ5A 2QTVA 1XZKA 3BKXA 3D2BA 3GJ4A 4RPHA 3RQSA 3WWPA 5LYJB 5JJIA 1RWKA 2B8TA 3L18A 3OLVA 4URUR 3TSOA 1TJYA 3UJCA 4D6XA 2WG0A 3TGLA 3KU4A 4XWGA 3IUBA 2ZU6A 2C9ZA 3AL2A 4DLKA 3ZN2A 4HWRA 4JT2A 1D6SA 3GYGA 4QE3A 3PD7A 1AKYA 1UOOA 2P3LA 2HHJA 4KLZA 5DLDA 2QSJA 5IAKA 4BQRA 4V1CA 1BVUA 1KYQA 1OFHA 1PR9A 2FHPA 3FWNA 1T25A 4TSFD 3F2IA 1XJCA 2H2AA 3HJRA 1QH0A 3RABA 4BZPA 2A35A 4CMAA 5LSAA 3UN1A 4O4IF 1RI5A 4WZBE 5FO1A 4K03A 5CX4A 4YAJA 1GU1A 2UVPA 1PV4A 2H57A 2BRUA 3QTBA 2M6LA 4BLRA 3AHJA 2Q6KA 1NP6A 3ZZ0A 1M1UA 1XRPA 2BTQB 2OCLA 2WG1A 4Q93A 1QQTA 4AF7A 1M2WA 5MN5A 2AS0A 3EPLA 3Q4GA 3AUAA 1OFUX 3H8SA 3UK6A 4TGLA 3LAWA 4BKRA 1Y1QA 3QMVA 4PO1A 2QY6A 1PNTA 4IEEA 4CLRB 4E13A 1N0IA 1QANA 2PH1A 3RVOA 1AS3A 3H4MA 3TZCA 1NUAA 1OAAA 2FOLA 1GGKA 2V7UA 3QKRA 1ZONA 4TMXA 3MJSA 3D4IA 1I5EA 4J9UE 4UE3S 1Q2UA 3MWEB 1HF3A 1FYXA 1YL5A 3EF1A 3QUAA 1UXGA 3A31A 4Q0MA 4US1R 5GONB 3S2YA 2IKQA 3DEZA 4MGHA 4EY4A 4YIHA 3PJGA 3EDOA 1UM9A 1YMUA 2OO5C 1KR2A 2O7RA 1JDSA 2X5XA 1BFKA 3EJ6A 4TV9F 3D3EA 4TXHA 4ACAA 1ADJA 5HDQA 3T35A 4KXXA 5JSYA 4MQFB 1TAUA 1BKDR 1H65A 2FHSA 1M2VA 2J85A 5JAHA 3JQEA 1WDTA 3TD6A 2IHUA 5C5IA 5BOSA 4IP0A 4ZCQA 2FPWA 4XLZA 4CBVA 5JBNA 4RC9A 3U49A 2XXAB 1OUMA 3HDVA 9GPBA 4HXEB 2PGAA 4OJNA 1E7YA 2WJZB 1G4AE 3QYPA 2J41A 2QUKA 1E1RD 4IRUB 2L19A 2RGWA 2IP4A 2C7RA 4HB0A 3R6LA 1T2AA 2QAGA 3WIVA 2NUAB 5JMTA 4O08A 1E9AA 5T5QA 1S96A 2NU8B 4TMWA 1Q74A 2OPBA 5FOSA 4BZXA 2WFLB 5JTUA 3B6KA 2I6GA 2X9VA 1AQNA 3LKVA 3M33A 4BRUA 1RAFA 2Z8YM 1CS0B 1T24A 1NUQA 3N7AA 3FWKA 2FZGA 1RHRA 1GL6A 5KKNB 4AKEA 5PGMA 1TMYA 5DV9A 2PNFA 2K7ZA 3IAS6 4IIJB 4R2IA 3H11A 5JRJA 2O3TA 4XGRA 3OZGA 2IFTA 5HS6A 5J3JA 1T1RA 3QHQA 3IUEA 4HDQB 5HUHA 2R7MA 3AEUB 4W1QA 1IG0A 5NULA 2AIRA 1GKIA 2NZ2A 3SF8A 2ZJFA 3ESQA 1Y7PA 2UV8A 3HXTA 1UMCB 4Q34A 2IYEA 5KNBA 4IXWA 4L8FA 1S9HA 3QHAA 5E7QA 4UVIA 5B12A 1P1HA 1A04A 3V3TA 3ETEA 2PUEA 1AVTA 4YJ2F 4GO1A 1WZEA 1KSGA 3WA6A 1JQLB 4JK3A 1R6AA 1CRWG 1RXCA 2F00A 4Z9AA 5AW4A 4HVCA 4TTAA 1U8UA 3QX3A 5KJ6A 2V9ZA 3EQ2A 4I81A 2PRJA 3LVFO 3JZIA 2YYAA 1OROA 2BF7A 3HWWA 1OBOA 4C3ZA 1KZ6A 3VH2A 5K6AA 3WLEA 4FQ5A 3RR2A 2WD7B 4LQCA 3U3XA 4K6FA 1U2PA 3ROFA 5HYVA 1B15A 5IZCC 2XBMA 5CLFA 1C3OB 1N9GB 1AE1A 4URZR 1SBYA 3JZAA 2F8LA 5FO0A 1OXMA 1R12A 1Z37A 3V2IA 2A5FA 1TEVA 2ORYA 1UBRS 2I4IA 2UVQA 4IWNA 3SYRA 5GVRA 3ZD8A 3QEAZ 3P2JA 3NO4A 2Q8PA 4L27A 1RRPA 2UU9B 3UZUA 1S4MA 3CPSA 1JA9A 1ZD4A 3RBZA 3DO5A 2ZDQA 4ECAA 4JI0B 4W5WA 5LIRA 3HVJA 1NAIA 1KFEB 4J4HA 3ZXSA 2RGAA 3FKSD 3OJFA 1LNZA 1R6TA 2F3PA 5ALKA 4BNMA 2C58A 1MCZA 5DWQA 4FW9A 3PFGA 1RLIA 3WP1B 4FHDA 3JARA 3NFYA 4DWVA 2BHNA 2D5AA 2VDPB 2OXIA 3D6FA 2NSHA 1YASA 4FI3C 2Z98A 4NICA 4F2PA 3OF3A 1GKLA 4WHMA 2WM2A 3WLSA 1MH9A 3O74A 1Z45A 3KQLA 4XM0A 4PN3A 3AU9A 4QVIA 1U7ZA 4DQ0A 3OQ1A 4LA4A 5KCZA 1W88B 1QR6A 3VPAA 5LYJF 1ESCA 3H5WA 4JMLA 1WW2A 4ZOQI 3NEYA 1P7CA 3KUKA 3SBOA 4XJSA 4XWKA 2B7CA 2R1TA 1CY8A 3CYFA 2X4DA 4IJWA 1RXVA 4P7KA 2PUHA 1N2IA 4UPEA 1Z2NX 1B0UA 1FFWA 1TEZA 5G0SA 2EFCB 1TAQA 4ACBA 4IFTA 4V0RA 1KZ9A 3QY9A 5K0TA 2A4MA 5C7OO 2OCDA 4G1EB 3H5AA 4IRXA 2DEUA 1XQ9A 2B4AA 5GADl 1YGYA 2GPWA 4RD3A 2J3IA 2PVPA 3VYSB 1NN3A 3OFND 3GD5A 1VZ3A 5ENZA 4TLDA 5CB8A 5CXSA 1VPWA 4OSEA 4M54A 3W34A 3C97A 3HKDA 4PFJA 4TSKA 1DFIA 4LXQA 3QW4B 4M9RA 1RTTA 3FSGD 5BUZA 1OZFA 1XRSB 5K8UA 4LYHA 1PK8A 4URVR 4NX2A 5DGIA 2NVUA 1CFZA 3I3OA 1GUYA 4QLOA 2ZEJA 3F67A 4EKGA 5BYAA 3LUDA 2NO4A 5L95A 3SEZA 3DTTA 3WTCA 1JBQA 1ZISA 1KH2A 2XI4A 3G9ZA 4J16C 5EAIA 4GBGA 4DQKA 1QSGA 1KKMA 3ND8A 3FOFC 1U3TA 1RC8A 5A7GA 1IUKA 3PYLA 2OBFA 2ZYUX 1B76A 4XQCA 4FUTA 2WSYB 3ND9A 3QLJA 4YUXA 2A9VA 5JO9A 1P44A 3LQ4A 1NMYA 4B31A 3EG9B 1USUA 3ONFA 4X60A 3KCQA 3ZIUA 2JEOA 1KI6B 3Q8WA 3QJ5A 4Q9HA 1US8A 1BMTA 4E5VA 3L8ZA 5TS2A 3PXGA 1E89A 3UBTA 5KNCH 3IHWA 1LKZA 2GBLC 3GMTA 3BERA 1Q7TA 5GONF 1G55A 3NIGB 3UG7A 4URYR 1YVDA 2RKOA 3EASA 3RIYA 1U90A 3K6KA 3WE7A 3HJHA 1BCSA 5CA1B 1R74A 3T4PA 4N01A 2ODAA 2GERA 4Y98A 4N47A 1ZOPA 4LXXA 3P4YA 2C3UA 3TPFA 4H1UA 2JH9A 3OTIA 1AG9A 3AERA 1IUOA 3K4HA 1AKRA 1I2DA 5CVCA 3ZXXA 2WU3A 4NZ9A 3A3OA 5A6SB 4Q03A 1NZDA 3UGKA 1T2CA 2H4HA 1TF2A 2PCJA 3MC1A 2Z83A 3SF0A 2QM8A 2FJPA 1WVGA 4R68A 1PNQA 5FLYA 5B55A 1RAGA 1I5RA 4ZVPA 7ABPA 8LDHA 4CEHA 5C1DA 2JPDA 3T5MA 1CETA 2G88A 1NGSA 2PMFA 4EW3A 4QTYA 5FPPA 2AMLA 1L4MA 4DZRA 3DFKA 2WWYA 2D2EA 3C6MA 1H23A 3Q0IA 1O5IA 4C7BA 1Z68A 1A8PA 3K1ZA 3K92A 4LZWA 1P17A 3HCWA 4M0DA 2F59A 3FPKA 1MJFA 3DC2A 4JI7B 3IXMA 1RYYA 1V1RA 1XROA 3A10A 3OZUA 2RCYA 3S8YA 1S1CA 4D9MA 5DW0A 1KVTA 5ADVA 1G66A 5ICGA 3BA6A 1C9KA 4PEVA 2XE7A 3ICVA 2R6CA 3LBIA 4Z0NA 1MJNA 5EMHA 3B6IA 1IVYA 4IWYA 1IVSA 4N4AA 3NYQA 1VHTA 1JQJC 2ZYSA 2OFFA 3OQOA 4CT0A 1KEVA 4BQEA 1VRCA 4BNLA 3BTOA 4G24A 3RPEA 2EIHA 3OQHA 1P0FA 4PXAA 2FUG6 3QKIA 1HRKA 3SWWA 1FQKA 3O3OB 1WJGA 1ZGHA 2CCJA 4WA8A 5CM8B 3IS3A 2NTJA 3RV4A 3C24A 2HWYA 2AOUB 5DTRA 4UD6A 4INZA 4IFIA 2P79A 1ZWKA 4ZQFA 2JGFA 5FI1B 3NONA 3DUFA 4LRWA 4X8OA 4QLBA 2V7VA 2RK4A 3KQMA 4N9WA 4PC1A 3KM0A 4YS6A 3F3MA 1LV8A 1OV6A 1Y5LA 2I4TA 2RI0A 2ERCA 1C1XB 5JH7B 3ZX4A 1NV9A 1KY2A 3MEQA 2YC2C 1JDZA 1ODIA 1SCUA 2O2IA 3VU8A 1XEFA 2N0SA 1C8BA 3INGA 1NF3A 1P62B 3VI4B 3ZWWA 4BVAA 4U0KA 4CG3A 5I3CA 3FTDA 1JVBA 5SZJA 1TADA 4B8WA 3WDMA 4LW8A 4MW4A 2HU2A 2ZRBA 1C9MA 3DMNA 2FPIB 3FCAA 5BW4A 1ACLA 1PT8A 3WWDA 4QG7A 3O8LA 4U8GA 3O1IC 4DYDA 1E2LA 2FLVA 3CVVA 4XIGS 1QC5B 3L4KA 3QEBZ 1R66A 4MCHA 4OI2A 1KZYC 3EXEA 3DVSX 3WGKA 5HZMA 1G5TA 1UBJS 3S81A 2PSJA 5IYZB 4ZQIA 5THQA 4TS1A 1HEIA 3DMHA 2XT9A 3RRMA 4AF6A 1T4BA 1VKJA 2A9QA 2Q1YA 3FXAA 5B2EA 1Y6ZA 1HQCA 1VPVA 3JD0A 3MQ2A 1G20B 5K0NA 1DX6A 1OTXA 5DTEA 2CVZA 4P4LA 1PBTA 4KGZA 3PIIA 2ZBUA 1O4WA 2YZGA 2BGJA 3KKPA 2JFXA 4XOUA 5EQDA 4U7DA 1ZY2A 3KD3A 1F8FA 4ZZ2A 4CEJB 4MUAA 1PR6A 2GA9A 2I2DA 2Q2WA 1XMIA 2ZJYA 1SQ5A 1RYFA 4H7DA 4IDCA 4S35A 4M7WA 4UDXX 3WRYC 4LE1A 4X00A 2ETXA 3OIGA 5G0TA 1P3Y1 2B6HA 3N2NA 2OAEA 4IVRA 3STXA 3VR6H 3KZOA 1A2BA 2BGMA 2DPYA 5C31A 4S2EA 1TLFA 4OX9Y 5I3ZA 4M6WA 2B0JA 4LQLA 3KLMX 3L7KA 1W8IA 1YKGA 3RAJA 3X1DA 2QK4A 2XWBF 3LUFA 2A30A 3NTLA 1ESMA 5ALXA 1R88A 2ZE8A 3WNDA 3UJ8A 2BEUB 1SXJB 1BX1A 5DM0A 2G9VA 3C7TA 1W30A 1MDFA 2A5LA 2VRWA 3CH4B 3OMXA 2Q27A 2XEDA 3LKDA 3A9UA 5LKAA 3DDHA 4RNCA 4X45A 4TVOA 3THYA 5LB4A 5K8VA 2OZLB 4DNQA 2EIXA 2J33A 4AS1A 3MF4A 5G4KB 4A8JB 4OI0A 5CR9A 1TYZA 2C7GA 2Q41A 4N8DA 1JIIA 1BN7A 1JSRA 1UXIA 4JYPA 1DV2A 3SG0A 4MTLA 1GTZA 3A4TA 2F2TA 1S2NA 1W34A 4XGKA 1UDRA 2Y1KA 3AP1A 4YRDA 4JI2B 2RCNA 1L4UA 5EY5B 2Q3EA 5JS6A 2ECOA 721PA 1JEYB 2L0XA 5DE3A 4JVOA 1P1BA 2GCGA 1XI2A 3EBPA 3QFCA 3KFVA 2HHLA 4IHAA 1IXYA 3G0DA 5A2GA 3PJFA 2NU7A 3GLGB 4M98A 4RMNA 3U3RA 1WQ4A 3TGWA 2YL2A 5TEWA 2PLWA 4CR8A 2G72A 1A76A 1Z5VA 3ILSA 4A9AA 1Y8RA 4INAA 3PTAA 2FPPB 2UVDA 3C8DA 3AR6A 2EKPA 2OCGA 3L06A 2PX8A 2PRYA 3M6IA 4H7KA 3ESXA 4XVQA 4TMVA 1PGQA 1CR6A 1DWOA 4JDPA 5BPFA 5CDGA 1UT5A 1U7XA 2ENWA 1VECA 1GRRA 3ZWYA 4H1TA 1LW6E 2GK7A 5ESWA 3BGWA 3SJCA 4CQNA 2DY1A 4O2RA 4YPFA 1P91A 2RKWA 2IYWA 4HPWA 1YUBA 1ORTA 1UC9A 2JI6A 2ORIA 1FRFS 2AUNA 2P41A 2XDQA 4OCZA 2M98A 4D81A 2OM6A 2YIMA 3ANLA 3F5SA 3WL7A 4KFCA 1T8YA 2JGEA 5K09A 3OIDA 1EFUA 1JR3A 1LXCA 3BHMA 3GP3A 3NIBA 3W5SA 3GFRA 5KTMA 5LZ7A 5DX8A 4BWYA 5JC1A 2JVJA 5KWIA 4TZ6A 1RHKA 2HD4A 1PR4A 3BD9A 3I01M 3ON5A 2JIDA 4ZOEA 2QBYA 1MB0A 3HLKA 2LD4A 5HJ5A 4BKOA 2K4MA 3ELWA 3G88A 1NUPA 3I23A 4WQMA 4KO3S 2C57A 3KLOA 3VO9A 4NXMB 1D0SA 1C1HA 3WGYA 1Q3TA 3KSRA 4W8OA 4WFIA 4POOA 1CT9A 2ZSIA 2F64A 3OEYA 1PKXA 2GBGA 3KPUA 4C1NA 4NG5A 1VYVA 1SEVA 1T3HA 4F2DA 1A9OA 2FOXA 1OC2A 1LNSA 2OVFA 3QITA 4YAUA 1CZNA 3OJ0A 5CDYA 4JNCA 4F1KA 2AE1A 3WMFA 3K16A 1ZJWA 3ITKA 3PR2B 1G3UA 1U9IC 3O8CA 3RVJA 3QE0A 4MJLA 5JEEA 2QLFA 4MRNA 1QDEA 3WYEA 2JFWA 3V1MA 3ZGXA 4EVIA 3M3HA 1XVIA 1TAGA 1OIVA 1YBFA 5IVKA 1JSCA 2AFVA 3QG5A 2CUTA 1S01A 2VSNA 4WLVA 3TTTA 4X66B 2O05A 3U3ZA 4N3CA 4RVHA 5EVJA 2VZ8A 4JBGA 4FMCB 4UBOA 1USKA 2EV9A 2HEIA 2GD2A 4FZRA 2X6RA 1UOQA 2GFHA 4WACA 3QSYA 3A4NA 3PI7A 4BPBA 3UC5A 5FEUA 1CUAA 4YBZA 2G06A 1T2NA 3UPDA 4BNNA 1HDGO 5JH7F 5DLEA 5F1KA 3VO8A 1XDDA 3OZCA 4LVOA 4E08A 2XDAA 4H4DA 2W0MA 1ZYUA 3GO4A 2YHAA 1Q44A 1V8ZA 1VOTA 4OP3A 1AV7A 3D64A 4ESOA 3GZ4A 3SDZA 1C0KA 2XMQA 2LWIA 2ZR7A 3JYLA 3IRVA 3KEQA 4RJKA 3ZTYA 3RKSA 4EPVA 1MAHA 2QDXA 1RZUA 1PN3A 4MPJA 2BMDA 4YQEA 2G70A 3FB4A 5KOYA 4M76B 3ZDYB 4QU8A 4CPDA 5EKSA 1L4KA 1YE8A 5SY6A 2FNAA 2G9NA 3H86A 5IYZF 3QI7A 4Y1EA 3PDJA 5AW5A 3W9UA 5CG1A 4J3NA 3AY6A 2WYOA 3K2QA 2G1AA 2DQZA 1VJGA 2Q6IA 1CK4A 1Z13A 3DDOA 3MJFA 3IOBA 3MZ0A 4ZQGA 5DXFA 4DDHA 2HIAA 1JIVA 1WLYA 1W5TA 5H80A 1PZHA 2HO5A 3K8QA 2OHIA 4RVSA 4TYPA 2XQKA 1C7IA 2WKQA 3OZFA 2CBZA 1IQUA 4NCHA 4WJKB 3TIXB 4CIDA 4O25A 3AEQA 3NHUA 2R65A 2XLCA 1V5EA 2BRUC 3G49A 1KQFA 3TI9A 3NHJA 1FRZA 5EXPA 4B83A 3QVWA 5A3JA 2NV0A 3L4SO 5EHXA 3CISA 1PL7A 4YV7A 4LSMA 1XEAA 4L1KA 2AGVA 3TSZA 1KFJB 5JAOA 4YJHB 3I2JA 1D1PA 1Z2CA 1TO1E 4AZ3A 3C2QA 4NONA 2QTNA 3L41A 3FLMA 1BDMA 2OTCA 3N8KA 4IKOA 1JHAA 1THTA 5KYWA 1ZA1A 1KOJA 2CXQA 4RXMA 4LI0A 5AVJA 1B8PA 1N8SA 2H4ZA 3DB2A 4DYVA 4OFBA 1GA6A 2YTZA 1ZRHA 3PF9A 5JJCA 4NATA 4R01A 5K4GA 1PNRA 1FPMA 1NRJB 3ENNA 2HA3A 3ENVA 3U4DA 1S2OA 2EKBA 4BMZA 2XA2A 5DBIA 1BVYF 1ONOA 3S40A 3TDMA 1P2FA 1YOVB 3NM5A 2VNKA 2QORA 5JHGB 2F48A 1R9MA 3BRQA 1M34A 2EERA 3BE4A 3ANMA 1RXYA 4HYYA 4JWKA 1R9GA 5DHPA 5EMJA 4GUDA 4BMOB 3R5XA 1CJBA 1ZNQO 4ZDJA 1G8YA 4EJ2A 4TT8A 2IYOA 4EGAA 5ITZB 5DVZA 4OJYA 4LJ4A 4GOLD 4ZOCA 1DMSA 3IUMA 1BHQ1 1WG8A 1KEUA 3KJZA 3PYXA 4HWGA 2NAPA 2HNKA 1UXHA 2NQ2C 2WYUA 5C34B 2QAGC 3PXAA 5CTJA 3UMBA 3C5WP 3PQ2A 5TRTA 3ZY5A 5MGBA 2G40A 2HYDA 3KU1A 4MZXA 4MW6A 2BSXA 2FSPA 3CX8A 1TUBB 2LCQA 1H2RS 1C30A 3EXHB 2BJWA 4JYZA 1ML4A 4MJ7A 1F51E 1KI9A 3T5AA 1YDWA 1C0EA 3NETA 3TW8B 1QQAA 2ZJBA 1AKVA 3VR2A 1S2DA 4ENPA 3RF7A 1JFFA 1KTIA 1QVVA 2QE6A 3P27A 3EC2A 1G98A 4N5IX 4PGFA 4BWVA 1GWNA 2XD9A 2QVCA 3WKAA 2F3UA 2ZIEA 4JELA 4PX2A 5TQVA 4AK9A 4GR9A 2E6UX 2NXCA 1G2IA 2JK1A 4UNQA 1RAEA 5HF8A 2PVSA 1KH3A 2PYDA 4FW8A 4QQNA 3CGWA 4XFJA 4F84A 3LK6A 1IQPA 1B8VA 1O58A 1SPBS 4JY7A 2PKEA 5FUWA 4C05A 5EJ5A 2I9KA 3T6KA 2I7VA 3DBRB 4Z2YA 1RSZA 1JR3E 1I3NA 1E6KA 3EA5A 1EZ1A 3PVZA 2WD9A 2PJUA 4POAA 4K28A 1M67A 3TSWA 3VNAA 5K6AC 3U80A 5E2BA 1WXFA 2ZXEA 4WY8A 2RC6A 2X8LA 2E4ZA 4RQBA 4DUYB 3GLIB 3V97A 2ZPUA 2BIFA 2O2DA 3PGVA 1RE0A 3QKRB 1YQEA 4ZV9A 3TD2A 3PE6A 3SBDA 3RARA 1RQGA 2IEYA 1JG4A 3QG1A 3IMEA 3QY0A 2ZUUA 4LSZA 3T5CA 2YMPA 4OHZA 1VPDA 4I5DA 3QE4A 5D85A 5AW8A 4F3YA 1H8EA 5A4DA 4V0MA 3CLRC 1ORDA 5JPDA 4QXRA 1SKBA 1M2VB 4NU8X 5F64A 3U3JA 5J2TA 3KSAC 4WJZA 2QD3A 1WZCA 3SC2B 4Q4CA 4YJDA 1O89A 3GJZA 1E3EA 4OAQA 5E8JA 4X3OA 2R6AA 1ZD3A 3B13B 4FNMA 4UAJA 1OFIA 1QHFA 2FPLA 4LVCA 3I0NA 2OQ2A 4ND7A 3BRWD 1NW3A 2NU9A 3NXSA 4FMCF 3D4LA 1PZEA 4INOA 4J7AA 4QBTA 3S70A 1OH7A 1I2CA 1Q0QA 4YC7A 4KQIA 4HJXA 4YN3A 4BV3A 2UUBB 4BUJA 2WTNA 2LIPA 4NE9A 1AUQA 1BJTA 2D1TA 2NO9A 3C8MA 5LBIA 1FQJA 1XC7A 3FYUB 3L4EA 3LOPA 4B35A 1Y1LA 5E9AA 3COSA 5GV8A 2D2IA 1ZH0A 3W3AA 4U2GA 2ENUA 1XZGA 3AW8A 3UJDA 5KZMB 3D4OA 1IXZA 3H11B 3MUNA 1WSBA 1E5DA 2AN9A 2GZAA 4RKWA 4GQBA 4I50B 3EIWA 4L76A 2PMEA 2J7PD 2VBIA 1Y6QA 4TV8B 1XFAA 3CLTD 2ARKA 5BSMA 4JZYA 6GPBA 1QU3A 3HCRA 4JFAA 7YASA 3QXHA 4KUGA 4R41A 3EHEA 1EE2A 1SOVA 4LDJA 4ITRC 1RWPA 1TK9A 1H0RA 1VLJA 3EZLA 5TPZA 5JISA 3OX1A 5MN6A 3AIMA 1L5MA 3MCAA 4HDCA 3QVLA 2XCSB 2JG3A 4U4AA 3MLEA 4MVJF 4LCEA 3IBTA 1CCWA 2XTJA 4MRSA 3VAAA 3JATB 3ESCA 2X9GA 2CFRA 4GQIA 3K5IA 4ZZIA 4JGBA 5BW6B 2BGWA 4J4BA 2DTDA 4BN0A 2J45A 4RF4A 4NWIA 5ERYA 1EG2A 5CFRA 1QJ4A 3BJZA 2AI1A 1FDTA 1UKZA 4II7A 4RDXA 4MYDA 3ZK9A 3NBZC 4LDAA 4QL3A 3VKWA 4O4LA 1N1MA 4JL8A 4C20A 4C4XA 1R0WA 3VMFA 3SBXA 4YCAA 3SXUA 3V4FA 1IN4A 7MDHA 4MVJP 1YS4A 1O97D 2RG1A 3ET5A 3NORA 4FN5A 5AKYA 4UM9B 1E66A 3PX3A 4MPDA 4W7SA 5HMMA 3ML1A 5A1JA 3O7WA 3ROPA 2BSQA 1F8YA 3CNNA 221PA 3Q1KA 5GGYA 3VR0A 3A2MA 3AB7A 3GCWA 2XUIA 4OHUA 5CJ2A 3PEYA 3EEYA 4Q48A 4QSHA 1GOTA 2EW2A 4XJTA 2NP7A 4HHEA 1H3NA 4RJJA 2PRIA 3PIDA 4PGAA 2WWVD 4JLJA 2ZI5A 1M34E 3E5RA 1J0EA 2H0QA 4BKMA 2G8NA 5IXJA 1J1ZA 1DKUA 2D1YA 2Q4RA 3RUPA 1P45A 4COKA 1U2RA 3Q6MA 3RYCA 2FMIA 2PUAA 1YQ9A 3E61A 5LZ2A 4QWWA 2Q3CA 1GUFA 1K08A 1K63A 4L5BA 5HSGA 4IHJB 2FSHA 2FWAA 2BVNA 2QE7D 3A70A 3K35A 2UAGA 3F6YA 1IEQA 3FDIA 3NYIA 4I2NA 4LGVA 4P84A 4UBJA 3PS9A 4PXYA 4YDSA 3AVYA 2GBCA 3M1AA 1IZ9A 2WW8A 4YRCA 4YMWA 4Q3NA 5H0IA 2HRZA 4EYEA 1QCYA 1PR1A 3HWX1 3LRXA 1NF2A 1RHQA 4F4UA 5G4KA 2WLSA 3BJIC 3TR6A 4ERXA 5GWXA 1MBZA 1N9ZA 3J7TA 1G8AA 1DKNA 1QWSA 4FE4A 1DBQA 5DGDA 2PJRA 1BS1A 4XB6B 3HDYA 5DGXA 3LBAA 3RBVA 3HABA 1O6ZA 3NYWA 4EQ6B 1NUTA 1T4GA 3G2IA 3L1JA 1I32A 4LZOA 5E2AA 2BGRA 1BFUA 2LIVA 5CM9C 2MMGA 3KPJA 4BEJA 1TJPB 2ZP1A 4ZAVA 4NARA 5JMOA 1CUZA 4IQ8A 3L79A 1KC3A 1PJLA 4HH1A 3C5VA 3D7MA 4LNUB 4PZZA 2VL7A 2BBOA 3N8GA 2Y1WA 1SK8A 1MV5A 4RKEA 2HM7A 4UXIA 1EVJA 2QD1A 3N75A 3W7VA 1RZVA 5CXXA 2AEFA 2C31A 4NYMQ 4DT1B 1IUNA 4EGQA 2B6NA 4XB1A 1U5BA 1JEDA 3FYTA 1P5RA 5F51A 4KFUA 4CIWA 3AHDA 1UWCA 1J2EA 3UMSA 1CJKC 4R1PA 1FU7A 1Z0UA 3QNWA 4KVZA 1XR3A 4CM4A 5KOJB 5LQAA 1MB3A 2H08A 2IHVA 4MMXB 1CUSA 4D9EA 1N1GA 3T3MB 1L6IA 1RQRA 4KQ6A 3NBKA 4WJLA 5MN4A 1K6MA 3C3PA 3B6JA 2D54A 3MTGA 2C5AA 3MUFA 4G4JA 4MLZA 1FB5A 4QOHA 4YIKA 4B84A 1KI7A 5A5DA 4TUYA 2WFAA 4M46A 1G17A 3PHIA 4X6LA 1T10A 5BO5A 1LS6A 2C99A 5KKAA 2DLCX 4H6XA 4V0ME 3K9CA 2Y1LA 2FX3A 4MYUA 5AUQA 1E2JA 5IJWA 5TQJA 1VI2A 1L3BA 4HBGA 3NBYC 4RVNA 4MQ4A 4FFMA 4P3NA 3AERB 2F3RA 1CKEA 1Z0IA 1Y7HA 2VHXA 4HI0E 3HY6A 3PGMA 2RARA 1E5XA 1PZMA 4DIBA 3S29A 2H2WA 4MWDA 4K6HA 1DRKA 3P0RA 3UWKA 4H0NA 4EO4A 3T9EA 2BFAA 3TR5A 3IQEA 2GK3A 3DOJA 4RFSA 5HPYB 4ZJPA 1DQNA 2G7MC 2ZYIA 4XR9A 1RRGA 1ABBA 4BMSA 5JZVA 2JRCA 2Q4EA 2VRBA 4RLQA 5CFOA 3KDPA 3FVVA 3UMRA 5J4HA 2QJFA 2P27A 2YCBA 3NI2A 4M88A 1UM8A 1ZJ5A 2QQEA 3C7CB 5DKFA 5KNBH 4A15A 3CZPA 2CJFA 1V2GA 3FF1A 3IKMB 4JHXA 2GCNA 2C9CA 2GR9A 2JFYA 4V0OA 4D41A 1Z63A 3PNYA 3EPKA 3FCXA 5ALQA 4BYMA 4DM3A 4BMYA 1ATIA 4JP2A 1AS0A 4FCTA 4FE7A 4I50F 5F5XA 3ZIAA 1ZGBA 3G2HA 4TV8F 1QTNA 3OBBA 4NPAA 1LY1A 5ITWA 3EZXA 1SVOA 2WTAA 1G5IA 3RVPA 3D8TA 4EFNA 3ECAA 2DSTA 3W78A 4NR0A 5C5DA 3MTAA 4Y67A 4ZVNA 3GR6A 3TH5A 3MTBA 1XNGA 2ZETA 5KVSA 2VSOA 5GJCA 1GRVA 2G1KA 1X1EA 4B3RB 2BMFA 4NFSA 3UH1A 4DAOA 1TEHA 1JFRA 4IJUA 3B1VA 2D7DA 1XD2A 2IU6A 1E9SA 2C1EA 4YTEA 3UB2A 4FC6A 4C3UA 1OFGA 3E82A 4RU1A 3R74A 2Q4BA 3QGMA 1M6YA 3T9FA 5K3FA 4FMBB 1J97A 2GJ9A 3GHHA 1S7CA 4A03A 1EAYA 5G0VA 3GLGA 2N42A 1FU8A 2DG2A 2H1WA 1MQ9A 3HFGA 1D0VA 2C3MA 2ZRNA 3HN2A 5HWSA 2JIRA 3GL9A 1YU9A 4G0OA 2D4HA 2HO4A 4C0JA 4CZ2A 1EE9A 4Q1EA 5AUOB 4EDHA 3EIXA 3VTAA 1QHSA 4ZI5A 2BGIA 3EIQA 1W6RA 5E7MA 4FR0A 5KX5B 3LUAA 5AW7A 5I7AA 3N6XA 4TWJA 5CEJA 1GPDG 1RPAA 1B8UA 3PKZA 4K3UA 1TLLA 5ES3A 3W5UA 1JKFA 4TZ0A 3M81A 1FMJA 3OCZA 2EJVA 1TM4E 2CEKA 2I22A 4BJ3A 3EPHA 2RJOA 4WNCA 1E7WA 3EQ9A 3RKUA 3UMGA 4F5EA 4O3MA 3VV3A 1M1XB 1RWOA 1ZI6A 3MS4A 1EHCA 2FVXA 3I0ZA 1UQTA 2V6GA 1N34B 4I1PA 1P8AA 1T6XA 2QG6A 3RTEA 5DYGA 2WYVA 3UICA 3CPJB 3W6UA 1KO1A 2OUKA 2VCEA 4UXHA 3EY9A 5DK4A 1NVKA 2NW6A 4RTQA 2VTBB 5D1NA 3M5CA 3S44A 3FPGA 3EUAA 2JIOA 3PXEA 2GNPA 2Y9MB 1SD5A 5DRYA 5E4JA 5JU6A 1BROA 5T4HA 2A9KA 2N9UA 5HE8A 3SQMA 1WO8A 3LY9A 2GPAA 4IHJF 4HNRA 4L0CA 4DQLA 2QLNA 2F3TA 1E32A 4XM2A 16PKA 1VGVA 3EAGA 1ETHA 3IV7A 1KWKA 4LTMA 3FCSB 4X41A 5EA2A 2EJBA 2P9YA 5JUWA 2E5LB 1Y1TA 3NT4A 1KPHA 3AI3A 1T91A 4B7ZA 1YRLA 1U5CA 3I0MA 2G0TA 3VC7A 2O2HA 3HB9A 4XRGA 3ES9A 3OZ7A 4W99A 3C3AA 4NCKA 1YR7A 2JGNA 2PMWB 3A9RA 1NBIA 3DA8A 5KVCA 5ALPA 1DRWA 4EW1A 2RAUA 4ZGBA 4RHCA 5EJ7A 2J3JA 4ZZ3A 3HDGA 4FVTA 3W6OA 3WWYA 2XECA 3QA9A 1W35A 1BD4A 2BM9A 3OE7D 5E6SB 3B70A 2ILVA 4BAGA 4Y2YA 5ITSA 3SLKA 4UTVA 2X13A 3R3HA 3SJBA 1FNDA 1QP8A 5LXTF 4KWEA 5EIOA 4M1WA 4CR7A 1RR6A 3HVKA 2OV8A 3HO6A 1MB4A 4LRQA 3OCVA 5HBGA 3C3CA 4YWJA 1KOLA 3OZSA 1U1CA 1Y4UA 2HA2A 1KJQA 4IQ4A 1W4RA 1MOZA 2Y67A 3IJPA 5D3KA 3GI1A 2XUGA 4Z4EA 3DTYA 3WIUA 1OKKD 2NU7B 2HSDA 3DE6X 5E1BA 4WLEA 2GHRA 4DMHA 2QW1A 5EIXA 2VQ6A 3DVAB 1ZN9A 4CKCA 1JA0A 1UL1X 3VISA 5H1YA 1G5QA 3O91A 3UFBA 3J80A 2HHCA 5JT1A 4E5PA 1OHHD 1TZCA 3GPLA 3JVDA 1Y3HA 3WRXA 2PQ2A 4G63A 1JR2A 4AN4A 1BN6A 2I7TA 4AC9A 5BUSA 4G1UC 1S2IA 1YS9A 1YB7A 3PUXA 1KZ7B 3OQNA 2NV6A 5TC4A 4DJDC 1AHHA 2C59A 4KQHA 5EJMA 2EHDA 3DAHA 2OL4A 3N28A 3HUFA 2QJRA 2AH5A 3OWHA 2IXTA 3FW1A 2VXBA 3RM3A 3X2SA 3PNQA 1SBNE 5AJXA 1E9CA 4IOLA 4KQ9A 5ILOA 1J0DA 2H4XA 4IJVA 4UPDA 2XDQB 1YONA 5KSPA 4ZAZA 3UJAA 3KV3O 2O3RA 3K9NA 4TSRA 2N47A 4YMHA 1NONA 3QU9A 1TFUA 5COAA 3OLXA 2XYGA 3MWGA 1X1AA 5LQDA 1EVYA 3LGAA 4J6EA 4EX6A 1P9WA 2B0CA 2QLJA 4L51A 3CEPB 4MV1A 3NDBB 4UREA 4UUPA 2Q0XA 4ZAXA 2MOKA 3C6XA 1VCOA 2OXRA 2PUGA 4HZGA 3LPCA 1DKLA 1E79D 4AXBA 1HEYA 4KAAA 5TIIA 5AKGA 4US2R 3Q6NA 3O26A 2Y66A 4N65A 1RZRA 2QMZA 3FX2A 1T0IA 3ICCA 2GXUA 3EW9A 1S4QA 3OUUA 4WWHA 1T34A 2IU3A 4YAWA 1OV4A 3FTNA 3SIXA 4DF3A 5EVCA 2VQDA 4UTOA 1KJZA 1GFIA 1SCDA 4EG0A 3DBOB 1QFSA 1YJCA 3BAFA 1TI7A 5F23A 1IAQA 5SYMA 3L8YA 5DCLA 4ARSA 2ZAGA 3D6JA 2JH3A 2YV5A 3VNBA 3OT1A 4IOMA 4A8HA 1ULSA 5BN3B 5CXQA 1MRZA 5FQNA 1JEAA 4U1RA 3ZV3A 1E2IA 4W4TA 2RHBA 1YQDA 3OFVA 5CT5A 4D74A 4GL2A 1PFYA 5H8WA 1XQVA 3A1WA 3UB3A 1WUHS 4K9QA 1YVEI 2R7KA 3JQDA 2C4KA 3H5TA 4WTOA 1X7ZA 1Z5WA 2YHSA 1DAKA 3IUNA 4FOTA 4MULA 1RC0A 2X2FA 2XCOA 3CEHA 5LQSA 3WRWA 4EIWA 2XKBA 2AQIA 1DG3A 2N1BA 2OV4A 2EBHX 3K0BA 2Z5LA 4PS0A 2CXHA 1H2AS 2ZUDA 3WGNA 4KSCA 4D82A 5LKRA 3W5BA 3TLBA 4FLEA 1ZIDA 4G4SO 1ZGAA 4AUNA 5JJBA 3LT4A 3ZU2A 5F1YA 4LECA 3IEKA 3NVMB 1I01A 1COZA 1YCDA 2HMTA 2NXEA 4A5OA 4ZTBA 821PA 1IQRA 3LCCA 1F60A 1GTG1 1EUCA 1Y1SA 4KX5A 3W8NA 1AZTA 5J58A 1OU4A 1RMYA 4B6SA 3O1HB 3ELDA 4NP6A 5K7SA 1GL7A 3REQB 4AYWA 4GI5A 4BVLA 3GJ5A 5M04A 3PRHA 4E51A 4GX5A 1ZD5A 4BNTA 2ZJ4A 1LI4A 4MR8B 3KFXA 1RWVA 5TNXA 4CLHA 1W5EA 1XZQA 3BIOA 4OAPA 3RT9A 3FKSA 2WT9A 1H94A 3IAFA 4PWZA 2OXTA 4DLBA 4WZ6A 5D5HA 3U44A 1UXKA 2QHXA 4RK6A 1M6NA 3AEQB 3GLHB 5CLGA 4QEDA 2HT1A 3ZWCA 2H5EA 1XJQA 3LJKA 5JECA 3A1SA 5HQTA 3AXTA 4MMYB 1ZJYA 1LRJA 2BMAA 3V6LA 3R8FA 1LDNA 3B82A 3IBYA 3GJ6A 2E0IA 2P2CA 3OZWA 2IOYA 4BS9A 2ZTVA 4HMPA 3RANA 3KOUA 1ULBA 3F8WA 4RVOA 4RZQA 1DTSA 1B8OA 3NM4A 4DCGA 3R5JA 2VK1A 4KFRA 1GPWB 4HZUA 2PTHA 3IB3A 1QQ6A 4S0ZA 1VFPA 4KO2S 3G59A 1T6YA 3LVBA 4IDNA 1LLQA 2DWPA 2OXFA 4LDQA 5DHQA 1YDHA 3JS5A 4CN8A 4UU8A 1GKUB 1YB1A 2IE8A 1UP4A 2JGMA 3KE8A 4JQZA 3RQIA 2CFSA 2Z8YA 1ZNXA 2IUFA 3IP8A 1UPTA 1YZYA 2OG1A 1NLYA 3HV0A 1VDMA 1E5VA 5LNK1 1OGJA 3S1AA 3HZRA 5P21A 5AVZA 3PU6A 4QX6A 3MYYA 5JSQA 2V96A 3FI9A 3OFNA 4EHJA 5I4BA 1PE0A 3KSZO 3FFBA 1Y3BE 5DLPA 4DPMA 5BURA 1TVKA 2PZGA 3NGMA 4RLHA 4Z8YA 3GZTB 3SC4A 5ALRA 2E4AA 5BYKA 4EA8A 3CCBA 4ND6A 1JUDA 3CIOA 3I73A 1OREA 5T41A 4IYJA 4LX0A 1FS6A 1N7IA 4XYEA 1JB1A 1P1CA 3LX6A 4WCFA 5DDIP 5L3VA 1DJMA 3U7GA 2J59A 2WJ3A 3CUSA 2DULA 3D7SA 3FRJA 1UZNA 1HYBA 1OX4A 3A4VA 3TFWA 1YL6A 4NOLA 3TD9A 4WD3A 1J0BA 3DEAA 4HAZA 4HGPA 4IH9A 1NP3A 4ZHQB 2CFOA 2E49A 1PK7A 5U1PA 1G291 5LQKA 3F6SA 3ADPA 1JFFB 1VYUA 3DZGA 4PZEA 3TCNA 5IT5A 1E77A 2QG9A 3E9QA 4JOSA 1MT3A 4DW8A 2HMVA 2QVZX 3H1BA 1J24A 4QVKA 4E94A 3GVIA 4P0PB 1TXGA 2MSKA 4YBRA 2ORED 4KPGA 5HF9A 5IARA 3R3SA 5LQUA 5CIYA 3N3BC 2W43A 4NBTA 3R5HA 2VF2A 3L7LA 3WKBA 3SVZA 1UWKA 2P78A 1ZJ4A 1DQYA 2NZWA 1PJTA 3BB1A 3OZRA 4UEQA 4JZKA 3WYAA 5AVTA 2B1QA 5BOVA 1U2GA 3GU3A 3ACDA 3DV2A 3DHYA 3NBXX 3OMLA 4A3SA 3LQQA 1SJ9A 4B33A 5BVHA 3GBSA 3KB1A 2VDWA 4FOPA 3ABIA 2CMFA 3HC7A 2P77A 1FQWA 4ITVA 2IL1A 1LS1A 1PJSA 1H42A 1NOKA 4X1KB 2J3LA 1OLSA 1VYTA 4LWPA 1KAOA 3OPNA 4IUBS 2P5SA 1JDUA 4BIMA 4ZXFA 2WF7A 1FP2A 4GRDA 2XOKD 1U1IA 1PR3A 1ZN7A 1N2CB 3PTLA 3DLHA 2HIMA 2FRDA 5F7XA 3N2KB 4CGZA 1NIPA 1O95A 3FCOA 4Z7QB 3PXUA 5AVXA 3V42A 2G5PA 2IEIA 4AUMA 5BPHA 3QXSA 3HEBA 4UM5A 4QJ5A 4BDSA 3DZKA 3H4VA 5ES4B 4FDUA 1PX0A 5K3EA 3GQVA 3FIUA 3HCFA 4LDZA 4BX9A 4LJKA 3E0XA 5I6DA 2XB2A 1A9XB 4ECEA 4G84A 4BB0A 4WKNA 5D3MA 5IUJC 2WUDA 1G9SA 4UM7A 4F56A 1S8FA 3QPWA 4DVGA 1WL8A 3GT0A 1UJ2A 3A7EA 1RM5A 4KWIA 4OBBA 5AJVB 3E58A 3D3QA 3N53A 4M0MA 4E3ZA 1N3BA 1NFQA 3O75A 4HN2A 3D5TA 3ICQB 3A6KA 3V4ZA 5M5BA 2H9IA 3DL0A 3EJWA 3AF5A 2RI1A 3K2EA